4J4TA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j4tA00
4HP8A 4IZHA 3DBHA 3IIEA 3K2EA 5G0TA 3DZKA 4XB2A 3FHLA 3ZNQA 3E8XA 2YHIB 3ZI0A 2ZIZA 5JC1A 2X86A 3IDSA 2A94A 6ADHA 2AQ8A 4J4TA 4XYMA 3UICA 3JQEA 1XU7A 4NR0A 4XQCA 1PJTA 2BF7A 2IZ0A 3UGKA 1ISFA 5KKCA 1QLJA 4IDFA 4PLCA 1LRJA 1HDYA 2F00A 4A5OA 1R16A 4M87A 2I66A 5AYVA 4E5NA 4KTVE 1E1NA 2NU6A 4AJ4A 4BQRA 3QE3A 4OQYA 1C1DB 1T26A 3T4XA 4O6VA 3D1LA 4ROSA 5KJFA 1UXKA 4WLNA 5F1KA 5F5LA 3IQDB 4ZHSA 1HDGO 4PCVA 2UAGA 3ZU3A 1LSJA 3JTMA 3KB6A 5GZ6A 3U3XA 5MDHA 1L1FA 2VHWA 5LDHA 1SOVA 2GZ3A 4CLOB 3ZWOA 3ZWWA 1BXKA 3DZBA 3ZNNA 1EBUA 1GCUA 3C1AA 4IGEA 1H9AA 1UH5A 3ZHBA 1P74A 3UOGA 1DLIA 4EUHA 3I83A 3FWNA 2BKAA 2ZQYA 3FPCA 4HV4A 1ML3A 2VT3A 5IDQA 1DXYA 3K2BA 3TPCA 2G76A 3AOEC 1VJ0A 1ADGA 2IYPA 2X6TA 4LW8A 4J2OA 3PJGA 4YAGA 2X0IA 2AA3A 1C0LA 2JL1A 4G5HA 2IDZA 1E6UA 1J0XO 1K3TA 3JQGB 3L9WA 3OECA 3VDRA 1YQXA 1UDCA 3A06A 4IIVA 2I3AA 4GBJA 3LT1A 2BHLA 1GPDG 1LLUA 5A03A 4CL3A 3GAZA 4F3YA 1NYTA 3KLPX 3ZW9A 2HMWA 4J9VA 3NEPX 5DCYA 4CMHA 4F6LA 2W90A 1GFSA 4DPLA 3PVZA 2B4TO 4FFPA 4ZVVA 1TLTA 5A06A 3PGJA 4GVXA 4BNIA 4CM5A 4XDYA 3QHAA 4BS9A 1DHRA 4R16A 1EVZA 4RZHA 2P9GA 3DBVO 1NVTA 1NWHA 3NKLA 3HUDA 3ZV5A 1L7EA 1ZUD1 2GN9A 2Y1EA 4A7PA 4J0FA 3NGLA 4OOEA 1A4IA 3ONFA 5A5FA 3MTGA 1WDMA 5JFOA 1I3MA 1NXQA 3DMYA 1H2BA 3QWHA 4IPTA 4XX0A 5EINA 2Q49A 3H5AA 5K6AA 4MVJE 2DU8A 4DTIA 2B37A 4PLWA 4R1SA 1UZNA 5THQA 5K9ZA 4E13A 1YVEI 2JFHA 3BMQB 3E03A 4EUEA 1HEUA 2GZ1A 1YJ8A 3DB2A 1GTMA 4BKPA 3PFFA 4MP3A 3AFNA 3HN7A 4IZIA 1YQDA 3F4LA 5T64A 1R66A 4B7CA 5B12A 1M6WA 3WIEA 5JDIC 2O3JA 1TB4A 3CXRA 2X9GA 5H81A 3KV3O 4AJNA 3QVTA 4HY3A 4N5LA 4DLLA 1PS0A 2WE8A 3E1KA 4DRYA 3TRIA 4CM4A 1JU9A 4L74A 4M55A 5CDSA 1O94A 4XYEA 3K73O 4PG4A 3RU9A 4ALLA 2FRDA 2BFAA 4XGNA 3RUIA 3AI2A 3OQ6A 3JQ9A 4BO0A 3RU7A 3GN2A 3LVFO 4CR7A 3VVBA 1D4FA 2AHRA 4HUJA 4EJMA 4OHUA 3B1KA 4J91A 2WDZA 4CL8A 1J49A 4UEOA 3JQ7A 2HMSA 3JYNA 3KYBA 3NJ8A 8LDHA 3QRWA 4RF2A 2NADA 4NG5A 5BR7A 2DQ4A 3UH1A 4DLAA 3QVXA 5F1PA 3VPHA 1TT5B 3DOOA 3I52A 3KZVA 3L4BC 4BNMA 4CR6A 5ADHA 3R0IA 2BLLA 3R3SA 2VQ3A 4JQCA 2QYSA 1UDAA 3TZCA 4JK3A 1A72A 7MDHA 4A10A 1PZHA 4NBRA 5KVVA 3RFVA 2C82A 4J16A 3ADOA 4PLFA 2IE0A 9LDTA 4E30A 4IQGA 2Y0DA 2CFCA 5EL0A 2O50A 3WDSA 1C0IA 2NUAA 1ZK2A 3RROA 1BVRA 3WGYA 3LF2A 3W4KA 4LK3A 1GYQA 4R01A 1V35A 5T6BA 1E0DA 3GEMA 4Y67A 1KIFA 4BOYA 5KVCA 3JQAA 4BB6A 4CLRB 4Z9YA 2I5PO 4NPCA 5DBIA 4ILKA 1NX6A 2WYVA 4KZPA 2EEZA 2QQ5A 3LLVA 1U1IA 3ZWBA 3A28A 4K6CA 1YQGA 1WPQA 4U7WA 4Z6KA 4CLOA 2ILTA 3G1UA 5GY7A 1TI7A 4RDIA 1Q0LA 1NQOA 1MP0A 2QIOA 4MVJA 2ZB4A 4I5FA 2VOJA 2AEMA 5JCJD 4BO8A 3ON5A 3AM3A 2DUWA 1EVIA 4E2WA 3GNTA 3RQSA 3PI7A 3TZHA 4X54A 2VRBA 1U4OA 1W0CA 3TSCA 1GZ4A 3A14A 3GN1A 5TJ9A 2Z1NA 4K1LA 4NFYA 4XGIA 3RKUA 1FDWA 3EVTA 4NJOA 4NI5A 5TF4A 5AVOA 2JHFA 4BO1A 1E7MA 3HDYA 1PR3A 3L9XA 3OBBA 4Z3DA 2VOEA 3V1UA 2JJYA 1B16A 5DN9A 3VOSA 2OO5A 1UP7A 4BNYA 4FIZA 1ZW1A 1AHHA 3DAGA 3HFSA 4RL6A 2OP0A 3UN1A 3BMOA 3AW9A 1LQTA 1QKIA 2DFDA 4QSMA 4CM8B 3HDQA 4TVOA 1KEUA 2WD7B 3JQGA 1NHGA 2IODA 2VUTA 2WSBA 4P4GA 3M1LA 4L4XA 2AEJA 1VJTA 4N54A 1JWBB 1E3EA 2V6MA 2YDYA 4AFNA 4IMPA 4MKXA 3CKYA 3LF1A 2WEKA 5HRUA 3U9LA 1V9LA 5A4DA 1WNTA 1KC3A 2C7VA 2RH4A 3V8BA 1N5DA 3H6KA 3QY9A 3H4VA 4HKTA 1FDSA 1Q1NA 5TLSA 4YVFA 3GDGA 1V0JA 3LK7A 4CMGA 3QJ5A 4GL4A 4B8ZA 4RO0A 5A5EA 1HYHA 2DUUA 2YJZA 2PV7A 2ZB8A 3C8MA 4FC7A 2R00C 3TDKA 3VZQA 1XR3A 1XQ1A 1ZSVA 3AOGA 2FZWA 3K92A 3QA9A 3I9OA 4Q9NA 4QXMA 4R69A 2VWQA 4TSKA 3RC1A 4XCVA 3SXPA 5C7OO 2VRCD 1W73A 3IUPA 2QZZA 4FBGA 1NTOA 5KJ1A 1MG0A 1JW9B 4GVLA 1T1SA 1QP8A 4K6FA 3W8EA 2IRWA 1LRLA 5B1YA 5COQA 2I76A 2BI8A 3I9NA 1X0XA 1XQ6A 4EI2A 4PN3A 1P0FA 3BTSA 4ZQGA 4FFRA 5L9AA 4R54A 1GQYA 4B4OA 2UVDA 4JP2A 1BGVA 4BV8A 4RVUA 3H9GA 3RKRA 1M6HA 4JBIA 3GY0A 4RLSA 1K89A 1OBFO 1Y1PA 4ZQHA 2NWQA 4GX0A 3EZLA 1HE5A 1SO8A 3JQBC 2BFOA 3RUHA 1I3KA 5JAZA 3INGA 2IEDA 3V1TC 1UAGA 3VPGA 3WTCA 3ANMA 3HFGA 2YDXA 1N8KA 1GU7A 2Q99A 4Y9DA 5TT0A 2EV9A 1EQ2A 1XEAA 2C54A 7ADHA 1T25A 3TN7A 1E7YA 1P3DA 2NACA 3ZWYA 1W8DA 2H5LA 4NHEA 2FR0A 3DHYA 3TZQA 1DPGA 1KC1A 4LMPA 3AFMA 3OSUA 4JLWA 2D5AA 5DT9A 3F1KA 1AE1A 1K0UA 4OM8A 4WLOA 2C5AA 1HXHA 3VPXA 4YB8A 5L3ZA 4RVDA 1ZJYA 2RBEA 1EUCA 4AJ1A 4D44A 3LZ6A 5JSFA 2G1UA 2H9IA 3EGOA 5FWNA 1OMOA 3OEWA 4Z0HO 5HM8A 4PLTA 4B7UA 1TT5A 3PHGA 4FS3A 3UF0A 4CV1A 4J1SA 4FJ2A 1A7AA 4OO3A 2J3HA 3ITDA 4Y6SA 1NHWA 4BO9A 4FW8A 1R4MB 4WPGA 1WDKA 1EVJA 3ENKA 3VTZA 4RPLA 1B15A 3D64A 1P1KA 4R5HA 4XYGA 4YT8A 2PFGA 4FSHA 4MKZA 1U9JA 4GKBA 2PR2A 4RPHA 4TRJA 1FJHA 1ZSNA 3M1AA 1LLQA 3W8FA 4CLRA 1E1MA 3FSRA 4BUCA 5U9CA 1QORA 4K26A 1GQ2A 1R0KA 2J5QA 4EEZA 5TJHA 1CETA 5AXCA 3AM4A 3V2HA 3F5QA 2Y0EA 4L4SA 3OM9A 5CDYA 1LXCA 3BIOA 1ZXLA 1BDMA 5I8WA 1F06A 1YE3A 4YJHB 3ORFA 4IXWA 3K5PA 3WWYA 4TWRA 5A9SA 1YL6A 2J3KA 2D5CA 4J0EA 3ZV6A 5L4NA 4FGWA 4BO4A 2F1KA 3DQPA 4G2NA 4JBHA 1U8XX 3IL2A 2HDHA 3OH8A 2X5OA 3ZN2A 3GUYA 4XEHA 1QSGA 2GN4A 3S8MA 3D4NA 1CIVA 5AXAA 1YH3A 2PKQO 2WYUA 1D1TA 4L73A 2G5CA 4OKIA 1D8AA 2AE2A 3GT0A 