4J4TA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j4tA00
4TVBA 3BHMA 4GI2A 2O7SA 1KEPA 3RASA 2UYYA 3IP3A 1M67A 3FF4A 2Y0DA 3C85A 4DPMA 4JCOA 2A92A 2O3QA 2Y0EA 5L53A 1D4FA 2C2XA 1Z7EA 3ZCXA 5BQFA 3SXPA 1GCUA 1EVZA 2NM0A 4RZHA 2C7VA 4Y8VA 4YCAA 1WWKA 2QIOA 3NTOA 1C0PA 4Z9YA 3TPCA 1TXGA 5TJHA 3ZZNA 5DOVA 4BMVA 4E5PA 3F3SA 1B3RA 1KVQA 3E9NA 3NGLA 4ND1A 4FS3A 2NADA 4HNGA 5DP2A 5KKAA 4YRBA 4CM8B 1SEVA 3ETEA 3Q9UA 2GUGA 2VQ3A 1E3LA 2O3JA 2D0IA 4TKMA 3SJUA 1KETA 3OBBA 3GGPA 3O8QB 2X6TA 4BB6A 4CMIA 1LRLA 3F5QA 3OIFA 2ZIZA 1IUKA 3JQGB 4YBZA 1ENYA 2DQ4A 4HXYA 1P0CA 1ZKMA 3GGOA 1ZK4A 4QSMA 5CFZA 5HRUA 1HT0A 4FFLA 4IDBA 4B79A 2O4CA 5CDTA 3AUUA 3H5RA 3WGHA 4HFNA 1SC6A 1SEPA 3I9KA 5IZ4A 3F1KA 1JA9A 3JQFC 3KRTA 3UXYA 4O0LA 4JN6B 1J5PA 2IYPA 1AGNA 4RPJA 3SX2A 8ADHA 4YQYA 1U2GA 1VJ1A 3WYBA 4OXYA 2BGLA 4WLFA 4EZBA 4RQTA 4BKUA 1SZJG 1S7CA 5F21A 2WYVA 1KOLA 3K8ZA 4B7CA 4BNTA 1UXGA 4NHEA 3RUFA 1SMKA 3WFIA 4B8WA 1ONNA 4IDGA 1G0NA 4ZQGA 4UAGA 3SVTA 4IJUA 4W7HA 1UP4A 1Y8RB 5GMOA 4P8RA 4DWVA 2GZ1A 3HUDA 1HWYA 4W9NA 3OJLA 4BMSA 5K9ZA 4BNWA 2XXJA 2J5RA 1H6BA 2AA3A 4R51A 2GYYA 2Q1UA 2DKNA 3Q6IA 5FFFA 4BNUA 1NR7A 4YAJA 2ZJ1A 4CUKA 1M76A 4E12A 4P4LA 3C1OA 3L6DA 1Q0HA 2GD1O 1E77A 4YXFA 4EGFA 1DRVA 3HHPA 2B35A 5JLAA 5IFLA 3CE6A 2LDXA 5K6AA 3IKTA 5TNXA 4CM9A 4JJIA 1P3DA 3ZNQA 1OOEA 1PJBA 4XDZA 4UUOA 3JD0A 2YY7A 4L4XA 3EDMA 4FFNA 4WNIA 3ZI0A 5DNAA 5DCWA 4RV9A 4RF4A 4B4OA 1RKXA 4BGIA 4XCVA 1YXMA 4CLOA 3GDFA 3PWZA 3CMMA 1N2SA 2Q4BA 3JQBA 1PZHA 1PS9A 1VKOA 1X14A 1NBOA 2FOIA 3GDGA 4IINA 4U0KA 3D3WA 1LSUA 3FNFA 4IDEA 4B3HA 3RVDA 1N1GA 1P74A 1D1TA 2RIRA 4BO9A 4BOYA 4CM6A 5A4DA 3Q2KA 2AE2A 2D59A 4CMJA 1Y9AA 9LDBA 3L77A 3M2TA 3I52A 4MPDA 5KJFA 2VNSA 4PLWA 2HK8A 4I9HA 4E2XA 5I9LA 2YV2A 2DM6A 2NACA 2I66A 2I65A 3DAFA 2PH5A 4DIFA 3R6DA 3D7LA 1LDMA 4I5DA 4PLVA 5IAAA 2J3HA 1QXSA 4MVJG 2X8LA 4BNZA 3NT4A 3ZW9A 4DXHA 3D5TA 1EVJA 1S6YA 3B6ZA 3WDSA 2CVZA 3GOHA 3NTQA 4OIMA 3PQFA 3I3OA 1I32A 4R1TA 3JQ9A 5BSFA 4URFA 2IODA 1B7GO 1UJMA 2OOSA 2ZYDA 2DPGA 3GFGA 4I08A 2A4KA 3E9QA 1FMCA 4DQUA 4UVHA 1T2CA 3GK3A 2BKAA 1NAIA 2HRBA 4IDCA 4E33A 1R0KA 2AHRA 4FSHA 4BNFA 3VH2A 2Y05A 1ONPA 1BSVA 3L6EA 4IGFA 5CG2A 3L4BA 1PQWA 3PHJA 4PG5A 4BGVA 3KYCB 4XR4A 4XYLA 3TZKA 4J43A 1DC5A 2YFHA 5C37A 1E1NA 1UAGA 2PH3A 3DXFA 4E30A 4XRGA 3TWOA 3F4LA 1NHGA 4JK3A 5F3RA 2JJYA 3PTZA 5FWNA 1BTOA 1V35A 1ENOA 4MVJD 1B14A 3H5AA 3BXXA 4RLHA 5I7EA 3DZJA 3GN2A 4EJMA 4BNGA 4HY3A 3TZCA 2VHZA 3CZMA 3BZUA 1RM4A 4BHTA 1E7SA 3EGOA 4N5MA 5TGDA 5DBFA 5ER6A 2EKLA 5A9SA 2WE7A 2R00A 1HL3A 1SOVA 1R0LA 3QY9A 4OQZA 4GX0A 2Z95A 4K26A 2D3TA 5JCJD 1YGYA 2BFMA 2V6MA 2ZQYA 4NI5A 3RD5A 3ZDFA 4W82A 3OP4A 1EE2A 1GQQA 3GH3A 4I9UA 4PVDA 3C7AA 3ANNA 4UVGA 3KB6A 3BYZA 2EJVA 2C5EA 4UEKA 1NPDA 3QRWA 3TJRA 1P77A 1XLTA 3FWNA 1QG6A 1AUPA 3PIIA 3WQSB 4RVDA 1NWHA 1F8FA 4IPTA 4U6SA 4M49A 4F6LA 5CDSA 3MTJA 1YL6A 4L74A 3TF5A 4OXKA 4HBGA 1EQ2A 3H9JA 5ES3A 4PG6A 4IQGA 4ZD6A 1PJ4A 4TQGA 4XQGA 3ZWXA 4CLEA 3G79A 4O59O 2AEJA 3W8FA 2JD2A 1A71A 5L7YA 2Q99A 1NX6A 3DEYX 4TWRA 1KY5A 2P9EA 4LN1A 3C24A 3PDJA 2R6JA 4DGSA 5EQDA 4J7XA 2JD1A 3QVXA 3FSRA 5GZ3A 4N5NA 4NBTA 4RJTA 4BKQA 3BHIA 2B5WA 2HK7A 1DFIA 1C1DA 2NTVA 2TMGA 2BELA 4R69A 4CLRB 4ZRNA 1HSZA 2PD4A 3Q2IA 4WJZA 2BFAA 3BAZA 3K73O 5KOIA 2VUUA 5IXSA 4AJKA 2D5AA 1UH5A 2YDXA 2Z5LA 3O9ZA 2WD7B 3AI3A 1UAYA 3RUDA 2I5PO 1SPXA 2AEFA 1GFSA 3JQFA 1QYXA 3WR5A 5TRTA 4D41A 2VYND 3PIDA 4ID9A 4DMLA 2B83A 1LEHA 3WGTA 1RM3A 3RJ5A 4CQMA 1PGOA 4KQXA 3JTMA 1CYDA 1LSOA 4JXKA 1ZFNA 3OH8A 4ALMA 4PG7A 4ONEA 4RPGA 4MIYA 4IM7A 5F1OA 2CUKA 1ZVMA 5U9CA 2P5YA 1E3EA 2RAFA 4UVEA 3MCVA 4XYBA 1BXGB 3S55A 4BO0A 3RFTA 2GF2A 3CIFA 5COBA 4R01A 1N9GB 5HA5A 5CEJA 1U1IA 1YRLA 4WEQA 4CMBA 3KSUA 1Z73A 3VVCA 1UDAA 1RM5A 2GR9A 1PZEA 4U8GA 1MFPA 4WLVA 5BT9A 4XGIA 3GN1A 5T64A 3KV3O 1ZMTA 1GV1A 2F1KA 2BGMA 3BTSA 3U4CA 4D79A 3LT2A 1GPDG 3PPIA 3VDRA 1MG0A 4MKZA 3H7AA 2XF8A 3ZNPA 1V6AA 2HMWA 4C4OA 1OBFO 4DLBA 5JY6A 3S2GA 1G1AA 3V1YA 4ZVVA 1V0JA 3BMNB 4S3MA 3ZV5A 3ZWNA 3IIEA 4N54A 2D1YA 1FF9A 3O8QA 4J4BA 4WCFA 1IPEA 4MVJE 1KEWA 2G76A 4XWYA 4Y6SA 5H81A 3JQGA 4AJOA 3GT0A 1E6UA 3W6UA 1Z75A 1GZ6A 1PR3A 4J0FA 3UFXA 4PLTA 4YACA 1X7HA 2NLOA 3ZWWA 1JVSA 1NFFA 2BI8A 4YT5A 2W2LA 1R4MB 2DVMA 1LNQA 5AOVA 3DZKA 2JAPA 1E6WA 2F00A 4NU5A 4B4UA 1U7TA 3ONDA 4RGBA 3GVPA 3OA0A 5A04A 4J9VA 1DJQA 4LISA 1PZFA 4FJ0A 5L9AA 4XB1A 5T8KC 3TOZA 3W6ZA 1HKUA 1Y8RA 3GAZA 2V7PA 3VOSA 5KVCA 1PL8A 3W8EA 2UDPA 3VKUA 2D5CA 1E5QA 5AXBA 2DC1A 4CODB 4LVCA 4Q3BA 1DLIA 4L4SA 1H93A 1MXFA 4QEDA 2VWHA 3A4VA 3IC5A 1I24A 3NTRA 4ALKA 3ZNNA 4OH1A 5KCZA 4JBGA 3DDNA 4EUHA 4U5QA 3GNQA 3S2EA 4JLWA 3LC1O 4CLDA 2QZ9A 5T6BA 3WWZA 4L75A 3H65A 4U0JA 5JAIA 3OIGA 4QXMA 4ZA2A 3ROQA 1U5CA 5IDXA 2ZCVA 1Y81A 3ZV6A 1HZZA 1QYCA 3BMQB 3PVZA 4XQEA 4LK3A 3ZWYA 1LLUA 3MJEA 2CVOA 3LLSA 4XJSA 1R4NB 2DLDA 1DDOA 3GGGA 6LDHA 3AFMA 3DBLB 4EEZA 1TLTA 4FFOA 2DBVO 5J23A 2EEZA 2Q49A 4FDAA 4LSWA 4KUEA 2GO1A 4NPCA 3ZWCA 1GCOA 1ISMA 1CDOA 3C1TA 4RQUA 4ILKA 4L4RA 4PRKA 1K5HA 4QFCA 