3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
1TNDA 2FZ4A 1PLLA 2D4HA 2KB0A 4JVSB 3LD9A 1I2DA 1QHXA 1DBSA 1DO2A 2C9CA 3C8UA 2WKPA 1QHGA 3HR7A 4KI0A 4MITA 4NYMR 4PPGA 4QBIA 4GI7A 4TTRA 4UKDA 2OV2A 2YJTD 3QXHA 5KYKA 1TUIA 1QG4A 2EQBA 5DHFA 4KLZA 4YMVA 4FXPA 1UDWA 2OE2A 4MUBA 4YC7A 1W2GA 1RIFA 5AUQA 3LX5A 1HYQA 3A1SA 2XOKA 3TGPA 2D2FA 4NYMQ 1S1MA 5G3YA 5DE3A 1VCOA 5FL7A 5JMTA 5L3SB 5B64A 1ODFA 3TJZA 3CWZA 1M74A 1VPLA 3KKPA 3BC1A 2Q3HA 4TQ9A 2GK6A 1IHUA 4NZYA 3UWKA 1UBCA 4NU0A 2OILA 4ACAA 4MRVA 4M8NE 4UJ3A 1E9BA 1G291 1XCMA 2ODEA 4NHOA 4ITRC 3F0TA 3LVQE 4Q9LA 3LAWA 4AKGA 2KWIA 3X1YA 1KI6B 2ERYA 3EIQA 4NDZA 2JJ1D 3LBHA 4YXWA 4JLJA 1LTQA 4Q1BA 2FFAA 1R5NA 4FN5A 4E22A 3CH5A 1UEJA 4D26A 3KKMA 3GQBA 1EG7A 4PAOA 2ZRHA 5BYJA 4QXAA 2QBYB 1NJFA 2VHJA 1P7CA 2WKRA 2F6RA 3KQNA 2XTMA 1CJUC 2JAQA 3M0EA 1LY1A 3THXA 2ZREA 2RB4A 1Q3HA 4Q5IA 4CF7A 3ZH9B 4TMVA 2GF9A 4TYYA 1OPXA 3B60A 4KBFA 3L0SA 1EFRA 2HT1A 2ZRIA 5LD2B 4HEJA 3GLFA 5KSZA 2ZS8A 4Q7MB 1DELA 1G5RA 2ZSDA 4AY2A 4L15A 1C1YA 3LRPA 2BMDA 2PMKA 2NMVA 3Q72A 3QKSA 1IN7A 1M8PA 2OCBA 4RD1A 2WWIA 1IN6A 1E96A 3SYLA 4G5GA 3BIFA 4KO8A 2DFTA 4KCGA 2CL7X 4KFRA 4MRRA 2QENA 3KKQA 5FOTA 3NDPA 3E70C 5HKKD 5C1BA 1MKYA 1UJ2A 1FUUA 1E2MA 1Z6AA 3B5JA 1KI7A 1KKLA 1R5BA 5IK2A 4AD8A 4EFMA 1E2DA 4KFSA 3A36A 1ZM7A 4LBZA 4PPNA 3BORA 1GFIA 5KOYA 2BBSA 2CVHA 1GDDA 3U7FB 2B6HA 2VQSA 1ZM2A 3QKSB 3OFND 4AKHA 4MDFA 2QRZA 5SZIA 3CX7A 5KNCA 4V03A 4S2EA 3TAUA 1HA3A 4BZXA 1Q1ZA 3R7WA 2CHVA 2Q21A 3B1WA 4NMMA 3A4NA 3VTKA 4DEXA 3IEVA 2ATXA 1N5KA 3GLGE 3TKLA 2XITA 4W5JA 1OXVA 2G0NA 4LI0A 4BUJA 2EYQA 3THOA 3C15C 4OKSA 3DHWC 3LXRA 2OBNA 3LX8A 4G3XA 4TMKA 1VCMA 2JJ1A 4W5HA 1S8FA 4ZDIA 3OZXA 2RGXA 1ONBA 4EAQA 5CK5A 3WYFA 3CPEA 4ZDKA 1G3QA 2QE7A 1XXHB 5DIFA 1YZNA 2C95A 4EJSC 4D6PA 2QM7A 1OFTA 3KUDA 2YOGA 3FMPB 4F7WA 3V4RA 3SQXA 4CZ2A 2X2FA 1D9ZA 3PITA 2VH5R 1M7BA 2WJGA 2ZI7A 2IYWA 4M9ZA 4DDTA 1AKEA 2HLDA 5CITA 1UAAA 1G18A 2ZI9A 2OFWA 4G5SA 1COWA 3IHWA 1E9SA 1XMSA 1V43A 2IYLD 4GSYA 2ODBA 2YINC 3LLMA 4POAA 3AVUA 2VSFA 1Q44A 3KFXA 3EPHA 2XTZA 1FX0B 1E2IA 2D74A 3SHWA 3VX4A 2LKDA 1YZQA 4Q4JB 4YQFA 2PT7A 1XXHE 4O3MA 4IW3B 4EPYA 2ZJ5A 1ESMA 4FWTA 4A0FA 3K0CC 1DAHA 5DH9A 3KXIA 1EK0A 3QIAA 3L0IB 2GXAA 2OFOA 3QKTA 1P5ZB 4NTZA 5L3RA 1E4VA 4QHTA 3O47A 4PC3A 2Q3FA 3ASZA 2XZOA 1Z0JA 2R6AA 1N6HA 2ZRAA 3DM5A 3IO3A 1Q22A 2EW1A 2PCJA 2IYZA 4UNQA 4URZR 1P73A 4K8OA 2OO7A 3TSOA 1Z29A 5HZKA 2R6CA 4DVGA 5EUMA 1ESNA 3GP8A 3FFAA 1E2QA 2WVJA 1W46A 2GEDA 2V4ZA 4TLBA 4BEBA 4GDFA 2ZVPX 3OAAD 2JLSA 1RW4A 3PR1A 4NCNA 1OE0A 2GRJA 4HZUA 2OHFA 1Z63A 1MT0A 1W36D 4BLOA 1OHHA 3QXJA 4RZ2A 1XFAA 3VHXA 2QZ4A 3D6TB 1S3GA 3Q7PA 2DYKA 4BASA 2R6GA 2OCPA 2NOAA 4JVLA 2GJ9A 2QG6A 4JLVA 3C4JA 1NKSA 1KI2A 4C0HA 1W0JD 3OEHD 3W3AA 1WF3A 2H7VA 1JBKA 3NC1C 4JSYA 3QBTA 1DG1G 1GVNB 1W0KA 1E79D 2ZJ8A 2J3EA 4P32A 4ABYA 1RVDA 2AK2A 4DLSA 3K70C 1T5IA 2PZEA 5AJZA 1EWQA 2DPXA 4URXR 2BM1A 1P2SA 3S1AB 4KVGA 1II8B 2QTFA 3H2YA 5GJWC 3SS8A 3CRRA 2HXSA 2PX0A 2YWHA 4MQBA 4B48A 2ZI3A 2H5EA 2EFEB 2BKUA 3M4YA 3QG1A 1M2OB 1NI3A 2R65A 4OK6A 4QG7A 3U4QB 4PPFA 3F3YA 4AI6A 4B2LA 1XD9A 1EX6A 4CEJA 1HEIA 4OI1A 2FSIA 3UXMA 4NH0A 1COWD 3UATA 2AR7A 2FWRA 2ZR7A 3DDCA 3NH9A 1JR6A 2VEDA 2GEUA 3SI7A 3ONWA 1Y3AA 5LD2C 3W5IA 2V6JA 2QGZA 1I4LD 1KAGA 4NYJR 4AYWA 3CKLA 1VHLA 2NTYC 3L0OA 4F91B 4DDUA 1D5CA 1BMFA 5EXXA 4TLEA 2ZI4A 1CLUA 1KO8A 3MAAC 2DWOA 4RD6A 3TW8B 2XJ9A 2D7CA 5HCNA 5SZKB 4IOKA 1ZD8A 3U4QA 2L0XA 2FE4A 2ZQ5A 1WRBA 3V9PA 1N6NA 3NBXX 1ZU4A 1XPUA 1DARA 1TQ4A 1DAMA 4WA7A 3WMGA 2H18A 3UMFA 4JLNA 1DPFA 1XCGB 3KKOA 3T1OA 3THYB 5H68A 4IDHA 1EX7A 1C9KA 1JB1A 4JJZA 4A92A 4DSNA 3TSWA 2JASA 3V00A 1OJLA 4A8JC 3KL4A 1G21E 2EFCB 4LBWA 4BFTA 1MRSA 4US2R 2PJZA 4PSKA 2O8DB 3QXCA 4GZMA 2GJAA 2ZU6A 1AIPA 2OAP1 1CR2A 3UG7A 5CJ2A 1T9HA 2G77B 2C96A 2ZS9A 3GEEA 1CTQA 3WYGA 3BRWD 3K9NA 3RRYA 3O8DA 2R44A 2Z4SA 2HV8A 3PG5A 4KXFB 3EPLA 4FI3C 4DSOA 3K53A 3AVYA 2FF7A 4TZ0A 4JYCA 4BFZA 1KIMA 4GMXA 2JJ8A 4R98A 4H9GA 1Z6YA 4M1YA 3DL0A 3QUSA 4ACBA 5KDLA 2IEZA 1W0JA 3OEHA 5DO9A 4LYJA 4IEEA 1NLFA 1R8SA 1W0KD 4Z51A 4RD2A 3BK7A 4U5XA 3NTUA 3NKVA 1QHSA 1E2HA 2ZSFA 3UIEA 1UM8A 3EX7C 2IYUA 1O87A 1P9NA 3TK1A 3M6AA 3AP3A 3VFDA 2IUTA 5FTJA 2O8EB 1XU4A 4JLMA 4YMUA 2HLDD 3BERA 4L9SA 3I61A 1PVOA 3GLHA 2IXGA 1KZGB 5EJEA 4OHZA 4WXRA 4X8OA 4B6FA 5A4JA 1FQKA 2VP6A 1II0A 2IWHA 2IYTA 1W4BA 2BBTA 4CT5A 3D3QA 4D4KA 2G6BA 1RJ9A 1NVVQ 4B35A 2J5XA 3L43A 5JJIA 4ZCLA 4OQLA 2IS6A 4HZIA 5FUXA 1WMSA 1IY0A 5HTKA 1GNRA 2GJKA 1EWRA 4EUNA 1W49A 3CNOA 4ASUA 2ZVQX 2ZUDA 1M34E 1XEXA 5FTMA 2WWFA 2GA8A 5M04A 1CR4A 4I1SA 3TW4A 1ZVQA 2QNRA 5GJVC 1ZNXA 3QXXA 4M9QA 4EDHA 3LW8A 5D3MA 1II8A 3BWDD 5E7MA 5KU1A 1SULA 3NHBA 3QF7A 1TQDA 3ASYA 3PUXA 1VCNA 1DOAA 1CF4A 2DWPA 2O8BB 4HDOB 4XSHA 2AKYA 2ZM5A 3AVOA 4D4JA 1VYUA 3DMDA 1XP8A 2OZEA 1GL9B 2QU8A 3X2SA 3BJIC 2PT5A 1Q57A 1CXZA 1OHHD 2WOOA 5SZJA 1J8YF 1F2UA 2PMDA 3RDPA 2A30A 2QPTA 1IY2A 1SHKA 4N0EA 1G4UR 221PA 3ZDQA 4M9SA 2BBOA 1AZSC 3Q7QA 5E95A 2KBFA 3NBFA 3Q5EA 1OSNA 4B34A 