3E5RA 1LUAA 1T2AA 5HA5A 2DC1A 4DREA 2HLPA 2NQ8A 1ZCJA 2OBYA 5JE8A 5CG2A 4PFJA 1ZEMA 4CM8A 5JCXA 4DLBA 4O59O 2WD7A 2YFQA 4BNGA 3U4CA 4CQLB 2XXJA 2HK7A 3DZIA 4N5NA 1ULUA 3FNHA 3ZWXA 4ALJA 3KUXA 4BQPA 4A0SA 4XYLA 3WGIA 3WYCA 2GRAA 2ZYAA 4L8VA 3LC7O 4FCCA 4XQEA 4P4NA 1DC5A 3EK2A 4B3IA 5DOVA 2TMGA 4QECA 1DFHA 1QYDA 2CVZA 4RVFA 1H6DA 4Z9XA 4YRAA 1KY5A 1NAIA 1JAYA 3MJSA 4HNGA 4GLOA 4BKOA 1CWUA 3H9JA 2YQ4A 4AJEA 5TGDA 4W6ZA 4J9UE 4YAJA 5LCXA 4ZU3A 2Q2VA 3TWOA 2WM3A 3IKTA 1OI7A 3VKUA 1QLHA 2VZ0A 4KUHA 1PR9A 1LDEA 1HDXA 1AUPA 4BO5A 4DVJA 2DPGA 3HDHA 3ETEA 2FPPA 3U4HA 1U3UA 4HX5A 4MVJP 3N58A 4MOWA 4Z9FA 4NBWA 4A03A 4BGUA 5JCJA 2FSSA 1U3TA 4GX1A 4XQ9A 3X2FA 3VH1A 4NIMA 4BO2A 4FFOA 1JAXA 1B8UA 2I65A 3BTUA 5IXYA 1KVTA 3RUEA 5DULA 3ROPA 2J3IA 1EMDA 3GGGA 2NLOA 3FBTA 2VTDA 1S7CA 3HHPA 1X15A 3STHA 3T7CA 4PRKA 3ZWPA 5JW6A 1HE3A 1SC6A 1C3VA 4R9RA 4TVBA 4E5PA 5EQDA 1H94A 4E6PA 3RVDA 4E3ZA 2Q1UA 1X1EA 2PGLA 2WYWA 3MJ4A 4LRTB 4EGFA 1Q0HA 1DIHA 1OC4A 3F6YA 3MJVA 1M2WA 5JBIA 4JXKA 4E5YA 1V3UA 3ANNA 3UHAA 4WECA 5G0WA 2O4CA 1ZKMA 5FI5A 5C7IO 4AJ2A 2X58A 1Q7GA 3MOGA 4DXHA 3E9MA 4B79A 5KVQA 4IY1A 2V6GA 1MV8A 1PEDA 4YRBA 4NBUA 2Q1WA 3JV7A 2X9NA 4IDAA 2B4QA 4WCFB 4DQXA 1XCBA 4WASA 3H7AA 2OMEA 4QO8A 4HFNA 2P9CA 1DFGA 4CUKA 3WBFA 1H5QA 2O7SA 4RQTA 3ICPA 4DMLA 3C7AA 4P8RA 1PS9A 3L6OO 4RQUA 3ROMA 5THKA 1U5CA 3AUTA 4J90A 1CJCA 4PRLA 1PTJA 3CSDA 2PD4A 4L4RA 1W4ZA 1Z45A 2OGUA 5CHEA 5DNAA 1R4MA 4Q3BA 4XWYA 2HJSA 1UAYA 3B1JA 1H0KA 4EJ6A 3GF4A 4I5EA 2FR1A 3FBGA 4AL4A 1XDWA 5IDWA 1NPTO 1E3JA 1JKJA 3GAFA 3RBZA 3NRCA 4IBOA 2HO5A 2NTJA 3WGQA 4J1NA 4DC0A 2HAEA 3ASUA 5I7EA 2JD2A 3HNPA 4QFCA 1UXHA 2NTVA 1ISJA 2PD3A 3FI9A 1QYWA 3JQAD 2NTNA 1I24A 5BNIA 2JHGA 4YBZA 4CV2A 2Z1MA 1PQPA 4BNKA 5AOVA 1KOLA 1PGQA 4CPDA 3V2UA 4EZBA 3FTPA 3OQ1A 3PIIA 1VJ1A 1X14A 4XDZA 1Q2XA 1PJ2A 4YJHA 1X7GA 2I9PA 4Q3AA 1QV7A 3WGZA 5IG2A 4NDNE 3L77A 1QYXA 1NM5A 2P68A 1NQTA 4Q39A 1ARZA 4R3NA 4MVJD 3MOIA 4RZIA 5TNXA 4YAEA 4ZD6A 3GHYA 4A2CA 3TZ6A 1GEGA 1G1AA 4XRRA 4QUKA 1BXGB 4GGOA 1E6EA 4L0QA 3W1VA 2B5WA 2EWMA 1IHXA 3H5RA 1P44A 3L07A 3GGPA 4DMMA 2X7HA 3FCOA 1DB3A 3CMCO 3JQCA 4JX8A 1FF9A 4L75A 4N5MA 3JQ7B 3GMDA 2BMAA 1AHIA 4W7HA 4BMVA 1NPDA 4CQLA 4DPMA 1N9GB 4E32A 1E3LA 1E7RA 2VHVA 3B1FA 1M66A 1U4SA 1EUZA 2EGGA 4RV9A 3PQFA 1IPEA 4DWVA 5KJCA 4ZQBA 3BMCB 4R1TA 4ZQEA 5T57A 4D46A 2UDPA 3JQFA 3JD4A 5IF3A 3JYOA 2ZCUA 4IJUA 1NVGA 3VHRA 1M67A 2B0JA 3CE6A 3DFZA 5DP2A 5CEEA 4PZCA 1ZZEA 5EN4A 2B69A 4B4UA 2E49A 5IJZA 4YCAA 1U2DA 1XYGA 3DAPA 1LNQA 4FOOA 3I4CA 1HKUA 4IXTA 2GNAA 1O95A 4D7AA 1E7QA 3AK4A 4L76A 3ZWNA 2PWZA 3R6DA 4FFMA 3JQAB 5L95A 2FHSA 3N74A 1K2WA 1IOLA 1IY8A 4BGEA 2ZYDA 1NR7A 4D3DA 3IJRA 1ZNQO 3FTNA 4ND2A 1P1HA 1T2FA 4TZTA 4RF5A 4DIFA 5CFZA 1T4BA 1VLLA 1ZMOA 3GLQA 4KWHA 3PPIA 4IDEA 2A35A 1I8TA 3ZU5A 1E3IA 2PH5A 1R0SA 4WCDA 4XR4A 3DMTA 1Y8RB 3IKVA 1KERA 4HADA 3KBOA 2GYYA 1O0SA 3OEYA 4WK6A 4HNHA 4PGFA 4CMEA 1EBFA 1PWZA 4Z0TA 2DTDA 1FDVA 3BYZA 2ZKLA 2DPHA 3DOJA 5EMHA 3RSHA 1DDOA 3ENNA 3P2YA 1ID1A 3KYDB 4CMBA 4DGSA 3SVTA 3OQBA 3D4PA 4NU5A 4XYBA 5C7LO 4BNNA 1CQIA 1D1SA 2X5JO 3ONEA 4YEDA 1VL8A 2CF6A 4MDHA 4D45A 4YT4A 3CZRA 2FOIA 1E7SA 3WGTA 3PYLA 3BMOB 4KDFA 1FMCA 1U7HA 1T4DA 1DEHA 3NTRA 1P31A 4YR9A 3W4JA 4ALIA 2J3JA 2O2SA 5L51A 3ROKA 2JFFA 4WCFA 4Q3NA 4WLEA 1KVUA 3ZWCA 4B3HA 2HKIA 4QEDA 2H1SA 1D3AA 2RHCA 3Q9NA 4H15A 4IQ0A 4CQMB 3BMNB 4C4OA 2PH3A 1KVSA 4OQZA 1LLCA 5I9MA 2Y99A 1QV6A 3Q2IA 4DQUA 2WE7A 4CV0A 4MVJG 2G17A 5IZCC 4JBGA 2J5RA 4C7JA 4YA6A 4BL5A 2GSDA 5L45A 1IZ0A 4OIMA 4G65A 5JDCC 5C5IA 3RUAA 3VVCA 3G0OA 1Y9EA 3QQPA 4CM3A 1T2CA 2X9VA 4ID9A 2JCXA 4ZQFA 1LSOA 3OFSA 4J6FA 1MXFA 4BNTA 1YBVA 1N7HA 5KVSA 4AJPA 4BO7A 1T2DA 4JN6B 4CJXA 2NVUB 1WW8A 5T8KA 2EXXA 3NGXA 4IDGA 3FPLA 3IUSA 3EDMA 3Q3CA 3HSKA 4IUYA 3WSWA 4Z3KA 5KNLA 1JN0A 1J5PA 5EQFA 5BSGA 1E6WA 1RYDA 1BRMA 4A26A 3WQRA 1GZ3A 3DZFA 1E1LA 3ZWVA 5L4LA 3SJUA 3QVSA 2QHXA 2OL4A 1PGPA 3G3EA 3JYLA 1Z6ZA 4MP8A 1HDCA 3I1JA 1YB5A 3HJAA 3MTJA 2CNBA 5JMPA 4I5GA 2Q4EA 4DBVO 3JQDA 3PJDA 5ENDA 1N2SA 1LDNA 3C24A 2BH9A 2AXQA 3H5NA 1BXGA 3HB4X 4GWGA 1SZJG 1GUYA 1EQUA 2UYYA 2P91A 3B20A 3WGGA 1C0PA 3DBLB 1GV1A 3MEQA 3JSAA 3HN2A 1DC3A 3F1LA 4LGVA 1QYVA 4BV9A 5DCWA 3Q6IA 4I9NA 5TSDA 4TKMA 4KWIA 3TZKA 4S1VA 1GYRA 3GQVA 3D5QA 2X8LA 5KJEA 2Q45A 1N9GA 3DZGA 4U0JA 1MFPA 6LDHA 2C59A 4PLGA 5CP8A 4DQVA 4M89A 4U0KA 3TNLA 1LQUA 4IINA 1Z7BA 2C20A 4ZRMA 3H2SA 2VZ8A 3OA0A 3BMCA 5HBRA 2HQ1A 3D4OA 1KYQA 1P1IA 3DC2A 2CVQA 1X7HA 1QG6A 3KETA 3GNSA 3TL2A 4E2YA 4M49A 4GX2A 3WFJA 1GQQA 1V6AA 3KHUA 3TJRA 3W4IA 3DL2A 3K30A 1SOWA 1I10A 2OZPA 2IXAA 3VH2A 3RBVA 3EZYA 1VC2A 2YV3A 1ZK0A 1WMAA 5CAEA 5I7VA 2EGHA 5IZ4A 1EZ4A 3QIVA 3HE3A 4PLYA 2BRUA 1XHLA 1PJSA 2AG5A 1I33A 1WWKA 1PS8A 3W6ZA 2Q4BA 1EVYA 2QX7A 4FPXA 3UCXA 2R6JA 2GN8A 3OIFA 1PSDA 2RIRA 1Y8RA 2NU7A 3I3OA 4F45A 2VUSA 2NQTA 4J49A 2ZB3A 5A9SB 3PJEA 4JJGA 3S2IA 4J4HA 4JP3A 3E48A 3WYEA 4OL9A 4WOKA 4KOAA 5FYDA 1YL7A 4BMSA 1P1JA 5JC8A 5L4SA 1HL3A 5ENVA 2Q1SA 3KYDA 1DRWA 1OFGA 3AU9A 4UAGA 