4J4TA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j4tA00
3JQGB 2I6TA 3TWOA 3S2EA 1GAEO 3VAZA 1CETA 2HK7A 5B4TA 5JC1A 1U5AA 4CLOA 4OHUA 4KQWA 2O3TA 1AHIA 3D0OA 3W4JA 4NBUA 2D0IA 3G17A 4MVJD 3EAGA 5BSGA 2O3JA 4NMHA 5JY1A 2CMDA 4D3FA 5CDUA 1PJSA 4FW8A 1A7KA 5BNFA 1PJLA 2YV1A 2VUTA 2Y1FA 2X9GA 1N1EA 1Y8RB 1MB4A 1PL6A 2X22A 4WKGA 2NTNA 4OL9A 1ONPA 4PG4A 1ZK2A 2I99A 2NQTA 3RUEA 1MX3A 2RHCA 1X13A 3AI3A 4CM4B 1PSDA 3I9LA 1NFRA 3IKVA 3PJDA 1TI7A 2HMSA 1IZ9A 1P1IA 2O23A 3ZHBA 4Q3BA 4B7CA 3E8XA 1X0XA 3ZU3A 3EY4A 4H16A 1D1TA 4JNKA 1CYDA 4GSLA 1V35A 1HE2A 4QO8A 2NVUB 4AICA 1UP6A 3DBLA 1BW9B 1QR6A 1LDYA 4RPGA 1ZZEA 2VNAA 5JE8A 3W4KA 1HLDA 2BGMA 3CIFA 3MCVA 1Q7CA 4RVDA 2X86A 4RVUA 3U4IA 1P31A 1LSSA 3KYCA 1BG6A 1DO8A 1W0CA 3AY6A 4KQXA 4PN3A 5C7OO 4DGSA 4E6PA 4M55A 3IMFA 1MC4A 2HSDA 3JQAD 3KLMX 4NFYA 4RPHA 1V8BA 3AK4A 4TMFA 4XGKA 2GR9A 1VSUA 1V3UA 2OBNA 3TNLA 3OF2A 3FHLA 4LRSB 4QTZA 2QW8A 3OM9A 1GL3A 4OQYA 1F06A 2RCYA 3H5RA 1Q1NA 3T7CA 3AY7A 3PGJA 3RROA 2OO5A 1DC4A 1YDEA 3KLPX 3PYMA 4QECA 4B7XA 5KKCA 1O8CA 4BIIA 1PGPA 1PL8A 1EDOA 1SEPA 1NVMB 3UF0A 5IZCC 1EFKA 3TJRA 3FSRA 4E5NA 3QY9A 1ENPA 4DWVA 3RC9A 2IRWA 3GGOA 1UJMA 4RDIA 2IXAA 4DLBA 4A03A 3WNQA 1E3WA 3I3OA 4BQRA 5JCXA 3GAFA 1G0NA 2CVZA 2PK3A 3I6QA 4MIEA 3D3WB 4W82A 4B8ZA 3PHJA 1UP4A 3RC7A 3G79A 4YRDA 1XG5A 3ZV6A 3O4RA 5JAZA 2HK9A 4G2NA 3DL2A 2A94A 3RUAA 3BMQA 5KJ6A 4EI2A 4Z0HO 2C5AA 4KP7A 3FBTA 4OJNA 1R37A 2NWQA 3E6AA 8ADHA 3WIDA 1O6ZA 3B20A 1ZVMA 2OUIA 4N5MA 5BT9A 5F1KA 1A71A 1ISFA 4UULA 2W8ZA 3Q3CA 2PA3A 2QZ9A 3QJ5A 3RBXA 3FWNA 4P38A 4RF5A 1BSVA 1Z75A 1XQ6A 5JMPA 1ADFA 5I7FA 2FN7A 2AA3A 4F6LA 1PS0A 1UH5A 2A92A 4AJJA 3GVHA 1WPQA 4FFNA 4PG8A 4L4XA 1SCUA 4L4RA 2PV7A 1LLQA 3ZWAA 1K5HA 3DB2A 2EP5A 2C0CA 3PHLA 1ZSNA 3AU8A 1EQUA 5ADHA 4NH4A 1NYTA 1R12A 1YOVB 1LBEA 2G76A 1Z73A 4MKRA 4PRKA 4ALNA 3H2ZA 3ZWWA 1YRLA 2UUPA 3RBZA 4CMIB 1HTBA 1IL0A 3PEFA 1Y6JA 1ZJZA 1A5ZA 2NVBA 4L76A 5G4KA 3SVTA 2GZ1A 1RM4A 1VSVA 2Q3EA 4IZIA 4R4JA 5HS4A 4E13A 5GZ6A 4MKXA 4AJ4A 1LRJA 2P2SA 1LNQA 3IC5A 4M8SA 2NSDA 1GTMA 3JQFC 4GX2A 3E18A 4FGWA 4IGFA 4BGEA 3I6IA 1T4DA 4J0EA 3BHMA 2C7GA 1EBUA 1W4ZA 3JD3A 3OFSA 1UAYA 2PH5A 4II3A 5ER9A 3Q9UA 4OAQA 5T57A 4I5EA 4BNFA 4DRYA 1YBMA 2AHRA 2Q45A 3LT1A 4W7IA 1AE1A 2Q49A 4TVBA 1C0IA 3PHGA 1YQDA 2H1SA 1NM5A 3QWIA 2DVMA 5A4DA 1W73A 3CMMA 2EV9A 2DTEA 1ISGA 3UN1A 2OMEA 2BKAA 4HXYA 1B7GO 1MXHA 5I9NA 3Q2KA 4PCVA 2JHGA 2O7QA 4FN4A 5DCUA 5FYDA 2B5VA 2R00A 3V2UA 1X1EA 1Z82A 1ZMTA 4FSHA 2QYTA 3JQ7B 3RUFA 3ZWXA 4AJNA 4BO9A 5DOZA 1Y9AA 1ADGA 1PQPA 2BF7A 3E03A 5A3VA 4DLLA 1U7TA 2NU8A 1T24A 2PGLA 4PVDA 1J0XO 3UW3A 4ALLA 4EUHA 1QXSA 1WZIA 4CLHA 2OGUA 1Z7BA 3IOYA 3PPIA 1R0LA 5JLAA 3ROMA 3ROQA 4Z9YA 3MWDB 2CF5A 2SCUA 4IIUA 3P19A 3WDSA 4RV9A 3UXYA 3DZFA 1BXKA 4XQEA 4BB6A 3QE3A 4ZQGA 4EUEA 1SAYA 2E37A 1KEUA 1DBVO 1IHXA 3MEQA 2CY0A 4KUGA 3ROPA 1I3LA 1E7YA 4MPDA 3D3EA 3EDMA 3AUTA 4DIOA 4AJ2A 2V6FA 3R1IA 3QVXA 5I7EA 2VHVA 1ULUA 2G82A 3I83A 5DOVA 4RGBA 4J1QA 2X9NA 1JKJA 4TSKA 2B69A 4BO5A 3GGGA 5JDIC 1YO6A 5EQDA 4Z6KA 5JS6A 4MVJA 5KNLA 4Z3KA 4CLDA 5CPFA 3E5RA 1GZ3A 3NT5A 1VE9A 4BMVA 2NTJA 1MG0A 1LSOA 3KBOA 4BVAA 3IUSA 3VDRA 3RBVA 2PTGA 3SX2A 1E6EA 3D4PA 1JTVA 4KUHA 1LSJA 3ADOA 3H9QA 3PDJA 1ADBA 3D4NA 5L3ZA 3AJRA 1BWSA 1A4UA 5EN4A 3V2HA 2P5YA 5A05A 4R1TA 3CZRA 2X0NA 3QVOA 2Y99A 1W6UA 3LVFO 5G4LA 5ICMA 4XIJA 2PZLA 1HT0A 1EE9A 4ZICA 1G0OA 3WGOA 4BGIA 1E3LA 2Y67A 1KC1A 5JPIA 3PGXA 5KWEA 4URFA 5F1PA 1H6DA 2FRDA 4FOSA 5G0TA 2AEMA 4CLRB 2DM6A 2RBEA 4Q3CA 1R4NA 2WSBA 3VZQA 4NHEA 5ENVA 4KWHA 3GDOA 1F8GA 4NPCA 5A1TA 3A4VA 2CF6A 1DRWA 1HF3A 2X5OA 3BTVA 4RVSA 1DLJA 3CINA 4CL8A 5IDWA 2HMTA 4INAA 3GVXA 4BKRA 3SEFA 3FI9A 1Z6ZA 1N92A 2CFCA 4RZHA 4IQ0A 4E21A 3D5TA 5T67A 2PGJA 4YAKA 3DOOA 2Y68A 3H5NA 1A72A 2OL4A 3F6YA 1E3EA 3JQAA 5TNXA 1AUPA 1P3DA 3PYXA 2JFFA 4EEZA 2JD2A 3B1FA 2Q4EA 4U5QA 4FBGA 2CVQA 1PR9A 3ANNA 4ZHSA 2EHDA 3AOGA 4DPMA 1C3VA 4DC0A 4RLSA 3UCXA 1EDZA 5JYEA 3BAZA 4J1NA 5K6AA 3QA9A 1YVEI 5ICSA 2YHUA 4XDYA 3M2TA 1H5QA 2OZPA 1EFLA 1MC5A 5B12A 4E5KA 3OQ1A 3UCFA 4XWYA 1NAHA 1P44A 4CQMD 1IE3A 3ENNA 4PG5A 3TDKA 1UDCA 2BGKA 4W9NA 3WXBA 1ULSA 4M86A 1ISIA 1IUKA 4EGFA 3GEDA 4R51A 2HQ1A 2HKIA 1U2DA 1RM3A 1WLYA 3RAJA 5L4LA 2DQ4A 4OGWA 2E6UX 1ZUD1 1SMKA 4XB1A 4BO4A 4JJIA 4CMEC 4DMMA 2Y1OA 4BNNA 5DCWA 3RCBA 2C29D 2E48A 3ZGYA 4JCOA 2QRLA 4B79A 1WP4A 1I2ZA 2BGLA 4K6CA 4CQLB 1VL6A 3GUCA 4Q3AA 4F45A 3M1AA 2DLDA 3INRA 1VJ1A 4OXYA 5H83A 4L74A 4BS9A 6LDHA 1UXGA 1YDWA 5JCJD 1FK8A 1C1DB 4I5GA 1WDKA 1XWFA 2FSSA 1D7OA 4NBVA 5ILOA 3CUKA 3ZWBA 2PY6A 1RWBA 4OSOA 3INGA 3WGYA 2DC1A 4W99A 1S6YA 4IQGA 1VJ0A 1K0UA 1EVIA 4G65A 5B1YA 1XU7A 1E7RA 1HKUA 4O0LA 3DWFA 5U4QA 1U8FO 2WD7B 4B7UA 1DDOA 1LEHA 1WDMA 3GRPA 4TRNA 5DF1A 1LRKA 2GGSA 2VWHA 1T2DA 4GX0A 1I5RA 4TKMA 4CMGA 1D1SA 1PWZA 2VT3A 3MOGA 1VKNA 4YR9A 3CEAA 3GVIA 1H6BA 3MJSA 4PLWA 4MVJH 3ZDFA 3W1VA 1SB8A 1NNUA 4YXFA 2HMUA 1EUZA 3K5PA 3ZN2A 2C2YA 2ZJ1A 1Y9EA 4NJMB 3FWZA 4J3FA 1JAXA 5G0VA 4B4VA 5KJEA 3A28A 1HEUA 4WK6A 2D5AA 3V2GA 