4LXTA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp-qui3n and 5-n-formyl-thf
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
273
structure length
273
Chain Sequence
GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords WlaRD, a sugar 3N-formyl transferase
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 89
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxtA00
4LXUA 4LY3A 4LXQA 4LY0A 4LXTA 4WKGA 4LXXA 1Z7EA 4LXYA
chains in the Genus database with same CATH superfamily
3ML1A 5KX5F 3RARA 1WXQA 2V6GA 3G2KA 2QQFA 4IHJF 1Y5MA 3DJFA 2CMFA 5BOVA 3V7YA 3WTCA 2GPWA 3NC1C 4NYIR 3C74A 4RX1A 1JE0A 1NF9A 2GEVA 2YZGA 1AK9A 1WU8A 4UE2A 2I55A 2IK8A 3F4LA 3OCXA 1PJ8A 4PZCA 1II8B 1G8YA 2G40A 2OC9A 1PJBA 1PFVA 2WHXA 4RIFA 4TMZA 1JAIA 5AM1A 4Z0HO 3PNLA 4CUJA 4CUZA 1PDOA 2IZ5A 3OZAA 4IQ0A 1Y4UA 2AEEA 4LPSA 4A8TA 5B36A 2MDTA 1D6SA 1M0WA 4B3SB 4Z7QB 3CWCA 4FR2A 3P94A 1JILA 2YJ4A 3I45A 3RTDA 1SULA 1PWZA 1XA0A 4YPVA 2CZQA 1CRQA 1E2JA 1XA4A 4RVSA 3B8EA 4BC1A 5FFNA 1IHDA 1T8PA 2B30A 1P0IA 4AYWA 3SU8A 2JBAB 5IJ9B 1C0EA 1U3DA 4FQ8A 1ECCA 5HK9A 1GSOA 2ZTSA 1WXXA 4PLWA 3QMWA 4IYJA 2BFCA 2FPLA 2XMPA 1H23A 4GVPA 2IGBA 4DJTA 1K8QA 3JQ8A 4NR0A 4QDJA 2QM0A 3I83A 3NX4A 3ZNOA 1NMYA 3I1YA 1QKIA 3EIWA 4YXWA 5AKXA 3REGA 3ESBA 3VGJA 1Y3HA 5ED0A 5J3JA 3K6RA 5K5EA 1KI6B 1X7WA 3RK0A 1E9RA 2BJWA 1WHTA 4HLUC 4R7GA 5DWVA 4MW5A 5CNIA 2IW3A 3U40A 1W4CA 4UNQA 2H4HA 1S8OA 3CH7A 3OE1A 2JANA 3H4IA 2VHTA 1LRLA 3W5SA 4ASUD 2IDZA 3O8QB 4M1MA 5K0BA 2FDCA 3T34A 3KWFA 1HSOA 4CEIB 2OV3A 1DJNA 2ZUTA 3OCCA 4V0NA 5AXDA 1E5XA 1NQWA 1O94A 2G9UA 4FHCA 3TZCA 1HNWB 4LAFA 2JCBA 3K6SA 1FFCA 4XX0B 5I9TA 1MUUA 1F5SA 3B13B 3WIOA 3S1SA 2TS1A 3FB1A 3HVUA 2G77B 4MI9A 1QYIA 4HNGA 3W6PA 3L4JA 5IKEA 1PJSA 3ZCPA 1E7WA 4M8LA 1CJMA 4PO3X 5T4HA 3TX6A 4WINA 1BO6A 4LRYA 4X45A 1HNNA 1KI3A 3QBJA 3KBOA 1THGA 5LA6A 2ZBUA 3WZLA 1H93A 2QVZX 3W06A 2OCIA 1LPPA 1G7CA 1M0SA 3CZ9A 3K4HA 1E1KA 1PWXA 4GLLA 1JALA 2ZCVA 3EVZA 2UYGA 4J3JA 1W4AA 4RFVA 2FA9A 2HRRA 1XTQA 1HT0A 3EW7A 4L3WA 4UAVA 2ZEJA 4U7WA 2VJCA 1XCOA 3DDCA 4V0MA 1IPHA 4CI9A 3LQYA 5LWQA 2C3PA 1R66A 4FHEA 3V8BA 5CT6A 3AR3A 1MTOA 2A6PA 1O03A 2Z09A 4MICA 2RKWA 3HS3A 4AKIA 2PUHA 4Q37A 4EK9A 4F9EA 4CIWA 5GJBA 4N3BA 4L50A 2IH5A 4J2HA 1YJ8A 1X7ZB 3ABSB 2JZNA 5TIIA 3GUVA 3ND8A 2BL4A 3MYRA 3RADC 1ESDA 3KIPA 1H22A 3EXFA 5EXSA 2X7XA 3W5VA 4UQLA 1HDOA 2A1TS 4M1WA 4MR8B 2P75A 5DBIA 3CUKA 1V48A 5LP1A 1EGMB 4JP2A 1U3FA 3WJ2A 5BWMA 2HK7A 4ROSA 1PNQA 3DZCA 3WNZA 2Q8NA 4YT2A 1GT6A 2GVZC 5CVDA 1UC8A 3KTAA 3ZCSA 4ZC8A 2DQSA 1DOAA 3FKSA 1HG1A 2O8NA 2B25A 3TD2A 1NG9A 4Z53A 2D0DA 5ANRB 5KYYB 4LECA 2E1RA 2H54A 1OZFA 1P29A 5AO9A 2BTQA 1RTTA 1LJLA 3GUHA 4JI3B 1U80A 2F1HA 3CISA 2XZDA 4MJ7A 1OASA 1LLUA 4FGUA 3BILA 1PSDA 3DD5A 4GXQA 3O0DA 3WHLA 1NXWA 4JYCA 3ESCA 4QVIA 1VCNA 2IZZA 4J4TA 1YE8A 3F6YA 3OLXA 4RA9A 3DJYA 3WDLA 4ZGWA 1B43A 3DV9A 1HYQA 4HDKB 1TYDE 2PRZA 3ROZA 1LJUA 1X1TA 1EG7A 1GZ4A 2ZJ1A 3GLQA 4P84A 4Q3EA 4B48A 4EA9A 2HTFA 3JQFA 1E1QD 3LWDA 4QT4A 2FSVA 2C3MA 3DV2A 1Y80A 1BFDA 3DQPA 3GLGB 4OXKA 1F9AA 2JVKA 1QE5A 2ZTLA 4E46A 4PLHA 4LCBA 1L9XA 3A1DA 5L6MB 1UPBA 1OXKB 1P4JA 3H6GA 3K05A 4RK4A 4CQJA 3ZGNA 1NQTA 1ZKDA 2AZ4A 4JU9A 1TYEB 4DSAA 1KEEB 1GG2A 1V1RA 1BJKA 5WRFA 4C0WA 4NBLA 3SP1A 1ZNZA 2QNBA 5G53C 5IULC 3I1FA 3BRQA 4A1FA 4BTEA 1RC0A 2CNLA 1GLVA 1RQGA 3ISTA 4B31A 4H7IA 2R5WA 4KGXA 1YRHA 2NN3C 2WILA 3BXFA 4IWYA 3S68A 2CE2X 3QRWA 1Y7HA 2HSJA 3HPQA 1OXMA 3KVOA 4QSHA 3ZQ6A 2NUPA 2AQKA 4IDEA 3WRWA 2VLIA 5DW3A 1RYZA 1DEKA 1YVEI 1ZJ4A 2WU8A 4X8OA 3NBUA 5ALJA 1I14A 4AYTA 2C5SA 4QUBA 2GZHA 2J9FA 3DWIA 4W5QA 2PLFA 1E60A 1PVVA 3D64A 3NWEA 4DSOA 1PJAA 1U28C 2IY8A 2O0LA 4AWBA 1JH9A 4TYWA 5EMLA 1H3EA 3D0QA 2QZ9A 1HDZA 3LVBA 1J90A 5LBUA 3NJ4A 4U5QA 3AILA 4A2PA 2O7NA 3HWSA 3X2FA 4LDZA 3ZY5A 3V8QA 1PVOA 3U3DA 3TSZA 3ZZ0A 1VJTA 1NX9A 3R9XA 2XMRA 3EGDB 3GFVA 2C3UA 4YV2A 3H8VA 5LMZA 4DUGD 1G5PA 2WM2A 2JKZA 5CB6A 3H1PA 4Q4HB 5BO5A 3B48A 1KOLA 2LKCA 2MYNA 1ZP6A 2FCAA 4KVFA 3K94A 5DMHA 4QTYA 3G68A 1ZH4A 1QIIA 3JQAB 4FQ5A 1KRHA 4WX2B 1S8NA 3LT4A 4YALA 5AW1A 3UAVA 5JIBA 1KEVA 2VN8A 2VXOA 5EKTA 1I4TD 4ZEVA 2AN9A 3TW8A 5KSZA 3JAMA 4TWAA 2IXFA 2JLYA 4OHXA 1R64A 3KEFA 4L4ZA 1AGRA 4EGAA 1IJFA 1UFVA 2X9QA 3F7TA 1EFRA 5K4AA 3ZDEA 1Z39A 3R3YA 4B44A 2R85A 3A9SA 2JAHA 1LBHA 3DUFA 1Z0ZA 5E7MA 4D56A 4C6SA 5KOJA 1K7CA 1E2HA 3NVMB 2YIJA 3BERA 5U4XA 5L7WA 4NK4A 1D7AA 4GP7A 4REOA 4NEGA 1EB8A 1UJMA 1K8YB 2J4CA 3EEFA 2HJ9A 4MNTA 1EBFA 2PT7A 3RTEA 3Q2OA 5TT1A 5LUAA 1X1EA 3WKDA 4RF2A 3IDSA 1Z74A 2QR5A 3BMOA 4COOA 2OHXA 1KPGA 2QRLA 3MTGA 4E51A 4E5MA 1EFHA 1STOA 4RDXA 5EZ5A 2JA1A 2Q62A 1FJGB 5CEEA 5A5GA 1H2AS 4E5UA 5C18A 2CLIB 1WDKA 5D6OA 3GFQA 3WA6A 2J5XA 3K9HA 1QS0A 2VXYA 3GA5A 3MTDA 3B8HA 3IB3A 5FO0A 1DPGA 2AF3C 2BP7A 3K53A 1AQLA 3QBDA 4FBGA 5J4KA 4ED9A 4RPJA 4UJ3A 1R4AA 2FSGA 4MV8A 4HZUB 4NYMQ 2IUYA 1GA1A 2PZ8A 4NQZA 2JJ2D 3LU1A 1OT3A 1JTFA 1NP3A 1ICIA 4Q7LA 1FMTA 4GLJA 3W2TA 3IBFA 5TPWA 5CDTA 1VHLA 2H0RA 4RHUA 5FHRA 3BJEA 5K20A 3CRVA 2V9PA 3EQZA 3OE5A 3BX1A 3PQEA 3QI7A 4NX2A 3ENZA 