3CLSD

Crystal structure of the r236c mutant of etf from methylophilus methylotrophus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
b'SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSCPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein subunit beta
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
total genus 95
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clsD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clsD02
4JZYA 1R6XA 1N3LA 3INNA 3Q12A 3IODA 3A05A 5FNZA 3CLSC 1ZUNA 1MC1A 2GOYA 1H3EA 2J08A 1WZ2A 4JUDX 3FETA 2VBIA 1LI5A 2A1UA 1K4KA 2E89A 4J75A 1POXA 5K3SA 4JUFA 1IVSA 2YY5A 1F9AA 1F4LA 3HV0A 2WQ7A 4KR7A 3COWA 2HMAA 1Y42X 1KORA 1U28C 4GM4A 1BS2A 3ND7A 2CYCA 2VXOA 4U8HA 3RHSA 4GM0A 3QE4A 1G8GA 1PFWA 1Q77A 4EG6A 4JYZA 1MOPA 4BUZA 4F4UA 4JXZA 1JIJA 4ZCSA 1YUMA 3EA4A 3IMCA 2IHUA 3N05A 3ZXIA 4NATA 1MCZA 1F7UA 3IMGA 3G5AA 3KFLA 1IFXA 4MVXA 4ZT5A 5J5AA 4ND7A 4ZP1A 1J1ZA 2D13A 1UPAA 2DERA 3H05A 4FVTA 4BVEA 3G6KA 3BL5A 1TYAE 2I1LA 1B6TA 1X8XA 3FNRA 3SDBA 1K4MA 3FY4A 4K9LA 1M8JA 4R2MA 1NURA 5IJXA 1EUYA 1YHZA 4ZZIA 1CT9A 5DB4A 1O95D 4NZPA 3A2KA 4DE5A 1J1UA 4U7JA 1M2KA 4O8ZA 4ZCRA 3EY9A 1N2IA 3FHJA 4JUCA 1WOYA 4F56A 4NX2A 5EJMA 2DPLA 4Q93A 5IHXA 4EG7A 3N9IA 1MJHA 4PBTA 2XRYA 1K92A 4HJXA 4EF6A 1OWOA 1EXDA 3U3DA 4RMHA 2QUIA 1ULHA 3AL0C 2EJCA 1QTQA 5BWOA 1T9DA 1E3TA 4UTNA 2VK1A 3AG5A 2EZ4A 3RIGA 1J09A 2EZ8A 2QQFA 3N2YA 5K0SA 2CV1A 4HDAA 2JI8A 4G6ZA 4BN4A 1JIIA 3H97A 3F6BX 4K0RA 1T9BA 4X3OA 1U2DC 4MPJA 2WQ6A 3IVCA 2H59A 1YIAA 1YULA 1OZFA 1TQ8A 3H99A 1M2NA 1OWNA 3OE1A 2OV4A 5EJ9A 2CV2A 1WY5A 1G59A 1YI1A 4MZXA 3Q4GA 4UU8A 1WKBA 3N8HA 2E18A 4NAHA 4FEEA 1QRUA 4K9KA 1S5PA 3VGJA 3JWPA 1U0BB 5EJ7A 1WXFA 1XNGA 2H2DA 1WXEA 2OD2A 1H3FA 4G5YA 4MVCA 4UZEA 4BWVA 3ZJTA 1QJCA 2CUZA 4PY2A 1Y9DA 2WVAA 2TS1A 2YXNA 2QJTA 1U3CA 4YP5A 1OD6A 4QREA 3TZLA 3SZGA 1VL2A 1JZSA 3P52A 2O5RA 1XLTC 1QQTA 1YTLA 1EFPB 2C5SA 3RFFA 4BVGA 4JU8A 1O94C 3ZIUA 5BNZA 3PRHA 1H3NA 1PFVA 3H9CA 2DETA 1SZDA 5H7XA 5EJ8A 1T6ZA 4R8MA 4JFAA 1J21A 2J09A 3LOQA 3CLTD 1J8FA 1EFPA 5LM3A 2BYTA 2Z08A 3MXTA 3LQ1A 1QU2A 3CLUD 4YBRA 2JA2A 5DASA 3LCJA 3ND6A 2PZAA 4BVHA 1G8HA 2Q29A 4K9NA 1V5FA 2EL7A 1KH1A 3A04A 3FDXA 4KR9A 4NDAA 4EGAA 3L93A 2QJOA 4Q16A 4ZT4A 1PG2A 4ARCA 1NUQA 4JD5A 3GMIA 3ZGZA 1VBMA 2FRDC 4C7BA 3IOCA 3TZEA 4C78A 2CSXA 1KP3A 3NV7A 4RUKA 3ZJVA 1YUNA 4BV3A 5J58A 3MLAA 4UTRA 1P7PA 2CV0A 4CT0A 1M8FA 1Q11A 5EJ4A 4MW7A 3CLRC 4RMIA 3IVGA 2YWCA 4DDHA 4ARIA 1JEEA 1I6LA 2Q5OA 1U3DA 2IJGX 4MW2A 1IQUA 5LLTA 1U2GC 1ZJWA 2D5BA 4ZCQA 2VBFA 3CVUA 2FSVC 2JI9A 1NSYA 1TYDE 3HGMA 1M2HA 2NYRA 4QPZA 1NUUA 4MUJA 4BVFA 4OUDB 1JILA 3C8ZA 4R2LA 1N2BA 2X3FA 3A4IA 2NXWA 3HWWA 1EUQA 1XNHA 1M83A 2JLAA 4XSVA 4J1TC 1COZA 1NP7A 4KR6A 3H9BA 5AHWA 1KQNA 1NUTA 1J20A 3ZUGA 4JXXA 4BVBA 3RK1A 2H2FA 4OUDA 3X1MA 1EFVB 2QQGA 4YP6A 1WXHA 1WXIA 1BFDA 2Q5JA 3OTWA 4MUEA 2PZ8A 3TQIA 2UZ1B 2BRUC 1U7DA 2W93A 4V1CI 1POWA 4ZT2A 4JT9A 1Q17A 4DLPA 1TFUA 3NBKA 3GLTA 3GLRA 1MRZA 2J07A 3IH5A 3HMQA 3CVVA 1EFVA 1XJQA 1TYBE 4AS1A 1O6BA 1R6UA 2PANA 2H2IA 5EKDA 2UZ1A 2E21A 4HPWA 2HZ7A 1KH2A 1J70A 1I6KA 2D54A 3IAEA 1O0CA 1V5GA 1WQ3A 4MLPA 1WJGA 3D6VA 4QELA 4CDNA 1D4OA 3KT8A 1LI7A 1N75A 4XFJA 4A91A 3CLSD 4ZT3A 1UPBA 1ILEA 2HGZA 1HYBA 3KT0A 3OP1A 4DJAA 1M2JA 3RK0A 1IQ0A 4DNXA 3FIUA 1YBHA 3DV2A 4MW9A 4J16C 2JI6A 1PG0A 4HJRA 1FYDA 1TYCA 2CYAA 1MBZA 2E0IA 2Z3VA 4ZCPA 3UK2A 3CVWA 2J5BA 1DJLA 4JSRA 1MA3A 4UUBA 3COZA 2JANA 3FWKA 3AG6A 4PBRA 1O97C 2FR8C 1UFVA 3G59A 2EZUA 4GM1A 1OWMA 4MW5A 4MW1A 1PVDA 3HL4A 1KAMA 2EZTA 3IDFA 1MAWA 2RD2A 2VBGA 1YNOA 4TWJA 1N1DA 3P0IA 3DLAA 4P2BA 1T9GS 1OZGA 4RJIA 5FEMA 4IG9A 2R5WA 4EFKA 3ISJA 4Y6OA 4MW6A 4UTXA 1VBKA 4KPUB 3D4BA 4IAOA 2Q5LA 3L92A 2HJHA 2IELA 5DEIA 3HFJA 3COVA 2EZ9A 3ZG6A 4RJJA 4UTVA 2VK8A 4Y6LA 1SURA 1G8FA 2PG3A 1SZCA 4L2IB 3GLSA 3NBAA 5FO0A 2OD9A 4FEGA 1OZHA 4RJKA 4NAUA 2YWBA 4KPUA 5D7NA 1N2EA 1O0BA 2WVHA 3E27A 2X0KA 2IHVA 4RMGA 1Q19A 3MLBA 1EJ2A 3CF4G 2FN3A 1YHYA 2GKSA 1PNOA 1U31A 2OORC 4RMJA 2AG1A 1NM5C 4L2IA 4GP9A 4MWDA 1I6MA 2PFSA 4R0NA 3PNBA 2H2GA 1PFYA 4GG1A 4BV2A 5KCMA 1O96B 3EYAA 1IHOA 1GN8A 1QPBA 2JLCA 4G1CA 4ZCTA 3SEZA 3ZGVA 4MUHA 4MVYA 2VK4A 2H4HA 1KR2A 1PTJC 3FZNA 3HWX1 2X1MA 3TNJA 1KQOA 1VLHA 1KKUA 1ZPDA 4EG3A 1IQRA 1IH8A 1EE1A 4EG5A 3CA8A 2OQ2A 4MPPA 1N2GA 1O96A 1WQ4A 3ZXSA 4H3SA 4V1CB 1OWPA 3PDHA 1D2RA 1V47A 2CT8A 3COYA 2C31A 1T9GR 2A4MA 3I05A 2JIBA 1JECA 3IUBA 1KP2A 4GU5A 4X0EA 4DDMA 1Q1AA 4JUBA 2H2HA 1O95C 4D5GA 1PO7A 2A1TS 4PBSA 5TGTA 5HUHA 4K9MA 4MW4A 1M2GA 4Q9DA 4V1CA 5TEWA 3RJZA 2PIDA 1Q6ZA 3GLUA 1XNJA 2OD7A 4ZT6A 5IMSA 3PNVA 2V0GA 1U7XA 3P0JA 2Z09A 3X1JA 5KHAA 3F6EX 2A88A 2QUJA 1GTRA 1MAUA 3GLVA 1GZUA 3SZ3A 2ZUEA 3IAFA 4QBTA 1S4MA 1YC2A 4MQ5A 1JGTA 1O94D 2ZP1A 1KAQA 3IOBA 4I6JA 4QQ8A 4MUFA 2A86A 4MUNA 4IF6A 1JIKA 2H29A 3TS1A 2QUHA 3D6UA 2IHTA 1M1ZA 5BWNA 5HUJA 4HK4A 1WXGA 2DR2A 2Q5QA 2VTBB 3ND5A 5HG0A 3ZJUA 1T9CA 3PKJA 3Q10A 2JAXA 3DPIA 1MB2A 4WNYA 4GRIA 4WSOA 3K35A 1QU3A 3JR3A 1QNFA 5DK4A 4MUGA 3S3TA 1MB9A 3IMEA 3RIYA 3FG9A 1N2HA 4MWCA 