3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
3PUWA 3FKSD 3N2IA 3ADCA 3P4YA 1QHSA 2Q3FA 2IEZA 4QBHA 1Z2CA 1NBMD 3OAAA 3VNUA 3U4QB 2QTVB 1FW6A 5KTYA 4MGZR 2ZS8A 4BLOA 3VKHA 3KQUA 3SJAA 1D2NA 2FU5C 5CK5A 2CVFA 3U5ZB 1DAGA 2QQEA 2ZRAA 5DSZA 2IYXA 4QL3A 3ASYA 3B1YA 1VG0B 4ZDIA 3RRYA 1Q3HA 1MR3F 1IN8A 2IYSA 2Q9CA 1JAIA 1N5JA 2I3BA 2O8CA 2WWWA 4HATA 1O3YA 2GAAA 2A5FA 4HSEA 1E32A 1E2EA 3D31A 3SJBA 1XMVA 4M22A 4UXHA 1AN0A 3U7EB 4QJ5A 5H8WA 2XZLA 2IUSA 2ZJBA 4MKHA 4QXAA 1EFUA 4OL0A 1Q44A 2HDNB 5FTKA 4CYMA 3QPVA 1SVMA 5P21A 4FD2A 3AVYA 2WWFA 2WBLC 1Y63A 1UEJA 2ZU6A 3K9HA 4HAUA 2NTYC 4NDZA 4JVMA 4FWIB 1OFUX 1YR9A 2BMDA 1VCIA 4PTLA 2ZYVX 2W2VA 3B1WA 2YHSA 1XCGB 3QENA 4OQLA 3IO3A 2RGNA 3ZH9B 4YMVA 4ZV4A 1OFIA 5KPJA 5TY0A 5FOTA 1X6VA 2O8EA 1HYQA 2NIPA 4Q01A 3U44B 1ZNZA 3QXCA 1SVIA 5G3ZA 1E2DA 4QM7A 3IDQA 4AKIA 4URYR 3QF4A 3WNBA 3NG1A 3CONA 4PC6A 3T5GA 3TK1A 1L7VC 3AP1A 3OEEA 4PQYA 3X1XA 2JLVA 1AGPA 5EXXA 2C2HA 1KSHA 5KSZA 1P2SA 2R6AA 2A3RA 2QSYA 1U0LA 3D8BA 3B13B 4M1KA 4R7ZA 2R6FA 4GFDA 2NOAA 1GNRA 2QZ4A 4IRUB 1FUKA 1MKYA 4ZDJA 8OHMA 2BDTA 3HU1A 1EWQA 1K5DA 3KZ1E 3C16C 2W0SA 3VR2A 1Z0FA 4C0SA 2KI5A 2EFCB 1G8GA 2H57A 5FR1A 1GNPA 4F7WA 5KHOC 2GKSA 3OEHA 3KKMA 1XJCA 1NF3A 1NP6A 4AK9A 1GILA 2WICA 4URXR 1GKIA 1RPZA 2JEOA 3RLFA 1DAKA 3BGWA 1WRBA 3R8FA 2OXRA 1N5LA 1ZNYA 3F8TA 2QP4A 1BYUA 2JLRA 5AJVB 4D82A 5JHHB 4MRSA 4QBGB 1RJ9B 1YZQA 2H18A 3QEJA 1AGRA 1UBFA 2JDID 1XEWY 1R0ZA 1W46A 1T91A 2F3RA 4PQFA 1S2MA 4RZ2A 4A6XA 3IQXA 4PZLA 2PL3A 3G82C 3QKRB 3P27A 1TPZA 5FI0B 1OSNA 2V1XA 1BIFA 2BCGY 2YC4C 3KJEA 4PX9A 1EFHA 2CJWA 4XVRA 2ASEA 4NYIR 4YDSA 5EZ6B 1ZNWA 2DPXA 4M0LA 4BQSA 2IS6A 4RFSA 2GF0A 2RHDA 4L15A 2QE7D 3CKLA 2ZRLA 4O2RA 1QVAA 1G7SA 2H92A 1NVUQ 1YZKA 1XXHB 1JEEA 3H4MA 3R7WB 2F6RA 2WMOB 2ZAMA 3MMPA 1IONA 4DXAA 1P2VA 1DVRA 1M7BA 2NG1A 3KXLA 1OIXA 1Q57A 3L0IB 4DSNA 5A4JA 2QY9A 2QORA 2VLIA 5FTJA 1CJTC 3IIMA 3GJ6A 3TAHA 1N6OA 4W7SA 5FPSA 2IHBA 5GJWC 3GP8A 2J3EA 3MRSA 1SVSA 3SZRA 3BBPA 3ASZA 4US0R 4Q4JA 5TDHA 1A1VA 2RKOA 3H2YA 1SZPA 2NZ8A 1UM8A 1YZLA 1BS1A 5JWHA 1W44A 4LJAA 3TVDA 2AXNA 3NDBB 3AVUA 3AUXA 4EJSA 2HF9A 2NPIA 3LRPA 2DR3A 1S96A 4LJ5A 4IHQA 4H1VA 5KSOA 1VCNA 3P26A 2BOVA 3QUSA 2WZQA 3K0CA 5DIFA 1KMHA 3U3OA 4HLUA 2WJIA 5FUWA 2I4IA 2IL1A 3HPQA 5EUMA 2IS2A 1K6MA 5KDLA 4ZKEA 1CEEA 2V3CC 1QDEA 4A6PA 1US8B 3BB4A 4EJSB 2P6UA 5KDDA 2GJKA 2X2EA 3HU2A 4HDCA 1G8YA 5JI2E 2RGCA 3OESA 1ONBA 2ZUBA 3IIJA 3AKEA 4G5SA 2G1JA 3PG5A 2QRNA 3L8ZA 1E2NA 4IVRA 3GLHB 5CM9C 1EXMA 3TMKA 1GNQA 3QXSA 2R6CA 2QROA 4CT4B 4RJLA 3FHOA 2IF0A 1LVGA 3FFAA 1EX7A 4NHOA 2QPAA 1JECA 5TV2A 5E7IA 5FBLB 3SN6A 1NVXQ 4QNRA 5L8VA 1T9HA 4JBYA 2BBSA 3MWKA 3PITA 4Q7KA 5D3MB 1CJMA 3RS5A 3A1VA 4TMVA 2C9OA 4JLPA 1N2CE 5B57C 3HU3A 3PR1A 4GBMA 1NIJA 5JHGB 1G3MA 4EJSC 2ZJOA 2VBCA 3BORA 3WHKA 3LBIA 3BFKA 2PJZA 4PAMA 3Q7PA 2E87A 3S1AB 2XXAA 5B58C 4HUQA 4US1R 1SKYB 1IOZA 1GIAA 4IOMA 4LCBA 3V4RA 4QGFA 2IA5A 2RGXA 2ZETA 1G18A 2FV8A 4V0LA 2ZRMA 2Q21A 1PZNA 1FP6A 1RIFA 3B1VA 3KKPA 3B1XA 4LBYA 2OCBA 4Q7JB 4ON9A 1TTTA 1SXJA 1YZUA 5CM8B 3KKOA 3S1AA 2NO1A 2W58A 4JL8A 4Q9IA 4UNRA 3PJRA 3I62A 4M9XA 4DEYA 3BAFA 2EVWX 5F98A 1FP7A 4KVGA 1NN1A 2WWGA 4LDJA 2ZE7A 2WOOA 3K70B 4D4LA 5HKKA 3GLFA 1WF3A 3TBKA 4TQ9A 2IYQA 3CIOA 1N3BA 5AUQA 2J7KA 4EPXA 5DI3B 3A1UA 3K0FA 1NVWQ 4JKIA 1NG9A 3BB1A 2J9RA 5FTMA 4YLGA 2Q3MA 1BYIA 1RW4A 1ZW6A 3AGQA 4UNSA 3ADDA 1L2TA 2ZRNA 4UNPA 2G1KA 2W83A 1FX0B 1PLKA 1TF2A 5AUNB 1VIAA 1T6NA 4NYIQ 3VU9B 4B48A 4KHZA 5JS7A 4BASA 1FMLA 5GJCA 4OI0A 3KQNA 4OJQA 2VTKA 4QKQA 3JVUA 2BM0A 4PPQA 3CNNA 5LDDC 1IN5A 3B6EA 3RWMB 2V7QD 1FTNA 4V0NA 3ZQ6A 4DDTA 2C99A 3EC1A 4JBWA 1UPTA 4TYNA 3OEHD 1OW3B 1E79A 4Q4AA 1OXSC 4RKFA 1KDRA 1GOTA 4YMWA 1C1YA 3K09C 5EP3A 2WWYA 4AKHA 4KO8A 4DZZA 4C0HA 4JT2A 2QENA 1G5PA 3BXZA 1GP2A 3A1SA 3E2IA 4EIWA 2QMHA 2ZJYA 3FMOB 4LRWA 1GRNA 2GJSA 2NQ2C 1KMQA 2AN9A 4DLYA 1FQKA 3OAAD 1KDPA 1CULC 2A5GA 2VSXA 1DPFA 5LD2C 4MYTA 5KNCA 1UKEA 2N42A 1SKYE 1KO1A 2OHFA 3CX8A 4BFUA 1SHKA 4CEJA 2XITA 1GTVA 2YWFA 5BQ5A 5FPTA 4M9SA 1II8B 1XZPA 3U4QA 2OAP1 1RRCA 1IY2A 3FHTA 2VP9A 2CMKA 4YMSA 1GL9B 1Z0AA 4JSYA 3EXAA 4Z1MD 3GJ4A 4PO9A 5HKKD 3ZZTA 1KAGA 1E96A 1KNXA 3NHBA 3SDZA 5CLLA 3NDPA 2B8WA 2BHRA 2PEZA 4A8JB 2CHGA 1EFTA 1MRSA 4TMXA 1E0JA 2H1LA 1EX6A 3KKNA 4F93B 3LWNA 1CR2A 1P73A 4KODA 2VQSA 4RZUA 4QGAA 3CRQA 2OFOA 1SHZA 4ZI2A 4KLZA 2OEPA 1KSJA 1N25A 3EIHA 2H8KA 1MOZA 3FPAA 5K8TA 3RC3A 4BFSA 2VF8A 4LV5B 3WXMA 3BRWD 3QF7A 3U60B 1S3GA 5L3VA 4QHTA 2QPOA 4YDHB 3B9QA 1OHHD 1S1MA 421PA 4Q4LA 5FBWB 3FYHA 4QG7A 3PFIA 3AP3A 5CB6A 1ZUIA 2GBLA 1HA3A 1UBEA 2CDNA 3DO6A 2XOKD 2ZRCA 3GLHA 2HUPA 1TU4A 1OKKA 1XTIA 2NGRA 3NBYC 1Q21A 1LB1B 221PA 4X8MA 1SQ5A 3QF4B 5FOVA 3UXMA 3AM1A 4CRWB 2IEYA 4W5JA 1G3UA 3TUJC 5J4LA 3K70D 4G1UC 1E2HA 4B76A 4BRUA 5FUYA 1OIVA 2ZI9A 1TNDA 2VYFA 1Q1EA 3Q3JB 4LJ7A 5FOXA 4WXPA 4JYBA 1LTQA 4MYHA 3CX7A 4HYYA 1KK0A 1XNJA 1ZM7A 4TL7A 2FG5A 3AVVA 2ANBA 2IS1A 2D2FA 2Z83A 3CF6R 5KNDA 2ZAOA 3QNUA 3ZQJA 3DZ8A 2C04A 2QA5A 4OHXA 2O8FB 5UKDA 