3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
3K8YA 3KXLA 2FN4A 4KLNA 3QJYA 2QAGB 3TQCA 3ADKA 1NVUQ 1P75A 2HUPA 1P9RA 3AUXA 2XNDD 2EFCB 2IYVA 2WSMA 1S3GA 1VKJA 2P6UA 2YHSA 3QKTA 4ZO4A 3PV0A 1PLKA 2GK7A 3KTAB 4DB2A 2GF9A 2QPAA 3K0AA 5JRJA 1OFUX 3OFNA 5BYJA 2ZITA 4DKXA 4NYMQ 2XSZD 5EE9A 3A4NA 4LYAA 1JEEA 1IN4A 2PCLA 4LBWA 4RJLA 4GNKA 4XD7D 3C5HA 2UKDA 1Y3AA 1JPNA 4QGHA 2FMXA 4URUR 3RS4A 5CM8B 2ERXA 2NO1A 1W4CA 2OLJA 3UIEA 2JLWA 5J4KA 1S9HA 4Q4HA 4LPSA 1E9RA 2ZROA 4MGKR 3CZQA 1HUQA 1KI6B 4EQ6B 5D3MA 1Q44A 1DEKA 1CJKC 2ZE5A 4B2LA 1COWD 5GJVC 4IOJA 3WRXC 1KK2A 1U8ZA 2CMKA 2A5JA 2BMFA 3L8YA 1L2TA 2RGNA 4WZAE 5CB6A 2UZIR 2ZANA 4WOPA 2V9PA 3OAAD 4Q9LA 3SFZA 5HCIA 3FYHA 2Q21A 2VP5A 3QY0A 3AVTA 4OK6A 4QL3A 4XJXA 1G18A 1SXJD 4DLUA 2ASEA 4V0KA 3LLUA 2CVFA 3Q72A 2OCYC 2ZS7A 3QNUA 3TK1A 4Z51A 1IXZA 4PQRA 1SXJB 1OIWA 1J7KA 3PUYA 2AHOA 1XX6A 4OHZA 3TW4A 1S1CA 5DO9A 3P1JA 2WJGA 3UPUA 2ZAOA 3QEOA 3QE0A 5DE3A 3R9XA 1T0JB 4FD2A 3QXCA 4NYJR 4WAUA 5FBQB 3VTKA 2MSCB 2EFEB 2ZJYA 1MABA 5FTJA 5FBRB 4E03A 2Z4RA 4JT2A 1UEIA 2QQ0A 3EIHA 3GLHA 1NG9A 2GF0A 2XZLA 1BIFA 2J0UB 3NH9A 2R6DA 3AF3A 4DDTA 3GD7A 5GJCA 4Q9JA 4TYWA 1EXMA 4AYXA 5HZHA 1OFHA 1YR7A 2J7KA 1E2HA 3C16C 1UBEA 1ZYUA 3CBQA 2XZOA 3QQ5A 4PC7A 2WWYA 4G5GA 4KBGA 2MSDB 3L8ZA 3PITA 4JZKA 4LHXA 4Q9HA 2V1XA 1NG1A 1E79A 2GWHA 1KDPA 2ZREA 1X6VA 2JATA 2JJ1A 1G3QA 1ZIPA 4C30A 4OBEA 1CRQA 1SHKA 2IW3A 2P6RA 1V5WA 2YV5A 1DAHA 3R9IA 3EX7C 4D26A 2H7VA 1DG1G 2O52A 2ZRCA 1KO5A 4JBWA 4RD6A 4ZIRB 1FNNA 1II9A 1EFRD 2FSFA 1PUIA 4G1UC 5AJYA 2VP9A 2O8EB 2Q9CA 1NP6A 3PXGA 1G5RA 1YJ5A 2QUZA 1E6CA 1NNEA 5AR1A 3Q5EA 3NDPA 1ZU4A 2WIBA 3KDSE 2ODBA 4G0NA 2OCBA 2VL7A 3PIRA 3W8RA 121PA 1QVRA 1H65A 5EXTA 2QP4A 3CPHA 2PZEA 1NJFA 3RC8A 4A6XA 1P7CA 1W2HA 3KL4A 4DT1B 4ZDIA 1W4AA 4OK3A 5EP2A 4F93B 4M1YA 2QP9X 3E1SA 1E1RA 3R8FA 2D4HA 1CJUC 2QT1A 1VMAA 1Z0IA 4EDHA 4Q02A 3SEAA 2H5EA 4DUGA 2YOHA 1OHHD 3T15A 3IBGA 3THXB 2BMDA 1ZRHA 2WMOB 4CVNA 3ZVNA 1IY1A 4C9BA 3QSYA 1KMHA 3I4LA 5LD2C 3F5FA 2ZRFA 2A9KA 2I4IA 4EFNA 3OEED 2BHRA 2RKOA 2ZRJA 4M53A 2RGXA 3QKRA 2GXUA 3IPXA 3IPYA 4HUQA 3EA0A 2H17A 4UNRA 2GCOB 3TUZC 4F4JA 2R44A 2GJAA 4EAQA 4PPQA 4FINA 4C0KA 1IQPA 1NVXQ 4GP7A 2IEZA 2QAGA 3QBTA 1G21E 2G6BA 1UKYA 2Q0HA 2PEZA 3L0SA 4KVGA 5B58C 3RRZA 3C41J 2ONKA 3KTAA 1AN0A 2PBRA 1TUIA 2IUSA 2WJIA 3LFUA 1ZW6A 3I5YA 5KPJA 2JLYA 3CZPA 3QPWA 2Z43A 4Z8YA 5TDHA 1E2QA 3IO3A 4GPTA 4QNMA 5JCPA 4NPHA 4TQUS 1XEWX 4H1VA 1RJ9B 1CLUA 2IF2A 3CRVA 3CWQA 1VDZA 2EYUA 1AGPA 3GPLA 3W6OA 3VR6A 5F3WB 1U9IA 1QHHB 3EPLA 3IHLA 4DCNA 4Z1MD 5TXGA 2WICA 3Q85A 3AVYA 3GQBA 4DSOA 1IOZA 1NBME 3AF0A 1IY2A 4QJ3A 5TY0A 4A15A 2ZJ8A 2X8AA 3U4QB 2GJKA 3GJ7A 1GNRA 1F2TB 3FVQA 4AKIA 1XTRA 3VHLB 4OJQA 4E5UA 2QRZA 4BE7B 1G8HA 3DMDA 4C2TA 4KI0A 4BASA 4QRHA 4NBSA 4IDNA 4QHYA 4JJZA 5DNYB 2R62A 4TYYA 3PEWA 2J7PD 3A36A 1QHGA 3AF1A 3KQNA 5E3HA 1R5BA 3AVQA 1ZNXA 2XNSA 2DB3A 1W47A 3RSOA 3K53A 4R71A 4UNNA 2F1JA 3HR8A 4MUBA 1KAGA 2WJJA 5CB8A 4JLJA 1LF0A 1FX0B 2GNOA 1AKEA 1A5TA 2C9YA 2X19A 2VP2A 2JIZA 1VG8A 2OT3B 3HU2A 3MCAA 3U3JA 1C1YA 2C98A 2VHTA 3MJRA 3FDIA 3F3YA 5A0FA 4KODA 2J0UA 3MWLA 3VX4A 4ZCLA 3BAFA 1GSIA 4LV5B 4RCZA 3KKOA 1CXZA 1SKYB 2X2FA 3OEHD 4ILEA 1U0LA 1YU9A 1MKYA 4AI6A 2J0QA 1UF9A 3UANA 5FBLB 2QGZA 4JT4A 1W0KA 1W44A 1DAIA 2ODEA 3PCRB 3WYGA 2XAUA 3NXSA 3QF4B 4B71A 2WWXA 2BMJA 1Z3IX 1FTSA 5BN3A 1DS6A 3AP1A 4L16A 2WJHA 4Q5IA 3BFVA 1GG2A 2CNWD 2WMNB 4TT3D 5GVRA 4BZXA 4EPXA 1U2RA 2QQEA 5BWMA 4D4JA 1NKSA 3A1WA 2P67A 4DVGA 1GOTA 1AM4D 2FG5A 5CITA 1U98A 3DM5A 5LB4A 4GBMA 4A1FA 1M74A 4ASUA 1G9XA 3P20A 3CM0A 3RS3A 2QI9C 2ODNA 1Q3TA 4ZIRA 2ANCA 1DO0A 1N3BA 1M6NA 2GAOA 3DOEA 3KJEA 4M21A 3ASZA 4Q48A 4YDSA 2JDID 5C2JB 2O8EA 4B34A 2PX3A 4MUAA 4Q7JB 5FOSA 1KI9A 2AWNA 3QXJA 5DI9A 3F0TA 5KSOA 2EU8A 1JQLB 621PA 3IILA 1E2JA 1N5KA 1OXUA 3B1VA 1HE8B 1E2MA 4GZLA 5L3QA 1HEIA 4ZI2A 2BCJQ 2KBEA 3EASA 1XJCA 4IFBA 4PHGA 2AL7A 4TLCA 3KKPA 4DT1A 5FPYA 3K70B 1GL9B 4NYMR 1ZM4A 2ZRBA 4US1R 4Y0VA 2W6JD 3W3AA 2PT7A 3VNUA 2JJ2A 1E69A 1KSJA 1W36B 2P6NA 5EXXA 4DCVA 1N0WA 1KTVA 3TAHA 3THXA 1KJWA 2GCNA 2D62A 4B3XA 1PLJA 1T3SA 2XTZA 4PZLA 4BFYA 5KSPA 2YZ2A 1AS0A 3CF6R 1G6HA 4ARZB 2ZI9A 2H8KA 3BXZA 1ZM9A 3C7KA 4MYTA 2HLDD 5JEEA 2ZJ2A 1Q1EA 5KTYA 1WDTA 4QOSA 2CL6X 2BM1A 2GCOA 2IYYA 3RNLA 2R6CA 2JASA 3T5GA 1XBTA 4CEIB 1T8TA 1IAQA 4WIAA 3NH6A 3AP3A 2WSSA 2ZU6A 3LXRA 3B1ZA 1IY0A 1AIPA 1TADA 3KJHA 2QENA 2VSXA 3NWJA 2WOOA 4NYIQ 4UNSA 4CDGA 5KHOC 2ZUDA 3TUIC 2AXNA 2QROA 1ZU5A 1Z6YA 2F1HA 4Q03A 4D4LA 2BKUA 4D4KA 1QG2A 1KI4A 3W5JA 5AUQA 4HAWA 1OH6A 3RS7A 1NLYA 2KE5A 5L8VA 2I3BA 2IXFA 1TF2A 5EP1A 1F2UB 3O8DA 3NHBA 3D8BA 2IXGA 2WAYA 3VAAA 3X1DA 2QMOA 2OFWA 2IS2A 5JEDA 3E2IA 3MWYW 3GMTA 1RJ9A 5JHGB 4M8NE 4CEHB 3TSZA 3FMOB 3VR5A 2WV9A 2N1BA 3QIAA 3VKWA 4PAOA 4DDUA 4JS0A 1QHHA 1Z2AA 4N0DA 3ZH9B 1OB5A 4LV8B 1BMFA 1IHUA 1A1VA 4UQOA 1NY6A 4DLZA 1W0JD 2YYZA 4YXWD 4C0JA 4M1KA 2IL1A 1VTKA 1Q0UA 1F2TA 4M1SA 4JLOA 3U7HB 4B47A 5C18A 1Z07A 1K5GA 2KJQA 4QBIA 4PO9A 4L5BA 1DAFA 2QMEA 1CEEA 