4I99A 1SKYE 5IC4A 2QZJA 4UU1A 3CX8A 3UICA 2F43A 4MVJA 4M38A 2JHGA 4LKRA 2I80A 3AONB 4A73A 5JDCA 4QXAA 2SICE 2YS7A 4RSRA 4M6WB 3FZGA 5H68A 2A94A 3ENVA 3QLVA 4JP8A 5EKUA 1GPH1 1SRRA 2G1JA 2QR2A 3T5TA 1J2RA 1E3JA 2SHKA 2UVQA 3F6RA 3PUYA 1LSJA 4MVJP 1GNRA 1QV7A 3BFXA 4CM6A 5KVAA 1Y6ZA 4FC6A 1DLIA 2RMKA 4LE0A 4P36A 2RGNA 4C0AC 4DLPA 3FOZA 4M87A 5T57A 3OM8A 3ZWDA 4HVLA 3I62A 5B5SA 4JJZA 3RVSA 1XZNA 2BM0A 4DTIA 2Z8XA 5B57C 4Z0PA 1OC2A 4CF7A 3ANXA 2AMLA 1MJNA 2JD1A 5G1OA 5JECA 3TAUA 2M32A 3H2JA 4WLFA 4CDNA 2WK1A 3GQBB 2VDWA 4QJIA 3FZEA 1FVOA 4GYKA 3VR6D 3T9FA 3QVTA 3SYMA 4DMUB 2OOKA 1OLOA 1I6KA 5TC4A 3FBTA 4FD2A 4CJXA 5HFNA 1WJGA 3WGQA 3C70A 4A8JA 3WIBA 1BQ4A 2CXTA 4UHFA 1T4CA 3OX4A 5DU2A 1KO8A 2JFOA 1YOVA 5FWDA 3B3QA 4XWTA 3TOSA 4LOJA 4JXXA 1J2YA 3N87A 5DHRA 1L4UA 4HI0E 1APBA 1Z6GA 3VDRA 4H4EA 1H1TA 3LP5A 1OAOA 3BWCA 3LTEA 4NZPA 3RUIA 4D3YA 5C8XA 3KQUA 1N6NA 1N33B 3SWWA 4D9KA 1JHDA 4E32A 1YB2A 4DWVA 1TRHA 3PQ7A 1VI5A 4YA6A 5DHSA 4AO8A 3CXUA 1JDUA 2LCIA 5CR9A 1F8YA 3KEQA 4BZZA 4ZJUA 4RTNA 1EUYA 3RJTA 3L7LA 3GH1A 1YACA 1NZFA 1JYFA 3KJEA 1FQOA 3FPAA 3PNSA 3MK31 3D1LA 2DHCA 2DFTA 2XQIA 1E2MA 1Z5GA 2ENUA 2EXXA 2Z0MA 3KTOA 3O8DA 5AW4A 5KVSA 2RHOA 1KJ8A 2IZ6A 3NYWA 1TADA 4GRDA 4BNDB 4E5VA 1P9LA 1CY4A 1QF6A 2WMOB 3GHYA 1N0VC 3ZXXA 1AZWA 1SCJA 3IVCA 3PIRA 4FOOA 1LQTA 2FH5B 1Z16A 4DT1B 1EDBA 4CCSA 2H0AA 3I2JA 1ORHA 1WV1A 3EIXA 2X22A 3P2OA 4HAYA 3VO8A 4YCMA 5CFNA 3UHOA 4JB0A 1PYOA 3CNQS 1F4VA 4HDSB 1Y3BE 1BYUA 1SVKA 2TSYB 3KS9A 3I5AA 3QA9A 2ZQ5A 4LZWA 4HPWA 4J0DA 1GZ6A 3UYLA 2UZ1A 1WCIB 4TMFA 3KXPA 1JG2A 4KH0A 1FXWA 4LNUB 2C7PA 2EP5A 5EIAA 1E2KA 1ZLXA 2GYUA 2WBLC 3LP6A 4HN9A 4TV9B 1NSTA 1RW4A 1GHTA 1TJNA 3DM5A 3INGA 3TJRA 1EFKA 5B58C 2VPYA 4BB5A 2QQ5A 3BG5A 3HCAA 2WJVA 3IQEA 3C14C 4UD2A 3D2BA 3VQTA 2WUGA 1PKEA 1LVUA 1T5SA 4K86A 3DWEX 2H7YA 1RM0A 3S6JA 2COUA 2Y1XA 3S28A 3UUEA 4BMPB 3D3WB 1VE5A 4ENVA 6REQB 1IZ8A 2DERA 1OTHA 2F7SA 5GADl 5K0TA 3IVGA 5FOQA 1PQPA 2MJLA 1TAGA 1GPYA 2WU4A 3CLSC 4RM3A 4BFCA 2E4YA 3ZWQA 3THWA 1NN3A 3DHVA 3AW8A 2Q21A 1F4LA 3IDOA 1IN1A 3PZBA 3LCJA 3LECA 4P34A 4GLBA 4URUR 1MABB 2GCNA 4PXSA 3OSZA 1F17A 3SLGA 5E2BA 10MHA 3N2GB 4ENRA 1BFUA 1CT9A 4QXQA 4DBLC 1D2GA 5A6SB 2FSVC 2IOHA 3O91A 5CU7A 2V5VA 4W9MC 1BS9A 1OA1A 1SPBS 1POXA 3IAS6 4RZ3A 2NTVA 1G6KA 2XZOA 1NT4A 2C5LA 4BX3A 3AIIA 4JYAB 1WW2A 5DASA 4YC7A 2WEKA 4HS9A 3UXHA 5CGQB 2PYIA 3G8CA 3QTLA 2E55A 2I91A 1GPMA 1E9FA 1NI4B 2X5NA 3BWEA 2AHRA 5KJFA 1XMOB 2I3DA 3OX1A 1N6KA 4E2YA 5M2QA 1SUCA 5DWDA 2RGGA 3W2IA 4HQNA 1R4MA 3AEUB 4IBOA 4JJ8A 2E5WA 2ZWVA 1VKRA 4OG2A 1CEEA 3ON5A 4PWYA 1DGQA 1YZKA 2AKAB 1IB6A 2PZKA 1DRUA 1QQTA 1YI8A 2NADA 3A05A 3ENKA 1GVHA 1HMYA 1AXEA 3F1LA 3BF7A 3QUTA 4ARSA 2YXEA 3UOWA 4UULA 1BMQA 4AS1A 1P5ZB 4MVCA 1W9MA 3EPLA 2V03A 3U3XA 3GFBA 5DM0A 1JFRA 1ISIA 2GYYA 3C4QA 5KVVA 3MWJA 4W1SA 5J9FA 2XX3A 1T8WA 3KD3A 2SKDA 3SDBA 2Q5OA 3GRKA 3GU3A 2EG5A 4I9UA 5I7EA 5JCOA 2YUIA 3TIGA 1BJTA 1TTTA 2ZANA 2IYLD 2PCJA 3EVTA 3ZJTA 1IWPB 3NKLA 4S1WA 1YR9A 3DDNA 1JXMA 1NJGA 3PRKE 2R1TB 2BSXA 2YR0A 4FK8A 4I50A 4IXMA 4U6QA 4EY3A 2D2EA 5EIEA 2ZYIA 2NPFA 5KNDH 2XJ4A 2PX4A 4ZXPA 4FT2A 4KKVA 4ILKA 4IFBA 3JQGB 4URYR 3SE0A 3VSDA 1QOZA 1KAHA 3F6PA 2BFBB 4QJBA 2J33A 2QA5A 4K6FA 4ZZIA 3ID6C 4A91A 5A2QA 2JAXA 4JB3A 4MGYR 5ARBA 5KSOA 2VQ3A 3SYLA 4HKTA 4B84A 2G1UA 4L27A 1CLUA 1NJSA 2R8EA 1AS0A 4LJ8A 4EKIA 4F1JA 2AI1A 3U56A 3FY4A 5KJEA 4YV0A 1WP4A 5HZGA 2IPNA 2PRYA 4DB4A 1YUMA 4J07A 2AFHB 3M49A 4CLRA 2B4RO 2AMFA 1I7DA 1GQSA 4HG2A 5JWRA 3QVJA 1CKEA 3L05A 1FA9A 4J0FA 3PQ3A 1BCRB 1XIVA 3DDSA 5GGXA 2HU5A 4K9NA 4ZK6A 3FTEA 5K09A 1FVXA 1G21B 1YIDA 1C80A 3AF1A 8ADHA 5EHIA 3ZI7A 2ZRHA 2IUEA 3E48A 2UVDA 1V7PC 5AVUA 3VTZA 5JHGB 3D02A 3HH8A 3SIWA 5DYWA 4A10A 2CXPA 3A6EA 1O97D 3RG2A 3LI2A 3AUXA 2ERYA 2OHFA 5F78A 4ARZB 3JX9A 1RQ2A 1Y3CE 4O2BB 1GGNA 5HZMA 1L5SA 4IUYA 4IVNA 1E2BA 1GZUA 3F46A 4W6QA 3VA7A 2AHOA 2WTMA 2AOUB 3G5TA 3H04A 5JZ9A 4MRSA 2HBZA 3F78A 3ZY3A 2ZUWA 4EL5A 3PC7A 1SOUA 1Y6RA 1MX5A 2C84A 3VC7A 2Y66A 1W36D 5E9JA 1OYWA 1T3ZA 1TEXA 2M98A 2X8BA 3FTDA 3PDHA 1IU9A 2QG9A 2B6HA 2EW8A 1GAJA 3GD7A 4GPBA 2FSSA 4BKRA 4DLKA 3QNMA 2DF8A 1E7RA 1PW5A 3KQHA 2G9VA 3ZKWA 5LL6P 5F7JA 4D3XA 2P0YA 4WH0A 1A1SA 4GICA 2HMAA 1XD2B 2HRDA 1ST2A 2EZ8A 2GXSA 3AJRA 1YDGA 1AGPA 5LMCA 1CRWG 3HNOA 1X2EA 3L6BA 4DEYA 2HCJB 4MARA 4QYMA 5FJJA 4PS1A 1H5QA 4PWZA 3SIRA 4PONA 4LE2A 4AMUA 4OQYA 2XYHA 1RYMA 1RWKA 2O2YA 4AJPA 3QLVC 1R12A 2XUQA 3A2MA 2IU4A 4NJMB 5ALWA 3DC2A 4DMMA 4FCVA 1E69A 4PTYA 2J3KA 3VPDA 2BC9A 1KNQA 1A0OA 3L9XA 4BL5A 2HO5A 5LOVF 3KEGA 4Y9SA 3HWRA 5TQ0B 3DBHA 3JRNA 3NTRA 1ZH2A 3OU7A 3HFJA 2KYRA 4OQPA 3NZEA 5CPFA 1MH1A 5IFKA 2A92A 1JWLA 4AECA 1SCDA 1GKUB 1EJ0A 3WRXA 1H2WA 3AEKA 4KLAA 2QGFA 4ECAA 3OU6A 1NN5A 2G76A 1T13A 3ZQ4A 4I5DA 1T6XA 1WXWA 3DKRA 1Q1EA 1QFXA 4TQGA 4XIYA 4MUBA 2CL5A 3LX6A 4BNTA 1ESZA 2YMPA 1XR3A 2YICA 4PFQA 6PFKA 1EINA 1D3AA 3JQ7A 5AJWA 5JFTA 3IIJA 1GY8A 5LQKA 1YZHA 5D7NA 1GFIA 1T6ZA 3ZXYA 1DV1A 5I3CA 2BTEA 3U61B 3LRTA 2CDRA 3A2NA 2Q0SA 3WYNA 2HDOA 2JGRA 1YXMA 2VF8A 2HPZA 1TM7E 3R7LA 