3CLSD

Crystal structure of the r236c mutant of etf from methylophilus methylotrophus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSCPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein subunit beta
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
total genus 95
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clsD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clsD02
4XFDA 1CT9A 1V5GA 1JIJA 4X3PA 4Y6QA 2VTBB 1K97A 4F4HA 2QQFA 2VBGA 1PNQA 3COVA 4KGDA 3KT3A 2QUJA 2A1UA 2WVHA 1WKBA 3L92A 3GLSA 2E0IA 3ZGZA 2FWNA 1IHOA 4TWJA 2VBIA 5D7NA 4AQ7A 4RMJA 5LM3A 1I6KA 4G1CA 4GM1A 3VU8A 1Q6ZA 1K92A 5HUJA 4S1OA 5FEMA 2J08A 1OWPA 3FY4A 3EY9A 5F23A 1H3NA 1F9AA 1XLTC 3RJZA 4I6JA 4TS1A 1WJGA 1JHDA 1O95C 2H2HA 3HFJA 2EZ9A 4C7BA 5DEIA 4MWCA 1TFUA 3CVXA 2HMAA 4H3SA 4BWVA 3KT8A 3N8HA 2Z09A 4G6ZA 4DDHA 4EG7A 3X1JA 3GLRA 1LI5A 1KH1A 4Q93A 3G59A 3RBAA 3FI0A 3AG6A 1ULHA 3TZEA 4BV3A 4RJJA 2IJGX 1BFDA 4Q16A 1M8FA 1N2GA 2RD2A 1JEDA 1QU2A 1KP3A 4MW0A 1J09A 4G5FA 4MUNA 5KHAA 4K9OA 4A91A 4BUZA 3HL4A 3TNJA 3EYAA 1JIIA 2PG3A 3CLUC 1M1ZA 2DR2A 1YI1A 1J1UA 1BS2A 4X3OA 4WSOA 1OWMA 1M2GA 1KP2A 2IHUA 1IRXA 1KQOA 1S4MA 1F7UA 2CYAA 1OBHA 3ZXIA 1U7DA 3SDBA 4TWIA 4MZXA 1MBZA 1QU3A 4IAOA 3JXEA 2W93A 2O8VA 3E27A 3ZJUA 2CUZA 4MWEA 1MJHA 4MUEA 1POXA 4MQ5A 4ZT2A 5K0TA 3FZNA 2PIDA 1GPMA 5DEOA 4UTRA 4U8HA 4ZT4A 3SEQA 2H59A 4Y6OA 1Y9DA 4EG3A 4O8ZA 2AZXA 2CT8A 4DDKA 1MRZA 1IQUA 4OUDA 3ZG6A 1QJCA 2V0GA 1X6VA 3PNVA 2Z08A 3ZJTA 2Q5JA 5K6RA 3H9BA 3RIGA 1OWNA 1T6XA 1TYBE 1IQRA 5FO0A 2Q29A 4MUIA 1QNFA 3OTWA 1I2DA 2E21A 2IP1A 2R5WA 4L2IB 2WSIA 3IOEA 2XRZA 5K2OA 2BTEA 4JUCA 3X1KA 3ND5A 3HMQA 5K0SA 1PFVA 3HWWA 4ND7A 1NURA 2H2FA 4DE5A 3X1MA 1MC1A 4MULA 5EJAA 4D5GA 2X7JA 1WQ3A 1XNGA 2H2DA 2VJYA 3FNRA 1NUPA 2DXIA 3AG5A 3COYA 3SP1A 2JLCA 5AHWA 3JR3A 4C78A 4K0RA 3RK1A 4ZT3A 3H97A 4GM0A 5K3SA 2HGZA 1YUMA 2X1MA 3PXUA 2J5BA 3CVYA 3IAEA 1XJQA 3A4IA 4U7JA 4UTXA 1YUNA 3HV0A 2WVGA 1KR2A 4ZCRA 2ZUFA 1COZA 2J4DA 3LOQA 2VK4A 1PI3A 2DETA 1NUTA 3ZGOA 2XRYA 2C5SA 4P2BA 5J58A 3OE1A 4JUAA 1H1TA 1JMVA 3AKZA 5TEWA 2VK8A 4MW7A 2PANA 1O0BA 3E9YA 1WQ4A 1FYDA 3IUBA 4JXZA 1EFVA 1KORA 3ZIUA 3P0HA 1U3CA 3LCJA 2VTBA 1YHYA 1TYCA 1I6MA 4QRDA 5DB4A 1OVMA 3MUEA 1S5PA 3CVWA 5IHXA 1IVSA 1M2HA 1UPBA 4MW2A 2QUHA 3CLTC 2H4FA 3H9CA 4ZT5A 1YI8A 2FRDC 2VK1A 3ND6A 1DJLA 1PO7A 1EFVB 3UMVA 4KPUB 2JAXA 4UZFA 4RUKA 4YP7A 4MQ6A 3TS1A 2GOYA 2A1TR 5EKDA 2PZBA 3FETA 4RJIA 1J70A 2FR8C 1KH2A 2OQ2A 4NZPA 4YMIA 1TQ8A 4BN4A 4AS1A 2A1TS 1O97D 3LQ1A 1T9CA 4CQNA 2QTRA 1Q19A 4MVWA 1F4LA 2QTMA 1O97C 1QQTA 4HD8A 3D6UA 2D54A 1GTSA 4K9LA 4DDMA 4BV2A 1IH8A 2CV0A 4YP5A 1MAWA 3IDFA 1O95D 1N75A 3P0JA 2EZUA 1O94C 1PT9A 3AL0C 3G5AA 3KT6A 3GLUA 1YNOA 2WQ6A 2WVAA 5BWLA 1ZPDA 4IG9A 4IF6A 1VBNA 3A04A 5FNZA 2AG0A 4DJAA 1POWA 4GP9A 1Q14A 4HJXA 4FVTA 1NUQA 1ZUNA 4EF6A 1OWOA 2CYCA 1V5EA 1N77A 3PRHA 3ZUGA 3PNBA 1Y42X 3CLRC 3N2YA 4RJKA 3GMIA 1EJ2A 3CLUD 3CVVA 2H2AA 2E89A 3UY4A 4HPWA 4NATA 1K4KA 4JZYA 3IVGA 4K9KA 1ICIA 2A86A 5EJ8A 1T6ZA 1N2JA 3F6EX 4NDAA 1N78A 3QTTA 4XFJA 3F6BX 3RIYA 4JD5A 3P52A 4R2MA 4JUBA 4MLPA 3I05A 3IMEA 5K6TA 1WXIA 4HK4A 1FFYA 3D4BA 3VGJA 4MVYA 1JIKA 1GTRA 5EJ9A 1MA3A 1KQNA 4KKVA 4F56A 4YP6A 2AG6A 1EUYA 4UTVA 1T9AA 1H3FA 5KWVA 1YC2A 4L2IA 1EE1A 1PTJC 2Q5QA 1NP7A 1H3EA 1D2RA 5EJ5A 1KAQA 4UU8A 2PFSA 1UFVA 3UC5A 3ILVA 5DGTA 4J1TC 4ND6A 3CVUA 1NYLA 1GAXA 1OZGA 2DEUA 2G36A 4MW6A 4HJRA 1WY5A 2X3FA 1KH3A 2D5BA 3Q10A 5DASA 1XNJA 1OD6A 1TYAE 1ILEA 2OD7A 3GLTA 4CDMA 2A84A 3RFFA 2A4MA 3A2KA 5HG0A 4FZ3A 1DNPA 1TYDE 5J5AA 2OORC 2IHTA 1J1ZA 3DLAA 4UTNA 3IUEA 4JSRA 2D13A 1WOYA 3SEZA 1PG2A 4ZCPA 3ELBA 4PBRA 3COZA 3COWA 5FYQA 3SZ3A 1UPAA 2NZ2A 4MWDA 2PZAA 3TQIA 1YBHA 2H2IA 1NM5C 1OBCA 4MUGA 1YIDA 3FG9A 1T6YA 4EG1A 3UOWA 4U63A 2J07A 3FHJA 4UZEA 1KAMA 4ARIA 3FIUA 4UU7A 2QJFA 3FOCA 1Q77A 4QBTA 1VBKA 2JANA 1U2GC 1OWLA 3CLSC 3MXTA 4MW4A 5JBNA 2O5RA 1LI7A 1N1DA 2I1LA 4ZCSA 1I6LA 4OJMX 5TS2A 1PYDA 1VBMA 1R6TA 1TEZA 1JGTA 4BVBA 4G5YA 1U31A 1NI5A 5J59A 2HZ7A 4I6GA 2A88A 2H4HA 4L3OA 1S7GA 2IHVA 4ZP1A 2JI8A 4BVEA 4MVCA 1QPBA 3NBAA 1YHZA 5EJ7A 2YWBA 1XNHA 1GLNA 3F3MA 4KPUA 1JECA 4GM4A 1LW7A 1T9GS 3IH5A 1K4MA 4BN5A 3BL5A 1J21A 1N2OA 3RK0A 2NSYA 3CLTD 4CDNA 3D7KA 2B4YA 2BYTA 4MVXA 4J76A 3PKJA 1M8GA 2FN3A 5H16A 2Q27A 4E1AA 4MW1A 2B7LA 1ZJWA 3FLMA 1R6UA 5LLTA 1EUQA 2QUKA 2QJTA 3MMXA 2NYRA 2QTNA 1U28C 2V3WA 1O96A 2OD2A 4JUFA 4JU9A 5EJMA 4V1CA 4X0EA 2Q5LA 4K9QA 1PG0A 1E3TA 2QQGA 3PNYA 2EL7A 1N2HA 5H7XA 1JILA 4EG4A 2H4JA 1V47A 1O94D 1QRTA 3ZGVA 1YI0A 5MFZA 3IAFA 3FWKA 1O96B 3PKIA 4MUKA 1G8FA 1M8PA 1R6XA 2TS1A 2CYBA 4MW5A 2CV1A 1T9BA 4V1CB 1EFPB 3IOCA 3DV2A 2H29A 2UZ1A 4K03A 3IVXA 4MUHA 5TGTA 3U3DA 3EA4A 1N2EA 2GKSA 2Q5OA 4UUAA 1JEEA 5BWNA 3IVCA 3CLRD 4XSVA 3CF4G 1P7PA 3HZRA 2E18A 2JLAA 1M8KA 3OP1A 3K35A 2QUIA 4DNXA 2CFOA 2JI7A 4I5IA 4K9MA 4UUBA 1YIAA 2UZ1B 1NUUA 1YTLA 2BRUC 5BWOA 2RE8A 3MLAA 3A05A 3SYTA 4QELA 2A1UB 1YULA 4BVFA 4DLPA 3N9IA 1GZUA 3U1VA 2PGNA 2CSXA 4MPRA 1KQPA 2DLCX 2EZ8A 2OO5C 3DO8A 4ARCA 4F4UA 1O6BA 1U7XA 1WXGA 4GU5A 