4RKFA 1RPZA 1Z0FA 3GJ4A 4BLRA 4MDEA 3RYTC 4W5JA 3I1FA 4I1UA 3GFTA 1J70A 1CU1A 5J47A 2PMDA 5L3SA 4PPNA 2H57A 4MRVA 1AQYA 4AD8A 4JLBA 3PQCA 3VNVA 1G1MA 1OIVA 2ZRHA 1HE1C 3PR1A 4TTQA 3IUYA 3SFVA 1ZCBA 1FX0A 2WWHA 3PUXA 4PO1A 1UBFA 2YOFA 1N6NA 4HLUA 4LJAA 4MKIA 5IF9A 4AKGA 2PL3A 4TMKA 2W6IA 1P9WA 4DLXA 1SVWA 1T9HA 4A8JB 5KU1A 3GCGA 1HT1E 5JZVA 4PAMA 1EFTA 3ZGXA 2PX0A 3GLGA 4B6FA 3H1TA 4E07A 4TQ9A 4P4TA 1CRPA 4TL9A 4F38A 4MYCA 2NPFA 3NBXX 1SZPA 3BC1A 2WOJA 2GRJA 1VCMA 4B43A 4MGYR 4D4MA 3ZJYA 4C0SA 3B9QA 2H18A 3IIJA 3WP0A 4QBFA 4O3MA 2DFKB 4F91B 3QF4A 2Q3MA 2A5FA 4QBHA 2OBNA 1GUAA 4LBVA 2V3CC 4FCTA 2FJUA 1VYVA 3N5CA 4PXAA 1AJEA 2BOVA 4A0FA 2B8TA 2ZSDA 3K0EA 2R6GA 1WBDA 2X2EA 2GESA 1CULC 1XU4A 1BYUA 5FTNA 4ZV4A 4QBGB 4KSBA 3PG5A 3ZS8A 3CB4A 4C0BA 4K46A 5SZKB 2IT1A 5KSZA 1EX6A 1T4GA 2XTMA 2GEVA 2PH1A 3DZ8A 1II0A 3RABA 4GOKA 3GLIB 2KSQA 1ZM7A 1B0UA 5FUVA 3EG5A 3MD0A 5ANRB 4EIWA 2ZJAA 1MO4A 2A5DA 2A5YB 2ZYWX 1IONA 4D0NA 3AF4A 4G01B 3BB3A 5EE1A 1R8SA 2R6FA 3ICQB 4TQAA 3CO5A 4V0MA 3NBYC 2ZRLA 3NTUA 3R8CA 4DLTA 1E0KA 1Q22A 2ZRDA 1SQ5A 3BK7A 3AVWA 1KO7A 1T3HA 2REBA 3G82C 1KSGA 2CE2X 2QTFA 5DIFA 1XTKA 4I4LA 1GWNA 3X1XA 1CR0A 3OIYA 3NEJA 4EKDA 4OI4A 2ZAMA 2TMKA 3NC0C 3LX8A 3TNFA 3UMFA 4HATA 1N5IA 3BFXA 3FKQA 4ARZA 2VYFA 4Q1CA 4YMTA 1RRCA 1ZNYA 4URYR 1XRJA 2G0NA 1N6HA 1NVVR 1FP6A 5EE0A 1KMQA 5D3QA 1KOFA 3WMEA 3VKGA 1T3LA 4QXAA 4P31A 4CEIA 3L43A 4TWZA 4X8LA 1L4UA 2J3EA 3IQWA 3TJZA 1KSHA 2O8DA 1E79D 3TQFA 2JJ1D 1JJ7A 1N5LA 5AUNB 3EXAA 2V4ZA 4H1UA 3M4YA 1RVDA 2PZGA 3FB4A 1G16A 2NO9A 3LBHA 3K0CA 1R2QA 2YVUA 2AXPA 1Z0DA 1F5NA 3QPUA 3TR0A 1FW6A 2AK2A 3AF2A 3SJBA 1KY2A 4BPBA 2DHRA 1F2UA 4UNQA 2BBTA 1IJEA 3BB4A 4QHSA 4ESHA 3CF2A 1HY3A 1Q20A 1JNYA 3QXSA 3RS5A 4FCWA 4JLDA 5BN4A 2AN9A 4PPFA 3ZS9A 5J4YA 5DHAA 4GP6A 4LHZA 1TU4A 3EZ9A 3MMPA 1QVAA 2GJSA 2NPIA 3QXXA 4KVAA 5FPSA 2QAJA 4TYQA 3EIQA 3DKVA 3WMGA 3W34A 1ZCAA 3U7GA 4C2UA 2GEUA 1E1RD 3MWKA 3L0OA 1XZQA 2ZRIA 3DL0A 2FFBA 1BS1A 2EYQA 3HJNA 4Q19A 4RZ2A 4XH9B 2W00A 4XSGA 1IN8A 2V54A 1W46A 2ZRGA 3I3SR 3KQUA 1TU3A 2GXQA 1I2DA 2ZRNA 4DJTA 4V03A 2G0TA 3TIFA 5JJKA 4QGAA 1N5JA 1ZC4A 1OXSC 1X1RA 1MO6A 1KMHB 2QG6A 4L9SA 2VSFA 4EFMA 1SGWA 1EWRA 4ITRC 2ZM5A 2V1UA 4PR0A 2F6RA 2WKRA 4HUQB 4LK2A 3FFBA 1VHTA 4FXPA 4KXFB 3IQXA 1XEXB 3MGCA 1UKVY 2VTKA 2OILA 2OZEA 4JIMA 3GP8A 4LJ7A 1SVKA 1I4DD 1UJ2A 5LB2A 4A8JA 2XOKA 1UADA 5H8WA 5FUXA 3T1TA 1RFLA 4OQFA 4QKQA 3I73A 2PLRA 1U8AA 3A6PC 3K9HA 3FWYA 3PENA 2IUUA 2GBLC 4BFZA 1E3MA 4CEJB 1TAGA 2V6IA 1KK1A 1DOAA 2O0KA 2VRWA 2PCJA 5DLQC 5FOXA 4V02A 4DEYA 2A78A 2OBMA 4IXNA 4L4UA 4PQYA 3TW8B 1Z0AA 4AG6A 1AS2A 2P5SA 5CLQA 5SZHB 4V0OA 3RWOA 5EP4A 3LQQA 1JI0A 2CCGA 1G7CA 1NMYA 3WNCA 3GLFE 3HYRA 3VR4A 1VECA 1DBSA 2BEJA 5FL7D 5IHPA 1KSFX 4Q1EA 3SNHA 1YZUA 3N2IA 4Q01A 1ESNA 2G1KA 1GKIA 1GFIA 2V7QD 2YC4C 3K09A 4JL6A 3T06B 1CP2A 1SXJE 3LBNA 4RKEA 4JL5A 3GLIA 2G88A 3THYB 3KXKA 4NCIA 5BW8A 4A9AA 4CZ2A 5LBIA 5HPYB 4RZ3A 1VPLA 2AFIE 4US0R 1DPFA 1NLFA 2J46A 3S1AB 3A1UA 1AK2A 2GAAA 4OHXA 1A2BA 3UMSA 4IDPA 4Q9KA 4C0QC 2D74A 4HAZA 4MKFA 6Q21A 2VF7A 4Q7LA 2FFQA 2B8WA 4MRSA 4NYIR 4ESVA 1U0HC 1PZNA 2YWFA 5KOYA 3TSWA 5K8UA 4DLRA 2W2VA 4NDZA 4NONA 5GADl 4OQNA 5LD2B 3AVXA 4URVR 3O8RA 2HF8A 2IYUA 3W5IA 1E2PA 1TF7A 1VG1A 2ZYUX 3MSXA 4P32A 2XEXA 5AJXA 5JHHB 5JJLA 2GVZC 2JIZD 4JYBA 2O8BA 2GEDA 4DBLC 3O8CA 1GIAA 4D2IA 4HB0A 4ZPXA 4ABYA 4NKRA 1FQJA 4EPRA 2OXCA 4LPKA 2IYRA 4BFSA 5C4MA 1J90A 1WCV1 2G9NA 1G4UR 3SN6A 2G77B 4TZ6A 2VP4A 4BUJA 1E2DA 3L0PA 1SULA 2BBOA 4JVLA 4MRPA 2RMKA 2BJWA 1ZM2A 3KUDA 4R2HA 3U44B 4LC1A 1JXMA 1GRQA 3E70C 2JGNA 2OXRA 3CKLA 5SZIA 2V8OA 2ZR7A 1RRPA 2CL0X 1LW7A 1G8FA 2CLSA 3TRFA 3FHCB 4GI7A 4DLVA 1OXVA 1A7JA 1KK0A 4PSKA 1UBCA 1NY5A 1OE0A 4GMXA 2QPOA 1NN0A 4FMCF 5HE8A 4JSTA 5BQ5A 4ASUD 1LS6A 4RFSB 4W9MC 1U94A 1P2TA 1PUJA 4D6PA 3EARA 3N70A 1TTTA 2JJ8A 1MR3F 2Z0MA 1NSFA 5BXQC 3CH5A 3KKQA 4TL8A 3ADBA 5DYIA 1NIJA 3TE6A 4R9UC 2RGEA 1RC8A 2IA5A 4N1AA 3LH5A 4M1WA 2WJYA 4C4PA 1NKTA 1H8HA 2EVWX 5E7JA 5IK2A 1G64A 3AV0B 5FOUA 3C5CA 2PEYA 4E09A 3B8HA 1XPUA 4JLVA 4F7WA 1UFQA 5L3QB 4NCKA 1R8QA 1F3OA 1Z28A 1TQ6A 3EWSA 2NGRA 5G53C 1RYHA 2AKAB 1OF1A 1VG0B 5EP3A 4KLZA 5L3VA 1P6XA 2JJ2D 4KCGA 1FPMA 3CNNA 1E9SA 4M9QA 5J4HA 1DTSA 5H68A 1EESA 3B2EA 4NCHA 4V0NA 3IIMA 2HJVA 1NN5A 3CLVA 3IO5A 4D81A 3GFPA 1P60A 2HYDA 4UNPA 3RRMA 4LGMA 3SYLA 2R9VA 3K9LA 1OKKA 3QG5A 4N0EA 4AKEA 4MA4A 1R0XA 3K1JA 4B35A 3CF0A 1XCPA 2W2XA 1NIPA 2F9MA 4UJ3A 1WB9A 2CK3A 4HEJA 3MRSA 3DM9B 4ZCIA 1D9ZA 4AIIA 5HKKD 1E9AA 1XTJA 1XEXA 1KI8A 4IDQA 2F7SA 2DWQA 2XGJA 2C77A 2C04A 2WSSD 2YINC 2IYSA 4R2IA 4XWOA 2LCFA 3LD9A 3LAWA 3BFKA 3NBFA 4M9SA 1TMKA 5DGXA 3I8XA 4B32A 4DCSA 4E22A 1SXJC 2DR3A 2MSEB 3D31A 3FTQA 3EPKA 1Z5ZA 3IKJA 3CR7A 2ZS8A 1N25A 2FE4A 1QDEA 4YQFA 1XTQA 2VLIA 3REFA 4YDHB 4OL0A 4NE2A 2QMUA 3TMKA 3Q3JB 5AUPB 1W49A 4KFTA 2Y8EA 3JVUA 4CEJA 2Q3FA 4Y0AA 2RHMA 1LVGA 1V43A 3FMIA 3EZFA 1G8PA 4LV6A 2GJ8A 2P0EA 3ICEA 2MMCA 3PEYA 2EQBA 2XNDA 4JVSB 4Q4AB 1E9FA 4AG5A 3Q8XB 1LFDB 4RSGA 