3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
b'EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
3MLEA 5FOSA 2NGRA 3LA6A 4DLUA 1E1RA 4QOSA 3ZZ0A 5JEEA 1RE0A 3THXB 1TUEA 1XPUA 5E7IA 4PTLA 4TL8A 2VHJA 1SZPA 3OIYA 1EX7A 2EQBA 2I4IA 2ORVA 3BAFA 1UBFA 3WP0A 5JLJA 1SVMA 4N0EA 1N6OA 4F4JA 1DAFA 4R2IA 3EZFA 4US0R 4DCTA 1Q1QA 3CRMA 4HZUA 1O3YA 1XEXB 3RHFA 2QAGA 1UPTA 3OESA 3VX3A 3BH0A 2O8EB 4A8JC 4PC2A 4BLPA 3SFVA 3N70A 5D3MB 2O8FA 2J59A 5IDVA 2GCOA 4DEXA 1UADA 1NP6A 2PLRA 3LAWA 3QY0A 2JAQA 2F3TA 4V0LA 1IM2A 4D80A 3EIQA 3X1WA 1QVRA 3IO5A 4BRWA 2YOFA 3Q72A 3I5XA 1DO0A 2ZJZA 4J0QA 4NCJA 4UXHA 5FH9A 1P5ZB 5CYOA 4YQFA 3K70D 1TAGA 1AGRA 3Q85A 3ETLA 3B7GA 4PPGA 3UATA 3L8ZA 4JBXA 1Z29A 2B8TA 3ND8A 4DJTA 1CXZA 4P0TA 4LDJA 4A6PA 2D7CA 1KNXA 1X3SA 2ZRBA 4PFSA 3EWSA 421PA 2NZ8A 1ZAKA 4NYMQ 4DDTA 2DFLA 2IXFA 2AXPA 2F1HA 2C98A 2JDIA 2WWWA 1U99A 5CB6A 4N1AA 1E9BA 1CLUA 2QROA 3UKDA 3U44A 4TL6A 4D2IA 2YYZA 1GVNB 3EARA 4JBWA 3K09A 4ACBA 2EYUA 2AK3A 3K53A 2H8KA 3MJHA 4R98A 1W0KA 3A1WA 2ZUDA 2FDCA 5LD2B 4DHEA 3OEHA 1VIAA 1VCNA 3GLIB 3C16C 5CJ2A 2J41A 2BBWA 4DC9A 1MRSA 1KI7A 2RGDA 5FUYA 4C7OA 1W46A 5A4JA 4KITB 2WAXA 2GKSA 5HPYB 5FOVA 4C0AC 3N2EA 2IWRA 3A36A 2HJGA 3CZPA 1G3IA 1HT2E 3TAHA 4BFUA 2QY9A 2WV9A 2UZ3A 3MMPA 4DEYA 2JA1A 5JEDA 2WIBA 4IOMA 1MV5A 2VRWA 2OFOA 1RRFA 1YZKA 2Z6VA 2V55B 4QNMA 3BS4A 2CL7X 1YE8A 3AGPA 3H1TA 4QHTA 5LPNA 1R0ZA 3NH9A 3U5ZB 1D2EA 4DUGA 2ONJA 3ZS9A 1MR3F 5DI3A 5JFGA 3FGNA 2RHMA 721PA 2FG5A 4Q4HB 2ZS9A 1QZXA 3L43A 3VX4A 3DOEA 2C8VA 3A4LA 3IBYA 1WDTA 521PA 4FMDF 4MYCA 3TBKA 4ZKDA 1NJFA 2GJ8A 3DMNA 1W0JA 3VR4A 1Y63A 2WVJA 3B78A 4PC1A 3AF4A 4MKIA 4BEBA 4OBEA 2AFIE 4POAA 5B58C 2ZR7A 2FGJA 1E4YA 1HT1E 1OH7A 1ZCBA 3K9NA 4PQRA 1CJUC 2QZ4A 5JECA 1VG0B 3TSOA 5SZKB 1JEDA 3KDSE 5TY0A 2JLXA 4DLSA 3QKTA 3CRRA 3NIBA 5P21A 3B5JA 1G291 1OFIA 2AFHE 2ZE8A 1DELA 4RCZA 2OM2A 2XJ9A 2IBMA 2NZJA 1YJ5A 4Q7KA 4RZ2A 1JI0A 2GXSA 1T3SA 2J87A 1G64A 3I8SA 4BUJA 1NMYA 4Q66C 2ZQ5A 4URZR 4D25A 3BBPA 1W36D 3TR0A 4M22A 2CE2X 3CNOA 2HYDA 2VP2A 3R7WB 5GVSA 1SXJC 2B21A 2JIZD 1EWQA 1Q0UA 1E2JA 3SN6A 2BMJA 5EE0A 4LHXA 1DAHA 2IK8A 5TV2A 4EQ6A 5FPSA 2ZI4A 4HYYA 4KV9A 1LY1A 1U8YA 2FSGA 2GBLA 4EPTA 2YOHA 3F5FA 4ZKEA 2P65A 4LBZA 4U02A 2O8CA 4YLGA 3P20A 4TLAA 4IJMA 5E7MA 1MO6A 3WHKA 5IT5A 3CPHA 4G1UC 4TTRA 4LX0A 2QP4A 4M1YA 4PZLA 3IHWA 5C4GB 5AUOB 1SGWA 1M2OB 1KK1A 2RGXA 1YR6A 3OE7D 2WSSD 4HDOB 3FB4A 4PHTA 3LX8A 4OL0A 1IBRA 4GBMA 2ZSDA 4DT1B 1ZNWA 4GOJA 3PXGA 5KPJA 4HUTA 1E2HA 3QXXA 1TADA 3EAQA 4IDHA 2CE7A 2PL3A 2ZYWX 4M4SA 1DEKA 2ODEA 2XNDD 4LYJA 4K46A 3JVVA 3SHFA 2ZM5A 3Q5EA 4TYYA 1XX6A 4AK9A 5K8IA 1FTSA 3GPLA 4LBYA 4PO8A 3KX2A 1ZUIA 4NYJR 2O0KA 3U7FB 4NCHA 2L0XA 2QAGC 1AN0A 1X86B 3DL0A 2PH1A 2BEJA 4HDCA 2J0SA 2DR3A 2IXEA 2C78A 2IX3A 5JI3E 1Z6TA 1YZQA 4NCNA 2ZROA 4FI3C 4TMTA 2OEPA 2IYRA 2QN6A 4M1MA 5CITA 4MYTA 3DKVA 4X8LA 5DGXA 3FMPB 2IT1A 2OFWA 2ZRCA 5H1YA 3W6OA 1G3RA 4B44A 1SHKA 1U98A 3QXSA 4KFUA 3ADKA 5G3YA 1XXHE 3HR8A 2ERXA 1TPZA 4P4TA 1DE0A 4XSHA 3RLFA 1E79A 3D7MA 4CDGA 2JJ2D 4DLYA 5GADl 1KSFX 4WA7A 1E9SA 5J4HA 3P32A 1ESMA 2V8OA 1CP2A 1ZM4A 2HJVA 4DXAA 3SQWA 3I4LA 4TLBA 2QNRA 1HE8B 1XMJA 1KJYA 3SU8A 2CL0X 2P6RA 5CK4A 2GESA 1GNPA 4KFTA 5JI2E 3EA5A 1R6BX 4RVCA 5CIWA 2CMKA 3CB4A 2YV5A 1PUIA 2FV8A 3UG7A 1NVWQ 1NN3A 2OLJA 4CRWB 1K5DA 2QGNA 5FPHA 3PIRA 4PQYA 2P6UA 2QMHA 3ZLJA 1Z6GA 1I2MA 1SVSA 3BB1A 3ZGXA 4P4SB 3TUZC 3W3ZB 3BFXA 4FN5A 5JRJA 4MRNA 3GLHE 2PBRA 3VHLB 2GJAA 1EXMA 3PR1A 2O8DB 4Z54A 1JQLB 2JATA 4JYBA 3UMRA 4AWXA 3GJXC 2FSIA 3HYTA 3Q7PA 4CEIA 2R6GA 4AC9A 2JLVA 1XD8A 3UXMA 1NMXA 1UBGA 1T9HA 