1PNOA 4EFKA 1EXDA 4Q9DA 1SZDA 4KXQA 3H05A 1JZQA 4ZCTA 5AHKA 1N0HA 4K9NA 1V8FA 4JXXA 2V0CA 3GUZA 2X1LA 1G8HA 2DERA 1VL2A 1NSYA 1Q15A 1KKUA 5MGNA 1PFYA 4JUDX 1VLHA 5IMSA 3FH0A 2J09A 3VRHA 5HUHA 1O0CA 1M2NA 1PFUA 2YY5A 1NZJA 5EJ4A 4MUJA 1T9DA 3D6VA 5KCMA 4EG8A 1MOPA 1YC5A 2DUMA 4NAHA 2Q28A 5DGDA 1MB2A 1WXHA 1U3DA 2DPLA 1PVDA 4Y6LA 3GLVA 2YWCA 4RMHA 1OZFA 2FSVC 3IMCA 2OD9A 4MPPA 4KR6A 1ZH6A 3Q12A 4BVGA 3HWX1 3FSJX 3RHSA 1MAUA 4FEGA 1Q1AA 5BNZA 3K9WA 4EG6A 4RPIA 1Z8NA 2JI6A 1RQGA 1Q17A 3SZGA 3CR8A 4R2LA 4JT9A 3IOBA 5IJXA 2IELA 4FEEA 1J20A 2EZTA 4HDAA 4V1CI 1A8HA 1U0BB 3JWPA 1QRUA 3PDHA 4QQ8A 4GG1A 2EJCA 4ZT7A 4R0NA 4UTZA 3U31A 1WXFA 4JYZA 1HZZC 1MB9A 3KT0A 2NXWA 3M5WA 2GM3A 2QJOA 3CLSD 2PXHA 1N2IA 1ZH0A 1IQ0A 3KFLA 2PZ8A 1B6TA 4WNYA 4MUFA 3ZXSA 3IODA 1WXEA 3NV7A 1WZ2A 2H2GA 1GN8A 3AIIA 4OUDB 1QTQA 2DJIA 4KR7A 4I6EA 4EG5A 3ZJVA 3S3TA 1M8JA 1Q11A 5DK4A 3ISJA 3N05A 5EJ6A 3CA8A 4BVHA 3TZLA 4MPJA 1X8XA 1UPCA 3C8ZA 1N2BA 3AFHA 1M83A 4JT8A 3DPIA 3H99A 2VBFA 4JFAA 2PGOA 1SURA 1T9GR 4PBTA 1M2KA 4R8MA 1HYBA 1OZHA 2HJHA 5LFAA 4RMIA 2OV4A 1M2JA 4FZJA 1IFXA 1J8FA 3HGMA 2AKEA 2JA2A 1N3LA 2CV2A 3MLBA 4MW9A 4J16C 4NAUA 1F7VA 2YXNA 1D4OA 3FDXA 4ZZIA 4MWBA 3LE8A 4PY2A 4YBRA 3QE4A 2X0KA 2ZUEA 4QREA 4ZCQA 4NX2A 1G8GA 4GRIA 3TQOA 3L93A 1MCZA 2AG1A 4D5EA 3ND7A 1SZCA 4COKA 3P0IA 1G59A 4EGAA 4GPEA 4KR9A 3NBKA 3UK2A 3IMGA 1EFPA 3G6KA 1O5TA 4MAFA 4F3RA 1QRSA 2JI9A 4QPZA 1JZSA 3K32A 4JU8A 4CT0A 4ZT6A 4PBSA 1V5FA 4J75A 1NUSA 2Z3VA 2A7XA 1JSCA 2EZ4A 3Q4GA 5TEVA 2JIBA 4K9PA 5MF6A 5MFPA 1PFWA 3INNA 2WQ7A 4RMGA 5FO1A 2C31A 2ZP1A 2VXOA 1U2DC 3QTBA 3D81A 2WB2A
chains in the Genus database with same CATH superfamily
3FSGA 3NO4A 1CJCA 1A9ZA 1K97A 2YUTA 3W3AA 4LRYA 2BEJA 2Q7DA 3D3NA 2BN4A 2P1DA 3NEYA 1CJSA 2X41A 1SUDA 2EW1A 3ON5A 1G4AE 5K9ZA 3IBTA 4D8TA 2EW8A 1JSLA 1SNYA 1EBBA 4PQEA 4BMDA 5HWSA 1RYEA 4AQ7A 5EWJB 1UOOA 2IOFK 2WF8A 1UZAA 1YOBA 2WJHA 3FUXA 4BAUA 3DDWA 5TY0A 3FY4A 5BMVF 3SEAA 3P0FA 1ECCA 3FMOB 3R5HA 4O1IA 3CVOA 3RNLA 3PDUA 4W5OA 2C2HA 4JLVA 2EJUA 2VEDA 4FN5A 5FA5A 5I5GA 4EFMA 2BOVA 3C7DB 3DYVA 4WLNA 1WZUA 4YDRA 4ES6A 4JP3A 1VGVA 3NTXA 3E82A 3FJYA 1X8JA 3PRYA 5HTOA 2XZPA 2QZZA 3U3XA 5ALEA 4BV3A 3L1VA 3PNSA 4UJ3A 1VKRA 4XX0B 4GRDA 1RBZA 3BMOB 4UHCA 5THXA 1RTTA 2NZVG 2X6TA 2SECE 1M8FA 2QGFA 1PSDA 2BI4A 1C1DB 1TUBA 1NULA 2UVDA 3I39X 1U8UA 1NLFA 3DGEC 4MW0A 3A1EA 4ZI7F 3I6MA 5HQ3A 4LJRA 3O47A 3NAGA 3VFDA 1GQSA 2NO5A 5FD8A 1XXHE 1CF4A 1ADBA 1PWEA 3STHA 2WTBA 3H1BA 4PFQA 5ARCA 5JXIA 1T6BY 1T0BA 1TW2A 1OY1A 1QIMA 4RHYA 4YECA 5KYNA 2IOQA 1KP2A 5KOJB 2YOGA 3UZUA 2QRKA 5DGCA 3G0OA 3KQMA 4GOND 4J2HA 2JCBA 5AESA 3R7LA 2FJPA 3TRIA 1ZNYA 4QBIA 5JO0A 3GZ4A 5DE3A 1MBZA 5BMVA 2YICA 3UTDA 3A3OA 5AW7A 3JQ9A 1P2DA 4RGQA 1UKYA 2F90A 4NV0A 4TX1A 4WVLA 3T9CA 2F1IA 2I67A 4PYQA 1Q2XA 4L8VA 3CR7A 5KTKA 1M6WA 2BRUA 1MG0A 1I7SB 3IQZA 4O8ZA 4ZAZA 3K2EA 2Z8YM 4OPMA 1XCPA 4BFSA 2OKCA 1XFDA 4QUIA 3VTFA 4LGCA 3WR5A 1R9NA 1OXUA 3WHPA 1NV9A 2Q5JA 4FE7A 4J7UA 3A0UA 4MGIR 5TGDA 1ECLA 3WB9A 1CY7A 2RCYA 4HWOA 1SCBA 2NVUA 4M1EA 1QNFA 3P9KA 2OXIA 3SF8A 4ZI7A 1JQBA 1GQYA 4JBLA 5B53A 4A92A 1SVWA 2V7XA 3HWWA 3BWCA 5EXSA 4D9HA 3QI7A 5BWBA 4QA9A 3MTIA 2CXQA 3LLSA 3H5AA 4HUQA 2XMGA 4HQNA 4OKNA 5AVZA 1PT5A 4R98A 2B82A 1QR6A 1G6KA 2KB0A 3FA2A 3LNTA 2ZJ1A 1P45A 4TRJA 4C3UA 5JADA 5AKKA 2XMSA 1DARA 4FYWA 3RK1A 5FR2A 4C0SA 1FQJA 3NFRA 3NIFB 4QHSA 5EZ5A 1H66A 1TK9A 3N2EA 3SSAA 4WKBA 3T4EA 2WBLC 4Q7MB 4B82A 2WMNB 4JROA 4HC4A 3TH5A 4PZCA 2OCYC 3LT4A 4B81A 2J4DA 2GD1O 3SJZA 3C3JA 4LHEA 3RKRA 3KKZA 2VK4A 3NM4A 2Z95A 4Q4HB 4XM1A 1LK7A 1Y3BE 1I7DA 1AGPA 1W2GA 1KDVA 4LDJA 2ZTHA 1QKKA 2RARA 3EXHB 4FMCB 1UBFA 3LHDA 4DTCA 4ZVMA 4RTRA 3GCWA 3EDMA 3GVXA 2BZ1A 2RC5A 1DAMA 1LDMA 3AY7A 1Z5ZA 3V8EA 1AHNA 1FYDA 3IKVA 5TQ2B 3RS7A 2PSDA 5DM1A 1KEUA 1KJ8A 2EKQA 2ZRDA 1JJAA 2AEJA 2BEUA 3ZIUA 4BLPA 3K1JA 2B21A 4GPZA 3SDSA 4R1PA 1CZKA 1SM4A 3GUHA 4K5QA 3AHHA 3T38A 1Z68A 3QY0A 3VR1A 2CLKB 2QP3A 3ZHCA 1AC5A 1X7XB 4BS9A 4E88A 1XRPA 1Y34E 3NHYA 2I7DA 4LKRA 4NAVA 5L40A 1M2HA 1XV5A 2C54A 3KEGA 2E85A 4MW2A 5D85A 5EMHA 4B2IA 1BCSB 2QP4A 3CLTC 3RIMA 3TNFA 3TUIC 5F98A 3CLHA 1YOVB 2C5FA 1PO7A 2V5VA 4RDCA 3G9QA 5IXJA 4ZI5A 4PHFA 3SFVA 1M1XB 4I1IA 2NO4A 4W5RA 3WL3A 2D0PB 3IT2A 2X9LA 4INPA 3KYJB 4XTCS 3WHLA 5B1YA 2OQ2A 3X1XA 4EKGA 2BFNA 5F1OA 4CT4B 4QC2A 3DOCA 2QTRA 1TDJA 5TVKA 4A8PA 7REQB 4UTPA 2QTMA 3HUDA 4Q4AB 4MQ4A 3OZBA 5TPZA 2NYUA 4R2XA 1F3OA 1XTRA 3P2IA 4RGBA 1KMCA 4PHHA 3TBKA 2NZWA 5AKIA 3M4NA 3F71A 4DIKA 4R0VA 3LH5A 4EKEA 2OP0A 4LI0A 3BXHA 4U2DA 4EUSA 2ZQYA 5CDGA 2EQAA 4P84A 1VBNA 1U2SA 2CK3D 4K6KA 3BXOA 3OIDA 3ZU2A 2OGTA 1B0AA 2J0QA 5JU6A 3EOBI 3B53X 1GGKA 1ZUNA 2CY0A 3P94A 3UFBA 4CI9A 2J0EA 2D6FA 1PGQA 3N2YA 4N5DA 1AQUA 2AEEA 4IUDS 5ENZA 3ROFA 4WPGA 1FJ2A 1TD1A 3G8BA 3KJFA 3R9WA 2XCOA 4ITVA 1T15A 2A86A 1Z74A 4QQFA 4Y9RA 4FLMA 1ZVVA 1I5OA 2VF5X 1JMKC 2VHEA 4DA0A 1Q2UA 1EVIA 4NONA 4OQLA 3TQFA 2I80A 4OHUA 2WT4A 1CUFA 3K7EA 2FMXA 4JD5A 3F78A 4NSNA 1XELA 1CD5A 2VT7A 4K9RA 5FI3A 2X8JB 3IPLA 3AVQA 1J0EA 4W6QA 3UJ9A 3MRXA 