1IWBB

Crystal structure of diol dehydratase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
b'GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIOL DEHYDRATASE alpha chain
molecule tags Lyase
source organism Klebsiella oxytoca
publication title Substrate-induced conformational change of a coenzyme B12-dependent enzyme: crystal structure of the substrate-free form of diol dehydratase
pubmed doi rcsb
total genus 60
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2002-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1iwbB00
3BRCA 1UC5B 1EEXB 1DIOB 1IWPB 1IWBB 2D0PB 3WB1A 1EGVB 2D0OB 5D5QA 1NBWB 1UC4B 3AUJB 1MMFB 3WB0A 1EGMB 3WB2A 5D5PA
chains in the Genus database with same CATH superfamily
1CS0A 3LOQA 4B73A 1X6VA 2IXAA 4RZQA 1TD9A 4MWBA 3VHLB 5LYJB 3BHJA 3CF0A 1TCBA 5KWEA 1M72A 2ZRMA 2BFWA 3H2KA 4OU5A 3DVRX 4CL0A 1IN4A 5IJWA 2FB9A 1JMVA 1I36A 1XK7A 1IZ9A 3C7DB 3EH1A 4NOMA 4TKUA 2Z3WA 4KQIA 4I6GA 2NU7B 5AXDA 3Q40A 3VPFA 5F77A 3NM5A 5B3JA 5LWHA 2FXVA 2RGNA 3F5QA 4PLGA 1YV9A 3OPYB 3QX8A 2CYCA 5CA0A 4ZYLA 4GP6A 1MA3A 4RCYA 1CZUA 4KLCA 1KQOA 3ZLTA 4D6YA 4G0ZA 4KZPA 4PFKA 1IU9A 3WLKX 3EQ6A 3RPEA 1YZHA 5LZ7A 3QLTA 4DR5B 1JFTA 1D4ZA 5EUQB 4RAQA 3ZWYA 1J9GA 1QBKC 2EGGA 2C5SA 2H5IA 2Q27A 1C3XA 1L7PA 1S2IA 3GROA 4XCVA 4D99A 3MPOA 2BGMA 5LP1A 2QTWB 1IBLB 3ABOB 3U4MA 2R5NA 1NVFA 5AW8A 3EEQA 4TV8A 3NDIA 2OG1A 1NJ2A 3WGOA 3K8QA 4U9HS 2VAXA 3TLZA 5HGJA 4LZAA 3W5CA 2C2ZA 3L77A 5G4KB 4XUEA 4R2LA 4MV5A 1ZIDA 2BTOA 4JFAA 4BTLA 1RXUA 4F4HA 2HWWA 2CKDA 3QVVA 4HNUA 3GJYA 3VOSA 1VIAA 4JI0B 5KZMB 3U9SA 3LX4A 4KGZA 4UNIA 1AZSC 4B31A 3M9XA 2BC9A 3OICA 1C1XB 4EYOA 4JBLA 1FTNA 4BO6A 3OZIA 4AM8A 2JZOA 4IXWA 1P3JA 4JP3A 5AWFC 4NG5A 1M1YE 5ALNA 4F56A 3LF1A 1HA3A 2PL5A 4WNAB 3TSCA 3THYB 4X6LA 3U3XA 4JP5A 2B8JA 3MWJA 3H5WA 4IIVA 2PX3A 1YZQA 5L3RA 1JLKA 4PXSA 4NPCA 4BNHA 4ER7A 3DBLA 4JI2B 2XIJA 3R09A 4RMIA 1U81A 4YVFA 1BGXT 4WKCA 4PSDA 1QYXA 3G8YA 1T9DA 1QKKA 2CHQA 5ALOA 4FFDA 1VSVA 4XH9B 3ZWQA 1CB0A 3EGXB 4X7MA 5JS6A 1XRLA 2YASA 3KP1A 4KGXA 5AUQA 3VRHA 4OATA 1E2HA 4DA0A 4E5KA 2GCGA 4R9SA 1CQWA 2DF8A 1MC5A 5TMDA 2JKZA 5K8JB 4B82A 5DTJA 1QO0A 1P62B 1GGJA 3M6IA 1N34B 4ZMSA 3DNFA 2BZ0A 2ZITA 3KFXA 3PYXA 2AOUA 2GPYA 1TAQA 2QUJA 4L8YA 1RE1A 3JXEA 4M6WB 2DLDA 3LBAA 1NX6A 2H7YA 1SD1A 2MTBA 4JA2A 4MUEA 4TMZA 1XAIA 1K3TA 3T9FA 1GU0A 1MDFA 1WXWA 3CEJA 4XUCA 2YICA 2FMXA 2JH8A 4U7PB 5FYQA 2ILTA 3L0DA 2PFSA 5J23A 1DVRA 2LIVA 2O2EA 2VA9A 1XMIA 4HMQA 4OI2A 3E0XA 1AO0A 1A2BA 4UPDA 2IIPA 5AJVB 2ZSHA 1R6VA 3UPUA 1UKAA 1YQEA 3JVUA 3DXYA 3RARA 3W8RA 5BW4A 1QIGA 4JYCA 1JZSA 1Q6ZA 3I9V1 3RS2A 1A9XA 3EQ8A 3WRXA 2XDYA 5IUNC 5LLSA 2E4VA 3CZCA 4KAAA 3PXCX 4ZYZA 5CT8A 1YK0A 2R8ZA 3L8GA 5H9VA 4WJLA 1QH9A 1NDUA 2CK3D 2J5BA 1W73A 3FMOB 4Q93A 4QREA 3IVGA 5DGDA 5CCEA 3UH1A 4M8SA 3URMA 4GBMA 1H93A 4IUCS 3WL8A 1TM7E 3AH8A 4JGGA 1G98A 1GXSB 3CYFA 2XKKA 3T34A 3ZHCA 4RVFA 3K4QA 1H2RS 3ICWA 5CVJA 3REOA 2JBWA 3I9FA 3W77A 2EGUA 4L0CA 2ADFA 3PWSA 4TUYF 2GK6A 1Q21A 4XVUA 5FUWA 3ZU3A 2DR2A 4AMZA 3C5CA 4MLPA 4GVXA 2XVZA 2GSWA 4RKYA 2JD0A 3BULA 4DR2B 2WEKA 1W4ZA 1UKZA 4KQWA 1L1EA 3JZIA 4NFLA 4TT8A 3AZQA 5HJ5A 5IWCA 2HHCA 3AF6A 1LDNA 4FVTA 4TTTS 4AX4A 1JPVA 1RC0A 1JSCA 1JEOA 2HSDA 3WJ1A 3B1VA 3CZMA 4UNQA 4CKYA 2KJQA 3LECA 3PHBE 1NPDA 3H83A 1ECBA 1RLIA 1TTHA 4TKMA 3A31A 4AY5A 1F2UB 2FRXA 1XF9A 4LVUA 4RJJA 4QA9A 4YAIA 3CMMA 4ZVVA 3TB4A 2NP7A 3SZ3A 1JIKA 5FOSA 5CEEA 3BMNA 2FYTA 3KJIA 4JJIA 4QJ5A 2RGRA 2P9BA 4BNFA 1RAEA 3I05A 2RBKA 4LQLA 4RJ2A 1XELA 2ERCA 4QEKA 2VPXA 4Y30A 3U3RA 121PA 2R7LA 2VJDA 3LWBA 2REQA 2YR0A 2X40A 1U31A 2PKXA 4WN9A 4LECA 3LRPA 4TMTA 2BEKA 2OBBA 3IULA 4QO7A 4JIMA 2AT1A 3EN0A 1QG6A 1JSRA 1OR8A 1T6YA 1Z5WA 1KHTA 1ZXLA 3A4IA 3SZOA 3V8VA 2QRMA 1RAIA 1VIVA 2G88A 5ECYA 4ARVA 4B83A 3PQ2A 3CN9A 2AYYA 4H1UA 3P32A 2RGEA 1A7AA 2E4YA 2L19A 3WRYC 4OLJA 2JGFA 2QE6A 3QMWA 4UUOA 1LI4A 4W8GA 1AA9A 2QVBA 4UM8B 3NTQA 3KALA 3QXJA 3RC8A 1IN6A 1ZH0A 2RH5A 3HKDB 1P6XA 1WQ4A 4NP6A 4B35A 3OIDA 3DL4A 5BMVF 5E9QA 3K70D 2IP4A 3P5SA 4AXBA 5FRDA 3F6SA 2UXDB 5AVQA 2RIRA 4OSEA 1NXWA 1ZH4A 3L0SA 3PR1A 4H0CA 2ZKLA 3THSA 3VX3A 5IKMA 5K3OA 3NMUF 3GCXA 2PWYA 4HQ0A 2ZIWB 3KC2A 4BKUA 5AVVA 1GKKA 1HZJA 2VDWB 1DAFA 1SXJA 4O8CA 3ZV5A 1U2EA 5CRIA 4GKVA 1H6DA 2ORIA 2JCYA 1OX4B 3KOOA 3N6XA 1V7QA 1I5OA 3CO5A 4RELA 1E4EB 3K5WA 2O2GA 3G85A 3H11A 4N0PA 1I7NA 4Q9DA 4Z86A 4D3FA 1OH5A 3KKKA 1GM5A 2NP6A 1CY7A 4KR7A 3DF7A 2PZFA 3ED1A 3UCEA 1TAGA 5CG1A 1I7DA 2CVFA 1IY0A 1KKMA 3A4MA 4LMBA 3DZGA 4J3JA 5FBWB 1RWOA 3A1WA 3PR2B 4NMMA 4WY5A 2OV3A 3FSGD 2AN9A 1ZOSA 2GZ1A 4NFHA 3VV2A 3KEGA 1YRBA 2I7XA 4J8PA 1NE7A 2I2CA 2ECPA 4BGUA 4UHKA 3JARA 4MS1B 3WGYA 3EIWA 5HGXA 1RRFA 1XQXA 3FPLA 5CXSA 4GG1A 4QASA 3OFSA 1FSSA 4II7A 4J1TA 4EARA 4PIVA 1EWRA 1A9TA 4I1PA 5KCMA 2GZ2A 1THMA 2ZR7A 3P8ZA 4H3KB 4BLVA 2Z95A 1E62A 4TKVA 1B1CA 1FS6A 1G6OA 3A4VA 4FN5A 1DMSA 1TFRA 5DCWA 3SP1A 1B3RA 1GFSA 4URHA 5JARA 2IUYA 2IXEA 5CFLA 1BJRE 1PT9A 3KXLA 3O73A 4Z9FA 5DEOA 3T95A 4LMAA 3HVJA 1MMFB 2EHJA 3L1UA 3NORA 2PT6A 2BEVA 1A5BB 4EVQA 2IZ0A 3HY4A 1NQVA 3F1KA 