4M1MA 5JI2E 1MO4A 4V0OA 3SFVA 1N5JA 2GEVA 2IF0A 4BLQA 1MRNA 2I4IA 1H8ED 4IVRA 2V1UA 4A36A 3W90A 1ZUIA 2YWGA 3GFOA 4K81B 1ZMXA 3IO5A 3QI2A 2ZTSA 1RRCA 4JBXA 2QQ0A 2AXNA 2VP5A 3K1JA 3DVLA 4OHXA 5B30A 4X8LA 2OBMA 1GWNA 4IXNA 1BKDR 4IHQA 3FMOB 3A8TA 2F3TA 2ZR0A 2VHCA 1GILA 3CF2A 4PO9A 1TQ6A 4PR0A 1KTVA 3Q8XB 1NSTA 3DZDA 3JZMA 1OH5A 1DO0A 3SJCA 3T61A 3K8YA 1A82A 4OJKA 5JCPA 2ZROA 5JJLA 4BGDA 3CWQA 1DG3A 4C0LA 1W5SA 3VHLB 1YZTA 3K9GA 4V0LA 3VX3A 2QAJA 2VHQA 1KK2A 4KFTA 3U3MA 2D7DA 2P6UA 2V55B 4LC1A 3NVAA 4UXJA 4WBSA 1NKTA 2BMFA 4B43A 4XWOA 4DC9A 4DHEA 4ZDJA 5C4MA 2JDID 4KSBA 3AF3A 4OJQA 4P0TA 3UKDA 3C14C 4KFUA 1XEFA 3K0CA 4DCUA 1T0JB 2D3WA 3C16C 3OIVA 1YE8A 3W6PA 3J81k 1CKEA 1HTWA 2GXQA 3QPWA 4HAWA 3QQ5A 3VU9A 1DTSA 2QGNA 4OI4A 2AX4A 2CHGA 3K70D 4UJ5A 1E99A 1ETUA 3F5FA 4GFDA 5FBWB 3EWSA 4ARZA 5KO2A 4C30A 4DDWA 3CONA 4QOSA 2GNOA 3LFUA 1I2MA 1JQLB 2GZAA 1KSFX 2VSOA 3K0AA 1SXJD 4TSFA 2PZFA 3AF0A 2GKSA 1Y63A 1G64A 3AQ4A 4C2UA 2BEJA 1WE2A 3BH7A 5L3QA 1BOFA 3HYTA 1YVDA 2ZRDA 2H57A 4Q1DA 3FKQA 5CM8B 4A4DA 4AYTA 3KFVA 3FYHA 2VHUA 1ZM9A 2P3SA 2YZ2A 5FR1A 2FFQA 3FDIA 3TR5A 5D3MB 4PC6A 1G7RA 4AURA 1ZD1A 1SVIA 1WB9A 4TTPA 3FMIA 4E07A 1SQ5A 4CEHA 4MGKR 4RFSB 1OB2A 1Z07A 3ZD6A 3NWJA 5TY0A 2A5DA 1TU3A 1GSIA 4CW7A 4HAUA 3IDQA 4CEIA 2CE7A 5KSOA 4GOJA 1X86B 2X77A 1P3JA 2I1VB 2RHDA 3KJEA 4IFEA 4QGFA 1E2PA 3GLFB 4M4SA 2G1KA 3EZ7A 2ATVA 1OXXK 4LYHA 2PLFA 3L82B 2CE2X 1SVSA 2V7QD 5DHAA 1XDBA 1KJYA 2WZQA 1OW3B 2D62A 2XB4A 4LC0A 3S1AA 1TTTA 5IRCD 4C2TA 1H65A 5F9FA 2IYQA 4MGYR 1EFHA 4MRSA 4O0MA 2OCAA 4IDNA 4OQFA 1FPMA 1T3LA 5EXPA 5FR2A 2NZ8A 4QBFA 2OEPA 1Q1QA 1HQCA 3A4LA 2PLRA 1D2MA 1GKUB 2QAGC 2IS4A 1CRQA 5F2EA 1W48A 4V0NA 4AYXA 3QY0A 4A8JB 1XZQA 3UG6A 2RGAA 3K9LA 4LJ5A 4PC7A 4CRWB 4EPTA 2HF8A 4BQSA 3A58B 1G20E 2BV3A 4Q9JA 1W47A 1JR3A 1QZXA 1E9FA 1XEWY 1EXMA 4Q4AA 1J70A 2YC4C 3RRNA 3TNFA 4OYHA 2PBRA 3RWOA 2I3BA 5CDFA 1TL7C 4YDHB 1P2TA 2FEMA 1CJKC 4R7ZA 1DAGA 3RS4A 2O0HA 2CCKA 2P0EA 4G5QA 3WMEA 1KK3A 2F55A 4AG6A 1NY6A 3CM0A 4HSEA 2D2EA 1SVKA 3ZIAA 2REBA 3RS2A 2FSHA 2JGNA 1E2KA 1EESA 1AGRA 5DLQC 1DEKA 3TR0A 2OESA 3GEHA 3L0PA 4B33A 1F2UB 1L2TA 1M7HA 3NC0C 2AN9A 2JLUA 4HLUC 1VHTA 3GJXC 2ASEA 1NLZA 2CK3D 4WZ6A 1AS3A 3CRQA 3CPHA 2KJQA 4HAZA 4Q4AB 1PZNA 4PQFA 1XD2A 2P67A 1AS0A 1YHNA 2HCBA 3CZQA 1KSJA 3UWOA 1ZINA 4D2IA 3NBZC 1CR0A 4Q18A 3C5CA 2BHRA 4JIMA 4MUAA 1Q1EA 1T3HA 3TBKA 1GRQA 4A9AA 4DLZA 5KUTA 4IOJA 3GJ3A 3UANA 4LV6A 4RD0A 3IPYA 2WV9A 3I5YA 2V8OA 4D80A 1N3BA 1FW6A 4GL2A 2VF8A 2XSZA 4PHGA 1QHHB 2P2LA 3NEJA 2GK7A 4U7DA 1UADA 5SZHB 1NF3A 2J7PA 3G5UA 4MH0R 1N6LA 2C9YA 3IQWA 1XNJA 3U60B 4PAMA 2X19A 1UFQA 4F4IA 1XPOA 2LWIA 1GTVA 2OLJA 1JJVA 2IYYA 3NBYC 4TL6A 4O25A 3OE7A 1K8RA 4PO8A 2J0UA 3I92A 3QSYA 4NE2A 3EZ2A 4AWXA 4F38A 4Z1MD 4LPKA 2QROA 2IWRA 4KBGA 1N25A 1U81A 2X8AA 4E03A 1LS1A 1N5IA 1VCIA 4F93B 3VNVA 3SYNA 2BEKA 1E1RD 3BAFA 2ORIA 3B1YA 1G8PA 2FV8A 1RJ9B 2IEYA 2A5JA 2VP0A 4YLGA 4CT4B 4D4LA 4CGZA 1F60A 2O0JA 4TLDA 3WNBA 4DT1A 4DSUA 1Q12A 1SKYE 4TSFD 4QL3A 4W7SA 4UNRA 3OEEA 4PC1A 1Q1BA 4MDEA 1OFHA 1KO1A 4XJXA 5BYKA 2W6ID 4IOLA 2DR3A 4AKEA 2GDJA 5KHOC 5LDDC 4DB4A 3PJRA 2QI9C 3N70A 2ZRGA 1VDZA 1KOFA 4KHZA 3VR3A 1KGDA 1B23P 4C0QC 4Q9KA 1YJ5A 4QRHA 5FBRB 1B0UA 5TVKA 4LHWA 5DN6A 2JJ2A 1F2TB 4B2IA 2DHRA 5FOSA 4C0BA 1ZU5A 3ZIAD 1XTKA 2O8FB 4B3XA 3P27A 4AG5A 2ZRNA 4LGMA 2CDNA 4AIIA 3DMNA 2J46A 1P9RA 4HDQB 5CIQA 3ZZ0A 3L2OB 2OFXA 2NO6A 4RZXA 2Z6VA 3I8SA 1EFCA 3CPJB 5FUWA 4A8JA 2OSBA 4LJ7A 1FTSA 4OQMA 3CR8A 2CLSA 3MFYA 2AFIE 1X8JA 2AWOA 4CYMA 2B7BA 3BE4A 3I3SR 4I4LA 1D2EA 3KXKA 3LY5A 3GJ0A 4R9UC 4FMCF 3BXZA 1Q20A 3NXSA 3RRZA 2F7SA 2ZJBA 4PHHA 3L8YA 1UKYA 4P31A 1OIWA 3AKEA 2NIPA 1AM4D 3H84A 2V7QA 3T12A 5TB5A 4ZKDA 2V1XA 2ZUCA 4LBVA 2QP3A 4BFSA 4LV8B 4M1SA 1E3MA 2B7CA 4ZKEA 4PTLA 3ZVRA 5JHHB 4TMWA 4LJAA 2VP9A 1KK0A 3DO6A 2IYSA 1IBRA 1XWIA 3TH5A 3LWNA 5LBIA 4NP6A 2VL7A 1XTJA 2Z83A 1FTNA 3AB3A 5HR5A 2ZE8A 3V4FA 3CR7A 4DLWA 1QDEA 1E1QA 4Z1MA 4FMDB 4OHYA 4Q02A 2VA8A 5DNYB 1E2JA 1A1VA 2NO9A 1JXOA 3EG5A 1N5LA 4JL6A 2ZSBA 3BOSA 3RANA 5B57C 2JLWA 1JR3D 4QJ5A 2F3RA 4Z8XA 4PANA 2BM0A 5EE5B 5K8UA 4Q7JB 2FFBA 2HDNB 3AVPA 2R6DA 2ONJA 5AUPB 1P6XA 2F1HA 1G3IA 4DUGD 2P65A 3EPJA 3FE2A 4HI0E 1W36B 3TMKA 5ANRB 5EP1A 2W6IA 1RC8A 1YKSA 4PXAA 2YC2C 4TLCA 1GKYA 1GKIA 1ZBDA 1XTSA 2YOHA 4KLNA 3EWAA 2O8BA 1JEDA 2B8WA 3A1UA 1K5DA 4MA4A 4TT3D 4EFLA 4EJSA 1WBBA 2RGCA 2IC5A 3W6OA 1N0WA 2RAPA 4HAXA 3OIUA 2ZU0C 4XWAA 2GAAA 3R9WA 1XJCA 3SE0A 1IQPA 1EGAA 4PZLA 2R9VA 1KO7A 5EQTA 4I1UA 2F9MA 1IONA 3W8RA 3U44A 4QGGA 2IUUA 2A7QA 1KDRA 5FBVB 1XBTA 3TAHA 3ZS9A 4FMBB 3OIYA 1GNQA 4NBSA 4PHFA 1RRPA 2ZR9A 4M9XA 1U90A 4KYIB 4A2WA 3ECCA 2QSYA 5F3WB 3GJ7A 1Z47A 1ZAKA 2XXAB 4NYIQ 5FPKA 2OAQ1 4J0QA 4CIDA 3CF0A 3VR6A 3RS3A 1OXTA 1KNQA 1KY3A 1Z0AA 3R9XA 1OT3A 4HUQB 3SJAA 2O8EA 1AK2A 1NBMA 3X1WA 1G9XA 4LY6A 4DBLC 3EA5A 3RRMA 2ZUBA 5HKKA 3QKRA 4BRWA 4Q19A 4KJZA 4RY2A 3P20A 4YONB 5GJBA 2N1BA 1EFTA 2O8FA 4C0AC 5CDFE 4XD7D 2ZRFA 2JLXA 4FCTA 4F4CA 1UKZA 1DAIA 4AK9A 