3YASA

Hydroxynitrile lyase complexed with acetone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3yasA00
3FVRA 2QTBA 5HQ3B 4C01A 5JZBA 3IUMA 3OTQA 2CUTA 5HK8A 4Y2JA 3ZV7A 1B41A 2GYWA 5ALFA 2VQ6A 1AQLA 4KAAA 2XMSA 1VA4A 5ALMA 3OOSA 4L72A 4B83A 3BF8A 5ALEA 5CXUA 1IUPA 5FUMA 2ECFA 1GT6A 1Y7IA 3STXA 1QO9A 2RIPA 1MJ5A 2QKYA 1L7AA 4G4GA 3ESBA 1J1IA 4U2GA 4CIAA 5CH3A 1O6FA 4CCYB 2QZPA 5LZ9A 2XUKA 3EIOA 5ALKA 4BTVA 3WL8A 4BRZA 2DHCA 1W4LA 1CEXA 2Z8XA 4KE7A 1CR6A 4KR0A 2OAEA 1LPAB 5T4FA 3RM3A 3PF8A 3W05A 4B85A 3DYIA 5D3KA 4N5HX 4XJVA 1HDEA 4WJLA 5CBKA 4FLMA 5HF5A 1A88A 3PDCA 3HC7A 1R9MA 3STVA 4QNNA 4BBZA 1HPLA 1ZIYA 4QDOA 5EHZA 3DOHA 5ALSA 2VJDA 1BCRA 3DCNA 4GHWA 1NU6A 5ALPA 3WWOA 1USWA 4LIPD 5AKKA 1WB5A 3ZLUA 3G0GA 5A62A 2XUPA 1QFMA 1G4HA 3GA7A 3IBTA 4AO7A 2C4HA 3HACA 1SCQA 1BN6A 1MPXA 4U2FA 5JANA 3WMRA 4I4CA 4Y2SA 1CUBA 5D3ZA 2D5LA 4UBLA 5AO9A 4ZXFA 4H7JA 2VAXA 3WWDA 3V1KA 3HXKA 5BOVA 2JEZA 1QE3A 2WIKA 2BUBA 3CXUA 1Q83A 3FVTA 3PFCA 2XUDA 3DDUA 1IUNA 2BGNA 5E4TA 5DNUA 5ESRA 2DQYA 1CUIA 1CUFA 2DHDA 4BVKA 3QZUA 4LXGA 5IVDA 4DYHA 1QIHA 2C58A 4BP9A 2WTNA 5CH8A 3G0IA 1J06A 5ALVA 1P0IA 4JYMA 2GYUA 4OCZA 2C0QA 2HU7A 1H2XA 4H7EA 5ALTA 5AKLA 1CUWA 2Z3WA 2WKWA 4MWSA 1BCSA 1N5RA 3KDAA 4HXFB 5CT4A 2XUQA 3EQ9A 1MAAA 3ED1A 5FPQA 2ACEA 4J0HA 3D4LA 3BL8A 4UFNA 1JJIA 4KE8A 4MYSA 2G5TA 4CCWA 5IVKA 1K4YA 5YASA 3QPAA 5LP1A 4FOLA 3G02A 3QPDA 4D9JA 1FFEA 3OG9A 1UZAA 3QMVA 4H7KA 4QLOA 3W04A 3AFIA 1BRTA 2W6CX 2FUKA 5A7GA 5ALOA 1R9NA 1XLVA 1WB6A 2DCMA 2H9YA 4OYYA 4KEAA 1LPMA 3WI7A 4DSAA 1TCCA 3VISA 2JF0A 5JAHA 2XMBA 2V9ZA 1CUJA 3F98A 4HXGA 4RPCA 1XRLA 3FBWA 3AINA 1Q84A 1U4NA 1TIBA 3IIIA 1UT6A 3R3UA 3I2GA 1TAHA 2BGRA 1JKMA 4WFKA 2HIHA 4AN0A 2ZJ7A 2IX9A 3C5VA 1XZCA 3H18A 5DTJA 1ZICA 3O9VA 1BEZA 5KWIA 4QDTA 4OSEA 1UK7A 1IZ8A 1O6GA 1ZI8A 1NU8A 5DLPA 2WJ4A 1JFRA 3G9ZA 3I6ZA 4GWLA 1EK2A 1J2EA 3MUOA 2JGKA 4RE5A 3FCYA 4DLNA 5JAPA 3S8YA 5E2IA 2WUGA 4MQLA 2BKLA 1SC9A 5HKAA 4JNCA 2XT0A 1VA5A 4HXEB 3FWHA 2HFJA 3WK5A 2QXUA 2PL5A 4QDUA 2ACKA 4HTAA 2HA6A 2PVSA 3STTA 5ALYA 4EB0A 1ZIXA 3A70A 4L3WA 5D7BA 1UK8A 1CV2A 3F8SA 4FNMA 4QZVA 2XB6A 2JGIA 4B82A 1CUDA 5EHXA 1GQRA 4GW3A 2BAGA 2WUDA 3B5EA 3HJUA 5CT6A 5HK9A 1BEEA 1TKRA 2OQVA 5JATA 5ALDA 3STYA 2J4FA 4PV7A 4UHEA 1VXRA 2G63A 5DJ5A 4K6HA 4WDQA 1H2WA 1DQYA 2PSHA 1EX9A 4KACA 3KD2A 4NZZA 5DWDA 4AMZA 4B9EA 1BROA 3RKSA 3FLBA 5BV7A 4X93A 3WKEA 1GKLA 3OM8A 3WYDA 4PSCA 1BU8A 4BCCA 4IHAA 1E8DA 3KWJA 7YASA 1QIFA 2FJ0A 3R3VA 4G8BA 3D2AA 2YXPX 1TK3A 4Q05A 5AIBA 3WK6A 4GEGA 3OURA 1MN6A 1LPPA 3D2BA 5JD4A 2VEOA 3ANTA 4G9GA 4Y2PA 2XQFA 2WHRA 1LGYA 2WTMA 1P0QA 1ORVA 2G5PA 1AUOA 3C6BA 4U2CA 2VAVA 2GZRA 3VJLA 4OUKX 5C81A 2GYVA 3K9BA 3RK4A 3A2MA 2CMFA 2IITA 2EDCA 4IQ4A 2VTVA 4ITVA 1ZD2P 3I6YA 1GPLA 2WUEA 4HZGA 4MWTA 1L7QA 3WWEA 3TRDA 1QONA 5AICA 2R8BA 1E8NA 2CJPA 2WU3A 3H2IA 4PSUA 5EHQA 3D7RA 2BJHA 2O2HA 5AM1A 3WA6A 1EXWA 3QMMA 1SFRA 3HI4A 4X94A 2O2GA 4Q3OA 1MX5A 5ALQA 2H7YA 3RARA 2GBIA 4X6YA 3WL6A 4X00A 3N2ZB 3C6XA 3ZLVA 1W76A 5JASA 3C43A 4N5IX 1TRHA 3GROA 1QIJA 4PNZA 4UHDA 1ZOIA 4OPMA 4W1PA 4P93A 4MXDA 1PV1A 4RGYA 3OC0A 5AM0A 4ZGBA 5KWJA 2OAGA 3GBSA 2OG1A 4JUIA 2WG2A 4C4XA 2XMGA 3VXKA 5AK6A 1K8QA 1GKKA 4F60A 2Z3ZA 5CT8A 5JD6A 2WFLA 2NW6A 3AJAA 4BDTA 1THGA 1ZI9A 4OB6A 4J0JA 5I8PA 2G4LA 1FFBA 4O08A 1YAJA 2V96A 4W9RA 4BCDA 3FNBA 4ARBA 1LPOA 2WFZA 2Y2VA 4JH0A 3G0BA 5AI5A 2ZYRA 4Y2XA 4DM7A 4W1RA 1FFDA 2EEPA 2JGEA 4AO8A 1A7UA 5ISMA 1QGED 5HKBA 5AKYA 5AH0A 4ARAA 1DX6A 1AGYA 4CFSA 2JIDA 3H17A 1UWCA 2YYSA 3FYTA 2EDAA 3DOIA 4QLAA 2O7RA 4QEKA 3HEAA 1UKBA 2WIDA 3H1AA 2QS9A 1XZBA 4MQMA 1U2EA 2WSLA 3R41A 1OILA 1UK9A 2WJ3A 3WA7A 4AX4A 5AI4A 1HBJA 2X8BA 1VOTA 2CB9A 4TPKA 1YCDA 3F9CA 5AIAA 4H7IA 1X2EA 1LLFA 1U8EA 5K3FA 3HRHA 3ICWA 3JYHA 1ZJ4A 3W9BA 4EZIA 5ALWA 5AM2A 2GBFA 3DL4A 5D6OA 2IIVA 3W9UA 1WB4A 5FPPA 1DWQA 3V48A 4FFWA 5K3CA 3FAKA 1CUSA 3IVMA 3WYNA 5DYYA 3DL7A 5ALUA 3EF3A 4N8EA 4FMPA 5LKAA 1Z68A 5FDFA 1RP1A 5AKXA 4AB1A 5I9IA 4BC0A 3C8HA 1MX1A 4MJ3A 2GBGA 4QDXA 1CUEA 1G42A 1CLEA 3EBLA 2I3DA 2XLBA 5BWBA 2XQKA 1E5TA 2WIGA 4PO3X 4TGLA 3G9TA 1XFDA 2AXEA 3QVMA 3ESDA 4I19A 4ZV9A 2ONCA 3WL7A 5CURA 4H7DA 4GBGA 4PF1A 2XI4A 4AZ3A 4FDMA 3NOXA 4FNGA 3PFBA 4DGQA 5CW2A 1MT3A 4UBJA 2OCLA 1CVLA 2RAUA 2PSEA 2XMCA 1ZD4A 5CTAA 5HFNA 4NVRA 5J3JA 1DTEA 1XZHA 2RHTA 2OLEA 1JJBA 4BE9A 5DTIA 2HA5A 3O95A 1HLGA 1XQWA 1YB7A 1ZGBA 2HU5A 1YS2X 3C87A 4X97A 1XQVA 4GLBA 1LZLA 2WG1A 1XRMA 4HRYA 4X95A 3ZPXA 2RONA 4H18A 4M0MA 1GXSA 5HF6A 3AUKA 1ZGCA 2OGTA 5AOCA 2O7VA 2QJWA 3I6MA 3ICVA 5LZ7A 2ZYSA 2RHWA 3A2NA 5ALZA 4Q1VA 2R11A 2QUBA 3YASA 3DD5A 2I03A 3I2KA 3G7NA 1AC5A 5LLSA 5JAOA 5AKGA 4L0CA 3FYUA 5ALLA 1C7IA 3G0CA 1JU3A 2JGJA 1RWQA 2WG0A 3AZQA 3CCBA 3WKCA 4C4YA 2QM0A 3VJMA 3F67A 1XQYA 2WIJA 4QE3A 1MAHA 1E3QA 3ILSA 4BZWA 4X92A 4E11A 1ORWA 2AJCA 4ZRDA 4G4JA 5ALNA 1R88A 3FLAA 3WQHA 5EI5A 3I28A 4UBIA 1XZDA 2Z8ZA 4P92A 4F0JA 4XIIA 1JMYA 3FOBA 3WK4A 4AXBA 3DS8A 1AURA 1XROA 3GZJA 4J0KA 1VXOA 2ZYHA 1MO2A 3S2ZA 4DNPA 3EQ7A 5JAUA 1WPXA 4HRXA 2H7XA 