1JWAB 2IHVA 1G0OA 1SIOA 1F6BA 2O3UA 4BN0A 4ZI7F 3HXQA 1HH4A 1JMYA 4DZRA 3WGIA 2EZ9A 1JKFA 5IYZA 5KNBH 3JQPA 5ARCA 1ZAYA 4WGGA 1PEKE 2BR4A 2GJ4A 5KVAA 4EO7A 3GW8A 1BTOA 2BF7A 4G5XA 3VC1A 3ROMA 5IVKA 1AS0A 5ESRA 2FY8A 4L2IA 3CUTA 4XTCS 4KE7A 4G89A 4F1JA 5EQJB 1Z5NA 2Q9AA 3ME5A 3OZAA 4IH1A 4U2CA 4F4JA 1PJAA 1G19A 2WM8A 3LNCA 1BKYA 3DPIA 4H7JA 1T9BA 3RJTA 3ULKA 4I99A 1GVNB 5EJ5A 3G7SA 1TYEB 1GPBA 3D6UA 5H02A 4CR8A 2BGRA 3PHHA 4I4CA 4R2HA 4XX0B 1GR1A 3KAJA 3OEHD 2VR1A 2IEAA 3O92A 3OFJA 5FLXA 3GCDA 4XVRA 5KNBA 3KHUA 3AERB 4NBWA 2IUEA 3F7NA 3FVVA 4MR8A 5FR1A 4DL9A 3HVRA 2XRMA 4PG5A 1JB1A 3LP8A 4RY0A 5CGQB 2JVIA 2VZ0A 3ASYA 1L4YA 5B53A 4RKWA 4LWPA 4V0QA 1NY5A 2VT7A 3WS7A 3UKJA 3Q6MA 3AF0A 4C3OB 2HT1A 1VLLA 1CQJA 1Y8RA 2ID4A 2VPWA 2ISSD 3R74A 1NW7A 1V6AA 1Y4AE 4YPFA 1L5KA 2C1ZA 3HCOA 3IB3A 3WFIA 1G6HA 2BVNA 3EPJA 1JVBA 3MUOA 4GX1A 2IH2A 1I6WA 2PS0A 4Y2XA 5JISA 2Y0CA 2V7PA 3OZRA 3ZIAA 1ZJYA 2WFAA 2Y1CA 2I9PA 3CEHA 1NZFA 4HWKA 3HXOA 2H1IA 4U2DA 2OYCA 1JEJA 1BCRA 2BE9A 2IDKA 2WDZA 1YZNA 3NASA 1CHNA 4N5DA 4P93A 1EX7A 3LIPA 1KQNA 1NWHA 3ZWVA 1A8UA 1QIDA 3G2JA 3WYCA 1G18A 4CF4A 1XPJA 3HB7A 1BWRA 4PN3A 1QB7A 2H16A 1Q77A 3GB9A 4LHEA 2IOFA 1SD2A 5SICE 1KP3A 4BKQA 3BL5A 1EXMA 3F67A 5TB5A 1E1CB 2BGNA 5LQNA 3TB6A 1VSQA 1FQWA 1OHHA 1JHUA 1VL5A 5ALFA 4CLDA 3N8HA 2MOKA 2HKIA 4YY3B 5KKNB 1DCTA 4TVKA 3IRUA 2C4UA 2VZLA 2WY2D 1G3UA 2C31A 2YYAA 1X80A 2FR1A 4LYYA 3DDHA 2K4MA 2ZVQX 3IIEA 4WCDA 1WD7A 4PC6A 1SU8A 2CCKA 3FHTA 4QPDA 5E0OA 1TB4A 1CKEA 5I5EA 2ODQA 1HPLA 1E4EA 3KYCB 1QKJA 4NCAA 1UIMA 1SEVA 3DB1A 3OHSX 3EVEA 2CL0X 1YK1A 4WX2B 1ENPA 3GELA 4RDIA 2EKBA 3N2NA 1OJLA 3NIFB 4ZXPA 2BFBA 3GAFA 4ZGGA 3FETA 4JYZA 3M0EA 2BM9A 3K0AB 5DX8A 2IPAB 4KXVA 1EP9A 2AHOA 3UHFA 3ROPA 4MKIA 2R00A 1ML4A 4BE9A 4RCZA 4TWAA 3LIIA 3OZEA 1AGPA 3WAJA 2ZUWA 2PWAA 3DZ8A 2XUFA 1ZSYA 3MILA 3R2JA 4G09A 2CXOA 3TBHA 2OV8A 4FWTA 3CRQA 4O1IA 2QRZA 1WXEA 4UTRA 2EQBA 3I23A 5HM6A 1TL7C 4MJ3A 2Q4OA 3T3HA 4B44A 5HEKA 2Q5HA 4C6TB 3RRYA 1TJ4A 2H06A 4IIHA 1XQ1A 5IU6A 1Y6FA 3NHWA 4M7PA 1VJ0A 5DIZA 1Z2DA 4FR5A 1Y9JA 2OXCA 3EY9A 3KB8A 5D3MB 4Z0TA 3ZZMA 3CRW1 2HTFA 1YU6A 3BMNB 3EMVA 3IJRA 3KKEA 2DWOA 1ACJA 2QRJA 3ECSA 4OP3A 1GQSA 3DAGA 3EK2A 5I7SA 5A9RA 5DRYA 2LXNA 2Q3DA 4FJ2A 3KIPA 2B34A 3E3LA 4NTZA 3SJ7A 5KC8A 3I9NA 3W06A 2GUWA 3A3PA 2WTEA 3E7FA 2I7DA 3I8OA 4LF8B 4DUYB 4XVQA 2PKYX 5DK4A 5JT1A 2FW1A 1P61B 3BJIC 4FBGA 2Q2WA 4MVYA 5DMHA 2WINI 3EWNA 2W2TA 4QFBA 1V45E 3QFSA 4KEAA 1FK8A 2QK4A 3RAFC 4L72A 3LQRA 1EP1B 3N5KA 3ICQB 3VJMA 4H15A 3DCIA 3KL2A 2H2WA 4PO3X 3K0HA 1XV5A 9ABPA 4OKSA 4M8IA 4HVCA 3WB9A 1PJBA 3E6AA 3V8MA 4G4JA 3HKDA 3DOHA 4S1NA 1CIVA 1JQBA 5KSZA 1Q57A 4DLXA 4HAYA 3GRAA 4DANA 3VISA 1PGQA 4QQRA 4CM1A 4YT2A 2AV6A 3FTFA 3OQMA 3U7RA 3S1LA 1FDWA 1M8GA 4U0JA 1I14A 4E0BA 4OAQA 2VEDA 1A9SA 1LRKA 3LWDA 1NV9A 1T4BA 2Q6OA 3DFUA 2QYOA 2Y8EA 5ICGA 2W5UA 1Q7RA 1CY4A 5H83A 2Y1OA 5DTMA 4CTKA 3TTUA 1Z5UA 1G6KA 1U3CA 4H3SA 3GMTA 1BFKA 4UCWA 3OQIA 3WE7A 4NK4A 4J91A 4NMHA 5A7FA 3TW0A 4ZU1X 3GVXA 1AIPA 3WGZA 2VK8A 3GLQA 3LO5A 2HA2A 2W42A 4P54A 2BF4A 2Z6AA 2N1MA 4UM9D 3G5UA 1PZEA 4JBNA 3WADA 3WQBA 2R86A 1T4DA 4IDDA 5KYYB 1HOXA 1C4KA 2OY0A 1ZVQA 1PJCA 4M0KA 1QR6A 4Z0HO 5BV7A 2VJCA 2WD7A 5FOWA 1GTJ1 3RFUA 1TGVA 1BVRA 2E18A 4K2HA 5I48A 2IU3A 5J40A 2J3KA 4LJRA 2I2FA 4V2IA 2BM0A 1UFOA 3ET4A 4FFBB 4HQKA 4Z9AA 3O3NB 1EAMA 1JMKC 4HI0E 2C3MA 2PSHA 4NYMQ 3HKBA 5ES3A 4NF2A 1PQ4A 1OLXB 4YP6A 2EX1A 2Y0EA 3PFHA 4DDHA 5JV5A 1K2VN 4US1R 1NMEA 1PBNA 4KNYA 2ZK7A 4IUBS 1N3BA 1AH2A 1P4JA 5LXTB 1GZ7A 3DBLB 3I6QA 2GAIA 1X74A 1YB6A 3Q98A 5D8DA 3VQTA 3BRSA 3KQSA 2B7LA 3I5MA 4NAHA 3SHVA 2A59A 3VR3D 7REQB 1AN0A 2VDNB 3MRTA 4I81A 2LCQA 3W8FA 4QJ3A 2ZGVA 3NWBA 4C0HA 1Y33E 2FEXA 3VU9B 3WDMA 1EZZA 1KI6B 5AW3A 4A27A 1YQQA 2G6BA 2QORA 1JS1X 3RTBA 2V7WA 4LOIA 3RGWS 1H42A 4P84A 1FW6A 4WAUA 3W34A 1U0LA 1ZN9A 1N2CE 2ZR0A 1ZVMA 3OQJA 4AULA 4CLOB 1UWLA 4U3JA 3DZJA 3PWTA 1KAOA 3ZE6A 4JKYA 2ICAA 4DABA 2QLMA 5JEDA 1I94B 4ABTA 1NKSA 2GRAA 3QEJA 3IPYA 4BCDA 4QM7A 3EGOA 5A1JA 1WSDA 4D4KA 1Z2PX 3QBJA 1P4GA 3S1AA 1RHKA 4C7VA 3LCUA 4B6QA 3JZAA 5JZOA 1YB1A 3LG2A 3FWPA 4N47A 4A7PA 3A6FA 1E8DA 1Y4ZA 4YRMA 1R18A 2ZS8A 1N36B 2OBYA 4RLQA 4C01A 2WV9A 2IHZA 3A6GA 3N5CA 5AHOA 3EVGA 5K8VA 1R6DA 5F7JA 5FHQA 2F55A 5JSQA 4P0QB 1TF7A 4HEA1 4BMSA 1CJBA 2IFTA 3FNBA 3OPVA 3COWA 1LX7A 2QZPA 4Y9RA 4FOPA 3UVEA 1AGYA 3ZU4A 1MAWA 1JRLA 2FZKA 2WIBA 4OQ4A 3AUTA 4IFEA 3WL4A 2Q1XA 1I4DD 3RHSA 1Q0ZA 3OVMA 1EGHA 3IUSA 3N28A 5EHNA 4OYRA 3E48A 1IPFA 3AL3A 1HBJA 1W5EA 2WILA 4JUDX 3L7KA 4M38A 4G1UC 2Y0DA 3TQFA 1X7YA 1XZ8A 3A6KA 3QVGA 4AZ0A 5JNLA 3HO8A 5CCXA 4N3NA 4MAAA 5B37A 1CEYA 3RUCA 3GLRA 1WS6A 2FR8C 2UVPB 3HACA 1P7VA 4R7GA 4MITA 4YASA 1NNUA 4C2AA 1GUDA 1OIXA 3AVWA 1UPUA 2PRYA 3STUA 1DGQA 2JGEA 2XVXA 3VR2A 4AL4A 1SVMA 1FYFA 2G8NA 3FPCA 3OMLA 2ZJ0A 4IDCA 4M9QA 4UTZA 3TVTA 4GMFA 2ZM5A 4TGLA 1Z88A 3LBNA 4DIFA 3UJBA 5D3ZA 5EE1A 1ZMRA 1NP7A 3T7DA 3NTLA 1TO1E 2W22A 4G36A 4D8XA 1G5TA 4DS3A 1HDRA 2X15A 1Q0TA 2QGNA 3TNLA 2GESA 4OEHA 2X1HA 2P6NA 1NYTA 3QWAA 1CCWA 1K8ZB 2QG9A 3BJEA 1FTSA 3I64A 