1IWBB

Crystal structure of diol dehydratase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DIOL DEHYDRATASE alpha chain
publication title Substrate-induced conformational change of a coenzyme B12-dependent enzyme: crystal structure of the substrate-free form of diol dehydratase
pubmed doi rcsb
source organism Klebsiella oxytoca
total genus 60
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2002-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1iwbB00
1UC5B 1UC4B 2D0PB 3BRCA 5D5PA 3WB0A 1EEXB 1NBWB 1MMFB 1DIOB 1IWPB 1EGMB 1IWBB 5D5QA 2D0OB 1EGVB 3WB1A 3AUJB 3WB2A
chains in the Genus database with same CATH superfamily
1IQRA 1DTWB 4QLBA 2C9MA 4ZCRA 4G23A 2H57A 4FCWA 4EEKA 3G8YA 3TM4A 4YT2A 3ROXA 1KERA 3A2LA 4HXFB 1FUKA 1FYDA 1V45E 2IQ5A 5EY5B 3RSFA 3FW1A 4IS2A 4MSUA 1LRLA 5TQVA 4FUTA 1RQPA 5GPBA 2VJYA 2HRDA 3T6KA 4GC9A 4B33A 4ZJZA 1JTVA 4KV7A 4QC2A 3A9UA 1CR1A 1N2GA 5DBEX 4DV4B 1O94C 3U37A 3V6LA 2AFVA 3A3PA 3GEEA 1TA0A 1FX0B 2DG2A 3L4EA 3NWEA 4DSZA 2JPDA 2CV0A 2I03A 2NSLA 4LDZA 3ZX4A 3JWIA 4EG5A 3GPIA 3HLYA 3RADC 4BE9A 2EW1A 4ZO6A 3I23A 4EQ6A 1RQ2A 4KTVE 5AHKA 2FZWA 1MR3F 1A97A 1BN6A 3QM1A 5HK8A 2HLPA 4ZV9A 3LCJA 4Z9XA 2WM3A 2AHOA 4RDHA 4JL6A 3DCJA 1UK7A 2JARA 2Z6AA 1XQVA 2VJCA 2WB4A 3GN1A 1Z5NA 2JJYA 2WJAA 3NAQA 4QOGA 1E4EB 4J43A 5CIWA 2CCKA 1UZMA 1T9BA 1X80A 4Q4LA 3ES9A 5DW3A 3DW3X 4QUJA 4UNPA 1JIUA 4G81A 4MW9A 2Q1YA 4C4XA 2Y2UA 1RQRA 4CV0A 5JRZA 5TPZA 4TXLA 1Z8HA 2FW6A 4G1EB 1ZESA 4P83A 3RJMA 3N2LA 6PFKA 2M1XA 2X7XA 2REQB 1WD5A 1BOFA 4K6GA 1KDYA 1Z56C 4R01A 1XHLA 2ID4A 2QUZA 1NJSA 3G2PA 1RR6A 3O3CA 3A9RA 2PIAA 4Q03A 4YDQA 1G7CA 4P34A 2CLIB 2L69A 3KE8A 4B6QA 4MHOA 3IC5A 3STVA 1TFRA 4A1FA 4AUKA 5JEEA 3QXGA 4E3ZA 2AJLI 2A9QA 1F48A 3BMOB 1G2QA 3WGGA 1KI7A 3L8DA 5D3ZA 5F5LA 3WBJA 4D9CA 2JAPA 1N2BA 1UKBA 2E6KA 1JIJA 1HO3A 2IKQA 2PAAA 5IMSA 3K6SA 2FR0A 2QDKA 1XQWA 2HSEA 3WBBA 2CWDA 2QKYA 5K3AA 2C5HA 3RYHA 4DC0A 3AZQA 2BGUA 5B7PA 3FDZB 2J07A 1OIXA 4X90A 1T2CA 1UKAA 4C08A 5EJ7A 1T5DX 3TLZA 1Z0UA 1QP7A 4KX3A 1SH7A 2XYVA 1HETA 3FMIA 3FOBA 2GH1A 3NHPA 4NF2A 5MN6A 1D2MA 1W9HA 1WCIA 4C0LA 3KAQA 1V96A 5DHQA 3DZDA 1P2FA 1ZUNB 1BNCA 1I51A 1I4LD 2P5TB 3B6ZA 2KYRA 2V1XA 4F84A 4AQ7A 4FX2A 4EG6A 3KB6A 1I10A 2OTCA 1EXMA 4G9EA 4UHKA 2G0TA 2BD0A 1C2YA 3KHUA 3TLGA 1OY1A 3K31A 1YNSA 3MGKA 3AEXA 2NUPA 1F6DA 3O8RA 3DR3A 1HV8A 1U7XA 2FPKA 5BYJA 4GP7A 4X1YB 4JKOA 1HE8B 1LTHR 3PIIA 9ABPA 3EXG2 2O5CA 3IPAA 3PV0A 5ESDA 1Y0BA 4JB8A 4YUWA 2XMRA 3GJTA 3U4HA 2ZRKA 2X2EA 1FRZA 1OOEA 3H9JA 4WLOA 4BC0A 1XTZA 4C3UA 2IU3A 2QTAA 5TMBA 2DECA 3MLEA 4RWEA 2F3SA 3CU5A 5EMJA 1SGWA 3SQDA 4BX9A 3QITA 2Q0QA 2P9TA 4QJ3A 1P7ZA 5ADHA 1I7SB 1N7JA 5T7BA 3HNOA 3UW1A 3C8DA 1U0HC 4D9MA 5I9SA 1NQ5A 1UINA 1DEKA 4AECA 4Z4GA 4WA8A 1DIOB 3HU3A 1C9EA 1JU4A 2B7LA 4N4AA 1LPAB 2CV1A 2ZWPA 3TZLA 3OZBA 4IG9A 3WIUA 4NYJR 2C9ZA 3KKZA 1B43A 3N0WA 4LCJA 3FPCA 1D4ZA 1F8XA 2RG7A 3LS2A 2YZGA 3HBAA 3N07A 1NTRA 1V8DA 4Q01A 1J2EA 5KMGA 4B6GA 4U7TB 4EJSC 2BF7A 4FP9A 1NA5A 4YRRA 3OCZA 2PUBA 3WGHA 3FHOA 1KI2A 3Q5DA 3V1UA 1O94D 3EULA 1K2VN 5BSMA 1AO3A 1WZUA 2J3KA 4O4JB 1VA5A 1T6BY 3UGKA 4Q21A 1NV9A 4QHYA 1FNMA 4UVDA 2Z83A 1X8XA 2J7PA 3EWAA 1A76A 3SF8A 1LRKA 2WVGA 3RFTA 4NMLA 3U3OA 3UXHA 1USUA 3SXPA 3X2SA 4LZAA 3LX6A 5F7OA 3T3MB 1BW9B 3R8XA 3TYXA 1JU9A 3IILA 1S1MA 5FUBA 1KR5A 1IBSA 2OCGA 1U3FA 5CB4A 2FMHA 3E7XA 3LSYA 5FR1A 4BP1A 2AX3A 2D2VA 3ABQB 3LC7O 4IUCS 3THOA 4YAJA 1JBKA 1F4VA 1OTXA 3DOUA 3E0QA 4G4SP 1D03A 4TN5A 3UUEA 5KWJA 4ND5A 2QVYX 3WYNA 2UYGA 1DX4A 3AR2A 3FPEA 1BVYF 1PEDA 1V1MA 1WZEA 1C3VA 5DN6A 2O8CA 2J0VA 2EJCA 4NQRA 4MNTA 3RB8A 1R74A 5DM4A 1JPUA 2F3UA 1J1UA 1TPYA 1R4AA 3DVLA 5DGHA 4B87A 3L0ZA 4MS1A 2G4LA 3QPUA 2VPYA 4WLFA 1WXGA 1XDSA 2HRRA 1Z5VA 4QATA 1DUIA 4LMBA 5A1TA 1UM8A 2FPRA 2J6BA 3ABRB 4L15A 2I9KA 4XM0A 2QJOA 1XHEA 2YRWA 3CVOA 4YC7A 1C80A 2NU7B 4RXUA 2C1XA 1Q83A 2IUEA 2JI4A 4Q6WA 1HWYA 4E09A 4ENWA 4EL5A 4QUAA 1U02A 1X1QA 4BJ5A 3FZGA 4LVNA 3TRJA 1GY8A 5DWVA 2VG8A 2UZ4A 4QPZA 3UAXA 4HFRA 3E35A 3BD7A 5DEIA 1H2WA 5JAPA 5ICEA 2DYKA 3RAFC 1YJ5A 3DGFC 5HCNA 1XDWA 3CJTA 4J7AA 1N2OA 3G7SA 4LOAA 4P36A 1NW5A 3SJ7A 3FFBA 3TZHA 3WK8A 3EMDA 4L9SA 3FDIA 3FOEC 3AIIA 3JPWA 4TV9B 2W0SA 1ZDMA 5A3JA 1YFZA 2WYWA 4LXIA 5B37A 1T0HB 1OQAA 1ATIA 2Q45A 4GX1A 3DZCA 4WERA 1Z6PA 4F04A 5KTSA 3AO0B 1K3UB 2D2FA 2VWGA 4PYQA 4ARVA 3I2GA 1LZLA 4KIWA 4Z4FA 2HI0A 4ZQHA 4MUHA 4PHFA 3IJ5A 3M6AA 1KEZA 4HNUA 2QT0A 2CHFA 3CT4A 3EYWA 4BFLA 5DM0A 1QYXA 1OFGA 4L50A 2BC9A 4BS9A 3EGDB 2PL1A 4G07A 1ISHA 1SJ9A 1ZMTA 2Q3HA 2UVDA 4RM2A 1BG6A 3MWEB 4A0QA 3I04A 4WNAA 4DLYA 3IDOA 4HDMB 4BX0A 4AS2A 3WWDA 2XCLA 3U49A 4IIFA 3UY4A 1H9AA 2D0PB 1B15A 3EQ6A 3M34A 4HNRA 4JT8A 5FB3A 4AY3A 3FWPA 4RIGA 3UJHA 4N7BA 1W5EA 1VRCA 2WYVA 3KSDO 4GPEA 4QTXA 2DUNA 2X1LA 2WWIA 721PA 4B3MB 2GI4A 5KSWB 3MD9A 3F78A 5IAOA 2DFKB 2CL7X 3ZV4A 2H2FA 4UNQA 4ICIA 4Z1OA 4JZYA 1LQ2A 5L9AA 2RJ3A 2JIBA 2QSZA 3MCTA 5DX8A 4B48A 1VL1A 2PEZA 3NFYA 3T4UA 1G18A 3T1QA 1ODJA 2OQIA 4POAA 4BNDB 4BNKA 1N2JA 4RADA 2BTEA 5EQDA 3PDUA 4JDUA 4RL4A 3O83A 1ZOOA 3NS7A 3TNYA 