4S1OA 3SP1A 4AQ7A 3CR8A 3KT3A 2VTBA 2AKEA 5DEOA 1JHDA 1NI5A 4Y6QA 3LE8A 1NYLA 3QTTA 5TEVA 3UOWA 2DJIA 2Q28A 3JXEA 1M8PA 3CVYA 1S7GA 1YC5A 4K9QA 1N77A 5EJ5A 2X1LA 4JU9A 5MGNA 4F3RA 5MFZA 3KT6A 1JMVA 4EG8A 3K9WA 5TS2A 3UMVA 1ICIA 2H4JA 4HD8A 1PT9A 2A1TR 3D81A 4ZT7A 3X1KA 4KGDA 1PYDA 3DO8A 3CLRD 3M5WA 1QRTA 4U63A 4E1AA 4UUAA 4TWIA 4EG1A 4UZFA 4EG4A 1TEZA 1YI0A 4JUAA 4J76A 5FO1A 5H16A 3VRHA 2VJYA 5EJAA 4CQNA 5LFAA 3U31A 2H2AA 3IUEA 4QRDA 1R6TA 3AFHA 4RPIA 3CLTC 4TS1A 3F3MA 4MVWA 5BWLA 4ND6A 2AZXA 2G36A 5K2OA 2DEUA 1GTSA 3CLUC 3SYTA 2A7XA 4KXQA 3AIIA 1JSCA 2DLCX 1Q15A 3PXUA 2AG0A 3FI0A 3IOEA 3QTBA 4UTZA 5K0TA 4MQ6A 4MULA 1UPCA 3MMXA 1OBCA 4I6EA 3HZRA 4MWBA 5JBNA 2WB2A 4X3PA 2ZUFA 2A84A 1GAXA 5K6RA 2B4YA 4FZ3A 1OWLA 1F7VA 1PFUA 1M8GA 2RE8A 1VBNA 1Q14A 1V5EA 3VU8A 2QTMA 2H4FA 1T6XA 3RBAA 1RQGA 1OVMA 3SEQA 2O8VA 1IRXA 2QJFA 1QRSA 1Z8NA 4K9OA 2WSIA 5KWVA 2XRZA 4L3OA 4I6GA 4YMIA 5EJ6A 3MUEA 5K6TA 3UC5A 4CDMA 5MFPA 5AHKA 2CFOA 3ILVA 1YIDA 2QUKA 1DNPA 4MUIA 3IVXA 1H1TA 2X7JA 4COKA 1NUSA 4MAFA 1PNQA 2DXIA 4D5EA 2IP1A 3FLMA 1NUPA 3ELBA 1N78A 1FFYA 2OO5C 4DDKA 1JEDA 5FYQA 4YP7A 4OJMX 4MW0A 1T9AA 1OBHA 3FOCA 2NSYA 1N2OA 1X6VA 4KKVA 2BTEA 1V8FA 2QTRA 1GPMA 1KQPA 3K32A 3AKZA 1HZZC 2Q27A 5MF6A 1N2JA 1T6YA 4XFDA 3ZGOA 4G5FA 5DGDA 2V0CA 1O97D 4JT8A 4F4HA 5F23A 3FSJX 4K03A 1YI8A 2QTNA 3GUZA 1N0HA 4MWEA 3PKIA 4GPEA 4UU7A 1ZH6A 2V3WA 2CYBA 1A8HA 2WVGA 2PZBA 2PXHA 1LW7A 3PNYA 2PGNA 4MUKA 1JZQA 3P0HA 1K97A 1KH3A 1M8KA 2J4DA 4FZJA 1NZJA 4MPRA 4I5IA 5DGTA 4BN5A 2JI7A 1ZH0A 3FH0A 2B7LA 5J59A 3TQOA 2FWNA 3D7KA 2DUMA 2GM3A 2AG6A 1O5TA 3CVXA 1I2DA 3UY4A 2PGOA 2A1UB 1PI3A 3E9YA 4K9PA 2NZ2A 3U1VA 1GLNA
chains in the Genus database with same CATH superfamily
4BE7B 1YCDA 1X7YA 2AX4A 3Q12A 3IHLA 3GRFA 1A4XA 1Z6ZA 3CLSC 5AW5A 5LB2A 1ZR4A 4UE2A 4CF4A 2GBPA 4L7QA 1LTKA 1ZRHA 2YWXA 3B2EA 3G8BA 2ZRIA 3TI9A 1NG1A 4Y2UA 4UXHA 1Q74A 1VIMA 4HAXA 1AE1A 1SBTA 1JG3A 3DMNA 5HFNA 4CUJA 3RW9A 1S7CA 3W2EA 3HV0A 2TSYB 2POQX 1FDUA 1USKA 5KYTA 3QTLA 1P4AA 3BZBA 1KWKA 2IXGA 5CT9A 3AYZB 1L7DA 3G0GA 1EK1A 1IBSA 1TIPA 1SVOA 2WG2A 3OZRA 1QVVA 1T4GA 2VHTA 2WPDA 3FVTA 3QE4A 2W90A 1NATA 1V35A 4GBGA 4NU0A 4UHHA 4F38A 3HDTA 5IKOA 1U1IA 4I50F 4DARA 1P0QA 3SQNA 3MINA 3MT0A 1A2BA 1W44A 2IHUA 3OHPA 5CX4A 4YAKA 4YRZA 2GGSA 1DO2A 3IELA 4Y2RA 5KTRA 5JWRA 5CRIA 3OIDA 2IEGA 2AYYA 2P2SA 3C3DA 4WK0B 4ZT5A 4CM7A 4PVCA 2TMDA 3R0JA 1UPAA 3CUUA 1HSZA 5F7ZA 4PLCA 4X64B 5C4MA 1JV2B 1Z0FA 4ZZ2A 5IKPA 4OLJA 1TGVA 3SQOA 4NECA 4XPIA 1DQPA 2AD1A 1EUYA 4AI6A 2JLVA 1DKRA 3HNRA 1OKKD 1RC1A 1SU4A 5DM4A 4DCVA 2XCOA 4DUPA 4O8ZA 2ZRDA 1WOYA 3LT0A 2B35A 3WK5A 1L4MA 3MCZA 1OVGA 2VHJA 2GDJA 1CR6A 3PTZA 1DIBA 3W9UA 2XRYA 2Q8PA 1XVVA 3CSDA 3C3MA 3KP1A 4NCNA 1QF7A 2CFTA 4QICA 2RG7A 3FDIA 3AL0C 4E5PA 3NG1A 1D2EA 3EIFA 5J9FA 3X1YA 1CDEA 1YVEI 4RWZA 4XYLA 3I45A 3MWDA 1KPHA 2KBEA 3BRWD 4UQOA 4BN4A 1XQXA 1FPQA 1WM1A 3A0RB 2JGFA 1GKIA 2ISCA 5CX1A 1RHKA 2C2OA 3E6AA 3MMSA 1NRIA 1E64A 2A9KA 5IKMA 3QIAA 1FL9A 4L8YA 3R7WB 1NQ5A 5BNTA 1MVNA 4Y2TA 3LO5A 1E98A 4LJ4A 1FMCA 1ZI8A 2WJ6A 3RKRA 2ZJ5A 1VHDA 4UCWA 2W22A 2QYHA 3DL0A 3ORFA 1YFLA 4LW8A 3K1JA 2VUHB 3GJ5A 2HO5A 3SYRA 1LK0A 3SM3A 3ZKAA 2Z6UA 5C7LO 3I2GA 5BYBA 4M37A 3SBOA 4HP8A 4EHIA 5LQUA 5EJ7A 5TLSA 3U4DA 2ZUCA 1YS2X 3BIFA 4LZOA 4HDSA 2WVAA 1IY9A 3BMCA 3AJ8A 3O31A 4PCAA 4UBJA 3IBYA 4NU6A 3REQA 1FYEA 4R1LA 3TK1A 2E4ZA 3WR5A 4BQQA 3FJYA 1M34B 5TE9A 1VL2A 1E96A 1ZBQA 2L0XA 3MOIA 1ZFNA 2WV9A 1VQ1A 1NRJB 2DQYA 4PV7A 1QQTA 5DH9A 2HWYA 3WP1B 3TBKA 3OQIA 4J4BA 2C5EA 1U0NA 2PHZA 4ZEWA 3RTBA 5FTJA 3WWOA 2B4RO 1W93A 3KR2A 3OCVA 5F2EA 5CAEB 1AJEA 3GP8A 1WF6A 2REQA 1BFKA 1ZVKA 3B1JA 5EJ8A 2VUUA 1T6ZA 4LE2A 3G2IA 4PFQA 4P58A 3MEQA 2BCJQ 3BAZA 6AT1A 4BZXA 3SJBA 3HPRA 1QS0A 3JQPA 4UE3S 1XF1A 1EFPA 2PYZA 1OLUA 3GHHA 3NS7A 4X71A 5P21A 1SU8A 3EVZA 3OZAA 2P6RA 1A88A 3DBVO 5T7BA 2FWIA 3GEEA 2PKQO 1AS2A 4ABTA 1ENPA 2WWYA 1QCZA 2I22A 5KQPA 2A4KA 1UAAA 4DCTA 2IL1A 1LV7A 1MOQA 3FYCA 3P0FA 3A04A 4AZVA 2LDBA 1NONA 3IILA 1L7RA 2GEJA 4Z4QA 1NPYA 2R6R1 1N8TA 4XOIA 3E5MA 1PG2A 3GU3A 2BGRA 2HIGA 4Z9AA 2J0VA 3UAOA 4RQUA 2EDCA 2O1WA 3V42A 4NZMA 3TZEA 1CFJA 4OHBA 1HYEA 2AYZA 3NJRA 1C14A 4TM7A 3ZVNA 1Y8RB 1NVTA 2VZ9A 2HWKA 3LI2A 3RO7A 4PAOA 3SYMA 2Q2VA 1RKXA 3DLCA 2G83A 5HPYB 1W4RA 2IJGX 4WDQA 1DDOA 3OCCA 4ALMA 3AVWA 1YBFA 1FNDA 4JY7A 3RWOA 3SYKA 3W8NA 2HT1A 2AJDA 2PSHA 1IUNA 3D4LA 3EIXA 2FPKA 2C2HA 3H86A 3WICA 2HRRA 2IODA 3FNHA 1GGEA 3PF8A 4HGYA 4XLZA 1WB6A 4X1KB 1SQ6A 2XE8A 2O54A 2EC5A 3H9JA 3I1YA 2FMIA 4V3BA 3VU3A 3NKLA 4LECA 3NCHA 4BRWA 1ADJA 1Y1RA 2P6UA 4PZPA 4CKYA 1YONA 4H3HB 1K8YB 5HE8A 4QGBA 1M6VA 1W46A 2CVZA 2FKAA 4JYCA 3HWSA 4O1MA 3Q1KA 2V74B 2LR0A 3P9SA 3ROFA 3RK1A 1X7HA 2K5UA 5IJZA 3VZPA 5LMUB 1VG1A 3HXTA 2RONA 2ZIEA 1E5DA 1FYFA 3CXUA 2GCIA 2BRUC 2UZ1B 4YREA 3AOEC 4ZT2A 3SLGA 1PR9A 4WOPA 1E8MA 5DNCA 4DLPA 5B57C 4KRFA 1SBHA 5EMKA 4XIYA 2GN9A 4WKGA 1U2RA 1T29A 3FHCB 4S1TA 5GOTA 3MTBA 3H1FA 1NKTA 4LXYA 3KQSA 1O6BA 2VDOB 3OAAD 3OBIA 4Q3NA 1GUYA 3GEMA 1YL5A 4B82A 1T24A 5KC8A 1W5FA 2QVGA 1QDLB 2E21A 