1IWBB

Crystal structure of diol dehydratase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIOL DEHYDRATASE alpha chain
publication title Substrate-induced conformational change of a coenzyme B12-dependent enzyme: crystal structure of the substrate-free form of diol dehydratase
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 60
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2002-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1iwbB00
1DIOB 2D0PB 1IWBB 5D5QA 1EGVB 2D0OB 1EGMB 1NBWB 3BRCA 1IWPB 1MMFB 3WB1A 3WB2A 1UC4B 3WB0A 5D5PA 1UC5B 1EEXB 3AUJB
chains in the Genus database with same CATH superfamily
1C1HA 1JEEA 5H59A 1EDDA 5C3MA 5LMNB 1Z75A 1KK1A 2IHUA 2X6RA 4HLQB 2D0IA 3LCMA 5HM8A 3ONFA 1JDSA 2Q2QA 4IVNA 3N59A 5B53A 1PJCA 2BFAA 2PQMA 1PR4A 5B7GA 4CN9A 2KHZA 2SCUB 2VLIA 3DM5A 1B8UA 3FGOA 2NV2B 1VI6A 2Q0QA 1JMVA 8OHMA 2E5LB 3OT4A 3PYLA 1LLUA 1WDKA 4MV3A 4HV4A 4AZVA 2C2MA 5CIYA 1URPA 3FNGA 3QY9A 2W0MA 3KPWA 4DWWA 1TIPA 4YMUA 5JNWA 1KWGA 5M04A 1UDBA 1FA9A 2AJLI 4QFCA 1F4PA 3R77A 4Q82A 5GJCA 3TK1A 4LUCA 3AKZA 2ZJ5A 4WOBA 2OVFA 1RJFA 5CDUA 4ODIA 2BFPA 1WXEA 3VU8A 4AC9A 4F4DA 1NMZA 2V74B 1MVLA 4C2BA 1ZGBA 3WMRA 2HK7A 1MX1A 2IYZA 3LUFA 3K05A 1AHNA 1QX4A 2CVHA 3H5OA 3IT0A 3VTFA 3NVMB 4KEAA 3PE3A 2PX8A 5GPBA 3W8NA 1N7JA 4X1IA 4JJ7A 2CJWA 3UMYA 1UZAA 5JYDA 3CUTA 4PIPA 3R1IA 5TQ2A 2IVZA 4ZCTA 2YV1A 1P2FA 1XFDA 2RKBA 3R7NA 3WL5A 1TT7A 4GOXA 1N92A 2H52A 4U7HA 4WFQA 2BGWA 1ZRNA 1W4AA 1IMJA 2N47A 4NDNE 2VZLA 1F6WA 4RTSA 4LYYA 2C1XA 5BSRA 2ZBFA 4P4UA 4UEJA 2ONYA 1CEEA 1QMPA 3CH4B 4W5OA 2C8JA 2HEIA 3FKSA 4DYVA 4KLRA 4YRGA 2LW7A 4DJFC 5KB3A 1KZGB 3EGOA 2R5FA 3EF1A 3MFYA 4FXOA 4B87A 1ST3A 2Q3BA 5A05A 1NN1A 4TV8B 5K0CA 4LNHA 5CA0F 5L4LA 3REQA 4EPRA 5AVYA 3OE7D 3RS0A 2VL7A 2W6NA 1EFCA 3ZD8A 3MBIA 2O0KA 3KYJB 4L16A 2QSUA 2D8MA 3I4FA 4XM2A 5IHXA 1HFWA 1QB8A 3OCVA 1KWKA 4NXMB 3VYUB 2I6FA 2HQSA 2OCDA 1RYMA 4PPFA 2AOVA 1X7WB 2VSYA 3O8QA 1Z4IA 3OZXA 3TTXA 4GKVA 3ZS9A 3L8EA 1J70A 3SQMA 3HCPA 2C4MA 1WBDA 1JEYB 1DBWA 2WMYA 5AVUA 3IUYA 2VP5A 3NBZC 3IP1A 3EVCA 3RD5A 4X9XA 5KQLA 3ZLUA 2R6CA 4OREX 2HCFA 4N3BA 5F35A 2GZ3A 3IUSA 4YJHA 3U7HB 3CF2A 2PZKA 1PR2A 3B38A 2CFSA 4RJ2A 4QUAA 2IHJA 4I4CA 4FJ0A 1L5NA 4BJ3A 1T6YA 4NXNB 1GG8A 1EFRD 3OY7A 5FOXA 3OPYB 4CTKA 4XSGA 1XYYA 1NATA 3V1TC 1MXFA 5IC4A 4QAJA 2R1UA 1IIRA 3T1VA 3NDJA 2C97A 1YE8A 5TMPA 3KXPA 3HUDA 4MPDA 5J40A 1E5XA 3LBHA 1MC4A 3MQ4A 4MB0A 2GVNA 2UYQA 3R0ZA 1RQPA 1K88A 1UKAA 2AQIA 1BEZA 1Z15A 4HB2A 1KXJA 3BTSA 3F78A 4S35A 4MWSA 1PGNA 1OROA 5FR1A 2AX3A 3BXOA 1FNMA 1FRZA 4J8PA 4N6OA 4PONA 1QGED 1NQWA 1VPEA 4J0IA 1ZI6A 1UMCB 3E70C 1Y1LA 2JRLA 3DDOA 4B44A 3KJEA 1VP9A 3GGCA 1TK9A 4ZAZA 3RSQA 3THRA 5HIJA 3I5AA 4LA4A 3TR0A 4DMFA 4QVGA 3E23A 3H2IA 3EY4A 4YAWA 2XB4A 2WHPB 4ARSA 3NYQA 1TAHA 1QS0A 2P5UA 3V4FA 1VLLA 1R0BA 3QA3E 5G4KB 3UXEA 1UH5A 1DIBA 4J0CA 3ZKWB 1GJRA 1H4TA 1JVSA 1T35A 2BHLA 4KJZA 4Q9JA 1XZKA 2ORED 3V7NA 3RM3A 3QF4B 3HGTA 4PYIA 4KVFA 4HVTA 1Y1TA 2WB2A 1XQWA 4P84A 1C7FA 1R0LA 1XQYA 1DADA 1ZUIA 2OZLB 3B6EA 4FFDA 1THMA 4PZLA 3AI1A 1I14A 2ODQA 1AKEA 5FJIA 3KT8A 4PLPA 4U00A 4AN4A 1VKRA 4RWZA 3TKAA 5I51A 5JATA 1P1BA 2Q46A 3VYVA 1X7XA 5JC8A 1AXGA 4C88A 1PYDA 4CV3A 3STYA 3GZTB 4F97A 1ZOSA 2CHGA 1UKVY 1YDWA 4FYJA 4I1YA 5B4TA 5M2QA 1ZI9A 3DHWC 4V0KA 3K9NA 2PQ2A 1E8MA 2NN3C 2XEXA 4IH1A 4UTOA 3UMSA 1GQQA 3D7RA 5TXGA 2B34A 1M73E 5DN9A 4FOOA 3WLAA 1TW2A 4E7PA 4E51A 2IS2A 1BA3A 1THGA 1LPBB 3EZ7A 3RIHA 4K9OA 5CTJA 2ECFA 4YQEA 1QKIA 4LQDA 3GFSA 5IVKA 3EZNA 4EY5A 4G1MB 1KFCB 2Z83A 3HZRA 4ESHA 1XHFA 2BEWA 3G5LA 3RH0A 4YACA 3FGZA 3V2IA 3TX6A 1CVIA 4LDPA 4MHTA 1ZQ1A 1JHUA 1HDYA 2BGJA 3UO8B 2J7KA 4OLFA 2CLSA 5F4BA 4D9MA 2J7PA 3CWQA 4KRYA 2C3PA 1JDPA 2QIPA 3FLMA 4C4SA 3O74A 1Z6PA 3ZYZA 1QGDA 3GP3A 5DTIA 1U2PA 4AMUA 1IDN1 2ZBDA 1MJNA 1VHQA 3BN3A 2ECPA 1I7DA 5EWLA 2W00A 3Q7SA 2HK8A 4FHCA 2D4AA 3I73A 2PX6A 5KYTA 3HLYA 4TYNA 5AKHA 3X1MA 1WR8A 2AYZA 4O4JB 2A0YA 3FYDA 5BUCA 3SZMA 1OBCA 5KCMA 2Q28A 1QIIA 4B3JA 1QP0A 5H70A 1Q95A 3DKPA 2O7QA 2Q5OA 3R8FA 2FUG6 3SICE 2CFCA 4Y9DA 2Q0XA 4MJ7A 2C58A 1XE3A 2CDNA 4IJ5A 3VPCA 4E33A 1NRWA 2WF6A 3H4VA 1H2YA 4FUQA 4QO8A 3A1DA 1BMFD 5KHAA 4DPLA 4Q6BA 3ROGA 3VBCA 3WYCA 3RABA 3I9V6 4DTCA 2ZRIA 3GLIE 1PU2A 1YVRA 1K06A 5AJXA 3W5CA 3WNBA 4PYRA 2HMVA 1CP3A 4TYQA 4M1ZA 3U80A 5HGXA 1EKXA 3QNUA 3RF7A 1GLVA 4EECA 1SKMA 3WFJA 3T4XA 2QX9A 4YLYA 4HL6A 1ENOA 2NVOA 3TAHA 4CWAA 4DVGA 5I7UA 3U3MA 5ALOA 4OX9Y 2W2KB 3RASA 2H54A 1YDEA 3VKVA 4K0KB 2GZDA 3FPBA 1V3QE 4NBWA 3MT9A 1Q3KA 2YZKA 4NJEB 1Q15A 1B7GO 2E6KA 1HTWA 2VK1A 1MQ9A 3SYNA 4LNAA 1JIUA 4D99A 2SKDA 2PLAA 3MJEA 3KQSA 2NADA 2PSJA 3V2UA 1G18A 3C1TA 3NXSA 3KOWA 4BKOA 1X7ZA 2JIBA 3LT1A 2B3TA 3Q3VA 1SZJG 2OPBA 3NO4A 3LRXA 1XTZA 2B6HA 5CVUA 1YBHA 3NHYA 1UKYA 2YCBA 4A82A 4YJ2A 2Q3CA 4PSUA 3O2QB 4MICA 1BW9A 3RRYA 3DHVA 4R05A 2JFUA 1ZRMA 1PT8A 3NBUA 3ZY5A 1M6VB 1C8VB 3B8EA 3LUCA 1Q1GA 3TXAA 3RYCA 2IXTA 3AI7A 5LQNA 3WYAA 2JAOA 3UHPA 2QT0A 3MRXA 4HFJA 4C3VA 2CD7A 4WBSA 4W82A 3VPBA 2GF2A 4MKFA 1Q1ZA 2W98A 2Q2WA 3GGOA 2I3ZA 3NJ4A 4EHJA 