1ZOPA 4TWAA 4C89A 2I66A 3T5MA 4EITA 1GPKA 1K3FA 4TSFA 3UMJA 4EHIA 5CIQA 2I2WA 2C7OA 3PC7A 1G98A 2G08A 5K99A 3RYCA 2Y1DA 4P4SA 4L74A 4PYMA 1ULZA 4GFDA 4ZJPA 4GZ6A 1TZBA 2W48A 4U7FA 2AKEA 5KQPA 3W9UA 4DREA 2OD9A 3KKLA 5GONB 4KXFB 5CB6A 1OJLA 1NV8A 1ES9A 2W2LD 3CMCO 3KB2A 3LOUA 3ZK7A 1E1YA 4XWOA 3O4VA 4HQLA 1DX6A 2C4VA 1PJCA 1WSAA 1NULA 4DNFA 3DOEA 4LX0A 3F6CA 4R2JA 1BROA 4N40A 3D31A 4UCFA 2IWRA 3S27A 2P5UA 3ZU2A 1TEZA 2NV0A 5JAOA 5DYTA 1M2JA 4EGSA 2UYHA 4OLFA 1GZDA 2XB8A 1BS1A 4UJ5A 2P9GA 4G5QA 5LN1A 1YRBA 3K0FA 2J87A 2OXCA 5DTQA 3E5RA 4FKZA 5COQA 4BNLA 4DUGA 4ZHQF 4FUQA 2O8DB 4JI5B 4QJ5A 4X6YA 2UYYA 1B23P 3KAKA 1MMFB 1E89A 4V0KA 3VDRA 3B1WA 3U13A 4PLZA 4S1WA 1T9AA 2FUG1 3VYRB 2HWXA 2X40A 1EFKA 3MYYA 4RLHA 1QTNA 2CLLB 5LBIA 1GP2A 4B1FA 5SZIA 1CRWG 4IOMA 3T3EA 4A2PA 5GADl 4D25A 1VFNA 5DB4A 3OM8A 1VMDA 1P1RA 5LMCA 4OK5A 1RMYA 2OZLA 2YYZA 4V1CI 2AC7A 4WKBA 1QBGA 2Z09A 3SE0A 4CR8A 1GGNA 1Y4AE 4RHUA 4BUCA 4DRXA 1PYOA 1W0CA 3HNRA 4FE7A 4DR7B 2G0AA 4JGBA 1V8FA 3UHAA 3I34X 4UHBA 3BFJA 1ZKMA 1ZLYA 2H7YA 3LDHA 4BZWA 1Q2XA 3G2MA 3H0EA 4V3CA 1ZRHA 1J06A 2QZPA 2JCVA 3EXAA 2CFSA 3KLNA 4PWYA 4MI6A 5H7XA 3RTDA 1JDUA 1QQBA 4LK3A 4YBZA 3WLSA 3ZCPA 4GR4A 4ZI7B 3GCDA 3DTVB 3T5PA 1TW3A 1FDRA 1JQBA 1TF2A 1CJCA 2C96A 2YL2A 3BE5A 3NBFA 5AQEA 1D04A 2QG6A 4FYJA 4LMRA 4DA0A 1Z7EA 2B2NA 4GMXA 1NLUA 3EG9B 1Z22A 4YJDA 4FWTA 2BW0A 5HE8A 2ATVA 1VJGA 4IS3A 4KAAA 4X7MA 4JOQA 2RBEA 2Y99A 1U8TA 3NHMA 5ALKA 1Q16A 4YN3A 4A92A 3JR3A 2JJ1A 2FJUA 4NH0A 3HADA 1BN7A 4PSDA 1CY2A 2NU9A 3ZDBA 2V0GA 4HDNB 4AP9A 3AT1A 4EJMA 3UA4A 1W581 1RRCA 1JAIA 1S4QA 3W8EA 4ZT5A 3IP7A 2GJAA 3SZUA 3OQOA 1N2XA 1HT0A 4INOA 1QV9A 3CLKA 3KIPA 1DO0A 4Y2SA 3RIMA 4TZKA 1L5NA 3ZHOA 2IXAA 3AI3A 1B93A 2A9JA 2LGJA 4TS3A 1BMTA 4MWOA 1YUNA 1Y98A 4K9SA 2DT8A 3UQZA 2X2PA 3VFDA 2DFNA 1TM1E 3R8CA 4WOBA 1ZM7A 3HKCB 2DWQA 10MHA 1VKRA 3H5NA 3H11B 4U3JB 4NBTA 3NONA 5K03A 4BECA 1D09A 1UFOA 2II6A 1JQLB 4B3TB 1QK4A 1G8HA 2W2VA 3OU2A 1KVSA 3WV5A 1IIRA 5FF9A 3M9WA 2YV3A 1UBFA 2H5JA 3F67A 4DLLA 4DLUA 4ANFA 1NMSA 5CFNA 2XCUA 3HKEB 5C4MA 3ADCA 4JLKA 2H0QA 2QSJA 1GR0A 3H9EO 2PQ2A 1E92A 2XD4A 5B2EA 2SECE 3HE3A 2OO5A 1KJ8A 4FDMA 4ZO7A 4DB2A 4GOXA 3VAYA 2WU1A 4R7ZA 5JMWA 4EPTA 3KKKA 4NQZA 3KQHA 1BDIA 3HJHA 1IVSA 3P0IA 3FDXA 3IEXA 3PNLA 4LXTA 2RGXA 3MTEA 1EJ0A 4JNKA 4WECA 3Q8KA 3DLIA 3ICOA 4RKEA 5F9MA 5BOSB 4N7RA 2G6TA 1UCFA 3H8WA 2R2AA 2XA1A 5EZYA 2AQ8A 2MSLA 1FDVA 5H3CA 3T0GA 3MJRA 5HQTA 2ZDQA 3U3ZA 2QYOA 4EG4A 5DTMA 3ZX5A 1W36C 1B74A 3AY0A 2FG7C 5FHRA 3MAGA 4IX9A 4Q4CA 1FSGA 3WRWA 4RJJA 3GLRA 1WIWA 3OPXA 1EXVA 2ZRPA 5GVSA 1OW3B 4QVIA 1G5RA 2JBHA 4D0SA 1CW2B 3L5KA 2E1RA 3RC8A 4MLDA 3QA9A 1KZGB 3GVIA 2VYVA 3VV2A 3UPTA 2CLCX 4ZCTA 3IPLA 1EX7A 4UHFA 4CLOA 2UVPA 4W8GA 5ESWA 2ZJ1A 3EZ9A 1UMDB 4DIBA 1OLUA 1I4OA 1L5HA 3LXMA 3HLTA 1ZM9A 1BGXT 2HLDD 1QUEA 2I4TA 4U9IS 4YDHB 4C14A 3AJDA 3KUKA 3SXUB 4I81A 1PQ4A 2IUFA 3CF4G 3NBMA 1FRQA 2C8VA 3L6CA 3NBZC 4BNZA 4HVCA 2L19A 4CPDA 3PHBE 1AKVA 1F3LA 4PC1A 4KHZA 3VMMA 4DCGA 1H69A 4YV0A 3RNLA 4DXDA 1INLA 3V33A 3ZNNA 3WRYA 4BQFA 4IMJB 2QS9A 4HPWA 3T5DA 1TU0A 1KAMA 3AFIA 3WGIA 1Z74A 3E84A 3KWJA 1GXSB 2OPBA 4HAOA 2VCYA 2NT4A 4NXNB 3EIOA 3S2UA 1HM5A 2X76A 4G5GA 2IEDA 2B1QA 1ZBQA 2XYRA 4W9NA 5H82A 3UOWA 1Z4KA 4DMGA 1DCTA 1X7GA 4RV9A 4WY8A 3A7DA 3NETA 1SUFA 2I6FA 2VTBB 2IYYA 2QG9A 3GMSA 3O4HA 4PC7A 3HEAA 4Y1RA 5AJHA 1UBOS 1E2FA 1FNCA 2YJTD 3O3OB 4LNHA 4PC3A 4ZO8A 4IGIA 5EPOA 1VCIA 3NUGA 4PO9A 4IRMA 3PXCX 4G4JA 4H7IA 3SY8A 2YJ3A 3OZAA 5LB4A 4KPFC 1Y7TA 5KQRA 2JGDB 2VJBA 2ZBRA 1S6YA 3TW4A 3QKRB 1HMPA 4PRYA 2V7UA 2YWXA 4I08A 4HT3B 1SVNA 1T1GA 3VR2A 4FXOA 2ZBVA 4MVXA 4HUTA 3K0SA 2ADFA 1BFUA 2OBMA 5JALA 5AKZA 3MWFA 4US1R 5CDUA 5LFAA 4EW3A 4II3A 3AL0C 3IBCA 1VHLA 4JVOA 3RQSA 5A1JA 1T5TA 3B12A 4Q00A 1PL0A 5A6SB 5IG2A 2ZB2A 3B6KA 3IUEA 1U8UA 3QUBA 2L82A 5IBRA 2GBFA 4Q7KA 1XMPA 2PA0A 3TQRA 3VH2A 3Q87B 3ICPA 2OKGA 1PSWA 5AIAA 2FPMA 1GYRA 2NTNA 2YR0A 1JT2A 3JQ7A 2DTDA 4NMMA 2DR0A 1LK5A 5BT8A 1N5DA 1R0KA 4P35A 1X7YB 1G8MA 3HWSA 1R5JA 5DOVA 5FPHA 3GUHA 1OAAA 5B36A 5JRJA 3AGQA 1SPXA 3L8FA 1F8UA 3LOPA 4UHEA 1E2LA 3G89A 5AW9A 5DWDA 3ROQA 4EA6A 1YB6A 2J6HA 1WUJS 1ZVMA 5EMHA 1JMYA 4X3OA 3QBDA 2BM0A 4RHYA 5EIWA 1B6TA 3P5SA 4BLQA 3RE1A 1Z0KA 3IRUA 4N9WA 1YDHA 3PPYA 2P9EA 3ZDRA 5K0TA 1P19A 2VPQA 4JLDA 3GFVA 3L7OA 4M37A 5D2CA 3NKVA 3TZKA 1QTRA 1BMFA 1XE3A 2F17A 4HQKA 1Q3KA 1Z39A 1FYFA 3UVEA 5K0EA 2ENUA 3F2IA 1VDZA 1DQPA 1W36D 3C1AA 3L1JA 4IVNA 2Q28A 1IWOA 5FR2A 4GUAA 2MT9A 4EYGA 3BRSA 4KFUA 2PPVA 2REBA 1A8QA 4AURA 1Q44A 2D4AA 3GCGA 3K1AA 3JVUA 5IFLA 4MCAA 1R8QA 4ND6A 3V55A 1NVFA 1OI7A 1F4PA 4YRNA 3UGTA 1E61A 3EEBA 1BYIA 1SR8A 4GGMX 5FO1A 4C03A 2Z8ZA 1RYZA 3QX7A 1I0IA 1I8TA 3L3BA 5BNFA 3ISJA 4PM4A 5TDHA 3VU9B 1NXQA 3C98A 4H1HA 1L5RA 1Z7BA 4EBFA 4BWGA 1Y4SA 2G5PA 7ABPA 1L3CA 1NBWB 1DWPA 1O6CA 1DJNA 1EM8A 2OOSA 3INGA 3DCIA 4ROSA 5IAEA 2YASA 1SXJC 1SHJA 3PFWO 2HK7A 3BN3A 1G3QA 1H2HA 3TVTA 4MWDA 4DLZA 3LXXA 1SUBA 2VAWA 1HK7A 4BP9A 2UXDB 1ZD9A 2QORA 4WOJA 5FPSA 3A6GA 2ZUVA 1P4AA 3ROZA 4DVJA 5T6BA 4DR2B 1EK5A 3OBIA 