3H2JA 4J0DA 1UOQA 3T4UA 1QIEA 4BP8A 1QIGA 4HVTA 4E15A 1XRPA 4E14A 5ALXA 5CRIA 1XQXA 1XRNA 4WFIA 3BDVA 1QIIA 1WCYA 1EVEA 2OCGA 3C6ZA 1Q0ZA 3WWCA 1J07A 2XUHA 3DLTA 2OPHA 3WZLA 4X90A 5E4YA 5HF9A 2VATA 2ZJFA 1F6WA 4XX1A 4KRYA 3DJYA 4BTLA 4KE6A 2WIFA 4X85A 5A71A 1TQHA 3VKFA 4OU5A 1BN7A 3KXPA 3WLAA 4J0GA 5JYCA 4V2IA 1CUGA 1X2BA 3H19A 5BWCA 4B84A 3FSGD 2HRRA 1EDBA 3C6YA 4H7HA 3WKAA 5FKJA 2PX6A 2BUAA 3BIXA 1JU4A 3KOOA 2AJ8A 1G66A 1W1IA 1GQSA 1H23A 1UFOA 4IH9A 3IUJA 5DNWA 1EI9A 2PUHA 4ROTA 1XZMA 2P8SA 4UFOA 3M81A 4CIBA 1EDDA 2B9VA 1I6WA 5CXXA 5AKJA 1PJAA 3IUNA 4UHHA 1MNQA 3AIMA 3QITA 3IULA 3VJKA 2OCIA 2H7CA 3V1MA 5AI6A 3ZI7A 2CEKA 1R50A 1K63A 1QFSA 3B3QA 2BCEA 1K5PA 3IB3A 1VZ3A 5DYTA 3LCRA 2WHPA 5C8VA 3D3NA 3WK7A 1QO7A 1XZIA 3HYSA 3R3XA 3LLCA 5IH7A 1CRLA 1N8SA 2PSJA 3H0CA 2HDWA 4C89A 3STUA 2PU5A 1AZWA 3O0DA 2K2QB 4EY4A 4P08A 4ZWNA 1B6GA 3QPCA 3R3ZA 5AKHA 5AOAA 1A8UA 1JMKC 1EB9A 5K3DA 1XLUA 5FLKA 5HQ3A 1QJ4A 2AJLI 1DWOA 2FX5A 1ODTC 3U0VA 3VVLA 2WILA 2HM7A 3BF7A 3TGLA 2V97A 3IURA 4RE6A 1X70A 4C6HA 3JW8A 3L1IA 2VJCA 2HADA 2DR0A 4YPVA 3H1BA 1LBSA 3WKBA 3ESAA 4MYDA 2VA9A 2WQZA 3FCXA 4M0EA 5AI9A 4A23A 1P0MA 4BATA 2B61A 2J3DA 1VLQA 5DNVA 1IVYA 5K3EA 5LIPA 2HA3A 4CG3A 1BS9A 3QM1A 2VJBA 4X7BA 4CG2A 4QWMA 4KRXA 5HCUA 5AK3A 4CCYA 4FBLA 5AHXA 3L1JA 3V1NA 1C7JA 4GECA 1FJ2A 3I1YA 4QDZA 3VVMA 4BB0A 3W06A 1U65A 4PSDA 1YA4A 3G0DA 2QUAA 2WUFA 4YASA 3SX4A 3WIOA 2XDWA 3D5EA 1EINA 3GFFA 3SC2A 5SYMA 4EY7A 5JADA 1VKHA 2XQGA 4FTWA 1P0PA 2VF2A 4WCVA 5AOBA 4DTCA 5AI0A 3AZPA 2DHEA 5EFZA 1WOMA 1UKAA 1ODCA 1QIKA 3M82A 2CZQA 4KYVA 3NUZA 4BC1A 5K3BA 2ZYIA 1QIMA 1AX9A 1L7RA 1XRQA 3MGAA 5C7YA 2OGZA 4CG1A 1DU4A 4X6UA 5HFAA 1C4XA 1CUXA 4EUSA 3H04A 6YASA 1FFCA 2Y1KA 4QA9A 1CQWA 2RI6A 4UHCA 4CI9A 1WHSA 4OYLA 2CKMA 2YASA 3O4HA 5ALHA 5IVIA 1UXOA 1LBTA 3BE8A 5LYYA 2B4KA 4K6KA 1PFQA 1SCKA 1CUHA 1CIJA 5EIEA 3I2FA 4H7FA 5AI8A 3G9UA 4WFJA 4U2EA 4K5QA 5AK5A 5CMLA 1Y7HA 3E0XA 5H3HA 2DFPA 3WK8A 4KAFA 4RNCA 1XLWA 3MVEA 2VJAA 2DSNA 1TCBA 1KU0A 1YAHA 4UFPA 5C8ZA 3IA2A 1R3DA 3DQZA 1CUCA 4BRSA 1H22A 1R1DA 2PBLA 4B81A 2OXEA 4UUQA 1OCEA 1M33A 3OPMA 3IUQA 1JJFA 4Y9SA 1K6EA 4KJXA 2XUIA 3PUHA 4DMFA 3STWA 1ZD5A 5ALRA 3HLKA 3WKDA 4EY6A 1NX9A 1EVQA 5FP0A 5A6VA 4BDSA 1T4MA 3ZLTA 4BVJA 4Z49A 1DQZA 3F96A 3O9MA 3A2LA 3VDXA 1QTRA 4J0IA 4B9AA 3DYVA 1JT2A 2PSFA 2HU8A 3PI6A 5AM5A 3F97A 2OCKA 4BVLA 2C0PA 2HFKA 3L1HA 2WJ6A 4GXNA 1Y37A 3AIOA 5JIBA 1N1MA 5LZ5A 3UUEA 3A6ZA 1LPBB 1GGVA 1UKCA 1ODSA 5KBYA 5AJHA 2C5FA 5EIHA 2XUOA 4Q82A 5JD5A 2XUGA 3CN9A 3IDAA 2I3ZA 1WM1A 1YSCA 1QOZA 1EA5A 3C70A 3QMWA 4J7AA 1SCIA 2ORYA 4FLFA 5LZ8A 1DT3A 3AILA 1MU0A 3U1TA 4OB7A 4BAGA 4WY8A 3PF9A 2JGFA 3D2CA 4LHEA 3FLEA 3BXPA 4AQDA 1GPKA 3LIIA 1N5MA 3H2HA 4UHFA 1ETHA 4TVKA 2HA4A 4WY5A 3UUFA 1F0NA 3QH4A 4H35A 3LS2A 4FBMA 1ZJ5A 3BJMA 2I78A 1CUZA 3WK9A 4IO0A 1BE0A 2PPLA 3I2HA 4EY8A 2HA2A 4B6GA 5ALJA 2XE4A 4FFVA 1IZ7A 4OU4A 1FFAA 3K6KA 4BZZA 4B80A 4EY5A 1F8UA 5FV4A 3I2IA 5AKIA 3I2JA 1DX4A 4EA6A 1UK6A 4G8DA 3Q8WA 3D0KA 4JEIA 3MUNA 4JYPA 1ZI6A 3M3DA 4X3CA 4K6GA 4DNQA 3O4GA 2BFNA 4NMWA 4FHZA 2WFLB 1MX9A 4X6XA 1XKLA 3V9AA 4J0CA 2QR5A 2PSDA 4OB8A 4WDRA 1H2YA 3WZMA 1E8MA 3E3AA 4G5XA 3FYUC 5JZ9A 2V98A 1XZKA 4DNOA 3DNMA 1R4ZA 2JGLA 1WHTA 5EGNA 4YK7A 2BUCA 2Z5GA 4XWGA 4W1SA 2OQIA 5AP9A 4AMYA 3BWXA 2B20A 3O4JA 2RGUA 1XKTA 3C45A 4IH1A 4EBBA 1MNAA 2WHQA 4KAJA 1CQZA 4B0PA 2VT6A 2XMQA 3QYJA 4BAUA 1CUAA 5IKXA 2X5XA 1W6RA 2WU4A 1EH5A 4H0CA 1ZD3A 4HAIA 3KSRA 1IMJA 3BJRA 3JWEA 1CUVA 2XUFA 5JARA 4OD0A 3O4IA 5CT9A 3WL5A 4LYDA 2ES4A 2QOEA 4C87A 2JGMA 4J03A 5K3FB 3C8DA 3HSSA 3N0TA 1IUOA 2QJRA 4Y2QA 4Y2RA 3R3YA 1DINA 2YH2A 1KEZA 3H2KA 4UPDA 1CUYA 3GUUA 1VJ5A 4INZA 4B0OA 2CBGA 3ANSA 1HQDA 4G1FA 5SYNA 4N8SA 5AM3A 3E1GA 5HF8A 4F21A 5K5EA 2ZSIA 4NS4A 4KE9A 4B7ZA 5LKRA 1WPRA 1DT5A 2XQJA 1UOPA 4HS9A 4M0FA 2XLCA 3HZOA 2Y6UA 1JI3A 3RLIA 5I7UA 5EIAA 2XMDA 5A2GA 3K2IA 4DMKA 1QZ3A 1LPNA 2HHAA 1LZKA 5EHNA 2O2IA 4FKBA 3DKRA 1GPNA 5K3AA 4MEAA 2JBWA 5T4HA 2HL6A 4DIUA 3V1LA 1LPSA 2VSQA 4GI1A 4UBNA 4FLEA 2HA7A 2XUJA 5CT5A 4PQEA 1XRRA 1E66A 1XZJA 1RYYA 3EQ8A 4U2BA 4MEBA 5AM4A 3AZOA 1H2ZA 1AKNA 2E3JA 2J3QA 3D59A 3SK0A 3G8YA 1XZGA 2Y2UA 3NWOA 5T4BA 3I1IA 2D0DA 3TJMA 5T4EA 5HZGA 2FJPA 2C7BA 1YS1X 1LNSA 3TEJA 3AIKA 4AO6A 3NGMA 4UBKA 4Y7DA 2ZSHA 1VE6A 4LXIA 4Y2UA 5F4ZA 1FSSA 4DMHA 2QT9A 4ZREA 4A5SA 3W2TA 5KREA 3BIWA 5FRDA 1EB8A 3WJ1A 2HRQA 4FWBA 1G5FA 4LYEA 4K2AA 5ALIA 5FOQA 1TCAA 3FYUB 4G8CA 1EDEA 3PICA 1XZLA 1EK1A 2QRUA 5DYWA 4L9AA 4BYMA 4GDMA 1EHYA 1QLWA 1VZ2A 5AK4A 1XZEA 4P9NA 4H77A 4E46A 3R40A 4DNFA 2ZVDA 1GZ7A 4XVCA 1XZAA 4PW0A 3WIBA 1OXMA 1A8QA 4LXHA 2QXTA 3WWPA 2WLSA 1CFJA 2PKYX 3ZWQA 1THTA 4J3JA 3X3HA 5C8XA 5IVHA 5ALGA 4BE4A 3T52A 1YB6A 1W75A 4DSZA 4Y2YA 1HKHA 4X71A 4ETWA 3PE6A 4I3FA 1CPYA 2XUAA 2X76A 1YA8A 1QIDA 3G9XA 3QBJA 4C88A 4QWWA 4A16A 2QMQA 2W22A 2C5GA 2VT7A 3SWWA 3HABA 3LIPA 2JEYA 4YX9A 1S8OA 1YASA 2PU7A 4Y2VA 3C5WP 3ESCA 3R0VA 4BAZA 3E4DA 4C4ZA 4G4IA 5E4JA 1CUUA 3LP5A 2GZSA 5AKZA 4W1QA 2UZ0A 2HA0A 1F0PA 4Q3LA 3FSGA 3KWFA 5LZ2A 3H2GA 2AJBA 2Q0XA 3DEAA 2LIPA 1KU6A 2QVBA 3CN7A 3CCCA 2WFMA 3GELA 1VE7A 3P2MA 4U2DA 1MTZA 1ISPA 1ACJA 1QTIA 5JZSA 4Q34A 2PM8A 2PUJA 4Q3KA 4Y2TA 2J4CA 3Q0TA 1SOMA 1A8SA 1UOOA 1HL7A 1Q0RA 4LKOA 5A7FA 4BCBA 4N8DA 4ZI5A 4EHBA 3PUIA 3R3WA 4UBOA 5AKEA 5A7HA 4ZV7A 4W63A 4AZ0A 4UBMA 3M83A 4X91A 5FXMA 3UMJA 5LZ4A 4UHBA 2H1IA 2XMZA 3DKKA 2WHPB 2ROQA 3BDIA 2ZJ6A 4DMCA 2AJDA 2WM2A 1XZFA 1DWPA 2DQZA 2XMRA 4S0XA 3WJ2A 1AMNA 5CH5A 5JALA 4IH4A 4G9EA 2Y6VA 1D07A 1ACLA 1W52X 2XQIA 1E89A 4F5ZA 1T2NA 4AN1A 1YR2A 3B12A 2OGSA 2GBCA
