3YASA

Hydroxynitrile lyase complexed with acetone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3yasA00
2VF2A 2VJBA 3BJMA 2BCEA 5CT8A 1C4XA 5ALUA 4BTLA 2H9YA 4QDUA 5FPPA 3VVLA 4A23A 4N5IX 3VVMA 1QGED 3BL8A 4ZV7A 2E3JA 3GFFA 3IDAA 5ALEA 3R3ZA 2FJPA 4G1FA 5EGNA 1CUYA 5EHNA 4OD0A 1R1DA 2PSHA 1ZI8A 1T4MA 3FCYA 3H2JA 1QONA 4G8DA 2X5XA 4BVLA 4X94A 2G63A 6YASA 2AXEA 5T4FA 1QTIA 4WY5A 2ACEA 5DNWA 1LBTA 2QZPA 5AKHA 4PV7A 4G9GA 4G4JA 5J3JA 2J4CA 3Q8WA 1RWQA 2OCIA 1FFAA 4K5QA 1Q84A 1H2XA 3I2GA 4X7BA 2XMQA 3I28A 4QNNA 4MWSA 1W1IA 2GBCA 2HA3A 4X92A 4EZIA 3WA6A 3OPMA 1EDEA 3OTQA 1QIMA 5AP9A 3AJAA 3AUKA 2XMBA 3NUZA 1UK7A 4MQMA 1CIJA 1Y7HA 4CFSA 1JFRA 3G0BA 3C6BA 2ZJ6A 1B6GA 2XUGA 1H23A 3TJMA 3DD5A 4PSUA 1QIKA 4FFWA 3CCBA 3K6KA 3O4GA 3WKAA 4KACA 5FKJA 2WFLA 1ZOIA 3VDXA 5CH5A 2EDAA 2XUOA 3MUOA 2XQIA 5K3BA 1R4ZA 1X2BA 5SYNA 4OCZA 2R11A 4AMZA 5AI8A 2JBWA 4ZRDA 4W1SA 1DX4A 3WMRA 1N1MA 5JZ9A 1CPYA 1TAHA 5CXXA 3DOIA 3I6YA 4Y2VA 3D4LA 2CUTA 2OAGA 3BF7A 2VT6A 2ZVDA 3QM1A 4AO7A 4BDSA 3WK7A 5AI4A 4M0EA 5ALIA 5KWIA 1XLVA 3O95A 1UZAA 3A2NA 1XZBA 1CUXA 5EIAA 1EK1A 1VE7A 5E4YA 2PL5A 2I3ZA 3FYUC 3F98A 4LYEA 3STUA 1UOQA 2BFNA 1VXRA 1XQVA 1QJ4A 1WB6A 2WFZA 3G8YA 4W1PA 4UBLA 2WHPA 3I1IA 2XUPA 2WIFA 4WCVA 4G8BA 3S8YA 5DWDA 4EUSA 1CQZA 1KU0A 3W04A 4B81A 5FDFA 1XQWA 3P2MA 5CH8A 4CCYB 3CXUA 1XZMA 1ETHA 3HLKA 5BV7A 2QXUA 1WPRA 4QDOA 5AIBA 5JADA 4CG2A 4WY8A 2X8BA 2PU7A 3I2HA 3FLAA 4FLMA 2WSLA 2OCKA 5FUMA 3WWDA 3QMWA 2C5FA 1UKAA 1MX9A 4BC0A 1VKHA 2JEYA 5CH3A 1K6EA 1XROA 3WYDA 3QITA 2O7RA 4DMCA 2RHWA 3WKDA 4FLFA 2RHTA 4CCWA 2QUBA 5C8XA 1HLGA 5I8PA 4E11A 4DNQA 1VA5A 3ZI7A 3H19A 4HXEB 3ZPXA 5AI6A 3C43A 2CJPA 3VISA 1A88A 1CV2A 1OCEA 3QBJA 1R9NA 1XRNA 4UFPA 2C58A 1IUOA 4QLOA 4DNFA 3D2BA 3H0CA 1IVYA 3AIKA 1GKLA 4NZZA 1TCAA 4AMYA 4INZA 3EF3A 3DJYA 2HADA 1EA5A 4GBGA 2DHCA 1RYYA 1U2EA 1D07A 4HRXA 5ALPA 4IH9A 5LKRA 4BZZA 4UBJA 4ETWA 1QIEA 2XMSA 5FRDA 4GI1A 1R50A 1EXWA 5LYYA 5AKIA 4U2BA 4AZ0A 1YB6A 1IZ8A 1JU3A 5HF6A 3PICA 5AM1A 2RIPA 3JYHA 2V96A 3PUHA 4BDTA 1GKKA 1GXSA 2XUQA 5LZ7A 2QRUA 2XMCA 1MU0A 5D6OA 1MX5A 1BEZA 3MGAA 4N8EA 1BCSA 3OG9A 1XRRA 5HK8A 3QVMA 4JNCA 3ICWA 3M83A 3LCRA 3F96A 4FFVA 4LHEA 3WQHA 1DQZA 5E2IA 4QEKA 3ZLUA 3G0IA 5BWCA 3WIBA 2HDWA 2WLSA 4Q05A 1UK6A 2RAUA 3HI4A 2C7BA 4E46A 5BOVA 3EBLA 5CMLA 3KWJA 3D2AA 3V1NA 4W63A 3OOSA 1GPLA 1XZGA 3ZV7A 5K3FA 2K2QB 4KYVA 4EY7A 1EB8A 3ED1A 2WUDA 2XB6A 1K4YA 1W76A 1AX9A 2ACKA 3C5WP 2QM0A 4H7HA 3C8DA 3O4HA 4RPCA 3GZJA 1ORVA 4Y2PA 2AJLI 2GBIA 4DGQA 3F67A 4ZGBA 1XKLA 2P8SA 1MPXA 1BN6A 4NS4A 2AJ8A 1G5FA 4EBBA 5ALOA 1R9MA 5ALNA 3O9VA 1CUEA 2Z5GA 1TQHA 1IZ7A 4BTVA 1JKMA 4G5XA 4Y2QA 4DNPA 3AZPA 4J0IA 1NX9A 3LIPA 1G42A 4KE9A 1FFBA 4B9EA 3WYNA 5DYYA 1YSCA 4X90A 3R3UA 3WL8A 2J3DA 4UBKA 5JIBA 2O2IA 1LPAB 4KR0A 1A7UA 4B7ZA 1RP1A 4FNMA 2XQFA 5JAOA 3BJRA 5EHZA 4WDRA 1Y7IA 4UBOA 4B83A 1GZ7A 2HFJA 5HKAA 4WFKA 1CUFA 1CUIA 3PUIA 1SCKA 4QA9A 1WB5A 1VZ2A 3PFBA 1SCIA 5LIPA 1T2NA 4XWGA 4W1RA 4ROTA 2H7XA 2WKWA 3WJ1A 2C5GA 2PSEA 4WFIA 4JUIA 2BKLA 4F5ZA 4C87A 1XQYA 5JATA 1O6FA 3ESDA 5ALQA 3EQ9A 1YR2A 1ISPA 1MNAA 3ZWQA 1ODSA 4BZWA 1THTA 1VE6A 4FWBA 1SC9A 2Z3WA 4BCCA 2C0QA 2XMRA 4BBZA 1W4LA 3WL5A 4PF1A 5CURA 5K3EA 1XZFA 1VA4A 4PQEA 4BCBA 3FYUA 2ZJ7A 4HRYA 1H2ZA 3TRDA 1G4HA 3UMJA 1GPKA 1JJBA 3L1IA 4U2FA 1U8EA 3WL7A 3M82A 3WK9A 5H3HA 4KRYA 5ALTA 4LXGA 5AM2A 3WJ2A 1CUVA 5EFZA 1UWCA 3WL6A 5HZGA 2VJDA 3HJUA 1NU6A 2Y2UA 2WUGA 3KXPA 3VKFA 3K2IA 1TKRA 5AICA 4H7DA 2DFPA 4D9JA 2ORYA 3FOBA 1AC5A 2DHEA 4ZV9A 3BWXA 4FTWA 1SCQA 2J3QA 2GYUA 1DT3A 2WIGA 3AIOA 1DU4A 3H17A 5JANA 1E8DA 2JGFA 1XRQA 4UBNA 5T4HA 5KREA 1K8QA 3FSGA 4QDXA 4BE9A 5C8ZA 4ZI5A 4MEBA 2XQKA 4X97A 2HL6A 1E89A 4BCDA 1XZIA 1YS1X 1MN6A 2WTMA 2B4KA 3RKSA 4J7AA 3FLBA 1UT6A 4Y2RA 5K3DA 3R3XA 3IUMA 2WM2A 3HC7A 2WU4A 1ACJA 1LZLA 4Q1VA 4KEAA 4P08A 2I3DA 3WIOA 1BE0A 2JGKA 2BGNA 2XE4A 3WK8A 3QMMA 4BVKA 1YAHA 2H7CA 4RE6A 4I4CA 2OG1A 1DWQA 2OAEA 4FKBA 5CT5A 1DWOA 5FXMA 1CUDA 3FYUB 4MQLA 2H7YA 4QZVA 3IB3A 1LLFA 5AHXA 2YYSA 4ZREA 2VAVA 3TGLA 1QTRA 5CT4A 3IA2A 1Y37A 3DYVA 2HA2A 3PF8A 4DMFA 5IVHA 2OGSA 4IQ4A 1TIBA 2NW6A 5DLPA 4UBMA 1QIDA 5D7BA 3G9XA 3DNMA 1HPLA 4J3JA 3H2HA 2XI4A 3EQ7A 5EIHA 3N2ZB 3R3WA 1ACLA 5LKAA 4CIBA 3ICVA 4AO6A 2HU7A 1DTEA 4N5HX 2C0PA 2BGRA 2QT9A 4W1QA 2V98A 3A2MA 3STTA 2G5PA 2JGMA 4BB0A 4GEGA 1IUPA 5CW2A 1ZD4A 2JGIA 1EX9A 1USWA 4NMWA 2OQIA 3HYSA 1WOMA 2PBLA 2EEPA 3W06A 3WK6A 4LXHA 2WIKA 5HQ3A 5AKYA 4BRSA 4RE5A 2PU5A 4K6GA 5ESRA 3C87A 3ESBA 5JYCA 4OB6A 3TEJA 1QLWA 1MX1A 3LP5A 2HIHA 2PM8A 3R3YA 3ZLVA 3WWEA 4HS9A 1E8NA 3I6MA 3BE8A 4QDZA 4TGLA 2OGZA 1P0MA 3O0DA 2WHQA 4OYYA 2WU3A 5JARA 1MJ5A 2PSDA 3EIOA 1N5MA 4H7IA 1WB4A 4DLNA 2XDWA 1E5TA 2HRQA 5EIEA 3C6YA 1X70A 4QWMA 5BWBA 3YASA 1UK8A 2Z8ZA 1JMYA 2HA6A 1KU6A 4Y2JA 1PJAA 1XZKA 4J0KA 4Y7DA 3QPAA 5DYTA 5AI5A 4X6XA 3WWCA 3B12A 2XMZA 4BP9A 1XZLA 1ODCA 1CVLA 2PX6A 4F21A 3OM8A 2WFLB 5JAUA 2B61A 2GZRA 4NVRA 2Y2VA 4RNCA 4B9AA 2RI6A 4B80A 1CFJA 3D59A 5IVIA 1FFDA 2QJWA 4AN1A 4P92A 4G4GA 4FOLA 1ZD3A 5C8VA 