4PLYA 4IGEA 5ER9A 1T2FA 1V9LA 3GDOA 4XIYA 2Q46A 3FNHA 1SB8A 4JIGA 2VZ9A 3OETA 3UH1A 2VN8A 1L7EA 5DCUA 2C0CA 1CF2O 2WSBA 1KC1A 3OJ0A 4F45A 4RVHA 3OQBA 4YJGB 4GKVA 1WMBA 4D44A 2RH4A 2Y1EA 4YT8A 5LDGA 1E6EA 4BKRA 1PZGA 4ZQBA 1H9AA 4KQWA 2P4QA 2OMEA 3CEAA 1IZ9A 1XGKA 2BHLA 4JBIA 4LSMA 5KNLA 3IUSA 3QHAA 1LDEA 2YQ5A 1HYEA 1BW9A 3T7CA 3IS3A 1K6JA 3WGZA 5A06A 3DL2A 2C20A 3OM9A 3TL2A 4XX0A 1NR1A 5F1KA 4YRAA 3L6OO 1GL3A 3OSUA 2Q1WA 4XYMA 5B4UA 1U28A 3AY3A 2OBYA 1DXYA 5TS3A 3WGQA 1QMGA 1XKQA 3ULKA 2IRWA 1GADO 1IYZA 3G1TA 4RF5A 4QO8A 4W6ZA 1BDBA 1XU7A 3ASUA 3JQAB 3TFOA 1B0AA 1Z82A 2A94A 3ADOA 4NFYA 4OMUA 1XU9A 4R3WA 1NM5A 4D0SA 3C7CB 1OAAA 3VH3A 1K6IA 3LLVA 3JQ7A 4NFSA 4R9SA 3PP8A 3WBBA 1XHLA 2GN4A 2YZ7A 4BNVA 2IDZA 3ZGYA 1LX6A 1V8BA 2XXBA 3GQVA 4RPHA 5G0UA 4R5HA 3UCFA 1JLLA 1GYRA 1A4IA 2X5KO 3CMCO 1L7DA 2EIHA 3K5PA 3X2EA 1VM6A 3VTZA 2NV6A 4YJFB 4CV3A 3I4FA 2O2SA 1CIVA 2HRZA 1I10A 3KM0A 2CF5A 1Y5RA 4YYZA 1LI4A 1YB5A 2UV8A 1Z74A 2Y1DA 1VSVA 1T4DA 4OSPA 3LK7A 4K28A 1HYHA 3DB2A 3OHSX 3JQ8A 3GMSA 5THKA 3UAGA 2WYWA 2X58A 3FTNA 4E2ZA 3ICPA 3DZGA 1VJTA 3KEQA 3P7MA 4OYRA 2P9GA 3P19A 1LJ8A 1GUZA 2OZPA 4D42A 1AHIA 1H9BA 4TKLA 4XGKA 5IN4A 2AG5A 5JBIA 4FJ1A 1R16A 4UUPA 5JDCC 1KIFA 2EF1A 4JP2A 5BNIA 3DBRB 3P5SA 1ONOA 1T25A 2WWRA 2X9GA 1DLJA 2VWPA 5G4LA 5H82A 5JAQA 3TZQA 3ETDA 3I23A 4AJJA 4EUEA 3VZRA 2JL1A 4LCEA 4WLEA 1VL6A 3Q3CA 1YB4A 4UEJA 4MVJF 3ZHBA 4CM1A 5CG1A 2P4HX 4FW8A 4HWKA 3AUSA 4DBZA 1HDYA 1GZ4A 3TRIA 4C7JA 1U8FO 3D64A 3WX0A 5L4SA 1XQ6A 2CZCA 4YAGA 3GEMA 2FWMX 3EW7A 4NBWA 5L4NA 4BVAA 4AJEA 3GFBA 2UUPA 3JD3A 3RI3A 4O63O 1IY8A 2CSUA 3ZHXA 1WPQA 2GDZA 2BLLA 2W8ZA 3CKYA 1PGJA 3DAPA 2HMVA 5F1PA 4E31A 1P31A 5TF4A 3DONA 2FRDA 1Q7GA 3VVBA 5A02A 1P44A 3G17A 4JNKA 3PZRA 4ZU3A 3PQDA 1GQ2A 1KYQA 1U3VA 5HS6A 3F6YA 1KEVA 1YQXA 3OA2A 1YS4A 3BMCB 3DBHA 2EXXA 4CR7A 1FXSA 3OJOA 1TVEA 1AXGA 1ZK2A 2WE8A 3RWBA 4IIVA 4YJHA 5C3MA 3OQ6A 3AU9A 5COAA 5IG2A 2GN8A 4JROA 3ADPA 4H7PA 1XEAA 2O48X 2O23A 3GRPA 3R1IA 4K6FA 1EEHA 1PJ3A 3U4IA 1YJ8A 2TMDA 3HWRA 1WMAA 5AXCA 4CJXA 5T8KA 2RCYA 1TA4A 4CM5A 2CF6A 4YPOA 3R0IA 3D1LA 4R16A 1BXGA 3IOYA 2I67A 1D1SA 4RVUA 2NWQA 3UGKA 2EGGA 1DFHA 5BSEA 3MJSA 4XR9A 1YQGA 4I5EA 3U62A 4Y6RA 4PN3A 2QRJA 3Q11A 5TLSA 1HDRA 4DPLA 3DMYA 1JWBB 1Y8QA 4J91A 4NU6A 4BO3A 1DBVO 1I36A 3JYQA 3M2PA 4LMPA 5KTKA 2XPCA 3BMNA 5ICSA 3OECA 1JDJA 1X13A 2EP7A 5A5FA 1LC0A 1ZXBA 3QVWA 5DULA 3VH4A 4CQMD 1LXCA 1T2DA 3HB4X 3IMFA 4TRRA 1JAXA 1YOVA 2AQHA 3PZBA 3OICA 4B4WA 3E18A 2BFOA 3B1JA 1YE3A 1D3AA 4FFMA 3TQHA 5TQVA 1F06A 1H94A 1R4MA 2YHIB 1CWUA 5FF9A 1O8CA 1SCUA 3ZV4A 1K6XA 3COSA 5BSGA 4XDYA 1EUZA 1JWAB 4A73A 3LT4A 1H0KA 2WTBA 3WYCA 1T1RA 3RUHA 3K96A 3NX4A 5HS4A 5JDIA 1HDGO 3EZYA 3NKLA 3RBVA 5JXWA 1YONA 3KHUA 4MDHA 1GR0A 4W7IA 3WSVA 5L51A 1I2ZA 1NAHA 2B4QA 3GHYA 3CUKA 2X23A 4Q3EA 5AQ1A 1I2BA 2J3KA 2YFQA 3LC7O 3EUWA 2O7QA 3STHA 1AN9A 1XA0A 3C3XA 4AJNA 2QRKA 5GY7A 1UZLA 4Z9FA 4LRSB 4TROA 4CUZA 2DBQA 4FD3A 1E1MA 1LLQA 3JCZA 3H9UA 4GGPA 3HN2A 2IXBA 3WNVA 5CEFA 5MDHA 5JPIA 2NQ8A 5JMWA 4XQ9A 4CL3A 2BH9A 5JC8A 2ZCUA 3GUYA 2OP0A 2Y66A 3ITKA 1ZH8A 3AK4A 4OL9A 8LDHA 3DR3A 3BMQA 5JY1A 2W2LD 1T2AA 3KVOA 4FC6A 4ND4A 4D7AA 1R4NA 1QYWA 1ULUA 4XB2A 3K2BA 3RCBA 3VC7A 2PV7A 4KTTE 3W8DA 1VPDA 3MEQA 3QVSA 1PWXA 3DWFA 3LU1A 4CM3A 2GERA 2X0RA 3AI1A 3DFUA 3V1UA 2QYSA 4NJOA 1P0FA 1A5ZA 2RHCA 1CQJA 3A1NA 4CV0A 5A9TA 4HP8A 4I1IA 1UXKA 2ZTUA 1ISGA 2HAEA 4PZEA 3T4XA 3G0OA 4CM4B 2ZK7A 2Y1OA 1DIHA 3FR8A 4KWHA 1WXDA 4IXWA 3RQSA 3WWYA 1QKIA 4IDDA 1X15A 4Q3AA 4FN4A 1BXKA 1WZEA 4GLOA 1T4BA 3JV7A 2H63A 1MB4A 2EKQA 4AVYA 1U5AA 3RC2A 3VZPA 4EITA 5G0WA 1BVRA 5JDCA 4LCJA 3ANLA 4CV1A 1K0UA 2ZTLA 1E1LA 1OI7A 1U2DA 4RZIA 2J8ZA 3A28A 4B4VA 3GRKA 1F17A 1PQUA 2JFGA 4Q3DA 3GA0A 5TIIA 1WW8A 3D5QA 1VJ0A 3DOOA 4DVJA 2Y0CA 3WQRA 5EESA 5DCYA 1GEEA 2I3GA 3D3EA 4XD2A 1SO8A 1I3MA 2Y67A 9LDTA 2V6BA 4ESOA 2FPPA 4CQLB 3ZWOA 4DTIA 5I7VA 5JO9A 1FJHA 2HU2A 1KVRA 1ZJZA 1Y1PA 3INTA 3FWZA 3GVHA 1AXEA 1DPGA 3GC6A 3I9MA 1ZSVA 4MIOA 4Q9NA 3KZVA 1QYVA 1LA2A 1TI7A 3LVFO 4J0EA 2EWMA 4G5HA 4PG8A 1DRUA 3S2FA 2CDCA 4LGVA 2FSSA 1ISJA 4NBRA 4PRLA 5B4TA 4ZGWA 4YQZA 5G0TA 1EVYA 2NTNA 5MGBA 3DMTC 1MA0A 2DUWA 1ADGA 4IZIA 4TRMA 4E5MA 1B15A 1QR6A 4YJFA 1KC3A 1YVEI 5FI5A 4IJKA 4L76A 1ZJYA 1ZK1A 3B20A 4NFHA 5EL0A 3H9GA 3EC7A 5TSDA 3D4PA 5JE8A 1P33A 1DIGA 1DAPA 2C7GA 5A3JA 1O94A 3IUPA 1EK6A 4WLOA 2HMUA 5ENDA 4PLCA 2BRUA 4CMEA 4M86A 4HADA 1LTHR 3CTMA 3HDJA 4GKBA 4I9NA 3KXDA 3CZRA 4GBJA 2PGLA 1PSDA 3WOHA 1O95A 1R66A 4WECA 3H9QA 3PFWO 1YBAA 4RDHA 3V1TC 3H4VA 4PLHA 5CDUA 4HFMA 1ZSYA 2BD0A 3ONFA 1IPFA 1WDLA 1H5QA 4GQAA 1DAOA 4FC7A 2D8AA 1BVUA 5JMPA 1GYQA 2VTDA 2HJRA 3DHYA 3MWEB 5L95A 1NQTA 5KJEA 4MVJP 4NNJA 1O5IA 3UN1A 1EBFA 3E5RA 2B4TO 2VUTA 4MINA 2PWZA 3IQDB 4KMSA 4QO7A 3ZNOA 3A06A 1OZAA 4YTEA 1GDHA 1D7OA 1SNYA 2PR2A 5DBGA 3E82A 1DHRA 3UF0A 1PL7A 1Z7BA 2OFPA 2HLPA 1RYDA 5IDQA 1FDTA 2GN9A 4IBOA 4RVFA 3GPDG 2ZYGA 2C54A 4L9RA 4GAEA 5AXAA 1PS0A 4KUGA 5U1PA 3S1LA 3LQFA 1XQ1A 4QFDA 1TB4A 1GQYA 