1BYIA 3QKUA 4LOAA 1DADA 4B44A 4LYAA 1W44A 1F48A 1E1QD 3QE0A 5JEDA 3JVUA 2ZIAA 3EZ9A 2R2AA 3OFNA 5AJWA 4DCSA 4C3ZA 5JEEA 3SQWA 1ZNZA 2DCUA 2YHSA 3DOFA 4HLQB 4QBGB 2J0UB 1YZKA 1G8FA 2BBWA 2FPLA 3EC2A 1XEXB 4S35A 4TYWA 2V54A 4BZPA 4DXAA 1F3OA 3LH5A 1NVXQ 2P6RA 2YOFA 5KNDA 2QBYA 3QENA 1UBEA 4FIDA 1U99A 2XTNA 3CUEF 3U6KA 3K0EA 2ZYVX 3TQFA 4JLAA 3CX8A 3SR0A 1KI8A 4G01B 2Q9BA 5LPNA 3B7GA 2FZLA 2BJWA 3HU2A 3KX2A 1TPZA 1RKBA 2GTPA 2V3CC 4GP7A 4PSVA 1BH2A 4JLPA 4K46A 2C5LA 5FTLA 3H86A 3MRSA 1ANKA 1N6OA 2J87A 3C5HA 3VKHA 1SXJE 3QEJA 4RD4A 1R5OA 1GNPA 2OBLA 4ZIRA 2GCOB 4N3NA 3AF4A 3KQLA 2ANBA 5J4VA 3PEUA 2ZSAA 5H70A 1FQJA 1G4AE 1F2TA 1N6PA 5EE0A 1LB1B 2G83A 3IIKA 1MABB 4UQOA 4WAUA 3WNDA 3EA0A 3PUYA 3VKWA 5K8LA 3HJNA 3WRYC 3B2EA 1MR3F 2OG2A 2IL1A 4DCVA 2CXXA 4X8HA 4EIWA 2CL6X 4DKXA 3KXLA 2FH5B 1GL7A 1SXJB 2QT1A 3D7MA 4RSGA 1NN3A 2ZJ2A 3AKDA 4PPQA 1DAEA 4BFUA 2NO1A 3BH6A 3T1VA 4A0HA 1IN4A 3KUCA 2JLVA 3PEWA 4Q4HB 3QOFA 3AP1A 2E1RA 3I72A 2FOLA 1OXUA 1PLJA 1NBME 4M1WA 4LCBA 4JYBA 1XZPA 5J4HA 721PA 5BXQC 4LHZA 2OUKA 3FGNA 4LJYA 821PA 5EUQB 2RCNA 4TL8A 4JS0A 1JQJC 2YKGA 2UVQA 2MSCB 2Q9AA 4NCKA 3VAAA 3B9PA 1M1YE 2FPMA 2CJWA 3AF2A 2WOJA 1YR6A 3OF5A 4M1OA 1T91A 5EXSA 2PEZA 1VECA 3PUZA 2GETA 2QORA 4L4UA 5AJVB 3TUIC 1QVRA 4A0GA 3IKJA 4LZZA 2VF7A 3A1VA 4PQYA 1JXMA 5G53C 2ORVA 4OK3A 2PH1A 5FL3A 3MWJA 1NMYA 4DUGA 4KSCA 4YMTA 4IXMA 1SVMA 2VLIA 2ZJYA 3B9QA 3W5JA 1T8TA 5A0FA 3TE6A 4WZBE 3EW9A 2W83A 2XNDD 1Z06A 4R71A 5FUVA 1KI6A 4DLXA 2WSSA 4U00A 1Z08A 1U98A 2HJVA 1DS6A 3PUWA 4BLPA 5JRZA 1WDTA 2E87A 5J4YA 5KNBA 5JJKA 3FMFA 4HB2A 621PA 5AWFC 2FNAA 1NIJA 2FSFA 4G5OA 4Q7LA 5FTNA 4RCYA 3AP2A 1T6NA 1YZLA 1KMHA 2ANCA 1U8AA 2RGNC 1YRAA 2GCPA 4KODA 1UKVY 1Z22A 1P62B 5FOWA 4KITB 2MMGA 4LK2A 2ZPTX 4LDJA 3SJZA 2R8RA 1NSFA 3W8NA 1MO5A 4IRUB 1VMAA 1KZ7B 4XVRA 5TARA 3R8FA 2HJGA 4JLOA 1IJEA 1P61B 2A2ZA 2KSQA 3B82A 4L8GA 3T1TA 1D9XA 4OK5A 2OT3B 5EP3A 2HT6A 5FOXA 3WP1B 1E2EA 1QG2A 2QN6A 2WMOB 1BMFD 4LHXA 3TUZC 2WBLC 3KZ1E 2GVDC 2JLRA 1R0XA 2R6FA 1T5LA 1HE8B 4BLTA 2W2VA 1NBMD 1J8MF 3U7HB 4PZZA 4OI2A 2W0SA 4E09A 8OHMA 2CCJA 1VIYA 3VNUA 1KYIA 2CVFA 2KBEA 4HB0A 5JZVA 4D0LB 4LPSA 2H16A 5F98A 1GUAA 3GD7A 3K0SA 3OAAA 2ZI6A 1NRJB 2GCOA 2P6NA 4IDOA 4P4SB 4BECA 2JIZD 1G8GA 4Q9IA 1X1RA 3ADCA 3TUJC 3L8ZA 1CJMA 4OQXA 5TV2A 2J41A 2F9LA 3WMFA 1CRPA 1O3YA 1LVGA 1G8YA 1E0KA 1XMVA 4P3YA 5FL7D 5FFMA 1KI3A 3GLGB 2V9PA 5IDVA 2UKDA 3EIEA 1CS4C 5CJPA 1CJVC 4QBHA 4BRUA 2WSMA 3MCAA 3AKYA 5EE9A 5EZ6B 3VU9B 4DWJA 4GT1A 1SZPA 1A7JA 1E79A 2IBMA 3AVTA 2AD5A 3CF6R 3AM1A 1U0HC 1GRNA 3SEAA 1XF9A 3WY9A 2X1VA 1QHNA 4JMPA 4PC2A 3TSZA 2XNDA 3PV0A 5JWOA 3QF4B 1RZ3A 2EYUA 1L4YA 1J7KA 3ZGXA 4HZUB 3JVVA 5C2JB 2REOA 2QP4A 1QHYA 5E3HA 1ZCBA 1II9A 5IT5A 3DEFA 3B1XA 3B85A 4EQ6A 1YZGA 4BWYA 2JCSA 3SBDA 3ZJYA 3AVQA 4BFVA 1G3UA 3W3ZB 4M0LA 4L9WA 4URUR 4W5WA 5B2ZA 1TEVA 5FI0B 5D3QA 4MRPA 4MKHA 4R2IA 1ZJ6A 2FGJA 3KJIA 3FTQA 3U7EB 1I4DD 4M21A 1KSHA 2XEXA 5FI1B 3ZS8A 4ZIRB 1TX4B 5HCIA 2WJHA 3LO5A 2C2HA 5AUOB 5AUNB 1Q3TA 5L3VA 4IJMA 2VRWA 5KPJA 2DFKB 1ZC4A 3AUXA 4PSAA 1E0SA 4B2PA 4C9BA 3UMSA 4MYHA 3X1XA 1BO6A 2IHBA 3PEVA 4B76A 2AXPA 2A5YB 3D8BA 3I4LA 4PZYA 3E5HA 4CEIB 2FGKA 3KQUA 1VYVA 4B75A 1C4OA 2J0QA 1HQYE 3NEYA 5JECA 4FCVA 4I99A 2AHOA 5UKDA 3NHAA 1F5NA 4PAQA 4TZ6A 1JEEA 1RYFA 3FHCB 3WBKA 5KDDA 2BC9A 3RVBA 3WYAA 1GG2A 5P21A 2O0KA 4D0NA 2W58A 1UKEA 1P9WA 3BFVA 2IW3A 5LB2A 1XRJA 5TMPA 1WP9A 1P72A 1PUJA 3FPAA 3HWSA 3RYTC 4B73A 3MJRA 2C8VA 1A4RA 1ZUNB 2QMUA 4FCWA 1DE0A 2WICA 4Q7KA 4WXPA 5L3QB 3ICQB 3JZAA 2N42A 1E0AA 4QNMA 3REFA 2ZRKA 4C7OB 3AEZA 1U0LA 4GOXA 1Z3IX 2HUPA 3OIWA 4FMCB 1LFDB 1US8B 5FBLB 4HYYA 4G0NA 4YXWD 1GRRA 1ZIOA 3SBEA 1RYHA 1JECA 3ZVNA 1J90A 1R6BX 4KU4A 5FPHA 3REGA 1S9DA 3T5DA 2JLZA 1H8EA 1YU9A 1J2JA 3I8XA 2EFDB 2OM2A 3MUFA 4LJ4A 4LV5B 4RD3A 4TWZA 3OESA 2HYDA 3CRVA 2MSEB 2RGDA 4GP6A 4RKEA 2CMKA 2ZRJA 3DOEA 4GZLA 1FNNA 3GJ8A 2EU8A 2QE7D 4G1UC 2ZE7A 3AVVA 4BZQA 2ZRLA 4DT1B 2IA5A 4JT2A 1WA5A 1VG9B 1NN5A 2GVZC 3P1JA 4KVAA 3U6BA 3PFIA 3K0FB 3UPUA 4A0RA 3EAQA 1U0JA 3WNCA 3KJGA 1A5TA 4KAXA 3TVDA 4XVUA 1HY3A 3W6NA 4RVCA 2G3YA 1I4TD 2Q6TA 3LV8A 2LKCA 1X8KA 2QY9A 4M53A 4NONA 5HE9A 2IYXA 1GP2A 4OQNA 1YRBA 1NP6A 1NY5A 4YMSA 3GLGA 1KHTA 1SKQA 1U9IA 4Z8YA 2ZITA 1OH7A 3BFKA 4UXHA 1W7AA 5AK0A 4O2LA 5FPTA 2QMOA 1D2NA 5BQ5A 4HUTA 4OHVA 4JT4A 1OXSC 3IBYA 1N0UA 4Q1AA 4URYR 4NYIR 2GXSA 2ZI5A 1Q21A 4FW9A 5L3SA 2DBYA 4A6XA 3DM9B 5HE8A 1E9EA 5HZHA 2WJVA 3GLFE 1HT1E 3MG9A 2Z5FA 4TQAA 3FFBA 4RCZA 1VTKA 4ZI2A 3SNHA 3BBPA 5H8WA 4RZUA 5IK2D 3N2EA 5DGXA 5DSZA 2J9RA 1MABA 2A9KA 2CL0X 3EZFA 2JIZA 4MYUA 4F4JA 4LJ9A 1N6KA 2O8CB 3HYRA 1Z6GA 2ZRBA 3QJYA 4YDSA 4MGIR 3ZZTA 5HPYB 5J4LA 5BW8A 3SU8A 4M22A 1OFIA 1T4GA 2VTKA 1W5TA 2WJIA 3Q5DA 3RLFA 3G0HA 4MKIA 2GBLA 1SXJA 5EZ5A 3ZD7A 3AV0B 4HLUA 2EVWX 4TYQA 5EXTA 3GLIE 3E2IA 4HAVA 3WHKA 1AKYA 1E2FA 2ORWA 2F43A 5DI3A 3NG1A 4EFNA 4D4MA 3U5ZB 4DLVA 4OL0A 3EXAA 1ZD9A 1VG0B 4XVQA 2PEYA 1VKJA 1R10A 3IGFA 1X6VA 2DY1A 2VP4A 4DLTA 1KO5A 2VYFA 4Q1CA 4JLDA 