4B0OA 4F0JA 2WJ6A 2XUKA 4KRXA 2Y6VA 1BROA 4JYMA 3NWOA 4Y2XA 3JWEA 1MAHA 4MYDA 3V1MA 2XLCA 1N5RA 1YA4A 4C88A 4M0MA 4PSDA 4XVCA 2Y1KA 1ZIXA 1K5PA 3H2GA 4UHFA 5FV4A 2W22A 1ODTC 4MEAA 2Q0XA 1U4NA 1K63A 4J0DA 4L9AA 4BAZA 4HXFB 1BN7A 2I03A 4OB8A 1EDBA 2QKYA 3G9UA 2JGEA 1ZD2P 3F8SA 1XFDA 2WIJA 4FMPA 2WHPB 5KWJA 2BAGA 3I2IA 4DM7A 2B9VA 2BUBA 4Y2TA 1DX6A 5DTIA 5JD5A 3ESAA 2VSQA 1MNQA 2FX5A 2IITA 2PKYX 4ITVA 1QO9A 1MAAA 3U0VA 4AXBA 4PO3X 5CT9A 1WHTA 3D7RA 3LS2A 2WG0A 1CUUA 2WUFA 5DTJA 4Q34A 1EB9A 3CN7A 3QH4A 4AO8A 3C6XA 2ROQA 5HF5A 1LPMA 5JASA 4H7KA 4UHHA 3BIXA 1WPXA 3G7NA 5LZ9A 4XIIA 1BU8A 1J07A 4DSZA 1QE3A 2XUAA 3EQ8A 1R3DA 3WZLA 1R88A 4E14A 1QZ3A 2XMDA 5IVDA 3QMVA 4P9NA 2XQGA 3BXPA 4EA6A 1UFOA 4KJXA 1CUHA 3ANSA 4LXIA 4BAGA 5A2GA 1I6WA 3C70A 2V97A 3E3AA 5FP0A 1LPBB 3VJKA 3HACA 4H0CA 5DJ5A 3D5EA 1AKNA 1GGVA 2V9ZA 2O7VA 5ALWA 4HVTA 2RONA 3DL7A 3ESCA 1J2EA 5AKJA 2WHRA 1ZI9A 4B0PA 1JJFA 4U2CA 3CCCA 4KAFA 4K6HA 4UPDA 5C7YA 5ALVA 2UZ0A 2CKMA 1HBJA 2XT0A 4LYDA 1QIHA 5K3AA 1TK3A 5ALRA 1CR6A 3L1JA 5AKXA 3M81A 1L7QA 1BCRA 2AJBA 1XZHA 4ARBA 1Q0RA 1XZAA 5I9IA 2HRRA 5D3KA 1W6RA 2OGTA 2OXEA 2J4FA 4DSAA 5AO9A 3T4UA 2ZYSA 2HU8A 3N0TA 4B6GA 2X76A 2IIVA 4OSEA 2QJRA 2HFKA 2CBGA 5IKXA 3NOXA 4MJ3A 4WFJA 3F9CA 1QFMA 5LZ5A 4E15A 3DDUA 5AOAA 4UHCA 3H1AA 3AFIA 3KWFA 4Q3OA 5LZ4A 3G9ZA 5EI5A 1B41A 4FHZA 4W9RA 1JT2A 1EINA 3IUQA 3WWPA 3W9BA 3F97A 3WWOA 4CG3A 1EVQA 1XRPA 5JZBA 4C4ZA 2VTVA 3I1YA 4Y2UA 3O4JA 5ALYA 3IUNA 4L72A 5CBKA 1KEZA 1QIJA 5K3FB 2WILA 1U65A 3GBSA 5HF8A 5CXUA 2Y6UA 5ALXA 5ALFA 1XKTA 5KBYA 4Q3KA 3PE6A 3GUUA 4ARAA 3PF9A 2OLEA 4G4IA 3PFCA 3QPDA 4M0FA 4U2EA 4KAJA 4L3WA 2QTBA 2QXTA 1ZJ5A 2DHDA 4EHBA 4IO0A 1E66A 3PI6A 4C4XA 3C5VA 4FBLA 1ORWA 5AI0A 4KE8A 2VATA 4UBIA 3M3DA 2VQ6A 4GWLA 1A8QA 2ZYRA 1WHSA 2GBGA 1HDEA 3STXA 5AOCA 1JU4A 1LPOA 3G0CA 3Q0TA 3OC0A 2QOEA 2DR0A 5A62A 2ZJFA 4TPKA 4X85A 2QMQA 3X3HA 2JGLA 1YS2X 3E1GA 2JIDA 3NGMA 4BC1A 1EDDA 4H7EA 3C45A 3O9MA 4BYMA 1CEXA 5JAHA 4V2IA 1CRLA 1XQXA 2DQYA 3HSSA 1UOOA 2VJCA 5AJHA 4UUQA 4C4YA 1YCDA 1JMKC 2D5LA 2WTNA 4AN0A 4J0JA 2HU5A 3VJMA 1TCBA 3G9TA 1P0QA 3LIIA 3V9AA 4CIAA 4BVJA 4X91A 5K3CA 5F4ZA 3WA7A 3LLCA 5ISMA 1QIIA 1A8SA 3STWA 5ALLA 2PPLA 3DS8A 3BF8A 4J03A 1ZICA 5HFNA 3I2JA 5C81A 4O08A 4AX4A 2GBFA 4WDQA 1IUNA 3FSGD 4H7JA 1EI9A 4DMHA 3HEAA 1QFSA 3HXKA 4BP8A 1THGA 1W52X 3O4IA 2FUKA 5CTAA 3I2KA 1DWPA 1JJIA 1HKHA 3FAKA 2D0DA 3FNBA 4GXNA 1FJ2A 5JAPA 4ZWNA 3H18A 1WM1A 5ALSA 4KAAA 1A8UA 4YK7A 1YA8A 1CUCA 4CCYA 1YAJA 3K9BA 4XX1A 1O6GA 3DYIA 1XZJA 5AOBA 5AM3A 5CT6A 3HZOA 1JI3A 1MO2A 3V1LA 3DLTA 4X71A 4X6UA 3KDAA 1BS9A 3SK0A 4B85A 2BUAA 4BRZA 3W05A 4U2DA 2XUJA 2VJAA 4EY4A 1CUBA 5ALGA 2W6CX 4N8DA 2PSFA 3QPCA 3IULA 4ZXFA 3UUFA 1QIFA 4UFOA 4MWTA 1F0PA 5JALA 4A5SA 4QE3A 5AM5A 3FBWA 2Z3ZA 4JYPA 2YXPX 3T52A 1QO7A 4MYSA 2ZYHA 1WCYA 5A6VA 2VT7A 3IBTA 5AKGA 4C01A 1XZCA 2EDCA 3MVEA 4HZGA 3ILSA 5DNUA 4EY6A 3DKRA 1Q0ZA 1UKBA 1VLQA 3FCXA 2PUJA 1GQSA 3H2IA 2OCGA 5A7FA 4OB7A 3W9UA 4B84A 5ALMA 4F60A 2XUIA 4OYLA 4YPVA 1CUZA 3WK5A 2QVBA 5AM0A 1CUAA 2WFMA 2WQZA 4IH4A 3B5EA 4H7FA 3RK4A 1CUGA 1AGYA 1YASA 4DTCA 1EHYA 3G02A 1E8MA 2HHAA 5FOQA 2HA7A 3RLIA 3FLEA 4GDMA 4EB0A 5HCUA 4RGYA 2DCMA 3R0VA 2WIDA 3A6ZA 1ZD5A 3D2CA 2I78A 1G66A 1UK9A 2QS9A 3DOHA 3AIMA 1HQDA 1J1IA 1EH5A 1VXOA 1F0NA 1LZKA 4EY8A 1CUJA 5JD6A 2QR5A 1AURA 4DIUA 2C4HA 3D3NA 2ECFA 3D0KA 1ZJ4A 1ZGBA 3I6ZA 3IURA 1DQYA 3BDIA 1LPPA 1YB7A 5DYWA 5T4BA 5IVKA 5DNVA 2G5TA 1ZIYA 3DEAA 4J0HA 1XZDA 1SOMA 2WG1A 4K2AA 3ANTA 2ES4A 3FVRA 3OURA 1UXOA 4C89A 3H2KA 5LP1A 2CB9A 4N8SA 4G8CA 1VZ3A 3VXKA 4X3CA 2O2HA 4G9EA 1QOZA 4L0CA 2VAXA 2H1IA 1M33A 2BJHA 4DYHA 2DSNA 3IUJA 3VJLA 3R40A 2HA4A 2BUCA 1XLWA 3DKKA 1L7AA 4FBMA 2O2GA 5HQ3B 1PFQA 3HRHA 2ZYIA 3E4DA 5LLSA 4LKOA 3WI7A 1ZI6A 3IVMA 4Z49A 4OPMA 4Y9SA 4IH1A 3AILA 3V1KA 4UHDA 2PVSA 1QIGA 5LZ8A 1EK2A 7YASA 5I7UA 3QZUA 1F8UA 1C7IA 3KSRA 5AK5A 3DQZA 2IX9A 1LPSA 2LIPA 4Y2YA 1FFCA 1GPNA 2CEKA 3H1BA 1H2WA 4DMKA 5LZ2A 3A2LA 4HAIA 3I2FA 2OPHA 4XJVA 5AH0A 1AZWA 1UOPA 4YASA 2OCLA 5FLKA 1VOTA 4UHEA 3PDCA 1OILA 2CMFA 1N8SA 4QDTA 1OXMA 4S0XA 3W2TA 3GELA 4AB1A 2WJ3A 3A70A 1XRLA 2HM7A 3V48A 1IMJA 4K6KA 4B82A 1LGYA 4X6YA 3H04A 2R8BA 5AKKA 1EVEA 4GLBA 1VJ5A 3KOOA 4BE4A 5E4JA 1LPNA 4TVKA 4UHBA 1ZGCA 5CRIA 1FFEA 1TCCA 3C8HA 5AK3A 5HFAA 5AKLA 4FLEA 3ZLTA 4AZ3A 1AUOA 1CUSA 4X95A 2HA0A 1W75A 4H77A 4Q3LA 4BAUA 1NU8A 3RARA 5JD4A 4H18A 4IHAA 2WG2A 5A71A 5HKBA 1Q83A 5AIAA 1PV1A 3RM3A 5ALJA 1BRTA 3GROA 4KE7A 3STYA 4CI9A 3GA7A 1S8OA 4A16A 3KD2A 5T4EA 5SYMA 3R41A 3C6ZA 3WKEA 3U1TA 5HF9A 3WKCA 5FPQA 2G4LA 3STVA 1XZEA 4YX9A 2B20A 4GW3A 2WUEA 1GQRA 3BIWA 1TRHA 2Z8XA 1HL7A 3S2ZA 4OU5A 4PSCA 3QYJA 3G0DA 3L1HA 2XUDA 4Q82A 3AZQA 4U2GA 2XUFA 4Y2SA 1XLUA 3JW8A 1DT5A 2HA5A 3AZOA 1P0IA 2ONCA 5EHXA 3IIIA 4HXGA 4AQDA 2VA9A 2YH2A 5D3ZA 3FYTA 4CG1A 3AINA 4MXDA 2GZSA 5YASA 1BEEA 4KE6A 5K5EA 5AK4A 1Z68A 2PUHA 2ZSHA 2QUAA 4I3FA 5IH7A 3HABA 1CUWA 5AKEA 3DCNA 4X93A 2PSJA 4PW0A 4HTAA 1L7RA 5EHQA 1SFRA 1CQWA 3WKBA 1DINA 4UFNA 2GYVA 2DQZA 5E4TA 1E3QA 1FSSA 1XRMA 5ALHA 4OUKX 1J06A 1UKCA 2ZSIA 4PNZA 2AJDA 4QLAA 5AK6A 4I19A 3E0XA 1AQLA 4C6HA 4J0CA 5A7GA 4FDMA 1AMNA 1LBSA 3BDVA 4DNOA 4J0GA 1H2YA 4LIPD 5ALKA 5JZSA 3SWWA 2GYWA 4JH0A 1C7JA 1MTZA 4GECA 3FVTA 3DL4A 4X00A 1GT6A 3UUEA 1F6WA 4OU4A 2JF0A 4QWWA 2XQJA 3R3VA 4FNGA 5AI9A 3FWHA 3CN9A 2OQVA 2VEOA 2XLBA 1X2EA 4EY5A 2RGUA 3WLAA 2XMGA 3WK4A 2CZQA 3SX4A 1MT3A 2AJCA 3MUNA 3B3QA 4H35A 4WJLA 4BATA 4GHWA 1LNSA 2YASA 4JEIA 5HK9A 1P0PA 5AKZA 2JGJA 3G0GA 5ALZA 2JEZA 2FJ0A 2XUHA 1H22A 1CLEA 2WJ4A 5ALDA 5AM4A 5A7HA 4P93A 3WZMA 3SC2A