chains in the Genus database with same CATH superfamily
1MAUA 1P1HA 4O4JA 1QGDA 2UV8A 4JP2A 1J2TA 4TLCA 3OQ6A 3VZDA 4XD2A 4XVQA 4MGIR 3I58A 3R7WB 4C01A 3N74A 1NQOA 1PBTA 1O5TA 5ESWA 2W70A 3COJA 2PMCA 1KYVA 2ATIA 1FQKA 3A9VA 1ABEA 1TC2A 1RI4A 4IIEA 1B0ZA 3PSHA 4P38A 2ZP1A 2RKWA 3GD7A 5HK8A 3AVYA 4BFVA 3DMYA 4Y2JA 5J2UB 3ZV7A 5KYWB 3PQ6A 1ZKMA 3ELUA 2NAFA 3SBOA 4KAAA 2XMSA 3VU3A 3QELA 4JI6B 3VR2D 4HFRA 1U3WA 1N3BA 2VPZA 2JBHA 2HNBA 3EIHA 4MA4A 5D7NA 1ZVKA 4D45A 3ZWXA 8ADHA 1IRXA 3SSAA 5IABA 3OOSA 1PSZA 1AQNA 5F52A 3FB4A 3LY5A 3IJPA 5ILOA 2DQSA 4JELA 2R1UA 3DWFA 1XQ1A 3FWYA 1EFUA 3WVNA 3KV1A 3F73A 4ES6A 1N5JA 3DBHB 3GEPA 3SI7A 1TEHA 3N05A 2DUNA 3LRXA 1P2BA 3AG5A 4MRSA 5GGYA 3T61A 2O8EA 3ZWCA 3OEEA 4CU5A 3MTJA 2P11A 3OPYI 4QYMA 2PKQO 4O2AB 3FDZA 3AB7A 4MGZR 8ABPA 4G1UC 3D6VA 1NVBA 1SUBA 4MQ4A 4U9IS 2R4UA 3NYQA 3N07A 4FYKA 1G3QA 1OFIA 3GCWA 2QTLA 5BW8A 3FNGA 4U2GA 2X9LA 4Z53A 4NOKA 5CBPA 3OCUA 5A4FS 2JJQA 2WT9A 1TA9A 2HGSA 3NPAA 3IXQA 4L8FA 3LL7A 5HBGA 4MW6A 3ABIA 2Z58A 1FP6A 1IBCA 1LDMA 2GETA 3KTOA 2QZPA 3SJAA 2QMZA 2XUKA 3W90A 1EU1A 3E2IA 5ALKA 3V4VB 5HGJA 4YCSA 4K9SA 3WL8A 1SK9A 2B0CA 3RTBA 3DD1A 3K2EA 4BRZA 3QE2A 3ZHXA 4RJTA 1JHAA 2V0GA 3JVDA 1FDWA 2TSYB 1RWNA 2FP4B 3BRWA 4Y9RA 1CEXA 3AHGA 2VC2B 1Z7GA 1JLSA 1S2MA 3SC2B 4KE7A 4Q1BA 3U7RA 3IRVA 2I9KA 2G04A 3OJEA 4I8XA 4BGIA 3VPFA 2AKEA 2VOJA 2X9QA 4LZLA 3GJ8A 1L7MA 3MCTA 4JUFA 4LE0A 3WIUA 4DJEC 2O8FA 5CVEA 1Y7LA 3O1JC 3PF8A 2VWGA 3GDWA 2R7MA 4YJDA 4C0BA 4BLTA 3AF6A 1Y4AE 2V7UA 3DYIA 1JEDA 5CLIA 1JFFB 3M6LA 3TZEA 5CFLA 2IEIA 1MOSA 3EXIA 4H0FA 5CDSA 1YHNA 4NQRA 1WSDA 5EQTA 3MW8A 3HGMA 5CBKA 4FLMA 2O1WA 1B26A 3E9QA 3VPAA 4OX9B 5KQRA 3HDGA 3RRXA 2R751 5JBQA 3PXDA 1R9MA 2QAGA 4TTPA 2CLEB 3A9WA 1U5CA 4HYEA 1HPLA 1SBHA 2UYYA 5DLDA 5B1SA 1R0YA 1I7QB 3IPXA 3LOPA 1X14A 3MJCA 5EHZA 2HV8A 2QBYA 4YMTA 3LTEA 4AY3A 5I9BA 3DCNA 3WWOA 3NM5A 4PFSA 1OJ7A 1TB4A 4OH1A 5J2TF 5AKKA 2QAJA 4TTRA 2BE9A 4DVGA 2OYCA 1L4EA 2E82A 2XUPA 3G0OA 3GEDA 1QFMA 5B3KA 2H18A 1UC4B 1Z07A 3BSFA 4PR0A 3Q7QA 3GEIA 2MYTA 1UXIA 5CK5A 2FSPA 2VDUE 4WLFA 1J7KA 4QFDA 2XIQA 4AO7A 3NDBB 5K01A 3LKBA 2E18A 1Y6GA 4REMA 3VC7A 5ETJA 5G0TA 4TZKA 2R66A 5DMXA 1J2YA 2XKBA 4G5FA 3T9EA 2H85A 1XE3A 2EFCB 3CKMA 4NU5A 4WNAA 4CV0A 4A73A 1EG2A 3MJRA 4J9VA 4U2FA 4DFDA 2H00A 1JG3A 4O5AA 4IKEA 3WB0A 3FHTA 1E62A 3WMRA 3EXHA 3K0AB 4KVZA 2OVBA 3IOYA 1XN4A 4I4CA 2X8JA 4ALMA 4KRFA 3C7KA 2IHZA 5FBRB 2DPLA 1CUBA 1KPGA 1TLLA 1U90A 3CB2A 3NC0C 3IT0A 3HEBA 1G8YA 2D5LA 3CZ4A 4UBLA 5D3ZA 4H7JA 4W5JA 2C2HA 4G0QA 4QPCA 5KTMA 3R9IA 3DUFA 1W34A 5HR5A 3ORHA 3NJ8A 3H1FA 1X7ZA 4O4JF 4DCTA 3V1KA 1KOFA 4G2NA 1MABB 3DZJA 4QUKA 5KOJB 4UM7A 2YVLA 4L6AA 4DS3A 3RG2A 3LKVA 1QE3A 3QNWA 1D2HA 2ZQYA 3AFHA 1C0EA 1D6MA 4COKA 1HETA 3HP1A 3CXUA 1DLJA 4ZEOA 4KO4S 2CGEA 2MU1A 3EIEA 3FMIA 5IDYA 1WKVA 3PFCA 4Z3OA 2OUKA 2VDPB 1XI2A 1A7JA 2GNPA 5ESRA 1WP4A 4MTCA 1CS0A 3JTEA 2VAMA 1VGVA 3ISTA 4NCHA 3ANLA 5J5AA 4AZ0B 1TEVA 2OKGA 3PX3A 2J0VA 5JW6A 2AOUB 3I8SA 3WHKA 1K5GA 2ZRKA 3HVUA 3CU5A 4OQPA 3T7CA 4LDAA 4Y9UA 4BVKA 4F2PA 2XW6A 4YY3B 1L5SA 3QZUA 3UJHA 3VO9A 4A26A 3ADBA 2B4QA 1AZTA 1DIAA 2R6HA 4NCNA 4V02A 3TD6A 2KJQA 1KQOA 1IZZA 1T9ZA 2IUTA 3G0IA 1LNZA 5CH8A 1J06A 1FLDA 1RXSA 3DTNA 1ISFA 1E6LA 1K3TA 5ALVA 2MYNA 1G0NA 1P0IA 4C4RA 3KVOA 4B6QA 2GYUA 4CLHA 1NW6A 4CM4B 2BFEB 1UKEA 3PKJA 4Q9HA 2QGNA 1H2XA 3NYRA 4Q93A 3TL6A 2YZKA 3BK7A 3IBGA 1W5BA 2CNDA 2D4HA 4H31A 1RVDA 4AMGA 2B8NA 2JAOA 5FHRA 1HE5A 4U6NA 1O6BA 3GFVA 1P9LA 3LPCA 3Q9NA 1L5ZA 3FKJA 1N4AA 4IX1A 5IC4A 1F2TB 3BTOA 1QH1A 1TAQA 1EBBA 5LDHA 3QU5A 2FW0A 3MGBA 1SOAA 1PI3A 2OHJA 3CKYA 4POAA 1E7WA 3AKZA 4WZ6A 1MAAA 1UPUA 3MM4A 3ED1A 3X1MA 1W0JD 2EV9A 4KIUA 4ZT2A 5FPQA 4C4PA 1AN0A 4TWRA 4Y2GA 2C5SA 2LDXA 4NZOA 1NM5C 4RJKA 4J0HA 4UXHA 5LQSA 4A6PA 4HRVA 1OZ0A 2OHVA 1OBHA 2RARA 2NXEA 2FPKA 1CDDA 3DTVD 3VU1A 4EKIA 3P9KA 1FFSA 2HO4A 4J4HA 4UQPA 2GJ8A 5B6IA 5A3RA 5GZ1A 2AOVA 4R68A 5KTRA 3FTCA 3TTUA 1QGUA 5IVKA 4BMPB 3ELWA 3NDJA 4HFNA 4HQLA 4I1RA 2BH2A 3KJGA 1K4YA 4KWEA 4UREA 2FX3A 2KLBA 2XJ4A 3OMLA 1WCXA 3QPAA 2J7KA 3B3AA 3ND5A 4FOLA 3W6ZA 4KPEC 4G6ZA 1PLJA 1KSJA 4OATA 5CLQA 5EGSA 1Z5WA 3OZEA 3U7EB 1UZAA 2AX3A 2BOVA 4YR7A 3MHTA 2EVWX 1QHEA 3I01A 1N9GA 4JJAA 1HQKA 2IV7A 2G67A 1IVNA 4MLDA 3ZHUA 4CR6A 4MAMA 1WDLA 1GTSA 3K5IA 4WZZA 2J9YB 1AM4D 4WSOA 5DYNA 2FUKA 4CDRA 1B1AA 4JLAA 5DBOA 4D0LB 4KXWA 1TCUA 1F8YA 1XTQA 1G9SA 3QUAA 5A7GA 2M6SA 4NF2A 1M1YA 1J8YF 1Z17A 2Z1MA 2ZBVA 1XDZA 