4YT8A 4A2CA 5IXYA 1LX6A 2HRBA 4MIOA 3DQPA 3PZBA 4GPD1 3GPIA 3BTSA 4XIYA 2VYVD 3PQEA 3GEMA 5C7IO 1JWAB 1YB5A 4PLZA 1UAGA 3OH8A 4EITA 2AQIA 4H3VA 4E2WA 1A4IA 1HDRA 4CPDA 5TSDA 3A1NA 5EQFA 4AVYA 4FR5A 2GNAA 1E1MA 4JX8A 4R1NA 4CMAA 4WGGA 1X15A 2XAAA 1VM6A 4QSMA 1QYWA 2I66A 1PGQA 1N9GB 2CD9A 3ANMA 3D5QA 2W2KB 4OO3A 5L45A 1LDGA 1M6HA 3SXPA 4GX1A 4AFNA 2ZCVA 4CUKA 5IXSA 3QWAA 2PKQO 3RWBA 4YRBA 5IDQA 1ZIDA 1WAMA 1C1XA 3GG9A 2Q4BA 1GUYA 3VH2A 3AI1A 3BMCA 5T8KC 2CDAA 1KVSA 2NQ8A 3QV1A 4J0FA 5H81A 3F5SA 3KVOA 7MDHA 1I3KA 3OEWA 1YL5A 3G49A 1B2LA 2VOEA 1BGVA 3A06A 4E2YA 2Q2VA 1UXIA 4D46A 3DZIA 2EJVA 3H6KA 4IZHA 4N5LA 4W4TA 5JAIA 5DZSA 1NQOA 1AGNA 4PIVA 1YJ8A 3VZPA 1BMDA 1ZBQA 3BZUA 3I23A 3QLJA 1WVGA 2QG4A 4FDAA 2B36A 1C14A 3GMSA 4G81A 3ZHYA 3H3JA 5BQFA 5KJ1A 4A26A 1ID1A 2BELA 3B1KA 3F4LA 3H65A 1LDNA 1R16A 4BNIA 4BNKA 2CUKA 3VPHA 2WDZA 1H94A 3F4BA 3OJEA 3WQRA 3P7MA 3O8QB 3QHAA 4NBRA 1CRWG 3RKUA 3RU9A 1H2BA 4D3DA 1LDEA 4IY1A 3RD5A 4YACA 4LGVA 3DHEA 3OIDA 4RQUA 2YJZA 3D4OA 2VZ8A 4GMGA 4BNMA 1FDUA 2GN8A 3BXXA 2QYSA 3HDYA 3IKTA 5L9AA 5A06A 3HUDA 2W90A 5TC4A 1SEVA 5T64A 2FPIA 3ZNQA 1NTOA 3WB9A 3DBRA 2NADA 1MV8A 5A9SA 3KUXA 1P45A 1RYEA 3GK3A 4MJLA 1AXGA 1LRLA 4BNUA 4CL3A 5FI5A 3UAGA 3MJ4A 5MDHA 1GUFA 2HU2A 3HDHA 1TT5A 3HDQA 4J4TA 2E4AA 2O50A 1T25A 1QRRA 4YJFA 5L7TA 1EQ2A 4FFLA 2GERA 4WEQA 3WTBA 4FPXA 2J8ZA 5KKAA 4FJ1A 5AXBA 2NLOA 1KYQA 4PLPA 3GOHA 2DBVO 2ZYGA 3OEYA 4KOAA 1IY8A 2A35A 3GZNA 4EJ0A 4Y9DA 4Z3DA 2FR0A 1IZ0A 3WS7A 3WX0A 2A4KA 1E1LA 2YY7A 4WJZA 3IP3A 3NT4A 1FDVA 4P4GA 4BNLA 1ZJYA 1U3WA 1CIVA 4M1QA 4QFCA 3OETA 1GEEA 4J1SA 2UAGA 4A73A 4HX5A 3OMLA 4YDRA 3ORFA 1N1GA 4LISA 4O1MA 4ALIA 4BV9A 2ZB8A 3GDGA 2ZTUA 3CE6A 4YPOA 4EJMA 1OMOA 1KS9A 1JVBA 5JMWA 3WGIA 3DBHB 2OHXA 4JGBA 3H9GA 3WGQA 2H9IA 2VOJA 3E82A 1OC4A 4GI2A 3UH1A 3NJ4A 5AXAA 2IE0A 2D4AA 1CDOA 4UUMA 4J49A 2EIHA 1I3MA 4NJOA 4GAEA 4LVCA 4KDEA 2O48X 4DBZA 3IDSA 1T4BA 5G0WA 1HL3A 4J4HA 3WJAA 4GVXA 2GUGA 3E9QA 3E9NA 1K3TA 1MUUA 4L0QA 4CQMA 2ZB7A 3KETA 1U3UA 5I9MA 4BNJA 3ROKA 3OJOA 5IDXA 2V65A 1ENZA 1QLJA 1KVQA 3U4DA 3VTFA 4XDZA 1XQ1A 4R16A 4NQZA 1GQ2A 2ZATA 4RF2A 3NDRA 4LK3A 4WLVA 3VHRA 4JXKA 1NQAO 2FWMX 4D43A 1I01A 3VH4A 5JAMA 3S2IA 5TQVA 4C7KA 5JCJA 1YQGA 1HDCA 1NPTO 3N7UA 4QXMA 4RPLA 1Y81A 2DTDA 4O63O 1DAOA 1PS9A 1PZEA 3ZWOA 1GYRA 2H5LA 3DBLB 3K30A 4KDFA 4WCDA 5DNAA 3JQ6A 3ZU4A 3IP1A 1E6WA 3JQBA 4DMLA 3AM5A 3CTMA 4JBIA 2QIOA 2PFGA 3COSA 1U28A 5COAA 1TVEA 3NT2A 5HBRA 4ITUA 1L1FA 3UVEA 2V6GA 4XCVA 2GPTA 1EZ4A 2X0RA 1KEWA 3CPSA 3HG7A 3M2PA 5GZ1A 3AFMA 1F14A 3GN1A 1N8KA 3EZYA 4P8RA 4XQ9A 5CAEA 3FTPA 1GZ6A 3GT0A 3W6ZA 1NFFA 4ROSA 3KV3O 1P1KA 5TLSA 3D7LA 3I4CA 4TKLA 5AOVA 1B16A 4CM8B 4B3IA 1XCBA 4IJVA 4RDHA 5A9RA 2LDBA 2NU7A 3JQGA 5K0ZA 2WYVA 4GKVA 4R3WA 4JJGA 2GDZA 5AYVA 5JC8A 2Y0EA 5TT0A 4PLGA 4BGUA 3AOEA 3RKRA 1I8TA 4OKIA 1XR3A 1BXZA 3GDFA 3PI7A 3OJ0A 4P4LA 3RQSA 5LC1A 4ZQHA 2D8AA 2VYVA 5A03A 3U49A 1NVTA 2UDPA 4HP8A 4DPKA 3DMTA 2BFMA 3DAFA 4UUNA 3KZVA 3AUSA 5C37A 2Z95A 3G3EA 3RJ9A 4WLOA 3PTZA 2AQ8A 3WOHA 2Q2WA 3ADPA 2FY8A 3ONDA 3GR6A 3DZKA 1F17A 3L0DA 3AW9A 2PZJA 5DCYA 1ZXBA 1DFGA 2RHRA 4XYEA 3LC2O 1IYZA 2I3GA 1Y7TA 1P0CA 2GN4A 3F5QA 3PWZA 4UEJA 3WWYA 1U7HA 5THKA 5JW6A 4IDGA 1T1RA 2J3IA 5HA5A 1BHSA 2R00C 1R4MB 1M76A 4GX5A 1LQUA 1DC5A 3F1LA 1LDMA 1BW9A 1JWBB 2ZK7A 3SC4A 3TZKA 5T5QA 3UICA 1F12A 3W8DA 4B8WA 3B70A 1JLLA 3NJ8A 4AJEA 1DC3A 2HMVA 3FNHA 4XYGA 4CM6A 3WLEA 1QV7A 3VH3A 1V3TA 2Y93A 3RSHA 3ZV4A 3OIGA 1DLIA 4ND5A 1EVJA 2YZ7A 2JCVA 1BDMA 4R1SA 5H82A 1QP8A 1PL7A 3BMNB 2AQHA 4A27A 3OIFA 3AU9A 3LDHA 2D3TA 1PTJA 1TA4A 2FZWA 2Y1DA 3F1KA 2B37A 5U9CA 3S2FA 3AFNA 3DZJA 1K6XA 1Y5RA 3GZ4A 1AXEA 3C1OA 2P4HX 1HZJA 4Q3NA 2GO1A 2ZB3A 3ZNOA 4BNWA 4A5OA 3MJTA 2I3AA 4II2A 2I65A 5KCZA 4R9RA 1QMGA 1UZMA 3HFSA 2PZKA 1JAYA 4B3JA 4B4OA 4OQZA 2EG9A 4ZRMA 4GGPA 4D41A 4R9SA 2J3HA 2D1YA 3K6JA 4K6FA 3ZI0A 3WICA 1OI7A 4E2XA 2HK8A 2GSDA 2YFQA 4XX0A 5C3MA 3FNEA 5F1OA 1V6AA 3UKOA 4Z0TA 5A5EA 2AEJA 3QSGA 4JP2A 1XU9A 3C7CB 2PLAA 2GYYA 3RUDA 1M2WA 2Y1GA 4UVHA 3ABIA 1UXKA 2D2IA 3W8FA 3ZV3A 4D42A 3TPCA 3GMDA 1RM5A 2DAPA 4CV0A 4DYVA 1G1AA 4I1IA 4IIVA 2O4CA 1BXGB 2AQKA 1O9BA 2JFHA 4XB2A 3EK2A 4WOKA 5ENDA 3JD0A 4IS3A 4CMCA 1H9AA 2JD0A 2YFHA 4IS2A 1SNYA 3ZHZA 4DXHA 4HBGA 4Q9NA 1ZK0A 4TRRA 3KSDO 3FR7A 3WGHA 4GWGA 4EUFA 2BD0A 3HE3A 4CM3A 4N54A 3C3XA 4DUPA 4E5MA 2PWZA 3KYBA 1ZCJA 1Y1PA 3GLQA 2W2LD 4XEHA 2NTVA 2JAPA 4NDNE 2WYUA 1YOVA 3D64A 4GLOA 3U5TA 1X7DA 3OJLA 4WLNA 4B4WA 2VHWA 4BGVA 1PJ4A 2EW2A 1DIAA 4CMIA 5JFOA 1W8DA 3ZWVA 2GN9A 2NNLD 1DSSG 3DBVO 2IDZA 3PQDA 3K96A 1LDBA 2GLXA 2WMDA 1K6JA 1NWHA 1LLUA 4WPGA 2ZTLA 5EIOA 4MO2A 4PLTA 4CM9D 4DA9A 4BHTA 5EESA 3FNFA 4ALMA 1G6KA 1XYGA 1T2CA 1EEHA 3BTOA 3CSDA 1UUFA 4W9NC 5DN9A 1NXQA 4GL4A 4PRLA 3DFZA 1R0KA 1GPJA 1KBZA 2DT5A 1CF2O 1JQBA 4M49A 5JY6A 2PGDA 3PJEA 4YQYA 3LLSA 1MFPA 1Z45A 1DB3A 1KY5A 4B4UA 4D3SA 4PZCA 3QVSA 3B1JA 5DBIA 3I52A 4S1VA 2YW9A 2OP1A 1M75A 1LI4A 5ILGA 2AMFA 4EJ6A 1E7MA 3TOZA 1NQ5A 1EBFA 1EUDA 4LN1A 2YQ5A 