chains in the Genus database with same CATH superfamily
1P6UA 2VF2A 3AFMA 1I1QB 2FFJA 3IR6A 4DGSA 3BJMA 4TN5A 3PHGA 3HG7A 1V95A 1BA2A 2QP3A 5D3MB 1L4EA 3K9FC 4O1HA 4U5XA 2ZWPA 4QDUA 4N01A 2DE0X 1TIKA 3BWMA 5A4DA 3ZDCA 2EOAA 5DGIA 2VNIA 5FL7A 1PGQA 3BL8A 4H3VA 4UZFA 1KDOA 1KFKB 2BGTA 4LPKA 5H8WA 3BZUA 4MUIA 4G0WA 4OJMX 3BMQB 4ZVQA 4JI1B 1UP4A 4PC3A 3IVRA 1DAEA 3TR0A 3UUWA 2FW8A 3GNQA 1IAVA 2AEMA 2HC9A 3OT5A 5LMZA 1IG0A 1T5HX 3TDMA 4G1FA 3ZN2A 1GPWB 5JWOA 5EGNA 2YWDA 1ICIA 3SHFA 4RETA 2WJAA 1H42A 3DHYA 1Z25A 4PO8A 5FCDA 2RGGA 4JLUA 3U7RA 3UT6A 4CG0A 4I46A 3URMA 3WDMA 4DA6A 2IHYA 4QX6A 1SHKA 3LQYA 3OA0A 1IM5A 2PSHA 3VU1A 1V2HE 4HZUB 1QV9A 1E3TA 2VSOA 1AKQA 2IODA 1L7XA 3NHPA 3O1HB 4RY9A 3ZCRA 4DCGA 5L95A 3SHVA 4X66B 3U60B 4X24A 3DEKA 3H2JA 3WX0A 2FMUA 5F7OA 4M1MA 1Z0SA 2IQ5A 2VHYA 4WX2B 2IU0A 1MHPA 4ARUA 1IOWA 1FVXA 2X5NA 4KN8A 4DG5A 3IEUA 4ETNA 4LF7B 2VUIB 5T4FA 3OP4A 1SK9A 1QYDA 1QTIA 4JC8A 2CVQA 2O2EA 1RI1A 4QU8A 2O8CB 2ACEA 2OBLA 4HNAA 2QZPA 3BA1A 4YNBA 2FN7A 1C80A 5HZHA 3SJZA 1G60A 3S70A 2WMDA 1A5SB 1NXXA 2ZAMA 4Y1RA 4GI5A 2W6NA 4GU5A 4S1VA 5J3JA 3NHRA 4RPHA 1T9GR 3EGWA 4H4CA 3OPVA 3VR2D 4IRUB 3SFVA 4PHGA 3A9SA 3HU2A 4YP6A 5F5NA 1SQSA 1H2XA 3PGMA 2IXDA 2XXBA 4DC0A 1XBTA 3TW6A 4GPAA 3JQDA 1P5JA 4YJFA 4QNNA 2JJYA 2MYPA 5BN3B 4HQLA 1W1IA 1GR0A 1AKMA 1DKOA 3FPJA 4RZ3A 5B2FA 1I10A 2H4FA 2IHTA 1CJVC 2VCHA 4R71A 4BFCA 3EEIA 4X92A 1SOVA 5GVRA 4EZIA 1MDBA 2BHNA 1W1WA 3HJGA 2JGNA 3D3WB 3NDPA 2QYSA 1Q6ZA 4GAEA 3CWCA 5H83A 4CQMB 1WCXA 3OPMA 3OHSX 3ZV3A 2BKXA 4KDRA 1FMFA 1LI4A 3OTQA 1MFPA 1AHPA 1QIMA 5JXGA 5AP9A 4W5OA 1FYXA 3AUKA 4RPLA 5JU6A 1P18A 1GPDG 3GRKA 3NUZA 1CIJA 1Y7HA 2FFAA 4M83A 4CFSA 4D1YA 4RGQA 4DEYA 4I4LA 2OMKA 3GFVA 4CMJA 3C6BA 2PZBA 3F3MA 1S8AA 1XX6A 2FMTA 1B6GA 4EWLA 1OJLA 5D5QA 2J6HA 5DCLA 3RU7A 1T1RA 3QLJA 1H23A 4R51A 1RPTA 5I8ZA 2YXDA 1RYHA 2XOEA 4JUCA 3ROPA 2QG9A 2V7GA 1KWKA 2BHRA 3WIEA 4EELA 1V41E 2GD2A 1EGVB 5FX2A 1I6LA 1HG0A 4HAZA 4M7WA 4XJXA 1QJCA 3EGDB 2EDAA 2HK7A 3C7DB 3LQ1A 5LD2B 2NZ8A 2MWMA 2SCUA 4BMPB 2V8BA 3PNKA 4LZZA 3SSAA 2QYHA 4EHIA 3W6PA 3OE5A 1AHIA 1C2YA 4MS4B 4AMZA 1WXFA 2CLEB 5KHLB 2JBWA 4JNKA 2GTHA 4XASA 3T1HB 1OGYA 1A9QA 4L5AA 1UBRS 3L43A 5F64A 5DHUA 2J0SA 7REQA 5JZ9A 3FROA 3Q2KA 4L51A 2ZBRA 1M2JA 1J8VA 2ZT7A 3Q40A 5G0TA 3W5BA 4GKBA 4OXRA 3KR0A 1WW8A 4TRJA 5DOVA 3LGAA 3K31A 1T24A 4HLDA 5K99A 2GTIA 1DXOA 3D4LA 3KUUA 1UWKA 4U7HA 2XE6A 1LVHA 1XDGA 2AQKA 2I9PA 3DTYA 1AKTA 1V1JA 3DMYA 1D6NA 1JG1A 2OYRA 1PT9A 2CUTA 3PQCA 1J70A 2FKNA 2I55A 5ICSA 1TAQA 2B8EA 2DOKA 4S3MA 5AI4A 3IGFA 5FQNA 4W7SA 1NVDA 1KS2A 2IOHA 5TJHA 5BQ3A 5ALIA 1XA3A 3A6LA 2G80A 1HDOA 2GLXA 4O2LA 3I04M 3TLAA 1HTWA 3UMVA 4YCNA 1L4BA 1I24A 3A2NA 3UMGA 4OFZA 5EIAA 3RUFA 2IP1A 5D5HA 1EK1A 1K7FB 4PE5B 4DXHA 3IALA 3PDWA 4RD6A 3RHTA 2ZT8A 3DZDA 4LTDA 3W34A 3RADC 1UBHS 4WQMA 3FOZA 4ARZA 5IZCC 3STUA 3RWMB 7ADHA 3ZG6A 2AOXA 5G0WA 1QHXA 1VXRA 2BFNA 1M2KA 3KYCB 4UPVA 4B2PA 1SXIA 5KQPA 5FTWA 1SG0A 3J81k 4LJRA 1SQ6A 4XQCA 1Y9ZA 2OO3A 4IYJA 4UBLA 1YMVA 1E61A 1ZCJA 2GK4A 2IZ6A 3P9ZA 2WHPA 4G23A 4G26A 2D7CA 5U1PA 2MSCB 4ISBA 1HX7A 1MG0A 1QHHB 4H6PA 2GASA 1BXZA 3AVXA 2DVMA 1YS4A 5GM2A 4OI2A 5KTOA 3E9ZA 1GD1O 3QWIA 3HP4A 3DE0X 4B81A 2XTNA 3X2EA 1XQWA 1UADA 3P2MA 5F9MA 5CH8A 3SM3A 4U4AA 3VHQA 3WGTA 3GCDA 1S1MA 3F8WA 4I4NA 3VR6D 2ZATA 4H0NA 1JUDA 4ZANA 1IXKA 4CCYB 3LOUA 1IWOA 4PXSA 3U3ZA 4E5NA 4NJMB 2WU0A 1UZMA 1UPTA 4IEEA 4JEMA 4XQ0A 5BV7A 1D1TA 4ZOQI 2JHPA 5F73A 1GNTA 1PWXA 1S02A 1T9BA 4YROA 3DMNA 1NYTA 1SBHA 1SU7A 2FKAA 2B37A 4LYGA 2D1FA 3BGVA 5DK6A 2VJMA 1U2PA 1WV0A 3IIEA 3NZEA 2OXCA 1QE5A 1ZW1A 4RZ2A 5DT9A 5T41A 2R6HA 5JADA 3BD8A 2BI8A 3KG2A 4MUMA 4EW3A 1EFRA 4JT8A 1GLGA 1PQYA 2GXQA 1Y5LA 2Q1XA 3RQSA 4D82A 1R8YA 1G4AE 4LF8B 1ESEA 1D4AA 3P2OA 2QTZA 4J9VA 1C8BA 4RBNA 4DLZA 5K6TA 3AVUA 3JVVA 4FLMA 4YGXB 3TW0A 1ZLXA 2O3RA 2BMAA 2B7BA 4RVNA 1R6VA 3CX8A 3U40A 1FZTA 1Z34A 4Q19A 4MAFA 3IUPA 1XSEA 2NVBA 5KNBD 2HIAA 1Y1QA 3N2GA 1YBHA 3LXUX 5EP1A 1HXHA 4A9AA 1W2GA 4E2FA 2J5BA 2HWYA 3M2PA 5CH3A 3VO1A 4CLOB 2ZQ5A 1RAAA 4JI3B 1XROA 1R2QA 4ENPA 3AXSA 4FN4A 1GA6A 3FMFA 4WN9A 4MQUA 4DB2A 1CQIA 3CW2A 1BXGB 4OV6B 2P3LA 3C1OA 4UU7A 4EVQA 1U7UA 4XA8A 5C8XA 1HLGA 1PE0A 4GLOA 2QUJA 4M2LA 4RPIA 1JE0A 1JHUA 4E11A 5F76A 3PSHA 3E27A 1YHYA 5FEMA 3R2JA 2B1RA 3L5OA 5MN4A 3T7DA 1AKWA 4RTQA 2J0UA 4CM8B 4MEJA 1IZ9A 2JFYA 3CJRA 2R6ZA 5C5IA 4XQGA 3OLZA 4C0XA 5KTTA 1D6MA 1D9XA 3PJFA 1CV2A 3NTQA 3QLUC 3ZQ6A 4LTNA 1V7PC 