2O3RA 3TLEA 3SQOA 1Z07A 4UUQA 4BNUA 1EUZA 1EIWA 2BKAA 1Q0LA 2OSBA 3KYDB 1G8PA 4ACAA 4D46A 3A1UA 1GDDA 3CUWA 3MJCA 3IALA 3V8VA 2XV1A 3EGXA 3CGGA 5J63A 3WQBA 2NUPA 2Y1GA 1H3EA 1Z6YA 1HQYE 2VDOB 2W0MA 2WF5A 4WECA 3L0ZA 1V45E 4P4GA 5LZ4A 2Q0QA 5AKJA 1PTKA 4H18A 3L1UA 1WY5A 2QE7D 1NP3A 1JDZA 1R8QA 2JL1A 3T5BA 2IPLA 1MAHA 2FXIA 2I6GA 4UHEA 2JIZA 5EJFA 4X1YB 2V8BA 4BAZA 1ILEA 1EJ6A 1MJFA 3K92A 4MHOA 1UT8A 3ICCA 3M9XA 3SVTA 4X54A 5KKCA 2BT4A 3PJFA 1FC0A 1QGYA 2WSLA 5GQSA 2WLTA 1Y1PA 1IUKA 1FYEA 1L3CA 1QYIA 2AC4A 3I2JA 2Z43A 4UBJA 3V4RA 4QG7A 4LIPD 1P6XA 1GFWA 2RB4A 1D2EA 4OXNA 2EJBA 5E8JA 5K0GA 1XR3A 1FDSA 5FYQA 4GGOA 4KP7A 3QWHA 4HVTA 5K4HA 4JIGA 3E1SA 3Q88A 1OBCA 3VBEA 3ETNA 3CUUA 3ZW8A 4GPD1 1XEFA 3UW3A 4JYCA 3F1LA 1N5DA 4RDXA 3RR2A 1RRGA 2A30A 2HQBA 3GNLA 5D3QA 4GI3A 4P4TA 2F62A 4G65A 3TE6A 2BHRA 1BG6A 2HA2A 1U2GC 3INTA 4I3HA 3TTYA 3PLRA 5IU6A 2VUHB 1QK5A 5BN5B 4D0NA 1B8OA 3I12A 2IZOA 2YL2A 4IDAA 4LS3A 1MH9A 1CRZA 1VBMA 1JGTA 3ECCA 4QDTA 3DZGA 1J9GA 2XT9A 4G5YA 4LCJA 4BO2A 4YT5A 5HIJA 2H1IA 1KJNA 1WEHA 2ZSUA 2AQIA 4S04A 5IN4A 4C7MA 3L7KA 2DSNA 3QPCA 4HDNB 1CLEA 5B36A 4PYOA 3T0GA 1Q6YA 3MQ4A 5EKTA 1DWOA 4QVIA 4OBWA 3ZDEA 1M6EX 2FQYA 1WMAA 4DJJA 1J21A 4XQCA 4ALIA 2WIDA 5KTTA 1PGOA 3EXFA 2OCBA 3WLEA 5TNXA 2VF7A 1NW5A 4KO3S 3HY4A 4KITB 2HCBA 3R5KA 1XTKA 4WW0A 4XQGA 2NXJA 3PEWA 1VHJA 2C3MA 2NYRA 4C2BA 3RS9A 2ZWPA 4MS1B 1P6QA 4Z6KA 3F5SA 3R5TA 3O84A 3EJ6A 2B25A 2Q2VA 3F47A 2O3QA 3GDOA 3PZBA 4HDRB 1JR3E 2Y27A 1IJBA 1E3TA 2B1JA 1QH1A 3IJRA 1KETA 3EEBA 5FOUA 1YJ8A 2H7CA 5KOHA 3EDOA 2CHQA 1KXJA 2XY4A 1AA6A 5HP4A 2CFRA 3W2EA 3NDJA 5COBA 4BNDA 4NAUA 4KR3A 1FFDA 2QZ9A 1MA0A 2R79A 2W43A 3G23A 4HMPA 1Z4IA 4I1SA 5DFAA 5KBYA 2OPBA 4JVNA 2X5KO 5DHTA 4CNQA 2PQ6A 4N18A 4MLDA 4KYVA 1BOFA 2B2NA 4I81A 2CDAA 1Y0BA 1DQSA 3ZQ6A 1EEXB 3TPCA 4BZPA 5JATA 4M53A 3SOZA 4FXOA 2YXLA 1GNVA 3QH4A 4U1RA 3NBMA 3V7UA 4L5IA 4UUBA 3KETA 1KFKB 2C7BA 3PC4A 4D4GA 3CZRA 5KJ6A 1CP2A 1ACJA 1J0AA 2ZRKA 3P4UA 3AR6A 2ZRBA 4B71A 5JD6A 2D3WA 4OSOA 1FUUA 1Y7TA 2BMWA 3ISVA 3B38A 4MP6A 1YRQA 3P9QA 4AP9A 4DW8A 2WM8A 3T06B 5HF9A 1E6CA 2A9VA 2FPSA 3JVEA 1O4WA 2PGNA 4IFBA 3U1VA 4EKNB 5IRCD 3DH0A 2NQ2C 1U80A 4EP1A 4A8JC 3OJFA 1HOTA 1P4AA 4FW8A 4CW7A 4QUDA 2ZYSA 5KO2A 3GRKA 4O4IF 4OQPA 3RARA 1WVIA 4DEVA 5B3JC 1LZKA 3GEDA 4NQRA 2B37A 2JHPA 2BJHA 1HMPA 4N0MA 1G8AA 1ZD8A 2WJVA 5G02A 1N0HA 4D3XA 1UC5B 1V8FA 4YMGA 3QOFA 5HKKA 2L69A 3K09A 3I1JA 1G5IA 4MJLA 2H57A 3ZWWA 1NPTO 4KSCA 2YINC 3VO9A 2D2EA 2X9NA 3BD9A 4KFTA 3TKAA 3Q72A 1V95A 1LX6A 3L7CA 4M37A 2IH5A 4MKFA 2Q2OA 2VYVA 1D1PA 1WTAA 2HXYA 4IYRA 1K3UB 3U19A 2C4TA 2WMOB 2FEPA 3GFGA 1GPAA 1T9ZA 4FP9A 2WHPB 4YMWA 3TPFA 1HDCA 1T8TA 1U3DA 3KELA 3W8DA 4MWTA 1WTCA 4PONA 5KNCA 2Q3DA 2PV7A 2UYQA 4MQUA 4QPNA 2XGOA 1TM2A 3FKJA 2XECA 4I8XA 5D1HA 4G5RA 4N7MA 3Q12A 4HKTA 1X8LA 5G2OA 1IBLB 3Q7SA 3FHLA 3RSGA 1M6VA 5GV7A 3UFXB 4K9SA 4C0QC 4C4AA 2HT1A 1CEEA 3SZGA 4CMJA 5H5JA 5IG2A 4O4IA 3CZPA 2PHZA 3EN0A 1MX1A 1IPFA 2NU9A 3C5CA 2YYYA 3G8CA 4FHEA 4KRYA 2PNFA 4TV9B 4FFRA 5JAZA 1BU5A 1P0PA 1PLKA 2Q7XA 2ZB3A 1ZO8A 3GJ3A 4QFDA 3U31A 4YCBA 1CEXA 3MOIA 2RSLA 3HLYA 1H69A 2YIVX 3KLMX 2QG4A 4FYYA 5HOEA 2ID7A 4PZ9A 3WK5A 4EHAA 1HG0A 2EC5A 1D7OA 1JHQA 3GD7A 1P72A 1VIDA 1KYYA 2P9CA 4F3KA 4D8WA 3I64A 2XWJI 5F7JA 4CIAA 2OECA 1N6LA 4AY4A 5KKNB 4G25A 4HX9A 1QTQA 4MYRA 4ND8B 3CRQA 3L4BC 3DTVD 4NOLA 4RCZA 2EEPA 2A9FA 3H13A 3ONNA 5HE8A 3D8UA 2HCJB 2AFIB 3N05A 3MAAC 2QN7A 4KGXA 1S2NA 1ADGA 3CIFA 4DRYA 2R00A 2F00A 2XYPA 2NUAB 5JJ5A 4JT8A 1AQJA 4NCIA 2MYPA 5A04A 4EKYA 1IJEA 2IZ5A 4B3MB 2HX1A 3AHGA 3KAKA 3BL8A 2XEDA 4PBTA 1I1OA 4MQEA 3LIIA 4BB0A 4RMIA 4RQAA 1CUIA 2ZM6B 3JQBC 4I66A 4KN6A 2JA2A 2CL7X 3TSAA 2FEMA 1P6UA 3QNUA 4GUAA 1RDFA 1E99A 2R4UA 1HXHA 2VDJA 2FTKE 2YXNA 2VSXA 4LOIA 1JLSA 4OFBA 4M49A 4YBRA 1WY7A 1XK7A 2DF8A 1JHOA 3MJHA 2VDQB 2QRNA 2JH3A 3O93A 4E14A 4ND3A 3IPYA 2OYRA 4HGYA 4LF9B 3G88A 2G9QA 1ENPA 3FFTA 3P9NA 4HGOA 4FOOA 1IAQA 1WSBA 1Z6PA 2AMJA 4HXGA 4LG1A 3SR4A 3P20A 4KG7A 4BCDA 1OIXA 2XCQA 4CLHA 4NBWA 1PL0A 1Z2AA 1T1RA 1RLOA 2ADFA 2IY7A 2RK4A 4RPLA 3UMBA 3QYPA 1PT6A 2M98A 4BO6A 2UUAB 4S35A 3T95A 1YK1A 3I34X 3ND9A 1J4AA 3PGVA 4WY2A 5LMUB 4NE2A 1R4MB 1H4QA 3GEIA 4K9PA 2ECPA 1QHFA 3A3YA 4RF5A 3IXMA 3T1QA 5IT0A 4QZVA 1D2NA 4MWSA 1QCCA 3KBOA 4AJNA 1DRWA 3MRVA 5I48A 1R0WA 2BFCB 3BHNA 4KN9S 2XHEA 1JR3A 4Y18A 4CCYB 2QX4A 3OMXA 2HV8A 2PMKA 3BXPA 1GUAA 1RIIA 2PUWA 2QMYA 3QLJA 2VSYA 4Y9SA 3NR2A 4Q47A 4D0GA 4U7WA 2PUDA 3C8MA 3M6MD 1ES9A 1MQ8B 1QV6A 1ZM7A 2HXGA 3LLUA 4KQCA 4OYLA 3BFPA 4QUJA 5AM5A 1VZ2A 1XDWA 2PVSA 4BO7A 1F0YA 2FPLA 1D2AA 2WTXA 5LQKA 3VKHA 4L0DA 5CDFE 1OZAA 3FYUA 2IGTA 4C7KA 1JA1A 3DBLA 4MA4A 3FPGA 3Q7IA 3NATA 4KQ6A 1PS8A 1J2TA 1VHDA 1KSJA 1XWFA 2BLNA 4M1TA 5CVUA 3T9EA 4DMFA 3RW9A 4NJEA 1FPQA 4L5BA 4OXKA 3PQ3A 4Q3KA 4QWWA 5SZIA 5K7SA 3EZ7A 2ZVJA 1X7ZA 4RY0A 1DC8A 3CNOA 3L0SA 2EIHA 2JCGA 3N86A 5FBRB 2QRJA 5BW8A 1YS2X 3EG9B 4BE4A 1MW9X 1DP4A 5IF3A 3OJ0A 4GOJA 1ULHA 1E2QA 3J80A 5HGXA 1K6EA 3VR3A 3DLTA 2VT6A 1AKNA 4B43A 1Y4ZA 2R5NA 1E89A 4BUZA 5KHAA 1J09A 