3OM8A 2GPWA 3K6SA 1MABA 5CA1A 4Z4GA 3DDCA 5AUNB 1V3UA 4BX8A 1J0AA 3EA0A 3KJGA 4EQ6B 4X90A 1UXKA 5EIXA 2PUAA 1DPGA 4I46A 5AW0A 3AP1A 4OP2A 2QUIA 4DLVA 1SKYE 3DAOA 4LV8B 2ZRDA 4IUYA 4BP1A 4KIWA 2PGAA 1KH3A 3NWJA 4MOWA 4DTIA 1E7RA 2IYSA 4O5AA 4KQEA 5KJCA 3KPVA 2EXXA 3AJ9A 3IMCA 3BS4A 5LKAA 3OLYA 4A27A 4CF7A 1MHTA 2NT3A 2BKAA 1GKLA 2ZVPX 4UNIA 4MW1A 4W4TA 5FWYB 5CDGA 1UWLA 4CJXA 1U2GC 6PFKA 2I62A 3BIWA 2X7JA 2G5CA 4JLSA 3PYXA 2ZAIA 4JI3B 2C3OA 2PTHA 1TF7A 4UU0A 2YWFA 2YQ5A 5FFFA 1AMNA 3A6HA 3KZCA 1GRCA 5HFNA 4IDPA 1FFDA 3RROA 4FIDA 4GM0A 4LY3A 3AR2A 4DC1A 3DW3X 2NV0A 2FR8C 1KMIY 2KMLA 3HDQA 4HH0A 4KFCA 4UAGA 3QEKA 1G9XA 2D62A 4MGZR 1QYCA 1XLUA 3AONB 1JKIA 2XYQA 3L46A 4KK3A 1HNXB 4MYCA 3P1JA 4OK5A 2OSVA 1XD2A 4YYEA 4P5PA 3NIBA 1I4WA 1X1EA 1VMAA 1JDBC 2I6GA 4QJ4A 5HM6A 1VXRA 3IA7A 4E5YA 5SZIA 4PWZA 3D0KA 4O63O 3BGWA 4EFMA 1X15A 1XCGB 7REQB 1ZK3A 1LLFA 1I10A 1YZTA 4CIWA 2Y1OA 2OPHA 2HHHB 3C5WP 4R1NA 3KDSE 2VRBA 3FI0A 2VUHB 3PCXA 3B48A 1PZMA 1HYEA 4DMKA 2VQEB 1QIDA 2QVGA 5BURA 1EXNA 2J0UB 1YU9A 2OBXA 1QLHA 2XZLA 2BH9A 2ZBVA 4XVRA 5AOVA 3REGA 3KB1A 5BYBA 1RQLA 1NJ5A 1EVKA 2COEA 2M6KA 1IJFA 3OETA 2D7JA 1JYEA 2EOAA 3N2KB 2BFCB 1JEDA 2HV8A 3HQ4O 2AC7A 4QYTA 1ZZEA 3NASA 5D51S 5GZ6A 4YX9A 2INGX 1ZC3A 2R66A 3G8AA 1KDRA 4HBZA 3ZY6A 4JLKA 1IAQA 2GRAA 4RKFA 1I4OA 3D7KA 1T26A 1Q1EA 3F9CA 3EIFA 3SKXA 4RF2A 1F0NA 4LS3A 1FJXA 3IAAA 1QH1A 2NU7A 1T6BY 1J00A 4GPIB 3THOA 5DIZA 1WXGA 1XD9A 5FWDA 2Y1FA 3TTSA 1MN6A 5T57A 1X1RA 1YB1A 2GEVA 4P4TA 1K0FA 5AUQA 1WHSB 1RHRA 1TB4A 4DLTA 3TG8A 1IBKB 2XSZD 2O19A 4IH9A 1PTJC 1ZM3A 4JL8A 1EDEA 3DD5A 1FFXA 4FSXA 1N6HA 4GDMA 3AMVA 3CJRA 4M0FA 4MA5A 1ZQ9A 3EWNA 4HF7A 4RKQA 5TF0A 1Z36A 2W6CX 5JH7A 3QKSA 5EPOA 4G9EA 1YS7A 1GT91 1HA3A 3JY6A 2AZDA 3D3WB 3ZHQA 4F1WA 2AR7A 3PJRA 1YRLA 1AD2A 2O8BB 4CMGA 1M5TA 1VBKA 2BBSA 2GYUA 3EC2A 1ZEMA 1VLJA 1RXCA 1ZDMA 2XVMA 5TMDA 1YR3A 3EK2A 3UMCA 1ELOA 4DBLC 2VF2A 1VMIA 4EK9A 2X3FA 1LBQA 2GRUA 5DMHA 1POWA 4QVKA 4RH1A 4UZSA 2BLLA 4IDFA 4RSGA 3L8ZA 3S7TA 5EJ5A 1C9MA 4HNGA 2WJ4A 1FTWA 1QFYA 3WHPA 2ODTX 4HATA 4H7KA 3BXPA 4FJ1A 5CLIA 3ZJVA 4KBGA 4DQ0A 2RHOA 3FH0A 2EF0A 2WTNA 2JI6A 4FMDF 5TS2A 1F3OA 1VYTA 2KPOA 3O8DA 5EXSA 3S40A 4QGSA 2PGNA 1Z25A 4QTTB 1DZ3A 1GGMA 2A33A 2A9KA 4XIIA 5A3VA 4G8BA 3FGNA 1J2RA 4G4SP 5K0LA 1DIGA 2XD4A 4O2RA 1E77A 1OFHA 2WK1A 3D1VA 3JASB 3PDHA 4MP3A 5FO1A 2CXTA 4G0NA 4EYKA 4Q3LA 5L95A 5J1SB 3EH1A 1BE6A 1HOXA 1XPJA 3GVHA 4FNAA 4PG6A 4EF6A 5ABPA 2GM3A 4Q9DA 2IA5A 3VR4A 5HQ3A 4UUQA 1T43A 2JVKA 3E05A 3DVRX 4FR2A 4C05A 1D1SA 3GQBA 3GPBA 3QUCA 4GW3A 4O2BF 3DCIA 4XSHA 3AFOA 1T25A 5IMBA 2ZUBA 3RRXA 4CXMA 4MCIA 4S1VA 2VO1A 3TDNA 3W9UA 2B25A 2ZSHA 3GMIA 4WFKA 3AYZB 1J06A 5EINA 3CLUC 3CNOA 2PUTA 2A57A 4IG9A 1B42A 4C3UA 2FCAA 3JQCA 1SIUA 3QWAA 2JLRA 3AJ8A 1Y7IA 3JZMA 3DGEC 5TGZA 5IT5A 5JIBA 2QU8A 2R8BA 2R7AA 4YUYA 1W4CA 2BFOA 3GP8A 3WZ2A 6REQA 1K4MA 3G49A 5KQRA 1KPHA 1JR3E 3AR8A 4PGAA 4YJDA 3ROEA 1P91A 4LMPA 2CXUA 1L1FA 2EG9A 3FPLA 4MUHA 3C4JA 1JL3A 1FLNA 1T0HB 2J9ZB 2X8BA 4NNJA 3OZGA 4IIFA 1VQ1A 3E61A 3FLEA 3Q2IA 4EJSB 4JI4B 1CQJB 3THSA 4O4LF 1CFZA 4UQLA 1C14A 3CRVA 5COAA 3H8WA 4HDRB 2BMEA 2CMKA 1SKYB 2NZJA 2O2CA 4NBVA 1LDEA 2IC5A 3IAM6 4H18A 4A4DA 1JHVA 1ZH2A 1LJUA 2PD3A 3LBIA 4QLAA 2HBRA 4XGKA 2AS0A 1Q7TA 1WU7A 1FSGA 2JKYA 2P90A 4KPEC 5C1DA 3A9SA 2F3UA 5BWMA 2Q1UA 5JQGF 1AQNA 1CBUA 5E1MA 4X45A 4A0SA 2OTCA 2X0DA 2M98A 5CW1A 1JECA 3U44B 3EIEA 4MKXA 5E9QA 4CKWB 2C88A 4E22A 1YWGO 1YZLA 2PT9A 2PJDA 1R0YA 3LY9A 2JG3A 1L5KA 3G2PA 1E1MA 2CKMA 4EA7A 3LC1O 4YCMA 2XCIA 1HM5A 1PLKA 4DXHA 3R23A 2H5IA 3F6RA 1ISPA 5AVJA 4N6GA 3O8OA 4RF3A 2ZB8A 1XEXB 4LJAA 3QXXA 4F9EA 1MO4A 4IIVA 5EVCA 1GAEO 5EWMA 3N75A 5KYWB 1ZESA 4RMIA 1UC5B 3V4LA 2H4JA 4D43A 4RLQA 1YXMA 1FBTA 3ZDFA 3BAZA 5GONA 3CNQS 1BHQ1 2DOKA 4J1TC 3C98A 4CMIB 1GY8A 1NHWA 4ENQA 3DWIA 4D9IA 5K0BA 1AKRA 4F5YA 1K9SA 4YECA 1ADJA 1IB0A 1Z2DA 2VK2A 3WAJA 1QYDA 1NE7A 5FPPA 1L4MA 2MTBA 6CHYA 1ZIPA 4IM7A 4PLFA 2WSMA 3QUTA 1D1QA 2FFAA 2FPIA 2IJGX 3VPFA 1L5SA 3CBGA 4KR6A 1B4DA 1SG0A 4OMUA 1BMTA 1E1KA 4OHYA 1KEKA 4BMYA 3CR7A 2JHAA 1STOA 3TQRA 3WB2A 5CFPA 1WXIA 3H9CA 4JODA 1JHRA 4DBVO 4EX6A 4EG7A 2QRHA 1U99A 3QG1A 1RI3A 4YXWA 4CV2A 2W11A 5A9TA 4F06A 3Q0IA 2QMHA 1M33A 1EFVA 4YB8A 3FOWA 4QNMA 5JD5A 4PHTA 2Q6KA 4WUTA 1AKYA 1FL9A 1QO9A 4EI8A 1XAGA 1T3ZA 1X86B 2WIAA 5TGDA 2Y0CA 1EFHA 3PHIA 2G1KA 3SC3A 4F5ZA 4A6PA 4OK3A 1JDVA 1P5FA 1IZYA 1RWKA 3GB9A 3G2HA 2C4NA 2PZFA 3QVMA 5C7LO 4FDLA 3QU7A 4J91A 5HS4A 2BHSA 3UV7A 1RRGA 4X44A 3RW9A 4HFRA 4JLUA 5E6SA 2PUEA 4UMFA 5FLKA 3EQ8A 3GROA 4NK4A 3GP5A 1FEZA 3SVTA 4HDAA 3VYSB 5B3LA 1RWPA 2VNAA 4HUQB 3VHRA 4PU0A 3A2KA 1GGFA 4HD8A 1TJ5A 1V41E 5KHOC 1AGRA 4EG1A 3GJTA 1QU3A 1TCAA 5JD6A 4F3TA 2Z56A 3ZUGA 3SIXA 2AF4C 3LF1A 4CL0A 3GRRA 4OX9B 4MVXA 3HB0A 1GQYA 4D82A 2FRXA 1VHWA 3CEMA 4U9IS 4V0OA 3SBEA 5A5EA 1R0RE 3BSYA 4JCCA 3CGGA 3AR7A 4GMXA 1ZM9A 2YQZA 4QYWA 3ZBQA 1TO1E 1KI9A 3D9QX 4V3BA 1M1YB 3R8CA 4RPJA 1L7QA 2IT1A 1XCBA 2HA4A 2V7QD 3MT0A 1QBKC 4JUCA 1G60A 4KXMA 4S1PA 5DN6A 5A4DA 5JJCA 4Y2TA 1GITA 3AINA 1G3QA 