1JQDA 2R7LA 2R79A 1XRNA 1YZGA 2COKA 1EVIA 3PQDA 4UFPA 5KOJA 5L53A 1ZRHA 5FBHA 2C58A 1QKIA 3OZDA 3PWKA 1J22A 4ARVA 1FX0A 4LYAA 3D2BA 3H0CA 1RZ3A 4JCOA 4BWVA 3IIJA 1P31A 3NYWA 1TCAA 3WYBA 3TZHA 3ZKWB 4BO0A 4EG0A 1PGJA 3B5JA 3FAZA 4G1VA 2I7CA 2AFHB 2NZ2A 2WNIA 3CLRC 5DNAA 2QUZA 1L4KA 4KQXA 1C9NA 4PCVA 4DLVA 1DKNA 1ID1A 2J41A 3W8RA 4LSZA 3RS8A 4JBXA 2IEBA 2X4IA 3DJYA 5G53C 1EA5A 4JI7B 5TV2A 5A4KA 3VTFA 1RYYA 3HQ4O 4UKDA 2AF3C 2AG8A 4F2DA 1KSFX 4BNYA 4NMHA 1C41A 5CDYA 3IJPA 1E2MA 2VXCA 3DZ8A 5EJ7A 3HMKA 2P9YA 1C7ZA 4UBJA 2VNKA 1PRYA 3KZCA 5CFNA 4QQRA 5KTYA 2E7ZA 4Q00A 3SCZA 3BWYA 3N2KA 4NFHA 4ZVUA 1Q6YA 2E85A 3UXEA 3HVRA 5AKIA 3D5TA 1XTUA 3BTUA 2Z2JA 1OFGA 4N0QA 4BMOB 4M0PA 3NHSA 5HF6A 4J43A 4MIKA 5B64A 2BL4A 4D3XA 3C74A 4FFPA 3GRZA 4QXMA 3NWEA 4UQOA 1OPRA 3I30X 5EN4A 3SYNA 4LC0A 4WXRA 1C9KA 2HF8A 4BDTA 2ZRDA 1BDBA 4QPJC 2PUAA 3KQYA 4MW6A 4B3TB 5NLLA 4LN1A 1V5IA 4BO8A 4HVLA 5F23A 2HRBA 1U9IA 3EEBA 5EQTA 1GXSA 4YC7A 5EPUA 1H6DA 1QLHA 2DC1A 2XUQA 3ZHQA 3BXXA 5HILA 2WSBA 3HCDA 2XMCA 3N59A 3QU7A 1DKMA 3UWSA 1OSNA 1XCOA 3ZV6A 2JK1A 2GX6A 4EKGA 2VJOA 3D6MA 4RJKA 2IKQA 4Y9UA 1BCSA 1Q17A 4KH1A 421PA 3OG9A 2PFGA 3FRJA 4G9BA 3RU9A 2O59A 1CJTC 1YIOA 1P3Y1 1M5RA 3CRZA 8GPBA 2K2WA 5DBGA 1UM9B 4XLTA 5HK8A 3B9RA 5DLDA 2IT1A 3T4EA 3TCNA 4OX9B 1AZSC 2UYCA 1H0KA 3KHKA 1US8A 5LB4A 2PYZA 1CNMA 1Z26A 1EK0A 1E4OA 4JNCA 4GZ3A 1X7ZB 1M0EA 4BMXA 2EW1A 1Q50A 4FQ7A 4LHEA 3WQHA 3M4JA 1IEVA 2CY0A 1XDSA 4LQDA 3QY0A 5E2IA 3I9MA 2PKRA 2AQIA 2BBOA 3TNYA 5K2OA 1P4HA 1ZC3A 2Q6KA 1YGYA 2GKSA 3J7TA 1T5DX 3OCUA 3HJNA 4YRGA 1LDMA 2O1XA 2HDWA 1FDSA 1Q19A 3DMFA 2C9YA 3PXDA 3LDHA 5JBQA 1UJCA 2G06A 3G5UA 1EFPA 3OE1A 5GOZA 1NBWB 4AUNA 5KC9A 3BH6A 4N48A 1ZYUA 3DWGA 3EZXA 4RV4A 3THYA 3E9RA 3DVRX 1Q15A 3FI9A 3FDXA 1E6LA 1MB9A 2E4WA 3ICPA 3RREA 2ECQA 1L7DA 2BTEA 5GVSA 5LSAA 2H6EA 3W1VA 4YAUA 1GPLA 2CZGA 1XCLA 2Q5HA 4IX1A 5K3FA 1ISMA 2ZI4A 2FSFA 2EBHX 5A04A 2I8AA 1XMJA 2XNCA 4Z9AA 4HQ6A 4Q4DA 1EMDA 1VCOA 1ZVKA 2C5AA 4TZTA 4BLUA 3FM9A 4AKIA 1G8YA 4CYMA 3E03A 2K6GA 2I67A 4DC9A 3DKVA 2EZUA 2FUNB 4H1TA 4DE5A 2HLDA 2QM0A 4KDFA 5J5VA 2R8RA 4LYFA 4BUCA 3PWZA 4NESA 4HAUA 3R6GA 3UT5B 4NCHA 1OFHA 1OFUA 3FWNA 3JRWA 2UYGA 1OJ7A 2AJLI 1WZ2A 4DPLA 3AB8A 1R6DA 4DGQA 3F67A 3VR3A 1U3VA 4KMOA 3KQWA 4YAEA 4ZGBA 2F67A 5F77A 2ZZNA 4PLZA 1Y89A 2OWDA 3CX4A 3C7AA 2O3UA 5I6DA 5GJBA 3MBIA 3PWTA 1DAGA 4KOAA 4P4SA 2W37A 2P5TB 2JCVA 2CXSA 1WOYA 4DUYB 2QDXA 3MINB 4HOYA 2GZ3A 1ZRSA 2AJ8A 3DV0A 1D1QA 4QOHA 4S1NA 5ALOA 5EERA 4HEHA 3NBZC 2H0QA 4IIVA 1CUEA 1UC4B 5HIIA 1DIHA 3ELDA 4GMHA 7AT1A 2KBEA 5I51A 3AP3A 3PNOA 1TQHA 3BN3A 3OT1A 1DEXA 1YQ9A 2IZ0A 1JKMA 4KPUA 3F5DA 3HDQA 3K5IA 5I5GA 1TC1A 3AZPA 3GDFA 3AGPA 1WL8A 2FSVC 4L5CA 3L4EA 5BMVF 2QN8A 2WJVA 3CW9A 3LIPA 1OX5A 1PFGA 1B3RA 2ZIVB 2EJTA 4NOKA 4V38A 4WK2B 1ZOSA 1W1UA 3B1KA 1XD2B 4LGYA 4B9EA 4B3MB 4KC0A 1MP0A 3MD0A 4UASA 4BJ5A 5DYYA 1KRXA 3OPXA 1YSCA 2C2YA 4GEKA 5TPWB 1HUQA 4C4OA 4X90A 2Q7DA 5B4TA 4NC9A 3PKZA 5BUZA 1JSCA 1XXLA 3I5YA 1XTZA 1TAUA 2AG1A 5JIBA 1ZGHA 1AOXA 2C9DA 2HQOA 2JI8A 4EDHA 3DMRA 1LPAB 4MUBA 4KR0A 5E9QA 3WGKA 3J80A 3EWSA 1GQOA 2FPLA 1Y8QB 5CG1A 4FNMA 3DV2A 2P3SA 1JG2A 2CNOA 3JWGA 2N3ZA 4U5QA 1FFHA 2YZGA 4R1UA 5LM3A 3KQOA 1HYHA 5K6AA 1YDFA 1JEDA 2FHSA 1F6BA 1ZXLA 3BJRA 4D9HA 5ITSA 1A8IA 3K9QO 4LOAA 4UBOA 4WW0A 1ZNWA 1TJ3A 5JSUA 1P2BA 3DC7A 1CCWA 4LW8A 1GZ7A 3DXZA 1G5HA 1Y3HA 3LNCA 3EASA 3SD7A 2HFJA 3U7HB 3H5IA 5LBTA 4YB8A 5LOVA 4WAUA 3T7SA 4JP8A 1FC0A 1JT9A 3OE7A 3RVDA 1YV9A 3MTAA 4G85A 2OA0A 3G2QA 2J0VA 1CUFA 3E9EA 3OPYA 4PC7A 3PUIA 1G8SA 1LJLA 4JP3A 4FDUA 1GKIA 3GJ3A 5P21A 4IZOA 3WDSA 1WB5A 5EOVA 5JDIC 2VWGA 2FXVA 2ZU0C 5DYIA 5EEGA 5H5JA 3BWDD 3LO8A 4BFZA 4C78A 4C2BA 3OFSA 1SCIA 4AX8A 1T2NA 1SCAA 5JD3A 1YCFA 4D41A 2VHVA 3IOCA 1XJQA 5F1OA 3G2MA 5FOWA 1GZ5A 1NI4B 4WH0A 1SCUA 4C4SA 2FF5A 4ROTA 4CUKA 1G20E 2Z0MA 4MNTA 4QAJA 4DAOA 2G83A 2HWKA 1X92A 5AFSA 1NONA 2HLNA 3MJDA 4TZKA 4J91A 2V54A 521PA 4ZT6A 3T5DA 3WRXC 4DT1B 2XCRB 1P0CA 3EVFA 4YRRA 1G3UA 1M2OA 2C5GA 4IQFA 3BSFA 5AJYA 1JG7A 4JUIA 5E6SA 5DLYA 2XRFA 4S05A 1ZHFA 2RHGB 3WGOA 3ZGNA 2Y27A 3MAGA 1ZX1A 3NHAA 4KWHA 1PR9A 4ZCSA 2QJOA 1S2DA 4PSKA 4W6ZA 4AZ3B 3EQ9A 3DVAB 4E7PA 1YR2A 1ISPA 3O5AA 3ZWQA 1C7RA 4EG1A 3AOGA 4XRRA 2OVFA 4BZWA 1VE6A 3GFOA 5CA0F 9LDBA 4QUHA 4UC0A 5DRYA 1Y42X 4EG8A 4AJHA 2YKGA 1GZ4A 1RXUA 3TKYA 4KN5A 3K0FB 1HT1E 1L4HA 4M9SA 4M53A 2RGRA 4X3PA 1NN5A 4CMGA 4EARA 3BEDA 2PL1A 3LVQE 1OLSB 3PC8A 5CURA 3IAXA 3KR1A 4MW7A 4PX3A 2FEPA 4ZJUA 5K3EA 2JG3A 1UP6A 1O95A 1EZ1A 2CMDA 5G2OA 4B44A 1VA4A 3A8TA 2BMVA 3B3AA 5EE5B 2JI7A 4JI5B 4LF6B 4XUEA 5BQFA 2UUPA 1XELA 2OENG 1SVKA 1N6RA 1OXBB 3LRTA 3M8KA 2H8GA 1OI7A 3A1NA 1FMCA 3GG9A 4UDXX 1V8PA 4WVFA 3WGIA 3O4FA 1P29A 1QZTA 1RBZA 3MA0A 4L7VA 3T94A 1YZTA 3UWMA 3ZS8A 3KQNA 2DPGA 4OFXA 3T3HA 2BDUA 1O6CA 2SKEA 4JZKA 2BR3A 2OFFA 5BMVA 3THWB 1CZLA 3OJWA 3QKTA 1H2ZA 2CNWA 4PGAA 1KJ9A 1IK6A 4LRYA 3C15C 3ZOKA 4WESB 1AMUA 1F2TA 2OCBA 3KKEA 2NADA 4O4JB 4U0KA 5A6SA 3V8VA 1GAEO 3CXRA 3PUWA 4KN6A 3WL7A 2CHUA 