1N5KA 4HAYA 3R20A 3A36A 1NY6A 4DCUA 1GSIA 4NU0A 3CH4B 2FDCA 3IPYA 5D3QA 4RSGA 5IDVA 1K5GA 3L0OA 4HEJA 2ZS9A 1A2BA 5CB8A 3I92A 4CZ2A 2CE2X 2CL7X 4URUR 5FH9A 2J7PD 3VR4A 3DOFA 4GP6A 1HV8A 1P62B 1OB5A 3LV8A 3ZZUA 3R9IA 2QPTA 3QY0A 1G8PA 1Z22A 4NPHA 2QM7A 4LYFA 4DHEA 4FMCF 4LK2A 5FOWA 1E9SA 4KVAA 3WY9A 3P32A 3KUCA 3NEJA 3EARA 4UNNA 1CJKC 4KCGA 2PJRA 2J46A 1KO8A 1E1QA 4KV9A 1AK2A 2P6NA 4RD2A 3HP1A 1DG1G 5GVSA 2GHIA 3CUEF 3CX6A 3MUFA 2F1JA 4OHWA 2RB4A 4GOJA 1NSFA 1L8QA 5F9HA 1Q20A 3THWA 3BWDD 2F1RA 3ECCA 4BLQA 3QJYA 3SBDA 1OV4A 2P67A 1NLFA 3N70A 2FH5B 1W4CA 4WIAA 2ZRJA 3AGPA 3ZS9A 3VHLB 2GZDA 2AFHE 3Q7QA 1OKKD 2RGDA 2V54A 4TLAA 1ZCBA 4LHXA 1Z6GA 3BB3A 4BEJA 1IM2A 2DCUA 3F0TA 2VP6A 3QBTA 4LZZA 1GG2A 4TMZA 3THWB 3ZGXA 3I4LA 5F2EA 1W49A 3GQBA 3EASA 1E2MA 2GK6A 2ZQ5A 4LJ4A 4C0QC 4HZUB 2ZE6A 4P32A 1R6BX 1VCOA 1ZRHA 3VKWA 3PEUA 1YR6A 4U7DA 3GPLA 1JXMA 1UEIA 3EWSA 1CRQA 5EJEA 1GVNB 4Q4AB 4LBWA 1J8YF 1Z8FA 1U0HC 2CCKA 4GNKA 4NYJR 1H8HA 4FN5A 3AVOA 2GA8A 2P5SA 1G7RA 1CXZA 2QAGA 2OLKA 2WV9A 3D7MA 1IJFA 3E1SA 4TL9A 3GLIA 2BVNA 3QKUA 4V0ME 2ZR7A 4OK3A 5EE5B 3B8HA 2WAXA 2ERYA 6Q21A 1VDZA 4PZZA 4PC2A 2ZJ2A 4TYPA 4K46A 5BWMA 4XWOA 2YZ2A 3UMSA 1T5LA 2HT1A 4MGKR 4LY6A 4X8HA 4BFWA 3TAUA 1F48A 5BW8A 1YE8A 5FPKA 2VHQA 4UJ3A 3SNHA 4BPBA 5C46F 3NC1C 4C7OB 2QG6A 4IOJA 1G3QA 1R7RA 5C2JB 3GFPA 2AFIE 2WOJA 4B73A 1YZNA 2A2ZA 4YMUA 1XD8A 5DH9A 2ZRGA 3RABA 2HJVA 3NBZC 3I8SA 4TTRA 4GPTA 1JB1A 1NLZA 3SFVA 3CZQA 4A4DA 3ZD6A 3FB4A 4O2LA 1OFTA 3ZZ0A 2YOHA 2W6ID 1B0UA 2DWQA 1ZUHA 2XSZA 4B3CA 1KYIA 1CS4C 1RRFA 1T8TA 3PUXA 1P72A 1ZVQA 3IGFA 4V0MA 3SYLA 5B64A 4TL8A 3FMFA 1MH1A 1NMZA 1F2UB 2BV3A 3B5JA 4BECA 3ZVLA 5AJZA 1J99A 3C41J 1DS6A 4AYTA 4N1AA 4Q9HA 1P3JA 2D7CA 3B78A 3MJHA 5CLQA 4C0BA 2B6HA 1KI6A 1Z6YA 3KTAA 4G0NA 4XH9B 1N6KA 2FFAA 1G3IA 1WDTA 2FN4A 5FL7D 2C5LA 4MITA 4OYHA 4ESVA 1J8MF 2R2AA 4EQ6B 3FOZA 1QHIA 1M7GA 3AEZA 3O47A 1NG1A 1OPXA 5AJWA 1UDWA 2Z6VA 2GNOA 1E69A 1N6NA 2YWGA 4O25A 3WP0A 5CDFE 4PSAA 4Q1AA 4AI6A 2LKDA 5BXQC 2UKDA 2ORWA 4CT5A 4JYCA 1OFHA 3B7GA 2GETA 3CRW1 3DPUA 4GSYA 3GLGA 3AF3A 3IIKA 2ANCA 1P5ZB 3ZYCA 1XP8A 1JI0A 4EFMA 1P61B 5CIWA 2Z5FA 5EP1A 1KI3A 4R2HA 4O0MA 3T61A 2O8FA 1G291 1K8RA 2VSFA 3W6PA 1LS6A 3MWLA 2PT7A 2GJAA 2JDIA 5DO9A 1P7CA 3DZDA 2AK3A 4WA7A 5GJBA 2IYYA 3NC0C 1GM5A 3ZD7A 3N2EA 4TMWA 1NVVQ 4DSTA 4Q21A 4AIIA 4D4MA 2FWRA 4Q1FA 1G64A 4TTPA 4ACAA 4V0OA 4IOKA 2XNDA 3TQFA 4TLBA 3E70C 4V02A 5J4YA 5LD2B 2D7DA 1U8AA 1XTRA 3IILA 2UZIR 2RH5A 4D4KA 1XXHA 3VX3A 1MRNA 2GESA 4IW3B 4IJMA 4MKFA 3R7WA 3QXXA 1QVRA 4R98A 2JASA 2QNRA 1EG7A 5BYJA 2ODWA 1HY3A 2GVDC 5DNYB 4FINA 3ADBA 3CR7A 1KZ7B 3OIYA 2MMGA 2XNSA 2JJ2A 2QM8A 4DB4A 4I1OA 1S9HA 3EW9A 1JR3D 4DKXA 2C96A 2P65A 3ETLA 4I81A 2ODBA 2CLDX 4JJKA 3C4JA 2IYRA 2ZI6A 1N0WA 1H8EA 1Q22A 2XJ9A 3U6KA 2AWOA 1KGDA 3IPXA 1YVDA 1BMFA 4KXFB 4V0KA 4A0RA 1FPMA 4TZ0A 2CK3A 2H17A 521PA 3BOSA 3CO5A 2ZXUA 1CF4A 1RVDA 5TB5A 4C2TA 2V7QA 1Z63A 4W5WA 3IQWA 1RRPA 1UADA 2ODNA 3EA5A 4GMDA 5DYGA 1FQJA 2ZREA 3W3ZB 1W36C 3LX5A 5G53C 1KK2A 4HZUA 1YU9A 2GEUA 4RZXA 3O8BA 2WVJA 4B33A 4Z54A 1FL9A 1CP2A 3UK6A 4A8JA 2BM1A 5JFGA 3AVPA 1US8A 3SHWA 3LFUA 5C18A 2ATVA 1SVOA 2JJ1A 2WSSD 2D4HA 1ZIPA 3HR8A 5G40A 4AG6A 2N1BA 3THOA 1ESNA 2KE5A 1COWA 1YR7A 2X2FA 4ZDWA 4XSHA 4U02A 4HB0A 3DL0A 1H8ED 3M0EA 3K9GA 1M1YE 3LLMA 1BO6A 1VYVA 1JQLB 2FPMA 1IXRC 3H86A 1GRQA 2ONKA 2VP5A 3PQCA 4M1TA 4UXIA 4Q03A 1TADA 2C98A 1R5NA 4PC3A 2ZPTX 4DCTA 4PPGA 1IY1A 4DCSA 3C15C 4G5OA 3KFVA 3SQXA 3BERA 5HR5A 5JMTA 4IVPA 1S4QA 3QKTA 4EPVA 1KJZA 3E5HA 3W8RA 4DLXA 3KJGA 2IYVA 4BLTA 4M4SA 5K8LA 4Q19A 4QFMA 2GF9A 1E98A 3ZS8A 4A2WA 5LBIA 5M04A 1TMKA 4TYWA 3D3QA 5H68A 2V55B 3UWKA 2FF7A 3EAQA 3VFDA 2JA1A 3T06B 4NCHA 2I1QA 5AUOB 1XPRA 1W36B 3ONWA 2FMXA 2JLSA 3P20A 3Q5DA 4HDQB 4DJTA 2Q9BA 1TUEA 3KKQA 1NKSA 3THYA 2BBOA 1XEFA 1SXJB 3EA0A 4TT3D 3B2EA 5JZVA 1DAIA 3BE4A 3C14C 2ORVA 3AVWA 4PPFA 1P9WA 1UKZA 5E7MA 3MWYW 3LXXA 3RHFA 5CDFA 5BYKA 1OB2A 4JS0A 3P1JA 1ZNXA 1G19A 5JS8A 3AKCA 1E2PA 1R4AA 3W5JA 2IYWA 2XSZD 4QC2A 3T12A 1Z6TA 1HTWA 2VP4A 1NLYA 3SBEA 4M1OA 4W9MC 2VEDA 2X19A 2WKQA 2ZRPA 3BIFA 4NCJA 3O8RA 4EPWA 1VECA 2PEYA 4TYQA 4UXJA 1Z06A 2HEIA 5HE9A 1PLLA 3LO5A 5JEDA 1E6CA 3CRRA 4B74A 5HZKA 3FVQA 3KB1A 3REFA 4BZXA 2P6RA 2A9KA 1NVVR 2RAPA 2ZEJA 1UAAA 1KSGA 4DLZA 3QXJA 1BOFA 2WSSA 2ZR9A 3EWAA 2AWNA 2Z4RA 3GJ8A 4AYXA 4DDUA 3L8YA 1Z47A 2CJWB 3DM9B 4NH0A 5FL7A 1W4BA 2HJGA 4Q4JB 2C03A 1R0WA 4RFSB 4MYUA 4F91B 4A36A 3B85A 4DLSA 3CB4A 4HLUC 3UG7A 3BC1A 1Y3AA 3CNOA 2E1RA 4G5RA 3HYTA 5ANRB 1ETUA 4JBXA 1XD9A 1Z29A 3PIRA 1E0SA 1VHTA 2IXFA 3VQTA 2WWXA 1TQ6A 4HUTA 4GL2A 1W4RA 4A9AA 5J47A 5IRCD 2A5DA 1KI1A 1NJGA 1W0JD 2ZUCA 3K0EA 4GOXA 3O8CA 3ZVNA 4GP7A 4OQMA 1EK0A 2G0TA 1AJEA 4P4SB 3GLGE 1T5IA 1M2OB 5AR1A 3ND9A 5HCNA 3AVTA 3LQQA 1TQ2A 2O52A 2O0JA 1AZSC 4DLRA 1RE0A 4KJZA 2OUKA 2KBEA 2CBZA 1GZSA 2IBMA 4CDGA 2A5JA 2XEXA 1U8YA 4RD0A 2I1VB 3BH6A 3QG1A 4D6PA 5JWRA 5DHFA 2ZRDA 3KJHA 3M4YA 1WE2A 1TEXA 2XTMA 5FOUA 2BKUA 2NZJA 4HDOB 2ZIAA 4N0DA 