1IPFA 3W2GA 4KWHA 4NPHA 5CX1B 5JXWA 2AH5A 3K9FC 1V3QE 1RAFA 4PZUA 4YRJA 3RGWS 4OG2A 1OLXA 3H9UA 3L8EA 4OYYA 4JUDX 2OYRA 5IEJA 1QKIA 4DDUA 4KEAA 1XB2A 4ALLA 1F60A 2H65A 2PVPA 2OB2A 3BFPA 4UE6A 3VHRA 4FCVA 4H17A 1TCCA 2ZIWB 3TH5A 2OFXA 3W5DA 4TXNA 4BX8A 1A3CA 1KAMA 3PXEA 2I6TA 2O2CA 2OMEA 3AVWA 2V9ZA 3FHJA 4J49A 4HXGA 1A8PA 2PPVA 1QK5A 1OLUB 1ONSA 3B6EA 2RK6A 1M1NB 3DQQA 3H9CA 4ROSA 4CQLB 3FTEA 4YDSA 2BTQA 3WNCA 1YT5A 2ZWMA 2NZYA 1KI7A 6ADHA 2VCEA 2QTCA 1IM8A 1CZHA 3LECA 2FRVA 5SZKB 1GITA 2P9GA 3O8NA 4N03A 1WXHA 4PLCA 2A0XA 3JYLA 4DR3B 3VSDA 1JAIA 1W49A 3SJZA 2Y4OA 4GAEA 2IWRA 4WBSA 5JMWA 2PRZA 2E48A 1GG2A 4BGDA 1XTIA 4LY0A 1J2UA 4EW3A 3REOA 2GCEA 4YCDA 3D7NA 1L4GA 2XRMA 3O83A 4NBSA 4OHVA 3HR7A 2BKUA 2P65A 4IFBA 5CK4A 1EFPB 2QI9C 1L1RA 4BY9E 3QTTA 4CQJA 4LSZA 1R0ZA 4RF5A 1QZUA 5H16A 4F38A 1XZCA 4D8YA 2WLTA 3TM4A 3PS9A 1WVGA 1ZICA 1PTKA 2RB4A 1R8XA 4OM8A 4E4TA 1LI5A 1BEZA 2HMUA 4QDTA 1ZMTA 4RY9A 4A5OA 2X4DA 4OSEA 1IZ8A 4BU1A 1CZNA 2D3WA 5JNUA 4NFLA 4UNRA 4ATNA 2BFCB 1A7KA 2JKZA 5DLPA 1OQAA 2HCJB 3WYAA 4BO1A 1EQ2A 2XRYA 2WJ4A 3HL0A 3DDHA 4JB0A 3AUJB 5AW6A 4CUKA 1CY2A 1DLIA 1D4OA 2H5EA 2NYRA 3G9ZA 3I6ZA 2EW8A 4GWLA 5LNK1 5EJMA 3VTZA 4C14A 1ABBA 1EK2A 2A0KA 3KLMX 1J2EA 4O5OA 4OLJA 1P73A 1HDYA 3X43A 3FCYA 1KWGA 2ATEA 4WOKA 5ESXA 1AV7A 4KUGA 4GL2A 1SVNA 1A2OA 4YRGA 3C3YA 1AB5A 1Q0UA 3JWHA 2Q2OA 4BX2A 1RXCA 4ZALA 2VBFA 4MQLA 3L2OB 4ZOLA 4PC2A 1J9GA 5HKAA 1AKWA 3R3SA 4IM7A 3CUYA 2RC5A 4JNCA 2QVLA 3AOGA 3ZVNA 4KGVA 4DEXA 2VUIB 2B82A 3DEHA 2FR8A 4CEIB 3B9QA 4U3JA 2C5AA 4YV0A 3Q5DA 1I30A 4DQ0A 3BS4A 1RI3A 1A9SA 2GRUA 3KB8A 4NCXA 3WK5A 3WR5A 1H05A 3ANMA 5CEEA 4MKIA 3OPYB 1NSTA 1W581 4QDUA 1KDRA 1R0RE 1DDIA 2ERXA 2HA6A 5KINB 2P41A 4PCAA 1ZK0A 1NBMD 2OC4A 1J0DA 3KQOA 2HZ7A 3BE5A 1G9XA 2BYTA 3JZFA 2A8YA 4Q3DA 1OMOA 4WK6A 3ZWNA 1V16A 2G88A 1RKQA 2JZOA 4HPXB 2IYRA 1G21B 3KLBA 4IV0A 1L5YA 2QSJA 4ZRNA 4AP5A 4B34A 4CETA 3L1KA 2Q0HA 1E3EA 4FNMA 3OF5A 1KE1A 3G5AA 1W4BA 2W6MA 4MJ7A 4QHTA 4JUCA 3TR5A 4A4DA 2JGIA 1G3UA 3B1WA 4HB0A 5EHXA 2FPGB 1GEGA 1QRSA 4REQB 3NT4A 1KJIA 4RAOA 4BNNA 4O2BA 3B5EA 3NXKA 3HCPA 3HJUA 4TTJA 3GLTA 3KT6A 5HK9A 2G9NA 2HSGA 4N6OA 4CTOA 1TKRA 4MQFB 3KEFA 3E53A 2ZJ0A 3FOCA 4N47A 2OQVA 4EX6A 5JATA 1T0HB 5DSXA 4YLGA 3RBZA 4PV7A 4UHEA 3Q0EA 3OQMA 1VXRA 3CNLA 4NEQA 4YTEA 3UZUA 2BN4A 1A2QA 3PD1A 3IXMA 1GOTA 3R6LA 3LWZA 1LJ8A 5L40A 1UBTS 1CFZA 3EJ6A 5CX4A 3TJRA 4DWVA 1BE8A 1ULUA 2FR1A 1ZJZA 2ZBUA 3JVEA 1NYLA 2X2OA 3QPBA 5PNTA 2Q2WA 1M2GA 4EUFA 5ED0A 1G8FA 3N2KA 2DLCX 3K1JA 3K1AA 1N7IA 3PHJA 4FOSA 5ER6A 2YNMA 1EX9A 4HNHA 3AUSA 1HKUA 4ND5A 3FWNA 1T3SA 1T43A 4GU5A 4NZZA 2ZYVX 3KWLA 5G41A 3RSHA 4R2IA 2VUHB 4XWAA 3RU9A 5IS2A 3PEWA 1L7VC 2CVOA 4AG6A 3CGGA 1DGQA 4LRXA 2FR0A 2QMUA 4KFUA 4M3NA 4FFBB 3DP7A 3UHOA 1ZNYA 1UBNA 2YY5A 3JQ7A 1ADFA 4WHMA 4TXLA 2MMCA 4QYSA 1XJ5A 2M6KA 4G0UA 4V3CA 3ADPA 4K0KB 1R7RA 4E5DA 1BU8A 5BURA 1YQTA 1L0BA 2Y05A 3EEBA 4FOOA 4G5HA 4NJEB 5GWXA 3EB9A 1HT2E 3FPJA 1UDWA 4FZRA 4B2LA 1QIFA 3OZSA 3L9XA 3A1VA 3R3VA 4MWCA 4G8BA 2HPZA 1P72A 5HW0A 5FTJA 1G55A 3V55A 4EFKA 1TK3A 3HQ4O 1V8BA 2D1YA 5L7WA 4NY1A 3JATA 3MWKA 4WA8A 4M8KA 2X6QA 1Z4MA 3OURA 4MKRA 3WISA 3EA5A 5B3JC 2J8ZA 3RTGA 3W2FA 3ITEA 3EWSA 1LPPA 1JJ7A 1RDFA 3CRRA 3ZE7A 2FKAA 1A9XB 2HY7A 3AEUA 3LPLA 1G8JA 4URWR 4HNAA 4XM1A 4ER0A 1ISGA 2AW5A 3ZWAA 1YR9A 2WJZB 3L6UA 3E8SA 4HWTA 4L50A 3ETNA 1VL8A 1I3OA 2BKAA 2MSEB 3MWYW 3R44A 3ZI0A 3HXOA 1GPBA 5EUMA 2PH5A 1GPH1 1ZDMA 4BV3A 1ORVA 2IKSA 5BSWA 5LQUA 1KOGA 2ZITA 2VSOA 4E5UA 4MZXA 3WFIA 1O77A 1ULTA 1OGIA 2GHRA 4J1TC 1VC2A 3TRKA 4F7WA 4NCAA 3PT5A 1QV7A 3PC3A 1ZCJA 2AB0A 4BIIA 4OQQA 2GZRA 4XTCS 5A4AA 4D9MA 1Y8QB 2FGKA 5J5CA 3M6FA 2HEIA 1ZNXA 3ZOZA 3GGJA 1CHNA 2GYVA 1PK9A 2X42A 2ABWA 3WL4A 2I67A 1ZEMA 2AX4A 3LQ4A 3MSXA 4IEEA 3A2MA 1DOHA 3A9RA 4NHOA 2CMFA 2ZRPA 3NH6A 1ZC3A 2IITA 2BSAA 4ED9A 3E9CA 2DX7A 3G3EA 4ITVA 5E9QA 5LU8A 3GVHA 3E8MA 2AOTB 1GPLA 2PGDA 2EZ8A 4WXYB 3UCFA 4AMBA 1SPBS 3NIFB 3FLMA 1Z62A 3TKYA 2PHZA 1SIUA 2ZUDA 4HQKA 3TRDA 3NTXA 4R2XA 1K8XB 4FP9A 1KZ4A 1MFPA 2X4IA 5FL7A 4BB5A 1KOJA 4QT4A 3EGOA 1E2MA 4OHUA 1YB2A 4ZOLF 5EJ8A 2ONKA 1E98A 3P52A 1ZBQA 3QU2A 4NKRA 3SF8A 1B6SA 1WZ2A 1EXWA 2IZ1A 2C9MA 3QMMA 1NOIA 1TD1A 2H5IA 4W4TA 5FUBA 5C4IA 2FWNA 1Z4IA 1M3SA 3AHCA 2VJLA 1YJCA 2O2GA 4MICA 1MX5A 5LQNA 4GM4A 5ALQA 3RARA 4X6YA 3FUCA 1Q21A 3BMNB 1Q3TA 3JWGA 3N86A 2WWVD 4D9FA 5KTNA 1WBDA 2CVFA 2XZLA 3N2ZB 1ZM2A 2ZEJA 5IPFA 3OX4A 5FOSA 4M8LA 3TIFA 4EF4A 1TPZA 3COYA 3O84A 5KS2A 1BHSA 3OTWA 1AKVA 4E32A 2HT1A 2EBHX 4MV9A 3B9RA 4EO7A 1ZK3A 2WICA 2WAYA 2BEUB 3JQGB 4KMMA 5GJWC 3SEAA 1EE2A 2QZSA 4JLOA 4OI0A 1GAEO 3P9YA 4X8OA 2H17A 8ATCA 3J81k 2UXBB 4UHDA 4PX9A 2B34A 2VSFA 4OPMA 4W1PA 2HLHA 2JFNA 3DOJA 3KQTA 3ZCTA 2IGTA 3A4NA 1NJSA 2OLKA 2PGNA 3UMCA 3IMCA 3LGXA 2I6GA 1D5CA 4MGEA 3VKUA 3OC0A 5BSRA 4ZGBA 1UMBB 4RFSB 3MB8A 4FEYA 5EL0A 3EZ2A 1Q6ZA 4KRGA 2WG2A 4C4XA 4INOA 2J08A 1KS9A 3I09A 1WUHS 1CZRA 1AKRA 4O2BF 3JTMA 3CLUC 3DWGA 2ZCJA 3PJGA 4N7BA 5CHYA 1GKKA 2IZ7A 2W2PA 1KPHA 2A84A 3CVUA 