3YASA

Hydroxynitrile lyase complexed with acetone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 98
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3yasA00
2C5FA 3LP5A 4O08A 1ISPA 1XLVA 1XZCA 4G4JA 3BDIA 3ZI7A 3WZLA 2ZSHA 1AKNA 3V1NA 4X90A 1CUDA 1E8DA 5FDFA 2XMSA 5EHZA 2JGIA 4UPDA 4Q3KA 2YYSA 1TCAA 4BE9A 5E4TA 3KOOA 2Q0XA 2B9VA 3SK0A 5AIBA 3H2IA 5AICA 5D3KA 5HF5A 4G9EA 3FBWA 5AKEA 3R3WA 3DLTA 3QYJA 4L0CA 2ZJ7A 2HA6A 1N1MA 2WTNA 3WL7A 2PL5A 2HRQA 4QWMA 3LLCA 1QTIA 1M33A 1H2WA 5A62A 3H2GA 4H35A 4E14A 3QPAA 3WI7A 4WFJA 4CG3A 1C7JA 2XUHA 4BTVA 3WKBA 3P2MA 1XZGA 4RE5A 1HQDA 1JFRA 4QLAA 4CCWA 3WLAA 1ZICA 3B5EA 1LPPA 4HVTA 3ZLUA 3HJUA 1R50A 3HXKA 1XRNA 2HA3A 2I03A 3G8YA 3G0GA 3NOXA 1SCIA 5LZ8A 2AJDA 1ACJA 5DYWA 3TGLA 5I7UA 3F96A 1K63A 2OXEA 4PQEA 3N2ZB 4X3CA 2PSDA 4KAFA 3ED1A 3G7NA 3ZLTA 2W22A 4EUSA 2XUGA 2B4KA 3FYUA 5AKKA 1ZJ4A 3I28A 2H1IA 1B6GA 3I2FA 3STVA 4QEKA 1BS9A 3CXUA 4H7IA 3ICVA 3R3YA 2XUQA 2HA4A 3AIMA 5CH5A 5C8VA 3O4IA 1JMYA 2JGEA 1IUOA 1MAAA 4N8EA 2OG1A 3V1MA 4WFIA 2RHWA 1QIKA 5K3DA 1ODSA 1WHSA 1MNQA 5AI0A 2C58A 4AX4A 3FNBA 5HKBA 5AO9A 2QM0A 4UBOA 4ZI5A 1ODTC 1UK6A 4MEBA 1CUGA 2YXPX 4BTLA 1TCCA 5D7BA 1R1DA 1XRQA 2GYWA 2H9YA 5AHXA 2CMFA 4G8BA 4B80A 4Q3LA 1U8EA 3NWOA 4UHBA 2B61A 3HRHA 5HK9A 3KWFA 2HM7A 1WPXA 4ZWNA 3A70A 5AI6A 1JU3A 3WWCA 4OD0A 4WCVA 1N5MA 1U4NA 1CIJA 2WHPB 3QITA 4CIBA 4J0HA 1CUCA 3RLIA 1E8MA 2WLSA 4KAAA 4MEAA 1JJIA 4K6KA 5KREA 2JF0A 1BE0A 5K3EA 1XRPA 4NMWA 4BC0A 3M83A 5ALNA 2QUBA 4OU5A 3KWJA 3I2GA 4UBIA 4OUKX 5E4JA 4B81A 2WU4A 3R3XA 3WL8A 4BATA 4KE7A 3FCYA 5JAUA 1VZ3A 4P92A 5K3CA 1HDEA 3H18A 3FLBA 1XZIA 3JYHA 4H0CA 1W1IA 1AUOA 1QIIA 4UHFA 4Q34A 2AJCA 4AQDA 4AZ3A 2OAGA 5A2GA 3Q8WA 4TPKA 4QDUA 4UHHA 3I2HA 3WK8A 3G9TA 5DTJA 4IQ4A 3EIOA 4W1SA 2ZYRA 1UK7A 3O95A 5T4BA 3ESAA 3M82A 2WG1A 2WIFA 2VJCA 4ETWA 2BAGA 3PUHA 1JI3A 5HF8A 5CW2A 3WQHA 4FFWA 1R9MA 3DCNA 1CR6A 3IDAA 1XLUA 1CUIA 3DL4A 4PNZA 3QM1A 1LPNA 4XWGA 4LHEA 5D6OA 5AI5A 3FSGA 3RKSA 5A7GA 3WL5A 1GPLA 2R8BA 3BL8A 3W05A 1DWQA 1YSCA 4WY8A 4LIPD 4KRXA 4N8SA 2QXUA 5T4EA 4GBGA 3BDVA 3SX4A 1E3QA 3A2LA 1XKLA 4BB0A 2DHDA 2V96A 2WUGA 5ALSA 2Z3WA 3GUUA 2XUOA 1PV1A 2DQYA 2WHPA 2WQZA 3C43A 2QJWA 5JYCA 3E4DA 2O2IA 4W1QA 4P08A 2PVSA 4Y2RA 4GXNA 1TKRA 1E66A 4P93A 1J06A 3OOSA 2PU7A 2JEZA 5AP9A 5JZSA 2DHEA 2H7YA 4RE6A 3I2JA 2DSNA 2ZYIA 4DMCA 3WYNA 2J4FA 3KXPA 4ZV7A 1UXOA 3C8DA 1OCEA 3T52A 2FX5A 3F9CA 4K5QA 1CQWA 4X91A 2DFPA 3H0CA 4HXFB 4CI9A 5ALHA 4G9GA 5AKLA 3IVMA 4MQLA 5CURA 1R9NA 2JGMA 4G5XA 2K2QB 2GBIA 4ZRDA 3PUIA 4NZZA 3L1IA 3WKAA 3F8SA 4H7HA 2B20A 1UFOA 1H23A 3I2KA 2YH2A 4ZGBA 3GA7A 4X97A 1XZAA 1CPYA 4UHDA 5DTIA 5C8ZA 2QVBA 3C70A 4KR0A 1VA4A 4F0JA 3A6ZA 3HABA 1QO7A 1T4MA 1VA5A 2GZRA 2EEPA 1MX5A 4BP8A 1AURA 2CBGA 1EX9A 4X95A 1XRLA 4M0FA 3BF8A 1P0MA 4LYEA 3D59A 5C8XA 3O4JA 3VJMA 5FRDA 4G4IA 2DHCA 2HRRA 2XUAA 5AKGA 5CT4A 3HC7A 1A88A 4DM7A 3EQ7A 4KE9A 2BUCA 3LIPA 4OB8A 3AINA 5E4YA 5I9IA 2ZJ6A 5AM3A 2VJDA 2J4CA 5FP0A 5AM2A 5AI8A 4A5SA 3WA6A 1YB7A 1OILA 1S8OA 4IHAA 3BJRA 1J1IA 4W9RA 2XDWA 1TRHA 2VAXA 1G5FA 5YASA 2HU8A 3H1BA 5AK6A 2QTBA 2CJPA 2C0QA 1IMJA 3O0DA 1BU8A 5DWDA 3QMVA 3ZWQA 3LS2A 1X70A 4FBLA 1FFCA 3WA7A 4EZIA 1WHTA 2QXTA 2JGKA 5E2IA 5AKZA 5KWJA 2OGSA 3AFIA 1JT2A 2CKMA 2NW6A 3QH4A 3ESCA 1VXRA 3NUZA 4QDZA 5K3BA 3FYTA 2H7CA 4G8DA 5JD4A 1LPBB 1WPRA 4LKOA 3R40A 1GKLA 3EQ8A 5CH8A 1SCKA 3MGAA 1LPMA 3EBLA 4H77A 1EA5A 3C8HA 4GECA 3K6KA 1CVLA 4I3FA 1U2EA 2ROQA 4Y2YA 1BCSA 3V1LA 1QFSA 2ZJFA 4C4YA 5JAHA 1DT5A 4M0MA 2PM8A 4Y2PA 4Q3OA 5BWBA 4W1RA 4Y2UA 1W52X 2BKLA 2ACKA 2Z8ZA 4CG1A 3CCBA 2VAVA 3C6BA 4X92A 4AO7A 3R3ZA 4HXGA 4DNFA 1EK2A 2Y6UA 1DWOA 1ZIYA 4KE6A 3IUNA 3DYIA 4PW0A 1UOQA 4OB7A 1BROA 2RIPA 3F98A 1YR2A 1E5TA 1X2EA 2O7VA 1DT3A 3WIBA 2GBCA 3KSRA 2PKYX 4TVKA 2EDCA 5ALEA 4B9AA 3VISA 1THGA 2X5XA 4K6GA 3G0CA 2BJHA 4AN1A 1IVYA 1FFBA 4DMKA 1EDBA 5IVKA 3GZJA 3HSSA 3D0KA 5EIAA 2ACEA 4UBNA 3G0IA 4L9AA 3JW8A 5HQ3A 2XUJA 3GELA 1VLQA 1XZMA 4RNCA 2JGJA 2PBLA 4K2AA 1VE6A 2VF2A 5IKXA 1CUXA 2J3QA 5AKIA 1XQXA 4N8DA 3DDUA 4PSDA 1K4YA 1USWA 2X76A 5DLPA 1DU4A 3M81A 5DYTA 4HS9A 3WWEA 4BVJA 1F0PA 3PICA 1L7AA 4FLEA 5KBYA 1QZ3A 3LIIA 4GLBA 1A8UA 3ESDA 2CEKA 4UBKA 2XMQA 3W04A 1EH5A 2VT7A 3G0DA 5ESRA 5ALVA 3BF7A 4KYVA 1CUWA 1CUSA 4AO6A 4BRZA 1W76A 2IX9A 5CRIA 4EA6A 4L72A 3WWDA 3I6MA 1RWQA 4BAZA 2QS9A 5HFNA 5JATA 2OGTA 4GDMA 3TRDA 1FJ2A 1YS1X 4LYDA 3SC2A 3QBJA 4BAUA 3FLEA 2OPHA 3DJYA 1HKHA 1ZI8A 1JJBA 3G9XA 4FOLA 1ZD5A 4QDOA 2AJ8A 1E8NA 1WB4A 3VKFA 4XVCA 5AOCA 2PPLA 2C0PA 4JH0A 5AH0A 4OU4A 1EVQA 5EGNA 5HF9A 2QMQA 5T4FA 2HADA 4X00A 2GBGA 5ALZA 2AXEA 2HA7A 3AZQA 1YA8A 2XE4A 4U2EA 6YASA 2I78A 4L3WA 3K9BA 1WB5A 1GXSA 1GPKA 2HFJA 1XZDA 4DTCA 1VXOA 4F60A 2V9ZA 3DKKA 5AI4A 4FBMA 2WHRA 5CMLA 5A71A 5DYYA 5IVIA 5AJHA 1XKTA 2XLBA 3C5WP 3WKCA 1GKKA 3ANTA 3VJLA 2I3ZA 1GGVA 2XUDA 4QDTA 1CQZA 1SC9A 1CUJA 1QIFA 1O6FA 1SCQA 4ARAA 3O4GA 3D3NA 1G4HA 1ZD4A 3HEAA 5CTAA 3GBSA 2RHTA 3C6ZA 3L1HA 4MXDA 4Y7DA 2DQZA 4G1FA 4BVLA 2X8BA 4OPMA 4U2CA 5LZ9A 1YAHA 2QKYA 1LPOA 