3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
3LDAA 4CF7A 5UKDA 1H65A 2GBLA 4FN5A 4D4LA 3BB4A 3ZD7A 3AF3A 1U99A 4TSFA 3LY5A 1J2JA 5JRZA 3JZAA 4TLCA 4BFVA 4P4SB 4DLXA 4B34A 1Z0KA 5TARA 5C46F 1E3MA 1E9DA 4AKEA 4WVFA 2TMKA 3GLFB 1R0ZA 2W83A 4RZ3A 1GL6A 5FBLB 2AX4A 3WP1B 4F92B 2CLCX 2HJVA 3HJNA 1CLUA 2HUPA 3N5CA 4XTCS 3EAQA 3MD0A 3RAPR 1AM4D 3REGA 4PZLA 5JS8A 5JI3E 1OF1A 4B3XA 2ZS7A 3GLGA 4H1UA 1P73A 1P4SA 1ZU5A 2KBFA 3C7KA 4B73A 3MLEA 2P67A 3CRQA 1HV8A 5LD2C 4RKEA 1L4YA 3MAAC 3BS4A 4LJ8A 1R5NA 2R65A 4EDHA 1P9RA 3QKUA 3K70C 1PUIA 1Y3AA 2QTHA 1FTSA 3H0KA 3VU9B 3KQLA 5BXQC 3KJHA 3H4MA 4DDTA 5J40A 4XWOA 1NLYA 2J0UA 2JGNA 3UK6A 2J7PD 5BQ5A 1ZM2A 3QKSB 2NO7A 1RJ9A 4MGKR 2PH1A 1Z83A 3PEUA 3AVQA 3TE6A 3AM1A 1XFAA 3SHWA 2VP2A 2CE2X 1ZP6A 4R9UC 3B5JA 3L82B 3W8NA 3B1XA 4C30A 3NWJA 1N5LA 3AGPA 1GFIA 2IYTA 2IK8A 3CRVA 3QG5A 1ETUA 3GLIB 3QBTA 2BMJA 1W4BA 1TU4A 2LCFA 2I3BA 4LHXA 2C2HA 2ZJZA 2CXXA 3TH5A 1IN8A 4O0MA 3EC1A 4A36A 5AR1A 4OI1A 5HE8A 1II8A 3WYFA 1DTSA 4V0KA 4GL2A 3QBVA 3NVAA 3SBEA 4Q4LA 4IKEA 1MO6A 2H57A 2ZJBA 4C0BA 5BW8A 1P61B 3LQRA 3ZH9B 2ZPTX 3IO3A 5L3QA 2ZR0A 1G7TA 1RIFA 4CRWB 1F2UB 1L4UA 3C5HA 3IGFA 3R20A 4HZUA 4W5HA 2FFAA 4DEXA 1P2SA 4NYIQ 2HCBA 4JYBA 4JKYA 5M04A 3KQUA 1KO8A 1SKQA 4NU0A 4CYMA 4N0DA 1ESMA 2GF0A 2W6IA 1VIAA 4M9SA 1HUQA 1VG9B 4LZZA 1E2QA 4N3NA 4NCKA 4A8JC 4DJTA 3E1SA 3CZPA 1DOAA 3MMPA 5HCNA 4MITA 5JWOA 2IX3A 1IJEA 3AQ4A 3RS4A 3PUVA 4YMTA 2O8DA 5DSZA 2PEYA 1RKBA 1UF9A 3KJEA 1ZMXA 2R6CA 5FBWB 2D2FA 2IUTA 3AKDA 1KY3A 1XMVA 2XJ9A 2F1IA 1NMXA 2IEYA 2Z4SA 3CKLA 3P26A 5KDLA 5TDHA 1XWIA 3BXZA 4LY6A 4C0AC 3IPYA 1VDZA 5FOWA 2GZDA 2WWXA 1PV4A 3AVVA 2EW1A 4BLSA 3NDBB 2QT1A 2ANBA 1SHKA 3QXCA 2IS6A 4Q1DA 1D9ZA 4UNQA 2IUUA 3UKDA 1KDOA 2G0NA 3A4MA 1LTQA 2LKCA 4D82A 4DSNA 1F6BA 4Q1AA 1DAMA 3VKHA 4K8OA 3IO5A 2C03A 4AD8A 2E1RA 3T12A 3SDZA 3P4XA 1RE0A 1HURA 3SJBA 1JBKA 4HLDA 4KVGA 3K70D 1DAHA 1E6CA 2WSMA 4XSGA 1WDTA 2HXSA 2ZRNA 3GLHE 3T1TA 3D31A 3R8FA 3PEWA 1OW3B 1QG4A 1X1RA 4UXJA 3O8BA 5B64A 2ZAOA 3EIEA 4Q48A 1L8QA 2J0UB 2KE5A 3I61A 1QHIA 4Q66C 1XTQA 2QQ0A 4FMDF 4LHYA 4HDCA 3WRXC 2HYDA 4JBXA 5DGXA 1KIMA 3KQHA 2F43B 4JIMA 1DAEA 2D4HA 3B1YA 3DMDA 2OZEA 2IYYA 4TL8A 4TYPA 4OHXA 2P5SA 4P32A 5EP4A 3LBHA 2D74A 4MDEA 2REXB 3QUSA 2ORIA 1G6OA 4CEHA 1KO7A 2W2VA 3SI7A 1OH5A 4BRWA 1E4YA 2PX0A 2BJWA 4M9XA 3I3SR 1BYUA 2VSOA 1N5JA 1T91A 3IIMA 1JJ7A 1A82A 2ZRAA 2P5TB 1EXMA 3CWQA 3MFYA 1AJEA 1GKIA 3QI2A 3LVQE 3QPWA 2WZQA 1G7SA 3WYAA 1NG9A 1SVMA 3SJZA 1ZIOA 4PSVA 3CX7A 2J9RA 1T0HB 3FYHA 3GMTA 2C96A 2UZIR 4Q1EA 2JDIA 3MWYW 3DO6A 1F2UA 2ZJYA 4RKFA 3QF4A 1LS6A 1G8HA 1MH1A 2OBMA 3CF2A 5G3YA 4DZZA 4V0NA 1YZKA 4KFSA 1BKDR 2DHRA 2QMEA 2QT0A 1CRPA 3AB3A 4ABYA 2VF7A 4V02A 4Z8YA 1JECA 4QGGA 4AY2A 1XEWX 4C4PA 2VLIA 2OFXA 3B78A 2XXAB 2VHCA 2ZRGA 4HDOB 4RJLA 3TAHA 3EZ6A 2GNOA 3GJ7A 1XD2B 2FZ4A 5FPTA 1OH6A 1ZVQA 1KK0A 1X8LA 3KB1A 1XXHB 1N25A 2JAQA 3B9QA 2IWHA 3ICQB 2IYUA 4A2PA 1EX6A 2HJGA 4Q47A 1IXRC 5B57C 1EGAA 5DO9A 3ADDA 4IXNA 1E1QD 1BS1A 4TYQA 1N6IA 1A4RA 3MSXA 2VHJA 2NZJA 4V0ME 2P6NA 1A1VA 4DCVA 2JIZA 1IQPA 1X86B 4LRWA 2J45A 3FHTA 3GLHB 4CEJB 4MGZR 4NE2A 1N6OA 1S1MA 1DG3A 4Q9HA 1R0XA 4P4SA 1JPNA 5BN4A 1Z0IA 2KJQA 1JR3D 3VR6A 2JJ1A 1NY6A 2VRWA 4QXAA 1XP8A 2J87A 2A5YB 2HCJB 2ZR9A 2W0MA 2F1HA 2IEZA 3CH5A 2DFNA 3C41J 3AVYA 2JLRA 5CDFE 1M34E 1P2TA 2ASEA 2C8VA 2MMGA 3EW9A 3BB1A 3PUWA 3QIAA 4QBIA 4BFYA 1A2BA 4LX0A 1E96A 2IF2A 2YINC 4W9MC 4JL8A 3TK1A 1OXUA 1T3HA 1FX0A 4QGHA 4BZXA 1SZPA 2GCNA 5CK4A 1UKZA 2KSQA 3R7WB 5FOUA 5G53C 5FTNA 4Z1MA 3AVTA 2PLFA 3ASYA 2YNMA 1W0KD 4YXWA 3SQXA 4OHYA 5FBRB 1NL3A 4LPSA 4DKXA 2D7DA 4QBHA 1XCGB 2WJHA 1BIFA 4EFMA 4KI0A 4M53A 2GK6A 1OFUX 2NPIA 4QHTA 2GEDA 2NO6A 3G0HA 2ZI9A 4URXR 4JLDA 4ZDJA 1VECA 2RAPA 1NY5A 5AUPB 2ZUCA 1COWA 1X3SA 2OAQ1 3OEEA 3FE2A 5DI3A 2AKYA 1CBUA 1E98A 2WMOB 3TR5A 1KI2A 2CHQA 2H5EA 2V54A 1T8TA 2AD5A 5E95A 3W8RA 1OKKA 4EPWA 1SXJC 2IYRA 1KAOA 2CCJA 4QGFA 5FL3A 4B6EA 4G5GA 4EPTA 2XZOA 2VEDA 3IIKA 3EARA 1RVDA 3U6KA 1GRNA 1NBMA 1F48A 5EQTA 2Z6VA 4NDZA 4JLVA 5C4MA 3RLFA 1KJWA 4BLRA 4F91B 4EIWA 4KJZA 4LPKA 4ACAA 1B0UA 2NMVA 2H7VA 3SFVA 2J1LA 4Q7MB 4LBYA 1CIPA 4TT3A 2AXPA 2XOKA 2J7KA 1E2GA 4E22A 1OXTA 4AK9A 3GEHA 4YMVA 2BDTA 4IVRA 3RANA 3EZ7A 2NPFA 1W0KA 3A6PC 3RS7A 3NTUA 6Q21A 2X2FA 3M6AA 2O8DB 2C95A 3QKRA 2GRJA 4WZAE 3SOPA 2HF9A 3VR2A 3VX3A 2VP0A 1FW6A 3BB3A 4V0LA 3AF1A 2WKRA 1YQTA 3RC8A 1XTJA 1Z0AA 3CIOA 4BZQA 5FUXA 4X8MA 1R8QA 1Z0JA 4KCGA 4OQFA 4URVR 3IBYA 4KO8A 1SKYE 1XF9A 4MA4A 4C0QC 2WWFA 4TQAA 4O3MA 3ASZA 4JLAA 2Z5FA 3SJAA 1P9WA 4TL9A 2Q3HA 2CDNA 1SXJB 4M2LA 4GP7A 3EA0A 4UJ3A 1XPUA 5KNDA 4TMKA 4ILEA 4LJ4A 4I4LA 3U3JA 4B3CA 4TL6A 4DLVA 1Q3HA 1TEXA 4WAUA 4OK5A 5LPNA 3WY9A 3U44B 3B2EA 4TYYA 3UMSA 1K5DA 1VCNA 1JPJA 1LW7A 1HY3A 2FE4A 4ACBA 2Q9CA 1Z6AA 3K0AA 5FR2A 3ZD6A 2G6BA 4E07A 2IA5A 5FBQB 5HR5A 1XPOA 1UKVY 2ZITA 2RGBA 4IDPA 1FPMA 1Z07A 3OE7A 1GNQA 2JLVA 1D2MA 4KFRA 2F43A 4TMWA 1JAIA 3QENA 1IBRA 1OB2A 2OEPA 3HWSA 5FH9A 5JRJA 4WBSA 2V1UA 4GFDA 5DI3B 2H92A 