2Z4RA 2CHGA 3QSYA 4MA4A 3Q3JB 1NI3A 3RS2A 3RYTC 1MH1A 4B34A 3GLGE 1RKBA 4JMPA 2ZYTX 1AS0A 3NG1A 1BOFA 4LC1A 3W9YA 4GSYA 2YVUA 3NDBB 2W83A 1FL9A 4KU4A 3WBJA 1J8YF 3KUDA 2OZEA 1SKYB 2SHKA 5HZHA 1AM4D 3DZDA 4BASA 2IUSA 2FSHA 3LQRA 4D4JA 4XVRA 3MGCA 2CCKA 3UWOA 2ZE7A 4MKFA 1G8YA 3H4MA 4PC3A 2F43B 5EJEA 1CKEA 3SS8A 2REOA 4B76A 1OYWA 1Y3AA 2EFGA 1KHTA 2W6JD 3FHCB 2ASEA 1JPJA 4ILEA 1T3HA 3FKQA 5FBLB 4CVNA 1XRJA 1MKYA 2DWPA 5DE3A 4NP6A 3PEWA 2X19A 4NCKA 3QBTA 5KNCA 2OT3B 3CONA 2C04A 1E1QD 1Z47A 3BORA 2ZRNA 1UM8A 3QG5A 1US8B 1N3BA 3FTQA 1YZUA 2ORIA 1IN7A 4BEJA 4DLZA 4TLCA 2YZ2A 4G5OA 1SVOA 1RJ9B 2UZIR 4JLPA 3AVXA 4JBYA 3WHLA 4G5QA 2ZAMA 3I72A 3S1AB 3R20A 2ZRIA 2IWHA 3BB3A 2ZI7A 4LPSA 1RVDA 4M2LA 2ZR9A 4URVR 1EFHA 2PX3A 1II8A 4GOXA 4RD4A 4MGKR 4QBFA 2DY1A 3ICQB 3OEEA 2H57A 2NO6A 2F1JA 2GA8A 2XTZA 1I4LD 1U2RA 4L16A 2A2ZA 5DI9A 5FTLA 1TQ6A 3GJ6A 4WZBE 3V4FA 1YRAA 1KIMA 3PQCA 1MT0A 2WHXA 1NNEA 4IVRA 2FZ4A 4KJZA 3U6BA 3QF4B 1FFHA 2N1BA 1AZSC 4B3FX 2PCJA 4JZKA 5FL7D 4BFTA 1RYHA 3CPJB 5FOUA 1W5SA 3NEJA 2QPTA 3WNCA 3P27A 4QJ4A 2GZAA 4G5SA 2ZJOA 2FFQA 1SVWA 1H65A 2XZOA 2PX0A 4TMZA 1HYQA 1Z28A 3FFBA 1R10A 4HAXA 1QBKC 2P5SA 4CIDA 3LDAA 3ZVRA 2O52A 4L5BA 4TLEA 2GXAA 2XZPA 2YJTD 4FCWA 3ZDQA 1OH5A 4OQXA 1OB2A 4KLNA 4TMWA 2CJWB 1G7TA 4DSUA 3PENA 2VP6A 4QJ3A 2R9VA 3CUEF 3CX8A 4YMTA 1Z6XA 1ZVQA 4AYTA 4TMKA 5FPTA 3LBHA 4ARZB 4UJ5A 1SXJB 2FWRA 3AEZA 4XD7D 6Q21A 1XTKA 4C0QC 3TGPA 1B0UA 1FP6A 4EPXA 1ZYUA 3MUFA 4EFMA 1P60A 3EPLA 1N6HA 1U90A 2VSFA 4Q4AA 5TB5A 3A6PC 2ZSBA 5IF9A 1QHHB 1M34E 2FFHA 2RGBA 3K0FB 2GCPA 4A1FA 3C15C 4GP7A 4E5UA 1OXUA 4ZDKA 1RW4A 1U81A 4QHYA 1P2UA 2OBLA 3KB1A 3OHMA 3B1VA 3U4QA 2FX3A 3VR1A 1P2SA 4XVUA 1Q21A 3GLFB 2HUPA 3QKRA 4A9AA 2JJ1D 4BE7B 1S1MA 2ZE6A 1R0XA 3CF6R 3LX5A 2XITA 3SE0A 3GEIA 2MMGA 1WF3A 2VP5A 1RRGA 3ZVNA 2B7BA 4BPBA 3AKEA 4OKSA 2WWGA 1E94E 4XWKA 1GWNA 4TYWA 4D0GA 3VHXA 4HZUB 2DBYA 1YU9A 4Q7MB 4QC2A 1RZ3A 4B32A 2QAGB 2ZS8A 4IOJA 4NPHA 2Q9CA 3EIHA 1WMSA 3IQXA 2H18A 1QHNA 4LK2A 1AKYA 2E87A 3RC3A 5K8UA 1CRQA 2C77A 4WBSA 1JBKA 3LO5A 4CYMA 2O8FB 2J5XA 2AKYA 2QL6A 2ZYVX 2GCOB 1QHSA 4LZZA 1JJ7A 4MRVA 1U9IC 1R0YA 1L4UA 4KODA 4Q9HA 4URUR 2IYXA 1H8ED 5F9HA 2WWYA 2OILA 1AA9A 3SYLA 3D3QA 3SBEA 2C9CA 4TSFD 4B71A 1JR3D 2HLDA 1YZLA 1ZP6A 4UXJA 1KI6A 3ZZTA 1YR7A 1E2QA 1YRBA 2X77A 4W5JA 2X2EA 4TMXA 3PV0A 1E96A 1MRNA 3H84A 4PX9A 4QXAA 4CW7A 2ZUBA 1LF0A 2RKOA 3BH7A 1KAGA 3W3AA 2O0HA 1UEIA 1P61B 1U0JA 3AB3A 4OHWA 4F7WA 4HEJA 4EAQA 1ZNYA 5F9FA 1YQTA 4YDHB 3Q5DA 2HXSA 3QKSA 5L3SA 4QBIA 2A7QA 4QBGB 3LH5A 2Q21A 4C0KA 1X6VA 2IYZA 1PV4A 2WMNB 3OIVA 1COWA 3ASYA 3TW4A 5DYIA 1Q44A 1G3QA 1VG8A 5G53C 1DVRA 1S4QA 1VIYA 2H7VA 3PEVA 3P4XA 3PCRB 3NBFA 2XX3A 4LSGA 3WYAA 1ZM3A 3U44B 1VTKA 1HQCA 4M9XA 4BFYA 3I5YA 2JLUA 2OHFA 5C2JB 2GTPA 5B30A 3EPKA 5JHGB 2RCNA 4NYIR 4DZZA 1W44A 2W58A 5AUQA 4C0JA 2GETA 3FE2A 2YC4C 3OAAA 2RGNA 5EE3A 4WAUA 2ZRAA 4IEIA 5AR1A 1XCGB 1KI3A 2VHTA 1LB1B 1UFQA 1D5CA 3KKPA 4HAUA 2KSQA 4C7OB 2ZI5A 5J47A 5TMPA 3T35A 3T5DA 2IEZA 1WCV1 2VTKA 5E95A 5FOWA 2IL1A 2JASA 3AP3A 1G3MA 4PHGA 2WM9B 2WIAA 3TSZA 1XTJA 3CKLA 3KFVA 2P3SA 5SZHB 1F48A 1IN4A 1D2MA 4B35A 2XJ4A 4PPFA 3CPEA 3ZD7A 3TR5A 3TMKA 3ICEA 1W48A 2EWWA 1CR0A 2XSZD 4HB4A 4B2IA 1KOFA 3A1UA 2F1IA 2J0QA 4JLBA 5JWOA 1FPMA 2EFEB 5DI3B 3HP1A 3WRYC 3B13B 3I61A 2GAOA 3HU3A 4R7ZA 1D6JA 3IGFA 5D3QA 2LKDA 3K0CA 4BZXA 2N42A 1PLLA 1ZBDA 4PHHA 1Z3IX 3I8XA 2I1VB 1OF1A 4JL6A 2OUKA 4ESHA 4X8HA 1GM5A 5BYJA 3KXLA 1E98A 3GLHA 2IF0A 2AR7A 4LGMA 4PANA 1T8TA 4V0ME 2Z5FA 3GEHA 2QE7D 4JLVA 1G7RA 3KQUA 2ANBA 1R0WA 3M0EA 4AYWA 4F4CA 4BZQA 3KJHA 5F3WB 