4H7FA 2HFKA 3FCXA 1H2XA 3M3DA 3IB3A 2DCMA 2GBFA 2QRUA 1NU6A 1ZI9A 2XMZA 4UBMA 1ORWA 1H2ZA 4FKBA 1ZJ5A 4AO8A 4EHBA 1XFDA 3QZUA 2C7BA 2V98A 1R3DA 2RI6A 1VKHA 5I8PA 1E89A 3C6YA 1EK1A 5CH3A 2Y2VA 4Y2SA 3PE6A 4PV7A 1AX9A 4FNMA 4B85A 3GFFA 1T2NA 2PSFA 1QLWA 2ZSIA 2UZ0A 4BDSA 1ZD2P 1W75A 5AKHA 3MUOA 1CUEA 2WG2A 1XZEA 3VVLA 2WKWA 1LPAB 3IUQA 1EI9A 2XMRA 2WFMA 5ALQA 4AMZA 2XT0A 1XZLA 4WFKA 3AJAA 1ZIXA 1P0PA 1PJAA 1HLGA 4J0DA 3IUMA 3IULA 4UHCA 3IIIA 4AMYA 2XQJA 2JGLA 3WWPA 4QE3A 2HHAA 5LKAA 4J3JA 5DNWA 4N5HX 1WOMA 1UOPA 2WUFA 4XJVA 4A16A 1QTRA 3ZLVA 1YAJA 2IIVA 1BN7A 3KDAA 4F5ZA 4KACA 4FDMA 1LLFA 4ROTA 1EHYA 3OURA 1ZGCA 3AUKA 1EVEA 4BYMA 2PU5A 4OSEA 1HPLA 3GROA 4BCDA 5JZ9A 2HA2A 4EB0A 3I1IA 4I19A 4B0PA 2Z3ZA 1CUUA 1ORVA 2VQ6A 2ZVDA 2WUDA 4E46A 3AZOA 4Z49A 1XZKA 4FLFA 3E1GA 1CLEA 4H7KA 1UK8A 2BGRA 3BJMA 1J07A 2PSHA 3I6ZA 5AM1A 1UK9A 4C89A 3WZMA 2QR5A 4Y2XA 4AZ0A 5EI5A 4XIIA 2ECFA 4Y2VA 3I6YA 5ALTA 1OXMA 3D5EA 4Y2JA 3VXKA 5ISMA 3OTQA 4QA9A 4DIUA 1QE3A 4QDXA 1CUYA 2JEYA 2WUEA 5HKAA 5C81A 5AK5A 5JD5A 3QPDA 3G9UA 4B84A 2WFLB 2WM2A 3Q0TA 3V48A 1MAHA 4BBZA 3HACA 2DR0A 4S0XA 3S2ZA 3DQZA 3YASA 1VZ2A 1ZGBA 1CV2A 4B0OA 1WB6A 2XMGA 3ESBA 4UUQA 3LCRA 3H1AA 4BCCA 3BIXA 1L7RA 1A7UA 3TEJA 4MWTA 5ALGA 4J0GA 1MNAA 1UZAA 3IUJA 1R88A 5FLKA 1XQVA 3W2TA 4J0JA 3IURA 1GZ7A 4ITVA 3R3UA 4JYMA 4M0EA 1XQYA 1MTZA 5LP1A 1XZFA 3V1KA 3H2KA 5LZ2A 1IUNA 2XI4A 4DNOA 2XLCA 1RYYA 1XZJA 4INZA 1ACLA 3PFBA 4PSCA 5LYYA 2XUKA 1K8QA 4WDRA 3OM8A 5HQ3B 3UUFA 1H22A 1JJFA 3IA2A 5AOBA 3VVMA 2WJ4A 4W1PA 1N5RA 4OB6A 5IVDA 3ZV7A 4KJXA 5K5EA 4E11A 4LXGA 1TCBA 2ORYA 5ALJA 5JANA 2V97A 5LLSA 4DSZA 1Z68A 4JNCA 1JMKC 4J7AA 5D3ZA 1L7QA 2GYUA 1P0QA 3U0VA 4YPVA 5T4HA 2FJ0A 1QIDA 4PF1A 2XUFA 1QIEA 1DTEA 4F21A 1N8SA 4KEAA 1MX1A 4HRXA 3L1JA 1KU0A 4HRYA 1X2BA 4W63A 4ZXFA 4CCYB 5LIPA 5AKJA 2BCEA 5CT6A 4X71A 2PUHA 1LZLA 3WWOA 3QVMA 1H2YA 4X94A 5JADA 5LKRA 4J03A 1IZ7A 3I2IA 4GEGA 4UFNA 5ALRA 3DNMA 3BXPA 1CUZA 4B82A 2CZQA 1ZOIA 4Y2QA 1LPSA 4H7JA 3OPMA 4FHZA 1SFRA 3ANSA 4GHWA 2WFLA 2XQKA 4MQMA 2O7RA 4WDQA 3FVTA 2VSQA 3O9MA 4BC1A 5JASA 1EXWA 2P8SA 1HBJA 4FNGA 1C7IA 1QOZA 3MUNA 1LZKA 1LNSA 1QIJA 4YK7A 3O9VA 5JZBA 1IUPA 3OG9A 5HFAA 2ONCA 4C01A 1Y7IA 5HCUA 1TK3A 5LZ5A 1EINA 4PO3X 3C87A 1IZ8A 4EY6A 4A23A 5IH7A 5AM0A 2G5TA 4FFVA 1ZI6A 3DL7A 1MT3A 3ZPXA 1YB6A 3ICWA 3G0BA 3W9BA 1QIMA 3WIOA 3DOHA 4DGQA 1BN6A 5DNUA 1DQYA 2ZYHA 3UMJA 4AB1A 3DEAA 3STWA 1BEZA 5IVHA 2WU3A 5EIEA 3E0XA 5CT5A 5DNVA 1LBTA 4Y2TA 4UHEA 1G66A 4H7EA 2WJ6A 1VE7A 3G9ZA 5ALPA 1DX4A 2AJBA 1GQRA 1AZWA 3R0VA 4OYYA 5CBKA 2FUKA 4UBJA 5A7HA 1Q0RA 2D5LA 5FKJA 4BAGA 3WK9A 1F6WA 3CCCA 1FSSA 2OLEA 1R4ZA 3PDCA 1EB9A 4UBLA 5JAPA 1BCRA 4X85A 3UUEA 4BZZA 5A7FA 2RONA 4FLMA 4CIAA 3D2BA 4CCYA 3A2NA 1TIBA 5ALLA 5ALIA 5AI9A 4QZVA 3HI4A 4BE4A 1KU6A 4LXHA 2J3DA 3RARA 3RK4A 2PSJA 3D2CA 3BE8A 5EIHA 2BUAA 3D4LA 4B6GA 4AXBA 4V2IA 2C5GA 2VT6A 5CT8A 4PSUA 2G4LA 1DX6A 4AN0A 3WK6A 4QNNA 2OCIA 4RPCA 2VA9A 1GQSA 3CN7A 4B83A 1TQHA 5LZ7A 1XZHA 5AKXA 4BZWA 3MVEA 5AM5A 5ALFA 1K6EA 1QO9A 2OCLA 5JD6A 1XRMA 1QIHA 2JGFA 2WIDA 5EFZA 4U2FA 1BRTA 4GW3A 4DNQA 2XUIA 3RM3A 3R41A 4XX1A 4MWSA 3X3HA 3QMMA 5ALKA 3B3QA 2QT9A 4NS4A 3I1YA 1DQZA 2WSLA 4C4ZA 4HTAA 1UT6A 2ZYSA 1EDEA 3H2HA 4MYDA 1YA4A 4C4XA 4X93A 1W6RA 4K6HA 3K2IA 2XQGA 2ES4A 3WL6A 2R11A 4I4CA 2O2GA 5AM4A 5FXMA 5CT9A 1A8QA 1EB8A 3AILA 4X7BA 1KEZA 3E3AA 1HL7A 2WIJA 4GWLA 5EHNA 4DYHA 3U1TA 4EBBA 3A2MA 1UKAA 3DYVA 4DNPA 1EDDA 4MJ3A 3QMWA 5EHXA 1AQLA 5BV7A 4WJLA 5J3JA 1CUFA 4TGLA 2JBWA 4G4GA 1MU0A 4JYPA 3DKRA 5AK4A 5ALOA 4X6UA 4RGYA 2QUAA 2PUJA 2E3JA 4Y9SA 2WILA 3FOBA 4YX9A 5ALMA 2H7XA 2I3DA 1XQWA 3WKEA 5ALXA 5A6VA 5FPPA 3STTA 4EY5A 1CUVA 2W6CX 3D2AA 1LBSA 4IH9A 3KD2A 1D07A 4J0IA 2QJRA 2HDWA 3WKDA 3QPCA 5EHQA 4J0CA 3W06A 5ALYA 4FWBA 3STUA 1YASA 3TJMA 2CB9A 1A8SA 2QZPA 4DMHA 1CFJA 2YASA 1PFQA 3H2JA 1Y37A 1U65A 4DSAA 5K3FB 2HA0A 4UFOA 4ZV9A 2AJLI 1G42A 4KAJA 2BUBA 1CEXA 2RGUA 5AKYA 4C6HA 4ZREA 3ILSA 5JAOA 7YASA 3VJKA 4IH1A 4Q05A 3H17A 1FFEA 1CUBA 5H3HA 4H18A 3AIOA 3FLAA 4QLOA 1TAHA 5CXUA 4MYSA 1FFDA 2GYVA 4HZGA 5FOQA 4X6XA 4C88A 4FMPA 1Q83A 3BWXA 1MN6A 4ARBA 4B7ZA 3PFCA 2Z8XA 1AMNA 1QFMA 5JALA 1MO2A 2Y2UA 3N0TA 2Y6VA 1QGED 2WG0A 1THTA 1UKBA 2OCKA 2RAUA 4JUIA 1WM1A 4E15A 1UOOA 1CRLA 3PF9A 2HA5A 4UFPA 1O6GA 2EDAA 1Y7HA 3R3VA 3V9AA 2GZSA 1XZBA 5C7YA 4H7DA 4JEIA 1MPXA 2OAEA 3FYUC 1Q84A 3S8YA 1WCYA 2PSEA 5AOAA 1GT6A 3H19A 4YASA 4KE8A 4FTWA 4OYLA 2BFNA 3C45A 1P0IA 2OGZA 3WK7A 5ALWA 1YCDA 3WK5A 5HF6A 1J2EA 1GPNA 3D7RA 4P9NA 3FSGD 5FPQA 4Q1VA 2VEOA 5AIAA 4D9JA 2CUTA 1BEEA 2WIKA 1CUAA 3OC0A 3CN9A 1JKMA 3AIKA 5K3FA 2OQIA 5JIBA 4U2BA 4BDTA 2XMBA 1FFAA 3EF3A 2G63A 4DMFA 2BGNA 2Z5GA 2XMDA 2XMCA 1ODCA 3VDXA 1NU8A 3WYDA 1ZD3A 2QOEA 3DOIA 4BCBA 1UKCA 3W9UA 1VJ5A 3NGMA 5ALUA 4J0KA 2OQVA 2FJPA 5LZ4A 5HZGA 5HK8A 3F67A 3H04A 2Y1KA 4C87A 4EY8A 4CFSA 2JIDA 5BWCA 3FVRA 2VTVA 1F8UA 3PI6A 2O2HA 3DS8A 4N5IX 3WJ1A 3FWHA 3WJ2A 1SOMA 4IO0A 2HU7A 5AK3A 5DJ5A 2C4HA 5KWIA 2XB6A 3G02A 4QWWA 2XUPA 4BP9A 4BRSA 3HZOA 4DLNA 2HIHA 2HL6A 2VATA 2G5PA 3WK4A 1XRRA 5JARA 2WTMA 4OCZA 2PX6A 3SWWA 2WHQA 1YS2X 3BIWA 3WMRA 1QJ4A 5ALDA 4U2DA 4LXIA 1UWCA 4BVKA 4KRYA 4U2GA 5BOVA 1ETHA 1K5PA 3FAKA 1DINA 3F97A 4HXEB 2D0DA 1I6WA 1QONA 3AZPA 1QIGA 2VJBA 1CUHA 5CXXA 3JWEA 1XLWA 3HLKA 4Q82A 1B41A 1MX9A 2WIGA 3IBTA 4WY5A 3B12A 1XROA 2HU5A 5FUMA 4X6YA 4B9EA 3C5VA 2LIPA 1DWPA 4EY4A 5F4ZA 4G8CA 1MJ5A 3STXA 5K3AA 1W4LA 2OCGA 1RP1A 1VOTA 4GI1A 3FYUB 1JU4A 2WJ3A 5SYMA 1Q0ZA 3PF8A 5SYNA 3C6XA 1AC5A 1AGYA 2XQFA 4IH4A 3T4UA 2VJAA 1C4XA 5FV4A 2XQIA 4HAIA 4EY7A 2IITA 4NVRA 3HYSA 3O4HA 4CG2A 1F0NA 3EQ9A 3STYA 1NX9A 1LGYA 2WFZA 3DD5A