1L5FA 3CQ9A 5DTIA 1H2RS 4JJEA 2W42A 1Y3AA 2VO1A 3HXTA 5A71A 5LXTF 4KN6A 3P5BA 1IOWA 3ZY2A 4Q9DA 4XW2A 3AR9A 5DLDA 3F47A 4HG2A 1CEXA 4PSVA 3OLZA 2Z9CA 2CFIA 3LVQE 4K8RB 4MV7A 3W2HA 2R6R1 1X3LA 5LDDC 1NYQA 2CDAA 4YR7A 4OQPA 3R23A 3W6UA 4YQFA 1UFRA 3M8KA 3ANXA 3EIWA 1FU8A 2VS1A 1UWVA 1CX9B 3OF5A 2I91A 4XKJA 2QRHA 1AH2A 3OTOB 1E8NA 2VUSA 1I7DA 2JFBA 4PO1A 1EAYA 1GA4A 2PZAA 2ZYSA 2DR3A 2VNIA 1KMCA 2XECA 4MGIR 4TS9A 5FBLB 1B0UA 4MQBA 1HE5A 1WPQA 2GN2A 1JHQA 5FAXA 3CT6A 3ENVA 1F9AA 3QKSB 4ACBA 1M1XB 1JSLA 5JUWA 3HVRA 4X1IA 3OJXA 1FP2A 1J8QA 1A8HA 2B3TA 3LT0A 3NDBB 1ZUIA 5EHXA 2DBVO 4ARSA 2OA0A 1A9SA 5ICFA 3IQXA 3OI7A 1J20A 3FYUC 2V0NA 4GEGA 2WHPA 1W4ZA 2AJTA 2QG4A 5DBGA 3R41A 3ROKA 1PKEA 2OO7A 1PU2A 5REQB 1PV2A 3UWDA 2KB0A 3WB9A 1B26A 3JPYA 4NYIQ 2BOVA 3THYB 3L49A 1KQNA 5DI3B 3T4PA 2Q8NA 1OROA 4RK7A 4OX9B 3B1KA 1GIAA 3F5FA 3UH0A 5I5EA 2TS1A 3C6YA 5TQ2A 2QA5A 3LYUA 1GEEA 1FOEB 4TYQA 1GSIA 1LGYA 1WKBA 5AJVB 3Q8LA 3FUTA 2ETXA 1OKKA 2LDXA 3LUBA 2WG1A 5BYAA 1SMKA 3O1JC 1PQWA 2Z1NA 2O5EA 5DNDA 1U3GA 1FUUA 1QFYA 1T8UA 2IP2A 5A9SB 2PWZA 1J56A 1I3CA 1XZJA 3NM4A 4FN5A 1ZVJA 1E3JA 2XKBA 4D3YA 3LLSA 1Y9ZA 3B6IA 4FNGA 3SSAA 3UAZA 4RL6A 1R0LA 2AX4A 2XQGA 4B8YA 4OSEA 1I2MA 1JEAA 2VUUA 2ZIZA 4M0CA 2GAFA 3MCZA 2WWYA 2HJ9A 2YINC 1N9ZA 3H18A 4RORA 5LSAA 1NNI1 5JQGA 1M7HA 3H99A 2EGUA 5TT0A 1MVOA 1Z5OA 2C82A 2LRHA 3SVZA 3V97A 4QSHA 3GR6A 4XB6B 5TX7A 4F06A 3AXSA 5E6UA 2C54A 2Q5QA 3AJAA 1JIXA 3HY4A 3T9EA 2B3DA 3G17A 5FWDA 2OYRA 4ZAYA 2V6JA 4IEIA 2WWFA 4URVR 2AOTB 4ALNA 2IEZA 5AKGA 1ICIA 5ERGB 1H0RA 3OQIA 3TMYA 5JXJA 3L8MA 3TRKA 2IH2A 1ZNQO 2YHIB 3WB0A 4KRGA 4BO6A 1WQ3A 4IIHA 4F4HA 1NUHA 1SQ5A 2DB3A 4Y3UA 3P2OA 1AHIA 1JHUA 2DPGA 3FFXA 2V98A 1QOZA 4J0HA 4M0EA 2PBFA 1N6RA 3JASB 3V2GA 1C3LA 4B7AA 5BW8A 2BFDA 1Y6RA 3O6VA 4IIEA 5F1KA 3I2JA 1OAKA 1M1YA 3JV7A 1E2IA 1RZRA 1NLYA 3JQAA 3A4IA 3NR2A 3R5XA 2NADA 4Y18A 4C01A 3O38A 2QMUA 2ZUTA 3VU8A 1RKBA 3N8KA 3L0OA 3GD7A 3DE1X 3WRXA 4CIVA 1SCJA 2Y4OA 3U48A 2GK7A 3WHIA 1XKTA 4D42A 2JLXA 3PUHA 2D1TA 3JQPA 2OXRA 4F8YA 2P9YA 3RODA 4XFDA 3ZZ0A 4EGQA 1JDVA 4MKGA 4PICA 3WIDA 2YMMA 1L1EA 3OTIA 2QN6A 3VC2A 5KU1A 3LLVA 5FBWB 4CQLB 1OBOA 4YRKA 2GJ9A 3AF4A 4EF4A 1IBLB 1CF9A 4MWSA 1HI9A 2R11A 2V5UA 3LE8A 4JXKA 4YP9A 3KV1A 3OLYA 4R51A 1RJ9B 1WEKA 4MO2A 1AKUA 3IB6A 2CXUA 3A9WA 2GN1A 4HH3C 3PIRA 1DC7A 3D5QA 4ZYWA 1TEXA 1I3KA 4G84A 4LYDA 3T5TA 2NU8A 1ZD8A 2ORWA 3ETDA 3H8VA 3L8HA 5JFTA 2F3TA 4DA4A 4UZSA 5KYXA 3OOSA 1WQ4A 3NDRA 4FJ1A 5LVAA 1OHHA 3BD9A 3HB1A 1Z3IX 2IYUA 2QR2A 3KOXA 3MQFA 4IILA 3A2KA 4OQQA 4CLXA 2LCFA 1JIQA 1XZPA 2QTVB 3VOSA 3MF4A 4EJ0A 4RTJA 3GZ4A 1XALA 1YKGA 2FFAA 3ETGA 4JYPA 2X0RA 3G59A 3U4DA 1R18A 4RABA 4CHTA 5AVXA 4IQGA 3VKWA 3UJDA 4JI3B 3M4YA 4A6XA 3CF2A 2P67A 4DR6B 1H42A 1CE8A 2O7NA 4I1UA 3P4YA 4FBGA 3C8UA 1U7PA 2QVBA 3GLHA 3E7PA 4LXUA 3N70A 4DILA 4KQGA 4MK4A 4ZAXA 1NG9A 5IC5A 1NN1A 3ZEAA 3IHLA 2O8NA 3I6YA 4UD2A 2PLRA 2WSSD 2Q4RA 1TF5A 1Y7IA 2J1LA 1PJZA 1R8YA 4ZZ1A 2E18A 2PO7A 1ODFA 3D8TA 3ELDA 4PY2A 4RWZA 2I7TA 5G02A 2IU0A 4MRPA 4NARA 5J23A 4I0WB 1GG5A 3CSUA 2FRXA 2CCGA 4BNMA 1QOPB 3L1KA 4WUTA 5EG5A 3ZVRA 1EGMB 3HUFA 4U00A 4IIDA 3SE7A 2WF6A 3GGSA 3CKMA 3HRIA 1JSRA 2GM5A 4OHXA 1QIGA 2B9EA 3M3DA 1JDTA 3R5HA 3VBCA 4QFDA 1VLZA 3GDHA 1C14A 3PUVA 2HMTA 3WZLA 8OHMA 2A9VA 3PGXA 3OJFA 5LA6F 3UKOA 4MVJF 1QYDA 1MT0A 3FPFA 5EGSA 1XPUA 4IW3B 1AK2A 2YFYA 4Q4JA 1EK6A 4P82A 2I2XB 4TSRA 2QTHA 4EI8A 3CN9A 4V0ME 1QQTA 4NHOA 2ODEA 3IT2A 1Q0HA 1PTKA 1T25A 3WHKA 1HUQA 2QY9A 4PAOA 1XDZA 2VT6A 3HSKA 3K96A 4PYOA 2V8OA 5A5FA 1QHNA 1E98A 5F23A 4JK3A 5JNUA 5DGXA 2GDJA 4QG3A 4RHEA 3GPBA 4WZAA 4RTSA 4S1VA 1NXSA 1PR1A 2GJ4A 1FMTA 4I99A 3GVCA 4Q5IA 5JSKA 5HXAA 1IOVA 3A9TA 2PUFA 1PG0A 1U1IA 1TVKB 4J4TA 1FXUA 2HSGA 2I1WA 2ZAMA 3PYMA 5DGIA 1K92A 3EDRA 2L2QA 2G1JA 3TL3A 2BFOA 3FVTA 3VR3A 1GO2A 1P5HA 1FEZA 3GLVA 4WVLA 4NFSA 1U2EA 5C8ZA 1UBJS 2HH9A 1MOPA 1J5EB 1R10A 1X1CA 3DKIA 3UAOA 2CJFA 2QBYB 4M9SA 1JEYA 3KL2A 4JYMA 3AUAA 1J5XA 1FW8A 3IEKA 4A36A 2B4QA 1JXAA 2C5FA 4EAAA 1QH8B 2G1AA 4JBNA 4MUYA 3FVRA 4E4RA 2PSDA 5C7YA 4U0KA 2WHEA 3KSAC 1R66A 1RSZA 2J09A 3NPAA 1PJ8A 1GM5A 4J7UA 3JQCA 4O2LA 2A3RA 3QLVA 4CGYA 1Z4IA 2PAFA 1W44A 4YCAA 5E2IA 4CJXA 1JFFA 2LW7A 1SXQA 2P40A 3OCCA 4MYCA 1OA1A 4AD8A 4CM4A 3T9AA 3KT6A 4A91A 4RENA 1XF9A 3GMIA 4XLZA 5H80A 4FKMA 4U7JA 1MC4A 1Z2AA 5CDYA 3IA2A 1IU9A 4YMGA 3EEIA 3JZIA 4WHMA 3SM3A 4EHAA 4GMDA 4D3SA 2HCFA 3HUEA 1TOAA 1WM1A 2VHQA 1U94A 2WC1A 1KVQA 3HCWA 3GLTA 2RGWA 3JYNA 4H4CA 3RR2A 3PICA 5G40A 2P77A 5L3RA 1EFAA 4RTQA 2QZ9A 1X70A 1L5MA 1NDQA 2H7CA 5BUZA 1ORTA 1YU9A 2IIPA 1NBIA 3D1VA 3AH8A 5I7SA 2PLNA 3L1VA 5DNEA 1PE0A 2EOAA 4WACA 5TMDA 1HSOA 4V1CB 2AKYA 4WV3A 1PGQA 4HXYA 1K7EB 1WMBA 1SUEA 2NU6B 4GBMA 1P2GA 4IDQA 4O4IB 1JJIA 5SZHB 3ZZTA 3PDWA 3C3WA 2QMHA 4XQ9A 4G1MB 1PEYA 1IONA 2YJZA 3KAPA 4X65B 2GS9A 3RSCA 1KFJB 3E7WA 3PE6A 1JNXX 4XUGB 4ZVUA 4YJ3B 4JYZA 3H2KA 3AF6A 5I9LA 1J7JA 2PH5A 3OURA 4KRXA 1U4SA 3QEMA 4P3YA 4I3FA 4ZARA 3CRW1 3VH1A 2BEVA 4IKEA 4X9XA 4AVYA 1BE0A 2V97A 3B52X 4A0GA 3TOZA 1UBUS 1Y3HA 4QVGA 2AG6A 