1OLXA 4DMKA 2ZRBA 1NNEA 4ZVUA 1CSEE 4FE3A 2O23A 3R5FA 3QYFA 3NWOA 1N75A 1YZUA 2EBHX 1N1EA 5D3ZA 3QE0A 3VPAA 4LSMA 4D81A 4H7DA 3F5SA 2O0JA 1KHHA 2QY6A 4KK3A 2QXTA 1PLJA 3TQSA 3OZUA 3CN9A 4D0RA 3EB9A 4YHBA 3G2OA 1IWBB 1CE8A 4HGNA 4WNYA 1N2CA 1U9YA 4Q4LA 4KPFC 1KDZA 1XKXA 3B53X 1P9OA 2XXAB 1WV0A 2R1ZA 2ZI6A 1M74A 1L5YA 4BV8A 4C06A 2PL3A 3CUTA 4AN0A 5EHZA 1QYDA 4UTPA 1ILWA 3ZU5A 4OATA 2DOKA 2W5UA 3ORYA 4GNRA 5EHQA 2CYBA 4F7WA 2W0SA 4RC9A 4Y2XA 3HP4A 3EC7A 3GFFA 2Q45A 3C3AA 3TLXA 4PRZA 5KYUA 1A4UA 1D2RA 3PEWA 1YCFA 1DAPA 1OHHA 1YR6A 4J1TA 2QAGA 5IUJC 1IDOA 4JX8A 1KRWA 2BRUC 3I8SA 4MLZA 1E2NA 1UEIA 2VF4X 2VZ8A 2ID7A 3SR0A 3UT5A 2G67A 4P4SA 3CNOA 4EHJA 2C2MA 3O26A 4O1HA 1AK1A 2PA3A 1EEHA 2GK6A 1C7IA 3RUEA 1Z68A 4DKXA 4LVOA 3WG9A 4EPYA 3KR2A 4KTTE 4A15A 1KSGA 1JZQA 3CGWA 1Y63A 4WV3A 1QQAA 1DBQA 3EVBA 3RVKA 3QFRA 5E8RA 1MKYA 1RKVA 1YBAA 1LKZA 2XXJA 4WZBB 2VAVA 1J8QA 3ZGYA 3A11A 4RJLA 5FFMA 1N8NA 2ZRFA 3JZDA 2PUAA 5H83A 4DIUA 3HN6A 2ZB2A 5ALQA 1K9VF 5CH8A 5TRTA 2OP0A 1GCIA 4UHCA 1YT5A 4BNXA 3O38A 5IJ0B 4F6RA 3QYPA 1AB6A 2HQRA 2X40A 4A03A 5CB4B 1Z5OA 3O5AA 1YS2X 1O95C 5FUQA 2Q07A 4L2IB 3UBTA 1EA5A 1TM3E 3B1YA 5CT5A 3ED5A 4ZEMA 4R1NA 3ICPA 2YRWA 3VO9A 4BE4A 2DPYA 1FQKA 2J48A 1EUZA 1P0CA 4U2CA 4YJ3F 3UJBA 3CVWA 3WISA 2W48A 2ZAGA 2IDKA 4WOCA 2FPMA 2R47A 1OWPA 1UPUA 2DHQA 3CJRA 4Q6BA 3T0FA 1Q0LA 1MFZA 1PUJA 2PPVA 2IP2A 1T2DA 3B1XA 3BN3A 4HF7A 4LISA 1E1CB 3FAZA 3I5UA 4FD3A 4FJ1A 2PS1A 4L76A 4QGBA 3L0BA 1FMFA 2QUHA 1CUFA 2ETVA 4G41A 2ETXA 2RHMA 3UM9A 3WQBA 2X0IA 3Q5GA 4J0GA 3VZBA 4RQAA 1N8TA 4HAUA 1YZGA 5ADVA 1E6MA 2QJOA 1NUPA 1S9DA 2C31A 3KOMA 4RJ2A 3ZDAA 1I5OA 4BUZA 2F4VB 3I9KA 3IQWA 3L0ZA 4BMDA 1Q6YA 2YRXA 5E6SA 2X4DA 3K1YA 4M60A 3VR2D 3IT0A 2X19A 3N75A 1DCKA 3ED1A 4OKSA 5JASA 5F1YA 3CQ9A 4KFCA 1GT91 1CZLA 1NIJA 3I2KA 4RMNA 2G9ZA 3SLKA 4G5GA 3U81A 1LPOA 1JB9A 5JSZA 5AVTA 5F9FA 1W4LA 1E3SA 5LCXA 1E79D 1ULBA 4G0XA 1ZFNA 4NCNA 2P5TB 1US8A 4NRDA 1GUAA 3H6HA 2J9ZB 2NZ8A 1S02A 2QTVB 3PQ6A 2RHRA 4YO7A 5HRUA 3JAKA 3O8NA 1ISHA 3EZGA 3IQHX 3EFOB 4LRXA 5B1EA 5KWSA 1NNUA 1QB7A 1XDUA 2HA2A 1IYZA 2WOOA 4HLQB 1VG1A 3T4EA 4GI3A 4ZDIA 2V5AA 4A2CA 5K6TA 2HJGA 5KYTA 4H1UA 3NHSA 2B35A 3S1AA 3BL6A 1SB8A 3EDMA 1PX2A 3GRZA 1G6Q1 5JCOC 5IDVA 4INOA 2WJ6A 4PQEA 4RHXA 3KKKA 1XEWX 4EG0A 3EEBA 2PEYA 5K3BA 2JCGA 4BLRA 2EFDB 4GGPA 3VC2A 1TE2A 4CV2A 1NN0A 1ORDA 3T3DA 1DIHA 1NVGA 3EAQA 4FGKA 4LHXA 4MSUA 4Q16A 4YMTA 5P21A 3ND6A 1OFIA 4JQCA 1ODLA 2H8KA 4FWIB 3FM9A 4UCXA 3GELA 4BVGA 3DS8A 1JHAA 5I7OA 4IIVA 1DAOA 4JDPA 2FLKA 4I9HA 4MVYA 4X3CA 5CNKA 1Q92A 4XGQA 3U5TA 3IR7A 5JAOA 1GFSA 1CUDA 2Z5VA 3IV7A 4QOFA 4ZA2A 3WLFA 2V58A 1X14A 3PUIA 1CUUA 2LCFA 1XEWY 4RZUA 4YCDA 3WIEA 5CEFA 1G2IA 4MPRA 5F2EA 2YY5A 4QTZA 1A04A 2W2XA 1IBCA 4YGXB 2JGFA 5BRNA 3Q85A 4HXGA 4LK3A 3KL2A 3TXAA 5CCEA 2QT9A 4RPIA 1W30A 4OGGA 5EMJA 2D6FA 1UOEA 3ZD8A 1KYWA 4HWRA 1XNGA 2FN7A 2H9YA 5FULA 4N47A 2ZT7A 1M5UA 1BDBA 1WVIA 2P9TA 2RK6A 2YY7A 3C4VA 3A2LA 1ZI9A 3KXDA 4NCIA 4HGOA 4B6PA 1TAUA 1JKXA 5K99A 5LM3A 4KFUA 1WMSA 4REQA 2B8JA 2H63A 2VL7A 5FNVF 3NTQA 2Z8ZA 2VNAA 3SXPA 4XJXA 1ARZA 2P65A 1N3IA 2R9VA 3LJKA 3PDIA 5DV9A 3LPAA 3T7CA 4D5GA 4EBBA 1EIZA 4P53A 2GMWA 2X5JO 2PZJA 3V7WA 5AT1A 3UV3A 1WCXA 4N41A 4XEUA 3PA8A 3THYB 3L41A 2VA9A 4FGSA 3JVVA 4BWVA 5BWCA 1UWVA 2HZ7A 3T5CA 5IVHA 3DLTA 4PSVA 1BOOA 4N3NA 1QRTA 3PP8A 4HDOB 3OQVA 1PL6A 1NN1A 1GA4A 1T1GA 1Z4QA 3GEDA 1Z0SA 2AH5A 3NI2A 2AYZA 4GBED 3MCWA 4UM8B 3LWNA 1OJLA 2GK4A 1KARA 3U4QA 1WZ2A 2OYCA 1ISSA 1VG0B 1PJ3A 3CUWA 2IBMA 4Z9XA 3TSYA 2F1IA 2ZIVB 2A9FA 4Q3BA 1RIIA 1S2OA 3IAM6 2W6OA 1NQ5A 1P2BA 4AURA 3ZCUA 2O2XA 2GBFA 1SHKA 2PVCA 3MHPA 3OTQA 2JJ1A 3E6AA 1KIAA 2O14A 3H0CA 3OEEA 5JSYA 1QZTA 3W9YA 5IKMA 2H1WA 4O2AB 5IT4A 3B9RA 4HK4A 3ICQB 4RZXA 4AD8A 4BFVA 1UMCA 1KK3A 3HZRA 3L49A 4WY5A 4DIOA 1GV1A 3WK7A 3Q4GA 3ZE8A 4CDGA 2XKAA 3SHOA 4DRZA 1I2AA 1LLQA 3ANSA 1C9MA 1JEDA 3IXQA 1T8UA 1GKLA 1L5MA 1QSGA 2J0VA 4C4ZA 4I1OA 4JS0A 1Q3HA 1JIVA 5ES4B 1BHSA 2G6BA 3E9DA 2XZLA 2V54A 1ZRMA 1QIMA 3OZRA 3ADDA 3Q2KA 2IIBA 1QYWA 2R86A 5CT8A 3WIUA 3O73A 1W29A 2PQMA 5BW8A 1EE1A 4R31A 2O5VA 1N2CE 2YYSA 2WT4A 3F4KA 1RPJA 3JYQA 3K5PA 3MTBA 2AQ8A 1I4DD 4GO1A 2NU8A 3VR3A 1N5JA 4DZTA 2W6ZA 5ICCA 1GZ3A 2XA9A 3CU5A 3QP9A 4HGZA 4LY6A 4PQRA 1DUIA 1QQ5A 3DTNA 4US1R 2CXRA 5ILQA 2OVBA 3WS7A 3MPUA 3ZWBA 4CF5A 2AF4C 4IDNA 5CM8B 1Z7BA 2D4AA 5H4HA 3RSZA 2WAMA 2XBMA 1CBUA 4MUEA 2I6GA 2REBA 3GVCA 4JKOA 2EVWX 1ZK2A 1C1HA 3T0IA 2GWRA 4LJ4A 1B1CA 2BGUA 4QAJA 3PIDA 3VOTA 1L6IA 1NVDA 1TEZA 3OIYA 4ZRMA 1C7JA 4IIFA 4J2OA 2RC5A 3DLCA 1Y6JA 4HNAA 1YJCA 1MC4A 5IAKA 5DNYB 3ZCQA 1LZLA 4Z49A 1YFJA 3QXCA 4M9UA 4P22A 2ZWPA 4JGBA 1N1GA 3GFGA 1FPQA 3LT0A 4M0KA 1D09A 4HUQA 1EE9A 4Q24A 2QQGA 4MP6A 3JZIA 3V1YA 4AJOA 2I3AA 3RHSA 5EZYF 2XADA 1K75A 1NZJA 3CA8A 3FR7A 1GO2A 5AJUA 4JI5B 1F3OA 1ZOIA 2VDLB 5LOVB 5LPNA 1VHJA 4ZI7F 2VHYA 3A6GA 4W63A 5BUZA 3ZGZA 4QFCA 3EVNA 3R7AA 3EXHA 3G7SA 2PX3A 4B40A 2FJPA 4O1IA 5SY4A 2GVDC 2PZAA 1Y0BA 1FB5A 1LF0A 3QU7A 3W2GA 4AY3A 3QKRB 1XTVA 4M46A 2YVKA 3BB3A 3K0EA 2HIAA 1D1SA 2NNLD 