1GGKA 3UF0A 4CFZA 4D9HA 3GOHA 3SWWA 4YN3A 5CDFE 1V4NA 1U9IA 2YJ3A 2CZGA 4IJKA 3H7IA 4LHSA 1E4OA 1RQGA 2MHCA 3GJ7A 4MA4A 4NMMA 2ORYA 3HS3A 3OMLA 4KXYA 1EFRA 3G5MA 4QOEA 2ACEA 3GL9A 5BSVA 1UFQA 1BROA 4R51A 4EABA 4EGJA 4MPPA 1CX9B 4LYDA 1CTQA 5EJGA 4PC3A 2MSWA 4BUCA 1SVKA 5CAEA 3OICA 3NDRA 1PQPA 1RLIA 3AC0A 4JX9A 5IAKA 1U2SA 3FMPB 4W7SA 3AP3A 3DKIA 2VTBA 4BDSA 1I5EA 1AZTA 3R5JA 4MV4A 1SQ0A 4XJSA 4IMRA 1IEVA 5BRJA 2ROQA 3TRKA 1XMIA 3QBDA 4DCUA 2V9PA 2H4FA 3LUGA 1I80A 4WN9A 4Z0NA 1DELA 2JGNA 4JLVA 1NDQA 4LHWA 3PPYA 1G7TA 2YVUA 3IHKA 2GBFA 4KQIA 4UXJA 5EHGA 3W8EA 1W85A 2G9ZA 4IIDA 3NETA 3H04A 4BFYA 2GCOB 3ODPA 1E9FA 2JBAA 3TUIC 3V32A 1V16B 3C74A 3G2JA 1CU1A 2QMOA 1GA1A 5JNRA 3QTTA 4TS9A 1ZUD1 3AHGA 3WK8A 2E4ZA 4NCHA 4GSYA 1XF9A 2EJTA 7MDHA 1RXYA 2VH1A 3HO1A 2F7SA 1J9GA 1CS0A 3BWMA 1T9GR 5DHTA 4U6QA 3T0GA 2KM1A 3ADKA 2I5PO 1CR0A 3GJ5A 3L05A 3MW8A 4E5UA 4EENA 1S2OA 2XZPA 1QTQA 4C7JA 3TO5A 5G3YA 3CN9A 3IHLA 1J7KA 4I6GA 2HXSA 4BCBA 1BIFA 4LEIA 1UM9A 2Q5EA 1PWYE 2AFHE 2FZLA 4N5IX 1T13A 1Z29A 1H1LA 1SD2A 4C08A 1K2VN 1QR6A 5LB2A 1L3BA 1TQDA 2ZSDA 3WRWA 1UT8A 1VL0A 2Q0SA 4Q3KA 4X3CA 2JH3A 3TBHA 3WK9A 4DSUA 3CPJB 1PR6A 1H0SA 2H0QA 4JXJA 3AHHA 3C5EA 3KJXA 4MDEA 1BA2A 3QBJA 4C3ZA 3ICCA 3Q1KA 1PZHA 3BJZA 2DBRA 2H9YA 3LKDA 1KK2A 2L17A 2HJ9A 4V0RA 4LKRA 1JTVA 2W8BB 1DAIA 2PWZA 2GBIA 5BO5A 4LJ5A 2UZ1B 3JWGA 1HT1E 2I71A 4CIBA 4YUXA 2DKFA 1TECE 2XOKD 5JHHB 2J9RA 2EBUA 3O75A 3KZ1E 5BY2A 4HAZA 1H2EA 2EHDA 4AYXA 1P33A 1YZQA 4N0DA 4B75A 3ZVMA 4M0PA 5EZ6B 5CLQA 1CUAA 2E55A 2MCFA 2HA0A 4CEIB 4KCGA 4U2BA 2P27A 2R25B 3ODGA 3DZGA 2F3PA 3R5TA 5HMMA 3RR2A 1XRQA 1EHIA 4CM7A 3C8DA 4KAJA 5K1ZA 1RJ9B 1Z7GA 3K2EA 1ZKMA 2YIJA 2ZETA 1GRVA 2ZATA 4HQNA 3INTA 2ZYGA 1CNEA 3DZFA 3SYLA 4IIUA 3U1TA 4DQLA 5JY1A 2CL5A 2JVIA 4Y1GA 1E2DA 4QYIA 2CYAA 2DQKA 2IPLA 3BB1A 4FU0A 5ECGC 3ZXSA 4DNFA 4R0MA 4DMCA 4DWVA 4GQAA 4REQA 1Z5UA 3ITDA 4EL0A 1C81A 2CE7A 3T3MB 4LBWA 3MCZA 4OHVA 4G5FA 5FRDA 1ZXLA 1FFYA 3A9UA 5A4AA 1Z0JA 1OFUA 1OIXA 3AZOA 4FYKA 3ORYA 1AJEA 1WP9A 4AQ7A 2EGGA 1TJ3A 1KP2A 5FA5A 5IM4A 2QQGA 5HCNA 4YO7A 4FT2A 1R0KA 2Z2ZA 3DJYA 2J46A 3ELUA 4E07A 1C1YA 2PMWB 1N9GA 3LF2A 2OCIA 5K8CA 4OA8A 1SEPA 3L5OA 1S9HA 2JEOA 1BDIA 1QYRA 4AO6A 3ILYA 3RO7A 3SHTA 4YAUA 4E13A 4OLAA 3RADC 2VJMB 3F8SA 3A28A 1IQPA 5T41A 1HLDA 2FRDA 2H59A 3O31A 3LXUX 3PCTA 4KE8A 1GPAA 2IKSA 4YBRA 5AOCA 4QOFA 3I6YA 3K0KA 4O6VA 4FW9A 5FKJA 1WA5A 2R1VA 1TM5E 4Z9FA 2I1WA 1LRKA 4DBZA 2XVAA 4ABTA 3I09A 4IVPA 2O50A 4EKNB 3X2FA 3NKVA 5SICE 4DEXA 4ZEMA 4MEAA 2FJUA 3GRCA 2AWOA 1B1CA 1Y5NA 3M6FA 4FMCB 4KIFA 4TKUA 3JYOA 1UAYA 3L8MA 5EZYA 3FFXA 2BM1A 3AQIA 1FC0A 3NKFA 4V2IA 3TCXB 1J8QA 1OWOA 4B2IA 4D0GA 4DJDC 1U3VA 1QX3A 2H18A 2PJUA 2WM8A 4E09A 2JFOA 1M6HA 3BXGA 1T29A 4DMUB 3LCUA 1EGQA 4IGEA 2V55B 1J8MF 3O83A 1G64A 1U9CA 2PCLA 4Q9NA 3OQOA 4G0QA 4B4UA 4Q5IA 5BWOA 1Q0ZA 2GBPA 2C1EA 1LBTA 2GERA 4GD3Q 3FYUB 3OX4A 1AV6A 1XZQA 4ZDIA 2DUJA 2XMQA 1UIRA 1J7JA 2H1IA 3ROKA 4KH1A 5LP6F 3B89A 3FYHA 3CLHA 5FFMA 5J63A 3TLGB 2HU7A 2RK6A 3K1AA 3UJCA 3K9GA 2J4DA 3GZJA 3ECCA 3ZCQA 4QDKA 5HE8A 4BVFA 3VC7A 2X0FA 1RVDA 4F8JA 3EZGA 1RMYA 2PLFA 3TOXA 1AHIA 3OZUA 2P2DA 3PGLA 4DA8A 2YJNA 4C7BA 1CW2B 2D3WA 2QVLA 1G9TA 2AK2A 3BG5A 2UU9B 2FWAA 4NEQA 3S8YA 3GCZA 5IVIA 2P40A 1TUBA 1HURA 4JSRA 4KR3A 5AKLA 5CCXA 3EVGA 3NI2A 3M6IA 4RH3A 3LQ1A 5DNUA 3E6AA 1ML3A 2WKRA 3ESCA 1YB6A 5IUJC 2CNWA 4RV4A 3Q0TA 4AECA 3OQHA 1ZJ4A 3ESDA 1JLLB 2IX9A 1QOPB 1NV8A 2BGTA 5F2OA 5C31A 1XK7A 4TSRA 3S29A 4AY6A 4Y7CA 5ES4B 1SCAA 3Q1LA 5H82A 5KYVA 1PT5A 4CF5A 4NPAA 4ER7A 1B00A 4HFMA 3RAJA 3TPZA 1ORVA 3QWBA 1IJBA 2HFKA 5ENDA 1P5HA 1DKRA 2VNSA 3G02A 4JL6A 1B8VA 3ZGYA 5F7OA 2Z6QA 4D8VA 3HJUA 2WUFA 4Y98A 1LX6A 3AETB 4BNVA 2PIDA 4DW8A 1WPQA 4IRUB 4R1UA 1C3LA 3PGA1 1MNQA 2ZFUA 4YJGB 5LYJA 2ZRKA 4YCLA 4DMRA 1F06A 4YCNA 1TEVA 1QU2A 2EGUA 5JSQA 2H5LA 1CJCA 1XZBA 2AFHB 4DA0A 5BMVF 3O8CA 3EB9A 1YK0A 1HDGO 1NW4A 5U4QA 3WS7A 1OWLA 4ZXFA 3UMMA 1NX6A 1V1JA 2OXTA 4AQDA 3KSAC 1D9XA 1L5ZA 3TOZA 2MDTA 3NXKA 5HF8A 2X8AA 5A6VA 1E3TA 3V9AA 2CJYA 1BOOA 3RLIA 4O8ZA 1UK6A 3BZWA 1D4FA 3JZIA 3AM1A 3KG2A 1S3IA 4YMVA 4Z3KA 5E7IA 3E81A 3KOMA 2AMVA 1Z6GA 4KVZA 1ZVVA 2BR5A 1ZAKA 3H2KA 3PTZA 1TE2A 4IXWA 4AUEA 4M8NE 2D1FA 3K7EA 1E1QA 3UK0A 4DM3A 1C9JA 4G9BA 4U3JB 1RXWA 1DINA 1RRKA 2QEQA 1V5EA 3M6AA 4HLNA 1TJYA 1E9VA 2OCLA 1G3RA 1G17A 1QJ4A 3RU7A 3W34A 3AJEA 1ESEA 1YC2A 3EIOA 1GZVA 1F2TB 2YZGA 3KXDA 1T2FA 1LV8A 1HT2E 2ZR7A 2Q3FA 4RTLA 3OLVA 2NLOA 1IN5A 1KYTA 1RAAA 3DBIA 4IUBS 1ULTA 1J21A 4Y9TA 3OM9A 1SCNE 1ZR2A 2H9AA 1IXRC 1KSHA 3R40A 4AP6A 3LT0A 5C1IA 1EUYA 2GPBA 3AEYA 2FUKA 4TKVB 3IERA 1QV7A 3DYVA 1P7WA 4AKSA 5I4KA 2EZUA 2WFAA 3BX1A 3IOYA 1YRAA 4ZVVA 3Q6NA 4CKXA 2XDQA 3AGPA 3TZKA 5L51A 3MAGA 5DOVA 3M0EA 5FBWB 2DMRA 1W88B 1TQ2A 2SHKA 4BLOA 2XSZA 1N5MA 3KPUA 3C3WA 3MJTA 1OTYA 1KAOA 2X40A 3RYTC 1A4UA 4G24A 3G23A 1CZRA 2WKSA 1CZNA 1BGVA 5F76A 4B6SA 221PA 2HF9A 4KO3S 3SVZA 5HVNA 4US2R 4DB4A 5CA0B 4TZTA 1N5KA 2EKLA 4LX0A 1XMVA 4QLOA 1KO5A 4PTZA 2ST1A 3DEKA 5K3SA 2GZHA 3AVUA 1T4DA 4N5HX 3FB4A 4NK5A 4C6HA 1H2BA 