5CEEA 4JROA 2FSVA 1R4NB 4E31A 3ZWMA 1DRUA 4CMBA 2X5JO 2Q50A 2VNSA 3OA2A 1K6IA 1B3BA 3E5MA 4JJFA 4U7WA 1WMAA 2DFDA 3TSCA 3DHYA 3KHUA 2OORA 5CG2A 4HKTA 4E32A 2Y1CA 4GH5A 3NTRA 3F47A 4BNHA 4MKZA 2EKPA 5HS6A 3GF4A 4RQTA 1P1FA 4ND3A 2QRJA 3FCOA 2A9FA 2CDBA 4R01A 1B3RA 1T1SA 3C7DB 2YDYA 2EW8A 2OP0A 3FPLA 3OECA 3U4HA 1HSOA 2AEFA 3V1TC 5BNTA 3PQFA 3F9IA 1X0VA 4HY3A 3GEGA 3K2EA 4YA6A 1NAIA 3DAGA 3QWFA 3ZWPA 2ZQYA 4HV4A 3R3JA 1I0ZA 1UXHA 3ENKA 3IJPA 3T4XA 3WJ7A 4CM7A 4M89A 3C1AA 2X6TA 4C4OA 3JQFA 4BQPA 3Q11A 4ND2A 2EERA 2XF8A 3HDJA 1XELA 1CERA 3PK0A 3ITDA 3QW2A 5FEUA 3H9UA 2C7VA 2X5KO 4K9DA 3LC1O 4FOOA 4WCFA 4XR4A 4XD2A 1YXMA 3BMOB 5KTKA 1UDBA 1K2WA 1UDAA 1VRWA 3NGXA 1Y8QB 4G5HA 4MIYA 1S7CA 4EBFA 5EJ2A 2C2XA 2I5PO 1JVSA 4LVUA 2ZJ0A 3LU1A 3UFXA 2VN8A 2YQ4A 4E0BA 4L8VA 2VRCD 3SJUA 3WLFA 4QQRA 4MVJF 4LMRA 4AJPA 1GUZA 5CEFA 1GYPA 3PFWO 4JQCA 4WLFA 4OYRA 4CLRA 5CP8A 4ZD6A 2O4UX 1NR7A 2G17A 4DYDA 4YVFA 4U8GA 3JQ8B 2IZ1A 4RVGA 3F46A 4CR6A 4DREA 1YB4A 1M6WA 3OICA 4HUJA 4AL4A 2CDCA 4ZJUA 1HZZA 1QG6A 4BNXA 5B4UA 2DPHA 5AQ1A 1NWCA 4K26A 1DIGA 4FGSA 1XHLA 3TZ6A 4NFSA 4NBWA 1NBOA 5HRUA 2IODA 1DRVA 4DQXA 3ZV5A 5JBIA 1GU7A 4GLLA 2C54A 5IJZA 1I33A 2VWPA 2QZZA 4D0RA 2C82A 3EUWA 4BNZA 2PD6A 2Y1EA 3GNTA 3LSYA 2H63A 3O9ZA 4K28A 3ASVA 4EZBA 2ZB4A 3K2BA 4L4SA 3N58A 4XJSA 5IDYA 3ETDA 1LLDA 4ZQBA 3BHJA 4YJHB 1Q0HA 3CH6A 2VT2A 4FFRA 4HFJA 4U0KA 5JDIA 2H6EA 4NIMA 5COBA 1PZFA 4AJKA 2ZIZA 5HWSA 4CV1A 1KEPA 4YJDA 3I9JA 5F5NA 1YB1A 4DC1A 2IZ0A 2OOSA 1JKFA 5DBFA 3GFGA 4QEDA 3ZCXA 3HJAA 2JKVA 4PLVA 3JV7A 2LDXA 1YS4A 2AW5A 4EW6A 2EKLA 1Y5MA 3FNGA 5B37A 5FI3A 1MFZA 3OP4A 4F6CA 1FXSA 3EVNA 4UUPA 1PS8A 4YAEA 3HWRA 4LW8A 5CDYA 3E9MA 2P4QA 3CXRA 1YL6A 1NFQA 3M6IA 4MDHA 1NPDA 3NUGA 4YRAA 1YGYA 3HSKA 3TF5A 4GSKA 2WEKA 2VYND 3FRJA 4CMJA 4IUYA 4HADA 4RZIA 3NYWA 2JJYA 4FIZA 4DTIA 1T2AA 1D3AA 1HDYA 3ITKA 2BI7A 3NDIA 4J7CA 2VRBA 1D4FA 1E7SA 1GCOA 2AG8A 3DONA 3HB4X 3RC1A 4DVJA 3AM3A 5CDGA 3U62A 3PZRA 3VPFA 1NP3A 4DQUA 3WQSB 1P74A 3ZHXA 3BMCB 5BSHA 1ONOA 1PZHA 2P9GA 1XKQA 5AXDA 1ZO8A 4AG3A 1Q0LA 3DZGA 2NVWA 3MJCA 4DIFA 4Y6PA 1CQIA 4TZKA 1Z74A 2BHLA 2EP7A 2V6MA 3BA1A 4PG6A 9LDBA 4L9RA 3WIEA 1QORA 5JO9A 1N5DA 1LLCA 3JQEA 5JDCC 3ZW8A 1R0SA 4BO0A 2WD7A 2W4QA 2X7HA 4NK4A 3VDQA 1PZGA 2W2LA 3G1TA 3PVZA 1A7AA 4XZ3A 5CFZA 3VKUA 3JQ9A 3JYPA 3PYLA 4MVJG 4Q3DA 3QWBA 3LF1A 2CNBA 1LC0A 1YBAA 3PJGA 1SOWA 5KJCA 4PFJA 1E3SA 4E2ZA 3WMWA 4D45A 4NJMA 3V8BA 2Q1WA 2BFOA 4IJUA 2VHZA 3HN7A 4JLWA 4XYBA 1ZMOA 1V0JA 2Q1SA 4CM9A 3QP9A 3L4BA 1GFSA 4KTVE 4DLAA 1HXHA 1UZNA 2O3RA 2VWGA 4I9UA 3H7AA 3KEQA 2XXJA 1OBFO 4TVOA 1GPDG 1XA0A 4OH1A 2AXQA 4YJGB 3LZ6A 5LDGA 3AI2A 5THQA 4CMEA 3ZW9A 8LDHA 3JYLA 3DBRB 4CODB 1GDHA 1DPGA 3KOUA 2HJRA 2Q1UA 1N7HA 1VL0A 1V9LA 4YQZA 2I67A 3KB6A 1TT5B 5KVQA 4YAGA 4DPLA 4BO7A 1N9GA 2HMWA 3DAPA 2W2KA 4LMPA 1HE4A 4D79A 2HO5A 2RAFA 4IQ8A 4BNYA 1LXCA 3K31A 2J3JA 2DKNA 4RVHA 4DQVA 3T4EA 1E1NA 3NEPX 1N7GA 4I08A 1FDSA 3FN4A 3JQDA 2QX7A 3JQBC 3EZLA 6ADHA 1C0PA 3E48A 3U9LA 3ZZNA 7ADHA 1BRMA 2J5QA 4RL6A 1C0KA 4U0JA 2Y0DA 5L51A 2C07A 3DHNA 1E7WA 2PD3A 2C5EA 3AM4A 3MTGA 1ISMA 2PZMA 3UUWA 4S3MA 5K9ZA 1PGNA 2EGGA 2EXXA 4GBJA 1LUAA 2V7PA 3RJ5A 3KYDA 1HYGA 5F5LA 2GN6A 1B8PA 2WTBA 4HFRA 4J2HA 4YTEA 3ZNPA 5BR7A 1KVUA 4OMUA 5FWNA 1PJ2A 4NU5A 3WR5A 4BUCA 3PWSA 3Q0EA 4MINA 4TRJA 4A10A 4Y6RA 4IMPA 2VUSA 4AJLA 4YEDA 2J6IA 3RASA 4ALJA 2YHIA 3O8QA 1PQWA 4HWKA 4PZEA 3VH1A 3P5SA 2P91A 2X58A 3AOEC 2BI8A 1EE2A 3OQ6A 4OXKA 2DBQA 4FD3A 3ICPA 2VZ9A 4E5YA 3HFGA 3JCZA 3S2GA 1O0SA 3OA0A 1OFGA 4UVDA 4KMSA 4IDCA 3RUIA 3GN2A 1K89A 4IXWA 4OIMA 3RFTA 4AJ1A 4OSPA 1UXJA 4NZ9A 4A0SA 3HQ4O 3DR3A 3TZQA 3DTYA 2G1UA 4CLOB 4J4BA 2VQ3A 1I32A 2X0IA 2P9EA 2VRCA 3KXDA 4TQGA 3FTNA 1PJTA 1Z7EA 1MG5A 2CZCA 1FF9A 1I3NA 1LJ8A 4MVJI 1U4SA 4RO0A 5L4NA 1DHRA 1XSEA 1BDBA 1DJQA 3SBOA 5CPBA 5TX7A 1H6CA 3ON5A 1T2FA 3U0BA 3EYWA 4IINA 4O59O 4R5HA 4ND4A 2J5RA 2JCXA 2Q2QA 4FFOA 3DOJA 4DIBA 2Q46A 3GNSA 3I9NA 4QX6A 3WGZA 3PXXA 3DOCA 4OKNA 3K73O 1KOLA 4CR7A 2PR2A 3JQCA 1V3VA 5IF3A 1DJNA 1FDTA 2GRAA 3O26A 3AY3A 1KEVA 4BO8A 4R68A 3ETGA 1B8VA 2NACA 1DIRA 5LDHA 2BFPA 3AUUA 4FFMA 2ZQZA 4Y98A 5I8WA 3VZSA 3DBHA 2C20A 5U1PA 3SC6A 1XLTA 2DPGA 2X9VA 2PD4A 3DO5A 1U3TA 2C59A 4UUOA 5L95A 1PEDA 3VC7A 4CMKA 1E7QA 4D0SA 3ZWYA 1KIFA 2CVOA 3KYCB 1P1RA 2HJSA 2YDXA 1SC6A 4WEOA 2P68A 4BKPA 3WSVA 3RFXA 3TQHA 4IDDA 1YE3A 3IL2A 1JDJA 5IFLA 2B35A 1DAPA 2WD8A 1H9BA 3GVCA 5AXCA 3UCEA 4PG7A 1IPFA 1ONNA 2G0TA 1WW8A 4Q3EA 3VTZA 1WDLA 4MP6A 1SPXA 1A9ZA 1ZKMA 4J91A 1P0FA 1U9JA 3JYOA 2YV3A 2HDHA 2VYNA 2B4TO 2CSUA 2IZZA 3OBBA 1ISHA 1GEGA 3C8MA 3O03A 4IDEA 2YV2A 4E4YA 2ZYDA 3KM0A 3OJFA 3HADA 1J49A 2WM3A 3PDUA 1QYVA 3NAQA 5TF4A 4IJKA 3Q9NA 3NGLA 1TB4A 1NPYA 4J9UE 1H6AA 4E30A 1E3WB 2B83A 3HN2A 1F0YA 1VJTA 5FFFA 1HWYA 1Q7GA 1Y8RA 4J9VA 2FR1A 4TROA 5TS3A 1F8FA 4U6QA 5JO0A 1HLPA 1U2GA 1ZSVA 3ICCA 2AE1A 5JYDA 3PWKA 1EVZA 4CM4A 2NM0A 3H3FA 3BMQB 4UREA 3K92A 3EC7A 2X23A 4BKUA 4YWJA 4KZPA 4BMSA 2R6JA 5L40A 4L75A 4OXNA 2F00A 1MP0A 1WXDA 2GF2A 