1Q20A 3A37A 3GFOA 5EUMA 3REGA 3IPXA 2NPFA 4UJ3A 5EUQB 3X1ZA 1NBMD 3DPUA 4HAYA 4U5XA 4ZCLA 1EFRD 2FFBA 1KY2A 5GJVC 2QGZA 1KK3A 4LY6A 4TQUS 2QPOA 4IXNA 2G0NA 3ADDA 1HY3A 3REFA 3RWMB 4ITRC 1II9A 2V1XA 4GL2A 3THYA 5TVKA 1NG9A 4JT2A 3SNHA 4M8NE 1AKEA 3EZ2A 1LS6A 4GFDA 4M53A 4NBSA 4LHYA 4EQ6B 4L15A 2FGKA 1IAQA 2VHQA 4JLDA 2AL7A 2ZRDA 3AVQA 4JLKA 5AJVB 4HLUC 3VR6A 4M1OA 3BRWD 4RJLA 4D82A 3KQHA 3W8NA 5FI0B 2V1UA 1M1YE 2XOKA 4GZLA 5FBVB 1G18A 2O8CB 5LDDC 2GF9A 3NH6A 2WZQA 4LV8B 3RVBA 4DDWA 4UXIA 1GZSA 4ZPXA 1AJEA 4KI0A 2GHIA 1P62B 2GJ9A 4G5RA 3DHWC 3VQTA 1KNQA 2OAQ1 2BDTA 2C99A 3EWAA 2D3WA 1OXSC 3MD0A 4JL5A 3LLMA 1P2VA 3ZS8A 4DDUA 4M1SA 3AGQA 2EYQA 4JL8A 2ZVQX 1VECA 2W0MA 1KO8A 3A1VA 5B64A 3A8TA 1OKKA 1KI4A 1OV4A 3TH5A 4DDVA 2GZDA 3IEUA 3NBZC 3RANA 4DB2A 2ZI6A 2GJKA 3B1ZA 5KSOA 1ZCAA 2GF0A 3AQ4A 5ANRB 2G0TA 3MJRA 4EFNA 5FPYA 3EPHA 4C3ZA 4Q9LA 4UNNA 2BOVA 2EU8A 5JRZA 1P6XA 1XEWX 2KBFA 1GNQA 1NSTA 4L9SA 2W6IA 2NMVA 4Q1FA 4FCTA 1JJVA 1E0SA 1NIPA 1E2MA 1XEFA 2C96A 3B85A 3E70C 3HU2A 3NVAA 2EFCB 4YMSA 4D0NA 3PUWA 4PZZA 4Q47A 4JIMA 1G17A 4OQLA 4HATA 5FL3A 4JLJA 3H2YA 1TU3A 1EFCA 3U61B 1E2LA 1SXJD 3DM9B 4LJAA 4YXWA 4ZV4A 4RCYA 2J9RA 1OH8A 2WJIA 1P75A 3JZMA 3JZAA 3TVDA 4DCNA 3KJEA 4HI0E 2FE4A 2GVZC 3QOFA 4RZUA 1Z0IA 2Z83A 4IXMA 4Q02A 1N0VC 2IYLD 3VR2A 1Q3HA 3LD9A 3HPQA 2BV3A 4RKEA 4WOPA 3CR7A 4W5HA 5L8VA 1E9FA 3IIMA 1A7JA 2DFKB 1WA5A 3AUXA 4IEEA 2V54A 3NKVA 3GJ4A 1JQJC 4Q4JA 5EXSA 2DWOA 5EE5B 4WXPA 3TQFA 1E1RD 1KO5A 5L3VA 4QGHA 1KYIA 5DNYB 4PQFA 4RFSA 3AF3A 3VR5A 4TYPA 5CIQA 4IDPA 1V5WA 4L8GA 4ESVA 1QRAA 3OE7A 4OK3A 1S8FA 2WSSA 3EZ7A 1NVVR 2W2TA 4Q1EA 4EJSA 3IEVA 2XTMA 4PAQA 4KAXA 2QP3A 1R2QA 4V0OA 1WE2A 4I81A 5JWRA 1XTIA 1G3UA 4A4DA 3CF0A 1E6CA 5CLLA 3DKPA 1X8KA 2G88A 3FVQA 5F98A 1YZGA 1ELOA 3CM0A 5IRCD 2IEYA 4R2HA 4K8OA 2HT6A 5LB2A 5FFMA 3IDQA 3TUJC 3AP2A 1UBCA 2QSZA 4FMDB 1N6LA 2RHDA 2Z0MA 2HCBA 1OHHD 5IHPA 3IUYA 3Q9LA 3SI7A 2D62A 3WRXC 3FHTA 3K0CC 3KXKA 5GJWC 3U3MA 4PO1A 5TARA 2JEOA 1DADA 3TAUA 1GNRA 2BJWA 2ODBA 2ZETA 3I92A 1G8HA 3ZVMA 3EC2A 3LXXA 1SKQA 4C0LA 2R44A 2JJ2A 5BN4A 4QBHA 3W5JA 2C9OA 4N0DA 2E1RA 2HV8A 4Z1MA 3U2QA 4WW0A 1II8B 2YKGA 3BD9A 1S96A 1X8LA 3DO6A 4CT5A 2D4HA 5EZ6B 2OCAA 3PFIA 2VP4A 3OFND 1A1VA 2PCLA 3TE6A 3BIFA 1OH6A 5FUXA 3AV0B 1A2BA 3KFXA 4RKFA 1G4UR 4HAVA 1P73A 5JJKA 4MRSA 2BMFA 3OEHD 3E2IA 1NKTA 1ZM7A 2E9SA 4X8MA 4AI6A 2PEYA 3QIAA 4AKEA 1JECA 1IJFA 3THXA 5FI1B 1HV8A 1UKYA 1G8PA 5SZIA 2J45A 1G19A 1FNNA 1DAMA 3EC1A 4HB0A 4YMWA 5KSYA 3CRVA 4RZXA 4TTQA 2BMDA 2ZJ8A 3IHLA 3WMFA 1VMAA 4G5GA 4KSCA 3TVTA 4DLRA 1N6IA 1PJRA 2Z4SA 1YKSA 3HDTA 2WKRA 3RRYA 1GAJA 1K6MA 1N6RA 3C14C 2YHSA 3O8CA 4LC0A 3RDPA 4AURA 1IY1A 2VHCA 4UNRA 3K8YA 3L0IB 2O8EA 3LW7A 1Z6AA 3VAAA 3GD7A 1IONA 4C9BA 2IYTA 4IVQA 3KB2A 3RABA 1E2FA 1CBUA 4JVMA 1LFDB 2FPMA 2OXRA 5AJWA 1Z6YA 3AKCA 2ZRHA 4TYNA 3BE4A 2ZJ2A 4MDFA 2BWJA 1ZIPA 2BMEA 1Q1ZA 4MUBA 4EUNA 4AKHA 2IA5A 2FPLA 4KYIB 4ZI3A 4WVFA 1HURA 1Z07A 5JZVA 2CBZA 1QHGA 5HE9A 1E2IA 4LJ4A 4Q4AB 2F1RA 1J90A 2ZRPA 3ZVLA 4HDQB 4BRUA 4A15A 1KSHA 5DLQC 4MDEA 1II0A 1NY6A 4AKGA 2WPDA 5EP3A 2VP9A 2W6JA 4IDOA 5HKKD 1K5GA 4KVAA 2CDNA 3C41J 3K0AA 1HH4A 3W6PA 2F9MA 1XTRA 4KCGA 2HT1A 4V0MA 1Q57A 3U4QB 4GMXA 4Q9IA 3Q8XB 4AIIA 5J5CA 3QKRB 1WRBA 1IHUA 4V02A 3R9IA 2WSMA 3KKNA 2BC9A 2ANCA 4NMMA 5HE8A 4GP6A 5FTJA 1A5TA 2WAYA 3CO5A 4OJKA 4DWJA 3NTUA 4KVGA 1LVGA 1OT3A 3W6NA 4B3GA 5LB4A 1P7CA 4D81A 1E3MA 1NG1A 4RD6A 4A2QA 3FDIA 1EK0A 5K8TA 2GILA 4QG7A 2MSDB 1Z06A 3I3SR 4LHVA 2G1KA 2V7QD 3FKSD 1CJKC 1KO1A 2XGJA 1T3LA 3FYHA 3K09C 2FPKA 4A2WA 4DKXA 2VSXA 3AVTA 1SVKA 5BYKA 5FL7A 