5E7JA 3NH6A 1UKYA 1WXQA 3C14C 3NH9A 2A5FA 5JWHA 3WBJA 2JDID 3FFAA 1OHHD 1W46A 3PXGA 1NP6A 2XNDD 4L4UA 2G1JA 2ZE5A 4TMXA 1Z2AA 3B82A 4NCHA 1XEFA 4LOAA 2JLXA 4JZKA 1VHLA 2IXFA 5EXPA 1VG1A 2IL1A 3QF4B 3QKTA 4BFUA 4YMUA 1FQJA 1U81A 1T3LA 1NJFA 1P9NA 3KTAA 4KBFA 4EUNA 5FTJA 1N6KA 2C77A 4HUQB 3W3ZB 3SFZA 4EJSB 1JXMA 1E32A 3ZVLA 4ZDWA 3UXMA 4E09A 1QDEA 3VNVA 2C98A 1G3RA 1ZUHA 4TTQA 1KDPA 2GBLC 2XNDA 1S0UA 4NH0A 3QE0A 1OXVA 2G83A 2R6AA 1XTKA 3L2OB 5KNBA 1NI3A 1XXHA 2OFWA 1RYHA 3AVOA 4OI4A 1W0JD 1ZM9A 2BEKA 4UXIA 1US8B 1GM5A 1XBTA 2FPMA 3TAUA 3FKQA 2WWIA 4LHWA 1FUKA 1PLLA 4PHHA 3IPXA 4LHZA 4QOSA 5GJCA 3DMNA 4A2QA 4LJYA 4KFTA 3TBKA 3RS2A 3U61B 3UATA 1X6VA 4MGIR 3GLHA 4AG6A 4Q7KA 4CEJA 4RD4A 3WMGA 4FD2A 2FSIA 2HYIC 1SXJA 1GKUB 1QHSA 2VP9A 2XSZD 2F9MA 2D62A 2QM7A 5K8LA 4Q9LA 5GJWC 1QHHA 4JT4A 4QNRA 3RS3A 3QSYA 3TVTA 1YZQA 1NG1A 4O2RA 2QORA 4NYJQ 3ND9A 3CPHA 5KO2A 5EE5B 1R5BA 3FOZA 3BFVA 1DEKA 2RGAA 1BO6A 2ZUDA 5HKKA 1E2PA 2FFBA 5H70A 3U7GA 1EWQA 1DE0A 2ZTSA 3NBYC 3QEJA 3BD9A 4TTPA 4I1SA 3R9XA 3TRFA 1WE2A 4W5WA 2QNRA 1Z5ZA 5DN6A 3TKLA 1U9IC 3T1VA 2ATVA 2NQ2C 2YC2C 3O8DA 4D4JA 2V55B 2HV8A 2P6RA 1P5ZB 1ZW6A 2CJWB 3FWYA 3DDCA 1ZNWA 2IS4A 1GL9B 4Z8XA 2OESA 2C9OA 1G8YA 3K9HA 2DPXA 1W36C 3RABA 1VKJA 1AGPA 2PMKA 1K6MA 2EFEB 1T6NA 4QC2A 2OFOA 4QG7A 3FPAA 2WICA 1Z47A 4OYHA 4Y0AA 3ZJYA 2X8AA 1CU1A 4OI2A 1KTVA 4LJ7A 1TUEA 2FV8A 2AK2A 4OJKA 1FL9A 4LHVA 3I1FA 2BV3A 1NMYA 5JJLA 2ZIAA 5CJPA 3VR5A 3OIUA 2O8CB 4QBGB 3AVWA 2JLUA 3FTQA 4CVNA 4KYIB 4LYFA 4B2IA 4DLRA 4JL6A 2XOKD 3D8BA 4II7A 1LF0A 2X77A 4Q1CA 3E70C 4KSCA 3SJCA 3GD7A 4RVCA 3IBGA 1NF3A 3K53A 1I4DD 4G0NA 4HUQA 4JVNA 4DDVA 2IYXA 1P60A 4LI0A 821PA 1IXSB 1XD8A 4BE7B 2YHSA 2V1XA 4PAMA 5CIQA 1HH4A 1TNDA 2EWVA 1TU3A 3P4YA 4MRSA 3VX4A 3P32A 2I1QA 4JLPA 1E0JA 1Z2CA 4BQSA 4MRVA 4EFLA 4QNMA 4LCBA 4RCZA 4BWYA 3PIRA 1OPXA 1KK2A 2GEUA 4IEIA 4Z54A 1VCMA 2MSDB 1E2FA 1R8SA 3CZQA 1KSJA 1LF5A 2ZVQX 4DLWA 2OBLA 4ZI2A 3NIBA 4GP6A 4UXHA 3AV0B 3LQQA 3QKRB 4IFEA 4KYUA 4QL3A 1ANKA 2BWJA 4LJAA 1XRJA 2P2LA 4AYTA 2Z4RA 2ZRJA 3NHAA 1E9CA 1P72A 1T4GA 2V7QD 3KFVA 4NYMQ 1WQ1R 2KI5A 2XITA 2FPLA 2CLSA 1N0WA 4MKFA 3BAFA 1DELA 1P75A 1RRGA 4K81B 5KDOA 5IDVA 2H17A 4R2IA 2VL7A 2J0SA 5KSPA 2Q0HA 4BPBA 1TQ6A 4XD7A 3LBIA 1HE8B 1UFQA 4MYTA 4L16A 3UMRA 2GXAA 2GVZC 3T5DA 5FI0B 2W00A 4B33A 4TZ6A 4XH9B 5DE3A 1CJUC 4QM7A 4O25A 5FOTA 2F3RA 4ARZA 1RRFA 3HPQA 4E5UA 2Q9AA 2WPDD 5JI2E 3AUXA 1LNZA 1Z08A 4Q4JA 4M1SA 3SNHA 1HYQA 4F7WA 1D9XA 2JJ2A 4L9SA 2MSEB 2IT1A 3T61A 3A36A 1E2NA 1JJVA 1A7JA 4F4CA 2B8WA 1O87A 3I4LA 2QAGA 2YOHA 5CLQA 4ZDIA 2RGDA 5H68A 1NSTA 1TQ4A 3VHXA 2AR7A 1RRCA 1GZSA 3GJ3A 3GJXC 4QJ5A 5JLJA 2GXQA 2YOFA 4DDUA 4BFSA 2XX3A 1ZNZA 1JR3E 1U0LA 1ZNXA 5B30A 3CW2A 1W5TA 5H1YA 3CO5A 1G7RA 2YC4C 3K1JA 2OILA 2CMKA 1KKMA 3G82C 2B21A 1KDTA 4IVPA 4RD1A 3X1YA 4POAA 4B3FX 1H8HD 4BZPA 3KFXA 3Q9LA 5AUQA 4OQNA 1M6NA 4LYJA 4JLBA 3VR4A 1U0HC 3AVPA 2B7CA 3CRRA 4RFVA 4WA7A 2IYLD 3K09A 1VMAA 1JI0A 1P2VA 1T5IA 1OIWA 4TWZA 2GF9A 2AWNA 2E87A 5FFMA 3TLXA 3UMFA 4UNRA 2VHQA 3KXKA 1XCPA 1II0A 1G16A 1TL7C 1W2HA 2BKUA 4Q1BA 721PA 4GOKA 2P3SA 2GESA 1UBEA 4QRHA 4BLPA 4L15A 3RDPA 1XD2A 3LX5A 1J8YF 4O2LA 5CYOA 1C1YA 4PX9A 3DZDA 1Z8FA 3QPVA 3QPUA 2C99A 2RGCA 4D25A 2OHFA 3PJRA 121PA 3KZ1E 4GI7A 2FEOA 1DS6A 4FWTA 2P0EA 1G4UR 2F3TA 1F2TB 1N5KA 4D4KA 2OM2A 2O0KA 2X19A 3OFNA 1EWRA 1V43A 5A0FA 2R6FA 2ZI7A 3PEVA 3AEZA 1CULC 3THWB 4LV8B 3MGCA 1U8AA 1VCIA 3THOA 2J59A 2QU8A 1OFTA 2QY9A 2Z83A 3RC3A 3PUYA 4MKIA 3D6TB 5EE3A 4HAWA 4B47A 2MMCA 3FFBA 5ELXA 4X8OA 1U8ZA 4A0RA 2CK3A 2O8FB 5AK0A 4ASUA 4MRRA 3VQTA 1ZD8A 3O8CA 1YKSA 2ZRPA 2V9PA 4ITRC 4QBFA 3MJRA 5GVSA 5J4YA 2F7SA 4LSGA 5L3RA 5KNCA 3QG1A 1YZNA 4S2EA 5HCIA 4D0LB 1OH8A 4XOIA 1QHHB 1TAGA 4PQYA 4ZDKA 3RS0A 2ODBA 1FX0B 2FZLA 4M8NE 2H8KA 2QMHA 1OFHA 5LB4A 1Z6XA 2ZYTX 4D80A 4DLYA 3AP2A 3FDIA 4TLAA 4NZYA 3T1QA 4MYCA 1Q20A 2PMDA 1DARA 1N0VC 4RSGA 3K0FA 1ZD9A 3PCRB 4NKRA 4HI0E 4UNSA 5DIFA 5KHOC 4TYWA 2NG1A 4FMCF 2CJWA 1YZTA 1E0KA 1IONA 4PC7A 2A30A 2PT5A 4WIAA 4RZ2A 3FKSD 2Y8EA 2AFIE 2CNWD 4IDHA 4NYIR 4IJMA 2FGKA 3EPHA 2GCPA 3K9LA 4GBMA 2WKPA 4JBYA 2W0SA 2ZJOA 4PSAA 4BUJA 3BE4A 4KLZA 2ZETA 4DSOA 3SHFA 2ECKA 3WNCA 5JCPA 5DI9A 2VHTA 3R9IA 1SVOA 3THXB 1E79D 1P3JA 3ZYCA 2GILA 1M74A 2C9YA 3FMOB 3Q3JB 4IDQA 1M7HA 2HXYA 3NEJA 2W2XA 1Z63A 1KI3A 1KZ7B 4RD3A 1E1QA 4F4JA 3ICEA 5EJEA 3I5XA 3KQNA 1ONBA 2PL3A 3BJIC 4UKDA 1AS3A 2AHOA 4EQ6A 4YC7A 1RZ3A 1U90A 3GJ6A 3SU8A 2NTYC 2RGEA 1Z3IX 3QXXA 1PZNA 4PC1A 4WZBE 1KI1A 4DB2A 4C0SA 2XTNA 2WPDA 1XMSA 1P6XA 1LV7A 1NVUQ 2YWEA 2FA9A 2QE7D 3KKQA 5FOSA 4LV6A 4XWKA 3IILA 4PO1A 2W2TA 4BFWA 3B1WA 3ZZTA 3ZLJA 4X8HA 1KJYA 4JVLA 3AKEA 4F4IA 4B76A 3EIHA 3ZS9A 4LBZA 4EPVA 1IY0A 1DPFA 4IOLA 4OK6A 3FMIA 4Q4HA 5KU1A 5HPYB 2EYQA 1GRRA 4EKDA 3DKVA 1OB5A 1F5NA 1J90A 3G5UA 2AK3A 4YDHB 1C4OA 1QHGA 4I1VA 2PBRA 3U3RA 4I81A 2ORWA 1EK0A 4GMDA 1S2MA 3ZDQA 2OCYC 2F9LA 4HB3A 3RHFA 2J3EA 2ZYWX 1UJ2A 5J47A 3SZRA 2AKAB 4HB2A 3FHOA 1ZUIA 4DWJA 1M8PA 1DADA 1G64A 1MOZA 4HATA 