3VR2A 1ZP6A 3THYA 1CR4A 1P2VA 3T34A 3BH0A 1SVMA 4TL6A 4Q9IA 5DHFA 3S1AA 2QNRA 2FGJA 3ZZTA 3U7EB 3RSLA 3CUEF 4HDCA 2D3WA 3I32A 4LRWA 3B82A 2IS6A 4LC0A 2GZAA 5JFGA 3CWZA 4WVFA 3ZD7A 2IHBA 1VG9B 4MGZR 3ZQ6A 4G5SA 4P4UA 5E95A 5L3SB 5A4JA 1GM5A 1XB2A 2QY9A 2CL7X 4DZZA 1MO5A 2YNMA 3ETLA 4FMDF 4ZDKA 1R0WA 4HDOB 4AWXA 2W6ID 3K0FB 1TPZA 1M1YE 5C4GB 2VEDA 1XFAA 1KNQA 2VHUA 4LBZA 3P27A 2ZSBA 2W0MA 3PFIA 1GAJA 2NMVA 3GLGB 3W6NA 4J0QA 1GRNA 2QM8A 4QM6A 3FMFA 2QZ4A 2BV3A 1BO6A 1ZD1A 2NQ2C 3KUCA 1JECA 5C46F 5DN6A 3QUSA 5CM9C 3B85A 4BLTA 4B3BA 4EPWA 1T0HB 4YMVA 3SU8A 2AFHE 2FU5C 1S8FA 3U44A 1D6JA 5C1BA 3HU1A 3TKLA 5HCNA 5EUQB 3FMPB 2O8CB 5E7IA 4KO8A 4RD4A 2WWGA 3GJXC 2NZ8A 1B23P 4B74A 2WPDA 1E0JA 721PA 3U6BA 2VHJA 4GDFA 2EWWA 4XTRA 2DBYA 4DWJA 2IYQA 2EFDB 4TMXA 1LS1A 4PPGA 1KZGB 3OIVA 4B3DA 4RFSA 1QBKC 4H9GA 4Q4JB 3T1OA 1E9DA 1YQTA 2XB2A 2QP3A 1S96A 2ZS9A 2FPMA 4EJSC 1O3YA 2D06A 5DI3A 3A4MA 5EJEA 1D9XA 1ETUA 2DY1A 4LHVA 3KQHA 2LWIA 1JJVA 4HDQB 2WM9B 1E2IA 2BM0A 3QPVA 3G0HA 2JLUA 2J59A 1TNDA 1T5LA 3B5JA 3SJCA 2FA9A 3RDPA 1CJVC 2OG2A 3DPUA 4YMSA 4BFXA 3LVRE 2WBLC 1QHNA 3OZXA 2REXB 3K70D 4KFUA 3DMNA 4O2RA 1N6KA 4A92A 3LBIA 1AZTA 3DO6A 2ATXA 1YZTA 1E98A 2ATVA 4QFMA 1XPOA 1E4VA 3SQXA 3OESA 4KYIB 3AH8A 2ZYVX 1IXSB 1T5IA 3I5XA 1W36D 3QBVA 2VBCA 1XTSA 3AGPA 4M0LA 4EPVA 3B1XA 4FMBB 5FL3A 1KIMA 5EZ6B 3TLXA 2HT1A 3TVDA 4JLAA 4L8GA 2QL6A 4IVPA 5J4VA 1E0SA 4BLOA 1BYIA 1GKYA 1F6BA 1Y63A 3WMFA 1E2LA 4D80A 3FPAA 1Q21A 1WF3A 3U3MA 4BQSA 4X8MA 3KXIA 2IXEA 2ZE8A 4LYFA 3SC3A 3UWKA 2PJZA 4BFUA 2IWRA 1FL9A 2A3RA 4BLQA 4TMTA 1UM8A 4IXMA 5FOWA 1IM2A 2WAXA 4OYHA 4PC3A 5DISB 2O8DB 2OFOA 4FN5A 3OIWA 5G3ZA 3UATA 1II8B 2FV8A 1RIFA 1YVDA 2D7CA 3WNBA 4PSVA 4BFWA 3V4FA 2J9RA 1IN7A 3ZZUA 2CJWA 5P21A 4JJKA 2FGKA 4YLGA 1G3RA 4F92B 1AA9A 4MGIR 1OB2A 3LW7A 3Q9LA 3ZLJA 3RRYA 1JPJA 4LHWA 4OKSA 4XVRA 3EW9A 2JLQA 2BIFA 2XTNA 5F2EA 2ORVA 4UXHA 3SR0A 2XB4A 3UG6A 2UVQA 4OHYA 4V0LA 4FI3C 1RRGA 2O0HA 2J0VA 2DFLA 4Q1FA 2GZDA 5B64A 2RH5A 2O5VA 3QEJA 4Q4AA 2IHYA 4X8OA 2X77A 1Q3HA 1XXHE 2R65A 2DFTA 3ASYA 4IEEA 2OEPA 4JKIA 4QM7A 2C03A 3LNCA 5E7MA 4Q1DA 1XD2B 1TEVA 2VIIA 4M1MA 5FI0B 2F3TA 4HSEA 1LNZA 1DARA 4HAXA 2IS1A 3IEUA 3THWA 4NH0A 1HH4A 2ZQ5A 4QHTA 1I4TD 3U2QA 1DE0A 4K81B 2ZI5A 4B33A 2IWHA 4Q66C 4PX9A 3BERA 5FR1A 4IJMA 4NHOA 3MLEA 2OAP1 1GKUB 2V6JA 4M2LA 2PMKA 2BKEA 4I99A 4AY2A 1E2EA 3EWAA 4CT4B 4JVMA 1GP2A 3A1TA 3L82B 1JR3A 1OXTA 2WKQA 2IYXA 2H92A 4UJ5A 1AKYA 5IRCD 1FUUA 1X8LA 2RGBA 3K0FA 1OH7A 1ZUHA 2WWFA 1G3IA 2C9CA 2XOKD 4II7A 2IK8A 1ZUIA 3VHXA 1ZNZA 2VH5R 1T8UA 5IT5A 4PANA 1UAAA 5GJBA 3VFDA 1YR8A 1RRFA 3OFND 1NBMA 1R5OA 5EE5B 1CKEA 1ZM3A 2ZUCA 1KNXA 1H8EA 2AR7A 2YWEA 4HB2A 5G40A 1C4OA 4A4DA 1N0VC 2OLKA 4BLSA 2GA8A 3BH6A 1E9EA 1U90A 3RVBA 3ZQJA 2B6HA 4GOXA 3QVVA 1XNJA 5FTMA 3GLIE 3D7MA 5KSYA 3GJ3A 2DWPA 3LLMA 2FX3A 5FPKA 2O8CA 2CE7A 3E5HA 3KB2A 1OYYA 4IDHA 3LRPA 2WZQA 4B3FX 2ZVQX 2C78A 3ZIAA 2AWOA 2WIAA 2D2FA 5CK4A 1KKMA 3N2EA 4HLCA 821PA 4NMMA 3AKCA 1A2KC 2C99A 4CRWB 4ZKDA 4Q4JA 2ERYA 3CPJB 3HP1A 3AUYA 2O8FB 3QXHA 3Q7PA 2JA1A 3R7WB 4EPYA 3RRNA 1LF5A 4A36A 1JALA 5JWRA 1KO1A 1XMVA 1U8YA 5AJVB 2ZR0A 2XZPA 521PA 4LOAA 1JXOA 2ZI3A 5JCZA 4GT1A 1Z29A 2HYIC 2OUKA 1RW4A 3UG7A 4OI0A 4ZDJA 4HZUB 1Z6XA 2CCKA 1DVRA 3M0EA 3BBPA 3C15C 1GDDA 2C95A 3IDQA 3MUFA 3KQLA 3H2YA 1P5ZB 4C3ZA 4QNRA 1TF5A 3BH7A 3CX6A 3R20A 1OW3B 1OXXK 3EPHA 2RAPA 5JBQA 3GLHE 5EXSA 5F98A 1FNMA 4LY6A 1UDXA 4Q4LA 2BCGY 1EFHA 4QJ4A 2Z5FA 3U3RA 4DSTA 2P65A 4DSUA 2N42A 2G3YA 2HT6A 1EX7A 1D2EA 3VQTA 4HB3A 1HQYE 2QRNA 5B2ZA 1ZUNB 2O8BB 2W58A 4NCJA 4I1VA 2HCJB 1UKEA 1P62B 3VMFA 4LWZA 4PC6A 4TL7A 1ELOA 4GZMA 4TN1A 4QG7A 2QT0A 5JECA 2ZVPX 2KWIA 1SVOA 2FOLA 3AVOA 3QVUA 5FPHA 1TUEA 3B60A 1QF9A 4US2R 2J0SA 3ZYCA 3TH5A 1O87A 2A5GA 2F3RA 1E2NA 4CIDA 1Z0KA 3GJ5A 2GKSA 2ZUBA 3WP1B 3EC2A 1NMZA 1QZXA 4OQLA 2XITA 1GL6A 3X2SA 2ZU0C 4JLMA 1II8A 1J2JA 1L7VC 4LCBA 1FUKA 2CDNA 1KGDA 3DVLA 1WXQA 2Z4SA 3M1IA 2JLVA 1VCIA 2KBFA 3AGQA 5UKDA 3AKYA 4WZ6A 1AQUA 1L4YA 3ADCA 3SDZA 3RANA 1LB1B 2L0XA 2WJVA 4TSFA 5HTKA 1N6IA 3PEVA 2GILA 1AZSC 4LBYA 1CTQA 3WBJA 2WHXA 3B9PA 5JRZA 2FDCA 2BEKA 4YONB 3IHWA 2RB4A 4AURA 1KJZA 4EFLA 1G6OA 2OFXA 3M6AA 4LJ4A 5E4FA 3RC3A 5J40A 5HZKA 5JJIA 5JS7A 3O47A 5AK0A 1R0YA 2QORA 3KJIA 1IXRC 1XD2A 3SHWA 2QE7A 2VO1A 4POAA 4DXAA 1YZKA 3T12A 2ANBA 1SVIA 1XP8A 5KNDA 1VCNA 1N6PA 4DB4A 3WNDA 1KO8A 5H1YA 2REOA 4A2PA 3B6EA 2OE2A 4XTCS 3T61A 1F60A 2OESA 4TYPA 4DUGD 2FSIA 3TVTA 2D2EA 5EQTA 2VQSA 3OE7A 3D6TB 3LX5A 3W90A 3AKEA 2QA5A 3TUJC 4A0RA 3X1WA 4KITB 4TMVA 1KI2A 3NC1C 1OKKD 1GTVA 2IF0A 4LJ9A 2CHQA 2JEOA 4KFRA 1ZNWA 3JZAA 3BS4A 5FPTA 2Q6TA 4RD1A 2YWHA 1OSNA 5FR2A 4A2QA 3J81k 3JVVA 2R8RA 3LXXA 1KK3A 1YZNA 4CF7A 1IN5A 3DEFA 1W0JA 4U7DA 3THOA 4AKHA 1KZ7B 1X8JA 2GJ9A 3CNLA 1XCGB 5L3RA 4JLPA 3U5ZB 1XCMA 4B3CA 1UDWA 1FTNA 1W1WA 3CONA 2VF8A 4KYUA 3PUVA 1WRBA 2WVJA 2OCAA 4S2EA 3K0SA 1JR6A 2GCPA 4TMZA 1VIAA 4BZPA 1E9BA 5ELXA 1DADA 2EW1A 2J1LA 1LTQA 2DCUA 1W2GA 1RYFA 2OAQ1 1P2SA 2WKPA 1BKDR 5TARA 