2O2CA 3AVQA 4KQMA 1JKJA 3COPA 3LBAA 2C59A 5A05A 5IC4A 2RI0A 4MI9A 2PQ0A 1J2TA 4DPKA 4ZHQA 1YV9A 1LX6A 1B7GO 2O07A 3BL5A 2FV8A 4PCUA 1ZHOA 1P8AA 1MZPA 2QRGA 4JJ4A 2YDYA 4CDMA 4Z51A 2OHIA 3EEOA 5BN3A 4JQYA 4YJ2F 4CNQA 2FFQA 1Y33E 1CR6A 3SHQA 3C6BA 1R5OA 3GDFA 4W1QA 5KNDH 5CM8B 1DG3A 1AZLA 4OFZA 4MW7A 4LHXA 2Z95A 4PSCA 4YTEA 3W5IA 5TGDA 5D51S 4B0OA 3QJ5A 3HZRA 2WUDA 3D3KA 4O4HB 5LDGA 3KRTA 1AF4A 4LIPD 1ZNXA 3BJEA 5MF6A 1DXOA 3C3BA 5CYFA 1DEAA 3SS8A 4XOUA 2K5UA 1MOSA 3DLTA 3H4IA 3PEVA 5A3QA 3CZMA 3LKDA 2OQRA 3HB5X 5CEEA 2A0UA 3MWDA 1DTEA 3F6YA 5IJZA 1QKKA 3KHTA 1NP3A 1L7EA 1X7ZB 1CB7A 2V6MA 1Y4DE 3C45A 4C7BA 4GS5A 1G1AA 3W5HA 3K35A 4F2PA 3BDAA 3E9CA 3JWGA 4TVSA 4R7TA 1Z26A 4CU2A 2ADOA 1GPWB 5B1YA 3PXUA 2ZYVX 5JASA 3ZWWA 5AHXA 3Q4GA 3AKYA 3F3MA 1PD1A 4TRJA 1T1RA 3AP1A 2XCIA 3FZEA 4DTCA 3OEHD 4JLBA 1NRWA 2CD7A 4L0DA 3SLRA 3IQIX 1Q0SA 1W35A 4MHTA 1J9GA 4DEYA 2Y0DA 2PZGA 2X5XA 3EISA 2WM2A 2IZZA 3ENQA 3FRHA 3PA8A 4TQAA 4ZV4A 1I6KA 1PWXA 2WWTA 2PPLA 4UOZA 4MV4A 2VEOA 4EGCB 1NNLA 4Q4AA 1P31A 1VI6A 5IARA 5T4EA 2GB4A 1ECCA 4UAUA 3RBZA 3WAGA 4I50F 4CN8A 4D4GA 5ITWA 3JQ8B 1I3LA 4TN1A 1C3OA 1Q92A 2QUAA 1O94A 2FUNB 5EHQA 3SR0A 1BE8A 1KETA 3UPDA 4DJ5X 3OZFA 2WNIA 4J0FA 1F38A 2FZ4A 3D4NA 4KQCA 4NICA 2JH9A 2IPNA 3G6KA 3L8GA 2ZOSA 4YBRA 4YP6A 1RJGA 1E63A 1UP7A 3JRNA 2JD1A 2PKQO 2GGSA 2R84A 1OSNA 2H4XA 4CMCA 3E22B 4DM7A 5H3HA 1KI8A 1VG0B 2SNIE 3OPYB 4MVYA 5HF9A 4ARBA 5KINB 3RTEA 1QRRA 2FMTA 5EKUA 3DXFA 4DVGA 3DFFA 3UBTA 2GCPA 3G02A 5JRDS 1EH5A 1JHPA 1TAGA 4JC0A 3Q2IA 5DYGA 2O2ZA 2AJBA 3PITA 4OHFA 1D6MA 2JEZA 3BHIA 2VAVA 4B3BA 2IY8A 1M6NA 2QTWB 4LCEA 2RHWA 3OQHA 2QTBA 1G4HA 2C9BA 2ZU6A 5IASA 3KETA 4XSVA 1QCZA 1YUBA 2AJDA 1QRSA 1QG2A 2WMOB 4G0YA 4AJEA 1V71A 3MAAC 1CC1S 2OY0A 4KOEC 4E2WA 3G79A 2Z58A 1BEEA 1Z47A 3WG9A 2VXBA 1NVKA 1Q91A 4FFVA 3KOYA 1OX6A 3IPRA 4F1KA 1RRGA 3BERA 4ZHSA 4XM2A 1YS4A 4MR9B 2XNDD 1M5TA 1X2BA 4Q9JA 1E4YA 1N6IA 3EGEA 1IUPA 3GRFA 2FQWA 7ADHA 1D7AA 1FX1A 4F5EA 4HDSB 4C7MA 5UKDA 3MIIA 2HF9A 1K68A 2Y1GA 2P9HA 4EG3A 3QVTA 1REQA 3B1JA 2WD7A 2WICA 2ZSIA 5FTJA 3NI2A 5F3RA 3CWZA 3VNVA 2LDBA 2RCYA 3D6AA 4R9NA 4OLJA 3W4IA 1U2DC 1GTVA 1SOMA 3DEZA 2IXTA 1NN0A 3RARA 3WISA 1VI2A 3LLCA 5DYNA 2UYQA 3AC0A 2QGZA 2W93A 3HJAA 4IINA 2PJUA 3GP8A 2V7TA 2YMPA 1Y9JA 3TI7A 5FEMA 4WI1A 3LLUA 2BCGY 3L8CA 2IHBA 3LMKA 4M4SA 5FADA 3CM0A 1E3WB 1OWPA 2MR5A 4NBSA 1GQRA 3FFAA 4RM3A 3ESAA 1U28C 1ZY2A 4KU4A 3L0BA 4KI0A 3SYRA 4NZPA 1Z0IA 1KDPA 2I2FA 4MJLA 1ZIDA 4RVCA 1BWQA 3PNPA 4D3XA 1FRVA 3PFKA 3PI7A 2CJYA 2W6JD 1F5SA 4TUYF 3W1VA 4K0RA 1EU1A 1U0EA 5EEHA 2M6KA 3NXSA 4D9BA 4YYZA 1QJ4A 2HF8A 1L6RA 4EEXA 3ROGA 3F46A 5IRCD 1N2ZA 1AM4D 1UBSB 3R5JA 2UUAB 1RLTA 3T7JA 1Y5RA 4WQMA 3CR7A 1EFCA 2VDWA 3DLCA 3DAHA 3ZKAA 2Y1XA 1PNTA 1CTQA 1SKYE 3QLEA 5CYPA 4NSNA 5KJFA 2IODA 4RZSA 5DN9A 4LVCA 1TJYA 1XVTA 2A0XA 4TKZA 1Y6GA 1XK7A 2V96A 3H1PA 3LQRA 4QUDA 4ZOEA 3D9QX 4PLPA 3ER6A 3GUCA 4JLSA 3AM5A 1D1SA 4KOAA 4F2HA 1ZNYA 2HA7A 1FTNA 5AVVA 1I7QB 1MBZA 3P2KA 3F4LA 3VDQA 5HSGA 1FDIA 3PC6A 5EA2A 1V8OA 1SUSA 5EE0A 3UKDA 4I1PA 3OZ7A 3HUTA 1D8AA 3UWOA 4L5JA 1LPPA 2PZFA 3GZTB 3BE8A 2ZYRA 3L9XA 4IL5A 1MFZA 4Y9DA 3TW0A 4I3HA 1LXCA 3LKZA 1E1MA 3MINB 3EIHA 1UAAA 3INTA 3EGIA 2AI1A 3Q85A 1HYGA 4YK7A 1MQAA 2W2LA 1DCFA 1T5OA 3O0DA 4QBTA 2YWEA 4CT4B 1DDIA 3PNVA 3I05A 1DELA 1Q19A 1SKYB 1WB4A 2JFOA 3IE2A 3EA4A 4HDKB 4A03A 5IF9A 5GV7A 4ER3A 1AZWA 1M72A 2H4JA 4EX6A 2QMYA 5SICE 1SOAA 2NYAA 3H3JA 4WBXC 4BMDA 3OE1A 3E5MA 5D7NA 3R6TA 2BRUC 2XHEA 4IZ6A 3CEHA 4HZIA 4N03A 1G8JA 1SBHA 1ZIPA 2E85A 2IHJA 1USKA 2IBMA 1KH1A 3EFEA 5FI3A 2FSVC 5LZ5A 1P1FA 3WP1B 5IVPA 2YN4A 3VMFA 2OV8A 2YQ4A 2Z5FA 2EF1A 3LAWA 2EC5A 1TM5E 4OB8A 5EYPA 4CEHA 5ALDA 1TEHA 4KXUA 4YH1A 1WXEA 2J3HA 3HKDA 3LT4A 1Z36A 1KZ9A 2IEGA 3R3WA 2X23A 5LQSA 1VBFA 3EFOB 1HQCA 5I7OA 1GYPA 2GO1A 3KP1A 3EWSA 2FEMA 5IJXA 4EUNA 4IUDS 3EDCA 2JK1A 4PVDA 5K3FA 4LRXA 1YQQA 2G83A 2INGX 2PGNA 4LJAA 3P97A 1ISPA 3FTQA 3IQFA 1W29A 3FLMA 4EYSA 2GKGA 2YWJA 4HDOB 4U2CA 5A0VA 3TX2A 1T9DA 1RWXA 1JHXA 2ZI3A 2CFRA 1SXGA 1XEFA 2CXPA 3OQPA 2OC4A 2Q3BA 2X22A 3NVMB 3RCBA 3WA7A 1GUDA 3WC4A 4D9HA 1J8YF 3EAGA 2JLZA 1FFGA 4YB8A 2XVXA 1J1IA 4X45A 3FOWA 1G9TA 1BX1A 1WMAA 4H7KA 4O08A 4V0SA 2C5EA 3GEMA 2QXTA 4OVKA 5AJXA 2ZQ5A 2Z3ZA 1KWKA 2QE7D 3LBHA 1JH9A 1GAJA 3F90A 3SHFA 2PUVA 1Y3CE 2OCXA 3TJRA 2ZB7A 3SJUA 3UOGA 3CEJA 4CMEA 4OLBA 4KHPB 3V1YA 2BBOA 2GCNA 3CUVA 5BP7A 1B8VA 1XDUA 4HS4A 2OV6A 1AMNA 5AM1A 2EZUA 4M9RA 3DH0A 1GDHA 1OXMA 3L8EA 4TXNA 5AKHA 4D26A 3T38A 1TMKA 1D5CA 3O8QA 1U0OC 1QH1B 3DEHA 2ECQA 1KHTA 4MDYA 1E0AA 1YASA 3UJPA 2ZJFA 5BSEA 4JR2A 5K2MA 5ADVA 2CVQA 1JS1X 2BKAA 2BEUB 7MHTA 2R8RA 3QP9A 2I78A 4QXOA 2CVFA 1NQUA 1J8DA 4F2DA 1LPSA 1KEPA 4HN9A 4CMGA 1THGA 5C3MA 1SC4A 5EJ9A 1MP0A 2JFVA 4LRTB 5CNKA 1BE1A 3S2SA 3NRCA 3UV6A 2J3JA 2JGLA 3F0TA 4QSMA 2C0QA 3ZY5A 8AT1A 1C7RA 3DR5A 3R24A 5LXTA 2CFTA 1DBPA 2BMJA 1WHSA 4XRRA 3L84A 4FFSA 2B2CA 1N57A 5HUHA 1P6XA 3AY6A 3N39C 3THWA 4OMUA 3Q7TA 1NPTO 2LIPA 2GHRA 2ODTX 4GMKA 4MDFA 2E5FA 2I4OA 3KHSA 1ZAYA 2JGEA 2C00A 3W3AD 2OB1A 3KU4A 