4C0KA 1CXZA 4TTRA 2ZI4A 1R6BX 2IS1A 1ZCBA 4JVMA 4OK3A 4ZKDA 2WIBA 3EWSA 2RH5A 1KI6A 1YJ5A 1KY2A 4OKSA 2GXSA 4DLUA 4AKGA 4LBVA 2WBLC 3OF5A 3LX8A 1HEIA 1VG8A 2ZVPX 2IYWA 1TUIA 1HTWA 5DISB 1KSHA 1F60A 1TQDA 4XVQA 2F55A 3CM0A 3E2IA 2LWIA 2DY1A 3W5IA 3OEED 1GUAA 1ZU4A 4AYWA 4FMCB 1R7RA 5AJYA 4OHVA 4PZZA 4OQXA 4B75A 3O8RA 1G41A 2J0QA 4RFSB 4FCWA 1UBFA 3K0AB 1OJLA 3GPLA 3B1VA 3U4QA 2VTKA 3K9NA 2KBEA 4TLDA 4A8JB 4ZIRA 1T3SA 1RJ9B 1G8FA 3ADKA 2DFLA 4KBGA 2ZE7A 1ZRHA 4Q5IA 5FI1B 5JS7A 4MRPA 2GA8A 3NXSA 4QFMA 1NLZA 2W6JA 3MWKA 3LAWA 1AS2A 4DCUA 1KYIA 2W6ID 3M1IA 2GAOA 2VP6A 5F2EA 1W4AA 1LVGA 1ZUNB 2WSSA 3PG5A 4ZCMA 2QAGB 5EP1A 3SYLA 1L2TA 4FW9A 4OL0A 3TGPA 3GLGE 1N3BA 4ESHA 1SHZA 4PAQA 1R4AA 4GRAA 3A1VA 2BKEA 4C0LA 3NC1C 1A5TA 2QSYA 3UG7A 2V8OA 4GZLA 3DOFA 4RZXA 2QZ4A 3F3YA 4KITB 1ZBDA 4EQ6B 2QG6A 3V4RA 1R5OA 4KAXA 4PHGA 3OFND 3NEYA 4C2UA 1SVLA 2O8EB 4DCSA 4HLUA 2B6HA 4YONB 5JWRA 1T8UA 3BWDD 4MUAA 4QGAA 2EQBA 1J99A 2F1RA 2XAUA 1GSIA 3T15A 1AS0A 4DCTA 2H1LA 1DAFA 1S3SA 2QEQA 5DHAA 3A1SA 1IHUA 3JZMA 2IHBA 5DN6D 4W5JA 3FVQA 1Z6YA 2ZSEA 2ZUBA 5K8IA 2WWGA 2CHVA 1XTRA 1OYYA 2D3WA 4EJSC 2XB2A 3SYKA 1N6LA 4DLZA 1FQKA 3I5YA 5EE9A 5KTYA 1IJFA 2CEAA 1P62B 3W6OA 1G1MA 3IQXA 4OHWA 3Q72A 3F5FA 1KKLA 1XCMA 3C8UA 4M1TA 4Q01A 2QGZA 5SZJA 2XTMA 5KYKA 3H86A 2GZAA 2CK3D 1US8A 1N6HA 1Q0UA 1E9EA 3I8XA 3BIFA 1BYIA 1FTNA 1XEXA 3QF7A 3GLFE 3EZ9A 4IOMA 3I62A 3RVBA 1ZNYA 3U7FB 2SHKA 2WHXA 2XZLA 2V3CC 3FMPB 1GWNA 2OV2A 2ZSAA 4R2HA 1FP6A 4P4TA 4M21A 4LYAA 4DCNA 3U7EB 2ZRKA 1DO0A 1XTIA 3NKVA 4B43A 4TLEA 3BH6A 2HT6A 2PJZA 2VH5R 2ZREA 4DRZA 5F9FA 3LLUA 4DT1B 3U2QA 1OYWA 5G3ZA 1C9KA 1Q12A 5BYKA 1ZM4A 4HEJA 1YZGA 4QHSA 3TQFA 4LK2A 4HB0A 1E9BA 5FUVA 5SZHB 2CBZA 4RFSA 3BFKA 2PT7A 1IN5A 1D2NA 2QA5A 1NLFA 2FSHA 4ZIRB 1AKYA 4UJ5A 2OXRA 1T5LA 3IKJA 3BGWA 3PEYA 2A9KA 1S9HA 2EFGA 3HP1A 4NYJR 1PUJA 1X8JA 2BIFA 3PV0A 4YLGA 1BMFD 1XEWY 2QRNA 3LFUA 2OCBA 3K0FB 3P1JA 1AQYA 1NN3A 5DH9A 5AUNB 2GKSA 2I4IA 1PJRA 2OO7A 4IW3B 3LV8A 3KB2A 4BEJA 3BH0A 1H8ED 2FFHA 4KODA 1QVRA 4Q03A 4PXAA 4JJZA 1XB2A 3MWJA 4G01B 5L3VA 4BASA 3J81k 2O0HA 2RMKA 4GOJA 1TMKA 3L0PA 2JASA 2WMNB 1CEEA 3CNOA 4JLOA 1NVXQ 5KPJA 1YE8A 2YZ2A 3AP1A 4NPHA 2WKQA 1OXXK 1N6NA 5AJXA 2ZE8A 4NTZA 2EFHB 2ZJ8A 4I1OA 4A9AA 4A82A 4NMMA 1MV5A 2ZANA 2RGNC 4GDFA 1FFHA 3U3MA 2ERYA 1DAKA 1IM2A 5LDDC 1G4AE 1RFLA 3ZVMA 2O8EA 2JCSA 4PQFA 5J4VA 3EA5A 4MDFA 4PQRA 4U7DA 3OE7D 5KSZA 1CTQA 1EX7A 1WRBA 1Z0FA 4FIDA 3SEAA 1MABB 5FBVB 1GNRA 2YWGA 4WXPA 3UG6A 1G5PA 4M22A 1Z06A 4X8LA 3VTKA 3MCAA 1FOEB 2JLQA 2MSCB 1S1CA 2WWWA 5J4LA 1ZC3A 2EFCB 2R6GA 4H1VA 1SVSA 5FUWA 2ZJAA 2QSZA 1GITA 3WXMA 4P3YA 1UKEA 4BFTA 4Q19A 4M1KA 4M1OA 1E2EA 2W6JD 3IIJA 3HR7A 1FZQA 4TQ9A 3GP8A 1JALA 4RD6A 2EWWA 4BEBA 3D7MA 3B13B 3CB4A 4FWIB 3TW4A 5JECA 2QM8A 4A0GA 3THYA 1AK2A 2ERXA 2OLKA 8OHMA 2UVQA 2QPAA 4V03A 4GNKA 2WTUA 1TTTA 2JJ8A 2BCJQ 4PHTA 2V6IA 5CB6A 3JVVA 3NBXX 3A4NA 3TSOA 4LYHA 2IYVA 4BGDA 2Z0MA 3LRPA 1JQLB 1WBDA 4C7OA 5EZ5A 2O52A 4DDWA 4LJ6A 4LJ5A 5JSZB 3GFPA 2ZYVX 1J70A 3I32A 3ZVRA 3OAAA 3NC0C 4D6PA 3PFIA 4WXRA 3FGNA 4A0FA 1W2GA 2F1JA 5BN5A 1G20E 1NIJA 1E1RA 1XJ0A 3KDSE 5IF9A 2ZSDA 3W9YA 3HU1A 2NO1A 221PA 1JR3A 3SQWA 4RY2A 4LBWA 1E69A 3UWOA 4ARZB 1PVOA 1OIVA 1QF9A 1FUUA 4CW7A 3U6BA 4OBEA 2WJVA 3RRMA 3BC1A 2ZSFA 2GHIA 3RWOA 1CR4A 1DAIA 1KZGB 3EXAA 4RCYA 3WRYC 3ADBA 4I99A 5IRCD 4HLCA 4CEIB 4A15A 1ZM7A 4H9GA 2YWFA 2YV5A 1KNQA 2J41A 4A8JA 1OKKD 3K9GA 2QRZA 4CDGA 2FPKA 1UAAA 3NHBA 1EFRA 2B92A 4GMXA 1NKTA 2OSBA 4R98A 3CPJB 3KQKA 3BBPA 2OLJA 2WM9B 1IY1A 2R8RA 2ZRBA 3WBKA 4ZPXA 1Z6TA 3EX7C 2BJVA 4Q9KA 2HLDA 1KSFX 4PTLA 4B3DA 1GOTA 2VPPA 2FDCA 2BEJA 2LKDA 1GL7A 4GZMA 5KOYA 5CLLA 2WJYA 3DKPA 1XU4A 2ZQ5A 4JMPA 1V5WA 1FMJA 1II8B 2JJ2D 2A7QA 1UEJA 2WAXA 1G19A 4JYCA 2HT1A 4OQLA 4D0GA 2GJAA 1OT3A 1W4RA 2ONKA 4MKHA 2WJIA 3C15C 4AIIA 3OIVA 5L3QB 1SXJE 2A3RA 1B23P 1DAGA 1YR9A 1CP2A 2QE7A 5JZVA 3IDQA 2DR3A 5CM9C 4A4DA 1SVKA 5JJIA 2DYKA 3A8TA 3K0CA 3SS8A 2FSFA 1HQCA 3FKSA 1EFTA 3THYB 2GEVA 2ZR7A 2AWOA 2WIAA 4HAYA 3SBDA 4DUGA 5C1BA 3H2YA 1CR0A 3WHKA 3THWA 3I92A 2G3YA 4PZYA 2RB4A 1I4TD 1AIPA 2DB3A 1XPRA 4YDSA 2AL7A 5DHFA 2QBYA 5AJWA 5IK2D 3GEEA 4BECA 2BMDA 4DVGA 2BVNA 5LB2A 1GTVA 2YKGA 3HR8A 4URUR 4LC1A 4M1MA 1T0JB 1ESNA 4B71A 4JBWA 4BLOA 2BCGY 1YU9A 4K46A 4HAZA 5AWFC 2FX3A 1W47A 1OLOA 3DZ8A 1NN5A 1OXSC 2JEOA 3V4FA 2A5GA 2BC9A 4DSTA 2GJKA 5KSOA 2FEMA 1Q57A 1GAJA 1J8MF 3S1AB 3BH7A 2FMXA 3U60B 3MWLA 1QRAA 1WF3A 1ZINA 3UIEA 1SVWA 1W5SA 5BWMA 4CEIA 1G5TA 2WSSD 3CX6A 2ORVA 3W5JA 3P20A 3KX2A 2IXEA 4IXMA 2A5JA 4I1UA 5JEDA 2QP9X 4C2TA 2DBYA 4IDOA 3DM5A 1Q1QA 1ZAKA 5TMPA 1BOFA 1DVRA 1G9XA 1JXOA 1ZIPA 2PEZA 4L5BA 4PAOA 2CCGA 1YR6A 4BLQA 3A4LA 3CNLA 3B6EA 5LD2B 4YXWD 4B32A 2B7BA 2X2EA 2JATA 4LDJA 4L9WA 2QMUA 3RWMB 4D26A 2ZRMA 4BFZA 3TW8B 2OXCA 1GG2A 2BBSA 4JVSB 4NL4H 1UADA 2WAYA 1VYTA 1Q22A 1G3IA 1ZJ6A 3IHLA 3UANA 2GXUA 3U3KA 3MJHA 2EU8A 3K0EA 5BN3A 3P27A 3B7GA 4HUTA 2ZM5A 1WBBA 5KDDA 2IS2A 4DUGD 4D81A 2EYUA 3WNBA 1U94A 4YMSA 4PSKA 1F3OA 4HYYA 