2XT6A 4CDGA 1Z4NA 1QMPA 3NVDA 1Y3HA 2IW1A 4AUEA 1CR2A 1SH7A 1THMA 1R0YA 2AKYA 4KBFA 3WWDA 1JYFA 2DE0X 1W2HA 2KYRA 2QIPA 2PD3A 4KLZA 1ZH8A 2RJOA 1K9SA 4CKEA 1O0CA 5JAQA 3W05A 1WJGA 4CLXA 5KQGA 1MHTA 4KREA 5EFZA 3R8XA 5HWSA 2E4UA 2EKZA 2P3LA 2QPOA 3KT8A 3S5UA 1Y1TA 4C4AA 3ENQA 3HRIA 3CLKA 3KT0A 1M2JA 5IJ0A 1KS9A 1WD5A 5E6RB 4XGRA 3OQMA 3HJFA 4MRRA 1HYQA 2JI6A 4HQOA 5IJWA 5HTOA 2XGGA 1Z16A 2IZ6A 4ZQHA 5K01A 2ZZMA 4GGMX 1N6RA 3UK2A 2BEJA 2BHTA 2I6XA 1UFKA 3ZLTA 5DW3A 1NWCA 2P6MA 2A0YA 3OCJA 4OHRA 4ZQCB 4YWHA 1PWZA 2AJLI 1O9GA 4GM1A 3MT9A 2JD2A 2OAP1 3GJ7A 3PUXA 3EF1A 1ECBA 2DQSA 4NBRA 1ZGBA 4B35A 4G2NA 4OAOA 5BV2P 4Z9XA 3SXPA 1MW9X 2BEWA 3AHCA 4ZU1X 2BUCA 2OHXA 2QUZA 1ACMA 5L3RA 3ORHA 4G8CA 3EUEA 4MAMA 5FWXA 4HDNA 2H16A 2Y67A 3F5MA 2EZ9A 3HCCA 3HUEA 5ANRB 1P5ZB 2JAQA 3NETA 4XJTA 5BT9A 4EO7A 1JDTA 1L1QA 1PU2A 4TT3A 4WOCA 1SZCA 1Q92A 1P6XA 2NWQA 2P9QA 2QVYX 1XV5A 4ITUA 4RABA 5DRYA 5F5NA 5A4AA 1WVGA 4F71A 2GM9A 2Z4SA 4LCBA 4C30A 2IW3A 5ELXA 1NYQA 5CDSA 2IHVA 1FMLA 3RUFA 5JJ5A 1YFJA 1HNWB 4MSUA 4YMVA 1HXHA 4QGHA 4QXPA 4TZ0A 5F2OA 2Y92A 2ZXEA 2AG1A 3L8ZA 3MXOA 1NM5C 5D6NA 5CNMA 1RHRA 2MHCA 3AF6A 4L2IA 4XIGS 1TM7E 4ABYA 5HGXA 1NSTA 1XKQA 3PNBA 3WBFA 4RHFA 5JADA 3AK4A 2XF8A 1I2AA 5LXTF 2XZLA 1U8TA 1WW3A 2JLCA 4I55B 3SD7A 4CT5A 2YV3A 5KSZA 3ZGVA 3SEZA 1USGA 1WOMA 2BZGA 4MUHA 1P6QA 2FGJA 2ZIAA 3C14C 3JYQA 1Y3IA 3O8QA 4HY3A 4CU5A 4JVSB 2X1MA 1E2LA 1Y6FA 4HCJA 1OX6A 1AKWA 3S6JA 3R9KA 2JLXA 3FNBA 2ZCJA 4WXMA 1XVTA 1KZYC 2VPIA 4HB3A 3RE1A 4DF3A 3GD7A 4QT4A 2GBIA 4Z7QB 4KFCA 4K26A 3VR5H 1SGWA 3R5JA 2CHGA 4AZWA 4FHGA 3FHLA 2GFHA 4X6XA 3F1LA 4JJAA 3SCZA 4YUWA 3A14A 2P9GA 3PWZA 1E6WA 5HRCA 1X7GA 1WXXA 3BSYA 1N5OX 3LECA 5AXCA 1TT5B 4D5GA 3L7LA 5JMOA 2A1TS 2PRSA 4POAA 1Y8AA 2I9PA 5I9NA 1DAMA 1FMJA 4HYQA 3G0IA 4UUPA 2X9GA 1H4TA 1S2GA 3HJRA 5LMZA 3M6UA 2YQ5A 1W59A 4P80A 4U39A 4DC9A 4AG6A 2J4CA 1REQB 2MMGA 1I5OA 4LY3A 2ZIWB 5KHAA 1SG9A 2R3SA 3I52A 5C3UA 2IS1A 1Y1QA 2JGAA 1KDRA 3SSAA 3HN7A 1BJTA 2NOAA 1WKVA 2JKYA 1E77A 3U0VA 1ATZA 1BMQA 2R97A 4RBNA 2QOEA 2HLDD 4WVFA 3JAKB 4JI0B 2MSLA 4B6RA 1GR0A 2B8JA 3SHVA 1JT2A 4YJ2A 3H75A 2H4WA 4GL4A 5LA6A 2BJHA 2JVJA 1U0RA 2IPXA 3W6OA 1RKVA 2BE9A 1OFVA 4WASA 2HJWA 4DJJA 2ZBDA 3RWBA 2XE7A 3FRIA 1XEWY 1NXSA 5ELLA 5LNK6 1DBWA 3QLUA 4HYEA 4F97A 1O5OA 3F9IA 2VPTA 4ZMRA 1KYXA 2WYWA 2DHRA 2J0SA 1S8NA 2OSVA 1QKJA 1DXYA 1Q6YA 1TF7A 1K8XB 5J2TA 1QHFA 2ZYDA 2VAPA 3BMNA 1CUYA 3QU7A 1UINA 1YS6A 2W48A 4G3XA 4GH5A 4TUYB 5EL0A 3CGWA 3UMGA 2G07A 4C2AA 5IHPA 1R74A 2OBXA 3JV7A 4ZGBA 1YA4A 4C4RA 4DAOA 2O3JA 2H9YA 3EXEB 2BI7A 1T6BY 2GJAA 2ZAIA 3TLKA 4A9AA 4K87A 1VJGA 2XXBA 5CD1A 3HFGA 3N5CA 3QMPA 3NRBA 4JLWA 2ZUUA 4R2KA 1A8UA 5DYWA 4TWIA 2H1WA 4EG1A 4Q05A 3OOHA 3IP9A 1Z5NA 3NHWA 4BEVA 4EPRA 4BU1A 3DOIA 4W8HA 1YA6A 3T54A 1DADA 3OP4A 1K7CA 1O6GA 2B2NA 4PGMA 5KPDA 3MWFA 4F2HA 4YRNA 4RNDB 1JDVA 2B2XA 3HBJA 3IT2A 4RFSB 2P8SA 1QYWA 1GTSA 3U61B 5C46F 1VECA 1BMFA 1SVUA 5DXAA 4H3VA 3ET5A 2GPBA 1E9AA 1L5RA 1Q15A 3KLMX 2O2SA 2JFYA 3D4OA 1Q7RA 1MP0A 4O02B 2C8LA 1MB0A 3I42A 3AB3A 3BXPA 4XX1A 4FWIB 3AJDA 5EZ5A 3ABQB 4QQKA 5A1TA 4DLLA 4LE1A 2BUAA 2I6GA 2GPTA 2WICA 3V4SA 1Z0AA 1T5IA 3FNQA 4KFTA 1VJ1A 1OBFO 4DRXB 3VU8A 1KJJA 4CM8B 3RIEA 4AXXA 4HQFA 2AJTA 4K9SA 2O8VA 4HLNA 5TQ0B 3DKIA 4NCHA 1EIWA 2ECQA 4V0RA 2VP3A 4BEWA 2D8MA 1KAOA 5TMPA 1MO3A 1Z06A 3MW8A 3M4YA 4B3XA 4D9IA 4RV9A 2CFCA 3TW8B 5E3IA 2IUSA 3OM8A 3DP9A 4HTFA 5K1ZA 4LVUA 4FIZA 1LJ8A 1UAGA 3VDNB 1NV9A 1VSTA 1GADO 1W76A 3ED1A 3FDJA 4JR0A 3WHLA 2WRZA 4G09A 3FR7A 4Q3OA 1ST2A 4ACBA 4HKTA 4YJHA 3VKWA 4ZIRA 5LDDC 2N9UA 2YMQA 9LDTA 5AUPB 1ADYA 2J7PD 3SF8A 3SNHA 5FBHA 4NOJA 2IH2A 4M8NE 3U7FB 3WNCA 1YQ9A 3PRKE 1OXKB 1DEAA 2YMPA 2ST1A 2GAAA 4W6QA 4TRNA 2BTEA 1U8EA 2ZATA 4BQEA 4UQLA 4G97A 1NASA 2ZR7A 4J0HA 4BKRA 3A9VA 4DNQA 2HHAA 5CLFA 4AJ2A 1WHSA 1XTJA 3PHCA 4UU7A 2BD0A 4X62B 1NNEA 2PJDA 2V3WA 1WBJB 3VNRA 1ZY2A 3PA8A 4OI0A 5C8YF 2HMWA 3V6LA 2GEFA 1KH3A 2RAFA 4TMVA 6LDHA 4ZYTA 1RAFA 3F4KA 5DGTA 4YRAA 3A37A 3MMNA 5BSFA 3UT0A 1ZH0A 3RTDA 4DV4B 2DUMA 4RDHA 1AQ6A 3QOFA 4XLTA 1QGED 4G25A 3NDPA 5B58C 1O6CA 4BLWA 3SMQA 4ALNA 4CM3A 3KTOA 5CPBA 5BUSA 2H0RA 3PHBE 4EB6A 4D44A 2DBVO 4MMZB 3EEFA 5J40A 4OH7A 4U00A 5ECGC 1JBKA 4I50B 4UBOA 1ENZA 4C7VA 2DWQA 4TMKA 1YKSA 3LWDA 4A8HA 5AHRA 5F2NA 5JAIA 3UV3A 4GOJA 2UVDA 1QIJA 2AQKA 2J9YB 4LDAA 2H3EA 2ZWAA 1EQ2A 4LOHA 4DLSA 2PKQP 5FHQA 4PGGA 4XWAA 2FXIA 1DFHA 3RC8A 2RH4A 2XA2A 3KS9A 4UASA 3MOGA 2YOFA 1I8TA 2G7ZA 3L6BA 3VFDA 2ZAYA 2Z0MA 2ZBFA 4GFDA 3FWNA 4HDMB 4MDFA 2ZYVX 3NPMA 1Q1EA 4RSRA 4LRUA 5KAMA 5KB3A 3NM6B 2YWDA 4IOJA 3U9SA 3HCBA 4XJSA 3VAZA 1HLFA 5EQDA 2NO0A 1FZTA 2YHBA 3LUJA 4KYUA 3WTCA 5HKBA 2MSKA 1PJLA 3O1IC 1H05A 1CRWG 5DYNA 4PCLA 1Z13A 4NCKA 5K3FA 4HNGA 2CHFA 4KVAA 4B3FX 3IESA 3N2GB 5AOVA 4PLTA 1A8SA 3SLRA 1EHYA 4DYHA 4YC7A 3RVLA 5C5DA 3R2JA 5KQRA 4CRWB 2WKSA 4X00A 2C4KA 4MQFB 5JMTA 2QLTA 3OZEA 4C4SA 2MYNA 1E3DA 1X92A 2I1LA 5CH5A 1X8XA 2FEMA 3PENA 4EX6A 1WDKA 1SHZA 3F49S 3M83A 4A1OA 4PPGA 4TTPA 3SIWA 1HDGO 3A2KA 2I7XA 5AUQA 3U4GA 1KHTA 1OU4A 5JJKA 4TTVA 