1WAMA 3NHBA 1HETA 3K4HA 4PBSA 1FRFS 1L4FA 1P17A 2A92A 3N3BC 2AXNA 3ZU2A 3ENNA 4NAVA 1KPGA 1M8PA 4O5OA 3IAS6 2OFOA 2LD4A 3PIRA 3W8FA 4NC9A 3P2EA 2FX2A 4MWGA 3VO2A 4G5GA 4BTVA 3H6HA 4ZDJA 1HYBA 1IPFA 3OKCA 3KKNA 3LAWA 4UUPA 5B2FA 4QUDA 3QY0A 4FYMA 2HMSA 4C1NA 2WKPA 3Q3JB 1VIAA 3VR0A 1L5MA 2EFYA 2QXTA 2OKCA 2WHYA 1QIEA 1DXYA 5KQSA 1M2NA 2BZ0A 3HWRA 5IASA 3LCJA 1DWPA 3ZBUA 4ZJUA 4DXDA 2Q4DA 5KSPA 5BSFA 1TFUA 2Q9BA 5B36A 3T3HA 1EXWA 1TF2A 1N8TA 4UHCA 3WBBA 4DA7A 5ALGA 3JSAA 1VKOA 1ZMTA 2WWHA 1VBMA 3QKRA 3PNKA 1C4OA 1OV6A 5A4JA 4P38A 1JH8A 4BATA 2PS1A 3RVQA 4E1AA 3THWB 1Y0BA 2DUNA 3EE6A 4G8DA 5GOZA 3A1EA 2HX1A 1P3DA 4HNHA 2GN6A 5AM3A 1QG6A 4QHYA 3L43A 1ZMXA 4QO7A 3FDFA 3VKFA 4YDQA 2ZRGA 1XHLA 4NBRA 2BAGA 4OKNA 2YZNA 2QRLA 3RCBA 2IEIA 3RC3A 5IN4A 1YQWA 3HBMA 3QFFA 4JY7A 3FRIA 4LZLA 3FMFA 3L4BC 3LQRA 4B6FA 4E5SA 4EKIA 4QQRA 3IP5A 2X8WA 4HVLA 2JJ8A 3U7FB 2V0CA 1AT1A 5DO9A 3REOA 5KOIA 3PWZA 2VIIA 1IUKA 1XTSA 4L08A 4UREA 4HTAA 3PQ3A 3ZTTA 2XODA 1DJQA 3QE3A 3ID6C 1PF7E 3CLVA 3DV2A 3EUEA 1B41A 1Y3BE 4ZAFA 1VSUA 1XZ8A 3R0IA 3R2JA 3UZUA 3OLQA 3OQ1A 4O1HA 1L7RA 3TBKA 3J7TA 3QJ5A 1KAGA 1QK3A 2UZ0A 4B2PA 4BXOA 3BL6A 1PG5A 4OFBA 4RQAA 1R5JA 4X60A 1L7BA 1GR0A 2Y9MB 4C7MA 3W05A 3CRZA 4ZI7A 2AIRA 3BSWA 1QR2A 1OCEA 3CKYA 1DHRA 3I1YA 4Q3AA 5E6RB 1DIAA 4EHNA 3LM8A 2FZGA 2DHQA 2CXXA 2O1WA 3FXAA 2QDKA 3BGDA 3EBOA 3A2NA 2OHJA 2ZRMA 1UK7A 5A9SB 1JFSA 3T4UA 3DE7X 4JC4A 4KQXA 4BE9A 1LRLA 4ITUA 4D9JA 5HRUA 3VR3D 3WL6A 1A96A 5JUWA 4NHOA 3THXB 3T7AA 1K63A 3EHDA 1UBEA 1B6SA 1N7IA 1ZOPA 2BGMA 2J07A 3ENKA 3F6SA 3WJ7A 1DEKA 1SUCA 2O8VA 4LYJA 4ZRMA 1ISIA 1PJ8A 1VFPA 3I6MA 4U9HS 2H65A 3DS8A 4O33A 3TIVA 1XTQA 1XQVA 4L1KA 2ONZA 3OJXA 2HT1A 4IDQA 4YROA 2HDOA 3E5NA 1DLIA 4BGUA 3AQ4A 5AD1A 2CEKA 1E92A 4OXIA 2ZE6A 1K89A 1P2DA 1SVLA 3HADA 4M7WA 4ZVTA 4QASA 1BD4A 4X6LA 1OJLA 3CLKA 2BL4A 3N0XA 4ZCQA 2AZ4A 1HLPA 3AU8A 1N75A 2PH5A 3IV7A 3NOVA 4ZPXA 4BV2A 1VYHA 1NG9A 1I32A 2MR6A 3ESBA 1YQTA 3SC6A 3FWYA 3IHWA 1SVSA 3GFFA 3NDPA 2G63A 2JGIA 1KI1A 2Z3VA 3ND8A 3L7MA 1QH0A 3OZBA 1NZDA 4JC0A 5E3JA 3UAXA 1TUIA 3ORSA 3LRPA 2JIOA 1QRAA 3JPYA 1VL2A 2O3JA 4LJYA 4NARA 1G21E 2B35A 2Y6UA 3FF4A 4LY0A 4ZVOA 1DRUA 4JI6B 5CFRA 5JJ5A 2ZR9A 3BMOA 5C1BA 5I4IA 4RK7A 3TN7A 1LBSA 1T6NA 4C43A 4L4YA 1VMKA 3A2MA 1YZKA 1HBJA 2JGRA 3ZOZA 5L3QB 2H7VA 5SYNA 3I4LA 1MD9A 4MQBA 4F86A 4AO7A 2AOWA 2C7PA 2YOGA 3K8ZA 1ARZA 1YB4A 3OQJA 3GFQA 4MGIR 4KWCA 1M6EX 1KJYA 2ATEA 4HYYA 4K2AA 2OXFA 3UT0A 1KMHB 3KWLA 4P7BA 4LWOA 3OOEA 4JYPA 3U7QA 3FPKA 3F6EX 3P7MA 2BV3A 1X0XA 3LXRA 4MQFA 1FP1D 5B1IA 3MF4A 1ZY2A 3WB9A 2YJZA 4B2YA 4JHLA 1N2SA 2FFRA 3F74A 4I8DA 5EUMA 3DL7A 4C0BA 5B7NA 3CKKA 1WHTA 1X9GA 1Z4MA 2HWXA 3PUWA 2I2WA 4H9GA 5KI6A 3KJZA 3TUJC 4BL5A 4EB8A 4AULA 3DVAB 2GMWA 2PX0A 3NV7A 1MORA 2XGMA 4UTNA 2XZTA 1UANA 2JIMA 3FR7A 4EYEA 1G5QA 3LDAA 4MVJD 5G40A 1T4MA 2E0IA 2V7QA 1EHYA 1KIFA 1LNSA 1XTUA 4ZI3A 2Y6VA 5IEJA 3IL2A 1NA5A 4UHEA 2XCRB 3IVXA 4KUHA 4HNAA 1XNJA 4IXTA 1HYGA 2RGNC 3RVNA 4X20A 3K71B 3QX3A 1R50A 2WV7A 5CT8A 4Y2YA 5HIIA 3TPFA 3NVAA 4EJFA 3EBPA 4CKEB 3TMAA 2ZIXB 2QLFA 3ENQA 1TJ4A 2QS9A 2XPCA 3R5HA 4J29A 4FWIB 3GBVA 4OQLA 4YASA 4V1CA 4N7MA 1MO2A 4ZOBA 1MGPA 4DHWA 3ADCA 1G2PA 4LF7B 2AN5A 2FEMA 2X42A 1DRKA 3U4MA 1Y1PA 4CQLB 2XB2A 3IPXA 4R40A 2C0QA 3AT1A 3Q8XB 1TU0A 2HLNA 4J1QA 1U0NA 3GLFB 4G37A 4BLUA 4BLQA 1SCBA 2ES4A 5CT4A 2FFQA 3SKVA 1G6KA 2HPAA 2O59A 3N8GA 3ZI4A 2WPNA 1PO7A 4PN3A 2Y67A 4EO4A 4NFLA 1NJ1A 2J3HA 3M1IA 5CPBA 3UNXA 2OM6A 2YVAA 2FUCA 1P61B 2VSFA 3DTYA 3UTCA 5KNBD 3CYFA 2ZWIA 2W6PA 3I5MA 2O0LA 1JFFA 3TUZC 3KRTA 2GZ2A 1P9OA 4FHEA 2RGGA 3OWHA 5CIQA 1EGAA 4E5DA 1MFPA 1R9MA 2WAOA 4D5EA 4I6JA 1KGDA 1C7QA 4K9DA 2Y27A 2ORIA 3TD9A 3QITA 3MWDA 3LPCA 1GV0A 2H2HA 5AP9A 4JP3A 4A8PA 4IJ6A 2I7CA 1ZGGA 1EEHA 4FFOA 5KS2A 5I7HA 4YA6A 3ZE8A 5C5EA 3W7BA 2BEVB 3WLKX 1ZCFA 1SIOA 1N3IA 1M54A 2VDJA 2YJGA 3LO5A 3LGSA 4BO0A 2H85A 5KO2A 2AQHA 4HDMB 3KELA 4JLPA 5TPWA 2ZBUA 3A6JA 3TJMA 2WA2A 3TZQA 1X38A 3F7OA 1JQKA 3J81k 3ADOA 3L40A 5CVJA 4XKJA 4QAQA 2TMYA 521PA 3ES9A 2GYWA 5C8YB 1N8NA 1QTNA 2ZUUA 3JYHA 4LXUA 3WYNA 2GSDA 1T9CA 1YJCA 4BAZA 1BTOA 3DM9B 1NLUA 1L5YA 1A9QA 2I6SA 2YCLA 2P6PA 5EJ8A 5F9FA 1OFIA 4LXXA 4WN3A 5CLGA 3RB8A 2HC9A 3F46A 1EP2B 2FEXA 2FFHA 3KZKA 4JMLA 4OXNA 3N5CA 4PG4A 3TI7A 5JALA 3TZHA 3OF2A 5KQGA 1SAYA 2C2ZA 4RTKA 2QLLA 3IB6A 1J99A 4CR7A 5JSFA 2XTJA 3N8HA 4UFPA 3A1SA 3TBFA 1DAHA 3K73O 2AW5A 3QPAA 3OTIA 5J2TA 2O57A 2FEPA 2O2IA 4M36A 4KAFA 1A95A 3BH7A 3H11B 3P5SA 1ODTC 1Z34A 2JI8A 3V55A 2VNJA 2CV0A 1NVGA 2BFFB 5HZGA 4CLDA 1UJ6A 3DUFB 4JEHA 4TVOA 3O91A 4BJ1A 5B4VA 2HZ7A 4Z4IA 4EGAA 2R87A 3UXMA 1YQQA 3HJHA 1IULA 3AV3A 3TVYA 4C4TA 2NO0A 3ZV7A 3U5TA 4M0CA 4H0CA 1ZRHA 1VB5A 4G1EB 2HJWA 4XDYA 3HM9A 5REQB 4CV1A 2HA5A 1WP4A 3NAGA 5FAKA 3A25A 3RYFB 2YY6A 2JZCA 5LA6A 4F2HA 3CMCO 3ANSA 3O2SB 4UUBA 1G55A 1I2AA 3QHAA 5B6IA 5IDQA 2QTGA 2PBRA 2DRIA 2FY8A 1OAOC 3TKYA 1E79A 2RHTA 3HABA 4NCJA 1O2DA 1PJZA 1HR0B 2ZTVA 1U6KA 2CXSA 3A4NA 1R4MA 2J4FA 2FPPA 2NYVA 3A4LA 1SU6A 1DUVG 3TVTA 3ZHYA 4AO8A 2ZVQX 1TEZA 3CISA 3PNOA 3AUTA 