4WLUA 4R41A 3JYQA 3IOYA 3NJ4A 4HBGA 3V5NA 2NVBA 1XG5A 2WWRA 1HYEA 2LDBA 5H82A 3PXXA 3UAGA 2VZ9A 1SNYA 2OHXA 3PZBA 4UEKA 1LEHA 1I2ZA 3KO8A 5BSEA 4IJKA 2Y05A 3LT0A 4BO6A 1DC4A 1XKQA 3S55A 3WFIA 1F17A 2B4RO 1UXJA 4W82A 5CDGA 3DDNA 5ILGA 3SC4A 2DBRA 4BNWA 2VT2A 2YQ5A 1O9BA 2EF1A 3BMNA 2V6BA 3RC7A 4CQMA 2PLAA 3C3XA 4FDAA 3DZHA 3H8VA 4HXYA 1Y5MA 3OF2A 3PYMA 4NK5A 3WG9A 1P45A 5DBFA 1ZFNA 2Y67A 4II3A 4YPOA 5DZSA 4AJIA 3H2ZA 3GZNB 3INRA 4M8SA 1D7OA 2OORA 2QW8A 3I9KA 1ENZA 5DCUA 3U62A 1WVGA 2AEFA 4CMAA 1RM3A 5A04A 4WE3A 4HWKA 2I67A 4R5MA 4TMFA 1A4UA 2AQIA 2CUKA 1F0YA 1F14A 3HG7A 4IJVA 5L7TA 5JAQA 5JNLA 5K6AC 4ONEA 5MGBA 4MVJF 5B4VA 5F21A 2BD0A 2NVUA 1E7WA 2GF2A 1KEWA 3OJLA 3P2OA 5G0UA 5L40A 1YGYA 2R2GA 3EYWA 3KEQA 4OGWA 5DP1A 3WS7A 3WSVA 3DR3A 4E4YA 1F8FA 2PZLA 4L9RA 4CUZA 2PY6A 1MXHA 2X0NA 3GGOA 4WGGA 2BGKA 2VCYA 4I8XA 4LCJA 4I08A 2GLXA 3AY7A 4IJWA 2CDAA 5AXBA 4UVEA 3GR6A 2EKQA 4IS3A 3AY6A 3E18A 2DVMA 2Y93A 3ETDA 2PGJA 2VWPA 3QWBA 3JYPA 1YXMA 4N18A 4YAIA 3JCZA 4H16A 3RUFA 4AJLA 3KRTA 2XPCA 4YJDA 1P33A 1GD1O 3ETGA 3W6UA 1O89A 1U3VA 3GRPA 2D3TA 3RAJA 3K31A 3I23A 2D4AA 2EJWA 3JQ9C 1BW9B 3DBLA 3FNGA 4GQAA 3K9QO 1JQBA 2ZTMA 3NTQA 2P2SA 4LVUA 5A05A 3V1YA 3FR7A 4R4JA 3U5TA 2JFGA 3EAGA 4O1MA 2EP5A 4CM1A 4NQZA 1I3NA 1OAAA 3DXFA 1EK6A 3E6AA 2DT5A 3A4VA 2HMTA 5EIOA 1LSUA 4JCOA 4Q3DA 3PQEA 2HUNA 4RGBA 5JMWA 1XA0A 3E82A 1GUZA 1ZVMA 4BKQA 1O6ZA 3OP4A 3UW3A 3W8DA 5CEFA 3IS3A 2H6EA 4RF3A 1HZZA 4UUOA 4OXNA 1PZFA 4O0LA 3ZDFA 4BKRA 3PLRA 3GRKA 5L7YA 1YOVB 4EUFA 1HLDA 3ADPA 1UDBA 1EDZA 4YJGB 1A7KA 1G0NA 4ITUA 3AI3A 4PG6A 1X13A 5KKAA 2CF5A 2CVOA 2PZKA 1T1RA 4AJJA 1A9YA 5IXSA 2P9EA 3OJFA 1YRLA 3ZU4A 5KCZA 2X4GA 2A9FA 3GH3A 1MFZA 1XU9A 2G82A 3UCEA 4OMUA 1VL6A 1UR5A 3L6DA 4FQ8A 5G4KB 4M1QA 3ZU2A 2PD6A 2BFPA 3P19A 1DRUA 1OZAA 3SEFA 3G79A 5HS6A 3VTFA 1PGOA 1LBEA 3WLEA 1QMGA 4EEXA 1CRWG 1LA2A 3LLSA 2LDXA 1PJQA 3ASVA 4MO2A 4XZ3A 5COAA 3PTZA 5BSFA 1Z73A 3WMXA 3GFGA 5DBGA 1VKOA 4WKGA 2OFPA 2UUOA 1YBMA 3PK0A 3WXBA 2ZB7A 4MVJH 4D3SA 2OBNA 3QVOA 4B4WA 1H93A 2VWGA 2PZJA 2W2KB 3NT5A 1GDHA 4CUJA 4B3JA 1A71A 2RHRA 3U4IA 1I2CA 1YWGO 4TKLA 1LX6A 1TT7A 1ZIDA 2NM0A 2QG4A 4J1TA 1ISGA 1IZ9A 4YDRA 2DBZA 4W9NA 1Y7TA 3VDQA 1DBVO 2EW8A 1VSUA 2O4UX 4AJKA 1VI2A 4CMIB 5F1OA 3I6IA 3RD5A 5BNTA 3IP1A 3FD8A 4LN1A 4Y6RA 5LC1A 1ZSYA 4I9UA 5F3RA 5FF9A 3IP3A 5TX7A 3OICA 1T2EA 3TOZA 1J6UA 4QT0A 1IPFA 1I36A 2O3SA 1RPNA 3RJ5A 3ZGYA 3FNEA 2O3QA 4IDDA 2OXIA 4MKRA 2X1HA 3F47A 1LC3A 3GZNA 2HJRA 4PLZA 3DTTA 2E37A 5A1TA 4W4TA 1SEPA 1ORRA 3SC6A 3K96A 1VM6A 4NK4A 3TF5A 2EKLA 3PGXA 3GNQA 5AQ1A 2C07A 3D7LA 5JO9A 3TL3A 1LU9A 4OXKA 3ABIA 4BNFA 1EE9A 1RYEA 2YV1A 1PWXA 3VZSA 3PHIA 2YFHA 1EDOA 1YJQA 3CPSA 3PIDA 3EVNA 4INAA 4BNVA 4XGKA 4PVDA 1ISIA 3EHEA 1ZH8A 3SJ7A 3QVWA 2YV2A 2W98A 5I9LA 2Y1OA 1QR6A 4P4LA 3PJFA 4J4BA 3WGOA 4TQGA 3SX2A 2PZMA 1HZJA 2RH8A 3X2EA 4K28A 1U5AA 1HDZA 3IAHA 4EITA 3PWZA 3HQ4O 4CMKA 2PTGA 1YKFA 1AGNA 3GVPA 4JIGA 1GAEO 2GUGA 3D3WA 3MJCA 2CDCA 3TFQA 4NFSA 4PG5A 1BW9A 3F4BA 3BHJA 1NAHA 3GVCA 3PDUA 4OSPA 1FXSA 2YHUA 4CMCA 4H7PA 4LVCA 4NU6A 3V2GA 3DAFA 2JCVA 3KSUA 1DHTA 4DC1A 2O3UA 3LYLA 4LMRA 2DM6A 3K6JA 1YO6A 3GVIA 3D5TA 1N92A 4RDHA 3CMMA 4KUEA 5A3VA 3TQHA 3AOEA 3GVXA 2OOSA 2J5KA 1CF2O 1PZEA 1N1EA 3IJPA 3Q9UA 4LRSB 4E2ZA 1F8GA 4XRGA 2Q1TA 3GMSA 3JD1A 3WIDA 2V7PA 2FWMX 3DHEA 4YXFA 3CTMA 1R0LA 1F12A 3EUWA 2QRLA 3E9QA 3JQ6A 2B5VA 2VHXA 1BTOA 1BWSA 4AICA 4B7XA 4WUVA 5JY6A 1XELA 1NP3A 5K0ZA 3GEGA 1YOVA 3D0OA 3LDHA 4Y98A 4D3FA 2DLDA 3PQDA 4YJGA 3ITKA 8ADHA 1R6DA 3K8ZA 2UV8A 2FZEA 3IC5A 1Q0QA 4DYDA 2A92A 3ZZNA 1M75A 3NX4A 1TXGA 1P1FA 3VKVA 1KS9A 5B37A 4E0BA 4BIIA 4OOFA 3KLMX 3O38A 1R4NB 4CLHA 1RWBA 3WLFA 3DONA 3WTBA 5G4KA 1I5RA 1Q7BA 3QWIA 1SMKA 3ZHYA 4BNLA 1LDBA 2C29D 3HDJA 4CM9A 4GWKA 5HTOA 2AQKA 3OMLA 1O5IA 1DIRA 1LDGA 4OH1A 1NQ5A 5EERA 2Y1GA 4FJ1A 4BGVA 4A27A 4GSKA 3GG9A 4PVCA 2VYNA 4IQ8A 4XB1A 4XA8A 4XJSA 3AUAA 3BTVA 3TOXA 2FP4A 2Q3EA 2VYVA 1IE3A 1BSVA 1I0ZA 2B35A 2ZTLA 5ES3A 5JS6A 1LRKA 1MA0A 4FOSA 2W2KA 2CY0A 5JDIA 2D1YA 4MPDA 3EC7A 2AE1A 3FRJA 3GZ4A 2Z5LA 1PU2A 2EERA 1KBZA 2FPGA 4FJ0A 3PWSA 1NFFA 3ULKA 5KWEA 1B26A 1IB6A 3O4RA 3H9QA 3OJOA 4WJZA 1Y81A 4CMIA 3BHMA 3DBRB 4GH5A 2Y68A 3H65A 1UZMA 2POQX 1B8PA 3GG2A 5EJ2A 4E5MA 4LCEA 1KEVA 3CINA 1CYDA 1VE9A 2NSDA 2G0TA 2XOXA 5ICSA 5H83A 2CD9A 3H3JA 4XJTA 3VZPA 1G6KA 1C1XB 3AY3A 3A1NA 4FFNA 2PK3A 4QQRA 4CQMD 3GC6A 9LDBA 4NZ9A 1WLYA 4RLHA 3R3JA 4J1QA 3CIFA 4DIOA 2C7GA 2FSVA 1NASA 3SLKA 4BB5A 2PKRA 5TS3A 5EPOA 4GMGA 5A3JA 3M6IA 3NDRA 4XD2A 2P5YA 3L4BA 2FPIA 2H63A 1MB4A 3Q2KA 4H3VA 3L4SO 3ZCXA 1B2LA 1VKNA 4MIYA 4UUMA 2WTBA 1K5HA 4PIVA 5IDXA 4WEQA 4TRRA 4PZDA 5CPFA 3AUUA 4ZA2A 3PHJA 4DA9A 1FK8A 1ZK4A 4NMHA 3FF4A 4GGPA 4E5KA 1UXIA 1WMBA 1IL0A 3LC2O 1PIWA 3WOHA 1VSVA 1AXGA 1YS4A 2HU2A 4AJHA 4BNXA 3BAZA 1SBYA 4II2A 4OAQA 4ALMA 2GO1A 3A9WA 4PLPA 2D2IA 4D0RA 4D43A 4P22A 4BNJA 4A73A 1HRDA 1PX0A 1GUFA 1CDOA 2ZK7A 1V3VA 3VPFA 3PEFA 2WMDA 3PHHA 4YQZA 4NNJA 4UUNA 5G4LA 1Y9AA 1X0VA 4E33A 3ZV4A 4BMNA 2AMFA 