3M82A 4MLDA 3WK9A 2XHEA 1PZMA 4WNAB 4X1OA 3NONA 5AM2A 1EWRA 1MVOA 1T3GA 3WJ2A 5FUXA 1CUVA 2Z2IA 4MV3A 4A3SA 2BCGY 4DBVO 1BKSB 1A9XA 1XTIA 5CX4A 4N7RA 4L9RA 4R8KA 3T38A 3ZE6A 2JJ1D 3G5MA 5EKSA 1A76A 3E22A 3FGNA 4XDHA 3RF6A 3RHFA 2P9EA 2ZR0A 4R4JA 2Z95A 4ZVRA 1RCTE 1TM4E 4ME6A 5K0CA 4YY3B 4EW2A 1KBOA 1ABEA 3DZKA 1DLJA 4D9JA 4JXZA 1RRGA 4DMUB 2UU9B 4LZAA 4A8HA 4Z4HA 4MR9B 4QUAA 4F4IA 3M2TA 5CIQA 3BWXA 3QNMA 4ZV9A 4LSMA 4P86A 5LDHA 2B69A 1J8DA 3L7LA 1G7TA 1SCQA 1XI2A 3ZI0A 4RVUA 3TG8A 3GRVA 3DTVB 2GYUA 1DT3A 1O97C 2BFDA 3MQFA 3NWBA 4FU0A 4TM8A 3UG6A 1HDCA 2RHDA 1GITA 3KKOA 4UTVA 1VMKA 3NV9A 2AX4A 5E2BA 1DU4A 2CSUA 4CV1A 1D5CA 4C7XA 3SBOA 3H17A 1UKZA 2ZEJA 1U0FA 2Y4OA 4TSFD 2JGFA 4RK5A 2AN5A 2BWJA 1XRQA 4UBNA 1RQNA 4KQJA 3B3JA 5CGQB 2ATXA 3RRFA 1PUIA 1U2RA 3BFXA 3U4GA 4Y6OA 4EL5A 1F5SA 1LKZA 4E2XA 1OAOA 1UMDB 2W2NA 1OBOA 1VRVA 3S55A 1SCJA 4D92A 1D0SA 3PRJA 1U63A 4MMYB 5DRTA 2WMOB 3GLSA 1EUYA 1DHRA 5ITZB 2PVPA 4Q3AA 3U7QA 4IIUA 1Z7YA 4BE9A 1C7FA 2I33A 3G9QA 3OIGA 1VPWA 2C07A 1H5UA 2G67A 2NVUB 4MEBA 1P7VA 2HL6A 2LGJA 1P2TA 3I04A 1SCUB 1XZIA 3PXBA 2ZRMA 5KDLA 4PZCA 1RQ7A 4LHYA 4MI1A 2QQEA 3IEXA 2GEBA 3EIHA 2C9CA 4C05A 2COUA 4FGKA 1QGYA 5A3RA 5CD9A 1JDBB 3G82C 3VR5D 2YWHA 4FR5A 2R6FA 4Q01A 1RM4A 3AQIA 4LRWA 5K8IA 2Q1UA 2KQUA 4B7XA 3CSDA 2NQ2C 4BNMA 3E70C 1AXEA 3GGSA 3RC7A 1AK2A 1A5ZA 1EEXB 1NFRA 2WZQA 4PBRA 5IN5A 2PX0A 5CA0A 3HXTA 1TW3A 4L5YA 4M7PA 2BEWA 3PLRA 3UMYA 4G4SP 1ACJA 1XDDA 1RFLA 1EJBA 2I3GA 3LHSA 2I2XB 3RKRA 1L8OA 4P08A 4M87A 5J4KA 2A0KA 1VJCA 2VBIA 3A6GA 3AERA 2Q4DA 3T35A 1DKPA 4NYJR 4RKFA 5GGXA 2JGKA 1UJ6A 2BHLA 1ZUHA 2FSSA 4WOCA 5E38A 2AWNA 1WSWA 4LCBA 4XOIA 1HR0B 2H7CA 1WETA 4X1YA 1WB9A 2WVAA 4YV7A 1L8LA 1VMDA 2BF7A 3EW7A 2X0RA 4K8RB 3RAPR 3ZTYA 1J2TA 4E03A 4FKBA 1C2TA 4KXXA 4XD7D 1CUDA 2J6BA 3MJVA 4MQLA 3KL2A 2ATIA 2PZ8A 1U9ZA 3OZIA 3QXCA 2BEUB 5TQ0B 4AJIA 3QV1A 1W4AA 3IB3A 3MT8A 3O8LA 3PYMA 1P9OA 1M6VB 3ZE1B 5K8UA 5AHXA 1P0FA 5MGNA 3F8TA 1QG4A 2YYSA 4MI6A 3PK0A 1G21A 1YFKA 2ZBDA 1SH7A 4LOJA 4ZREA 2C4NA 3T7AA 1EVZA 3PC4A 4CETA 1YOVA 4FUTA 3TGLA 1QTRA 5TMDA 1G20A 1XMPA 5EG5A 3OMLA 4INJA 1EGAA 2GETA 2O05A 1P1CA 3L1UA 3CZMA 2JFPA 4RMGA 4Y9DA 1OXTA 4Y98A 3VKGA 1F20A 2LR0A 1D3AA 2D7DA 2DFLA 1K88A 2I5PO 2W58A 2W00A 4PGGA 1Q7TA 4MGHA 3GYBA 1PZFA 3PEEA 4QU0A 5F7JA 2MSDB 3KZ1E 3MT0A 3ZH9B 1T9KA 1M74A 3M70A 2FFBA 4HDKA 1MJHA 4L57A 5EAIA 2FFHA 4TYYA 1QFXA 1X94A 3DNMA 4D2IA 4URVR 5F98A 5D1HA 4FDAA 4J3JA 2G9VA 3GK3A 4NH4A 4Q16A 3H2HA 2XI4A 5JYBA 5LU8A 5BVHB 4EUNA 4D02A 3AR5A 4UAVA 1Y3FE 3RFVA 5JS7A 3OJCA 4FYJA 5B4UA 1Z5OA 1SY7A 3N2ZB 5IASA 2AEFA 2PGJA 3PL5A 4DPMA 3EFEA 1WLYA 4TWRA 1RRPA 5FORA 1L5HA 4CIBA 5HDBB 1KC3A 1A5AB 1G1AA 3RWOA 3QJGA 4Q9JA 3WLTA 2IXEA 1GPYA 5C3UA 2KI5A 2R5WA 1A5TA 1KC1A 4R83A 1E96A 5U4XA 4J8PA 4O33A 3T0FA 4CQNA 3UF0A 3K9HA 4DYDA 1ISHA 2CLLB 3EVNA 3O8QB 3WRWA 1M7HA 2IYOA 2OILA 1AVTA 1IPHA 4L8YA 4DCSA 2RGNA 1QX3A 2FEWB 2LW7A 2QRMA 4BO2A 1XTKA 2HEGA 3A2MA 1P6QA 2PANA 2FR8A 3OEYA 4NFLA 1YQWA 4QIHA 5ENZA 3STTA 4DYVA 4YJ2B 3HLYA 2JFWA 3F6EX 4DDHA 2O3SA 1DHTA 3UY4A 3PNPA 5HTOA 4I08A 4KWCA 1EX9A 1UXIA 1RU3A 3E8SA 1NUUA 3MWJA 3QOWA 5EZ5A 3UAXA 3B3GA 1NJ2A 1SULA 3QF4A 3V32A 5REQA 5JEDA 4PAWA 2OGUA 1L7EA 4PHCA 2PBLA 2RHHA 3W06A 3R9XA 2Q3EA 1L4LA 3QU9A 2CLHB 4LXHA 1FU4A 3ZE8A 4R2HA 3VVBA 1UDWA 4D8XA 1JDSA 2DY0A 3G5AA 1VKNA 4EZEA 2B94A 4DCVA 5AYVA 4Z4GA 1WMAA 2BFFA 1JLLA 4IXWA 4OLFA 3T0IA 1YJ8A 1ABFA 2GEVA 3HDYA 3DEJA 4K6GA 4Y6QA 3D5QA 3MF4A 3C87A 3O1LA 4O3FA 3O38A 1KYQA 1QF7A 5JYCA 2JGRA 4LXUA 3VO9A 3NM4A 4TV8B 2QAJA 1OZ0A 1KYIA 1ZCZA 2CXQA 2NPOA 1ACMA 2X7XA 3GEIA 3ISTA 4HB4A 3NW9A 2QTTA 4MUYA 3V1TC 3UKJA 3TLKA 1KOJA 4JY7A 4ND6A 4D81A 1XK6A 2BHTA 3F7OA 4QJIA 3N0XA 3PCXA 3MOIA 2B5OA 4NE2A 4C22A 2VHJA 3BE8A 2VPXA 2OTCA 1J20A 3LUCA 2VDWB 3EIWA 4S0ZA 2HUNA 3ESQA 5T8KA 5DK4A 1YNSA 3D7SA 4UAGA 4S2EA 1LW6E 1QOQB 2WU3A 5JWHA 1DIBA 3SZMA 3ONNA 4RHTA 2PSDA 4M1YA 4XGRA 5MDHA 1T8WA 5KX5B 3GEHA 1PEDA 3I8OA 2XAUA 5F52A 4DLNA 1UFVA 3U9SA 4F92B 4M8KA 1KQ3A 3QLTA 1X70A 4ESEA 5EIEA 4I1OA 1TF2A 2YVKA 3F90A 2V7VA 1YJCA 2HBYA 5EKTA 4DAEA 3WBJA 3B6EA 5IUJC 4PG5A 4JOQA 1TVEA 2Z8ZA 3EDOA 5JAIA 1O96B 1P5FA 3ASUA 1L1RA 2ZT5A 3ZLJA 1Y1PA 2YMLA 1E4EB 3BCSA 5KNBA 1XRSB 3DDZX 3PYXA 1FNSA 5GIOE 3TTTA 4JROA 1W34A 4U0JA 1V7QA 4I8IA 4QNMA 2HI0A 1XVAA 4PLCA 2LTAA 3DB1A 4Q15A 2B7LA 3H4MA 3OCCA 3KVNA 3IUSA 3UJHA 4D9IA 3FHTA 1IFXA 4BLSA 1H1LA 1XZLA 1WQ3A 4OM7A 3ZH2A 4TZ0A 2Q3MA 2VYND 2X2EA 3SOZA 1U6KA 5I4IA 1T5IA 1Q77A 4ZC1A 3P0IA 3OM8A 1IOLA 4U7TB 4Y7CA 2ZSKA 3AEUB 4MVJM 4AULA 5JAUA 2B61A 4ZKDA 3AIIA 3RAJA 4GZ5A 1R5JA 5IANA 4NEHB 2EYQA 2OV2A 1DOHA 2Y77A 4M9XA 3RF7A 4GFDA 1DNPA 5KYVA 2RI6A 4C0WA 2ZXEA 4CVNA 4IJQA 3VDMA 1G2QA 5F1KA 2ZJBA 3FOFC 2P67A 4IKOA 2C7RA 3L7DA 3A6DA 2BLNA 5HGXA 3SKVA 2IDZA 1WX1A 4G89A 3NOOA 4XX0B 2YC2C 5GP1A 2FUG6 2NO5A 3MPOA 4AN1A 5A3QA 2V7WA 5LUBA 1ZD3A 5KWVA 1E2KA 3HGQA 5THKA 4XUGB 4B0OA 3IHLA 4F0JA 3UYLA 1NQTA 4JVLA 2XUKA 2V74B 2ZR9A 3WG9A 3AGQA 4WBNF 4D6XA 3NWOA 3TQCA 4ZDJA 2EL7A 