3AF2A 4A0HA 5G41A 2CXXA 3KKMA 1W36C 3CR8A 1A4RA 1GILA 3X1DA 3CRW1 1HUQA 1W49A 5KYKA 3NC0C 2OBNA 4JSYA 2VF8A 5FPKA 1KI6B 4JVNA 2N46A 4LYAA 5A0FA 3CH4B 4MITA 4B75A 5DHAA 5TDHA 3J81k 3C7KA 5J4YA 1S9DA 2WWHA 5FTMA 2ZRFA 2D74A 2D7DA 1TMKA 1KDPA 1TF5A 2PMKA 4RD1A 3TSWA 1G16A 1GKYA 3I1FA 4IOLA 3W8RA 1J8MF 3EX7C 3QKSB 2F9LA 4PC7A 5L3SB 4GRAA 4P3YA 4XD7A 1GOTA 1KKLA 2BJVA 1XD2A 1E2KA 1TEXA 4R9UC 1MO3A 5DN6D 3L0OA 3ONWA 3U3KA 3T1OA 1FMLA 5KNBA 5KDLA 4D6PA 1F2UA 2IYVA 1EWRA 4MYHA 4PHFA 1OE0A 4JSTA 4XTRA 2G9NA 2XXAA 1OXXK 3EXAA 1OLOA 4BLOA 1T91A 2BBSA 1TTTA 3GEEA 2G83A 3MSXA 5FR2A 3T1QA 1FNMA 1Z0DA 2GXUA 1R5OA 3ECCA 3L8YA 2BVNA 1NN5A 4FW9A 1CEEA 2GRJA 2QPAA 3NBYC 4GOKA 3BFVA 1JXMA 1UDXA 2VLIA 3NWJA 3RSOA 1GKUB 1S1CA 3JVUA 3K0EA 2RGAA 3LVQE 1RRCA 1XXHB 1ZU4A 3A4NA 1W47A 3W5IA 2WJJA 3DZ8A 4MGIR 4BLTA 1ONBA 1FUKA 1S9HA 3QXHA 1WXQA 3TLXA 4HLDA 1FQJA 1NN0A 3O8DA 2HYIC 4MGYR 2CHQA 3B82A 2D2EA 2VL7A 2ZRLA 4DRZA 2OBMA 4ZDWA 3K0SA 4EPRA 4WZ6A 5EQTA 2X1VA 3KJIA 5JMTA 2YWFA 4KFRA 2IS2A 2ZR0A 1EFTA 4JJZA 2ONKA 3UK6A 1TNDA 5JJIA 1ZINA 1TEVA 4TT3D 2YWEA 1GP2A 3MCAA 5DISB 3ZYCA 3AVWA 1CR4A 5DSZA 2RAPA 4HLQB 4TSFA 3R8CA 4ZO4A 2BKUA 3IO3A 3BK7A 2J46A 4S2EA 4OQNA 2BBOA 3AH8A 5DO9A 2GBLC 4LYHA 1P72A 4PSAA 2QT0A 3RRNA 4EPVA 1WBBA 4JVSB 1WQ1R 2RGEA 1XMIA 3ADBA 2AWNA 3GLHB 4RFVA 1VG1A 1W5TA 4CT4B 1U8ZA 1E9DA 1XZPA 1TF2A 1G41A 2H5EA 2BEKA 3RS3A 1VYTA 1DOAA 2WJHA 4B2LA 3NC1C 1VHLA 1YZTA 3KQLA 1XWIA 1DAGA 3AP1A 5H8WA 4O2RA 5A5GA 5JBQA 1IQPA 3GLGB 2HF8A 4B48A 4JKIA 4O2LA 4Q19A 1F60A 4NKRA 1S0UA 1J7KA 1ANKA 2CLSA 4LV5B 3AVVA 4C2UA 2PT7A 3PITA 5KO2A 2CL6X 5IK2D 2KWIA 3OIWA 4OK6A 2CK3D 1ZC3A 5CM9C 1SQ5A 1E99A 2QEQA 3K9GA 5ELXA 1BH2A 1NVXQ 4HZIA 4BZPA 1NLFA 4I4LA 2EVWX 4B3XA 3IILA 5FBQB 1FMJA 4RZ3A 5BN3A 1GRQA 3VKHA 1G8GA 3WNBA 3THYB 5EP4A 4LJ9A 1F5NA 2R6CA 5CLQA 4H1VA 2WKQA 2QMOA 2ERYA 1HEIA 1HE1C 1JAHA 2V6IA 2VA8A 3B1XA 4QL3A 1EESA 1IN5A 3ASZA 2GK7A 2QBYA 4FXPA 2C95A 3H0KA 1UKEA 4KHZA 4E09A 3C4JA 4A8JA 3SQXA 4LOAA 1R8QA 2J0UA 1N2CE 4A36A 1E0AA 5LBIA 3AVYA 5JJLA 4P31A 4B74A 4TWZA 2WWIA 2GEUA 3OEED 1OIXA 2PMDA 3B9QA 1HQYE 1GUAA 2FZLA 1XJCA 1KDRA 4XSGA 2G1JA 2KB0A 2ZI3A 4I1UA 2YWGA 5AJXA 5J4KA 1E9CA 1KI1A 4YONB 2DB3A 2OO7A 4D0LB 2JLZA 2OFXA 1M7BA 1XPOA 1B23P 4KFSA 1TQ2A 4H9GA 4BLRA 4QKQA 4N3NA 1LV7A 3ZJYA 1ZC4A 3HJNA 5HCNA 4BLSA 1J2JA 2VYFA 2GNOA 3NHAA 2CEAA 3AVOA 2VHUA 2OE2A 1GL7A 3KL4A 2GAAA 1XU4A 3KJGA 4LJ7A 2O8DA 1M7HA 1GL6A 2IS4A 2FMXA 1OJLA 1KTVA 4LHWA 4ASUA 1WB9A 1D2NA 2FFAA 5FOTA 1PLKA 1E2GA 4JJKA 1G7SA 2ZTSA 1GFIA 3O8BA 1OIVA 4LJ5A 4Q1AA 2HF9A 3I32A 1CR2A 4C30A 4IVPA 3GJ5A 2PZFA 1NBMA 3GCGA 1VHTA 3RRZA 5FR1A 4M0LA 1IXRC 121PA 1CJTC 2V9PA 2FN4A 1P2TA 3AKYA 1VYUA 2ECKA 4IRUB 2VF7A 3U3OA 4P4UA 3ZZUA 2AN9A 2GJSA 4NZYA 2QTVB 1W36B 1GRNA 5HCIA 3LBIA 3DEFA 1R7RA 1ZNZA 4LWZA 3PG5A 4PSVA 1NKSA 3VU9A 4GDFA 3RS7A 1JNYA 1VKJA 4DSTA 4NCIA 1WBDA 1ETUA 2WKPA 4F4IA 2ZJBA 1U0HC 5C18A 1GRRA 5B2ZA 1IY0A 1CTQA 2FOLA 1E0JA 1YZNA 2BKEA 4Q4JB 4TN1A 4UKDA 1OFTA 2FNAA 4HB2A 4IDNA 2ZI9A 2XEXA 5DHFA 3ZIAD 4DLTA 4EPYA 3S1AA 1GSIA 4RFSB 2ZSFA 2CNWD 1IN6A 4KBGA 4CEHA 3SR0A 2R65A 2ZAOA 2IF2A 2A5JA 4Z8XA 4YDSA 4HSEA 4LUCA 5DH9A 1KAOA 3LNCA 4TLDA 4DCUA 2QTFA 3CF2A 4EJSB 1UKZA 3V4RA 4FMCF 2WMOB 1E2PA 2ORWA 4M1WA 4MKGA 2PT5A 3SEAA 4Y0VA 3MWJA 1FW6A 2XNSA 1CJVC 3OZXA 3SYKA 4A6XA 4DSNA 1W1WA 4R71A 2XZLA 5DIFA 3KXIA 4HLCA 1E9RA 1ZIOA 3BC1A 4C2TA 2O8BA 4FINA 4LYFA 3GJ8A 3PJRA 1BIFA 1NY5A 3KTAA 2BCJQ 4FWTA 2PLFA 2EFDB 2RB4A 3CLVA 1KSJA 5H70A 2WWXA 1H8HD 3RS5A 2P2LA 4ZI2A 4EKDA 1UDWA 3F0TA 4IDQA 4NYJQ 1DARA 1L4YA 4PR0A 2AKAB 4G01B 4B2PA 1P9WA 