1MHPA 5AJUA 3NC1C 2OV6A 1NR1A 3H4IA 4NABA 2VAPA 1NOJA 4LYFA 4OHKA 4E4RA 2NW6A 1KMNA 2ZJOA 1B3BA 4IINA 4KXVA 3W7BA 1ZI9A 3KUDA 4FD2A 4MV1A 4OB6A 2I5PO 5I9MA 4HX2A 4HWKA 4RZ3A 5K03A 1WD7A 3GCZA 1FMCA 5BQXA 1V41E 1YAJA 1A77A 2GVDC 2J9XB 3VTKA 2RHHA 3DLPX 5GAJA 4B73A 1U1DA 2PO5A 4UVDA 4QUDA 3KM0A 3FNBA 1B0PA 4ND3A 2Z6AA 2DT5A 1EUDA 2HMYB 3QE0A 4IIUA 3LFUA 1FP4B 2OXIA 5A3SA 4ZI7B 2GT1A 2B8JA 4ME6A 1TU0A 2BR4A 4MDHA 2Z6UA 3FX2A 1SH7A 1N77A 3VA7A 4YT8A 4MRVA 2YBDA 2G8NA 1IAVA 5AI5A 3G8BA 4RHTA 3I53A 3S3TA 4H1TA 4OJKA 4YRAA 5TVGA 5IARA 5DP1A 3ZNQA 1TJNA 2AEEA 1FFDA 4YV1A 2EEPA 1XDUA 3QUSA 4IDPA 3VDQA 1W36C 3K05A 2WSIA 4K0RA 4AO8A 2PZGA 4B2IA 3OT5A 2ZRIA 1SIOA 4CODB 5ISMA 1QGED 3ELDA 3D3KA 4IWYA 3Q5EA 5AH0A 3JVUA 4LDJA 5BRJA 1WO8A 2J9FA 3BWBA 1V0JA 3S27A 2V03A 5CR9A 1OB5A 3MK31 3DE5X 1P1BA 2F9LA 3DDCA 5BN4B 1IHYA 4RK5A 3S1SA 1UWCA 2JGRA 2P9EA 4CHTA 4XDYA 1K98A 1Z63A 4N5DA 3QFHA 1M1UA 5JBNA 4PZDA 3VOTA 4N48A 3DOIA 3PHIA 3SIWA 3GQVA 4EL0A 2IE0A 3DLBA 2TYSB 1Y3HA 1Y1TA 4FHEA 4DLVA 3IE1A 3ZYZA 2OE2A 5GJBA 4D0SA 3Q11A 3KQKA 3D8RA 2WIDA 4D97A 2ZAGA 5DM1A 3UJ9A 2FF5A 2QS9A 4MQMA 1HTBA 1SU7A 3LC2O 3ZCUA 1ADGA 1OILA 1RPNA 3TOZA 2WJ3A 1GRNA 2QD1A 4G5YA 3VNVA 1WY7A 4JT9A 4AX4A 3P26A 2C2MA 5TB5A 1XZQA 3BGDA 3UEOA 3KSMA 3HP4A 2QE6A 2WSSA 1F6BA 4KJZA 3MWDB 4PAGA 1VHWA 2G28A 4AM8A 4TPKA 4F92B 5D51S 2SCUA 4H7IA 5B36A 3K5HA 1X2EA 4P3XA 3AERA 1P2SA 3B1XA 3CZ9A 3ICWA 4P3OA 4D4LA 4L3VA 3JYHA 4C78A 1AK9A 2GCOA 3WQBA 1OH8A 3GLFB 4JP3A 5IDQA 3HA5A 4N5LA 3PXBA 3REGA 4TL8A 4FDUA 2JEOA 5GTDA 5JXJA 3P9NA 4I5EA 1UMCB 3R0XA 3W9UA 3L6OO 1WB4A 2C9CA 4TXMA 2OEPA 5K8JB 1D7AA 1U0TA 2ZJYA 3BXFA 4FFWA 3PTAA 2J9ZB 4KXQA 4GEKA 2B3DA 4C2AA 3NFRA 4CF3A 4DQKA 4H1HA 4XRRA 1FS4A 3CINA 5DCWA 3ZXXA 5F77A 2BEWB 2E85A 3FAKA 1CUSA 4LI3X 3AEKB 3B3GA 4HDAA 1D1QA 1RJFA 4GQIA 4KN8A 5DYYA 5TGZA 1NUAA 1P5JA 3N0WA 5EC8A 3TQRA 2E21A 4KU4A 1CXZA 2RAPA 3KJNA 2IKQA 2O7QA 2ZT5A 5ALUA 1TTPB 2OZPA 4D41A 2YOGA 4M49A 4FMPA 1V37A 5LKAA 2H9AA 4JI7B 2FB9A 2O8DA 1CJBA 2QLFA 3GMDA 3PDUA 5BO5A 5I9NA 2FQYA 4G0ZA 1DKQA 4LPSA 1TE2A 2AFIB 3RFTA 4CBVA 4ZVNA 2W4QA 5LYJF 4B3MB 2WSYB 4EL5A 4ENTA 2GBGA 2Z2XA 2IHKA 1DAPA 2O3QA 3A36A 1TT7A 3C6KA 4G5SA 4K6MA 5BWBA 1H3NA 5TMBA 2CL5A 4EOGA 2WT8A 2IOYA 4MH0R 1Z56C 5AHOA 5GIOE 1DG9A 3ZJYA 1ZJYA 3OTHA 1E5LA 3R4VA 4QJIA 3QVMA 4GMFA 4OM7A 2JLXA 3H4MA 4MW5A 1Y42X 1NXWA 1PWHA 1GRRA 5JXHA 1LI4A 2P2YA 2VK4A 4OQDA 3FIJA 5CURA 1V48A 4NG5A 1NTOA 1S3IA 2CMDA 5E38A 1DC6A 1N7HA 1QP8A 3NAMA 4G5OA 2XI4A 4PF1A 3UN1A 1GRQA 4ALJA 1YOVB 2B6HA 2ECKA 3CSDA 4NBKA 2YHIB 3I3OA 4U1RA 5C1IA 2NP6A 3H2ZA 1XPJA 2H06A 1IXSB 1RYHA 1XU9A 4OK3A 3NOXA 3IQXA 5JR3A 1FIUA 3CX6A 2ZBPA 3P7MA 4QQ8A 3DLAA 5FLXA 3VGPA 1EE1A 1GGHA 1E59A 4F6RB 4RPGA 1ZCBA 2VHUA 4MVJH 3U9LA 1T0PA 4US0R 1GL7A 3GPCA 4UBJA 4IPTA 1R0XA 3BL6A 4XSVA 4V1CA 4CLXA 4A0RA 4MYCA 1BMFD 3F7NA 3SAJA 2VZ9A 2V7XA 4LV8B 4R1OA 5GPBA 1J23A 1RQPA 3LX6A 1VSTA 4MI3A 3QU7A 4RZUA 4NVRA 2XRFA 1O4VA 5EQFA 3VYVA 3WYGA 1DTEA 2RHTA 4I55B 1AMOA 5J3JA 3MUEA 4XFDA 4TWIA 2CUZA 3KCNA 1FDOA 3QENA 4J29A 1VDZA 1JJBA 2XGSA 4RH0A 2HA5A 3BVPA 3W77A 3C98A 3ZKWB 1KDZA 2EX1A 1ZGHA 3B48A 2AUTA 5E9WA 4ZJYA 5JDCA 1Q3HA 1YRYE 1YS2X 3H6HA 2QD2A 3U60B 3CUKA 4ARUA 3K2BA 3JAWA 4QPNA 4DV3B 3I6BA 5BPHA 2V7WA 2IQIA 4TWAA 3ZX5A 1O7JA 2C54A 4QDJA 3VSEA 1E2LA 4X95A 5AW4A 1QHGA 3QBTA 5CIQA 5L3ZA 4PYKA 2JAUA 4R1LA 2GS9A 3EEFA 3VM6A 3ABZA 1KI1A 4DPLA 5KYXA 3AUKA 1NNSA 1ECCA 4GWKA 4K46A 1Z5PA 5IBQA 1M54A 3IUPA 4YDQA 3OI7A 1B1CA 3K09C 5AOCA 2F3PA 2XZOA 3A1DA 3P5BA 4C6TB 3OE5A 3NWJA 1QHHB 2ZYSA 3KKQA 3OESA 4GOMD 3CEJA 5ENZA 1X7HA 4ZVSA 1N2ZA 2R11A 1JHPA 1VYHA 1WY5A 3E3NA 3O8LA 4I8IA 2WIBA 4XB6B 5DM4A 3TEFA 1EFLA 3W5SA 1SCBA 1XT6A 2BRUA 5DXAA 3H1EA 1ZUD1 3DZHA 5JI3E 2VHQA 4O4LB 1T9KA 2BSXA 3NC4A 2ZXFA 3V34A 3LW7A 2DWUA 3NRJA 3QI7A 4HLDA 4WESB 4X0EA 5EJGA 3RS7A 3VPGA 1AC5A 1D1PA 3EHEA 1MEOA 3KB2A 3HXPA 3QVJA 5DGCA 4ZVLA 5LLSA 2X0FA 5JAOA 5K2OA 1DIGA 1CS4C 1UQRA 2MT9A 4QQRA 2QJFA 2P7IA 4JP1A 3FYUA 3ER6A 4L0CA 4RLQA 4MPDA 4G8JA 3PHCA 1VLZA 3RH0A 4F45A 3G0CA 4UNIA 1JU3A 3OHSX 4BPRA 1RWVA 3CCBA 3EH1A 3WKCA 4QL3A 2YNMD 1QFYA 4D5GA 1OWOA 2QB5A 4F06A 2WRZA 3GLGA 3KXLA 2Z1DA 2I1WA 4NG4A 5L51A 4M53A 2PH3A 4TKUB 1V1RB 3U3JA 1XQYA 1NX6A 4N39A 4TTAA 1E1KA 2ZUFA 2RAFA 2NM0A 4OJTA 5IT9A 4R01A 5K0NA 4B76A 1TO2E 2GJAA 1MAHA 4FE4A 2O4UX 3ILSA 4BZWA 1NVWQ 3AP1A 4WI1A 1Y89A 3EUWA 2D5CA 4LX8A 1NWCA 4OMCA 2V54A 4CHGA 4ZK6A 3DMTA 5ALNA 1JKIA 1O6CA 1QDEA 1RQRA 3AG6A 4MUJA 3RS5A 3U7FB 1CEYA 2JFZA 1LLCA 1USVA 1T1GA 3CX8A 2M2IA 2WJIA 1XZDA 1U1CA 3PXUA 5HNKA 1HE4A 1HOTA 1RRMA 3HN7A 2EF0A 1ZJWA 1IE3A 4LNHA 5JQGA 2Y1FA 2YJ6A 3RFCA 1FMTA 4BNTA 1OH7A 1LSUA 4XIIA 1JMYA 2EW2A 2ZSUA 3SC3A 3FOBA 3H9BA 4OXRA 1U0NA 3NNNA 1K6JA 1PKXA 2R00C 2ZT8A 3GLHE 3SZOA 3ROEA 3DS8A 4AXBA 3AHDA 5T57A 1IZ0A 3ETDA 1MO2A 5FA6A 5LP6C 4FC7A 4CTJA 1Y34E 1A98A 4F71A 2AD5A 3B13B 1IXYA 2VHCA 4R2HA 1II9A 5JAUA 2KYRA 5JO0A 4KR3A 1WPXA 2E9SA 4HRXA 2FTKE 2OV2A 4UU8A 3W5CA 4J0DA 1UOQA 2YIMA 1Z2EA 4NTZA 4JIGA 