chains in the Genus database with same CATH superfamily
1FVHA 2G5GX 4BX8A 2GXSA 2MYPA 2PPVA 3Q6NA 2QRGA 3DO8A 4C9BA 4KR9A 3RHSA 2FN9A 2ZWIA 5L7WA 3O83A 4ZFNA 1XLVA 5DHPA 4UUNA 5IMSA 4M0UA 3TZEA 2SECE 2YJGA 3ME5A 1S2IA 1G8MA 1VSUA 1VYTA 3B2NA 3SZUA 4YCMA 3AR8A 1JP7A 1P2BA 2BV3A 1RQLA 5FBZA 1B26A 1SOAA 2OBMA 3MINB 5IJ9A 1ZW1A 3VOSA 1E1QA 4OSPA 3DKVA 4Y6GB 4N0QA 3V1NA 3PPXA 4XYEA 2DZDA 1CUDA 2R1TA 2Y0CA 3O3NB 1U28C 3B36A 3S0JA 1GA4A 3OM9A 1F6DA 3MB8A 1Q0SA 4HJXA 4DCUA 1US8B 3HP1A 4PG7A 1TCAA 3GRRA 1SWVA 2PS0A 4E09A 5KJEA 3MZ0A 1OFUA 4YRGA 3FOAA 2Q0XA 3LKDA 4FQ8A 4OHOA 4GMGA 3SK0A 2IW1A 3M6FA 3UVEA 2R6FA 4S1OA 3NWEA 1RJ9A 4XUGB 3FBWA 3G2MA 3Q7SA 3ICEA 4GI5A 1NXPA 4IKEA 3MWGA 3PR1A 4BNGA 1M8PA 2C3PA 3ZWOA 5CYPA 4CMCA 1GGKA 4LJ8A 4PG5A 2ZWOA 3W0LB 3H8VA 5JCZA 1IIRA 2WWIA 4LBZA 2GF9A 3ZQJA 1SULA 4TMZA 4XPZA 5FA8A 3WL7A 5A06A 5BP7A 4XOIA 3KOXA 2BGTA 5HKOA 1QTIA 1PW5A 5CIYA 1QP7A 5AVQA 1Z45A 2IYOA 4ZQCB 3NBMA 1H2WA 3ZDEA 1F9AA 4RENA 1VRWA 1FU4A 2SKDA 3E7XA 3K0FB 4I3GA 4CKCB 4KGVA 1W5SA 2CC2A 4ROSA 4YAGA 4ZI7A 3IQXA 3LV8A 4URHA 5IYZB 1OE0A 2AGVA 3R6LA 4PPFA 3UFBA 1X1EA 3WI7A 5BN4A 5MN5A 3VUEA 1C3XA 4I55F 4FHEA 4NATA 1VMDA 3L7KA 2AFRA 2D59A 4KXQA 4UCQA 1TFRA 1C9MA 4ZOLF 1SM4A 2QRMA 3LPNA 4K9LA 4HG2A 3SZLA 1OB5A 1W25A 5EXXA 1E6MA 5GOTA 4KNVA 4RHCA 2HIAA 1E9EA 1KIAA 3QELA 3A1VA 3BGOS 3WLAA 4DMLA 1NY6A 1ZICA 5AXCA 3NC1C 2C20A 3V8PA 4NNOA 1T29A 1QDEA 3EXEB 3ESRA 3QWFA 3S4YA 3BIFA 4WZ6A 4XIYA 4QM7A 4ON9A 3KZXA 4YP7A 5EKSA 3V6MA 2E6UX 3UZUA 5JRJA 1CFZA 4ZT4A 1P6XA 4MMYB 4NAUA 4F9EA 3RS0A 3AVYA 1V5IA 4QPNA 1V11A 4DLVA 2YC2C 3NOXA 4IDAA 4EQZA 4ZU3A 2H8GA 1N9KA 3S5JA 1ZGAA 4WE3A 1Z47A 2G40A 2AJDA 5GQSA 1Y8CA 3B7PA 1EXNA 3OFSA 4L73A 4MIOA 1TM3E 4DIDA 1H4SA 3WRYA 2O2YA 1UJCA 1UL1X 3CW9A 1CY1A 3EC1A 3NHUA 3REQA 5JT1A 1OJLA 4RMJA 5COAA 4DJTA 1C7FA 2AUMA 3ZLTA 4GI7A 2W22A 2XXAA 3GUCA 3T1TA 1FPMA 2PY6A 2AG8A 2B4KA 3QU7A 2IZZA 3FYUA 1LTKA 4JC8A 3I28A 2H1IA 1HMPA 1ZXLA 3R7WA 3DXYA 5TPZD 2BN4A 3OZDA 2I3BA 4NS1A 2EAUA 5JQGB 3K5PA 4YJGA 3CZCA 4BB5A 3GDGA 4JITA 3E18A 1RW4A 1KY3A 4WOPA 3EGOA 1PKEA 4PLWA 5TQ0A 1APBA 4H7IA 2MMGA 1KI6B 1VB5A 1YDFA 2VP9A 3CTPA 3H4MA 2E4UA 2X7XA 4MQ6A 3H75A 4XARA 5A5DA 2I1VB 2YXDA 2REXB 2MT9A 2HA4A 4Y9DA 5BYKA 2OB1A 4IRMA 1GQFA 4LOLA 3L05A 1UAGA 4BNTA 4EK9A 4WZZA 2IBMA 3MWFA 5SV2A 1ZGJA 3RQSA 1SCUB 2OG1A 3NIBA 3FPJA 2VT2A 4BBJA 2Q4BA 4WFIA 5E7IA 3GMIA 1XO1A 5FWXB 1FMFA 3DOEA 2XWJI 3QVKA 1QF9A 5CCDA 1KI2A 1NMXA 3FVVA 3QX8A 1ODSA 2NVUB 3GN2A 3JYOA 4KV7A 4YUWA 1SA0A 2A1UA 3I23A 1KR5A 2IYEA 3JQFC 4L5AA 4KQMA 2ZBRA 4RVOA 3FNBA 5FTWA 2J0SA 1C8LA 2X5NA 1G8HA 2GEVA 3K09A 3O2NA 3Q7PA 1UKZA 1YZFA 4P81A 4JLVA 4OREX 1N75A 3I39X 4DLXA 3CKLA 4JLNA 2JD0A 3L8GA 4GF5A 4Z7QB 2HDOA 4UBOA 4IDEA 1ODTC 3T9FA 4DA7A 2QUJA 1ZCFA 3L6BA 2GFIA 4NZMA 1AQYA 2WIAA 1KOGA 3QUTA 2NQ8A 2YXPX 1TCCA 1KOJA 3S28A 4F8EA 2XXJA 5D7BA 3TRKA 2F4VB 1VTKA 1XRQA 2QPAA 1D2HA 1XVVA 4KUEA 3R75A 3UOAB 1RRKA 4QOFA 1GRVA 3ND8A 5AHXA 2CMFA 3DGFC 2FQWA 4JT8A 3UM9A 1DKOA 1S3IA 4HFNA 5TXGA 4W5JA 5KNDD 1JDBB 1SKYB 3HBNA 1CETA 3NYIA 4XLTA 5FL7A 2A59A 3KSDO 4Q3LA 4YLGA 4BEVA 4YXWD 5IU6A 4UHBA 1PBNA 4QQNA 3WGOA 4U7DA 5F3WB 4CEIA 2CJXA 2IEZA 3KUCA 2O7NA 4N6NA 1L1EA 1U8UA 4FMDF 1FU7A 3JYPA 3GNLA 4K6MA 4XSVA 5FTJA 1TMYA 3KWFA 4BVEA 4KBYA 2JATA 3HO1A 3WDSA 3SZRA 2F1KA 1J20A 1XEAA 2F3PA 1X87A 2RAPA 3FLMA 3LYLA 1F2DA 3GEDA 2QDKA 5K0JA 1NVMB 1YNSA 3I2YX 1XEFA 5AI6A 3EC2A 1S8FA 3QXHA 1SNYA 5DGXA 1N5MA 2WLTA 3VYSB 5JDIC 1TKCA 3KT0A 1CIJA 1E4YA 2PKRA 2QYHA 3MQ2A 1T2DA 4EHLA 2ZROA 2WHPB 4Q7JB 4UXHA 4F1JA 2GZ3A 4P4GA 1UPCA 2RCNA 4QASA 2H2FA 4PO9A 3SM9A 1I0LA 3NTRA 1Q14A 4NBVA 2PEYA 1M8KA 1E8MA 1CWUA 4MUEA 2UYOA 5JCJD 2A9KA 3M6AA 2CHUA 4KREA 3NYQA 3HJGA 4XQ0A 1N6PA 5TS3A 3S1LA 2B4RO 4FHGA 1JJIA 4HQLA 4K6KA 1OC4A 4BEJA 3AUTA 4D26A 4TSFD 1R7RA 1SRQA 1R0BA 3OX1A 5K2MA 3LQKA 4MLZA 5ICEA 1TO1E 1CNMA 2G1JA 2OY0A 3URKA 5FWNA 3WQRA 4YJKA 1GRCA 2WJIA 3JRXA 1BMTA 4NMWA 3R7AA 5A0TA 2CDRA 5TY0A 1X1AA 1ESDA 1ZG3A 1XD2B 4QXOA 3BUSA 4EG5A 5ALNA 5IF3A 4FDAA 2EIHA 2ZRDA 2CVQA 3BCRA 4G0OA 4Y1GA 2PZKA 2R84A 3H1FA 2QX7A 3I2GA 2M6LA 2O5EA 3NHFA 4FFDA 2XTJA 4PCLA 3L4KA 3NNSA 4PFKA 1O0CA 3DOFA 4QYXA 4B81A 3SY8A 3DL0A 4L28A 1M1YB 3FDIA 4EI7A 1W5TA 2OZPA 4R8VA 1BMFA 2GO1A 3JZAA 4GO1A 4P3KA 3FCYA 3RTGA 4DLBA 5JAUA 2ONKA 4PTLA 1EWRA 1ULTA 4M1TA 3KRTA 2PUEA 2J3HA 1VZ3A 3E61A 4YACA 1MHTA 2W2MA 5DXFA 3DM5A 2GPSA 3EIEA 4JJ8A 