4IOKA 3MMNA 2L18A 1PX0A 4J4TA 2OBBA 2ZUWA 3KCNA 2FOXA 5F3DA 3LY8A 1OX5A 4N48A 4A2WA 2VHYA 1O6FA 4P3OA 4M7RA 2RH9B 4UUNA 2ZR8A 4J1SA 1U63A 1Y63A 4I99A 3EY9A 3O7MA 4QJBA 3OZEA 1HDCA 3PJFA 2REQB 1PYGA 4WBNF 3CONA 2XW6A 2NU6A 2PMCA 3C0KA 4BNYA 1NGSA 3NONA 4FBGA 1Y6RA 3VC2A 1FFAA 1E9BA 2UYHA 1J0XO 3FOAA 3C3AA 5IVHA 4IS2A 3M4ZA 4BKRA 1U9YA 2F59A 2BPOA 2ZBQA 1THZA 3CH7A 3IOBA 2J3IA 1NTRA 3TDMA 4UW9A 3RJ5A 4DSZA 3L04A 2AZMA 4NPHA 1MU0A 3A6EA 1JAZA 2QSZA 6REQB 3WDSA 2Y2VA 3OOJA 1S3GA 3LQQA 3V7YA 1R5BA 1RKBA 4YHHB 4I50F 4Q48A 5DASA 2FPGB 3TQQA 4FMDB 3NGLA 1EM6A 3PDUA 3I2IA 4PTYA 4N18A 1T9GS 4Q1AA 5E0OA 3ROXA 1NKSA 2BF7A 3NS7A 4MRMB 5EPEA 1KQFA 3FYUC 2AG6A 3FHLA 3L92A 4E11A 4LMBA 1TT5B 3R7FA 3RT9A 3ZNPA 1HQYE 4E2XA 2WWYA 2VHXA 4JEMA 4I5DA 1N2OA 3P4XA 2PYDA 5BT8A 4CEJA 2CLFB 2WRZA 3C8ZA 2QTWB 4MUXA 5LYYA 1U2GA 1PVDA 1ZVQA 4DY6A 1U2ZA 4XQ0A 2ZVJA 4UJ3A 4WACA 5FWXA 3SCZA 4FEEA 4O2BB 4RIEA 2WT4A 1REQB 1H0RA 2OQRA 3NORA 5CK4A 1EX7A 2X3UA 4AUNA 4F72A 3RWBA 4HMQA 3U7RA 3PUIA 4B7CA 4X66B 3TPCA 3IQEA 3LIPA 2FR8A 3HFJA 1A97A 2IYFA 4OM8A 4Q3DA 2JJ1D 4KQGA 2V7TA 2ZQ5A 4O25A 5F1PA 2OGSA 2AG5A 5CLHA 5LDDC 3H83A 2JIZD 1GKIA 4TTTS 2QRPA 2Z3WA 1N34B 3HXLA 3DEIA 2P6UA 3JQ9C 1AS2A 4HYQA 2QR5A 3WDKA 3ISVA 3P9KA 5L4NA 2GK6A 3U9SA 3L4KA 4AAYA 3DB1A 3BFVA 3NUZA 1SZPA 1X70A 2GEKA 5EG5A 4UUOA 3DNMA 1HG0A 2BHNA 3IDOA 3QU5A 3AIIA 3FLBA 1NZJA 4O4LB 1KORA 4OI0A 4JLNA 1XSEA 2GNOA 2C95A 1QQ5A 1VKHA 2BDUA 3GEMA 2B2XA 3WWEA 2RHJA 5LBIA 1BAPA 1E3EA 1VE5A 2EWWA 4HGYA 5IAEA 3HXQA 3DTVB 5E2AA 1CY2A 1U0LA 2QU7A 1D8TA 3AEQB 2X0EA 5L3VA 1Y8QB 3NC4A 2P79A 3DE1X 3K9BA 2YVQA 4LZAA 4WNAB 1C3JA 3V4VB 1UBRS 2XIQA 1GA6A 3SU8A 5DXJA 1L5QA 2G70A 1QFZA 3QEMB 4RKWA 3ZCPA 1UP4A 1JT2A 3LX8A 3NEAA 1FW6A 1TYBE 1DJOA 3GJ4A 1A1SA 1POXA 1FFHA 2F1JA 1P9LA 2ZIVB 3DMGA 2G71A 3HKEA 3IEPA 4F6LA 2ZDHA 1WOMA 2B1RA 3NU1A 5BVHA 1FDRA 1CR6A 3BUSA 4P4SB 3TJZA 3RRMA 5L8VA 3G6WA 4GVXA 3ZIUA 4BP9A 3B3GA 3H75A 2MSCB 4LGYA 1RM5A 2A1TS 5ESXA 5ECDA 1YNOA 2B5VA 3OJWA 4FD2A 2P4UA 3DOCA 2J9FA 4KOEC 4XARA 4BWGA 1HZZC 2IV2X 2E4WA 4RZIA 1X80A 3QELA 4YP6A 5LZ5A 1PTJA 1E1CB 3UJ3X 3HEMA 5AW7A 3A6ZA 4FDAA 4CL3A 4XR4A 3VR4H 4C14A 2RKOA 1GU0A 3L18A 1YCDA 1M7GA 2HQOA 3T5TA 1MQSA 3TAXA 3DBHA 4X64B 3MG9A 1FIUA 2VXBA 1OTHA 2ZJ2A 1ID8A 3G9ZA 4M0EA 2X9VA 2F90A 3KQYA 3ZWMA 4KXLA 1Z47A 1DEAA 4DJ5X 3BXXA 2IOFK 4RS3A 3KLMX 3P52A 1RFLA 4JDPA 1Q20A 5DI3A 2VDWB 3DO5A 3ZCTA 4B7ZA 3ILHA 2LNDA 1P7ZA 2JC3A 4C0WA 1NNI1 4MPJA 4QQ8A 1YA4A 3KTDA 4Q4AB 1VCHA 7ABPA 1W0JD 3W5VA 5A6SB 3O4VA 4DKXA 1KTIA 1DDOA 3CLRD 4WY8A 1MB3A 1NF3A 2V6JA 4CTOA 3HFGA 4F0JA 1E0AA 4JT2A 5D8DA 1B73A 1BEEA 2H2WA 3Q3CA 4EI7A 2YIDA 1NU6A 4J0HA 1EA7A 3AIKA 2TS1A 1RYHA 2IHKA 4K9MA 4CMCA 2QP9X 4INZA 4IZ6A 16PKA 4WCFB 5ERXA 4BLVA 2BUAA 4GP9A 2AKEA 1M34E 3E0XA 3PICA 1NYLA 1KI8A 1SUEA 4JXZA 1Z2AA 2PZGA 3JQ6A 3GCWA 1Y7PA 3TLZA 4ZDKA 1IHXA 1P1IA 2Y8EA 3HM2A 2HGZA 1GSOA 4QX6A 3F8WA 1TJPB 5CJPA 1D2NA 2IL1A 3AW8A 1GEGA 3TDKA 4BNDA 4LYAA 2AOXA 4LK3A 1WDTA 2JL1A 4HC4A 3HCAA 4I5FA 3V46A 1C0KA 3CZMA 1KI6A 4MJXA 1GPYA 3W7VA 5KQPA 1U1IA 2YHIA 2P9JA 3FWKA 4DCGA 1FDWA 2O2ZA 3M6WA 1Y81A 2HSGA 1QH8B 5K8TA 2JCGA 5TSDA 3H1BA 1I0ZA 4P53A 5C5IA 5FXMA 3HA5A 1JAYA 1NJSA 4PXSA 1NDUA 1NC1A 3RVSA 2WSSD 3UANA 1IN4A 2AOUB 4YUVA 5KMGA 4OQXA 3B7PA 4DUGA 2X5JO 1SHLA 3IP7A 2AFVA 4MGKR 3RU2A 4BGVA 3V1YA 2I4OA 2JZNA 4JZYA 4N82A 4BMXA 2NVBA 4ER5A 2JAWA 1VSBA 1J09A 3R7WA 3OIDA 5F51A 3OD1A 3LHFA 3BSFA 2JLYA 1U5BB 2X5OA 3G2IA 4Y1RB 1GNVA 2A4KA 3VHXA 3EZ2A 1U3WA 2AG1A 3AI2A 4RIIA 3OURA 4TTRA 4QULA 4GECA 9ATCA 4TS4A 3IVMA 2EP8A 2VTKA 4OB8A 4OQDA 2WVJA 5BSGA 4L0CA 2SCUA 3IILA 1MA3A 1ESDA 4GQIA 4OTZA 4EOGA 3F3SA 4UNQA 1H65A 2QL6A 4RVOA 1JAXA 1RWMA 1C80A 3OJEA 3Q15C 4QGAA 1QZZA 4RTRA 4LGVA 3A3NA 1SXJB 2UUPA 3X2SA 4MA0A 5DGHA 2JCXA 1LQTA 2O0MA 2AUTA 3P9QA 1Z8HA 3KR9A 4KV7A 3VSBA 4Z4FA 1RKQA 1L5HB 3NGMA 4BJ5A 2N42A 3ZKAA 5E0KB 3FBWA 4JC8A 4J1TA 3HMQA 2P0EA 3IRUA 4WOKA 1N6NA 3O9MA 4J3NA 3QKTA 1I3OA 4M6WB 1X74A 2J3QA 1F20A 2XMDA 4GLBA 2AXPA 4UVGA 3EVBA 3OPMA 5CVDA 1HO3A 3AOGA 3OZIA 4UEKA 4NDZA 3G68A 4GMGA 1GFWA 3WI7A 4I9GA 4PX2A 5LQKA 3B9QA 2YN0A 3LVFO 3OSZA 4PZUA 3FHJA 3VZCA 1RYYA 5HUQA 1SC1A 3OX2A 1U6JA 4F84A 3P9CA 5A3QA 4YEDA 4B4VA 1EB8A 3MTJA 2FE4A 3M3HA 4YCBA 1AHPA 4WFJA 4BS9A 1S8OA 3R6GA 2DCMA 2JCVA 5FNVB 4RENA 4WPGA 4WL0A 2AN1A 3I4CA 1VE9A 4QD3A 2CB9A 3MIIA 5IYZB 2O3UA 3BULA 4JX8A 4TV8A 3WGHA 1UP6A 2WSYB 3S2YA 1RWNA 3NP7A 2ZSIA 1YASA 2WABA 4KXVA 1NNEA 5JVDF 1L7PA 3AK4A 3H5TA 2EJWA 2M6SA 3NKLA 4WZZA 1E18A 2DQSA 3MLAA 2EIXA 1G2IA 1X7WA 3U4HA 1T1IA 5CLJA 1MBZA 5ERGB 3A58B 1JLKA 1JZTA 1IWOA 1COWD 1G2QA 2NTNA 3N74A 5EQTA 1JEYA 1P4SA 1QYWA 4BQPA 1GTMA 1KVTA 4I8XA 2IDKA 1X3LA 3WHIA 3L79A 4YRTA 3ZCRA 4X94A 3QYFA 2ZXEA 4IOLA 1AF4A 5HE9A 3OU7A 4ASUD 3HXTA 3BICA 2DETA 1OIWA 1TCUA 2H9IA 3PHGA 1JJIA 4M89A 5JW6A 4A5OA 1KGSA 1BHO1 3RRJA 5JRJA 1SUAA 2J31A 3AOEC 2C8LA 3OPYA 2GBCA 1LBEA 4LXHA 3I0ZA 2BJHA 4NJMB 4Z2YA 3RFFA 3SIWA 2Z2JA 5CCEA 4DIOA 1JRLA 2FQQA 4HPWA 2IYXA 4E08A 4JGBA 4B0PA 4KI0A 5I7SA 4ZO4A 3KQNA 2CUKA 3HRIA 