5ITWA 2UV8A 5TT1A 1CJCA 2VTEA 4MVJP 3U4CA 1R6DA 2J3KA 2NVUA 1RJWA 5DP2A 1Q2XA 4CM8A 2R2GA 1M66A 1PGOA 4D44A 2POQX 1YKFA 4HNHA 2ZCUA 4U6SA 3SLKA 1GYQA 1KERA 2EF1A 5BNIA 1OZAA 4NK5A 3EHEA 3ETEA 4CV3A 4BMNA 3PIIA 1HE5A 1U5CA 4YT5A 3TL2A 3L4SO 3WFJA 5DP1A 1VKOA 1VLLA 2VHXA 3C24A 3ZNNA 3RI3A 5A9TA 1UZLA 2B4QA 2OBYA 2D59A 4YB8A 5KVCA 2OFPA 3UHAA 3W4IA 3AWDA 2O7SA 2X4GA 3VOSA 3GG2A 3WSWA 1U1IA 5G4KB 4D7AA 5CEJA 5A5FA 4IXTA 2PKQP 3I1JA 3TL3A 1EVYA 3PHHA 3ULKA 3A9WA 5ES3A 2IEDA 3OSUA 1I10A 4CJXA 1E6UA 3EVTA 2Z1MA 3L6OO 3VPXA 3OHSX 2JL1A 3QQPA 3C85A 3DEYX 5JAQA 4XRRA 1HDXA 1N2SA 4IPTA 4Z9XA 5LCXA 1E77A 1VI2A 3QVWA 1R4MA 1O95A 4ALKA 4O5OA 2NU9A 1D8AA 3RUCA 5IG2A 4ZGWA 2DTXA 2WE8A 1SZJG 1GZ4A 3LT4A 1PJ3A 2F1KA 3OQBA 3F3SA 3D3WA 4GVLA 4TWRA 3PFFA 2VTDA 5CDTA 1ENYA 4R54A 2IXBA 3TRIA 3MOIA 3O38A 2FMUA 4A7PA 4UVEA 5L7YA 1EUCA 1DIHA 2XPCA 4ZN6A 5IN4A 1QKIA 2HRZA 1GY8A 1GV1A 3LQFA 2UVDA 1I30A 5EERA 4MP3A 1ARZA 3BMNA 2JHFA 4XJTA 4TRMA 4ND1A 4BO1A 1HSZA 3NKLA 2Y0CA 1ZK3A 4NU6A 4J7XA 1I24A 1PU2A 4CLEA 4IBOA 3H9JA 5EL0A 3FR8A 1DXYA 2HUNA 1KY4A 4EEXA 4AJOA 2AG5A 3ASUA 4I8XA 1YJQA 3JD1A 4CV2A 1J4AA 2BRUA 1BTOA 3ZWNA 2Y66A 4WCFC 1AN9A 1JN0A 3IIEA 3LT0A 5A04A 3JYNA 2HLPA 1YH3A 2GASA 1X7HA 4QO7A 3KSZO 4XRGA 1XDWA 3L6DA 3NTOA 4LCJA 2FHSA 1YONA 4BNVA 4FQ8A 4LSMA 3SJ7A 4PVCA 2RIRA 2J5KA 1B0AA 3E1KA 3GGPA 3MJEA 5K6AC 5I7VA 5KVSA 4I9NA 1JKIA 4Z9FA 4BB5A 4MVJM 1XIVA 5IZCA 4BV8A 3A14A 4YYZA 3GA0A 4E12A 1SOVA 4ZRNA 3PLNA 1PJQA 5ER6A 1U4OA 5A02A 3KO8A 2JAHA 1I2BA 5TGDA 1JA9A 2FPPA 3DXFA 4IDAA 1QV6A 3KSUA 3LLVA 2AE2A 1BXGA 3M1LA 3U3XA 4XQCA 1E0DA 1PIWA 3ZU5A 4QT0A 3EGOA 2ZKLA 1H2HA 2V6BA 1R15A 2ZYAA 4JBGA 4ZA2A 3MWEB 1NHGA 2HCTA 3INTA 3UOGA 5CHEA 4R41A 3S8MA 3CMCO 1P77A 3W8EA 4ZQFA 3WGGA 1TT7A 1ZK1A 4WOJA 3B6ZA 4UVGA 3GRKA 4ZQEA 3R0IA 1DFIA 2ILTA 2DU8A 2PNFA 3LC7O 1ZXLA 2FP4A 2QRKA 1FDWA 1KVTA 1RM0A 3JQ7A 3R6DA 1GV0A 3WGTA 1DHTA 3DDNA 3GQVA 4HFMA 3FF4A 1JU9A 1VC2A 5L53A 1SBYA 2E49A 1ENOA 4PLCA 2IEBA 1NHWA 3PHIA 1YL7A 3JYQA 3R3SA 4N18A 2PKRA 3G1UA 4IDBA 5C7LO 5G0UA 3L6EA 3BTUA 3JQAB 5JXWA 3QIVA 1X14A 4GWKA 1J5PA 4X54A 4WCFB 1LC3A 2B4RO 4J16A 4PLFA 1P1JA 5ITVA 2NUAA 2O3QA 4R69A 4YT4A 5GZ3A 4NI5A 1MA0A 2D5CA 2O3SA 2Y05A 3VZRA 1PR3A 1VPDA 2WE7A 3IUPA 3MZ0A 4YAJA 5A3JA 3U09A 1IOLA 2FOIA 4J43A 1HDZA 4KUEA 1DOHA 4Y6SA 5KVVA 3NRCA 1QYDA 3WYEA 2EEZA 1VL8A 3GNQA 2JFGA 3MTJA 5COQA 3HHPA 1YBVA 5G0SA 1TXGA 4AJHA 3HNPA 2NU6A 5EINA 4I5FA 3RUHA 3QVTA 1MLDA 3K8ZA 1PJCA 4WECA 3JSAA 4H15A 1ZFNA 1J6UA 1U3VA 2Z5LA 3DFUA 4JN6B 4J90A 2GD1O 3BYZA 4XGNA 1R66A 3WG9A 4CMHA 1PJBA 3L9WA 4FJ2A 5DULA 3DTTA 3C7AA 4NR0A 2FZEA 1ORRA 1HYHA 2TMGA 2XXBA 3IJRA 3RVDA 4B3HA 1GCUA 3DZHA 5EPOA 3WQQA 2O2SA 1E92A 2I76A 1E3JA 5BSEA 3JQ9C 1EK6A 3LK7A 1GR0A 1ZH8A 3I9OA 4RF4A 5KIAA 1I36A 1GADO 4XKJA 4FC7A 4MP8A 4R3NA 4E5PA 1YQXA 3NTQA 4R5MA 4WNIA 1P33A 1NQTA 4WNCA 1I2CA 3LF2A 1QSGA 3QRWA 3L07A 3GUYA 1ZK4A 4BOYA 1DFHA 4BNGA 1X7GA 3LT2A 2TMDA 4BNTA 3L4BC 4BL5A 4QFDA 3RU7A 1PX0A 4ILKA 3KRTA 1B14A 5TJHA 4HFNA 4YCAA 1XGKA 1HDGO 3IQDB 3WWZA 1T2EA 4WE3A 5F21A 4E3ZA 1NX6A 3BMOA 2DUWA 1YWGO 3NDJA 1TLTA 2JCYA 5J23A 3VKVA 4JK3A 1Y8QA 4RORA 2NV6A 1ZNQO 4YT2A 1U8XX 1X1TA 2G5CA 3GFBA 3NV9A 4TZTA 3PIDA 1OOEA 1GD1O 4IMRA 4WLUA 1FJHA 4PLYA 2BFAA 2QHXA 1P1HA 3PRJA 4PLHA 2VHYA 5KJFA 3WBFA 1PGJA 1DIBA 3IS3A 2WJPA 3JQ8A 1E5QA 2I9PA 4UEKA 1NVGA 2P9CA 4FS3A 4J1TA 3L77A 1XEAA 2ZTMA 1QLHA 4XGIA 4CQLA 3SLGA 4JP3A 4NG5A 2QQ5A 1T26A 1Q7BA 3VVCA 2BH9A 4WUVA 1C1DA 1OC2A 5GMOA 1C0LA 5JNLA 4H7PA 3LYLA 5I9LA 4CUZA 2HAEA 3EMKA 1C1XB 1L7DA 1UP7A 1WMBA 5JSFA 1MXFA 3NX4A 4JIGA 4OOEA 1DC6A 2XOXA 1NASA 2EKQA 3WFIA 3TFOA 3TN7A 3ONEA 4ZVVA 3KTDA 4YJHA 4ESOA 3DC2A 2GZ2A 1UR5A 2Q99A 4MVJE 4DL9A 1Q0QA 1HETA 3PLRA 2B5WA 3D1LA 3V5NA 4FFPA 2ZTVA 4XYMA 4KWIA 2OXIA 4FB5A 9LDTA 2DUUA 5HM8A 5EMHA 3H2SA 3PP8A 3H8VA 2WWRA 5DBGA 4UEOA 2PH3A 1ISJA 3TZCA 4AJIA 1IB6A 1LQTA 3MJVA 3EW7A 4HNGA 4N7RA 4C7JA 1HYEA 4Z0PA 3I9KA 1KETA 3GAZA 3KEOA 4JBHA 4CLXA 4KTTE 5L4SA 4F46A 1L7EA 1ML3A 3I4FA 4YAIA 3TFQA 1E3IA 1E5LA 4Q39A 4BKOA 3GHYA 4ZU3A 3H4VA 1IULA 4N5NA 2VWQA 3FBGA 1H93A 5I8ZA 4CUJA 4LRTB 4XYLA 1IPEA 4WASA 3ST7A 4FJ0A 4MOWA 5IN5A 3P2YA 1KC3A 3Q1LA 1ADCA 2Q1TA 1A27A 2X1HA 2DBZA 1A9YA 3HB5X 3JD2A 4IM7A 3H9EO 3VPGA 3X2EA 3C1TA 1E1KA 1O94A 4CR8A 2EGHA 4E33A 1WWKA 4EDFA 5FF9A 1MGOA 5A9SB 1RYDA 3GVPA 1GQQA 2EJWA 4ID9A 4GMFA 1HRDA 1P9LA 2VZ0A 2IYOA 3DMYA 3WTCA 3WMXA 2Z1NA 3P2OA 1OAAA 2UYYA 2JD1A 3KYDB 4YJFB 2DBRA 1CQJA 4IJWA 1NR1A 5T6BA 3S1LA 4BKQA 5BSFA 2BMAA 5TIIA 4I5DA 5L7WA 3AUAA 3GH3A 1ZEMA 3I9MA 4W7HA 3H5AA 5TJ9A 3GHHA 3S55A 3K9QO 2GZ3A 1HDOA 3GZNB 1ZSYA 3V1UA 3I5MA 1SB9A 1LTHR 3N74A 3RFVA 4CM5A 3Q2IA 5G2OA 1PWXA 2O3UA 4RLHA 2YHIB 4UAGA 3TOXA 4RJTA 2P5UA 2RH4A 4IGEA 4J7UA 2ET6A 4LSWA 4O6VA 2FPGA 4W6ZA 2YUTA 1O5IA 5GY7A 5IZ4A 3IAHA 4UVIA 4BO6A 4IDFA 3CZMA 2X8LA 1AHHA 3ZH2A 2B0JA 5C5IA 2DFVA 3GC6A 4YJGA 1PQUA 1TEHA 3CKYA 4M54A 4BO2A 4EYEA 4M87A 3FD8A 3WYCA 1KVRA 3V1YA 4QUKA 5I7SA 4J6FA 2UUOA 5CG1A 2FR8A 5CDSA 