5NLLA 1QIEA 3T4UA 3FR7A 2QQFA 1NJ5A 1KI9A 1F14A 3V4LA 4IIJA 3L8GA 3K32A 3B1FA 1G16A 2BV3A 3VU8A 4WACA 3LUKA 4C0LA 4JU8A 3TLJA 3WQSB 3H8SA 1XEXA 4LDNA 4RF3A 4ALNA 1NVFA 5HSGA 1P2TA 1JU9A 1Q0ZA 3ZHSA 3PLAE 2OPHA 4HEA6 4MR8B 3OFNA 4ZVPA 4K6OA 2BMDA 2NXWA 2RH8A 3E8XA 3WZLA 4BO9A 1UIMA 5E4YA 5HF9A 5IASA 2B7LA 3DWEX 4PM4A 2WF9A 3SQOA 2IYNA 4ND1A 4C07A 1X39A 3HY6A 1P7YA 1EXVA 1HDXA 2WIFA 4X85A 3FPBA 1U3UA 4DF3A 3ZU5A 4JC5A 2W2NA 3A10A 5FWXB 4R8MA 1EWRA 4J91A 3PHGA 3WLAA 3BWDD 3GGOA 5GONA 1RHJA 1RRVA 1X2BA 4AZTA 2FEMA 5CJJA 5A0TA 4DIBA 1SULA 1WUTA 1M8KA 4DWJA 1EDBA 3HL4A 3ZC3A 3D8BA 4U6QA 3HG7A 2Z8YM 4YRRA 4H7HA 4ILKA 5EY5B 3V42A 3WHPA 3WKAA 3P96A 2B5OA 5FKJA 1Q0HA 3OO0A 3R77A 1ABFA 1JU4A 1N0WA 3BIXA 4OHRA 1U2SA 4PYOA 1PT7A 4NV3A 5ADVA 2C5BA 2RFLA 3PTLA 2GN1A 4EG0A 2VQDA 1W1IA 4FS8A 1FYVA 1DOZA 1UXHA 3AP3A 4BNDB 3PDIB 2ZTLA 3AVPA 4D6YA 1P44A 1ZJ6A 1G17A 1YI1A 1PGNA 1XRJA 3TVTA 5EESA 1NNEA 3OICA 2Q3FA 2GK3A 4O4IA 4A0GA 4R8VA 3OQJA 3QF7A 3A3KA 2G6BA 1SQGA 3OIVA 3RU3A 1XZMA 1LX6A 5E95A 2I8CA 2ZRGA 3K6JA 2NT3A 2WW8A 1T4CA 2VP4A 4FR0A 5CD9A 2HJSA 1WOYA 3QLJA 1EFTA 3OOJA 4ID9A 1E2JA 1N2JA 2I2CA 4ZAWA 1I6WA 4KLCA 2ZZNA 1EWKA 4RTKA 3LRTA 1XL1A 4XFJA 4CKCA 3QX7A 4Z7QB 2Q4RA 2UAGA 1G8PA 2FEOA 1GD1O 1DAFA 4RSRA 4XD7D 4MV3A 1DAIA 5FTLA 1WEKA 4B6SA 3KSUA 1J21A 3IUNA 4UHHA 4WN3A 4RESA 5I4KA 4FQ8A 1K7EB 1E3WA 2NU9B 2NU8B 3KLOA 4NS1A 3T9BA 2Y8EA 3TAXA 4YRFA 1E92A 4KPFC 4JR2A 3O93A 5A3VA 1SZCA 2H5LA 3NBZC 4NYIQ 4CXMA 1A27A 3OWHA 3T9CA 3N8GA 1N7JA 3HJCA 3LC1O 2OCIA 1RLMA 4GLOA 2QV7A 1NUTA 3V1MA 2XNKA 4I1VA 2YVAA 3KEQA 3EVFA 1G19A 2E5FA 2C1ZA 2I71A 3N8HA 4L5AA 1K63A 2ZPTX 3S2IA 5C5DA 2HAEA 1EIZA 4IG4A 1IM5A 4MPTA 3DE4X 1U28C 1VG9B 1OLSB 1VZ3A 5TQ2B 2GEDA 2AZMA 2VHWA 1J49A 1Z6PA 3VFDA 4XKJA 2FRDA 3DT9A 2ZAYA 5G4KA 5C8DA 3MA0A 1IONA 3LCRA 3THOA 4BQFA 2OVFA 5A3JA 2PIAA 5A4KA 2V59A 3MJ4A 1UJ6A 1JXOA 4IVQA 5AXBA 4ANFA 2GYYA 4J75A 1PR9A 4F9FA 5C8VA 1PAUA 2ISQA 3HHEA 2ZPUA 4PZ0A 1QO7A 2GFQA 4MRPA 1JHVA 3CEAA 1E64A 2D59A 1UPCA 3HYSA 1W1WA 3JPWA 2OCYC 3W8RA 4IXDA 4JHLA 1CRLA 4INAA 5IMSA 2FV8A 2ODEA 3G2KA 4Q00A 2DWPA 2XCUA 3UCXA 3KZXA 1B74A 1FBTA 3R6WA 4GX0A 4Z8XA 3X2FA 1VIVA 2BD0A 3R0JA 1KC1A 2PU5A 3V6MA 2CEAA 4EZBA 2Q4EA 3PYXA 5A03A 1Y8RB 3O8QB 2K2QB 3K70D 1NQVA 4MAFA 5GZ3A 4IJ6A 5DV9A 2GNOA 4ZWNA 4B6RA 1B6GA 2PWZA 2BGKA 4QGAA 2ZB4A 2HJWA 2HBRA 4AW9A 5JQGF 4HV4A 4XUGB 5AKHA 4PLPA 3DO5A 1NDUA 4EK9A 4UDOA 1LRLA 2ILVA 2IUSA 3I4LA 5AW3A 2HBYA 4N0QA 1XLUA 2P4SA 2XWQA 5FLKA 2VWPA 1TADA 2JGAA 4GPD1 3R7WA 1B76A 5TQVA 1KQNA 3Q7IA 1L9KA 3L02A 1YBFA 2SKCA 4FIZA 2JATA 4J6FA 3SKYA 2A1IA 1WUIS 2G25A 1KF0A 3HZZA 3NS7A 1QWSA 5AR1A 2R1ZA 2OHHA 3VVLA 1PHRA 1ZR2A 5KYWA 4DSOA 3D3EA 4IIJF 2XE8A 4LFCB 4FYWA 1P74A 3TUIC 1V9CA 1NAIA 5F23A 4DR4B 3I12A 3R5HA 3VR6A 3NIDB 1X70A 4B46A 4DRZA 4DR1B 4C6HA 2G9VA 5D87A 2VN8A 3JW8A 4ZVUA 2WSSD 1AS2A 1BCSB 4CQMB 1OZGA 1QXSA 2UZ1B 3AWIA 2GK4A 3BTUA 1MJNA 4MQ5A 1YVEI 4QECA 4FFRA 4MGHA 2OXCA 1TXGA 2CLHB 3PFIA 4P82A 5CGQB 5EOVA 5C52B 3HMKA 2GZHA 3ESRA 3K0CA 3IV6A 9ABPA 1EWQA 1OT5A 4PTYA 3DBHA 1J2JA 4K9NA 2IV3A 1ZGZA 4ZDKA 3WKBA 3NIBA 2PUVA 1D0SA 2VT2A 3ZD8A 2FF7A 4XQ0A 1Y3IA 2Q3BA 2FE1A 4AI6A 3KB6A 1VL2A 1E77A 3P2KA 3ODPA 2ODAA 2WQZA 5LWQA 4HPWA 1UJ2A 4M0EA 4O2AA 4YRKA 4A23A 3CBGA 1ECGA 3D54D 4LOKA 5GONF 1YR8A 4XYBA 2D2FA 1XDGA 1A2KC 1T35A 5ULLA 1IK6A 1VLQA 5DNVA 3C1AA 3TZHA 1GL6A 1T3ZA 1H1DA 1BS9A 3QM1A 2DH6A 3ZTTA 2IPOA 2MR6A 3VGJA 2QNBA 5EERA 4BLOA 3BH0A 1EWYA 3IEXA 4QWMA 5TLSA 1IXRC 2YJ4A 1PTJC 5AHXA 3N8KA 1C7JA 3PCRB 3I1YA 3WP0A 3PPVA 3Q8XB 1T3LA 1U65A 4LQ4A 4O4IF 1YA4A 2HJ9A 4PGFA 3I9LA 4JOCA 1GA4A 2C8JA 2IHBA 4QJ4A 5DGIA 2WPDA 2FP4A 3BH7A 2XDWA 2WZBA 3K35A 3ZK7A 4F11A 1EINA 3SC2A 1RXEA 1W0CA 3TIXB 1AQUA 2AKAB 4UMVA 4UPEA 4WX2B 1SKMA 3ZXYA 1OLOA 3L05A 4WH0A 2PT9A 4ZRMA 5B7NA 3HYCA 3PNKA 3TTYA 1IY2A 2FPXA 1VKHA 3QOXA 4P4NA 3E82A 2O7NA 1W46A 4Y6GB 4L5CA 1CR4A 1KZYC 5AOBA 3K2QA 4DTCA 3DKPA 1DQPA 1JFFA 4WV3A 5J4KA 4PY2A 3AZPA 2DHEA 3P0RA 4DSTA 5IUJC 3AW8A 3EUAA 1OWLA 1UKAA 3RUDA 1EVYA 1AUXA 1KYYA 1YMVA 4GZMA 5DHTA 3TW4A 3EVAA 3KZNA 1A69A 2GR9A 3M82A 1H2BA 1J25A 3QA3E 1FVFA 3DWIA 1RHMA 2VUUA 1HUQA 1PJ8A 2JRLA 1IN5A 1RWWA 2Q1XA 4IV5A 2CCGA 2JVJA 1I5RA 1O9GA 2PA0A 1AX9A 1UT8A 2V5UA 4J16C 1GQ2A 1MQ8B 1RYFA 3T3GA 3BYZA 1B2LA 2OHOA 3FDIA 3NGXA 2ONJA 3GMSA 1DU4A 5FOUA 4D0GA 1S96A 2XTZA 3ZQ6A 3A25A 1O1YA 1P9OA 1R0CA 4TYPA 3IYLW 1C4XA 4BZQA 3QVLA 1E5XA 1CJCA 2ZRAA 1IL0A 1G7SA 4HD8A 3TX2A 2AYYA 4OHWA 4B45A 3DC2A 1Z15A 6YASA 3DE2X 5EJ6A 4KDRA 5K05A 4QA9A 1CQWA 4RD0A 3VYTB 2HMWA 1X74A 3LCUA 3M5DA 4PE5B 4YA6A 4ONEA 3WDLA 4CI9A 3WLPA 3JQRA 1X7YB 1VKJA 4URFA 5L3SA 1NMSA 1Q92A 4FUTA 1W8IA 1CJUC 3BOSA 4WUTA 4DC0A 1KIMA 1Q7TA 4EY3A 2A14A 2QF7A 2B4KA 2V7BA 1DXHA 1PFQA 3G2HA 4RV4A 1RXIA 3ENKA 3K0AA 2W6OA 1CULC 4CMIB 2X0EA 2EL9A 2IEBA 5ICMA 4JYAB 1TK2A 2ACVA 2MSKA 3DP9A 3I5MA 4PRKA 1YL6A 2HXYA 3DAHA 3BFJA 3PKIA 3WGZA 4O3MA 4B79A 4G9BA 1NW8A 2FEPA 1L8LA 2YYYA 4OBBA 5IAAA 2BONA 5F2KA 5JJ5A 4JXZA 1LU9A 2W48A 4YQEA 1CZKA 