1Z0JA 2KJQA 3B9PA 2PZEA 4CEJA 3B1YA 1MO4A 4ZIRA 3E5HA 4KLZA 5L3RA 5KUTA 1BS1A 1BYUA 1BMFD 4QGAA 2W2XA 5EXPA 4QM6A 4V0KA 3AVPA 1P3JA 3MWKA 2W0SA 2IYYA 3GLIE 2IS1A 1COWD 3D31A 4I1OA 1KMHA 1DAEA 3FHOA 4OK5A 4PO9A 1X1SA 1HA3A 4BECA 2ZXUA 2FJUA 1QHHA 1R5NA 4GI7A 3I73A 3LWNA 3C8UA 2H16A 1XCMA 3QI2A 5EP2A 3ADCA 1KJWA 4QNRA 3BXZA 4DLXA 1E2DA 4DBLC 4GT1A 3SJCA 4L9WA 4TTPA 1D9ZA 1E4VA 3W34A 5CDFE 4PC6A 4MRPA 5E4FA 4KYUA 1OIWA 3Q7QA 3QXCA 1CRPA 4IW3B 5KHOC 4KSBA 4IFEA 2ATXA 3AUYA 1M74A 3THWA 3FPAA 1MABA 1XJ0A 1ZUHA 3NXSA 2VPPA 3CNLA 2JLQA 1ZW6A 2QRZA 4BFSA 1R5BA 2AD5A 4OHZA 5C1BA 1UBEA 3MRSA 3U7GA 3HWSA 1E69A 3WBKA 3SJBA 2AD1A 3DM5A 5AJZA 2CVHA 4XOIA 1Z08A 2J7KA 1N6PA 4II7A 1QG4A 2FA9A 4JLNA 1OSNA 1SVLA 1Q22A 2B8WA 4A82A 4A0FA 1FTNA 2H17A 3PVSA 1Q12A 2R6FA 2AX4A 3OF5A 2QU8A 4WIAA 3CNNA 4PAOA 1FX0A 3KUCA 1CULC 3RAPR 1XDBA 1GIAA 5FTKA 2G3YA 2O0JA 2OCBA 4ZDIA 3WMEA 2BM0A 3D6TB 2DHRA 1OHHA 1UF9A 3LW8A 1F2TA 1JR6A 2C2HA 1QHYA 1ZNXA 3A1SA 3KKOA 4P32A 4WXRA 2Q3HA 2J7PD 4GPTA 1KGDA 4LJ8A 5KNDA 3I62A 4US1R 2IHYA 2W2VA 4QGFA 2I3BA 3K0AB 1Z22A 1NRJB 1KI2A 1C4OA 2X8AA 2BHRA 3BOSA 4NE2A 2YINC 2UKDA 1FOEB 2JGNA 4W5WA 1EX6A 1PUJA 2I1QA 3KKQA 1BO6A 5KDOA 5FTNA 5KOYA 1KI8A 1JXOA 3A4MA 3BB4A 2ODWA 4ON9A 5G40A 1G6OA 3MAAC 2Q0HA 2IUTA 1SVIA 2YNMA 4QM7A 1NLYA 2JIZA 1YHNA 4E07A 1G5RA 4MRRA 2RGCA 2V4ZA 1XD9A 3EA0A 1N5JA 5HZKA 3RC8A 3T61A 3OFNA 1TX4B 1CF4A 5JSZA 2LCFA 3UIEA 2WOOA 1C9KA 1TF7A 1G21E 1MO5A 1ZD8A 3GP8A 1JR3E 1SHZA 3LLUA 4WZAE 2ODNA 4W7SA 5L3QA 2OV2A 2K5UA 4MKHA 5CJPA 5C46F 2AHOA 2QA5A 1CU1A 1KZGB 1RPZA 2QMEA 1UJ2A 4PPQA 1NSFA 3LV8A 3G0HA 3GQBA 5FUWA 1KI9A 1NMZA 4YC7A 4ZCMA 2A3RA 1G4AE 1G8FA 4FCVA 1AK2A 2CLCX 3EASA 2RGNC 3EG5A 4CEIB 4ABYA 3O8RA 3R8FA 3M4YA 4AG6A 2W00A 3G5UA 3TQCA 3B8HA 1GKIA 1DAKA 1FUUA 2XOKD 4FD2A 5FOXA 3AM1A 1LTQA 1EFUA 3R9WA 2WWFA 4PXAA 4B6EA 1E2EA 3N5CA 1DPFA 2XNDA 2HXYA 4B73A 4DCVA 1AZTA 1PLJA 1ZD1A 1NJGA 1CS4C 4OQFA 5BQ5A 4F38A 1OW3B 2ZRMA 1AS3A 4BWYA 2B7CA 2JCSA 4TYQA 1OFUX 5CYPA 3VMFA 1GL9B 1VG9B 3TIFA 5EP1A 4NONA 2QENA 3PUYA 4HUQA 4C0HA 3FMFA 1OKKD 2WJYA 2QT1A 3DDCA 1XD2B 5AK0A 3SOPA 2V3CC 1Q3TA 2ZVPX 2PZGA 1L2TA 2UVQA 3UANA 5EZ5A 4C0SA 4LV6A 3DVLA 4UNQA 3L0PA 4V03A 5J4LA 1W4AA 5M04A 2Z43A 1FP7A 4IKEA 1F2UB 3VKGA 4MH0R 2XXAB 1U8AA 5HKKA 4V0NA 1JPNA 3N2IA 2QM7A 5HR5A 2GEVA 3QUSA 2A5GA 1XTSA 1AQYA 4A0RA 2W6ID 3E1SA 4IHQA 4O0MA 3K70C 5JCPA 2B6HA 4GMDA 4LJ6A 1T8UA 221PA 4GNKA 2JDID 4G0NA 4Q00A 1CIPA 1L7VC 2CVFA 3LQQA 1GTVA 3B6EA 3FMOB 4A92A 2C9YA 2ZSAA 2ZIAA 3M6AA 3PUXA 3U3JA 5JS8A 2OESA 4YXWD 821PA 1AS2A 2LWIA 2QI9C 5BN5A 3GJ7A 2NO7A 2IS6A 1W0KD 3BWDD 5AUNB 1ZMXA 2GVDC 1KY3A 3U7EB 2G6BA 4B3DA 2ATVA 3MWLA 1W2GA 2YWHA 2V7QA 2P0EA 4JVLA 4TL7A 4JYCA 4YMUA 3FKSA 3RRMA 4OI0A 4O25A 1LNZA 2J0VA 4MYUA 4Q7JB 3EZ9A 1VCMA 4TZ6A 4Z51A 2JLSA 2HCJB 3GMTA 1QHXA 3B1WA 2NQ2C 4TL9A 1G7CA 1EGAA 1P4SA 1IJEA 3IIKA 4P33A 2Y8EA 1OXVA 1Z0AA 4B47A 1XPRA 1RC8A 1NF3A 1SULA 1XEXA 3SHWA 4I99A 1JB1A 4M1KA 2Q6TA 3UMSA 2A9KA 4LHZA 2HEIA 2WJVA 1JALA 3PUZA 1M8PA 1FZQA 1S3GA 1SKYE 4DUGD 2REXB 1NBME 1XBTA 1UAAA 3X2SA 5D3MA 2QG6A 2WICA 3ZQJA 5KTYA 3CX6A 3EW9A 3DOFA 4NDZA 2ZITA 1DG1G 1CJMA 1G20E 2CCJA 3T34A 1DBSA 2NO0A 1ZRHA 2V6JA 4URYR 1AIPA 2VBCA 2FH5B 4CZ2A 1JEEA 3AVUA 5HTKA 4ERNA 1W0JD 4TMVA 1RYFA 3CWQA 2A5FA 5DN6A 3KZ1E 4OYHA 3ZQ6A 3T06B 4I1SA 2VSOA 5BW8A 3WYFA 3QEJA 3X1YA 1LF5A 3IKJA 1XP8A 4BQSA 1E1QA 3IQWA 2A5DA 3VR3A 3SYNA 1XMSA 3SJZA 4C0BA 1LS1A 1NL3A 1T4GA 1DS6A 3SDZA 3C5CA 4JLMA 1ZD9A 1M7GA 4Q4LA 4CGZA 1KMQA 4K81B 4FIDA 3LVRE 3VNUA 5KU1A 3FOZA 3DMDA 4RD2A 2QBYB 2QRNA 1GDDA 4LI0A 1A2KC 1N0UA 