2YWHA 1SXIA 3IODA 4J1TC 4J6EA 4LXQA 5B2ZA 2GN0A 2VUHB 1JW9B 1RLMA 2PFKA 3NDIA 5JPCA 3T3NA 4FNMA 3WBFA 3K1AA 4G0OA 1H69A 2CFRA 3I4LA 3MINA 3RVBA 1CJSA 3VTAA 1ODKA 3IS3A 3JTMA 2BFEB 3C6KA 3LLCA 4PQFA 4RVOA 1JSXA 4OF4A 3CG4A 4C4PA 3NGMA 2NX2A 3L9WA 1U7XA 2DBYA 4QIHA 2Z08A 2WLSA 3VKVA 2FMTA 1UBGA 4X63A 2PRKA 3OOHA 4N6OA 2DUMA 4FM9A 4HNHA 1ZXLA 4NU5A 1J8YF 3BKXA 3Q0TA 4BRZA 5EGSA 3ETDA 2E6KA 2RGYA 2O1EA 3L84A 3MT7A 2ZYGA 1C3JA 3ASVA 3F90A 5ADWA 3PNMA 4HRXA 2DR2A 4EW2A 3UJ6A 4CIBA 2PWBA 3Q8XB 2GKSA 3QU2A 2WNIA 3R7BA 1FFEA 4Z3DA 4TV8F 2FWIA 4KB5A 1IN4A 2XWSA 1W4ZA 3KP1A 5HUHA 2WG2A 4UCQA 3GCXA 4M0LA 2R6ZA 5JPDA 3IAEA 3OPYA 5BSFA 2GAOA 2J6CA 1EFVB 1DWPA 2FJUA 3TFWA 1P31A 2OD2A 2X8LA 3MFQA 5HE9A 3GUCA 4OSPA 4B71A 5AOVA 4ZZ1A 3B5JA 5LVAA 2J8ZA 3U48A 1F7UA 1M0TA 4YWJA 1QYCA 5EC8A 4V03A 4UQPA 2WHYA 3R3SA 4KOAA 5HOEA 1JDPA 3AEQA 2YCBA 1R6DA 2EQ5A 3HB1A 2AFRA 2D59A 4IQGA 4Q4DA 2IE0A 3RNLA 1SPXA 1R8XA 5KDOA 2IIQA 4GF5A 4GZ5A 4O2LA 1RWMA 5ILGA 4RGVA 1J8VA 1GTZA 1USVA 5MGBA 1WL8A 4IX9A 2W8BA 2WFAA 2FEMA 3DMDA 3OZDA 2A0UA 3P45A 2VH1A 1GKKA 4U8HA 4CEJA 4PG8A 1EM8B 1NNI1 1P1RA 2Q0HA 2W11A 2JATA 1W5TA 1FE8A 1RIFA 3EISA 1R3UA 3LUBA 1JPUA 1LX6A 1MGOA 1MMFB 4P4UA 4TLCA 3F74A 3X1YA 3KSMA 3FBWA 3NHFA 4ABYA 4WT7A 3BZWA 1XXHA 1QWSA 2YQZA 4ZZ3A 3L7KA 2HMUA 3QNWA 3QUQA 3OFKA 4O4LF 5I4IA 4DJJA 3NHZA 4HS4A 1PJZA 1MFPA 5F35A 3M5WA 1PFGA 2EOAA 3FF1A 4M7OA 2M9MA 1CZOA 3L6UA 4GP9A 1WPRA 3ASYA 4MQ4A 2FN9A 4C0KA 3MS7A 4AJLA 1YGYA 2JK1A 3EMKA 3PWZA 1M9NA 4FKZA 3WWDA 4Y2QA 1T2VA 3CFYA 1ORIA 2E4ZA 4JLDA 5FO1A 1BXGA 2WP0A 3L18A 3SQMA 1JBEA 3TSWA 2YXPX 5E1DA 1IZ7A 3X1WA 2WZDA 4J1NA 4ER6A 1OAAA 1PQWA 1S2GA 3FBGA 3PUHA 1EK5A 3KALA 4JP1A 4BZXA 3FHOA 5KQLA 3GVPA 3VR5H 1NVTA 3N2NA 2IYZA 2Z04A 1PZFA 3OUTA 5BN5B 1UBEA 2JAQA 4H7FA 4DIKA 4DLYA 4LRSB 3UWDA 1IVYA 3I2GA 3DFFA 4D41A 4DPKA 1YGPA 1XQWA 4II2A 3PEFA 4Z1OA 5HP4A 3PUWA 2C7VA 3UY4A 2C88A 1RWPA 3EX7C 1CEXA 1XJQA 5T3UA 4PY2A 3C48A 2VAPA 2XRMA 1Q17A 3SICE 1G16A 5C8YF 2FW0A 3RU2A 4G2TA 1M2WA 3IQXA 2PGIA 2QTZA 4D44A 4ENWA 1E9AA 3UB3A 1EGHA 2LCQA 2QJWA 3V6MA 4KPUA 4YEDA 2XCSB 3V3TA 3LHFA 4XWWA 3OD1A 2WUFA 3GEMA 2C2ZA 5BUCA 1N0WA 4JT2A 4MCJA 3ZH2A 3BGSA 3FUUA 4IDGA 3TLGB 2G5TA 3BEDA 4RJIA 3NB0A 2ZRNA 4NF2A 4PPNA 3C6MA 3H8WA 3RE1A 4JWKA 1MHTA 5JO9A 1SU8A 1H9BA 2GO7A 3LDFA 1A2OA 1CRZA 4IRMA 4RSMA 2QTCA 4WXHA 3T5GA 4FB4A 1QKJA 1LV8A 2PX5A 5AVSA 1U4SA 2OUKA 3BMXA 4W8HA 4K7JA 3LW8A 3TCNA 4EDFA 4OHMA 1J2UA 1QGUA 1XAHA 2SBTA 5IAEA 4D46A 3H83A 3WL4A 1F1BA 4EHBA 4AULA 3ZHZA 3LOPA 4DDWA 2EFEB 5IHPA 2ZSJA 3RK4A 2A58A 3Q3HA 1LDBA 4FZ5A 3FYUB 4WZAB 3UW1A 1JPVA 3ZZTA 4EUEA 4HQLA 3IBSA 5F33A 1L1QA 4ILEA 4C0JA 2FF5A 5JVDB 1RRMA 2A78A 2JW5A 3KK0A 4YCBA 5I4KA 1D04A 4Q48A 1KDTA 4GS5A 4MW0A 1V43A 2HMYB 1D2EA 1GPWB 2DTDA 2X13A 4RH3A 4LFCB 2QL9A 3WLKX 1Q1BA 2VFAA 1X3SA 3AUAA 5FUBA 2Y93A 4XRRA 3CRW1 2QUJA 3E9ZA 3EAGA 1T0PA 5TJ9A 5DYNA 1QLJA 4MUGA 4HFMA 1A9QA 4DLLA 2VP6A 3O82A 4RVFA 2OZLB 2PXHA 4N03A 4V0OA 2HPHA 1UKCA 3AWIA 4BWGA 3U80A 1LFDB 4RLHA 1TT5B 5C7YA 2HYDA 3ESYA 4M88A 1Z73A 4LWOA 1NUTA 1PX0A 3KR9A 3HXKA 1TC2A 1GOTA 4QQRA 3TNYA 3DG9A 1GCGA 4B3RB 2BKXA 3AKYA 3MMPA 3W34A 2IHYA 3DGEC 3O84A 3UAZA 1AMUA 5EIOA 3DZHA 5IMSA 2IU6A 1SKUA 1WXHA 2Y1EA 2LP4Y 1T26A 2Y27A 4RELA 3U62A 4YRFA 3FWHA 1V16B 4GXNA 1UWCA 3DE2X 2W70A 4FMCF 3Q3JB 3GGCA 4FE7A 3ZHVA 3U37A 3U9TA 2V65A 4NL4H 5LBIA 1ZWKA 2ZI4A 2G3YA 2KHZA 3Q7TA 4QL3A 4RADA 2Z8YA 1G7SA 4LZAA 5FYDA 2RHTA 5EQJB 3W8FA 4PV7A 2P41A 2EX4A 5GOTA 1KE1A 5HTOA 1J42A 2BZ1A 3EGWA 2QHXA 3DVAA 3ACBA 2QM3A 4MWBA 4NZMA 4XLZA 2FRVA 1M67A 3LUJA 4P3PA 3WAKA 3ANTA 1DEXA 2Q6IA 2OCKA 1V9SA 3QG5A 4U7GA 4WNAA 1HETA 4KQJA 1HOXA 1SVOA 5CFLA 3B89A 2AZTA 4C4OA 3KE8A 2D7DA 2VNJA 1UZMA 1M1YB 1RQNA 4NIMA 1Q6ZA 4YRLA 2ZWAA 1M7HA 3VVMA 3U17A 3HCOA 3KOYA 1TGYA 3RIMA 2H0QA 1XL0A 1ESMA 1Z88A 2J9XB 3BCUA 1U2GC 4QTXA 5BSVA 1PV2A 3DCIA 2BKLA 2PNJA 3GOHA 1SZDA 5K8LA 2VQFB 5HIJA 1EP3B 2YNMA 2FSUA 3L0CA 1LI7A 2EFJA 4YJ2B 5TS3A 3UG6A 1YRLA 4R0MA 1TO1E 5LLDA 5J2UB 3NGLA 2NSYA 4ND7A 3UAYA 1TQDA 3D6TB 5LQMA 2JIZA 3GUYA 2Z2ZA 1EVZA 4LDQA 3WRYA 2ADOA 3FNFA 3OZCA 2FFAA 1EM6A 3GDHA 3VU1A 3ZGXA 2QMHA 1AD2A 4LQLA 5TMDA 1CZNA 2AG0A 4YV1A 6YASA 3WGZA 4BVFA 3BWDD 3W3AH 1ITZA 5EG5A 1IAVA 2BH9A 3N39C 4KN5A 1G20B 1E2FA 1E1NA 1VM6A 2DY0A 2OMEA 3AL3A 4RCYA 5AKIA 3TPFA 4RTRA 1DBWA 3DXYA 5DN6A 4CFSA 2EJBA 1N6HA 4Q1VA 5DGTA 3Q98A 3V9AA 2ACKA 1QHHB 1XLWA 2H85A 3DT9A 3IJRA 4E5DA 2O8EB 1IOWA 3Q8KA 5L3SB 1VCMA 2GUWA 3A1CA 3KOUA 1AKYA 4I9NA 1CF4A 4B81A 3FIJA 1OZ0A 3R0IA 2GCEA 4QDOA 2RGUA 5DM1A 2KI5A 3BWXA 4FFOA 4TKUA 4DR7B 1QFJA 1SXQA 4DLNA 1LZKA 4WESA 4FEEA 4DIMA 3HKEA 4WK4B 2IXAA 3PIIA 3T3IA 4M0CA 3L04A 4I9FA 1I0LA 2CUTA 2IS2A 3WDMA 1JR4A 1Z47A 3RU7A 3EQ9A 5F12A 2VPWA 1C0LA 1U8XX 2ZSEA 1UK6A 1AUXA 2QE6A 2QX8A 2XUZA 5FV4A 1K2VN 2ECPA 4GM0A 4PF1A 1GDTA 5JQGA 1X8JA 1FY2A 3FGNA 4C3ZA 5A03A 2PLNA 3N2YA 1PLKA 1S3IA 4PFKA 3W5HA 3CLTD 4IIEA 5FXMA 4ESOA 3ZDDA 5BW4A 3A1VA 1Z07A 2G1AA 3EGXB 1K7SN 1SRQA 4NCHA 2ZRCA 1PR1A 1WMEA 4OPMA 4CF4A 3HXLA 4MV4A 2E4AA 1XXHE 2AQIA 5CMLA 