3D3QA 1CBUA 3U61B 4XWKA 1Z83A 4OJKA 3SBEA 3GEHA 5CDFA 3LWNA 4B2PA 4W5HA 3U60B 1G7RA 1N2CE 1XMIA 2BBSA 1NL3A 2DWOA 4B75A 4C7OB 3ZDQA 4IKEA 3MWJA 3NVAA 2LKDA 3BE4A 2NG1A 2XXAB 3KX2A 2F9LA 2FSHA 3C14C 3LVQE 1E1QA 3PUZA 4BWYA 3W9YA 2AX4A 3T5DA 2O8FA 3W3ZB 3R7WA 4WW0A 1FMJA 4X8HA 1YR9A 2C8VA 2FWRA 4TLBA 2R2AA 4BEBA 1R6BX 2P3SA 3C4JA 3RAPR 5M04A 4HZUA 2FNAA 4LJYA 5EZ5A 3FGNA 3ZZ0A 1HV8A 1WA5A 2QM7A 1ZD9A 1S3SA 3VX3A 1X8KA 5CJ2A 2LKCA 4LHYA 1XWIA 2J41A 1G4AE 1Q57A 2EFGA 2QSZA 3VR1A 3WYAA 3BD9A 4XOIA 1ZINA 1HQCA 1IBRA 2BBWA 3BOSA 4HAUA 1P4SA 3HWSA 4LUCA 2IEYA 5LPNA 1DAEA 1F48A 2E87A 1M2OB 1NF3A 3T1VA 5FBWB 2ZSAA 4QGFA 4AYTA 1T91A 5JLJA 1U99A 5JSZA 3GLFB 4WXRA 2R6AA 5J5CA 3QG1A 3BWDD 3LY5A 2XJ4A 3CRW1 5K8TA 4NU0A 1P61B 4OK5A 5KUTA 5DN6D 4LSGA 1XEFA 1KI1A 2QSYA 4Z54A 1QHYA 4N3NA 4A0GA 5BYKA 2OCPA 4IOLA 1W0KD 4HLQB 2H16A 1XTIA 2GBLA 2CHGA 1HT2E 4P0TA 4WXPA 2ZI7A 3AVVA 2NOAA 2VP0A 3CW2A 4PHFA 4GL2A 2IYLD 2WPDD 2YJTD 3WHLA 2QU8A 2QEQA 3KKNA 2QTHA 2ZETA 3LO5A 1P2UA 1QHSA 4I1OA 4MRNA 4A82A 3F8TA 4FIDA 1YKSA 1N6OA 4MITA 5JWOA 221PA 3I8SA 4GFDA 4Q7MB 4RCYA 3H4MA 4O0MA 1NN1A 4L15A 3ZD6A 5FBVB 2UZ3A 3A58B 2HF9A 5BN5A 1QRAA 1ODFA 2GDJA 1FP7A 1L8QA 5KDDA 2Z6VA 2BVNA 2IYTA 4S35A 4PHHA 4G3XA 3UXMA 4JVNA 5DI3B 2PT5A 4JBXA 1CR1A 3RLFA 2ZEJA 2QAGC 3QOFA 1FZQA 3EPJA 2FZLA 4PSAA 2OBLA 4P3YA 1PLLA 3RWMB 3FHTA 1DG3A 1MH1A 3HPQA 1P72A 1J99A 5H70A 1KY3A 2ODWA 2NZJA 3CRMA 4HB4A 5G41A 2A2ZA 2QBYB 5TVKA 2FZ4A 3FKSA 2O0JA 3WHKA 1KI3A 4KU4A 3I72A 2VP6A 4B3GA 2HXYA 2ZRAA 2OM2A 2QPTA 1NJGA 4HLDA 2F43B 1VYTA 2RGGA 2KI5A 1FMLA 2ORIA 2AD1A 4KSCA 2XJ9A 1RZ3A 4NTZA 1GVNB 2CBZA 3NEYA 5TV2A 4DSNA 2GETA 3SJAA 3L2OB 4DLYA 1U9IC 1E4YA 4C0HA 2D7DA 1PV4A 1JQJC 2FPLA 4ACAA 1X3SA 1NSTA 1I2MA 2RCNA 8OHMA 1MRNA 3CNOA 1XD9A 1YHNA 4TLAA 3GEIA 1CR2A 4MH0R 1G3MA 1XDBA 1Z0JA 1Z6TA 4JBYA 3W6PA 1CJTC 5JI2E 3CX8A 2PLFA 3BRWD 2FPKA 1HTWA 2P5TB 2VHCA 3GJ0A 5J4LA 4KHZA 3LV8A 3VU9A 2DFNA 3SZRA 4B6EA 5A5GA 2NO0A 3MJHA 1UPTA 1S0UA 2BJVA 2CJWB 2IBMA 3EC1A 3IGFA 2GZHA 2C9OA 5HR5A 5JI3E 1KYIA 2Q9BA 3CPEA 4TZ0A 2BMEA 2MMGA 4OHWA 4JLNA 1S2MA 2VSOA 3LA6A 1WE2A 4EJSB 3GFOA 4CGZA 1NI3A 2Q9AA 4RD2A 4UXIA 4C7OA 4BRWA 1KJYA 2XXAA 1E9CA 2GK6A 5FH9A 4B2IA 4B48A 1EWQA 2ORWA 3U3KA 2FH5B 4WBSA 1BMFD 1UBGA 4GMDA 1M8PA 1WP9A 2XSZA 1OH5A 1HYQA 3GEEA 4YC7A 2HEIA 1HA3A 4F4IA 2XX3A 4IOKA 3B78A 3THWB 1G7SA 3FHOA 1JEDA 4XD7A 1QHIA 4BECA 1JR3E 1OPXA 4PFSA 5FUWA 1W48A 421PA 5B30A 1YE8A 3RS2A 4D82A 3L0IB 3KKMA 1E2KA 4ERNA 4LX0A 4RZUA 2C2HA 3QF7A 5G3YA 2JLXA 3EAQA 4G5QA 3AKDA 4HAYA 1KI6A 4IDOA 4KV9A 2VPPA 3DHWC 4EQ6A 5FL7A 1NVVQ 3KB1A 4W5WA 3GLGE 3O8BA 1R4AA 4YMUA 4DLWA 1G291 2AD5A 2ZXUA 5TB5A 1JR3D 4IOMA 2G1JA 1G5PA 3NG1A 1COWA 2V7QA 2ZRMA 1YZLA 4JL8A 1SKYE 3SOPA 5B57C 2HDNB 2FF7A 2OV2A 3A1VA 3B13B 1DELA 3VR3A 3GJ6A 1S9DA 4M9XA 1N6LA 3GLFA 1E2GA 3NHAA 2JCSA 1X1SA 3OAAA 5CLLA 2QN6A 4A0HA 4CT5A 2AK3A 2JLZA 1IN6A 1TQ2A 1CIPA 4QJ5A 4UXJA 3FFAA 3HR7A 2SHKA 1NBMD 5FOTA 1SXJA 3HU3A 1H8ED 3EIEA 1OIXA 2BWJA 3I92A 1TQ4A 4A2WA 4DIDA 1ZC3A 4Q7KA 4Q18A 4AC9A 5AUOB 2VA8A 2QMHA 5FOVA 5KNCA 1Z6AA 2IYWA 1LY1A 4MQBA 2ZI4A 1U81A 1G8GA 3ZIAD 3OF5A 3U6KA 3AEZA 3CIOA 4OQXA 2G83A 2QTVB 3BJIC 1WMSA 4IRUB 5CIWA 4FW9A 4GOJA 2GXAA 4LJ5A 2B92A 1OJLA 1K5DA 4Z8XA 1IJFA 1VCOA 3X1YA 1Q1ZA 3QKSB 4LZZA 4B76A 1PVOA 1ANKA 2B21A 4DCUA 2DPXA 4DCTA 4V0ME 5CYPA 3PEUA 1ZAKA 3BORA 2Z83A 3RHFA 4BEJA 3ZVMA 1U0JA 1NN3A 4PZYA 4LJ8A 1MV5A 2P2LA 3SQWA 1G20E 1W4BA 2IYZA 4EUNA 2YOGA 3WXMA 1K6MA 5CYOA 1R5NA 1TL7C 1SVLA 2HXSA 2GXSA 4JSYA 4JLKA 3HYTA 1ZMXA 3NDBB 3HPRA 1G41A 4URZR 2QBYA 1FQKA 1Z47A 1N6RA 3QENA 5CK5A 3IBYA 1JAHA 3SYNA 3TGPA 2ZIAA 2A7QA 4IW3B 2F43A 1EFRA 3OHMA 2RGCA 5IDVA 1T6NA 1P9NA 2CEAA 4KFSA 2RHDA 3U7FB 4IHQA 3PJRA 3AQ4A 4TTRA 4P33A 1M7HA 3SBDA 1OH8A 4IFEA 1D8TA 4XSHA 1GL7A 4PC2A 3SHFA 3TAUA 2X1VA 2ONJA 4D25A 1BH2A 1NMXA 5TMPA 1CS4C 2YWGA 1EGAA 1TEXA 2J45A 2WWWA 2N46A 4WA7A 4M4SA 4LYHA 3PVSA 2CCJA 2OO7A 1MO3A 2ZR9A 3EZ7A 4DRZA 1UEJA 5AWFC 4D0GA 1HURA 2KB0A 4PO8A 2B7CA 1RE0A 3AVPA 1OHHA 4QC2A 1EFUA 1I4LD 4JMPA 4U00A 4U5XA 3V00A 1A82A 4DDWA 1TX4B 1JB1A 1XMSA 4TSFD 1AGRA 4FMCB 4W7SA 5K8IA 2A30A 3OEEA 5JWHA 1YRAA 1BOFA 1ZIOA 1D2NA 5HE9A 4HLUC 4UKDA 4EJSA 1G3UA 4LDJA 4HUTA 1GITA 4ZCMA 5HKKA 3T1QA 3KQKA 5CIQA 5KDOA 1W7AA 1OFTA 1XD8A 1CJMA 3CRQA 4XWAA 4IVQA 3P26A 4TMWA 1ESMA 5LDDC 1D5CA 3ECCA 3KFXA 4OHVA 3B1YA 1DAKA 1G19A 1YZQA 2BDTA 3BIFA 1S1MA 3NBZC 2IS4A 5GVSA 1US8B 2ZRKA 1KKLA 2QE7D 4PTLA 4YMWA 1WQ1R 2QGNA 4MKHA 1RKBA 4R98A 3I62A 5KPDA 4M9ZA 1Q12A 2HJGA 4AYWA 4DDVA 1ONBA 4FWTA 1M7BA 2ZTSA 1EK0A 1D2MA 4HYYA 1OV4A 3C8UA 4NYJQ 1Q1QA 2FSGA 3OE7D 4NZYA 3KFVA 4RY2A 4Q00A 3DZDA 2Q3HA 3H86A 4DEXA 5F9HA 4ACBA 4FWIB 1X86B 1XEWY 2J87A 4MKGA 3AB3A 4IEIA 5JMTA 1G8YA 3CH4B 4HAVA 1R10A 3B7GA 5FTLA 1KAOA 1Z2CA 4Z1MA 3MAAC 1EFCA 4IVRA 4RZXA 4BFVA 3UKDA 3LW8A 1C9KA 1LV7A 1W5SA 3KJGA 1ZD8A 4KJZA 4DLSA 3LDAA 3U4QA 2EFHB 4P4SB 3K9GA 1DO2A 1SKQA 1GNPA 2JLSA 1WBBA 2ZJZA 1XXHB 4ON9A 3R9WA 4TYNA 5CDFE 2ZYTX 1XZPA 1Z06A 2ZSFA 