3T5GA 5CK5A 1OPRA 3MTAA 1Z29A 1FS6A 1B7GO 1VFPA 1XZIA 4H0CA 1M7BA 5DCLA 4Z6KA 1V3UA 3GJXC 3MT9A 1W1IA 2ZS7A 4G5SA 1ZC3A 4U8GA 3GDOA 1E9RA 3D54D 3OPYB 1H2HA 4UHFA 1ZVQA 4IUCS 1EFDN 3BMQB 4O4LA 1K68A 4Q48A 4RWEA 5AHOA 5CX1A 4RHXA 4YMLA 1H9AA 4ZAYA 4AZ3A 1G5RA 2F67A 3CUKA 1FYXA 4FGJA 4I5DA 4QUBA 4A0FA 3ZCRA 4BV9A 5A2GA 3IIKA 3RSZA 1HR0B 5BUCA 1J0EA 3FMGA 5FR2A 4I8XA 4A0SA 1MVNA 1KSJA 2P9HA 3MTQA 5D5PA 2V9PA 4TXNA 4CIDA 2VTBA 3M70A 4HBGA 3EWNA 5BV8A 5ADWA 1Y6FA 5B2ZA 4HEA6 2XH8A 2H3EA 5CDSA 2ZYRA 4DLAA 4I1UA 3AR7A 3HLYA 3WYAA 4JB3A 4I46A 4JI5B 3HYNA 1YS4A 2W2XA 2WIBA 4CCAA 1JHOA 1V1JA 3I9V1 3OTGA 2QRHA 3T0IA 3PIRA 3T1VA 3WFZA 4CKWB 4BEWA 1AUQA 1PJBA 2BAGA 2DKFA 3RYTC 1GGNA 1JI3A 3OMWA 3QLUC 1IXRC 5CW2A 4XYLA 4IEIA 1WUHS 2BGKA 3MHPA 4H15A 2H4FA 4Q3DA 2ZRAA 4F4UA 4DG8A 2PQ6A 4PG4A 3GL9A 3I83A 3UUGA 3U7RA 2OZVA 3C4QA 1SC1A 3GVIA 1MRNA 4LG1A 2VAPA 1O5TA 3CNQS 3GFBA 3DCNA 2P7HA 5KAPA 1G3IA 5HZMA 2C3MA 1TMGE 2ZAGA 5DP1A 3H99A 4BJ3A 1NURA 1CCWA 4LWQA 3Q4GA 1XLUA 3EEFA 1N6KA 4HEQA 5DP2A 1VPEA 1NVGA 2CUZA 1QVWA 1AIPA 3FFXA 4LOHA 3MCTA 4LY0A 4MV7A 4PNZA 1PD1A 2B4QA 3QM1A 3MMSA 1KO5A 4NXNB 2FPWA 5D6OA 1YZLA 5AI5A 1NXSA 2EBWA 3L84A 4QYSA 3LT1A 1H1DA 2WYIA 4LRTB 1RT9A 2FPSA 4GZ3A 2BMJA 3RKSA 3CX8A 5BV2P 1XNJA 1SU7A 1V26A 2WMDA 1ZXXA 3OMXA 1NJ8A 2MIIA 4JVLA 4Q4HA 3SFTA 1AHNA 5J2UF 3CW8X 2W0MA 1C9EA 2FMFA 2QJOA 3BMNB 1DWQA 4GMXA 4DANA 1YSCA 2P7IA 2H17A 3TW8A 3CGWA 5AW2A 3KAPA 2CHEA 1V8PA 5T4EA 1WHTB 2DLNA 3CNNA 3B82A 4J76A 2ZAOA 2P78A 1WAMA 4IUYA 4DLYA 1U3FA 3SX4A 1C1XB 5FFMA 1EXDA 1HT3A 2HF7A 1IN1A 1PEDA 3FRJA 3RWBA 1C30B 1YMVA 3GRYA 3JTEA 3L6EA 4UTZA 5HCNA 1RVDA 2B0JA 1J90A 1HRKA 2V96A 1RM4A 3D7KA 3ER6A 4XKJA 3SYTA 4HN2A 1RXUA 4LQDA 2GB4A 2RMKA 4NENA 3GUUA 5DNCA 3TMYA 3PD0A 3GR6A 3ORFA 4PS1A 1PV1A 3W3AD 1CS4C 4KLCA 1AKTA 4MQUA 2IUYA 4KSCA 3MELA 1R0LA 1OXUA 2WQZA 1HL3A 3GLKA 4ZQGA 2QJWA 5FWAA 2C4MA 3QLTA 3ID6C 2HZ7A 1QKJA 1W8IA 4P93A 3VX3A 3NJRA 3EBPA 4X3PA 1P2UA 4NQRA 4GC5A 3D7SA 3AP2A 2PU7A 4D56A 3FI9A 1DRJA 3VYRB 2WT9A 2BOVA 2H7YA 4CWAA 4KBGA 4ZI7F 1S3FA 2FQQA 2X5OA 4E5YA 5BUSA 4DMCA 5EMMA 1CJTC 1XA3A 3C7KA 1OTXA 3TW4A 5C8YF 3P0FA 1KQFA 3I37X 1J49A 3ICCA 4MZDA 4JLAA 4H1WA 2IV2X 2GQ0A 4I36A 2HK9A 3CQ9A 4ZODA 1OCEA 1WB9A 1YR7A 4QXPA 3WGKA 2XB2A 4K5QA 3I01M 3H16A 1LJUA 1Q0QA 1YT5A 2VJPA 3AM3A 2D0OB 2JDIA 3B8EA 1XTJA 3ZBTA 2DFPA 4ZYYA 4PLTA 1ZAKA 5ALHA 1BX3A 4FMCF 3IVMA 1SQ0A 5A9RA 5M04A 2C7OA 3MEQA 2DHQA 1GUBA 4L5BA 1R3UA 3DEIA 3ETEA 5LA6B 3UMVA 1N2BA 1RDFA 3EFHA 3MJFA 4G5XA 5I7SA 2PT5A 4ZKEA 1M8JA 3FRIA 4TV9A 4A8JC 2C1ZA 2RBEA 1ZMBA 3UGTA 1DXOA 4X7PA 4KMSA 3VO1A 2AYXA 2V4UA 2Q28A 2VYVD 3GLSA 1H23A 4ENPA 3GJTA 4D41A 3I2KA 2JLCA 1N5JA 5TPWB 4GQAA 1UM9A 1BA3A 2HRZA 4G65A 2IEBA 4BQOA 4Z4GA 4W9NC 1QG2A 1YIDA 4HB4A 1CX9B 1T6XA 2H1FA 3RWOA 5DN6A 2ZJAA 1QG0A 4UHDA 2ODTX 4L9SA 5HFJA 3SNHA 1K8ZB 4X1KA 5DTIA 3OQBA 4H59A 1NC1A 2YY5A 3ZIAD 5KAMA 4D43A 1J4AA 4V0KA 1SBHA 3VTAA 3ADDA 4F3RA 1W2WB 2QD4A 4JK3A 4OFZA 2VHUA 1OAKA 1QU3A 1BS2A 4V0RA 4EUKA 5JNSA 3PC8A 4PNPA 3MQFA 4MV4A 2YC4C 3KWLA 3RG2A 3W3AH 4UAVA 1F06A 2PKWA 2J6BA 1BKDR 1F8FA 2ZDHA 4BMOB 3DA8A 3L4EA 3NP9A 1FP4B 3FSEA 4O2BB 2BISA 1T9GR 5F5XA 3KV1A 5K03A 4JI0B 3MCVA 4RJKA 2OCBA 3BF8A 3PWZA 5JCXA 4DDWA 1P0MA 1LFAA 3PNKA 5FV7A 4GZ5A 4B7CA 3A2KA 3DPUA 4HXYA 5FRDA 4DV0B 1TA0A 4Z4IA 2XUAA 1Z2AA 1YQEA 1T0JB 2ATIA 2ZSEA 4NCHA 3OQJA 2OEPA 2WZCA 3EQ7A 4QVGA 1A3CA 3BSYA 2CLLB 4OB8A 3P4YA 2NV6A 2OD7A 5E4YA 1C50A 4DRXA 3KZVA 3MNFA 3BD7A 1N7HA 3E82A 5T5QA 3CFYA 2GZHA 2EG9A 3VPDA 4GX0A 1N5DA 3WIDA 1MQ8B 2P2YA 5KC8A 5IT9A 2G8LA 1IQPA 1DV1A 1P72A 1R6TA 1W0JA 3LUGA 5FP0A 4F72A 2P3QA 5AM2A 1KI7A 2M1ZA 4A5SA 1PDVA 2OTCA 3JQPA 4IGEA 2RHHA 3SBDA 4A2PA 2G25A 2M98A 2P0AA 4IHAA 3EW7A 2IUUA 1RKBA 3L01A 2GEUA 5A4FS 4W9RA 3MJVA 4U5XA 4Z7NB 1KMIY 4O4IF 3OX2A 2GX6A 1KKUA 3SLRA 2YDXA 4D9FA 1JPVA 5T67A 4KFCA 4E12A 3AESB 1GPYA 2Q0QA 1V2GA 2NQ2C 3I92A 1IMJA 1ZM7A 4AF7A 1L8AA 3W2HA 3CLRD 3O0DA 1BU8A 1YRHA 2PT7A 4IW3B 1EJBA 5DWDA 3W8DA 4KXFB 5AHKA 5DGDA 3HL4A 3LS2A 1XCBA 4BLSA 3VZRA 5I51A 1ND6A 1JSXA 2BJVA 1RI2A 1NW6A 2H2HA 2H51A 2O2CA 4MLDA 4QYMA 3ONFA 1XN4A 1U3WA 3I0ZA 1Y6QA 1PK8A 2AE1A 2COUA 3G3EA 3PU6A 5CU7A 4LDPA 3RS4A 1C0KA 5KQRA 5AKZA 2ADOA 5KWJA 2O48X 1KJJA 2YBDA 5TC4A 2V7GA 3TB4A 3QPWA 1RMTA 1FRZA 1JT2A 1LBEA 2ZUDA 1KNXA 1N5KA 4ARUA 5KKNB 5LP6A 3ESCA 1TVKB 3ZD6A 1J8VA 4HDSA 1TADA 3L6UA 3O6VA 1OSNA 1AKWA 2VBFA 2CYAA 3KVNA 1H5QA 3WNCA 1I8TA 3FYTA 4C3ZA 4BO8A 4TLBA 4ECEA 2QTAA 1FPQA 3KTAB 3P4XA 2ZI9A 2I6XA 1XAIA 2BGIA 2FNAA 4G8DA 4X20A 3TNJA 3U7FB 1KFCB 2A3NA 3AF5A 3OT4A 2AR9A 1LPBB 1GG5A 1WPRA 2Q2OA 3ED5A 1UJBA 4JEMA 4LKOA 3REOA 3A6EA 1GKLA 1MDBA 4LW8A 3RFFA 3T35A 3WTCA 3IMKA 4FKZA 4L08A 4YPFA 4EEKA 3G17A 3I5MA 2R8OA 4F6CA 5CH8A 3MGAA 1LPMA 2RC6A 3I4FA 4MPRA 2YKGA 1IL0A 1D0SA 3DVAA 4BMPB 1HNWB 2O8NA 4HLUC 2M6SA 4Q93A 5DE3A 1IYZA 1SHLA 2XRYA 4GECA 4KQXA 4I3FA 4EB8A 5ENDA 1WP9A 1U2EA 4GE0A 3Q2KA 1OAOA 1VDZA 1PR4A 2ROQA 3LCJA 4NOLA 2ZSAA 3UK1A 2W2PA 3GMSA 4KLNA 3W78A 3ZEIA 4EYOA 2VL7A 