1PG2A 3ZKAA 2HK6A 2JJ1D 1I5RA 3EG9A 2RGWA 3T7JA 2H1SA 1V1JA 1V2GA 3B20A 1UK8A 3PXGA 1J33A 2OOSA 1DX4A 1BDHA 2XKBA 4Z4EA 4BO0A 1YDHA 2ON6A 3Q88A 3OPNA 4TLLB 3VDMA 1XMXA 2FEOA 3JATA 4X7PA 4BO8A 5DXFA 1V96A 3W2FA 3T61A 4C7BA 2ZT6A 1NC1A 1GYQA 1W5FA 5FI5A 5A3JA 1PHPA 4O4LF 2FOLA 3ASZA 1JALA 2ZEJA 3LHDA 4JOSA 4KRXA 3BSSA 3PUVA 4L9WA 4RV9A 3WKCA 3AM5A 4JSRA 1O9HA 2G9ZA 4OMCA 3B1KA 4RQTA 1P77A 3E1GA 4U4AA 1CUFA 1O03A 2OLKA 3IKVA 1I3OA 3MWKA 3Q87B 4ALKA 1ZVVA 3W4KA 4NABA 4JZKA 1U2RA 2P30A 1X8KA 3H2SA 3HG7A 4FXPA 1VIDA 4QJIA 1ILEA 1RDFA 4QBGB 1GO2A 1JG6A 1LDYA 3PC8A 1KNQA 2QN9A 2W2KA 3GZNB 3UXEA 2OUKA 3PT5A 2J3DA 4NZZA 3GT4A 5EJ2A 3D0KA 1BX3A 5KHAA 1FMJA 2WOJA 1JXQA 3FROA 3K2EA 3OEYA 1UQTA 2CDRA 1N8TA 3C6KA 2GASA 3RSLA 3RUPA 4B4VA 3EGCA 4D9KA 3CW2A 4C4SA 4CN8A 5GV7A 5AUOB 3RAPR 4LOLA 3GRUA 1CJCA 1DC7A 2CV0A 3H19A 1FUYB 5AKZA 1W49A 3KSBC 3NB0A 4RF3A 3WOVA 1NN0A 4DYHA 3MYRA 3SEZA 1Y5IA 1EB8A 4V1CB 5EE0A 2VOJA 3QBVA 5J3JA 3FTEA 1ZO8A 1QGAA 1IJEA 2VVTA 1Y6ZA 4ZTBA 3LS2A 4KQJA 4QGAA 4OJYA 4L4UA 1I7QB 5DLDA 3LQFA 2C7GA 4M99A 3CINA 4XLLA 3K6RA 1KC3A 4MB2A 3EEYA 3KV1A 3WXBA 3I04M 2D2VA 1DT3A 3UATA 1D2CA 2FKAA 1I6KA 2Z8XA 4ZZ1A 3TVDA 3LXMA 3RTGA 3IPAA 4EG6A 3RUEA 2C9MA 3EDRA 4MRAA 3NETA 5JCZA 2CFOA 1OROA 1W9MA 3IIJA 4F5YA 4J0JA 3UPTA 3NHYA 3TO5A 3DFMA 2HA3A 1KGSA 2C98A 5KYVA 4RTSA 5CHEA 1HKUA 1BRTA 4I1VA 2ZM6B 4PYOA 4PZ9A 1NVDA 1AOXA 4KL8S 4D0RA 2I4NA 1BE6A 2PZJA 3DE4X 4I4TF 4PONA 2JH9A 2PJDA 4KR9A 4YV0A 4ZDKA 1CUEA 3QNWA 1J99A 1UT8A 1MN6A 2GZDA 4BB0A 4YYZA 4IHAA 1N5RA 1XZAA 1RLJA 1VJTA 1GKUB 1JU3A 1IOWA 4YUXA 2XAUA 1ORIA 2WHYA 5CW1A 3W2EA 2G8LA 3O1JC 4MRVA 4ZEWA 1PAUA 2OQVA 3SC2B 5C80A 2CDNA 3HMQA 1WDLA 4EY6A 1OXBB 1IC6A 1JIJA 4D80A 1SHJA 3EDQA 1WLSA 4JV5B 4TXNA 4ER3A 3GEGA 1BS2A 3CZAA 1Z18A 1OFGA 3FE2A 1L7OA 3FBGA 3FHJA 4ZHQB 5F2NA 1XZPA 2Q5QA 5FH9A 1AZWA 1RKVA 2GKSA 1TM3E 3CKLA 4UCFA 4HWPA 3EG5A 3PENA 2A0XA 2FPGA 4J0HA 5K6AA 3U60B 1QF6A 2DKFA 2GM9A 3QLUC 1U99A 5FOQA 1X92A 4A2QA 2HDNB 2SICE 1SK8A 1ATIA 1GITA 2XHEA 3L46A 1QGUB 2VEOA 4M1TA 3COJA 2GZRA 4HRVA 3CGWA 4TYMA 3A2NA 3X43A 3OAAA 2EC5A 2GEUA 2O8BA 1H3FA 2BJVA 2ID8A 3F6PA 2PBRA 2PKQP 4ZCSA 3OT1A 4HV4A 2HMVA 5BOSB 3TLMA 5LP6C 4YO8A 2HO4A 4MGIR 2I55A 4LYFA 4A1FA 4UDOA 1IG3A 1QMPA 2GWHA 3H5AA 1PJRA 3LC0A 3GLFB 3T5MA 3DA8A 4J0GA 5DN9A 4ZAVA 4HBGA 1V5EA 3AIMA 3TZ6A 1VKHA 2B4RO 1VIMA 2A33A 2QX6A 4PNHA 2QQGA 2QY9A 5A4FS 4KBYA 3PIRA 4X61A 2XCIA 1OWLA 2FUNB 1Z17A 4UHBA 3SOPA 3X1YA 2R25B 4J2TA 3P2EA 4UMVA 1SUEA 1EG7A 2JJMA 1XD9A 1R8SA 3LK6A 2XQIA 4GECA 1QKIA 4Q7MB 3N07A 3A36A 2ZRGA 3ZCSA 1C5KA 1SUFA 4BVFA 1DQPA 3P5BA 2JA1A 3K5IA 4OO3A 3CNQS 1VSBA 4PPYA 4BQRA 4D9FA 1LDEA 4OIMA 5LKRA 3JPYA 4XGQA 3ADBA 4A8JB 4MKXA 3GK3A 4HATA 2CLIB 2H0AA 3ET5A 3Q1KA 1YBFA 1BMFA 2QSZA 3SK0A 4X92A 3TIVA 3U62A 3ROEA 4HG2A 1JPUA 3D7KA 3L49A 1WUKS 4ZANA 2IH4A 3I30X 3GZJA 3B1JA 2H1HA 4JX8A 2PLAA 1D6NA 3KFLA 3ND7A 2GQ0A 3AC0A 4H08A 3OZUA 2J7PA 1LBQA 2WM9B 2ZUCA 4FYIA 4U7HA 3VC3A 5FPTA 2BGTA 2IU4A 2WKSA 3DP7A 5L3ZA 4FYWA 3WLAA 2XT6A 3QXXA 4EF4A 4UVGA 3BB1A 5AW4A 3QQPA 1GPWB 4MROA 1T2AA 3L9XA 3VYVA 3GLTA 2HEIA 5BN1A 1GSIA 1Q14A 3EIUA 2FX3A 2QVZX 4JQYA 1P0PA 4OKIA 1BDIA 1PTJC 1L7NA 3OSUA 3KOWA 5EHGA 1FJXA 2QN8A 3V7NA 4LJ7A 4DZTA 5JYBA 1SO8A 1FUUA 1ZUHA 1C0EA 4GI5A 2NO6A 1NVVR 4KQHA 2GNOA 3GXBA 3NHFA 5FWYA 5F9HA 1SC4A 1IEQA 2F8TA 4KWHA 2JCGA 1Z22A 2CEKA 5EWJB 5K3FA 5JCXA 1W8DA 1IFXA 2B92A 3KXDA 1B8PA 2BMWA 1TE2A 1C1HA 2AN4A 3ITDA 1RRKA 3PTAA 1PSZA 1GJRA 1TEXA 3KT6A 3DKKA 2G82A 2EARA 3MNFA 3TQQA 5B1HA 2H4JA 3BRWD 5HILA 5KWSA 2PWBA 3R7NA 2I3BA 1BROA 1DKQA 1YNSA 3AJ9A 4DIKA 2OO7A 1RHJA 2QYTA 2DQSA 4X6YA 3HM2A 1S2DA 3EEBA 4P3NA 1MB9A 3LWNA 1YBMA 4J7CA 2X1VA 4ESHA 2IGBA 4ZQBA 4EBBA 1M2FA 1QE3A 5JMWA 4RH1A 4A6XA 4Z7OB 1BCRB 1XYVA 1YDEA 1JIQA 3CX8A 3D3WB 3FMIA 1RKBA 4JX9A 4K40A 5T5QA 3RLIA 1KAGA 2BFEB 5CDGA 5AKKA 2J3HA 3S68A 3R7DA 1N25A 2Q07A 1J1IA 2YJNA 4XJSA 4XVHA 3JQGB 4DLUA 1Q3HA 4KPGA 3RW9A 4A0HA 1E1CA 5HNKA 2AI1A 1NF2A 1BX0A 1JJBA 3IOYA 2OFOA 5H80A 4DMKA 4Q4HB 5H1YA 1IJBA 1H1LB 1RPZA 1MV5A 4Z4FA 4K0KB 3G2HA 4MQFB 3K30A 4Q9KA 5LIPA 3FHCB 3TLGB 4MWGA 1TEHA 4LSZA 3RUDA 3EX7C 3VNUA 2PUFA 3GU3A 3AVQA 3MTDA 2W6ID 5KOIA 4TOIA 4U9UA 5LOVF 3IDSA 3N7TA 3QK7A 4LJLA 4RA6B 1UKEA 3ZW8A 1I4LD 1ZN7A 3CG4A 4P92A 3VZBA 1H3NA 2RHOA 4QTZA 4RZHA 1P75A 3GARA 3JQAB 2V03A 3QPCA 3HJNA 1HFKA 1RQ7A 2Y6UA 3PGA1 1MB3A 1IQRA 4FS3A 4MIOA 3VTKA 1QX4A 4CCSA 3DOCA 2W6ZA 5TC4A 3HUEA 3F5MA 3JYHA 5A4IS 4QBKA 1ODTC 1IEVA 3FJYA 4V38A 3E8MA 3Q7TA 2ZZMA 1JAXA 1P6UA 2LPMA 4YUAA 2A84A 5KYWB 1NVBA 2HRDA 4AY6A 1U3GA 1N5DA 4PFJA 4YJKA 5EJ9A 3QOYA 5I01A 1JDUA 3JYQA 1M1UA 3QW2A 3GVCA 2P2LA 3IP8A 4QDJA 3CCFA 3R3HA 5B1SA 4Z9YA 4DY6A 3X1XA 2GZMA 1FQKA 4KQFA 3EQ2A 3B48A 4W5JA 4X3OA 3ZGVA 2NOAA 3NBFA 3WYNA 2YC2C 3X1JA 3OLCX 2RONA 4LF9B 1E3QA 3ETHA 1ML3A 2EJTA 1X7GA 4IGIA 4ND8A 1NW4A 3H16A 3GMDA 4GXNA 2Z5VA 4XWTA 1M34E 5K0CA 1Y6QA 3F78A 1KO5A 4MHOA 1T0HB 4OFBA 1Z4OA 2FPMA 2H1CA 1UZLA 2HK7A 1BEUB 5K3FB 5C8ZA 4ARUA 1D7AA 3Q2OA 4E08A 4P31A 4R83A 2CXXA 2VTEA 1IWOA 2JGIA 3JARB 1JKXA 3WKEA 