1JLLA 5TIIA 4EYEA 2EJVA 1MUUA 2C5EA 3U0BA 1S6YA 5I9NA 5JPIA 1H6AA 3C1OA 1U3WA 1GYPA 1PQUA 1R15A 3RASA 2P4HX 3DOCA 2O3TA 4S3MA 4ZJUA 2DBQA 1X7DA 2X22A 2ZATA 3S2FA 4KUGA 2GCGA 3P7MA 2W2LA 3UUWA 3U09A 3DEYX 4ALKA 1JKFA 5EESA 3NYWA 1HETA 2J8ZA 3PDJA 4OKNA 1B0AA 1ONOA 3KM0A 2WD8A 5FEUA 4IIUA 1JVSA 3EY4A 5CG1A 4IGFA 2I99A 1DJQA 4J7XA 1NVMB 4WOJA 2R00A 4O5OA 4DPKA 5DF1A 4YTEA 1CERA 2C2YA 1R4NA 1AXEA 4UUPA 3NDJA 3WNQA 5KIAA 3C7CB 4CLEA 2AW5A 3F9IA 1MLDA 2GN6A 1WP4A 3H3FA 4XQGA 3SLGA 3Q1LA 3R1IA 4BNHA 4R3WA 5I8ZA 4U5QA 1WAMA 2BGLA 3BXXA 3NUGA 4BO3A 4YYZA 1HLPA 1ULSA 2AG8A 1DAOA 4RF4A 4ND4A 4E21A 1Z82A 2P5UA 3GFBA 3FR8A 3O03A 4TRMA 3TFOA 1A9ZA 3INTA 1NQAO 1P0CA 1L7DA 3WQSB 3AWDA 1UP4A 3GOHA 1VPDA 3I6QA 5F5NA 1I2BA 2OP1A 4NFHA 4JROA 3JQBA 2PGDA 4ZN6A 3NT2A 1GEEA 1EFLA 3OIDA 1B7GO 4RORA 4OJNA 5JYEA 3C1TA 2HRZA 4BKUA 5A9RA 3NT4A 2XAAA 1PL8A 4FD3A 3DBRA 4AVYA 3JD0A 4RJTA 3BA1A 2RCYA 4J2HA 1R12A 2Q46A 3JQFC 4GI2A 1YONA 1R37A 2VNAA 3VH4A 1ZO8A 1J4AA 4KQXA 3ZWMA 1TA4A 3MJEA 4JJFA 3KXDA 1C1XA 3JQ8B 3GPDG 1P77A 2DBVO 3UFXA 3QW2A 3UKOA 1DIBA 4WNIA 4I1IA 3OHSX 4FB5A 2NNLD 1UUFA 3PWKA 1NPYA 1DLJA 2YHIA 3QV1A 2J6IA 1HT0A 3KYCB 5B4TA 1ISMA 2Z95A 2VTEA 1E3WB 3JD3A 4O63O 1DIAA 2Y1FA 3WNVA 2GZ2A 5GZ3A 2ZQZA 2O2YA 5FI3A 3O26A 2Y1DA 5LDGA 1PZGA 2WJPA 3UXYA 1ENPA 1JKIA 4CODB 1YBAA 4D79A 1MX3A 3DMTC 3GA0A 3S1LA 3WQQA 3OJ0A 4UULA 5CDUA 4JJIA 4CMEC 1C1DA 1SEVA 1SPXA 5KTKA 1RM5A 3Q11A 3MZ0A 1T24A 3GDOA 4PG7A 1P9LA 1YL5A 5TT1A 2C2XA 1PJBA 4MVJI 1HWYA 5ILOA 2HRBA 2VHYA 4MINA 5BNFA 3WICA 3HADA 5KJ6A 2TMDA 2O23A 1BHSA 2YUTA 1NWCA 1XWFA 1SB9A 4ND5A 4EDFA 2VHZA 4I9HA 4MIEA 3OA2A 4EJ0A 1KVRA 1WXDA 2CMDA 3N7UA 4C7KA 4R9SA 3GHHA 1A27A 3MJTA 4WCFC 1GR0A 4URFA 4YJFB 3SBOA 1MGOA 3LU1A 2FR8A 3PLNA 1MG5A 4M54A 3COSA 1DSSG 2DAPA 5TQVA 2QZ9A 4RVGA 5BSHA 2I6TA 4J7CA 2IEBA 1SAYA 1IYZA 3KVOA 4PZEA 1XGKA 2PA3A 1DO8A 3UCFA 3QWAA 2HCTA 2DFVA 3B6ZA 1LLDA 1ZK3A 5IAAA 3G1TA 1GADO 5JXWA 1X1TA 2O3RA 4FN4A 5IDYA 2E4AA 4IMRA 3S2EA 5J23A 2FMUA 1ONNA 3RFTA 3CUKA 4UVDA 2IZZA 1Y8QB 3ONDA 3PHLA 3OJEA 5T8KC 2GR9A 3DZJA 2ZCVA 4QX6A 5CDTA 3NAQA 1RKXA 1MC4A 3IMFA 3PP8A 3WYBA 1IUKA 1KEPA 2ET6A 1ZMTA 3ZH2A 3ST7A 5A02A 3RIHA 3EMKA 4RCVA 4OYRA 5JAMA 1V8BA 2A4KA 2PNFA 1Q7CA 1B3RA 1CQJA 3HWRA 4OXYA 5BQFA 1ADFA 2IZ1A 5ITVA 1WDLA 4U8GA 1EFKA 1EK5A 1PJ3A 1QRRA 3LT2A 4GKVA 3LQFA 3BMQA 1I30A 1XIVA 4Y8VA 1PQWA 3KEOA 4IDBA 1HSZA 3WX0A 4CM9D 4AJOA 3AI1A 4ALNA 2DTXA 1XLTA 2CZCA 1LDYA 4Q3CA 2GASA 3D3WB 2JCYA 3GUCA 2GERA 4F46A 1LI4A 1Y5RA 2JAHA 2YYYA 2VYND 1BMDA 3O8QB 3ANLA 4ND3A 1Z75A 3P5SA 4UEJA 1GCOA 4YT2A 2GD1O 1RM0A 2IXBA 5GZ1A 5KOIA 2B83A 2IYOA 3PYXA 2VYVD 2P4QA 2W4QA 2HK8A 3WWZA 2Y0CA 4MIOA 3WJAA 4MP6A 3O9ZA 4YACA 3HB5X 1NBOA 2Q2WA 2NVWA 5C3MA 1YB4A 1UXGA 2FY8A 3T4EA 5FFFA 1PL7A 2V65A 1NR1A 2AQHA 1Z7EA 3F3SA 4U6SA 4N7RA 3GEDA 1W6UA 3JQ8A 3DHNA 1B8VA 5B4UA 1GPJA 1RM4A 1PL6A 5GMOA 1JTVA 1JVBA 3L0DA 2C0CA 5JY1A 2GPTA 3PZRA 1DAPA 5G2OA 5L53A 3ICCA 3ZNPA 4GAEA 2EG9A 1SB8A 1O8CA 4RVSA 1LJ8A 3KYCA 1ZK1A 3AUSA 1ENYA 4E2XA 1E3WA 3BZUA 3MWDB 1H2HA 1NFQA 1LSSA 2EIHA 3F5SA 4HFRA 1HDRA 1N1GA 1C14A 1TEHA 4R51A 4TRNA 5C37A 4TROA 1QYCA 3QP9A 1YDEA 4BGIA 4LSMA 4NBVA 4UREA 3ZNOA 4DBZA 3GVHA 5JO0A 4PG8A 3RCBA 3H9EO 4AG3A 1AN9A 1WZIA 1B14A 5G0SA 4CM6A 1RJWA 2DKNA 3ZV3A 2VUUA 2ZTVA 5IN4A 4UVIA 4E12A 5ER9A 1BDBA 1U2GA 4GPD1 1Y6JA 2O48X 2JAPA 4Q3EA 4KP7A 4QO7A 4JNKA 5CPBA 3DFUA 5DOZA 2NU9A 4BHTA 2QRKA 4FR5A 3FN4A 2B36A 4IDCA 4CLDA 1E3SA 1E5QA 4W99A 1HTBA 1DJNA 2E82A 3JD2A 4YQYA 4TZKA 1DFIA 4J7UA 5JAIA 2HSDA 3U49A 5ICMA 1B3BA 1M76A 4GMFA 3QLJA 4J43A 2HMUA 4K9DA 3H9UA 3M2PA 2X5KO 3Q0EA 2Q2QA 4RPJA 4U6QA 1KY4A 5JYDA 1ISHA 4LISA 1U28A 1XSEA 1NNUA 3T7EA 2I3GA 4YJFA 4F6CA 4NJMB 1QXSA 4R68A 1ZJZA 1GZ6A 3CH6A 1BXZA 3QSGA 3RC9A 2BGMA 4CMJA 1C0KA 3AJRA 3DO5A 3DWFA 4J3FA 5HWSA 1G0OA 1E5LA 1GL3A 5U1PA 1FDUA 4CR8A 1CEQA 3DBHB 3LT4A 2VWHA 4GX5A 1A5ZA 1JDJA 4KQWA 1BVUA 3NDIA 1E77A 2D8AA 1HSOA 1YDWA 4PLHA 4OSOA 2CSUA 2D0IA 5CEJA 3UVEA 1LTHR 2YZ7A 1Y8QA 2XF8A 2EHDA 5T5QA 4ESOA 1EEHA 1N7GA 2W2LD 2OUIA 4WNCA 5A9TA 3GDFA 1PJLA 3G49A 1PGJA 5I7FA 5TC4A 2XXBA 4FFLA 4RPGA 4MJLA 4XIYA 3VPSA 1VL0A 3WGHA 3MWEB 3CEAA 4GSLA 1PJ4A 2Q50A 2ZYGA 3FNFA 4DIBA 5TRTA 4D41A 2EW2A 4XIJA 5ITWA 2HMVA 1SCUA 1UJMA 2JKVA 2V6FA 4ND1A 4DUPA 1IULA 4JGBA 1I3LA 5DDIP 1LDMA 3C7DB 1VRWA 3LC1O 4LSWA 1DRVA 1DIGA 4DL9A 1PJCA 1H9BA 1PGNA 3U4DA 2E6UX 3BTOA 1U7TA 2YY7A 4QTZA 5JLAA 3L6EA 4YT5A 1TVEA 1ZEJA 4CLXA 1ONPA 3RBXA 2UUPA 1H6BA 4R1UA 2NV6A 1HF3A 1I01A 2X23A 3AM5A 2EP7A 2PKQP 3O8QA 4ZICA 4B8WA 2W8ZA 3I9LA 3OETA 3MCVA 3S2GA 4I5DA 1WZEA 1DOHA 3I9JA 4HFMA 1MC5A 2BELA 3KTDA 1KETA 3HZZA 4NH4A 3F46A 2NU8A 1ZBQA 3WJ7A 2SCUA 1ZXBA 3G17A 4WLVA 2Y1CA 3ZHZA 1U8FO 1UP6A 4YWJA 4R1NA 1K6JA 4Y6PA 1ADBA 3QWFA 3I4FA 2VN8A 2ZJ0A 4NBTA 5L7WA 3GK3A 2YW9A 1UZLA 3AU8A 4BVAA 2EKPA 3DTYA 3RI3A 1ENOA 3NV9A 2RAFA 5T67A 4BNUA 3B70A 1P1RA 2GDZA 3WR5A 4KDEA 1HYGA 3I5MA 4BNZA 2QYTA 2X0RA 5COBA 4G81A 4WEOA 5U4QA 1K6IA 4M86A 4P38A 3RWBA 1EE2A 3BHIA 