3HU3A 3RHFA 5CB8A 4I1OA 3K70B 3A6PC 4EJSB 1E6CA 1IM2A 4V0MA 2YV5A 1U9IC 4H1VA 3D31A 4UXIA 1N6IA 1JI0A 1OV4A 3AGQA 5G40A 3GLIB 1AZTA 2RGNA 2WAXA 1RRGA 3TQCA 1UBFA 2FDCA 2WPDD 4D25A 4RFVA 1JJ7A 1XJQA 2CBZA 4MYTA 3U3OA 1XPRA 4JZKA 1IY1A 4Q4LA 1NN0A 3GLHB 4B3CA 4A1FA 2IHYA 1S1CA 2OXCA 3A4MA 2RKOA 3BB1A 4LYFA 1ZP6A 1VG8A 4B3FX 1AJEA 4TN1A 4TLAA 4Q01A 4ZPXA 1Z6TA 3P26A 2OXRA 4JBWA 4X8MA 1P60A 4WIAA 3U3JA 1VYTA 5CYPA 1CJTC 2NO0A 3CIOA 1FUKA 2QTVB 2NG1A 4M1KA 2BWJA 1SHZA 1AGPA 2EFGA 2F1IA 2KE5A 1JPNA 2WWXA 4EPRA 4A15A 2ZSEA 3LA6A 3THWA 3AKCA 2G88A 1N0VC 1WCV1 1EFUA 1ZYUA 2XJ4A 4P33A 3ZZUA 3VMFA 2QMEA 2YWEA 1ZCAA 4B3DA 1OH8A 2C78A 3R7WB 1SVWA 1XMIA 3WRXC 1M7GA 1CR1A 3B8HA 1OIXA 5DI9A 3PXGA 4LBYA 4MRNA 3BD9A 3LBNA 1MH1A 4A6PA 1ZM4A 3QPUA 4YMWA 4ZCMA 4QM7A 2RHMA 4HDCA 2P5SA 2ZXUA 4UNPA 3VR2A 3WBJA 1G1MA 1UDXA 4I81A 2AKAB 2IUSA 4LJ6A 2IK8A 1OF1A 4IOMA 1NVUQ 2JA1A 4GRAA 5DYGA 5JI3E 1CULC 1S9HA 5J40A 1G7SA 521PA 4JJKA 4QGHA 2WJYA 2PL3A 4XSGA 4IKEA 3ZLJA 1SVLA 1IOZA 5B58C 4QKQA 2WIBA 1KDPA 4IFBA 2O8DA 2IS2A 2ERXA 2E9SA 2MSDB 2BIFA 1Z28A 1KJZA 3I5XA 2C03A 3GMTA 4CEHB 3IPXA 1SKYB 3U61B 4BEJA 1DAFA 1R0YA 2QL6A 4MKFA 5C46F 1NJGA 2MMCA 1PJRA 1S4QA 3KB2A 4TL9A 4TL7A 4ESVA 3PQCA 1ZM3A 1WXQA 5JFGA 1GITA 3K0AB 2XZLA 2VPPA 2HF9A 2RGGA 3SOPA 1TF5A 3KJHA 2REXB 1P4SA 4DLUA 2YWFA 5H1YA 2J59A 2Z4RA 4ILEA 3ETLA 3NH6A 1NL3A 3QVUA 3RS0A 4Q66C 3EASA 3MWLA 2BMJA 3RC8A 1G7TA 5J4KA 3H4MA 1PUIA 1LV7A 2CCGA 5DISB 4Q48A 2JLYA 1IJFA 2XSZD 2ZAMA 5JS8A 4Q1EA 1ZNYA 1BS1A 1XTIA 2FG5A 4GOKA 3G82C 1E9DA 4DSTA 2WTUA 1RE0A 5JCZA 2F43B 3SHFA 1F6BA 1KKMA 4ASUD 1TU4A 3CX6A 3HP1A 4WVFA 4C0KA 4TMXA 2W6JD 3IHLA 1NMXA 5FUYA 2ZE5A 5ELXA 1KO4A 2CEAA 4DB2A 4Q21A 3N2IA 3N5CA 2C77A 1KAOA 1YZUA 1HE1C 1Z2AA 2SHKA 2O52A 1AA9A 2H8KA 3DKVA 3KB1A 3PENA 2Q9CA 4V0KA 3AVXA 2YVUA 2R62A 2YNMA 1P2VA 3BGWA 2BMEA 3TLXA 2V6IA 4XOIA 1JNYA 1PLKA 3Q85A 4Y0VA 3O8RA 1ZUHA 2FN4A 1G5PA 2ZRPA 4GMDA 5FH9A 1K5GA 3C41J 5EP2A 2OLKA 3OEED 1MV5A 3THXB 1XXHA 1IXSB 1G8HA 1NLYA 1TF7A 2LCFA 2VBCA 2QAGA 3I62A 4II7A 3MJHA 3AH8A 3MD0A 3MMPA 4MGZR 4EKDA 2C04A 6Q21A 1HUQA 5JWRA 3ICEA 3RC3A 3CNLA 1HURA 4A2QA 4JVNA 3ZYCA 4BE7B 2GJSA 4P4SA 4AC9A 1MOZA 3RAPR 4QJ3A 2BDTA 2CLCX 2NO7A 3HPRA 5F9HA 1HT2E 5FBQB 3GJ6A 4Q4JA 2A5GA 5AR1A 1CBUA 3GFPA 4U02A 5KSPA 1L4UA 1E0JA 4LSGA 2PJRA 1E9RA 2AK3A 2ZS7A 3IIJA 1FMJA 2RMKA 3O8BA 4O2RA 2WPDA 4GNKA 1KJWA 1KY2A 3FB4A 5K8IA 4JL8A 1V5WA 1UBGA 4HB3A 3PIRA 2XGJA 4URVR 3WXMA 4C7OA 2XZPA 4MKGA 1U94A 5CLQA 2DFLA 3BS4A 4GBMA 2YYZA 4JBYA 1P2UA 4IDPA 5K8TA 2X2EA 3CZPA 1HH4A 3WHLA 2C98A 4B47A 1S3SA 4GPTA 1FNMA 1CEEA 4BLRA 2ZJAA 2QSZA 2ZETA 5AJXA 1KDTA 2CHQA 1JPJA 2UZ3A 1GOTA 4XIGS 4FD2A 2CLDX 4C4PA 4EPWA 1JR3E 2ZEJA 4BFXA 1BIFA 4BPBA 5BWMA 2Q3MA 3QBVA 3HPQA 1SVOA 5CLLA 1IN8A 3SDZA 3LXXA 1S96A 3P4XA 1TAGA 4M1TA 3CRMA 3HU1A 1KI1A 2BCJQ 2W6JA 1NG9A 4CDGA 5CYOA 2JDIA 1E1RA 4MYCA 3C7KA 3A37A 4N1AA 4DDVA 1Z2CA 4NCHA 1U8ZA 2VIIA 3VR4A 4WZAE 1QBKC 1XJ0A 2AFHE 3F8TA 2ZAOA 1G41A 2AL7A 2FEOA 4DCNA 1HV8A 1A2KC 1G16A 1S2MA 3AGPA 1IXZA 3UK6A 5DYIA 2ZRMA 3LLUA 2B21A 2QT0A 3PUVA 4JKIA 2A78A 3UMRA 2ZJZA 5J47A 4KV9A 2C99A 3K09A 4RKFA 5KPDA 3ND9A 1T0HB 3TIFA 5E7IA 1W4CA 2GHIA 4TYPA 1NG1A 2ODNA 5EE1A 4HATA 1X3SA 1UEIA 2ZYWX 1RRFA 4EPVA 4BFWA 4TT3A 1NIPA 2GESA 1AQUA 4F92B 2GBLC 4CEJB 1W2HA 1KI4A 2Q0HA 1ZIPA 4V02A 5CK4A 1Z0FA 3OHMA 4M2LA 2BVNA 1Z5ZA 4TTQA 2DWQA 3MLEA 1U2RA 1KDOA 5E4FA 3TRFA 2W2TA 4JLKA 2Y8EA 1LW7A 1TQ2A 1VG1A 1YR8A 4HLDA 1Z8FA 1GIAA 2F1RA 4DEYA 1VIAA 3GFTA 2GCNA 5DI3B 4LRWA 1X1SA 2QA5A 3QF4A 2EWWA 4WW0A 1OLOA 1U8YA 1E94E 2I1QA 2PZGA 3QG5A 2O5VA 4DIDA 2QUZA 4HB4A 4RFSA 2IX3A 1QHHA 1NMZA 2WHXA 3THYA 2XAUA 2OCYC 5L8VA 4DCTA 4IVQA 1LNZA 1W4RA 5IHPA 2J0VA 2AWNA 3DKPA 5FTKA 1PV4A 1QHIA 4P4TA 1FZQA 2NQ2C 4HAYA 4QM6A 1TMKA 1GAJA 2N46A 4XD7A 2D06A 1Z0DA 1DAKA 1LF0A 1NVWQ 2BKEA 1CU1A 2FU5C 2IXEA 4QHSA 2W2XA 3K09C 3GPLA 4D81A 2JATA 2G0TA 2HCJB 4I1VA 4B3BA 2Z0MA 5JLJA 4OHWA 4B74A 1ZRHA 1L8QA 1YQTA 2H17A 4KYUA 3ADBA 3RNLA 2NGRA 5G3ZA 5EP4A 2DFNA 4H1UA 3BB3A 1T8UA 1W4AA 4QNRA 3SYKA 5GADl 1G7CA 2VP2A 5CB6A 1XD2B 4DIEA 3B6EA 2NZJA 4HLCA 1H8HA 2ZYUX 3CRW1 4JKYA 3ZQJA 1E9CA 4NYJQ 3LNCA 4D82A 1D6JA 2QTHA 3AVWA 1E2LA 1DVRA 4PQRA 1AN0A 2IXFA 3SC3A 2IYVA 4Q1FA 3LDAA 1XMJA 3THWB 2FPKA 2EWVA 1JALA 3T5GA 2WM9B 5JSZB 3ADDA 1E4YA 1KMQA 1E32A 3RWMB 1OKKD 3B13B 3NIBA 2RGEA 3PVSA 3FVQA 1WQ1R 4Q47A 1W1WA 3QVVA 1ZW6A 5FOUA 4US0R 4XTCS 2HYIC 3IUYA 2J0SA 2H1LA 4ZV4A 3HDTA 3O8CA 1GZSA 1YR9A 4XTRA 1JAIA 2ONKA 2CK3A 2IF2A 2XXAA 5JS7A 2XB2A 1OYYA 5E7JA 1LF5A 2BCGY 2QRNA 3T35A 2IS1A 1US8A 1R0WA 3CLVA 5J5CA 1FP7A 2G1JA 4NPHA 4UNNA 3KKNA 5GVRA 5JWHA 4LX0A 3RS5A 4Q00A 4NCJA 5BN5A 3KQHA 4PHTA 2JLQA 4TQUS 1UPTA 3I73A 4Q03A 4QC2A 4UNSA 3FKSA 1KMHB 2P5TB 3T06B 3AUYA 3U3RA 2UZIR 5FPSA 2BJVA 3CO5A 1FFHA 3VR5A 5C18A 4NL4H 3W34A 3B1ZA 2QP9X 4XH9B 2CNWA 4RJLA 4CVNA 3FHTA 3SJBA 5JRJA 1XTQA 1X8LA 2XX3A 4A2PA 4A82A 2J7PD 3B78A 3U3KA 4DLYA 3HR8A 2EFHB 3IBGA 4ARZB 4IDQA 2FSGA 4E5UA 1P75A 1Z0KA 4IVPA 3KTAA 