1VYVA 2OG2A 5FOXA 5C2JB 1EFCA 3ZZ0A 2QTVB 3OIWA 2IYQA 2QPOA 2Z43A 1E2MA 3ZVNA 3KTAB 5P21A 2AFHE 3A1UA 2CE7A 4LUCA 3TIFA 1WB9A 1HT1E 4W7SA 1LY1A 1KK3A 3ADCA 1GVNB 1QHYA 2J0VA 1ZYUA 2XTZA 4B2PA 1TQ2A 4Q4HB 3TR0A 4FMBB 4HSEA 2H18A 5G40A 5C4GB 4ZCLA 1D8TA 2N46A 4AKHA 3KJIA 4IOKA 3SR0A 2RGXA 3LLMA 3MG9A 4DLTA 1U98A 1D2EA 1Q44A 1KO4A 3AF2A 4AKIA 4C0JA 2DWOA 1KI4A 4TN1A 5J4KA 1M7BA 2ZEJA 5JJKA 5FOVA 3ZIAA 3EPKA 1SQ5A 2N42A 4KLNA 2HDNB 2OT3B 3MUFA 4F93B 1N2CE 4PFSA 2ODWA 1JR6A 5CM8B 5CJ2A 2R62A 3M4YA 3DL0A 2A2ZA 2E9SA 2OUKA 2ZRHA 3WMFA 3HYRA 3WNDA 4B3BA 3VHLB 4TMVA 3IUYA 2ODEA 4C7OB 1Z28A 3QVVA 5EE0A 3O47A 3TQCA 4XVUA 1J7KA 3TUJC 4E03A 4JL5A 3RRYA 2GK7A 3LVRE 4A0HA 1KI9A 5JSZA 3VKGA 3AKCA 1S3GA 1GILA 2VIIA 3HDTA 3S1AA 5L8VA 4B35A 1W36D 2AD1A 3UWKA 4MQBA 1SKYB 2R44A 2PZEA 4NCJA 3LH5A 5JMTA 2VF8A 1Q1EA 4KFUA 5DNYB 1U8YA 2JIZD 3CRMA 1GDDA 5DYGA 3U4QB 1KDRA 2WWHA 2GDJA 5EP2A 4URWR 2Q9BA 1NKSA 3B1ZA 3FMFA 5L3SB 2HF8A 3CF0A 1PLKA 2WJJA 1XZPA 1NMZA 1E9RA 2FSGA 1IN7A 1E1RD 3KJGA 4V0MA 3CRW1 5EXXA 3R7WA 5A5GA 1G8GA 3LWNA 5FPHA 5K8TA 5A4JA 3OEHA 5TXGA 4DEYA 4TQUS 2ZJ5A 5EXSA 2XB4A 2NZ8A 4CT5A 2KWIA 1OHHA 2D06A 1G8PA 4PPQA 4BLTA 2PLRA 3CNNA 5GVRA 3VNUA 2FOLA 5HZKA 5ANRB 4G5OA 2UZ3A 1WA5A 3AF0A 3C5CA 4JLNA 5AUOB 3L0IB 1Z22A 1CKEA 3K09C 1X1SA 3N2EA 2REBA 4Z51A 3X1ZA 3VFDA 3VKWA 3ZQJA 5K8UA 1NBME 2YVUA 4M1WA 1NRJB 4JLJA 5AJZA 2O8CA 1K8RA 5JBQA 1W1WA 1AKEA 2FWRA 4MH0R 1KMHB 4JS0A 2I1VB 3OEHD 4NCIA 3ECCA 1IOZA 4EAQA 5EE1A 4Q21A 3CUEF 1NJGA 2R2AA 1KAGA 4Z1MD 4TL7A 4FINA 1E0AA 1UPTA 1L7VC 1KSGA 3T35A 4ZO4A 3ZS8A 1OV4A 3FHCB 3L8ZA 5F9HA 4LC0A 1XTSA 1TX4B 2WJGA 4B74A 2QROA 1QHNA 5FTMA 2RGGA 3QXJA 2DFTA 4IDNA 2QL6A 1GKYA 5LBIA 2N1BA 4G3XA 4NHOA 3EIQA 4GT1A 4XD7D 2J5XA 1W0JA 1KNXA 1PLJA 1UDXA 1SULA 2GJ8A 5HTKA 3ZZUA 3QXSA 1EESA 3AGQA 3RNLA 4JJKA 1XEXB 3PUXA 4URYR 5E3HA 2ODNA 3X1DA 2O8BA 2WOJA 2NO9A 1OE0A 2OCPA 1E0SA 1DO2A 3GFOA 3PENA 1MO4A 4EPRA 3U7HB 2WVJA 4OI0A 1TF7A 4QKQA 4MRNA 5D3MB 1YR7A 4YMWA 4U02A 1NBMD 2QBYB 1G3QA 2CHGA 2GWHA 4DIEA 2R9VA 2O0JA 1MRSA 3NBFA 2Q3FA 4Q02A 4TLBA 5FUYA 4MGYR 1S9DA 1I2DA 2RHMA 5EUQB 1W48A 1OH7A 1W4CA 2NGRA 4RD0A 1KJZA 1U2RA 3KXLA 3T06B 2IBMA 3GLFA 1EFRD 1EG7A 2ZU6A 1IY2A 5FL7D 2GCOB 3PQCA 3L0SA 2IXGA 3WP0A 2D2EA 2K5UA 4HLUC 1JNYA 3Q85A 4KU4A 4PPGA 4TT3D 4GSYA 1MO5A 4JSTA 4LV5B 3BOSA 1NVWQ 2GAAA 1MKYA 1E9FA 2C04A 2RCNA 4MYHA 4A2WA 3FB4A 3CR7A 1CR2A 2VSXA 3TNFA 4Q4JB 4A92A 2BBOA 3CF6R 3DPUA 4FCTA 1JB1A 4XIGS 4QJ3A 2JLWA 1TF5A 5FTKA 3X2SA 3R8CA 5HKKD 1CJVC 2VO1A 4LJ9A 5H8WA 2ZRLA 2GTPA 5J5CA 4KVAA 3U44A 2BMFA 1CS4C 3VMFA 1KI7A 2QUZA 5F3WB 2KB0A 1W44A 3GLIE 2BM0A 1Y63A 5FL7A 3JVUA 2XSZA 1M1YE 4AYXA 3EC2A 1ELOA 3QOFA 3QJYA 5CITA 3KKMA 1Q1ZA 4XVRA 1NN0A 3I72A 3GJ8A 1YZUA 4P31A 4IFBA 2R6DA 1Z6GA 3K70B 4B48A 4TSFD 1WMSA 3KL4A 4LGMA 2V4ZA 3PR1A 3EPJA 2EVWX 2NIPA 3AKYA 4FCVA 1I2MA 3GLIA 1KMHA 1RW4A 5TV2A 3LO5A 1MABA 1AN0A 1TADA 1E2KA 3QEOA 1T9HA 2CLDX 1E2HA 1R0YA 521PA 1XMJA 2IYZA 4TMTA 2ZRDA 4DSUA 1VPLA 2J46A 2VA8A 5AJVB 3LW7A 1D5CA 2QAGC 1VCOA 4U00A 4EPYA 2WWYA 1E2LA 2PCJA 4D4MA 3ZIAD 1F2TA 4AC9A 2O8BB 3L8YA 3B9PA 1G5RA 3K8YA 1U0JA 1IN4A 2H16A 2CVFA 1E2JA 2QP3A 1N6RA 2DCUA 1SXJD 4N0EA 4PO9A 1XNJA 3TVDA 4B44A 2XEXA 2JJ1D 2G88A 1GIAA 3EZ2A 3GJ4A 4XJXA 3RRZA 1U9IA 3GFTA 3W34A 1JAHA 1P2UA 1K5GA 3NG1A 1ZM3A 1OIXA 1QZXA 3LW8A 3KUDA 1WCV1 2O8FA 4FMDB 1NIPA 1S4QA 3NBZC 1YR8A 2RHDA 1M7GA 1W7AA 4G1UC 1KOFA 3ONWA 2YOGA 5JEEA 1RYFA 5JFGA 2G1KA 3WYGA 3HYTA 1ZD1A 4Q00A 1Q1BA 2IWRA 1II9A 2J7PA 3RSOA 4MKGA 5G41A 3QNUA 3Q8XB 1HT2E 1QVAA 2CL6X 4C0HA 1YHNA 1RRPA 2XZPA 4XTRA 5HE9A 5CIWA 2JLZA 4Q4AA 1TF2A 3GQBA 3V9PA 4XSHA 1KHTA 2Q6TA 4V0OA 1UDWA 5FPYA 5FTLA 1E2IA 3OHMA 1CRQA 2DWQA 4PHFA 4JLMA 4N1AA 1VYUA 2QENA 1N0UA 4Q9IA 2PX3A 1YRAA 2A78A 3B8HA 3NDPA 3RRNA 1AA9A 4ZI3A 4IRUB 2ZS8A 3L0OA 3EASA 3W6PA 2C78A 5SZKB 2F6RA 2XJ4A 3ZGXA 3SN6A 4DC9A 4ZCIA 2ZROA 4UQOA 2WV9A 3THXA 3T1OA 1RPZA 2DWPA 5JHHB 2IYSA 1KO1A 1R10A 2RGNA 2ZXUA 3W6NA 4ZKEA 1NVVQ 1HA3A 1XMIA 2P65A 4M4SA 3E5HA 2X1VA 1JEDA 3OESA 1AZSC 2RKOA 4NP6A 1MRNA 4PPNA 1TPZA 2IHYA 3DHWC 3K0CC 3QQ5A 3ZQ6A 4EFNA 3Q5DA 4WZ6A 1ODFA 3RS5A 1JEEA 5D3QA 3EZFA 1UEIA 2GETA 4UNPA 4C3ZA 2VSFA 2FFQA 4QJ4A 4YQFA 1KK1A 1KO5A 4J0QA 1LFDB 5GJVC 1E94E 1QBKC 3QXHA 2YWHA 2QGNA 1XXHE 3EG5A 2IUSA 1UBGA 2IF0A 1G17A 4P0TA 1FP7A 2XGJA 4Q18A 3A37A 4CT4B 1AQUA 2QPTA 4PR0A 1XZQA 1G21E 2XXAA 1QHXA 5TB5A 4A6PA 1I4LD 2ZJ2A 3N2IA 3PUZA 5EUMA 1GNPA 2L0XA 4HAVA 4D2IA 3Q7PA 2ZAMA 2FGJA 3A1WA 3V00A 2AXNA 1IAQA 3A1TA 3M0EA 4BRUA 1OFIA 5FPKA 2VQSA 3D3QA 3VR1A 4Q9JA 4KXFB 1DG1G 4CZ2A 1AGRA 4FXPA 4GOXA 4DLSA 1Q21A 5E7IA 2BOVA 1COWD 1G6HA 3GEIA 5B58C 2QTFA 3T5GA 4AURA 2A5DA 1XD9A 2NO0A 4M0LA 5CDFA 4IVQA 2P6UA 3LXRA 4WW0A 5KSYA 5D3MA 4WOPA 4DBLC 1UM8A 4A6XA 1KI6B 4NBSA 3OZXA 4R71A 1ZCAA 1XDBA 1Q3TA 1DBSA 3I73A 1G3MA 3SYNA 4DHEA 4TMZA 5CYPA 3GLGB 2ANCA 3CBQA 3WMEA 2BMEA 2C9CA 3IHWA 4PO8A 2ZI6A 4PC2A 4C9BA 4ZV4A 2Q21A 5B2ZA 1OSNA 4B2LA 2EFDB 3CLVA 2VP4A 1CJKC 2GCOA 3CONA 3GCGA 2ZI3A 2G0TA 