3C5HA 2QQEA 3ZD6A 4NYIQ 4A8JB 2ZSEA 3RSLA 3V9PA 2IXGA 4XH9B 2J0UB 2XB2A 3IIJA 5FBRB 8OHMA 1P9RA 3AF0A 4Z1MD 4OHYA 1U9IA 3QEOA 5GJBA 3WY9A 3GLIA 1I4DD 1HTWA 2QP9X 3QENA 2G77B 1AQUA 4IOKA 3ND9A 4TQ9A 1ODFA 1KZ7B 3A58B 4HAWA 5JCZA 4LBWA 1TQ4A 3WYGA 4URXR 2WOJA 3VNVA 2Q9AA 4Y0AA 2OXCA 1S3SA 4LPKA 4TT3A 3QVUA 2PJZA 4OHVA 2RH5A 5CDFA 4NL4H 5UKDA 2A78A 2O5VA 5B57C 2QUZA 1AGPA 1R8SA 2QQ0A 4BLQA 1WP9A 4H1UA 621PA 2H1LA 1KKMA 3HU1A 2YOGA 5TXGA 2XTNA 1XZQA 2GEDA 1IY2A 2BCGY 1DG3A 1SXJE 2AXNA 1XF9A 3QJYA 3U3RA 2ZRJA 1ZUNB 2PEZA 4U00A 3PEUA 2Q3FA 4UQOA 1N0WA 2F3RA 4Q4HA 2IHBA 2DFNA 5EE9A 2X2FA 3SFZA 4W9MC 5DYGA 1ESNA 3QKUA 2DWQA 3PUVA 1GG2A 4QGGA 4M9SA 2QORA 4NYMR 2B92A 4GZMA 4EJSC 1KSGA 5FUVA 3WXMA 1OXTA 4HB3A 3BH6A 3L0SA 4CF7A 3NBXX 1GITA 2ZJYA 5IK2A 1UKVY 2CK3A 3CW2A 1E2NA 1N5LA 1DO2A 1TU4A 2R62A 4B33A 3GLFE 1W2HA 3QBVA 3MG9A 4EDHA 2Q9BA 2XB4A 3TUIC 1I4TD 4LJYA 4URWR 3W90A 2BBTA 2WPDD 3L82B 4JS0A 2JJ1A 3FMIA 3VU9B 3FFAA 1D8TA 3HPRA 1W4CA 4LBVA 4A2PA 3THOA 2ZJAA 1E79D 4NHOA 2NIPA 3CX7A 1V43A 2NO1A 1Z83A 4QJ5A 4AKIA 1G5TA 3CBQA 1N5KA 1U94A 3BERA 3LFUA 1C1YA 2GZHA 2IC5A 4B3CA 1QHIA 4Q18A 3TK1A 5K8LA 5JWHA 3R7WA 3HR7A 4DLVA 2J1LA 1XMVA 2QTHA 5G3ZA 2IYUA 4DB4A 1W4BA 1NN1A 1J70A 1XJQA 4CEHB 3GJ3A 4IFBA 4JLAA 1E9EA 4DVGA 1XTQA 2DPXA 1F3OA 3WNDA 2WJGA 1N6KA 4JLOA 4F92B 2R8RA 1H8EA 2C03A 3CWZA 4BFXA 1G5PA 2OCPA 2DFTA 3NHBA 5E3HA 4XWOA 1QF9A 5GVRA 1JR3A 4PSKA 2ZRGA 1T5IA 1VDZA 3T12A 5GJCA 4FWIB 2ZPTX 4D4MA 2P67A 3V00A 4Q1BA 3AKDA 3K70B 4E22A 3LRPA 3LBNA 2FEMA 3T1TA 2O8BB 4M21A 1XNJA 4RD3A 4LCBA 2OLKA 2CHVA 3KTAB 4DT1A 2NTYC 1NVUQ 5J40A 4RD0A 4AD8A 4NTZA 3FWYA 1KK0A 3G82C 4EIWA 3VKWA 3WMGA 4XJXA 2CCGA 3TKLA 1K8RA 1N6NA 3M1IA 1F6BA 4F93B 2JJ8A 1TUIA 4S35A 4DCSA 4EPWA 3QVVA 1KO4A 1ZU5A 2RGGA 4E03A 4CEJB 1P9NA 4ZIRB 2ZREA 3SJAA 3BFKA 1MOZA 3CIOA 3D8BA 3P1JA 3QPVA 3BGWA 4KBFA 3RNLA 2CLDX 4O3MA 3U60B 2A5YB 2C5LA 2P5TB 1KMHB 2EWVA 3AF1A 4BFWA 3GFTA 1U0LA 1NLZA 3NEYA 4Q21A 4HLUA 3ZH9B 2PJRA 3LXRA 4TQAA 1XB2A 3UPUA 2JLWA 1A82A 1ZJ6A 2GXQA 4Q7LA 4Q1DA 1TL7C 3CH5A 1QDEA 4QHSA 2KI5A 3T5GA 5J4VA 5F2EA 3SBDA 1L8QA 2ZEJA 4KXFB 2XAUA 2MSEB 4DIDA 3THWB 2D2FA 3ZIAA 1MABB 1NIJA 2H92A 4G3XA 4NH0A 1UEJA 4QRHA 3K9LA 2XSZA 4DLWA 2CNWA 3F8TA 4BFVA 2NG1A 1CR1A 4D4KA 2REBA 4B3BA 1G9XA 4Q9KA 1R4AA 3VTKA 3QPUA 1T0HB 3HYRA 3OIUA 4ZDJA 3TW8B 2KE5A 2ZANA 2EFHB 2Q3MA 3PEYA 2ZJ5A 3QF7A 4OQMA 1IN8A 2OCYC 2ZRKA 3P26A 2J3EA 3QPWA 4JT4A 5SZJA 4P4SA 1OFHA 1Z0KA 3QNUA 5EXXA 1E0KA 1YR9A 4D26A 1IXZA 3IPYA 1IXSB 2BM1A 1E32A 5LD2C 3F3YA 4M1TA 2DCUA 1NVVQ 1FX0B 2IW3A 2NOAA 3LY5A 1N25A 4B6FA 2A30A 2IYQA 2QE7A 2VH5R 5CM8B 5FBWB 2WTUA 3QQ5A 3EIEA 2AWOA 4KO8A 2ZS7A 4DIEA 2FEOA 3MFYA 4XIGS 1VCIA 4D4LA 2ZYUX 1I2DA 1F2TB 3P4YA 3X1XA 5AJYA 1H8HA 1QG2A 4MQBA 1Z8FA 4AG5A 5JHHB 1X8JA 3IBGA 4XTCS 1PZNA 1YVDA 2IYWA 1RFLA 4BGDA 3H86A 1EFRA 1RRPA 4HAZA 4NU0A 3B60A 3EPJA 1LW7A 4ACAA 5BWMA 1M6NA 5KPDA 2GWHA 2ZUCA 3WP1B 2FSFA 2F43A 3CRQA 1BKDR 1YR8A 1BMFA 4MGZR 4Q03A 3TNFA 4I1VA 4OI1A 4L4UA 2IYSA 2ZU6A 3QXJA 5KSZA 1D9XA 4Q5IA 1E9AA 3U6KA 4OJQA 2R6DA 4M9QA 2RMKA 1W7AA 2QM8A 4XVQA 3RWOA 2LKCA 2YC2C 4MUAA 4LRWA 3KQKA 2F6RA 2NPIA 1JAIA 3GFPA 4Z8YA 3SZRA 3UWKA 2P6NA 1Z63A 5JSZB 2DYKA 1US8A 4XWAA 1S2MA 3QE0A 5L3QB 1OPXA 2VO1A 3CZQA 1RJ9A 4PAMA 1O87A 4RY2A 3RS0A 3T1VA 1KJZA 4OHXA 1T5LA 1VCOA 2VQSA 2ZE5A 3SC3A 2AK2A 1XXHA 1DTSA 4Q9JA 4A0GA 2QAJA 1Z2CA 2R6AA 2FU5C 4OI2A 5E7JA 5CB8A 1Z0FA 3K9HA 3UG6A 3O47A 3L2OB 1T0JB 4AYXA 1ZM9A 3NDPA 1G1MA 2D06A 1Z5ZA 2GDJA 3EZ6A 3RS4A 4QFMA 3U7HB 1TQDA 1J99A 2JLRA 2ZU0C 3QF4A 5C4MA 1XEWY 2MMCA 5AWFC 2MSCB 1W4RA 3BJIC 1Z2AA 