5A4MS 4FFLA 4EW3A 1CYDA 2I6SA 3HPRA 1ILEA 1MW9X 4MYUA 2I2FA 3L5KA 4HYYA 4UXJA 4JYBA 2WSSA 4RD6A 3ETLA 1JPJA 1T3LA 2PS0A 1YE3A 2FPOA 1GGFA 2HWYA 5I9MA 4A9AA 2Q6TA 5IT9A 2BGNA 1YZQA 3WNQA 1JEQA 2IIVA 5CA0B 1A2QA 2DECA 4EGFA 4PINA 1R5OA 3H11B 4I4IA 1IVNA 4RBNA 3TNFA 3O8CA 2VDUE 4BRSA 4EZIA 2ZJFA 4P33A 1IHUA 4D96A 1Z0UA 2VI5A 3K35A 2QTTA 4TLBA 5BR8B 2SKEA 1C0PA 1UF9A 2XKBA 3TQCA 4GDFA 5IM4F 3UZUA 2WF6A 2A9VA 4BPRA 4V24A 2O2JA 4EHNA 5JAHA 1RLIA 4H16A 4U8GA 1YJQA 3MCVA 2YDYA 4MA0A 4NV1A 2NZWA 1SFRA 2V7WA 4N48A 4MQFA 5B2FA 3R7SA 2V6JA 2R5NA 3NV9A 4PGGA 4JR1A 3VO1A 1HBJA 2ZYAA 3C3DA 4Q00A 2VKQA 2O8VA 5TDHA 3V42A 1NR7A 1IFXA 3PT5A 2CB9A 1G8PA 3S29A 3IUBA 2BFAA 3LKBA 4TROA 4CTJA 4P4GA 4GX5A 1BN7A 3JASA 5TJHA 2RIRA 2A0KA 1WG8A 1DG1G 3CVOA 1A5BB 1FXSA 2WHPB 3GZNA 4AAYA 3ZY4A 4Y6OA 1U7WA 2QBYB 2PCLA 2HQSA 3OX2A 1E6UA 1ID1A 2X0FA 5ITZA 4CMCA 4DYDA 5FI0B 3RREA 1ABBA 1G3IA 1IQPA 5JS7A 3HXQA 4U9UA 1QE0A 4MO2A 3JAWA 2XTNA 2QW1A 3EMVA 1XC7A 3DZGA 3AXSA 4AZ3A 4UEKA 2PUDA 1UBSB 1E4EB 4RPLA 4BNKA 3L7NA 2A3NA 2ZYUX 3H2IA 4KSBA 4PLYA 2A30A 2H2GA 3EQ8A 5EWJB 4F4IA 2Q8PA 2VJNA 1LQ2A 3L6EA 3RR2A 3RM3A 4BLOA 2C42A 4I3FA 2I29A 4DZZA 2QN2A 1EAYA 1KYZA 1NWCA 2FVYA 1G3RA 3G59A 3VBCA 4ZHQF 1HFWA 3D3EA 3V4PB 4YJFA 4A6EA 1N36B 2AZDA 2FSFA 2R8PA 3BCSA 1YQTA 1AK2A 3X2EA 1GRQA 1PR3A 4TT3A 2XAAA 2DLNA 1G19A 2WU0A 1CJUC 3EHDA 4AJ1A 1XCGB 1KMIY 1XP5A 1JQAA 4ZICA 4JA2A 3V1UA 3A1EA 1EPUA 1KU6A 4D4GA 2IP1A 1YBHA 5B6PA 3JYNA 3T8YA 1SG6A 3AT1A 1K5DA 2CJXA 3GY0A 1A97A 1PDVA 5HJ5A 2C5FA 3LX8A 1SIWA 2PH1A 1W94A 3WZ2A 5AOBA 2O8DB 5K3FB 4CLOB 4MTCA 1Q0HA 1O6FA 5DWQA 4Q39A 2MYPA 1GXSA 1E3IA 3ADKA 1SD5A 5M3BA 3ZWPA 5BQ3A 4Q05A 4R4JA 3TL6A 3OQOA 5IAOA 2X1HA 3DZ8A 5H3CA 1JZSA 5GVRA 1S2MA 1W5EA 2IELA 4ACBA 4BZQA 5LLTA 1OB2A 1BXKA 1L7NA 3WLPA 3E5NA 2QROA 4X1OA 3CPEA 4CKYA 4L95C 1NF2A 1RKBA 4OL0A 3LG2A 5B1YA 1NUSA 4TYMA 1I2CA 5AJZA 3V46A 1JA0A 4GQBA 2AZXA 2C1XA 2VSOA 2PUWA 3WL8A 3BE4A 1L5OA 1AUPA 2HH9A 1Z0KA 4EPRA 1B8OA 1ZMTA 2H1HA 1JR3D 4Q21A 3TQRA 5I51A 1SK9A 1D0SA 4IUBS 4LBZA 5FHQA 2BKVA 3QPCA 4N0DA 5BN4A 3VAZA 1RR6A 1JPNA 1Y9EA 3KDPA 4MRRA 4XJTA 5DNVA 1ENYA 2DJ5A 4NESA 3VU9B 2NACA 2PLWA 5DI9A 2J85A 4CDRA 5CIQA 3QENA 1GQYA 1UODA 3SY8A 2NYRA 2I4IA 2HGZA 1ZVVA 1FS6A 1RLUA 2O0KA 5HR5A 2O8BB 4F2HA 4QDUA 3L1VA 2XITA 2D74A 2OB1A 3ZTWA 5JJ5A 3RBXA 4F2PA 2YMLA 4DRXB 1G3UA 2QSZA 1H2YA 2NTNA 1D9ZA 1Z34A 1X1CA 3KVNA 3Q1LA 1Y8QB 2NO6A 3HI6A 1AE1A 5JMOA 3MS2A 3BCRA 2X14A 1YQQA 2BDEA 3EGIA 3HWWA 3U4IA 4J16C 1X7YB 2XNHA 4X94A 2VRCD 4HYEA 4Z4CA 3LOUA 2AJTA 1KVQA 2PIDA 5C1BA 5JMTA 2W2TA 2XUPA 3CW9A 1F2TB 4QGHA 4D92A 3IJEB 1KFCB 2JAWA 2P9QA 3O0TA 3GGDA 1SBHA 5TPZD 2X5OA 5LD2C 2Q9UA 1E58A 2JHPA 1RPAA 4F4HA 1S7GA 1BIFA 1XTSA 2O2CA 4AC9A 5ELLA 1GPNA 2JRLA 3GL9A 3PVCA 4EYKA 4IIBA 4NH0A 4B2PA 4E0BA 2Q5JA 4TSRA 5BSUA 3OE4A 3H7IA 4JI6B 1ULUA 3LFHA 4NMHA 3WGYA 1DKRA 1UL1X 4FSXA 4DM7A 3LD9A 4KIFA 1CRLA 3QVKA 1D1QA 1F2UA 5I8PA 2CL6X 4LG1A 1YK0A 4ZT2A 1SVUA 1GTVA 1ZXBA 2CXHA 2E3JA 2IEAA 2HRCA 4IFEA 4R01A 3ZC3A 5H8WA 2RCYA 2GD6A 4POAA 4R2LA 2Q2VA 3DEKA 1XZFA 3URMA 1TI7A 5BSGA 3PRJA 3A9TA 4MUYA 1S89A 2XR1A 4PNEA 2O2SA 1CJVC 4JVOA 3VZQA 3H1FA 4JZYA 1YB4A 1NOJA 4LUCA 3QYAA 2OFWA 3QVUA 1E63A 2JIRA 2BI4A 3DBRB 4DIEA 2CNNA 3I6MA 3JQAD 5KX5B 1KP3A 4YMGA 1RSZA 3AHIA 4IHJB 9LDBA 1SUIA 3HR7A 4U0KA 5ALNA 3R8CA 4CFYA 2R79A 4O4JB 5HYVA 1PT7A 4O29A 3LXXA 4XQGA 3THSA 2BEUB 2Y0EA 4DFDA 4BJ6A 2PG3A 1EK1A 1POWA 2R6JA 4ND4A 2R48A 4OHOA 5FOVA 1SBCA 1SM4A 3DWGA 1NUHA 1OWOA 4PZAA 3BVPA 3FCUB 3QX7A 4X71A 4UEQA 1FLDA 1TUEA 1Y7IA 4DQVA 2ZUEA 1PL0A 2X7JA 1JAYA 1HO3A 2HC9A 4JB2A 4R83A 3V6LA 2XWBF 4LXIA 3RU3A 2ZAYA 2XF8A 5LQAA 3ZDXB 1SKMA 3E7FA 3ICVA 3KFXA 2HFJA 3OHSX 1SVWA 4QGSA 3OBIA 1XN1A 3U7IA 1F12A 4F93B 1LY1A 4DLRA 4XIGS 1GCUA 4QREA 3I01M 1ZVMA 4JBWA 1JMKC 3IE0A 1EWKA 3EFHA 5G0TA 2I3ZA 1ZHOA 4OHPA 2BEWB 3VSBA 1OBFO 3F7MA 3HACA 4JELA 3UIEA 5FTMA 1NLMA 3Q8WA 4B8YA 3RT1A 4XARA 1O96A 1X1RA 2HCBA 3IBTA 4A6XA 1OGYA 4INAA 4WKCA 5JAPA 1YZLA 5ED4A 3LPNA 2I2DA 3GEHA 2GARA 2YV5A 1ZBQA 1V11A 3PICA 1Z2NX 2CL7X 4F71A 1XYVA 3HN7A 4B3XA 5JNTA 1FRNA 2WR8A 1MR3F 1KQNA 1LJ8A 1SCNE 4PBTA 5B1DA 2ZVJA 1DP4A 1E2IA 1VFPA 4KC0A 4L28A 4KXFB 3HY4A 2VSNA 2F55A 3ADPA 8ATCA 4FFBA 4C6RA 5E8JA 3D6AA 4UHDA 3NIFB 4MUKA 4FQ7A 3DOIA 4HNSA 2MSCB 1VE6A 3EXAA 4ZAXA 4RKWA 1NC3A 1OE0A 2IEDA 4LYJA 3CIOA 5EJGA 3GD5A 2XE4A 3PNBA 5JW6A 1FRFS 1JLLA 3GJ6A 2F90A 4II7A 2OZPA 2RONA 4WBXC 1QH8B 1E98A 1MB2A 2BFFA 3CEAA 4RPHA 5ENVA 3RAPR 4E14A 2PAFA 1FP4B 3IAS1 4UBMA 1ZVKA 1QVVA 2BFCB 3ZPXA 1FFAA 2ZJZA 4OFWA 3T3OA 3MT0A 4LZLA 2MSNA 5B1HA 1RWBA 5KREA 1TGVA 2EYUA 1PTJA 1V71A 1C3EA 3NIBA 4V0SA 4S1OA 4WXYB 5TMEA 4CGYA 1NU8A 4G4JA 4WCFC 2XYQA 1DAKA 1QZ3A 3FFTA 4ZV9A 5KYGA 5LZ4A 1U63A 1SKYB 4I1RA 4GSYA 1VA4A 2YQ4A 2B7CA 3WGOA 3EWIA 1RJFA 4TXMA 1XLUA 4XLTA 4BX2A 1Q91A 4EO4A 1C4XA 2GAJA 4CM3A 2VHQA 4HB4A 4D9MA 3V4ZA 3H13A 4HR7A 1G64A 2W2VA 4TKVA 1N2OA 4Q82A 4Y9TA 3SE7A 3SHWA 4BKOA 1GEEA 5BSWA 3FSEA 5GIOE 3HJAA 2OHVA 2XMCA 1HDIA 3NUGA 3E3NA 4O5AA 1PI3A 3GT3A 3RLFA 1KZ4A 2HRBA 