3VO8A 5LIRA 4CKCA 5BO5A 4QHYA 2WW8A 4C0SA 2F3PA 3QX9A 1KVUA 3EW9A 1YQUA 1L5OA 1E1NA 4JBWA 2BBWA 1JUDA 4RU1A 2GN6A 5FPQA 1BEEA 4GMGA 5IARA 3U3DA 4YCDA 2Q3DA 5CFOA 3CZMA 3KZMA 1U65A 3UHAA 4C89A 3FMVA 4IWYA 2VK1A 2EZ4A 2YZ7A 3AOEA 4Z1MD 5HOQA 1YQEA 4DDWA 3UTDA 4XQCA 1GCAA 3EXIA 2H9IA 3HKEA 5SY6A 4EB3A 1YVDA 1LUAA 1OI3A 3PL5A 1I2CA 1PJAA 3DEKA 1SG6A 1Z5GA 4LWQA 4EHNA 1XZIA 3AHEA 1I9CA 1OXBB 3CF2A 1V16A 2CUNA 5JXGA 1H6DA 1J0AA 1UBRS 3IUJA 4M98A 3CNHA 2VJMB 5DBFA 1G5FA 4HDOB 4LBVA 3MTEA 5HZGA 3IKTA 4A6DA 1E5XA 1FJHA 3OY7A 1H3FA 4MYHA 3VV2A 3OEEA 4EFNA 5HZMA 3C7TA 1IXRC 2PUDA 3STVA 4MR7B 3LZCA 4DA8A 4FCCA 1AHNA 5IT5A 2ZETA 3URMA 2HF9A 2OV1A 4DT1B 3FYUB 3ZXYA 2ZWVA 1E0DA 3S2UA 3RJ9A 3MAAC 4DTCA 1SQSA 1XCPA 1DQNA 2O5RA 2WM3A 3LPMA 3OO0A 4JJGA 2JGMA 1YTLA 4L1KA 4MKHA 5JCJA 5ITWA 2M2IA 1M2VB 1WB5A 2X7XA 4MV1A 1UKAA 2WJHA 3L6UA 2A9FA 1BHQ1 4YP9A 1RIIA 2RGNC 3I72A 2C92A 3A6JA 4LJ8A 5H7XA 1WUTA 4I4IA 5IKXA 1M74A 2IXFA 1T1IA 1UXHA 1EESA 3GCZA 4I5GA 2HSEA 5C31A 3PX3A 5THKA 3CUSA 4OSEA 3G7SA 1SXIA 5JD4A 1YQDA 1JJIA 4DHEA 4DWVA 4FOOA 4KUGA 1NZFA 3PUVA 5AUNB 2O9JA 1CEQA 4NMWA 3L79A 2HWXA 5B7QA 2I4LA 4FHZA 2H4XA 3RS2A 2AEMA 3ND6A 5EY5B 1J2UA 4K9NA 3A9CA 4O4HF 2WUWE 4CJXA 4JLBA 4FYYA 2EJWA 1N1EA 3V8EA 1KQFA 3GLFB 2JVKA 2W5UA 1KAHA 3OC6A 5KVAA 2Q6IA 3AFOA 1NUQA 2QP4A 2WIGA 2WJYA 1GPYA 1NM5A 1LFDB 1DC8A 1SB9A 4EYOA 1L8LA 4O25A 2VPXA 1HETA 2HHHB 1JT9A 2FCAA 2VF7A 4EW1A 4IRMA 3ORYA 3ZEIA 3LUGA 2ZRKA 3G5LA 3L8HA 1R7RA 1FVOA 2IYAA 4FBMA 2HXYA 1H0HA 2ZANA 3OPYI 1TE2A 1PN3A 1SUWA 1X1DA 4EITA 1DKUA 1X9GA 1DRWA 3EGCA 1Z2CA 3IV6A 2JI9A 4L0CA 2JJYA 3HGMA 4URUR 3RROA 1YRYE 3BX1A 4I66A 4Z8YA 1VIVA 3FFWA 4H6XA 2EERA 2W2VA 2WD7A 5L7TA 3OT1B 3DLBA 3DB1A 2Q0SA 3JQFA 2W6IA 4CMGA 4KE7A 5KO2A 4LYJA 3DTVB 4CIBA 3B2QA 3G2JA 4UFNA 1GPDG 4H1VA 1EVZA 1VA5A 1QHIA 1GQ2A 1M73E 4WT7A 1NUTA 4BVBA 3BKXA 2AOTA 5F4BA 3S5JA 4CN9A 1RYFA 2H92A 4GPZA 3HZOA 1QDUA 3SXUA 2UAGA 4D4LA 1WXIA 1UT6A 1ZU5A 2PLWA 1OV6A 5E3HA 1NXXA 3TBFA 2ZWOA 5EIWA 1I7SB 3PTAA 4XD2A 5KNBH 5JASA 3AVVA 1ACLA 5D3MB 5F3DA 2V98A 3A6ZA 3TJRA 3BGWA 3ZHOA 1I33A 1CUDA 1PJ3A 3JRNA 3A6DA 3FKJA 1RW4A 3YASA 3ZE9A 5TARA 3GLQA 2CL0X 2R0QC 4AY6A 3AU9A 2PANA 3IS3A 3EZYA 1ZHHA 5EKDA 2E55A 2DT5A 4G0XA 4FD3A 1E60A 4RH1A 5J5CA 5I4IA 3KKPA 4BFTA 1C4OA 1K5DA 5TVKA 3ZBQA 2PUWA 2HA4A 3LQ4A 3IAEA 1EJ6A 1R2QA 2BEVA 2D3TA 3A2MA 2IBTA 3S8MA 3R0VA 1V5GA 4PW0A 5LL6P 4BZWA 3KQOA 3UA3A 1X7WB 4KPYA 2GFIA 2FRXA 3B38A 3ESDA 1RXEA 1P80A 2ZI3A 1DZ3A 4NBTA 2QW1A 4DR5B 2DC1A 4ZPXA 2Q7OE 4YRBA 3N8KA 3G5UA 3VR1A 4ENQA 3CYFA 1D2HA 3DV2A 3CT4A 1X87A 2YYYA 3D7SA 3FIUA 2RGDA 3EXHB 4EI2A 4GKBA 1CJMA 4REQB 1BCRA 1I4OA 2V45A 1UKYA 2FR8C 3ECCA 4RQBA 2VRCD 3JD1A 4EHLA 4YXWA 2BMDA 4XB1A 1S3FA 1LLFA 3HSKA 5M29A 4R1OA 4JJ6A 4U7TB 3IDFA 1Y7HA 3HB4X 4FGZA 2VT2A 4E7PA 3QYJA 1N25A 1KEEA 1HTBA 4IDAA 4RLQA 2IYPA 3VV3A 2WYOA 3MELA 4F5EA 5JSFA 1M6HA 2JFWA 2PL3A 3WGLA 4CF5A 1NOJA 2YWJA 1JQ5A 4IO0A 4E09A 4JBGA 4ETIA 2DSTA 1LSJA 3GEPA 5LXTB 4BY9E 1SURA 2HYIC 4M2LA 2WABA 5IH7A 3AEKA 1E7SA 5CJPA 5CMLA 2IV2X 1A5AB 2QUBA 1FSFA 2A94A 3F96A 2CVFA 1AQJA 4A82A 2ZB7A 5EHXA 1QHHB 5KTMA 4WLEA 3UW1A 5D5PA 4AULA 3SZLA 1M2OA 2WNSA 4CCYA 4CEIB 1RAIA 2ZE7A 5ALXA 1PZHA 5GJBA 1U8FO 4B3RB 4V3CA 3RSQA 3UCFA 3KWLA 1OAOA 1WCV1 3L8YA 3S2FA 5A7FA 4DYDA 4LZPA 2PZKA 5JPDA 4HGNA 4DZTA 3B20A 4NULA 1HFKA 1KEPA 3O2SB 3CEMA 3R4CA 5AKHA 4DPMA 5IN5A 2XB4A 4AF8A 5JRDS 4RK5A 2ZUDA 1UQTA 1P7ZA 1UK9A 5EWMB 1VI6A 1PTJC 2CHEA 3FZNA 2O7RA 1KQOA 5KYYA 2V7VA 1IEQA 2JIPA 2ZAOA 3HZHA 4TN5A 5HF6A 4ZPJA 1Z88A 3QUAA 2B99A 4EG5A 5CA1F 3EOBI 3DMHA 2OQ2A 4PYQA 4KEAA 4EA7A 1PZMA 5CNKA 5I9BA 4DLYA 2H0AA 1B14A 1RI3A 1IHYA 2GEUA 3NONA 1CNEA 4YRLA 2PBRA 1IY2A 1KO7A 3GNTA 1WSBA 3OE5A 3G2MA 5A03A 1DX4A 3DE1X 3B82A 4IDNA 3LUCA 4D7AA 4E3WA 5I9IA 3LSYA 5TT1A 1A4UA 2IV7A 3O82A 2Z1NA 3EGXB 4G41A 3RVJA 3CLHA 3OZBA 3RJZA 1U04A 3KR0A 4HNQA 4BNWA 3CPHA 1XKTA 2YIDA 2XB8A 3LHIA 1IM5A 3MWEB 4P3PA 2OD7A 5AJHA 2PGAA 5HRAA 4AX4A 4UM9B 5B37A 3B48A 1XYVA 2J3MA 3TM5A 3M6IA 3P0EA 3UPTA 2HB6A 2WB4A 3E0QA 3WHIA 3FPGA 2QN1A 2M1ZA 2QUJA 2XXJA 1QFYA 4MRPA 4OJQA 2B8WA 5IP5A 1L5YA 2GCOB 4OP1A 3KHUA 3C5WP 3S2YA 4DEVA 1KGDA 1YZTA 3DE4X 3FDFA 4FFVA 3BCHA 3C3BA 1RIFA 2H18A 4QQ8A 1QGAA 4MA4A 1X9IA 3DBRA 16PKA 2H07A 3AV3A 3D8UA 1JIKA 4KSCA 4Y2HA 3U4CA 3UXMA 3X0DA 4YUAA 7ABPA 1XU7A 2NVUA 5L6MB 3PR2B 4WZAB 1L5QA 4C22A 1FFWA 3I9V1 2ZB8A 3BH7A 4RPLA 1MF7A 1LF5A 1BVYF 2B25A 2DCUA 2C9DA 3LPAA 5G3YA 3GLKA 3ND5A 5CW2A 3RNOA 1XK6A 4K3UA 3R9XA 2J0UA 2E2WA 1I24A 1AT1A 3NHAA 3DPIA 4BQFA 5IF3A 3JY6A 1RSZA 1QHXA 2Z9BA 3KQVA 1RR6A 5F4ZA 5T4FA 4EPTA 1J1IA 4ED9A 1QRDA 3BL6A 4OHOA 4OQMA 1W47A 1JHVA 4YBZA 4W7SA 1VRWA 2V03A 5DHSA 1XRNA 2D7DA 5BW6B 4R2IA 4V0OA 1CG6A 4IIDA 3QFTA 1WPQA 3Q7PA 3UWKA 5CTAA 3VR4A 3E61A 3QMMA 3K9WA 1B8PA 4HD8A 3KJXA 1G18A 4XYBA 4KH0A 4HS4A 1QRTA 2R7KA 4JQCA 4U9IS 1M0WA 1CDDA 1ABFA 1IEVA 1Q0LA 2XDWA 3HSSA 4JSYA 5GOZA 3ZHZA 3ZWVA 2RC5A 4BFWA 4K6OA 4M53A 1U5AA 3IMKA 4GYYA 2N0SA 1QZZA 1I30A 3P9CA 2B8TA 4EGSA 5EXEA 1EX1A 3KSBC 5FIUA 2I55A 3LUPA 