3QVUA 3DVLA 3KKOA 4US1R 3F8TA 3TSWA 4A1FA 1E99A 3LBNA 1HQYE 3DM9B 5IK2A 1SGWA 2CL0X 3PVSA 3GJ0A 3EPLA 4AI6A 2GJ9A 4PPFA 4AG5A 621PA 1XJQA 1EFUA 1ZC4A 1G7CA 1NNEA 5EP3A 1UBCA 3U3OA 4PANA 2WOOA 4B6FA 1S96A 2GZHA 4ASUD 3WHLA 4RZUA 3Q5EA 4JT2A 2ATXA 1X8KA 3BERA 2QI9C 4PC6A 3A58B 2PZFA 4HLQB 1E4VA 3BORA 2ZS9A 3Q7QA 3IEVA 2ZRIA 3C16C 1W49A 4US0R 3H1TA 4IEEA 4RD2A 3AVXA 3BRWD 1VTKA 2C5LA 3HPRA 1WP9A 3CR8A 5E7MA 4FI3C 3AH8A 2BM1A 3U5ZB 5KUTA 5EXTA 1FMLA 3DEFA 1M2OB 2QAJA 1VIYA 2BBTA 2NOAA 2FH5B 3B60A 1BMFA 3TUZC 2Q3MA 3CWZA 4G5QA 4P4UA 2JLSA 4HAUA 2BBWA 2OBNA 3F0TA 3AVUA 4URZR 3KUCA 2ZU0C 5DLQC 4KV9A 2G77B 1GRQA 3RSLA 3R9WA 3X1WA 2FN4A 1Z0DA 1LS1A 2YYZA 4OHZA 4EPXA 2UKDA 3SC3A 3TJZA 2QQEA 4M9QA 1H8HA 2JLYA 1W36B 3IEUA 2FJUA 4CGZA 5GADl 1JQJC 3W3AA 5DYIA 1A2KC 1P7CA 2W58A 4ON9A 4QM6A 3B85A 1R0WA 3VAAA 3AUYA 4NONA 2ZE6A 2FU5C 3ND8A 5TY0A 4D0NA 5J4HA 3MRSA 4ESVA 1N6PA 2CVHA 4UNNA 1S8FA 1Z29A 4QHYA 1YVDA 4DIDA 3EWAA 1D6JA 5IHPA 5JHGB 4HDQB 3CX8A 1AZTA 3LXXA 2VBCA 1IN6A 3VR3A 1MR3F 3BK7A 1E2DA 2GJSA 3LD9A 4CIDA 4DT1A 4ERNA 3HU2A 4IOJA 2PJRA 4G5SA 1R2QA 2JA1A 1H8EA 2ZRFA 1BH2A 2OCAA 4B3GA 5BYJA 5FPSA 1NVVR 4Q1FA 2GVDC 2V6JA 5JCZA 1CJMA 5CK5A 5GJBA 4Q7LA 5CB8A 3IQWA 1CF4A 4TZ0A 1O3YA 2B8TA 1FNMA 2CCKA 3TSZA 2VHUA 2VYFA 2CL7X 3I8SA 3QY0A 5L3SA 4L8GA 5E4FA 3GJ5A 1QG2A 4Q4AB 3HU3A 4KHZA 3VU9A 3W90A 2ONJA 5IT5A 3OIYA 1SVIA 5HZHA 4TYNA 4P33A 3KKNA 3H84A 2REOA 4MYUA 4F38A 1XJCA 1G3UA 4DB4A 2FF7A 2IC5A 2D7CA 4LWZA 3AF4A 4NYMR 3QKSA 2OE2A 4AWXA 2V7QA 4CEHB 3CH4B 1NSFA 1CJTC 2QP4A 1XX6A 1VHTA 2HLDD 2OAP1 4M9ZA 4KSBA 3AP3A 5C18A 3K0SA 2YJTD 3KKPA 421PA 4PC3A 1E79A 3DOEA 2XNSA 3CPEA 1MO3A 4NCNA 3PITA 2QMOA 4HZIA 4IHQA 1CR1A 3TUIC 1N5IA 4S35A 5SZIA 1VG0B 4BFXA 4JKIA 3T34A 1KMQA 3KXIA 3L43A 3LNCA 2PZGA 1YRBA 2CNWA 4JLKA 1IXZA 2ZSBA 3TMKA 4M1YA 4G5RA 1HE1C 4US2R 1YZLA 2FNAA 3N70A 1GP2A 1EFHA 1FNNA 1RC8A 4U5XA 5FR1A 2DFKB 2HEIA 4GPTA 5KPDA 4XWAA 4OJQA 1LB1B 2BHRA 3C4JA 2IW3A 4MUBA 2G9NA 2FG5A 2QN6A 3BFXA 1G291 1TEVA 4HAXA 1E9AA 1MT0A 3RYTC 4HB4A 3SE0A 2ZYUX 4HZUB 5EZ6B 2AN9A 3LA6A 3UPUA 3ETLA 4Q7JB 4R7ZA 2PCLA 1KGDA 2O5VA 4EJSA 1KI8A 2VP5A 4Y0VA 4JSYA 2ZRCA 2ZI5A 5TVKA 4DXAA 5F98A 3OAAD 1NN1A 4OQMA 3X1XA 1E9SA 3REFA 1G18A
chains in the Genus database with same CATH superfamily
4C22A 1KJIA 1VSQA 1XVTA 4FDMA 3F6CA 4NNPA 4EB3A 4CF7A 1U3FA 4FGKA 4FN5A 1DMRA 4OLJA 5EJMA 1RQPA 2K7FA 2FP4A 4QPNA 4RXMA 3QIVA 2ONCA 1U99A 3HKDA 4QFDA 1J2TA 3BSSA 4B3HA 2SECE 3NIFB 1JFSA 4XDYA 1S7GA 3IHKA 1UXGA 4U7HA 3SC4A 3FLMA 3ZU6A 4HV4A 4X62B 2PZ8A 1WOYA 3H17A 4AUKA 4W6ZA 5C46F 3W5BA 4Y6RA 4WNCA 3AJ9A 4LFAB 1QP4A 4WVFA 3ETEA 3CT4A 1FP4A 1R0ZA 3D2CA 3C7DB 2JCXA 2W4QA 2PWYA 3L92A 3PD1A 4BEVA 4F92B 4W5RA 4YROA 3JQ9C 1ECBA 2G5GX 2IZ1A 2HJVA 1UODA 3HJNA 4IBOA 5IAJA 4MJLA 3EAQA 1LA2A 3MD0A 1VM6A 3RAPR 4D74A 4PZLA 3DD1A 2B1JA 2ZS7A 2EF0A 3ELWA 3NHKA 4B73A 1YUNA 1A04A 2Q3EA 3RRBA 3A70A 4LCEA 4F45A 1EP1B 5BW4A 1WR8A 2VXCA 2W2LA 2NACA 5EWMB 4K6KA 1DMSA 2OBFA 3BS4A 3H8WA 5AM2A 2R65A 3N53A 4X24A 2VCYA 4PS0A 4C3OB 3PI6A 3VO8A 1G63A 1WZIA 1AV7A 1YGPA 1KP3A 5H81A 3VU9B 3H0KA 3U0VA 1WVGA 2R8XA 1D6MA 3K5WA 3FD8A 1P0QA 4DCGA 3EF1A 2FR0A 2J67A 4DZTA 3UWDA 2XIQA 4PG7A 4DDTA 3UAOA 2PM8A 3WGVA 1B8OA 2XH8A 1NLYA 2PJUA 5I9NA 5K45A 1EM8A 4RC9A 1JIXA 4QUKA 3CCBA 3NV9A 4EHAA 2OD2A 2J7PD 5DULA 1KQNA 4HFMA 3AHJA 2NO7A 5K3EA 1RJ9A 1ZH6A 4MGKR 2PH1A 4Q9AA 4DIOA 2ZVJA 4CGYA 1XFAA 2ZUWA 2C7GA 5AJTA 2CE2X 1ZP6A 1E20A 3LM8A 3ES9A 3AJEA 3B5JA 1WHTA 4YAEA 1OX6A 3OPQA 5BUZA 1N5LA 3AGPA 4E5NA 2IYTA 3TOXA 1LWNA 4X7PA 1ID8A 1Y80A 1W4BA 4ETMA 3L7IA 1PS8A 2LCFA 2I3BA 3PWSA 3MGAA 5U1PA 3TZHA 2C2HA 2ZJZA 5EZYF 1M73E 3TH5A 4AP9A 1GN9A 4DVJA 1IJBA 1YBHA 5C53B 4JQOA 1QKJA 2WM3A 5AR1A 3WFJA 1FU4A 1IZ8A 1ATZA 4OI1A 5HE8A 2QM3A 2VWPA 4K3VA 5LJLA 2WUWE 2PHZA 3QBVA 4MINA 3TQSA 3FZNA 3NRCA 5LQDA 1OLXA 2H57A 4ZQFA 1NUPA 3G2LA 1HTTA 1L9KA 4YMGA 2HMWA 1JFFB 2W6MA 3GRYA 3OHPA 1PG0A 1JSLA 4CRWB 3ELBA 1L4UA 2NNLD 4J0FA 1JDVA 1N3IA 1E92A 1JV2B 3MUEA 1C3LA 3QPBA 4LXUA 1MXHA 3SQLA 4F8YA 2HCBA 2YHBA 4H4CA 4JKYA 3WLIA 1SKQA 4E08A 3EGXA 3UYLA 2QT9A 3EXIA 4N0DA 3HTXA 1B42A 1ESMA 1NHWA 5K3CA 5AW4A 4ZTUB 4ZT2A 4ZVMA 2F8MA 4A8JC 1F8FA 3KZXA 1KZ6A 3F3KA 2QD4A 1J6UA 1YJAA 4MITA 4CKXA 5JWOA 3D6VA 2J5QA 2HJ9A 2PMCA 2CXQA 1EP3B 3BRQA 4O5AA 4UOQA 5I7WA 2ZRQA 2PEYA 1H93A 1RKBA 2XGOA 4K0RA 1ZMXA 2LV8A 5DSZA 5JLAA 2ZAGA 1FDTA 2M6SA 5SY4A 2XJ9A 1L8OA 4R5MA 3MTEA 3P26A 3CKLA 5KDLA 1L4GA 3TN7A 2J6HA 3LLCA 4KE8A 1J49A 3OZUA 3VAAA 4GWGA 1VDZA 2AX3A 5EPOA 3UT6A 4D9NA 4BNFA 3OZAA 3AVVA 3LDUA 1NV9A 2CDBA 1ZSVA 4MW6A 4ER6A 3AI7A 2LNDA 3A6FA 2GH1A 4LY9A 2RC5A 3CRZA 5IW8A 2ZYSA 1R0KA 4N5LA 2LXNA 1GYQA 3QE2A 4MI3A 4UNQA 2I3AA 3HKEB 1F9AA 4AM8A 2G0NA 4NOJA 1NW5A 1L5RA 1T10A 3B9RA 4G0ZA 1VMDA 4RNCA 1P77A 1M0WA 3BXPA 4C0WA 5BN4B 5EUBA 2H2FA 1ZK4A 5JSUA 3EVGA 3FI9A 3IO5A 4OHMA 4ZU1X 5H0IA 4BIMA 1GZHB 1MRZA 2XQJA 3LSYA 3EFEA 3JQAD 3P4XA 4L2IB 1GGNA 4HLDA 4LZOA 4DJ5X 3KYCB 1TEZA 1NBIA 1XDGA 1ZJ4A 2PZJA 4AJ9A 4WLNA 