1DJQA 4INJA 1XFAA 3A4MA 2HB6A 3G8DA 1QP7A 2OG1A 3OTIA 4IDHA 2O6LA 2I3BA 2A0YA 1XG5A 3NBYC 1MPXA 4QM7A 2HJVA 1CJCA 3HV2A 4B3DA 1OT5A 3B3FA 2PX2A 2P6UA 1E2PA 1TF5A 2C3OA 1DARA 2P9BA 4BS9A 4HQFA 5G0SA 2FOXA 5KTPA 2AB0A 4KVGA 3THRA 1QRDA 1UC5B 1VZ2A 2OTCA 1U2RA 2P2LA 2ZRMA 3MC1A 1EWVA 2IYYA 5U9CA 3LY7A 3CEHA 3F8WA 5COQA 5DBHX 5F21A 1TU3A 3L7AA 4MQBA 1XMIA 1FNSA 4MQLA 3W6NA 4QATA 1FFYA 1U2TA 1UKAA 2GZAA 2VHJA 4MA4A 4F3RA 621PA 1QC5B 1E3WA 5E95A 3U7JA 2HLPA 3FVQA 5L45A 3T7KA 4PIMA 4YP5A 4FHFA 2F9MA 2IVZA 3AZPA 1E94E 2LBPA 4K9MA 3VPCA 1RPNA 4KO2S 1ZUWA 5MN6A 4MS1B 2DM6A 1W96A 3AR6A 4GMKA 4HEA6 4BVEA 5C7OO 4NBVA 4DQLA 5K01A 1GDHA 3A70A 4FGLA 4J76A 1OGIA 1ZEJA 1N5OX 1AF7A 4OHBA 5EPUA 4EPVA 1AC5A 3EXFB 1OMOA 2OYRA 4X60A 2IHUA 3FVTA 4DG9A 4K6OA 2EWWA 1FUUA 2BFMA 3DV0B 3R3WA 2QN3A 4IJWA 2YWXA 2I1VB 5ALKA 2FGJA 4PNPA 1JJFA 1M1ZA 4H7JA 4KQWA 5JFOA 2XBLA 2XIQA 2O4UX 2QXYA 5IYZB 4PO1A 3L0YA 5JAUA 1NZDA 1ZD8A 3QU5A 3I5XA 3IKVA 1NAHA 3CLSD 4YRNA 2HF8A 2WF8A 1FDOA 4ZI3A 1W25A 1SG0A 4D79A 4KRYA 5EEHA 5I45A 1QE3A 2VP3A 3D59A 4EG5A 3IPCA 4ZODA 2L18A 2C78A 3FTFA 2BLNA 1V35A 1NXTA 1UDAA 1VB5A 3M4ZA 4B34A 3V8NA 4HL6A 2OGUA 2DWPA 5CW2A 1E3EA 2MINA 1Z8DA 5DNDA 4E5SA 1RAHA 4RA9B 2ZCJA 1VKNA 3PUKA 4FYMA 1XB2A 3GWZA 2Q1UA 2XQGA 4FZJA 3ONVA 3IUYA 3OTHA 4DVGA 4XWYA 5JWOA 3OO0A 2E5LB 1DWQA 5B58T 4IJMA 2FCRA 2HEIA 5EFOA 3H5WA 4CKWA 4NNOA 4C1BA 1DDOA 1GFWA 2QRVA 3FN4A 4M0EA 1OH8A 3QOFA 5CX1B 4C7OA 2R6DA 4QYIA 4EARA 1MRNA 5IW8A 4O08A 3HR4A 2Z1DA 1UJ4A 2GGSA 2JDID 5DNCA 3QIVA 1R8QA 2FZGA 1CQIA 4AICA 3ONNA 4UFNA 1UANA 1X38A 2CYAA 2Z2JA 3QMPA 4MTLA 3UTDA 2G9QA 3AVQA 1AKNA 3JZMA 1KMCA 5EIBD 5F3DA 1XXLA 4X1IA 1THZA 3WC4A 1GAEO 5B12A 1EVEA 2QKYA 4S04A 1ZKMA 2JGLA 2AIRA 3DM9B 3E8MA 1GG8A 3A36A 3IP5A 5KS2A 4IIUA 4MDFA 2HQOA 2A9OA 2RGCA 3TK1A 2RI6A 2IEYA 2C59A 2VXCA 3FOFC 1IQRA 2PY6A 1QUFA 3AP3A 2ZP1A 3O4FA 4IHQA 4H77A 5THXA 2VP5A 3VH1A 5JSFA 4ER3A 3FSGA 4C5BA 1UXOA 5EMKA 1MEEA 4CR7A 1DBVO 1UIRA 1H8EA 3D4NA 4M7PA 2HDHA 2J9FB 1F0PA 3DBLB 3JRWA 3NHUA 4HB2A 3OQIB 2F17A 4LSWA 3UK7A 4L4SA 4CHTA 5B4TA 9ABPA 1EVLA 3EQ2A 4QUHA 2E87A 1RT9A 1QGYA 2I62A 2PGJA 2V0GA 3IC5A 5LQNA 2J3MA 2F64A 1YIOA 2I6UA 4TWZA 1QU2A 2QD4A 2H7VA 4E6PA 3HKBA 4ZYWA 2B92A 1XYGA 2ZB8A 3AVWA 3SZUA 3FMIA 4Q4JB 1ISMA 3WNVA 3I12A 4KXYA 2B1GA 2XSZD 2NUBA 2II6A 3ROFA 4UC0A 1XI2A 3QXXA 4B3CA 2EF1A 1Z37A 1W0JD 5KSWB 4TLDA 5E4FA 1ML4A 1INLA 4IMJB 4JVSB 2CT8A 3ODGA 2O1WA 2UXCB 2Z9DA 2WZCA 4G4GA 3TW8B 3MLEA 2Y1FA 3LWBA 4QPCA 4RHEA 3R7WB 5JSUA 4PLFA 1VIYA 3TR0A 1L8LA 3HDJA 4BLQA 3BM5A 2I2CA 5CDFE 1M2HA 5JH7B 2AUTA 2VQSA 2XE8A 1B16A 3N6RA 4BDTA 1I51A 3NHJA 2C04A 3RIGA 2B8TA 1NULA 2QTGA 3N6XA 3O4HA 3D8TA 2G9NA 1G7RA 2L69A 1H66A 4CCYA 3UFXA 3PK0A 2PBRA 5C81A 1JLSA 2FNAA 4U00A 5JNVA 1N3BA 1RMTA 1E4OA 2Y1WA 3ZWCA 4D3SA 4YP9A 4DCMA 5IBCA 2BR3A 3TUJC 4WKNA 2ZITA 4LVCA 5H5JA 1WEKA 3O9MA 1CJKC 2ID8A 3RS0A 3M82A 1ECPA 2PL1A 3SZMA 1MBZA 4HDNA 5E4YA 1PGJA 3RRJA 4Y1FA 2IGTA 1ATZA 4JU8A 3W05A 2OILA 1E0KA 3EIOA 3GMDA 2IF0A 1EFAA 4DBZA 4PSDA 3B2QA 3QY0A 3FA2A 1C1XB 2WTUA 3ZS8A 1IUPA 1ZH0A 2N9UA 4RYDA 4F5EA 1G4UR 3BK1A 4UD6A 1P5RA 2UYOA 3KXIA 2FI1A 3PL5A 4PTZA 4NNJA 4RKEA 1QS0B 4V2IA 3T61A 1ZINA 4JBIA 3PDJA 1OPXA 2O0MA 2JLBA 4DCJA 3EXEB 4GXRA 4UNNA 1OXXK 3HJGA 5JLJA 1GCAA 2POCA 1CQXA 1JECA 3CE9A 4Q4AB 3ADBA 4M3NA 4DYHA 3N0TA 1C1DB 3DZKA 4I55F 4EEXA 2VO1A 5AW5A 2REOA 1VCOA 5ESWA 4DA8A 5TPWB 1AIPA 4QD3A 5FAXA 4D80A 1O89A 2QU7A 4PCLA 5JZVA 1YB5A 1H0SA 1XWFA 3B3JA 3MOSA 4FTWA 2FRDA 3NC4A 4DABA 3AHGA 2F9FA 3PJGA 1CLEA 1Q21A 1R0XA 4P32A 2R7NA 4GZ6A 3UMBA 3JWPA 5B3JC 1V4NA 1T1RA 2R96A 5BN1A 2EFCB 4PFSA 3SSMA 2CUKA 3U7RA 3WBBA 4C7XA 3DMHA 3T7EA 1NV8A 2A9QA 4MLCA 1Z0IA 3AH8A 3S0JA 1BA3A 3OFVA 5ER9A 5KHOC 2C5AA 3GG2A 4NYMR 3RLIA 3JPYA 4N5LA 4EGCB 2IYNA 1DQNA 4J90A 4MMZB 3DOHA 1DBIA 1SU4A 5K8UA 3B6JA 4R8VA 3A14A 1KEUA 3D31A 1G5FA 3G0IA 4L9SA 4RPGA 1XZCA 1ABEA 1WVGA 2DSNA 3TEJA 2XEDA 3C98A 2WB2A 1CTQA 1I1NA 1MTZA 3TB6A 2X7HA 3OQBA 5CW1A 2KLBA 3OM0A 1Y4SA 4OXIA 4RANA 2V3WA 5LYJF 1KPHA 1I36A 4N0EA 3U0VA 4AMGA 1NE7A 3AR7A 4ALIA 1FRVA 2PKCA 3PHGA 1MZVA 1XGKA 3FOBA 3OLWA 1FLNA 4KGVA 1OF1A 1W73A 4RJJA 1DTSA 2XV1A 4DPMA 3I6YA 4OM7A 4BTLA 1JG4A 4ZYZA 2FG5A 1Z5ZA 2V1XA 3TEFA 2WMYA 3JVUA 1L5KA 4BKPA 1LDNA 1YOVB 4NCAA 2PJZA 3EYAA 1MV8A 3F9IA 1OY1A 2C8KA 4Q9DA 2B1RA 4RGBA 4J7AA 3OZIA 4R8KA 5C7IO 3UHAA 3LQQA 4UOQA 4DC1A 4P80A 1NKTA 1LUAA 1JVSA 1EH5A 2DWQA 3NHKA 4REMA 1SAYA 4ZO7A 2K2WA 4JITA 1WE2A 5DIFA 1GPAA 3KCQA 3FROA 3QJGA 3TVYA 1XK6A 2J5QA 1DVRA 1GPDG 3S40A 3DD1A 1N2JA 1U3UA 1RCFA 1U1GA 3ME5A 1NDQA 1BGXT 1A2BA 4JZKA 3KO8A 1E1QA 1EQAA 4Q1CA 1KYTA 2V74B 4L16A 4G2NA 2DR0A 1GZVA 3R74A 3QQ5A 4H1TA 1ND6A 1WNFA 4KIGA 5ILOA 1YQDA 1NQXA 2WM3A 2YOGA 5BYBA 1JU4A 2ZYTX 4D4MA 4DR4B 4Y3UA 5DW0A 2IEZA 2BMWA 3JWHA 4K9QA 3QLJA 4IF4A 3RYHB 2CNDA 3WAJA 2AW5A 1VCIA 3W90A 2PSFA 3FYSA 4IKOA 5DTQA 1VC2A 1IMOA 1BX3A 2ZSDA 3IMCA 2VP0A 5HWSA 2L0XA 3IHKA 1LD3A 3C5VA 5KNCD 3DE7X 4NP6A 4UM7A 4E03A 3HBJA 1JB1A 4PRLA 2YN2A 3KD2A 4DLXA 1E2GA 3A3YA 2PXCA 2GBPA 4O8ZA 3A8TA 