3OPMA 5M04A 2HA7A 4O4JB 1WQ1R 4M54A 1CR2A 1SXJB 3R8CA 4YCSA 4IWXA 4S1WA 4XRGA 3T3OA 3EXAA 4WASA 2YN4A 3W06A 1RD4A 3V8NA 4R71A 5K0BA 2JGDA 3EGCA 2NU6B 2JZCA 1ODFA 4G0NA 1MJGM 2I2FA 1H2EA 4IDBA 4OHRA 5IM5A 4YDSA 4EGCB 2O2XA 3IP7A 2I3BA 1AN0A 2AFIE 2UZIR 3FTPA 4J3JA 1FL9A 3F98A 4YRGA 2WD9A 1KE2A 2YHAA 3GFTA 1NYTA 3ZS8A 1FDTA 5CNMA 4CHGA 3ZWMA 1VPEA 3UT5A 3WS7A 3V6MA 1RKBA 4KR2A 2QMHA 2YHSA 2OKGA 3T3DA 1OLSA 4UVIA 3IA7A 1IE3A 1YZGA 2JCYA 5MDHA 1K2WA 3EWNA 4KXLA 5KX5B 1SXGA 3QBTA 4QTYA 1DL5A 4FHFA 2ZI4A 3KQLA 1DAGA 1T1IA 4KQWA 5HS6A 1Z4NA 1Z8DA 3FNBA 3H9BA 1ZMTA 2DM6A 3F6EX 1UBMS 2XRZA 1Z12A 1BXRA 2FFBA 2WSIA 4LNUA 4EYSA 4HTFB 3D31A 4EGSA 1GAWA 2JVJA 1MFPA 1SCDA 1EGAA 1XTPA 1PQ4A 2V9PA 1DJMA 1LLUA 2H5JA 3DQQA 3KEFA 1L9XA 3X1MA 3KZVA 1MC1A 4AJ9A 4TM7A 4KYUA 5TVGA 4MS3A 1BHQ1 3M33A 4HWRA 1PBTA 3D43A 4JB8A 4LPSA 4LE2A 2G77B 2R7AA 4Q9IA 5EWLA 3OJLA 4US0R 3FBWA 2X1MA 3EULA 1EP1B 5EJEA 1FVFA 4EJSA 5FH9A 2ZUTA 3T7AA 2R1TA 5IJZA 3ADDA 4YRJA 1TM3E 3NVKI 1F1JA 2JIOA 1T26A 3OZGA 4QASA 2PSHA 4WEQA 2ZYRA 3KS9A 1EI9A 4RDIA 5IK2D 1B0PA 1XJWA 1DXQA 2R7MA 3H5OA 4IY1A 4CM8B 4LZOA 2JGAA 4LSMA 4EK9A 3OM9A 2HC9A 5DN6A 4ESEA 2XAAA 4XPIB 2P2LA 6YASA 2ZCUA 4FXPA 4KO1S 1U5BA 4YGYA 3UYLA 4PIPA 3OLWA 2A5LA 5A6SB 3UTCA 1Z2PX 3FDZA 1F2TB 1FRQA 4EGFA 1PU2A 2QX9A 5F21A 1UBUS 4AUEA 1AHPA 1KJZA 1J0BA 2Q1SA 2XYVA 3BE5A 3GO4A 3P2YA 2O8BB 2AT1A 1YCGA 3NAZA 2JGFA 1PGNA 3T6KA 1Z4MA 3INYA 5DTRA 2ANBA 2I03A 3DVAB 4IBOA 1ESZA 4HP8A 2XUIA 4RHUA 1CFZA 1ML3A 4K2HA 3CVWA 2P77A 1OR8A 1Q74A 3MC1A 5TMEA 4KUGA 5DJ5A 3LO5A 5BQXA 3OM8A 3DMHA 1Z7GA 3BL6A 1TA9A 4EJ0A 1Y9AA 1KO1A 1R2QA 2WYOA 3BRSA 4MX8A 3NOOA 3A6HA 4G0MA 5T4EA 1E6KA 2NU8B 3WV4A 2OZLA 3FETA 2C9DA 4KXMA 2VPPA 2Y99A 2HRQA 1YF3A 1M0SA 3VAYA 2RGBA 4NDNE 3NDBB 4QBHA 3TTXA 2JFFA 3KOUA 2W6ZA 4KI0A 3QLVA 2VP9A 2HPZA 3Q3VA 4HD8A 1LNZA 1I4EB 2I8AA 3R40A 2QRGA 5T64A 1LRJA 3QKUA 1R50A 1MAWA 5F5XA 2XR1A 4WV3A 4J1NA 2AIRA 3GGCA 3DL7A 3EH2A 2O2ZA 3IVRA 5HRUA 2XYHA 4EBFA 1UMKA 4XQEA 3TLBA 1POWA 2V54A 1L5VA 1Q7RA 1BDBA 3DKPA 1QG0A 4YJ2F 3RASA 2SKEA 3BFJA 1DBQA 2DUUA 2OM2A 4JHXA 4ZD6A 1WUHS 3T5TA 2MSDB 2ZUWA 5J43A 1XUOA 4FDUA 1SC1A 2DWQA 2G80A 3LVRE 3DJFA 5HZKA 3WWOA 4LGVA 2CB9A 4NATA 3IMFA 4RY9A 1N92A 3UY4A 1Z6XA 2WJ6A 2ZRCA 4KLNA 1G6HA 1ZIDA 4JR1A 4IWYA 4UUMA 4YRCA 5T57A 4MROA 2KBFA 5LZ7A 4ZO6A 3U7RA 1A9TA 4M99A 5CX1A 4AWAA 4AY3A 5GADl 1FNSA 3F49S 5G1OA 4XFJA 3C4VA 3VZBA 1ST2A 3H0KA 2ZATA 4YX9A 3C3AA 5A71A 5K0LA 3ZHSA 3U3RA 4DSNA 4HK4A 4N39A 3ZC3A 4H3KB 4Q18A 4FC7A 3HKEA 1G0OA 2GZMA 1RQXA 1ULSA 4O2BB 4RVGA 3WYBA 4YUVA 5HKBA 4KKVA 3KYCB 4AY2A 3BK2A 4I5FA 2JIRA 3HCBA 3HKDB 3G0BA 4R6XA 1RJDA 4E7OA 3DE4X 2UVPA 2G0AA 1ZXBA 4KGVA 1XMOB 1YC2A 5CLHA 1NGSA 4L2IA 2QX7A 1O9GA 1NP7A 2WWXA 3SXPA 3TLZA 1AGNA 2WW8A 2C77A 1PD0A 4YJ2A 4EL5A 3KQQA 3GQBA 1TM7E 4ARBA 2IXAA 5E9AA 4D3FA 1T35A 3G2NA 3ZW9A 1U8XX 4HJRA 5LBIA 3QMWA 2QR2A 2ZANA 4TLLB 1OASA 2FZVA 1E2MA 5EIWA 1P39A 1PS0A 1ZK4A 3K30A 3O9VA 4OFXA 3FD8A 2XUJA 4BNHA 3F8TA 3PG5A 1RADA 1RI2A 3WP1B 3ZWCA 4BZQA 1UZMA 1GCIA 3EASA 4X60A 2YXDA 4X92A 3NG1A 3NH9A 4ZEMA 1LSUA 3LM8A 3H2GA 3IUEA 3OTHA 4RY8A 1RM4A 2HHCA 3NTUA 2QXUA 2QLFA 3Q9NA 4RYLA 4DYHA 1ZN2A 2LBPA 2G3YA 2DLDA 2C2BA 1AK9A 2Y0BA 1AQNA 5EZYB 3BAFA 3RSQA 3AJEA 4AUNA 5THQA 3OU2A 1U9CA 2H48A 3UJAA 3K8OE 1VYHA 1ZVQA 2QUBA 3LF2A 4Z3KA 3KPYA 3HYRA 5JTUA 2ZT7A 1LF0A 5JO9A 1OCEA 4BQEA 2LZ0A 1DIAA 4OL0A 5T3YA 4YP1A 2WPDD 4P0QB 1VBKA 2ZJ3A 2FUNB 5GIPE 2BFOA 4LVOA 3WAJA 1BE6A 1O8CA 1F4PA 3KD2A 4KIUA 3F6RA 4ENSA 3DVQX 3UF0A 1BEEA 4RK6A 1MENA 1VG0B 4HT3B 2IZ6A 4NBRA 1NI5A 4TUYF 2ZRPA 1HYEA 1I3MA 2P5UA 3B2NA 3DCJA 3I2GA 2Q3CA 4FNAA 4I6GA 4BNMA 1L5GB 2K6GA 4ZP1A 1C0PA 4FDAA 4MVCA 2OK7A 5FA6A 3HC7A 3NBAA 1B4DA 3VJMA 3PS9A 2ODPA 1RYMA 3DT6A 4YI5A 3VVLA 1JN0A 1GLNA 1M1NB 1XCMA 2QLMA 4G81A 4QJBA 3RJMA 4YI3A 3WLPA 4JBHA 1UM8A 4CBVA 1N2OA 3E8XA 1YDFA 2QNRA 2VPIA 1T2NA 4WN3A 1LI4A 1DKOA 4WJKB 4AICA 1R6AA 3V1NA 4HAUA 4J0KA 3QUTA 3ZTYA 5ESWA 2I6TA 2RH8A 4MW1A 3V8BA 4AF6A 4BLQA 5EIXA 1Z3CA 4DUYB 2WOJA 1XHEA 2VI5A 5KYWB 3VNVA 1LC0A 2I22A 4I1OA 5EJMA 4ZVLA 1VMDA 4EY6A 5LIPA 1UJ5A 4LMRA 1LBIA 4TXJA 1UBLS 3VDRA 5JJLA 2OCDA 3ORSA 2WWYA 2JJYA 3KLNA 3KIPA 3O2JA 3ZKWB 4EUNA 4WBNB 1ML4A 2QQGA 5IVDA 3ZDDA 1TQ6A 1DAKA 1HURA 2E2WA 3NHMA 1Z0AA 3PRKE 2WK1A 2XUPA 1OGIA 4TUYA 1RQPA 2FMKA 3FWKA 5LDDC 1NP6A 3NKFA 4RJTA 1R6XA 1CQJA 1E0SA 1S8OA 3AHFA 3GPCA 3OEHD 5EL0A 1A69A 2IT1A 1M0EA 5C80A 1BGVA 3DZHA 2YJZA 4IGFA 4EJ6A 3GMDA 5K3BA 5JVDA 4GLFA 5HZHA 4HNHA 1RRFA 1JEYB 3EA4A 3NU1A 2ATCA 1P0IA 3EVDA 3GK3A 1E1YA 2WJPA 3PXEA 4Z2YA 3JTMA 4GLLA 4MJXA 1U7ZA 5JNSA 3VZPA 2MTBA 3THWB 4EPRA 3GLHB 2ZJYA 4WT7A 2C8KA 3HCWA 1SXPA 1AKWA 5CNJA 3RHZA 4F9TA 4YCCA 1RNLA 3EQ8A 4K9MA 4P3KA 2BPOA 2QN9A 1M73E 3MELA 3DV0B 2VHZA 2L18A 3A1SA 4JENA 4A9AA 4L8WB 3EH1A 4RSHA 3U4AA 1GUFA 1BHO1 2LGJA 2HADA 4BO0A 1BSVA 1C2YA 1J8QA 1NKSA 3I76A 3PFIA 1LGYA 5D87A 5BRAA 3PVZA 3L4EA 5AVTA 2IS6A 4EB3A 3B9RA 2FRDA 1RHQA 1U1FA 5DP2A 2PEYA 4K46A 5TT0A 1A27A 5AJYA 4I4IA 1J97A 1XKQA 4YACA 3CX8A 1X0VA 5F73A 1GSAA 