4HEA1 2RHJA 4BP1A 1U2SA 1ECLA 4FGLA 3C3WA 1RKQA 3V1MA 5AW5A 2VH1A 4F11A 2NU6A 1RRMA 2XLCA 1WV1A 4FFOA 1VSUA 4CM3A 1NVKA 3IEMA 4TYMA 3T95A 3AV0B 4HWGA 2QPOA 4GPTA 1Y9JA 3S29A 1GRVA 4F4DA 5B6JA 1VPEA 2EHDA 4NZPA 4WSOA 4C03A 4XVCA 4YMWA 1NFQA 5AVQA 2H18A 3A25A 1MRZA 4MJLA 2X23A 3SXUA 1HYQA 1Z5GA 2E21A 2W22A 4MEAA 1VJ0A 1L7MA 5INTA 1CKEA 1HE4A 3NMUF 1Y81A 3ZHTA 2WWVD 3W2FA 3EZ2A 5KYGA 1U4NA 1EBBA 1W87A 2ZYVX 5IJ0B 2XRYA 4J0DA 3UTDA 2B1QA 3W5VA 5IWAB 1T5SA 1PJRA 3DTTA 3DLBA 5JCOA 1EDBA 1XYVA 1MRNA 3G9UA 4AICA 5IKEA 2PD6A 3A1DA 2W70A 3E23A 3OFVA 4TN1A 3E5MA 4AD8A 1SBIA 1ULSA 3DWFA 4KXUA 1GZVA 1NJ5A 1UJNA 1DX9A 3U44A 4WRRA 1I3MA 3THOA 3IAS1 2P8JA 1X77A 3N7AA 3HVJA 1E63A 1M10A 4DM7A 1GTRA 1S0UA 4Y2TA 3RFUA 1DX6A 3RROA 3GH1A 3QOFA 4IV8A 3N2YA 2FP4A 1K89A 2XWQA 3AUUA 4UNIA 3U4AA 4DDWA 2D5IA 5GINE 2XKAA 2FX5A 4ILKA 1AMOA 1E5DA 1PWZA 1C3XA 1QO9A 3QEMB 5H3CA 1MAAA 4AROA 1ONNA 2XODA 4I4TB 5CDTA 3EC7A 5KKAA 4AZTA 3KAJA 1IDN1 1FMJA 4AXBA 3REGA 5I9NA 2YNMD 4P34A 3SJBA 4Z4FA 4IEIA 1N9ZA 2GEFA 1K5GA 5AVRA 5IX8A 3FR7A 1CUUA 1FTQA 2QBYB 2WUFA 4Q4JB 4PAGA 3K0HA 1TUIA 2C57A 4XYBA 2OP1A 3CN7A 3NPMA 2SKDA 3ZW8A 2A35A 4ZHQF 4MWCA 1YRAA 3LNTA 2V55B 4LX0A 4RV9A 4CKEA 2AEEA 3QLEA 5EIBD 3WLOA 3V3KA 2ROQA 2AHOA 5DBOA 3GFPA 1SUAA 2TMGA 3WMGA 4D0SA 3GQBA 3OLCX 4R98A 2QRLA 5AESA 1U90A 1WPXA 3MJ4A 2YN0A 3A05A 4WADA 5LZ9A 1YIAA 2A0YA 2L0XA 2P6MA 4NCKA 1QVWA 2J7KA 2OHXA 2PY6A 3H8VA 3HWSA 4GYWA 4J2OA 1GQFA 1KQFA 3H0EA 1XO1A 3VO8A 5T7BA 3L0OA 4RULA 1JYFA 10MHA 2XMDA 1NLZA 5IVDA 3QMVA 3ZDAA 1Z8DA 2E6UX 1GM5A 1SXHA 4P9NA 1GJRA 2NO0A 1TMOA 1P6XA 3BXPA 4WCFB 4KJXA 4F2GA 2G1PA 1CY0A 3ANSA 1BH2A 3JQAB 3JV7A 4TMVA 3V9PA 4QYTA 3K32A 2V97A 3SLRA 1NMQA 5CVVA 1IY2A 4I81A 4F3KA 3EZYA 1JIKA 5KJ6A 4HR7A 2C7PA 2LDXA 4EA9A 3Q5DA 4EPTA 1KKLA 2WHEA 2Z8YM 4OJQA 2I8LA 4TKUA 3WJAA 4EMBA 3ETEA 3KDSE 4KI7A 4EFKA 4V1CA 2ZTLA 5DHRA 3VTZA 2GPAA 1TM7E 4P5DA 3Q5GA 4NZ9A 4ECEA 2ERCA 3GP8A 2J09A 3M1AA 2ID4A 4L85A 3QVTA 1JA9A 2Y1GA 3QW2A 2HAEA 4HDNA 5LP6C 3TQQA 3WSTA 3ZZ1A 3G5TA 4IVPA 2VJPA 4Y1EA 1XOIA 2KHZA 4FCWA 5E1OA 3SYKA 1ZINA 4WBNA 1MEJA 1O77A 5E7JA 3DL7A 1KEEB 1Z88A 2CF6A 4UXJA 1J2EA 3ND5A 4H31A 3EXIA 2DG2A 3B48A 4G1EB 5EUQB 4Z8XA 1ECPA 1MORA 5CEJA 3VC7A 4GLFA 1PT5A 2X3UA 5ES4B 2P40A 3EQ6A 4HEQA 4GPBA 4ZC8A 2FMHA 1LY1A 4ENSA 4YWHA 1NNEA 1BYIA 2Y4NA 4U2CA 3WFZA 1Q3TA 3CIFA 3CCCA 4K6HA 4UPDA 3EC1A 4EYKA 5FPTA 3AKCA 4NAHA 3WJ7A 1CQJA 3HJHA 4UQPA 2W6IA 3FWYA 3G5LA 4I9FA 2CKMA 3L7YA 1JZSA 1LSOA 2P2LA 3KYBA 4TMFA 1HBJA 1UBKS 1AQ6A 2O3JA 4OI1A 4YXFA 5IJ9A 2QX7A 2XT0A 1DG1G 3P32A 1P61B 4OKSA 2G9ZA 1DJNA 4I6EA 2JHAA 3CBGA 1U1EA 1YUBA 3EYAA 4LYDA 5DI3A 3Q3VA 5A03A 3EGIA 4HSEA 3VR0A 1O5OA 3NX4A 2G8LA 4IJ6A 5ALRA 1ZOLA 1T2DA 2ZBQA 4C43A 1RYNA 2FPMA 2RKBA 3L1JA 4IJUA 4JJ8A 4PANA 3L4JA 3QA3E 2D5BA 2X0JA 3RBAA 3CZ9A 5DASA 5AKXA 4YUVA 3WR5A 4X1KB 4MRNA 1EE2A 3CUSA 5FNZA 3GMIA 4YUAA 5FBQB 1BCRA 5EYPB 3KZVA 1OPXA 5AUPB 2R7KA 1JJVA 2VP5A 2WABA 5I9IA 2YJGA 1EK5A 1W6RA 2OGTA 2P27A 3E2MA 2OXEA 4MQFB 5B3JC 1KWGA 1T6BY 2JLAA 2RHLA 3OOEA 3GFGA 1FP6A 5EWLA 1D2GA 1A72A 3GJ5A 3NDBB 3KLNA 4QJ3A 2V6GA 4FE7A 2PRSA 1DZIA 1DEKA 4HHEA 5AJUA 1RJGA 3QKSA 1TM1E 1F14A 3S2GA 1GNPA 3TPZA 4C3VA 3H86A 1LRLA 2JAWA 4QXPA 3SE0A 3DE7X 2FP4B 4NU5A 2G72A 5KU7A 1E0JA 5DTRA 4HUQA 2X76A 4CEJA 1XPOA 1J9GA 3S28A 1R37A 2Y8EA 2HFKA 1NP3A 3UKDA 2BRUA 1L7VC 2HO4A 1RNLA 2NVOA 3PA8A 2EF0A 1X7YB 4RDCA 2ODTX 1DBSA 1CDDA 4RL6A 2DR2A 1VJGA 4FYHA 2NUPB 4MX8A 2C42A 3Q7RA 1TIPA 4NFSA 4OXYA 3E48A 2RGYA 4KBGA 1FSPA 3D3QA 4LMRA 3IV7A 3KWFA 4BVEA 3G9ZA 4EA7A 4W99A 3VU3A 4J1TC 5F5LA 1ODKA 1K8XB 2X5KO 4BMNA 2AZ4A 2MYTA 1JT2A 1E3SA 2N1BA 2V0CA 1NVFA 3DDWA 3N8IA 4WK6A 3CR3C 4X41A 2AEJA 5LQCA 3ONFA 2ZJ3A 3W9BA 4KLZA 1GSAA 3F97A 4J4BA 5FFFA 1Z7WA 1GRCA 4Q12A 4DSNA 3WWOA 1IBCA 4L6IA 1Q91A 3AY0A 3ZY6A 1W9HA 2CVPA 4A27A 1I7QB 1HDRA 1XRPA 4ZVTA 3R5HA 2FQXA 1E60A 5CA1A 4XYGA 3RVBA 4DLXA 3I1YA 4UXIA 3O4JA 4ENTA 3BSWA 3UHAA 4TVSA 1Z2EA 3P2YA 1NNLA 3TNLA 3AKZA 3RI3A 5J1TB 3ZE0B 3A9UA 4EG3A 5F78A 3PEVA 1CBUA 1MCZA 2ODWA 1SR8A 3L1VA 3NH6A 4NMMA 3L7NA 4DLPA 3K8OE 3OQMA 3DAFA 5KSWB 4RQTA 2DKFA 2VPYA 3KTAA 1RHUA 3OZGA 1QB8A 2GHRA 2MMGA 3GFBA 4N12A 4OYHA 2FB9A 1XKTA 3SF8A 1MW8X 5CB0A 4B3JA 4MVJE 9GPBA 3HCAA 1X0XA 1WZEA 2VIIA 3FKJA 3H83A 4D6PA 4DA9A 1I5RA 3EG9A 1IVNA 1DDOA 4NR0A 3NO4A 3BQ9A 4ARAA 1RWBA 4LX8A 5A02A 4RDXA 4UQLA 3ECCA 3EWNA 4OHBA 4BIIA 3QPDA 4FYPA 2HPAA 2ZUTA 5EE0A 5B1YA 4M8LA 3U26A 2JB9A 2JFGA 3W5IA 5B1IA 4L3WA 4RZQA 4X6LA 3E61A 2QXTA 3WNDA 1J0AA 3K8QA 1QDEA 1FDIA 2Q5LA 1N3LA 3BHIA 4XPIB 1F8FA 1X1AA 1NR7A 3ZWWA 2A30A 4X20A 5L45A 3HZHA 4QGAA 3ZD8A 3LRXA 3PI6A 1Z4QA 2Q1YA 4PM4A 2D4HA 1CQJB 1ORWA 3DZJA 5DMXA 3S99A 4Z7JA 2FK8A 3VRHA 4UBIA 1MEEA 3JQQA 4L74A 1BYUA 1U98A 2PO5A 2JIOA 1U7WA 2I22A 3NT2A 1JEEA 1A8QA 1IY9A 1T8YA 2YOHA 3IXLA 1T9GS 1BAPA 1RYFA 2ZYRA 3NRBA 5HKLA 4F86A 1C5KA 3CZPA 1E7SA 4ENUA 3FYSA 2QT1A 4G0YA 4AZWA 3N8GA 1KOGA 4B7UA 2FWRA 2RHBA 2M6LA 2OYCA 2C4UA 4MCAA 1QAQA 1A96A 3BL5A 4IXMA 4EI8A 1E7MA 5HA5A 