4YWJA 1WVGA 4OOEA 4P38A 2ZTVA 3FPLA 3WTBA 3CXRA 2EG9A 4A0SA 3GZNB 1LDNA 1Q0LA 1VL8A 2JD0A 4RLSA 1ZW1A 1XELA 2I99A 2UUOA 3WMXA 3IAHA 1NWCA 2WM3A 3FN4A 1QSGA 3N58A 3NDIA 3QA9A 1LBEA 4NK4A 3P2YA 1YB1A 1PJLA 4WLUA 1ISIA 4NMHA 1B26A 4NJMB 1KVTA 4R1SA 2VTEA 4BQRA 1WAMA 1N7HA 4WCDA 5IDYA 1FDVA 1KERA 3ROKA 3JQEA 4DIBA 2W4QA 5A5EA 4IS2A 3WGYA 1DFGA 2GRAA 4RORA 3IP1A 3GUCA 1NHWA 3PJFA 4DMMA 3UUWA 3GMDA 3O4RA 3UHAA 3VAZA 4IXTA 3F47A 1GYPA 4IS3A 1LLDA 3A14A 1ZEMA 1B2LA 3PHIA 1F8GA 4W4TA 3WFJA 4H15A 2QYTA 3E5MA 2X7HA 1RPNA 2YV1A 2WMDA 4ROSA 4AJPA 4A03A 5B4VA 4GWKA 3KBOA 3VH1A 4JP3A 4Y67A 3LT0A 4CM8A 3HFGA 1BXZA 3NJ4A 3P2OA 4TMFA 3S8MA 1M6HA 3U3XA 3PRJA 4IZHA 4A26A 1UXJA 2YYYA 2NU6A 3MJTA 3OQ1A 4AICA 1WDKA 2A35A 2BGKA 4DYDA 4B8ZA 1WNTA 1PJSA 2RBEA 4N18A 5T57A 3HDQA 2ZB8A 2HCTA 2YW9A 3DOCA 4OQYA 3RU7A 1NVGA 2JFHA 3O38A 1E92A 1EFKA 4EDFA 3H9EO 1OFGA 4M87A 3KYDB 2HO5A 4GVLA 4RL6A 7MDHA 2YHIA 2PTGA 3ON5A 1V3UA 4EUFA 2VRCA 3H2SA 2HSDA 1Y7TA 4GL4A 5CP8A 3T4EA 4P4GA 1I8TA 1Q7CA 3M6IA 4J4HA 2FHSA 3MWDB 5F5LA 4BNJA 1X7DA 4TZKA 3HNPA 1B8UA 4FGSA 4FPXA 4KDEA 4BO6A 4PLFA 5L4LA 1DO8A 3EHEA 4ND3A 2EHDA 4AL4A 5FYDA 3QVTA 3PJDA 3U9LA 4XYGA 2E48A 4Q39A 5G4KB 4GSKA 1ZCJA 3LYLA 1X0XA 3RU9A 1ZZEA 5LDHA 1YDWA 1IHYA 3ROMA 3KETA 1PTJA 1NQ5A 3JD1A 5EN4A 1DIBA 4PIVA 1G6KA 2B37A 4XZ3A 4S1VA 1I0ZA 1K2WA 2ZKLA 4PZDA 4BL5A 4GX1A 3VZSA 4NR0A 4CMGA 5BR7A 5IDWA 2Q4EA 1LC3A 1UDBA 2P9CA 4O5OA 3NYWA 3EAGA 4FFPA 3QLJA 3UW3A 2Y1GA 3TDKA 3RAJA 1I33A 3GEDA 1DRWA 3ONEA 4HNHA 1ISFA 3AUAA 4O6VA 4I5GA 4RVSA 3L07A 4II2A 1BHSA 5ENVA 4OOFA 3VZQA 4RVGA 4WE3A 3TSCA 3OIDA 4P4NA 3NAQA 2AW5A 3DMTA 2H9IA 5L7TA 2FP4A 2GSDA 1JW9B 2O3UA 3JD2A 1PJTA 4OXNA 1UUFA 4CMHA 4BNMA 1JQBA 5T67A 4XKJA 3H2ZA 3MJ4A 3DZFA 4RF3A 4CR8A 2Y93A 4XGNA 4DBVO 3HQ4O 4K9DA 4BGEA 4R1NA 4GGOA 4FR5A 3FTPA 2ZYAA 4ITUA 1J6UA 3NDRA 1UZMA 3WIDA 4BNHA 4BO2A 4Z0HO 3FPCA 1O89A 3DHEA 1JKJA 3LF2A 3ROPA 5JNLA 2GNAA 4AFNA 1HEUA 3AU8A 3PYMA 4TRNA 3IJRA 5KVQA 3BHJA 5EERA 3WG9A 1JKFA 5JAMA 1YL5A 3D3WB 4QX6A 1SAYA 1HLPA 3ZWAA 1F12A 1MX3A 1NYTA 1MG5A 2HJSA 4J9UE 2IZZA 4HX5A 2VUSA 1PWZA 1ZXLA 3DOJA 3JYNA 2I3AA 1TEHA 2GZ2A 2WDZA 4MVJA 4PCVA 4CM9D 2FR8A 1RYEA 3O26A 4J6FA 1E3WB 1K89A 1MLDA 4D3SA 5KIAA 2Y99A 2IYOA 4WKGA 4BO7A 4YT2A 1TT5B 1WLYA 3RJ9A 2OGUA 3AOGA 3KYCA 1M6WA 3TFQA 1ADBA 1P1FA 4YVFA 3AM5A 4GPD1 1X1TA 4ZN6A 1PJQA 3IDSA 4CQLA 1GV0A 4AG3A 4UVIA 4ND2A 1Q2XA 3ICCA 2J3JA 3ZU2A 4DUPA 4LW8A 1E7RA 2ZB3A 3RFXA 1ADCA 4NBVA 1BG6A 1O9BA 1XWFA 4W9NC 4BO4A 3OEYA 1LRKA 1MC5A 1ULSA 3FHLA 4CV2A 3AY6A 4EJ6A 2OL4A 4JBHA 3WNQA 3ZV3A 1PGNA 3NEPX 5DN9A 3S2IA 4FOOA 2X5OA 1A7AA 4PGFA 4TZTA 4WNCA 1H6AA 4RO0A 5K0ZA 2I6TA 1LUAA 4PLZA 2DFVA 5ILGA 3KUXA 2OHXA 1ZBQA 2FMUA 4INAA 5EMHA 2NVWA 3GF4A 3GZ4A 4YDRA 3E48A 4OKIA 4DLAA 4UVDA 1UZNA 3RFVA 4IDAA 3W4JA 3I1JA 3PWKA 4WUVA 4BNXA 3RKRA 3QP9A 1IOLA 4HKTA 4J2HA 3AWDA 3EYWA 2C2YA 4DA9A 3HSKA 1DSSG 3RBZA 1KS9A 1MUUA 5A9SB 4BKOA 4N7RA 5LCXA 2JFFA 1RJWA 1E7WA 4MOWA 1I3NA 4I5FA 1HYGA 4MVJM 4D43A 3RUEA 2RH8A 5JYDA 2B0JA 1GEGA 1I01A 3JQ6A 4X54A 4YRDA 2JHGA 1BWSA 3PI7A 2IZ0A 2PD3A 3LT1A 2PKRA 3WTCA 1FDSA 4RPLA 1W0CA 3VHRA 2G5CA 4JQCA 3U5TA 1XSEA 2I76A 1DIRA 3ENKA 3U4DA 2FN7A 2H5LA 3NT2A 1SOWA 2NU9A 4E2WA 2VOJA 1QP8A 1DOHA 3U4HA 3VDQA 5A9RA 5C7LO 1F0YA 1NPYA 4J16A 4A27A 1C0KA 3JQ9C 5AVOA 4CUJA 5DF1A 5L3ZA 1PJ2A 4Y6PA 5C5IA 4KOAA 1T26A 4BO1A 1EQUA 1P1IA 2PZJA 3PHGA 2AEMA 4B3IA 4CLRA 3OEWA 3JYPA 1EUDA 1M75A 2DFDA 2HDHA 1H2HA 2DU8A 1OC4A 3EMKA 2WYUA 3B70A 3HN7A 2Q2WA 3E1KA 2VZ8A 3LDHA 4D45A 5CEEA 3ZWVA 3LF1A 2V6FA 2VHXA 2D2IA 2WD7A 1E3SA 2W90A 4MO2A 3V2GA 2HQ1A 4ALJA 4RDIA 1EBUA 3PK0A 3H6KA 3H3JA 2X0NA 5ICMA 2NTJA 5L40A 4WK6A 3GZNA 2O4UX 2QG4A 2Y1FA 3R3SA 4E32A 5IZCC 4YEDA 3DZBA 1X7GA 3RUCA 1NQOA 1IZ0A 1P1KA 1C1DB 1HE5A 2VWQA 3PXXA 4Z6KA 5CAEA 4IQ0A 2JAHA 4DLLA 4EJ0A 3PDUA 4IIUA 4MIEA 4PG4A 4NJMA 4OJNA 4OM8A 1W6UA 2AXQA 5EINA 3AFNA 1PU2A 1LRJA 3A9WA 3DBVO 1A7KA 1PGQA 4U7WA 4AJ4A 1R12A 3MJVA 2GASA 2D4AA 4GWGA 1N9GA 2FZWA 3FBTA 4CMKA 3I5MA 3TL3A 4R5MA 4CQMB 2FZEA 3GVXA 2GLXA 1VL0A 4MP8A 3WXBA 4XIJA 3K2EA 3TZ6A 2CDAA 4C7KA 3TOXA 3SLGA 2PA3A 4BKPA 2YHUA 4YAIA 3H3FA 3I9NA 3SC6A 1F14A 2VHVA 4ZHSA 4IMRA 4E3ZA 1PL6A 2QW8A 4PLPA 1NQAO 1GUFA 1CRWG 4WASA 4JJFA 1R0SA 1UP6A 1VE9A 4DC1A 5KJ6A 3K92A 3PEFA 1E7YA 1UXHA 3INGA 5HM8A 1Q1NA 3HFSA 1X0VA 2CFCA 4UUMA 2NNLD 2PZLA 2PY6A 3FD8A 3WGGA 2ZB4A 2X4GA 1FK8A 3I83A 1NXQA 3VTFA 2O3RA 3HZZA 3T7EA 4BO8A 4PLGA 1JVBA 2VOEA 5CHEA 4L0QA 4G2NA 1UP7A 3WJ7A 2GGSA 3WYEA 4BUCA 3KYDA 1EMDA 1MFZA 1W8DA 1YWGO 2BI7A 2X0JA 3Q1LA 4MKXA 4UUNA 4IUYA 5COQA 2Q50A 3TN7A 4WCFB 1NNUA 1C1XB 2Q1SA 3NGXA 1YDEA 1H2BA 3NT5A 3F4BA 3B1KA 4I8XA 3QWFA 4IQ8A 3VPHA 4XA8A 7ADHA 5JCXA 4A2CA 5FEUA 3VPXA 4AJLA 2EW8A 1DHTA 4ZJUA 1HE2A 2JCYA 4R3NA 3WLFA 2O2YA 4BNLA 5G4KA 1LQUA 1PIWA 1P9LA 3HE3A 3VPFA 1P1HA 1U3TA 3FBGA 1QRRA 2XOXA 4HFJA 1HSOA 3JSAA 1J0XO 3U49A 2YV3A 2EP5A 6ADHA 1U8XX 1C3VA 3PWSA 1HTBA 3BA1A 4J1QA 3QJ5A 4D46A 2C59A 1PJCA 2PGJA 1LSSA 1HETA 1XCBA 5G0VA 3HB5X 1TT7A 