3X1DA 3OE7D 3R8CA 3GCGA 3DZ8A 1N6RA 5C4GB 1KNXA 4TMZA 3R9IA 4BLSA 1RPZA 2GZDA 1Z6XA 1AS2A 2XOKD 4QFMA 2GJ8A 3E1SA 2IYRA 3SN6A 2J1LA 1LS6A 3EPKA 2J7KA 3FOZA 2VO1A 3MSXA 1TADA 1IXRC 4OBEA 2O8CA 1JAHA 3CB4A 2CJWB 3T34A 1G3RA 1TF2A 2WWGA 3QEOA 3VKGA 4FINA 2GXUA 1IN5A 3BH0A 4Q9HA 1FX0A 4QGAA 2VHTA 3CNNA 3ZQ6A 2WWWA 4LJ8A 3RSOA 1AQYA 3QKRB 1FP6A 2ECKA 5LB4A 2ZRCA 1H8HD 4LUCA 5IF9A 2A5FA 1K6MA 1NN1A 3PEYA 1XCPA 4ZCIA 2F1JA 4DRZA 4FMDF 2QMHA 4PFSA 3MGCA 4LWZA 2NPIA 3U7GA 5KTYA 1Z0IA 1J99A 4C0SA 2FMXA 3A1TA 1FMLA 1BYUA 1KK1A 2WJJA 3FWYA 3R20A 2DB3A 1XTRA 1E2NA 5KSYA 3AF1A 2K5UA 421PA 1OKKA 3LQQA 3W9YA 3QNUA 4NCIA 5EE3A 2WAYA 3U2QA 1TEXA 3TVTA 4ON9A 3CH4B 1FOEB 2WKQA 3CW2A 3GJ4A 4B6EA 2HEIA 1R2QA 4JLBA 4V0ME 5BN3A 4JSTA 1R0ZA 4L5BA 5CM9C 1XEWX 2ZANA 1NNEA 2QPOA 2W0MA 1XX6A 2ODWA 2RH5A 3GJ5A 3RSLA 2Z43A 1CIPA 4R2HA 1E2GA 3QPVA 4D0GA 3Q3JB 2QEQA 4B32A 2AD1A 1G3MA 3QXSA 4Q4HA 5GJCA 4ZO4A 4B3GA 1SXJC 3BFXA 5FPYA 2GWHA 3VQTA 3ZVLA 1UF9A 2IT1A 1W36C 1D8TA 2W00A 5JBQA 4EQ6B 5CIWA 1RFLA 5FOVA 3BB4A 2FX3A 4L16A 4QHYA 5G41A 3FKSD 3PCRB 1Q0UA 3EARA 3ADKA 4RZ3A 1OH6A 1IAQA 2FJUA 2GZHA 4LHYA 3FHOA 2C9OA 3GEIA 3LVRE 2GILA 4QJ4A 4JVMA 3X1ZA 4BFYA 1ZC3A 5TXGA 3KDSE 2FFHA 4EPXA 3EIHA 4URWR 1G6OA 2HXYA 5TDHA 4W9MC 4WOPA 4ESHA 3T1QA 3MWKA 5AJYA 1OFUX 2B8TA 2WWYA 4FWIB 2B92A 3KQKA 4US1R 3WP0A 1KI9A 4ERNA 3IIMA 1ELOA 2J45A 3VR1A 3GLHE 2TMKA 3SFZA 3CBQA 1MO6A 2BOVA 1E9AA 4LHVA 1Z83A 5KDOA 3IQXA 1G19A 1QF9A 3P32A 4Y0AA 3SZRA 1NVVR 1FL9A 3LW7A 1CP2A 1YR7A 4PO1A 1S0UA 1ZNWA 1KSGA 4ZI3A 1WBDA 2ZYTX 3ND8A 4P4UA 4OI0A 3U44B 3ZVMA 1M6NA 1OIVA 1TUEA 3A1WA 3Q9LA 4TMTA 4XWKA 2WSSD 5JHGB 2FA9A 3H0KA 1GM5A 3T15A 121PA 2A3RA 1QRAA 3I1FA 5DN6D 2JJ2D 2ZJOA 1XB2A 2WWHA 1SGWA 1OB5A 2QQEA 1G6HA 2RGBA 1E98A 3B1VA 3IEUA 1N2CE 4Z54A 3P4YA 5GVSA 4IEIA 1L7VC 1MO3A 2PX3A 3EZ6A 2H92A 3KTAB 3H1TA 3IILA 2NPFA 2KI5A 4B71A 4HUQA 4ZDWA 2QAGB 2QPAA 5A5GA 1G5TA 1EFRD 2QM8A 3RS7A 1E69A 1T3SA 4DJTA 1G17A 5JSZA 1QVAA 4N0DA 3EC1A 4DLRA 4JL5A 2WMNB 1R8QA 3DPUA 3I32A 4TYNA 2ZE6A 2WIAA 3MWYW 3LBIA 4G5RA 3K9HA 5BN4A 2VSXA 3LQRA 1OYWA 4DZZA 1GL6A 1R7RA 2XNSA 4PX9A 4AKIA 2JEOA 1XD8A 3GLIA 4NKRA 4C0JA 3NDBB 2GAOA 1R4AA 3M1IA 1A2BA 3K0FA 2G9NA 3RABA 2PCLA 2GF0A 2CNWD
chains in the Genus database with same CATH superfamily
4WDRA 2DKNA 1FFDA 1PLLA 3FA2A 4H3SA 3PCXA 1Z12A 1RR6A 3MMSA 1Q83A 4GBED 5IXJA 3MNFA 1DBSA 4KI0A 4NYMR 3BTOA 3EG9B 2IQIA 3HSYA 4HEQA 4UKDA 1QFJA 4QBIA 3JQAD 4TTRA 3N0VA 5LKAA 2YJTD 4AN0A 1A7AA 2ZYAA 5EVJA 3TZEA 4IXWA 5DHFA 2NW6A 3FB1A 5THKA 2P2GA 3OZVA 4FXPA 3AXTA 2V6BA 2RG7A 2VHYA 3NIFB 2HA4A 1EAMA 5AUQA 1M76A 1HYQA 2XOKA 2D2FA 4UOQA 4YRGA 2JIPA 1S1MA 1TZMA 1E7SA 1UDAA 2O7SA 1VCOA 1Y3HA 5FL7A 2HSZA 4N76A 1VKZA 2BFFA 5IW8A 2VH2A 4U6NA 1K97A 3B52X 1LBQA 3N28A 3RC7A 5DLDA 4CKEA 5FWYA 1HNZB 4TQ9A 4B7UA 3DZIA 1UM9A 1NDHA 1SK8A 2H4XA 1AKQA 4IQ8A 4WHMA 3F0TA 3OPQA 4ISCA 4Q9LA 2QKYA 2PKXA 5C8ZA 2ST1A 4AKGA 2WA1A 2VRCA 2QQGA 3DLCA 4Z3OA 3WI7A 2E18A 2EL9A 3EIQA 2JJ1D 2VJMB 2XTAA 3FNGA 1DKMA 3LBHA 4LXTA 4UMDA 4YRTA 1I24A 1C8VB 4XUGB 3FBTA 5HIJA 1UEJA 4UREA 4C4YA 4NFLA 1C9DB 3I30X 3KKMA 4OKIA 3X43A 1EG7A 3DC2A 1W85A 4PAOA 5HRCA 5KOHA 1G6KA 1MAWA 4FSHA 1NX9A 2RGWA 4P53A 2VK1A 4HN2A 4QXAA 3QHAA 2QBYB 1SM4A 4E31A 5LQAA 1A9PA 3KU1A 3IXLA 2CLEB 3R3WA 1JEAA 1J9EA 3CGGA 3KE9A 3QU9A 3M0EA 3DLTA 1LY1A 1YT5A 3JATA 1XLWA 2FUCA 4IG4A 5KWVA 2ZREA 1J5PA 1VL5A 4K6HA 4Q5IA 3OJ0A 4AAYA 3BHIA 4FN4A 2WTBA 5K2MA 1OPXA 3B60A 4KBFA 5A5FA 2AG6A 3DHVA 1NVGA 1EFRA 1L5KA 1NAIA 2DUUA 4DFDA 5LNK6 5BMVB 2YR0A 1ND6A 4HEA6 1DELA 2C00A 1PNRA 4Y6GB 3I1IA 5DGCA 2PWAA 4L15A 1C1YA 1SUWA 2BMDA 3N7AA 4R9NA 4R7TA 5DTJA 5JPIA 3RJMA 1AGYA 1QMGA 3NRCA 1O94D 3Q72A 1RRVA 4K8RB 5TEVA 1IN7A 2JRLA 3S2IA 1M8PA 3T54A 2FQYA 2ZTHA 4R2XA 1IN6A 1E96A 1SVUA 3WAKA 1ABEA 1QRTA 1EUDB 1LWOA 2RH4A 3F2IA 1X77A 3N8HA 2CL7X 1NJSA 4MRRA 3KKQA 3A6KA 1EZ4A 2C07A 1DO8A 1YZHA 2WIKA 3NT5A 3RYIA 1HL3A 2B2CA 1QBGA 3E70C 3G1TA 4ZI5A 4AX4A 2J9GA 1KYTA 2PSFA 2PS0A 1UJ2A 1FUUA 3CEAA 1GCAA 5A4FS 4B1FA 1EWKA 1KKLA 2YY6A 3ELYA 1E6UA 2O7RA 3D0RA 3EPRA 4RV4A 5EAIA 5IDYA 1TEZA 5FNVB 4W99A 3RU2A 3W78A 1Z18A 3A36A 4W1SA 1B8NA 1KR2A 2H8GA 4LBZA 4PPNA 5D1NA 4CMAA 2ZT6A 4ALNA 3COJA 3OPXA 2FRVA 2CVHA 3U7FB 3WGMA 2P90A 3QLUA 1QLJA 2I6FA 4AKHA 4MDFA 1A9ZA 1NQXA 2NTEA 3AI7A 1CF9A 3ITNA 4MUGA 4S2EA 2IHZA 3S29A 4DNPA 5BSWA 1RWVA 2CSUA 1Q1ZA 2LGJA 2CHVA 3R7WA 4C78A 5GZ1A 3E9DA 4NMMA 4WNAA 3A4NA 4BVGA 4CQMA 4G0VA 4DEXA 3K2EA 2ZT7A 2E21A 2ATXA 5EZSA 1N5KA 3ESCA 3ZDYB 3GLGE 1ZVMA 5EJ7A 2P9FA 4XQCA 2XITA 3WAGA 2WI8A 1OXVA 3TXXA 1UC9A 1SB9A 1ABFA 2QVZX 1VSVA 3JQDA 4A8TA 3G02A 5D2CA 3E03A 4Z4FA 4OQQA 1ENZA 1DNPA 4LGCA 2F4NA 1AUXA 1TD1A 4W5HA 1S8FA 3T41A 3SX4A 4ZDIA 1S2NA 3G9QA 5IAAA 4MJXA 1N36B 4K88A 1G3QA 5DIFA 5CG1A 4EJSC 1Z4MA 4MUIA 2QM7A 2XEDA 1MOSA 3O73A 2YOGA 4P6VF 3QVKA 3R5HA 5AH0A 5H3LA 4KIUA 4E5KA 1KTIA 3DUFA 2QSJA 1MDBA 1UXHA 1BE8A 2AFRA 4A26A 4CN9A 3BWMA 1VLQA 2WJGA 4M9ZA 2NU8B 4DDTA 4MTCA 4HNUA 1YSCA 2G04A 3QNWA 4Q6WA 