4D8XA 3PEWA 1NJ2A 1OW3B 4PZ0A 4RW0A 4XVHA 4ZGBA 3C5WP 4BNJA 4LDRA 1BDBA 3EIEA 5F5LA 4Q48A 4MMXB 2KE5A 1QLHA 1PG2A 5B37A 5GZ1A 4R01A 4DMGA 5EMKA 2WABA 3HI6A 1Y4SA 3ZWOA 1N2CA 2GEKA 1VMKA 4HDCA 5HIIA 3K1AB 3HR4A 1YQEA 2HYDA 2Q2QA 2V7TA 3F7OA 4G4JA 3A3NA 4IO0A 4QYIB 3VJKA 1KETA 4J76A 3K35A 1TUGA 2D4HA 2GN9A 3B1YA 3O8QA 4EKYA 4FDUA 4P32A 1H2BA 1V1RB 2D74A 4R8SA 2XUAA 3EW7A 3QUSA 1DIBA 2ORIA 4MDEA 1GL3A 1T26A 2W2VA 5DBIA 2DFDA 2X0RA 3I64A 4H15A 4PINA 4BRWA 2FR1A 5JU6A 1XLUA 3H4TA 2VSOA 3IIMA 4X92A 5FWNA 4RWEA 2X6QA 2NU8B 4O8CA 1WETA 2BFFA 5LCXA 1JYEA 4B6RA 1Z15A 3A2KA 3QPWA 3RC1A 1DKQA 3JQGB 3PRYA 2VPIA 1NG9A 4UDOA 4RS3A 2PA3A 1KDZA 5T7BA 3GMTA 2AH5A 3HZZA 3PQ6A 4U9UA 4WLUA 4F60A 3EPPA 3IKMB 4DY6A 3QF4A 1LS6A 5L3ZA 5FI3A 1G8HA 4WEQA 4MUMA 3P52A 4DZZA 2JIOA 4V0NA 3WK4A 5AI4A 1EXWA 5DHSA 2A88A 1FRZA 1H4TA 1TTPB 1N1GA 2HPHA 2ERCA 2GUGA 1GD1O 4KG7A 4Z8YA 5SYMA 4AY2A 1I5EA 3KQVA 1KTIA 4FDLA 1X1AA 1MMFB 2C4WA 3EIUA 3B78A 2PYIA 1E7MA 4U2CA 3ENNA 2VHCA 4WFQA 4YAKA 2FPOA 1XTUA 5AHKA 3W4JA 4UHDA 2GNOA 2P30A 3CLTC 4UU7A 5HX7A 3LZ6A 4F3TA 5K3FA 3KB1A 3QMPA 3DCYA 3OFJA 3LZDA 4ZU6X 4HN4B 4HGOA 1PNRA 3MMSA 2IYUA 2SKDA 4A2PA 4UAJA 1PO7A 1IXRC 2CHFA 2FWBA 4KIGA 3TMAA 5DO9A 3E9RA 3QE9Y 1BS1A 4TYQA 1O1YA 2HHLA 4PNHA 5EY5B 1A4RA 4QQRA 3RUPA 4KIWA 2P6NA 4M87A 4PX3A 1A1VA 2Z58A 1GGFA 1X87A 1N57A 4CEJB 4MGZR 4LVUA 3EZNA 4HDRB 1XZMA 3AERA 2G25A 4MWTA 1QDLB 3ER8A 1I2AA 4P4SA 4K9OA 5C81A 1QPZA 4EGFA 4H6VA 3JARB 3VR6A 4G65A 1AH2A 4D45A 3CV3A 3JQPA 1AXRA 2PX5A 3KZKA 2X23A 2JZOA 4QPZA 4BO1A 4YP9A 1XP8A 5AW9A 1ZWLA 4FC7A 3VOTA 4EJFA 2IEZA 5CX1B 1CQIA 3UW1A 2DFNA 2DU8A 3WWEA 4INOA 2DQSA 4QVGA 4NRDA 5BYAA 5BNWA 5JOQA 3QIAA 3ZCVA 4LX0A 1VJ0A 4EJ6A 5JCJD 1ZWKA 2PANA 1Y9DA 3LGAA 4JL8A 3TK1A 4BMXA 4QVKA 4LF9B 1VB5A 1I2ZA 1P1KA 4ND8B 4AP6A 3UXYA 4EITA 1J0AA 5CK4A 4YUYA 5DEIA 2FW7A 2KSQA 1Y89A 1GAWA 3EBPA 2Q6KA 3FLAA 3IKVA 3LCJA 3FUUA 4HP8A 3ZHCA 5ADVA 4BCDA 2JKZA 5T67A 2R84A 2C4VA 3NJ8A 3SQXA 1AGNA 4W5OA 2J5RA 4H0CA 1W19A 1L7NA 4JXKA 2D7DA 1OC2A 1KBOA 3B52X 3QYAA 4G1MB 1G5HA 2I4TA 2PZKA 3SZUA 5A6VA 3W2FA 2ZQZA 1J2EA 2VNSA 3BCHA 4EFMA 4TMFA 1L7DA 1AO3A 4LZJA 2SCUB 4M53A 2WAAA 4KX3A 1W96A 5EJFA 4YA6A 3S8YA 3LCUA 2BGKA 3P9ZA 1YQXA 2ZI9A 4RQBA 1UP7A 1SVNA 4URXR 4CODB 2RAPA 3MMXA 4LVOA 2XDAA 1TVKB 2OAQ1 3P45A 1IRXA 2I91A 3HEAA 1CDDA 4QARA 4RCVA 5DI3A 2WMOB 2B69A 3DP7A 2RHCA 3N3AC 1CIVA 1SEPA 4KWCA 1WULS 3WMRA 2V54A 4CF6A 1U9YA 4EI9A 2W43A 2F59A 4H3SA 3UMMA 2AD5A 1G8MA 7GPBA 2A1UB 5JNUA 1YQUA 4I9HA 1YB5A 1OKKA 3ONEA 3W2IA 4RK1A 1ZRSA 4U39A 1SQFA 3AIKA 1NBWB 1ECCA 1R64A 1T6XA 2CCJA 2OZLA 1Y1PA 3FZGA 4X95A 3BVPA 1RZRA 4ENUA 1D4FA 1W6UA 2H31A 2CLEB 3EARA 2FN8A 2R6HA 2WJ3A 3O74A 4HFNA 4U7WA 4LMPA 5C4MA 3SX0A 2IPNA 1FFAA 4Y1RB 2WT9A 4EYSA 2RBKA 5BSMA 3BXFA 4FNGA 5AI0A 4EUSA 2NMVA 2D7JA 4YT2A 4ZCPA 5HYVA 3GMIA 5HRCA 4IJVA 1YCGA 3RVJA 2VDVE 3L01A 1U7TA 2R5WA 3NANA 2XOKA 2J7KA 1IUPA 1O9BA 1K7EB 2ZXFA 2WJZB 3IJPA 3KE9A 2R1UA 4JBHA 4ZRDA 1N5DA 4P5DA 4BTLA 3GEHA 3EB9A 1WPQA 3ZV6A 4KOEC 5A06A 3RANA 3WSVA 1W0KA 5AXCA 2JHPA 4YJ2B 2XW6A 2X5XA 2PRYA 4MWGA 1BHQ1 3M1AA 2O8DB 2C95A 3SOPA 3A3YA 4WZAE 4ARAA 3II6X 4XDHA 2O2JA 4BNWA 2ZWAA 4NNJA 1A98A 1JHZA 1ORWA 3A7EA 3WLLA 1SQSA 2XA9A 2CXSA 1V9SA 3SHVA 1FDUA 1UK9A 4O4HA 1C0PA 4EYEA 4DV1B 4BZQA 1X2EA 4CTOA 1LDNA 1FP2A 1ZICA 2Y9MB 4XYLA 1R8QA 2NYVA 3U7QB 1ZGCA 4NX2A 2D5LA 4RBNA 1Q16A 4MA4A 4C0QC 2AG8A 2COUA 2WWFA 1BGVA 5BNZA 5KYTA 1LJ8A 4O3MA 1BJRE 3HB1A 1N2IA 4Y2QA 4H7HA 1P9WA 4TL9A 1WUKS 5CG2A 2G9RA 1H2EA 1K5PA 4M2LA 3K0KA 3QYFA 4R2WA 1KWGA 3EA0A 1LQUA 2JFVA 4RHEA 4FR5A 5DEOA 1XPUA 1OZAA 1GV0A 3O21A 3FPEA 4I4LA 4TXMA 5KVVA 4BQNA 1ZZGA 2JFPA 4DYVA 1DBWA 4AX8A 1NJ5A 2XQVA 2YZKA 2XCQA 1RRMA 2UUAB 2VBGA 1U2EA 1TEXA 2PUWA 3C3JA 3N8KA 4TXJA 4Z2AA 3IMEA 3TIIA 3U44B 4TYYA 2CLIB 4KXQA 1NW8A 1JHPA 2JCYA 4UFNA 5ALZA 3U1VA 1JPJA 3V1UA 4GR5A 2O7SA 3BZBA 1Z6AA 1MBZA 3R7SA 4ZI7A 4UMFA 1M34A 5KX5A 1JLHA 1WIWA 3AM4A 4MUEA 1GJRA 1Y6ZA 2JCGA 3QOXA 3QVGB 5I7AA 5JALA 3MA0A 1ESDA 1UKVY 4U6NA 3RTCA 1FPMA 3F5SA 3MTJA 2Q4EA 2VTBA 3AZQA 4X63A 2I55A 5C5DA 4F04A 4KFRA 4IIDA 4L02A 3D3KA 4MP8A 3OG9A 1Z4NA 1OB2A 2OEPA 3PFCA 4YECA 3TZLA 1Q7GA 3BWXA 5KAPA 4GI2A 4GFDA 4R2JA 4HT3B 3AHHA 1HSOA 1KWKA 4QD3A 5E7JA 3NH6A 5T41A 1YJQA 5AP9A 2PTGA 4D4GA 1L4FA 1WXQA 3JWGA 4E5KA 4GEKA 5JWHA 4REQB 1Q84A 3H05A 3HDYA 5GY7A 1QIGA 4DMHA 1UXJA 3FFAA 1BZYA 3M3PA 1AF4A 3B20A 2Z2KA 5I9MA 1H85A 1UC9A 3FYUC 3W7BA 3UC5A 3N76A 4PLHA 4NCHA 5C52B 2OXIA 4LOAA 1KR2A 5IJWA 3E03A 3H5AA 5C7IO 1C2YA 2HO4A 2PSSA 2VQDA 2W90A 3DE7X 2NW6A 2ZKLA 4PG6A 1Z2DA 5L7YA 5I4IA 4BFUA 4Y30A 4OHBA 5IBRA 1U81A 1T3LA 1P9NA 4HFRA 4D9MA 1R4MB 1Z37A 5HP4A 2WIDA 1PQWA 2Y27A 1N6KA 2C77A 2QSJA 5C7OO 3I53A 3I2YX 2W6ZA 1EEHA 4C88A 2C58A 1F20A 1TK3A 2XB8A 3A3PA 2QZPA 4ZDWA 3UXMA 3LF1A 4IGFA 2BMAA 4BO0A 4E09A 2NP7A 3B6JA 4ZAWA 2HPAA 4WMLA 3AQIA 1RC1A 4N39A 2GBLC 2XNDA 3BKWA 1UXHA 4KWTA 5H4GA 3C6KA 4MMYB 1OXVA 1XTKA 2C9DA 2G83A 2R6AA 3OOWA 5AVKA 4EFKA 3IUNA 5AI9A 4I55B 4OI4A 1W0JD 