2PX5A 1DO8A 4HMOA 2GZAA 4KB5A 4DV7B 1MABA 5CMLA 5E7MA 2FUNB 4NNPA 3EVCA 3JRNA 3CXRA 4L5JA 5KOJA 3LX5A 1AA6A 1FX0B 3DB1A 3DEIA 5BSTA 3WIEA 3L7DA 3UQYS 3PWZA 3ZDRA 3NYWA 3KAKA 4KAFA 2PFSA 4LQCA 3MVEA 2G1AA 4RC9A 4YV2A 1JA9A 2O0JA 4OI2A 2X41A 2YVKA 3GCDA 5J2UF 4AJIA 3U13A 3TW0A 3T7KA 1T2VA 1SY7A 3AVQA 3TOSA 1QVVA 4G0VA 3VPXA 2INGX 2QZ9A 2VF5X 4DLUA 3TSWA 2ENWA 2EZTA 2RH4A 3M4XA 2KX7A 2AOUA 3NWEA 3PUJA 3T5DA 4ZJZA 2JFFA 3R5TA 4JJ8A 2P1ZA 2Z4RA 1R1DA 2PH7A 3PC6A 4GT1A 3UKOA 4Y6QA 4Y6PA 1F48A 3EA4A 2R47A 2OXEA 1BMQA 1RJWA 4FSHA 1OCEA 1RKUA 3D3WB 4KZKA 3OA2A 5H8WA 1OFUA 4LJ4A 1Z0SA 1GU0A 3T1VA 4KJXA 5BW4A 2FSSA 4NZPA 1RZUA 3PCXA 2H3HA 4NBWA 1LTHR 4FILA 4CM4A 3L4BA 2BFEA 2HCTA 3J81A 1HYBA 1LI7A 1QDUA 1PS0A 3BHNA 3HJGA 3NATA 5DT2A 3ZJ4A 4E31A 1JBEA 2RGGA 3QFCA 3U4GA 4D4MA 4YLYA 3RIGA 1KSGA 4Q9LA 4DARA 4F2HA 2OPBA 3DEKA 1V7CA 4O2AF 4DUYB 3D4PA 1EVQA 4WCFB 3KTAB 5FP0A 1F2TA 3U7QB 5IYZB 4RK7A 4ZOEA 2P6RA 2WWWA 1D1SA 4X54A 4H08A 4L76A 1WCIB 3U3XA 2TRSB 4A10A 3AEXA 3A4TA 2QWXA 2J32A 4XSGA 4Z49A 1P5RA 5IZCA 1P80A 2YHSA 4N54A 4DZTA 2JASA 2IC5A 4CIWA 3EYWA 3A2LA 2FK7A 1TAUA 3KR0A 5B2EA 1WXFA 1QTRA 1UPTA 3OAAD 4FB4A 4NE2A 5DLYA 1L4HA 4J0IA 3UGQA 5AW8A 2O8CB 3E9EA 1MC5A 1CZUA 3DYVA 4P3PA 1OC2A 1TECE 3ZDZB 2FMHA 2FYTA 3TXXA 3K53A 5BR7A 5IN4A 3QI2A 4EYEA 3KQLA 5D85A 5KTYA 3JQFA 4HH0A 1JA0A 1LB1B 2AN4A 4QBIA 5ENDA 3S8MA 3AM1A 4G97A 4E7OA 1U0JA 3E6AA 3SPXA 1MV5A 3SZ3A 4OQXA 1IEQA 1VMDA 4J0QA 1MORA 3RAJA 5CFMA 2VJQA 4UJ3A 1T9GS 2C0PA 3WV4A 1V11B 2HFKA 4B7UA 1ADBA 1M8FA 1S3FA 4EGSA 1Y98A 4I9FA 5CFQA 3ZDAA 2Q9UA 2RHGB 5L53A 2I7XA 3QFRA 1B7GO 1K0FA 2LV8A 3NTLA 3AIOA 3BQMB 2W2LA 3EIFA 1T5LA 3I9NA 3EFOB 1ATIA 3DCIA 1ELOA 1F2UB 1LRJA 2NTVA 1I1OA 4OAPA 1LPBB 3UVEA 4YP7A 1ZH8A 2C2XA 1M6VB 4MP3A 3S40A 5E1DA 4GSKA 5KVQA 1DE0A 5DKFA 5KBYA 2JLSA 2A5YB 2JCYA 2IDJA 1NYQA 3GF4A 1GL9B 1ZFNA 3T7EA 2P9CA 10MHA 2E55A 4KXMA 5CX1A 1YMQA 2XUGA 4JA0A 4Y6SA 4RGQA 1Y3FE 3L1UA 5JYBA 2C78A 3FKQA 3ML1A 3UATA 4ZIRA 2J45A 2Y0DA 5I7AA 1I14A 1DFGA 4J2OA 4WAUA 3IDAA 3C15C 2FZEA 3PC4A 3RVDA 4A0FA 2I6QA 1EA5A 3LO5A 2PUAA 5EMNA 3TXAA 3W6UA 1D6JA 3OBBA 1GZ6A 1OZAA 1T5IA 1FYFA 3LAWA 4RDHA 1B3RA 2HTFA 2CL6X 2VJPA 3GCXA 3QVOA 3NRBA 4K88A 1OLUA 5I4CA 3QSGA 1M1NA 2XGOA 1K88A 4LNAA 4CQLA 1KTVA 3DULA 4K9DA 4FLFA 2FWRA 3TL2A 2C0CA 3FUXA 2J3LA 4LNUB 5LZ8A 3C39A 2C7OA 3AILA 2YTZA 4XM0A 1HDIA 3QWAA 4BRWA 3OBIA 1XUOA 3UICA 2Z8YA 1ZITA 3KZKA 4A8JB 3OKPA 3RC1A 4CEHA 1I5EA 2Q5JA 1BFUA 4R71A 3EAFA 1GYRA 4DABA 1TO6A 3FLEA 3SJ7A 3OLQA 2EBFX 4J6EA 3WHLA 3HCOA 4ZANA 5E3JA 4AQDA 2YV4A 1N5MA 3TSCA 4D57A 3ST7A 4R1TA 3UUFA 2G1PA 1XJ0A 1IU9A 2NO4A 1K4MA 3LT0A 3Q98A 3ZUGA 1BS2A 3OY2A 1AQIA 1DEKA 1GCIA 1Q20A 1ZJ5A 3UWPA 3C14C 2H6EA 3TRJA 2VWHA 5CLJA 3MTAA 4KQGA 1W4RA 2PMWB 3BJMA 4QQNA 5EE1A 2PE5A 2I78A 1CUZA 1V1MB 3QKRB 3QV2A 2EGGA 4B3TB 1TQ2A 2WWHA 2BFCA 3VPCA 2PRJA 3X1YA 3PUXA 2V4MA 4DZZA 2JVKA 4MIEA 3CG0A 5ICCA 5FBWB 3GJQA 4UXJA 2R5WA 2PCJA 1SU4A 2REQB 1HYHA 1GR0A 1NN0A 5HFJA 4JL8A 5GM2A 4L0MA 2XD9A 2XE4A 4NBTA 2JIOA 2Q3HA 2YOHA 5I9SA 3VR4A 2AMVA 3FG9A 5B58C 4A9AA 1G38A 3CT4A 3GNTA 1CE8B 1Z25A 1SKYB 1GDTA 4CFZA 1ZH4A 3U9SA 4TROA 1QZTA 1S1MA 5I4IA 1TM1E 3K8QA 1VYTA 1XTTA 4O02B 4OFWA 5DSZA 1E79A 4EY5A 3QX3A 3Q41A 5J47A 5FV4A 5AKIA 1QRUA 3KFXA 4BNGA 1DX4A 4EA6A 4EENA 1HNNA 2L69A 1C80A 3UB2A 5BMOA 4CEIA 2XF2A 3KQPA 1P4RA 3WGJA 2GN2A 4D74A 2AG6A 3JQAB 3TTXA 3LA6A 3OZUA 4JEIA 4P22A 3OPYA 4FI3F 4PPYA 5FLEX 2JNWA 1ZI6A 3ZZ0A 4D3XA 2F4NA 1KBOA 2GH1A 3CURA 3S2SA 2B35A 4YUWA 5I7FA 3FOFC 2DT8A 4HAVA 4GBJA 4ISCA 4QAJA 1BD3A 2DXIA 3AR8A 1QQ5A 1H1LB 2Q6LA 4MUXA 2WFLB 1MX9A 3GNSA 3N87A 2F43B 4Y8VA 1XKLA 1YRLA 2DTEA 2ZI9A 3LDAA 1JYFA 2QR5A 4NRDA 2DTDA 1G21A 2PSDA 2JKVA 3CF6R 4OB8A 1N33B 1PFWA 4B6FA 5EZ6B 4KK3A 4BVEA 3RUHA 2CWWA 3RVNA 4H27A 4OJYA 4M9CA 3WZMA 2V7EA 2H1HA 2X0DA 4ENSA 3ZU2A 5I51A 2FPGA 1EFVB 2WWFA 4REQA 4I2VA 2H29A 3W7AA 2OOKA 1TYAE 3OEYA 3CRW1 2YXLA 4ZT7A 3O8RA 2CV0A 3HZHA 4FKMA 4KMSA 2EZ9A 4UW9A 1JIXA 1QP0A 3CZMA 1SVSA 3AFNA 3KCQA 4MQFA 1F51E 3DNMA 2WWRA 3EDMA 4R05A 2YFYA 3SCZA 7AT1A 4D42A 1PZGA 3T3PB 4BBPA 5EGNA 1GZ3A 5BWMA 2C04A 3F6PA 4YK7A 1HYGA 2Z5GA 2CMKA 5AP9A 3WMWA 5KYUB 1MKYA 3EMBA 2YN4A 2P9YA 1TFUA 5K0GA 1PEDA 4QC2A 4RJJA 3BWXA 2XWPA 5FJJA 1TQDA 4D44A 4U39A 1V5WA 3O4JA 1H69A 4MB6A 5BOSB 1W36B 1ZHOA 4X24A 4IH1A 3VR6D 4CKYA 4EBBA 1MNAA 3INYA 1E61A 2Q5QA 2IYOA 1QZXA 2EG5A 4QTZA 2IYPA 3U6BA 2XBUA 4JYBA 1NF2A 2HWYA 1LSJA 4B0PA 4IDOA 2WR8A 3ZS9A 5E0KB 2YWJA 2YRXA 3QYJA 5FV7A 2NUPB 1JDUA 4FFBA 4BAUA 5F9FA 2GD6A 4OXYA 4U7WA 3DFIA 3MZ0A 4E94A 2XRZA 4Q7KA 1SXJC 3EVGA 1K1EA 2JH3A 1JE0A 4F3CA 1TRKA 1W6RA 2X5XA 3DW1X 4NJEA 2NU7B 5ERXA 1Z18A 1T4GA 2YUIA 3CBQA 3Q85A 2D5AA 3BWMA 4FDVA 4DLLA 3G7UA 3AY6A 4E08A 5G0UA 4ZEXA 1JR6A 3TR0A 1QHFA 5FHQA 1B6TA 3JWEA 4ILEA 1UP7A 2DECA 4S24A 3SMQA 3JYNA 3U4CA 3EZXA 3UAYA 5C2JB 5ARDA 1MIOB 2XUFA 2D0OB 2RHRA 3KKMA 4DDTA 3UBTA 2SHKA 1S4QA 1VL1A 4PQRA 3RAFC 4LY9A 3A4MA 1MH1A 5FNZA 1PNTA 2MTBA 2WSMA 3ZBUA 2CDRA 4XCXA 2ES4A 2DFVA 2YFQA 4IIBA 