1P2DA 4IS2A 3G0CA 3BH6A 4H3VA 2IGTA 5EP3A 2QT9A 4JLAA 4OUDB 3WICA 1K4MA 3H6GA 4A6EA 3OZBA 3V55A 1XTQA 3H2JA 5TSDA 3BFPA 1NZDA 3D8TA 4HLUA 4BFUA 1HG0A 4LF7B 1SVOA 4ESVA 1Z36A 4QBHA 3RE1A 1JE1A 1UKBA 1J23A 1G5QA 1LI5A 4WN9B 5JUWA 2AMLA 5EWLA 4RTQA 4YC7A 4PGGA 4H27A 4NBLA 1N5LA 3DTYA 4UATA 1HNXB 1EI9A 3CVXA 1JVSA 1ZSNA 2PRJA 1NOKA 2FZCA 3QTLA 5FFMA 1II0A 4LQDA 1GL3A 2YYZA 3LA8A 2MMGA 1WMAA 1G8HA 2XMZA 4F9TA 2WSLA 5BWMA 1DQNA 2FWMX 2WYHA 1QFZA 3THYA 4CM9A 2A8YA 1FYXA 3HBFA 4L6CA 4R0VA 2XJ4A 1DWPA 5IH7A 3JVIA 2K7FA 2D1RA 3FH0A 2WFLA 3IVRA 3UTCA 3OZWA 2KX7A 2FX2A 3QYJA 1SCUB 4ICIA 4HYTA 5CIWA 2FPPA 4MICA 3FVWA 3H2IA 4TS1A 5G2OA 2C83A 1JIXA 2VLIA 1S3SA 1XF1A 3HH8A 4G6ZA 3WLJA 1HDOA 3A1TA 1Y8QA 4LDPA 1G20E 2BGLA 2UYCA 2JIPA 3SJAA 2PUWA 1QVVA 4MR7A 2FETA 2JASA 2B37A 4UUPA 4LZWA 5EWJA 1SXJB 1TW2A 1OREA 4ZQEA 3TX2A 1MJFA 4RS3A 2YOHA 4FMCF 4IHKA 5CDTA 2NUBA 1PHRA 4MVJE 3UUWA 1JUDA 3U7IA 3TOCA 2P41A 4D26A 3DEFA 3NC1C 1ESEA 4GOXA 3RYIB 3VR1A 1MQ9A 3F9RA 3ELDA 3GGOA 1VL8A 4FGKA 3THWB 1BVHA 1TGYA 4P53A 4B3XA 2GSDA 1Z39A 3WLPA 1CJSA 3K9QO 4F4IA 3OX1A 1YRHA 1DBQA 2NV0A 1KPHA 2RJOA 1PZMA 1K63A 2GZ3A 3CZ4A 4JR0A 4AZVA 5HUHA 4Z4GA 5EZSA 3OU6A 3D2LA 3O4IA 4LV6A 4WRRA 3ELUA 3P7MA 3WB0A 2UZ1B 3SHTA 2FJUA 3SKVA 5J2UB 4E12A 4RY9A 1W87A 3RU7A 4DWWA 4YRTA 3R6GA 1XDWA 1XZEA 4DEXA 1IZZA 3HZHA 5KJEA 2YMPA 1YMVA 3WIUA 4YRFA 3GNTA 3PU6A 3ZBTA 1ISFA 5BNWA 4F3TA 4F38A 3WYGA 4UU0A 1GNQA 3DS8A 3ZK8A 4KWEA 2XWPA 4W9NA 3ZHQA 3RSOA 4K9MA 2A0YA 5E1BA 5IW8A 5KYUA 4XM0A 3VR5D 4A23A 3MHTA 3I01A 5LB2A 3BUSA 4JHXA 2ZTSA 4D8VA 2FZ4A 4B33A 4HVLA 1L3IA 1F2UA 4CI9A 3QYPA 3SF8A 5A9SA 3T5TA 4XD7A 4WZZA 1QLJA 5FADA 5BYBA 5DZSA 1U8ZA 2C95A 4UE6A 4I55A 2B8TA 4BTEA 1A5SB 1K6JA 4PRYA 4C3VA 2J32A 1OI7A 3EGXA 3GMIA 4LEIA 2FE1A 2GPTA 3PJEA 5TT1A 4WPGA 4JP1A 4YAJA 4H77A 4IIBA 2IF0A 3HZOA 3NTOA 3WIBA 1HDXA 3JV7A 3UAZA 3KYJB 621PA 1JPJA 2AEEA 5T8KA 2DFNA 3TQCA 1QRSA 3MCVA 1IMOA 1BOOA 3TQHA 2XJ9A 1SZDA 4I50B 4COKA 3C0KA 4OBBA 3WISA 1JFFA 4DQXA 1A9OA 1IXZA 3FFAA 3HYTA 3V7UA 2R66A 1OC2A 2CY0A 2PYZA 4FGZA 2OK8A 3QU7A 3H5TA 3NATA 1F7VA 5J2TF 1BA2A 4J0QA 3TGLA 3E82A 4K6MA 4B4WA 4C6HA 2WF7A 3LE8A 2OZVA 1ISHA 3KB6A 1DQSA 4A1OA 1ZQ9A 4P7KA 3HCPA 4CU2A 4HEJA 1EQAA 3I9MA 2I6XA 4MS3A 1B0AA 2OLEA 3SX2A 2XA9A 4ZMBA 5C35A 3OQIB 4GM1A 3U4CA 5HQ3B 2DHCA 3D4LA 3JWGA 4FS8A 4W8HA 3H3XA 4ATNA 3VDRA 2YN4A 1J2RA 4AWAA 5IHPA 1UAAA 2A5FA 1VLHA 1H23A 2AFVA 3O5AA 2CMGA 3JAKB 1T8UA 3V1TC 4B47A 4KO8A 3DOJA 4CG0A 2VCEA 1JYSA 3TZLA 4EB6A 2FPIB 4IIXA 3A9VA 3DMNA 2AMFA 1QH0A 5F1YA 1TMGE 2WJGA 3AUUA 4N6NA 5BN5B 5L3SB 2HMTA 5DP1A 3JZDA 1SOWA 4AJJA 2DT5A 5KTSA 1OFUX 3JWIA 1OAOC 3ONEA 2HIGA 4HS9A 2EFGA 4AICA 1E4OA 3ZVNA 2PNFA 3LVBA 1UBUS 1NLMA 3M89A 4XYMA 4TSFD 2F8SA 5JAQA 2QMZA 1CR0A 1WSBA 2VYQA 3MB8A 1RADA 1S3FA 3HL4A 3WMXA 4MWTA 5I7HA 3D1LA 1CUAA 1XFDA 1G9TA 2AC4A 3I92A 3INYA 3GNLA 4DAEA 1Z7YA 6YASA 1EBBA 2X19A 4JELA 1B43A 4PTLA 3A4LA 4F5ZA 3GLIB 2IHTA 4YMWA 5EIOA 4JUCA 1Z38A 4FD2A 1Z4PX 3O47A 9LDTA 3THXB 1BG6A 3RC2A 2G4CA 4CT0A 5A9SB 2QRUA 2V3VA 1CS0B 1EZ1A 1P1IA 1VTKA 2Y4NA 2XEDA 4CKWB 4LTNA 1LBSA 1ZA1A 2H31A 1W85B 3CX4A 4I3FA 1NRWA 1RQPA 5ENDA 1LTHR 1REQA 2VPZA 4TXMA 2BMDA 5ESDA 1IM5A 1G8GA 5L3QA 5G41A 1PLLA 4LRWA 2ZROA 1WABA 2DWPA 4H0FA 4NCHA 3TTXA 5IANA 3NBZC 4O2AB 2BN4A 2PKRA 4W63A 4HMPA 2N75A 3LMKA 5T6BA 3AO0B 1G38A 4A92A 3VJKA 4OHZA 1KMHA 5D7NA 2HHJA 5FPQA 1RRVA 1QRRA 4BNDA 1M2WA 3D4IA 4ZCMA 1FXUA 2CT8A 1GWNA 3UJNA 2HB6A 2CYAA 3D59A 3ILHA 4JT8A 4L07A 3WK4A 3GLIE 1A1VA 3SHWA 3ESDA 3DF9A 4LKRA 5H7XA 1XLWA 1FNMA 3WYEA 2YFHA 1A82A 5FL7A 4F7WA 1LU9A 3HWSA 4OXKA 5FV4A 1C4OA 1DKUA 4YAWA 3C5VA 3CUYA 4IQ0A 1BRMA 3RFTA 3KTDA 1EWKA 3ZDEA 3GDWA 2YFKA 4B3FX 1IE3A 3UBMA 1R8QA 1GNSA 2FSSA 2CE2X 2GCEA 2KBEA 3LM8A 3T3NA 2G76A 3P0IA 4Z51A 5AD1A 3L4SO 2G07A 4L08A 5CEFA 4C0QC 5CIQA 4BNDB 2DXIA 2ZXEA 1G5FA 2KE5A 3DGEC 2BSXA 3IUNA 3KXPA 1II8B 1NONA 2YOFA 1B6GA 4OMUA 4PYIA 3ZQJA 4PQYA 4HAZA 5LDDC 3ZDAA 1FPMA 5CNJA 1OXMA 3VR5H 2C8KA 2KWIA 3P96A 1DKLA 3UV6A 2P5UA 5EE9A 3ZJTA 3HU5A 4Q05A 5K6RA 2AFHE 4KMMA 1K7SN 4NE7A 4ALMA 4DDWA 4DMCA 3LW8A 4CV3A 1B7GO 1IHOA 4LNHA 1KS2A 1RWXA 5D7BA 4Z49A 5DBGA 1FFYA 2A35A 2CFTA 1PUXA 2GFQA 3OPMA 4MNTA 5P21A 3UMRA 1JHZA 2G0NA 1PX0A 2ZOSA 4FZJA 4BO2A 5ES4B 3PBKA 3Q8XB 2GJ9A 4ZIRB 2IZ7A 4IXMA 4MDYA 4CLOA 2E85A 3W2GA 1J9ZA 4GKBA 1R0WA 3UJ7A 3DE5X 2IXTA 3DEIA 1RHRA 3LXUX 2NYVA 1W5AA 4LOAA 4ZVPA 4EOGA 4G9BA 4QPCA 1KI6A 4YBRA 2WIJA 2C29D 4U2GA 3JD0A 3VR6A 1YA8A 3BXFA 4F60A 3BM5A 1XHLA 5JBNA 3BMOB 3FFWA 1Y7TA 5LA6F 1G66A 5EKUA 1JB9A 4C08A 2GPSA 5T6MA 4OLAA 5TJHA 4PXAA 3LBHA 5DM60 1CJMA 5ALIA 1WL8A 4QUDA 1C14A 3VPAA 5F7ZA 1TQDA 3IH5A 5A7HA 3GDGA 4AWXA 3GX1A 4MJ7A 1IK4A 1G21E 3FUVA 5KDOA 5CX1B 4F3CA 4QXQA 4TS3A 1BHJA 4QGGA 5B55A 2VZ8A 3ZLUA 1YZKA 2GD0A 2HXSA 2AG8A 3VTFA 1KSHA 4H9GA 3O21A 2AQIA 1QC5A 1NKVA 3BILA 3DT8A 2JJ2D 2Y6VA 3NM6B 3GFOA 1WV1A 3WZLA 2YXLA 5KSWB 2HWUA 3HKCB 3I6BA 4S3MA 2VXCA 5HKBA 4PHCA 1HZZA 1SRRA 5DW0A 1L7XA 1TVEA 2ZJAA 1LSUA 1R27A 1A8IA 4ND4A 1GTZA 2GM3A 4WMLA 4XE5A 2FSVA 4KKVA 3U2QA 3Q7RA 3BFKA 