3LFUA 4PAQA 2BGNA 3WL6A 4XA8A 3R6TA 5L3ZA 3OVMA 4DSZA 4RPJA 2EW1A 1BXRB 4TLDA 4Y3UA 2PU5A 4KXQA 2VNSA 2J5KA 1TI7A 1JL3A 2ZBQA 3AIIA 4F5YA 4Q5IA 1E1QA 3RBZA 3L8GA 2CDRA 3R0XA 1L8AA 1NT4A 2RHCA 2H1RA 2HAEA 4G01B 4Y2SA 3NNNA 4MULA 4E5VA 5J4YA 2Q62A 5LWQA 3JQBA 5LD2C 1Q0SA 1QH0A 5F9FA 3PUWA 1PKXA 4I1IA 3EA5A 4K6CA 2W6JD 2CHUA 5HW0A 1GAXA 1R6DA 3L1KA 3UNXA 5IYZA 1F7VA 1E61A 2IPMA 4QPDA 1KPIA 1OLXA 2EBWA 3UUWA 1D1SA 1VI5A 4H16A 1KDVA 2A5JA 2P5TB 4MJLA 3ZY6A 3OH8A 4YCCA 5L45A 4IOLA 3RAJA 5LYJF 4O2AB 1ODTC 1T43A 2C5GA 4D43A 1H5NA 6GPBA 3GJSA 4L5JA 4QLAA 2PNFA 4ROTA 4A2WA 2ODEA 4PSDA 4PS0A 1HDYA 3IGFA 4YMIA 3UC5A 1NP3A 3HKBA 1TK9A 1CB0A 4ND3A 2ICAA 4PAWA 2ACEA 3LOUA 2WTXA 2B2CA 1B4DA 1TM5E 3LIPA 1XNRB 3L0BA 2QSJA 3BXFA 2PX2A 1K6IA 1VE6A 3I64A 4F5WA 1J25A 4RIHA 5ADWA 5FX2A 3WLTA 3CLVA 3OJWA 1VBFA 5C8YB 4RD6A 1X7XA 4HXGA 3G89A 4FFDA 3RG8A 1T9AA 1G2IA 1R4NB 4IIUA 3VPHA 4B6OA 5E95A 1PD1A 1PRYA 4CIVA 3K32A 3MSXA 1KQPA 1J07A 1YCGA 4MCHA 3DULA 4QQFA 4RJ2A 2XGJA 3HGTA 3JAWA 4Q9AA 4RETA 3HN6A 4C2BA 5AK5A 1N2JA 3PR3A 3C1OA 3G0OA 5LKAA 2HF8A 1Z6QA 2VIIA 2V0CA 1N5JA 2A5YB 3G0BA 4K03A 3GUZA 2WU0A 1CR1A 2X8WA 2TYSB 4KE9A 1W88A 2Z8XA 3NTOA 4MWTA 4PYNA 5CBKA 3P0HA 5IEBA 2O8DA 2G9QA 3ZWCA 1Z9BA 4BLQA 1FNNA 1RMTA 2VKQA 3ZE6A 4IV5A 4NMHA 4N76A 1ZK0A 4FFWA 5AIAA 3VI3B 1BEZA 1Y6ZA 3AY6A 4MP6A 1TAQA 1P44A 3EZ2A 4XWWA 3PPVA 2RBGA 5TMEA 3VMMA 4X95A 1ZESA 2RGNA 3L6DA 2JC3A 4FQ7A 4ZYZA 5HM6A 1E0AA 4QFBA 4AJ9A 4K9PA 2EDAA 2GWRA 2NZ2A 4W9RA 1VSUA 4X1YB 5SZIA 4A5SA 1EX7A 1L1RA 4BOYA 1N3LA 1I7DA 4MINA 1R00A 2G1KA 1ZUNA 2IEAA 1T1RA 2J08A 4IJKA 3WL8A 4OYHA 4QTZA 2PKYX 3FETA 4XIJA 1JKMA 2FY8A 3DUWA 5CVEA 5U4XA 6ABPA 1PQPA 3Q40A 5CHEA 1GQOA 1JLRA 2HMUA 1W73A 1CUGA 2I4TA 1BDHA 1C81A 3K09A 2HX1A 4OLFA 3COWA 4QARA 4CG3A 3FNEA 1QH9A 1U28C 4D98A 1DG3A 5DK6A 4A3SA 3B6IA 3GI1A 4D42A 2GR9A 1SUSA 3T9FA 4UBMA 3U49A 3AF0A 3C6BA 4D6PA 2B0JA 3CH6A 2G04A 3N0WA 3WY9A 5T3YA 2IDMA 5CEEA 3JYLA 3G85A 4C7KA 2IIBA 3L1HA 4B80A 5JNLA 3G3EA 4B8YA 3TL3A 3RR2A 2NUAB 1Z25A 1XRQA 3PNLA 1Z2EA 2F1KA 4MVXA 1PR3A 1V1RA 3F4LA 1CEXA 2VJCA 3NP7A 4LHZA 4Z99A 3U3JA 4XB6B 1O4WA 1DX6A 1E2HA 1Y0BA 4JB8A 2NUTA 4S2EA 5A3SA 5REQB 3RF7A 5H3CA 2M9MA 4PLFA 3T9DA 3FY4A 1V3UA 3TFWA 3CBQA 5AK0A 4B74A 4QPCA 2VTKA 1DKOA 1NRWA 2DPXA 3Q8XB 3QPUA 2O2HA 4NZPA 1VPWA 3IBSA 4DE5A 1VPLA 3KRTA 1RHQA 4N5IX 1OFGA 2GJKA 1SJ9A 5IHXA 4H4CA 3HJCA 1V96A 1KJNA 1Q21A 3ZZMA 1EXDA 3ONVA 1JX6A 4JHXA 5J3JA 4C5AA 1E89A 1OILA 3NIDB 5EHGA 3O26A 3GDFA 3LX6A 3OO1A 3PK0A 1T6NA 4ZI2A 1QTQA 1GN9A 1E3JA 4FYPA 4G9BA 5ICCA 2WIJA 4DG5A 1YR2A 1V3TA 3RIGA 4F60A 1R9MA 1JU4A 5DNUA 5JSZB 2E87A 1Z0DA 2I1WA 1OMOA 4AN1A 3KJGA 3IT0A 3QXXA 3LSTA 1QV9A 2QAGA 1MV5A 4OKNA 4Y9DA 4B6JA 1P4RA 1CJTC 4U6QA 4AK9A 1U1FA 4I1SA 4Z3DA 2Q8QA 5IM4A 1Q84A 5GIOE 1OA0A 2X77A 3AR7A 4C0QC 4DDTA 3HXLA 4HHEA 4WKCA 1C9KA 3AR3A 4PYKA 1RJFA 5KYKA 1BU5A 3QVGA 2ZYRA 4FD2A 4FZVA 1YK0A 1NXPA 1H2ZA 1S2IA 4Q9NA 1D0SA 2FP3A 2FZ4A 2MTBA 2O6LA 2ZSBA 4TZKA 2EATA 3A28A 4MV4A 4M1YA 3U3ZA 5EC8A 5CVUA 3N8IA 3GEHA 5ELMA 2CUZA 3HP4A 5K8LA 1AU9A 2MSEB 2TS1A 2YS6A 3KKEA 4LDZA 3QG5A 2QJTA 3KEOA 2VHZA 1ADCA 1Z7EA 1EFRA 4OQFA 4KDFA 3UHPA 4A03A 2B7BA 2RHOA 2UZ4A 2IZ1A 2JAWA 4EMTA 1LJUA 2DM6A 4LSMA 1GOTA 4Q4HB 1VE7A 2XBUA 3VSCA 4ZALA 5HJEA 3PICA 4O4HB 3U62A 1ZISA 3H13A 2QX7A 4QPNA 3ZHBA 2FN4A 3DV0A 4BEJA 4DIMA 2H1LA 4MV3A 2PLRA 3OX4A 1JH8A 7GPBA 1O4VA 2NO1A 1DTWB 2G80A 1TB4A 4TXHA 5GONB 5B4VA 2BYTA 3ZV4A 4RKRA 1N4AA 3KG2A 3BIXA 4OK5A 2I6FA 3DL4A 4ARSA 5KVVA 1RLTA 1TAUA 1GGMA 2HIAA 3EEQA 1JLLA 1ZGGA 3EEOA 1Q1ZA 3E2PA 4RGVA 1I4EB 3BDAA 5D00A 3O5AA 1Z6YA 4MB0A 3WGIA 3ZE7A 2UUBB 1GTL1 2F8SA 3BIWA 1UMDB 4AJNA 2RKBA 5AKZA 3MHTA 2YY6A 2JATA 1P4JA 1T8SA 3PNSA 3HE3A 2WWHA 1R6BX 2FQQA 4LDPA 2AL7A 3OCWA 3KKZA 3B7GA 3QE2A 4QFCA 2MYTA 2GNPA 4C0LA 4E03A 4ZJUA 4ZVSA 1ZIXA 4L76A 4DV0B 2Y1CA 4R9NA 4IQGA 4LRXA 1G5PA 1GU7A 5AKJA 1G5IA 3BHNA 1AUQA 3EYWA 3T61A 3WDMA 3OU7A 3JYHA 2ODNA 3TR6A 1XHEA 4GVLA 5DRTA 3FIJA 3L84A 3TIGA 1UP4A 3CHYA 4OQDA 4YJ3A 5JQGF 4KHPB 1A8QA 2P4UA 1VKNA 2W2OA 3NHPA 4DSAA 5JBQA 2YHIA 3VOBA 2Z3ZA 2EG5A 4OV6B 4CIXA 4ZGWA 2PRZA 1O87A 2GN4A 3HKCB 5TRTA 3ABOB 3RC3A 3T5MA 2XUZA 3VH4A 2YZMA 5AH0A 2WIKA 3WO1A 4QJ5A 3TDNA 1OGJA 1TMOA 4ZI7A 4DR2B 1DE0A 4DDVA 2FE4A 4UU0A 2AI1A 4HEQA 4BNLA 3K8OE 4IJQA 3UHJA 5KOJA 3O8CA 4P3KA 3R0ZA 1EXNA 4NYIR 3DDNA 3D6TB 3FXAA 4X93A 1VPTA 4CPDA 2AEFA 4P9NA 3ZUGA 2IOQA 5KTNA 3H5OA 1EFVB 3GFTA 2JA1A 3HUUA 3PITA 1P8JA 3TH5A 3TUJC 3OPNA 3T5PA 2W6NA 1HDRA 1D7AA 4C03A 2PLAA 1I3LA 2F7SA 5CD9A 1MENA 4L08A 1TLTA 1SC4A 5KNCA 4LYAA 4K6KA 4LEIA 4DOMA 1FMTA 1SCUA 1CX9B 1UBJS 4HN2A 1Y5MA 4FP9A 4CLOA 1NVMB 4DREA 3S1AB 4BQPA 4HGRA 2RMKA 3PHLA 3ZZTA 3QBVA 1Z4LA 2ZRGA 2Q5FA 4H59A 2E1PA 4HPWA 4OBWA 1PGNA 4CL2A 2PUFA 1IZ9A 2IPNA 1RQRA 3BD8A 1UXJA 4IRXA 4RZ2A 1CUZA 1I6KA 1KH2A 1Q1NA 1RWPA 3KQUA 4IW3B 4EY7A 1JKXA 1AGNA 4BPRA 4BX0A 4GBJA 2CLEB 2CLCX 4X85A 1IZYA 3SOZA 3D6VA 3I01A 1RJDA 1GO2A 3TEMA 3TZKA 5BVGB 1LEHA 4ZT3A 1TOAA 4QNNA 3EASA 1P91A 2HGZA 3GLTA 1M6EX 1ILEA 3DO5A 3E9ZA 1AXGA 4O29A 2O2GA 