1W7AA 4D0GA 5GADl 2ZRFA 4Z1MA 2FEMA 1X1SA 1X8LA 1XTQA 2F7SA 4BFYA 4QHYA 3UMRA 4JLOA 4CEIA 1ZJ6A 3LBHA 1Z0KA 2O5VA 2HXSA 2MSCB 3LLUA 3AF4A 3GJ5A 5KSPA 5FL3A 4DEXA 4M1SA 1T0JB 2HF8A 4IEEA 1JR3E 2VPPA 2WJYA 2DYKA 3W6OA 4I1UA 1P9RA 5AWFC 2QI9C 1ODFA 4MUBA 2YV5A 1NI3A 1QHYA 5SZIA 2AKAB 1XEXA 2FSFA 3TSWA 2VO1A 4UKDA 3TSZA 3IBGA 1I2MA 2FJUA 3CRVA 5JI3E 4HZIA 5KOYA 1E9EA 1CR0A 1LS1A 2ODEA 2W6IA 4MRNA 2O8DA 4XJXA 3AQ4A 4B44A 2QU8A 4IDNA 1KZGB 1E2FA 2Q3HA 4CW7A 4PZYA 1TF7A 1XF9A 2GCPA 3QPWA 3SFZA 3KQHA 2BC9A 3GMTA 2ZI3A 4MRPA 4TYYA 3CBQA 2GAOA 2J41A 3R9XA 1DBSA 5D3MA 2R44A 4ZPXA 1ZD1A 2QE7A 3U3KA 1CLUA 1VG8A 5L3QB 1ZU4A 1DTSA 1KSFX 3Q5EA 2WTUA 5JCPA 2AHOA 1OXVA 4WAUA 2GXAA 4B32A 4A0GA 1W47A 2GBLC 1F2TA 2O8DB 1CIPA 3TRFA 4Q1CA 1JQJC 1E4VA 2MMCA 5EP4A 2JIZD 3TQCA 1M6NA 2OCPA 1G7CA 2F43B 4QGHA 3IBYA 4BGDA 4ZIRB 5IT5A 3U7FB 4TLEA 1W0KA 5C4GB 4NYJQ 2F1IA 4ASUD 3L43A 3GLFB 4TWZA 4IDHA 1TQDA 3J81k 1W4AA 3MWJA 4NZYA 1AA9A 1NL3A 2EYQA 2H5EA 2QL6A 3KTAB 1AKEA 3IO5A 3LVRE 1XMIA 1ESMA 3ICQB 4TLDA 1XPUA 3GJ0A 5E4FA 1QRAA 2Z0MA 4I4LA 1E9RA 3W8NA 1G8FA 1MABB 2BJVA 5KDOA 4KFTA 3NH9A 2IYZA 3TR0A 4D2IA 4IFBA 1XXHE 4RD6A 1Q1BA 3QKSA 3QPUA 4PR0A 3RS3A 1RYFA 4WZ6A 4AURA 2J0VA 1R5OA 3CM0A 1JR6A 3EPHA 4OI4A 2BMFA 4DIEA 2SHKA 1MV5A 4PHGA 4BFTA 3PENA 2GK7A 3R8CA 1CKEA 3UATA 4C9BA 5CK4A 4DRZA 2JLZA 1E3MA 5J4VA 3NH6A 4PPNA 4GOKA 3CPEA 4L9WA 3Q85A 4P31A 5GJVC 4B71A 2QGNA 3HPRA 1L4YA 2FFBA 4QBFA 1E1QD 1ZUNB 3PUYA 4ABYA 5HE8A 2GRJA 5EE0A 3AV0B 4Z51A 2X8AA 4KFRA 5SZKB 1JPNA 4BFXA 2XZOA 4G5GA 1RC8A 1KI7A 1FFHA 3LH5A 3THXA 4BE7B 2DHRA 3H84A 3NEYA 1W48A 5H1YA 2JAQA 5SZHB 3OE7D 1XWIA 3WYFA 4EUNA 4HLDA 4ILEA 1XB2A 4RY2A 4IDPA 2R62A 4L16A 4DLWA 4K81B 4LJ9A 3LBNA 3LW8A 1XRJA 4JSTA 1CBUA 2BCJQ 2AK2A 4YXWD 1U2RA 5JSZB 4DB2A 1IBRA 4FCTA 5K8IA 2FFHA 1A4RA 1D2EA 2W00A 4JVSB 121PA 4QM6A 1DO2A 1A5TA 2L0XA 5L3SB 4DSUA 3OHMA 4M1MA 2B92A 5EXTA 4QJ3A 4CEHA 3SOPA 4BWYA 1F6BA 1E9CA 2NO0A 1AS2A 2AKYA 2OZEA 1R5BA 4LV6A 3OF5A 3PUVA 3SYKA 3WMFA 4F4JA 1XCMA 1GRRA 2FX3A 1N6HA 3A1WA 4JLBA 2E9SA 3Q9LA 2CLCX 2EFEB 2WKPA 4NCNA 3I32A 1CR1A 4AYWA 3GLIB 2YVUA 1Z0DA 1WB9A 4DT1B 2YNMA 2EWWA 2CL6X 5J40A 4IDQA 3K0AA 4JL6A 1KAOA 4M21A 3UG6A 2WJGA 2DB3A 1MO4A 3U6BA 3IKJA 4CIDA 4KFSA 1MO5A 3GJ3A 1E2JA 1NN0A 1U99A 1NMXA 2PMDA 1E1RA 3U3MA 1U0JA 3MAAC 2YYZA 3NXSA 5LB4A 2WIAA 5BN3A 4M53A 5C1BA 1D2MA 4Y0AA 4HAWA 2XOKA 5JEEA 2G6BA 2CVHA 2ZROA 4OBEA 2OBNA 1VYUA 4OQXA 3AF2A 1IXSB 4JLMA 4DLUA 4KAXA 4CGZA 2EWVA 3NWJA 2BKEA 2P5TB 1NNEA 1IN4A 2QP9X 1NN5A 1DO0A 2ZE8A 4LYHA 1WP9A 4V03A 2FE4A 4FMCB 4XTCS 4L8GA 5CJPA 2Y8EA 4WZAE 1DELA 1KKMA 3SS8A 1N6RA 3PV0A 4BLSA 2O8CB 5DISB 2ZUDA 4X8OA 1XJQA 2X1VA 5CYPA 4Q9KA 4BRWA 1HE8B 3K9LA 2QAJA 3LX8A 2FOLA 2OV2A 2CL0X 4B6EA 4N0EA 2JLXA 2J59A 3VMFA 5EE1A 4EFLA 5HCIA 3I72A 3OE7A 4ZDKA 2NMVA 1S0UA 2CEAA 2OBLA 2VHCA 1LW7A 1T4GA 1YHNA 4QJ4A 2JATA 5FUXA 5B2ZA 1CTQA 1XU4A 1Q12A 2AD5A 2REBA 2TMKA 4OHZA 3U3RA 4H9GA 4LX0A 2ZRBA 3L0PA 4C30A 1QF9A 1U9IC 3EPKA 3NTUA 5J4KA 2J0QA 1OYWA 3OIWA 2FNAA 1XX6A 5FPYA 4XWAA 2ERXA 2CLSA 3MFYA 4FI3C 4JVNA 4TZ6A 1KI6B 4JT4A 4BFVA 3CW2A 1E0AA 3PEYA 3H0KA 1NBMA 1R8SA 1JNYA 4HB4A 2ECKA 1PLJA 3QI2A 1IXZA 2R8RA 1YRAA 2NO7A 4PHFA 2OCAA 5GVRA 2HLDD 3ZDQA 3GLFE 2C77A 3EZ7A 1HE1C 3KX2A 2O0HA 2X77A 5FBQB 1KIMA 1OH7A 4BEBA 2VSOA 2CNWA 821PA 2RCNA 1IAQA 2B8TA 4R71A 2B7BA 5B30A 1YRBA 2QMUA 1TU3A 2V4ZA 4YMTA 1QHHB 2IYUA 1QG4A 1P4SA 1P9NA 4R2IA 5AJYA 1G8HA 2P0EA 3I5YA 3RSLA 1OLOA 1E79D 1T3LA 2PZEA 4EKDA 4B3GA 1SGWA 1KI2A 3C7KA 1JAHA 1NIPA 1D5CA 2H16A 1AS0A 3FMIA 4A2PA 1PUJA 2XB2A 3IEVA 5F9FA 4A8JC 2IT1A 1N6PA 3K53A 1TEVA 1FUUA 2XZPA 2XNDD 1LF0A 2KSQA 2ZE5A 4UNQA 5DHAA 1Z83A 2ZANA 4NTZA 4ZKDA 2YOGA 1IN6A 1P2TA 3L82B 5C4MA 1H8HD 2NO6A 4IVQA 1II9A 5FR2A 2ATXA 1HQCA 1YR8A 4LHZA 4QNMA 1N6LA 2WKRA 3TVTA 3DOEA 2IYLD 4NKRA 3VHXA 4D4JA 4MQBA 4P3YA 3PEWA 1EFCA 1UKVY 4XVQA 2QAGB 4OHYA 3AF1A 1DAFA 2IC5A 2YJTD 3ND8A 2Q0HA 4Q1EA 4JZKA 4TQAA 1DAHA 1LF5A 3WMGA 4WW0A 1W2HA 4NYMR 4S2EA 4LC1A 5JRJA 2PX3A 1GKYA 2G9NA 1U9IA 1JALA 1BMFD 1TAGA 3ZVMA 2B7CA 5TVKA 1CJUC 4BZPA 2PMKA 2GJ9A 3GLHE 1G5TA 1FNNA 4NMMA 4FMDB 3REGA 5G41A 4E09A 1QZXA 3ZVRA 3LAWA 1E9BA 3OFND 4PHTA 1QHGA 2W2TA 4Q48A 1MO6A 5HTKA 5L3SA 1T0HB 2GCNA 3RS0A 1G7TA 4JJZA 4A2QA 5KSYA 1HT1E 4A82A 2QGZA 2VP2A 2C9CA 1N0UA 2B21A 3GFOA 2WAYA 1AQUA 1KO4A 2CXXA 1QG2A 2HV8A 2YC2C 4BZQA 3X2SA 3QOFA 1W0JA 4F92B 4XTRA 3WRYC 1IY0A 5H70A 1WQ1R 2J0UB 2O8BA 1Z0IA 2F9MA 1UFQA 4P4UA 2D2EA 2W6JD 2GZHA 1FTSA 2CE7A 1KKLA 3RNLA 1KMHB 2YINC 4Q18A 3T1OA 1A2KC 1YKSA 4P33A 1XZQA 4ARZA 1ZM2A 2GCOB 2QP3A 3MD0A 1X8JA 1ZINA 3CZPA 3EPJA 4I99A 1GUAA 1T8UA 1Q1QA 4AWXA 3CH5A 3RAPR 3AB3A 2QMOA 3TIFA 3M1IA 4U5XA 2O8EB 2OXCA 3CRMA 3EX7C 3X1WA 1W1WA 3U44A 2D62A 2A7QA 3OIVA 3JZAA 2KBFA 2CCJA 4LBVA 4ASUA 721PA 3EPLA 2BBTA 4ZO4A 4C0JA 3GD7A 1SVWA 3UMFA 2QMEA 1D9ZA 1Q1ZA 5EXPA 1VTKA 2WPDD 1PJRA 1YZGA 1ZC3A 4DUGA 4TN1A 2FPKA 3CPHA 2VP0A 2XJ4A 1WBDA 1LNZA 2PT5A 2GWHA 1E4YA 4F38A 2IK8A 5EQTA 2IYTA 2RGAA 4OQFA 4C0AC 4EDHA 