4TS9A 3REQA 1ZITA 4S12A 4F3KA 3DW1X 3MWYW 4FR2A 3RH0A 2HW8A 5KVCA 1G21B 1K3UB 1Q1ZA 2AA3A 1XCMA 4L3OA 4P7JA 1RC8A 3GRVA 3LQ1A 4HWTA 2EDCA 3I3SR 3RIEA 1CQIA 4KK3A 4JHLA 5GVRA 3PNMA 4D8UA 3U6KA 3EPLA 2IHNA 2H4FA 1UMDA 2J9ZB 3G9UA 1OZFA 4HPWA 2BMJA 3RKSA 1XZDA 4Q34A 4Y7CA 3UA3A 5FTLA 3SE0A 4PWZA 3KQPA 4N49A 5HFJA 4J16A 1B16A 1STOA 5AKHA 3UG7A 5EEGA 3NNNA 1E9CA 4ABYA 1XJ0A 3ZHUA 4YREA 5CR9A 4HC4A 1V25A 1YBVA 1UM9B 4FIZA 3KE8A 3CIOA 3W3AD 2IK8A 4EY4A 5LMUB 2ZR9A 3M7IA 4N8SA 1SKMA 1ZMTA 1AF4A 2AFIA 3OM0A 3PNOA 4K0RA 2FQXA 3JVVA 4IY1A 3SCZA 3V8RA 2R1TA 5EJEA 4NULA 5K0JA 1KERA 5JATA 2N1BA 3PXUA 3QX3A 4F46A 2ZYAA 1J8FA 2G36A 2VQ3A 1O95C 2JLRA 2RB5A 3T1NA 1OGYA 4WZBE 5IC6A 1OVGA 2HPVA 1DWUA 2R1VA 2X0RA 1I2AA 2R6AA 3CLKA 3IQXA 1RXSA 2V7QD 4LI0A 4Z8YA 4E14A 2AF4C 3Q3JB 4ROSA 3TM4A 2XT9A 4E5YA 4BLPA 1MW9X 1SPBS 3NBXX 3QWBA 5J5VA 4TTJA 3PGLA 4PC7A 1LV7A 1I1NA 2QZJA 1PK9A 4HO1X 2VP2A 3EXG2 4HN4B 1NJSA 3K35A 1W48A 1ONBA 3UENA 4E94A 1KQPA 2HU2A 1NN3A 3C8DA 4MUGA 1G7TA 1CE8A 2BI4A 4RVNA 2XY4A 1MABB 4E4YA 1H9BA 4N7JA 1KZ4A 4LWQA 3EOAI 1TPYA 4OHPA 4QQKA 1UWVA 4Q21A 4ITVA 1LWOA 3E4CA 1HE3A 1JYEA 1WNTA 1V5FA 4E4RA 4BBZA 1RI2A 3FKQA 1J5PA 3LKBA 4EECA 3NHJA 4RESA 1S2OA 3H3JA 4P22A 1Z6AA 4PO9A 5D1NA 5JCJA 4BX0A 2F1RA 5TIIA 2VWQA 4PX2A 4OAPA 1XKXA 1P0IA 3D2BA 2QX9A 5DNAA 4MCIA 2PZMA 2HJVA 3LDFA 4CLRB 1L8OA 2DQZA 1O4VA 2P65A 4JEIA 1AK2A 3DOUA 1P7CA 4Q24A 1JVNA 3AUSA 4E6EA 1FLAA 5CM8B 4YRAA 4JL8A 3EYAA 4IVRA 4PX5A 1E94E 3FFBA 3MS2A 4MCJA 4CV1A 5BV2P 1NW5A 1VHJA 1RU3A 4L5IA 4Q3KA 4V3CA 3SLRA 4BEBA 3Q9NA 3IP7A 2IU0A 2ATEA 4BNTA 1C9YA 1SG9A 2HIAA 2MJLA 4XYGA 4OTZA 1Y4UA 2GK3A 3L8ZA 4CPDA 4P08A 3IDZA 3VYSB 1U4SA 3H5OA 4BKMA 4CJXA 1X80B 2VT2A 4ES6A 1N5KA 2Q99A 2WG0A 3TAXA 4KDCA 4YRJA 3HXMA 1R0CA 3FWYA 4IIJB 1YQTA 3BK1A 3GBVA 2ZRKA 4MK4A 1P2TA 1W96A 2Q9BA 3K1ZA 4L8VA 1VE6A 3ZHOA 4DG9A 1UBRS 1UF9A 2POCA 1GTSA 2P1DA 4NFSA 1VBKA 2OSVA 3FR8A 3NH6A 1LPBB 1LJLA 2VQSA 2Z4TA 5JZMA 3UOGA 4AIRA 3IHLA 2B1QA 4OI4A 1NHGA 4KGVA 5KVVA 4K6KA 2WHRA 3RWBA 4G01B 4J6EA 4GHWA 4IF6A 1CJVC 4TTPA 2BR3A 4NV3A 2WW8A 3AVOA 1IBRA 3C3DA 2BFFB 2YZMA 5IEBA 2WSMA 1Z0JA 3UZUA 1P39A 2WJVA 2I4IA 2VBGA 1W5BA 3BD6A 4UKDA 3SKYA 2V98A 2DAPA 3PR3A 1C9DB 5CP8A 2FQ1A 3KZ1E 3KKZA 3B6EA 1RM5A 1P60A 1YDWA 3FNRA 2ZBEA 1OX6A 1YJBA 4OJNA 2RAFA 3QSGA 5L53A 5IJ0B 5MDHA 3R3XA 1FUEA 1N7HA 3HP1A 1NYRA 1XJWA 1ENOA 2NXJA 3JYPA 2VATA 3IBGA 4FCVA 1PBTA 4UZFA 5LPNA 4YMGA 4G24A 2O2DA 3OTQA 3S8MA 1KHHA 5B3LA 4LZOA 5M34A 4FJ1A 3N2ZB 2YQ4A 1A4RA 2F1OA 1DEOA 1FMCA 1RJWA 1QH8A 4TYQA 5FNZA 2XSZA 3UWMA 1VIYA 3KDSE 3MINB 2O0LA 3GLKA 4HXFB 5IH3A 1E9VA 5ITSA 1QORA 3UEOA 3QKRA 2VL7A 1W5TA 3ZY4A 2OOKA 3ABRB 2MR6A 1NW3A 3MFYA 4TV9B 5MN5A 4RTRA 1D6JA 1L5SA 2FUKA 5CVVA 2BGIA 2DUWA 1GY8A 2WSIA 2Z0MA 4YJFB 5CCBA 3GLGE 1P8JA 1ZZGA 4DQLA 3F6CA 3GG2A 1MH9A 3G8BA 1XZQA 2H7CA 5TMBA 1PEYA 2BGJA 1TQ8A 4M60A 3CVOA 721PA 4HNAB 4HDQB 1JX6A 1MO2A 2BM1A 2XZPA 3A3OA 4LVOA 4UAJA 5COQA 3NP7A 1SIWA 4Y6GB 3ON5A 4M1MA 1G8SA 1L4NA 2VH5R 1POXA 1Z68A 3QQ5A 5EIBD 3GJ5A 3R7LA 4TV9A 1YUBA 5LD2B 4WEOA 1J22A 2QMEA 1CFJA 2M6SA 2PGNA 3DZFA 5JCOC 3NAQA 1Z13A 4B9EA 4EFLA 5FAKA 2AZ4A 3NTVA 3Q12A 4KH1A 1B4DA 3UOAB 5EZQA 4EKDA 4JI8B 3A9WA 2JVKA 3B3FA 4OPMA 3DFFA 3LC1O 1SXQA 1LBIA 4YACA 2CZQA 5DHFA 4JXZA 1ZBQA 2QRVB 4LC1A 4LISA 4R6WA 4RTLA 2VSQA 4LRYA 4ZYWA 3ZGLA 2XCRB 5EWMB 4LV5B 5E1OA 1YVDA 3K0FB 3G68A 3T3MB 1KIMA 2FXIA 2HIHA 1FQJA 2R3SA 4E5PA 4DLAA 4DB2A 1SBCA 4LJAA 3JQ9C 1WY5A 4PSUA 3VKGA 1LJ8A 1UXOA 4GM4A 3U4HA 4HQNA 3FZGA 3JSAA 4GOMD 2ONKA 4ZQGA 1KXZA 1L8LA 3SSNA 4IRXA 3WYFA 1PI3A 1P0MA 1Y3CE 4NHEA 5UKDA 2QRVA 3C6XA 5H0IA 2CHFA 3NUQA 2Q2QA 2C97A 4WNAA 4MSUA 4DMMA 3ENZA 2ZSEA 1D2NA 1JEQA 1IDN1 2XF2A 3NYRA 1DXOA 4PG8A 3FGNA 3EA4A 1B1AA 1N6HA 2ZU0C 3BMQB 3TNYA 2EP8A 1Y3DE 3OCUA 4YTEA 2OZPA 4WOKA 4WKOA 1VECA 4RU1A 1SOVA 3JQAD 1SOUA 3RF7A 3V80A 1C7JA 4G0PA 3VI4B 4BXOB 3JPWA 2FU5C 4MQ4A 3K1AA 2V7TA 3VH4A 3QKRB 3L8EA 2MHCA 3HPRA 3MT8A 5IABA 2P75A 2WVHA 2QX7A 2ZPUA 3CZQA 3UMGA 5JJKA 3KKMA 1V48A 4YIKA 2BEJA 2WJWA 2VKQA 2X1MA 4MVJF 4YJFA 5ELLA 3WWOA 2OAEA 1YGPA 1D5CA 2M32A 4BV9A 1CQZA 1UMCB 1XRRA 4LXYA 3SPXA 4CI0B 5LNK1 2ZI5A 3WGJA 4BZWA 4KI0A 3HCNA 4QLAA 3CUVA 1W76A 2GN2A 1ZUIA 4IICA 1GAEO 4EWLA 5FBKA 1T8WA 2DGDA 2WUEA 3ZI7A 3UA4A 5A2GA 5CLFA 1VMIA 2XWBF 3WQHA 4LSMA 1RP1A 3NBMA 5IM4A 5DNYB 1DEXA 3L0IB 2ORYA 4M53A 1G16A 4O33A 1QTQA 1E1KA 4I19A 5HPYB 2FDCA 1M5TA 3CQ9A 4JLKA 4OQPA 3B2EA 3DUFA 1IPEA 1F8FA 1GZ3A 2WKQA 2JCVA 5JDCC 4G37A 2D74A 4J3NA 1AKEA 1QG2A 4TS4A 1VGQA 5JBQA 3BCHA 2YXBA 3KXKA 1HQKA 1Z7EA 4I46A 4UPVA 5HIKA 5L4NA 1HSZA 1CZKA 5IUKC 4YJ3B 4RTOA 4AF7A 4B7ZA 5AVKA 1K75A 4WJZA 2LIPA 4DUZB 3VSAA 2ZJOA 2O3RA 5JH7F 2MYNA 3HV0A 4CMEC 3V2UA 1EVEA 5JDIC 1ZK1A 2B4QA 2JB9A 3SBDA 4URVR 1OC4A 4OL0A 1SHKA 1SQ0A 3EMKA 5IAGA 5E6RA 4RULA 3B5IA 4D3SA 2GB4A 3CTMA 3AUJB 5AYVA 5T57A 1XK6A 3H9GA 3HXPA 5DBHX 3QFFA 4B4UA 4M0LA 3HRKA 3IAFA 4L95C 1P1BA 4MVJH 3QTTA 4OJTA 3TTTA 3ZGNA 4CQNA 1SQFA 3IP3A 2C5LA 2HHAA 3I72A 4NZMA 4V0NA 3AL2A 1BO6A 4NCBA 1KJ8A 3AZPA 5LR6A 1O6CA 1BE8A 2MINA 1S2GA 