2FJPA 4BO7A 5FAKA 1U7ZA 1VA4A 4PZDA 1BSVA 2FPMA 4RSHA 3TAUA 1FU8A 3SC2A 2XYPA 3C3KA 4PHHA 4LHZA 3C48A 4ND5A 3HB5X 4GPIB 5AKXA 5EAIA 1A9QA 2QTBA 4JNKA 3DF7A 5B3AA 3TBKA 3U61B 5LBTA 5JZBA 4RF5A 3K9FC 5A7HA 1LJLA 3ODGA 1BEUB 3WMGA 1J8FA 4FD2A 1ZH2A 2D6FA 2HYIC 1JQKA 5CT4A 4AQDA 1GKUB 1QHSA 4C7BA 1DU4A 1KYZA 2F9MA 2D62A 1L6RA 5K3DA 5LXTF 3W2EA 1EVYA 2NQTA 3VC7A 3QSYA 5BR1A 2VK2A 3TVTA 1IYZA 3ND9A 4R1PA 1LLQA 1R5BA 3OJFA 6CHYA 4H7DA 2XCIA 2JJYA 3FOZA 1FYWA 5J2UF 1BO6A 2ZUDA 5KBYA 1W2WB 3O4FA 3VNVA 1U5BA 1E2PA 3U7GA 2ZTSA 3PGKA 3K4PA 3CX3A 4XGIA 4B79A 4M6WA 1RHMA 2H06A 3ZD8A 1XZGA 1L1QA 2HO5A 4DBVO 1JQBA 1JJIA 2LD4A 4ND6A 3QFCA 4OFXA 4K1XA 4S1NA 5DW0A 3TKLA 2NQ2C 3EEBA 5ALRA 2V55B 1P5ZB 3PJDA 3SGLA 1DFIA 2IS4A 1JEYA 3AZOA 1O95D 4N49A 4D9JA 3RYHA 2Z4TA 2VC2B 1IZ9A 4CMEA 4UDYX 2R8BA 5FORA 2C1XA 3CE9A 4XARA 1L5KA 4MRMA 3RABA 4MMZB 1IIBA 1DXHA 1QLJA 3R7NA 4A27A 2J32A 2OFOA 3QITA 4F3CA 2C1ZA 2VRCD 1JTEA 2WP0A 1CUAA 2C07A 3FPAA 3QX7A 4YRLA 5TQ2B 1G66A 5C2JB 4OYHA 2J3HA 4P2GA 1DT5A 2AC4A 2IUEA 5BMOA 3BK1A 4TS1A 1MB3A 3MJFA 1Z34A 1KYYA 4HQ6A 2FV8A 1E8MA 2AK2A 3RVRA 1RAGA 5BQXA 1NI4B 4NZMA 2I2FA 3VPFA 1JIJA 4KQ9A 2YN4A 2HY7A 5AJHA 3WLAA 1NMYA 3NMUF 5JJLA 2OGUA 2ZIAA 3DDSA 2HWXA 2J9GA 4KYTA 1YJXA 3UVEA 1J24A 4MV5A 1MUUA 4O2BF 4P08A 3A32A 1KQPA 3EULA 2JLUA 4CKCA 3N2GA 5BW5A 4ZWNA 3D8BA 4NJMA 4Q1CA 1SUBA 3ZDAA 2JI4A 3QV2A 5J2TA 2IIVA 4KSCA 2ACVA 1V5IA 1IHYA 2RSLA 2WRZA 3GD7A 2QVLA 2OHIA 4TVSA 4M60A 4I2NA 1I7LA 1JW9B 3B89A 1XD8A 1G8SA 4OHRA 1FZTA 4XKJA 4XM0A 4JXZA 3EGVA 5FPPA 3RSFA 3ABQB 2EWVA 1TU3A 3UJAA 4JC4A 3I42A 1GAQA 2Z5GA 1DV2A 3Q40A 9ABPA 1DKMA 5CLJA 5ALLA 4JLPA 1E0JA 1KU0A 2HLPA 3RHTA 5IKEA 4BQSA 1U2GA 3WLSA 2GRAA 2DY0A 3E5RA 2VZLA 3ER6A 2HF2A 3OA0A 5EG5A 3P2KA 3ZWBA 4EFLA 5JQGB 2WSBA 1X15A 5CRIA 4BWYA 4K2HA 4AX4A 7ADHA 3L4KA 1YBVA 2O2YA 1RQGA 1TJ5A 2O9JA 2R68A 3L18A 4DDHA 4KXVA 1NP3A 1OOEA 4FLMA 1V96A 4I3HA 3H6HA 1UMCA 4BLUA 4KYUA 1OCEA 1VA5A 1ANKA 2BWJA 3T0FA 1JIIA 2FXIA 3UAVA 2R86A 3W77A 3ZHTA 1XRJA 2P2LA 3LUPA 3V7FA 3WGLA 1XTVA 1V2GA 2Z4RA 4IV0A 1E9CA 3QVMA 2WWVD 1EFPA 1P72A 2V7QD 3KFVA 4XR9A 1SCBA 3TLYA 3V8PA 1M83A 4TV8F 3RE1A 3UXHA 4A8PA 2BH2A 1PN3A 2BZ0A 4ZYZA 3TB6A 3BAFA 4MKIA 3TNJA 2NXCA 4MI9A 1E1DA 4RGVA 4J7UA 3ZCXA 4MVJI 1JLRA 3GGGA 4KH1A 3GFQA 3IP3A 4PNEA 1JLKA 2MYNA 4NBVA 1CZLA 1ZQ1A 3SZ3A 1IPFA 2Q0HA 3FROA 1MNQA 4XEHA 5G4LA 1BCSB 3LBIA 4MYTA 3ECSA 4M9CA 4PYNA 5TSDA 4B33A 2Y77A 1JHAA 4E6PA 2GPBA 5DE3A 3W79A 4X3CA 4JYZA 1LSOA 3ZXYA 4E6EA 1YUMA 5ELMA 2DUMA 2REQA 4OP1A 4XIFA 4TLMB 2ZULA 3OJEA 4O25A 1NJSA 5FOTA 2ATIA 2Q4RA 4ARZA 2Z6QA 2WPDD 2XE8A 3LC2O 4MVJP 3ZWQA 5JI2E 1O54A 1LNZA 4UHFA 4UVIA 4M1SA 4FQ8A 3VPSA 5AQEA 2PUGA 3OJOA 1O2DA 4KAFA 2QL9A 2DT5A 2I5PO 3AR7A 2BM8A 3NBUA 3TI9A 3WA6A 5JJCA 2A9PA 2IT1A 2JGKA 3UH1A 2BZGA 3A6JA 1SPXA 2GSWA 2WNSA 3IBTA 3HC7A 4Q9DA 4F4CA 1KBQA 4ZOEA 3IQIX 2QAGA 1F1BA 4ZALA 5CLQA 1XRSB 2RGDA 4JK3A 5CNMA 4TTTS 2GUWA 1GZSA 3GJXC 3FPCA 4XX0A 3WOHA 5LQKA 4B7ZA 2YOFA 1O5IA 5REQA 1UFVA 2KW5A 3IUQA 4K9MA 2YCLA 1JR3E 1H4QA 4GQAA 1RWXA 4MW2A 1J0BA 3CW2A 5B30A 3FSEA 4FOPA 4KTTE 3V2GA 2YC4C 3K1JA 5K8LA 5CXQA 1LLCA 2CMKA 2ZTUA 4B6PA 3OTQA 2FEKA 4RVGA 4PXYA 4PCUA 2QSUA 4N5MA 4RD1A 5JBNA 3B3GA 7YASA 5FV4A 2P4HX 2A94A 3KFXA 5LYJF 16PKA 2WUDA 4LYJA 2QZ9A 2XVAA 4JLBA 4RABA 4UHHA 1CFZA 1NF8A 4QLBA 1YDHA 1VMAA 1G21B 4JJFA 1NM5C 1XLTA 3MLAA 4XCQA 3VDQA 3D7LA 2GF9A 2AWNA 3KLMX 1SBHA 4ZOBA 5CDYA 2VHQA 3SSOA 5A4KA 2ZTHA 2OO3A 1W2HA 4JBGA 5ALQA 2DR0A 3P0EA 3JVDA 3WLMA 2W2MA 3A4YA 4L15A 3RDPA 3TXAA 4LMBA 4HQOA 4O2LA 4UD2A 3HGMA 2CVZA 3SZOA 2H5IA 2PJDA 3QPVA 3QVXA 3FR8A 2C99A 1M1YB 4KO3S 1LBTA 3RBVA 4DIKA 3NKFA 1X7WB 2OHFA 1MZVA 3JXEA 1EYZA 2FEOA 4FWBA 1H66A 4TUYA 2F3TA 1F2TB 1N5KA 4FS3A 1GUDA 3NUQA 1F0KA 2OM2A 3QFSA 3S2FA 2EIHA 5ENDA 3FX2A 3L49A 2PKQO 4P3XA 3EMKA 3DFIA 4YJGA 2R6FA 3B2NA 4PNZA 3KJNA 1U3CA 1CULC 1IHDA 1SR8A 1UEXC 4LV8B 1GU1A 1A0OA 1IZ0A 1KJ8A 1U8AA 1ZGZA 3M2TA 4FFMA 4EMBA 2GGSA 1JGTA 1D07A 1DC5A 2ETVA 2J59A 2QU8A 3D3JA 3Q10A 3RC3A 5EIHA 1RABA 4GBGA 5B3JC 3BCRA 3HDHA 5FNVF 4XEUA 3NIWA 3H2GA 4HAWA 1FYDA 1V39A 5D51S 1XELA 2MSKA 4R68A 5F5XA 1SUWA 3OMLA 1U1FA 4FFBB 4G07A 1ISIA 2I7CA 4HY3A 4X8OA 4B6QA 4B80A 1U8ZA 4A0RA 5IARA 1JMVA 5LMUB 3JR3A 2O8FB 3BMQA 4PLFA 4NOMA 1E4OA 1ZD8A 5BUCA 1G9SA 4G1EB 4QBFA 2P35A 3G0BA 4LSGA 5L3RA 2QX8A 1DRWA 2PYZA 4PO9A 1DWPA 2Q1TA 4II2A 2NU8A 3RF6A 3ZY4A 1OH8A 4XOIA 1NQVA 4M3NA 1TAGA 4PQYA 1GZVA 1XT6A 3D8TA 3R0QA 2FOIA 4IIBA 4QT4A 1HX7A 3T0GA 4U9IS 2BISA 3ZHRA 3VU3A 4RS4A 1M6VA 2ZYTX 1GUFA 5GOTA 4DTIA 3T1QA 1QRSA 2A1IA 3G2IA 1HG1A 2O3UA 3G49A 3K0FA 3QE3A 4NKRA 3GZNA 4HI0E 5DIFA 4NABA 3HDQA 3OTIA 4D3XA 1Y34E 1I6LA 4FMCF 2HADA 1ZXLA 1H0HA 3IP6A 1P6UA 2OB2A 3G8YA 4HAOA 3EDQA 8LDHA 2A30A 2PT5A 1RXSA 3NHJA 4RZ2A 1B0PA 2AFIE 1MPXA 3BHJA 4CV0A 3QUQA 3K9LA 5ALWA 3ZW9A 2NPOA 2O1SA 3DV0B 2ZJOA 4PSAA 1GYRA 2DLNA 4P53A 3ZE9A 1M1NA 3SHFA 2BCEA 4ZT3A 5IJ0A 2EW8A 2PZMA 2VHTA 4PSUA 1E4EB 2XUDA 1A9TA 1E79D 1P3JA 2A7XA 3H1AA 3M34A 3FMOB 5CYGA 