1Z63A 4BRUA 2J7PA 2F1RA 3VKHA 2W83A 1DAGA 3EZ6A 2OHFA 4M22A 3T35A 3FOZA 3K70C 1KO4A 1G17A 1FOEB 2B7BA 2W2TA 4BLPA 3DOFA 5JS8A 3GJ8A 1GZSA 2W0SA 2ZSEA 2NIPA 1J8MF 4MYHA 5SZJA 4URWR 2K5UA 1P3JA 1W36C 2PJRA 4ZKEA 1NLZA 1XF9A 5FI1B 1E2FA 2I1QA 1E1QD 3ZVRA 3QKUA 1NVWQ 2J5XA 4RVCA 2DYKA 4MRRA 1QHXA 2BC9A 2F1IA 4Q47A 4URXR 2GVDC 3K0AB 4NCNA 3P32A 3TR5A 1E94E 1JAIA 1K8RA 1UKZA 2V55B 4HI0E 4M1OA 3OEHA 1ZJ6A 2ZJOA 5EUMA 3QKSA 3SYKA 5KYKA 2FEOA 4RFVA 3AM1A 1YR6A 1G5TA 4PZZA 1VIYA 4KAXA 4AK9A 4BFTA 3SE0A 4XVUA 4MYUA 3WRYC 5AJWA 2CVHA 2ZE6A 1YZGA 1A4RA 3CRRA 4RD3A 3MG9A 4XVQA 4B73A 3UK6A 3TSOA 1NRJB 2CNWA 1OLOA 4TT3A 4Q4HB 3Q7QA 3K0CC 2FEMA 2CXXA 4OI1A 4I81A 1P73A 3K9NA 5D3MB 1CF4A 2HV8A 1M34E 2JLRA 2WWIA 4MDFA 1G7TA 3SJZA 3V4RA 2IX3A 2ZE7A 2C96A 1YRBA 3NKVA 4JYCA 4FMDB 4WZBE 2GTPA 1E0AA 3B1WA 5JSZB 1KDTA 1R0ZA 1Z8FA 1JBKA 2JDIA 2NO7A 3EZ2A 4L9WA 4OI2A 4EPTA 1DAMA 1E96A 4TLEA 2CHVA 1GILA 3SS8A 3A1SA 4O2LA 2NO6A 3UWOA 2ZPTX 3TBKA 3JZMA 5FUYA 3ND9A 1MRSA 4C0LA 1Z6GA 3P4XA 5KDLA 2ZI6A 2E1RA 3WBKA 4KBFA 4LJ6A 2RGAA 4DHEA 4JKYA 2ZJBA 1W4RA 2YC2C 4K8OA 2HCBA 3CX7A 3X1ZA 2FFHA 1E32A 1KI7A 2W6JA 3A37A 1MABB 4BZQA 3EA5A 2EWVA 1XJQA 4OQMA 3UMRA 3I61A 4HZIA 1E99A 3GLHB 3QI2A 1N0UA 4Q21A 1Z08A 1XMJA 3CR8A 2E9SA 1PJRA 5CJPA 3BGWA 1SVSA 5DYGA 3DDCA 2HLDA 3U3OA 2C5LA 5GJWC 4O25A 3ADDA 4B44A 4PHTA 5DSZA 2JAQA 3G5UA 3OIUA 4QGGA 3DKPA 1H8HD 5IK2D 4ZI3A 4A8JC 4C0AC 2ZJ5A 3WYFA 2RGDA 3PUWA 3Q5DA 1Q1BA 2CLCX 4GRAA 4R7ZA 3H0KA 1M7GA 4LI0A 4I1SA 3W8NA 2VHQA 4ZDWA 4FCVA 1US8A 3KZ1E 2I1VB 4PAQA 1OYWA 1W5TA 1FFHA 5KNBA 2AKYA 2FFAA 1OFIA 2CLDX 3RS0A 3ND8A 4NL4H 3AVUA 3FKSD 2PZFA 1GNQA 1VYUA 4Q1AA 5KO2A 3WY9A 2YKGA 5AJZA 1XPRA 1TQDA 1GRRA 1Z22A 3H84A 4G5RA 1R7RA 2H1LA 5DH9A 3IEVA 4D0LB 5F9FA 3A4LA 1S4QA 3AP2A 4CEHA 1MT0A 3ZVLA 2WTUA 1XJ0A 1QG4A 2NTYC 3V9PA 1KDOA 4BGDA 1KDRA 1MOZA 3REGA 2CK3D 1ZBDA 4CW7A 3MFYA 3FE2A 3K09C 1OT3A 2IC5A 5FFMA 3LQRA 1ZVQA 4Q1BA 1EG7A 4F4CA 1SHZA 4PC1A 5EE3A 3SI7A 2RGNC 3HDTA 4PQFA 4P4SA 4YXWA 3BB1A 4TTPA 3A8TA 1AS3A 4XIGS 4DIEA 1XXHA 4M1TA 3IIKA 4G5OA 3NIBA 3P4YA 4U02A 5K8LA 2IUTA 3VU9B 2OSBA 4A6PA 1VHLA 5EXPA 4NP6A 1KHTA 2ZRPA 3ONWA 3QKRB 2F55A 4DC9A 4GSYA 1J8YF 4TLDA 4CYMA 5FTKA 4LYJA 2ECKA 2GHIA 4RD0A
chains in the Genus database with same CATH superfamily
3F74A 1Y98A 3K8YA 3V7YA 1W94A 3I52A 2B2CA 5E7QA 3ET4A 1CUDA 3FTCA 1NVUQ 4B2YA 3W2TA 1P9RA 1ZJZA 5HBGA 3QUQA 2RK3A 2WSMA 2LIVA 4CU2A 1TOAA 5FX2A 3BRSA 3M6FA 3PV0A 2GK7A 4QVKA 5AXAA 2PL9A 1FMCA 3MXOA 1ATIA 3I5MA 1WR8A 4RS3A 4AJOA 5KYVA 3VJKA 4F92B 4MUMA 2YDXA 2LUOA 5JRJA 3OFNA 3EIXA 3GRCA 1M67A 4U7GA 3KXPA 3BDIA 2GPNA 1H3NA 4FNGA 4MS4A 4DKXA 3P0FA 3UUGA 5EE9A 2GSDA 4DDKA 5IM5A 4NXNB 2A9JA 2HSEA 4ZOLA 1A7UA 3IIEA 3EXG2 2BKAA 4RE5A 3RYCA 3C5HA 2X13A 4HNGA 2UKDA 4DILA 4EYKA 5HF6A 1AQNA 3I9KA 3BVPA 2B5VA 5KVCA 4X62B 3CVWA 2PQ2A 5CM8B 3VU3A 2NO1A 3V55A 3H1EA 2VDMB 3R6TA 3P0JA 1YWGO 3UIEA 4DC1A 1S9HA 1P19A 3ET5A 1E9RA 2ZROA 4MGKR 1M6VB 4Q4HA 3UXEA 3W1EA 4FYXA 4GG1A 3OZUA 2I2WA 5ALHA 1HUQA 5FBZA 1SVUA 1V6AA 3L1VA 4M99A 1DBVO 1Q44A 1UDCA 1R27A 1KE1A 1CJKC 4B2LA 1COWD 1HSZA 2NUTA 1QAOA 1K9VF 3L8MA 1Y81A 2FN8A 1UMBB 3O82A 1M2KA 4IOJA 4FFPA 4AO8A 5KEIA 4IDFA 3CUSA 1LDYA 3VR3D 1NWHA 1QVVA 1A88A 3HO6A 3L8YA 1N2CB 1L2TA 3VYSB 2ZVDA 4KXNA 2R1VA 4ZI7A 1OMOA 4HDSA 5U4XA 3VNRA 5DHQA 5BMVB 3QTLA 2CV0A 4RTOA 5B1EA 5HGJA 2H9YA 3I2HA 4BBPA 3TQFA 1XP5A 1IAVA 3NUGA 3TK1A 2R4TA 3Q72A 3X43A 2OCYC 2ZS7A 4OHCA 1ZGZA 4PQRA 1SXJB 4HPJB 4OGFA 3OO0A 1J7KA 3IKLA 2XRMA 2AHOA 2QV0A 1FFAA 3FCSB 4JB0A 1TT5A 4OHZA 1NR1A 3TW4A 4KQ1A 2I22A 1V96A 3NJRA 1Z7EA 3GRAA 3QE0A 5DE3A 4I3HA 1ZK3A 3DCJA 1G98A 2GHQA 3R9XA 3OEWA 5EMHA 4FD2A 4NYJR 3QXCA 4V38A 4YAKA 2B9EA 4K86A 1M2JA 1N4DA 2B4RO 4OFZA 5FTJA 4FYPA 4WKNA 4UBLA 4JT2A 5LOVA 2YMMA 1UEIA 2YMLA 3ZI0A 2QQ0A 3GPIA 2R2GA 2Z09A 3HLKA 3A10A 5EERA 3UT5A 5A9SB 3IAAA 4PX5A 3AF3A 4IIXA 5GJCA 4Q9JA 1GA6A 1N92A 4AO7A 4ZU1X 1EXMA 1JIQA 5HZHA 3DKKA 1O0CA 1QOQB 4FYWA 1OFHA 4Q93A 3RKSA 4IHAA 1VLQA 4M36A 3RT7A 3T4PA 3TB6A 3U7QA 2XZOA 2GD2A 1SKUA 1Z13A 3ESQA 4G5GA 2PMEA 5FI3A 2D4AA 1L5MA 3L41A 3LM8A 1SBQA 1Z0SA 3AFNA 3PITA 1CDZA 4BO7A 1NUSA 1QBGA 4BVAA 4PICA 5EIFA 4EUKA 3G5LA 1IHYA 4LN1A 3QBEA 3SC6A 2ZREA 1ISPA 2JATA 2X0IA 1G3QA 1ZMBA 2PJUA 3BCUA 4GIBA 1G66A 4CIWA 1QORA 3MA0A 4FSDA 3NEPX 4UDXX 3EX7C 2FPWA 2QZPA 3OPVA 1RLTA 2PXXA 5BN1A 3R3XA 4YDRA 5DDIP 3O6VA 1S6YA 1KO5A 3L0ZA 3PEEA 2I3AA 4PONA 4QOJA 2LE0A 3WKDA 4BCCA 3M33A 3EVGA 3BG5A 2RBGA 3FCYA 2WSLA 2YBDA 5KQLA 2ZSKA 4ZIRB 3FI9A 1H5NA 3JARB 3OFSA 1PUIA 2VJKA 1SHLA 4FYIA 4UHFA 5AJYA 1JU9A 3ER9A 5JZBA 2FCAA 4MUXA 1EI9A 1NP6A 3PGKA 4B84A 1KC3A 2ENUA 2QZSA 3IQGX 3ND7A 3S55A 2YN0A 2FG6C 2R86A 2PKRA 1ZH4A 5C37A 2ODBA 2UDPA 3MRVA 1Y8RA 2B36A 2FWNA 4G0NA 1VJCA 4PQEA 3ZHZA 121PA 2ZB3A 4EB0A 1H65A 5EXTA 2QP4A 3CPHA 3RC8A 4KDFA 1PG5A 2ZTUA 3GAFA 2JLZA 1P7CA 4MR8A 5F52A 3OZEA 1M2HA 2YHAA 3MILA 2O3QA 3K32A 3KPUA 3G8BA 5EP2A 2QP9X 5DCLA 1E1RA 2FI1A 4F93B 3SK0A 2PWBA 3PHLA 1CJUC 2QT1A 1BXZA 1EDZA 