3SDBA 4D0NA 1A9XA 3B60A 1SXQA 5DI3B 2VXCA 1ZG3A 2JGMA 3V9AA 4J03A 5K3FB 3O4RA 3CVJA 3OLYA 4YI5A 3QX9A 4IUCS 3RRNA 2BEJA 3NQ41 3EVDA 1UEIA 2FW9A 3KBBA 1I4EB 3VR3A 2HSEA 3RRZA 4V0MA 4XDZA 1JDNA 2X15A 3CR8A 3SN6A 4DCJA 4Y2QA 2WFAA 2DERA 1I51A 2VPWA 1YZGA 2A0YA 2ZJ8A 4Y2RA 3R3YA 3FZYA 2OCAA 3SG0A 1KEZA 3ZV6A 4EYKA 2B94A 2SBTA 4DT1B 3C0KA 1KPIA 3I30X 1PCXA 1DJLA 1QK3A 1BMTA 3EDRA 3E7FA 3Q4GA 5DWVA 4X84A 4PHCA 1Y8QA 3ZE8A 1Z4NA 1HMYA 3EGCA 4HK4A 3PJRA 4GOOD 3TQTA 4ABYA 1J5EB 5SZIA 3USES 3BAZA 3ANSA 3HI6A 2HGZA 2R1VB 3R76A 3TM5A 4F7DA 3QOFA 5I4BA 5L45A 1JX6A 4NR0A 3S7TA 4AQ7A 3LZ6A 3SBEA 5EXTA 1NZDA 1U6JA 4FNAA 1W35A 1W9HA 4N8SA 4EPRA 2QLJA 4DMUB 5AM3A 2QGFA 4A7PA 2AOTA 3WNBA 1D8AA 1MEEA 5HF8A 4FONA 3SMVA 2G72A 2PLAA 2DFKB 3I3SR 2WV9A 4NATA 2QX6A 4NULA 2W6NA 5CHEA 3ZCPA 4TYMA 5F51A 5HYVA 2XXAB 3AYXB 1UOEA 3CF0A 1T4DA 4OTZA 3QVWA 2BLLA 3JZDA 1XTBA 3L6RA 4DIDA 2IHUA 2Z6VA 4K9KA 3MTDA 4V0NA 1JI3A 1Y6JA 3GJ6A 1TYZA 2Q5EA 1KK1A 5JMPA 2FU5C 1HY3A 2Q1SA 3BMNA 1H5UA 1QZ3A 1U9IA 2ZI4A 3EIWA 3G1UA 1L5MA 2EKLA 3PKZA 3FOWA 4GXRA 4QUJA 3UAVA 4PLYA 4IRMA 1RPAA 1LK5A 1ZONA 5B6JA 2XCSB 3EZLA 4ZCRA 1GADO 3GEMA 3CRQA 3AHIA 1JHZA 3AL3A 3IP1A 3LF1A 4Q03A 1XD2B 1PNQA 3JQGA 2BEUA 4YAUA 1A5TA 4LRQA 3BHMA 4UMEA 1PX2A 1LBHA 2VBGA 2AD1A 3GB9A 1U3FA 2Y1CA 4JYCA 4LOAA 1C8KA 4AZ3B 2RH5A 1N7GA 3NHYA 2VYNA 4DIUA 3O7MA 4YMGA 2NSHA 1W19A 2A3NA 3R5XA 5COBA 1Z38A 4WRRA 2W6JA 4E09A 4YN3A 1RC8A 1UMBA 3DAYA 4RFSA 3OIWA 4UBNA 4YROA 3AR6A 5D01A 2JAWA 1HQCA 3TUJC 5BR1A 1UL1X 5CFZA 2RHOA 1XRRA 2NO0A 1XZJA 4ZAYA 1RYYA 3LY7A 4M9UA 4YV7A 3EQ8A 1S2DA 2Z2IA 1TMKA 5B7PA 3OWOA 5AM4A 2B4RO 1BA2A 3JZMA 5BXYA 1MGOA 2E3JA 1ONBA 3VNBA 4OY3A 4EDFA 4JI4B 3D59A 3L6EA 1AHIA 2KW5A 3RAGA 4FEEA 1OPXA 2NO5A 3HZRA 4WT7A 4EELA 3NWOA 4XUDA 2RGAA 5H3LA 4CDGA 3WAJA 4ZZ3A 4PG7A 5T4BA 4DCGA 3I2YX 2EHDA 3L82B 4F2GA 1B43A 5C1BA 1AK2A 4UXIA 5T4EA 1KOLA 1KSFX 3K4QA 2RAVA 6GPBA 4FFSA 1VYVA 4W82A 4EI8A 5CJPA 1EGVB 1FP4A 4ZI7A 2C92A 3NGMA 4KO3S 4EATA 4EEZA 1UDCA 4KGZA 1Y9JA 2G82A 3X2SA 1TJPB 3FA2A 4BECA 1SKBA 4HB3A 1AS3A 1G2QA 1S0UA 2PZEA 1GXSB 2PBFA 4R3UC 4Y2UA 1CIVA 1R5BA 4PO8A 2XD4A 1ZUNB 1QK4A 5BRNA 5KTKA 2ZTHA 3RE1A 2AN5A 4CF5A 4RVFA 1EVZA 3L7KA 1F5NA 4FMBB 1RLOA 4URUR 2OWDA 4HG2A 3JWJA 5FPYA 1S01A 5DW0A 3ZHBA 4DMHA 3N0XA 3ER8A 1KMMA 3TKLA 2GKGA 3QEJA 4WE3A 3H3XA 3JD0A 4N3GA 3GZ4A 2UUCB 1NFRA 1P0CA 4UMDA 1XAHA 2IZ0A 3KU4A 3GY0A 3HDQA 1Q0TA 3DMFA 4P86A 2R8XA 3W5BA 2WTBA 2Q7DA 3PDWA 1EB8A 1NSYA 1XA4A 3B82A 1GUDA 3AHHA 2HRQA 4TWJA 5BN4A 2DWQA 4NENB 2ORIA 1RJDA 4YBZA 2PUWA 3PXAA 1JG7A 4BNZA 1MRSA 2JHFA 3GFTA 2G0TA 3TRFA 2IV2X 4ZKEA 3WMEA 2HK6A 4K6CA 4G8CA 1KQGA 4C5CA 4YR9A 1FRFS 1N0UA 4UM9D 2NT4A 1PLKA 4L9AA 3EGEA 4M9QA 4UU1A 4H3SA 1GRCA 2FW1A 1E4EB 2W6IA 3HJTA 2Z56A 4ZHQB 3E81A 4N3BA 2PG3A 1MFZA 1DKOA 1RBMA 5T6BA 1EHYA 1SBNE 1ZINA 3I83A 4N0DA 2ID7A 3B51X 5IMBA 1VZ2A 1AHHA 4GZ6A 5AK4A 4EGQA 1ZKDA 4P9NA 4ZDJA 4H77A 2XDQB 1KZ7B 2VXOA 5JV5A 4R69A 4TMVA 4W7HA 3R40A 4RUKA 4DNFA 1AU9A 2A9VA 2N1MA 4EHLA 2ZVDA 1GZ7A 2FZCA 4DA9A 3TVDA 1SVKA 3FNRA 2V9CA 3FIUA 1UP4A 3MWDA 3PQ8A 3K3PA 3N2EA 1VI6A 1Z5ZA 4EO4A 1O95A 5LVAA 1SURA 3MTEA 3BFXA 1I80A 4UE3S 4UNNA 1D2EA 3HB7A 3WYBA 3GLFA 3WWYA 1KK3A 1A1VA 1PG2A 3CNEA 2DLNA 2WNIA 1SU6A 1MB4A 1UMCA 2JBAA 2X3YA 3K9CA 4UAVA 3BSSA 1RQNA 2FDCA 2OK8A 2QXTA 2IDKA 3AJ9A 1AGNA 4QATA 3WLQA 2X58A 3M49A 1OE0A 1RZ3A 2PRYA 4F9GA 5B4VA 4DCPA 1N5IA 4N41A 2ZUUA 2ZRCA 1BS1A 2RK3A 2ACWA 2W2MA 3ZWQA 2BEWA 2XF8A 3E84A 4M38A 3RSFA 1ZOLA 4YAOA 3OZCA 4E51A 3AEKA 4C6RA 5B1DA 1THTA 2IBTA 4N76A 3NXSA 3QLTA 4P7GA 4PG8A 1Q1NA 5JZVA 1LWNA 3U2QA 4OEHA 2EGUA 1YB6A 1JXQA 3K0KA 2Y0BA 4OKSA 3VTFA 5IXSA 2GZ3A 4Q39A 4DSZA 1JS1X 1N57A 4EJMA 1VJCA 1NURA 3PE6A 4KGXA 1AVTA 2FP3A 2XUAA 1Z4PX 1SUIA 1VJ1A 1YA8A 1QIDA 4IJMA 2AFIA 3RVPA 4R31A 2AWNA 3B52X 1FJXA 1V1JA 1V8DA 4PCUA 3EPHA 2P2ZA 4QWWA 3MT0A 5AW7A 4A36A 1GG8A 1G0OA 4WXPA 3RCBA 2VRWA 2W22A 2C5GA 3CQ9A 4GX5A 5DXJA 2UXDB 1XU4A 2Q9CA 1F12A 4Q1DA 2GAIA 3QHQA 4DEYA 3BB3A 1ODIA 5E9AA 1U7DA 5C4GB 3WGTA 4JEMA 2PWBA 1GEEA 2VDMB 3OJLA 4AKHA 4L8LA 3L6BA 3OQPA 5ELMA 4Y2VA 2PUCA 4I6EA 4J2HA 2GPTA 3D0RA 2G9ZA 3ANXA 1Q3KA 3W6PA 4BAZA 1NNUA 2GPBA 3HYNA 3TZQA 2QW1A 3LBYA 1NKVA 1U31A 3U81A 3FTNA 4WQMA 5E4JA 1CUUA 3ULKA 1OZHA 3LP5A 1YOVA 1G60A 2GWHA 3CNHA 2DGDA 4UPVA 1Y1RA 2E1PA 2PUTA 2YHIA 4KXLA 3GN1A 3F78A 4DJFC 1D1TA 2FSVC 1GTMA 3FSGA 3LHKA 3KWFA 4JL5A 4WOPA 4F6RA 1ZM4A 1Q7CA 5LZ2A 3DAOA 4QU0A 2IYEA 3DCYA 3HKBB 5TY0A 1BX3A 3V4ZA 1DIBA 1BAPA 5GJCA 4ZI7F 2PLRA 3EC7A 1RLJA 2ZKLA 1TVCA 2QG9A 5H4GA 2DMRA 3IQDB 3M5CA 4OUDB 5FBQB 3PI7A 2Y1GA 1PSDA 2QVBA 2O2JA 2I7TA 4G1VA 4H16A 4F2WA 2HH9A 5DISB 4I55A 4IUBS 2WFMA 1M76A 4BQIA 2FHSA 1IEWA 3N58A 3P2MA 3RK1A 3S55A 1S1CA 4QDKA 4UAJA 3TFWA 1PV4A 3K7EA 3F2VA 1KS2A 5F73A 3ZKWA 1ISPA 4D3DA 1SEVA 1J90A 1AKTA 1TVKB 2GAJA 4CIDA 3A1CA 4DBZA 1O94D 5EIWA 1JPUA 3UV6A 2AFRA 1VL6A 1W2HA 3ANYB 4B3HA 3NAZA 3HPQA 3L4SO 1BHQ1 2PUJA 3I32A 1A9YA 3K0SA 3T1NA 5LFAA 4UULA 1QCCA 4INJA 4P8RA 1A8SA 1UOOA 2OHIA 2ZCUA