2VYVA 3UKOA 4E21A 5I9MA 5I7FA 2JCXA 3DHNA 5BNTA 1SBYA 2VRCD 4YAKA 3DBLA 1B16A 2VT2A 4A5OA 4YA6A 3WS7A 1YQDA 3WIEA 2CVQA 1JTVA 3ZU4A 2E82A 2AQIA 3EK2A 1ZMOA 4QUKA 5BSHA 1GU7A 5ITVA 3L9XA 3DZIA 2VRBA 1A27A 5H83A 1BDMA 1DB3A 3AI2A 1DC6A 4DC0A 1J4AA 3MJCA 2X22A 2X86A 4B3JA 3IL2A 2J6IA 4FQ8A 4D3DA 4YJGA 3JYOA 1GZ3A 1PGPA 4CM7A 2GCGA 3DC2A 2B36A 3OMLA 4KTVE 4WCFC 2VZ0A 5G0SA 3SBOA 4GX5A 1OC2A 2P91A 4BNYA 2EJWA 2PFGA 4XRRA 2IE0A 1Y9EA 1LU9A 4GMGA 4M54A 1KEUA 3W4KA 1LSJA 4II3A 1I30A 3WSWA 3C7DB 3CINA 4R9RA 1PEDA 5JO0A 4DL9A 3BTVA 1QLHA 4K1LA 4KUHA 1E3WA 1E0DA 4AJ1A 1CQIA 1EDZA 2W2KB 3CPSA 3DQPA 1TT5A 2B5VA 3SJ7A 3ZWBA 4BGUA 3WJAA 3GY0A 3OJFA 3UVEA 4BO5A 5AYVA 4Z3DA 1E7QA 5CDYA 3JQAA 2LDBA 4LRTB 4ZQEA 2IEDA 2IZ1A 1BW9B 3ZHYA 1MP0A 1ORRA 3GVCA 4J3FA 3UOGA 4R41A 5FI3A 5BNFA 1HZJA 2WD8A 2OORA 4MP6A 3GG9A 4R68A 3MOGA 4F6CA 4YT4A 4DIOA 2C07A 1IE3A 3E8XA 1QV7A 3OFSA 3V2HA 5TT0A 4TRJA 1O0SA 1P1JA 2C29D 3RUIA 1U3WA 3GEGA 5F5NA 1I2CA 1O6ZA 3AM3A 2NVUB 3U09A 4QT0A 4ALIA 1XIVA 3JQ7B 1ML3A 3PYLA 3JYLA 3GG2A 2OP1A 3KSDO 4NZ9A 2VHWA 1HE4A 1NVMB 2YQ4A 5IZCA 3DO5A 1T24A 1EDOA 4RF2A 3WGOA 3PQEA 4OSOA 1XG5A 2O3TA 2P5UA 1VLLA 2BF7A 5IN5A 1DEHA 2VWGA 3L9WA 3BMOB 4HV4A 3RSHA 5L7WA 4BS9A 4CLHA 4OAQA 2PKQP 2CD9A 4Y9DA 4M1QA 3N74A 1GTMA 3E9MA 1YO6A 3DBRA 2Q1TA 5IJZA 1NASA 1T1SA 1MGOA 4GX2A 2J5KA 3AM4A 3F5SA 1L1FA 3O03A 2NUAA 4GVXA 4D0RA 4GH5A 3JQ8B 1M2WA 4A7PA 1LDBA 5ADHA 1YBVA 5JW6A 4KWIA 5CDGA 4ZICA 4G65A 1ZEJA 4NH4A 3ASVA 3G1UA 5I7SA 1CETA 2NU8A 1DIAA 2OUIA 1E3IA 2JCVA 3KSZO 4E2YA 3L0DA 1KBZA 4IJVA 4YJDA 1CJCA 1EVIA 2DTDA 3JQCA 3RKUA 1ZK3A 1B3BA 3V8BA 2WEKA 4E5YA 3F9IA 2FPIA 5A3VA 3LSYA 1N5DA 2AE1A 2Q45A 1XDWA 1BRMA 3INRA 4QECA 3ZW8A 3DTTA 3KLMX 3DFZA 2PKQO 2ZB7A 3PHHA 3RUAA 3ZU5A 3I9OA 2ET6A 2EV9A 4KP7A 3EZLA 2FR1A 2PZKA 3FNGA 3OF2A 1Q7BA 3BMCA 1G0OA 1MC4A 4Z0TA 3RIHA 3W4IA 5HWSA 1I5RA 5ITWA 4H3VA 3K31A 2IXAA 3PYXA 5GZ1A 4FFRA 1C0LA 1P1RA 3GHHA 2HMTA 4U6QA 1ZUD1 2PK3A 1HDCA 2GZ3A 4EBFA 2PD6A 3LC2O 4E5KA 1KY4A 1U3UA 4OHUA 3H5NA 5JC1A 5EIOA 1GD1O 2WJPA 4G81A 1UDCA 2J5QA 3Q9NA 5EJ2A 4WEOA 1HXHA 2Q2VA 3KEOA 3KYBA 3QW2A 2YDYA 4HUJA 3NUGA 4Q3NA 3QVOA 3DBHB 2UVDA 3PGJA 1HLDA 5B12A 2X9VA 5CPFA 2HKIA 2EW2A 1R6DA 1YH3A 3F1LA 4YJHB 4OO3A 2I9PA 5KJCA 3WMWA 2UAGA 3NRCA 4Q3CA 2QQ5A 2EERA 1V3TA 4WGGA 1Q0QA 2J3IA 3PFFA 2AQ8A 5KVVA 5HTOA 4EEXA 1B8PA 1PX0A 2Y68A 1CERA 3QWIA 4IY1A 5JFOA 3WB9A 4J2OA 4IMPA 1EE9A 1A4UA 1NFRA 2CY0A 3AOEC 4F46A 5KVSA 5L45A 3UICA 2O3SA 2AQKA 4BV9A 1T2EA 2BFPA 3V5NA 4BQPA 4JGBA 4M8SA 3NDJA 1PR9A 1E7MA 3CSDA 4R1UA 1M66A 3MOIA 1GY8A 1R37A 2PLAA 2G82A 4WLNA 1SB9A 1E1KA 2FR0A 2V65A 2O50A 4AJIA 4H16A 5JYEA 1PS8A 3WICA 4DPKA 3PJEA 4FCCA 3IKVA 3RC7A 5I8ZA 4IDFA 4LMRA 2IEBA 4XQCA 4J7UA 4BB5A 2EKPA 3QWHA 1Y8QB 3NJ8A 3JD4A 3QIVA 4FIZA 1I3LA 3ITDA 4E0BA 1QLJA 3I4CA 2OBNA 1LLCA 1VKNA 3ZWMA 3MTGA 1U7HA 2W98A 1C14A 1HDZA 2ZTMA 3VKVA 3I9JA 1IL0A 1NTOA 2XAAA 2C5AA 2DTEA 1AE1A 2QX7A 4J7CA 1W4ZA 1C1XA 4CMIB 5LC1A 3E6AA 4L73A 3K6JA 1V3VA 1YOVB 4Z9XA 3WQQA 1HE3A 3FCOA 3BTUA 4XJTA 2CDBA 1ZK0A 1ID1A 5A1TA 3KTDA 2A9FA 4KDFA 1HDOA 5THQA 3KOUA 3H8VA 3HJAA 4IJWA 5TJ9A 4BMNA 2H1SA 3SLKA 4BV8A 4E5NA 1QV6A 2Z1NA 1A9ZA 1KVUA 5I8WA 4K6CA 1N8KA 5TC4A 2DBZA 4MVJH 3HG7A 4JJGA 1ENZA 3PLNA 3W1VA 2CNBA 4DRYA 4O1MA 2ZJ0A 2FY8A 2YUTA 2AG8A 1HDXA 5A03A 1K3TA 2QHXA 1JKIA 4RPKA 3KLPX 4AJHA 3FI9A 5KJ1A 4UEOA 3I6QA 4DYVA 4XEHA 5DT9A 3ABIA 5DZSA 4WPGA 3FR7A 3KO8A 4GMFA 1DC3A 5TX7A 5JSFA 3HDYA 3QE3A 1GPJA 4WOKA 4F3YA 3AY7A 2VNAA 2PGDA 1IULA 3M1LA 2Y1CA 4Z3KA 4CLXA 3ZU3A 3LZ6A 4YB8A 2G1UA 4R4JA 1NPTO 2DT5A 3WGIA 3VPSA 1GUYA 1WZIA 1XR3A 4WOJA 2YJZA 2E6UX 4CL8A 3ZH2A 1PQPA 3QV1A 3E03A 4CM4A 1MV8A 1YJQA 2C82A 3ZN2A 2H6EA 4CLOB 5T5QA 3G3EA 1JAYA 3GNSA 1FDUA 2EGHA 5GZ6A 4J49A 4Z0PA 4J90A 1R15A 2CMDA 4DQVA 5ILOA 1X1EA 3DZHA 4ZQFA 4ZRMA 4GLLA 5EPOA 4BNIA 4E6PA 4MKRA 3ENNA 2VYVD 1E3JA 1WP4A 3HADA 1MXHA 3D4NA 2DBRA 4FJ2A 3RC9A 5G2OA 4NK5A 4E4YA 2FPGA 4QQRA 2W2KA 2AMFA 1QORA 2NQTA 4GSLA 1ZNQO 5B37A 1EFLA 1EZ4A 3C1AA 5C7IO 1AHHA 2Q3EA 3BTOA 5JDIC 1VC2A 4PVCA 4BNKA 5A05A 2SCUA 5JCJA 3QWBA 4D3FA 5KKCA 2ILTA 3OJEA 4NIMA 3D0OA 5I9NA 1EK5A 1W73A 2E4AA 1A72A 4TSKA 1VRWA 1JN0A 1YKFA 3PHLA 3GPIA 5JS6A 3QSGA 4ALLA 2X9NA 2HK9A 3GVIA 4R54A 5DOZA 5B1YA 4DQXA 1DJNA 3X2FA 2OO5A 1Z45A 5EQFA 1EUCA 2Z1MA 1E5LA 1A9YA 1ARZA 1FDWA 2JHFA 4NDNE 1N7GA 3WBFA 5IF3A 5K6AC 2NVUA 1ENPA 1P45A 3UCXA 4UREA 3ST7A 3C8MA 2Q2QA 1U9JA 4NG5A 4J1NA 2DTXA 3PGXA 5U4QA 4B7UA 5C7OO 3F46A 4NQZA 2P68A 3EVNA 1J49A 3IJPA 1VSUA 3BMOA 4J4TA 5DBIA 4MJLA 4PZCA 3ETGA 3DTYA 4YR9A 3JQBC 3FNEA 1N92A 2GPTA 4YAEA 3JQAD 4JX8A 4BIIA 3CH6A 3PJGA 4AJ2A 1U4SA 3AW9A 5KWEA 3U0BA 1UXIA 3SC4A 4EW6A 1DC4A 1NP3A 1D8AA 4OGWA 5DP1A 3I9LA 4ALNA 1YL7A 1WDMA 1ZSNA 1ZO8A 2DPHA 2HMSA 2G0TA 2VHYA 3N7UA 1YBMA 3ORFA 3PLRA 4LVUA 3JQDA 4J1TA 4P22A 4NBUA 2FSVA 3GAFA 4KZPA 3ZWPA 1HF3A 4XYEA 1XYGA 3AOEA 1LDGA 2GN6A 2X1HA 4PFJA 1CEQA 2B69A 1UR5A 1LQTA 3ZHZA 1ZIDA 4TVOA 3EY4A 1RWBA 4HFRA 3RC1A 2DAPA 3L4SO 4Y98A 4FB5A 5AXDA 