1NN3A 2OG2A 3RWOA 3CF2A 4D26A 4BFZA 4XSGA 5IHPA 3I61A 1V43A 1G41A 4EQ6A 3A1TA 4YQFA 4IXNA 2HXYA 2RHMA 4HLQB 5TXGA 4A92A 3DKVA 1GAJA 3LY5A 2BEJA 2GVZC 4M8NE 3MG9A 4JIMA 2F1HA 2NPFA 2R65A 2W0MA 2YWHA 3RRZA 4MDEA 1QHXA 4RD1A 2QSZA 1CU1A 3TR5A 2HCJB 1KO7A 2Q6TA 2O0KA 2GXUA 2ZJZA 4JLDA 1D9XA 1VG9B 1RZ3A 2AXPA 3VAAA 1VIYA 3A6PC 3UIEA 2LCFA 2DWOA 3AF0A 3VR5A 3C5HA 4Q4HB 2ZM5A 1SKQA 1G6OA 3GLIE 4D25A 3I8XA 3FWYA 5ELXA 3U61B 3R9WA 2PZGA 1AZTA 1VYTA 2BIFA 4JLAA 4DUGD 4CF7A 3UWOA 3EZ9A 2ZSDA 1OYYA 3IHWA 3MLEA 3WP1B 1G3RA 1CJVC 1DEKA 3RSOA 3NBFA 1YZTA 4HB3A 3AP2A 3VX4A 2OFWA 2ZSBA 4DSOA 3TW4A 4B2PA 1ZD9A 3SE0A 4ZCIA 5CITA 4C2UA 1ZM4A 1SXJD 3THXB 1N5IA 1I4LD 1M74A 2ZI7A 4Q4HA 1E9AA 1TX4B 3QE0A 4IFEA 4DIDA 5JCZA 1OH6A 5IF9A 1XCPA 1KDTA 1XTKA 2WWHA 1XTJA 1OXTA 2YWEA 2QT0A 3DHWC 2DFLA 3JVVA 1XPOA 2MSEB 3CF0A 4GI7A 1OHHA 3ZJYA 2HYDA 3X1ZA 1H65A 1KY3A 4AG5A 1KO5A 1U8ZA 3VU9A 3DDCA 2HYIC 5DE3A 4TSFD 1YJ5A 1DE0A 1E2QA 4URZR 4XVUA 4PXAA 1KI8A 1G17A 1Q0UA 3LNCA 5AUPB 2OE2A 1P60A 1KI4A 1SVKA 2C8VA 2ZYTX 3F3YA 4PAOA 4C4PA 2REXB 3BK7A 4FW9A 3W6NA 2JJ1D 1ZD8A 2OT3B 4KITB 3I5XA 4Q02A 4KFUA 3VR1A 1VKJA 4B34A 3ZLJA 1E2LA 2EFHB 1W36D 1NJFA 1S8FA 1XMSA 2FPLA 2OFXA 2ZVQX 3NKVA 5L3RA 1SXJE 5JRZA 2XGJA 4RZ3A 2EU8A 4N3NA 3K1JA 2J87A 3FKQA 3X1DA 1PUIA 5DYIA 1W5SA 1G5RA 4O3MA 4RVCA 1RKBA 3LW7A 3FDIA 3EZ6A 3G5UA 2BJWA 5KU1A 3IEUA 3WRXC 4CEIB 3FE2A 5JECA 5EUQB 4IXMA 3SJZA 1D6JA 2ZYUX 4TSFA 3HJNA 1TQ4A 4Q7LA 3TH5A 4GT1A 4HAZA 4CEJB 5CJ2A 1P75A 1EFRD 2WHXA 4L4UA 3QEOA 1N6IA 4TL6A 4RFVA 1JBKA 3V9PA 2QQ0A 1U94A 5KYKA 4LHVA 4EFNA 1VPLA 2PCLA 2CHQA 3HWSA 2EQBA 1E99A 1WMSA 4JVLA 2W2XA 3CR8A 2DFTA 1F2UA 3W3AA 1XTSA 3UANA 3GJXC 4MKIA 2CCGA 5CIQA 4R9UC 2AD1A 4C3ZA 3NIBA 3WYAA 1LY1A 1U90A 1ZYUA 3FGNA 5LPNA 2A5YB 2BBWA 3THYB 4LPSA 1OXXK 2G77B 3GEEA 4B43A 3T35A 2IWRA 3KDSE 1SVLA 2ZI4A 4LGMA 1I4DD 2RGNC 3TUIC 1T3HA 5FOSA 1Z3IX 2P3SA 4WVFA 3ADKA 3DKPA 3MSXA 4Q00A 1IJEA 1KJYA 4AD8A 2R6DA 3HDTA 2JJ2D 2OBMA 3AKYA 4URWR 3T1TA 3CLVA 2GCOA 4LHWA 2IUUA 4JLKA 4KSCA 2ZJAA 3KXIA 1XBTA 2DFNA 2UZ3A 1NMYA 3EG5A 1U81A 2VIIA 4PQRA 2C9YA 2F55A 2J45A 2W6JA 3GLGB 4NCKA 5E3HA 2DFKB 3DVLA 1XJ0A 3CWQA 1WBBA 4B3BA 1MABA 2J0SA 2EYUA 4B35A 1IHUA 1I2DA 3B82A 3KFXA 5DGXA 1NKTA 3WNDA 3MJRA 4E22A 2GDJA 1LFDB 3T5DA 1BH2A 4C0LA 2EW1A 4D0LB 4IKEA 4QOSA 2FGJA 4UQOA 2RGBA 1GFIA 4RKEA 4GMXA 5J4HA 2QT1A 1G20E 1JXOA 2VHUA 4YC7A 3QKSB 4RCYA 3GJ7A 1C4OA 4L5BA 1RJ9A 3LD9A 3L2OB 1EGAA 4LC0A 4DWJA 3FTQA 3NHAA 1KDOA 1OH8A 3KL4A 5AK0A 5DN6D 4FMDF 5FBRB 2ZSFA 2V6IA 3K0FB 3SU8A 1R2QA 3JZMA 3RRNA 2FZLA 2JLQA 1X86B 5TMPA 2IS4A 3PUZA 1HT2E 2ZJ8A 3KUDA 3QSYA 1G16A 5G3YA 2CK3D 2N46A 5EP2A 3TSOA 4B75A 3SJCA 3QKRA 4OKSA 3K8YA 4XD7A 2VA8A 2ZYWX 3FFBA 1Z6AA 2HLDA 4MDFA 4NYMQ 3B60A 1Z5ZA 1OH5A 4ESHA 3RVBA 2Z43A 5KUTA 5JSZA 2PCJA 4MGYR 3DEFA 4OI2A 5JBQA 2ZSEA 4M1WA 4Q9LA 1F60A 3KXKA 3QXHA 1J70A 4FMBB 4AKGA 2FGKA 4II7A 2ZS7A 4QGGA 2XB4A 2YOFA 1MO3A 4NBSA 4TMKA 1M7HA 1HQYE 4P4SA 3T1QA 2EFDB 1S9DA 3QVVA 3KQKA 2G0NA 5JLJA 4PAQA 1D8TA 2XX3A 1E9DA 1FNMA 1UBCA 1UKYA 1XD2A 2PH1A 1NRJB 3TJZA 3Q72A 1A82A 2G88A 2P2LA 3K09A 3M6AA 4FXPA 4WXRA 4OI1A 4DLTA 1WXQA 4KU4A 4KYUA 1M8PA 1Z08A 2A30A 2GJ8A 3TW8B 3AVXA 4EPTA 4PHHA 5K8UA 2RGEA 3BH7A 1IQPA 1ZP6A 1AS3A 3OFNA 4L9SA 4NCIA 4PANA 3EIEA 4Z8YA 4DBLC 3W90A 2OSBA 2EFGA 4NONA 5SZJA 4DCVA 2JGNA 3I73A 1ZAKA 2J7PA 1XD2B 3GEIA 4B3XA 4XWKA 3RYTC 5JJIA 1X1RA 2OESA 3CWZA 2V9PA 5FPHA 1UBGA 3L0SA 4ZCMA 2WSMA 2ZI5A 5L3QA 4QHSA 3QQ5A 1PV4A 1PVOA 4PFSA 1JJ7A 1U98A 1F2TB 5A5GA 2V8OA 5J5CA 3H1TA 2ZRHA 2A78A 2ZITA 2CHVA 4X8LA 4ITRC 4EPYA 3A4LA 1GL7A 1OT3A 1X3SA 2H7VA 3D6TB 4Q1BA 1RFLA 3LXRA 1P2UA 621PA 2AX4A 5FTLA 3KQLA 4ARZB 2K5UA 1ELOA 2IHYA 2GEVA 2WM9B 1MT0A 4IDOA 4DC9A 1ZM3A 2F9LA 3EZFA 4ZCLA 4QBIA 4C7OA 4GRAA 4IEIA 3RS7A 1UDXA 2VH5R 1GL6A 3QVUA 2JLWA 4TTQA 3LA6A 4PSVA 4DCNA 1FOEB 4HAVA 1GWNA 3KB2A 3SR0A 5LB2A 2XXAB 2FSGA 5EXSA 3AUYA 4WOPA 4FWTA 2PLFA 4Q9JA 4FCWA 3BFVA 4Y0VA 1GDDA 1VHLA 1KOFA 3A58B 3UPUA 3BJIC 4B3FX 4OK6A 2WPDA 4WZBE 3U7HB 2J1LA 4HUQB 2DBYA 2D74A 1DG3A 1Z0JA 2ONJA 3ICEA 1EFRA 5EE9A 3O8DA 1TUIA 1KI9A 2ZRIA 3OEED 1QHNA 3DMDA 4OQNA 4EPRA 5FFMA 2GEDA 3QG5A 2BMJA 4OJKA 1KJWA 4P4TA 4HAXA 3OZXA 2MSDB 1ZU5A 4LUCA 4D0NA 1E0KA 2IXEA 4S35A 4RD3A 4LYJA 2RMKA 1E2KA 2PBRA 4G5QA 4KSBA 2IW3A 4GZLA 3K0CC 4TQUS 2ZJ5A 1R8QA 3DMNA 1A7JA 5E95A 3UKDA 4B2IA 4MRVA 1OIWA 1E9FA 1BKDR 4LBZA 1CR4A 4G3XA 4LSGA 3IUYA 4MYCA 3PEVA 5DI3A 5BN4A 2JLYA 1Z28A 4YXWA 4MGIR 4A1FA 2XTNA 2OO7A 5JJLA 3BD9A 1QHHA 2WJHA 3W5IA 4W5HA 3A37A 4TMTA 4ZI3A 3W9YA 5A0FA 4Q66C 2IXGA 4BUJA 1E94E 1JPJA 1RYHA 1W2GA 3GEHA 4LOAA 3SC3A 2GXSA 4D80A 2NO9A 4LHYA 1N0VC 1S1CA 2QRZA 3BS4A 1TL7C 4NE2A 2D06A 2DY1A 1FX0A 4KYIB 3BFXA 4PC1A 4CEHB 3FHCB 3TE6A 1NBME 1OE0A 4M2LA 5AJXA 2QTFA 1AQYA 1DAEA 5EE3A 5BN5A 3LVQE 1CRPA 2VHJA 1DADA 1P6XA 1HUQA 2ZRKA 3W34A 1Z2AA 4HLCA 5KO2A 3RC8A 1EESA 1XFAA 2LKCA 1I4TD 4WBSA 2OM2A 3SQWA 1UF9A 2RGGA 1KNQA 2OILA 3VTKA 1ZIOA 4DT1A 1UJ2A 3CPJB 1DAMA 4JL5A 2QBYB 3A8TA 1AIPA 3MCAA 