1NUAA 2FUEA 3PCXA 4PLPA 2VFAA 2XKAA 1E8MA 1Q6YA 3H1PA 5CBPB 1E59A 1I3CA 2QRJA 1OHHD 1NF2A 4N5HX 1H2RS 1KEEB 4YAGA 4J4BA 4KWIA 1XNHA 3I9JA 3X1MA 1BDHA 4F9TA 3ISJA 2BMDA 1ZRHA 1YD7A 4CVNA 3FOEC 1IY1A 1U8TA 2JCGA 1OGIA 2Q1TA 3SNKA 3WGOA 4UFPA 2H5LA 3I30X 4R7GA 3X0DA 2HEGA 3I4LA 5EWMB 5JISA 1O4VA 1DDOA 5C34B 1W85A 2ADFA 1VRWA 3NWEA 3JYNA 3QKRA 2GXUA 4R6XA 4IJWA 2OGZA 1M1NA 2DUWA 3AR4A 4BTEA 1VGQA 3KOMA 4HN2A 1M3SA 4HP8A 3FHJA 2OUIA 2P75A 4PPQA 3W5SA 3C5WP 3WYNA 3MUNA 4KMSA 1IQPA 1CQZA 6YASA 2IEZA 1KEUA 3HU5A 5K2MA 4TV9B 3QBTA 2ZCUA 1AK9A 1KIFA 1FFYA 4KVGA 4BIIA 3RRZA 5LMNB 2ONKA 4G36A 4MUEA 4EYQA 1WUJS 3HCRA 5IASA 3D0RA 5BSVA 1D2HA 3I9V1 3ZI4A 2AQKA 1AO0A 5LVAA 3AF6A 4YJDA 2XZTA 1BQ4A 3KYDB 2PXAA 3AX6A 2P4EA 2R00C 3ITDA 4H08A 3RK0A 2JLYA 4A2CA 3CZPA 3OF2A 4HWKA 4JSRA 3KKKA 4Y1GA 4LF9B 4O4LB 4HEHA 1E2QA 2G76A 2RI0A 1HLFA 2OHJA 1Z16A 4LI3X 4TQUS 1XEWX 4H1VA 1RJ9B 2A7XA 5JS2A 3E82A 2PKQO 5I7AA 1JZSA 1RJWA 4EZEA 2IF2A 1KARA 1IY9A 1VKHA 1KYXA 1J0EA 3AQIA 3CWQA 4AMUA 4PNHA 4B7CA 1I7DA 3VHRA 5IS2A 3EAGA 1Y9DA 2CUKA 2DR0A 3QJ5A 2EL9A 1N8KA 3EPLA 3M9XA 5JNSA 1CWUA 4FOPA 4R0MA 5G4LA 1FP2A 3T4EA 4JT8A 2AJBA 4OF4A 4PRKA 4ZWNA 1E7YA 2RHWA 2WICA 2FQXA 1X9GA 4IDEA 3GQBA 3JQAA 1D6MA 4QJ3A 4KLAA 5TY0A 4F2WA 4IUDS 2X8AA 3SDSA 1V8ZA 1GNRA 1XTRA 3E22B 2VA9A 1GZ6A 4OJQA 1JAZA 2BONA 1IJBA 2CHUA 5C4IA 5IF3A 2I80A 4C78A 4BE7B 1G8HA 3I42A 3D8SA 3V1KA 4IDNA 1G4HA 4DLBA 2R62A 1GPH1 1NOJA 5FNVF 1T15A 5BQFA 3AF1A 2A6PA 3IOYA 5E3HA 3QV2A 2ST1A 1ZNXA 2XNSA 3AVQA 4IWXA 4JCCA 2X1HA 4Q3CA 5GM2A 2ZZKA 3RSOA 4F5EA 3HR8A 4R71A 5MGNA 1ORHA 3K1AB 2QVLA 1UWLA 1Z5WA 2VQFB 4J1NA 4BZWA 2QLTA 1SR8A 3BKXA 4PX2A 1UOOA 2BHNA 4CLDA 3TLGB 4YCAA 3W8FA 1CYDA 1VG8A 1ISHA 2OT3B 2HMUA 3MCAA 4DQ0A 3T7DA 2UYHA 3RUIA 2VHTA 2I2FA 3AM5A 3WA6A 5IAOA 1Y82A 1YC2A 5DHTA 3BAFA 4HNHA 1GPYA 1Y3FE 3SMVA 3DULA 2B3DA 3HDJA 1UBJS 3OEHD 1KYYA 2P3QA 3KELA 1YU9A 4BNNA 2P2DA 2AEFA 1IVNA 1UF9A 1WNFA 3UANA 5JNWA 2HJRA 2H2GA 1W0KA 2VZ8A 4OKNA 1E4EA 1PFYA 2PFGA 3H8JA 4NEQA 2XAUA 2X0NA 4D9IA 2QD2A 3RYHB 1B00A 3JD3A 2D59A 1Z3IX 1FTSA 2EZ4A 2VK4A 3K4HA 1DS6A 3K96A 3AP1A 3RNOA 3KETA 4Q5IA 4CM7A 1GG2A 2W4QA 4F9EA 3V2HA 3C7CB 3PX2A 1NBAA 3MWFA 5JDIA 3M4ZA 3P5BA 1SBHA 3QX8A 3TECE 3C8MA 1E77A 1N2EA 1LLFA 4ARAA 5GMOA 3LF2A 5CGQB 3QMMA 4RPLA 3KSAC 1SJ9A 2AZXA 4HDRB 4G07A 4JEUA 4FB4A 2BFPA 1Q3TA 1STOA 3RVKA 3G2KA 4M54A 4XB1A 3TKAA 4MV4A 4F6CA 5LL6P 1M6NA 3EISA 2GAOA 3DOEA 4CMBA 5BVGB 2VOEA 3WGQA 5THKA 5C2JB 1ONNA 2PX3A 3H2IA 1Z15A 3QUTA 5ERGB 3QXJA 4ZVLA 1NQXA 4I2VA 5GONA 2IIVA 3IILA 2L69A 4ZCTA 5MFZA 1N5KA 3ZNQA 1QPZA 4R3UC 2J3IA 4IQ0A 3Q3GE 5ELMA 5TPWA 2A3NA 2BCJQ 2KBEA 4TLCA 1GZUA 1XJCA 4G81A 4N39A 1Q83A 5JYDA 1UBRS 1P0IA 1GAEO 4DT1A 1V95A 4NOLA 1JEQB 1NU6A 3RRXA 5FIUA 4CKWB 2OQVA 4NYMR 1W52X 2GASA 4OSOA 4PCVA 4PYJA 4Y0VA 4KXUA 3VNUA 5EEHA 3KUUA 2JJ2A 1O96A 1H23A 4QGSA 1CIJA 3MVEA 1PRYA 1BKSB 4ZD6A 1KJWA 3MT8A 4RE6A 3TKYA 3TG8A 5LUAA 1PLJA 4TKMA 4AUMA 4DA9A 4PZLA 3D4LA 2QQGA 4BFYA 2YZ2A 1UWVA 3D7LA 2YR0A 2GKGA 5AT1A 2H8KA 4Z5XA 1ZM9A 1FDOA 4U2EA 4BLVA 2C2ZA 3COYA 1K3TA 2ZJ2A 4MWZA 5JEEA 4X92A 1M0SA 9GPBA 5ECWA 5JAPA 1O0BA 5AW3A 4N48A 1QFJA 2RHLA 5CGZA 1T6ZA 4HUJA 1Y6FA 2IYYA 1XBTA 3GUCA 3VSEA 4GLLA 1XTVA 4DNQA 5FB3A 1FP1D 1GPMA 3FSJX 5BRJA 1PJSA 2LV8A 2MYTA 1AGYA 2W2OA 2QK4A 2WSSA 2ZU6A 3AP3A 2BFNA 3B1ZA 1AIPA 3AI2A 3NAZA 2QENA 4OXRA 4NYIQ 4XWGA 3WL3A 5C1BA 2Z98A 3N2ZB 3QFHA 2XD9A 3O7WA 2AXNA 2PS1A 2DQ4A 3SJCA 1Z6YA 1X9IA 2FOXA 4EB6A 1IC6A 1OXKB 1ZSYA 1Z6QA 3EULA 3G1WA 1HOTA 4RVOA 2OGWA 1QG2A 1GUDA 4I50F 1ECLA 2I2BA 5CBKA 3RS7A 2CGEA 3IP5A 4EUHA 1VLHA 3OQOA 4QTXA 3JRNA 1PQUA 4GUDA 1QHFA 3KZOA 4X71A 1KOLA 3FF4A 1M5RA 3O8DA 2DM6A 1I1OA 1Z2NX 2DUMA 2HV9A 4QAQA 4RWZA 4CFSA 4E4TA 4EF5A 4Q82A 4Z9AA 5LZ8A 3VAAA 1KVQA 2ILTA 3X1DA 5EJ5A 2IS2A 3MT9A 3MWYW 2Q62A 3SDBA 2E0IA 2W2KB 3L8FA 1CZLA 1M1UA 1NYLA 3M3DA 4YRLA 4DREA 3H1GA 1I30A 4Q3DA 4KN9S 4JS0A 1Z2AA 4OB6A 1BCRA 4BNDB 3BRQA 4ZHQF 5DNUA 4RENA 1YJ8A 1A9RA 3PJGA 2QR2A 3TOVA 4C6TB 3H5WA 3K35A 1IHUA 2GN6A 3EA4A 3Q4GA 1OBOA 4H4DA 3CRZA 4L3WA 3KSBC 2YYZA 3JAKA 3PKIA 4MS3A 4UM8B 4EGQA 1VTKA 1QTQA 3HN2A 2AZ4A 2WZBA 3B3QA 5JO0A 4AXBA 4WKOA 4L5BA 3L6EA 4XOUA 4RKFA 1YCGA 5EE1A 3KQPA 5ERYA 1Z0FA 1FRFS 1R4NB 1Y5LA 3GJ4A 2NW6A 4U63A 2WI8A 5AKXA 3RYTC 3T7KA 3DHNA 4BV8A 1DEXA 2L18A 4BUZA 4DQDA 3GFTA 5J47A 1UZUA 1ZN2A 3VOBA 4BJ3A 4N3GA 4PPNA 5DM2A 1RLJA 3P8ZA 5A3RA 4N8SA 3GVXA 3ITNA 1GNSA 1LJLA 4IIVA 4Q6BA 1WTAA 1G1MA 3VZCA 5HDQA 4BP9A 1HE1C 3PR1A 4BEWA 3IUYA 3EC7A 2WWHA 1M6YA 2FR1A 1QZTA 1NSYA 4LJAA 4MKIA 4HLUA 1VHDA 2HBZA 1WDWB 1XA3A 1TM1E 4OJTA 4H1WA 5A02A 4QASA 2YX1A 5I47A 3WMWA 1J9EA 1XMPA 1PIWA 3KLBA 1ENYA 1K08A 1T9HA 2WWVD 2CJFA 4XR9A 4A1OA 3RU3A 2O20A 1G5QA 4PAMA 1EFTA 3W77A 2PX0A 1R18A 2PD6A 4E07A 4MB6A 4F38A 4QTZA 3NJ4A 1DOHA 2PH5A 2FYTA 2IE8A 2NM0A 3W5DA 4B43A 4D4MA 1KE2A 1ZGAA 2I2DA 2G28A 3N2LA 3NTLA 3QGMA 1K8XB 1L8LA 2ZFUA 5FFFA 5IBQA 6PFKA 1V5GA 4N4AA 4G6ZA 4JXXA 3D0KA 3D6FA 3N6RA 4QBHA 4HTAA 4QT0A 1GUAA 4LBVA 5BXYA 