3KSZO 4CM7A 4UVGA 2VRCA 5IZCA 4XR9A 4D0SA 1IHYA 5IN5A 3RFXA 3RUCA 1KVQA 1JWAB 2ZTUA 1H6CA 3E9NA 3E5MA 4YRDA 3RC2A 4FGSA 2VNSA 4ZGWA 5JDCA 2BI7A 4RPKA 2GGSA 3D3EA 3VH3A 2E48A 2FN7A 3C85A 3WBBA 4YAKA 4Z0PA 3WMWA 2DTEA 3RJ9A 1V3TA 2CDBA 2HK9A 4PLVA 4WLFA 1GV0A 2O7QA 4W7IA 4XKJA 3OIGA 4D42A 4EBFA 3CZMA 1LC0A 3FWZA 4ZRNA 3GPIA 4GLLA 1OC2A 1HE2A 5AXDA 1K6XA 3LSYA 1FDTA 5I7SA 1E1KA 1OOEA 3KOUA 2ZJ1A 3I9MA 3RUDA 3VAZA 2X0JA 2QRJA 1EUDA 1JA9A 1E92A 5BT9A 4QFDA 4DYVA 3PFWO 1DC6A 1NFRA 5HS4A 4FC6A 3ZWAA 2BFMA 4KTTE 4UVHA 1YB1A 4W9NC 3VC7A 3WB9A 2Y66A 4HFJA 4E31A 1HE4A 5ER6A 4CM4B 1GY8A 3VZRA 2JD1A 4NJMA 2D59A 3M2TA 4EW6A 4IS2A 3EW7A 1BG6A 4MVJM 4CV3A 3ZHXA 1ADCA 4KMSA 1Z74A 3PRJA 4B4VA 2JD0A 4IM7A 3ZW8A 1I32A 5IFLA 5G0VA 3KSDO 1HDOA 3NTOA 4RVHA 3ROQA
chains in the Genus database with same CATH superfamily
1PZMA 1TU0A 4LHYA 1BJKA 1E2DA 1QO0D 1VMEA 3DBHA 3H2BA 3K2EA 5CGQB 4Z4HA 3DZKA 4XB2A 1U7OA 5JECA 1S2MA 3BIWA 3JU3A 4HDSA 2PYDA 4K9LA 4WFIA 4M9CA 2YHIB 3ZNQA 4P5DA 2A5FA 4BUZA 5IXJA 5BYAA 1WZ2A 1HNZB 1PX2A 2A94A 1MO2A 1O9HA 3EXIB 3P9PA 5ELXA 2XB8A 3I12A 4YO7A 4J4TA 1DTSA 2VQSA 3UAOA 4NR0A 4XQCA 2Q07A 2BF7A 2EBFX 2IZ0A 1P2FA 3PI6A 2GCIA 1NXVA 1K5DA 5G1NA 5IJXA 4CIAA 1QLJA 4IDFA 3UJ8A 4QE3A 1DRJA 1UBLS 2F00A 3AT1A 2VHTA 3QLUA 1WPGA 2IZOA 4BFCA 1R16A 2XUHA 3NYRA 3SYTA 4LJAA 2A30A 1E8MA 4A6EA 2LRHA 2VHJA 5F23A 4L95C 2I66A 4Z4FA 3VR6H 5J2TA 1VB5A 1R9JA 3EEIA 2Z09A 1ZGCA 3TB4A 3LP6A 1Y4AE 1CP3A 1W29A 2O5CA 3WL8A 2FEOA 3BORA 3KYIB 3AW8A 3AJAA 1ZGZA 3FWYA 1NI4B 2ROQA 2J3QA 4LOLA 2E4VA 4O6VA 5AHWA 1F2UA 3PNSA 4EK9A 2PUFA 1OH7A 4DA6A 2WDPA 3IDAA 2RAVA 2J0UB 1XXHA 3F96A 4N3CA 4PCVA 5PGMA 4A91A 2ZOSA 2CGEA 3BE5A 3T12A 3KB6A 2WM8A 3UT5A 4TV9F 4A23A 1NW8A 3LZCA 1J9GA 2XT6A 5CBKA 1P5RA 1GCGA 4PXSA 3S27A 4UHBA 2AOXA 3FKQA 3GP3A 2WI8A 4YMVA 4KR6A 4PGGA 4IGEA 1RRMA 3CLUC 3ZCTA 3QLVC 1WXEA 3ZHBA 1P74A 3AVUA 1PL0A 4EUHA 3I83A 3WIOA 3FWNA 1NNLA 2BKAA 2HJGA 3LUKA 2EQBA 1GAXA 2WOJA 2IEAA 5HUHA 16PKA 5DLPA 1WCYA 3C8DA 1AQUA 4M1TA 4I55B 1RMQA 2QD4A 3VC3A 2ZBGA 3BK2A 4EATA 3HBAA 3IBFA 1VJ0A 2VYCA 5DGTA 4BVFA 2IYPA 2NX2A 2H29A 3BL6A 4TKVB 1V43A 3G8BA 4J2OA 4B3TB 5DLDA 3TUJC 2ZT7A 3C3CA 3PD0A 2FQYA 4M0CA 3W5JA 4YAGA 1VZ3A 3GX1A 5E7QA 2IDZA 1DVRA 1J0XO 2H07A 3JRWA 2ZYUX 4I50B 4PFQA 5B1EA 3VDRA 3P0HA 4CGZA 2CLSA 5L8VA 2P8JA 5CURA 2I3AA 3IT1A 4M88A 5T4BA 4BWFB 1Z5NA 4EA9A 1KPHA 4MKGA 3GT3A 2YWBA 1TAHA 3CG4A 4BGDA 2GILA 1JFLA 3MB8A 4CMHA 4P92A 3I1FA 2Z56A 5HIKA 1T6ZA 5CRIA 1X7XB 3CURA 4M7OA 1ZRSA 4JJEA 4U6NA 1JRLA 5GP1A 1OT3A 3PGJA 4DCGA 3O5AA 3VQTA 1EDEA 1M2JA 2QNRA 4MPPA 4XDYA 3QHAA 1JLSA 1XALA 4R16A 4XSHA 3ZDYB 4F0JA 2C04A 4U7JA 3AYXB 1NVTA 1DMSA 1MGPA 1T3TA 3SQDA 2GN9A 2NTEA 3S0JA 3F3YA 4AULA 4ER0A 2G6BA 2FKNA 4IDQA 4N8DA 2X8JB 1W93A 1NXQA 3G8YA 1FMTA 3P9IA 4LVNA 5EINA 3O84A 4EM6A 4D4IA 2V54A 4MVJE 2J33A 1GTG1 3FOCA 4OLHA 1ZM3A 2B37A 4DR1B 4R1SA 1AZWA 3W05A 2Z6UA 3U7HB 1UPXA 4RQBA 2K87A 2HREA 2W9XA 4H1HA 1F7UA 1FRZA 1YVEI 2ZJ5A 3ODPA 4EUEA 2OCBA 1HEUA 2GZ1A 4OQDA 5DTRA 3L7JA 1OFTA 3EOZA 5HW0A 5H1YA 3VR1A 2GYVA 3HZRA 4YV0A 5HJEA 3PFFA 4MP3A 4KVAA 5D00A 2ZAMA 1OLSB 1R66A 3PL1A 4B7CA 5FBQB 3VDNB 1XI2A 5JATA 2O3JA 1JPVA 1TB4A 3CXRA 2C8VA 2R2AA 2B20A 2FUKA 3VHLB 3IP8A 3LUFA 5LSAA 3DP7A 2W2QA 3I8SA 3KV3O 4IR7A 5CIQA 3YASA 5KNDD 4JYPA 4J0DA 2WJWA 2ZUTA 1KE2A 2Y3IA 4HY3A 4K9OA 1BN6A 3ZHSA 5E1BA 4CYMA 4FHDA 4DLLA 5JBNA 3MRSA 4DA7A 2I78A 3R5FA 2QL5A 4KRYA 1UPBA 1Z2NX 2RCNA 4NCHA 1Z0KA 4L74A 3FKSA 3BCSA 3R7BA 2FW0A 3WA7A 1L7PA 4M55A 5CDSA 3RSQA 3DWIA 3B8EA 3P9RA 4ALLA 4BVBA 4JI8B 1K92A 1SCBA 3MUNA 4OD0A 3VI3B 4AZSA 3QBEA 3VZCA 1FOEB 3JQ9A 3O3MB 3RU7A 3LVFO 2ZVDA 2GAOA 1D4FA 2AHRA 3IAS1 4HUJA 2UZ0A 4Y6GB 3B1KA 3RRNA 3WI7A 2WF6A 4P08A 4EX7A 3OE4A 4UEOA 1BO6A 3OX2A 2FSVC 3JYNA 3NJ8A 4KRGA 4KN8A 4RF2A 4Q4HB 5BR7A 5DLYA 2DQ4A 2PRJA 5ALQA 3U13A 4MIKA 1ZHOA 3QVXA 1YS1X 4G1CA 4DNPA 3I52A 3PUHA 2IYUA 2ZUVA 1T8PA 2VDOB 2IYAA 4BNMA 5C0OE 4JUIA 4JQCA 5AI0A 1U7XA 3TZCA 5HRCA 1M74A 3L7MA 2H4FA 3SQXA 7MDHA 2G9UA 3PIRA 3N28A 5TMDA 3RFVA 5ERXA 5DM4A 4DMUB 1OX4B 1V1RA 3EIHA 4Q3LA 4E30A 4IQGA 4KJXA 2Y0DA 1R18A 5TPZD 3V9PA 5EL0A 4EENA 3J7TA 2I8CA 1C0IA 1M2EA 3JYHA 2F43A 4TXLA 3K1ZA 4YQEA 3OZVA 1V8OA 1OXVA 3I3SR 4LK3A 3W4KA 5L3VA 1E9AA 1E0DA 3HUTA 4BOYA 4HLCA 4BB6A 4RMJA 3PFBA 5C4GB 3R74A 4YMUA 1DI0A 2YMQA 3DSRA 1CS0A 1J97A 4PYLA 4YBRA 5ADUS 1NX6A 4D8YA 1IHOA 5EIHA 2WYVA 3ZHOA 2JJ1A 2EEZA 4LEIA 4CI9A 5JADA 2H5EA 1C5KA 1P75A 4JLJA 4JSRA 2VPTA 3ZXIA 5EP3A 1VGQA 2K7FA 1BMTA 1HEYA 4O8CA 3IJEB 3PKJA 2ZJBA 3RTDA 4AN1A 4CLOA 1QX3A 3IP9A 4N76A 3HO8A 4TYMA 3OKCA 1TI7A 4RDIA 4HN2A 2OBBA 1Q0LA 2QIOA 4E51A 3GDWA 4EHHA 1I7PA 2WAYA 2X2PA 2HSJA 1YC2A 3C15C 3UGQA 1KWGA 5EI5A 1VDMA 1L1QA 2VOJA 2WT8A 3ANYB 4AW9A 4E2WA 5F9FA 1JSXA 1G4HA 1MF7A 3K6KA 3UJAA 1EX1A 2CUTA 3PI7A 1DAGA 2YMPA 2VRBA 3PF9A 2GA9A 3QF7A 1W0CA 2Q4OA 5AK3A 3SIXA 1GZ4A 4LDJA 1H3NA 1T9GR 2IIVA 1JIIA 1Q1GA 4Z53A 3RKUA 1FS6A 4WNAB 3HCBA 1OTHA 3C5VA 4LXXA 2VJQA 1UMDB 4NI5A 5AVOA 4BP8A 1L7VC 