3RDPA 3GFTA 1XDBA 2ZSAA 4M9QA 3AH8A 1KK1A 1Z6XA 5IK2D 2BMEA 4I1SA 2KB0A 4JLNA 2GILA 4DVGA 1G1MA 4P0TA 4TT3A 3T15A 3U3JA 1F3OA 4B47A 3C8UA 4PC7A 1HH4A 4YONB 2R6GA 1C9KA 3RANA 2WJVA 2FZ4A 2XAUA 4U00A 1JJVA 2FFQA 4PO8A 1RRGA 2VRWA 1JEDA 2QEQA 1DARA 2QBYA 2G3YA 2KJQA 3EZ2A 4DLVA 2FSIA 1W5TA 3HR7A 4HI0E 4C0KA 3X1YA 2WJJA 1II0A 3LDAA 1KK3A 2PX0A 1XMJA 5HPYB 4POAA 1XEXB 3TGPA 3U7GA 4XD7D 3K0AB 3PVSA 4D81A 4AKEA 1J90A 4KBGA 3VNVA 3SYNA 1II8A 2QN6A 2XTZA 2ORIA 3TUZC 3A4NA 1QBKC 1J2JA 1FMJA 2R9VA 3I1FA 3IHLA 1SULA 2WMNB 4OK5A 1V5WA 1L4UA 2QUZA 4PSKA 2JJ8A 4IOLA 2J5XA 2LWIA 4GZMA 3B1ZA 2IF2A 3T1VA 4LI0A 4LJYA 1JR3A 4E03A 4B2LA 4JLVA 4ERNA 1F5NA 4QRHA 2J0UA 2HCBA 2JLUA 3SI7A 4HB2A 1E2IA 2O8BB 3ZIAA 2ZU0C 4DDWA 1OJLA 2VL7A 1ZMXA 2QAGC 1W0KD 3WMEA 1TF5A 5JWOA 4M9ZA 1AM4D 1IN7A 4PO1A 4UJ5A 2F43A 3WYGA 4TLCA 3QIAA 4ZIRA 2CNWD 4EAQA 1G9XA 3FMPB 4JKYA 4KI0A 5TARA 3RRMA 2WIBA 2JCSA 2PZFA 2VHTA 4Q47A 3G0HA 2ZR0A 1DOAA 1HURA 1G4AE 2QTHA 1VMAA 1XEWX 1OXUA 5F3WB 2KWIA 2F3TA 3TKLA 4US2R 3RS4A 1T3SA 3OIUA 4LV8B 2C78A 1R10A 4NL4H 2OCYC 4E5UA 1SXJC 2AL7A 4FCVA 4RCZA 4AC9A 2V1UA 1S3SA 4JLJA 3LQRA 5KPDA 2FSHA 1OF1A 1Q3TA 1HEIA 1X8KA 2BEKA 3TLXA 2G83A 5EZ5A 4MUAA 4CVNA 1ZCAA 3WHLA 4KBFA 3A4MA 2FEOA 3PCRB 1KHTA 3T34A 5KNBA 1B23P 3B9PA 1KTVA 5IK2A 4RD4A 4NP6A 3EIQA 4XOIA 1E2GA 3K0SA 4B6FA 4XIGS 2UVQA 2ZTSA 3PXGA 3K70C 3WBKA 1GITA 3WNCA 4ACBA 2D3WA 2IWHA 4MA4A 4Q5IA 3P4XA 1ZBDA 3EC2A 3V00A 4BLPA 1ANKA 5FTNA 4URVR 4J0QA 2IX3A 5FI1B 4M1YA 2DWPA 5DLQC 2WWIA 1ZM9A 3U2QA 1J7KA 1NY5A 3VKGA 2PLRA 4FIDA 5DN6A 3TNFA 2GTPA 1E1RD 2V6JA 1G21E 4I1VA 4KLNA 1EWRA 3QBVA 1M34E 4E07A 1VCMA 5HZHA 3N5CA 2ZVPX 4A0HA 1G4UR 4LJ6A 4Q1DA 2YKGA 1AKYA 3F5FA 2IUTA 1WCV1 4MRRA 3GCGA 2BWJA 3I3SR 4F4IA 4H1UA 1G6HA 2AR7A 2Z4SA 3AVQA 1COWD 4B3DA 4MH0R 2GZAA 3BH0A 4GDFA 5FBVB 4JMPA 1LV7A 4Z8XA 3RS2A 1R0XA 2C95A 3FKSA 3KJIA 3AKDA 2FA9A 2VF7A 5FUVA 3SHFA 2REOA 3ZIAD 5E7JA 4LPKA 4K8OA 4DDVA 5CYOA 1VG1A 3WBJA 4Q7MB 3Q8XB 3K9NA 1O87A 2Q9AA 3SEAA 3V4FA 4A15A 1GKUB 3CNLA 3C5CA 1NSTA 4G01B 4LWZA 2JIZA 1KY2A 3HYRA 3VR6A 1YQTA 4F4CA 2OAQ1 4MKGA 3NVAA 4A0FA 1ZC4A 1Z07A 4AY2A 3DM5A 3VR3A 1WA5A 1R0YA 5JJKA 1FZQA 2GXQA 3MGCA 2OLJA 2HT6A 4LYAA 4OHVA 5DI9A 4LJ8A 4BLRA 3NBXX
chains in the Genus database with same CATH superfamily
5CB4F 2OPBA 3DFFA 5E1BA 3SLRA 4EECA 1DWQA 3ADCA 2C7QA 1ID8A 4I0WB 5DNVA 3FVVA 3STTA 1TZCA 1Z2CA 3LK7A 4L5JA 3NVMB 4G5FA 1H2XA 4QBHA 3SX2A 2COEA 4PYJA 1W30A 2V58A 3ROKA 4C7JA 5KTYA 1JZQA 2XGGA 4RJIA 3WLSA 4KNWA 5IC4A 4K0RA 5DX8A 1D2NA 1TUBB 3U37A 2PX5A 2QQEA 3NBAA 2ZRAA 2HREA 2IYXA 4QL3A 5DSZA 3TNDA 3H1PA 4LJKA 1VG0B 2BGJA 2WHYA 4ZDIA 3RRYA 1MR3F 1IN8A 4KGXA 2IYSA 1JAIA 3ZJTA 1N5JA 2I3BA 4GYYA 4CMCA 1E1CB 3S8EA 2XGMA 2WWWA 1O3YA 3VKFA 3A6EA 2A5FA 3M3DA 4IZIA 1E32A 1TVCA 1E2EA 4EK9A 4O33A 4TV8A 1PDWA 3RVLA 2AFIB 3KTDA 3QYPA 1OBVA 4BJ5A 2G80A 2Z9DA 1N4DA 4QJ5A 4DM3A 1Y3CE 3SYMA 1DWUA 3ZOZA 3BHIA 5JVDB 1NHGA 2RBEA 3RUCA 2E4AA 3UTCA 4KIJA 1EFUA 4OL0A 4X41A 2WC1A 2H1VA 3DYBA 1R66A 2CLKB 3GCXA 4R41A 5DEOA 3NRBA 4N3BA 4NXNB 3AVYA 1U3TA 1I9CA 4IIFA 4DV2B 2ZU6A 5IAAA 3PT9A 3N7UA 1GNVA 4PBTA 3T7AA 1Y9JA 5CM2Z 1D2RA 1U3VA 1V1JA 1VJTA 1VCIA 3JY6A 2FY8A 2ZYVX 5AMXA 4ATNA 1H4VB 4OQLA 4AP5A 2RGNA 5KPJA 1ITZA 1NASA 1OFIA 3MCTA 5FOTA 1ND6A 4TKZA 3DXZA 2Y1KA 2O8EA 1DKPA 2NIPA 4OATA 1QP7A 3UZUA 1GYPA 2CBXA 2ACWA 5BNWA 4P8RA 3EXHB 4CPDA 4FP9A 2I6UA 1SVIA 4YCLA 4QM7A 2CHEA 3LHFA 4AKIA 2J3IA 3OQHA 1PGNA 2GRUA 1YB1A 1FFWA 3NG1A 5CNKA 2BY4A 2ZWOA 3ESAA 4MWSA 4PC6A 1BOOA 4OUDA 4EHIA 3F5QA 1SCKA 3BTUA 1RADA 2JLVA 1O9HA 4W5TA 1AGPA 3LT1A 1XCLA 1EFPB 3HA2A 4MA5A 3RTCA 1P2SA 3IAFA 4AJLA 3VR3D 1T9KA 2QSYA 4RTKA 1WM1A 2J5BA 5AKXA 1Q7EA 4GFDA 3BSYA 1ARZA 1GNRA 1JAZA 2L69A 3NHRA 1ATZA 5TGDA 1MKYA 3HSYA 5ULLA 1GFZA 1T10A 1EWQA 2GR9A 3KZ1E 1DZIA 3VR2A 1Z0FA 4C0SA 1KIAA 4N8SA 3ABIA 4DG5A 1JHDA 1XLTC 3QOYA 4EG1A 3LCJA 1GNPA 3MQ4A 5CB0A 1TZ2A 1UPFA 2BFWA 3OZWA 4EHJA 4AK9A 2PX8A 1E2BA 3TECE 2GEJA 1ZZEA 1S02A 2WLTA 4OB8A 5CJJA 3RLFA 1WRBA 3W06A 3VPSA 3I53A 1XNRB 2NNLD 1BYUA 2QP4A 2ZBEA 3DZKA 4N6OA 4D82A 3OKCA 2GHRA 4RV5A 3V7WA 3E9EA 5I4IA 1RJ9B 2H18A 3QEJA 1UBFA 2ZJ6A 2JDID 4CTOA 3B36A 1SUBA 4DMRA 1W46A 3KV1A 1T91A 3PNLA 2I99A 2ZPAA 3MWDA 1KH2A 4E5VA 3A27A 4EL5A 2LE0A 3T95A 2PL3A 2HWUA 3A6DA 3Q3HA 3N9IA 4L50A 1F17A 1TPZA 1PS0A 3O4IA 4JROA 4BEVA 2G82A 3BK1A 1VKNA 2YC4C 4QT4A 2K6GA 3EY9A 1EFHA 3ZJ5A 2Z2ZA 3A9VA 3GVXA 3VU3A 4Z5XA 5BV7A 1L5MA 4DMKA 1D3AA 4CIVA 5AT1A 4YDSA 5EZ6B 4ZQIA 4ZT4A 1ZNWA 3BIJA 4JP3A 1H2RS 5PGMA 2B98A 4BQSA 2PWBA 4N47A 1E2UA 1Z5OA 5DM4A 1RI1A 3I5AA 4XQEA 2ZRLA 1VA4A 3ND5A 1JIUA 1S2LA 3V32A 5ELMA 3UFXA 3HVJA 5COAA 4BE9A 3VDMA 4DGQA 3G6WA 3OTWA 3KXLA 4IS2A 3CLRC 3SVZA 1Q57A 5A4JA 4PLGA 2J9ZB 4P98A 3VJRA 1CJTC 3L4SO 5BV1A 1RLUA 3F3SA 2FPRA 1MF7A 3GJ6A 2IH5A 3HVHA 2ID4A 3QEMA 2XKKA 4W7SA 2C2WA 3CY6A 3FSGD 3ERCA 4US0R 4Q4JA 1WSDA 2I7TA 2RKOA 4TN5A 3FYSA 4XIIA 3DBOB 4I46A 2AXNA 1MB3A 4W9RA 4R5HA 3MIIA 4ALLA 4EITA 1YFZA 2IBTA 3NDBB 4EJSA 3AVUA 2ONZA 