1H0KA 3VPSA 3TZHA 4RCVA 4XQGA 4DBVO 4WLEA 4RPJA 1B15A 4CQMB 4GGOA 3G0OA 5AVOA 3PJFA 4RPKA 2BLLA 4NBTA 3ZWCA 4ONEA 3HZZA 1LSUA 1JW9B 1IHYA 1M67A 4I9HA 3JTMA 2X0JA 5F3RA 4GKBA 1BVRA 3DMTC 3T7EA 4LCEA 1FMCA 3WYBA 1EMDA 3QWHA 4XR9A 1CWUA 4Y8VA 4NFHA 3L9XA 3JD4A 3BHIA 1GQYA 3WNVA 5JDCA 3GY0A 3GPDG 1LA2A 4NNJA 3WBBA 1HE3A 3Q6IA 2O2YA 4FCCA 4BO3A 4F3YA 3W6UA 3FPCA 4RF3A 3STHA 5HTOA 4RVFA 1O89A 4CM1A 1EK5A 1SO8A 1B26A 1CEQA 4P4NA 4YBZA 3ZU2A 5T8KA 3UGKA 2GCGA 2W98A 4K1LA 1WNTA 3DZBA 3RC2A 1LU9A 2E82A 3RIHA 2YYYA 4PZDA 1QYXA 1QYCA 2VUUA 5KOIA 4L73A 4PGFA 4OOFA 2IYPA 4J2OA 5TRTA 3VVBA 4R1UA 1RPNA 4XA8A 2WYWA 3X2FA 3ANLA 4P22A 2VCYA 1B8UA 3BIOA 3ONFA 5B4VA 4GQAA 4FC6A 5IAAA 1WZEA 2EWMA 4OM8A 1DEHA 1BVUA 1RKXA 1ZW1A 5DT9A 5MGBA 1ZEJA 5DDIP 4Y67A 2RH8A
chains in the Genus database with same CATH superfamily
1QDLB 3RK4A 1VJCA 5B4TA 3IMKA 4D9MA 1MCZA 3C6QA 3CNOA 5HF5A 3W4JA 5MFZA 1A8SA 4B0OA 3NHUA 3NTUA 5BSGA 3K32A 2O3JA 3LHKA 4TL7A 4NMHA 4QNRA 2C99A 4F9EA 3OTHA 3Q7PA 5CDUA 3KEMA 4KVGA 4N3GA 2HRRA 5BNFA 3CR3C 1HA3A 1HBJA 1RC0A 3HS3A 2ZRDA 1O95C 4QHSA 4IV0A 1C9YA 4KVFA 2J7PA 1YS7A 1N1EA 1OLXB 1Z62A 5C80A 1SBHA 2AFIB 3BL8A 5AVWA 4W5QA 1ZK2A 3C3BA 1NXSA 1S1MA 2I99A 2ZRJA 1P6XA 2AG0A 2D1SA 9GPBA 4YRJA 3K1AB 1ACMA 1P6QA 1I7DA 4CM4B 3D7NA 1PSDA 1N5OX 4LJ8A 4WDRA 1JDBC 4S1TA 5K3CA 4MHTA 1TI7A 2O23A 4HPXB 1EXNA 2OENG 2UYGA 2MWMA 5CUQA 3K94A 4X1KB 3ZHBA 4B7CA 1LTQA 4X97A 2BP7B 1X0XA 5E3IA 3EY4A 4F12A 4MUMA 2CLCX 4ON9A 4Q4LA 1V35A 5F12A 1HE2A 2JAOA 3JWHA 2BDUA 4U9IS 4BMZA 1T36B 3T3NA 1QR6A 2W8BA 1KE1A 2QM7A 2UZAA 3LL7A 3SLRA 2XXAA 1TIKA 1SVNA 2Q3MA 1USUA 1K3FA 1JLLB 2BGMA 2IDKA 2YVLA 4J0KA 2P3QA 2E9SA 2HPAA 4HWOA 1Q7CA 1F7VA 2EHJA 2QW0X 3B6JA 3DQZA 2WKQA 3AUKA 3TRFA 3ZE2B 4F4HA 1W0CA 3ISJA 1E9RA 4FR0A 2GUWA 1MC4A 3IMFA 1Z37A 2HSDA 3HJTA 3JQAD 3L8YA 3KKZA 4UASA 4UU1A 1OHHD 3R75A 3E2IA 4X6XA 4XGKA 2WU3A 5KREA 1Q1AA 2BRUC 5JBNA 1MO4A 4IAOA 1JQKA 1S2DA 3ESZA 2DRIA 3UT0A 3OF2A 4C05A 4JKYA 4L0MA 3ZKWA 5IVDA 1ZU5A 5JEEA 3X43A 3OM9A 3BICA 2APJA 2CHUA 3E35A 4C76A 2RCYA 4ZAZA 5JV5A 6NULA 1JA1A 3H5RA 2VPWA 3D81A 2K7ZA 5B1EA 3UHFA 4E88A 4DV1B 1R3DA 4TXHA 1K98A 1CUYA 1DVRA 1W9HA 3G89A 1DC4A 2PSFA 3BULA 3NHZA 4MUHA 4A9AA 3PYMA 4XVRA 4QECA 3UB3A 1O8CA 1D2MA 3NRJA 9MHTA 2AI2A 1PL8A 3G9XA 3ZVLA 1VPEA 5J43A 2ID8A 1EFKA 2CXSA 1ZX1A 1ECLA 4DWVA 4EA6A 4JYAB 3B89A 3RC9A 1M1NB 3HH8A 4V0SA 3GGOA 2HZBA 1C7IA 2GVDC 1UJMA 1LY1A 1FL9A 4HQ0A 1TCUA 1NXWA 1NP7A 1E3WA 1WXHA 3CFYA 4BMXA 5LWQA 2HW8A 3ESDA 4IDQA 2CVZA 3I6QA 3K5WA 1H4SA 4UNIA 2R5NA 1X19A 3D3WB 3U7RA 3TLYA 1FU7A 4YASA 4EJ2A 4M83A 1M6YA 1JDBB 2P1DA 3PE4A 4O4IF 3RC7A 1T5BA 2QJOA 3M82A 3ZE9A 1PK7A 3ESYA 4ND7A 5B7QA 2HK9A 4G2NA 5JS7A 2A94A 2A9VA 2WT9A 3EISA 2AFRA 2FFBA 1A88A 3DT6A 4Z0HO 4HGZA 3FBTA 1P4HA 5GOZA 1CQZA 1R0ZA 4ZO9A 3EIEA 4R9NA 1XTBA 1OU4A 3WIOA 4UM9B 3NLLA 1O6ZA 5DM1A 3D6NB 5E8RA 1XALA 1ZVMA 3DDHA 3UGQA 4F72A 3A2MA 2ADOA 1VLMA 2Q2NA 3FMIA 4PZ0A 1JHRA 1RXYA 4AW9A 3FWNA 5UKDA 4RF5A 1BSVA 2Q6TA 1XPOA 3PCRB 3ZTTA 1CYEA 1ADFA 4DCVA 2FN7A 3FVTA 3GXBA 4FYIA 1R5NA 1PS0A 2GILA 4I5IA 1V45E 5GJVC 2ECPA 3QV2A 4FONA 2N1MA 3ZBPA 4PG8A 2PSEA 3OQJA 1SCUA 1KZ7B 4N0DA 5CLJA 1K5HA 1THGA 4UBNA 1N1DA 2VJAA 5EA2A 2H08A 3AU8A 3QLVA 2VBIA 4QARA 1LBEA 4I66A 2W0SA 3VUFA 3C3PA 1L7XA 2XADA 4HXEB 2FN3A 5CB0A 3RBZA 3ZCUA 1WBBA 4K03A 4HDMA 2PXXA 1H23A 1LF5A 1Y6JA 3L1VA 1T6ZA 4HH0A 5CMLA 4F2WA 2GZ1A 1JWLA 3BMXA 1F6DA 3SXUA 2Q3EA 1ESNA 2EWWA 3VYTB 4CIXA 1LRJA 1S3IA 1VJDA 2BGTA 3EVCA 2OBBA 3HBMA 3O8BA 4HMOA 4M21A 1LNQA 4EAQA 5SZKB 2NSDA 2GD2A 3DCJA 1E20A 4KVZA 2WM8A 3HXPA 2JJQA 2W6ZA 2FGKA 4EG8A 4UJ5A 3JD3A 3CR7A 4DLWA 3C45A 3DR5A 2PH5A 3GJ6A 5BOVA 3F90A 1LJUA 2VDOB 3HKCA 3Q9UA 1QHHA 1SC3A 4OAQA 1E64A 4I5EA 1T35A 3THOA 2PVSA 3KYJB 3K9NA 3JVEA 3VU0A 2HBRA 1U7XA 1C0IA 1IQPA 1M83A 4KPUA 1SN7A 4HGOA 3U1TA 1H0SA 1IHUA 4PBTA 1MJHA 1FJGB 1KR2A 1CX9B 1S5PA 1FS6A 2COKA 2GAIA 4C6HA 1UK7A 5A4DA 5BN5A 2EV9A 2X0FA 1XFAA 2Y6UA 3UN1A 2BKAA 5AI5A 2B3DA 4F6RB 1ZH2A 2O2EA 4KMOA 3R4VA 4TMZA 2AD1A 5EZQA 4FN4A 2RK4A 2AK3A 3N5KA 3A10A 3CKMA 3QVMA 5G1NA 1SCKA 3HCFA 4FSHA 3V2IA 2R9VA 3VHXB 2O19A 2P90A 2WBLC 2O2GA 5I5EA 1P75A 1Y9AA 2WM9B 5CX4A 4LX0A 3HJGA 3L01A 2BF7A 4RKWA 1HZZC 4V38A 3DUFA 3IR7A 2PGLA 1COZA 4PVDA 4ALLA 4DDUA 5PGMA 1WZIA 3WNDA 1SPBS 2OGUA 2Q5QA 2ZDGA 2NZJA 3CUVA 4TV8B 1NSFA 4NYJQ 4L8LA 1WB6A 5GM1A 1USVA 4RVCA 2IYSA 1G2IA 1FFAA 1T5HX 4LSZA 2JGRA 4LTNA 3P19A 3WDSA 5EZYA 4ZYZA 2O5VA 3DZFA 5TMPA 4X60A 5C31A 4OLAA 2PX6A 4K7JA 4EUEA 1W4RA 3X1YA 1C9JA 5CBKA 2OFXA 1YZGA 3F73A 3TM5A 1I3LA 1E7YA 2PO7A 2I6XA 4D3ZA 2NOAA 1QHSA 4AJ2A 3G7UA 2HL6A 3QVXA 4MW5A 3RYTC 3ZQ6A 2FW9A 3JWGA 5FUBA 3VSAA 2PYIA 1NUTA 3I83A 4MYRA 1P9NA 4TSKA 3VSCA 5JDIC 1ECJA 3TXAA 4OSEA 5KOJA 1JJ7A 5JS6A 3EX7C 2H3HA 2OG2A 3FZQA 4F85A 1D2RA 5KNLA 1GQSA 3NT5A 4G5XA 4BMVA 2NTJA 3GDWA 1F9AA 4ZK6A 3IUSA 3IR5A 2O2XA 3H2BA 1R8JA 1LBQA 2W9XA 4RK0A 4EA8A 1SRRA 3B5IA 2JEOA 1RWPA 3D3JA 3ECCA 3H9QA 2P9QA 3I34X 3UPTA 3GEHA 3D4NA 3A4YA 1H22A 4PC6A 