3V2UA 3NV9A 3GR6A 1ISHA 1H6CA 1BMDA 2PNFA 1I3KA 2VYNA 3QQPA 1N1EA 2X0IA 2X5JO 2E37A 3SEFA 1RM0A 2VT3A 1OMOA 4FGWA 3I6IA 4CPDA 3UCEA 3L4BC 2B4RO 4CR6A 3TNLA 3RBXA 2NVBA 2HUNA 4N5LA 5JAZA 4J1SA 4RCVA 4B7XA 1JU9A 1IB6A 1GAEO 2BMAA 2OXIA 4CMAA 1LDYA 1Z6ZA 4E13A 3M1AA 1BGVA 5CPBA 2QRLA 4ND5A 3WLEA 4EI2A 3ANMA 3D4OA 3Q0EA 1VI2A 4MVJI 3R3JA 2E49A 4FOSA 1NVTA 5DDIP 2QZZA 4W99A 1H6DA 4ZQHA 3VPGA 4CMCA 2RHRA 3AJRA 3QWAA 3TZHA 2NU7A 3K9QO 3G49A 2V6GA 4OKNA 2R00C 3AUTA 3EVTA 2P2SA 3RROA 4L8VA 1C0IA 1QYDA 2POQX 2PZMA 5HBRA 1Y5MA 3GNTA 4M89A 4UULA 1IHXA 1HRDA 3K30A 4FBGA 2ZQZA 4EYEA 3FRJA 4MP3A 1Y6JA 2VCYA 3GLQA 3MZ0A 3BIOA 2R2GA 3DAGA 1B8VA 4CMEC 1ADFA 3B1FA 4DREA 5TT1A 1KVSA 4QTZA 4A10A 2DUUA 2ZATA 4BNNA 2NSDA 5IXYA 1NFQA 2G17A 3HDHA 1U4OA 2JKVA 4M55A
chains in the Genus database with same CATH superfamily
2PR7A 3FHCB 2VC2B 4GI2A 5AKEA 1PP4A 1KEPA 3RASA 5KMGA 3GZJA 3IP3A 3QOFA 4JR0A 1MABB 3C85A 4WI1A 1QRUA 4M1WA 2BFBA 4RDCA 4CCSA 3C97A 2P6MA 3KE8A 2O3QA 2Y0EA 2Z83A 5L53A 3PXDA 3TAUA 3PS9A 3AR2A 2GN0A 3CUWA 3RYTC 3TXAA 3F8WA 4EBBA 2DJIA 4V0RA 1V2HE 13PKA 2Y6VA 4RZHA 4Y8VA 3ZLUA 4NV1A 2VSYA 3DSRA 3FMFA 4TS1A 2CUZA 5IJ9A 2COUA 3HXMA 1FZTA 1IQPA 2G7ZA 3NB0A 1WWKA 1SD2A 2B8NA 2YW2A 3RR2A 3TPCA 1TXGA 3EIEA 4NCJA 3T06B 4JJEA 3TSOA 3MILA 3ZWQA 3WO1A 4IF4A 1LPAB 3E9NA 3NGLA 3KR2A 4FS3A 4G24A 5DP2A 4X8HA 4YO7A 5ALYA 1L3IA 1PR2A 3TSYA 4BRWA 3VX3A 1SEVA 2HA5A 3ER6A 4BLVA 1TCCA 3FLEA 3GFSA 3ETEA 4Q1DA 1UJNA 3T3NA 5JCPA 4R1PA 1H2FA 1V45E 3H42B 4ZK6A 3QNUA 2BFEB 5A05A 1KETA 1CZRA 4IIHA 4DARA 1T9HA 1AD2A 3O8QB 4QRHA 4X6UA 3SNHA 5K8CA 4NXMB 3NHFA 1LRLA 4K7JA 2J33A 3F5QA 5C46F 5EHZA 2G83A 3CPJB 3JQGB 5IYZA 2J30A 1YU9A 5G3YA 4HXYA 1P0CA 1ZKMA 3CRNA 2XW6A 3GGOA 3HCDA 3N87A 4I1YA 4QSMA 1BIFA 4P84A 4PX9A 4F93B 1B8OA 4BCCA 4QUAA 4RTNA 4P83A 5CDTA 4E5SA 3AUUA 3H5RA 1RPTA 3JVIA 3VVMA 1IM8A 2C5BA 3RO7A 3FKJA 1JA9A 2QVZX 4B8YA 3UOAB 2HY7A 4F5YA 4O0LA 1J5PA 2F48A 1AGNA 1KI6B 2NAFA 2O06A 4YQYA 1BKYA 3SX2A 1WCWA 1JG3A 3KZOA 5JWHA 1AH2A 5G41A 1X8LA 2FPOA 2VQ6A 4ZO6A 6PFKA 1T13A 4B6EA 1REQB 3BF8A 4O4HF 4B7CA 3CVXA 3HKDA 1UXGA 1VE1A 2QW0X 4KEAA 4TLEA 1Y9DA 2A5GA 4IH1A 1ONNA 3WFIA 3O4FA 4K6HA 1O2DA 1MOZA 1CVRA 3EZNA 1OXBB 8OHMA 2Q3BA 1ECGA 5GMOA 4P8RA 1E2LA 1HWYA 2FG6C 5BMVF 2O7NA 3RS2A 3QFTA 3Q15C 3CEJA 1MVLA 2ZFUA 2C4WA 3HABA 1OI3A 1OXKB 2PX8A 2ZWAA 3BL6A 3MT8A 4R81A 4RDXA 1M2NA 4TV9B 2GYYA 4Q9DA 3A32A 4BNUA 5JJ5A 4QNNA 3DAHA 4YAJA 2I9KA 2R6HA 1K88A 3ZI7A 5B12A 4E12A 3D2AA 2A0UA 3GJ5A 5E7QA 2D0PB 1DZ3A 2BVNA 4KYIB 3VYTB 3AEZA 4EGFA 3CR8A 3DNPA 2GF0A 3CE6A 2YC4C 2LDXA 4RD1A 5BOSB 3UBMA 1YQTA 1AB5A 4MAAA 5DPMA 4DWOA 1E2BA 1M2HA 4IW3B 5E3HA 3ZNQA 1PJBA 1M34E 5BNZA 3GUUA 5KINB 4S1TA 1G7CA 2QK4A 3N0RA 4F2HA 3RSLA 3KKZA 2J6BA 1MJGM 4FFNA 4AZSA 1CUCA 3ZI0A 4M2LA 1H05A 2XKJE 4K9MA 4RV9A 3L1VA 4DJTA 4IHJA 1CUAA 3ILYA 4B4OA 1ZIXA 4BGIA 3GBPA 4X71A 2E0IA 4PSDA 1N2SA 3AM1A 2ODBA 3Q2OA 1ECFA 1Z8DA 3Q9LA 2PWPA 1RMYA 3GDGA 3MW8A 3PC8C 4FMBB 1C81A 3RVDA 3QLVC 1P74A 1YR3A 4O02B 4N5DA 2F3PA 2LV8A 4BO9A 5AD1A 4BVBA 4EMUA 1P9RA 2CJPA 1DE0A 2F67A 3U3MA 2GLTA 3D0RA 1E8MA 2FW9A 1F6DA 5DYWA 3ZWOA 4IIJA 1M5UA 4UTZA 1WVMA 1XRLA 1JA1A 1P19A 3ZHQA 5LQCA 1RWKA 2I66A 1S2GA 3VO8A 4TMYA 3ZIDA 1TJNA 1ZN2A 2ZS9A 1JKJB 4TV8B 4XFJA 4M0MA 3WL8A 3D7LA 1QDLB 3ZCRA 4EIWA 4DV0B 3GOQA 3HB7A 4GVPA 4LRYA 4KV9A 3UMVA 4BNZA 2QTRA 4EFNA 5AJXA 5JNWA 4OIMA 3UY4A 4LHVA 3EG9A 3VNAA 3X3HA 3PQFA 4LYHA 3W9YA 3I3OA 3QXCA 5K0JA 5CT8A 1W49A 4D4KA 5BSFA 3L8YA 5LYJF 4URFA 2I7CA 3TTVA 4JJ8A 1S9HA 2QRUA 4EEKA 2DPGA 3U4AA 2PQMA 2ZSAA 1KPGA 3GLTA 1FMCA 2VF5X 4KNVA 4ACAA 4DQUA 4ZMBA 3UWDA 4EF5A 1NAIA 1NVUQ 2H8KA 2QAGA 2VF4X 1O08A 2HGSA 3GB9A 4R1OA 1R0KA 2IYEA 3QX9A 1KYYA 5F2EA 4PZZA 1ONPA 1XTJA 1EM8A 3L4BA 1KMHA 3UKDA 1KJZA 2YHBA 5E6UA 3NVDA 3T5MA 3V4PB 4Q7LA 3M9LA 1GGFA 3LX4A 1CJTC 2JARA 2YN4A 5AM3A 1DC5A 2GA9A 4TOIA 2Z3VA 3LKVA 2XOKA 3QELA 1GAJA 3K9GA 4KWTA 1BE8A 3B78A 4K03A 2ACEA 5DGXA 1NHGA 3K0BA 2EL9A 4JK3A 1HZZC 3SZRA 2VDVE 1GNRA 4JA2A 5FWNA 1XZBA 3UNXA 2HLNA 4CL2A 1QONA 5K99A 5DYTA 3O3MB 3FNQA 3BXXA 4BBJA 2H1FA 3GN2A 2PS3A 1ZH0A 3MTDA 4BNGA 4NBLA 9GPBA 1DKPA 2HDNB 2ZYVX 3BIFA 3NS7A 4XJVA 4AY2A 2O8BA 1WUHS 2VHZA 3G5AA 1A9XB 2WLTA 3PPYA 1Y48E 2AS0A 1F1BA 1XZJA 4I50A 1BHQ1 2EQAA 2KBEA 5A9SA 5ER6A 3N7AA 1GITA 1NJ8A 2CXNA 2V55B 2WE7A 2GYVA 2Z1DA 3QMPA 1SOVA 1R0LA 1X70A 4I4NA 4OQZA 4GX0A 5ARDA 4BLPA 1T8TA 2Z95A 3FOAA 5HCNA 5KWJA 2O6HA 3RTGA 4MVCA 4N3BA 1LW7A 2ZQYA 1PFVA 2PX3A 1XQYA 3FW1A 1TVCA 4UPEA 3PGLA 1EE2A 1B42A 3NIWA 4ZVUA 5KDOA 2RI6A 2VDWB 1K4MA 4PVDA 1H2RS 1UANA 4UVGA 3ANNA 3OMXA 3NR2A 1PKEA 4ZCMA 1KKLA 3LX8A 4K05A 4UEKA 3CC8A 1AK1A 3QRWA 4RKFA 2OQVA 1I80A 4ZYWA 4LFBB 3CWCA 2GTPA 4GDFA 1AS3A 4B35A 2HWXA 2UKDA 4AN4A 3PIIA 2KMLA 3WQSB 4RVDA 4KBGA 1M8JA 1S96A 2FW8A 4Z8YA 3VR2D 1Q19A 3MTJA 1OU4A 4HSGA 1QP7A 3IDZA 4YCDA 1QPZA 3OKFA 3OC6A 4F92B 1SXJD 4OXKA 4DKJA 3AEUB 4IFBA 5LWQA 2GFIA 1T4CB 2VO1A 3CCCA 3Q7IA 3R7BA 2V3VA 4ZU6X 2CDRA 4WADA 2WJ4A 4MK4A 4AZ0B 2YICA 4KWCA 