1G6HA 4YMVA 3KQNA 1BYIA 2IUUA 1Q1BA 4BFZA 2TMKA 3T15A 4FMCB 3TJZA 4EFLA 2NO9A 2HDNB 4Q1CA 4PPNA 2FF7A 2KBEA 4PZYA 4B43A 1DAIA 5AUPB 1OB5A 1EG7A 4HUQB 4DSOA 4AY2A 2HLDD 1N5IA 2VEDA 1KDTA 4Q48A 1FQKA 2VP0A 4US2R 1T6NA 2OSBA 4OI4A 3QG1A 5JS7A 1X1RA 4UNSA 2OG2A 1VPLA 1ZM2A 1XCPA 2CJWA 4UNPA 2WBLC 5BXQC 4RSGA 5H68A 1OYYA 4JKYA 2J7PA 1KDOA 2GCNA 4ASUD 1RIFA 2F7SA 4ARZA 4Q01A 4F91B 1SXJA 3VFDA 3TRFA 2OAP1 5EXTA 4U7DA 2BIFA 3GJ0A 5KDDA 4TZ0A 3A1TA 1PVOA 4X8OA 4C4PA 3GLGA 2R2AA 4FMBB 1KO7A 1Q1EA 3UMFA 3K0FA 2QMUA 4M9ZA 1IOZA 3K1JA 2QSYA 3MWYW 1XFAA 5EE1A 5KSPA 1QVAA 4ZCIA 3B2EA 2GK6A 2VIIA 2JLYA 1KK2A 5CK5A 2F55A 1VYVA 3OAAD 2EW1A 3R9XA 3GLFA
chains in the Genus database with same CATH superfamily
2NV6A 3MLEA 4DG9A 1OUMA 1U9JA 3LA6A 3ZZ0A 1E1RA 5JEEA 3JALA 2X9QA 4CV3A 4HRXA 3JD4A 2VDQB 1H2HA 4PTLA 3HE3A 2Q1UA 5DNVA 1XU7A 1SZPA 3FOWA 1QGUB 3OC6A 1TO2E 3BAFA 2ORVA 3NXKA 2XYHA 1Z8NA 3S5UA 3WP0A 3K1AA 1EG2A 1TKAA 3HBJA 1SVMA 4IZOA 4K9KA 1DAFA 2P68A 3CRMA 3KE9A 3C3JA 1ZG3A 3IUNA 1OBVA 2H7CA 3QP9A 4G1MB 2D8MA 1WB4A 3JX9A 2QAGA 1IM8A 2O3TA 1I6WA 1GPYA 3OESA 1O9GA 2F1OA 1NFQA 4XYBA 5CFQA 4PC2A 3FPKA 4NR0A 3T4EA 3FWNA 1MIOA 3LKZA 4GC5A 5D3MB 2J59A 4YAJA 5A2QA 5IDVA 3UMBA 4S1PA 2HOQA 4XWGA 1B8UA 1NP6A 3LAWA 2VUUA 4TPKA 3WTBA 4IR7A 3WGLA 1IZYA 4I4TF 3AB8A 1VP9A 1XZNA 2G0AA 2QRHA 3IDSA 1EK1A 1U7WA 3HZZA 3I6IA 3IO5A 3P9RA 2YOFA 2IGBA 3I5MA 4FZ5A 4BRWA 3I5XA 1OLSA 3KO8A 1LQ2A 2WR8A 4LZAA 3EH1A 4J0QA 1TM1E 1FW8A 4LMPA 5H3LA 1L5KA 4DRXB 4ZREA 2XECA 3QVXA 4TTJA 4W5OA 1EGVB 1TAGA 4RIFA 4N0PA 1CNEA 2QWXA 4JBXA 1ZVKA 1XO1A 3ONEA 3COSA 4NPCA 1Z29A 2B8TA 4DJTA 4GE3A 4JH0A 3MIZA 4BIIA 3K0KA 5CT9A 3OCXA 1T29A 2QK4A 3IRVA 1HORA 1X3SA 1BKSB 3LBAA 1S3FA 3KZXA 2ZRBA 4N3CA 4RTRA 1GDTA 1C7QA 2NZ8A 3WV5A 4C6HA 4V38A 1FEZA 1NVBA 3G7UA 4XWTA 3PC8C 4PCVA 3I9V6 2NAFA 1U99A 3EIWA 1JIIA 3F2VA 3NEAA 5ERXA 2JGEA 4N1AA 1CLUA 3ADOA 4GOOD 5CHYA 3UKDA 3LPDA 4I1IA 2G76A 1L7AA 4JB3A 1UJ6A 3BZBA 2HBYA 3NUGA 4JBWA 3K09A 5ESRA 3RKUA 1XU9A 3Q3GE 4G0VA 2G70A 2AK3A 3DOIA 2H8KA 4R98A 4LIPD 4MGEA 2I8CA 3A1WA 3JARB 1I7NA 1QWOA 3FPBA 4RPGA 1EQAA 1Y4AE 5DMXA 5LD2B 4FS3A 1K97A 4FFWA 2WYOA 3SPXA 1EI9A 5C5CA 4P6VF 4YUYA 5E2BA 1XA0A 3WHIA 2B37A 2Q2NA 4MUEA 1GGHA 2H63A 2H3EA 1H4QA 3O3CA 4UEJA 3DC7A 4XX0B 3E1KA 4M1EA 3ZNPA 2YH2A 4YNBA 5KOYA 3SF8A 2GKSA 1K0FA 2I62A 3N8IA 3N2EA 4XRGA 2EX0A 3DEAA 4MR7B 3V2HA 4L4ZA 1CDZA 1T8YA 2OZLA 3TAHA 3AY0A 1L4HA 1RQGA 2X6TA 5T41A 4R68A 3RYHB 2JA1A 2ZTHA 3QFRA 7REQA 1PBNA 1PJ2A 2PGIA 4XGIA 4R1UA 3TZHA 1MZVA 4IH1A 3H1TA 4QNMA 1UPBA 2HHJA 5LPNA 3NH9A 3LKVA 3PFWO 1D2EA 4INAA 1EWTA 4MKZA 4DUGA 5JZOA 3U5ZB 3EAGA 4YPFA 4L75A 4J2TA 3FGNA 2DUNA 721PA 2RJOA 4J0DA 4ZHQF 3L43A 3QWHA 4OSPA 4IG4A 3R3HA 1OVMA 5AOVA 3A4LA 1GCGA 2PGAA 3LE8A 4MYCA 4TS4A 3NT2A 3FY4A 3TBKA 4MVJG 5IJ9A 3GUYA 4UUBA 4TV9B 1DQZA 4IS3A 3DMNA 5BYBA 3VR4A 4LOJA 5CG2A 3GHHA 1THGA 5ES4B 3UWDA 3E7DA 2R0QC 1SD5A 2COUA 4I6GA 4B7XA 4OBEA 2ZR7A 1WKBA 2FGJA 3WGKA 1VPVA 5JCXA 1A2QA 1UXJA 4P3OA 2WYUA 4MQLA 4B46A 3K9NA 5JECA 2C00A 3OA2A 3TSOA 5SZKB 3KDSE 1WZUA 3OZIA 3HNOA 3K6KA 4DMMA 4F2DA 5D00A 3Q3EA 2ZE8A 3A28A 1YTLA 2CLOB 1DELA 1XYYA 2EX1A 3USZA 2OM2A 3VDRA 3CVWA 1DC7A 1EK2A 2R11A 2I22A 3BXEA 1PO7A 3HRHA 5HM8A 5LJLA 1SUAA 4QPJC 2R68A 3QVTA 3SP1A 1VIVA 4HH3C 3ZE1B 1XZKA 1NVAA 2R5WA 3I8SA 4D44A 3G0IA 1UMDA 2I65A 4URZR 4D74A 4UM9B 3FFXA 5AW0A 3EMVA 3C39A 4HADA 3TLCA 3M6VA 3TR0A 3JQPA 4EEKA 2PK3A 3W9UA 4N82A 4I66A 4Q3LA 5GVSA 5KTPA 1SEPA 2HA5A 1JS1X 5C52B 5D7NA 2PN1A 2AMLA 2JIZD 5COAA 5FDFA 4PF1A 3L4KA 1E2JA 3TQRA 1IOLA 4LHXA 1W25A 2XE6A 4JEHA 2YVKA 2IK8A 