4BO1A 1PR3A 3LYUA 3QVJA 2PL5A 3G5AA 3V1UA 4N0DA 3PNLA 2OO5A 5DN9A 1OVMA 2VC2B 2XXAB 2A2ZA 4RL6A 3R09A 2OP0A 2VF4X 3DCYA 3BMOA 1VKRA 5C5EA 5C81A 4QSMA 1P2GA 4EVIA 1CY8A 2IF2A 1SK9A 1RLUA 1BGXT 2IEYA 3GPCA 1XZKA 2FRXA 1JIXA 1BAPA 2WC1A 3JQGA 3L0ZA 3LIPA 5HFAA 4P4GA 3TLAA 4YRIA 1I94B 2XI4A 1TTTA 2MOKA 3WK6A 1JWBB 1AS0A 1AM4D 4GNRA 3LDFA 2HDOA 4WDRA 3URKA 4MKXA 3CKYA 4Y3UA 2HX1A 3AG5A 3QG5A 4HAZA 5DLEA 3SSNA 3V4RA 3AG6A 1Z0IA 4AY4A 3VYSB 2AOTB 1V9LA 1C7QA 2YY5A 3HH8A 1WNTA 3HMQA 1Z6PA 3QX9A 4K46A 4QGBA 1Z7GA 4KNVA 3REFA 4CKXA 2CLHB 3H4VA 4TTSA 2VHQA 5FNVB 1HQDA 2Y8EA 3LK7A 4KYVA 4YVFA 1NZJA 3FM9A 4CMGA 4GHWA 4B8ZA 2IIBA 4RO0A 4D8VA 2PL3A 2OCXA 3WLMA 1RBZA 2YJZA 2J5BA 4HI0E 3X1WA 1AIPA 1H8HA 1ZSVA 4RHCA 3AOGA 4YAWA 4C1NA 1E5DA 4GQIA 3CRZA 3D8BA 4UBJA 2PX5A 4XCVA 4D2IA 2PH1A 2VRCD 1X70A 2ODAA 4HDKB 4GOJA 4UHFA 1NTOA 4OJTA 5ALZA 3DVSX 1JW9B 1FA9A 1UT8A 3GBPA 4FNAA 2IRWA 3FFAA 1LRLA 1W85B 4FZ5A 5BR1A 1OBHA 2FPPB 4XTRA 4ZU1X 2SECE 1IY1A 4Z8YA 1D4ZA 4F86A 5DGDA 4EI2A 5CVCA 3NZEA 5AM4A 5IABA 5FUQA 1J0CA 7REQB 4PYIA 2OXTA 4DJTA 4YGYA 4NE9A 4UQPA 5JS1A 4R54A 1GNTA 3H8WA 4XFKA 5IEJA 2QUZA 1N2HA 4YJ3F 2FZLA 1RWPA 4BV8A 1XEWX 1X7ZB 2OQRA 5IG2A 1M6HA 1R4AA 4JBIA 4Q9LA 3WBKA 4NNPA 2BEWB 2XJ4A 5ALXA 2PZAA 4ZQHA 2PSHA 3CEPB 3E35A 4CQMA 3EZLA 1UBEA 3SR0A 2BFOA 3H2YA 1TCCA 2IHBA 2VXBA 3TD9A 4ZAFA 3TTUA 4M7WA 5JAZA 2V0GA 3INGA 2DJIA 2QDXA 2XUGA 4DR3B 2NYVA 1O3YA 2YDXA 3NCTA 3KLNA 3BRWA 4Y9DA 3EGEA 5AW1A 2EV9A 3T38A 3UPUA 3A6FA 2R1VA 1MOPA 2QYHA 3V3TA 2OFFA 4CVNA 3TCKA 2H5LA 4NHEA 4FYHA 2ZZMA 3CSSA 4IDNA 2BUAA 4EMUA 4FYIA 4EQ6A 4X65B 4IEEA 4KSYA 3OSUA 3TAHA 3PD1A 3SFTA 2D5AA 3JASB 3OOSA 2IOYA 4G0YA 2ATVA 5AW3A 1NSTA 3LGAA 4OM8A 3ZKWB 4DF3A 2C5AA 3WDLA 1HXHA 4C6TB 1IN6A 1KMHA 4HWOA 5CD9A 4YRCA 2QRGA 1C7RA 1DKNA 1USUA 3D7SA 3OURA 3HL0A 3VDXA 2ETXA 4L16A 2ENWA 3KP1A 3VC7A 2VPPA 1DOZA 5LQMA 1Z6TA 1ZU4A 3GV0A 4P3NA 2COUA 3PDHA 1KDTA 1OMOA 3E9CA 4HJRA 1PFQA 2AH5A 4Z0HO 4OYHA 4PC7A 1MZVA 4AO6A 4B7UA 1TT5A 2FG5A 4ZYXA 5HM8A 5CB8A 4MKFA 1ZIXA 5EHXA 5JVDB 4CV1A 1FXWA 3H87A 1A7AA 4XWTA 5HIIA 2NO9A 4JHXA 3F8TA 4Y6SA 1NHWA 4F5WA 3DLCA 3OT4A 4FKBA 3FOBA 4G37A 4XUCA 3ZCPA 1R4MB 1AK1A 5WRFA 1Z8HA 2QQEA 3WXMA 1NC3A 1E1QA 4JLNA 4X1KB 3R7LA 4Q37A 1JDUA 2IP4A 4W6QA 1QS0B 1RXYA 5K05A 1MHTA 4R5HA 4YT8A 1W30A 4CIBA 1E96A 1Z0JA 4FSHA 4RPHA 1TAUA 1DWQA 2JIBA 4D0GA 4XVHA 3PQ4A 2CNDA 2EOAA 3L92A 2C5BA 4CLRA 1E1MA 2G5GX 3AIKA 2JFBA 3N8KA 4HQ6A 2VO1A 2HBRA 2FZVA 1E0JA 2IXEA 2GHQA 2WYIA 3IXLA 1R0KA 3JR7A 5DM60 3I1YA 2OZVA 5D86A 4CF4A 3OOHA 5DNYB 1EP2B 2IA5A 4IRMA 3TINA 5D3MA 3LLUA 3QX7A 5HUQA 3IVMA 1XMQB 4BXOA 1GL6A 4OBXA 1LXCA 2CWDA 3BIOA 5C35A 5KNCA 1TX4B 1KFBB 4F7WA 1J00A 1F06A 2IBMA 3ORFA 1DMRA 3AZPA 4WD3A 4YRFA 2IOQA 2AVNA 4DQ0A 1AUQA 1GPYA 1YL6A 3AR3A 3MUOA 5L4NA 4O3FA 1RLIA 4BO4A 2F1KA 2PPVA 3VNAA 3ZWDA 4G2NA 1XVLA 5NLLA 1Y9JA 3OH8A 4N0PA 3PPWA 1J99A 1II8B 1KQPA 1TQDA 1IOVA 1QSGA 2YZMA 3GUYA 5E3IA 3V34A 2GN4A 5AXAA 3PUZA 5HCNA 1XLUA 3PDCA 1D1TA 1BKDR 4MRVA 3T94A 4X6XA 1UC8A 3NWPA 2AE2A 2OKCA 3GT0A 5K0GA 1LUAA 1T2AA 3K9HA 4B2LA 1J8VA 4DREA 3A1VA 5JE8A 1GU0A 1FFGA 3RFUA 2HNKA 4DABA 5LUAA 4DLBA 4O59O 4UXHA 2CNNA 2VPXA 6REQB 2WD7A 2G80A 5E4JA 4AF7A 3ENVA 4MSUA 2D2VA 1NL3A 1WLSA 2YFQA 4G1MB 5LDDC 3GRZA 3U4CA 2ZIEA 3IDFA 3MFYA 4EGAA 2GT1A 4ALJA 1GUDA 2K2QB 3KUXA 5TDHA 4BQPA 3K5IA 3P0RA 2VTVA 4A0SA 4EHIA 4PQYA 1NVKA 3TOVA 3AEQA 3OTQA 5IHXA 4W1SA 4QFBA 3LC7O 3K16A 4QAJA 1K6EA 4MYUA 1DC5A 3EK2A 2H1IA 1QGDA 1TDJA 1Z5ZA 4QECA 1DFHA 4RVFA 1T8YA 1JTFA 1H6DA 4YRAA 1HGXA 1KY5A 3T7IA 1WABA 1E2MA 1DBSA 4PCAA 1NUPA 5CH8A 1PFYA 3MJSA 1U02A 4GLOA 3V48A 4CWAA 3DEKA 4IVPA 5TGDA 3EZ9A 3BG5A 1L4FA 1KGSA 3AKEA 3HS3A 3GARA 4IO0A 4X61A 3AHFA 3TWOA 3PRKE 4EIWA 3LA6A 5BRJA 3HYNA 1CUDA 3VKUA 4P6VF 4XSVA 1QLHA 1YASA 2BE9A 5EJMA 1IZYA 1HDXA 1SOMA 1OF1A 3KOOA 5EUMA 5BUCA 1Z5GA 4BO5A 2X4LA 2DPGA 4JI5B 3UMJA 1VI6A 1DWOA 1OASA 4R98A 3OOYA 4MTLA 3N58A 2CLEB 1TAGA 3ZBTA 3ZK8A 1SG9A 3AVPA 3VYWA 2Y2VA 5JCJA 5AUNB 4YLEA 1ZS9A 4GX1A 4IGKA 1DKUA 4EABA 1XLTC 3VH1A 1H0HA 1NXPA 4N3NA 4NIMA 5B2ZA 3X2FA 1UKEA 3WGMA 3PE3A 3UAWA 2PRSA 2V7QD 2C0PA 1PFKA 4JGIA 4F3TA 1A77A 1RKBA 1UZAA 2NXJA 5CJPA 2BN4A 3V42A 1EMDA 2ZRHA 3R0JA 3FBTA 2WFLB 2ZUCA 3HHPA 2H1WA 4OF4A 3STHA 4ODIA 5JW6A 1HE3A 5TPWB 4PN7A 2O8CB 4R81A 4L8LA 1PHRA 2YWHA 4FFSA 1ODTC 2WZCA 2ZSBA 3DKRA 5FWYA 4LYDA 1X1EA 2PGLA 1GTL1 1Q0HA 1U1CA 3JZDA 4J6EA 3MJVA 3U17A 3GEEA 2OSVA 3W3AH 4MWZA 2YWRA 3ANNA 1YZVA 1TVCA 2O4CA 1UM8A 1ZKMA 2VRWA 3P26A 5G0WA 2CZGA 2FWJA 3UGTA 2X58A 2XUOA 4AJ2A 4ZI7F 1XCGB 3E9MA 5JRDS 1OYOA 3Q5GA 1R50A 5KVQA 2EVWX 5FH9A 3UENA 3U3KA 4ETWA 5HOQA 1P8JA 2FWRA 4KSCA 5L3SA 1PEDA 1U3CA 1BHJA 3G0HA 4YRBA 1KJWA 3HY3A 1OH8A 2BKVA 4GLJA 1IBKB 4DQXA 4KWTA 1R5OA 3J7AC 1YULA 4M9QA 2QL6A 4DSAA 4HFNA 1LJUA 3O7WA 4RS3A 4JT8A 3QEMB 1G3MA 2H2FA 3FJYA 4JKOA 3T5GA 2W6ID 2J3MA 3BQMB 3MS4A 4V24A 3CLHA 1PS9A 3DYIA 4EO4A 4RQUA 3BMXA 3FUWA 3I45A 4LJLA 4O4HF 2RGNA 5AHXA 3R9KA 4PRLA 1T36B 2JJ2D 3NBQA 3PJRA 4ZANA 5DNAA 