1BW9A 5LU9A 4DCOA 3JQBC 4F21A 1Z8NA 3QVMA 1EFPA 1NQAO 3RAEC 1R00A 1Z6ZA 5JJCA 4PYJA 1KH1A 4TTTS 2Q3HA 5CLGA 2NVUA 3ENQA 1Y8RA 5KTSA 3BC1A 3I52A 1O95D 2Q9AA 2QTMA 3KSRA 2FHPA 4Q9KA 3UV6A 1YZTA 3IT2A 4ENQA 3OVMA 1EDDA 2DKNA 2PANA 3I8XA 1VECA 1WAMA 4LSGA 4YRKA 4IYRA 3REOA 1M2GA 4AKGA 4U39A 4OAOA 4YJHB 1WCYA 2JG3A 2PO7A 4J03A 2QX7A 4Q03A 3GLKA 5FRDA 3H8SA 4G84A 3WP1B 1UMKA 3Q6MA 2FYTA 3ZLBA 1DG3A 4DUGA 3P2MA 3UJ7A 2PPLA 2ZYSA 4Z99A 4D9CA 4YP0A 1IRXA 4ZYLA 3P4UA 1WMAA 4DV0B 3KYDA 3ITKA 4CNBA 4R5MA 2NQTA 4KR2A 4IEFB 4C87A 5DF1A 4H3KB 2DHEA 2HSEA 4H0CA 5IWAB 1ZIYA 2ZRJA 3H9CA 3PZRA 4GUAA 3FE2A 2GRAA 4OGLA 3T4UA 3CKKA 5TEWA 4HN2A 4DRYA 1XAGA 5CGZA 2I78A 4XYMA 1J6UA 1ZD5A 2ZWMA 4NWIA 2WJPA 4DL9A 4EY6A 1XQ1A 3H5NA 4BRUA 4TUYA 4PZYA 1OLUA 4DV1B 3P52A 1QVAA 1ZWLA 3DLAA 3IBGA 4L0MA 1KZ1A 3IAM1 4DLAA 2GJAA 4BNWA 1E6CA 4C7OB 1AOXA 1E64A 3R76A 3TOVA 1J97A 3HGTA 1XF1A 5FP0A 2I6TA 3T9EA 5JDIC 3LX5A 4EECA 3E18A 1ID8A 2RGWA 4QPPA 1DRWA 3R6TA 2N0SA 2VJAA 5D6NA 1R0YA 4PR3A 3KUCA 5L53A 4V1CA 2FZ5A 4DV6B 5KWEA 1VJ5A 2XDQB 3FMFA 1Q7GA 1RNLA 2QVLA 1DFHA 3LPCA 3E9EA 4DDMA 1G3MA 1S5PA 3DEFA 3JQ9C 3CV3A 3G85A 1R4MB 3L8GA 4I4TA 2JZCA 3HJCA 3U4AA 1GPUA 1BQ3A 2R8RA 2XOKD 1K4YA 1HQKA 1XU9A 4YQFA 4Z8XA 2C2BA 4DNXA 5EJ6A 3NTLA 4D6XA 3ORRA 3EBLA 2Q4EA 1KYQA 1NVWQ 4PCUA 4N7JA 4URZR 1ULZA 2ORWA 2V3CC 2N3ZA 2PKEA 3EVAA 4ID3A 4LF4B 2CHVA 2WWXA 3CNNA 1D2CA 4I46A 2H52A 2ZBFA 1V5IA 3IURA 5KQGA 4DA7A 2JJ2A 4MW6A 4XH9B 4CL0A 2PGLA 3GROA 2Y71A 3I2FA 4NJEB 3DTYA 4RA6A 5LU8A 221PA 4I50B 3TMAA 3O9VA 3Q15C 3U7FB 2D00A 2X9LA 4AXBA 1WP9A 4V2UA 4Y6GB 1Z7WA 4I8XA 2VT6A 3DL0A 3K16A 4PCVA 3MSXA 4FX5A 1BMFD 3FX2A 5AWFC 4ZRNA 1F7VA 2B5VA 1V37A 2POQX 2XMZA 2AD1A 4EMTA 1YTLA 2C5HA 3HHEA 2LE0A 3NXSA 1H4SA 1ZRSA 3EH1A 3I1IA 2GHTA 3G9UA 2JD2A 1KK0A 3TE7A 4FYJA 2JGDA 4UVHA 5K0NA 2ZTHA 3O2JA 3C3KA 1ZW1A 1AMNA 1B76A 1CFZA 1XRQA 4B76A 2QVXX 5K45A 2JI9A 4FJ0A 3A1WA 5KEIA 2R751 2GZMA 3VDXA 1U11A 3RJZA 4YRMA 1KQFA 2TRSB 1RQXA 1QF9A 4S12A 1C5KA 4LMAA 4CR6A 1SUBA 5UKDA 3KKPA 1KI2A 2I8LA 3BIWA 1V6CA 4RJKA 2LXNA 1T36A 3AWDA 4GOLD 2WMDA 2NUAB 3T99A 3ODPA 3NVDA 3DE3X 3OCUA 4KMMA 5H1YA 3CJQA 4OUDA 3EWAA 3VR6A 3Q8LA 1XU4A 2PUVA 3VR4D 2E49A 4M0DA 1KFJB 4ZYXA 2C4KA 3NRJA 4ZCRA 2D3TA 1I24A 1YWGO 1V1MA 4QJ5A 5DM60 4Q4CA 3I04M 1UFQA 2FUG6 3ABZA 1U2SA 1ZUNB 2P5YA 1A8SA 4BFWA 4TTVA 5D01A 4JUIA 5HJEA 4A16A 5C1DA 2EJTA 5JS2A 1U8EA 2G1KA 5BNTA 2ZS7A 5BY2A 1ODTC 4IEIA 4MVJI 1OREA 2RHJA 3GGSA 1VCHA 4QULA 4RKRA 2XCQA 3F4BA 4RIEA 3RSHA 3K2IA 4W6ZA 3IDAA 3UMFA 4BMVA 5ALVA 1EIWA 1JEAA 2C1EA 1JIIA 1NXPA 2ZATA 3FTPA 4LV8B 5JFGA 1AUOA 3C3EA 2J3JA 1KXZA 2P1RA 3MLBA 3BMQA 1Z12A 1F0KA 4CKEA 1BGVA 3KJFA 3E61A 3A6JA 5KTRA 4EFNA 1QM5A 2AG6A 4P5DA 1C8BA 4UPDA 5IP5A 1QG6A 3DVSX 1FX0B 3NOVA 2VZEA 1RWOA 2CMGA 4E30A 3AERB 1YKFA 3LDHA 1TPZA 3C8UA 3FHJA 3C15C 3TGPA 1Z4NA 3L7JA 1FFGA 5JT1A 3K9FC 4V39A 4AL4A 3IH5A 3AL2A 1SD1A 4IVRA 3WLAA 4UEWA 1H0KA 3HBLA 2CEAA 5JMWA 2JLZA 2XHZA 3FMGA 4EG3A 2VDVE 4R2JA 3TLYA 5BOSA 4H0NA 3SYKA 2W8ZA 4CQNA 5LKRA 5JYDA 3LLMA 1CUYA 1DIGA 1N2IA 1PGQA 3KU4A 3VKWA 4QXOA 1SO8A 1YUNA 2GEKA 2ZYDA 4AZ0B 4AZWA 4GBGA 3DBHB 1WRBA 1OFVA 2VOEA 4B6GA 1VI6A 2DPGA 2QD1A 3QWIA 4LXTA 4EYSA 5THQA 3ZVKA 2G4CA 3ENNA 4HFJA 2Q6OA 3D5QA 1U7UA 4H7PA 2QRJA 4IGAA 4KAFA 1V5WA 3AEKB 2BCJQ 2YW2A 1P6UA 4QHSA 3WLEA 4ARAA 2VQDA 4R1QA 1EDOA 1PDWA 1Y1KE 2C7BA 2Q5FA 3ECCA 4K9LA 3CVVA 3F73A 4FYYA 4A6PA 4Z54A 3OLQA 3HXTA 3ZHQA 5CHEA 4AJEA 3NDJA 3BH6A 3JQ7B 3SBXA 4FB5A 4TLMB 4JXZA 4QGFA 4LJSA 2B36A 2YXNA 3GYGA 2NXNA 1QH1A 1OSNA 3HQ4O 4U6SA 5IJZA 5JJIA 4HH1A 1X6VA 2E85A 5C7LO 3NAQA 1NRWA 3T5AA 3O3NB 4EG8A 1L5FA 2B8EA 2VPIA 4MV7A 2PKRA 4JBNA 1T5HX 4UUPA 5AVWA 2CXUA 2WLTA 4QODA 2J0UB 5F3WB 3FFAA 3OKFA 4OQFA 2EQBA 3ZE0B 3KPYA 3F8TA 3M5PA 3P20A 4TV9F 2KWIA 2AJDA 2GYWA 5I6DA 3WQRA 1OYOA 2X2FA 1O9GA 3IP9A 1CE8B 2HREA 1OBCA 4IDBA 4I7EA 1N2CB 4LVNA 5H59A 4YCSA 2V8OA 3G0CA 2ZRLA 5DPMA 1IXSB 4GEKA 3VNAA 4BO9A 2C4VA 1JHPA 3IHTA 2VA8A 1HT2E 3DOCA 1E6KA 3AR9A 1ADCA 3IKJA 1JHYA 3GPIA 3RRZA 1ZO8A 4JODA 5AM2A 3TSCA 3G7NA 4GG1A 1T3HA 4JL5A 4AJ2A 2G8NA 3PWTA 2A9PA 1IJEA 3KZKA 1TMYA 5ALYA 3T38A 1E8NA 2KSQA 3SC4A 3DE6X 1U6JA 5AKEA 1QG2A 3VBEA 1NJ8A 2V6FA 2HF9A 3EQ6A 4FZRA 4JB8A 2XCIA 4QOEA 3UT5B 4ZGBA 2ZR0A 2QTBA 2IKSA 1DZ3A 2E4XA 5JTUA 5CVJA 2ZXFA 4EQ6A 5HJ2A 3NVKI 4KXWA 5DXFA 1RYFA 4PBSA 2YIDA 1Y8ZA 6GPBA 2HIGA 3MIZA 3EGCA 1D1TA 1R4NA 2I6QA 1KL7A 3BULA 3ITNA 5DKFA 1UINA 2NYAA 1AZTA 2DWCA 5I7AA 5FBVB 1YF3A 2XUOA 3ZBUA 2VWQA 4EUKA 3W0LB 2WV9A 1FSGA 1YR3A 3B85A 2J7KA 2AR7A 3KOOA 1IBSA 4MKHA 1KP2A 1X87A 3R24A 1O4WA 2VDRB 4EQZA 3WADA 3RWBA 5AVYA 1XKQA 5AJXA 3R0VA 4LF8B 2ZI7A 3EG9B 2DTEA 1OIVA 3QUAA 4GXTA 4Y2PA 3AVUA 2FWAA 2HY7A 3FZNA 2WA2A 1F2VA 1J39A 2PMEA 2WICA 3O8RA 2O19A 1P39A 1YH3A 3K2QA 5SV2A 4X54A 1F0NA 1YDWA 3QVGB 4QGAA 1ZJZA 1HL3A 4MAMA 1ZOPA 4EJSA 3STVA 3HCNA 4YAOA 5FWXB 3TSAA 4G4SO 4JOQA 3HG7A 3MGBA 1BVHA 4MV6A 3W7VA 5FPYA 1G9XA 1VSBA 2OHJA 3WLHA 4DAOA 5A0TA 1KERA 2JNWA 1TK2A 1E77A 1R8YA 4M1TA 3OO1A 4I9GA 3ZD7A 3EXIB 4JL8A 4RORA 3U4CA 2X5XA 2IQIA 