1XMOB 1X42A 2XA9A 3PPIA 2K4MA 2Q7DA 5I7RA 1Z0AA 1NVVR 1B4DA 1H0HA 2H00A 4ZDWA 2PTHA 2A9OA 1ZCJA 4ZO4A 3CUKA 3UF0A 2O48X 4WFKA 3H0CA 1FPQA 1R0WA 3MUOA 1HT3A 3OZGA 2B35A 2IUTA 3NH6A 3NIDB 4MINA 3AJRA 4XCVA 4ZAGA 3ZHXA 4DOMA 1GL3A 1XJ5A 1J0DA 1B8UA 1WTCA 4ISBA 4O5AA 1ZW6A 1FBTA 2EIHA 5AOVA 1A9TA 1V2GA 2CW5A 5KCMA 1NW6A 4Q6BA 3PL1A 3QBJA 2WIFA 3DC7A 4NHEA 4UVHA 3K0CC 2XUHA 2O8EB 1QG0A 3UEOA 4C22A 3U7RA 1C1YA 1A71A 3NTXA 4Q1FA 3U26A 3B51X 1BTOA 3QEKA 5KDLA 1QDUA 2RH5A 2ZAGA 1TDJA 1AUPA 1D4OA 2R1VB 1BWPA 2WTMA 3OX3A 1L5VA 3QTBA 1J2YA 1TJ5A 2AJCA 1CUDA 1FRNA 1RRMA 1XF1A 4IIGA 1Z5WA 2IK8A 4U2GA 2BGRA 1XXLA 4PZZA 4XDGA 5FHQA 2PD4A 2CXSA 5THXA 1AKEA 4LMPA 1XZLA 5HIKA 4TXHA 1FL9A 3NHWA 1A9PA 1RKUA 3OJEA 2O8VA 4KVGA 1ZCBA 4WCVA 4W8OA 1EQ2A 1T5IA 3BRQA 3E23A 4PE5B 4D4MA 4UHCA 4AYXA 3QOXA 5K0CA 2OWDA 4KXXA 2I55A 4X20B 1PK9A 2PH1A 4NJOA 1I36A 1KTVA 1O6FA 3C14C 4FEAA 1F1BA 5HFAA 1U2GA 1SY7A 1UC4B 2HUPA 2Y0CA 3CEPB 1G59A 2XRFA 1I9CA 4WK6A 1GG9A 1FUYB 2VHZA 3PKJA 4L9RA 4GOLD 4IDHA 1CWUA 1HMYA 5JCPA 1QO9A 2PUHA 4ZIRB 3KTOA 4HQOA 4B3GA 2WPDA 3DE6X 5FOTA 2QTFA 2BMDA 4DRYA 1IYZA 5JLJA 2XGGA 2HD4A 1RPZA 3D3JA 1I5EA 3FCCA 4FYXA 1IY0A 3T94A 3STTA 1P1BA 3JATB 4LOLA 2ZIVB 2WAXA 4QA9A 1AV7A 3LVRE 1ISJA 1XTTA 2E4XA 1TI7A 1HLPA 1RAEA 1K3TA 2VHCA 3PYXA 3KYDA 4L95C 1EA7A 5F21A 4FNOA 4BKMA 3F9RA 3RC1A 3QK7A 1QQ6A 4ZOCA 5J3JA 1RE0A 1JDZA 1AZSC 1I32A 5HZGA 2K7FA 1KPHA 2E3JA 1D2NA 2G09A 4B2IA 4WW0A 1K75A 4ALMA 1ZD5A 1VRVA 8ADHA 1IBKB 1AJEA 1CUBA 1NX9A 3JZMA 1Y8CA 2D2IA 3G82C 2EFJA 2B4TO 1BXKA 2GF0A 1LSJA 3E4CA 3X2FA 2PX2A 3EFBA 1YDWA 2XGSA 4ND8B 5T6MA 2VWQA 3O8OB 3IP5A 3FJOA 1MQ9A 1ONOA 3WVNA 1KK1A 1CZUA 3UNXA 2HPVA 2BMVA 5ALVA 3GL9A 1MJFA 2VF5X 4HK4A 1VL0A 1WX1A 2CNKA 3IKJA 1ZSVA 4E31A 4A8PA 2OK7A 1B41A 3SIPA 1YQ9A 4BO5A 4EFNA 5JPDA 1WULS 1AZTA 2GA9A 4M86A 4TX1A 5IPFA 4HQFA 4C6TA 3BGDA 4Q1VA 3LRTA 4F45A 2JI7A 3G8CA 4HZGA 4L73A 2BKUA 5DHSA 3RSZA 1U8CB 1F17A 3I30X 1X9HA 3Q6NA 3A1NA 3OTGA 3TG8A 4U9UA 1XMSA 3P2JA 1RZUA 1G2IA 2ZSJA 4RPHA 5TMEA 3T3PB 4HWPA 5A4AA 3ZLJA 3V2HA 3K8OE 3OCJA 1US8A 2X4DA 1ONBA 3E1GA 3N2IA 3GZJA 1ATZA 3SJCA 3SHTA 1Q14A 5D00A 2GASA 2FXIA 1VP3A 3BBLA 2XF8A 3D0KA 2DU8A 1FLAA 3DBOB 2BHLA 4FC6A 4LDJA 3UC5A 3UJ3X 4MYRA 1VRWA 2C3YA 2FX5A 3IDZA 2VBCA 3DP7A 3HEBA 3NYQA 4HH4A 4UKDA 4EFLA 3UCFA 3WTBA 1XYVA 4WAUA 3ANNA 1Q1AA 4EATA 4J4BA 2XW6A 5JIBA 4Z4CA 3KSMA 3DQZA 1Z8NA 3VU1A 3F8WA 3R74A 3OD1A 1IUOA 3RC3A 2YWHA 5DM1A 5FBZA 3DHEA 3VGJA 4QUEA 4IR7A 4RZ2A 2XLCA 4J2TA 1VB5A 5FWXB 2WJ3A 2P2ZA 4G37A 2N46A 4B83A 3P45A 2C07A 4MGYR 1SVOA 3BC1A 3MSXA 4KXVA 2Y0EA 2FWIA 2O3SA 3A36A 2XT9A 3COZA 4GWGA 4L7VA 2ZS7A 2Y1CA 3BILA 4LJ9A 4YDRA 4P32A 4WBNF 4CKXA 2ZR9A 2Z3VA 4FZ5A 5EXSA 1DIAA 1QE3A 2NN3C 4KXLA 1L5GB 3W78A 2EATA 3WL5A 3UPUA 2ERXA 2FSPA 2G28A 2ZDGA 4LBWA 1GQSA 3NHRA 4FW8A 4OJQA 2CL6X 1V0JA 3JAKB 6REQA 3OY2A 4D4LA 3KQMA 2RJOA 3LPDA 4KDEA 5FA8A 3KELA 3OUZA 4LQ4A 5DCWA 1FMLA 1K98A 3ZDXB 3IEMA 1KVRA 3CUTA 1M6WA 2FZGA 3AI1A 3F2VA 5B7QA 2HXGA 2XNJA 5LP6B 5EVJA 1DARA 4UATA 4U2BA 1FJXA 4NJEB 2A9PA 1XTQA 3KYCA 5HILA 5LA6A 4EUFA 2A1IA 1JIKA 1RLMA 4MVJA 5KJCA 2WM9B 1YS2X 3AHHA 4AJHA 4JI0B 3FGNA 1S9DA 2V74B 2WJHA 2B8EA 3SKYA 1WUIS 4E2ZA 2F1RA 4ZI2A 5JXGA 2GOYA 3KVNA 3LRPA 4LSMA 4E1VA 2Z3WA 1GTZA 3TVDA 2YC2C 4AKSA 5AVTA 2VHWA 1KMNA 3G3EA 4PX2A 4FDLA 4LVOA 4MVJG 3WWPA 1AD2A 3KO8A 1GWNA 5EMLA 4CFYA 1R0CA 4C7KA 2C5AA 3G9ZA 4EKDA 4ZYZA 2ZKLA 1Y1RA 1PK8A 2ZJOA 5JDCA 5IWCA 4GQAA 2BGLA 4U0JA 4V0LA 1GL6A 1DIRA 3WDSA 4RTPA 3F8SA 5JNTA 1PK7A 4B35A 2UYCA 3CC8A 2BSAA 3DZJA 1J9EA 3HBFA 4ZCPA 2HSDA 3OAAA 3SQNA 5F4ZA 5B2FA 3DMHA 1TO1E 4B17A 1TJNA 1NAIA 4QQ8A 3BXXA 3ROFA 3GU3A 5DNWA 1RXUA 4NZZA 4Q3BA 3SPXA 1ODLA 4JMPA 1PFVA 2IDZA 3DDWA 1GRRA 1VKNA 4EQ6B 4KFTA 4MPRA 1OB2A 2DQZA 4MWCA 1E3LA 1ADBA 5C8DA 3ABOB 1CZKA 3V00A 1NXPA 1UBTS 2WZCA 4HB0A 4IICA 1NJ5A 3K09A 3LPMA 1B0ZA 4L28A 4XDHA 1X7XA 5L4NA 1SD5A 3CYFA 4YP1A 4IDPA 4OYRA 5KNCD 1T3LA 3KQWA 4BB6A 4RK6A 1VHTA 3PGVA 1X80B 1KJIA 1G4AE 2ZBUA 5L4SA 4G56A 5AVYA 1G291 4TS1A 1SBTA 1SVWA 3JD0A 1JECA 1GT6A 3FVWA 3R1IA 8LDHA 1AB5A 2PT6A 4NBUA 1Y6FA 5I5GA 1QG6A 2H1SA 3PR2B 4D3FA 2IVFA 4AG6A 1X19A 2Q2VA 4UUAA 5H4GA 1Y1LA 1S96A 4KQEA 5ILOA 3H1EA 4IVQA 1E2PA 3GPLA 2RKOA 5ICGA 1X15A 2V58A 4TKMA 2FP4A 5JYDA 1PR2A 1RFGE 1SK8A 1WOMA 2ZYGA 3GYBA 3EB9A 1U2SA 1H5QA 4LBYA 4WL0A 1LC0A 4A23A 3GH3A 4M1ZA 3AKZA 2XQVA 2XKJE 3L6UA 1OE0A 1CJKC 4ZALA 1IZ7A 2JFXA 3LX4A 4F9FA 2FFJA 4D43A 4ER7A 4J29A 1LJLA 1SBZA 2X1HA 4EP1A 3AB7A 3QG1A 3VSAA 1JLSA 3KUXA 3E3AA 4RTKA 4UU1A 2OG1A 5FT9A 2AFHA 4Y9SA 2I2CA 1RKXA 4FVTA 3K6SB 1E3IA 2FDRA 3CF6R 2HA6A 3W7BA 1P1IA 3BK2A 4L5BA 2NSHA 3UA3A 4Z2AA 3RYHB 1MC1A 3QU9A 5EIEA 3DKVA 4QPDA 4AWBA 2Q6LA 2I6TA 2W6OA 3OY7A 3R5KA 1PG5A 4XGIA 5D6NA 1FK8A 2OBXA 2RC6A 3E05A 3IAM6 2GBLC 5E2BA 3RLIA 2O0KA 3N2ZB 3WZMA 5DM60 5CCDA 3BOSA 4I9HA 3TOVA 4DUZB 3VYWA 4CNBA 1SCUA 4NE7A 1VE7A 1WCIB 1XEWX 4ATNA 3PJDA 3REFA 3CE6A 1DLIA 1O5TA 5KS2A 2GD0A 2DBQA 2QX4A 3L01A 3RC7A 3E2MA 4IZHA 1WVGA 3MN1A 4RSGA 4XSHA 4OIMA 1DBIA 2BUAA 4UMVA 4LF7B 2CLSA 2B5OA 