2V9ZA 4QLBA 3MTBA 4FHFA 1Q57A 2VBCA 2YNMC 2AL7A 2Y0PA 5LL6P 4AZ3B 1JHQA 2PGDA 2HUPA 3WSTA 3EW7A 1F6BA 3VOBA 1N1GA 1YQUA 5T3UA 2RHBA 1G3IA 1SY7A 1Z7EA 2DB3A 2W2VA 4O02B 2NGRA 3GJ8A 4HXGA 1UMCA 3PFBA 3PRYA 4RY9A 4Y2SA 4OQQA 2A9PA 4PPNA 3F90A 1DMRA 4JLBA 4NBSA 2RH4A 3U7GA 4CZ2A 5BN5B 3PF9A 2LV8A 5KC8A 3EWSA 2WHPA 3WNDA 4BEWA 1DXHA 1M34B 2JLWA 4MS4B 3ZE2B 3H65A 3H6KA 4OB6A 1B6GA 5AHKA 3TTVA 4B3BA 2K6GA 1GUDA 1XWFA 4RL4A 5G4KA 1V3VA 2XJ4A 3N6RA 1AS3A 4C07A 4LV6A 3ZKWA 1XKLA 2QD1A 5HIAA 1YS6A 2R2AA 4PQFA 2WWVD 3N28A 4A26A 4XYLA 3SDSA 3QF4A 4AG3A 1HTTA 1I01A 2CZQA 4MVJA 4HDSB 3H84A 1T9AA 5E1OA 3KSDO 4IW3B 1AK2A 1WSBA 2OZLA 2W9XA 3G0OA 4D02A 4YYZA 3HXMA 2OV4A 1E2GA 4OU5A 2RONA 2WILA 4EI2A 1KJJA 4R1PA 4DLUA 4TPKA 4AJ9A 1Q44A 3OPXA 4L5IA 4FQ8A 1XRPA 2IUFA 2PRZA 4RQUA 4XVQA 3LVQE 2OZPA 2B37A 4A0FA 5C35A 5JAOA 1MW8X 1OXTA 2LRHA 3C6BA 4K5QA 4EW1A 1U8XX 1OBHA 4UEOA 5H3CA 1JXMA 1Z6AA 2IPNA 2REBA 3GZNB 3IJ5A 1XRLA 4BWVA 3KT0A 3JQEA 4BZXA 3R3UA 1K6MA 4L51A 2JLXA 2IRWA 2OOSA 5LP6B 1MX3A 2HTEA 4IVQA 4U1RA 5KNBA 3KU4A 1PS9A 3P2MA 1JR2A 2OHHA 2YZ2A 1UFVA 2Y1GA 1UJNA 3V8EA 2I4RA 1TMKA 2PQ0A 4UM7A 1X3SA 5AYVA 1NVWQ 2ENWA 4D9BA 4R1OA 2WUDA 1SKAA 4EZBA 4F5WA 1XNRB 5DHFA 4N49A 2HWYA 1II9A 3W1EA 4A23A 4IX1A 1W19A 4EHHA 4OXRA 3K6KA 3G7SA 1L7AA 3UKOA 2BFEA 3BWEA 4W1PA 3KAPA 3WGLA 4F91B 1TLLA 2KBFA 3LXMA 4NV1A 4B84A 1XVIA 2JAQA 1D2MA 1E1YA 2D74A 1A9XB 3Q87B 5HPYB 5FOWA 5JWOA 1USIA 2IF2A 3NOQA 3N86A 4BFZA 2VJYA 1TM4E 1JMKC 1MC1A 1RU3A 2W6MA 1AE1A 1ONSA 3FNIA 4MRRA 4O4JA 1DQZA 3O94A 3CZAA 5FIUA 3JQ8B 2B8NA 1GL6A 1J07A 1KYYA 3F5DA 3KLOA 3W2HA 4JYZA 2IFTA 3NEPX 4FGLA 2DF8A 2P9EA 1OAKA 3RUAA 2PO5A 4PAMA 5DF1A 5DULA 3ZDDA 1M2FA 3RK1A 3DLAA 3E3AA 5DHQA 3P0JA 5EXXA 4R2IA 1W8DA 3MWGA 3VDRA 3IDAA 3P9RA 2QM0A 2J0QA 2VSQA 3OZWA 1EGHA 3WIOA 1CIVA 1K5GA 4BV8A 4AROA 2FMTA 1LPAB 3CS3A 2FMUA 1SCQA 3HLTA 5KJ6A 1FLDA 3EPKA 1VGQA 2FCRA 3IXQA 1TO2E 4R9SA 5FUXA 3NDIA 5JZOA 4DV1B 4QGBA 3C70A 1X7YB 2DPXA 2DFPA 1QGYA 5H81A 3FYSA 4YRKA 2W2KA 2O54A 2DBVO 2OAEA 3U9LA 4KAAA 1P77A 1UMBB 1XV5A 3I92A 3S5UA 1QAMA 3PQCA 3TAUA 4QXRA 4C21A 1Q19A 4F2PA 3OEYA 1R8QA 3HJGA 1JW9B 4HJRA 2FSVA 3A05A 3D5TA 1HE8B 4NJEA 2XYPA 4B73A 5HZKA 4OFWA 3FG9A 4K26A 3PI7A 1R3UA 1CDEA 4RVDA 5KNCA 4HZGA 4Q03A 4PNPA 1FRNA 1OXVA 4KH0A 3VX4A 3HHEA 1U94A 1UKBA 1UDCA 3B82A 4ZVQA 1FYVA 3Q7QA 1SMKA 4LCJA 4N0MA 5ELXA 2FR1A 1EE9A 1IZ9A 2FWBA 2ZTHA 2IXDA 3DLTA 5BRNA 2GXAA 2JFHA 2NTJA 1M6VA 4UUMA 4CHGA 2ZLBA 1SRQA 3SJUA 1YK1A 3EEBA 2P9GA 3PA6A 3FRHA 4RPHA 5HNKA 2DG2A 2Y9PB 4G0PA 3UQZA 4QWWA 1QKKA 1N5JA 5KDLA 4PG7A 1Q1AA 3IP8A 1FFEA 2PRSA 1NRJB 2RSLA 3K5WA 2P4EA 3LA8A 4C4AA 4N3GA 3JPWA 3DLHA 1JTFA 2W90A 2C2YA 4EQ6A 2YWBA 4MS1B 3PFWO 5I8WA 4QREA 2QAJA 2P4SA 3FZGA 3I23A 5H8WA 1YD7A 2O7SA 2VXOA 1FVFA 2R6AA 2EJCA 3ZE6A 5GM2A 4UQPA 1BS9A 2OAQ1 3C15C 4BFVA 1PJTA 5HX7A 3VPSA 3MJHA 4D81A 2VJQA 2P2NA 1UM8A 4JR0A 1UBNA 2PZAA 4MXDA 5TJ9A 1F0PA 3QMVA 4D5GA 1SVUA 1SBNE 1VPVA 2AMLA 4G0MA 3OP1A 4QDUA 5EJ7A 5FWYA 4PANA 5K0JA 4Q19A 1TU4A 1UMKA 1VGVA 3UA4A 3JQAD 1NJ6A 3WLLA 1UJ2A 2I34A 2AQ8A 2Q8PA 3CJTA 3K2IA 4LRYA 4PZCA 5DFAA 5BWLA 3QVSA 4H7JA 2XWQA 3PKJA 1Q91A 1KKUA 5AW2A 3N0RA 4FX2A 1F3LA 1ULUA 4YDHB 4BYMA 2W42A 1I2CA 4M0DA 3VDMA 4DYHA 3ANTA 2FG7C 3FDZB 3LTEA 4FWBA 1N0IA 1UBUS 3CRW1 2AR0A 4JNCA 1VLZA 1EUZA 1WCV1 4P4GA 2QN1A 4CNQA 2IY7A 5AJWA 4MIYA 5DXAA 1H66A 4J6EA 3WQSB 2PS0A 2QLMA 4RZ3A 1BXRB 2VZ9A 4BECA 1GZ7A 2O52A 1G4UR 1LS6A 2O9JA 1RMTA 4U2FA 5GWXA 3AIMA 3NHAA 4N5LA 5JS2A 3W3AD 3C6KA 4E5KA 4F7DA 2ZIWB 2HL6A 3JR3A 3LGAA 1JHPA 1DKMA 1XTJA 3GUHA 2HCTA 3U4IA 4HS4A 5AM2A 2HHAA 4I81A 5EJ6A 3GUUA 4BIMA 5JSZB 5EE1A 4E6EA 4HGPA 3M3DA 3BD7A 1WVMA 2EFGA 7REQA 3QENA 3JVDA 1JP7A 4WUVA 1OIVA 4P3XA 1I6MA 1PFQA 3SMVA 4F4IA 2ZI5A 3W5BA 2JJ1A 4G4GA 1I7LA 5H9WA 1IQ0A 5IVPA 1OB2A 1W36B 5HBGA 2YXDA 1C8BA 1CSEE 4CR8A 2MYNA 4UOQA 4BLPA 4PC7A 1EP3B 1TPYA 1UBLS 2O6LA 1IY1A 4KMRA 4EDFA 3KUCA 3O7WA 2J0UA 4IFTA 1ACLA 2P7HA 1CVRA 3UIEA 2OO5C 2PL9A 3K8YA 1MPTA 2GNPA 2HSDA 2C3YA 3OMXA 4I66A 4HYTA 1PK7A 2H6EA 3N2KA 2BFCA 3ESAA 3F5MA 4GR9A 1IIBA 2JFXA 1H3NA 1VCMA 4KYVA 1T9ZA 4YAJA 3ZNQA 1QANA 2R85A 5A5GA 5KDDA 5DSTA 1LC3A 1XWWA 2GM5A 4G1CA 1BE8A 3WBFA 4YWHA 2OCAA 3BTOA 1XMJA 5C5DA 5KYGA 5EN4A 4EKEA 4EFLA 1R4AA 2P65A 1TU3A 3KLBA 4WOPA 3RIMA 4BMPB 3LW8A 1PFUA 4WRRA 3KD3A 2TMKA 3VPHA 3UWOA 2H8GA 2IHTA 3DVSX 1WW2A 3ZLJA 2RBGA 5I9SA 1KYXA 4BQFA 1OFGA 1P4RA 3Q2OA 2PS9A 5HCIA 4P86A 2IHBA 2LUOA 1FS5A 3H19A 4MAAA 3ZV6A 5GP1A 3KR1A 4E03A 2DEUA 1PAUA 4JQCA 2JGFA 3EIUA 2O5RA 1NV9A 3JWIA 4HQFA 4NMWA 3AUXA 5F5XA 3D3WA 1JXQA 1ATIA 1JA0A 1VG0B 4JGGA 5ADVA 1FVHA 2O8BA 3KKQA 2WDPA 1PEKE 2C94A 4MAMA 1E58A 4ARAA 2KJQA 1QOQB 2QJFA 2QL7A 2O3TA 4W6QA 2FXVA 2ZYVX 2RI6A 3C8MA 3KDAA 4CODB 2X8LA 2VAVA 1S6YA 2G76A 5JI3E 1IN7A 1C9EA 4NU5A 2ZP1A 5BQ3A 2VPQA 3PR1A 1A9PA 4WLNA 3C8UA 3D7SA 3TECE 3LO8A 3ZHCA 1CERA 5FQNA 3G17A 2B9VA 4Z1MD 4C89A 3ZYCA 4IKEA 4BVAA 4DMLA 2ZIEA 1GL3A 4IOJA 4NULA 4UE6A 3T7TA 1F2DA 3D4IA 4NU6A 1KZ6A 3JASA 5HJ5A 4X8MA 2VHVA 4C4ZA 4FSDA 5TB5A 3VR2A 3B1FA 4UAJA 3E53A 