4GU5A 2BEVA 4R2XA 5AKYA 2UUOA 5K1ZA 4M9ZA 4ZTZB 2N75A 4LRUA 1JKFA 4WBNB 2XCUA 3LK7A 1YQUA 1EXDA 1GU1A 4JLBA 2BCEA 1OV4A 3MILA 4YGYA 3T7IA 3BZBA 3LCCA 2VATA 4LC9A 3SQNA 1GQFA 4OHUA 1ADBA 2F3RA 1T3SA 5DLPA 3T35A 2A84A 2M1ZA 4L07A 4CQMB 5BW5A 3IOCA 4MJLA 3OIGA 4HWGA 3JYLA 2JIOA 4JEUA 2Q5CA 1XMJA 4J6FA 1UPTA 4N40A 5LKAA 2NIPA 3KYIB 3MWGA 5LP6F 1L4NA 2P8JA 3A6DA 5FB3A 1UQUA 1CG6A 5KMGB 6ADHA 5BQPA 4N6GA 2IPXA 5CDHA 3ZV7A 1ZM2A 2ZBQA 3HCCA 2WD7A 3WIVA 2J46A 1GR0A 1XZIA 1UXGA 1USIA 1XALA 4DLUA 4IAOA 5DK6A 4W99A 4EO7A 2RGRA 1G55A 3NONA 2F3QA 3RROA 4GGMX 4ND5A 1EX9A 2J67A 3HVHA 1IG0A 3UC5A 4CDMA 3BMCB 5C8YA 5KYKA 3B5EA 1ADYA 4S1TA 1XNQB 1SVNA 1PBTA 3PFBA 1WHSA 1TVEA 2WABA 4HUJA 3T5PA 2YXDA 2CV1A 1XZ8A 2GESA 4L8LA 1O5TA 5FNVB 4PYIA 4BEJA 2HEGA 2YFHA 4PLTA 1K63A 5EUBA 1TJYA 4QKQA 1HE2A 1VYVA 2LZ0A 4HZGA 2DR3A 1ZZEA 2I9KA 3AZQA 2YIMA 5L8VA 2RE8A 1OYYA 2GCIA 2GCOB 4RACA 1J8MF 4ZYUA 4M8NE 3DGFC 2LIVA 5I5EA 4ETWA 3ZLJA 2O1SA 1U65A 4KQHA 4PX2A 3ZBPA 2G70A 2ZQZA 5EP4A 4QUAA 3HP7A 3KB2A 1TC1A 2XRYA 1PD0A 2Q50A 1LPNA 1QGOA 3GIDA 2FR1A 5DHUA 2QRMA 5A5EA 1KMMA 3V33A 4GL4A 1Q3TA 2D1TA 2HHCA 1M6NA 1KYYA 2WTEA 3DE0X 3IXMA 3N3BC 5ALLA 3HJUA 4M1SA 1Y5IA 2XEXA 3LKZA 3FRIA 4HX5A 2H9AA 4MVJG 2G0AA 4Y9DA 4ZCLA 5C53B 1K08A 4BB9A 1Y4DE 4JOSA 3MQ2A 2PUBA 1PR0A 2ZZNA 3UOAB 1G63A 3OJCA 3DT6A 2Q3FA 1V9LA 1SQFA 4GWLA 4DSNA 2ZIWB 3D3JA 1M2OB 4XEHA 5E4JA 3AFNA 2IPOA 4NDZA 2C9CA 3E7DA 2C5BA 3E22A 3PSAA 3EARA 1ORRA 4MQMA 1U2ZA 3G5UA 3I9OA 3S2YA 4R16A 2C95A 3DLBA 2BHRA 1HEIA 2HSWA 3K0FA 3NU1A 5HG0A 4CTMA 5AM3A 5DRYA 4QQFA 3ZU6A 5FDFA 1EAMA 2H4WA 5FWNA 4Q3OA 1CY1A 1L4EA 1I7NA 1TZCA 1XZKA 4GVXA 4CQLA 3IL2A 1KVRA 3D3NA 2IV3A 4L02A 3ZJYA 4KE7A 3PGJA 1GNLA 2ODQA 4RSHA 1M5RA 1NPYA 3M2PA 4O0LA 4EKYA 5A4DA 1JBKA 1JT2A 1KFBB 2WE7A 1IM2A 4MKFA 1J2EA 1P74A 1OI4A 2GLTA 1AVTA 2Z4SA 2QSYA 1VXRA 2VSQA 3OPXA 3QEOA 1G5HA 5SZHB 3RKSA 5KVCA 5AXAA 2YMQA 1SMKA 4WCDA 1X1DA 5IHXA 4M36A 3SX2A 3BRSA 5KBYA 4M2LA 2XKJE 2I4RA 1XRRA 5BT9A 4G5XA 2BD0A 2PUTA 1N5MA 2JEZA 3WOVA 4A5OA 3I92A 4IUCS 1LI5A 4JASB 4QU5A 1LVGA 4EM6A 3DDUA 1N7JA 4X5OA 1DB3A 4WIAA 4KR6A 4FW9A 2OMKA 3V8MA 4BEWA 3WL5A 1LXCA 1KYXA 2GOYA 2TMYA 4G5QA 3HABA 3UMJA 1CFJA 3OT1A 2IDMA 2CJYA 5A1JA 1JS1X 1RCTE 2ZRQA 4I2NA 2FW8A 3BHIA 3MB8A 2ZU0C 4JNKA 4MO9A 2GO1A 4Q47A 1Z62A 4BGEA 4U7HA 3NBZC 2PH3A 2RKBA 1FW6A 2V4ZA 2GDZA 3L01A 3ULKA 1GPKA 2X2OA 3EGVA 2C4HA 3A9VA 3QXHA 2GHRA 4WLEA 3TZHA 4DLZA 3K1JA 7ADHA 3RJMA 1G2QA 3FMVA 4O59O 4KQCA 2M6RA 2NUTB 2QX9A 1HSZA 2P3SA 5EERA 4ZDJA 1CY2A 1OX5A 2FTKE 4QOHA 2QAIA 1HDCA 1OV6A 3D5TA 3CH5A 2IF2A 5CLQA 4BIMA 5D51S 5AW7A 1HLPA 2I7VA 1QUEA 4D1YA 1UJNA 1USWA 3OPQA 4L15A 4B2YA 3FYHA 3LBHA 1HYEA 5E0KB 3HJFA 4HUQB 2J87A 4U3JA 2RKOA 5CG2A 2YHIB 1YAJA 4JGGA 5CNMA 5CB4F 1C3VA 1CY0A 2YYZA 2GNAA 4NG5A 5AICA 1K7YA 2FZKA 4WN9B 1E9VA 1YTUA 4GRAA 4ZOCA 3HA7A 3EXHB 3DPIA 4FDMA 5T41A 4BKMA 3EGEA 1N6PA 2LTAA 4L75A 4UUMA 4W7SA 2JPDA 3RS2A 4ZOEA 3DSRA 3VR2A 5FNZA 1JNYA 5E6UA 1GKIA 3P7MA 1RCUA 1Z2PX 3U7QB 1PJQA 2OO5A 2CJWA 4FFRA 3X1XA 5A4FS 3RV3A 2PO5A 2ZTVA 3Q9NA 2GK7A 3Q9SA 1P3DA 1D03A 2KM1A 1NMZA 4NY1A 1N7HA 2MU1A 2P40A 1FOEB 3MINB 4MKXA 5T3YA 2JARA 3EVGA 1MH9A 4YRGA 5K3EA 3WAGA 2P2DA 3FPHA 5IANA 3W5IA 1T4BA 3SF8B 4HAXA 1TLFA 5ELMA 2CDAA 5DI3B 1Y3FE 5CT9A 2XRZA 2P4QA 4Q9LA 5HKKD 4KFTA 5LMNB 5AHOA 1Q0RA 3FNRA 5KYWA 3UMMA 1HC7A 1UEJA 2CLMB 4ZT6A 3LDUA 3QBVA 4OD0A 4CT4B 4KR7A 4YB8A 2IC5A 2YZKA 2BEKA 1DAIA 1C0IA 4Q1FA 2JHFA 2W6ID 2NO9A 1AO3A 3GFTA 4AIIA 2IH2A 3ILHA 1AS2A 3C1UA 4OIMA 5JISA 1T6NA 2VBCA 2AK2A 3K0KA 2H4XA 3WR5A 2HMVA 3A6FA 2C7GA 5BORA 5I7UA 4BE9A 1Z4OA 3VH2A 1DJPA 1FMCA 1TYAE 4AY6A 1U31A 2NXCA 5HW0A 5EE9A 1PZEA 2X5KO 1HNZB 1GQQA 4I4NA 3EFBA 3WLLA 2CF5A 2ZIXB 4WUTA 2ZAMA 4E94A 1GG5A 4KHZA 4R40A 1V8PA 1RRFA 5THKA 2WKQA 2Q2NA 4D4IA 2X0EA 2Y8EA 5ECWA 2WPDA 1FTYA 3ELUA 4OM8A 5H9VA 4EW1A 3PDUA 1QDUA 3OTGA 1HZZC 3AIKA 1SKAA 4LHEA 4Q7JB 2ZU6A 4PGAA 1TMKA 4GOXA 2QJFA 3HGMA 5DLQC 2GF2A 3VNUA 4BP9A 5AM5A 4LX8A 2QTFA 2FV8A 3CNEA 4ZCTA 1P0FA 3FCYA 4O33A 2PL9A 2WAXA 3AY6A 2HYIC 3RTCA 4AJHA 4DJAA 4CEJB 4IIDA 1VBFA 4D25A 4LQDA 1KMNA 2OB2A 2X4IA 3PHCA 4HOYA 1GG9A 4CV0A 4OI2A 2Y0PA 4WKOA 2J0SA 2H18A 1SOMA 4ND8A 3CVXA 3KSZO 3L7MA 2WKSA 4OCZA 4B85A 1X7XA 4ZVVA 1RRCA 3HB7A 1YRBA 4MA5A 2FPUA 3LGXA 1JFFA 4B32A 1W75A 3O4GA 2PGNA 3ESRA 3FWPA 5BN3B 3OQMA 1SBZA 1WO8A 1Z6XA 1T9AA 2P2GA 2OBXA 4B7UA 2FXIA 1FP6A 3AESA 4LHWA 1YVUA 1BXGB 2R1VA 3GN2A 2C4UA 2FPIA 5BYAA 1PLLA 4F56A 4FZVA 2H1RA 2ZJ7A 1XMXA 2QPAA 2OV8A 3I9JA 2VYND 4XD7D 3WIDA 5HA5A 1Z82A 5CCBA 1NY6A 2Q1SA 5K7SA 4YMSA 4R2KA 5J2TA 5B4UA 4QLBA 4C6TB 3D0KA 1NVBA 2ONKA 1OKKD 1NF3A 3AHEA 3D7KA 1EB9A 3ZW8A 1TMGE 3E1KA 3GLIB 4YY3B 3AKZA 4G0WA 1DFGA 1CDZA 5SZKB 5AXCA 4MYRA 1J22A 1CUIA 2BV3A 4M4SA 1DJLA 1IHPA 3PX3A 1VHWA 4FCWA 3U9LA 1T8YA 2ZUDA 4BO7A 2I6XA 4DLVA 1XOIA 1NW6A 4NEHB 4RFSB 4DIDA 5JXHA 4M1QA 5E0OA 3FYCA 2BBWA 3HJRA 4GOMD 16PKA 4QLOA 2EEPA 2GXAA 1BCSB 1QF7A 4BO2A 4L8VA 4TMYA 1FNCA 1AZSC 4ZFNA 1O6GA 2V6IA 3LKVA 4AN4A 4YV7A 4EJ2A 2BFDB 1L5VA 4S1NA 3WMXA 5C80A 1MZPA