4HYYA 4Y0NA 4RHFA 3P2EA 3TDMA 5IDQA 3T34A 4YJ2A 4YQYA 2NWQA 4LHVA 3QEAZ 1NHGA 1SXJA 3QU4A 3COYA 3TLGB 4ECEA 1DC3A 4BNUA 3KLOA 2NO6A 4ZOLF 3VR6A 2NUPB 3T1HB 1SK9A 3BE6A 3D3WA 1XQXA 1QJCA 2G9RA 2ZBFA 3MJSA 3DS8A 2OV2A 1YBFA 3OQ1A 5KAPA 1P9OA 2Q6OA 1MFPA 5NULA 3ZW9A 4RZXA 3WKAA 3U44A 4PPGA 5IVIA 3CNOA 3EJ6A 2R7MA 2WUWE 1U6JA 3I62A 2OQVA 1V7ZA 3KR2A 1KMIY 1CDOA 1CUGA 1S7GA 3D81A 3F9IA 4P81A 6GPBA 4DMCA 3QWFA 4U7GA 3B1VA 1A9XA 5DLQC 5ADUS 1TZMA 3JQGA 3NIWA 5CB0A 4FWBA 1RHMA 3LQYA 5CP8A 1DWUA 3ISTA 4D46A 1JQ5A 1RHJA 1J09A 1GLVA 1KAHA 1Q50A 1EX6A 3H83A 1OAOC 2P3OA 3G2NA 3ILSA 2JASA 3LFTA 3SMQA 3E3MA 1GA1A 4H1WA 5JFOA 4ND2A 2PNJA 4E14A 1JBQA 4P4NA 2OV1A 3W8RA 1P45A 2LD4A 2R8EA 1W9MA 2BM9A 4JJ7A 3RJZA 1YS9A 2M32A 2HHAA 4FFMA 4JNCA 4Q3DA 3Q2OA 4WH0A 5K7SA 1RPTA 1OFUX 3BSSA 4G85A 5FI1B 2WB2A 2NZ2A 2PKCA 1KJYA 2R8XA 3H5TA 1CUYA 4ENPA 1AKWA 5DYIA 4BB9A 1WZCA 4CG0A 1UIRA 6ADHA 1ODSA 1Y9DA 2C4KA 4I50A 4NG5A 2NYRA 3TWOA 3EZ7A 1A1VA 2PWYA 4GBJA 1DAEA 7YASA 3GT4A 3CURA 3WSTA 5LQMA 2D1RA 4C3ZA 1N33B 3C4QA 1IXRC 4CL8A 3SF8B 2FR1A 1H9CA 1OB5A 2O6HA 1AQYA 5GQSA 3M6VA 1ONPA 3S8MA 3WGQA 4J16C 2WSSA 1QK3A 3RT7A 4DCJA 2YV1A 3C8MA 3Q7SA 3RH0A 4EGAA 3B9PA 5FPYA 2PRKA 1OLOA 3MRVA 3I5AA 3VO2A 4KGZA 2FQ1A 5CB4B 2FPGA 2WMNB 2GFIA 5AM5A 1P0MA 4ZEOA 5K6TA 2Q0HA 3MC1A 3PHHA 2OD7A 4EIWA 1Q0ZA 1XZFA 3BB1A 4JEHA 1C1DA 5ERXA 3VQTA 4AX8A 2B82A 1GLGA 2Q0XA 2BFBA 2WDZA 5K8IA 3MOIA 4BLSA 2YX1A 4ZQGA 2NTEA 4Z0HO 3T15A 4CG2A 1UBGA 1V1MB 3HA3A 3ECSA 3SS7X 5HUQA 2O8CB 2JH3A 3UFXA 2GPYA 1IXSB 2IYFA 3FWHA 1IVYA 4B2YA 4DADA 5K8VA 3FTEA 3B8HA 1UPTA 3LX8A 4DXAA 2ZUFA 5FX2A 4TLBA 2ADMA 2Q3DA 3M1AA 4O29A 4MS1B 4ZZ0A 3I04M 4YCBA 3NDPA 4PQGA 1M2FA 4C0HA 5M3BA 4DNOA 1UKVY 3V8PA 5EUMA 5K51A 2PX5A 3HU5A 4EO7A 4E33A 1CNMA 3DFKA 4ITUA 4WXMA 4UFPA 2Q3FA 4R54A 3VNRA 3I1YA 5E7IA 1E8MA 5DIFA 2XRZA 1U5BA 2IYNA 4PR3A 4ESOA 1LUAA 1ZGAA 4JBHA 1KA9H 1MC5A 3GMDA 4RF2A 3TKLA 2JFFA 4Y6LA 2Q4DA 5KJEA 1N8SA 3FHLA 3IOMA 2YZ2A 2B5WA 1TX4B 5CT4A 3G1WA 1YONA 1GHTA 3ANSA 1Z5ZA 3H9GA 3NT2A 4L4RA 1U0RA 2J0SA 2CVZA 4IF6A 4IH9A 4AMZA 3DULA 2VWHA 2XIQA 2GF2A 2HO5A 2H63A 3D8SA 3EQ8A 4K9PA 5DP2A 2G88A 3OQJA 1P3Y1 4DQLA 4KVFA 1JDBB 2KHZA 3RF6A 3S2GA 5ARDA 4XYGA 4DC9A 3EF1A 3TJZA 2RD2A 2AFRA 1IPFA 4N12A 1J90A 1FSSA 1B0PA 3B70A 3QF4A 4BHTA 1XSEA 1Z08A 3GEDA 3ANMA 4HDAA 2H1WA 2QZJA 1A4XA 2ZJ8A 1PW5A 5DDIP 2VAMA 2ZUWA 4XWYA 2P78A 4Q93A 3AWDA 4BASA 1JBEA 2HQSA 1U4OA 5HOQA 1FXSA 4WNAB 3UHJA 3MTIA 2ECKA 1L7DA 2Q9AA 4MA0A 5A7FA 5IT0A 1MXFA 3KVOA 2J30A 3LUDA 4N3BA 4TUYA 5FL7D 1C1XA 5H16A 2JFNA 2Q21A 5J4YA 4DQKA 2YVUA 4NI5A 3RS7A 2C2HA 1KS9A 1YI1A 4OP2A 2RHDA 3A6JA 3RKSA 4B74A 2EARA 3R77A 2YV2A 1DJMA 4MV6A 4TVKA 4YGYA 2CBZA 2FSIA 1KDRA 2DHCA 1MTOA 5J1SB 4D5GA 1JR3A 1TLTA 2FQQA 2EGGA 4Z9AA 3VJMA 2Q5HA 4YAKA 3FIUA 5HS4A 3Q3EA 1E6EA 2LKCA 4N7JA 2DFDA 5EESA 3VV3A 5JARA 4JLOA 3TNJA 1PI3A 1UWCA 1YZYA 1FXWF 3IHWA 3PGMA 2OILA 4FYMA 5DT2A 1OX5A 3Q1KA 1XTJA 1B00A 2RGUA 3DVAA 4NZYA 2BFCA 2ZQZA 4TWIA 4F4FA 2FU5C 3OJCA 4TRNA 4RVDA 1Z73A 2HNBA 3IS3A 3ZLTA 1IN4A 3FLEA 1C0IA 3PSHA 4AO8A 5K2OA 3HP4A 1O58A 4LJKA 5EP1A 5T3UA 4DABA 5JZMA 5KNBA 1JLRA 2J3DA 5AJZA 1I94B 1TZCA 2GRJA 2GXAA 2Q07A 5B58T 2VRCD 2WD8A 3QVSA 4L5YA 3I09A 4N49A 3NW9A 4KR9A 1VC2A 4P4SB 4DYDA 3A9VA 3X1DA 4EYKA 1RJDA 3K30A 1S2IA 2X6QA 1TVMA 1YD7A 2XXAA 1YJQA 5I8ZA 1L7QA 2CE2X 1DG9A 1IE3A 1MC8A 1TQ4A 2VC2B 4FDVA 5JO0A 4F3TA 4ZJUA 2VDMB 1ACJA 3DE0X 2OFPA 3DWFA 3LUCA 4ZREA 1OXVA 1EHYA 2I76A 4I1RA 5LU8A 4IJQA 3FPAA 4P4GA 3CGWA 3BIOA 1DZIA 2QVZX 4RPJA 4WZBE 5B3LA 3R4VA 1EIWA 3OCWA 2XSZD 3K0FB 4WOCA 4AUNA 4JXXA 3GC6A 3LP6A 1N0UA 1Z4NA 4EKIA 1NE2A 4GLFA 3VR5D 4BKQA 4N39A 1UBKS 5C53B 1DQRA 2UZIR 4HLUC 4OTZA 1J6UA 2W6ZA 1GL7A 3EPPA 4N9QA 3VZPA 4AS3A 2IXBA 3NG1A 3N8DA 4BNHA 2W8BA 4FMPA 3SJZA 3OZIA 5FP0A 3U81A 3QHPA 1KIFA 3AKDA 4I6EA 2OZLB 2YY5A 2Z8XA 3JQFC 1JFTA 4FFPA 1OLXA 4DRXB 5JCXA 3IVAA 3R7BA 3LPAA 5U1PA 2PS3A 2OHXA 1NVUQ 2Z9DA 2V3VA 3BT7A 3PC8C 5LLTA 2PD3A 4WN9A 1EDEA 3TDNA 2DLDA 1YL5A 1MENA 4CDRA 2J9XB 1VE6A 1AOXA 3G49A 3KQYA 4WZBB 1G3RA 2J9GA 5AVZA 3P2MA 1T0PA 5FLYA 3VVLA 2P8SA 4X91A 4BEVA 4EA9A 4KO2S 1LJUA 2P4EA 3WQBA 5KDOA 1UXHA 2HUNA 3I12A 4HMQA 1W4CA 1QBKC 3HVUA 4UTOA 4EPYA 4AZ0A 2A58A 2LPMA 5ALEA 5JS8A 2ZRJA 3VDNB 3LBNA 2GJ8A 3NBUA 3KZKA 2RMKA 1DKNA 1XAJA 4F4JA 1Q77A 1PD0A 2MYUA 2RSLA 3NNSA 3OMXA 4IRXA 2MWMA 4O8CA 5JHGB 3I8SA 3NVKI 4O33A 1D2RA 1X74A 1LI5A 1ABEA 1PQYA 3AHGA 3M9XA 1LDYA 4OMDA 2CXTA 1ZL2A 1ZM4A 1QKJA 2WWHA 2X0FA 3ZE9A 4LHEA 3D7RA 1XTRA 5DNVA 1F8YA 2ZWIA 2XUKA 4K9KA 5CM9C 1MB4A 2V6IA 1FLVA 1L4KA 3QVKA 3UJNA 1Q11A 4HAZA 4GO1A 1K08A 1XGKA 4GGOA 1G2PA 2Y3IA 3OIGA 1CRQA 2JNWA 2D0OB 3TD2A 4QBIA 1A8IA 1UM9A 3ADPA 3A1VA 2O05A 1JJAA 2XQJA 2YXDA 1QYWA 3CNHA 4L9AA 1I6MA 4PLFA 1D9ZA 2G5CA 3BULA 5FPPA 1DCKA 3PF9A 4QJBA 1AO0A 1XZGA 4BFWA 1PX2A 4FM9A 4BNWA 1QCYA 3K4PA 3KWFA 3WK4A 1W47A 1E5TA 3BZBA 4MYDA 5F35A 4CEJA 3L7DA 4E94A 2VPZA 2GM3A 2JAXA 1Z62A 2R0QC 2D5CA 2P6PA 5HCUA 3N8GA 3F4BA 4CCYA 4BMNA 3VTAA 1GRQA 1QIHA 3FKSD 4C20A 5D5QA 1ZK0A 3HYSA 4P86A 3H2IA 4G4SO 