2O14A 4C4RA 3NFRA 5B3LA 2CLKB 4PQGA 5C8DA 5JZVA 1B16A 1PP4A 3G0CA 1AXRA 5J63A 4F6LA 1WG8A 2JJ1A 5DM4A 3TR6A 2QM8A 2QOEA 2DR0A 3CPSA 1A82A 4GIBA 4HG2A 5A62A 5HM6A 4CU5A 5TXGA 5FI1B 3BIFA 2GFQA 4G36A 4U3JA 5L3QB 1IQ0A 5LVAA 3LCJA 3QVGA 3TPCA 2ODQA 3PJRA 1PFVA 3UCXA 3ETLA 3KU4A 5JO0A 3WGZA 1N2BA 5F5XA 5JJIA 3HB7A 1Z0FA 2JIDA 4COOA 5I9SA 3IO3A 4H7EA 4X7PA 3C45A 2ERYA 3O9MA 1CEXA 2O8NA 3JVDA 3QKSB 2C9MA 3EVDA 1NJFA 3PNQA 4A0HA 1XVIA 3AFNA 1HA3A 3S2IA 4WVLA 3IQXA 5K20A 5AD1A 1V16A 2QTVB 4UUQA 2RI1A 1GCAA 1OIXA 3G6WA 2C5EA 3JD1A 4TSFA 3A1SA 3DMGA 3W7AA 5H4GA 4AN0A 3D6NB 3AR8A 4FZ3A 5DNDA 4B7AA 2HBZA 2Q29A 1G6HA 1QO0A 2HU5A 2Z08A 3CFYA 4IDGA 5TT0A 1T2CA 3VJMA 3OZWA 1EIWA 3HL0A 3WB9A 4KCGA 1H3FA 4O2AB 4YUYA 3ZWYA 3G9TA 3KJZA 4BMSA 8ATCA 1YQQA 4Q3CA 4ZZ1A 4WV3A 4OHVA 2NX2A 4B3XA 3OAAD 4Q6WA 3PFFA 1H9BA 3I34X 5AVSA 2ZP1A 1XNJA 4I7EA 3UUGA 4R8SA 4HTFA 4K8OA 5K3CA 3SFZA 2WP8J 3CRW1 4LDAA 1W581 4WFQA 4E4YA 4LTMA 1J2JA 1E98A 2BMFA 3DBOB 1QIIA 2V7QD 4M55A 1SQFA 4Z7QB 3VNUA 5KYWB 4PHTA 5SYAA 2O57A 2I4OA 3CH5A 4FZVA 4KLNA 1NWCA 3AWIA 2R8ZA 4IWYA 4L3VA 5K9ZA 5KVVA 5B7NA 2HD4A 3UAZA 1EM8A 3VR5A 2VDVE 3INNA 3QOYA 4BLRA 2HR1A 4NCBA 1K27A 3ETHA 3OZXA 4N54A 4ZT4A 4IRXA 3DW1X 4HDMB 1GN9A 3LLVA 4E94A 5DV9A 1FLVA 5HFNA 1E5VA 4A2QA 3U16A 1D09A 1K6MA 3I2JA 2JFQA 5AW0A 4O08A 4Q0MA 4UTOA 1Q7GA 2PKXA 2WUWE 2ZIWB 1IUNA 4DA0A 3MYRA 2NU9B 4Z1MD 4PN3A 2BBTA 4RABA 4IMRA 2ZCVA 4DMHA 3HEAA 3JWJA 4LXXA 4BJ3A 1G55A 4BU1A 2ZBVA 4BP8A 4A92A 4NDZA 3OQJA 4LY6A 5DXAA 4ZYZA 4XFDA 4ZALA 3WGJA 1DWPA 2JAQA 2D0DA 3WLNA 3SYLA 3SYMA 1YVPA 1FJ2A 3KHSA 2CXNA 4QBIA 3KJNA 4ZWNA 4EAAA 4F9GA 2I71A 1P1HA 3DDCA 2GPSA 3H18A 1BMFD 5K3OA 1UQRA 5FOVA 4KQFA 1ODIA 3MUEA 1A8UA 2II6A 3Q1LA 5CDSA 3E53A 1GOTA 2NG1A 4XD7A 3UWPA 4DQUA 1KS9A 1WUKS 3PUZA 1XFAA 4UTPA 3K9BA 2AI1A 4ZVSA 4PGFA 3AUJB 1QC5B 3GX1A 1Y1LA 1VHJA 3L1KA 3NAZA 1T43A 1O6GA 2H4YA 2V6BA 3DYIA 3FNEA 2PS3A 4LEIA 5AM3A 3IQDB 1RXVA 2ZUSA 2C61A 3F6PA 4WGGA 2GCGA 5KTKA 1IUKA 4RA6A 3HZOA 4I5IA 2PRZA 3AR3A 4GX0A 2PR2A 2X4GA 1EHCA 4Q3NA 1E92A 3ELBA 2OY0A 4EUFA 2CXTA 2P4EA 3TRIA 3DLTA 4MPRA 4CM9D 1VI2A 1LV7A 3ANMA 3K94A 5C8YA 2ZETA 3KDAA 4RTOA 1B0AA 3P2EA 5I45A 1TYCA 3B13B 2A1IA 2Y0BA 1TX4B 3SK0A 4B85A 4B76A 3CWQA 5BN4A 1RQLA 3G8DA 2X40A 2XUJA 4BUJA 5FKJA 3EAFA 1W4RA 3HKCB 4CU2A 4N0DA 4UMDA 2P2YA 3EK2A 4JL6A 5BMOA 5JW6A 4N8DA 2GAAA 2PSFA 2VPPA 1DKRA 4W6QA 4ZXFA 1WF6A 1QIFA 1IULA 1P4AA 1RAGA 2H1CA 3HKBA 1F0PA 3NGXA 4X8HA 3THXB 1MKYA 2X2FA 4JLSA 1P7ZA 1A3CA 1Y3IA 2VDKB 2A7QA 1ZJ6A 3Q0IA 2VP3A 1AU9A 3IKVA 4LPSA 1Q7EA 3ML1A 3PUYA 5BW8A 2CGEA 1QO7A 4PX9A 3FI0A 2BSQA 2GKGA 4RX1A 4MYSA 1SUSA 1I8TA 3IBFA 2C0CA 4HI0E 2VK2A 3OJOA 3I8SA 2VXOA 4KBFA 4AQ7A 4WIAA 1IZZA 3LKBA 3UBMA 2QUKA 1IC6A 4LBWA 2GCPA 3ACCA 3W4KA 1JZQA 2OFWA 2R2GA 4JA0A 3K1JA 1UBNA 1EUCB 1KAEA 1V16B 3KFVA 4DPKA 2O2CA 1KK1A 1TLTA 2FWIA 1MPTA 1T1SA 4DDUA 3HBJA 4PC6A 3HY4A 5H9VA 2OHFA 4C2UA 1JX6A 1VPVA 1Q0ZA 1JB1A 4L4RA 3EZFA 1LDBA 1T9DA 3FCXA 1WCWA 4LBVA 4IZIA 5THXA 1I0LA 4REOA 4FR0A 2XKKA 1BMTA 3RSQA 4PCLA 2ODEA 2X0EA 2Q3LA 3AM4A 3W9UA 4B8ZA 1ZAKA 3FJYA 4DIDA 4NBTA 1E0KA 4AY3A 1COZA 2CF5A 4I50F 5CDGA 1XNRB 5I47A 1KZ9A 2OFPA 4HTFB 4Y3UA 3USZA 2OEPA 1CUZA 4AP6A 3WK5A 5HNKA 2DWPA 2OXRA 3X1ZA 5IAKA 1QZXA 2IP2A 1CIPA 5CNJA 1NBME 2H85A 3NNSA 3Q3EA 4E13A 1UUFA 2XT6A 4M1KA 5JQGB 5KYYA 2P5UA 1U8ZA 2QP4A 4PZYA 1Q2UA 1L2TA 4H7FA 1PQUA 4GMXA 4B3HA 3JQPA 1F9EA 2PWPA 4MIOA 5FJJA 3BXZA 2A9FA 2G8NA 1XMSA 3G02A 1PFWA 4F96A 4CT5A 2AOTA 1E8MA 4O4LF 4GPEA 1DFIA 4ML3A 5DFAA 2I9KA 1FCJA 2QYOA 5L9AA 2CB0A 2FW6A 3BSYA 3A4VA 2PUWA 1KYVA 4CEIB 2H06A 3QV2A 5AW2A 3ZHUA 1U9CA 5HCUA 3W1WA 3GOHA 1NUTA 4RGYA 3PX3A 1UDBA 2BGIA 4FI3F 1RKBA 1VSQA 5EKUA 3BGOS 4DSUA 1HRKA 3QTBA 1MOZA 2OBMA 3INYA 4HJRA 4BKOA 2W71A 1WNTA 2W6MA 1K3UB 4AG3A 1OB2A 1Z37A 3NALA 1ZSNA 2GVDC 3MCTA 1NVVQ 1AK9A 1RRKA 4LWOA 4DJTA 1CE8B 3LGXA 3D7KA 4PZDA 5HW0A 1FF9A 3I3OA 4JBHA 3D0QA 1VBNA 3BX1A 3COZA 2IV3A 1S3GA 5AHKA 3MTDA 3LDFA 2ZCUA 3PNBA 2Q2NA 2XSZA 3RO7A 1J1IA 1EH5A 3OZVA 4BKUA 3L6OO 2D0OB 3QFRA 2BTQB 1N36B 1LZKA 3VPBA 4EY8A 3UJ7A 1SRRA 2P9CA 2XY4A 2QTRA 2AXPA 2UKDA 3R0QA 2AI2A 2VYNA 4WKGA 4E6PA 1YL5A 2CSXA 5LR6A 3UTCA 9MHTA 1C4OA 3RFTA 1J09A 2XYRA 3T3EA 1G6KA 4EW1A 4ARSA 2EZ8A 4OXXA 4DIUA 3NVDA 5C8YB 3I1JA 3K6JA 3M9LA 3OY2A 1YB2A 2EBUA 2I1WA 2RK4A 2VSNA 4FPXA 3T5TA 5BQOA 1KE2A 4Q39A 4QPPA 2ZRIA 3KKLA 1L6IA 1KI4A 1ZJ4A 1QQ7A 2WFAA 3UBTA 2BP7B 2QXYA 1ECCA 3ETGA 3CLHA 1YONA 4DCUA 3BDIA 3VHRA 1S2IA 1UJ5A 3ENNA 2QVLA 5CX1B 5IEJA 4H6VA 5IVKA 4KQGA 1R4MA 3Q88A 2AJTA 1M83A 3E5NA 2FSIA 4E88A 1WO8A 3BE6A 1JKFA 1FRFS 2IC5A 2OC4A 3C0KA 2PV0A 3S0JA 2ES4A 4ZOAA 3FVRA 1LRJA 3ENVA 2BN4A 3LP6A 4LAFA 5JY6A 3AM3A 2WYUA 5KMGA 5K6RA 3LUFA 5K0LA 2QSUA 2G88A 3BIOA 1UBEA 3JAKB 1NXTA 4O5AA 4TUYA 1T4CA 1GZ6A 2DQSA 3C98A 1E1MA 3H2KA 4CTNA 2CB9A 2VO1A 1XEWY 1FDRA 1YMQA 1VCHA 1ENZA 1Y7TA 2IYTA 2XNDD 3CC8A 4P2BA 3T54A 3S8EA 4RF4A 1YKSA 4L0CA 1W25A 1ICEA 3I61A 4I50A 4WNYA 1Z0ZA 4F93B 3BK1A 2E6KA 1XMQB 5WRFA 3U3RA 5JTUA 4BV9A 6LDHA 