1P1JA 1Q0RA 4HDCA 4ZREA 4I1VA 5BN5A 4EYKA 5EHQA 2WUVA 2IITA 3U3MA 3H2BA 1CJCA 2VUSA 1Y33E 3WYBA 3GPIA 4Z2AA 2Q4BA 3WQHA 2NV6A 3H7AA 3G59A 2HF7A 2RGGA 3EUWA 3T3PB 1EK5A 2VSYA 4MW1A 3ROQA 3I4FA 3PXGA 3RS3A 1KAMA 2YH2A 5IBQA 4TWJA 5HFJA 4BKOA 1NXQA 4GNKA 1E4EA 4KQFA 2NT4A 3FCSB 3IT3A 1YVRA 4RQTA 3W9BA 3EFHA 4UPVA 1ZGZA 3IHKA 4HN4B 1XCMA 1CR0A 1FK8A 2R4TA 3O0TA 1UJNA 5TMBA 2QVXX 2G6TA 4Y2YA 2CZQA 1GR1A 2OBMA 2VK8A 3AUYA 4KQ6A 4Y6LA 4YRCA 5WRFA 3DOHA 4F12A 1L7EA 2CL5A 3DXZA 3ICEA 1VC2A 3RNLA 2WVHA 2BWJA 4J0GA 1O0BA 1Z17A 1NF2A 4AJJA 1UOOA 3VDQA 1SUCA 5BSMA 4EHHA 2IP4A 1ZH4A 5AO9A 2OFFA 5CA1B 3VNUA 2ZSUA 4NU5A 4Q6WA 4UXJA 3L41A 1V8BA 4H17A 3FMFA 5BQFA 2Y3IA 4MWDA 4OGKA 4RAOA 3EDOA 3QFRA 2MMCA 3OZTA 4Y0VA 2H2GA 2Z2YA 3Q9NA 4JGBA 1AOXA 5EIBD 2JHFA 3HA3A 2O0LA 1LA2A 2VF2A 3EYAA 4AWBA 1JSZA 3BWYA 3ZDDA 5AYVA 1RJGA 1Q7EA 2XDQA 5GZ6A 2F1OA 3KKQA 1W0JD 2GDZA 1OHHD 2VYFA 1Z26A 4ND1A 5AFSA 3VHXA 4I5DA 1A9TA 5DHQA 4B0PA 1ZM7A 4ZAYA 1JDBC 4L9AA 4IY1A 4DG8A 3TR5A 1FLVA 1G20A 1HLGA 2Q3FA 3B3FA 4I3GA 4G0VA 1UP7A 3NGLA 3CG0A 5LJIA 2OAQ1 3A6HA 4HZGA 1I3MA 1J2JA 3CRRA 3DL7A 2HV9A 3VVMA 1ECCA 1Q1BA 4J9VA 3W78A 2EFJA 2AFRA 4WZBE 2V6FA 5DLYA 5JD5A 1A2QA 1TC2A 2EWMA 2FPGA 4IKPA 5TC4A 3ZHTA 1FJGB 1GUZA 3M4NA 4MK4A 1LVHA 4RKFA 5I7HA 4KK4A 4DMKA 1P8AA 2BCEA 4KG7A 2VDJA 3P2YA 4DA0A 1HYGA 1T0IA 4HAVA 2YYZA 4WGFA 1MU0A 3UFXA 1WDWB 5K8JB 1EINA 1NDHA 3D3QA 3OY2A 4FS3A 1U8YA 4PINA 4R4JA 4D0NA 3JWHA 2HK7A 3HRKA 3ZBPA 5I7OA 3MRTA 3W1WA 2RHTA 4GT1A 1ND5A 3AL2A 3RS7A 5DZSA 3ZGYA 1WPGA 1ZCJA 4CQLA 1E0KA 2CLMB 1FFEA 4DV7B 2ZP1A 4LHWA 4EA8A 1H2FA 2GHQA 3TZCA 2VP9A 1O8BA 1OT5A 3EPPA 4YROA 1IZZA 4PXAA 4OGWA 4P34A 3EDMA 2W42A 4F3YA 4PXYA 4HK4A 3LP6A 4LA4A 1CRZA 3H5IA 4NABA 3ROTA 2DKNA 4YAOA 1N9KA 7ADHA 3TNFA 4EPXA 3THSA 4JWKA 4ZAGA 4DCOA 3AERB 3ICCA 2VOJA 1YR6A 3AEQA 3CRQA 5JAPA 1UCFA 3WNZA 4ZI5A 4P5EA 4DMMA 1TCVA 4KXXA 1MB9A 1XHLA 3IMEA 1VE9A 2H2WA 4JCOA 3R3ZA 2VYCA 1MZVA 4DC1A 1EPUA 1XMPA 3M3PA 3H0KA 3DZKA 3IBFA 2HA5A 4QBFA 5EWLB 1LPOA 2W8BA 1ONPA 3PG5A 5LP6C 2WPDD 2VYQA 3EEIA 4RDCA 3USCS 4AMZA 5BVHB 5IUJC 2IYNA 1YC5A 5JIBA 4RA9A 3CZQA 2QQEA 1W75A 3TFOA 2C8JA 2ENUA 5ECWA 4D8YA 3JARA 4XI9A 1P2DA 5FD8A 4UUAA 1U28A 5H83A 3GLIB 3SVLA 1N0UA 3S2SA 2FETA 2Z4RA 3BE5A 1Z68A 2VUTA 3DOEA 1Z38A 1DRUA 3LX8A 4FNAA 4RSMA 3GRCA 2F3UA 3Q2KA 1CJUC 4FLFA 4MVWA 3NTUA 3IUYA 2YINC 1EKXA 1F4VA 4C2UA 3K7EA 4AYXA 3PRJA 5F5XA 3KX2A 1QB7A 1SCBA 3WKBA 3REFA 3D3KA 1Z18A 3HVIA 2IUEA 3K0FB 4B9EA 1QE3A 1L1EA 2BZSA 3OE7A 4JSTA 2DLCX 5CYOA 1HE3A 4DA4A 2MYUA 3NVKI 1L7QA 2GZAA 1PJZA 3T95A 1L5HA 3KOXA 4PHCA 3TUIC 4ALJA 1S96A 2ZUFA 5IXSA 2R8PA 2CF6A 3CX3A 1GKYA 1SRRA 4G0MA 1NKSA 1PR0A 1Q14A 3TW4A 2DWPA 2W2KB 4PONA 5FBWB 3RBAA 3RM3A 1A9YA 5BQ5A 1ZW1A 4BGDA 4ZVLA 1KOGA 3TMYA 1IRXA 1CDZA 5B1SA 1XMVA 1BGVA 2NU6B 4ILKA 4YA6A 1KBQA 2J48A 2AEEA 3WL3A 2CUTA 2H5EA 1Y34E 2ZJFA 4BFLA 3TLBA 3ZV3A 4EPWA 5T57A 3ADCA 3A3PA 1B2RA 3ILVA 3QJGA 4OQEA 3KVOA 3REOA 2OLEA 3AJRA 1M1XB 4UREA 1MO5A 1K3TA 2V7PA 5JI3E 1AA6A 1IN1A 1YGPA 2Y76A 4PE5B 1EUCA 1SOVA 3LYHA 4I5FA 5CCEA 2H1OA 3G1WA 3PLNA 4D3DA 3ICQB 3Q7QA 2GZ3A 4IIXA 3GFPA 3LTNC 4OBXA 4PG8A 2YOHA 3NHSA 4Y98A 4J2TA 4YMSA 2EX0A 3C6ZA 3I1JA 4GGOA 4HLCA 4RW0A 2BGJA 4YCMA 5HOEA 3RSCA 4JV5B 2PBZA 2GRAA 2IPLA 1C80A 2QRJA 2X22A 2QZPA 2VAMA 1I2ZA 1HM5A 1V7CA 1PL6A 2GJSA 3CNLA 2BSAA 3AEUA 5T67A 1RXSA 2YJ6A 1O97D 2BTQB 1CLEA 1M5RA 1Z4PX 2P41A 4JLSA 1YI8A 2CZGA 4EW3A 3PV0A 4QDOA 5L3VA 3GRAA 3VR2A 4ZKDA 2NSJA 4MUKA 1DC7A 5ALOA 4W9MC 5DTRA 4DDUA 4OQQA 4KMSA 4I5IA 1IONA 4DZRA 2FW9A 3GJZA 3R3VA 4JGIA 4M8KA 1FA9A 3I0MA 4U5QA 2WF6A 5LSAA 1KAEA 2AG6A 4YLYA 1X19A 3P2IA 5B1DA 3U13A 4YDQA 1O77A 1U4SA 5G4KB 3E9YA 1QKKA 2BLNA 4M0CA 2JAOA 4QEKA 1JVBA 4JROA 1R6XA 2DBYA 4KGVA 4NJEA 2B8NA 2GOYA 5HEKA 3A9RA 4Q7KA 4RLHA 3ZWNA 4OSPA 3F6SA 3JQ9A 2HBZA 4BP1A 2QE7A 3QXHA 4IZOA 1Y7PA 4WK6A 2EKPA 3THWA 2FX2A 1VP9A 4FU0A 4DLZA 4J3JA 2CXPA 2W0MA 3CBGA 3LPLA 4JUFA 4UNPA 1Y4SA 4P7BA 2CLFB 3W3AH 3X43A 2UVQA 5DE3A 5LQJA 1GL9B 3ANYB 2Y27A 3V9PA 1WCYA 2J3JA 2WKRA 4P4GA 1GFZA 3EAFA 4B32A 3RSFA 4DIOA 2G76A 4Z0HO 1MOPA 1JZTA 4OB6A 4Z6KA 2XUOA 4LJYA 1B15A 3C8DA 3LKVA 3SS7X 5ERYA 3Q87B 4EJFA 5B7GA 2OXCA 4ZODA 3OPMA 1US8B 4OXRA 2Q1UA 3AESB 4YDSA 3TSZA 4ZVTA 2QF7A 3PJRA 1LVUA 3EDQA 2CLIB 2IEBA 3G5AA 3BHIA 5DJ5A 3WGHA 4UTPA 2UUAB 1B3BA 2PWAA 2B20A 5JECA 1NJFA 3G6KA 2C2WA 3BGOS 1WZUA 5FFNA 4LRWA 1MZPA 1GHTA 1YL7A 1E2MA 3MB8A 4ZDJA 4AKEA 1MAHA 5T3UA 3AM1A 1S02A 3UYLA 2Q6TA 4WBNA 1KC3A 2EQBA 2D1QA 1XZNA 2RB4A 4IEFB 1C1HA 4YDRA 4KE6A 3VMFA 4OX9Y 3Q3GE 4KMRA 5JNWA 3GGOA 1XDZA 4ND8B 2X9LA 4IIGA 4L78A 1XLVA 1BZYA 3CT6A 3IEPA 3TW0A 2BFFA 2PH7A 3DHYA 3V48A 3X2EA 3SHOA 3ER9A 3KUUA 4NJMB 3G1TA 3CR7A 2A57A 1DGQA 1DIHA 2ZRMA 3HBLA 4K40A 4RVDA 2MCFA 2NXJA 3LT4A 2A9RA 4TWRA 4E2WA 1HDEA 2RG1A 2CLDX 4OHFA 4WLFA 2PSSA 3R7BA 5DNDA 4E2FA 1Z2DA 1NI3A 2O8EA 3AUXA 4TLLB 4K6GA 3HY6A 2OCKA 4D02A 5AIBA 2B82A 4ML3A 3GEBA 3SE0A 1WWKA 4FXPA 4H18A 5IASA 2MOKA 2EBUA 1EWQA 2PE5A 1G20E 1M2NA 3MQFA 3L0IB 5KOHA 3D6FA 3ENWA 2YWEA 3QENA 1T2NA 2XAUA 4EUFA 