3OHSX 3GFVA 3UBMA 2CL5A 1S96A 3EPPA 4IHQA 4WFKA 3QWBA 5KSOA 1SCAA 3OLXA 1HPLA 2Z8ZA 3QUSA 4I2VA 3RKSA 2BR4A 2O3JA 5T64A 4DQ0A 4BMYA 2MCFA 4MI3A 1R6DA 1HRKA 2HDHA 4XGRA 5FUWA 2OGWA 3WWDA 2I4IA 3EVGA 3G02A 4EMBA 3HPQA 4QOHA 4CL2A 4PBSA 2IS2A 3IT3A 2V3CC 5T4BA 2UV8A 5CFNA 4HOYA 1US8B 3PUKA 3TEFA 3PWZA 1RJWA 3JD2A 4G81A 4DR7B 4HDCA 1N8SA 4IH1A 5CA1B 2UYCA 2GT1A 2BDUA 3T7SA 3IV7A 4BTVA 1M8FA 1PL6A 3DSRA 3JYLA 3PPYA 1T13A 1LWNA 4NVRA 5CM9C 1MZPA 1PV2A 5TGZA 4B9AA 3TMKA 2WA2A 3DE2X 3U4MA 2OENG 3QXSA 5IJXA 4CT4B 1G9TA 2OHGA 4RJLA 4URHA 2IF0A 1QO0A 4ZCSA 2ZQYA 1NDQA 3DDWA 4NHOA 5BNIA 4MWEA 1JQAA 5AW6A 3SN6A 4OLJA 1DRJA 2HSWA 4BKUA 2BBSA 4QOEA 3T3HA 4Q7KA 4WUTA 1DX6A 5JO0A 3OOJA 1KFJB 2UDPA 3V3TA 4F5YA 1TO2E 4QWWA 1QZTA 4X1IB 3JX9A 5KVVA 4O4LA 5B57C 3HU3A 1K5HA 3I09A 1MA3A 4WKNA 5DX0A 1BXZA 1OGYA 3DZGA 3H5WA 4WGFA 3UUGA 3W2GA 5TJHA 5BSHA 3QGMA 1SKAA 4X94A 3WQBA 2QF7A 4ZV9A 2IXBA 4BO0A 3B1KA 3H42B 2PJZA 1KJQA 2E87A 5AVSA 4BNKA 2XXAA 3O9ZA 1FYXA 4ZV7A 4HUQA 4H60A 1QQTA 3KAKA 1TRKA 1DXHA 1Z2EA 4LYEA 3DEIA 1V4NA 3P2KA 4LCBA 4HMQA 2IA5A 1TW3A 2RG7A 1UMKA 4RUKA 4V0LA 4MS1B 1XZNA 1ZFNA 3IIEA 1OREA 3KVVA 4JT8A 3CSDA 2H4HA 3O74A 1PK8A 4QQKA 3TRDA 1YC5A 2Q3EA 1NVEA 1R9JA 1SXJA 1YAHA 3CPSA 2IQ5A 5JQGA 3OUTA 3LBYA 1G66A 3P19A 3RODA 2NO1A 4ARUA 4Q9IA 4C4YA 2VPYA 1SBCA 1Q11A 1SY7A 5J23A 1KFEB 2G40A 2QTLA 3RFTA 5EC8A 4IIYA 2WWGA 2J0EA 1PNOA 3B8EA 2I0FA 5ALHA 2X0KA 3IKLA 2ZUTA 2CXQA 2YBEA 5AM3A 5B7GA 4IX1A 1PNQA 4JUBA 1V47A 4JI7B 4U7PB 3KOXA 3TBKA 4TUYA 1NW4A 2F3SA 2Z09A 5BOVA 1N3BA 5A04A 2J7KA 3G79A 4M37A 1MX1A 3FWZA 1T4DA 3IMFA 3KXDA 2XT0A 4NIMA 3MTIA 3UWMA 3A1UA 3ROPA 2CUKA 4EW2A 4ZOLF 1NG9A 1N5OX 3LUKA 3E03A 1YJCA 2M1XA 1RW4A 3JS5A 4PV7A 3GU3A 3ZEAA 1N7HA 4R8MA 1FX0B 1UMBA 2A7XA 2P6MA 4L5YA 3QE2A 4J3JA 4M0UA 4X95A 3U4GA 1QQAA 2FJPA 5CU7A 4B48A 5JNVA 1FK8A 3TR6A 3WJ1A 3DEHA 3I12A 3KPVA 2VDUE 3ZHUA 1W9MA 3GLUA 3PF8A 2V7PA 5HMMA 4JQCA 2YDYA 4CQLA 1THMA 1FP4A 3WGGA 3FYCA 4QKQA 3ICVA 3LQ2A 1YNSA 2Q6LA 3G49A 3I4CA 3KJZA 3D3NA 2D4AA 3CKKA 4KMSA 5GPBA 5LDDC 1IN5A 2VP3A 3RWMB 3OG9A 2HRCA 4DIKA 3DCJA 4F6LA 2M6RA 2ZWIA 3FFTA 4ZRDA 4F4DA 4IIEA 2C99A 2WZDA 3ZLVA 4JJGA 2AUNA 2A0FA 4QQFA 3KSDO 4JI4B 3R24A 5ITZB 2BTQB 2Y9PB 2NWQA 1VIVA 3KZVA 3WQQA 3S81A 1QRUA 5TMEA 4LFAB 2B8JA 1MC1A 4DZZA 4QDJA 4C0HA 4KQ1A 1G5PA 4O1HA 1TLFA 2W6OA 2NU8B 5GZ3A 1CUBA 1Q0PA 3DF7A 1ZW1A 3FMOB 3HA7A 3TTSA 4ITVA 4O2BF 1P4HA 2QRVA 2Q7DA 3AYXB 3L7CA 3KPJA 3QUTA 2YFKA 1FJGB 4NOJA 1SVNA 1B0AA 8AT1A 1K75A 5J2TB 3UAVA 1T25A 3M82A 5CEJA 4JSRA 4Z4HA 1WXIA 5T5QA 1UKEA 3KEOA 1SKYE 1M1NA 1KO1A 1Z5NA 2OHFA 1T3GA 4RPGA 1B1CA 2JBWA 4RZSA 5CNMA 4PG8A 1QAOA 2VPZA 4ALIA 3ODGA 2XITA 1GTVA 2YWFA 3PEFA 4NZ9A 1M2FA 2QN1A 5DBOA 1FZTA 3DWGA 4HNRA 2J30A 2N0SA 4DC1A 2IDMA 2VP9A 4AZ0B 4YMSA 5JYBA 3BD6A 4JSYA 3ZTTA 4GX5A 3GJ4A 3OX4A 5HKKD 1EXVA 3ZZTA 1ZQ1A 5HM6A 2ISCA 3A2MA 1E96A 4LDZA 4MVJG 4QRDA 4RHUA 3ZU5A 2WD7B 5CLLA 4N0QA 1HG0A 5BN3B 1ZRNA 1J06A 1RLMA 2BHRA 2HD4A 5ITSA 1MPXA 3H9EO 2R7AA 1T2FA 5F5LA 5IM5A 1EX6A 3EXHC 4E33A 2NVOA 3KKNA 4F93B 1E3LA 2NTEA 1CVRA 1CR2A 2H9IA 2ZBGA 3NPAA 3PWTA 4FZ5A 3W5DA 5EWLA 5THXA 3H5VA 3UT5B 3IE1A 2I6QA 3OA0A 4CF4A 3VO1A 1L6RA 1SHZA 3H5RA 3DFZA 4MCIA 3VVLA 4RPKA 4U7JA 1UAYA 1ZGGA 1ZEJA 2PU5A 2PZAA 3OFKA 4B6PA 1N25A 3EIHA 4LRSB 5HDQA 5ELLA 1EQAA 5BP7A 4D8UA 4XUEA 4FQ7A 4K9NA 4LV5B 5IKXA 3BRWD 3QF7A 1SXIA 4XZ3A 1TKRA 5F1OA 4QHTA 2QPOA 5FNVA 2NTVA 1JNXX 3B9QA 1IG3A 1OHHD 1XAGA 2VDQB 2ZPUA 1HQDA 1LUAA 1QOPB 3EGXB 2GBLA 2BFFB 1QYXA 1OROA 1UBEA 2UZAA 1EK5A 3DO6A 3V48A 1X94A 2XOKD 1GQFA 4GXNA 1PS8A 1Y48E 3IX7A 1BU5A 2NGRA 1KVQA 1JPUA 1WDMA 2A4KA 3K6KA 4HWKA 2H06A 4K9QA 1ZN9A 1WTAA 2PJUA 3GRFA 3PUHA 3UXMA 1N8TA 4BX3A 3TGLA 1VFNA 4QEZA 3O26A 4G1UC 1WVIA 1LLCA 2YH2A 3I2IA 4EY5A 4LY9A 2ZI9A 4LQ4A 2AN4A 2G9RA 4PZAA 5KYUA 1LTQA 1V6AA 3E7WA 1WZUA 4HGOA 1ZM7A 3AHEA 4TL7A 2BN4A 1UDAA 3VR5H 1CQPA 5C5CA 3NS7A 5K6AA 2D2FA 1H2AS 1P7WA 3X44A 4TQGA 6REQB 4OF4A 4FU0A 3OP4A 1MJNA 3ZQJA 1TQHA 4Z2AA 5EVCA 1ZCJA 3LUGA 2JS7A 2O8FB 3DLTA 5CEEA 3K0HA 5K3OA 4UOZA 1NY6A 4DCUA 1GSIA 3N07A 2XVXA 3CH4B 4PINA 3R3VA 3FTCA 4PYIA 3IPYA 1USGA 3QVMA 4MJ3A 5JY1A 1A2BA 2UAGA 4PICA 2CL7X 2XCIA 3ZDYB 2J7PD 2VCYA 1GZ5A 2NACA 3AHHA 4MHOA 3VR4A 3DOFA 5A06A 5ALXA 1HV8A 1M83A 3ZTWA 3H2KA 5EQDA 4H35A 4K7JA 1XQ6A 3R9IA 1I7LA 3C8MA 4OFXA 4C29A 3DWFA 1G8PA 4IIXA 4CM7A 2QM7A 1TC1A 3PGXA 5HXAA 3UWSA 4BB9A 3GT4A 3GDOA 3UB3A 1E3TA 1QX4A 1BDHA 1V1RB 5K3DA 1HLGA 2CW5A 3R3JA 3WY9A 4A10A 1BTOA 1H5UA 4DG9A 1G6Q1 2EFYA 2PBLA 3EARA 3FPFA 3OICA 4UNNA 2PU7A 1ZI9A 3KJNA 3MWDB 3O4FA 4CF3A 2J46A 4CIYA 3J81A 1DBQA 3I2JA 3TEJA 4KV9A 4MVCA 1KYZA 1FUIA 2JFHA 1FNDA 3AFGA 3G2HA 2R6ZA 2ZBRA 4IUYA 3HP1A 3O4GA 4RD2A 5ALDA 4TKUA 3CUEF 3UJCA 1JHZA 1PW7A 2I34A 2RB4A 1ORWA 4GOJA 5JIBA 5DNCA 2I2XB 3BWDD 3EQ2A 2C7OA 4AMUA 1MHPA 4UMDA 1KE1A 2DHQA 1IH8A 1W4CA 1YB5A 4MPDA 4URFA 1YS6A 3NHSA 5EYPA 2O2SA 3AGPA 1LX7A 3ZS9A 2I9KA 4YY3B 1LFAA 1VLLA 1QCYA 3A70A 3HVKA 3Q7QA 4UCWA 1OKKD 4OSOA 3IP6A 3IUQA 3O03A 4PFKA 