1U2TA 3DEZA 1ZQ1A 4JQZA 3K3PA 2HTFA 4HZGA 4HYEA 4OGKA 3W4KA 4DJTA 3UA3A 1CKEA 1QHHB 4EHBA 1AGRA 1QS0A 2P9GA 2JVIA 3FCEA 5DBEX 2X2PA 1P1KA 2YCBA 2BJVA 2O57A 3Q87B 4H0FA 3TDKA 4E07A 1SRQA 1OLOA 2GEVA 3IQFA 1JLHA 1CDEA 1PZHA 3CW8X 3VRHA 3WL8A 1XEXB 3VMFA 2G5PA 3D6VA 3ONEA 4DRXA 3SQXA 3MSCA 4BFTA 4ZVTA 1WXHA 2H3EA 2JD2A 4X1IA 2XRFA 4V2IA 3K4HA 5IW8A 3A1FA 1CR1A 4IEEA 4R83A 2I87A 3Q3EA 4QTZA 4YCJA 2JF0A 3CQ9A 2H16A 2VF2A 4AFNA 4BVGA 5FL7A 1OC4A 2J6CA 4E0BA 4CKCB 2PWZA 1TJNA 4N9WA 5F5LA 4LXGA 5ILGA 1WR8A 2JI6A 1LPPA 3W6NA 1Z8NA 4RPIA 4D4JA 4WZAB 3L6CA 3UJHA 1AKMA 2QDKA 2ZYGA 5HK9A 2VQSA 1A97A 2PKQO 1WP4A 4HDOB 1VLQA 2V6FA 3JWPA 1QRUA 3KHTA 4QQ8A 7MHTA 1A2BA 5HJ5A 1E9SA 2BMJA 3SOPA 2G4CA 3N8GA 4KN8A 2FDCA 4GT1A 1Z88A 2WF9A 1MO3A 4LYYA 1BIFA 1SC9A 2BZGA 1QFJA 1PSZA 2Y9MB 1BE1A 3GJ0A 3PA6A 2JLWA 5P8WA 5AK6A 3U26A 3IILA 3QG5A 2FUCA 3GP3A 4MUFA 1YS1X 4Z51A 4LF6B 2FSUA 4Q3DA 1L5KA 5B2FA 3ZJVA 1Y3IA 4URZR 1Q11A 1U0TA 2D8AA 5DLDA 5EJ6A 1L7QA 2XIJA 4CTJA 4HBGA 4C2TA 4JT4A 5F3RA 3QLUA 2PGOA 3DHWC 4RSRA 5ERXA 2RHLA 3UBMA 2EJVA 2DQKA 2R9VA 1T9GR 1M2KA 1NVUQ 3T4PA 1X7YA 3TCKA 1Q84A 2E5LB 3LO8A 1HYBA 3EQ6A 3EFBA 2P9YA 5KNBD 5BR8B 4ZWNA 1KHHA 1P7YA 2A0XA 4QM6A 2O7QA 1L1EA 3T9FA 5IBQA 2F4VB 1ZAKA 2NMVA 3FDXA 2IQ5A 3K2IA 1OXMA 4MWBA 1D2GA 4KVAA 4UD2A 2OORA 3NYQA 1Y5MA 2QGNA 4KDCA 2AWNA 2IYOA 3WXBA 4F38A 1SXJD 4KBGA 2ZRQA 3HYTA 5JBQA 1PV1A 1KYVA 1KEKA 4PGMA 3ROQA 1CU1A 3AEKB 5CHEA 4EYQA 1JAXA 1QB8A 5DHUA 1PW5A 4E6PA 1EA7A 2X4LA 2WJ3A 2ST1A 1KZYC 2RKOA 3QF4A 3EGVA 4P3PA 3NC0C 3VKUA 1NT4A 3S7ZA 4LRWA 4RVSA 2GASA 3PWSA 3W2FA 3T7RA 3WZMA 4DNQA 5A62A 4Q03A 1LQ2A 2W6OA 2MCFA 5B2ZA 1BGXT 4NVRA 5FX2A 2BD0A 2FSHA 2HBZA 1K06A 3TG8A 1CZNA 1MQ9A 4OI4A 5JSKA 3RAEC 5GPBA 4HLCA 5FWXB 2Z9DA 3H11B 2WB2A 2ZBRA 5M5BA 3VKGA 3SY8A 4RZ2A 3PHJA 4F4HA 3EQ9A 1QH8A 1M1UA 1W5TA 1SWVA 3QLEA 3TLMA 2YYAA 5AUOB 1NVVR 2B83A 2IZ0A 3F97A 4XEHA 4ASUA 2NSHA 2WVHA 3FN4A 2QMOA 3VU9B 1UM9B 4RVHA 1D4FA 1C14A 1S02A 3IQXA 4HN2A 4F5EA 1K88A 1U2QA 4YRBA 4FUQA 1EBUA 1SQ0A 1JDTA 2I99A 4EY7A 2J3LA 3A1CA 5DHQA 3QVJA 1JHZA 4ZU6X 4LHYA 3CIOA 1QQ5A 2DHRA 4Z9YA 4MQMA 1Y4DE 1E3IA 4XX1A 4UU1A 4NS4A 1I6WA 3I42A 2CXNA 4EX6A 3WXMA 1YMQA 3ETDA 3MCVA 4WK2B 1BRTA 3RJZA 3I3OA 2HFKA 3DSRA 2HOQA 4LI3X 4MVJE 1G8YA 4N0EA 3C6XA 3BXZA 4DQ0A 4ZOQI 5KI6A 5E7IA 3NALA 4H3SA 2EL9A 4J0JA 4TRNA 3ET5A 3AHCA 1JHRA 3DAHA 4K81B 3W5JA 4EW3A 2QM0A 1LI5A 2OAEA 4DR5B 1Z47A 3DM9B 1R8JA 5FPSA 1HLGA 4CWAA 4WZAE 4GSKA 2J8ZA 1K9SA 3ZNNA 1CUXA 4RESA 1BFDA 1SQGA 2R44A 3F6PA 3IEXA 3M6UA 4FSXA 4H6PA 4UASA 3ZE6A 5EN4A 1QVWA 4B2LA 4CV1A 5C9ZA 4LF5B 3U09A 1G8SA 3RIEA 3PC8C 2QRPA 2ZE6A 3QFCA 4BX9A 1HUQA 3N5CA 3C41J 1GFIA 1UKVY 1YI1A 1KK2A 4H4DA 5LOVA 2XCSB 4HH0A 4YRMA 3SZMA 1MVOA 1HWYA 3H6KA 2C5LA 3E2IA 1B42A 2PCJA 3E22A 4WY5A 5FOVA 3TFOA 2W6PA 2QZ4A 3AINA 4B3HA 1NVAA 3RUIA 1TUBB 1GPDG 3SDBA 3ASYA 3Q9LA 4CMGA 2JLZA 1WB5A 4UHBA 521PA 2XTZA 3SHVA 4BNTA 4IAOA 1UC4B 3CNNA 4Z4HA 5AKYA 2W93A 2XNJA 3E27A 1TZBA 1MJHA 2PQMA 3JQ8B 2IYPA 3OIUA 4MUEA 1HETA 2H7VA 5ENDA 4Q19A 5H8WA 4KPYA 2WAXA 2ZB8A 2H59A 1CHNA 2HO5A 3FMGA 2DGDA 2RHTA 4H7HA 1ZJ6A 4KGZA 5FUXA 4EUKA 3ZDXB 1EDEA 2FPGA 4XWKA 4GKJB 4X8MA 3AJRA 5BMVB 3KQUA 1DT5A 4OUDA 3KKPA 4Z8YA 1T0IA 3W79A 3MD0A 2UZ4A 1X9GA 4FHCA 4BNLA 2CLMB 2CXSA 1WLSA 4FDMA 3OFSA 3CUEF 2O59A 1QNLA 4L95C 1VYTA 2Q29A 4K6HA 2NT3A 2WJIA 1L7OA 3DTYA 4B8ZA 4DQKA 4FFOA 2VQDA 3IOEA 3R3SA 5D1NA 1FFBA 2FJUA 4FGUA 1PFVA 3LQ2A 4LYGA 2GMWA 1T8UA 3ZZNA 1PR1A 1TRKA 2PR7A 4X1OA 3UT6A 5LQCA 1UKBA 2W8BB 1TLFA 1SKBA 1UQTA 2AVDA 1J25A 2ODNA 2X7JA 3Q2KA 5A05A 1NUPA 2QT0A 2NVUB 3SF8B 4WGFA 1KBQA 2Q41A 3AKYA 3M4XA 2ZIUB 2ZM5A 1EFTA 1GGFA 4RK4A 3AP1A 1LRKA 4YROA 1EUCA 1Z83A 3PQ6A 4C1BA 1YUNA 4JI4B 4HUQB 1JSRA 5FTNA 1I5RA 2QD1A 1TMOA 2TRSB 3ACCA 4BKRA 1TJ4A 1COZA 1Y82A 2G5GX 2P9HA 4MQFA 2AR9A 1TNDA 4QIHA 4C0AC 1RQ7A 1TMYA 3SR0A 1SKMA 3O2SB 4IGKA 3CBGA 3QX9A 1XKXA 1CQZA 1RZUA 4KXXA 4Q1VA 4KK3A 2E49A 2QQ5A 5HRAA 1X1SA 2ZJBA 1XEWX 1I80A 4PLTA 4AMGA 3QSYA 1UMDB 2GEFA 3V1UA 1P5JA 1IEWA 2JFZA 4KDFA 1L5LA 3E4CA 5KSYA 2XDAA 3E05A 4I5DA 1NWHA 2IYEA 3ITKA 2QX6A 4B3FX 1XZFA 1ENOA 5E7MA 3RLIA 4BOYA 5LWHA 3P45A 1HZZA 1LBSA 1KORA 3WLAA 2CVQA 4JLOA 4MB0A 5KQLA 4NMHA 4EKIA 4QRDA 1LKZA 3IXLA 3QU4A 2ZVPX 5I7VA 1S5PA 2FK8A 4PG6A 4TMYA 4G0XA 4ZVVA 3TKLA 3V97A 5ARBA 2H4FA 4YAEA 4LSWA 1L3IA 3SC4A 1QYVA 1SK8A 2OHIA 2RI6A 1GYPA 2Y4OA 3TEFA 4DM4A 3WRYC 4KPUB 4BECA 3TS1A 4GQAA 1F8UA 4TTRA 4XGRA 5I01A 5AVKA 3KDAA 1XHLA 2ACWA 2P5YA 1P33A 3GDWA 1IVYA 2XQJA 2DFDA 5G41A 3OSZA 1CDOA 2VNHA 3SPXA 3F90A 1GKIA 3RRJA 7AT1A 5L3QA 1W4AA 2H3HA 1NNI1 2GEKA 5DYGA 1O97C 3NHUA 3L40A 1HY3A 4FCTA 4HUJA 4CETA 5IWAB 3PL5A 2ECFA 3GPDG 3OF2A 2GF9A 1HE1C 1YJAA 1ZH8A 5A3SA 4MJ3A 1GUBA 1UBTS 3UQYS 1Z6AA 4N3NA 3ESBA 1B93A 3B1WA 4WGGA 1JU3A 2RI0A 2I0FA 3LZCA 2YFHA 4JZKA 4MMZB 4Y0VA 3A04A 2BFBB 3QW2A 5FNZA 4L57A 1K5DA 2E4AA 3LT0A 4D99A 3OQOA 2C20A 4G86A 3A31A 3JALA 1NUQA 3AW8A 1XMJA 2YBEA 3PRHA 2HU2A 4GPIB 1Z62A 5KZMB 4DY6A 1AHHA 2XOKD 1TKAA 1U8AA 1WW8A 4JVSB 1IXKA 2JJ2A 4F3YA 3PENA 1FA9A 