3ASYA 5DXFA 1ZVQA 3KJNA 3H3FA 3O7MA 1ZW1A 4OHWA 2WZDA 3RS4A 4IZOA 5TGZA 5IAGA 1G21A 2QQGA 3BORA 821PA 2GN0A 5EZYB 4GPIB 2WU8A 3PXGA 3EIFA 3P0JA 4EZEA 2XNDA 1KAOA 4CKEA 2DSTA 3MGBA 3GRVA 3QBEA 4K6CA 2XNHA 2VDRB 4LA4A 4DA8A 4PV7A 4W5NA 2X9GA 1Z5PA 2BE7A 3VTZA 1A5SB 2P2LA 3JU3A 2GK6A 4WLVA 4L08A 1Q0UA 2GX6A 3FNHA 3O03A 5LM3A 3SIRA 1KU0A 1SNYA 1SZDA 3GROA 2V7PA 3N59A 1XUOA 2XTNA 4JP8A 2QL7A 4YRJA 1T5HX 3U17A 3FPGA 4IJWA 1POWA 2O0JA 2PD6A 3DFIA 4WCDA 3UB2A 1K9VF 4CLOB 4D9EA 4PWZA 2UVPB 5MFZA 2BL4A 1J5PA 4UTZA 3OLCX 4KLCA 4XWGA 4ZTBA 5L3VA 1UKEA 1ZMOA 1P1CA 3IUMA 5ETJA 1OLUB 1T3TA 1L5HB 2G1KA 3OZEA 2J9ZB 1TTTA 2WYOA 5TF4A 1LSOA 2C5GA 1E9VA 1OTYA 4M1EA 3HR7A 1BFDA 2G9ZA 4NCXA 1Q6YA 4KRFA 3PFGA 4NEGA 8MHTA 3MWKA 4FXPA 2F1HA 1WCYA 2HX1A 3S3TA 3BD6A 4D1YA 1CEEA 3WWZA 2ZSFA 4H16A 1MB3A 1D3AA 3I6BA 5C8VA 1DVRA 1H8ED 4B75A 3AOEA 3ZD9A 2LXNA 2ZU0C 3BF7A 2BIFA 4IWNA 2WHXA 3DOJA 1KE1A 3WP0A 1SUAA 3MA0A 2Q4TA 2ZI5A 4EW6A 2ORVA 4B6SA 5HKAA 3F6EX 1HDYA 2QMQA 4Q24A 5AO9A 3VPDA 2WT8A 3E9QA 1Q0QA 5LD2C 4AN1A 3AU9A 3HXMA 2JG3A 2VNHA 3IMFA 5EHIA 5TQ0A 2AZMA 1YK0A 1EWRA 1O9GA 3JX9A 4YV1A 2GQ0A 3LBIA 1KY2A 1LLFA 4F92B 4MKZA 4R71A 1R2QA 4Y1RB 2ZAIA 4GD3Q 4M0FA 1SUCA 2QZZA 2VHYA 1X9IA 1X77A 1M2GA 1DC8A 2H9YA 3TW8B 1ZGZA 4YMHA 3PF8A 2IJGX 4PZEA 5DYYA 1ILEA 1XL0A 5CM2Z 2OD2A 3O2NA 3V4LA 5CFMA 1HR0B 4R2MA 5DRYA 1MO5A 2HRBA 2AZ4A 2DM6A 3PQ2A 3EMVA 1BKYA 4ZGGA 1MJGM 5IKPA 1N36B 1KI3A 2FOIA 1PWEA 5CT8A 3S1SA 4OREX 4URUR 2CE7A 3DOIA 1HEUA 1SZCA 3E3LA 3M4ZA 4X00A 5J63A 3UAVA 1Q74A 2IU6A 2XUIA 1U3VA 5K3BA 3TOSA 3DDCA 3R6WA 1Q5PA 4HTAA 4X1OA 3LGSA 1JSZA 4H6XA 2W4QA 1P72A 4II7A 3R3XA 4LF9B 3ND5A 3PDHA 1WZIA 2QNIA 5TEWA 1ZJYA 2BDTA 2HJGA 2PT9A 2OKCA 2P9BA 2DTEA 3IDSA 3O47A 4FR2A 4P3PA 5IVDA 3QOYA 4HUJA 3GB9A 4MWEA 1Z6TA 4XE5A 2G5TA 2VDNB 3JQ7B 5LC1A 4UD6A 1JKMA 3CG4A 4ZQEA 4NULA 4QODA 3P0HA 2QT1A 2GFHA 4WZZA 4D3DA 5JTTA 3JD3A 3A14A 2Z8YM 1ODKA 3CMMA 3GQBA 3LUFA 3AY3A 3HO8A 2NYUA 5ICCA 4CL3A 4A6EA 1LVGA 3DVRX 3TSCA 1P7CA 3CR8A 1FSZA 3OICA 1ULBA 2WWXA 4FGJA 2J32A 3BWCA 3EAQA 4X84A 3WKCA 2PLWA 1Z25A 3ID6C 3HCAA 1LDMA 2XUFA 3KJHA 3FYCA 3L8ZA 4DW8A 1T6NA 2J5KA 2O2GA 4YAGA 4IH1A 2FJPA 2IX9A 4ZVQA 1PJAA 1KYVA 3HVHA 1D1QA 4LNAA 4WOPA 3C7KA 1IAVA 5CK4A 2D62A 2QI9C 1TYDE 3RUFA 3UCXA 3ZZMA 1K8YB 1YKFA 1AV6A 3IUJA 4OI4A 4Y2XA 2BR4A 2GILA 5FTMA 4KO4S 3DLAA 2JLUA 2H1RA 3ZE1B 2CYCA 4Z9FA 1FPMA 5KYNA 2OP1A 1YR6A 4EQZA 3K1AB 1R0BA 2BHNA 2ZATA 4G5RA 4AMUA 4ECAA 5JANA 4TYWA 4TWRA 1ZIXA 5LBTA 3S6JA 3AXTA 2YVQA 1MO2A 2A8YA 3FMGA 2PS9A 3UMRA 2Y27A 3IVGA 3OE5A 7AT1A 4WBNA 4HX5A 3N6XA 5JMOA 1EEXB 1FS6A 2WI8A 5DHPA 4BMCA 3RO7A 1A4IA 3HJGA 4TMVA 5C8YF 3E3NA 1MRZA 2QUBA 4ZQIA 3R8FA 1WB5A 3B1FA 3CJQA 3U5ZB 4HGYA 1EM8B 5DRTA 3PEFA 2QRVA 1FMFA 2DQ4A 1U28A 1KGSA 2HJWA 2JD2A 3IAEA 4OXIA 2VQ6A 4AP6A 2G72A 1ZO8A 2QM0A 3DV2A 4RKWA 4ODIA 4D3ZA 1MG5A 1YJXA 3IIIA 3X44A 4OQ4A 1I3OA 2JIPA 4JZKA 3ZY6A 2AN5A 3D8BA 1BVUA 1AGPA 3QX8A 1RM0A 4IHKA 1YFJA 4G8JA 3PQCA 2QNRA 3EJWA 3MUEA 1WMEA 4JIMA 3D3QA 4BFCA 1U9IA 1MAUA 5KQLA 4ZV7A 4RF5A 4WESA 2DERA 1NJGA 3C3PA 2H9IA 4LJ5A 4AJLA 2JJ2D 1SIOA 5TARA 4FGUA 1XJ0A 3NUQA 3P9PA 3H5OA 1Y4ZA 1ACLA 2GYYA 4YJ3F 3PJRA 1YHYA 4LYGA 2VZ0A 1RHUA 1VCHA 2BPOA 2UU9B 1DI0A 4FFDA 3W79A 5CJPA 3IURA 2PMFA 2ZSHA 3KVVA 4XJVA 3WYEA 1IPHA 4NOJA 3FYHA 1KQ3A 3OX1A 1OFUA 1VG9B 3BMXA 1PV4A 1JNYA 4FHFA 2ZSUA 4IBOA 4JFAA 5IKOA 3W77A 2D8MA 3AG5A 2NSYA 4B3IA 3ZZ1A 4A2QA 4OLAA 2CUNA 2V9PA 3ZI0A 3SBEA 4UTNA 1DBSA 4Q7MB 2MMCA 4GECA 4HEQA 3UUWA 3WS7A 5KNCH 2HC9A 2QX6A 1TCCA 2XCSB 4X1IB 2H5IA 5IH7A 4GI7A 4RTOA 2Q27A 4EARA 3NHKA 3G0IA 1SCAA 4JBXA 2DWCA 2GAIA 1SBCA 2Y2VA 2J5RA 3I9V6 4P7GA 3PPWA 3TZEA 4K26A 1SWVA 2WHPB 2QWXA 4L8YA 4OAPA 1ZH2A 4G65A 4QL3A 1YXMA 4L4ZA 4DIFA 2RHGB 2Z98A 4GP9A 2AG8A 1RYNA 4N3AA 3FYSA 1K7CA 2G8LA 4P0QB 2ZRIA 3CLSC 4P38A 5KIAA 2C4MA 2O59A 1LBQA 4YCMA 5TQ2B 2WSYB 3RU7A 1V5EA 1TCVA 2DBRA 3O8DA 2WE7A 3PHGA 1W85A 4RDCA 1ONSA 1D07A 1VXOA 1E79D 2ZRCA 4DT1A 1A0OA 3HUDA 4K88A 1SEVA 3CKLA 3CLTD 5F76A 4C3VA 3FNBA 2ERCA 2XTJA 1MB0A 4MX8A 1TECE 1O9HA 4RFSA 1M1YE 1X94A 5IKXA 3EMKA 4I7EA 2QRZA 4PZ9A 4EUSA 2V8BA 5JQWA 2Z1DA 4FI3F 2Y1KA 3GJ0A 3QRWA 1R8JA 2I71A 4G8CA 4UREA 1KAQA 4GXQA 1VBNA 4HR7A 4TT3A 3V46A 5CXQA 1JIVA 5HQJA 4ZZIA 4CIAA 3DUFA 2AXEA 2YMLA 3PNQA 5JQGB 2TMYA 3V48A 4DF3A 2J0EA 5EE3A 5E6UB 4M8SA 1R8XA 1AXEA 3NIFB 3CXRA 3I5UA 3KR9A 4K86A 4C9BA 4E5NA 3X1YA 1E5VA 3GT3A 1ECPA 2IYPA 3AVOA 5JVDF 1SU8A 5HFNA 6NULA 1KDOA 3OQIB 1NKSA 1RZ3A 2BDUA 2JDIA 2PWBA 1RWKA 5C1BA 1VIYA 2E7ZA 2JJMA 3IOYA 4FT4A 3WK5A 4DLSA 2AMLA 4FB5A 1DKRA 1NW3A 5BRJA 2BFPA 5A7GA 3R40A 5H81A 1W2WB 1G8SA 5SY4A 1IVNA 2BFDB 1NR1A 3AI2A 1CUUA 3ELWA 4O25A 4F8EA 1M1YB 1U8YA 2WHYA 3PDIA 1M8JA 1CZLA 5EIOA 3JQAB 5LP1A 2VT7A 3JS5A 4NPCA 4OMFG 4P92A 2RI6A 1QF9A 2ZVPX 4MMZB 1NFRA 1QLHA 3QOWA 3D6NB 3TXYA 2R48A 3BRCA 1SIWA 1L4BA 2A9FA 2QMZA 4FC7A 4GM0A 4Z1MA 3RASA 3IXMA 2HQOA 1P91A 2WSLA 2XWSA 3KZNA 2J9YB 3B3FA 1U9CA 1C8BA 2FWMX 4KRYA 1Z6GA 2FOLA 5INTA 2H65A 3C85A 3RRFA 4HSGA 4ZOLA 5ISMA 4J0QA 1S8FA 4E3WA 2JLAA 2MSNA 2PSHA 6YASA 