1FXSA 2P0YA 3L07A 4MPTA 3BSWA 2E18A 1YZQA 2DQKA 1ZVJA 4RK6A 1VTKA 2WAYA 1U0BB 4CTKA 1XE3A 3RRYA 3Q7EA 2EKBA 1TQ4A 1W9MA 3N2ZB 5K0FA 4X3CA 3KYJB 4TVOA 3VU9B 2J59A 4PN7A 1JPUA 1JAZA 3I6YA 3IFSA 3GPBA 3F90A 4FLMA 4GMXA 4Q3BA 3UHFA 3TLMA 4EJ6A 5A02A 2B36A 4IGIA 3R5HA 2NLOA 3BTOA 3R41A 3CPJB 2J7KA 4JLJA 2ODTX 3SK0A 5DISB 3LS2A 4AF6A 5LD2B 2V96A 4W5JA 4CV0A 1QORA 2XMDA 3PS9A 4KQMA 4ENPA 3ZIUA 3T5DA 5IBCA 4YB8A 2DETA 1S0UA 2BMEA 2HUNA 4ASUD 2VR1A 3CH4B 3Q5EA 2I3BA 3A3OA 5LR6A 1BH6A 3H04A 4B75A 4HWGA 3F47A 4B34A 5T8KC 2RKWA 5J4KA 5JMWA 3E22A 2OCAA 3LLMA 3IQFA 4CM4B 1CQJA 2HQRA 4LJSA 3STWA 2O59A 2I34A 3M3DA 1RRGA 2WJIA 5JQGB 2VP2A 4WNCA 2W2QA 4Q4AB 1B7GO 3OLWA 1DV1A 2FDXA 5LZ8A 3GLGA 3PC3A 1GM5A 1DG1G 2QR2A 3HCWA 3ID6C 3Q3JB 4RQAA 1Y1SA 5EE5B 4CEHA 1QRAA 4G0PA 3FJOA 5KBYA 2X8JB 5THQA 1E4OA 2HY7A 4TRJA 3KJFA 3EEYA 5IAEA 4TS4A 1GSOA 4JBXA 3WLPA 3O8RA 2Z2IA 1S4QA 3LT1A 3QVOA 2H11A 2P1ZA 2WKPA 1P2VA 3RV4A 5AW2A 1RAAA 4HSGA 2HOQA 4KQIA 2G7MC 2QTVA 1W49A 5AVTA 1NJ5A 4XLLA 3BFPA 2FSVC 2BHSA 3HJAA 3PUYA 1NSYA 3F7TA 3NHMA 3WB0A 5LQCA 5I51A 4AWXA 1BDBA 3AM5A 1RRKA 1D03A 4S35A 5CPFA 4DCJA 5JCZA 4M87A 1KMHA 5B3JC 3EJWA 4N5HX 2UXDB 1QYXA 4KAAA 5BSTA 4C6TB 3M6VA 3A4IA 3PBKA 2NXWA 1MDBA 2OHFA 3C0KA 3H2KA 2FQ1A 1M5UA 4MGEA 8GPBA 1EUQA 1NGSA 2E3JA 3L8FA 3N1UA 5LU9A 4MS3A 1KK1A 2X1HA 1K63A 2D2FA 1LRJA 1THGA 1UBSB 1KNQA 2FEPA 3ACDA 1M1YB 3AUTA 1WUJS 4LWOA 3H9BA 1Z63A 4I7EA 1C1DA 1QFZA 3WRYA 3UUEA 4E4TA 2H2FA 4F06A 3RADC 3GGJA 1W52X 4DIEA 3U4QA 3V2GA 1E6EA 4D74A 1GGJA 5JYCA 1C9JA 2R79A 4QYWA 2H8KA 2AR7A 3ZZUA 1EJBA 1MABA 1PUXA 3K9LA 5E7QA 2GBLA 1JEYB 5H4HA 1TFUA 2JLSA 1WMSA 5KINB 4G63A 1KQ3A 2JFXA 2YZ2A 5G02A 3BJEA 2HGSA 4DNOA 4TTJA 4TKUB 5BMOA 3MJTA 4TWZA 1ABEA 4KN9S 1YU9A 2PX6A 1OOEA 2B7CA 1WABA 4HDRB 4IR7A 3BFVA 4KUEA 4LXXA 4N9WA 1KTIA 1KFCB 1G63A 1RYHA 3DTVD 2R1TA 4YAFA 1KY3A 4OQNA 1P18A 1VXOA 3ENNA 4UDYX 4IGKA 2F2TA 4DCSA 2DFVA 3TMKA 2D54A 5E4JA 2DFTA 2LUOA 3CJTA 4NZOA 1WQ3A 2V8OA 1IG3A 4NE2A 3I23A 2I54A 5CLLA 5BPFA 5KNDH 3VDMA 1FQOA 2HLNA 3INYA 4XJVA 1O58A 5C0OE 3CLSD 4QX6A 4DRYA 2NO6A 3DBHB 5NLLA 1NHGA 4BO8A 1UBGA 7REQA 5HYVA 2CJYA 1ZJ5A 1RBQA 3CRVA 4HJRA 1NLUA 4CQJA 2XQGA 2CYAA 3HDVA 4JSRA 4X92A 4ARZB 1KKMA 5C8VA 1DJLA 5CBPA 2BFAA 1MA3A 2R7NA 4KRXA 4M6WA 4EYGA 3PIIA 2XMCA 2VP0A 2W2TA 4HLUC 4PG5A 3U9LA 3V4VB 4BKPA 5AJYA 3ZNNA 3I9JA 5TF4A 3HL4A 1IZ8A 1I6WA 4JOSA 2V6MA 4QU9A 1K7YA 3AUAA 3DLAA 3UT6A 4H3KB 1XZEA 1QQBA 1K1EA 1RCUA 4Y1RB 4PEVA 4MW6A 3TAUA 1DJNA 2PSEA 2R7AA 1KYYA 3D4BA 4IAOA 1L4BA 5B58T 2H5IA 5KS2A 4IIHA 4YV2A 2HPZA 2YDYA 2EIHA 1ZINA 3HI4A 3WKCA 2HFKA 3ACCA 4UNIA 5A05A 3TNDA 4P33A 1NG9A 2FAXA 3IO3A 1BMFD 4U7HA 1M3SA 3TMAA 3OZSA 3GRYA 4JEUA 2GESA 2YWBA 1JHUA 3KR9A 3P94A 4M99A 4DCGA 1TVKA 3ANSA 3L8EA 3N3AC 4DUGA 4OHYA 3L82B 2G9ZA 1R4MA 2RHDA 2GKSA 2VDNB 2W0SA 3OPYB 3QE3A 4NZ9A 4OAQA 1Y9EA 1X39A 2JAHA 1Z83A 2XVAA 1INLA 1VJRA 2E6KA 1X42A 3GARA 4ZO4A 1PFYA 4TL6A 2COUA 4GS5A 3A3YA 2H1SA 1KJ9A 3K70C 2FQXA 1M7GA 1J0CA 3WLFA 2EFCB 4F2PA 1PJTA 4MV8A 4WY8A 2PMKA 3DHWC 2XE6A 1LPAB 2PUCA 2H4HA 3PE6A 4QUEA 3W79A 4CQMA 5JROA 2LNDA 1GG2A 2OK7A 4P2GA 2QXTA 3QMWA 4NNJA 2CNOA 1UXOA 1BQEA 1L4FA 3DC2A 3IUMA 4FDUA 4RKEA 4X84A 2IIVA 3WMFA 4M0DA 4D4GA 4E21A 2C31A 4WY2A 1V9CA 2FWAA 4GQIA 3I05A 3A11A 5ALPA 5EP2A 1FP1D 1M1NA 3UG6A 3FTFA 1C29B 2P77A 2QRNA 5A5EA 3RYHB 5JD6A 2DKOA 3ETDA 3UMBA 2H2HA 4X5OA 2QRQA 3CUYA 4X1OA 3NHUA 1NRXA 3U7QA 4WIAA 3BMXA 4GI3A 1Q6ZA 3WGJA 3J7TA 4B40A 3R3XA 1HQKA 4O3MA 4P3YA 4F04A 1VPEA 3PNMA 4BWFB 1VJTA 1RLIA 3PC6A 2ZM6B 4PPFA 1QONA 3I04A 3FMIA 1OAKA 4M38A 1PL8A 2AD5A 2QYTA 3SIRA 5A3JA 1QR6A 3A27A 4PQRA 1GEEA 4QXRA 1RRCA 3K2EA 3R6WA 1TMKA 3Q85A 4C7OA 3ELWA 4YHHB 4OBEA 4DCMA 2PCLA 1Q7TA 3SZ3A 4YYEA 1KZ1A 3BE8A 2H5JA 4GOND 4ODIA 4MGHA 4EHJA 2FG7C 2Y1WA 4LNUA 4QATA 1KAQA 3ROXA 2CMKA 2YV5A 3NEAA 4WLOA 4DV6B 1G19A 4QQNA 4YR9A 1FB5A 5IF9A 5IK2A 1PFQA 1MLDA 5TQ2B 3THXA 3CGGA 2JPDA 1YQGA 1XEXA 1VXRA 3P96A 1T3GA 1O5IA 4LY6A 4CCSA 3ABRB 3QU4A 3QW2A 4YAUA 3K1TA 3VA7A 1G3MA 2JJQA 1U7WA 4CM6A 1EZ4A 1GZ7A 3DMFA 4OQ4A 1TVMA 4UM9D 1MB2A 3C2QA 3FLBA 4MH0R 4BO7A 1LLQA 5A9SA 1AN0A 1U3GA 1CZUA 4JITA 1MVOA 2AG5A 4LOLA 2VNKA 1I2MA 4OG2A 3B3GA 4LGYA 2FZLA 3RSOA 1MIHA 4JT4A 1SQ5A 3MUOA 2WE7A 1HNNA 3WGVA 5IM5A 4Y18A 3QKRB 5DYTA 4Y6QA 1G8KA 3MD0A 4J0CA 5C1IA 4JYAB 4P4SA 1T2CA 2W7TA 2WMDA 3FNFA 3DGEC 1RE0A 3VX4A 1YR9A 4BE9A 5BMVF 2XXAA 1ICIA 5TS2A 1EIZA 3RV3A 1XUOA 4TXLA 4KR3A 3D81A 1XX6A 2PJUA 4EW6A 3M5WA 1BE1A 1RRPA 4IS3A 1TEZA 3CSUA 2PSJA 1EI9A 1G8PA 4FN4A 2VJYA 2GNOA 4GL2A 2F1JA 1FU4A 3O8OB 4MKRA 3VR5D 3HO1A 3BJRA 1MG5A 4QVKA 5JRZA 2P7IA 4TS1A 3GXOA 4XWOA 2KM1A 3F46A 5DV9A 4OXIA 4PRYA 1W36C 2DEUA 1F9EA 3DQZA 3EFEA 3H2ZA 2R5NA 1HG1A 4Y2JA 2QP3A 3ZHUA 4EFMA 5INTA 3GC6A 4EA9A 4PQFA 5HILA 3QTBA 4K6HA 2C4TA 1ZNWA 1ZITA 4HXEB 4GLLA 4J3FA 5AQEA 1IXSB 4P8RA 1A77A 1D04A 4BQRA 4MIKA 4YRTA 2GLTA 4BNTA 3ZK8A 3R4VA 1HT0A 1T2EA 1ZNQO 3MAGA 4KO3S 1XCJA 4BFXA 4FZ3A 4E94A 4KXVA 3L7MA 1LFAA 1VBNA 2WWFA 3MRSA 2YCLA 3D8HA 4WJLA 1GGVA 3VC1A 1D5CA 3GLGE 1A82A 2WZCA 