5AVRA 4JXKA 4KE8A 1E64A 1JHAA 3UUEA 1EBFA 4GSYA 1E3WA 2YINC 3LLMA 4U2DA 5EIOA 2WE7A 2CFOA 4BV8A 2ZIZA 3E9MA 2ETVA 1FRQA 4RHEA 2OVFA 4EECA 2VK8A 3GWZA 3KFXA 4G23A 4E2XA 1FX0B 3T0GA 5KQGA 3SZMA 2LKDA 2WM2A 3RTEA 1EUCB 3CNEA 1E5TA 4HKTA 4ND1A 2IYPA 4X5OA 3K0CC 5A2QA 5CXUA 2XCSB 4KWTA 4BB5A 5FKJA 3LPNA 1NJ1A 3QKTA 1JJAA 1G0NA 3A27A 1U5CA 4O2AA 5L3RA 1E4VA 4LKOA 4PC3A 5BV7A 4G5XA 2AUNA 3RYCA 1X2BA 2R6AA 4L73A 5J9FA 2D54A 2AZ4A 1XAJA 3UZUA 2Y68A 1Y5IA 2ADFA 4GWLA 2PCJA 3TJMA 4YCNA 2CLIB 3CE6A 1NDQA 1Z7GA 3HKDB 4BQRA 4K8OA 5LP6B 2FWJA 3OJXA 1PJTA 3HDVA 1EGHA 3IP7A 3MT9A 4ZU3A 3W1WA 1EHCA 1LA2A 1ZDMA 1NUSA 4UM9B 2WVJA 4Q3BA 2V4ZA 1N0IA 1ZD4A 2R7AA 3Q2KA 2VT2A 1RW4A 2Y6UA 3PR1A 4U7JA 5FPQA 4YRJA 1OE0A 4HZUA 4F9GA 2OHFA 1XLTA 4C21A 3STHA 4BLOA 1CJBA 4C5AA 1OHHA 2J6BA 3QXJA 1NOJA 1XFAA 2VF2A 5G0VA 3RUPA 1NW8A 1S3GA 3Q7PA 4IV8A 3VHXA 4BKRA 5JJBA 4DC0A 4DWOA 1FQOA 1JEOA 1FTYA 3HYNA 5ERGB 3C4JA 4AS3A 3D64A 2JEYA 1IOWA 5D7BA 4QOIA 1EQUA 2ABWA 1WF3A 3JTEA 4LRUA 5A3RA 4QZVA 2H7VA 4CMJA 2W6OA 1LEHA 4EL5A 2VPQA 2YWCA 3QBTA 4AU1A 1DG1G 1GVNB 2BGTA 1E79D 2WVGA 4J03A 4ABYA 3GZNA 2EP7A 4RESA 5CUQA 5C1DA 2BM1A 4QQ8A 3S1AB 2HRRA 4TKVA 3FR8A 1II8B 3IUQA 1DIBA 2G9ZA 1CQPA 3F6PA 3QPCA 4AS2A 4KE6A 2CDBA 3IDSA 1UXOA 2VJKA 4N5NA 4PGFA 3UYKA 4NNJA 1CQZA 1M1XB 1SK9A 1YOVB 3F97A 3KZKA 4Z2YA 2BKUA 4F71A 1M2OB 1NI3A 2R65A 1XZBA 3U4QB 3JU3A 2GCEA 3D4NA 4I36A 3AOEA 3VVLA 2Y2UA 4X7PA 2WJ3A 4B2LA 3ZGZA 4AI6A 2D1FA 3OFSA 1XD9A 3UA3A 4CEJA 4Q6BA 1JDSA 4PNZA 3VH1A 5BUSA 4F3NA 2HLNA 2HHAA 2J85A 3PC2A 3DSRA 2AR7A 2FWRA 3DDCA 4DE5A 1E7WA 2J3QA 4LF4B 3S8MA 3OQBA 1R6TA 3SI7A 1BZYA 2PXCA 2CDRA 2QTLA 1CUSA 3W5IA 2WG2A 2YFQA 3E9CA 2V6JA 3GRUA 2QGZA 4JA2A 1LBEA 3DNPA 1KA9H 2P9QA 1JIIA 1P5FA 2EV9A 2NVUA 1RKUA 3F4BA 4C1BA 1W9MA 4CIXA 3QMVA 2GAJA 1YZYA 4LSMA 3AM5A 4ZQIA 5EXXA 2J9XB 1XZHA 4QGBA 3NGXA 1T3ZA 3VAZA 1RD4A 4HNTA 1IU9A 1KO8A 1KBOA 1GPDG 2DWOA 1FXWF 1XRRA 2A0UA 2XJ9A 3MWGA 1XRQA 5HCNA 1ZD8A 3GXBA 3U4QA 4ZHQA 3QMMA 3AFIA 2H7XA 4D79A 4RPGA 3ZNQA 2AOTB 1KH2A 3NQ41 4EX7A 3C1AA 4ZYXA 1ZU4A 4K28A 1LX7A 4QDXA 1XPUA 4OGKA 3RAGA 1QONA 3N39C 3H0EA 2DRIA 4JNCA 4ONEA 4JLNA 3R3JA 1K2WA 3ZIDA 1QTNA 3T1OA 1R3UA 1P74A 5LYJF 2ORYA 1LNQA 2OENG 3OPMA 4DSNA 3AIMA 2GJ4A 2C4HA 2R6ZA 3IV6A 3KL4A 4MCHA 4DJDC 1QB8A 2Q2VA 2ZB2A 4Q3AA 4F4HA 4ENRA 2B8JA 2B82A 3E53A 4PSKA 4OQ4A 4FD3A 2O8DB 3BWEA 3D9QX 1KMIY 3Q10A 2UUPA 2VKQA 3FDZB 2CVOA 3IHTA 4TLLB 1OZAA 1NQVA 2QX7A 2Y71A 4J4HA 2ZS9A 3GEEA 5COAA 5IJXA 5CDTA 4BUCA 1TO6A 3RRYA 3O8DA 5LLDA 2Z4SA 2YXDA 1X1CA 3PG5A 5F9MA 5JC1A 3EPLA 3UY4A 1F0PA 2VT7A 3AVYA 4R98A 4GMXA 3A0RB 2NO4A 1Z6YA 4FYKA 5C32A 1RIIA 3OEHA 2WINI 1C4XA 2D59A 5FPPA 1UBMS 1E2BA 4IIJA 1SRRA 5CMLA 1E63A 3UPTA 1IVYA 4IHJB 4AUNA 1R8SA 1W0KD 5IM4A 1BMTA 2C31A 3BK7A 2HRBA 2BGKA 2PKCA 3F71A 1E2HA 3NEAA 4U5XA 4AZSA 1IM5A 3LUKA 1O87A 1T2NA 4GLLA 1JZTA 4GZ3A 5SV2A 3ADOA 2VZ0A 3FPJA 3WVNA 3M6AA 2LDBA 2QL7A 2AUMA 3K1YA 3AP3A 3T7SA 2CGEA 3TCNA 5EHIA 2FSVA 3ZY6A 8AT1A 3H9EO 5IN5A 5KYUA 2PUBA 4QEDA 3NIGB 2VWGA 3WQSB 2O8EB 1OTYA 2I55A 5EMJA 5AI8A 1QC5A 2I3GA 5SY4A 5DTEA 3SKVA 4OQEA 3DVRX 3GLHA 3N2YA 4MWGA 4DSZA 3M6FA 1Z7EA 1GNTA 2FN3A 4NEQA 2AOVA 1CUBA 1ATZA 4PLHA 5CHEA 2XNCA 3LWDA 2JLAA 3FWPA 3O4FA 4OHBA 5L95A 4UCQA 3UK0A 4I5DA 5CVCA 3AFNA 4D4KA 2UUAB 4DYVA 2BBTA 4KYVA 4CT5A 4YMLA 1NP7A 3JYQA 1HFKA 4P3NA 1YC5A 5AI6A 1W2WB 2J5XA 3L43A 3WFZA 3MWDB 2IS6A 3EUFA 4HZIA 3OQHA 4OMFG 2JJMA 5BYBA 2IITA 4K3UA 1PWHA 3TZKA 1E1YA 2ZUDA 5DSTA 1E8MA 5FLXA 1Q7BA 1TUGA 4NV3A 5M04A 1FVFA 1DWPA 2WV7A 2X58A 3QLTA 1ZXBA 5GJVC 1ZNXA 4CTKA 1J5EB 1P4HA 1K8QA 3H5WA 4B7CA 1T2EA 4BN5A 2RHWA 1LCIA 2PWYA 4MWEA 4M9QA 4PYMA 4FZ5A 4UUMA 5B7NA 3IRVA 3WO1A 3IIIA 3QLEA 4U2CA 2PMBA 2Q3EA 2QRQA 4TYMA 3BAZA 3WADA 1Q0LA 4LG1A 4O5OA 4TRNA 2H2FA 3T3GA 4QBKA 1JFSA 3P2IA 5I7AA 1BDHA 2O8BB 3T0FA 2PT9A 1P5RA 4ZO9A 1LLQA 2VUUA 3NAGA 4GH5A 4XSHA 1B43A 1C1HA 3S4YA 2WYHA 3IR5A 3AVOA 4KAFA 3TL3A 4D4JA 4RHCA 2JFFA 1QQAA 2OZEA 1EXNA 3ACBA 3WJ1A 1CXZA 2YIVX 4R4JA 3R4CA 2GUGA 5SZJA 4IV5A 2PMDA 4TXLA 1IY2A 4OBXA 2VYQA 3FAZA 2PGJA 3AESA 3ZDQA 1CNMA 1GZUA 2AC2A 4INZA 4YAEA 3PC6A 5EHNA 5F51A 4PPYA 2BBOA 2OCIA 5E95A 4G5FA 3AUFA 3F46A 2RHRA 2A0XA 3R3UA 2FHSA 4YRDA 4BLQA 3A9UA 4LFAB 4NJEA 3OZEA 5IRCD 4J0HA 4A36A 1GUBA 2VJLA 3UMVA 3WGZA 3IO5A 1FSZA 2WT4A 2O4CA 1RJEA 4Q9AA 1A5BB 1VJRA 3PFHA 5FRDA 4TVBA 2X76A 5AVQA 2ZCUA 2FPGB 3BCRA 2OBMA 1GWNA 5JCOC 2GHRA 4KE9A 1OBFO 2XBMA 1BKDR 3ZEIA 1IWOA 2BY4A 5FO1A 1I2CA 1NVAA 2JF0A 1EP3B 3H2HA 5J58A 3UAOA 2VHCA 2HU8A 4KIFA 1OQAA 1X7YB 1NU6A 1U80A 4AZ0B 3SXPA 1NBWB 1TQ6A 3AG5A 2ET6A 3U7JA 4MW1A 1Z68A 4UOEA 1WDKA 3DZDA 3TLGB 1U0NA 1P0CA 3JZMA 3RPEA 1X92A 4CMGA 5AD1A 1OH5A 3W6UA 3T61A 2YVLA 1X13A 2BKAA 2FZVA 3I6QA 4BGDA 3CWQA 2O19A 1Y6GA 3HXLA 1RKXA 4K87A 4C0LA 1LI5A 1U8FO 2CVQA 4V0LA 3CZRA 5C7LO 4G36A 5K1ZA 1VHJA 2QAJA 4ECAA 4DR7B 4WFKA 2J09A 1MQ9A 1D2CA 4KFTA 5KOIA 3NHPA 5D1HA 1WW3A 3O2SB 3Q88A 4L75A 4D8XA 1Q0TA 1UFKA 3BGDA 2R60A 2CY0A 4B43A 1JHDA 1NKTA 4WBSA 3SZUA 1MV8A 