2ISSD 2PK3A 2VAXA 1T6YA 1Z4NA 3E6AA 4DYHA 1PNVA 4DA4A 4BFSA 4ZTUB 4AG5A 1VC2A 1FSGA 4RFVA 3EQ2A 3BAZA 2HBRA 1A27A 4IINA 4DLTA 5FWXA 1AF4A 3EZ9A 5DGHA 1XLWA 2BI7A 2BKAA 3DKKA 1C30A 3PQ6A 2NT4A 1K7YA 4Z9XA 1PFQA 2YW2A 2Z2XA 2JLVA 2PGAA 1YULA 1I32A 2XNJA 3QELA 3PZBA 4IQGA 5IWCA 1GUBA 3KC2A 2I2FA 3O3CA 2HHCA 3KEGA 4KXWA 5LLSA 4LKOA 1RZVA 3WI7A 1ZI6A 5TEWA 4ER5A 1KEPA 3D9QX 4PYMA 4U63A 5SICE 4ZRMA 4MRRA 1HY3A 1YK0A 1TKCA 1JAZA 2EYUA 4KHZA 3QVLA 1DKUA 2MYNA 2FMIA 4ATNA 3V1UA 3VX4A 5ELLA 3ZHXA 1VHWA 3LW8A 1R10A 2PVSA 1QIGA 2E1PA 3V80A 1ZC4A 5AHWA 5EXPA 1QDUA 4ZCIA 3ETDA 1WZUA 4A1FA 7YASA 4LFAB 4JX8A 3TI7A 2P5SA 1ZZEA 2J4DA 2HKIA 5BYKA 4BQFA 5B12A 1RLIA 1VPTA 4IJWA 2NZJA 3SSMA 1E18A 3VYRB 1T25A 1D2RA 3CPHA 3VPHA 3N9IA 4RGBA 1Z15A 2M1XA 4EITA 5JXIA 5KSZA 5FA8A 1GV1A 4LDZA 5D2CA 1H2WA 4DBLC 4EW6A 4DF3A 1NVBA 4L4UA 2P5YA 1Z18A 2ZRKA 2RE8A 3SSNA 4P36A 2O8FB 2ZJ2A 4XD2A 4LJSA 2VA8A 2Z9BA 4O1MA 2OPHA 5IP5A 4DMGA 5A4FS 2NZVG 1RJDA 4EVSA 4OATA 3OCZA 4TT8A 1VPDA 1O6BA 2OCLA 2D2IA 2X4LA 4YASA 5JHHB 1GUZA 5FLKA 4HKTA 2K87A 4BO9A 4JKIA 2ZI7A 3PDCA 3V55A 1M1NB 2VLBA 3DF9A 2QM7A 1DEHA 2Y3IA 3E3MA 1FW6A 2FJUA 2CDRA 2C3PA 4FFNA 1GNRA 2GS9A 2FZ5A 3PNVA 4TWJA 3LBNA 1NBMA 3CUVA 5LLDA 3R20A 1M7GA 1SZDA 1EFLA 1T1EA 3BHMA 4DR1B 3HPQA 2F7SA 4B1FA 4FHGA 3W2TA 4F4CA 4XB1A 4HV4A 1NG9A 3HFGA 1WPQA 1T6ZA 1OZHA 3ZD9A 3FR8A 3EVEA 4OQNA 1FNBA 1J8MF 4FHFA 4C04A 1XRLA 5GJVC 4UMVA 4LJYA 1ZH6A 2PXHA 1CJSA 4KDCA 1E20A 4KSBA 3KSDO 5PNTA 4ID9A 4JJGA 4K6KA 5D8DA 3VTAA 3O8RA 3RTBA 3ZNPA 2O4CA 4HX9A 3FZGA 3FFBA 3H04A 1F1BA 2AYYA 1QUFA 4TLMB 4KSYA 1GSHA 3S1AA 5IF3A 1XEXB 3G13A 3N6XA 4JBNA 2OC9A 1MQAA 1XXHB 2WZDA 2AB0A 1LPNA 4TVKA 3QG1A 3ZK7A 1KIFA 4LDRA 3RK1A 3UHJA 4RSGA 3EZGA 1AGPA 3JYPA 2DUJA 3O7WA 1GCGA 3BAFA 3KUKA 1P5ZB 3DR5A 7MDHA 1E2GA 3KB8A 3R0IA 5AK3A 5HFAA 1S8NA 3IP8A 1GYRA 4BLVA 4LJLA 3A1WA 3M6UA 2NO1A 2JZCA 4EEXA 2CJWB 1CDOA 1UJBA 4QHSA 1MO6A 3RKUA 2B4RO 2HA0A 3NHFA 2B82A 4GZMA 3T1NA 5JNVA 4MOWA 4EF5A 4WOBA 2R3SA 1LWOA 3C8MA 4GXRA 3GT7A 4BAUA 3L9XA 4LSGA 1MIOB 1ECJA 5ENVA 2ICAA 2Q6VA 2Y67A 1N2CE 4H18A 2INGX 2IYRA 2WG2A 3NASA 1E9CA 2XEXA 3DFMA 3MWDA 5A71A 4YAWA 1ZOPA 3AR2A 2NTJA 5HKBA 3UN1A 1Q83A 2AQ8A 1IZYA 1KJ8A 1NNI1 4PINA 3GY0A 2KLHA 1VIYA 1UEIA 3H2BA 1N5KA 2CFOA 4RD1A 5EY5B 1PEKE 2XA9A 5KQLA 5B36A 1L1EA 4KK3A 1I3KA 1KZ4A 2OR3A 3W5JA 3TFWA 3KKMA 1EP1B 2X3FA 3OFKA 1EWVA 3LL4A 3N6VA 3N8HA 1G16A 4F97A 4RIGA 4IUYA 4XFKA 2JCBA 5HUQA 1I2ZA 1SXJC 3ABSB 4J1NA 4N5DA 1LLDA 1S8OA 2DT5A 1L3CA 2RB4A 4MQEA 4AECA 1Z08A 4F6RA 3WLMA 3KD2A 1V1MB 2IZZA 3A26A 5B7GA 4YH1A 1HDGO 3PBKA 1O54A 1QP7A 3ZGXA 3R7WA 5A5VA 2JCSA 2DULA 1H8EA 3B38A 1L5OA 1H3EA 5FPQA 1BJRE 1PO7A 3RVMA 3PCTA 3UK6A 3PLNA 4UVHA 3DXYA 5FBZA 1KO8A 3WFJA 4Z0NA 5EL0A 3FRIA 4W5NA 3D7NA 1IYZA 2VKTA 4IKEA 2OCXA 2ZXUA 4NYMQ 3UT0A 3K5HA 3VR6H 2UVPB 2NO6A 2COEA 2QD2A 2ZYWX 2Z8XA 3EFOB 1M34B 1NASA 2CMKA 1MV8A 4KYIB 2AR0A 2KMLA 3CGGA 4OU5A 4Q3DA 3S2ZA 4CV0A 4B3IA 3I8XA 3OJ0A 2HLHA 3ANLA 1FU7A 1ZK4A 2XUDA 2JI6A 4GMKA 2QL5A 4OP2A 3GUYA 3B1WA 3AZQA 3JALA 4KFTA 2VSXA 2O0HA 2VDUE 3JVUA 4RORA 2WTBA 1QV6A 2WHXA 5JECA 2XBUA 3GJTA 2XUFA 3K0AB 3KLOA 1OR8A 3KJEA 3KPUA 3TLGB 5JXJA 1DT5A 2HA5A 3GAMA 3VMFA 1DDGA 2ONCA 4HXYA 2YW9A 1UDRA 4R0NA 1NZJA 1W5AA 3OM0A 4W8OA 4CLOA 3CLTC 3BXOA 3HSYA 1NF3A 3R5SA 4KRFA 3KBOA 1OLXB 1JQJC 3PP8A 2J3HA 5EUMA 4G8JA 5KNBH 1J23A 4PYLA 3RBVA 1V6SA 1YQTA 3AINA 3IOYA 5SY9A 3B6JA 3PPVA 3EXHA 4S24A 2J0QA 2YWRA 4PWYA 2CZCA 5FTJA 4FFBB 4QKQA 1QCYA 4M6WB 1M1UA 3AI7A 2J9GA 3BXHA 1KJJA 3NRJA 4ZEWA 3V4FA 4ER6A 2DJIA 3HABA 1CUWA 3R4VA 4NH0A 5AKEA 4IIDA 3ZWAA 5L7WA 1OH7A 1JG3A 2QLFA 2MCFA 3W5UA 3OPQA 1AO3A 2ZDQA 1ZKDA 2NGRA 4EX7A 5IBRA 3KVRA 4H1HA 4PW0A 3ROMA 2P78A 1K6XA 2R5NA 4UNRA 1RADA 3CF4A 1CQWA 3WKBA 4JLBA 2GN2A 4UFNA 1A9ZA 2PUBA 4HNHA 4C14A 1Z7EA 1RWKA 1RXEA 2BY4A 1OC4A 5ALHA 1QOPB 2PLWA 4JP1A 2OCYC 3LZCA 2PHZA 1JEOA 1P75A 1HG1A 2CL5A 1CRWG 2G4VA 2OORC 3HBMA 4FGJA 4XQ9A 1SMKA 1UKCA 2YICA 4IMJB 2XDYA 4JEHA 3EJ6A 2BFMA 1EZZA 3AB3A 3KU1A 3AONB 3HE3A 1GU0A 1QGUA 1AQLA 3H42B 3B9PA 4GXQA 3T99A 4D4KA 1DAOA 4ZVOA 2JNWA 3BWEA 1LBSA 4JP2A 4AUMA 3BDVA 4BNZA 3UXHA 4J0GA 1QK4A 3K09A 5JZSA 2X2OA 1SKQA 3EZLA 1Z0KA 5E6UA 4IGIA 5DLEA 2BV3A 4CF5A 3FMVA 2N0SA 4Q9DA 3ZW9A 1JLSA 3AF1A 1NVXQ 3FGOA 1XAGA 1E7RA 1P3JA 4GECA 3A11A 4YAOA 1DCMA 3PUVA 3FVTA 3QVXA 5AUNB 3CVYA 4GSKA 2C8VA 1PI3A 4CLEA 3OIYA 1GT6A 3GFRA 3MT9A 2RARA 3UUEA 3ZCXA 4DKXA 4CGZA 1P8AA 1TUBA 3MRSA 4IIYA 5AW1A 3FYHA 1T3SA 1PSWA 2Q8NA 2R47A 3OX2A 3GXBA 2H3HA 4QWWA 4ACBA 1Y34E 3R3VA 2Q4BA 4OL0A 2O8VA 4FNGA 1M2FA 1QTNA 3DE3X 3P1JA 3KRTA 4R7ZA 3RT1A 2QRVB 3FWHA 5TRTA 2O8EB 2OQVA 3R9KA 1X2EA 1H6BA 2RGUA 2P4HX 1QH0A 3WLAA 4ARIA 1UPUA 2Q21A 2FPRA 4IRMA 2SKCA 1VPLA 3AUYA 3V34A 4IHJB 1ZVJA 8AT1A 1IBRA 2IS1A 1X7XA 5FHRA 1GGEA 4BYGA 1RLOA 1XZ8A 3BFPA 4H35A 3OQNA 4WJLA 2C7GA 5DPMA 1UBJS 1SKYB 5C53B 2VPWA 4OHUA 1DEOA 1T9ZA 2P11A 3VU9B 2X8JA 4MW9A 3M49A 3DBIA 2R97A 4A03A 1BGVA 4WCVA 2GJ4A 3IRVA 5LQNA 5AKZA 3PI7A 4DVJA 2F1JA 3G0GA 2PRJA