4FCTA 1Z75A 1VYVA 5IN5A 4RLFA 1AJEA 4A0FA 3LBFA 2ZSDA 3K0EA 2R6GA 1KQPA 1YRHA 1TCAA 1MX5A 1A4IA 2X4IA 4OO3A 1HZZA 2AJCA 1XU4A 1BYUA 1ZISA 2WD7A 4M1ZA 2D5LA 4MCAA 3BWCA 2C1XA 4IH9A 4YB8A 5FTNA 4ZV4A 5C51B 1AXRA 1J0XO 5JADA 4M87A 4M0FA 3C6XA 3FTFA 1GCOA 1GAQA 3CB4A 5SZKB 4MVJA 3OX4A 2PN1A 1EX6A 1YDHA 4L6AA 2PDAA 3KZVA 2BL4A 4OHFA 2XTMA 2GEVA 4MK4A 4XX0A 1II0A 2IU6A 3OI7A 4A7PA 4DW8A 1UWCA 3EXFA 1B3BA 4F4FA 1I2BA 4ZOBA 3UB3A 4GR4A 4XWTA 4AU1A 1YQUA 5LP6F 1XRMA 4JI7B 2HB6A 1PQPA 3I6IA 1UAYA 2QLFA 2X0DA 2PUBA 4WBNF 3RVRA 1D2RA 2AKEA 5KOJA 1P9OA 1QIIA 3BB3A 1Q74A 3EVTA 3KWLA 2DZDA 1C5KA 3HDVA 3LHIA 2F64A 1WVGA 2ZSHA 3LPNA 2JD1A 2WJPA 4V0MA 5DOZA 3ZXXA 4CCYB 5CD9A 5ENVA 3IP9A 2AOUA 3NBYC 2GLXA 5KREA 3AW8A 2ZRLA 3NTUA 4KQKA 3R8CA 5HIAA 1E0KA 1KMMA 4LTNA 1SQ5A 3BK7A 4GM1A 4YECA 3AVWA 3IXLA 1KO7A 4RIEA 2XWJI 1QGAA 2XR1A 3U4HA 5DIFA 5K51A 1XTKA 2QM3A 3N59A 3W8DA 4EJFA 4KHPB 3X1XA 1KBZA 3N58A 3NEJA 4UHDA 4EKDA 5BOSB 3H11B 4YUZA 2ZAMA 4TKUA 1FPQA 3Q12A 2A4KA 4MULA 2V3WA 1JDBB 1JDNA 4NMXB 3G0BA 3V2IA 4YMTA 1RRCA 1MF7A 4QATA 1VE6A 4FFBA 3TW6A 2FW6A 1KIAA 4URYR 5JNVA 2IZ7A 2QJOA 5JJBA 3WYDA 3WMEA 1KMQA 2QL5A 5D3QA 4A73A 1L7XA 4B3MB 1EFVA 4J76A 2PTHA 1TD1A 3PWKA 3AYXB 5KQGA 1KEVA 3FFWA 1VPTA 4UVEA 4Q3NA 2HT1A 3WRYA 2C2MA 4X5OA 5TQ0B 4UOEA 2E89A 5EQFA 2ODAA 2PIAA 4BN0A 4MA0A 2D1SA 4H1UA 1L7MA 4G0XA 1C1HA 1RVDA 2B8NA 1G16A 4UEJA 4HCJA 3DVRX 1Z5NA 3ZHYA 3K0CA 1J1IA 2FW0A 2ECQA 4RJIA 2AXPA 3QPUA 1F5NA 2EKQA 2REQA 3VTZA 3ISTA 1FW6A 3O2SB 3R5FA 2BFDB 3H2JA 4ZREA 2QI9F 2GEJA 3N7AA 4C21A 1Z5PA 3BB4A 1IJEA 1G59A 3DMFA 3WXBA 1PZGA 1WB5A 1P80A 3VPSA 2HR1A 3PHGA 4NV1A 3R7FA 4ZEVA 4G2NA 4ZT7A 3KS9A 2YQZA 2FPIA 4JLDA 3FUTA 3PDWA 5BN4A 2AN9A 3GVIA 3T0GA 1NJ8A 4YMLA 5DHAA 4DDHA 3PR2B 1TU4A 3H17A 4B5KA 3MMPA 2GJSA 2NPIA 4KVAA 3QXXA 4RNCA 5T6MA 3N6XA 2AN1A 2QAJA 3KHKA 4TYQA 4DYDA 1QU3A 2OHOA 1OXBB 5ILGA 4NZPA 1RKUA 3A14A 1ZEMA 3U7GA 1L4EA 3NAMA 1E1RD 3MWKA 2B30A 1A9YA 1EVQA 1OBCA 1YVEI 3HJBA 3OO1A 4Q19A 1BS1A 1N8TA 2RHJA 5JXJA 2GEFA 4BX0A 3JQ7A 2C3PA 2L82A 3I3SR 2YCBA 1PBTA 4LRTB 3PJFA 2OHXA 1R8YA 5KTRA 2GXQA 2B8JA 2YN2A 4QUDA 1BFUA 4XQCA 4Y9TA 4E12A 3Q2KA 3W2FA 3HXQA 3NASA 4YJ2F 5EGSA 3TIFA 3T3HA 3ECSA 1OXSC 1X1RA 2K2QB 5G0SA 4ZJZA 2G4VA 4NZ9A 3D5QA 1MO6A 1KMHB 3R7AA 3UFXB 3W9SA 4ITRC 2V1UA 1T3GA 1FYXA 1AZWA 1MC4A 1T9DA 2F6RA 1Y3HA 2FP3A 3NOXA 2A0WA 3R5KA 4H6VA 4ND6A 5IYZB 1L1FA 3BIOA 1PJ3A 5JBIA 1NULA 1EDDA 1UKVY 3P9KA 4MQFB 5EFOA 5IX8A 2JVJA 1FTWA 2OZEA 3K6JA 4N7JA 1SVKA 2C4VA 2NVWA 1GPWB 4PGAA 5DM4A 5LB2A 4A8JA 2W2LA 1AVTA 2XOKA 5BR1A 2Q8PA 1LPBB 4KDEA 3A26A 2B99A 4RK6A 3QK7A 4L51A 5FUXA 1RFLA 1A95A 2CD9A 4QKQA 3I73A 2IY9A 2QB5A 5KTMA 5F77A 3GMSA 1WW2A 4RLHA 1TMOA 5F5NA 3T7SA 4JOBA 4QQNA 4YO7A 3H6GA 1ZIDA 4B7AA 4HBGA 1QKIA 1TW2A 3GO4A 4BO5A 4DRXB 5KYYA 4CEJB 2V6IA 1FSFA 4GPEA 1WSWA 2VRWA 1EG2A 2OYSA 2VG8A 4L4UA 3C45A 4FEEA 1Z0AA 1AS2A 2P5SA 2WDPA 5C5CA 4TRRA 5CLQA 4W8OA 3WI7A 1NVGA 5EP4A 4EYOA 1OI2A 3G2JA 4QELA 1HE5A 2Y67A 1K1EA 4NNJA 5F12A 3VR4A 5CDYA 1I3KA 1VECA 2EXXA 3TRDA 3CZCA 1W5AA 4PZPA 2FPSA 3CUTA 4J0IA 1G2OA 2H1SA 2YC4C 3JQAD 3SZMA 4BL5A 3NMUF 3QU5A 3QPCA 4J1TC 2Q5QA 5CH8A 4EFDA 3E9MA 2G88A 2I2XB 5FWYA 1YU6A 4CKEA 5BW8A 1L8OA 2Q3CA 3JAWB 4A9AA 5HPYB 3IR5A 4RZ3A 3RSZA 4C0WA 1LK0A 4C1NA 2O0LA 3PQ4A 1T2EA 1YI0A 1S2OA 3ORFA 3S1AB 3ZOKA 2Q5OA 3TS1A 3UMSA 4Q9KA 5KHLB 1FVFA 3DFZA 5C81A 2FX5A 4YS6A 2B0JA 4MRSA 4ESVA 4HADA 2Q4DA 2G9QA 2RAUA 4LDNA 4I14A 5B2FA 3FJYA 2W2VA 5DW0A 4MLDA 2A57A 1NRIA 1J39A 2H5IA 3QVXA 4OQNA 2RJ3A 4URVR 1RVV1 4J6FA 5FWXB 4MIYA 2IYUA 2P9EA 1D7AA 1PTJA 1VG1A 1VL0A 3MSXA 2Z30A 4JY7A 1WLYA 1GV1A 1M6WA 1ODCA 3JR7A 2OXTA 5JJLA 2JI6A 1EGHA 1EIZA 1Y8ZA 3I9FA 1W93A 4I3GA 3CLRC 3HK2A 4ZANA 1CV2A 1MVLA 5J1TB 5COAA 4ZPXA 1DKNA 4CKXA 1GTG1 5AJTA 5I8PA 3MHTA 4W6QA 2P7HA 4GWGA 1LQTA 1XRSB 4BFSA 1ULTA 4JK3A 1M34A 2H4FA 1ISGA 1FC0A 4HVLA 1A8SA 1X2BA 2R25B 1FUEA 1G4UR 4IMRA 4WXHA 4ZRDA 3WB9A 5HJEA 4EGAA 5L7WA 3K8OE 2VP4A 1NP7A 2ZJ3A 3IUNA 4B3IA 3NT2A 5H5JA 4MRPA 3DR3A 2BJWA 3E15A 4FGUA 4QAJA 4RKYA 1PKXA 2YZKA 5F51A 3KUDA 2HMSA 1VL2A 3RTEA 2ZUFA 3E70C 5DEOA 2WZDA 5E6RA 1Q0RA 5CURA 3R7DA 4AJNA 5HUQA 5CG1A 3G2PA 3WLPA 2WQZA 2Q1SA 5FOQA 3FHCB 2R84A 1TC2A 1QQ7A 3GU3A 1LBTA 2IU3A 2WF5A 1GGKA 1OC2A 3X1KA 4YAIA 4ZJYA 1E5LA 2DGDA 2G04A 2QPOA 2PE5A 1GL3A 3K6RA 3LUGA 4FMCF 3STYA 2VCEA 3ZX5A 3TQIA 1U94A 1P2TA 1PUJA 1JGTA 1V6CA 1TTTA 1QLWA 3X2FA 1SHUX 1NSFA 5J2UB 3R5XA 1BDJA 1LCIA 5G4KA 3BWEA 5FA8A 2A8YA 2AC7A 2PKXA 3C3BA 2BLLA 2RHBA 3QM1A 1QGED 4LY0A 4PYIA 2WJYA 5EEGA 1EFKA 1H8HA 3A25A 2EVWX 3DYBA 4JEHA 3AHEA 3RQIA 1G64A 2VTBB 5I9TA 1ULHA 3C5CA 4NJMA 1TTPB 3PR3A 4F3KA 3P7MA 1L7RA 5ICSA 3OTHA 1LSUA 5KQSA 1OROA 3ZKWB 4RJKA 5LU8A 4ZTZB 3HRKA 2ID8A 3STVA 4KQXA 1M2VB 3HG7A 5KQPA 5EPEA 4Q39A 2YV2A 2G5CA 1R8QA 1F3OA 5K6RA 5L3QB 1TQ8A 1Z28A 1TQ6A 4NFLA 1QX3A 5ITSA 1C1DA 4YRDA 4YRRA 1XYYA 3LX4A 2HGSA 3F9CA 3REQB 1OF1A 1VG0B 2BFBB 2QRLA 4E6PA 5E38A 5HIIA 3F47A 3PC6A 3M4XA 4GP9A 3VV2A 2JJ2D 3T94A 2NUAB 3BRCA 4M9QA 