4IXTA 4DC9A 2BR5A 2JDID 4GOOD 2NV0A 4OP3A 4YNBA 1V35A 1UOOA 1VE7A 1O95D 1EX9A 4ML3A 1MB0A 3L9XA 1IZ8A 1XEFA 2O2JA 3NCTA 3OIVA 3PQ3A 4KFUA 1YE8A 3W6PA 5IM4F 4HAWA 1HTWA 1U7DA 3SS9X 5EMKA 5HUJA 4EKEA 1BOOA 3EMKA 1P1CA 4FJ1A 4CV2A 3LNTA 5FADA 1RKVA 2CXTA 3HJTA 3VNBA 4IGAA 1Q0RA 2CHGA 5A0TA 1PDWA 1ETUA 3RVKA 2W2MA 3CONA 1H3NA 3SZ3A 1ADYA 3C87A 1GZ6A 3CIFA 4XQ0A 2YJ6A 1RJFA 5EVCA 1QG6A 1S2DA 1DRJA 2HQOA 3RFUA 4MWOA 1G64A 4Q4CA 4HDAA 3DA8A 4MZDA 4C2UA 2BEJA 2W8ZA 1I94B 3TOZA 1ZJZA 1N2ZA 4TOIA 3GEGA 1UMKA 4QJBA 4ITVA 1F14A 3IEKA 3EF1A 2ZRDA 3GGDA 3N2NA 3VR6H 2BFDA 5ESRA 5KWJA 1NRXA 3WMXA 4C43A 3HBAA 5K3OA 3GHHA 5LFAA 1PW7A 2YUIA 4B9AA 2HA2A 1LVHA 2PDAA 5CM8B 1ISSA 2IYNA 4A4DA 4ENTA 1JH9A 3KVNA 3MWEA 1KWKA 2DY0A 3GNLA 2E0IA 1XN4A 1RWMA 2YZ2A 1KHHA 1AB6A 5L7YA 3TAXA 1DEXA 5AOBA 4YJ3A 5D3MB 3SBXA 1JPVA 4AURA 2PZLA 1IFXA 1ZD1A 3KOMA 5I7VA 1I5OA 1RYEA 1JJFA 2CNBA 2JZCA 2DFVA 3DT6A 5JVDB 4OUKX 4QUJA 1OUMA 1SQ5A 4E07A 2AJBA 1T5SA 3LDHA 1HDEA 3Q1LA 1GTJ1 4EI9A 2C54A 2G67A 4GMKA 1G5HA 1ZS9A 4KWEA 4F5WA 2P30A 1NMSA 3AUKA 4BC1A 1R15A 3GFRA 5D8DA 4DM3A 5E3JA 5KJCA 1G55A 1YE5A 3EMVA 4LAFA 2JGKA 2RONA 2X77A 1P3JA 2FTKE 2I1VB 3KJEA 4IFEA 4QGFA 5B6IA 3GLFB 4M4SA 2MR5A 2DHEA 3DF7A 3K05A 2XYQA 4IMJB 5AW4A 4MVJM 1R8XA 4OHPA 2PUHA 3L82B 1SVSA 5DHAA 1XDBA 2WZQA 3G7UA 4M87A 4LC0A 1A96A 1OLUA 2H00A 1PIWA 5F9FA 4O0MA 4MRSA 4EG8A 4PRZA 4V3BA 3VPXA 2ECPA 5EXPA 1T3LA 2E4XA 2C4UA 4K0RA 5CD9A 3ET5A 2J48A 2SCUA 4QBFA 5DGDA 3O94A 1LQUA 2PQ0A 1FB5A 3LBFA 4W8GA 2J9ZB 2IE8A 4RL4A 3RD5A 1NJ6A 3JQ7B 4MWBA 1FLVA 4H60A 5CX1B 5T4BA 5JBNA 1MC8A 1CRQA 1TYCA 4V0NA 1XNRB 3QY0A 5K0LA 4FQ7A 2O9JA 4BRZA 4PC7A 3IVMA 3T7AA 4EPTA 2CXNA 1E92A 4H0NA 4RORA 2GM4A 4RYLA 3S70A 5BNFA 1E3TA 2D5IA 4OF4A 1W47A 4OYLA 3LKDA 3LHDA 1TMYA 1XEWY 3DFIA 5ENZA 1JTVA 4OM7A 2W22A 2FZCA 1YF3A 4ITUA 3C8DA 3LUDA 4MQEA 2CMHA 2PBRA 4YALA 2I3BA 3LA8A 5EJ8A 1P2TA 5FWDA 3CMCO 5I8ZA 4D9NA 2Q5CA 2I7TA 5CX4A 2FMIA 4LVUA 5JAZA 3RS4A 2O0HA 3RV3A 2CCKA 5B2EA 3ZHUA 1U04A 4WFJA 4B4OA 5IPFA 3UK2A 3OO0A 2I2DA 3ZIAA 3I1YA 2REBA 3RS2A 2F4VB 1LPOA 2XVMA 3IVRA 2QRGA 3RVNA 1U0SY 4OGGA 3V2UA 2IHKA 2IY8A 3EXIA 3GEHA 3UJHA 3QVTA 1BFKA 1F2UB 5JISA 4I50F 1RM5A 3BJZA 2BI4A 1VHTA 2I2FA 3AERA 4XWGA 3NJ4A 5EL0A 2CK3D 1QOQB 2AOUA 4J7AA 4LDPA 3COPA 3CRQA 2PWZA 3CPHA 4YJKA 5KINB 1PZNA 3BM5A 1XD2A 2G17A 2PSDA 1NOKA 4PCVA 3SMQA 4YX9A 1AS0A 1Y1LA 1N2BA 2FX2A 2HCBA 4D2IA 5HFNA 1CR0A 3OCWA 3TSCA 5KVAA 4YAKA 4G26A 4HR7A 2PL5A 3Q2OA 1N2SA 2CB0A 2GK3A 4M7RA 4MUAA 4U2BA 4O4IF 1QRRA 1EK2A 3TBKA 1GRQA 4DLZA 4QTYA 2I54A 5KUTA 3GJ3A 4NE9A 4JUBA 1T6XA 1NMEA 1XZIA 3BHMA 1XR3A 3IPYA 1ZX1A 1Y8AA 2VR1A 2V8OA 4J1TA 3IH5A 3H8VA 1U5BA 3KQTA 4GL2A 4TS1A 1XVTA 5LL6P 3NEJA 3KUXA 2NU7A 2GK7A 1UADA 5EQJB 3T9BA 1NF3A 3KJNA 2C5SA 4MK4A 3ZD8A 5TGTA 1ZUD1 2DKFA 1X7XA 1C1DA 2WFAA 2X41A 3VDQA 3U60B 1LI4A 1M2EA 5B7GA 4CIYA 3L49A 3MLAA 2RHTA 1XO1A 3AT1A 1RTKA 3JZFA 3T6KA 2OBBA 2YY5A 4O4HB 3RADC 3OE7A 4ZI7F 3IVGA 5KNCH 4HP8A 3D3NA 4PO8A 3RUHA 3LZDA 1ITZA 4AWXA 3PD7A 4Z1MD 4LPKA 2PNJA 1VKNA 4HXGA 3IE1A 1J00A 2QROA 2IWRA 2IKQA 2OB1A 4M49A 5K3DA 4FE7A 4IDBA 3RHTA 1U81A 2X8AA 4G0UA 4K9PA 3VNVA 4ZZ3A 3BAFA 4Q05A 4BDTA 1L7RA 2QQFA 4CT4B 4D4LA 1I1HA 1N8NA 3WGQA 1A3CA 1H1LB 2FPRA 1BVHA 1P8JA 4RPHA 2O54A 2D1SA 2OWDA 1T4CA 3OEEA 2ZBQA 3OCVA 4E21A 2YRWA 1VSUA 4OHFA 3OTWA 4IOLA 4ALMA 5LDDC 3L6RA 3RK4A 1NUUA 3N70A 2Y0DA 3BD8A 4ZOLB 4AMBA 1QO9A 4KHZA 4YRNA 2VK4A 1E58A 3SJ7A 1CEXA 1WXWA 3IHKA 4N3BA 4C0QC 3BF7A 4Q9KA 1YJ5A 1C9NA 4HRAA 2REQB 1PJ4A 3KHTA 3UJ6A 1B0UA 1YA4A 5D5HA 4BX0A 3DZCA 5DN6A 1UJNA 2VJYA 3T8YA 1FS6A 3ECSA 3ORSA 5FOSA 2ID4A 2DUNA 2RKWA 4YDRA 3ZHZA 3ZIAD 4F21A 3ZDAA 1GSHA 4OH1A 1NWHA 3RVRA 4WT7A 3Q3EA 3RCBA 3UGTA 4AG5A 3UA4A 3KYCA 1AX9A 1GZ5A 3WC4A 1HDOA 1Q2UA 3UBMA 4AZTA 5IDWA 4HDQB 2JCGA 1XQYA 2VUSA 5KAMA 4AJIA 1XQVA 2VBIA 4G37A 2OFXA 1SQGA 1VLLA 2NO6A 3UJ9A 2W6PA 1KFJB 2FCAA 5FUWA 2C2GA 5TE9A 3DVSX 2ZBGA 3D6JA 3OZIA 2BUCA 3LSYA 3GDWA 4X1YA 4LF7B 3NWEA 4I1PA 2B7BA 1IRXA 4QU9A 3AI1A 1M1YB 5I9TA 5HS4A 5AKZA 2ZBUA 4MHTA 1HZZA 4MWDA 2JAOA 3NZEA 3O1JC 3U62A 4KR0A 3TOSA 5JAIA 3IKVA 4R9UC 5CBKA 1AHPA 4R6XA 3V46A 3EAGA 3RRZA 2BGUA 3LYHA 3D5EA 3AQIA 3FRHA 3N5KA 2IUFA 1V16A 3ANLA 4ZAXA 2NIPA 1R9MA 3H84A 3T12A 4ZREA 5TB5A 3VJMA 2V1XA 2ZUCA 3BMQA 2WZCA 4LBVA 1YS6A 4WOCA 3TW6A 3S7ZA 1U3UA 2B7CA 2GO7A 4ZKEA 1X8XA 4XX0B 1RXVA 2GBFA 2HRDA 2Z6QA 3NGMA 3N07A 4WZBB 1P4RA 3PP8A 3PXXA 5F35A 1KK0A 2IYSA 1IBRA 2Q0XA 3JQAA 4F3YA 1JLSA 3IDOA 5ISMA 5LBIA 1KEVA 1U2PA 3C3EA 1LK7A 5BP7A 2CJYA 3QKIA 4MW2A 2HDHA 3DZJA 3D8SA 3EXHC 4D3YA 1MJNA 4CETA 4Y7DA 4J75A 3Q8MA 3AB3A 5HR5A 2ZE8A 3V4FA 3QWBA 2A6PA 2VXBA 2ON6A 2VA8A 3L0CA 5DNYB 4J76A 1A1VA 1KRWA 5BY2A 3EG5A 1N5LA 4I4TA 1TC2A 1KP3A 2PUJA 3LUCA 5G0UA 4C89A 3FCSB 2H5JA 2GN2A 1IXKA 4N0QA 1R8JA 4P2BA 3RF6A 5AVJA 2I6UA 1KFEB 4KBYA 4F56A 3LIIA 1H4TA 3DCJA 1ETHA 5L51A 4P81A 2LRHA 3R44A 3AEYA 5K8UA 3AVPA 4KI7A 1F20A 3NBQA 2I8LA 1QGYA 1DC8A 5D3KA 4HG2A 5FHRA 3OQVA 4L4YA 2P65A 1LQ2A 2R1VA 3FVVA 4HNSA 