1YIOA 3ZOKA 4IQ4A 4OXYA 1UBKS 1F48A 1CUUA 3GZ4A 4HLCA 3W9YA 3LFUA 4DIMA 3LUCA 3TUIC 1TMKA 3TTSA 2N0SA 4AN1A 2XMDA 1UPBA 3G1TA 4E1VA 1XMJA 1Z7GA 4HAWA 4NIMA 2L2QA 3MOIA 1OI2A 3CEAA 2R00C 3V1NA 5BWBA 1UC8A 4AYTA 4BRSA 4OXXA 4CIVA 1P72A 2VHVA 4IWNA 1UOPA 2DWQA 4UASA 4H60A 3JQ7A 3OM8A 2Z2IA 2IYTA 1DZ3A 3DNMA 4Y2RA 2DB3A 1QR2A 2C7BA 3EVBA 1YR9A 4OXQA 4Y6OA 3R76A 3WMWA 4Z4HA 1W59A 3AFHA 1PVOA 5E2AA 5GZ6A 4JA0A 1X1BA 1ECFA 2VJMA 2P79A 2C0CA 1FY2A 2WB4A 5F3RA 5K0EA 3WBJA 4AZ3A 4PPFA 1KU6A 3SXPA 5BV0A 5EJ4A 1SGWA 4RIGA 5G3YA 4LZZA 1JYFA 4A0FA 3ZX4A 4K9QA 3GRZA 1ZJWA 5J63A 4DV4B 3KTAA 2Z9BA 4I4NA 1CF9A 5LYJA 4GRIA 2ONZA 2HA4A 4IJUA 4OG2A 4MYRA 1E8NA 4LYEA 4EDHA 4B43A 4CDNA 1JDBC 1FYEA 3R3VA 4KPUA 5E38A 3ZHBA 4DLLA 2K5UA 1KE1A 2Z1DA 2WA2A 2GAFA 5LBTA 3M2PA 2CXRA 3NHLA 4NNPA 1P29A 3ZE7A 1ZC4A 4EAAA 2BUBA 2G67A 1OLSB 2PPVA 3ZVKA 2CLHB 3QG5A 1N6KA 4JT2A 4E51A 2WD9A 3FD8A 4KXFB 4CIWA 4LRQA 2F00A 4QAJA 2GLXA 3TEFA 3H84A 2C2WA 1Y5LA 3BTVA 4ARBA 2HLNA 4BJHB 4OHMA 4D0NA 2GVNA 1N77A 1QNFA 4B46A 3P9RA 3O9ZA 3AJRA 3ANXA 1PTJA 2YJZA 3G13A 5K5EA 1N0WA 4FLEA 1CEEA 1USIA 3A2KA 5AHWA 2GDZA 4INOA 2JJ1A 1GUFA 2ANCA 3I52A 2DPHA 3IB6A 1ZD4A 2AX4A 1YA6A 3QLVC 2OCLA 3ZLJA 4N5NA 3AHIA 2HD4A 4HDKB 2BLNA 4A5SA 1XAHA 4OGWA 4KODA 3VHXB 2FP3A 2H00A 1IBMB 1N4DA 1UJ5A 2B4KA 5JHGB 1BN7A 2WMDA 3FHLA 4NRDA 3O2NA 1UJMA 1H5QA 2DHRA 2DRIA 1K5GA 3MT9A 1WB9A 3ZYCA 1YULA 3MWLA 5KJ1A 1TT7A 3MIIA 4MW1A 2V5VA 4Q1DA 5NLLA 4B6JA 4CMEA 5C7OO 1PYOA 3N6RA 3Q9UA 2AR9A 1Q16A 2J08A 2Q3JA 2YBEA 3L0OA 4X1IB 4XSHA 1PUIA 3CF4A 4GDFA 1VL1A 3AHFA 5DO9A 1IJFA 4C6SA 4DN6A 3FPJA 3UV7A 1TF5A 1D0VA 2QQEA 3QUSA 4TKLA 5FEUA 4AY2A 2ABWA 3FSRA 4UARA 3QKSB 1QP8A 3B1WA 4NS1A 3S27A 2H4HA 4C4YA 3I12A 3NVAA 1A9YA 3RWOA 6REQA 5M5BA 2P6MA 1BSVA 2ZIUB 5CCDA 1PT6A 1K1EA 3GDHA 1AHNA 1LD3A 2FPGB 4H7DA 1TO2E 1EWVA 3A8TA 3W7AA 2NT4A 2RK4A 2OZEA 3ZG6A 1K7CA 1OU4A 3IAEA 3MGKA 3PNBA 4CM8A 4D0LB 4DIBA 1FP2A 2EFEB 4IIJA 3RYTC 1QU3A 5LN1A 2FG5A 1G4AE 3GJRA 2VHEA 1VKOA 4BMOB 2DTEA 2FP4B 2LD4A 2JBAB 1JLRA 1Z5GA 3MLEA 4GL2A 3PGXA 1KIFA 3QVKA 1TDJA 3D3JA 4L28A 3DEZA 4RY8A 3SQMA 2VXYA 5D6OA 1N1MA 1XFAA 1QDUA 4KE8A 3ZHVA 5I7EA 1XTJA 4R69A 1UPCA 3D7LA 3HSYA 3WK5A 3JR7A 3HCWA 5ESXA 3WZ2A 2JRCA 1RWPA 3HDGA 1FDTA 1HWYA 1R0LA 1GGNA 1RI1A 2ATIA 5DDIP 4EMUA 3SSOA 1KZ9A 1SU4A 2CNOA 3IXLA 5EUCA 3NDPA 4MVJD 2R8OA 5BOVA 3K20A 1XYYA 4WH0A 4E11A 2TECE 3BDVA 4JXJA 5K2OA 3H4MA 4Y6RA 3ZWBA 2AFHB 2WF8A 4W5OA 1JFLA 1Q1QA 1PJ4A 2PX2A 4YR9A 4Y1RA 5LDGA 5H81A 1MHTA 3DDUA 3DD1A 4R8KA 3HK2A 3NQ41 3QPUA 4QXPA 5DGXA 4RSGA 1T5HX 4F8JA 5BQ3A 4BHTA 1U1DA 1PE0A 4NNOA 4KB5A 4YRCA 4Q9IA 4U2FA 4BFWA 4QYSA 1JA1A 2RHMA 3PRHA 1RTTA 5HMLA 4AS2A 2MSLA 2ZJBA 3EDOA 3IQHX 4FEGA 4H1VA 5EJ6A 2QROA 4TMKA 4HDMB 4TRJA 1TTTA 3TRJA 5F7XA 3SSAA 3DDNA 2A1TS 2ZBRA 2OILA 4X7RA 1Z7BA 4U7DA 3LPLA 1JBKA 4MW4A 3TE6A 1MX3A 4HN9A 5SV2A 1PZHA 3NT4A 3GJQA 2P6PA 3P20A 4O1HA 4M87A 5CLHA 3HJBA 1QYWA 4YJHB 3RG8A 1DT5A 2EKDA 3Q85A 5DP2A 4MUMA 3WNBA 5HKKD 2H51A 4N65A 1ETHA 5GADl 1X8LA 3PQFA 2BT4A 3SY8A 5EMNA 3UK0A 5DYYA 1ZGZA 2A6PA 1X7ZB 3W9SA 3V46A 2HV9A 2D3TA 2G72A 2G28A 2VZ9A 1W30A 3ADPA 5EG5A 3N70A 3FPHA 4MV3A 4UD6A 4RHEA 3GLFA 2VJMB 3NNSA 3AX6A 4AKSA 3MIZA 2QUHA 1B8NA 3AJEA 3LOUA 3WQSB 1FDVA 1P9LA 2NUAA 2KB0A 4G3XA 1DS6A 3T0FA 3TQRA 4IDQA 1RKQA 4Z53A 4RZ3A 4INAA 3PSHA 5LUAA 1F60A 2M98A 1SCQA 2WPDD 3JZMA 4TTIA 1S7CA 2R2AA 2YIJA 3E3NA 5HE8A 4KN8A 1BD4A 4ME6A 1EJ0A 3B1XA 1WE2A 2OO5C 3VPGA 1AURA 2AJCA 4ZQIA 3TE7A 4MA5A 4RWZA 2Q5EA 2WIAA 3DMYA 1LRLA 1WULS 3H6HA 1RP7A 2C5AA 3JQQA 1N1GA 3MA0A 4GRAA 2DKNA 3TEJA 2PU5A 3V1YA 3AIIA 3DTVB 2FN8A 2J5XA 3ETEA 4QDTA 2QTBA 1L6IA 3KT0A 4EUFA 4BN4A 3U4QB 3BBLA 3CRNA 3EG9B 3K1JA 1R50A 5L6LB 1T5SA 2CNDA 3HWRA 5LMNB 1U8YA 2HSWA 5AJUA 5A5VA 3O1IC 3GUUA 3RNLA 1AD2A 3KOYA 1CRWG 3VZCA 4BFXA 1S2LA 2ODNA 5CIYA 3V7FA 1SZCA 5E8RA 3SNKA 1JXAA 4YRGA 3D54D 2ZSIA 3X1DA 5EAIA 5IFLA 1EIZA 1I7PA 1ODSA 2OGWA 5L6MB 2JCXA 4BQPA 3ASVA 4MP8A 1D5WA 2ST1A 1LX6A 1GD1O 3QX7A 2DH5A 5EOVA 5FR2A 3ZCXA 1MPTA 4DCJA 1E1DA 1J06A 1LY1A 3AEQA 3HBMA 3ZI0A 2GN9A 2XTMA 3DLTA 4ZJPA 4OY3A 1FFBA 2ZJ4A 2E4WA 5BN3A 1U1IA 2HDWA 3RC1A 4FDUA 1MIOB 2VBIA 2ZXUA 3LT5A 1SHUX 3FOAA 5G0UA 3T1YB 2TSYB 2C4HA 4MW9A 5JSYA 3GUHA 1C0IA 4EKYA 1Q0LA 3LGSA 3ISJA 3FXAA 5FFFA 2I65A 2JGNA 1K66A 2PEYA 1NWCA 4ZWNA 3K09C 5F23A 3FYDA 1VHTA 4OHRA 4R8LA 4REMA 3R9KA 1CV2A 1U0RA 4GBGA 3AI1A 1G4HA 4DMLA 1C8KA 3HRHA 2WT8A 4GOND 4BECA 3GP3A 3NZEA 1RM0A 1ESZA 2BKAA 1ARZA 3IQDB 1WR8A 2LZ0A 1GTG1 3UJDA 4TX1A 1YNOA 2EVWX 4WTOA 1NULA 2H11A 1A8PA 4L0DA 1F8YA 2C99A 2DBVO 4B32A 2HYDA 1VJDA 3PQEA 2ZSKA 4M0PA 1ZINA 2R9VA 2XD9A 3DEJA 1K6XA 1SWWA 1FXWA 4JL5A 5EEHA 3NC0C 4QHTA 2UV8A 5F78A 4O4JA 1AXGA 1RABA 4CM4A 3VXKA 4CF6A 2ZSFA 3SM3A 3K8YA 1JIVA 4TXHA 4LDJA 4WK6A 1N75A 1D2AA 3ZLBA 2JJQA 1HC7A 2QPLA 3AERA 5LOVB 3GZTB 4HY3A 3KETA 2JI7A 2WABA 3PC3A 1FS4A 4IV5A 4ZT3A 2HBZA 3SIRA 4C03A 3V1MA 3BE5A 2Q4BA 4BIIA 4IKEA 2LDBA 1I80A 1Z12A 2C77A 5FBVB 3WNDA 4CLHA 5KYGA 1OT3A 3WK8A 1KS9A 2WZQA 2FPRA 5E9JA 4BUJA 1BGWA 1MENA 2CJYA 3BSYA 3Q6IA 1E58A 