1XKLA 5L3ZA 2OAGA 3SQOA 2AOUB 3E4CA 3ID6C 1QIJA 4W7SA 2P5YA 2XYPA 5BY2A 1NXOA 3FM9A 3QVOA 2GM5A 1GN8A 4DANA 2C7BA 1BJTA 5ICMA 4XIJA 4KE6A 3O2SB 4GKJB 4IFEA 4V3CA 1HT0A 1KK0A 1ZD3A 4KZKA 4V2UA 3UFXB 4R1LA 1JBQA 4ZICA 5JFGA 4X7MA 2BFFA 2Y67A 1J2TA 4RADA 4RSMA 4C22A 2JH9A 3NBXX 4F9GA 1V9SA 3HABA 3O6VA 3PQ5A 4MVXA 4C0QC 4DIEA 4EQ6B 4FOSA 4OY3A 4PRYA 3MAJA 4GT1A 2RBEA 4WNAB 4MWOA 1YIOA 3JATB 3PUVA 3VZQA 1D7AA 2AZDA 4FYWA 1F8GA 4HJXA 2K5UA 3COVA 1OBOA 1DRWA 1HF3A 1L1EA 3VNUA 4INAA 4ZEMA 3GVXA 3FB4A 3SEFA 4L15A 1RWOA 3HCWA 3NH6A 2P7HA 4K1XA 3QLEA 5JUWA 2H57A 4TZ0A 2P27A 5I9BA 2ZVJA 5KQGA 1M8KA 1QOPB 3D5TA 2FEKA 3I0MA 2P40A 2IOYA 4D4HA 2P79A 3U4QA 1PWYE 4KQHA 1A72A 1WCYA 2W71A 4JL8A 3FSEA 4R0MA 2QZJA 1JE1A 3BCSA 2OL4A 1WD5A 5KTPA 4F3CA 1I3CA 4OPMA 1S8FA 3QGMA 4WKNA 5TNXA 3H99A 3QYJA 3NXKA 1VLJA 2JFFA 1GXSA 3OFJA 2RJOA 5DGXA 1MEEA 1RSZA 4H59A 4AG5A 4K9OA 5IJ0A 4G5QA 2HFKA 1OTHA 3IUQA 4LS3A 4RA9A 1PR9A 3DO6A 1EXWA 2QNRA 1O5TA 3M81A 3WP1B 4C06A 3FKSD 1SVMA 4DC0A 3MB8A 1FBNA 1I6LA 3IPAA 5JYEA 4RD1A 5JRJA 5EEHA 4J1NA 4XVCA 2ZWAA 1DDGA 2CFRA 1BYIA 1YVEI 4W1SA 2R1UA 2YHUA 3DOUA 3QU9A 5AESA 2FETA 1EUYA 2JLAA 1EFLA 1KYYA 2Z04A 2ZJAA 3H05A 3L4EA 5KSZA 3KJQA 2PJDA 2WIGA 3OQ1A 4NV3A 4XWYA 5B1DA 5K6TA 1DX6A 1FA9A 2Q5CA 3REGA 3JXEA 4JDUA 3TDKA 1ULHA 1UDCA 4W9NA 1Y9JA 3S40A 1R27A 1ISIA 1IUKA 2C4KA 4EGFA 1Y5IA 1NG9A 4S1NA 4R51A 4NU0A 4ARZA 4LJAA 4OQFA 5CH8A 1D03A 2E4ZA 1SVKA 4FBLA 3MPUA 4YCNA 2GF9A 5G02A 4DV5B 1CNFA 4XB1A 1GNPA 1MT0A 3KWLA 3NC4A 5AKZA 4BO4A 2GDJA 3UJPA 3P9ZA 5DTMA 3I5YA 4MI9A 2XRFA 3TEFA 2HSWA 3DOIA 4JCOA 2WJIA 4B79A 2B2CA 2M9MA 1J2UA 2BGLA 1B74A 3FCAA 3Q6MA 3VPAA 1VL6A 4EKDA 2ZWPA 2IKQA 2P62A 3M1AA 5KQRA 5KYXB 1P18A 4OXYA 1UXGA 2ZYSA 4ODIA 4LE0A 1M34A 4I5GA 1VPWA 2VZEA 4GOJA 3T3PB 2E2WA 1W52X 3C5VA 3P0EA 5EWLA 1QHXA 5JNUA 3ODGA 1EKXA 1EG2A 3ZWBA 1WXFA 2PY6A 2RHOA 3HWX1 2CCJA 3O3NB 1NMEA 1X8LA 2VLIA 4UNRA 3T9AA 1VOTA 3INGA 3M4YA 3L40A 1VSTA 4R2MA 3RGGA 2O2CA 2PRKA 2WTMA 1EBBA 1VBFA 2AK2A 3PXAA 3U3ZA 1IAQA 2OPBA 4GD3Q 4MS4B 2CKMA 4EY3A 4FEEA 2OSVA 1P61B 1QPBA 2IA5A 3EE6A 1WUJS 1E7RA 1HKUA 1SG9A 2UYOA 5JMTA 4MXDA 4BATA 2XUIA 5U4QA 3UJDA 5B2FA 4B7UA 3AEUA 4D96A 1DDOA 4M9ZA 1WDMA 5DF1A 1LRKA 2AR9A 2GK7A 2XEDA 3TSYA 3MVEA 4X9XA 3X1ZA 1RWKA 4I4TB 1D1SA 1UF9A 2VT3A 1EB9A 4Q4AA 2DG2A 3CEAA 2CLOB 3PC8C 1H6BA 2WR8A 3MJSA 1E18A 2A0FA 3QYFA 4P54A 3VPBA 3P1JA 2EJCA 2GVNA 1SB8A 3W1VA 2OUKA 1BIFA 1BE1A 4EMTA 3EBLA 4GQIA 1VRCA 2HMUA 1EUZA 3G7SA 2ZZMA 3FNRA 4NJMB 2JIQA 3FWZA 2QKYA 2YYZA 4J3FA 5CBPA 5I3ZA 5CT6A 5HCUA 4DW8A 1HEUA 1U9ZA 4F5DA 4YV0A 4WK6A 1ZGZA 4YT8A 4A2CA 1N5JA 4WK0B 4E5UA 2HRBA 3CF4G 3NANA 1SUIA 2O2ZA 3S5JA 2Z2XA 3BTSA 4HTFB 1CZNA 2WTEA 4N3CA 4XIYA 2AV6A 2OWDA 4H7FA 3W1EA 1JWAB 3F5MA 5EUQB 4QM6A 4H4EA 3R3HA 2JIMA 2AQIA 2LTAA 2N1BA 1A4IA 1XXHA 4QNMA 5IJ9B 1YBHA 1HOTA 1V7QA 5E4JA 1IOVA 3A1NA 3QPWA 2V6JA 4FR5A 2YCBA 3WL6A 4MRNA 1M1YB 1V47A 2C3YA 2IQIA 2R47A 3QX7A 3HTXA 1VM6A 2CFIA 3IDZA 4QSMA 2GN0A 1H1TA 2I66A 3JU3A 2NNWB 3MGKA 3HV0A 3M1IA 4UXIA 5L45A 5F4ZA 5BR8B 1UKZA 1LDGA 2VSFA 3C8HA 4HXGA 2ZCVA 3PDCA 4YRIA 5IXSA 1FLDA 3E9CA 3BREA 3SF0A 5IDQA 2Z6QA 2FFHA 5EFOA 3S70A 1D6NA 2R8BA 2H65A 5KNCA 5L8VA 1VA5A 4D0NA 2GWRA 1IN4A 4AWXA 3VV2A 4QLBA 3S81A 1EZ1A 5KYYB 4C4YA 5FAKA 2H1IA 2XQFA 4ZTZB 2O7NA 3ZDBA 2X2PA 1ORHA 4HYTA 1PG0A 2QRZA 3LH5A 3OEWA 1YL5A 3OZVA 1RXEA 3K9BA 2ORED 3G68A 3Q8LA 4OGLA 1BGVA 2ZYUX 4RD0A 4C4PA 2GPBA 4YCJA 3S2UA 1PV2A 1UXIA 2VK4A 2Y4OA 1XPRA 2WV7A 2D2EA 4W4TA 5H8WA 2PX8A 1Z0KA 4UHEA 1XTKA 4EHHA 1DXQA 3P9NA 1ZW6A 2ZVDA 4RTRA 1UFRA 2A9OA 3P2JA 1WUKS 3ZJVA 2CLHB 3N76A 5LJIA 2F59A 2HA3A 2E7ZA 2QG4A 1YFLA 5HYVA 1EUQA 1ZRSA 1H66A 4IIYA 4IV8A 4AS2A 2B36A 3ITNA 3GMSA 3UKJA 1ZD4A 3ZHYA 5FUXA 3H3JA 5J4HA 4UXHA 4LZPA 4X94A 1NKVA 4R2LA 1AM4D 1KRHA 2BGUA 1V6SA 1ID1A 5FUVA 4I3GA 4A26A 4BNIA 4QEZA 2HM7A 3BXFA 4BNKA 3D31A 3K6SB 4KW7A 3SEZA 4J8PA 5H9WA 1JQLB 4I4NA 4LY3A 3U17A 2GYUA 2OAEA 2PHZA 2WYOA 1OYVA 1CRWG 3AV0B 3RU9A 1LDEA 4IY1A 4JEMA 3BEDA 4LGVA 2Y6VA 3CLTD 1DINA 2FMKA 3DHEA 3FNQA 2UYHA 1F2UA 4WESA 4RQUA 821PA 1QZ3A 3HCCA 4HDSB 2EJUA 3D4OA 3K0EA 1YC5A 2EL9A 4GMGA 2Y0BA 2WLSA 2CNOA 2GN8A 2PZFA 1E66A 3LTNC 3O92A 3EXG1 3HUDA 4KLNA 3PV0A 1TGYA 2W90A 2CB0A 4X5OA 4ZYXA 5T64A 2FPIA 2J9YB 1FIUA 1P19A 3STUA 1I5OA 2YJTD 1Y7HA 2RFLA 5A4IS 4KBGA 3DE7X 2IGBA 2WRZA 1P45A 3R23A 1H8EA 3ONWA 3PT9A 4BMPB 1LRLA 5ARDA 4RD6A 4CL3A 2OV4A 2BM1A 3NNDA 1VI6A 3WK4A 4CIAA 1GTL1 2RHGB 5D3MA 3IP6A 4MX8A 2GJ4A 3AP2A 2HU2A 3ZLUA 1Q0TA 2CXQA 4HLUA 2C8JA 2O50A 3HNOA 3QFTA 1XMVA 1CUGA 3G8YA 4ZODA 2ADMA 3N28A 5CB6A 4EX6A 4TOIA 3SXJA 2GERA 3JAMA 4RE5A 1KRWA 2D7JA 2H2WA 4FPXA 4BXOB 5JATA 5KSYA 1VIAA 2R6CA 1ACJA 1LQ2A 1IY8A 5EY5B 2WIFA 1WP9A 4IXMA 4YUZA 4O2BF 4QOFA 1HGXA 3WX0A 4EG5A 4P4GA 1E60A 2HJ9A 4MROA 4N9WA 3UMSA 1ZJYA 1KBQA 5EUMA 1RVDA 1KI4A 1GEEA 3I2FA 1ZD5A 3OETA 1G1MA 2X4IA 3AF2A 3L18A 4HX5A 4COOA 5CB4A 2MINB 1SUAA 3C41J 1N1GA 2ZSBA 3QF4A 3A37A 1AKMA 1LH0A 1AHPA 3B7PA 3Q7RA 1W581 1D09A 4PQEA 3HO8A 1UBUS 