2RG1A 4GSYA 2CJXA 3O91A 1T6ZA 4MVJA 4FJ2A 2QRLA 4LWOA 5FUMA 3PEUA 5FNVF 5T7BA 5FF9A 1VPWA 2FF5A 3QKRB 4XXHA 3IAAA 1RKUA 1ZUNB 3BGOS 3ZU5A 3GIWA 3PD0A 4CKZA 4R2MA 5DISB 1TAHA 4L5JA 3MILA 1SIOA 3W7AA 3D4BA 1DINA 4WEOA 2Y0EA 3BWEA 1AZTA 2ASVA 4BTVA 1G63A 1XZNA 1DO2A 1UIRA 1NBMD 2CJWA 2VH1A 4IDNA 4YK7A 1DV2A 2A9QA 4U6NA 3GJ8A 4DDTA 2HO4A 3L2OB 4ZCIA 1H2BA 2PRJA 3EPHA 1BQ4A 4GVXA 5JAIA 1H3FA 2ZBPA 1CZOA 2BMFA 3MWLA 1EWVA 2IWHA 3VR2A 3W3AH 1EPUA 2EF1A 2YW2A 5KAMA 2JAPA 4YUXA 3A9SA 4KMRA 1E2GA 3D2AA 4DNFA 2A59A 2ADMA 3AF3A 3QKSA 3U0BA 5IUJC 1RT9A 2GLXA 3Q10A 1HE4A 4QOJA 4WX2B 1S89A 3SE0A 3EGXB 4OIMA 1SVIA 2PJUA 3OY7A 4C03A 2IA5A 4IJVA 4YRAA 1HL7A 2CNWD 5F1PA 5HG0A 5JXJA 1B73A 3OOWA 4H2DA 4J0GA 4QBKA 5J5AA 2R8YA 2FZEA 2N46A 3FGZA 4TMVA 4B48A 2RHHA 3P2EA 2XSZD 2R1VA 1QP0A 3QELA 1R5JA 1ZRMA 3EDQA 5A0TA 4AJJA 2QD3A 4R7TA 2GFQA 1UINA 5G4LA 1D3AA 4JBGA 4WNCA 1A72A 5HKOA 1V96A 3EVAA 1NM5C 3AY0A 3FG9A 2GSWA 1VI5A 4NULA 4U7PB 3W2GA 2J07A 3FM9A 3UCFA 4P98A 4ZICA 4QT0A 3RAJA 5I4CA 2QW8A 4HY3A 2MR6A 2RGYA 4NOKA 3S2EA 3ZI4A 2B78A 3Q9SA 4UU7A 4ARIA 2KJQA 1MZPA 1HE5A 2IXTA 1O1YA 2C2KA 4OAOA 1S2MA 3DMNA 1GZ7A 3PB3A 4MUBA 4QFMA 3MZ0A 3VH4A 1LI7A 4CODB 2CFCA 3B9BA 3GGSA 4G85A 5IDYA 2UUOA 5LBUA 5J2TF 4RANA 1OFIA 3LQKA 4IDCA 3RU3A 2B5WA 3G17A 1SUAA 4BBPA 2YWHA 3PEEA 2H8KA 3PR2B 4K2AA 4OHXA 2ICAA 4U7TB 4E33A 4JJIA 3KSUA 1ZNZA 1BTOA 1WOMA 4L5YA 3VC3A 4WLEA 4DLYA 1QPBA 5KTYA 5CPBA 3I61A 1UKCA 5TMPA 3W6OA 2Q6VA 3OLXA 3NMUF 2HWUA 4U4AA 1Y8QB 1TA0A 5DXFA 5H9VA 3AVOA 5CIYA 3L46A 1FLDA 2C5GA 3D8NA 3FTQA 5JC8A 2AEMA 3NYIA 4IV0A 4Q7JB 5J5VA 3ZWKA 4ZOCA 4DV2B 4UMEA 4CG1A 3HPRA 4EVRA 4TT3A 4E1AA 1USIA 2B34A 2FA9A 3TSCA 2ZJ4A 4F7DA 4UDNA 2AL7A 1E2FA 1GZHB 5H82A 3KTDA 5D51S 3MINA 1IG0A 4A6EA 1ZD2P 3QY9A 3C7AA 5A5GA 3LQQA 4U2CA 4B4OA 4X0EA 4W9MC 5IH3A 2R6R1 4Y6PA 4N47A 1N1MA 5EMKA 1DIGA 1YV9A 2VHVA 1XZKA 1P1FA 4G1EB 3RF6A 4EFLA 5J2TA 2CCKA 4RSGA 3WNCA 3SK0A 2OZEA 4BZZA 1YKGA 2CXTA 4WNIA 4XDHA 2JBHA 1Q3HA 2AZDA 2AOTB 2FPWA 3BULA 1ABFA 3DNMA 3GFOA 4BV9A 3NC1C 2KMLA 4PCAA 4QDJA 4H31A 2OESA 5C3UA 1WG8A 1TMGE 3CEAA 1YVDA 2ZZKA 1CK4A 3A9RA 2FRXA 1DAPA 1LPBB 5KOHB 5CAEA 2RAFA 3ZOZA 4QNMA 4KE8A 5BWNA 3CF4G 3WK6A 4J7AA 2NVOA 1EQAA 3IR6A 3JQGA 3NRBA 3Q8XB 3VTAA 5C7OO 1YIAA 3FDFA 3OTIA 1KDRA 1ZWLA 3H2KA 3FPHA 4P7JA 2WDPA 3CKKA 4FT4A 4IO1A 1QIEA 2OLEA 1I9CA 1TVCA 2V7PA 3QVKA 1QAMA 3KQTA 5AI5A 5HCUA 2W00A 2GR9A 2PBFA 1OFUA 1ILWA 1E69A 1X1TA 4QL3A 2DLCX 3CSUA 5EXEA 4IMJB 4D1YA 5D01A 4UAGA 4RL6A 3E3OA 4Q9DA 5BT9A 1XU7A 5FOQA 4C76A 4JI8B 1Z2DA 4KH0A 3DLBA 4GD3Q 1NTRA 2NOAA 5CYPA 4CIVA 4K9NA 4B4KA 1A9PA 2PGIA 2FOLA 1M67A 2PE5A 1VJ1A 3LY8A 2FN8A 2GTIA 4MIKA 3DT8A 3OZWA 4JS0A 1FNCA 2AN5A 3BIJA 3PJGA 4QSMA 4J6FA 5C1OA 5AHRA 1O2DA 5D3MA 4LC1A 3WRVA 5BURA 1II9A 1ECJA 5FJIA 3BSSA 3WMRA 1GFZA 3G7UA 4ZC8A 3OE5A 1HF3A 5ICGA 5EXTA 1IQPA 2KSQA 5DRTA 3LPNA 4ZI2A 4JYMA 3VDMA 2BBWA 2EIXA 3I2IA 3NHRA 4IIEA 4KQ9A 3OH8A 4LXUA 4RKEA 1SVLA 2NO1A 1F1BA 2QI9C 4WHMA 1M2OB 1JQDA 1WSDA 2BEWA 1AM4D 5IHPA 2GJ8A 1WUKS 5JAQA 3GRYA 2HNAA 5D5QA 3RS4A 1ZSNA 3C8DA 3JWJA 3VSBA 2EBUA 2ESRA 5E6UB 1Q1AA 4X20A 1QGED 4JT9A 1R00A 2RHOA 1MDFA 4N7JA 5BQOA 4QYTA 1MX5A 5DCUA 2CHUA 4DABA 4QXOA 1ZK3A 4B3CA 3O3NB 3PPIA 1SU4A 4UTZA 1MP0A 2NXWA 4E2ZA 3AIMA 2YTZA 5I7RA 3W5AA 3KLPX 1QOQB 2CNLA 1SXQA 1M6VB 2C1XA 4TYWA 2ZITA 1FDRA 3DBOB 3HBFA 3ND8A 1EVZA 1ZFNA 2Y6VA 4URUR 4O4IB 4W9NC 4FBLA 5CCDA 5TPWA 4BHTA 2H2GA 2DJIA 5EIBD 2PWPA 3AEUB 4ENWA 2GX6A 3W3AD 4XASA 5EPOA 1JP7A 2FUG1 5BNFA 5TXGA 3S3TA 3ISJA 1U0LA 1A4XA 3DEJA 1X70A 3WBFA 2ZSBA 3MTEA 3OKPA 4GZ6A 4MRRA 1LVHA 2UXBB 4R41A 3OZCA 4H6WA 3VPAA 3DPIA 4TOIA 5E2AA 1OX5A 2ZRAA 3MM4A 2YIJA 3D64A 1ZCJA 2UYCA 4BKOA 1QGOA 3TX6A 2DH5A 1C4XA 3UJ8A 4G8BA 3SHTA 1CQPA 1O8BA 2YJ6A 2LKDA 2Y66A 2K7FA 2P1RA 4QNNA 2ZI7A 5DBIA 3N5KA 5K0CA 3CKLA 3V4FA 1E2JA 1E61A 2X8BA 2M1ZA 4LWPA 5IARA 4NX2A 5FL3A 3K0AA 4BO8A 2DB3A 1RWWA 1U8FO 1QIJA 3DC2A 1MCZA 3BIFA 3U62A 4MKGA 4P3OA 4A0QA 2G04A 1ZZEA 3ADKA 1PR9A 3DDZX 4PLGA 4QBFA 1NVMB 1GA1A 2V1XA 3Q98A 2MYNA 3ZV3A 3K9CA 1ZNQO 4DFDA 3WNVA 1KVQA 5H68A 2ZIGA 1X8KA 2BF4A 3FUVA 3GEGA 4NH0A 5AOAA 3N2KA 3ICOA 4GIBA 2X3YA 2GZDA 3HRKA 3NEPX 4LMAA 5ALLA 3QXGA 4F4IA 2EZ4A 1U2GA 5MFPA 2O8FB 4D9CA 3CPHA 4RMGA 1QG4A 2CVHA 5AKZA 1HG1A 2CVPA 2IDKA 2VXOA 3B82A 1CP3A 4L3OA 1EIZA 4XFDA 2FWJA 1JIJA 2PS9A 3ROGA 1H6AA 2R8ZA 2WTAA 5EYPA 1PNQA 2A9RA 4B34A 4B3GA 1X1QA 2EBFX 5AKEA 1EXWA 2JBWA 2ZVDA 3L92A 3O8BA 1KE1A 2BR5A 3C3KA 4TWJA 1ISPA 1CF2O 1Z25A 1Q50A 4NHOA 4RMJA 2J30A 4E4YA 3AR2A 7ABPA 1HPLA 3MS4A 4PAOA 2IIPA 4LCEA 4AJ4A 2C99A 2CNDA 2G09A 3LQRA 3LUHA 1Y4SA 1P7VA 3HBMA 2O8EA 1NFFA 2I3DA 1I1HA 4N7BA 3FTCA 5CJ2A 3QITA 2LKCA 4OGFA 1PR4A 2H85A 4PHGA 4LNHA 3OE4A 4L6IA 4ZJPA 1OLXB 2WHYA 4Q66C 5MN4A 3NBZC 3RRNA 1MAAA 2C88A 2OWEA 3KB2A 1IEQA 3KVYA 4PN3A 5SYNA 1UC8A 4OLJA 3UQZA 4C7BA 3W5DA 1A50B 2J9FB 1R5BA 2B99A 2BP7B 1FP6A 3N8HA 4IIUA 1NW9B 1E7RA 4LF7B 3OZEA 1AZLA 1N7JA 1F3LA 2WD7A 3ANTA 2BFAA 4W99A 5AI0A 1JHVA 4FU0A 3T41A 2JDIA 4KIWA 1D7AA 3TAXA 1XWIA 2JLBA 5H3CA 4R05A 