3ROEA 4ID9A 4EHAA 3O74A 4UUNA 1EESA 5D86A 1SOUA 1NN5A 3CLVA 4GQIA 1E3QA 3GFPA 2WKSA 1P60A 1WS6A 4F0JA 5AI8A 3EGXB 4XX1A 5AVSA 1Q7TA 5JQGA 5EZSA 3W5CA 4IO1A 2PSFA 1Z56C 2YHUA 2ZAGA 4B35A 1IZ9A 3SC4A 2YWBA 3G17A 1RYEA 1U7DA 5DWVA 1B76A 1YS1X 5F64A 1D9ZA 4AIIA 5AVRA 4ETNA 5HKKD 1XTJA 1C9MA 1XEXA 4U2KA 1SBCA 4IDQA 5DB4A 2F7SA 3FRHA 3SG0A 2PAFA 2DWQA 3R4CA 1D09A 2C77A 2VNSA 2WSSD 4HQFA 2J3MA 2YINC 2IYSA 4HSGA 1G6KA 1GQFA 4Q24A 4R2IA 4U3JA 1R1DA 1TUBB 3LAWA 2BH9A 4M9SA 4EB3A 1UANA 4RTMA 2KYRA 3QI7A 1Z62A 2XQJA 1RDFA 3JWIA 4O2AA 4I1RA 1SXJC 2DR3A 1UBKS 3NDRA 1XVIA 3PWSA 4E5PA 3IKJA 4PLYA 5A4FS 1UZNA 4O1IA 1LBHA 4YQFA 4YRTA 1HNXB 1EQUA 2O4CA 2FDXA 2C7OA 5HQ3B 3TMKA 3DQPA 1TFRA 2NTVA 3L79A 1EYZA 4FU0A 2PIDA 4PNPA 1E60A 2FUG6 3LYLA 1LVGA 4G0MA 3IV9A 3GEPA 5ALFA 2X40A 4C7KA 5JQWA 3EDRA 1ITZA 1F0PA 1XRPA 3WGMA 1TCVA 4FBGA 4F85A 2VUHB 1RI1A 1U1FA 4BQIA 4BNWA 3PEYA 2H2AA 1E9FA 1JH8A 2BEUA 4AG5A 4ZV7A 3LC1O 1QCDA 3V7FA 2IBSA 3OU7A 4ZZ2A 1JE0A 5HZMA 3F46A 2NPOA 3DTVA 3K2BA 2OYCA 3MINB 5JSYA 4QYIA 3VR2A 3NANA 3THYA 1L5QA 4JHXA 1OZ0A 1KH3A 1WKBA 5FLYA 3DZJA 4IHJF 3B6KA 2G80A 4Q9IA 4XB2A 5ESDA 1ORRA 1YDWA 3QE9Y 3DC7A 3VI3B 5I3CA 4O4HB 3RSLA 3WZLA 1J07A 1IZZA 3L0YA 4JLUA 1Z73A 1VI5A 5JCXA 2H0RA 3I32A 1R0BA 1W5EA 1OZHA 3EFOB 2QG4A 2Y1XA 3LP6A 4IGAA 4YHBA 2MINA 2PKQP 3DWFA 1LPAB 3LGSA 3T5AA 2DFPA 1P1BA 5LUBA 3ZD7A 2IHBA 1WZEA 3L05A 1E3TA 5E95A 2OGSA 2EBFX 2QY9A 2CL7X 4Q3EA 4K3VA 1BWSA 1V8OA 3G68A 3N9IA 4LSMA 3JW8A 4BC0A 4YUAA 4BFCA 4HDOB 3GNTA 4LDQA 2QR5A 3EOAI 3BAZA 4MR9A 4Q1VA 1LZLA 4EOGA 2H0QA 1MPXA 3CSSA 4BAUA 2DECA 2ZIXB 4W5NA 3HKBA 1RWMA 4XWYA 4XPIB 3WWZA 2W0MA 2P30A 5DBEX 1IIBA 1GAJA 1X1DA 3VHXB 3GLGB 5I4CA 2AEJA 3W6NA 5KINB 4H4EA 4GW3A 4A03A 1V26A 2BV3A 2J30A 4U2CA 3ZI7A 2EJBA 5JROA 3O0DA 4ZOCA 2Y05A 1RHRA 1AHIA 3L7LA 1DJLA 3P2EA 3PSHA 1T0HB 2OAGA 3QEMA 2FU5C 1X1BA 3PDCA 2VAXA 3OJLA 4WESB 1LLDA 3U44A 1D6JA 1N5DA 2JFFA 1V7CA 3ELDA 4G5YA 3V1YA 2Y2UA 3A27A 3MYYA 4IQ8A 5EUQB 4BO6A 1WXHA 2O8CB 4PQGA 5LOVF 2NZ8A 4Z7QB 1E5DA 1HZJA 4B74A 1B23P 4N3BA 1YS7A 3HNPA 3VC1A 3U6BA 2VHJA 2JIMA 3IT3A 4ZAGA 4DWJA 3IT2A 1T8RA 2RIPA 4KDRA 4TMXA 1LS1A 3GN2A 1J2RA 3OIVA 4X7BA 2E5WA 3R3WA 5K0GA 4MVJD 1UOQA 4H9GA 5LWQA 3QEAZ 3ND6A 4C3UA 1E9DA 1YKFA 1S89A 3KQWA 3IP6A 4ENVA 4C7JA 2DQKA 2QP3A 4KN8A 2FPMA 2DTDA 3LOUA 2BR4A 4Q7QA 5AQ1A 4P82A 1KR5A 3MJTA 2WT4A 4NK4A 3T3DA 2LWIA 1JJVA 1RLMA 2VH2A 1BS2A 3QMPA 3BJRA 3R2JA 4HDQB 1HM5A 2PRYA 2G4LA 2CF5A 2VRCA 5AW4A 1JDZA 3VISA 1ZWKA 4P54A 1T5LA 2UYGA 3MS4A 1DCKA 3HGTA 1LDNA 1AQIA 1DWPA 1W5BA 3DT6A 3I0ZA 3IQDB 3SEZA 4BGVA 1O2DA 4F3TA 4CKBB 2HK8A 1ZVMA 2I62A 1HEYA 4OFWA 4U1RA 3DMNA 2PGDA 1N6KA 2JFUA 3ETJA 1AZTA 2NSDA 2P91A 2ATVA 1UT6A 1XPOA 1ESZA 4A0SA 1FIUA 3MJCA 3P9NA 2C92A 1P45A 2ZYVX 3AH8A 4KYIB 4PYNA 4DIFA 4EZBA 1T5IA 3I5XA 2FP4A 1QFYA 3TJRA 4MP6A 2AS0A 1IFXA 3D6NB 3IQHX 2ALJA 3MTAA 4TUYA 1D8AA 4JLAA 2YHIA 5GGYA 3G23A 5J4VA 1MB9A 3BIWA 1GKYA 1Y63A 2Y71A 1E2LA 3IMFA 1YNSA 2DX7A 3L02A 2I4TA 2ID9A 4UUMA 5CTJA 3RREA 4NECA 3KXIA 4K1LA 1RP1A 3IB3A 4LOLA 3N0WA 3SC3A 2PL1A 4ADSG 2JGDB 2IWRA 1UM8A 2P9TA 2PUAA 4TKZA 1R4ZA 2IZ0A 2WU1A 2IP4A 3STUA 2VJLA 3I5UA 3D4NA 3O8QA 4RTRA 3I09A 1C3XA 4FSHA 3UATA 2GEKA 1YVDA 2BM8A 5ALZA 5JSHA 3DNMA 1UPXA 1IN7A 3IUJA 1REQB 3E2PA 3CS3A 4YK7A 4ZVUA 4H6WA 3ZJ4A 4KQIA 3ESCA 2CJWA 2QTAA 4RF5A 2OHIA 4WLVA 3L18A 5CFOA 4EYEA 5BWCA 5TNXA 4YLGA 1F8UA 2ZPUA 1CUWA 4MGIR 3DE4X 1QP0A 3LW7A 3Q9LA 3SC2A 4YCJA 3TPCA 3RRYA 1JPJA 3FTDA 1PT5A 4S0ZA 4V3CA 4INJA 4CKCB 4JYZA 1EFLA 2XTNA 2ORVA 3SR0A 3GDWA 2Q2QA 2QJTA 3HN6A 1UP6A 1XLVA 3DWGA 2PGXA 1GG9A 2O0HA 4FI3C 4OMDA 4V0LA 4BMDA 2AG0A 4F9FA 1UPAA 4IIGA 4F6RA 3VAZA 2HF2A 1Q3HA 1XXHE 2R65A 3RYIB 1GSOA 2OEPA 3AJEA 1E6LA 1V4BA 2C03A 4NU8X 5EZYF 4MHTA 5E7MA 5TEVA 3UC5A 1POWA 2VIIA 4C7MA 4TSKA 4CG0A 3GEMA 4RHFA 3RADC 1EZ1A 1CX9B 4CODB 4GKJB 2XCLA 2IS1A 2WPNA 3HCBA 5I7SA 4HS4A 1G21A 2A5LA 2N75A 4JA0A 2ZQ5A 1I3OA 2XMQA 2BEVB 4K81B 3HDHA 2ZI5A 4DQKA 1G9TA 5CW1A 3MSCA 5FR1A 1NBEA 1Q0SA 4NHOA 3BCRA 2CWDA 1GKUB 3NIDB 3DFMA 2AVDA 1FK8A 2J9FB 3DBRB 1OVGA 3NHYA 3TTVA 5LN1A 2HC9A 3TEJA 3WWOA 4C22A 1IM5A 1Q2UA 5IKMA 3JWEA 4KEAA 1ZDMA 1GQQA 2PL5A 2VJAA 4JVMA 4N65A 5CPFA 3FI0A 3VNSA 5AHWA 4B7XA 1T13A 2WKQA 3THSA 2WFZA 4H16A 3K0FA 3WG9A 4WECA 2WWFA 2C9CA 4CM8A 1ZRSA 1WHTA 2C2BA 2W2LD 2XOKD 5BWLA 1EKXA 4LHEA 2O3JA 3HJHA 5FD8A 2QVXX 3KR0A 4DLPA 1E3EA 3L1JA 3EQZA 3W6ZA 2IYNA 1T8UA 1R00A 1UAAA 1I2ZA 4B85A 4LXTA 1I10A 3CKKA 3V4SA 2V74B 5JSKA 4M0UA 2Z5GA 1KFBB 1Y4UA 5MHTA 2IZ6A 2XVXA 5K05A 1Q7RA 1CKEA 4XKJA 3M2PA 5FADA 2PMCA 2YWEA 3ULKA 3UUFA 1NVKA 4K03A 3HA3A 2FRXA 3TLBA 3NHLA 2BE7A 3K3PA 2GA8A 3BH6A 1NZDA 4CJXA 1NKVA 1U90A 1N8NA 2B6HA 3ESZA 3KEGA 4NQRA 1ORTA 1U1DA 4G24A 3LLMA 3OQ6A 3SP1A 2HZBA 2NVUA 1WUHS 2GN0A 4AJJA 3EZYA 3L7NA 9LDTA 2VYVA 3I37X 4QFCA 4A8HA 3ZC3A 3UUEA 2AWOA 3IJPA 3PLNA 2V4UA 1BGVA 4MP3A 4XLLA 5CK4A 3G85A 1KKMA 3H3FA 1NBWB 5THQA 3TGWA 3HB0A 821PA 2VDRB 5D00A 1QU2A 3H13A 4ZKDA 3R44A 4Q4JA 3CPJB 1A69A 3GR6A 2JG3A </