5JD6A 3KQHA 1ADJA 1I1HA 1U1GA 5REQA 1D2RA 4R71A 4HZUB 5CYGA 1F5SA 4OOFA 3G82C 5BWLA 2P0YA 3VA7A 3RUHA 1ZA2A 2QR2A 3DBIA 5AI8A 1NM5C 4M9CA 4BO4A 2WI8A 4HSGA 1QG0A 4KVZA 3SHOA 3FOEC 3JW8A 4KI7A 4YQZA 4EK9A 1K5PA 3CH4B 1CWUA 3UN1A 4XZ3A 4Q1FA 1WD5A 3HLYA 2CVQA 1CNEA 4QWMA 3EGWA 2A9KA 3DKIA 3I61A 3GFPA 3HXKA 1V2HE 3AR6A 5DNVA 4UU8A 4P5PA 3A6ZA 3NRCA 5HBRA 2OCPA 3BMXA 4UCXA 3OPQA 4XIYA 3RT9A 4OQXA 3V2GA 3JZFA 3WYAA 3AFNA 4DIOA 1PJLA 4FQ8A 2R7NA 5HK8A 1KKLA 5CB4B 5J2UA 1LZKA 1KYWA 4WOPA 4HTFA 1R3UA 2CL5A 2JIZA 3ANNA 4X63A 5HG0A 3BXOA 1GCOA 1NR5A 2XVAA 2EFYA 4A10A 2F48A 3NIDB 4BNYA 3NVKI 3LBFA 2ZBVA 5CK4A 4BU0A 5IUJC 5JS7A 3G0OA 3V2HA 1ZONA 1Z2OX 2ZYRA 3PHLA 3R0JA 3ZWCA 1ZG3A 4J16C 2XNKA 2D8MA 2G9QA 1RI3A 1JV2B 2G09A 2CHVA 3MELA 3TKLA 4XXHA 4I08A 4DLWA 2HMWA 4XOUA 2EJVA 2YXPX 3LKVA 4IZOA 5BVGB 4KPFC 3L1JA 4J1SA 4INZA 3A6EA 2ZZKA 5JY1A 3KVOA 3L2OB 2HF9A 2HQBA 3W1VA 4D98A 1J6UA 2CL7X 5G0SA 3CLSC 3CS3A 1HE8B 3N2YA 4RA9A 5AK0A 4PR3A 4KR6A 2A4MA 1A98A 3PFIA 4WACA 2GDJA 3K1YA 3RSSA 4EDFA 4ZD6A 3LAWA 1CZHA 2Q6LA 4NE9A 5CT4A 3T7KA 5JADA 3B12A 4NJOA 2FMTA 2YFYA 4CCYA 3H7AA 1E99A 4QDUA 3WJ2A 2XB2A 2YXNA 1P0QA 1Y9AA 1E3MA 3RV3A 1FC0A 2VJKA 3KDAA 4G9GA 5SY6A 5IVIA 4WOJA 2XKJE 4OGFA 5JWOA 3B3QA 1WDWB 1YB4A 4FZRA 2BUAA 4DNOA 5CG2A 4LHWA 2X2EA 2IQ5A 2K6GA 4B4KA 3C43A 4HFJA 1RBQA 4DJJA 1N3LA 4OJKA 1GEEA 3CCCA 2O8FB 3EXFB 2JK1A 4RSHA 1JDBB 2IVFA 2DMRA 2X3UA 2XNJA 1Z4IA 1IUNA 1S7GA 4YP9A 1PVDA 1R74A 2XZDA 2XUQA 1O96B 2YBDA 4JUBA 1KYVA 4YRKA 4IUDS 4HDCA 4ZZ0A 5BW8A 2GPJA 1C3EA 1W0KD 4LRXA 4QNNA 3TD6A 1DG9A 1MT3A 3B36A 4Q48A 3VR4D 4BO9A 1F2DA 4MUNA 3PIDA 2I3AA 4QOEA 1ENYA 2RI6A 4XWAA 1QFXA 2UUOA 4QELA 2JGDA 4ZVUA 5CA1F 4S05A 4R8SA 2PZGA 2X9QA 1MG5A 2V8OA 2XUIA 2A78A 1U0JA 1R6BX 4EI2A 2XUZA 1OH6A 1ZN8A 2VPIA 1NV8A 4IW3B 1XPOA 2I91A 3DHVA 5TMEA 5EJIA 2PKQO 3PHIA 3QSYA 4F2PA 2IVZA 5IDVA 4ZYVA 1ZY2A 5I4CA 4YQFA 1ENZA 3TIFA 1SVIA 4ALNA 3TIXB 2Z09A 3OIVA 3FDIA 4UEKA 2IYYA 4BNVA 3NU1A 1IDOA 4GMGA 2CNKA 3DT9A 4DOMA 4C21A 3IP6A 4EITA 4G0VA 3GGGA 3QVXA 1QSGA 1FYDA 1M66A 2C8JA 2I66A 4ILEA 1Z8HA 1YR7A 5L8VA 2OHVA 2FGJA 3KU1A 2WDPA 3MSCA 1PSDA 2Y71A 1CS4C 1PF7E 3AYZB 4FC7A 5HIIA 4Q00A 5DYGA 3V4OA 3QVUA 1RJ9A 4F06A 1FDIA 3OKCA 4PW0A 2ZI3A 3A3KA 4L4RA 1A2OA 3IXQA 3KR9A 2Q5JA 1G8MA 5E9AA 1JR6A 2GEBA 3FDZB 4IR7A 5TS2A 5TPWB 4BZQA 4XWKA 4P35A 3U16A 3ICPA 1KVUA 4X66B 2AFIE 1RXVA 2P9YA 2J30A 4N6GA 4U2EA 4EB3A 4G07A 4LTDA 4RV4A 1EQUA 1KEUA 5HZKA 2PAFA 1CXZA 2EWMA 2G9NA 3VU1A 4EW3A 4CKXA 4JQSA 2YL2A 4RKEA 3NIWA 5FJIA 3P4XA 2BBOA 4Q37A 1PDWA 3QVLA 4YRQA 2WUDA 3RROA 3UGKA 4FOLA 5KOJB 1F0KA 1QAQA 2AI3A 3B51X 3HNOA 3ZXYA 3IJ5A 3FF1A 4OD0A 4X8MA 4EJSB 3FPAA 3D8UA 4BAUA 4QYIA 1CUSA 3FYCA 1M1NA 3U09A 5BPHA 3O90A 2QPAA 5FQOA 4NX2A 2PQ0A 1II9A 3UANA 5BURA 2JFWA 1BVYF 1PNRA 5LZ9A 1RLTA 3IE1A 1U1EA 3AFGA 3CH6A 3PPWA 4ZI5A 3TLGA 4BKOA 3W78A 4QNRA 3QMMA 5IDXA 2IYPA 3TNDA 2ZSAA 2E37A 3CNLA 1TT5A 1FNCA 4V3BA 5JSZA 2QTMA 4MTLA 3ZWXA 2OWDA 3F1LA 3PFGA 5CAEB 2CUZA 2QB5A 5IYZB 3LDAA 4RH0A 1EK2A 1YACA 3VSDA 3D81A 2LDXA 2ZJ3A 3A1EA 2FFJA 2Q6VA 3FCUB 5DBFA 2JI9A 4FINA 2XMSA 1KVRA 1THZA 3AHDA 2CLMB 3GFTA 4MQFA 4GYJA 3MB5A 1IZ0A 4OHUA 4JUFA 3C4JA 4JUIA 3VR5A 4DJDC 1V4NA 4WNIA 3ERCA 4KRFA 1Q22A 5JPDA 4DWVA 1RKUA 3MMXA 4LUCA 3KKPA 5HCUA 2ZTLA 5C4GB 3I9JA 4QRHA 1P4RA 2FN9A 1KOLA 1SCNE 1W1IA 1Z47A 3MMNA 1QHNA 3AKCA 2NO5A 2VUUA 1L5YA 3R4CA 5DM4A 4ZC1A 5KOHA 1N0UA 3CISA 1TCCA 4HLNA 1XOIA 3TLEA 3EXAA 3A0RB 3HJGA 5LBIA 4ESEA 1CUXA 2OV1A 4PXYA 4Y7DA 2XOKA 4HDRB 1NG9A 1SM4A 4MHTA 1KI7A 5DEIA 3IFSA 3G0BA 1YJAA 3RU2A 2OUIA 1E66A 5BV8A 1XP5A 2IHYA 3FZYA 3P9NA 3TKAA 1YQDA 3GOHA 1TVKA 1KK1A 2FMFA 5A1TA 4CCAA 1GOTA 1WZNA 4O8ZA 5HMMA 5CM2Z 2A94A 2XR1A 4DV5B 1ZNQO 2P4HX 3H04A 1X1EA 4FUQA 4ZOCA 1KI4A 3O3MB 2DY1A 5ENVA 4DW8A 4ZGWA 4K9DA 2NT3A 4P6VF 4MRNA 4M1QA 4P0PB 1CUDA 2P3OA 5E4FA 4HZIA 5C1DA 4BO1A 3E7XA 1PZGA 5HFAA 2QN7A 4YRRA 3MWFA 5HW0A 1DZIA 2WJ6A 3JAWA 5DNWA 4QOSA 4BLSA 4AYXA 1PD1A 1KJQA 5FTJA 1XL1A 3CLTD 3H5LA 4EYGA 2AUMA 1E0SA 4RPKA 3SIPA 2Q7XA 3ZS9A 2O9JA 4DKJA 4AMGA 4AG3A 4RCVA 1C0LA 1C9MA 1U8XX 1XI2A 1YKFA 5C52B 2HQOA 3H2GA 1QVWA 2L82A 5F52A 1KFEB 5B3JC 2X2FA 4RPIA 5JMTA 5I3CA 5B30A 4K03A 2EXXA 2J5KA 2OGTA 3TSZA 1K7YA 3AR5A 2YS7A 1QOZA 2FI1A 4EHAA 3AIKA 4XDHA 4KAJA 3BD9A 1Z6ZA 2BEUA 5AM3A 3RFVA 3DV0A 1XDGA 2X4DA 4ZO4A 5AJYA 2VPQA 2IEIA 2W2LA 3DWGA 2AOTB 5AJTA 3H97A 3H1FA 4ZIRA 2IW3A 1R6TA 1FU7A 2C88A 4L15A 1RFLA 1GDDA 1H2FA 3N2KA 1Q6YA 3J80A 3KAPA 3L1VA 4TSFA 1P3Y1 2XQGA 5E2BA 3SS9X 1O94C 4Y2JA 1VKNA 2PRZA 3E0QA 3QW4B 3OJEA 2P1RA 1F8XA 2PJZA 3B53X 1P9NA 1MVNA 3F3SA 1L4HA 3LCJA 4W7SA 5ALMA 1NMQA 5C5IA 1WCV1 2DULA 1U8AA 1R0RE 5I7VA 2P9HA 4B7CA 2QX4A 3D4OA 3KKNA 3ZKWA 4MEBA 1AQJA 2J46A 3QE0A 2WSSD 3HB4X 1IUKA 2IYQA 4CKBA 3N9IA 2YS6A 4A91A 6Q21A 5ICEA 3NM4A 4EGCB 3O7MA 1IH8A 3WAGA 4M98A 3A7DA 3U0VA 4UHFA 1FX0A 1O95A 5FQNA 3RREA 5CB4A 1CYDA 3BREA 4K9SA 2AKEA 1WDTA 3BERA 3F71A 4LS3A 4FOSA 3IBFA 4NU5A 2Z08A 2HU8A 5GWXA 2HFJA 2JFBA 3EIHA 4O4HB 5C7IO 3KZMA 1V16B 3PDIA 1S8FA 1E1RD 3KPWA 3O8OA 2JAWA 3DFKA 3WL6A 5HOEA 