3EDYA 4NJEB 1NX6A 4G5FA 5CNKA 2HU7A 1HFEL 5IASA 1JXMA 1VSVA 1J2UA 2B4TO 4ZOEA 4DPLA 1PEAA 1Z75A 5I9BA 5JI2E 4ID3A 1OWMA 3RODA 1ZSYA 5A6VA 1A8SA 1IRXA 3IAHA 4BX2A 3DD1A 3GCGA 4ME6A 4MSUA 4F97A 5CXUA 2VZ0A 4OHCA 4B83A 1V3QE 4CG2A 3RVMA 3C3XA 4YCMA 1OIWA 1NMSA 1E8DA 2JFQA 2PX6A 1PZXA 1UCFA 3A6KA 3C7KA 1WSWA 4HDMA 4NU8X 3RD5A 4AMZA 4C01A 2LP4Y 4E5PA 5JIBA 5K0ZA 2JAWA 4F71A 3AR9A 3TNYA 1B6SA 1CJTC 1CUUA 2BFEA 4CG3A 3FOBA 1C0IA 1YBAA 2GZAA 4B87A 5CLFA 5CEJA 4EG3A 2QMEA 4ZOBA 2HMUA 2R6HA 2SNIE 3DCYA 4E5KA 4JP2A 1RXCA 4MAAA 2HYIC 3TVYA 1X1RA 1E5QA 2J7KA 3JR7A 4J4BA 5AKXA 3A11A 5DSZA 5LC1A 4A8JA 5KQRA 1EK5A 1NQWA 1FP4B 5K2OA 1UOQA 2AN3A 3LUFA 1JHAA 5B3JA 3QNMA 3RJ9A 3NT5A 1GCOA 2O6HA 4L4YA 2BTEA 2AYZA 3QOWA 2WUGA 3EGIA 4ZDIA 4LWQA 3GFVA 4FYVA 4DNOA 5CEFA 4DE5A 2B61A 2C2MA 4CCAA 4JLJA 1NLYA 3I2HA 4RHCA 1XNGA 2ZE5A 3SP1A 4A0RA 3V4OA 2F43A 2FGKA 1RI5A 2IF0A 3CH5A 4K0RA 3OM1A 5E6SB 1WABA 4GM0A 5K3SA 3I8XA 5AW5A 1NVBA 5J47A 2CUNA 4Z54A 3KQNA 1OE0A 4FWIB 3IHTA 1EWQA 2PV0A 5DM0A 4RGVA 3HJAA 5K3OA 2NM0A 1KR2A 2OAGA 4R3NA 2QLBA 4TT8A 3T99A 3TIFA 3VO2A 2ZE8A 1W0CA 1ZGBA 3VPBA 1W88B 1J2JA 3AT1A 5BQ5A 3UKOA 5A3VA 3UWKA 3GRZA 3TB4A 1GA4A 2NW6A 3TZQA 4EJSB 4CI0B 2R1TB 1N7HA 3MTGA 2VK8A 3TEJA 1NVEA 5H4HA 4MW7A 1KYTA 5DWQA 1SCUA 5WRFA 4ZHQA 4ZK2A 2RDMA 1ZL0A 3AB7A 4EHNA 3LFTA 2XA1A 3W8NA 4B3TB 3WVNA 3O3OB 5ALJA 2R6CA 2O3UA 1P80A 4CMKA 1AS2A 2FW0A 4ZYUA 2RHJA 1YRYE 4MO9A 4D8XA 1S3IA 1BVUA 4PX5A 1BFKA 4MIOA 2ETVA 2O8DA 3K0CC 4GLJA 5B1SA 1NBWB 1YFKA 3OTQA 4MICA 4LFCB 4LDQA 3USES 3FDZB 1D07A 1FXWF 2Q9BA 3UAZA 3L4BA 2SCUB 1BXZA 1EH5A 5E1OA 1WKCA 1TRHA 1SOAA 5KJ1A 2G08A 2DWCA 3VPFA 4NMWA 1CVIA 3IFSA 4A23A 4EUHA 3ZHVA 4C6TB 3GQVA 5BW5A 1TQ8A 1ZHFA 3S68A 4DTIA 3H75A 5A9TA 4NLLA 3S40A 3DZFA 4G2NA 5TR9A 2QT1A 3KYIB 3RVNA 2NU7A 1I32A 2JHGA 1NRIA 2KHZA 3QOYA 1HMYA 3JQBA 2PKRA 4NYIR 1QQTA 4D92A 3FYDA 2YRFA 1GTSA 3CG4A 5LMCA 3R9IA 3W90A 2ATIA 3NAMA 4J16A 4DSAA 1WBDA 4FI3C 4GP6A 3HFRA 1P7WA 1V5IA 3GH1A 4B0PA 1J5XA 4E1BA 5JRJA 3DG9A 2WWHA 1QCDA 2JIZD 1C3OA 1K7CA 1DRKA 1TK3A 2Q9UA 4IF6A 4ERXA 5BWLA 1LBTA 4HJXA 4NXMB 2WT8A 2RBEA 1KK1A 3TLGA 3OKAA 4PCVA 4OXYA 1KI1A 1NUAA 1FXWA 1PT8A 2F2TA 1MO4A 2ASEA 2PT5A 1MH1A 3IA2A 4RD4A 1OXSC 4WCFC 4CCSA 2JG3A 2DFLA 4HZUB 4WRRA 5ALIA 3K4PA 4CV2A 1MHPA 4REMA 1U9ZA 5KUTA 1E7QA 3AILA 1OKKA 4HQOA 4MTLA 2BAGA 4RETA 1C3XA 5CFNA 5F7XA 2I71A 3COJA 1F2UB 2DCUA 2Z8ZA 4MWGA 3IE1A 4JWTA 3IMEA 1DDGA 2WA1A 3I73A 5BUZA 1MA3A 4JC5A 5J4KA 13PKA 3WMGA 2ZSDA 2QEQA 3NIWA 1MX3A 2P3OA 4LVUA 4RADA 4DQUA 4ZMBA 1FQWA 2NNLD 3IEKA 4LOHA 4KE9A 1DT3A 1R9MA 3L02A 3RHFA 3LUBA 2QOEA 4DT1A 1YAHA 1D2RA 1JG3A 1QF9A 1EDBA 3SXUA 3TIGA 5KHLB 3SVLA 3HSKA 2FP4B 2UU9B 4EMSA 3AGPA 5KSPA 4ZN6A 2EGUA 1QP8A 1RR6A 1NLUA 3AFIA 4M86A 1CXZA 4P7KA 3GLGA 4LYJA 4F46A 1QONA 4GEKA 2X4GA 5KS2A 5IABA 1W7AA 1EG7A 3B2QA 1OD6A 1C9EA 1ESCA 2OD7A 3GY0A 2GXQA 4CDMA 4CMHA 2G88A 3THSA 4PIMA 4YJ2B 3I45A 3GQBB 4OMDA 1RW4A 2M6RA 4EHFA 1J1ZA 4M0MA 3H2HA 1ZIPA 3O03A 1WWKA 1J8YF 3LKVA 4Q6WA 1MEEA 3A6DA 1PG2A 2NIPA 4ZCPA 3RADC 2QAGC 2Q07A 3COZA 1WBBA 1VPVA 4PN7A 5C51B 3VPXA 2F1OA 1YBHA 3ZS9A 1G55A 5CITA 2VTDA 2ZXEA 1YIDA 5DI9A 3WGTA 2H9YA 2W6QA 3KXDA 4UUPA 1YJCA 4G0ZA 4N0DA 4F96A 2HD4A 4M0EA 2A33A 4IH9A 4EABA 2A78A 1U9IC 4E11A 2H1SA 3SD7A 2ZS7A 5ALDA 4PNPA 3OFKA 3RYIB 5IANA 5KAPA 4RNDB 4RTJA 2IXBA 5BORA 1TAUA 2ZE7A 4GI7A 1WVMA 2OQIA 4ENRA 5ADHA 5LU8A 5T4HA 3VGPA 5BSWA 2MINB 4HDSA 2ORYA 4AYXA 1HRDA 3OCWA 5DLPA 2IEBA 4RZIA 3W8FA 4ESVA 1BDHA 3ZPXA 1TCVA 4TROA 4DB2A 2BI7A 2X77A 4BVEA 2ZYAA 2WYIA 4IS2A 4B6RA 4Z9BA 4C07A 3ILHA 4TKUA 3PE6A 1LLCA 1WPRA 4X5OA 1V16A 2D59A 3ZW7A 1DKNA 5DNCA 1L5ZA 3T7JA 3UH0A 4OFZA 4Q4LA 2J9GA 3U81A 1Z5PA 5AW2A 1NE2A 2B4YA 5DMXA 1DO8A 4UE2A 4DSZA 3KLOA 4CF7A 2HEGA 4I4NA 4QFCA 4BWYA 2X40A 2XVAA 2IIQA 2QRUA 1W0KA 3O8OB 3TTVA 4J0DA 4F4FA 3EVGA 3MGGA 2QJRA 4GBJA 1G5HA 1VKHA 1NXQA 2I29A 5IJ0A 2Z5FA 2JHCA 4DLBA 5HKKD 4MYTA 3N75A 4EO7A 2G70A 2GTPA 1TVEA 4TMZA 3K5HA 4JJFA 4EGJA 4MS4B 1PX2A 2R66A 4PVCA 4E4RA 2QX8A 1PZEA 1CY1A 1N0VC 1TX4B 1ZJYA 3J7AC 1H93A 1ORTA 1W4ZA 1M8PA 2VYVD 2VZEA 2CV1A 2DT5A 4QUGA 1IXZA 4H7DA 3BQNB 2KQUA 1RZ3A 3EUEA 2IPAB 5KNCD 3L77A 4Y9TA 3MBKA 5FR1A 3OU7A 4DZRA 1PEYA 3AQ4A 1ZAYA 2VUIB 2XGMA 1DTWB 2HAEA 1PWHA 3FHCB 2HJGA 3KYBA 3LKBA 2VQFB 1KMHB 4U02A 1Z0ZA 4LF4B 1THMA 2C2XA 1P2FA 2COUA 3BK1A 5K0NA 1ONBA 3K35A 1XN1A 3OP1A 4DNXA 1HTBA 1DUVG 4JNKA 2V6IA 1PD1A 2L19A 3GZJA 3PTZA 2G25A 4IG4A 3A27A 4NU0A 3IT0A 2VYNA 3R3HA 1EG2A 4GVLA 5DPMA 2GHIA 3SYTA 1T4GA 2RGGA 4LJ4A 3KOZA 4JY7A 1KZGB 4RK5A 2P2ZA 1G21A 1N6NA 2YQ4A 3IAUA 4ZPXA 2QLNA 5F2KA 3WQQA 2YVUA 5M3BA 5JQGA 4RE6A 2WG0A 1N0WA 1QFYA 3R6DA 5CT9A 1UPTA 5LQAA 3HE3A 4RBNA 4ARCA 5LXTF 1MB3A 1T9KA 1ZM4A 1P74A 3Q2IA 4UW9A 4D9KA 4GOMD 2GXSA 4RV5A 1J5PA 1R0CA 4IXTA 2IP4A 4W7SA 3BA1A 3ZU4A 3H2YA 2WU0A 2FG6C 2KYRA 3ZWVA 2A5FA 2GYWA 4IMPA 5CB8A 1ST3A 2HBYA 3FGOA 4DM3A 1KRHA 2GYYA 4D9JA 3KEMA 4BC0A 2OXTA 2XVZA 1BWRA 1T29A 2IBMA 4DPKA 3QBEA 4QVGA 4ZJYA 1RSZA 5K3EA 5LQJA 1W85B 1CIVA 1UPFA 1FTSA 1VLHA 1VL8A 2G17A 3CEJA 