4EA9A 1I7NA 3LA8A 4ND1A 1C7QA 3S7ZA 3KEOA 3WLEA 1DIBA 3HMQA 5IT0A 3ORYA 4DA8A 1HDGO 2ZJFA 3M1LA 1JDNA 3GJ4A 1U98A 1IBKB 1GTMA 4C7BA 1C8KA 2XNKA 4ZO6A 1OBHA 2QM3A 4TVOA 1WZEA 1OU0A 5F98A 1Z0DA 1WXEA 5EWMB 3T9AA 5C18A 1H9CA 2IY8A 2B8JA 2XE6A 2YJ4A 4W1RA 4XEHA 3LDAA 3SVLA 3HCRA 3DE5X 1DBQA 2CXPA 4CG1A 1UJ6A 2VAVA 5EZ5A 3T9BA 3C3MA 2XNDD 3D5QA 2VPXA 4OUDB 4S2UA 4AO7A 3R3ZA 5EXSA 4HXGA 4BO1A 1ISGA 4OGWA 3IKVA 4YHHB 4DC0A 2Z9CA 3CZRA 4OXRA 1GL6A 1NLYA 4PCVA 4PTYA 4RZQA 2JJMA 1DWOA 1MV8A 1SXJA 1XI2A 1ZIYA 1GUZA 4HGQA 3RS2A 3HJHA 3G5AA 4PVDA 4K8RB 5CCBA 1G5TA 4DT1B 4I1RA 3KR0A 5D3MA 2CLHB 2QL7A 4RGQA 5C8DA 3LDGA 4PW0A 5EQDA 1RWWA 3CX4A 4PZCA 3GU3A 4UTVA 4OB7A 4KB5A 2UYYA 1HQCA 2Z2ZA 1RJEA 3F98A 4D6YA 4YVFA 4HEJA 1E5TA 5JSQA 1Y48E 1MBZA 1MW8X 2B4AA 1GGMA 3QHQA 3CVWA 4DLWA 1DAFA 1U9ZA 3KSRA 1LH0A 4TVKA 4INOA 4YP0A 2J8ZA 3LE8A 3K96A 2E9SA 1QZXA 4BNMA 3NOVA 1FDIA 2W6JA 1XTSA 4JWTA 4QRHA 1ZEMA 2JFXA 3KR9A 4K6GA 1EE2A 3G0CA 4YMUA 3D6TB 2XR1A 1Z0KA 1DP4A 3NALA 4OG2A 4QARA 4AN1A 1K4MA 1DBSA 2QN1A 3F47A 4ZZ0A 3TZKA 1J0XO 3GZJA 3GJ0A 1XJ0A 4WZBA 3D0KA 4RIIA 1L5NA 2EKZA 2PJZA 3HB1A 3K4QA 3L5OA 3NBFA 4TWRA 4M3NA 1JEYA 4LX0A 3IAAA 4J29A 3UMCA 3ZWWA 3SJCA 3I9V6 1ECFA 4LYGA 1GZ5A 4FINA 3I58A 1NNUA 2XUJA 1Q3KA 3DUFA 3GELA 5TR9A 3R9XA 3CPHA 2Z4RA 1UKYA 1XZMA 3KFVA 4IHJA 2IU0A 2BEUB 2QEQA 2QTFA 4HDAA 4D44A 2OK8A 2AF4C 1P3DA 2Z56A 4PAMA 3IJPA 3PNSA 2WI8A 5IKXA 1FYWA 3GFVA 1EX7A 4PRLA 4KV9A 3HZRA 4KR3A 4RXMA 1UH5A 2J3QA 2JFWA 2GCOA 1ESCA 1XQXA 2CXHA 2H2AA 4A10A 4BOYA 4RMNA 5T64A 4G1BA 1D7OA 2XGGA 2FUCA 2WVAA 3M81A 2DPXA 3R9WA 2D5IA 3K9LA 4HAZA 5DYTA 5C37A 3C5CA 2IWRA 4BVJA 1OR8A 2RB4A 3PICA 5TPZA 1S89A 3HV0A 3IDSA 3AXSA 1MORA 1V8BA 1QNLA 2TRSB 3WLKX 2IUEA 1TZJA 3KB2A 5E95A 3QNUA 3RIXA 2GVDC 1W59A 3P2OA 3K31A 1ZAYA 1QZTA 3CSSA 1M2VA 2HMUA 5TV2A 1FYFA 3ESDA 1O6BA 1B16A 3W04A 4CDRA 1NM5A 3HXPA 2GETA 3NCTA 2QP4A 3QU9A 4MDHA 3ZHZA 1KTIA 1EH5A 2EFGA 1ESMA 1YIAA 4XD7A 2B3DA 5ESRA 3B3AA 1HA3A 2R0QC 1TB4A 2WKPA 8AT1A 3W1VA 4YCDA 1GIAA 5ALVA 4KYVA 4QICA 5KOJB 3CT4A 2YJZA 3H4VA 3QYAA 4RPLA 2YS6A 3DO6A 4U63A 5SY4A 2HK6A 4R5HA 2VSFA 1NRWA 1GZVA 2AQHA 1TM2A 2VDMB 2IX9A 2G3YA 2JLAA 3V5NA 5CRIA 1EFTA 1KHHA 4W8OA 3FY4A 5BNFA 1Z08A 1I5RA 1Y0BA 3MIZA 4IOKA 2IHYA 1X7YA 4JKOA 1MLDA 3PSAA 4WKNA 1VB3A 2MSNA 3N9IA 4KL8S 1DJQA 1EEXB 3PC3A 1ZSVA 4G0YA 4XGQA 2OENG 2QS9A 5HFNA 3GJZA 5BPFA 1R0YA 5TVKA 1AQ6A 2H1WA 3FZYA 2IP1A 2BR5A 2ZJ5A 3B6KA 4IG4A 1PV2A 1QCZA 1U7PA 3M8KA 5DI3A 3I73A 3VPBA 4RTOA 1RC0A 1FW6A 4IIBA 3WZ2A 4U9UA 2XF2A 3NONA 1WY5A 2JBHA 3SR0A 4ZEVA 3ENNA 1EVYA 2PGLA 3AGQA 4PZ0A 5HG0A 4KPUA 5LWHA 4K9OA 3G6WA 5CTJA 3H83A 4PG8A 2QRLA 3NM6B 3TE7A 3JD3A 3QTLA 5TMDA 5BYBA 4YXWA 1NPYA 4XIJA 2Z04A 4JC4A 1P1RA 2GF2A 1ZI8A 1TQ6A 4J7CA 4TV9F 4OMDA 3DZJA 2R4UA 4KQJA 1ODJA 4QDOA 1KMQA 1LK0A 1ZW6A 3QWAA 1AK1A 4P0PB 1QHHA 3C6KA 3OQNA 4HH1A 3VMMA 9MHTA 2PX0A 5JR3A 1Z8DA 4GBMA 3LVFO 3UMGA 3I62A 5EJMA 4XQGA 2EZ4A 2HTFA 3BXGA 1J25A 3PGA1 5JTTA 4XVCA 1EAMA 1KAOA 2BFAA 4CF4A 4WZAE 3OSUA 4GOLD 2H18A 4REQB 1TECE 5DI9A 3TLAA 1LBHA 4EVSA 3H9QA 3THRA 1GNSA 4TKMA 2C95A 2FPIA 3TWOA 5BSWA 2QMQA 1T8PA 3KKPA 3P0RA 5JMPA 4IJ5A 3QMPA 2B34A 4NYJR 4OAOA 3DZHA 3Q3IA 4Q37A 1MQAA 3ZV3A 4BXOA 3V8MA 1UDRA 2YUTA 4IMIB 4NPCA 4QFCA 1G2IA 2COKA 4HHEA 3CEPB 1YRQA 4BVHA 1HDIA 1F1BA 2WAYA 3R3HA 1UXGA 4RBNA 3FJOA 4Y1RA 4RZ3A 4TSFA 1Z62A 1G20E 1L9XA 3LECA 3DTVB 1GR0A 2VNJA 1TX4B 1RXSA 4MO2A 5JY6A 3QPVA 3VR5H 3OJEA 1OGYA 1RTKA 1L2TA 1E6CA 2R47A 2IPLA 2H16A 1OLOA 1GUYA 5I7AA 4ZI3A 1P3JA 3DKKA 5IAJA 2V74B 2VHJA 3GLHE 1LS1A 3JQBC 3UK2A 2IE0A 2JHPA 3D0OA 4UEJA 2JKYA 1M1NA 5DYYA 1XKTA 2XLBA 5AW4A 3JV7A 4GPBA 1R8YA 3UT0A 3U4DA 2H54A 3H3FA 3TJZA 2Y77A 1IJKA 2XZPA 3UBMA 1Q3TA 1WMEA 2C9CA 2J48A 3FDZB 4GZMA 4JBYA 3WKCA 4NYIR 4TWAA 5LUBA 4EF6A 2BW0A 3ANTA 1CJCA 2I3ZA 5ARDA 1UM8A 4TTAA 4QDTA 2P9TA 3NHWA 4YRQA 2AMJA 2QMOA 1OT3A 1SUIA 3FPLA 3Q8LA 4LGVA 1QPZA 1QZUA 1Z4NA 2DKOA 3CU5A 4JOCA 3VV3A 4EJ2A 1R6XA 4HGZA 1P1FA 3HA3A 1YXMA 1XWIA 3DE3X 1YOBA 4NCXA 5EZ6B 3WLSA 3WGUA 4OO3A 3GX1A 4NBSA 1SCQA 2GZ2A 3T54A 1M67A 1ZBQA 2EGGA 2FI1A 3VR1A 3CEAA 1ORIA 5CB4F 1F2TB 4ISCA 5DBGA 4CIVA 1O9HA 2O3TA 3WNVA 1X8KA 1VJGA 2Q1YA 4MXDA 1KYYA 1U0EA 4HQFA 5EJ7A 5EMKA 3O8OA 2FMKA 5AJVB 4AL4A 5NLLA 5CVTA 3B1ZA 4OPMA 1JECA 3PNOA 1BJKA 2HH9A 1YAHA 1T1JA 2CCGA 2ONYA 1J5EB 4TT3D 2WNIA 3TK1A 2RH4A 2JFQA 3FCXA 4DA9A 1L7DA 2NO0A 4U2KA 4JLOA 3WRXC 2GBFA 2NX2A 3D3EA 4ZVRA 1LVGA 2QRUA 1ADJA 2PUBA 4PVCA 5LP6F 3WAKA 2NSLA 5FORA 1FRVA 4AZ0B 1H85A 4NMLA 3DP7A 4LCBA 1B4DA 4UBMA 3TXYA 1X6VA 1RACA 1K9SA 2YHUA 1ZJ5A 4OATA 5BUQA 5EEGA 4B17A 1QMGA 2P9ZA 3IE0A 4ZTUB 1Q77A 1NAHA 1WQ4A 3GY0A 1RCUA 3ZS8A 3P5BA 1ODIA 3QZUA 3W5AA 1Q7BA 1PT8A 1FQOA 2C7BA 3TCKA 1BDHA 1J8QA 2RI6A 3GB9A 2FEOA 3OOWA 4MR8A 1ILEA 1Z6ZA 4NEGA 3FHTA 5I8PA 3D3WB 3C6YA 3TRIA 1CG6A 1W88B 1DUVG 1TDJA 2P5SA 3TRJA 4EGSA 2O57A 5KYVA 2Y2VA 4CEHB 5F4BA 3F6PA 4AN4A 2NO9A 1LDBA 2AT1A 4M8NE 4BKQA 4DDUA 2PSFA 4BIMA 1QLWA 2DUJA 2UZ0A 1OFVA 2V5AA 2WINI 1UC9A 2JI7A 2ZSIA 3KVYA 4QTTB 