4ZOLF 2PCJA 5BQOA 4IHKA 4ZK6A 4KRGA 2XRZA 2GKOA 2A7QA 1JKIA 3U3XA 2D1TA 3WWCA 3E7FA 4MRMB 5CM8B 1RMQA 1SXJB 1I36A 2JASA 4JEMA 4LHSA 3AUSA 4M1WA 1NV8A 4F46A 4W5HA 3M9LA 2N3ZA 4Q1VA 1P1IA 2CBXA 4PSAA 1RP1A 2HH9A 3L0SA 1FFYA 2I91A 4XM0A 2OBNA 5AKKA 2J30A 3RU9A 3DYVA 1W96A 2ZJ8A 4W82A 3VYWA 4Y2XA 4ENUA 1IUOA 2XYQA 5HIMA 1AKTA 1TU4A 2PZJA 3T7DA 1SULA 2RC6A 1DC3A 2ZAGA 3HVJA 1QO9A 2PA3A 3KU1A 4IDEA 1T8YA 4JLVA 2WOOA 2PQMA 2Q27A 4IXDA 4J1NA 4UMDA 4UHFA 5TJ9A 4XVCA 1Y9ZA 4OLHA 3AIMA 5TDHA 4MNTA 2V4MA 1D0IA 3E1GA 4U3JB 3RYIB 3U3OA 5IJ9B 5KTSA 2IBSA 3STHA 3TB4A 2O05A 2Q46A 3OLXA 2F43B 4KO1S 2C9OA 4MQEA 1N9ZA 3EUFA 3K3PA 4FCTA 3LDGA 1AGPA 1P45A 1P9RA 2ID8A 4PRKA 4AF7A 1A9XB 4C01A 3CZ4A 1VL0A 3BVPA 1NVKA 2EEPA 3DKPA 4XQ0A 2PGNA 1LW7A 3PNYA 5H3HA 5K3CA 1DAKA 2O2ZA 4MR8A 5IVKA 3KVYA 3Q11A 3W5UA 4CLRB 3R24A 1XZDA 5B3AA 4YRPA 1GKKA 1XZQA 4NV1A 2IIQA 4Q0MA 1OC2A 2WJGA 3FUCA 1RAHA 2OHVA 1QVAA 1UC5B 2JZOA 4ISBA 3WYDA 1MA0A 1PUIA 2FWNA 3AGQA 1Z22A 2PZGA 2VZLA 4Y2VA 2CE2X 4B81A 2ZGVA 5FWDA 1LF0A 1Q1QA 3PC8C 2CGEA 4BMOB 4HNRA 3ESYA 2J67A 1W1WA 4NS1A 3FWHA 3H0EA 3L9XA 4IJWA 5GWXA 4EG0A 2ZAMA 3CSSA 5T8KA 2RAUA 2QY9A 1XA4A 4GO1A 3UUFA 3I5AA 3DXYA 3IQIX 2CXQA 3LT5A 3QUBA 4BQNA 3C4JA 4KQ2A 3LRPA 1E0SA 1SHUX 2CDAA 2Z2JA 2YXDA 3K4HA 3U40A 4MGIR 5AW1A 1P19A 4KGXA 3IBGA 1JRLA 1YZUA 3ZD8A 2RGWA 1YU6A 5I8WA 3ZNPA 2HMAA 5F1OA 1ECLA 1KORA 2FXVA 3FSRA 3H1GA 3RVPA 4D96A 4NMMA 1U1CA 2OXFA 4RD4A 4U8HA 2G9VA 5GINE 2F3TA 4OEHA 4RVHA 1G8GA 3MUNA 2PO5A 3ZWYA 4FHFA 4KB5A 3K8ZA 4F93B 2J41A 3JZAA 3TLXA 1HWYA 1FNSA 1NUAA 1OE0A 3AT1A 3RGWS 1GQQA 1HNZB 2SBTA 1D6JA 1PV1A 4WERA 1RI1A 1VKJA 4JR2A 1G5TA 3D8BA 4TWAA 1KJYA 4P83A 2HSWA 2W6ID 3KFLA 1E3WB 1JEQB 4XX0B 3HB9A 5DCUA 4BO6A 2AZ4A 2FSVA 1OTHA 1VFNA 1XKXA 2AWOA 2IUYA 3JD3A 4Q3EA 4TV9F 1CD5A 4ZVMA 2DRIA 5GQSA 3C43A 3OX3A 4Y2QA 1B6TA 3RIMA 5KSWB 1Z07A 1T0PA 1K4MA 2AXNA 4IKEA 1D3AA 2BOVA 4QWMA 1NW4A 4U4AA 4YHBA 4JVLA 2B1QA 4LCJA 3ZKWA 3ESXA 2PX0A 2DPLA 2LPMA 2W4QA 3OA2A 4ON9A 4WINA 2BP7A 1P1KA 1ODSA 3BRWA 4WA8A 4PZYA 3VGPA 2WWTA 2PTHA 5K3DA 1LPMA 4FGJA 2R751 4TMWA 3KQWA 2O2DA 2WJ4A 4WN9B 1BOOA 5EMMA 1CULC 5JJBA 3TOCA 1F2UB 3ESRA 1T9DA 1IWOA 4MIOA 4AU1A 1KY4A 3AR4A 4WCVA 2EZ8A 2BPOA 3K94A 5CH3A 3SR3A 3CB4A 4RTRA 3RT1A 4ZOBA 3V2UA 5LP6B 3IIEA 2GFQA 2PKWA 1VMAA 4FEYA 1AK1A 1VIYA 1DIRA 1A98A 3OJEA 2ETXA 3HK2A 1KE2A 4BXOA 2I8CA 3H2SA 4LDQA 4EHDA 4WNAA 3ZLBA 4MKGA 3B5JA 4Q1CA 1TZ2A 1LC3A 4RHYA 2XQVA 2ACWA 2DUUA 4BB6A 1Z5OA 5M2QA 1Z33A 2VL7A 4QU8A 4YGXB 5KX5A 1FX0B 2CV2A 4TTSA 1CKEA 1MJGA 5IYZF 2ZT6A 5E6UB 3RQSA 1RXYA 3RI3A 3T9BA 3B70A 2QBYA 1JSLA 1CRQA 621PA 1UDAA 4D8TA 3J80A 1QJCA 1WVMA 3C3CA 2KB0A 4QUKA 2A67A 2Z6AA 4HADA 3GMTA 1JNXX 5KMGB 1DARA 2QR3A 3U4IA 1J8QA 1G16A 5KHLB 1V1JA 3NBYC 1W85B 3GZNA 1CF9A 3FRHA 2I7DA 4MUBA 4D3YA 1H2YA 3H2IA 2C5SA 4YUXA 3LC2O 1D2MA 4IICA 4MUYA 2BFCB 3MJFA 3Q3HA 5M5BA 1UBCA 5DI3B 1FFAA 3PRHA 1PFVA 1C30B 1DWOA 2BEUB 4MVJH 3C5HA 4GWLA 1G17A 1ISGA 4WPGA 1DKLA 3WB2A 3FBWA 1MTOA 4JFAA 3KQKA 1ZRMA 4PYJA 3LOQA 3KPWA 3ZN2A 2DBQA 3DMRA 5KI6A 5JNUA 3QU9A 1QHEA 2VCHA 2XZPA 3U7EB 1KL7A 1T5TA 1G21B 4FSXA 3NWPA 4BMYA 1Y37A 1U0EA 3DEZA 3THYB 1W4ZA 2FPUA 1K2WA 1VSVA 4OREX 4Q01A 3H4VA 3B7PA 3UJ8A 4ZU3A 5EQFA 1WULS 4RTSA 5UKDA 4QO8A 1PSDA 1PEKE 4OXYA 2OQVA 1GNLA 4ZEMA 4N3NA 1YJAA 3GW8A 4KBYA 2D00A 2J9RA 4BAZA 4CL3A 5E6SB 2WWIA 2PX4A 2UU9B 3EMDA 5BOVA 2DTXA 3E5NA 1D1QA 2PKEA 4HSEA 3T3IA 2IDZA 5EEHA 4CN8A 5ITZA 5J58A 2BM0A 2O48X 3OMLA 1HQDA 4RF4A 3CZAA 2XSZD 2Q5OA 3ONDA 4ARIA 3KVVA 1I4DD 5JTTA 4KV9A 2O8FA 4JQOA 1PSWA 5TPWA 1GILA 1XDWA 1I3OA 3T99A 4MLDA 1KDPA 2A33A 3DVRX 2PH1A 4JP8A 1V41E 4JBIA 3KYDA 4OUDB 1IN4A 3M4JA 2C7RA 2B8EA 3L6EA 3C8ZA 2P2LA 3FZYA 1ADFA 1BEUB 1UH5A 1PEYA 2J33A 2PSFA 2X6TA 2XCIA 2ZYSA 4IXWA 2R8RA 4P5DA 4R8KA 4WVLA 1FTYA 1LNZA 3LUAA 3WGKA 1NP7A 1YF3A 1GDDA 721PA 5ALLA 3DAOA 2MR6A 1AXRA 1MKYA 4KMMA 2J3IA 1I0IA 1X2EA 1KSHA 1T4MA 2JHPA 2UYOA 3R74A 2WYUA 4M83A 2J9XB 2FW8A 4RAQA 2BI4A 4KHZA 4J0EA 2OCPA 5K51A 4V1CI 2W93A 4DCCA 1FUUA 4H0FA 2HDNB 3DOCA 1MVLA 4LZNA 4NVRA 4O33A 2C5AA 5THXA 4UMFA 1BWQA 1C7QA 2AZMA 3B1ZA 3GAMA 5K0NA 2IE8A 3T4UA 1QIGA 2ZIUB 3JVUA 3TVTA 4BJ3A 5BN1A 1F6DA 2AVNA 1BDIA 3R7NA 1PZFA 1O6ZA 4R7ZA 3KVRA 5ETJA 2YWGA 3C87A 3FOAA 3DDHA 5DSTA 3FGNA 1OR8A 3WK9A 4QTYA 1FP4A 1KVSA 1NLZA 1Z7GA 2D62A 2DBRA 1GG8A 1KJIA 3AUUA 3ML1A 2I2DA 2FUNB 3JQGA 4L15A 4M0LA 3V97A 4AZ3A 4HFNA 1YDFA 5JS8A 1DKMA 5KVSA 2FDCA 4E5NA 3EE6A 3F7MA 4FBGA 2G1JA 5KQMA 1BHSA 1H9CA 3BJZA 3CN7A 4QELA 4AZTA 1JQ3A 2AE2A 1QH1B 1UBHS 3LHDA 4HNSA 4IJMA 2JBHA 5AM1A 1ZZEA 5A71A 4EB0A 3N0TA 5JANA 3FUXA 3IHWA 3RAPR 4DBVO 2JKVA 1FFBA 4O4JF 3L0ZA 2UVPA 4D56A 2DU8A 4H0NA 3I3OA 8ABPA 1VL1A 2PZLA 3MJVA 3D31A 1N5KA 2AQ8A 1II0A 2FSGA 2JL1A 4HRAA 1PJSA 1CU1A 1XI2A 3AHHA 1OWMA 4Q15A 3TLZA 3EUAA 1JHAA 1YK1A 1PK8A 2QM0A 5EP4A 3TRIA 4FOTA 3UKJA 2FV8A 1SCNE 4C3VA 4JCCA 4C76A 2RD2A 1T5OA 3P4XA 5EEGA 2BELA 2ZS8A 4WFQA 1FLAA 3G8AA 1PE0A 3GROA 1K6JA 3PNQA 4M7PA 4O2LA 1SXHA 1E1CA 3OCUA 2ZCVA 3V32A 4FTWA 4IDDA 1PL0A 2CXSA 1HH4A 1Y5LA 1OLOA 1VZ3A