3KR1A 3NWEA 4ZD6A 3DE7X 3S5UA 3IPXA 3WNZA 3KBBA 1FJXA 5H5JA 4CLEA 1W44A 3D81A 3NCHA 3WB1A 1YZFA 2BGWA 1VPVA 3IQHX 1G21E 2JD2A 3FCAA 4Z1OA 2IIPA 5B6PA 1A71A 3PL5A 4IQ4A 4XCQA 4MW7A 4RSHA 2R6JA 3A3OA 4I2NA 3DPIA 4YDHB 4DGSA 5EQDA 3AHJA 2A9KA 1MAAA 1G3MA 3OKPA 3F7OA 3QVXA 3UJDA 4B40A 3HYLA 1YRAA 5CXQA 5GZ3A 4NBTA 2G80A 5J3JA 1PFKA 3RYIB 4EPVA 2IYSA 1FSSA 2H3HA 2HK7A 3RC8A 1DFIA 3F5FA 1KHHA 5HKBA 3UJAA 2DY0A 2OA0A 1P3Y1 5JHGB 4R69A 3NM6B 5FPQA 1IBMB 3QHQA 2PD4A 4R2XA 2CNNA 4WJZA 5KHAA 3VU3A 3EH2A 4ZXFA 1FMFA 3C5CA 4RTMA 1UH5A 3O0DA 1OTYA 2PXCA 1PT8A 1Z8NA 1K9SA 1T6NA 2A9VA 2M6RA 4FE7A 5KPDA 4RHFA 4RANA 2C5FA 1JWLA 2JAOA 3U40A 2E4ZA 2HBRA 4GLBA 1JALA 3ICOA 5DSXA 5TRTA 1MEOA 1K7FB 1GXSB 2L42A 5DLDA 5FB3A 4DMLA 2WF6A 5KU1A 4AK9A 1W5EA 2QZJA 3OF3A 1N8SA 3OZIA 3S7ZA 1OXXK 4P4SA 5HEKA 3AKCA 3WGTA 1F60A 3RJ5A 3IOBA 5EAIA 3T5CA 5I01A 4ZYLA 3JTMA 1SU7A 2IU0A 3PR2B 4JXKA 3LI2A 1Q6ZA 1YUBA 2ODAA 2Z6UA 4LF8B 4Z4IA 1JR4A 2F9MA 3EBOA 4ONEA 5IM4A 2WWYA 3GLHA 5DW0A 3OEEA 1HFKA 1V37A 3MSXA 2X2EA 1YNSA 3IILA 1ZVMA 1E3EA 4G1VA 4ZVPA 2I4TA 3KXKA 4QU8A 1Q91A 5D01A 4AUNA 4BO0A 1O1YA 5F73A 2P11A 5G53C 1ID8A 5COBA 4NX2A 2WWIA 2F3TA 1OWOA 4IO0A 2I29A 2AN1A 2QZSA 2V0CA 3CPHA 2GBCA 1Y3HA 3S27A 3GQBB 3FPAA 2GR9A 1PZEA 3PGA1 4U8GA 3STVA 3RU3A 4RKRA 2F9FA 2Q2NA 3ZWDA 3MD9A 3TW8B 2HO4A 1OU0A 4U5XA 4J0JA 2P6UA 3HZRA 2JH9A 4LDPA 4U7GA 2WY2D 2BGMA 2L2QA 3BTSA 3CLKA 3GL9A 2CCKA 1GPDG 1GRNA 3A6FA 3PPIA 5BSTA 1L5HB 5KYXB 3OJXA 1M73E 2WFAA 3H7AA 1HRKA 1V6AA 2HMWA 1OBFO 3OM8A 2HJGA 5HJ2A 3DDWA 1BJKA 3I1YA 1UJ2A 3ORSA 2NG1A 4ZVVA 3BE4A 1K7EB 3ZOZA 2A6PA 5C8YA 5B64A 3BMNB 3OZRA 2FA9A 1GSHA 1R0RE 2QRNA 3ET5A 1HQDA 2NV0A 3ZWNA 3U80A 5CB8A 5L8VA 2D1YA 4UM9D 3LXXA 2ZBRA 4ZT3A 3EEOA 1WBDA 4YNBA 1BOFA 3DWEX 3IQIX 4C4PA 1NVAA 1FIUA 1NDUA 1UZUA 4L3OA 3GT0A 3IULA 3TGWA 5K5EA 4ERXA 3IOCA 3C3BA 1H5NA 3IAM1 4LPSA 3WKEA 4PLTA 4PZAA 1QVZA 3IEMA 5CYGA 1JVSA 1A5TA 2BI8A 2JLBA 3QM1A 4YT5A 1L7BA 5AOVA 2PUFA 1RLTA 3JASB 1W4AA 1AC5A 2JAPA 4B4UA 4X0EA 2L69A 1EHCA 2WF5A 1U7TA 2PRJA 2XMQA 1VTKA 3OA0A 3KB1A 4XOUA 3NRJA 5FOSA 1FJ2A 3CZCA 2FNAA 4X6XA 4ZOLA 3PL1A 4EH1A 1YIDA 5CYPA 4Q18A 3CJTA 5GGXA 2R6ZA 1DJQA 3UHPA 5ESDA 4MUNA 5IHPA 3BRSA 3LW8A 3U4QB 1HKUA 1Y8RA 4MITA 4YMTA 5B7QA 2V7PA 1XU4A 3PGKA 3VVLA 4KYUA 3MT0A 3W8EA 4NYMR 4KQ1A 4YP6A 4CZ2A 3ZK7A 2IQ5A 5CH3A 5AXBA 2UUAB 4GR9A 1NJ6A 4QXQA 1QGUB 3EOBI 4L4SA 4KIUA 1WXEA 4WZBE 4ALKA 1GNSA 2UU9B 2J08A 3D6TB 5CIYA 1SHKA 1SXJE 3DDNA 5KCZA 1TTHA 4EUHA 3PUXA 4TX1A 4UKDA 3SMQA 2ATVA 3WWZA 1QHFA 3H65A 3R9WA 3OIGA 5J2UF 5HKKA 3NVKI 4KPYA 1W581 4YAUA 4URUR 1KEZA 4HDSA 4ZA2A 2DKFA 5IDXA 2Z04A 1JDNA 2UZ0A 2HDWA 3Q5EA 1UPCA 2ZCVA 3S1AB 4QOHA 2D06A 3TLJA 5B3LA 4UHCA 3GEEA 4NJEA 3ZWYA 1KRXA 1RBYA 3U0VA 3L5KA 1A9QA 2XIQA 3LLSA 5DLEA 1R4NB 2DLDA 2GT1A 3ZZTA 3H5WA 1JEDA 3OBIA 3PWTA 3H7IA 3IT0A 4K81B 2P9BA 5HKLA 4JAVC 4EEZA 1UT6A 2ABWA 4PAOA 4FDAA 4JI5B 3DE4X 1PR1A 3P9PA 3HXKA 3SHFA 1LWOA 5BUSA 1GCOA 4HAZA 3C1TA 3H5IA 4RQUA 4BBAA 1P73A 4ZTUB 2I2DA 5ERYA 2GM4A 1XTTA 2R47A 5EOVA 3QMWA 4HEA1 4G0XA 1PNOA 4N8DA 4IGEA 5JAOA 2W5UA 3R3ZA 3ANXA 1TQ8A 3FNHA 1SB8A 1AG9A 1EXNA 1NP7A 1VJGA 1QTIA 2X13A 3PXCX 4FE3A 2JIRA 2O07A 2VZ9A 3UH1A 2CCJA 2VN8A 3F78A 3KWLA 1T2VA 4RD4A 6YASA 1CNFA 3QKUA 1IEQA 3CZPA 3K0KA 5EJIA 5E9JA 4F45A 3OQBA 4HDMA 4A2WA 3AJAA 4D44A 1KU0A 1DXOA 1KJJA 4D4LA 2RH4A 3GW8A 1DTEA 4JMPA 1KQOA 4ER7A 1RZUA 2HA3A 1R9NA 4QHTA 4RLQA 1EP3B 1BS2A 5CB4A 2JHCA 2K5UA 4PTZA 5AMXA 2IYAA 3SF8A 3K70D 5HCUA 4RFLA 2YQ5A 3N86A 3E9RA 2R7MA 1QBGA 1RHJA 2VCHA 2YXEA 1UBHS 3L2OB 1R3UA 1WU8A 1P5FA 1K6JA 1YZGA 3IS3A 4H6XA 3T7CA 5EXPA 4BX0A 4YROA 5A06A 3ILXA 3ORHA 1Y6RA 4QPPA 3TL2A 1A76A 1PCXA 3L6OO 4XLTA 3CO0S 3K09C 3OSUA 1H1TA 2QLMA 3R0ZA 4JSTA 4XYMA 2JZNA 2QB5A 4CWAA 2OBYA 4EG7A 1DXYA 5TS3A 4TS4A 5EE1A 1JXAA 2Q3JA 3TEJA 4C08A 3BDVA 1XKQA 4X60A 4UHKA 1IYZA 1IG0A 4W6ZA 1BDBA 1I6WA 1QIKA 5CDFA 2ZVPX 5F64A 3JSXA 3L8EA 3ADOA 4NFYA 4OMUA 3QYFA 4OB7A 4AKTA 1USGA 5A3QA 1XTSA 1D5CA 4Z8XA 3FYDA 4D0SA 1NQVA 1PDOA 1ZW6A 2ZYSA 4NFSA 4R9SA 5LBTA 1CUBA 1PW5A 2OXFA 3GCWA 3QI7A 4MUBA 1P4GA 2CHVA 2Q6LA 5HMLA 4GO1A 3UV7A 5JNVA 3FPBA 2PHZA 2YOHA 3EJ6A 6REQB 4OHKA 2IDZA 1V8BA 5M34A 3RANA 4RPHA 3LHDA 4TT3D 1GYRA 3CMCO 3T1YB 2P6PA 1L7DA 7ABPA 2EIHA 3X2EA 3O95A 2B20A 2GFHA 1UXOA 5JQGB 1ZPDA 3I4FA 1KZ1A 5IWAB 4D8TA 3IMKA 5E7JA 5FJJA 2P65A 1QOQB 2CF5A 3DTNA 1ZD9A 4ECEA 1A7JA 1LPSA 3QVMA 2CXRA 1OHHA 2G28A 4YYZA 4XW2A 1YB5A 1BMTA 1ZOSA 2Y1DA 4WY5A 5EKDA 3NLLA 4Q0MA 4GOND 5CLGA 5LQUA 3GMSA 1VDMA 1W35A 4CKWB 1LNZA 2WYWA 1X7YA 4Z4EA 2OHFA 3OZBA 1N6HA 4E2ZA 1U4NA 3ICPA 3DZGA 3P7MA 4WCVA 1I0IA 2ZRAA 4KQ2A 4RCYA 2PGAA 2H59A 3P19A 1SHZA 1O6BA 2F1OA 1H9BA 5CBKA 2AG5A 1NW8A 4MV6A 1KE2A 4FJ1A 3PA8A 5JDCC 2XOKD 5F12A 2EKZA 3DBRB 2WTMA 2VAPA 1SQ6A 4YMHA 5AVSA 3B85A 1PI3A 1DLJA 1TRKA 1DT3A 1KYWA 4LOHA 1UKCA 3I23A 5E4FA 5JAQA 1X19A 2IYNA 3EOAI 2FX5A 5GGYA 2WW8A 3DL0A 3Q3CA 4AKGA 3AP1A 3U1VA 3VNRA 1IDN1 2WF8A 5DGTA 4CM1A 5T4HA 4FW8A 2ONKA 1JKXA 3IAS6 1C2YA 5FULA 3ZTWA 