2UZ4A 4EQ6A 1X86B 1K4KA 4RL4A 1VG9B 4W5TA 1GFWA 1O4VA 5B12A 2A3RA 1YZNA 4OHPA 1LY1A 4EYKA 3T5PA 4L8VA 3A9CA 2FQXA 2EC5A 1HRDA 1YB2A 4TZ6A 5HUQA 2RGNC 3CHYA 3AJRA 4A6XA 3K0AB 1CF4A 4MMXB 4Q4AB 2DUUA 2TYSB 4PPGA 3V3TA 3DTNA 2G17A 4J1NA 1CC1S 4WBNB 1LQUA 1F5NA 2AIRA 1E3EA 4FCVA 1ZUNB 3WGNA 5B1SA 3ZY3A 2EJBA 1XZLA 1GRNA 2Z9DA 3U9TA 3RRJA 1T9DA 4NG5A 2ZIVB 4JS0A 1P0PA 1PJAA 2C7GA 3LF1A 4AKSA 1MZPA 4B5LA 2YWHA 3E1KA 1PQYA 4B48A 1FMTA 4H08A 4HTFB 5DLYA 4IV0A 3IPRA 2AK2A 1AK2A 1ESNA 3OAAD 1AJEA 4IFTA 4MMZB 4QPCA 1VG1A 1NV9A 1RI4A 1V1MB 2RK6A 1NBEA 5G3YA 3F6SA 5EA2A 5B1DA 5I9LA 1QCDA 2WFAA 4U6NA 3GGCA 3TCXB 5HRAA 1L4GA 3PWTA 4KP7A 4K46A 4UNNA 3TW0A 4N0MA 3K1YA 3THYA 2OPBA 2YJ6A 4YQFA 5F7OA 4Y1FA 2ZUFA 3ON5A 4DBZA 1G59A 1DKRA 2P4QA 3KSAC 1GCUA 3DEYX 3AY0A 4PIMA 2FWRA 1PEAA 2A33A 3ZLVA 3HZZA 2RGWA 4OXYA 2OESA 3GPBA 4CMIB 2ZRFA 5DSTA 3C15C 3DVRX 2EYQA 3TFWA 4A0HA 3I9LA 4OHZA 5JDCA 1GZ3A 2Z8YA 5GWXA 2Q3FA 1M75A 4JP5A 2HYIC 1M1XB 1G2PA 4YAEA 1E2NA 2PWPA 3GGOA 1Y5LA 2PQ2A 1LLFA 1QYXA 3A1CA 3FOWA 3I04M 4CM4A 3D4IA 3H86A 1XJ5A 3A9UA 3W5UA 3HKCB 3ZD7A 2PU5A 3CG4A 3GROA 1DO8A 2H4WA 2XOXA 3D8NA 5FHQA 3W6PA 1TM7E 4MUJA 4KO4S 4BCDA 1AVTA 2CZGA 1DPGA 4HNQA 2JGDA 2PS1A 3OJCA 1Y1RA 1A50B 4URZR 1ECBA 5CLFA 4K03A 5L3ZA 3RIMA 1QQ7A 1DKNA 3KDPA 3ZY2A 2VP6A 5TGDA 1Z4PX 4JLBA 4WN9B 1HEUA 3FH0A 2ZDGA 3ZNQA 4DSTA 2CVPA 2RE8A 1ORVA 2A35A 1MIOB 1Q1AA 3TGWA 1QC5A 3OEWA 2Q4DA 4GPAA 3ES9A 4ZXPA 5H4GA 3GJ6A 4CQJA 3C3XA 4E46A 1E2HA 4LHVA 2PX5A 3KYJB 3V34A 4ANFA 4W5QA 3OZTA 4TKVA 2OORA 4RD3A 5CLQA 1XZKA 2BHSA 5CLHA 4IXMA 4RDCA 5ILOA 3X1KA 1R9GA 2P69A 1ZQ9A 2QLMA 4INAA 2R1VB 4I6GA 1NXOA 5JCOC 1FUYB 2FSUA 1KS9A 2H1HA 3E1GA 3TPZA 3RTBA 3BJMA 1RBQA 4DBLE 4QBHA 3SDSA 3PEEA 5AM1A 3EB9A 2NMVA 2HMWA 4I66A 2EWWA 4C89A 2KQUA 2ZRBA 2CL6X 4Y2XA 3AHGA 4CPDA 1JBQA 2ECFA 3BRWA 3FDFA 3FWZA 3I6YA 3IKMB 4OA5A 1QPGA 1UBOS 2I6QA 3SDZA 4AMGA 1RXVA 1IJBA 1T1GA 3ERCA 3ROEA 3VFDA 4BGVA 3HFRA 2O2EA 3CBGA 3VXKA 1I2ZA 2X0FA 2X6QA 4TTVA 1B0ZA 1KKMA 1X77A 4OEHA 1UXIA 3PENA 4JDPA 2FUEA 3MD0A 5JWOA 4NBNA 3MB5A 1VM6A 1XTBA 2J59A 2QU7A 4ZVTA 5AK5A 1WXDA 1MH9A 3QPDA 2XY4A 5IXYA 1WP4A 2OQRA 1IWPB 1PD0A 3T3DA 4DADA 4B84A 1LI5A 3FIUA 4DTIA 2H57A 2Z1NA 2CW5A 2FSPA 4EH1A 3N2GB 3I5XA 1LC3A 3PDIB 4QYIB 3SX0A 1ONSA 2ODEA 1JKXA 2NXCA 2C54A 4YRAA 3EPLA 3K73O 1STOA 1W35A 2QTNA 4OBBA 3S2ZA 5KNBH 2ERXA 4IKPA 3ZWBA 2ZB4A 3VR2A 4IRXA 1DUIA 1YGPA 2GFHA 5ECWA 3SSOA 4DV3B 1YZTA 2B98A 3A7EA 5TMPA 4WUTA 2XMGA 5JD3A 2A0WA 3VKWA 3LCRA 4HWKA 4HNRA 4NABA 3TCNA 2FCAA 1A7UA 3LDFA 3TEJA 3EA0A 2WWWA 4I14A 2FP4B 3HYTA 3WIUA 3T8YA 2XV1A 3H5LA 4DNXA 2IS6A 1DZIA 1QCCA 4M8IA 4HN4B 2FQYA 2WHXA 2NXJA 1UZAA 3GHYA 3GJRA 3IUJA 3RRYA 2KMLA 1E77A 1G2QA 1T9GS 1YVEI 1R88A 2BFEA 1PFWA 2ZR9A 3SICE 4ERXA 2IYYA 5C5EA 3F1KA 3V4FA 3QSYA 1IM8A 1BQ4A 3LFTA 3VKUA 3W8NA 2D0PB 3FYHA 3PC4A 2OM2A 4MX8A 5JH7F 5CCXA 2VQFB 2GCPA 3OQIB 3L7YA 3CLVA 3H5VA 4EF5A 1Y6ZA 3EUFA 4H60A 1O95D 3MG9A 3PFKA 1RM5A 4RD1A 3TG2A 4C0LA 1XZFA 4JI6B 4MYRA 4RAOA 5EJFA 3R7BA 3V1KA 5L4SA 1MC8A 1ZK0A 4KIJA 1X1SA 5DHRA 2QVLA 3TLGA 3W4IA 3X0DA 4OGKA 4YT2A 5CG1A 1QV7A 3R5SA 4LJSA 2UXCB 1PR6A 2O8BB 1JNXX 1EHCA 1MB0A 2QZZA 4QNRA 2RGGA 3IKJA 4O0LA 4NX2A 4LNUA 3PFBA 1AGXA 1OXTA 2Y1FA 4XDYA 1ANKA 4AUNA 1SUDA 2FWNA 2BMDA 2Q2NA 5LYYA 2Z08A 4DWJA 1K8QA 2LDBA 4R1MA 4WDRA 4ZQBA 2CE2X 2X8WA 5F51A 1E20A 2CWDA 1JB1A 1KY2A 2I33A 3BG5A 4HDRB 2QMZA 1CY2A 5EXPA 4KFTA 4L0MA 3TLXA 5TF0A 3C16C 4LEIA 1EUDB 5DASA 4Z4CA 3IA2A 4MYUA 4AJPA 1KQ3A 1TF2A 1XV5A 2PIAA 2VDWB 2DU8A 2Z58A 3GWGA 4GQIA 4HDKA 1NQWA 1SZDA 1LK7A 1T3SA 3ML1A 3NEAA 1YFJA 3DCYA 4X1YA 2D2FA 4W1PA 3HTXA 1PR2A 5CM2Z 1XRSB 3AFMA 3RC2A 1N5RA 3GJQA 4G81A 5BVGA 1A9PA 1XL0A 5EIOA 1YCHA 1Q91A 2FCRA 2J3IA 2RB5A 4L27A 5IVDA 3TPFA 3ZV7A 3PXEA 1XB2A 3KJXA 1GR1A 2XNDA 4IXWA 4LXGA 1BEUB 4X0EA 2LKDA 1ORRA 1L4BA 3GRUA 4OHUA 1KO7A 2IHUA 3QU2A 3TG8A 3SCZA 4MZXA 3AG6A 3V4VB 3LTEA 1HUQA 1IHYA 3W77A 4LQ4A 2QE7A 9GPBA 2FEKA 1RHRA 5CA0B 5CB8A 5HQTA 4KPFC 5I6DA 5IDXA 1RKVA 5IT5A 2J9YB 3W2GA 4X84A 1QHGA 3MTBA 1BAPA 3JQFA 4C07A 1SG6A 2FF5A 2W6NA 4B6QA 1RPAA 2QG9A 2GLUA 1VSQA 4V1CB 1QIEA 1ISMA 1LLQA 3HY6A 2IOFK 3G7UA 3MF4A 1RQGA 2Q8NA 3DFFA 1GFZA 5ER6A 4G09A 4G1UC 1L4UA 4HRYA 1E1RA 1X2BA 3I72A 4W63A 3RAPR 1J8FA 1MOPA 1XP8A 2XX3A 1G7SA 3ICPA 3SZOA 1V3QE 2GK3A 2Q9BA 3FTQA 4LCJA 1UBLS 4OY3A 5JXHA 4CLRA 4K9SA 5KX5B 1WABA 1U1DA 2PS9A 3EDYA 3W9YA 2ZI6A 3N5CA 2B1QA 4R2JA 2ORED 3PX3A 3H5RA 3RS9A 5CT6A 1Y89A 3V7NA 3G8DA 1SVLA 2DQSA 4X71A 1R8QA 1LZLA 1U8FO 2GN1A 4DSOA 4DN6A 2OV2A 5AQEA 2W5UA 4MAAA 3EVFA 4D4LA 4POAA 5JADA 4OFBA 2JVIA 4ATNA 4J03A 3IPCA 5IJXA 1IEWA 5LNK6 3K6SB 5T41A 5EIFA 3MWEB 3DNMA 2C00A 4NNPA 4N01A 4PX9A 2JHFA 2ZUCA 5HKKD 1J97A 1DC4A 2CZQA 1N6NA 3DDNA 4BN0A 4DUGD 4Y2QA 1A4IA 3IBCA 4RLHA 4U1RA 4IP0A 1YMQA 3N07A 5FUQA 5TIIA 1G8YA 1EYZA 1Z7BA 2JD2A 4HFRA 1SFRA 4F46A 2O9JA 1DL5A 4D0RA 5M7EA 1RAIA 2YHIB 1BG6A 2IC5A 4KU4A 5HDBB 5B7GA 2YCBA 5DSZA 2O7RA 4WDQA 2YVUA 2JH8A 3TLJA 4HGNA 1S9DA 2Z3VA 1XHFA 4RC9A 1JU9A 2P6RA 3NI2A 