3KVVA 3NTVA 3NETA 5EP1A 1YKSA 1H22A 1OLXA 2B1RA 4UE2A 4UM7A 1GKIA 3CVOA 1ENPA 1QXSA 5HWSA 2FK7A 3DEYX 4KLNA 4R8RA 3LGAA 1JEDA 1CWUA 2QRVA 3GWGA 4EFLA 4EJSA 5LQJA 2R85A 4BLVA 1ZWLA 2RGCA 4I4TB 4DV2B 3W6OA 2J08A 3OT1B 3OWXA 3OPYI 1FZTA 2G25A 1GGKA 1QCYA 2RAPA 3FD8A 3OIUA 3TFOA 1TFUA 2JFYA 2OZLB 4XWAA 2XVXA 3D7NA 2QQ5A 3JYOA 2GAAA 3MT8A 4XGIA 5F33A 1XJCA 5H9VA 1EGAA 3CV3A 3R9WA 1YBHA 3AL3A 2X1HA 1L4GA 4CNQA 1AO3A 3DW3X 3PRJA 1K0UA 3CEHA 2F9MA 4YJGB 1SOAA 4R54A 3W8RA 3U44A 1MZPA 3OD5A 2A7QA 1KDRA 4YUXA 5JMOA 2FG6C 1TJYA 4F2GA 2B9VA 5KJ1A 4DCOA 4NBSA 3VNSA 1R16A 2FQWA 3FHLA 3JV7A 3FZYA 4LA4A 2ZR9A 3WQRA 1Y34E 4L6CA 3D54D 3L8DA 1K06A 2B5WA 4JUFA 1OJ7A 1DQZA 2VRNA 2QSYA 2PFGA 1V9SA 2B1IA 5KYTA 4LF9B 4KKXB 1YS9A 4NYIQ 3E3NA 3DBHA 3I05A 4NZ9A 1M2NA 3WE7A 4N6NA 3F5DA 4J0QA 5M3BA 16PKA 3C6QA 4UOZA 1BXRA 2XMDA 1SCKA 2PMWB 2ZBVA 3DMYA 2QW1A 5HQTA 4DR1B 1D09A 1QFZA 1Z0AA 2Y67A 1L5WA 4GKAA 2EKBA 2O8EA 3H5OA 3EQZA 4ID9A 3VTAA 4DBLC 3AMVA 4WRRA 4CKEB 2WZBA 2ZUBA 1I3MA 2FUG6 3Q5GA 4JLUA 4KJZA 5GOZA 4HWOA 3P20A 2DQ4A 4Q7EA 5CA1A 2YDXA 2WTNA 4N82A 5L3ZA 1UP6A 2V3VA 2ZRFA 2JLXA 1AGXA 3TWOA 3LP6A 1PT6A 4FCTA 3TZQA 3WYBA 1T1RA 4CTNA 3Q6NA 1FBTA 3TEFA 1DOZA 1DAIA 2DZDA 3ZNPA 3ROPA 2B0JA 1JXAA 4LYAA 4YRRA 1DDOA 3FR7A 2Y99A 3IAFA 4G6ZA 1CUAA 3DL4A 2ZIAA 3JVUA 2C8JA 3NANA 4C3ZA 4H7JA 1JA9A 1ZNZA 2DCUA 1V0JA 2B1GA 1PS8A 3G8DA 3M4XA 2J0UB 4OXYA 4QBGB 5H9WA 2FWAA 1YZKA 2BBWA 1WMBA 2Y1XA 4S35A 3V9AA 1QF7A 4IFTA 5I7RA 3S5UA 2PUEA 3DHNA 1EJBA 5CTAA 3HYSA 3F3KA 4BIIA 3QENA 2IEDA 1U99A 2XTNA 2C2KA 4CM6A 3ANYB 3TQFA 4JLAA 3CX8A 4MXDA 1QTRA 1PFGA 3QXGA 2BP7A 2BSXA 2FZLA 1YZFA 4G01B 2UZ1A 1UK9A 4TUYA 5FULA 4EHLA 3KX2A 4BNGA 4H7EA 1ZSVA 4OAOA 4JYAB 1J20A 2V3CC 4YACA 1NNUA 1Y82A 4K46A 1E1CB 1B00A 3H2KA 1T4CB 4QQKA 4PZDA 5FTLA 3C5HA 3OQPA 1MO2A 3ULKA 2VT6A 5AJUA 1R5OA 1GNPA 2JFHA 2P41A 8ABPA 1U7UA 8LDHA 5K03A 1KOGA 5HF5A 2QDKA 4FFSA 5ICGA 3ZN2A 3PEUA 2FUEA 3LECA 2MU1A 2ZSAA 2XMRA 4E1BA 5H70A 4WOBA 3CF4A 1ZIDA 5CFPA 1KYXA 3O1LA 4Q3KA 1MABB 2WUDA 3U9TA 1VMIA 1LLCA 1UMCA 4RHUA 5AW8A 3T9DA 3S40A 3NTOA 1IH8A 1Z5VA 3HJNA 2BKXA 3B2EA 2VVTA 2YYYA 5K5EA 3TD6A 1Z45A 4N0MA 2LCIA 1VPTA 2JGFA 3CEJA 4PLGA 4DCVA 2YMQA 4G65A 1YS4A 4HH3C 4R05A 5EWJA 2FH5B 3D7MA 1ZONA 2H11A 5FQNA 4RSGA 4DKXA 1PL8A 3FOEC 4ZOBA 3L4JA 1NN3A 4B46A 2J3KA 4INPA 2BD0A 4JI6B 2RFLA 5ESDA 2QM3A 4BFUA 4NC9A 4PNHA 3D5TA 3T1VA 4A0HA 2PKQO 4CLEA 3KUCA 4UBMA 2QJFA 1SXQA 2JLVA 4BGUA 4EZIA 2VDUE 4DPLA 1TXGA 4LCBA 3FN4A 4IPTA 1UOEA 3LRXA 4L51A 2GASA 1EBBA 1BCSA 1N5MA 1XZPA 2B25A 1U9ZA 2GDZA 2XA1A 3DQZA 3ITDA 4KSYA 4LJSA 3FGNA 4YT4A 5AHRA 4OYRA 5A6SA 2B98A 4NBNA 3KE8A 4DJAA 2HBZA 3V8EA 3L7IA 2G72A 2MSCB 1ZH4A 2QVXX 4TXHA 3I9LA 3VAAA 5JCXA 3M83A 1VHWA 9ATCA 3TKYA 2CJWA 3AF2A 3AV3A 5E2AA 2HPVA 4M1OA 3WV4A 1T91A 3HA5A 2PV7A 1Y42X 1HT0A 3GBPA 3KUUA 4J6EA 2QORA 1XN1A 3GRPA 3OC6A 4L4UA 3PWZA 4TUYF 3B48A 4A0GA 1H85A 2HJHA 3DO8A 3OTQA 4G85A 4REQA 2IIPA 3TLEA 3AR7A 3KTFA 4MOWA 3QYAA 1DTWA 2FWNA 1NYLA 2BTQB 2Z57A 4YMTA 1UIMA 4IXMA 3ONEA 4JBHA 2QN3A 5C5EA 3DZHA 3GGCA 3R5TA 3SQMA 2W83A 3L1VA 4RQBA 1MC4A 1U7HA 2NU8A 1KI6A 1EXWA 3L18A 4ZANA 1M0EA 4DLXA 1Z08A 1DS6A 3MGAA 1CB7A 5LDGA 2IV7A 4YTEA 4X61A 5JJKA 1Y89A 621PA 1W85B 3TNDA 4DMFA 1NIJA 5BT8A 2R25B 3B3FA 4G5OA 1TZJA 3CVJA 2HU5A 2JFZA 5CVEA 3AP2A 1T6NA 2FLKA 3C3KA 1FP4B 2JIOA 5CVUA 4FT2A 4MEAA 4ZK2A 1UKVY 5F4ZA 2WRZA 4EK9A 3PGA1 5MHTA 4QRIA 2MYPA 2G28A 3PUHA 5FOWA 2BTQA 1GQRA 2MMGA 3JW8A 3NS7A 2GPBA 3E15A 1JAXA 1NV9A 2B2XA 3K0BA 4LDJA 4FR2A 2YFYA 1L8XA 5EJ9A 1FP1D 2DU8A 1VMAA 4IRUB 3UMJA 5TARA 4WUVA 3OPYB 2A2ZA 4TXJA 2OGZA 3B82A 1J2EA 4L8GA 1RXIA 2FR8A 2MINA 2VSNA 2PWBA 4ZOCA 4KV7A 4HRXA 5IAGA 4KQGA 2FF5A 1C50A 2WTMA 3H65A 1RZRA 1SIWA 3RVOA 3OVMA 3BXOA 4LHXA 3TUZC 5A9TA 2WBLC 3P96A 2WHEA 4CMEC 4FQ8A 4ZT4A 3DLAA 4QDJA 5KS2A 3IFSA 1NE2A 2PRKA 4OLFA 4OP1A 1DWUA 3OQIB 1HE8B 4X1KA 1JJIA 4BLTA 3EGDB 3U7HB 1AQ6A 2PQ2A 2XCIA 2ZB8A 4OI2A 5F23A 5FWNA 8OHMA 2CCJA 3R0XA 1F6WA 3CT4A 2A0YA 2VF5X 1VIYA 3U80A 1LC0A 3VNUA 1KY5A 2KBEA 3ODGA 3ZK9A 4UHEA 1H9BA 2H16A 4KL8S 1ZJYA 5FV7A 2HB6A 3RFCA 4RSRA 2DLCX 1KOLA 4XIYA 1OI4A 2ZI6A 4DLNA 1A2OA 4BECA 2JIZD 3VKFA 1XDGA 1X1RA 4PWZA 4Z0NA 4LFCB 2YTZA 4JB0A 4TZKA 3MTEA 1AURA 4OQXA 3UWMA 5TV2A 4UBLA 4YCSA 5COBA 5AICA 5BR1A 3TQIA 3IEIA 4YJHA 4A73A 2VHEA 1C3JA 2NADA 1E0KA 3KB6A 1JKJB 4P3YA 3UMGA 2F3QA 3IJRA 4FYPA 3NV9A 1FP2A 2V9PA 3RT9A 4F04A 4M8LA 3JVDA 4GWGA 3ENQA 3QBDA 3KL2A 3NP9A 3N8IA 3RG2A 1CJVC 1THZA 2HMVA 1B8PA 1OBCA 1C3LA 1GV0A 2PD3A 2AG5A 1T1JA 4FLFA 3MCAA 4GDMA 1T5BA 4Z0TA 4BRUA 1M2VA 4GT1A 4F85A 2YHBA 3M1LA 4DIOA 1E79A 2VC2B 2ISCA 3HKDA 1P4GA 2AD5A 3CF6R 2O6LA 3G79A 4CLDA 3AM1A 4Z9YA 4MIOA 1KZ4A 1U0HC 2JC3A 3JS5A 3SYMA 4BWVA 2NN3C 3SEAA 5JH7B 3DE7X 2X1VA 4MX8A 3V1UA 5L53A 3FJYA 5DNEA 4FOPA 4JMPA 4PC2A 3WFIA 4FDVA 3PV0A 3QF4B 2I71A 1RZ3A 2BFBB 5AP9A 1ADFA 2EYUA 3DT8A 4EBBA 1Z7BA 1RHMA 2G1UA 2PAAA 3E6AA 4BU0A 2QP4A 2VHXA 3H0CA 4XQEA 4C2BA 5GOTA 3H9JA 1Z5GA 1VIMA 3S5JA 3LS2A 1ECGA 3B85A 1SJ9A