2BFDA 2DWPA 1X86B 4HYYA 4X1IB 4MR8B 3WGIA 1HH4A 4AI6A 1YRWA 1PYOA 3H9GA 2JBHA 5BVGA 1T34A 2A1UB 4BLOA 1DAHA 1JR3A 3GJ4A 3E82A 3DGFC 5BMVF 4RK4A 4EWLA 1OC4A 1JLRA 5G40A 3PD1A 4RC9A 1CFZA 4GI2A 3NJ4A 1OSNA 3A3YA 1PUJA 1Z68A 1BEEA 4UUMA 2EIHA 5JH7F 5MHTA 1I3MA 1M2HA 4K9MA 1NT2A 3M3PA 4GAEA 5JWHA 3TM4A 5K8LA 1FTSA 1T4BA 5G0WA 3PWTA 4Q18A 4DGQA 4GVXA 1IOZA 3E9QA 2NSLA 5IX8A 1MUUA 3OCYA 5EPEA 5LD2B 3EDQA 4Y2HA 2J48A 3WGLA 3ROKA 1MGPA 4O4JB 1ENZA 1W1IA 3S68A 3U4DA 1JFFB 1F2TB 1G7SA 4GG1A 2C9OA 4R16A 1WTAA 4OQDA 1F8XA 1WVMA 4YROA 5HE8A 3VHRA 4JXKA 3C6XA 1Z6AA 5DYNA 1V8DA 3O2NA 2FWMX 4WD3A 4DG9A 5A4KA 1ZR2A 2CSXA 5KNCH 2D62A 2QK4A 3UC5A 3IDQA 4ZI2A 2V7WA 1POXA 4OFXA 1DQRA 1JEEA 1OWOA 5SICE 1YQGA 4Q4DA 4G37A 3SICE 2FW1A 5DKFA 4QXMA 3BGVA 3UOWA 3DCIA 3NDBB 1Y81A 2G88A 4NYIR 4MLDA 3R8CA 5HJEA 4PS1A 3ZWOA 1G2QA 3K30A 2H5LA 3DBLB 2P69A 4KDFA 3BSWA 4WCDA 4KYTA 3IP1A 1DU4A 1WZ2A 4DR6B 3BUSA 1Y1LA 3AM5A 4C08A 5JADA 2C9ZA 2GI4A 1E9EA 3A6LA 4JBIA 4RY0A 1MD9A 3ZXUB 5ADVA 2G1PA 2PFGA 1UMCA 1YCFA 2HF9A 3L1JA 1CUEA 3EWNA 1QHYA 5DU2A 3ZUGA 1BJRE 1TTHA 4ITUA 4AO6A 1DEOA 3UVEA 2OFWA 3MTEA 5IPFA 2X0RA 1TC2A 1KEWA 2RDMA 3CPSA 3A1CA 1XN4A 3HG7A 4XB6B 4D82A 1QDUA 5GZ1A 1BDHA 1F14A 2AVNA 4Y9UA 3S99A 2BFEB 5IS2A 4R83A 4A8HA 2V1XA 4RSGA 3I8SA 3E1GA 3EAFA 3D7LA 3L6BA 2ZBEA 1Z8NA 3GLUA 1GNQA 3LAWA 5AOVA 3WLPA 4X20B 5C81A 1J8MF 1OA1A 3AIMA 3MWYW 5D87A 3ORHA 2H4HA 4L1KA 4BVHA 4CM8B 3IEMA 3RTGA 3SC2B 4UTNA 2NU7A 3E1SA 1A96A 3AESB 1DELA 2FSIA 2YZNA 4AZ0A 5K0ZA 1WW2A 2I91A 3GLKA 4LIPD 3ZCSA 1OY1A 3KG2A 4JJGA 2GDZA 4DR2B 5KTTA 4FFVA 4ZZ3A 4NMLA 5KPJA 1GKKA 4WNYA 4EY5A 4P84A 2I4NA 2A9JA 2SNIE 3RKRA 5DHQA 1QRDA 3WNZA 4JOBA 3JVVA 1U6JA 4OKIA 5C8YF 3PI7A 5GV7A 4HQRA 3NWPA 4KSYA 4FOLA 1CG6A 2ZDHA 2PH1A 3PKJA 1QTNA 3B9PA 4HP8A 3IRUA 1OLXA 1SIOA 2BFMA 3CBQA 4TWZA 4PIPA 2AFIA 4M6WA 1CIPA 4DCJA 2AUNA 1C9EA 4F2GA 2VHEA 1AOXA 1IZ8A 1QPGA 3C4VA 4C89A 3RJ9A 5D84A 3WRXC 3W3AD 2AQ8A 2V4ZA 4B76A 1N3YA 2ZI5A 2A14A 3F4KA 1RXUA 3K1AA 4QTUB 4BQOA 1F17A 1SUDA 2PZJA 2D2XA 1PL0A 2HNBA 3RS9A 2NZUG 3VNVA 1FDIA 2CVPA 4TYMA 1RHQA 2VPZA 2I3GA 2Z2IA 3KAKA 4MARA 4X1KA 5FBHA 3VR3A 1O3YA 1P0CA 2J08A 4NYIQ 3OTWA 5FTNA 3UB2A 4UEJA 4GBMA 1U7HA 2EKBA 1QG2A 4O2AB 2HIHA 5THKA 1L6IA 1T1RA 4XFJA 3X1XA 1M76A 2XUJA 2ECQA 1LQUA 2WSMA 4GX5A 4YGXB 2BEWB 1LDMA 1T36A 3KAPA 1QM5A 3PDWA 3JZAA 2QG9A 4G8CA 4MA0A 3THXB 1NMQA 1BE6A 2O7VA 2WA1A 3UICA 1VCOA 1F12A 3WYAA 1LPNA 3IBCA 1JLLA 3NJ8A 4N0MA 4AJEA 1UMDB 1G4UR 5TMEA 2EFCB 1W4LA 3FNHA 4G24A 4MGZR 4TM8A 4MQEB 4CM6A 1T15A 1JQEA 1L4KA 2G7MC 3R3UA 3TTYA 3VH3A 3ZCRA 2PEYA 2P2DA 1M7GA 2Y93A 3GRUA 3NB0A 3FOAA 4MWBA 3RSHA 1C9NA 5AVQA 1TNDA 3TLEA 1NATA 1EVJA 1I1HA 2CDRA 1L8QA 1K06A 2AVDA 2AOTA 3FIJA 3IGFA 2H1WA 3KZKA 1NIPA 2RGUA 3DKVA 3IAUA 2ZIAA 5H82A 1AKEA 2AQHA 3L7BA 4UOZA 1M2JA 1UWLA 1A5SB 3IHLA 5HGJA 2QS9A 2ZXFA 2HQBA 2JFPA 2XUAA 4QWWA 3AFNA 3BJIC 3DZJA 3VJMA 1D04A 3WVNA 4L51A 2I29A 2OK7A 4MCIA 2JW5A 1X1SA 4JI5B 4AY5A 5FD8A 1U98A 2PCJA 1OA0A 2NTEA 3GAAA 4NOJA 3W5AA 4H3KB 2GO1A 2XJ4A 3M33A 3U9SA 1T2NA 3WWCA 4DZRA 3ZNOA 4JSRA 1R88A 4RY8A 4B34A 1N78A 3CPHA 1W87A 2YYAA 1N2ZA 2DFKB 4F04A 5FV7A 2I2XB 2QZSA 3D8HA 4R9RA 1M1NA 4NESA 4RMJA 4LDRA 4X63A 3CJRA 1JAYA 1TO1E 2JGFA 4B3JA 3HJUA 1YK0A 1A0OA 4B4OA 1NTRA 2HCJB 3A1FA 4ZRMA 5HKKD 3O9MA 1I1NA 4GGPA 3A1SA 3RVMA 4MRAA 3R8XA 3ZI0A 1QZUA 4YMSA 4YO8A 1FFSA 2EU8A 1OI7A 1W0KA 1WCIB 2BCEA 3QFCA 4HD8A 2FMXA 3LE8A 3T9DA 3CF6R 1SM4A 4OB8A 4G97A 5C3MA 4HS4A 3D9QX 1V6AA 1KO1A 3UKOA 3V8RA 4CTNA 2AEJA 3QSGA 5C4MA 4ARCA 4JP2A 1XU9A 4HYEA 1GAWA 2QJWA 1RWQA 4DV7B 3EBOA 1JDSA 1TKAA 2E1PA 3G8AA 2VBCA 3WWOA 1V1MB 1YZTA 2GYYA 2PGIA 3S27A 3WK6A 4B2PA 2WSSD 2PQ0A 3O93A 1T2UA 1JKMA 2WKWA 2D2IA 3EJ6A 1AZWA 2FPPB 3DPUA 3MRXA 3NONA 4FQ7A 4FT4A 4GM4A 4K86A 4Q7KA 3ZDDA 4XX1A 3ANXA 4CV0A 3FGPA 1G1AA 1W19A 4RLQA 1BXGB 1O9BA 4I99A 4L3OA 3U7FB 5ENDA 1VG1A 1YA6A 1DTEA 3RNOA 3E53A 1CXZA 1MX9A 5LQKA 3G0CA 3ESCA 1HFKA 5DLQC 4C0HA 4ZYVA 4OHKA 2W2PA 5B58C 1JIIA 2BVNA 3FFBA 3IAFA 4HBGA 4QD3A 5IK2A 3RC3A 2YHAA 3IRVA 3TIXB 3WKBA 2F8SA 1IBRA 2I87A 3ZG6A 3B13B 3TINA 1CY0A 3EOZA 2OO7A 3HE3A 3T3HA 4N54A 1L5WA 1T8TA 1DGQA 3C3XA 4LY9A 3PQ7A 5F52A 2A58A 1U7ZA 3KYBA 1TJPB 4PBRA 5A0FA 5LB2A 3ZZTA 4NDNE 5IEJA 1UMKA 2JGKA 4OJQA 1KP9A 3DP9A 3GI1A 4R1OA 5H02A 3D64A 1XTQA 2VG8A 4WLNA 2XQIA 1PG5A 2LCFA 3HSSA 2VHWA 4RH1A 4X8LA 4IFBA 4CGZA 4UATA 4FSDA 4P7KA 1OREA 2EW2A 3MCAA 3NHKA 4YRQA 5BRAA 2GN9A 2QPTA 3SQXA 1LK7A 3E61A 2IDZA 1CUAA 1UPUA 2W2XA 3C7TA 5CLGA 3PQDA 1JKJB 1SK9A 2QOEA 4RY2A 3KZ1E 2CNDA 2E21A 3LKDA 3OPYA 3H4MA 4FQ5A 4AZWA 4Q7LA 2WMDA 4Q03A 2IPMA 4WPGA 4CM9D 1XV5A 4DA9A 4MRPA 3CM0A 3RRJA 5EESA 3FNFA 3GUVA 4P93A 4D9GA 4DR4B 1WE2A 1W75A 5FA6A 1E3MA 3CY6A 3KJFA 4NOKA 2LKCA 3WLTA 3IOMA 2PIAA 3QOXA 4JLVA 3ZJTA 2NUAB 4DR1B 5FTKA 4YC7A 1CF2O 1SBQA 1U2DC 4WERA 1C8BA 3CLRD 1A9SA 4EKGA 2W0MA 4NMWA 5IANA 5JY6A 4Z4QA 1ZJWA 3TGPA 3LWDA 2D1FA 1NQXA 3ZWKA 1UBCA 1MFPA 3GLFA 5BO5A 1KY5A 3GLVA 4CFSA 4PZCA 1OXVA 2AKEA 1FUKA 2Y9MB 