1R16A 1FEZA 3KQLA 3T7RA 4HFMA 1X1BA 2Q6OA 2I71A 4KC0A 5HILA 2P8SA 4N40A 3FGPA 2JCXA 1C7IA 1QOZA 2E21A 3MUNA 1LZKA 1QIJA 1U2GC 2ET6A 3GFGA 5E0OA 1KVSA 1ZVMA 3X1YA 4YPOA 3PLRA 1SEVA 3EF1A 5E1DA 3C98A 3VOBA 2YHSA 4MUBA 2R6JA 3O8DA 4E5UA 5FBHA 4N3NA 2EX1A 4FWTA 3LW8A 1KBQA 1PJQA 2WKSA 3O8QB 2I76A 2IEAA 2ZSJA 4XJSA 3M9WA 2KM1A 1EINA 5LZ5A 4PO3X 4YT4A 1LDYA 1KIMA 3C87A 4QXQA 5JS7A 3ZX4A 2DH6A 2F64A 3Q8KA 4AM8A 3B9BA 4R0MA 1OZGA 5F7JA 1VYUA 3SYRA 4OLAA 1N2XA 2BFBB 2UZ1B 4HX9A 1X9GA 1J70A 2YW2A 3QFTA 3HKDB 3VR6H 3DL7A 1MT3A 4MTLA 3ZPXA 4XD2A 2VH5R 3L4JA 1Z0ZA 3NW9A 4C6SA 2C4NA 2WYVA 2IZ5A 1RYDA 1ISHA 1F2VA 1VYHA 1YB6A 2B78A 3ICWA 3OEHA 1A9QA 3G0BA 4TMWA 5THXA 3RRFA 3W6NA 3W9BA 1I1NA 5JSHA 3ND6A 4D0SA 5G1NA 2ZYDA 2CLKB 3KS9A 1GPMA 1BN6A 1XDWA 1LF5A 3EMBA 5LMZA 3UMJA 3FPAA 1ML3A 3DV0B 4AT1A 4J1TA 5JJCA 3DMGA 1SBQA 2OWEA 2FR1A 3DEAA 3STWA 1BFUA 1PGQA 4RD4A 3GJSA 4M98A 1PJCA 2QMUA 1EK6A 1WDLA 2ON6A 4UUAA 3AOEA 2H0AA 2GERA 3RVPA 1Q7GA 1OYWA 2EX4A 2QE6A 3D7LA 4Y2TA 4GWKA 3NDPA 3RUIA 4H7EA 1YRLA 3QVSA 2ADMA 4PGMA 1GA6A 3HA7A 2H1LA 1KDYA 4B3HA 4RTKA 5EY5B 1VE7A 4YMIA 5CVUA 2WJGA 4J2OA 2AJBA 1J00A 1GQRA 3UJHA 2JAHA 2JZOA 3OFND 1XCLA 4UBJA 1TKAA 1P1KA 1S2DA 2EKLA 2GAJA 4TLDA 3PB3A 4GFDA 4O1MA 2NUPA 4GSYA 1MVLA 2D1QA 3DO5A 3BE6A 3PCTA 2P0YA 2XVZA 4BAGA 2Y1CA 4R83A 4KWCA 1VI5A 3L93A 3QLUA 4PQGA 3WHIA 1F7VA 5AW9A 3JR3A 1FSSA 2AC4A 1VCOA 1B76A 3VR3D 3AR5A 2QSYA 2OLEA 1P7YA 1MDFA 1A7KA 3L2OB 5IXSA 3OESA 4B45A 4POOA 1B6RA 2GPBA 2R87A 4UBLA 2BEWA 3FMVA 1XELA 3LX8A 4HJRA 2YUIA 2RC5A 5BN3B 4ARSA 2X8AA 4PQYA 1PT7A 3F46A 1Z3IX 3F49S 1O6ZA 2GD1O 2PG3A 4J91A 1PZFA 1HT0A 4FLMA 3UJCA 2GZDA 1GGJA 2AB0A 3T3PB 2ZWAA 4DHEA 2Z6AA 1U0SY 4LXQA 2I4OA 3N7UA 1TEVA 3HU1A 4GYJA 4LGCA 3K70B 1PI3A 3F8TA 3OICA 3B60A 4KYIB 1EXMA 3P19A 4LDRA 2QGNA 1NQAO 3O21A 1XZQA 1JTEA 1ZWLA 1B15A 1MOSA 4HAVA 2Q62A 3PITA 1FUKA 4JOQA 3S8MA 1PFKA 2QRQA 2AFHE 2ZWVA 1ZBDA 4EM6A 3F2IA 3RK4A 3VR4H 2F9MA 2PSJA 2BF4A 3U61B 2AD1A 3KK0A 2G1KA 1IUKA 3D2CA 1TVEA 3QY9A 2IF0A 1CQIA 5HXAA 3BE8A 5EIHA 2GFQA 1HG0A 4GVXA 3TVDA 3UFXA 2WWHA 3TDMA 3ZBUA 1X1CA 4B6GA 4EATA 1ZZGA 2C5GA 2VT6A 5CT8A 2YYAA 4ZZ3A 4EHDA 5TF4A 2FPKA 3CJRA 4QVIA 1JA1A 3U5ZB 4MK4A 3SQDA 2G4LA 1DX6A 4A82A 2ATVA 2V0NA 1PFGA 5KU1A 5DGIA 1KYXA 4MV9A 2OCIA 5FTMA 5FUVA 3RSGA 5JLJA 3A28A 1YACA 5E1BA 1AUVA 1LVHA 2OXRA 2PMFA 1HZZC 5EYPA 1PGOA 4YMWA 1M3SA 2IXFA 1NW3A 1KI1A 2I8CA 2VA9A 1TCUA 1D9ZA 2JPDA 2JZNA 3AK4A 3BORA 3N05A 4JVSB 1ECCA 4XTRA 3W3ZB 3IBYA 4B83A 4YRKA 3IGFA 2DBZA 4MRAA 5BMVA 2PS3A 2HO4A 2PD3A 3CXRA 4E0BA 3ONDA 4KFSA 3R44A 5AVYA 2WU1A 1QQAA 3A58B 1F8GA 2YZGA 3C3BA 4EFMA 3PDWA 4US0R 3DEFA 2BFPA 3RVMA 3WMGA 1QO9A 2PZLA 3V7FA 5JD6A 3GAZA 4L4RA 5LFAA 3T7KA 2PWBA 1RQ7A 2JGFA 3M3PA 1GDHA 3KKZA 3NHKA 3G2OA 2NWQA 4EEXA 4ZVLA 1TK2A 5FOVA 5IAOA 1OLUA 1ZN8A 3WP1B 1HYGA 4HNSA 5ILGA 2PRIA 4XCQA 3QIAA 1E63A 4OBWA 4JXZA 1PG5A 1PL7A 1QFYA 3OFVA 3HM2A 2JGNA 1QHIA 5IEBA 5T57A 2C04A 3N70A 1DDIA 4TLCA 5H9WA 4DV2B 1EM8B 3KYCA 1A8HA 1KJ8A 5K0ZA 1FTGA 2HHJA 2YW9A 1JHQA 3RM3A 5DBOA 4J3FA 4A8JA 2EHJA 4FI3C 3LQ1A 1ZCJA 2XE7A 3T61A 1SC4A 5GPBA 2L2QA 4MWSA 3ZS9A 2JIBA 2PV7A 4LBVA 2C7QA 4D8UA 5CB6A 1T9KA 4QOSA 1YI1A 1KORA 3OJOA 4EY3A 3W6OA 4EARA 1DC7A 3TE6A 3KTFA 2GD2A 1JG3A 5IJAA 2QT9A 5DHQA 1A5ZA 4S3MA 4NS4A 2BI8A 4TMXA 3GRVA 1DQZA 4C0BA 3RIGA 2DPGA 1J6UA 1UT6A 2R5NA 2XCOA 5KQMA 4F8YA 3Q2IA 4MR7A 4ABYA 1BHQ1 4GLOA 3H2HA 1YA4A 2FPLA 3VVCA 2WSBA 3VZSA 1M2EA 3BWEA 1X1TA 1TKBA 3LVRE 2Y9MB 3PVCA 4TL9A 2H92A 3HBMA 4X93A 5GV8A 2R7KA 2ZUWA 4K6HA 1DEXA 3RODA 3KAKA 4RY8A 4WCDA 4GKKB 1YJ8A 2GZMA 1P5ZB 4C2TA 4TTQA 1JEQA 2HHLA 2B69A 3T3OA 1OV6A 1MC1A 1YDEA 2AC2A 3QEKA 4GXQA 3SIXA 5AM4A 1A8QA 1EB8A 1R18A 3AILA 4FFBB 4QRIA 2QT1A 3L0IB 1KEZA 1ZJJA 2DJIA 2E87A 2GLXA 3E3AA 4MDYA 3OJXA 1QANA 1IHXA 1KK1A 2AFVA 2ONZA 4I4NA 2JH3A 3GEHA 4GWLA 4O2RA 3QVTA 4WA7A 3RJ9A 5JAMA 3ITDA 1YZHA 1YTUA 2Z95A 4PYOA 2VQDA 2J9FB 3OIFA 4WQMA 4MJ3A 1M8FA 1US8A 2G9VA 4Y2GA 2EJVA 3AEYA 2HD4A 2ZSDA 5EHXA 1HEIA 3PNBA 3UJ7A 1S01A 1K6XA 4J0EA 4ZTBA 1E9DA 1R0WA 2QTGA 3ONEA 3FOFC 3OEED 4IZIA 1Z35A 4LHYA 4WJKB 2YIDA 3UN1A 2WZBA 1MD9A 3KL4A 4F92B 1UC8A 4YCNA 4TGLA 2REQA 1E96A 4FOTA 2JBWA 1WSDA 1NRXA 4G4GA 1RQNA 3WMXA 1MMFB 1W4ZA 1FXSA 1WBJB 2YXLA 1N34B 4IPTA 1GU7A 2FXVA 5FLXA 5ALOA 3LQRA 3ISVA 4F3YA 2CK3D 1JRLA 2OP0A 4C29A 1QRTA 3ZDFA 3SJAA 3O5AA 1UANA 5AVTA 1XD8A 1CR0A 1PYDA 4IAOA 2DSTA 4UATA 1G5HA 5DVZA 3GLFE 4UW9A 2WILA 4CKCA 2VR1A 3W1WA 2P67A 3WNBA 5A1TA 2H7XA 4U00A 1AN0A 4PBRA 2VDQB 1N9GB 4MHTA 1R4MB 1JR6A 2H07A 4KDEA 3FTDA 2FMIA 1BRMA 4FGSA 3DW3X 4UNIA 4XA8A 3DZKA 1U99A 2IT1A 4P3YA 4MQEB 3W6UA 1GSHA 4ND8A 1KKLA 1TF5A 5KCZA 1LBSA 1VPTA 2A0UA 1SVUA 5BOSB 1KQGA 2QLJA 4OH1A 4ZAGA 2R85A 3SR3A 1N7GA 1YB1A 1JAZA 1R64A 4DR3B 2BELA 2QJRA 2BFCA 3ZU2A 2PZMA 4FX5A 2I99A 3EISA 3VTFA 4LJ4A 5B30A 2HDWA 1WZNA 2DT5A 3WKDA 3QPCA 2VBCA 1CJSA 2VUUA 3F9RA 1N5LA 4ZT2A 1L5YA 4LSZA 5EHQA 4J0CA 3FMFA 2R8RA 3LZ6A 1POWA 3K9WA 2GN8A 3LH5A 5ALYA 3ZHTA 4OX9B 1DRWA 3TNLA 1E6KA 3STUA 1GTL1 