2GH1A 3L7BA 3PUXA 4ZCMA 1TM3E 2ZS9A 3N9IA 2WR8A 4HY3A 1WS6A 3V2HA 1GSAA 3E3NA 2GAIA 4F46A 1H5UA 2PEYA 5KOHB 1QF9A 3MGAA 4ZZ1A 1DJNA 5B1EA 1Y4SA 2BFNA 4UHJA 4Y6LA 3SBXA 4BRSA 1GNLA 2GXSA 3C4VA 4JKYA 3SXUB 1VDMA 4KTTE 3QLUC 1QIMA 4OHOA 4DRZA 3U13A 5KUTA 2BJVA 1R6UA 1L4EA 1R27A 3O6VA 1MG5A 2ZYTX 3DWGA 4RADA 4E4YA 3I37X 3P9XA 4A0HA 1OY1A 3IQXA 3RS2A 4KGXA 4IILA 4OMDA 4AMZA 3EQ2A 1QAOA 4L5AA 4F4UA 3RUPA 5H68A 4BE7B 4KIUA 1XDDA 4MV5A 5DTEA 3FTEA 2V4ZA 2PWYA 3N0TA 4RMHA 1Z0DA 2ZYUX 4EJSA 3OHPA 1MEOA 1CQJA 3AUYA 4RGQA 4YK7A 3GFPA 3PFIA 3SMQA 3V3TA 4HDRA 5ITZB 3CW9A 3MNFA 2JH8A 3QTLA 4IIHA 3TW8B 4CLHA 2G6BA 2O3QA 3CG0A 2E6UX 2NNLD 4Q1DA 1LEHA 5F2EA 4JI5B 1JSCA 3SXPA 4QBGB 3LDGA 1Z7YA 3UBMA 721PA 3FJ1A 3IEVA 4LZNA 3RS9A 1GDHA 1PKXA 2OV3A 1N5LA 5J4YA 1RKVA 3U44A 3T1OA 5JS7A 1UPCA 4DLWA 3CSDA 4MPRA 1AV7A 4J7CA 2CL6X 3L4BA 4CKWA 1GADO 5C18A 1NL3A 2ZRFA 1BWSA 1TUGA 4NZYA 5GADl 5E2BA 3RIGA 5CCBA 1NF8A 1ORWA 5LLTA 3PEUA 3OAAD 3ZWAA 5BNFA 4URUR 4UTVA 1MAVA 4L22A 3L6CA 3BM5A 3QA9A 1GTZA 4M1WA 2WIJA 1L4BA 3STXA 3TL3A 4TKMA 3WYDA 1SXJC 2DHRA 1XEXA 4GEGA 3WLOA 5IJWA 5KYWA 5AJHA 2VT6A 3HCWA 4ZT5A 2HF7A 3R7LA 2I7DA 4QARA 1A98A 2YYYA 4AICA 3UFBA 4OUKX 3DZCA 4LI3X 2CD9A 4Y2GA 4CMIA 4DHEA 3ITKA 1DX4A 4HGRA 3GLHE 4P3KA 4KLNA 4MKZA 1UEXC 2RH5A 2R8OA 4PYOA 3WWYA 4Z1OA 4X65B 2CV2A 2IH2A 4ARUA 1FFBA 1VIVA 5L53A 2ABWA 2GK4A 1NXVA 3UAYA 1R6BX 3F9IA 4JJGA 4L76A 4B7UA 4BJHB 1N5IA 3ZY3A 3ENWA 3ESXA 2AKYA 2PGXA 4D3ZA 2Q21A 4MYDA 3P4YA 1ZSNA 3ASZA 4O4HF 4XWGA 1EVQA 2FWMX 5KJ1A 5JTTA 3IAUA 4G0XA 4HKTA 1ZD4A 4UTPA 3FZQA 1D1PA 5AVRA 2DLDA 2AXQA 4KXFB 3WR5A 4DIMA 1YA6A 1OLSA 4A8TA 5CHYA 4XA8A 2F3SA 3GXOA 4H1WA 3KTAB 4LJLA 3RTAA 2WQZA 3QPBA 5LCXA 1G42A 1A4XA 4HCJA 1AKWA 1O6BA 1ZKDA 4J7XA 4PGMA 3WA7A 4N5MA 1E2LA 4JVMA 1XALA 4C0JA 1WLSA 2ILTA 5LWHA 3KC2A 2QMUA 3EFHA 5CB4F 1HL3A 2OCGA 1WG8A 5HG0A 3HFRA 1JXOA 1NR7A 4MQMA 1W59A 5B3AA 2P68A 5C51B 4HUQA 1RPNA 1Z88A 3VMMA 3HSKA 1FMTA 3UMGA 1XAJA 2YNMD 3IODA 1J20A 2JZOA 1DARA 3KKPA 4MLCA 1D7AA 1E2IA 3DC2A 4TXHA 5IFLA 3JAMA 1GTSA 1EVZA 1C2TA 2EZTA 4LZOA 4R01A 1MKYA 2JBHA 3AR6A 3PD7A 1ZICA 2RHCA 4JFAA 2WTXA 2QWXA 4U2CA 4UCWA 2D06A 1CUUA 5TEVA 3EPJA 3FZYA 4IHJF 1O03A 1RZVA 1M1YA 1GNSA 4E1BA 1U80A 2C7GA 2PV7A 4CG0A 1PGQA 4F04A 4KFUA 1PL7A 2W2XA 1WMSA 3B36A 5GVRA 1P0QA 3PNSA 1KDPA 2ZRCA 4YMHA 1BKDR 1Q1NA 5CGZA 2ISSD 2V7XA 4ENWA 5UKDA 4D3FA 2LCFA 1QQAA 2J0EA 4MITA 5JNSA 1PJQA 3K0EA 4KNWA 2Q29A 3PNYA 5A2QA 5KKNB 2F48A 5K20A 3MELA 3U0VA 1JEQB 4Q18A 1S0UA 4HRAA 2I6UA 1MC5A 2GO1A 4P98A 1OLXB 2PUHA 2OFFA 3ST7A 5AMXA 2B8EA 4L5CA 4QTZA 1PUIA 1KYZA 2NPFA 4ESEA 3PWSA 4CGYA 2ZWMA 3LQ2A 5HRAA 3R5FA 3X44A 4FR5A 2DTEA 2RGNA 2HOQA 5MN6A 4K6HA 1T15A 1HSOA 2YRFA 4RK1A 3ILXA 4OHRA 3L1IA 3NDBB 2I2DA 2BHTA 2QUHA 1KDYA 1FOEB 1TTPB 1V8FA 4HNUA 2GK7A 4K9NA 1XA4A 2P0AA 4PZEA 2X7XA 5KPDA 4MLPA 2FP3A 3AKDA 1CUBA 5C7IO 5ICGA 3GIWA 2Q4BA 1VP3A 2GCOA 3X0DA 3OZFA 4WBNB 1JR3A 1V16A 1YKSA 5AK0A 5HIMA 3T7RA 3K8OE 3TMKA 1XWIA 3ZDCA 4Q1FA 2Q3DA 2JI4A 1CF2O 1T2AA 1XMXA 2Q62A 2HCBA 1FSSA 5FBKA 4A0QA 4FE3A 3F4BA 1E2MA 2HCRA 3NWBA 1U3TA 2FETA 1M5UA 3I72A 5EIHA 3G85A 1KMMA 2VBIA 2VJCA 5K0SA 2FQWA 3H4TA 4G5XA 3ROPA 3I2KA 3LVRE 3GC6A 4JBHA 1NUUA 4EW3A 4TMXA 4Q3CA 3EIWA 5M5BA 4YP7A 4HB0A 5DCLA 1UZMA 4FT4A 1SRRA 1UZNA 4U63A 4ENUA 2WZDA 3AKYA 4RCYA 3MBKA 4NV3A 5ADUS 1D2RA 3AKEA 3C85A 3O0TA 4K9LA 5IJXA 1XDSA 3BE4A 1S8NA 1ZU5A 3ZGVA 3GRKA 1BGXT 3WL4A 1DQRA 5KNDD 1SZCA 4FFLA 3K1JA 2DUUA 2CC2A 2VCEA 4JC5A 3FCXA 2AVDA 5KYUB 1MENA 1GOTA 1Z4PX 3VISA 5B57C 1AUPA 1G8MA 1ULAA 3VSAA 2CDCA 2Q4OA 2W8BA 4RBNA 5C32A 2BZSA 1CFJA 3RWMB 2UZ1A 1AO0A 1KZ9A 1XK6A 2XWPA 2Z8YM 1TAGA 3F6BX 3BF7A 5E1BA 2DKOA 4XWAA 3SNHA 5C8XA 4ER6A 1PW5A 1NXSA 1UBGA 5IZCC 2QRKA 4LF8B 3ZDEA 1T0IA 1CE8B 2F67A 1Z0IA 2WD9A 3BKWA 1NQOA 3AILA 3GLHB 3HN2A 5F23A 3FBTA 3UVEA 4E46A 2C7OA 1GN8A 1ZW6A 2V3WA 5DPMA 1V5IA 1J22A 4LE2A 4QOGA 2B7LA 2AJBA 4W5HA 3TS1A 1WM1A 2Z9DA 4DAOA 1W6RA 1UEIA 2OORA 1JHMA 3LIIA 3VDXA 1RJ9A 4HWTA 2QYOA 1S1CA 3B51X 3R0XA 2DC1A 5FTJA 1IUNA 1G6OA 4D6PA 2BI8A 3TJRA 1TZ2A 1YR6A 3CXUA 5JROA 1EI9A 1IFXA 2P8SA 3C43A 4RC9A 3O4RA 4OMFG 1MVNA 3CE6A 4PBRA 3LHKA 1AKMA 4W5WA 1OXSC 1E7YA 4ISCA 4LJSA 5JECA 4F6RB 3GK3A 1FZTA 1J97A 4KMSA 1SZDA 1ZNZA 2EYQA 2VF4X 3HVKA 1M2EA 4JVOA 3VVBA 4L9RA 3OY2A 4L8VA 2VJPA 1N0HA 5I01A 2EQBA 4HWOA 1QDLB 1LS1A 2PO7A 3P0EA 1LB1B 2BDTA 1YBFA 3CPEA 4EA9A 5C1PA 3D59A 3HDYA 1E6MA 1KY4A 1XF1A 3UJAA 3PX7A 1DU4A 2J6IA 3UJPA 1H9AA 1Q1BA 2XBLA 5BQPA 1UP7A 2RC5A 2XA2A 3WK6A 3H0KA 3H18A 1HDEA 3HCFA 1OAOA 4GOKA 1F2VA 2VJMA 4BMSA 5FL3A 3ZDZB 1IQRA 2B4TO 1EQ2A 5BWBA 2FMXA 4DADA 2X2OA 3KQWA 2AMYA 2NW6A 5FD8A 1NXOA 4ZO7A 5AXCA 2IXEA 2BCGY 2I6QA 5DSZA 3NYWA 4Y2VA 4PAQA 3W90A 3WOVA 3QPDA 3A6GA 2GCIA 3RFUA 1P44A 2E1RA 1ZVJA 3MERA 4WVLA 4D9NA 1U5CA 2GFIA 3Q8MA 1P1CA 3KPYA 3ONDA 3AVXA 1KRWA 2R1TA 4ZVUA 5LKRA 1LA2A 3ONNA 3QVJA 1ZD3A 1TZJA 2D54A 2ZPTX 2QRNA 2ZU0C 4HQKA 4PHGA 4D8TA 3OJFA 2UYCA 5FUQA 1N2BA 1JIQA 4EPWA 4KDFA 5FA8A 5AJVB 1Z74A 3GVPA 1O8BA 3B9BA 4GBED 4P4LA 4PHHA 3HWWA 3OJLA 2PZLA 3SLGA 