3HCNA 3NC0C 4HWKA 1P4RA 4G4SO 4M0FA 2CLIB 1K8RA 3TRIA 1U8FO 2FFQA 4QDXA 3SR4A 1NC3A 2DRIA 4E03A 4PYOA 1FBTA 3SEZA 5AHOA 3RT9A 2VK1A 2QLJA 2GPNA 4GW3A 1N34B 1RRPA 3P9ZA 1KE1A 1WUIS 3NI2A 5DIFA 4O63O 3QEMA 4X63A 2A9RA 3UO8B 3K6KA 2BDEA 2HMVA 2GI4A 3CNHA 4FM9A 1QQ6A 1TKRA 3LHSA 4KGVA 4JNCA 4LOAA 2ZBUA 3DONA 1FMLA 2BTEA 5A02A 4V03A 1P44A 3LBFA 5D3MB 3Q5GA 1WDWB 4ZU3A 3TOVA 4DLPA 3VI3B 2IGTA 1KEVA 2CNLA 2A5DA 4AZWA 3BMCB 3GLIB 2QQ0A 1M54A 1N6LA 2Y0BA 3N39C 5FBKA 2EXXA 1M8FA 4L5JA 1E69A 4CF5A 1TVEA 3UM9A 4CR7A 3KKOA 4HT3B 5AW4A 1U8CB 1X7WA 2WE8A 1EVQA 2FEWB 2WM9B 3RSFA 1IZYA 1T8YA 3WLHA 1G20A 3KQVA 2I6FA 4EI7A 3ILHA 5CVTA 4B3BA 1P5RA 5MF6A 3MIIA 4NYJR 3OM0A 1SVUA 4JUFA 5TB5A 4UOEA 2O48X 5FCDA 5JH7F 1R6UA 1USVA 4H7HA 1ND6A 2BRUC 1EEHA 1PJ3A 2H4JA 2ZJ8A 3BDAA 1EZZA 4KITB 3FGNA 3L3BA 5SZKB 4FLEA 4G4JA 1CUVA 4RTRA 4CI9A 4CJXA 1FFCA 5T8KA 2O8VA 2RCYA 3NP7A 1K3UB 2OZLA 4P7FA 3N8NA 5D84A 4ECAA 4RS4A 4D98A 1ABBA 1O95C 1ZUNA 3R0IA 4ZEOA 4NPHA 5A4MS 1OASA 3D1LA 4HRAA 3IOYA 5J4YA 4N0QA 1D1SA 4RVUA 2CUTA 3DQQA 3JWPA 2EGGA 2HIHA 1MIOB 2XUOA 5FUQA 4L08A 2F3UA 2GPYA 3CKLA 5LB2A 3MJSA 2NXCA 3E7WA 1YQGA 3D1JA 5KSOA 1HOXA 3U62A 3COZA 3HJBA 2YXLA 4KPFC 2X15A 2CYAA 3NU1A 5C5CA 1G55A 3OPXA 1ZX1A 5ITZB 1RC1A 3VR6A 3TLGB 5KC9A 4DUYB 5EJMA 3IPCA 3CNOA 4C88A 4YCSA 3OUUA 2P9TA 2XD4A 4LHXA 5DX0A 2ZSHA 4DJDC 4OQQA 1Z25A 3DOUA 3AY0A 4AURA 1N6PA 1DBVO 5FAXA 3R7DA 4EKNB 1DG1G 1XYYA 2I4NA 2MSWA 4FYWA 1I36A 3JYQA 5G3ZA 2C2HA 3IQZA 4LMPA 2WWXA 4IP0A 3RADC 4OBXA 2PT6A 2WZBA 2NU6B 3HYCA 3M9XA 4Y3UA 5BO5A 3HA7A 2EP7A 1VG1A 4UD2A 4HNVA 2ISCA 3QVWA 4C1NA 4EGSA 4A3SA 5CVDA 5EMNA 4EUNA 5KOHA 1NUSA 2DUNA 3KHKA 3EPRA 4I46A 5CT9A 4DUZB 3H4MA 4YP5A 4G09A 2IPAB 1FJGB 3OEED 3E18A 2V1UA 3B1JA 4DDMA 3ELDA 2KBFA 1DCMA 1Q44A 4C0JA 3K9LA 4OREX 2YHIB 1CWUA 2JLUA 3D3JA 1SCUA 3T12A 4DA4A 4ENVA 5EJFA 4HLUC 1DIOB 4PQFA 3LQYA 4FQ7A 2CV0A 4LE2A 4NBKA 4H6PA 2AG1A 1LPPA 3NHUA 4EG4A 5I6DA 3LUBA 2QP3A 1SU8A 3K96A 5JDIA 1QH8B 3EZYA 3AR9A 4O4IF 4MRMB 4OLHA 4W7IA 1GR0A 1CHDA 3RRYA 3BQMB 3PNPA 4PNZA 4ZXPA 3A36A 4C6TA 5L51A 3KEFA 1G8SA 4YS6A 2G6BA 4IGAA 2SKDA 1GARA 4LGYA 1Z35A 2FN3A 1NOKA 2X23A 3IQWA 4Q3EA 1KJNA 4F6RB 1I2BA 2J3KA 3AIKA 3PF9A 5JNTA 3EUWA 1E9RA 3VC2A 2GJ9A 1AN9A 4IFIA 4PIMA 3T35A 3W5UA 3SGLA 2O8DB 2BM8A 1EWKA 1WB5A 4TROA 3RSOA 4G26A 1E1MA 1W2WB 3H9UA 2WHQA 2O2XA 1NW7A 3WNVA 1FRVA 5CEFA 4GZ3A 5JPIA 2NQ8A 4F3TA 2LIPA 4Z1MA 3ISTA 4NNOA 3SFVA 4LF4B 1TRHA 2HLDA 2BL4A 4ADSG 1J9EA 4R0VA 4RU1A 3WNCA 1B6TA 1ZH8A 3AK4A 3IR7A 4RJIA 3EEYA 4EVRA 5LM3A 2EZ8A 1NI5A 4J94A 2NAPA 1T2AA 4FC6A 2OAQ1 2JKYA 3ZCPA 4BLRA 1ULUA 3LVQE 3AG6A 3OZFA 5ICFA 1KTIA 3K2BA 5IUKC 1GZ7A 3KT8A 5LZ5A 5DHTA 3UH0A 1YZ3A 5H3CA 2C98A 1UJ5A 2PV7A 2QRPA 5EJ4A 5K20A 3UMBA 1VPWA 2PUGA 2XZLA 5FOUA 1VPDA 1ZCAA 5E9WA 3ESQA 1X1CA 2IOHA 3MEQA 1DO2A 3MUFA 3WLKX 1E63A 1ZM3A 1U6IA 1IVSA 3JAKA 3V1UA 3AI1A 4RK6A 3G0BA 5IP5A 1A5ZA 1CQJA 3KVRA 4CV0A 3IFSA 4D4MA 1UEIA 4X3PA 5D7BA 1UXKA 2HBYA 1NZFA 1V9SA 2ZTUA 3CUVA 2W2MA 2OV4A 3T4XA 1CY1A 3N2ZB 4DXDA 1I4TD 2WQZA 1GN8A 1B73A 1X8JA 1TUEA 2Y1OA 2ZK7A 1N1DA 4E7OA 3ZLVA 2DXIA 2YVKA 2CD7A 4KWHA 3T9EA 2PRIA 3RYFA 3X0DA 1B8NA 3F5MA 3DE0X 4BFTA 3I30X 4Q3AA 4FN4A 2JGJA 3VZDA 4GOJA 3N2EA 2FRXA 1NURA 1BXKA 2X42A 3A2NA 3EVEA 5IKMA 1T4BA 3CS3A 2H63A 2Q4OA 5GV8A 5JAPA 3IPYA 1DCFA 2O05A 5F52A 4AVYA 4EITA 5J2TB 3L1IA 3PDIA 1BVYF 1P61B 3VISA 3ANLA 4MW2A 1K0UA 4XLZA 4JV5B 4GZMA 2XUHA 5FWYB 1E1LA 4JLSA 3WFZA 5LYYA 4YUYA 4RZIA 3RABA 2VNIA 3V3KA 3P1JA 2OG2A 4EABA 3G8DA 1Q15A 3A31A 3NIDB 2HSGA 1JQ5A 4JVOA 2A84A 3RC3A 4B4VA 5EKTA 3PQCA 1PQUA 3GA0A 4H3HB 3KXLA 3NC1C 2Y0CA 3K15A 4GMHA 4PYMA 3K8YA 3AIOA 1Z15A 2D13A 4HBZA 3UK6A 1GEEA 1J8QA 2MOKA 4GP9A 3SYRA 5BWCA 4MS3B 4E46A 4WINA 4UTXA 2Q8PA 3CUSA 1OFHA 3OCYA 1I3MA 1K9VF 1QIFA 3QNWA 4G0VA 1CUUA 3EEFA 4NAHA 5AVRA 1BD4A 4ZPJA 2IS6A 3IQGX 2OUKA 1M1NA 4FKMA 3X1XA 2HSWA 3W06A 1KVRA 1BWQA 3B5JA 1SC9A 2G88A 3AEKB 1A2KC 3GVHA 3I9MA 2JHAA 3P4XA 4LY6A 4N3NA 5FPPA 2VNKA 2JC3A 2AJCA 1K4YA 1TI7A 3EVCA 1XYVA 3S2FA 4B6RA 4B73A 4ZAFA 4GOKA 4BYMA 4EG8A 2OT3B 2GK7A 4C14A 4DJFC 1E3MA 1MC8A 3GLFA 1H2EA 4RL4A 4MMZB 1PR6A 5G0TA 3R76A 2CMHA 1GKKA 4H1UA 2OM6A 1MA0A 2NUTA 5E6SA 4C5CA 1B15A 4E5MA 1ABFA 1FS4A 1P4AA 1TYEB 1LBTA 4YHHB 2JFOA 2OTCA 3FPHA 4L76A 1Y80A 3SJZA 1CSEE 3ZE2B 5EL0A 3OQJA 5C1BA 2QENA 4AKEA 3A1TA 5M2QA 5TSDA 3DCIA 3GARA 1NNI1 2FG7C 4PONA 4RV5A 2ALJA 3KSRA 1DAPA 1XALA 3GLHE 4L22A 4NOLA 1O94A 3IUPA 4RTLA 5JZSA 2KPOA 2E4YA 3IEIA 3U3DA 5K3AA 3OFKA 4CMEA 1LD3A 2DUJA 4K1XA 4M86A 3TTXA 4FZJA 5C80A 3DL7A 1U6KA 1VHLA 2G77B 3KXDA 4LWOA 3F90A 3VZBA 1G7TA 2R85A 3DL4A 3CRW1 1CC1S 3NHRA 4YMVA 3EFHA 1GGMA 1R66A 4MJ3A 4PO9A 3CKKA 1YBAA 1ZGHA 1R5JA 3NNNA 4FBMA 4BJ5A 4DV4B 3NW9A 4BVFA 4C1BA 4TVSA 5JTUA 4JSRA 4L27A 5AW6A 1RAFA 1NI4A 1ZSYA 3CG4A 2V59A 3IAM6 2Q8QA 3QE0A 4G86A 4MI3A 4UMEA 5T4BA 4QUJA 3TZLA 1N57A 3CNBA 4Y2GA 1GTG1 3DPSA 2X5NA 3LCCA 1Q1AA 2P5SA 1BVUA 3WJ2A 1FNBA 1RI5A 2VDKB 2VTDA 3I8SA 3MWEB 3O4GA 4Q1BA 4S12A 2NU9B 5CFRA 