2PLAA 3GLHE 4KN8A 3AUUA 2Y0PA 4IDOA 1OVMA 2IYLD 2KI5A 3OC6A 1VSVA 3RVDA 4AULA 3UUGA 1T36A 2YV4A 3IRVA 3MCWA 3NTLA 4JUDX 4OBBA 4Y8VA 3ZHVA 3FE2A 4I19A 4QTUB 4IQ4A 2LR0A 5ALGA 3ZCXA 4YHHB 4FKBA 5E0OA 2YN2A 3PCTA 3PQ3A 2JF0A 5AHRA 1N6OA 4ZOBA 2NU8B 3BWEA 3B9QA 2ZRMA 5HGXA 2VBIA 1NOIA 1DADA 1IPEA 1EDBA 5KYXB 4UPVA 5KX5F 1QB7A 1WO8A 2DETA 4YRGA 2GT1A 1E20A 4OXNA 1KEEA 3FVQA 2IIVA 3UB3A 2FKAA 1KQFA 3IE1A 2OBYA 3OWOA 4EW2A 1NF2A 4KIJA 4YRCA 5HG0A 3SZMA 3AIKA 4HH0A 1YO6A 1KI1A 2B94A 4OHUA 4PVCA 1CE8B 1UC8A 2BLNA 2XADA 3SZRA 1PJ4A 2A59A 2GK4A 3W90A 3GLHB 2FFRA 3T5BA 3VZQA 3O26A 1BMDA 1ULHA 3NWPA 2IW1A 2WAOA 3ZWVA 2O1EA 3K0CA 1XQYA 2EG9A 2QV0A 4FJ0A 4PBTA 5CMLA 5BOVA 2IITA 1JE0A 4KPYA 5JZOA 1H3EA 1VQ1A 3DD1A 1V26A 1EE9A 2RHLA 4DIDA 2CHUA 3CLSD 5ARBA 1IN6A 4BATA 2JGKA 4J3JA 1KJZA 1FA9A 1Y4UA 3CBQA 3HJTA 2QAIA 4WZAE 4NATA 1IB0A 5ALFA 4Q15A 5AW2A 1B3RA 1GUYA 1ULSA 1YZKA 3KTFA 2FRDC 2D5BA 1GKUB 4E5PA 2DPYA 3ZDEA 1V41E 3LGXA 2EHDA 4LQCA 3CPSA 1N3LA 2OPHA 3WYBA 3V7FA 1S8AA 4YMVA 1MV8A 1EUCA 2C77A 2FZ5A 2NZJA 2WJ6A 2ZE7A 2HT1A 1CJMA 1T8PA 3ADOA 5JJLA 4HAYA 5DK4A 3HCNA 1B76A 4Y2PA 3I9LA 3TJMA 3ILXA 4CN9A 1VE9A 3CEMA 5ITZA 4KFCA 4KBFA 1BEUB 3SVTA 1ORRA 4R2WA 2AI3A 3NIBA 4Q4JB 2AYYA 2J0UA 5HPYB 4FEYA 2FFBA 1OBVA 3L2OB 5HK9A 2X2FA 3D6MA 2ZBQA 2HA4A 3KXPA 3MIZA 3QI2A 3TMAA 3UMGA 3VDMA 3ZWYA 2X9VA 4X97A 3DMFA 1BJTA 3LQFA 1JJVA 1BKDR 4WZAB 1ZICA 2EV9A 2BY4A 3B7GA 1N32B 3F1LA 2O57A 3D1LA 1DZ3A 4MH0R 3FD8A 4NTZA 5AOBA 2QMOA 2H2GA 3R0ZA 3OZUA 1ZH0A 3TW8A 1A95A 5HF6A 1QE5A 3IE0A 3OX4A 3H2GA 4MR8B 1XZCA 5G1PA 4HAUA 4JP5A 4RY8A 1Y6QA 3V2UA 4CKBA 1KH2A 4F97A 3DOOA 1JXMA 1VIAA 4L8GA 2IUSA 4A15A 1M10A 2HXSA 2EEZA 2OBLA 3FWYA 3HMKA 5GGXA 4EL0A 4ZYTA 2C5BA 4H08A 1H0SA 1DHTA 2QY6A 1YJAA 2W8ZA 3OCXA 4LV8B 3IEPA 1N1EA 5BV0A 1WHTA 4NYJQ 5A0FA 3NFRA 2J9FA 2RCNA 4JMLA 2OT3B 3SEZA 3WL3A 2YKGA 2AN3A 4PZPA 4MVJI 3O3NB 1Y6JA 3W4KA 2WFAA 3M70A 2HTFA 1XXHA 3HJFA 4DARA 5L51A 4QAQA 2WKSA 1EQAA 1G8FA 2BGNA 2ZAYA 1SCDA 3THXA 3AQ4A 3KZOA 2F1IA 1KZ4A 2H2IA 5JYEA 3MMSA 1E8DA 1JFFB 5TSDA 3ELUA 2CZQA 1DCMA 2B8JA 2OV3A 3W05A 4CM4B 5JDIC 3GEHA 2LV8A 1N6PA 3WZ2A 3MFYA 1JW9B 1E99A 5LQRA 4BNFA 5D3MA 5L3SA 2J59A 2X77A 4KEAA 1SB8A 5KNCA 5DGCA 2H4YA 2NAPA 3DMTC 3P32A 3PEUA 2BH9A 4FQ7A 2HLNA 1BU5A 1UT6A 1TUIA 2O2XA 4WFIA 4XA8A 2E49A 1FXWA 4BVGA 2Y6VA 4K9DA 2QPLA 4DSTA 1CUXA 1LFDB 4PYJA 3CSSA 4XJTA 1T2NA 4NBWA 5BWCA 5CDFA 4UPDA 5PNTA 3SYMA 5CT9A 3IAS6 2HF7A 3RWOA 2H1FA 2WFZA 3TRFA 3T35A 4D80A 1GCIA 3MMXA 1SD2A 1DU4A 4IOJA 4O4LF 4LYAA 5EP3A 3T8YA 1EESA 1JHVA 3IMEA 3TXXA 1C0PA 1NW7A 1YE8A 1FLDA 1AGRA 3AUKA 3ZGZA 4PINA 3CH7A 2VPIA 3ZXUB 1OREA 2DKNA 3BMNA 5KC9A 2EERA 2NYVA 4G4IA 3G0HA 1OZAA 2NQ8A 1VKZA 4RKFA 4PO8A 4ALLA 1STOA 1JPNA 1MX1A 1VPVA 3OEED 4KQ9A 5D3QA 2NXWA 3DAPA 2I2BA 3QEMB 4G1CA 5LPNA 4RK1A 3EUAA 1E32A 1YR8A 4Y7CA 1XAIA 3VZCA 3ITNA 4IIUA 3ZS8A 5I01A 3P2IA 4IRUB 1Q21A 2VDPB 1PSDA 5T67A 1JKJB 4L4XA 3S40A 5B4VA 1XD9A 3JWEA 1AHPA 1P2DA 4ZHQB 2X41A 2IHTA 3KOOA 4L4SA 4OYHA 2C84A 3M5WA 4ENQA 5I6DA 5BSVA 1ICEA 4FYKA 5B64A 2C7PA 1RVDA 2D0DA 5BN3B 4LGYA 3O2QB 3ITDA 3K9BA 3BHMA 1E9BA 1QIIA 4K1XA 4NNJA 4W5WA 1LI7A 3ZU6A 4XR9A 3RF7A 2EFCB 4TMXA 1ZC4A 2XIJA 2FOXA 2I6UA 3UT6A 3DBHA 4QUGA 2VOEA 3QXXA 2VPTA 1OV4A 1QUFA 3DMYA 3QKTA 5HJ5A 3IAM1 2WILA 3EXEA 1GQFA 2C4TA 2BMWA 1HH4A 1NBMD 3A4MA 3MWDB 5IDYA 3F8TA 1HDCA 3UAGA 1N0VC 2X8WA 4ZU1X 1I1NA 1E0SA 5B3AA 3GA0A 1W0JD 1HL3A 3P9QA 4GKKB 4DCMA 1FQJA 3DAGA 4NAVA 4RAQA 5CH5A 3VM6A 3TR5A 4ZODA 3WNZA 3EC7A 4UZFA 4OU5A 5H1YA 1P2BA 2IC5A 1KJWA 3GJSA 3JY6A 1R9MA 4MV5A 1UUFA 3WIEA 4UDNA 4HYEA 4NOLA 1CQXA 1RI3A 1XT6A 3BTOA 3TIXB 2H4WA 4BRZA 4DAEA 3BZUA 3EHDA 1YB2A 1SIUA 1KP2A 2Q6TA 2ZLBA 4M98A 1BRMA 3UMFA 1XAGA 1JE1A 3K15A 1O6GA 1SVSA 2QIPA 3TI9A 4A82A 4G5HA 4I4IA 1NL3A 1IJEA 3FDJA 4Q4AB 3DF7A 2I33A 3DE4X 2ZUBA 4FFWA 5BNWA 3A6DA 4RKQA 2VA9A 3A27A 4HUQA 2JHPA 3D0QA 3TE7A 3OHSX 1ZGJA 2HAEA 3KK0A 2WFLB 3RWMB 1XNQB 3MQ2A 3TEMA 2W6NA 1C3OB 2A1UA 2WWRA 3K0AA 4WMLA 5ESRA 1S2NA 5I7HA 4YJKA 2OXEA 1YI8A 5IDXA 1DWQA 2GRUA 2ZCJA 2X5NA 2X8BA 2XITA 1RJWA 3IP1A 4LV5B 5AKJA 2HM7A 3FJYA 1ZOIA 1C30A 3NHYA 1M0TA 1XMXA 1QRUA 1YS1X 2C8KA 2I8CA 4I5FA 4D56A 3FZNA 2VFAA 3I9JA 1A5BB 3H87A 2H48A 3KTDA 4JGGA 3TTTA 1AMOA 5D1NA 1Z29A 1ST2A 2DBYA 1HNZB 3MXOA 1XZNA 2YC4C 5AHOA 1K0UA 3OFVA 4JI8B 1ZD1A 2QENA 1CY0A 5C9ZA 1M8PA 3UV3A 4TXMA 1WDTA 4PLGA 4Z8YA 3FCEA 1HXHA 4B6OA 4GHWA 4NPAA 2FDCA 2LP4Y 3EY9A 3U4IA 1P61B 5EI5A 4B46A 1CR4A 3JZDA 5L7WA 4N76A 1QO7A 3GH1A 4EDHA 1Z0ZA 1YB1A 3SOPA 1I7LA 4FFOA 4CDNA 2C5LA 1XFAA 3RIXA 1Z6YA 3A04A 3DQPA 3LGAA 3Q72A 2HT6A 3ER8A 2AQKA 4ZI5A 5M2QA 1TAUA 5JNLA 2CHEA 5THQA 5C18A 4DJEC 5LKRA 5BSRA 2IGTA 4F2GA 5I47A 1OYOA 3VO9A 3K1ZA 1EVYA 5K45A 2A5YB 1QXSA 4C7OA 5ALLA 2E1PA 3LVBA 4LHSA 5HRUA 1DAPA 1EXNA 1REQB 2WD7B 2UUOA 4HRAA 4G0ZA 4CHGA 3AHIA 2CXOA 2VDQB 2YNMA 4RNCA 3S70A 1JDJA 1SHLA 2V4UA 4K2AA 2H85A 3T9BA 4U9HS 2D7DA 2RKWA 1M74A 1H0KA 4ZK2A 1SZPA 1VSBA 1FFHA 5BQPA 3T9CA 4KR3A 1RKQA 1MA3A 1V7PC 4Y2HA 2QB5A 5H02A 3X1ZA 5KB3A 3FNFA 1H2XA 2ASVA 1K6MA 3IMGA