1GTJ1 1W94A 4PX2A 1DXYA 1JHXA 1XALA 3MM4A 4YLEA 5M2QA 1KZ7B 4AY4A 3DBOB 4EB6A 4LKRA 1TUBA 4DV7B 5D6NA 4HYTA 5HJ5A 1XVAA 4UKDA 4OQPA 3TCKA 1VJCA 2F4VB 5F2NA 2RJOA 3CLTD 1U7OA 4YC7A 2ZB7A 3IT0A 3I5UA 4JHXA 5HG0A 3HVIA 2RGEA 1Z3IX 3QXXA 4I6JA 4WQMA 4YJHB 3SF0A 4WZBE 1KI1A 4R8KA 4Z86A 4C0SA 5I6DA 4CKEB 2XTNA 2WPDA 3OT1A 3V33A 1NVUQ 2IITA 4AB1A 3I6ZA 1XK6A 2FA9A 3AC0A 4OYRA 5KVQA 3I9NA 1CUFA 1AB5A 3B1WA 4CM5A 1C14A 1S6YA 3ZLJA 1R0CA 5FV7A 1A7KA 1KJYA 3PL1A 3ZJVA 1AURA 3AKEA 5FQOA 5ED4A 3EIHA 3GRPA 2R7KA 4LBZA 1KE1A 2PE5A 4IOLA 4OK6A 5KU1A 2C7OA 4NMXB 4LVCA 1GRRA 3I12A 4MLPA 3WLJA 4BNTA 3H0EA 2YQ5A 2ISSD 3GYGA 5BRNA 4E31A 1X13A 3IXMA 1C4OA 1QHGA 2GJ4A 3EYAA 2A0WA 4GYJA 3AL3A 3H5OA 4C7MA 4J1TC 1PL7A 2CXOA 2ORWA 4GMDA 1RBMA 5CLGA 1O57A 3ZDQA 2OCYC 4E5PA 2A92A 4GM1A 5K6TA 1WKBA 1E6WA 1HSZA 1MAWA 1XLWA 4PE5B 2J30A 4Q6BA 1LDEA 4U9HS 1UJ2A 4UE2A 4M8IA 4OUDA 3SZRA 3NHZA 4P5EA 3H2HA 4LI3X 3CSDA 1ZUIA 4MVJF 1JDUA 4B9EA 4OKIA 1MOZA 4C0KA 4UFPA 3RT9A 3T9AA 5LUAA 1CXZA 4TTRA 1E63A 2ZI4A 4I8XA 4PGFA 1GKKA 4RMNA 5K03A 1YJ8A 3E9DA 4B4WA 1GU0A 2DPMA 1U3WA 2QTGA 2RH5A 2XNJA 3BGOS 3DXFA 4RORA 1YJ5A 5TPWA 4AKGA 4DLUA 5C3UA 1JYFA 1E18A 3EHEA 3CLUC 1L5YA 1CX9B 2IYWA 4CG0A 5CBKA 1TQDA 4CLRB 1QTNA 2RHBA 2AQKA 3W5IA 5IYZA 2B6NA 2I6GA 4HVAA 4FYKA 3WNZA 3ZXXA 3C7CB 5LZ7A 5I7UA 4HJXA 1J2RA 4FBGA 4BMVA 3W04A 1XCJA 3PEEA 3S1SA 4IJQA 2AN5A 4ZYXA 2J0QA 4RFSB 2J6BA 2P78A 3TEJA 1EU1A 3DTVD 1QFXA 4MWZA 1UBFA 4HS4A 3K0AB 2C3UA 2IXAA 2YNMC 2A0FA 3U4QA 3CN9A 2PL5A 2VTKA 1MAHA 2KBEA 3O92A 3OOJA 3LXMA 3QELA 2DFLA 4S1OA 1ZRHA 1MIOA 2BKAA 4MIKA 4Q5IA 4K6GA 2GA8A 1G8JA 3OZEA 3ZDCA 1M2NA 1NXXA 2OECA 1IOVA 3MWKA 1JZSA 3GR6A 4PFKA 4ZO7A 3O26A 1WMBA 5F52A 3EPKA 4JC5A 2GERA 4WUVA 1EDOA 2IYOA 1UKAA 4I8DA 4Y2XA 5IFKA 4YALA 1VLQA 1BVRA 3A7DA 5J1SB 3PG5A 2WSSA 3UHOA 1JXQA 1UJ4A 2I65A 3QBDA 2B1IA 3SYLA 1Z6QA 2OHHA 4OL0A 2FZKA 4ESHA 1SHZA 4S24A 4GRAA 1QS0B 2BKEA 3A1VA 5B2FA 1J5XA 3NC1C 1A5TA 2NXJA 3CG0A 4IHJB 1HQKA 1O9GA 3TGWA 3IBFA 3F3YA 4MQUA 3PPXA 4OVKA 2QG6A 1X39A 4KAXA 1PSZA 4PYLA 3WGKA 1UJNA 4FB4A 2XWQA 4FFNA 2RHWA 1Q11A 1KOLA 2I7XA 1GTMA 1RBQA 1T8UA 2BEUA 1ZR2A 4MUAA 3QUCA 4PYQA 3JQ6A 1BA2A 2AMYA 1Y7IA 2XAUA 2D5CA 1YMQA 3FNBA 1HM5A 1I8TA 4F5DA 1N3YA 4DCTA 1S3SA 2QEQA 5DHAA 1X7XA 3JZMA 4DLPA 3QHQA 4II3A 4XB2A 2HI0A 1BHSA 2ZSEA 2D0OB 2HA0A 3NFRA 1PHRA 3Q6NA 2CHVA 1XTRA 1OYYA 5BQ3A 4NENA 4C2BA 1N6LA 4P34A 5BWOA 1FQKA 3I5YA 1FNBA 2CEAA 3W6OA 2H7CA 1PSWA 3BSYA 2FUG1 1G1MA 5IXSA 4OHWA 2UYYA 1KKLA 3C8UA 3BL8A 2QGZA 2UYOA 5SZJA 3RIGA 4KN6A 3A0RB 3DOCA 3FFWA 3KPUA 2CK3D 1F1JA 5ER9A 1XU7A 2GHTA 4ON9A 1D03A 2G1PA 2GPTA 1DT3A 4RA9B 2GEBA 3BIFA 3EDYA 1XEXA 4C4TA 5KNLA 1N8SA 1Z0SA 3U7FB 2XZLA 2SHKA 3WNVA 4U2BA 4YCMA 1ZPDA 4R2HA 2HWWA 1LSUA 1YTLA 3VPBA 5FYDA 3U7EB 2AJCA 5JW6A 2HRBA 3DLAA 3QNMA 1DO0A 1PJAA 1XAHA 3NKVA 3S8MA 2I7DA 1GRCA 4JI1B 3ZHBA 4AJNA 3IKLA 5F33A 4HHEA 2AIRA 3AU8A 3OJ0A 5JRDS 2PJZA 2VH5R 2ZREA 4ZTZB 2DKOA 4BQOA 4I3GA 5FPQA 2MDTA 4DT1B 3CE6A 3WK8A 2H4HA 3GVCA 3DZGA 5G3ZA 4EVIA 3ORRA 4YMIA 3RFCA 1W29A 1N9ZA 4F5WA 5BYKA 4LOJA 4G0YA 2ISQA 4QHSA 1KH1A 3RBAA 3R3YA 4C14A 4D9HA 2WYVA 3OO1A 1FW8A 2G5CA 2CBZA 2EJWA 4F4HA 4AAYA 1WU7A 4B84A 3PJEA 2DLDA 1D2NA 2QA5A 3K96A 1NLFA 3GP5A 5TX7A 2QS9A 4QWWA 3BMXA 4GM0A 4ZIRB 4AMUA 5C1DA 3IKJA 3L4BA 4ZK2A 2A9KA 3E6AA 1BHJA 1S9HA 3HP1A 4NFLA 3PV0A 4YJ3B 4OREX 1XEWY 3VUFA 1DEOA 1XRRA 2OCBA 3DFUA 3IB3A 1NN3A 5AUNB 3NWBA 2X6TA 4NV1A 1U8XX 1PJRA 2I4IA 2VUUA 3AHFA 2POQX 5DK6A 1Y9EA 2H1HA 3BH0A 5THKA 2FFHA 4L4RA 4EK9A 4E5DA 2YIJA 3GRRA 1T2EA 4PXAA 4AJ4A 5L3VA 2RMKA 3S40A 2FR8C 2JASA 1W59A 2QVYX 2QJWA 3W9SA 4AULA 1NVXQ 1YDWA 5KNDH 5KPJA 4NPHA 4RETA 5HILA 1OXXK 5J1TB 3T9CA 4RK5A 2ZE8A 3L1HA 1VP3A 4K6CA 3M5DA 5ESXA 4NMMA 4FHFA 5DM0A 1FXWF 2FWNA 3AILA 4J1SA 4A82A 4YRNA 5LJIA 1DAKA 1DKLA 3GMDA 1IM2A 3DH0A 3HM2A 4O4LF 4BVKA 2MT9A 4Z4CA 3AOGA 3IJ5A 1LH0A 3NOVA 3WK6A 3U16A 1IIRA 2BYTA 1RFLA 2V6FA 1UJMA 2JCSA 1RYNA 4ZFNA 1GDHA 4H6XA 5CDUA 3WL4A 3ZUGA 1ETHA 4BQIA 4R6WA 2W6QA 2V7XA 2HK9A 3SEAA 5A05A 3V4PB 1WXEA 5K0NA 4ZCTA 3IOMA 4JOCA 4M22A 3I4FA 4TPKA 4EYQA 4X8LA 3VTKA 1F8XA 1FOEB 2B5OA 3H65A 2CNBA 5J4LA 2GNAA 2AA3A 4MTLA 3UMBA 2PGJA 4Z4GA 4F72A 3B12A 1T2DA 2GVNA 3SX2A 2N9UA 1GNLA 2QSZA 4RUKA 1SKUA 1SUAA 1YV9A 1NQXA 1UKEA 3FOFC 3DTVB 4BFTA 1L7EA 2EHDA 4M1KA 1U0SY 2EF1A 3HCDA 4M1OA 5KINB 4LXTA 5LZ9A 5ICEA 3WGHA 1EUQA 1MH9A 5ALHA 3UUFA 5KB3A 2VJOA 2ZK7A 2HWUA 1I6MA 1FZQA 2Q49A 3CZCA 3CCFA 3KKZA 4DC1A 4RD6A 1OXMA 2EWWA 3X43A 5EVCA 5JECA 3LQYA 2JFWA 4RJKA 4A0GA 4CCAA 3AETA 4EGAA 4QOHA 4GNKA 4EY5A 1EZZA 3D1VA 1TTTA 3ZWVA 3MBIA 3VPCA 4LDPA 1GPYA 3JVVA 5CB6A 2P9EA 4LGYA 4MHTA 4MW9A 1IHOA 1IE3A 2JH8A 4LYHA 3PRJA 5IAGA 3MELA 4CF4A 1JQLB 4NDNE 1WBDA 1PNVA 4B5KA 1EDZA 1SD5A 2FRDC 1WDMA 3ZGVA 3TLMA 3WK5A 3D3EA 5LZ8A 3E9QA 4RLQA 4BO8A 1RHUA 2PLAA 4P7KA 5JSZB 2CZCA 4PGAA 3B3FA 5GONA 1Z0ZA 3V46A 3NC0C 2Z5VA 3VU1A 4D6PA 1GGHA 1U7WA 3PFIA 3WMXA 1FP4B 5JZMA 3EUFA 3ST7A 1W2GA 3AONB 2YXLA 5EQJB 3TTXA 1G20E 4GUDA 3TUJC 2BLNA