4MVJP 5L95A 2E21A 4CEJA 2YWJA 1O5IA 2VP3A 1EBFA 3E5RA 2P4SA 3DEAA 4E51A 5HJ7A 3L7OA 3O2NA 4P5PA 2PWAA 4D99A 4MINA 1KL7A 2PWZA 2HYDA 3IQDB 4KMSA 5CT5A 1S3GA 1G9XA 1OHHD 2HPVA 4I6JA 4NHOA 4OH7A 4F71A 4AJ9A 1D7OA 1T2NA 4PQYA 2IPMA 2JVIA 2PR2A 4JR1A 4E88A 1KPIA 1RVV1 1DHRA 1WDTA 3UF0A 4D4GA 4MWBA 4B09A 3LZCA 1YJAA 2J3LA 2RH5A 2ZJFA 1OAKA 5EQJB 4U2FA 5B53A 4PIPA 5JRJA 2GN9A 4QUGA 4IBOA 3OZAA 1XNQB 2FLVA 1SWWA 2Y8EA 4TXMA 3Q3JB 4GAEA 2NSLA 5AXAA 1QKJA 5JTTA 1RQPA 2PYDA 2C7PA 1KI4A 1PBTA 2A9QA 2YCBA 2XYHA 4ZKEA 3PUIA 2AX4A 4C4ZA 3LQFA 5CVEA 4Z2AA 2IIVA 1GQYA 1TVKB 1VBMA 1WVGA 4W6QA 1N9KA 1FFHA 1Q6YA 2FRVA 2PSEA 4N49A 4LA4A 3I45A 5GJCA 1JEOA 4A0SA 1IJFA 3AFIA 1KSFX 5HPYB 1LDNA 1Q0LA 2PA0A 1DWOA 1KQFA 1QHXA 2QSYA 4MEBA 2I99A 1NG1A 5LWHA 2JCSA 1U7UA 1XDBA 1YQ9A 3WMXA 2JFZA 1XD8A 4ZCSA 2AX3A 2IEAA 1QSGA 3FN4A 3N58A 3S1SA 1NUAA 4NK4A 3P2YA 1II9A 4J6EA 4R2KA 4WLUA 5B2EA 5BPFA 1ISIA 1J8FA 1Y9JA 4NMHA 1KVTA 2XF2A 4LX0A 2NUPA 3KJIA 4J8PA 4O4JA 1I14A 4LZPA 4LOJA 1KERA 1R74A 1RE0A 3EXIB 1W48A 2W4QA 1G64A 4M0PA 4QVKA 4CT0A 4IS2A 1NKSA 4DIBA 4AUEA 3EX7C 3P9KA 2XJ4A 5CYOA 5KYWB 2IK8A 4EQ6A 3DA8A 4BMOB 1EFHA 4QLBA 4LJ9A 1DWQA 2B9EA 4W4TA 3G89A 3X1JA 3E5MA 3REGA 5JS1A 2X7HA 3QKRA 2JGKA 5FBLB 1RPNA 3AFOA 2AVNA 4DLTA 3AGPA 1CEXA 1PHRA 2PV0A 2WMDA 3C6YA 5FRDA 4AJPA 3A0RB 4B3GA 3T5DA 2B99A 5B4VA 1JU3A 2VXCA 2HQBA 3WA6A 3VH1A 3CVVA 3LT0A 5EHQA 3YASA 1CF9A 4CM8A 4TMFA 1R18A 1M6HA 2Z4SA 3A9VA 4YV0A 5CXXA 4OMFG 5D51S 2YYYA 3MJTA 5EQTA 4AICA 2A35A 2BGKA 1TQDA 1M0TA 3I28A 4I5IA 2Q2OA 4KNWA 3SXJA 1UKZA 3THSA 3VSCA 3EVAA 3OQIB 2OQIA 2D2FA 2L0XA 4WMLA 2VHJA 4MI9A 1DAIA 2GNOA 1JQAA 1ADYA 2HCTA 3STWA 1WJGA 4IRMA 5F2NA 2R25B 1EFKA 5B3JA 4EDFA 1OFGA 4UDOA 7MDHA 3W5CA 1TC2A 2PTGA 1RHUA 3N2GA 3ON5A 1MO6A 3OIWA 5AESA 1W36D 4FEYA 4QEKA 4LNHA 3QPCA 4PGHA 1EFAA 4W8HA 4BVEA 4P4GA 3RGWS 5IC4A 2R6R1 1Q7CA 1Q1ZA 3NWOA 5F5LA 3MWDB 2WVGA 1QVAA 3E0XA 5CTJA 2CXHA 1Q22A 1YCDA 2I0FA 2Q9BA 2ZJ4A 4Q05A 4IHKA 4TZKA 4FPXA 1C9JA 3KFXA 4GIBA 3SOZA 4PLFA 2OG1A 2VYCA 4KE6A 2WA1A 2IPNA 4KQCA 4EGAA 3DMDA 3KFLA 1FVOA 3G68A 2EHDA 3OLXA 2WFMA 5EIBD 4LF6B 1PDWA 1XMXA 3U7RA 3RJTA 4QDZA 1SBQA 3EGXB 3WLSA 4KLNA 2XYGA 4GSKA 2RG1A 4PX3A 3TCXB 2F1HA 3UB4A 1SOUA 1IHYA 3NHBA 2OK8A 1PTJA 1UBLS 3LDUA 1IIBA 3SZUA 3AF4A 4PIVA 1JG4A 4ME6A 4Z9BA 3DGEC 2YIMA 3Q7SA 1X7XA 3WXBA 4A2QA 3VSBA 1UDBA 1XLUA 2ZJ3A 4G8DA 5K0EA 3NYWA 5JI2E 4MA0A 4GR5A 5KYUB 5K1ZA 1DAGA 3SPXA 3QLJA 2JANA 3UW3A 1AUQA 3TDKA 3TNDA 1KOGA 3EUAA 4GFDA 5CB0A 3BMXA 3HJFA 3VU0A 4BZPA 2GM9A 2ZUVA 3AVPA 1U8EA 5CFQA 1ISFA 5CA0A 4I5GA 4Q15A 3L07A 4MUHA 1HV8A 2PVPA 2XAUA 1UJ6A 3JATB 4TL9A 2UZ1A 1FTGA 3DMTA 2BP7B 1OSNA 5GOTA 5J47A 3MJFA 2WKWA 4OP1A 2GSDA 1JW9B 1UFRA 1IOWA 1PJTA 2GK6A 3BXOA 3QU7A 4UHBA 5EZ6B 2YOFA 4M0DA 5P21A 5THXA 5K09A 1YBFA 1A77A 1Z4IA 2WSYB 2CFOA 3DZFA 4XM1A 2WB2A 4CR8A 2Q5IA 3SZ3A 4XGNA 4DDHA 5IASA 4DBVO 4O33A 4JB0A 2DPLA 4BTEA 3I76A 2DJ5A 3FTPA 1JGTA 3SHWA 3G6KA 4ITUA 1ZL2A 3WIDA 1G5QA 1K27A 2JAWA 4Z0HO 2ASVA 1O89A 3DHEA 3ZY2A 4GL2A 2OYRA 1RQXA 2FFJA 4WERA 4DJEC 5JNLA 5AUQA 2AOXA 4GYWA 1DAHA 1HEUA 1P4HA 1RU3A 2ID7A 4Q1CA 1JTFA 3UYLA 5BQ3A 2BPOA 4W5TA 3D3WB 3D1VA 2IHZA 4IDNA 2NPIA 2FZCA 2PTHA 1TPZA 3HDTA 2JEYA 3EOZA 3HEAA 4AG6A 2HLDD 2XT0A 4XUGB 1DEAA 2VUSA 1PWZA 2VUIB 3WK4A 4CM9D 5IHXA 2GZ2A 2WDZA 4MVJA 2KS6A 2BSXA 2IE8A 3BZBA 1OXTA 1ECPA 2H29A 2FPKA 4IV8A 4BPRA 4J6FA 4JBLA 1SC3A 5K4GA 1UIMA 3D3NA 4AYWA 1FFGA 4D3SA 2JVKA 2IYOA 4WKGA 3UYKA 3SS7X 5EIFA 5HG0A 1W96A 3RJ9A 1RYYA 1Z5VA 1CIPA 1E1CB 2QNRA 3KYCA 1FYFA 4CEIB 1TYBE 3AM5A 3W6PA 1DBWA 2ZYWX 5A3RA 1X1TA 5BSUA 4HQ0A 2PEZA 3IDSA 3MCZA 4CQLA 4UVIA 2FWAA 2HWYA 3PQ7A 2J3JA 3ZU2A 3ZJ4A 4DUPA 4LW8A 1E7RA 1F5NA 3CN9A 5TQ2B 3U3JA 1GILA 1NGSA 1KDPA 4HDNA 4PGGA 1Y7HA 1O9BA 2Q7DA 3UJ6A 4BO4A 3H1TA 3VDXA 1SELA 2OV3A 1MD9A 3FHLA 1T5OA 2P30A 4EJ6A 1RTKA 1SVIA 2Y3IA 4M3NA 4CHTA 2OL4A 2AOWA 1UCFA 2ZJYA 2VQSA 4U7DA 1ZVVA 2XXAA 1GPH1 1PGNA 1U2SA 2C4NA 2XB4A 3NEPX 3PBKA 1QYIA 3BBPA 2ZXFA 5KKNB 4MHTA 3OOSA 3T5GA 3GAMA 2JIOA 2X5OA 1A7AA 1KH2A 3F74A 3NM4A 4I55F 1HEIA 5FWAA 2DMRA 4RO0A 4JT8A 5BN5B 1V26A 1KZHA 3HJRA 5DU2A 1A82A 2X0DA 4M8LA 1W1WA 1XL1A 2OFFA 1JQKA 2CJFA 3QW4B 5KTRA 2NVWA 3GF4A 4HD8A 4QYIB 3CNNA 2CLSA 4DLAA 1K7XB 4UVDA 3AVUA 1UZNA 3ACDA 3H75A 2BEJA 2GWHA 1IOLA 1VIYA 4HKTA 4P98A 1CRQA 1L5KA 3WWEA 2EC5A 4NU8X 3W2IA 1U9YA 1KYIA 2AMYA 4JR2A 3RBZA 4CYMA 1TO1E 1KS9A 3HFJA 4GOOD 4KRFA 5KQMA 1JDBB 4N7RA 4CF3A 3PEWA 5EJ8A 3AG5A 4YRFA 4PC2A 2VTBA 1JHYA 3NXKA 1HYGA 1VXRA 4HNQA 1XTIA 2VPPA 4F56A 3RUEA 2X19A 4WGFA 4D92A 1B74A 1GPNA 3ZVLA 3DOFA 4KXUA 2JHGA 2OV2A 4Q4JA 5F4ZA 1T5DX 3PI7A 4GKKB 2PSDA 3DWGA 1QNFA 1SD1A 5KX5A 4RK1A 1C3OA 4WXPA 4EYOA 2RGDA 1ANKA 2ZUCA 3WTCA 4OI1A 4RPLA 1WP9A 1AK9A 1VB5A 1ZN9A 1KBOA 1YCGA 4XWGA 3MGGA 3U4DA 3PFHA 3TR6A 2JZCA 1SOWA 2BGTA 3CT6A 1QF7A 1X80A 3KKMA 4D8VA 3LDFA 1N2BA 1SFRA 2OD7A 1KK2A 3VDQA 4J0KA 1NPYA 2RHWA 2PUTA 1KJQA 2BGRA 5BYJA 5DYIA 1C0KA 3QK7A 3QLEA 3I1IA 4H3KB 1HL7A 4RKEA 2NZUG 2XWPA 1Y4DE 1VDZA 3VR6H