1NJFA 1YASA 4DQLA 2EIXA 3OZSA 3VHLB 1LB1B 2ECPA 3MERA 4ND3A 1PJ4A 4BUZA 5I3CA 4M1QA 2OLKA 5AR1A 2QZPA 5CLGA 4CQMA 1E4VA 5JI2E 1Z2DA 4XX0A 4P35A 4CL8A 5E0KB 1JFVA 3QF4B 3D31A 5G4KB 1G20A 1Y37A 1U65A 5EHIA 5TS2A 1JFTA 3IJEB 5CNKA 3W2EA 1E9AA 2DR2A 4CKBA 1GITA 4IWXA 3D8TA 4MVJG 4UFOA 4ZV9A 4JIMA 1YO6A 4R9SA 5CVEA 4D98A 3RUCA 3L1UA 4OXQA 2COEA 2ISSD 2OFOA 2P90A 1R5BA 3IAS1 5L40A 1J9GA 5B7NA 4W82A 2OR3A 1G42A 3GLHA 1KH1A 3C5EA 2F8MA 3RG8A 4UE6A 5AKYA 1AB5A 1T35A 4MRMA 5JAOA 2PRKA 3NDIA 1JLRA 1U7XA 1P6QA 1X80B 2OZKA 4QGFA 4U6SA 4B4OA 1HE2A 1FFEA 2VG8A 1XTUA 3AP1A 4FJ1A 5IJZA 2OK7A 4A0QA 2ZI5A 4JEHA 3TXXA 4DL9A 1VJ0A 1KI6A 2IU3A 3ZWCA 1W36D 1C1DB 1LWOA 2IIPA 5JNUA 1ZS9A 2AI2A 4KGDA 3AO0B 4QLOA 3WLMA 4DIFA 4EHFA 5BVHA 3MS4A 3QJ5A 3SXPA 4C7MA 1PWYE 3KT8A 3LHIA 2NXNA 1ZK2A 2FLWA 4LWPA 4W9MC 2H9IA 3OLYA 4YUYA 2FRDC 5FOQA 1B0PA 5IMBA 5DM60 2CHFA 4YI5A 4RTNA 3IE1A 5KOHB 3QVLA 3DV9A 4UMDA 4XOUA 1V37A 2GD0A 3U2QA 4C88A 3S27A 3HYRA 4AY4A 2OHVA 1PW7A 1IJEA 1Q83A 2I7TA 2XE8A 1N1GA 3EARA 3IXQA 5DW0A 3TTUA 3DBRA 2E18A 2WYWA 2Y1GA 2CL7X 3IT3A 4B7ZA 1G21E 3NV9A 4JI8B 3GV0A 3A4LA 5FB3A 2R8ZA 2V3WA 3PPIA 3E9YA 4H1VA 1BKSB 1K1EA 4TWIA 2Z8XA 1CB0A 3LCVB 3U3KA 1GILA 1II8B 1CTQA 2ETVA 3L7DA 2P2CA 4NF2A 4YJHB 4Z8XA 1MO2A 2NXEA 2Y2UA 2XGJA 4FQ5A 4LBYA 4JSRA 5JNLA 1FJXA 4B3BA 4UU0A 2EKQA 2PA0A 1GEGA 1X7ZB 4UU8A 3Q8MA 2GTIA 4QFDA 4RLQA 4H27A 3KO8A 1UKBA 3JD0A 2QNRA 3M5CA 3I5UA 3K20A 3DWEX 4JKIA 1X13A 4I3HA 1GTSA 1A97A 1JBKA 2RAUA 1KYQA 1AQUA 3ETDA 5DEIA 1UBEA 5I4CA 2YOHA 3OCUA 5AHWA 4V24A 4Q39A 1J42A 4NJMB 4ERNA 3DF7A 2ADFA 3PF9A 3LT5A 3H5NA 4HGRA 5I3ZA 1UDXA 2NZ2A 3P9ZA 4HPXB 1U9CA 3IPYA 3EGCA 4Z99A 3LPDA 3ZI0A 1Y7HA 4YJ2A 3V9AA 2PAFA 4TXJA 4H7DA 5B4TA 5I4BA 2CUKA 5LB4A 3DWIA 5EEHA 3TZHA 4CZ2A 2YY6A 2BGJA 4MA0A 3UC5A 1PSWA 2PX8A 3GG9A 5E9QA 4O0MA 1VIVA 3OQ1A 4J1SA 4AP9A 4D79A 3ZJUA 1ZA1A 5J1SB 2VRWA 1RAGA 4HPJB 3UF0A 4Q02A 4B3IA 1Q84A 4BX3A 3JASB 2HHCA 1YZVA 2HLNA 1GPUA 2IEIA 1D1TA 3QNMA 1VKZA 3ZE7A 3AEQB 3QKTA 3N3AC 1UDCA 2J9RA 1GT6A 3F3SA 621PA 1NZJA 3F6RA 3L1VA 1MG0A 4QSMA 3UAGA 3D4PA 2JB9A 4NYIQ 2Z2YA 3IIEA 4IG9A 2FH5B 1WDKA 2BFNA 2M1XA 1PKXA 3HU2A 3M5DA 4N7RA 5J47A 3QA9A 1N6IA 1EFPB 2TSYB 2XPCA 2I0FA 4CGYA 3JD1A 1C1YA 1UDBA 2CXQA 1I9GA 2AN3A 2UUOA 3DZ8A 3EGVA 1MH1A 3BJZA 3T06B 2ZB2A 5BWMA 5L7TA 3RADC 4PO1A 2X3YA 4GRAA 3KWMA 4EDFA 3FX2A 2RHRA 2UVDA 2Q4TA 2V7PA 5SZHB 4QULA 5H81A 1ZH6A 2NTNA 3I9MA 5DMHA 2BM0A 4N3CA 2J3JA 1NVUQ 1N57A 3RV3A 1HZJA 1Q7CA 2IYAA 2VCYA 4HGYA 5EQJB 1Y8RB 5EJ9A 2VEOA 2ZRKA 1IAVA 4PQFA 1NJ2A 3EG5A 1VHDA 2W70A 4A5OA 2QN9A 5DWQA 5AIAA 1C8BA 5LMCA 1KJZA 3RUFA 5DTRA 2WIKA 1HNZB 1UWLA 3FG9A 1X7XB 4OMCA 5BMVF 3OC0A 2CXRA 2NUTB 3EOZA 3KXDA 2Q99A 3MJDA 3CN9A 4MA5A 3TTXA 2A6PA 5K3FA 2DFKB 4K9DA 3VH1A 2OQIA 3QKUA 3WNQA 2QL5A 3A6KA 3BBPA 3GEMA 1NVVR 2W2LA 1PYOA 5FPHA 2XWBF 4V0LA 4ZIRB 4IO1A 4RYLA 4XDHA 4GGOA 4TUYB 4XRGA 3SF0A 2FDCA 2IZ1A 3E35A 3WFJA 3BQNB 5DT2A 1V16A 3WL4A 1K2VN 4DCGA 1R0KA 2BGWA 1IHPA 2RCYA 2XMDA 1DFIA 2XMCA 2X8JB 5K8CA 2ORVA 2UYGA 1H1TA 2EW1A 3QP9A 2JLXA 3VDXA 1OYYA 3WYBA 1IQUA 3DEHA 5BSVA 4PAWA 4E7PA 3JU3A 4NV0A 4YQYA 4P4SB 5B1YA 4S1PA 2XWSA 5DRTA 3UTDA 2EARA 2QOEA 4G5QA 4MKZA 1GARA 1J56A 5KI6A 2VN8A 5CK4A 1WCIA 4PZEA 4CT0A 4ZJZA 1G3UA 1EBUA 3HN2A 3NGMA 2HR1A 3PFFA 4JVMA 1P5FA 2IKQA 3ZE2B 1PYGA 5K8UA 1OXKB 1Y1LA 1H42A 3N39C 1ORDA 2YNMA 5SZKB 1MO4A 2OFFA 3VSDA 4ZT7A 3VR0A 3EIUA 3BAZA 3F3MA 3OIWA 4TYPA 2XUZA 4JT2A 4WK6A 4OQFA 3TIXB 4D8VA 1KYZA 3EZLA 1UJNA 4C87A 4P3NA 1YDGA 3IIJA 3Q8XB 1Q0UA 4AK9A 2JA1A 2GVNA 2ZR8A 4EG6A 1OU4A 2APJA 1U0RA 2P6MA 3GT7A 4ND6A 3WGJA 5BWCA 5IJ9B 3AB8A 4R9NA 4CF5A 2DLCX 1E7YA 1O4WA 3FHCB 1I6LA 1AXGA 4AUEA 2BM8A 3B8HA 4BHTA 1T2EA 2XWPA 2R1TB 3BGVA 4HRAA 3X1ZA 2O2HA 2IV3A 3R77A 3QLJA 4UHJA 3INNA 5JOQA 2D1FA 2A67A 2EJCA 4B09A 1Y9EA 4PZUA 2QN2A 5D01A 2G9QA 3AONB 2HNBA 3KZOA 3SS9X 5JNTA 3LGAA 1FXUA 4X7MA 4MV3A 1T0PA 3WL3A 1ZCAA 3CO0S 1E9SA 1WLSA 1YI0A 5IAGA 5B6JA 1RJ9B 3AL3A 4HGOA 4NMMA 1WVMA 2XB6A 3OJWA 5IH3A 1V25A 2JJ2D 1UOEA 4G5OA 4NR0A 3G2HA 3EEYA 1N2CE 3BMNA 2OAP1 2ZK7A 5BT9A 16PKA 2IL1A 2MDTA 5KJCA 3BWYA 2UYHA 3H0EA 3HZOA 2WOOA 4DLNA 4W5HA 1ZX1A 1D4OA 2J30A 4OQNA 4E32A 1JXQA 2I7DA 2X13A 2PRZA 4YRCA 3R9IA 3NC4A 1KO1A 3CTMA 3H3XA 2WTMA 3K05A 5TNXA 2PX6A 4OOFA 3PG5A 3SWWA 4Q00A 2WABA 4ZI7B 2O3QA 4YLYA 3AV3A 1A2OA 1BA2A 4AF6A 2MMCA 4IGKA 4DLSA 5BN4B 1LBIA 4BVKA 1J1UA 3ZU3A 4KRYA 4RGVA 4BLVA 1D1PA 3WWYA 3LF2A 4FFNA 4CM9D 2JJ1A 5BOVA 1CIPA 3ND9A 1GGHA 5D87A 4CVNA 5BQXA 5KNLA 4N6GA 3FAKA 2X9GA 1C2TA 4M6WA 3ENKA 3PUJA 4WERA 2Z83A 3EFEA 3V4LA 4IEEA 1DINA 2SBTA 2DETA 3RD5A 2BDEA 1JZQA 2PSSA 1SXIA 2PGJA 3QELB 4FMCB 5I9NA 2E5LB 5CNJA 3EWSA 3OD1A 5FI3A 5LOVA 1XN1A 4TZKA 2PMEA 4BNKA 3W90A 5EP2A 5IYZF 5WRFA 3IP7A 4AY3A 4BYGA 4HVLA 4JYZA 2TMGA 4EGQA 2NU6A 3BIOA 4BMSA 4HAYA 3CEMA 1TJPB 1ZHHA 3BTOA 5CXXA 1JR3D 4ND7A 2R66A 3G88A 5DHUA 8MHTA 3JWEA 1QE0A 1A9XA 1XLWA 2D8MA 3MOSA 3ZCTA 1QRSA 2IHTA 2X4GA 3OFNA 2B5WA 1V11B 3FPSA 3SIPA 3RGWS 5A3SA 5CFMA 5TARA 4JSTA 3WRXA 4GMDA 3B12A