3T5TA 1RXCA 4BDSA 1I4WA 2ZIFA 4RFLA 3WTBA 4C08A 2CV0A 4NHEA 1CUCA 3AZQA 1Z6GA 4PF1A 4A5OA 3AG6A 1XV5A 3LDFA 2ZM6B 3QBTA 1ILEA 3HRKA 2C3YA 4HDKB 5AIAA 3UA4A 1E5VA 2NXJA 5J2UF 5F23A 4C0QC 1V5EA 1S8OA 2P78A 1SQFA 3HDQA 3BZWA 4MPPA 1PEDA 1YZ3A 1WW3A 4FDUA 3IR5A 2W4MA 1QU3A 3EWSA 3H8JA 4DMUB 5EJEA 1J8YF 4N5IX 5HFJA 3KT3A 1KBOA 1D2GA 1EEXB 2EJCA 1G7RA 3CVJA 2OLKA 2WV9A 3D7MA 1B41A 1LBHA 2BVNA 3B38A 3JR3A 4JELA 4X1OA 2JCGA 5EE5B 2OECA 3S2YA 1UXOA 4QTXA 1IEWA 2WAXA 4Y6QA 2X8WA 4BU1A 3PJEA 3AR3A 5AM0A 3D6VA 3P71T 3R5HA 4AQDA 1JRLA 4TZKA 5H0IA 1E62A 1M1YB 4K9OA 1CY2A 4G1EB 3KNZA 3NO4A 4DQVA 1GPJA 1NU6A 2BI7A 2PKQO 4BFWA 3G8AA 4RABA 3AF5A 3PC2A 2VHQA 4K6KA 3SNHA 4CFZA 1I5EA 4XQ9A 4MMZB 2O1SA 1P2FA 1JDBC 5H3CA 2QG6A 4IOJA 4G0OA 1GDHA 1CUHA 3GFPA 2AFIE 2WOJA 4KW7A 5K4GA 4LDAA 4PVDA 1PQ4A 3RF7A 2A2ZA 5ITZA 1PGOA 4HKTA 4UFPA 2IP4A 3AU9A 4TS3A 4O2AB 1EHYA 4RW0A 3RABA 3GRKA 3Q2OA 3I8SA 4TTRA 4GQAA 3UK2A 4E13A 1VE9A 4LWOA 2EKZA 4ZC8A 2F4VB 1AKWA 1VIMA 1JB1A 2UUOA 4HNTA 3SFVA 2GN9A 3UOWA 3IQIX 4UTZA 4OIFA 5I51A 4AW9A 1OFTA 4JJ8A 2W6ID 4MQMA 2IPOA 3WWOA 3GB9A 4V24A 4MVJD 4G63A 5CW1A 2IX3A 3CVOA 1DC7A 4ND6A 2EX4A 3VYRB 1PR6A 3A3YA 3A1CA 3PL1A 1UPCA 4LWQA 1D1TA 1RRFA 2JD0A 2O05A 1P72A 4I55A 2OYCA 3NORA 3UJHA 5JSQA 3HNOA 1PT5A 1XZCA 3JQCA 5B64A 2OGTA 3FCXA 3PPXA 3COZA 4GRDA 1MG5A 3B5JA 2AJDA 4BECA 3ZVLA 4R7TA 1PZGA 1UP6A 4H0NA 4BKQA 4B4OA 1YO6A 2PNFA 2JK0A 1DBIA 4QEKA 4N1AA 1QU2A 1U3DA 1ZH4A 2ST1A 3MJHA 1VE6A 2QQFA 5A5DA 1ACMA 5BSVA 4C0BA 4LKRA 3KTAA 1Z2PX 4YQEA 5CB4B 1GN8A 5JCOA 1Y9EA 2FFAA 1ESZA 1WDTA 4D0RA 5IJ9A 5MHTA 2C5LA 2G5GX 4YJHB 1K1EA 1NOIA 1J8MF 2R2AA 2J5KA 2C2ZA 3JATB 1S7GA 1M2HA 3AEZA 3NMUF 1ENZA 1NG1A 1RM3A 2YFHA 4KWHA 4NPAA 3M5DA 3AR7A 4E5DA 2DH5A 1E69A 2WINI 3TD9A 5IT4A 2RKBA 2Y93A 2XB8A 4IIHA 3WP0A 4PAWA 4CUZA 5B1IA 5CDFE 1QIIA 1YR3A 4I9GA 4Q1AA 5BVGB 1EVJA 1VSBA 4KLCA 3DCYA 4C20A 3F7TA 2PQ0A 4JYCA 4CR7A 3UWDA 2NV6A 3B7GA 2GETA 3CRW1 3JAKA 1YBMA 1R5JA 2WTEA 1X1CA 3AF3A 3QKWA 2Q7OE 2NV0A 2BMVA 3CN9A 3ETGA 1XP8A 1DRWA 2R751 1P61B 3L4BA 1QYDA 3NTLA 1LSUA 3VJKA 2X0JA 1IHXA 3B3AA 4TLLB 3ZGNA 1VL8A 2O8FA 3DPSA 2VNAA 1KQOA 1WUJS 2VSFA 1LS6A 3FR8A 3EGVA 3OTQA 1F7UA 2AK3A 1JWAB 3ZD7A 1GM5A 5EHZA 2QV0A 4S0XA 4Q21A 2GBGA 1PRYA 2FWRA 1FFXA 4L85A 1G64A 4MI1A 4PYRA 5AESA 4QLOA 4IOKA 2XNDA 5BQOA 4I6EA 3VI4B 3NONA 3OTOB 3ILVA 1QIGA 4TVSA 1N2GA 2I76A 2FP4B 2B82A 5GM2A 4NG5A 5FAXA 3R7WA 4EI8A 3IS3A 4CKCA 4GKJB 4R98A 5TS2A 3QY9A 1UR5A 2JASA 3KOZA 1AK9A 1U3WA 2B2CA 2ECOA 2KYRA 1LXCA 5JISA 2DT5A 4LY3A 5H3LA 4XIFA 1HY3A 5BYJA 2GVDC 2I8AA 3OIDA 4RZHA 1VOTA 1W1IA 3C5VA 3IDAA 4BNDB 2WU1A 3ADBA 1C0KA 5JBIA 5ECGC 2MMGA 2XNSA 3A9TA 4NZZA 6YASA 4XGIA 3ZWMA 4WOCA 2Y67A 3EW9A 4GKAA 1B74A 1W52X 3I83A 2PAAA 4YVFA 2CLDX 1BEEA 3I9MA 3RS8A 4JJKA 3SQLA 4CM8A 3B3JA 3U7JA 1XTZA 5DK4A 5EHNA 2AWOA 2UVPA 1UZAA 1L7NA 1XELA 3IPXA 3OPYI 4KXFB 1CZOA 5BQ3A 2QMQA 4YUWA 3OT5A 4V1CB 2H17A 5ADVA 3L5KA 3BOSA 2RONA 3CO5A 3NCTA 1CF4A 1RVDA 4DCCA 1F4VA 4DPLA 1A76A 2V7QA 3D3EA 2P3OA 4Z0NA 4ER0A 1RNLA 3C7CB 2PGOA 1TA4A 5DVZA 2WJAA 1ULHA 4J6EA 3IQWA 3KHSA 2ODNA 3TNLA 2JH8A 1V9CA 1W36C 2WHQA 1SHLA 2BLNA 3LX5A 3BVPA 5G53C 4ZGBA 1XMPA 5CVTA 4RORA 1UPUA 3RKRA 1EVLA 1VHQA 2CBGA 4JA2A 2AC4A 4RZXA 4HNSA 1BCSB 1TFUA 2WU4A 3DBRB 4PG6A 4D5GA 4B33A 4Z54A 1H6CA 2GSWA 4A8JA 3TW8A 2BFCB 3IQFA 5E6RA 2XXJA 1NBHA 3AVPA 4YCBA 3SHWA 1MRZA 1SVOA 2HA3A 1J09A 2D4HA 2B4RO 1EGHA 1ZGZA 1IIBA 2N1BA 3JARA 1ESNA 1D2AA 1WPRA 4JB2A 4WZBB 3RQSA 3RYHA 2E2WA 4HB0A 4U02A 3DL0A 1Z13A 1H8ED 2ZUSA 1DCMA 3FHLA 3GDWA 3HM2A 3K9GA 3ES9A 1EFVB 3LC7O 1YF3A 3DG9A 3S44A 1ZPDA 1PN3A 1M1YE 1YS2X 3EVEA 2YCLA 1JQLB 2FPMA 4EY7A 2QVGA 3BICA 1AF4A 4C6SA 3T9AA 3LHSA 3PQCA 1BNCA 1I2BA 2WPNA 4M1TA 4NE7A 4UXIA 3ZK7A 4DMCA 4Q03A 4IMIB 1TADA 1U4OA 1ZIYA 2AE1A 1M1YA 2C98A 2QYTA 2VK8A 3A6ZA 4PC3A 4B79A 5JNTA 1T9BA 3R5KA 5HQTA 1DKMA 3B3QA 4IUDS 4G1VA 4J0HA 4MYSA 3HWRA 1MP0A 3C15C 1E7WA 4CKWB 3WZ2A 1RMTA 4QECA 4L72A 5LM3A 1S4QA 3ZHBA 4JMLA 5K0BA 3W8RA 4DLXA 3WR5A 3KJGA 2IYVA 1FFBA 3BHNA 4M4SA 5K8LA 2CF5A 5BNFA 4PEVA 4RTOA 3D8HA 3QFCA 2DQ4A 3NYIA 1Y37A 4Z49A 5COQA 3WS7A 4DV4B 3L8EA 3ELWA 4D9GA 3ZWPA 4ZT7A 2L17A 5J2UA 1P7YA 2Y1LA 3A06A 2FMXA 5CMLA 4LG1A 2D5BA 5HKLA 1LQUA 4O08A 5DT2A 1E60A 1TUEA 1QSGA 2KHZA 1IWBB 2EHJA 1NKSA 2NZYA 3KKQA 4LZPA 2H0RA 1R6XA 2GUWA 1XEFA 4GOLD 1UQTA 3B2EA 5JZVA 3TOCA 1ZUD1 3KSRA 3C14C 4LQLA 3E3MA 4JX9A 4OXYA 1Z17A 2P68A 3ZDXB 3UJ8A 3LFHA 1JFVA 4GEGA 3LOQA 4ZYVA 3MWYW 3D0QA 3RHFA 3HB5X 2Y6UA 4JS0A 3GA5A 3FUVA 3P1JA 2BFDA 5CBKA 1KRXA 5DLDA 5K45A 3LP6A 2DECA 4NWIA 2CEKA 5JS8A 3A28A 2PFKA 3U80A 2AJCA 3T12A 1JSCA 2FK7A 1EE1A 3PHGA 2VP4A 1MIHA 3HY6A 1NLYA 3KV3O 3Q8MA 1KQ3A 1XVUA 1FSPA 3H2IA 2IU4A 5IM4A 5BR8B 3OOWA 5FCDA 3TIIA 1TM4E 5D51S 3VGPA 5G0UA 1IBLB 1UC5B 1DIBA 4UXJA 1V25A 1Z06A 2HEIA 3ER8A 3DE6X 1YB7A 3VI3B 4Y1GA 3I05A 3LO5A 3NJRA 5HZKA 1A72A 1MJGM 2XLCA 3T7EA 4G2TA 3HH8A 4F4FA 4YRSA 4E6PA 4DAOA 2FW8A 2OM6A 2DFDA 2WM3A 2ZEJA 4MUEA 4EF6A 5KCMA 1I6KA 3P0JA 1HZZC 2WSSA 