2FPSA 1Q1GA 2VJAA 3L7CA 2D1YA 3G5MA 4ZVNA 3U49A 3UH0A 2MR5A 5JRDS 5F5NA 2ZYIA 1NBWB 3KSZO 1SB8A 3QE3A 1PNOA 3CONA 2VRCD 4RSRA 4GICA 3ODPA 5AXAA 1XZJA 1ZMOA 2PRKA 1U0EA 1IPHA 4KDEA 3IBTA 3GPBA 3G2IA 3EDCA 4MZXA 3ZHYA 4BO3A 1E9FA 4IEEA 2INGX 3OKFA 4RHYA 2IOFK 3C3XA 4RMGA 3WGMA 4BU1A 4UM9B 2R79A 1XG5A 1E98A 5BR7A 1QWOA 5I4KA 1V3TA 2OLJA 1YS2X 3CUSA 3H0KA 4D81A 2YQ5A 5HRAA 5CB0A 5AKEA 2NXWA 1GZDA 1U2QA 2QQ0A 2EW2A 4HXEB 2BE7A 5EKDA 3H87A 1YZTA 5GONF 1H85A 5G4LA 4MEAA 1MC1A 4F4CA 3PFKA 1K8RA 2X0IA 3KYDA 1HL3A 3RODA 4DRYA 2RH8A 3IEUA 2FEKA 1LPSA 1PFWA 1RWBA 1QDEA 2PV7A 1E0AA 4CM8B 4WERA 5AK5A 1H0KA 2F43A 1ZZEA 1OZ0A 1TZMA 2WOOA 4NL4H 4ZT4A 1BZYA 1KOFA 3ROZA 4EMBA 2JARA 2FSPA 2H54A 5DHSA 2FFRA 1R1DA 1L8QA 1ZU4A 2EWVA 3GZNA 2EBUA 1XCPA 1WSWA 4UMFA 4RYLA 3WKAA 1UPTA 4M6WA 4BX2A 2ZS7A 1I5EA 5TARA 4KIWA 3O84A 2R5FA 2VYCA 3LQ2A 1NU8A 2PFGA 6NULA 4W5NA 1E9RA 3TLJA 3ZHRA 4UMEA 4CQLB 2P9JA 4LYHA 4ED9A 1YXMA 2BSAA 3AQ4A 1EHIA 1OWOA 1UPXA 1N3YA 1X9GA 1ORHA 2IZ5A 2QD5A 4LCJA 4P34A 3PKZA 2AIRA 4UM7A 1DX6A 1GUAA 4TTSA 2CDCA 2JFHA 1DC8A 5AH0A 3SE7A 2P9EA 5ISMA 2XMGA 3DB2A 4P7BA 3R9WA 3CX3A 4I1SA 3GJ8A 4MQEA 3FDXA 3AVTA 4AS1A 2ZJ2A 3FLAA 3MGCA 3ZDYB 3ZE9A 5K7SA 2NO4A 1DARA 3ZCQA 2PO7A 5EJAA 2XYVA 4UBJA 1RQLA 3H1GA 2VDWA 2FZLA 4GE3A 3VKHA 1A9ZA 3IV9A 1IIBA 1QVRA 1PFGA 3V3KA 1GN8A 4I1IA 1KY5A 2GXSA 1GT91 4CMIA 1U6IA 3QEAZ 1E3LA 2RK6A 2JGMA 2KMLA 4K6FA 1E3DA 3G1WA 4NK5A 4OL9A 4ZOLB 1CZOA 521PA 4F92B 2R11A 1M34B 3CNOA 3IE0A 3EYWA 1EXVA 3T9DA 2XCOA 1NYQA 4QODA 1GEGA 1UIRA 4PZDA 4RHCA 3X3HA 3MJFA 2CJPA 3NX4A 5JWHA 3FGOA 4LJ8A 2Z6UA 1JTEA 1FDOA 2WRZA 4PHGA 1NBAA 2HSEA 4G5QA 1ODLA 2F4VB 1O8BA 4CBVA 4BVJA 4GPZA 3DLBA 3FMPB 2DR3A 2C4NA 1E0KA 2Q5IA 3I45A 2CHGA 1ZJ5A 2XNDD 3T4UA 3K9FC 3LI2A 4YRPA 5ADVA 4N7RA 1PT5A 2ID7A 3TEMA 1M6HA 2W8BB 4Y6LA 3E9NA 4RXUA 4B8YA 2G83A 3SZLA 1CIPA 1N9KA 1QO0D 2PUHA 4LV8B 3EBLA 4X84A 1CZRA 3TMAA 1NXQA 3OA0A 5HIMA 2VYNA 3A06A 3E3AA 4KE6A 4M88A 4PU0A 4XSGA 3M4XA 5I9SA 4DAOA 1MF7A 5CXQA 5IKPA 2AI2A 5DSXA 3RYFA 2B4YA 2XUGA 1ELOA 1UZAA 3IT1A 5HOQA 4DNFA 3WR5A 2FWIA 3RVJA 3S81A 1CX9B 3I5UA 4ZOEA 1IOLA 3LT2A 3WSVA 3IUBA 3V8BA 1YF3A 4HNQA 5DF1A 1BN6A 5A3QA 4C20A 5LZ2A 2ACKA 3UT6A 1PQWA 4PYMA 4HT3B 5F12A 1CUJA 3OU2A 4YWJA 1F0YA 3HN2A 1RQXA 2P91A 1TZ2A 2HADA 2HX1A 1OBOA 2QUIA 4LN1A 3IAUA 1AUOA 3RTCA 3WP0A 4ETNA 5KNDD 4BWFB 1T0JB 3S1SA 3KBOA 1EBUA 2YN2A 3G2LA 3DOIA 4CQMD 2ZRLA 4Q82A 4AURA 2F17A 3L0PA 5DU2A 4FNMA 2GXAA 1NNI1 3B3AA 4ENQA 1J0BA 5IBCA 1E2GA 4WXRA 3NYQA 1HETA 4AMVA 1ADFA 3OUTA 1QTIA 4RW0A 3VNVA 4I4LA 1LNZA 1YVUA 4EPRA 1GZ6A 1JHVA 3EVTA 2GS9A 4W82A 4F6LA 4RIIA 2Q21A 2IIQA 3F6BX 3DWIA 3O75A 3GYBA 2YWCA 1W2WB 1N2SA 5BP7A 4OQMA 2AFHA 3UHOA 3EC7A 4ZAXA 4RC9A 1T6BY 1ZOOA 4ETWA 1B6RA 3BXHA 3NEAA 1XVVA 3PWKA 3QKTA 4NICA 3IR5A 4GYYA 4ZTUB 3EXIB 4M9SA 1ZM7A 3MCTA 4BZXA 1K6IA 5FUVA 3M6MD 1JFSA 3GWZA 3A10A 4HGPA 4XWGA 1GSAA 4NV0A 5DXJA 1TX4B 2OYRA 1GGEA 3CSDA 2O5RA 1Q0UA 1SUIA 4C14A 1TUGA 4BYGA 1JWBB 5AM4A 5IWAB 2BKVA 4YI3A 5K2MA 5EZYF 2W2VA 2DLNA 4DC9A 5JQGB 3V5NA 2F9MA 3AU9A 4CGYA 5F4BA 2VDVE 1JQKA 1YC5A 3RC3A 6PFKA 2VA8A 2PUTA 4FX5A 3U7FB 2FFAA 4EABA 1U2DC 1BNCA 4O4LB 2RSLA 2WWXA 2YIVX 3RDPA 3C97A 1EX6A 2ILVA 4L0MA 5DCLA 2VPPA 4GGOA 4NI5A 3B6MA 1SVWA 2P2CA 3HV2A 3MS4A 1J4AA 3ROTA 4P7FA 2Z57A 1DJLA 5IAJA 4IXNA 4O5OA 3SR3A 1DXHA 4JROA 1GILA 1C1DA 1LB1B 1C4XA 3AILA 4KQ1A 1UT6A 3CKYA 4B71A 4GGMX 1YJCA 3CZPA 3MJVA 2ZRNA 1AGNA 1M83A 1JG2A 1T6ZA 3ILYA 3I3OA 3MG9A 4YUVA 2C2KA 1HDEA 4BZPA 3LL7A 1T15A 2DPLA 2VSYA 4IIFA 2IQIA 4DHWA 3OI7A 3SX0A 3IQWA 4EYQA 3SICE 1OLXA 2WHPA 1NC3A 1B73A 2P4EA 3UUFA 3IHKA 2GO1A 3AUAA 4IRUB 4KQ9A 3HUDA 1YI8A 1X2EA 2PVCA 5FJJA 3V00A 3IDAA 1TIBA 3O2QB 4YCCA 4UTVA 5DGCA 1T5IA 2DBYA 3OBIA 3VYUB 5J4VA 1VMEA 2CC2A 2PBZA 2VHTA 3EGEA 2BH9A 2R7AA 4IIUA 3K9LA 2XDQB 3CHYA 4F2GA 1DTSA 2RHLA 3COVA 5DBIA 1JQ3A 2BCEA 2Y05A 3G17A 1MO4A 1QCYA 2C4WA 1NBMA 2JFYA 3M4YA 5LC1A 5JYCA 4N1AA 3Q8LA 3D64A 4RTKA 1R7RA 4N48A 2O4CA 3O4RA 5BNFA 4KXUA 2WD7B 2GYWA 3AVPA 4CKEA 4C05A 3UK6A 2PTHA 5EXXA 3VSEA 2PL1A 1SVNA 1M2VB 1PFVA 3ECAA 3FFXA 3L79A 3OQVA 3ZGZA 1DO8A 2UUPA 2Y4OA 1WHSB 3C3YA 1U0NA 1GA4A 1Z75A 2NZJA 2F3QA 2BFDB 1TAHA 5D87A 4RQBA 1FE8A 4AJOA 1QG4A 3WKBA 3CKKA 2B9EA 3I09A 3LFHA 3M1YA 4JK3A 1QUFA 2BI8A 3EXHB 3OQHA 4IDOA 4Q15A 4QFDA 3ZWOA 4ZCIA 2HN9A 3LO8A 3MAJA 4R1LA 1SKUA 2R5WA 3VOTA 2YUTA 1MNQA 3FN4A 4CM7A 4D9CA 2IITA 5FUBA 2LNDA 1VLZA 2AJBA 4BIMA 3BCUA 1JNXX 4OK6A 1JEYB 1AU9A 4XUGB 4AJEA 5I8WA 4EHHA 4L9AA 3UWKA 1C41A 1GAWA 1YHZA 1YE8A 3RM3A 3GD7A 4AJPA 5JFGA 4ZJYA 5JNRA 4TM8A 2WVJA 1Z2NX 4DLZA 2EJCA 4KC0A 1AT1A 1B6SA 1KVSA 4PVCA 2R60A 3G2MA 1JLHA 4GLOA 4AD8A 2QL6A 5A0VA 2ZRPA 2E89A 2VCHA 3UHPA 5FUMA 4MA0A 2UZAA 4ADSG 1VLJA 1W75A 5TV2A 1Y1QA 5I7UA 4CM6A 1WUIS 3AXTA 1AKQA 4CVNA 4GL4A 1DO2A 1B2LA 2A14A 3LKDA 1NBOA 1ZHFA 1NVWQ 3KPJA 3K1TA 4QEZA 3NEPX 2YNMC 4CLEA 4C43A 2CF6A 1TQ2A 3M9LA 5ITWA 2EIXA 3PEEA 1OFIA 3L7DA 3F74A 2AX3A 1OXSC 3R3ZA 2EBWA 2SBTA 1P7WA 3BE4A 3C7CB 4Q9JA 3U9TA 3SNHA 3TZEA 3WLOA 1EFVA 4OQQA 2C7QA 1RCFA 3OLVA 1ZAKA 1A4IA 1AB5A