3T9AA 5LN1A 3CVYA 4IXNA 4W5NA 3WK5A 1NT2A 4EHFA 1PK9A 5BR4A 4DUYB 1TCBA 2D5IA 4LXIA 2RHWA 2GCGA 2WFZA 1HDZA 3ZE7A 4JMPA 3FJOA 2ODAA 4YRSA 4MGHA 3OTQA 3U3RA 4DDUA 1X7HA 2AC2A 2CXOA 2GBGA 4WGGA 3A04A 5HRCA 3FYUA 4N3CA 1SVOA 2QZSA 1Z62A 3ADDA 3M4YA 1JFVA 4UHDA 4TMZA 4U7GA 1U2TA 3TLGA 2H63A 3GFGA 3NHMA 3NNSA 5G3ZA 3IP3A 1DC6A 3F0TA 2GAOA 1FDIA 1AGNA 2X9LA 1XEWY 3DKVA 2EKPA 1G5FA 2CN1A 4LDZA 3ROFA 3OZSA 5J23A 4XD7D 3TGLA 1C9YA 1X42A 4KQCA 2VXYA 1O6ZA 1EWKA 2CFIA 1M2GA 5B30A 4Q7JB 2DWOA 2A9OA 4BE4A 3AY6A 1VPLA 3G8YA 5GOTA 3QQPA 2VHJA 4BZWA 5GZ1A 1E1NA 1N0UA 2YW2A 4WLFA 3VZPA 1JQ5A 4M21A 4FFBB 4OAQA 4O29A 1P7VA 2XE6A 1QLWA 3KZMA 4KMMA 5GJWC 3Q11A 3VAYA 3R3JA 1ZGHA 1RI1A 3EF0A 1PIWA 3MOGA 1ECLA 1O94D 3IEKA 1JLLA 3DTVD 1K3TA 3JQ9A 1E8NA 4RE6A 2AUNA 2PZMA 4IMPA 5JE8A 3CCFA 4BUJA 1L7OA 2Z6VA 1WWKA 3MK31 4QJ5A 4RABA 5CJJA 3UYLA 2LTAA 3D43A 3QGMA 1OZHA 1U6IA 3BJIC 3M5CA 3FUXA 4WK6A 5ALQA 1N6LA 5FTMA 3UEOA 3W5IA 3AETA 2IZ1A 5DP2A 3KHSA 4YJGA 3O2JA 3HBNA 1KKLA 3LP6A 3CUUA 4YRCA 3QWFA 4IFEA 4WKGA 2AFHA 2F3QA 5KYXB 5DGDA 2DSNA 5ICMA 4QC2A 2OT3B 4GLJA 3QPCA 3X2EA 2ZCJA 4KREA 3ETJA 3OE4A 2NU8B 1HFJA 4GMHA 4P08A 4OFZA 4W63A 6AT1A 1CQZA 3KOOA 1L5WA 5ADWA 2ICAA 3IURA 3SZGA 1PJAA 1BYUA 2FPIB 3EARA 5FHRA 5FOVA 5FI1B 1Y9AA 1CUFA 4R6WA 3ZGLA 3BD9A 1PI3A 2VUSA 3FZEA 1LSOA 1PTKA 2J67A 1P2TA 1JH9A 3CZRA 3Q8KA 2HCJB 4G65A 4Q05A 3ZC3A 2FEWB 4G67A 2YWXA 4GOOD 3VZSA 6LDHA 4RYLA 5DM4A 4DEVA 3DT8A 5JDCA 1PCXA 5JSYA 1L7NA 1OFVA 4OJTA 4KHPB 1JXAA 1HE2A 4Z0PA 2GDJA 5J2UF 4F85A 1O57A 3GDGA 3GT7A 3CB2A 3U49A 1F2TA 1ESMA 1YIDA 3E8MA 5FUMA 3VU3A 5AW4A 1L4YA 3NW9A 1FTQA 2DBZA 1I94B 2IUTA 5L4SA 1C3XA 4WV3A 3IOMA 4IV5A 4LVOA 5IDVA 4EI9A 3VNUA 4RK6A 2YFHA 4NBLA 3FFBA 2E4AA 1Y42X 3DDNA 3TQCA 3G9XA 4TKVA 2YC2C 1GTVA 3HJFA 1DWQA 2Z2XA 4G2TA 1MJGM 1QP8A 5KTOA 3OWOA 1X1DA 4WKCA 1PJRA 1UBMS 2BZ1A 1CJTC 3UW3A 4BNKA 1RAIA 4PZYA 4DY4A 4DV3B 4LQ4A 3TE6A 1WJGA 1TMYA 2PS3A 4ZYWA 2JGJA 4KOAA 3SP1A 1W88A 2VWHA 2HAEA 3VZDA 4QOIA 1NKVA 1ZD9A 1IN6A 3I6ZA 2VEOA 1XJ5A 5LNK1 1EUCB 5LPNA 4EPTA 5AW8A 2QTRA 4AJKA 1KMNA 3W6NA 4ZFNA 2VUIB 4RX1A 4OPMA 1ZK2A 1T9KA 2XUZA 4FW8A 5CA0A 2XUKA 3OOWA 2XZDA 2YBDA 3JQQA 4L5YA 4IEEA 5JVDB 5K3CA 3BFKA 1YB7A 3ZV5A 3MTEA 2GM9A 3ZY4A 2C8KA 1BKYA 1TF5A 3I01M 2BMAA 1H5QA 1Y6JA 1FUKA 4MW7A 1YDFA 3UJNA 2VI5A 4EJ6A 4XGIA 1PWZA 3NRCA 1ODLA 1PUXA 1KBZA 3R0VA 4M1MA 5MHTA 1BH2A 4Z1MA 1NT4A 4U02A 4KC0A 3WYBA 1N6RA 4E70A 4GMDA 2JGKA 1FXWF 2QTTA 4AFNA 4JBWA 3U40A 4DM7A 3AM4A 4TRJA 4N03A 4GP6A 2FU5C 4WASA 1FMCA 1VHTA 1O5OA 3IHTA 4QJ3A 4J0FA 3PEFA 1JX6A 2EKZA 4HAOA 1OWPA 2E82A 1JHAA 4P4NA 4OHFA 3ETEA 1U0EA 2ZIUB 2R79A 1XP8A 2NSJA 5DBOA 3RREA 2G1UA 4TT3D 3DE0X 4MV6A 5IZCA 4Z7NB 1JJ7A 4RO0A 4BNZA 4F3NA 3W1WA 3FSGA 1YI0A 1XUOA 2P2SA 4NYIQ 4QUGA 5F73A 4BVJA 1U4NA 4IF6A 4DR7B 3GRUA 1LVUA 2Q3LA 1JYSA 1ZP6A 4R2HA 3TLJA 3THWA 5L3SB 4IX9A 4JJAA 4LRTB 1E0SA 4Y2HA 3VX3A 1JLMA 2WJJA 2XWBF 4OL0A 4GMFA 2NUTB 3MUNA 1SCUB 4KDCA 5AKEA 3HSSA 2O07A 3DDZX 4BASA 3G8DA 4BGEA 2HRRA 4OAPA 4JT4A 2ADMA 3FNEA 4X91A 1SXJD 1NXWA 4GIBA 3AUSA 2ERXA 4MZXA 3GJ3A 5DGCA 2ZZKA 1DRVA 2ECKA 5IT4A 1V8BA 3G2OA 1ZNYA 2UVQA 3P32A 3V8VA 2G9VA 5AOBA 3SN6A 1OUMA 3WLRA 3AVYA 4BEJA 4IGFA 3M33A 3H1EA 3RRNA 2GAAA 1D0SA 3ABRB 2AZXA 1IVSA 2H00A 3U4AA 2OHOA 4ALLA 1GUAA 2VRNA 2BLNA 1XTBA 4JAVC 2CF5A 3W06A 2VQDA 3SQOA 1G5IA 4IDEA 2FFBA 5AKXA 4NV0A 1EIZA 5EMNA 4YUWA 3NTRA 1C5KA 1MX5A 4XDZA 3ILSA 1I3KA 4N7JA 2RCYA 3TB6A 1RZRD 1LDNA 1AO3A 1L1EA 4PLCA 5DNCA 3OG9A 1G5RA 5JASA 2CMGA 3QYJA 1W4BA 3Q7TA 5E6RA 2J85A 3IXMA 4PS1A 3SIPA 5CG2A 3OAAA 5DNVA 4B17A 4OQPA 3AJRA 3DQZA 2X58A 1E3IA 1JFLA 1W49A 2P0YA 3GFRA 2AEMA 3ME5A 4R4JA 5IJAA 2PPLA 4J07A 5A9SA 2YMLA 4IQGA 3WLJA 1NXTA 3CRMA 4HQ6A 2GK3A 4LYEA 2ZI3A 3HR7A 3I53A 3U3OA 2C20A 3IT2A 4N12A 4BNNA 4MAFA 1UC9A 1ZITA 2IW3A 2XYHA 5CGQB 3THXA 3M82A 3V8RA 1BCRB 1MTOA 3C3JA 5C0OE 3FNBA 1XZEA 5HKOA 4ZAGA 4DT1B 2F3RA 2PUVA 3MJSA 3BRWD 2W6ZA 1K97A 1LNQA 4MR9B 4CQMB 5K3OA 4BQQA 5K05A 4YCJA 1B2LA 3E58A 5EEHA 5LZ7A 5AO9A 1YT5A 5CA1F 3T0FA 3UPUA 4RDCA 5DNEA 4RACA 1L4LA 3HL0A 1SUDA 2Y4OA 3L8YA 1A9SA 1ZBDA 3M8KA 4AQYB 3OP4A 4IIJB 3X3HA 3I34X 5B2ZA 3JALB 3L82B 3WXBA 1RQNA 2PRYA 3OT5A 1JI0A 3Q3GE 1K4KA 4G01B 4AJPA 5CD9A 3ZK8A 1NONA 5ALMA 3E0QA 1A8HA 5DHPA 4XEHA 3H8JA 4MW4A 4TGLA 3WJ1A 2DE0X 5D87A 4COOA 8MHTA 2AD1A 1VXOA 2R68A 3EFOB 2XGJA 3O5AA 3BREA 3P19A 3QUQA 4X93A 3RC7A 3T1YB 4P0PB 1VKNA 4IIXA 3FLAA 3U48A 1X1BA 1WB5A 4RK5A 2OMEA 1ULBA 5G0UA 3ZN2A 1C3OB 2B7BA 2OEPA 4QBIA 2G0AA 4EMBA 1P2VA 3W5AA 3NEYA 3E9NA 4MUMA 4N3NA 4EUFA 5BW5A 1GG5A 2PBFA 2PUJA 2VH5R 1ADFA 2OO7A 4TN5A 3BF8A 1YZGA 1OA0A 4UZFA 2QRGA 4CMKA 3RUEA 1JZQA 4U9UA 3D2BA 3IV9A 7YASA 5L3QA 1UBHS 4R1QA 3OCXA 2WNHA 5P8WA 2VAXA 4W8OA 3R7BA 1DBVO 2G80A 3FOFC 1RABA 4RVGA 1T5IA 3EDYA 1JYFA 2VPZA 3AVTA 3IQWA 2PD6A 3D7LA 3KYBA 4MVJG 1HT0A 3TR5A 3IALA 3VO1A 3T4PA 1KMHA 1MTZA 2QNRA 2CMHA 3BQMB 2ZCUA 1AXRA 2Q6OA 4TMFA 1ZLXA 1GCGA 1YQEA 3HC7A 3RWOA 3DPSA 2YNMA 5DBEX 4BIIA 4D9KA 1XYGA 2YW9A 4HRXA 3AEXA 4HSGA 1MGOA 7GPBA 3H05A 1CT9A 2WVGA 4IXMA 1R9GA