3G0OA 2P1DA 3QPBA 2XH8A 4K3UA 3SICE 4F97A 2WJPA 2CJWB 3DM9B 2WIFA 1B6RA 4NH0A 5FL7A 1SUFA 4HT3B 5JDCA 3DVAB 1PTJA 3IBCA 4Q4JB 1MOQA 1ZXLA 1TRHA 1B14A 4MYUA 3LM8A 1VQ1A 3QLVC 4QYWA 1LQ2A 2WQZA 1QHFA 2CDAA 2W22A 3LT2A 1N92A 4HLUC 4AJPA 1F1JA 1Y3AA 2C4HA 3CNOA 3GG9A 3KWFA 4G5RA 3FAZA 3E3NA 3UPTA 4Y18A 5FUBA 1E0SA 2C07A 1VHTA 2YHIB 2Z98A 3OJCA 3KEMA 4EUFA 3VQTA 1TQ6A 3U81A 4HUTA 4IQGA 5IRCD 5DB4A 2J3LA 3OETA 2EQ5A 1KI1A 2QD2A 1ICEA 4JQYA 5AVZA 1SFRA 5JXJA 4OQMA 1JKIA 3DL7A 3ZWKA 4P4SB 4ARBA 4MJ7A 1M2OB 2C20A 3LS2A 4R2LA 1QB7A 3ZY2A 3IURA 5HCNA 3K2EA 1AZSC 5ADHA 1RE0A 5AVRA 1WNFA 2Q1SA 1HFJA 2CBZA 3NTOA 3NIFB 2A5JA 2IVFA 2XPCA 4FE3A 2XEXA 1QPBA 4PE5B 4GBED 3BH6A 4WX2B 4ZZ0A 1RT9A 4XVCA 2ZRDA 1L0BA 1QE0A 3E23A 4ZALA 3GIDA 2WUDA 1WE2A 3FPCA 4FCCA 2ZAIA 4TXMA 1Q19A 3FMVA 1S3FA 3L6OO 3R6DA 4D0GA 1K86A 5GADl 4Z1MA 1X1SA 3MYRA 2F7SA 4F11A 2F8SA 3EGWA 1ZJ6A 1N2XA 5K20A 1SO8A 1Z0KA 2NYAA 3LBHA 4IV0A 3LO8A 3ZDDA 4DBZA 1Z7WA 3RH0A 1W75A 2MSCB 4XUDA 2MINB 1ODCA 1QZZA 2X3UA 5KYNA 2Z1NA 1WCXA 3GJ5A 1XVAA 4HNUA 2JBAA 1MW8X 3FCAA 2RE8A 4L74A 3KR9A 2C3MA 1KZ4A 1JR3E 2VPPA 2DYKA 3KYJB 2C4NA 2X13A 2JAOA 3JQEA 3NRJA 4MUBA 4R1TA 2BRUC 2XUIA 5SZIA 4KV7A 2GK3A 1RQ7A 3OLYA 4DLAA 5B3AA 3UXEA 1FFYA 1ILWA 1I2MA 2SCUA 2FN3A 1P1RA 3A26A 2HBYA 2WF6A 5ALVA 1TYZA 4L5CA 1KY5A 4EO9A 1LS1A 1CR0A 1JFFB 3EVCA 2H7CA 3UN1A 1JP7A 3E9DA 4KUHA 2HR1A 4XJXA 2O8DA 3AQ4A 3P2IA 2HHCA 2PWZA 1M2WA 2QU8A 4IDNA 1VP3A 1E2FA 4NZPA 3OMWA 4CW7A 1UM9A 3ORHA 4V38A 1LDNA 3DAGA 3F73A 4J1TC 1IWOA 2BC9A 1KRHA 2H5IA 1OLXA 4I5DA 4AZTA 5KTOA 1VLZA 4GE3A 3CBQA 5KX5A 4U6SA 1TJ4A 1JUDA 1FVHA 1UJCA 2QE7A 4MVJA 3U3KA 5L3QB 1ZU4A 1DTSA 2NO5A 3GP3A 3G5MA 4PG7A 1CFJA 4ZQCB 2WTUA 2AHOA 4WAUA 4KJXA 4B32A 3NP9A 1RWVA 1QGDA 3GY0A 4K86A 1SZJG 1W47A 1DCKA 2GBLC 4RA9A 4A0GA 4F6RA 5JAIA 1PE0A 1TDJA 1QCZA 2OBXA 3HGQA 3BGOS 2JIZD 3U40A 3C7DB 2XNJA 3H05A 4LNUB 4F21A 1XWFA 3IBYA 3EIFA 3X0DA 2FAXA 3FLAA 3MWEA 1W0KA 1N2OA 2F1IA 4ASUD 4YHHB 1OASA 2H51A 4O4HA 1RYNA 4NNJA 1FDOA 4OYRA 3LT4A 4TWZA 5IDYA 5JNLA 3J81k 3BD8A 3EW7A 2BYTA 2Y1XA 2QDXA 4ZARA 4BFCA 4ZAFA 2CZGA 1ESMA 3PYXA 5E4FA 1DQSA 1QRAA 2JFQA 4I4LA 5GGYA 4LF9B 2DUNA 1G8FA 5D7NA 1KPHA 3C97A 4RNCA 2EHDA 3ZLTA 3FPKA 3TR0A 3GJTA 3OQ6A 4IFBA 4GP9A 3HY4A 3KR2A 2HAEA 4RD6A 1VRVA 3U1BA 1CX9B 4J0EA 3NGMA 3FXAA 1HFKA 3ZDBA 1UDCA 3T1NA 1BFUA 1MJFA 2Z2KA 1Z36A 2I87A 3GAAA 4RM2A 1G59A 2AYYA 5EIXA 2GZ1A 1JR6A 4YAUA 3FDFA 3WLHA 2IOYA 3LU1A 2BMFA 2I2WA 2IRWA 2SHKA 3PKZA 4RXTA 4DIEA 1REQA 5A3RA 1CKEA 4F1KA 5BMOA 4MXDA 2V7EA 4DRZA 4R2MA 2AZTA 2VA9A 3VPXA 5J4VA 1L8XA 1Z45A 4PPNA 1T4CB 3CPEA 4Q34A 2PMFA 4DA9A 1QH8B 4UEWA 5K3AA 1Y5LA 2P4UA 1GCGA 1KZYC 3MRTA 4D4HA 2JEZA 3TQTA 4QBFA 1E59A 1C30A 1EZ4A 4ABYA 1FSZA 1L4BA 3KEGA 3P0FA 4OAOA 5HE8A 4ZEWA 3ZV5A 3AV0B 4KFRA 2NU8A 4NJEA 4TRRA 5HA5A 1RHKA 5BT9A 4X61A 1SG0A 3DYVA 4QSHA 3IJPA 3LH5A 5F5NA 5TPWA 3ULKA 3PC8A 2DHRA 2PZLA 4P08A 4F9TA 5KOIA 1IY8A 2GPBA 3U56A 1V2GA 3K1ZA 1P74A 1XWIA 2AH5A 3R4VA 1FVOA 4IDPA 3OSUA 3RVQA 3WNQA 4DLWA 3BL5A 3LBNA 5CCEA 5JNUA 1CR6A 1WU8A 1BHSA 2N1MA 2AK2A 1U2RA 5JSZB 3B89A 2MSWA 2X4IA 3CF4A 3W78A 1V0JA 4GO1A 5K8IA 2FFHA 1SWWA 2W00A 3FB1A 3W0LB 3WNZA 121PA 1OJ7A 1DO2A 3EOBI 2L0XA 4FHEA 5L3SB 4QO8A 2QZ9A 4LYGA 3HNRA 5EXTA 4IJUA 5AW4A 4J7CA 4B5KA 1R15A 3L7YA 1W4ZA 8ABPA 4LV6A 1GPH1 1CY7A 3BA6A 4OL9A 5IXSA 2H1SA 3DMTC 4FUTA 4WK2B 4I3FA 4DUPA 4TLMB 3E9YA 4WLEA 3TOXA 4H7EA 1MGOA 3FNQA 2VZ8A 2JB9A 2E9SA 2CLCX 4N5NA 3SAJA 1D5WA 1CR1A 2ZT8A 3LC0A 1GR0A 4Y2PA 4AYWA 3GLIB 1A2QA 1Z0DA 2PT6A 2BR3A 2YVUA 2Z9CA 2WHPB 1CLEA 2EWWA 2QQ5A 4KWCA 1KJ9A 1NUHA 3QITA 3JASA 5G02A 4JL6A 3F4LA 4K1XA 3GLRA 4ZOAA 5ICMA 4HWGA 3QVXA 4KQ9A 3RW9A 4N41A 2DB3A 3U4IA 1GPLA 5EWMA 2PIAA 2WT4A 3PE6A 4DSAA 1NMXA 2W4IA 3BT7A 3CYFA 3U3MA 4BQFA 4RX1A 4CQNA 4WASA 3DT9A 3MAAC 4P54A 2YYZA 3GFSA 3VU1A 3HDVA 4ZMBA 3KKZA 1J7JA 3TTXA 4WKOA 3P0EA 2ZSKA 4G23A 3ITNA 3AEKB 4HAWA 4EHLA 2CVHA 4F8EA 5JEEA 1KBQA 3WYEA 3IB3A 3DW1X 4LQCA 1O0SA 3AF2A 1LRLA 3BDAA 2CFTA 2QRUA 2XQGA 3L05A 2Q1YA 3RTGA 2Q2OA 1T1JA 5EJ7A 1PHRA 3FSEA 2EWVA 3NWJA 4WESB 1IN4A 3KUKA 2ZE8A 4LYHA 1Z56C 3LHIA 1JVNA 4AX4A 3IUMA 4AY4A 4CETA 1JE1A 4U8GA 4KX3A 1T2AA 1S6YA 2XQJA 4B83A 1GG8A 1PGJA 1VJ5A 2NPOA 4KQWA 3HM9A 2Y8EA 4H6WA 1KKMA 1N6RA 4X8OA 4DIOA 2JCBA 4KZKA 1JDPA 3LFTA 2Y4OA 5D6OA 1HE8B 3K9LA 4EGCB 2Q46A 3GFFA 4K3VA 1ADGA 1PTKA 5ALKA 4GYWA 5FTWA 1QIMA 3OT1B 5JC8A 1NZJA 2ZFUA 3I5UA 2DKOA 3OJWA 4KDFA 5HCIA 1TAHA 4BB0A 4NAUA 2O19A 3IOBA 4I08A 4QFBA 3S0JA 1T4GA 4DEVA 4R3UC 4XR9A 3D6NB 3SWWA 4YGXB 4Z4EA 2JARA 1Q12A 1SUWA 3SY8A 1R6UA 1OLSB 3E48A 4YS6A 2YXPX 2VJMB 3QMPA 3X1MA 1SKUA 1U9IC 2B3TA 3AIOA 2OZKA 1NJ5A 2WKWA 5F12A 4JXXA 2J0QA 1NBEA 4UHFA 5JXIA 5LP6A 2BM8A 4C6RA 4GW3A 5A1JA 3K71B 3D81A 5FPYA 4XWAA 3RRFA 1IL0A 3FWPA 3EXHA 2GSDA 1KI6B 3OLZA 1SKMA 1KZHA 1E0AA 2V0NA 3H0KA 1NBMA 1JNYA 4FKBA 4MW6A 4KQEA 3R3XA 1YBVA 3QI2A 4YN3A 2IDJA 1YRAA 4PHFA 1KFCB 3TD6A 3UHOA 3I2KA 1V8FA 3LZ6A 1HE1C 1Y8QA 2FMIA 2O0HA 2VLBA 2X77A 3DUFB 3KX2A 3PFCA 4S2UA