3CUVA 2H7CA 4LYHA 2EP8A 5JLJA 2HJSA 1UAYA 1Z2PX 3PC8A 4KO4S 2P77A 4XI9A 1AO0A 3GF4A 3OJWA 3EAFA 2TRSB 4NBSA 4WFJA 2FX3A 5BN4B 4GXQA 3RAPR 1PR0A 4N3GA 3IVGA 1KJJA 2C7RA 1UJ4A 3NRCA 1K7CA 3L7KA 4WN9B 1YS9A 2NTJA 1SC4A 2HAEA 3ASUA 3V1LA 1GPAA 1I3OA 1DBRA 5AKHA 1JFSA 2YJGA 2ZRAA 3GL9A 4F92B 5KHLB 3P4XA 2PZBA 2X42A 3RRFA 3U16A 4DCSA 3Q72A 5ALWA 3GPLA 2PD3A 4F56A 2V7VA 3K6SA 1QYWA 5BNIA 4JC4A 3MK31 4Q12A 3ZDDA 2ZRGA 4MRNA 2AZDA 3KEGA 3PU6A 4PPFA 3JAWB 1ORHA 1UADA 1KOLA 3UV7A 2XNHA 4OV6B 4RH3A 3STUA 3OQ1A 1L5RA 1ECBA 2DGDA 2FN3A 2PGOA 1Y80A 2WG1A 3ACBA 4WXHA 2ZXUA 3WGZA 2QLFA 2HHHB 2EDCA 3V8QA 3TS1A 4XXHA 4BPBA 4J3JA 1VP3A 5D5PA 3MMSA 4HAIA 2P5SA 1QYXA 1P73A 3C3MA 4MX8A 4Q39A 5C3UA 3WY9A 4AT1A 2ECKA 3MWFA 1ARZA 2WTAA 1FC0A 2MSCB 3OF3A 5BV2P 2W2PA 2HDNB 4ZD6A 4A2CA 2G7ZA 2BBWA 3TQSA 4BMDA 3W8NA 4YRGA 1UJ5A 4GGOA 2ZJ4A 2J48A 3EGWA 4KO1S 2YYZA 3JQPA 1YQQA 2HCRA 2VS1A 5IYZF 4RGQA 3WB1A 1IHXA 5BV0A 1FX0A 2O20A 4LK2A 5EIXA 1Q0RA 3R7FA 3KU1A 5FPTA 1TUBA 4KQ6A 3ZJUA 1ND6A 2OM2A 3E2IA 5IVDA 1DB3A 3CMCO 5J4HA 2V9PA 4L85A 1MJGA 3B9RA 3JQ7B 1AHIA 3NW9A 1M1YA 4D81A 2DHRA 2X2OA 1VL1A 4DPMA 2YJ5A 4E32A 1E7RA 5J9FA 2VHVA 4PYOA 4WCVA 1BDJA 3FPFA 2EGGA 2H2HA 2VAPA 3JRNA 3O8OA 4RV9A 2GESA 3BMCB 1KU6A 1ZRNA 4X63A 2B92A 5IF3A 4BU1A 1P18A 4IJUA 4B3FX 1NVGA 4CI0B 1QAMA 1M67A 2B0JA 2ZAYA 4HZUA 3DP9A 4P3YA 4JOCA 1P1BA 4PZCA 2FE1A 3ZZ1A 5EN4A 1YDGA 3WYGA 2ONZA 1WXQA 2WIGA 5TE9A 5KSWB 3OWHA 1JR4A 3QKUA 2RGWA 2VR1A 3KKOA 4R8KA 3JZFA 2GNAA 1MMFB 1N3IA 4EY6A 1AZLA 2IYEA 2PWZA 2EQ5A 3NNSA 1JYFA 3CW9A 5LA6F 2ODEA 2DT8A 2BPOA 2DZDA 4FFMA 1YRYE 3IA2A 2FHSA 2O14A 3N74A 4HB0A 1K2WA 4RHUA 2HA0A 1F8YA 1VI5A 2GTIA 2ZDGA 4RJIA 3TXXA 3HR7A 4GM0A 2HQOA 3WWEA 1ZMOA 2C42A 4P4SA 4ZOCA 4IDEA 3SKYA 1LBHA 5YASA 1SVLA 2XQFA 3SF8A 1A5AB 1CXZA 2PH5A 2EFCB 5HPYB 1R0SA 4WCDA 4XR4A 3TR5A 5JJLA 1FFHA 4YV7A 1YS2X 4LHEA 4IX1A 5EJ4A 2BGIA 1QCDA 4HNHA 4Q4CA 5JJIA 4FX5A 2CYAA 4JHLA 4PGFA 4QDTA 4CMEA 1DUSA 1PWZA 2P7IA 2YMLA 2WSYB 1GIAA 5J2UF 1TECE 3BCRA 3OVMA 1T6BY 1ZQ1A 3ENNA 3KYDB 4NE7A 1Y7LA 2BJHA 1IY9A 4WW0A 2DFKB 5EKTA 4ZT7A 1Q3TA 1NVDA 1ULAA 3S2UA 1GNQA 3CH5A 1GA1A 1CNFA 3NONA 1CQIA 1J1IA 1TRKA 4YEDA 3AP2A 1U80A 1VL8A 2GNOA 4MDHA 4QQNA 4D45A 4YT4A 4EB6A 3W7BA 4Q00A 3VR2A 5B3LA 4PC3A 3E8SA 1OTXA 3DD5A 2G83A 2OHGA 3P45A 2XKKA 3W1EA 1LBQA 4JBYA 2FUG6 2MMCA 2NIPA 2Y4NA 3HKDA 2ZBPA 3T7RA 3T4UA 1L7XA 1PFVA 1NXXA 4N01A 1QP0A 4YR9A 3W4JA 2YFKA 3RTAA 4BZQA 2PUTA 4WLEA 4ZAXA 3IEMA 1KVUA 3NETA 4HRAA 4PIMA 2QB5A 4QEDA 4DZZA 5HF9A 3C5EA 1V9SA 3F6CA 3Q9NA 2OXRA 4EVQA 3O94A 4AM8A 4CQMB 3BMNB 5E9JA 4K6HA 4C4OA 4RTPA 4EDHA 1N4DA 4CCSA 2QTAA 2AMJA 1GTJ1 1L7MA 2WQZA 3KC2A 3EFOA 1OPXA 2VF5X 4DQUA 2WJJA 3REGA 2JLQA 1VDZA 4MVJG 5M2QA 5IZCC 3PE6A 2BDTA 4YRZA 2P9ZA 1FX1A 3H2HA 4MI9A 1D2CA 2J5RA 2JNWA 4HZGA 2P0AA 2VVTA 1X1QA 2FW7A 2XA2A 3KDPA 4OPMA 4ZREA 4BL5A 4EPRA 2V4UA 5JDCC 3K72B 1U63A 5C5IA 2DFPA 4H35A 2E4YA 3S40A 1R8JA 4L0CA 1GNSA 1W2WB 3BE4A 3S8EA 1VMDA 2XODA 5CNMA 1BCSA 2QN2A 3R3HA 4O2AF 3II6X 4UKDA 5JQWA 2M32A 5KVSA 2P90A 1E0KA 1Z0FA 1T2DA 4FYXA 1CT9A 2PANA 4YP7A 4PAGA 2H4WA 2VPIA 3LMKA 1WW8A 4K40A 1KO5A 1NQUA 1RXEA 3MCWA 3D0RA 3PFHA 2OAP1 2Z8YA 4HH1A 3Q3CA 5DYYA 1OV4A 3HSKA 5EXTA 1O0CA 1YMUA 3T3GA 4CKCB 3OY7A 4Z0NA 4DCOA 2EKBA 3DAHA 4D02A 2UUAB 5K3CA 2QTWB 5GWXA 5KNLA 3UAZA 2VNJA 1BRMA 4A26A 1GZ3A 1C3OA 3DZFA 4CUKA 4BATA 5L4LA 3KIPA 2ISCA 1X38A 4X95A 1LVHA 1V1JA 2XHZA 4IVNA 1OW3B 4J0QA 3JYLA 1WU8A 2PX2A 1HDCA 3OX4A 1F0KA 1ZM9A 3QV2A 2GPBA 3PJDA 2PT5A 5ENDA 3C24A 2V97A 3AI7A 2BMFA 1OAOA 2B3DA 2VSOA 3OLCX 5IF9A 4J2TA 2GD0A 5DGHA 2JASA 3HB4X 1GFIA 1XQYA 3LQYA 1EQUA 3W2IA 3X1JA 3PPXA 2P91A 5IH3A 3GOQA 2YIMA 2IQ5A 4UMVA 2UUCB 2GF0A 1DT3A 1IVNA 5J5CA 3LPMA 5CVEA 2PVPA 3DTNA 1CCWA 2QRQA 3BRQA 4TLBA 2Y0PA 3HN2A 1QYVA 1TJ5A 5DCWA 4RE5A 3GLTA 4JXJA 4LHWA 5CLIA 2JS7A 5J3JA 4EI8A 3PC7A 3AR2A 1REQB 5KSYA 2EBHX 2X6QA 4TT3D 4PBSA 1W1WA 3D5QA 2X8LA 1NQXA 1WOMA 3I04A 5KJEA 3E5NA 1N9GA 2J6CA 5CVVA 6LDHA 5HP4A 2OYCA 1QANA 4DQVA 2BGRA 3F8SA 4G9GA 4ZVLA 3TNLA 1Z7BA 2C20A 1HMYA 1Z7YA 4KACA 4I4IA 1I7NA 1E18A 1W6RA 3H2SA 2BZSA 2P35A 2VZ8A 3LSTA 3H1BA 3NHMA 1GG2A 3GELA 1R10A 4PZYA 5AJZA 3GCXA 4FSDA 2QQFA 3O0DA 4QC2A 3DC2A 3VJMA 1NIPA 1IBRA 2FRVA 3B3QA 1HX7A 4CNBA 2AF4C 3QVGB 4E2YA 1GP2A 2ZVQX 1V5FA 4O02B 4X91A 3EARA 3WFJA 3CH7A 1XCPA 4Z1MA 1G8HA 3TJRA 3W4IA 2ZRBA 5JQGA 4DV3B 3DUFB 4CETA 4RENA 3VYTB 1GFZA 3K20A 2BSXA 1IHPA 1YQ9A 3E53A 3C5WP 4H1WA 2OZPA 2IXAA 1T9CA 3AEUA 5IPFA 3N0XA 3D2AA 4DCTA 4OJQA 4QZVA 3PQ8A 1UMBA 1GXSA 5CAEA 3VR6D 4H3KB 1IM2A 1FPMA 1EGMB 3BL5A 4GFDA 2N1MA 3CT4A 3HE3A 2AKEA 4NU8X 4IOLA 3M6VA 1I33A 2Q4TA 2Z08A 5DWQA 4B75A 1PS8A 1Z8DA 4DLXA 4B3SB 4OHYA 3UCXA 1OIVA 1PWHA 1XCJA 2GN8A 2J3DA 2RIRA 3F7NA 1DAIA 1E9SA 3DXYA 4GXRA 2AN3A 2ORIA 3BUSA 1D1PA 4MV4A 2NQTA 1NJ2A 4OFWA 1JHYA 3L6RA 4J4HA 1IFXA 1EFPA 2E4XA 3E48A 3O90A 3WYEA 5GTDA 3FAZA 4KOAA 5FYDA 1FSPA 2ZETA 4A0RA 1GLGA 3QUQA 4BMSA 5TEVA 1W5AA 4F4CA 2VPYA 2Q1SA 3HJCA 3A26A 3HKEA 3RIGA 4BZXA 4EKDA 