4S1VA 1NUHA 1W34A 3KXLA 2ZUFA 1TJ3A 2QX8A 2IWHA 1M75A 1LI4A 1UJ4A 4BQQA 1PWHA 3FRIA 1WMDA 2H4WA 2H51A 2WF9A 4QZVA 4PTZA 4JQYA 4R6XA 1EBFA 1EUDA 2C1ZA 3IJEB 3O8NA 5IW8A 4DV6B 4ABTA 2V58A 5C8ZA 3I04A 3VNAA 4GRIA 5LP6A 1IMOA 2X5JO 3E5MA 2ECKA 1JEJA 1TIPA 3BCUA 5E9QA 2HF2A 4MLCA 3BILA 2P11A 1O0BA 3H4IA 3NALA 1MT3A 3OZCA 4QJBA 4EFMA 3Q8KA 1F51E 3ZGZA 2XDQB 1C1HA 3DE0X 4RHTA 4PYJA 5BV0A 1SU6A 2A88A 4TV8A 3LPNA 4GMXA 4OP2A 3T5MA 3GF4A 3OZTA 1BS2A 1PP4A 4ND3A 2HXSA 5ALGA 1XTSA 2QRJA 2I1WA 3PQ2A 3QKSB 4EGCB 2FU5C 3FX2A 1QU3A 1GCAA 1B3RA 3I30X 5LYJA 4BTLA 1NVWQ 3SKXA 1J7KA 4EBBA 2XUKA 3FPLA 5KWSA 4UC0A 3U4HA 3BPSA 4AC9A 3H87A 4TWAA 4FKMA 4LHXA 4X44A 4BC0A 4CRWB 5BNTA 2HGSA 1W8IA 2FSGA 1E1DA 1GAJA 4G8BA 1BCSA 4BCCA 3NG1A 3V4VB 3K2EA 3NBKA 3V7FA 4YRLA 1QX3A 2RGEA 3COYA 1MZVA 4HYQA 1AGRA 4J07A 5FEMA 1A8PA 1NN1A 2Z2KA 4CM7A 1D0SA 3PDHA 5FOXA 4DLVA 3DDSA 4HPWA 2P78A 2EERA 2XF8A 4RGQA 1ST2A 3ASZA 4PTLA 4KXYA 3QW2A 5JOQA 3H9UA 2P9HA 4RXUA 4KQIA 5CT4A 5K05A 3R09A 3UV6A 3NI2A 5LU8A 1M6VA 3M0EA 1NRJB 1L4UA 3QKWA 1W25A 4IRMA 3LP6A 2WF5A 1Y63A 3MT0A 1KH2A 3H1AA 4IIBA 2J9FB 3U7GA 1RYBA 4A91A 1PFKA 2AOUA 1O6GA 1PEYA 1U1CA 3OD5A 2LCQA 4XI9A 1XD9A 2I5PO 1H65A 4HI0E 2RGCA 3AKDA 1WDWB 3UFXA 5B7PA 2VRCD 2PS1A 4IIGA 4M9RA 4TV9B 3LNCA 4WADA 3OO0A 1QO7A 2OCKA 4MVWA 1JXAA 2GBLC 2Q3JA 3U80A 5JXHA 5TE9A 1KSFX 4ER5A 1JMKC 4EQ6A 4OYRA 2O4UX 1NR7A 2BFBA 3QXHA 4WNAA 3NCHA 1AURA 3JATA 2RH5A 3JQ8B 1BC5A 3F46A 1MF7A 4IIJB 4X91A 1YB4A 2ARKA 1M6WA 2X4LA 4X7PA 8ABPA 3EXHC 4Y1RB 1O94C 1HZZA 4V24A 4OJYA 2OOKA 2NIPA 2PL3A 3KWFA 4MB0A 2PFSA 4PNPA 4UDYX 3ZGVA 2H54A 4XVUA 5JD5A 1DIGA 3BJZA 4BASA 5AJYA 4NFSA 2IP4A 4UZSA 2P7IA 2Z2ZA 4PBSA 3BDAA 4AMZA 1DRVA 2Q62A 3GZJA 1M72A 4GLLA 3HA7A 3PF8A 4AF7A 1G19A 4DLXA 4XLTA 5JG7A 2MSCB 2P9TA 3FPJA 3P96A 4OI4A 1I6WA 4UAUA 3X1JA 4EDHA 2BFNA 3EEOA 4JMLA 1O58A 2JIPA 4TTAA 5DNCA 5F23A 5ALEA 1T0HB 2H63A 2L19A 3O9ZA 4RK1A 3O1LA 4US0R 4FMBB 2K7FA 1JNXX 3N58A 2LV8A 5IDYA 3ETDA 1SVOA 3GFRA 2SKCA 3BHJA 4ZQBA 3UK2A 5K0JA 1OH5A 4M8LA 1HG1A 1Q0HA 2GBIA 5JDIA 3NH9A 2HDWA 2WUEA 2J3QA 1B1AA 3SBDA 4EMSA 3KV1A 1XNRB 1IG0A 2ZIZA 3FPAA 3I37X 3IUBA 5HWSA 4UU0A 1YB1A 3HZHA 4DUZB 3ZC3A 2VP5A 4XVQA 3CT6A 3GFGA 5J2UB 2QN7A 3EUAA 3ZCXA 5DNDA 3DEAA 3JV7A 2AOWA 3HVHA 1AGPA 2ANBA 4EW6A 3LHIA 3VJKA 3M9LA 3FA2A 1K8QA 1TW2A 3AB7A 3W5SA 3OLXA 3OP4A 4YAEA 3ZHQA 4UUPA 1PS8A 1CVIA 2NGRA 4EATA 2VHCA 3H5IA 5D1NA 1MDFA 4B6PA 2AJBA 4KU4A 1NFQA 1M54A 5GPBA 3NUGA 2NZ2A 1UQRA 1YGYA 1POWA 5TDHA 3TF5A 4GSKA 3QH4A 4EHJA 1Q3HA 4CMJA 4HADA 4OU4A 4L2IA 3ZCQA 3P9YA 4IVRA 3VC1A 3QXSA 5KYXA 1Y6FA 1E6CA 3ITKA 3BKXA 3S2SA 2Q4DA 2R11A 1D4FA 3DONA 3V7UA 1JHAA 3UENA 4HUTA 2OBMA 1VZ2A 2FSUA 4DVJA 1DQZA 5HM6A 5C7YA 2WYHA 3AM3A 5CCEA 1AUOA 2WQ7A 3VPFA 1NP3A 1YZKA 2VP3A 3ZHXA 3BMCB 3EXHB 4NZZA 3PQ3A 3BK2A 3DWGA 3L8DA 4K88A 5A5VA 1O0CA 2P9GA 2HCRA 2WU8A 1KPHA 1ODSA 1TCCA 1U1GA 1X7WB 3DTVD 3ESXA 3FFAA 4H0CA 1VB5A 3MJCA 3T0GA 1TVMA 2ZR8A 3ZQKA 4EW3A 4G0UA 1BVHA 1Z0DA 4Y6PA 4MS4A 3SPXA 4U5XA 1Z74A 2V6MA 4WAUA 9LDBA 4ZQCB 2HA5A 3WIEA 3EPRA 2ACKA 4KACA 4I55B 2JDIA 4TTJA 1PZMA 5JDCC 3AERA 3QHQA 3LXUX 4BO0A 2X7HA 1SQFA 4NK4A 4KBFA 3V97A 2CJYA 1GT91 1PZGA 4JQSA 2PRIA 5EI5A 1UKYA 2YVQA 3G1TA 3PVZA 4RPIA 4EF5A 2C4UA 3E2MA 4I4TA 4N41A 3DE5X 4Q3DA 4MVJG 1KO5A 2C7PA 3LF1A 2CNBA 4FHEA 4G4SP 2Q9UA 2QGZA 4GM0A 3HFJA 3V1LA 4CG1A 4DSUA 3PJGA 4L5YA 5FWDA 3OZXA 3K0CC 1SOWA 2NV0A 3H2KA 4ZAVA 3IOBA 3MHPA 4PFJA 4HRYA 4NJMA 3OEED 2Q1WA 3RSSA 2BFOA 2PR7A 8ATCA 1E2QA 1UBFA 2BGIA 2Q1SA 5EIEA 4REQA 1FP4B 2ZJOA 4DLAA 3AJAA 2XWQA 4G8DA 4WV3A 3ZD7A 2Z1DA 1PLKA 1MJGM 3CS3A 4HTFA 2O3RA 1V48A 3H7AA 5AJTA 2XXJA 2XVZA 1GPDG 2BUBA 3BSSA 3V8MA 1PSWA 1WHTB 2JNWA 4US1R 2IHUA 4YJGB 4D97A 5IJ9A 3LL4A 1QH1B 1ZZGA 2D2VA 3OFNA 1W6RA 3ZW9A 3JYLA 1Q0ZA 2ZWVA 2FJPA 2VYQA 4AP5A 3FCCA 3KWMA 5EAIA 3HV2A 4CKWB 4K9PA 1OBVA 1DPGA 2O1EA 1M1YA 1G8PA 5I4IA 4C6RA 4MS3B 5IM5A 1DARA 3KELA 5EMNA 1TT5B 3I09A 4H35A 5LMCA 5KNBA 3IQHX 1JLMA 2HMWA 2FCRA 2QM8A 4RKFA 5J5CA 1KSGA 5BV8A 3NWEA 1L7NA 1QF9A 4GE0A 4MB2A 4RVHA 2H8KA 4DQVA 1O95D 4UTZA 4H18A 4GF5A 5BQ5A 3IBFA 4ZV7A 5JYBA 5HIAA 3AEKB 1PNOA 3KALA 2PSDA 4KDCA 3ROZA 1B8OA 3FRHA 2JJ2D 1E69A 1TVKA 2VDWA 7ADHA 1LD3A 1BRMA 2CJFA 4KR2A 1WNFA 3AKYA 3G2JA 1J2RA 2OY0A 3ANYB 3AUFA 1NJSA 2C5EA 2RI6A 4X6LA 3IDOA 4Q02A 4DQKA 2B0CA 2PXHA 5LM3A 1ISMA 3FFXA 4ENPA 3RYIB 3PTAA 4G5YA 2EGGA 2OQRA 2ZRLA 4L6IA 1V71A 4PXYA 2G9VA 1T4GA 5B64A 1LGYA 4AT1A 2OXEA 1AMNA 4UM9D 3WZ2A 1KI9A 1N3LA 3BXHA 2A7XA 1ILWA 4GLFA 1FUEA 5F5LA 3UWMA 2FMIA 3H0KA 1GM5A 1F0PA 4RJ2A 2HC9A 2WTBA 3U3DA 2ZUVA 2PV0A 4YTEA 2AJ8A 5A7FA 5FWNA 1KVUA 3D0QA 1JSZA 3P4UA 3V8EA 5DW3A 5JAOA 2ZZNA 3OQPA 1Y4UA 2E5LB 1L4FA 1ZU4A 3EQ6A 3FDIA 4NU5A 3M83A 3K6SA 4UDXX 3I8OA 4MINA 2PPVA 2YX1A 2ASVA 2W2NA 3RASA 2YHIA 2C7RA 4U7PB 2RHBA 3L79A 4G63A 4F84A 1ZN8A 3ROGA 3AOEC 5JSQA 3GJ8A 4KHZA 1EJBA 4QXQA 1USWA 3QX3A 4HDSA 4P5PA 1EP2B 2VZ9A 4S1OA 1QFJA 3HFGA 2Z98A 3JCZA 3K1JA 4GYKA 4UVDA 1OFGA 3T1QA 3CW9A 2PZAA 3QTTA 1OLUB 1QRTA