1O0CA 1PFUA 2XMRA 2PRZA 3O4FA 4Q7QA 1HGXA 2IZZA 2VWGA 4MUJA 4PS0A 5DV9A 2ZUUA 1T4BA 4R2JA 4I55F 4BATA 2NX2A 1QS0B 2ORED 3TZHA 3ZD9A 1GG5A 2YW9A 4RTMA 1GV1A 2PMDA 2Q5CA 4JOBA 5HDQA 1O6GA 1VDZA 5DXJA 3PXAA 2FFRA 3TUJC 3GLIA 1ABBA 3NYRA 2PGDA 4LXIA 3HWX1 4DYVA 1NNUA 2PXAA 4XYGA 5FI5A 5HKAA 3T94A 3U3MA 4Q4JA 3VZCA 2VSQA 5LXTA 4Z4QA 3WFIA 3TW4A 4XGNA 5CT5A 3OD5A 4XLTA 3WBJA 1SOVA 2ZWMA 1J20A 3HADA 3QOXA 3RJTA 3RF7A 4HDCA 3JZFA 1SQFA 1ZU5A 3KZMA 3QXSA 3WWDA 4DSUA 3CG0A 1R8SA 1E9EA 2H18A 2R84A 3HEBA 5TC4A 3UKJA 2RGWA 4PC2A 4XR4A 4MP8A 5B7NA 4Z0TA 2I6SA 2B6NA 4FZ5A 2K4MA 1X15A 5JLAA 4WUTA 3TQSA 5CFQA 1LVGA 1GZ5A 1MT0A 2DFKB 3V2HA 3SHQA 1GAQA 2HCTA 2CUKA 2XQKA 1L5RA 3I9V1 5JCOC 4CMEC 2GD6A 4QRIA 4NXNB 3C6BA 1SIUA 4TTAA 1UPCA 4I55A 3C8ZA 4Y1RB 1OBVA 4RHFA 1CE8A 2OCXA 4EUEA 4FZRA 2XUFA 4G1VA 1D9XA 4TWBA 3NGLA 1DC4A 4YTEA 4DMHA 1PZFA 1NVVQ 4KU4A 2O3JA 5CA1F 3RYFA 2CV2A 1N4AA 1OFTA 2C1ZA 2VF4X 3A3PA 3H3XA 3IT3A 4CKEA 4EM6A 5LQUA 2OV8A 2J45A 1ULTA 5HFNA 2EBWA 2ZSJA 3BMQA 4V2UA 4UM7A 1FU4A 4D9BA 2XB4A 5IDVA 3OEEA 4PTLA 4YEDA 4DWWA 2XTMA 2GAFA 1H65A 4JB2A 4UATA 4D5EA 1SZCA 3VR3D 1EGHA 2PCLA 2ZJ7A 3FNGA 3UJBA 1T24A 2AZMA 1E60A 5AK0A 4Z2AA 2QXYA 4G9BA 1DE0A 3L7OA 3ZXYA 1BCRA 2OZPA 2C5EA 4HB3A 1I8TA 4OSPA 1KTIA 2YN0A 1NG9A 3HJGA 4AKEA 1X3LA 2WWTA 2P9TA 1KWGA 1V11A 2OZKA 1XJ5A 2IYZA 2PAFA 1ATIA 1BQEA 2ZAYA 3NWPA 3OA0A 1Q0SA 4FQ7A 4DCGA 3RRYA 1PFWA 4RD2A 5JDCC 2GJ9A 3SCZA 4CN8A 4D96A 1EDZA 1OH8A 1TTTA 1DLIA 1A71A 2VT3A 4DIFA 1MRNA 5KSWB 2R8BA 3I04M 5BYKA 2NO6A 2Y3IA 3COVA 3PD1A 4IVPA 4D4IA 4NYMR 5KNDD 1R15A 3ZWDA 4FEAA 3N8IA 2XVXA 1Q0QA 4OD0A 3B48A 5FLKA 5LWQA 4RW0A 4C88A 1YR7A 4PNHA 1NF8A 3CLKA 2ADOA 4FNGA 4JX8A 3DDHA 3AM5A 1A9OA 1AY0A 2C9YA 2IKSA 3IQWA 2CVZA 1EINA 1KBOA 1EKXA 1YJXA 3E18A 3OHMA 5EKXA 5HUJA 2J3DA 2NXCA 4MGZR 3TNLA 1AVTA 4KMMA 1Z5WA 4ENPA 1V71A 3ZBQA 1H23A 5ITWA 5GJBA 1UFQA 2Z6VA 3HR8A 2GLUA 1FVOA 4I6JA 4A16A 4B6SA 1BMQA 4UOEA 1GZ6A 3AM3A 2ORVA 4BMZA 1US8A 2Q4BA 1XA0A 1Z37A 2BHLA 2O1EA 4P7GA 3ZHUA 4OLBA 2HHAA 2I4IA 3X1JA 1BNCA 3DF9A 4ZMSA 1Z39A 4WIAA 2JFVA 1V8DA 2PH1A 1LA2A 4E51A 1M2VB 5G4KB 1N36B 1U7OA 3R77A 5A7HA 1MDBA 3ZNPA 4NMXB 3M1AA 2TMKA 3MS7A 4UCFA 5AOCA 3L04A 2DR2A 2J87A 3S55A 5EUMA 1J1UA 2FSFA 4AG6A 5U9CA 1MNQA 4MV3A 3N1UA 1QO0A 1NMYA 1PLJA 1TQHA 2A5JA 1WULS 4F11A 4J0IA 5DP1A 3GUCA 4ZQHA 4V3BA 2ZIFA 4M9ZA 4BVJA 1KK0A 5DN6D 1F0KA 1W34A 2HSWA 2UZAA 2AFHA 3LHSA 5DWVA 2M2IA 4MKHA 1N3YA 3S8YA 2C4WA 2O8VA 3LFUA 4TL7A 3QKWA 4QLAA 1OA0A 4LHWA 1G20E 2FDXA 1YRLA 4RD3A 4MRNA 3T3HA 1DC7A 4UTRA 2B35A 2O52A 4BP8A 2DFTA 4ICIA 3STWA 1ZKMA 4FGSA 1OXVA 3JZIA 1Y9DA 2HHLA 3D6TB 1OT3A 1ORVA 2IUEA 3GRCA 3O26A 5IDXA 3O95A 2AZXA 4DC1A 2QB5A 2REXB 2GN4A 2NSJA 1HQKA 5JHGB 1TTPB 1VIMA 3KQWA 3PNVA 4AJ2A 2NO7A 2UXDB 3A06A 3V4PB 5CD1A 5FO0A 1W87A 3F1KA 4R9NA 4D41A 1P31A 2E21A 3B3GA 4M9SA 3JD1A 5TJHA 2AX3A 3C3YA 3DUWA 1VMAA 1E66A 2FPGB 3HMQA 2B69A 2N0SA 4E5YA 1O5IA 5B1DA 4DCUA 3NX4A 2LCFA 5JARA 2BI8A 4I19A 4UBIA 1A5ZA 2X0EA 2QTVA 3UWPA 5C7YA 2ZJ0A 3IURA 4US1R 2IYYA 2AOVA 3NH6A 2HWWA 1DAIA 3VZDA 1XP5A 2IF2A 4G23A 1JNXX 1Z0DA 1Z8HA 1VBFA 2BW0A 3DBRB 3G8YA 4M1WA 1T0JB 2HGZA 1HNNA 3M6IA 3PXUA 2B0JA 4M6WA 1QV9A 1MTOA 3P27A 4R9VA 4FT2A 3ZJ5A 3A4IA 3RVPA 1C30A 3I9OA 3AF1A 3PGA1 3O75A 1SHJA 2PGXA 4KPFC 4UCQA 2HJ9A 4ZZ0A 3FWZA 1P5HA 3BE6A 4ZCRA 5KDOA 3PNLA 1XVTA 4LOLA 8OHMA 3MG9A 4TWAA 3VJRA 1VL5A 4MAMA 1NV8A 3OQ1A 3QVVA 4WDRA 1H94A 4CF3A 2D7CA 1RLTA 4JBIA 1DC6A 4CM3A 4E12A 4HWPA 2JGRA 2WQZA 4G4GA 1NJGA 3GHYA 3N28A 2H11A 4BQQA 2YASA 4MV1A 3Q6NA 3HR7A 3NIDB 2B8NA 3KXLA 4IDPA 2ZYIA 5FV4A 3BM5A 3IR7A 3QVGB 3AVXA 4LJ7A 4GL2A 3EEYA 5IX8A 4PO3X 4HS4A 3KZ1E 5KC9A 1HFKA 4U7GA 1DWPA 1ENYA 2PTGA 4OLFA 2HPVA 4A82A 5LP6C 1PBNA 1DAEA 3EZXA 3E7XA 2C00A 4B7UA 5JJIA 2ZBGA 4UOQA 4EDHA 2SHKA 2NP7A 1NNLA 2P65A 4G89A 1JH9A 2YWEA 5NLLA 3ND6A 3P8ZA 3ZBUA 2GA8A 4BNYA 1GU7A 3UV7A 4YN3A 4RUKA 2JBAA 1YS7A 2XLCA 3ETLA 3LLMA 1A9QA 3KUXA 2VZ9A 3OPQA 3R3XA 4REQB 3W1EA 2ZGVA 4RA9B 4RIEA 3WYCA 4EVIA 4MV6A 4REOA 3HXKA 5AVWA 1X13A 2W2QA 1F4LA 3S8MA 4YDHB 4CVNA 1USKA 1FVHA 4I9GA 4KSYA 3E15A 2IZ7A 1II8A 2D54A 1NW3A 3D6UA 4QXMA 4BL5A 3S4YA 3IP3A 3ADOA 2ZB7A 3TSOA 3KQSA 4OHBA 3TIXB 1AMOA 4KBYA 1U94A 3MAJA 1T91A 1Y81A 2YIDA 1M66A 2WUDA 3IDOA 1LBHA 1G5FA 2QVGA 1KYZA 1Q14A 2CHGA 2K87A 2PO7A 3NNDA 3QLTA 4Q12A 4V39A 3H4IA 2FR1A 2OAQ1 1U11A 3AC0A 3HBLA 4HLQB 2FE4A 4FCWA 2RI1A 3B85A 3KFVA 4IIXA 3R23A 2P6NA 3CVVA 2E89A 4BGIA 2P68A 4KEAA 4JZYA 3OOJA 2GXUA 2I2BA 3WI7A 3M83A 3FKSA 2EWWA 3LUCA 2XCLA 4QM7A 1FDUA 2CDRA 4XZ3A 1W1IA 1V1RA 2AGVA 3HJFA 1TVKA 2D2IA 2YN2A 2A3NA 4WBSA 5CB4F 3I72A 1ADFA 2SKDA 3CNLA 3VPSA 4ENVA 4E15A 3A3KA 1ISHA 4RENA 1Y3DE 3PHIA 3QVOA 5REQB 2P9BA 1P9LA 3EK2A 3HO6A 3W7BA 2VYCA 4KWEA 5EXDA 1T9AA 2CHEA 2FHSA 4JC4A 2CZQA 3VH3A 5AYVA 4OA5A 2FQQA 3B7PA 1MXHA 1UWLA 1EUDA 3UJNA 1RJ9A 3T61A 5EQJB 1SUIA 5IF9A 3ILVA 1Z73A 2HQOA 5EIFA 4JP8A 3W78A 4ENUA 3TF5A 4HWTA 3SS8A 2DEUA 2A0KA 4ALJA 3HQ4O 2QW1A 2VP0A 4RE5A 3I32A 1LX7A 4LISA 4AZ0A 3WIVA 3P4YA 1BJTA 4IVQA 3WMEA 5LYJF 2HK9A</