4RIEA 3AF0A 4WLUA 3I0MA 3U4GA 2AK2A 4CL0A 4CKWA 2QRVB 3V5NA 1FFCA 1QE3A 2V5VA 3CVJA 5H82A 3RS0A 3UAGA 3UMCA 1SNYA 3QFSA 4UEKA 4BDSA 1VHJA 2AV6A 3H4IA 3QI2A 5BSEA 2QGNA 1JPJA 2IYZA 4IJKA 1KIAA 3IB6A 3E2MA 3GXBA 4ARAA 3DDSA 1FFSA 4PAOA 1XKQA 2AWOA 2YTZA 5CLQA 1F17A 1T5SA 3HJUA 3SLRA 3PVSA 1SM4A 2YX1A 4QBFA 3WIUA 3ER8A 2VT2A 1J23A 5B3JA 3X1YA 2BM0A 4BRZA 1OGJA 4XDHA 2YV4A 2ID8A 5FLEX 3SY8A 3COYA 3ZLUA 1OH6A 3W5UA 2F55A 2Q6TA 3MJDA 1P45A 1RJ9B 3Q5EA 3S29A 3FFTA 3UXEA 5BW4A 4D8XA 3H2ZA 2RGBA 1PG5A 3RG8A 1XPUA 2AOWA 4M8SA 3ZE0B 4DDMA 1G7RA 4WWHA 2PX3A 2QW8A 2XCRB 1VHTA 2FYTA 1EFHA 3HRKA 5ISMA 2GAIA 3EVCA 4AUKA 1WVGA 2WV7A 2QM3A 3CEHA 2RHOA 4GPEA 5D84A 3VR3D 4WVLA 1XZAA 5L6MB 3LQQA 4LZNA 5JAQA 3VAYA 4MVJF 3NBXX 3QI7A 2JATA 4RD3A 1W9HA 3CNQS 2D1QA 5KOJB 1YS6A 4AAYA 4DEXA 1W36D 3UMFA 3FHCB 1QO7A 1VA4A 3OJLA 3GUZA 2ZUUA 4FXOA 3EYWA 3KEQA 4EECA 3WSVA 4HCJA 1LK7A 5E7MA 3UYKA 3U3OA 2PZLA 3FZGA 1P7CA 2PY6A 3IEIA 2A33A 3GGOA 3G5MA 3JTEA 1O77A 3DMHA 4I55F 1K9SA 3HP4A 1USVA 2BGKA 2VCYA 3OPMA 4PQGA 3ZHQA 1J2YA 1JEYA 3E9EA 3PCRB 2DKFA 4K9SA 1KAQA 3HJNA 4HNRA 1XEWY 4IS3A 1NE7A 3DKPA 3E18A 4V2UA 3F7OA 1C7EA 2FZ4A 1SUCA 5JCOC 3EIXA 5AKXA 1T2UA 5CFMA 1Q77A 4JL8A 3JCZA 3NWJA 4H16A 3C43A 3KRTA 2XPCA 4I50F 5LP1A 1B43A 2ECFA 1U3VA 1WXFA 1GRQA 3GRPA 4KIGA 4MS4A 4BX9A 2D4AA 2JI6A 3SC3A 1QU2A 5UKDA 2NXEA 1VPEA 2H0RA 3ORYA 4B2YA 4ZZ0A 1KBOA 3VYVA 2F3UA 1E1RD 1IDOA 2YOHA 4FCWA 5K1ZA 5AW2A 1Q19A 2VK1A 3V1YA 1CJKC 4WOCA 1ND5A 4UOZA 4HT3B 2E18A 1C3LA 1JEEA 3I9V6 1OAAA 1Z7WA 1CE8B 5ALJA 3E6AA 2DT5A 4KVFA 5EEHA 3A4VA 2HMTA 1GPH1 1SKAA 1SXJA 2CJWB 1JHAA 2O0KA 3PQEA 3WK5A 5JMWA 4BKQA 2BJWA 1VLVA 3HB1A 3QF4A 3OFKA 4I4LA 3VVLA 3WRYC 2QTTA 4S04A 3UBMA 2RGAA 3HCDA 3GLIB 4R6XA 3LBFA 2F48A 4RFSB 2WUFA 4EO7A 3KPUA 4N7JA 3EWNA 1PZFA 2DG2A 2I7TA 2RI0A 2GPNA 3EIWA 3VGJA 1TFRA 2PBLA 1WMSA 4MVYA 4YCNA 4N5DA 1JKJB 1O4WA 5L7YA 1DEXA 1HLDA 1W94A 4IOKA 4ZIRA 2Q3JA 1QF6A 1G0NA 3AI3A 5D6NA 1KMQA 3PSHA 1JJIA 1SHJA 4FBLA 5KKAA 1AA6A 2CVOA 3TX6A 1ORIA 1UZUA 2PZEA 3SQOA 1DL5A 3IAS6 3SZ3A 4BFUA 2JRCA 4R2JA 2H1OA 1MB3A 2P9EA 3KQTA 2OBXA 2QXYA 3DCIA 5KCZA 1FLDA 3R4CA 3HV0A 1DX9A 1MFZA 1UKCA 1GAJA 2G82A 2PDAA 4TTRA 2EQAA 5D51S 3H1EA 3Q3GE 1UR5A 1KK3A 2E4ZA 3AB8A 3L6DA 3QPUA 4FFBB 4HC4A 4JZYA 4LJRA 2PUGA 4BVKA 2HA7A 2XZOA 2FLVA 2PD6A 1KKUA 2ZJZA 3CCFA 4YV1A 1DRUA 2VJBA 1PSWA 3E22B 3SM3A 2AC4A 5AO9A 4K0RA 4NNOA 3RVRA 2Q3DA 3DR5A 5LYJF 4G5XA 3G79A 2Q21A 5HS6A 4DLUA 4YWHA 2DX7A 4EB0A 3C39A 5CH5A 5B6JA 1O03A 1QUEA 1Y3HA 1CRWG 3LLSA 4IIFA 3VOAA 2E5LB 4TLLB 1Z73A 2SHKA 3F9RA 3ZY4A 1GNPA 4B3RB 1HY3A 4WKGA 2Q5JA 4P33A 1YBMA 1X77A 3LBHA 3MLBA 4MV8A 2V9CA 2NQ2C 2XUKA 3A05A 4ND8B 5ALOA 2AG1A 4CUJA 1GDHA 5EIBC 2XBUA 4I5IA 3MT8A 3U4IA 4P32A 5IT0A 4YPVA 1Z35A 4ITRC 5JD3A 2NM0A 3ND7A 2YVQA 3M83A 3P9ZA 2QPOA 3T0IA 1ISGA 1KO4A 5F7OA 2FQXA 2GXUA 1T43A 3TTYA 4G8JA 2GPAA 4W9NA 2WTUA 5FOTA 2QUHA 2V7GA 1NC1A 4JOQA 2V45A 3AONB 3P94A 3Q7QA 5DGCA 3SF0A 1XMXA 5CXQA 3QZUA 3IP7A 4MUAA 3RD5A 4EGJA 3BD9A 1W2HA 1YC5A 4H18A 4I9UA 5F3RA 4GYYA 3IP3A 5TX7A 3U48A 3OICA 4LCBA 2OBLA 3Q2OA 6AT1A 3DO8A 1T2EA 1BA3A 3TOZA 4PYQA 4F3NA 4QXOA 4PSDA 1XC7A 2O3SA 2R86A 2OZLA 2VJMA 3RJ5A 3ZGYA 2ZBUA 1G2QA 1VFNA 2W22A 5J1SB 5HFJA 1YR2A 3GUHA 2X1HA 4LMAA 1R00A 5JIBA 2R84A 2HWKA 1XJWA 2HJRA 4GLBA 1KQ3A 3MXOA 4H27A 4NG4A 4KH0A 5EJEA 5ALDA 3BWVA 4L2IA 4EPXA 1U9CA 5H3HA 5G02A 3GJXC 3D3JA 3G13A 1P7VA 1SEPA 1ORRA 4QUEA 2RGCA 1V4BA 1JXMA 1VM6A 1Q7TA 2YXLA 1IY2A 4MPJA 5CT9A 4CIWA 4KV9A 5GVRA 1SXQA 3BE8A 5H3LA 2VJOA 4OA8A 3Q1KA 4CEIB 1A1SA 3VI4B 3QA3E 5K3BA 3PDIB 3GNQA 2R1ZA 1T8TA 3BSYA 3LVRE 2C07A 3Q3VA 5ELMA 1P6UA 3PX3A 4HDNA 1O1YA 2GBPA 3MGBA 4HMPA 2EZ8A 2GEBA 4TMVA 5E3HA 4BNFA 3UANA 2PYIA 5F35A 1PWXA 3GGCA 1P9RA 2VDNB 3VZSA 4QGSA 2YFHA 4KPGA 3THWA 1AKVA 1RLOA 3CPSA 3CLTC 3EVNA 4I6GA 4ZKEA 4DCCA 4QDXA 2VSXA 3WB2A 2FKAA 2ZJ3A 2PBRA 1ULTA 5IAGA 2JI4A 1CFJA 5IJ9A 1WL8A 3X43A 2WILA 1QONA 1JEOA 4GP6A 2D2FA 4OXIA 4EL5A 5I9LA 2VF8A 5FJJA 1I6KA 2PZMA 2WJGA 1U5AA 1HDZA 2NO4A 2GSWA 2YNMA 5DU2A 3W34A 4U9HS 1T9HA 2PKEA 1XDZA 2X2EA 5JYBA 5LZ2A 2DOKA 3BJMA 3GVPA 4NV1A 5FPQA 2KHZA 3A37A 4JIGA 5IJ0A 5JJKA 3O93A 5D5HA 1OGIA 1KI6B 2AR0A 3D3WA 1UMKA 2CDCA 1P2BA 2RHTA 3TFQA 2RG7A 4LJ7A 1XVVA 4M8NE 1LBTA 2GEDA 3ER6A 4MB2A 3BHJA 2E87A 3NEJA 4ZAZA 3GVCA 4OSPA 5BQPA 2XIQA 1G18A 4CMCA 1KSJA 3OQPA 2JCVA 4A6XA 1DHTA 2WJ4A 5FNVF 1POXA 1JWLA 2DM6A 3VPDA 5ALHA 4RA6B 3CMMA 3V8PA 4ON9A 3ZD6A 3STTA 3E1SA 3GVXA 1A95A 3Q9UA 3IJPA 1CF2O 1PZEA 3GRCA 3HVUA 3R41A 4YP1A 3TJMA 1F8GA 3N2YA 4NOJA 1E2BA 3NP7A 2AX3A 3ZCRA 3HTXA 4YRLA 3WIDA 3CVWA 2V7PA 4ZO4A 1H65A 2FWMX 1JH8A 4LF4B 1UBUS 3HU5A 2JFQA 4JLAA 4K88A 3GT4A 3EUWA 4RV4A 1JEDA 2JIRA 3E9QA 1C0EA 5CT5A 3CGGA 4FE3A 1M0EA 2XQIA 1Q7EA 4EB8A 1BWSA 4FVTA 2UZ1A 3H0EA 5AJWA 4AICA 1O6GA 1HOTA 2N0SA 4WUVA 5CYFA 1E9VA 1XELA 1YNSA 1J06A 3GEGA 3KXIA 2WHXA 1Q1EA 4M9SA 2ZYRA 2C4WA 5FWXA 2W5UA 3PGKA 2V7WA 3LECA 4GR5A 3VTKA 3QGMA 4YJGA 4GP9A 3FTCA 1L3IA 1JHOA 5TQ2A 1WV0A 1QGUA 3R9WA 1EDDA 3RTBA