1ZMOA 4PLPA 4R2LA 4DLLA 1WLSA 3OQBA 5FPSA 4EQ6A 4JV5B 4HYYA 1LY1A 8ATCA 2C2KA 2AOTB 2X58A 4UCQA 3ZDRA 3RH0A 4EPTA 1CK4A 2HRBA 2ZP1A 3FLMA 5AKIA 5ERGB 5FBKA 3T95A 1FLDA 2HFKA 3AUTA 3F5FA 5HQJA 4BNHA 2P65A 3EQZA 4CCYA 3U31A 5IT4A 4LBZA 1SCIA 3WHKA 5BWNA 4XEUA 1ABBA 5EIOA 5KTRA 1WEHA 1HDIA 2O8FB 5KAPA 2BM8A 1UZLA 5BSRA 5AUOB 5MN4A 1O77A 3N2NA 1SXPA 3HJGA 1YR6A 1GPKA 2GK4A 2WSSD 1Q16A 3RUDA 3WNZA 5D8DA 2QD2A 4K5QA 4R81A 2ZSDA 3UJ3X 1SXIA 3WE7A 1R00A 2IS6A 2R6R1 4HUTA 1C7JA 2W93A 3EAQA 2ZFUA 2XDWA 3BIOA 3RKSA 1EUQA 4P93A 4RTLA 4M4SA 3G7NA 3EJ6A 2BE9A 2CZCA 2WJ4A 3IMCA 4LWOA 2YHIB 4LYJA 1SB9A 4MW6A 1QU3A 4TYYA 3MAGA 3V7NA 1DT5A 3RJMA 5K99A 4TXLA 3CPSA 4LBYA 4PO8A 5LMNB 1ZUIA 4HWGA 5CU7A 4QWMA 2QAGC 3SDBA 4GM4A 4OFWA 5IVIA 2AN5A 2Z8YM 4XUGB 2X0KA 1KZ1A 2DR3A 2ZJ3A 2C78A 4RAOA 1TD9A 1EHCA 4NEQA 4MUGA 1Z6TA 4EMSA 1TJNA 4NCNA 1X0VA 2ZROA 4OSOA 4K6MA 2IYRA 4IQ8A 4UTPA 3WQHA 5CITA 2JGFA 3DKVA 3WJ7A 5H1YA 3AEXA 3ER9A 1E3QA 1EWYA 1G3RA 4R1NA 4B44A 1Y0BA 1R9MA 1XXHE 2OGTA 2VYVD 2IV2X 4P4TA 5BT8A 2FAXA 5TS3A 3DD1A 5KC9A 5AKYA 3WLHA 4ALNA 1H5NA 1ZUWA 3IAUA 2PUEA 3MMZA 4QDUA 4WA7A 4FLFA 5J4HA 3AUKA 1CP2A 1KS9A 1ZM4A 1KDVA 3PNVA 3SQWA 2OBXA 4RXUA 3Q8WA 3GPCA 5AXDA 3WJ2A 3LU1A 1JDZA 4RABA 5KTSA 3DNPA 3AR6A 1NC1A 2CL0X 4IZHA 2HLNA 1YDWA 4RTMA 3Q9SA 3PGA1 2ZSJA 3D7SA 4FZVA 1ZSYA 4IDEA 2XRFA 5AICA 2FW9A 5CK4A 2NU9B 1GNPA 4CLDA 5K5EA 5JI2E 1HLFA 4B7ZA 5EJIA 1WHSB 5BWBA 3ZQKA 5A3VA 3CB4A 5EJ8A 1PUIA 1TYBE 3QELA 1I3OA 1SOAA 3JATA 1HZJA 4ID3A 1ODCA 2O4CA 1KZYC 3HJRA 4ZYVA 4CRWB 2YYAA 5FPHA 2B1JA 1OILA 2PTGA 1L5VA 3OP4A 1Z6GA 2WE8A 4CFZA 4HT3B 3BB1A 4I5IA 3O74A 4PNZA 5K3AA 3ZGXA 4P4SB 3TUZC 1A27A 1GQSA 4FN5A 1V7QA 1USIA 4UCXA 3GLHE 2XMZA 1DL5A 1N3YA 1QGED 2GJAA 3IR6A 3A1DA 4HV4A 3ZJUA 3PR1A 4XVHA 1U0OC 3F96A 3PHHA 4LRSB 4U2CA 4X65B 3LUGA 1TLTA 1SRRA 4LKOA 4C0XA 1YRLA 5CCBA 2FSIA 3Q7PA 2JLVA 3IP1A 1ZCZA 1AHPA 2GF2A 1EDDA 3EC7A 1JT9A 2EP5A 3LO8A 1NMXA 1UBGA 2DE0X 3AEQA 3JVDA 2PS1A 3BQNB 3Q3JB 4B34A 1IPEA 2RK6A 1L7XA 2IXAA 1FYFA 3EIOA 5HGXA 1NWCA 3D3KA 4QTZA 1AS0A 1ODSA 4FDLA 3EFOB 3TZKA 3FCXA 1VFPA 3R0IA 3T41A 2X1LA 1J8YF 2OZEA 3FTEA 1AM4D 3PXUA 3KOZA 5F7OA 4RDIA 2QYSA 4Y6LA 4CMIB 1JA9A 2QVXX 1L7QA 3MGCA 4EB0A 5CG1A 1DWQA 3UWOA 3QTBA 1KFBB 4GBED 4MKFA 2VUIB 2Z98A 1BFKA 4LJSA 1L1QA 1R66A 4GQIA 2X4IA 3JTMA 2H4HA 3BPSA 4UBKA 2EBWA 4RH1A 4B76A 1KWGA 1IWBB 1RIIA 2DTEA 3EPPA 2EFGA 3TE7A 4KMRA 5KS2A 2VXOA 3CA8A 4ILEA 3H4VA 1LK7A 3PEFA 5KWEA 1BDBA 4EHKA 1U6KA 4M0FA 5DE3A 5DNUA 5HKOA 1OFUA 1SN7A 2X19A 1HM5A 3QBTA 5F12A 2GN4A 1CFZA 1KFKB 2OT3B 4PYMA 5CRIA 3UAVA 3BORA 2ZRNA 1TKCA 4LG1A 1R0LA 3D7NA 1E6UA 1SIOA 1IMOA 1GADO 3C3EA 1SVOA 3F6YA 5FFNA 4MRMA 3OPYI 3QVGB 2P9TA 3W2EA 2B61A 2IHTA 3BWYA 2ZRIA 2BEUB 2FEXA 2XUGA 2VJCA 3FSJX 3PNYA 1RACA 2ZR9A 4LPSA 4LAFA 4TXNA 2AMVA 5CYFA 3WDMA 1EFHA 3LFHA 3PUKA 4LXIA 1JIJA 1JLSA 1L4LA 2VJNA 1JHRA 2DY1A 4QQFA 3N76A 5AT1A 4DNQA 1KKUA 2H57A 2F1JA 2QUBA 3GBSA 2XTZA 3UJDA 2Q5LA 1PN3A 4O59O 3SLGA 2QNBA 4EL0A 5FTLA 2VAVA 2IHJA 4C03A 1TQ6A 1YACA 3GJ6A 1UKAA 5ADUS 3KYCB 1L3IA 4RHTA 4KAJA 4RM3A 2QYHA 1JIVA 1NSYA 5E6RB 3PQCA 2HRQA 2UVPA 2WHXA 5IPFA 1NNEA 1UC4B 2XVAA 2Y93A 2FZ4A 2X0NA 2BHTA 4KJZA 4ZRNA 3TRDA 5CFLA 1VGVA 3HB9A 3QU9A 2VNJA 1FFHA 2N1BA 2ZB8A 2B4TO 5IDYA 1VJ0A 1GNLA 2M32A 5J5AA 3ZBUA 1T2AA 4M60A 1U3FA 1HDRA 1W5SA 5A0TA 4KQCA 3H1AA 3RF7A 2V7WA 4DGSA 1KEZA 4G5SA 5HFAA 2NXEA 4WFIA 1YC2A 3FJ1A 1T25A 1IIRA 2G4LA 1GSOA 2PFGA 3GC6A 3HVJA 4RVFA 4JUCA 2Z57A 3E84A 1NFFA 2I76A 4RVUA 1XXLA 1HLGA 4BTEA 3L49A 4FUTA 5C51B 1Y6GA 3UFXA 1OOEA 1ZKDA 2QVLA 3LDAA 4XE5A 4Z4FA 4L5BA 3TSAA 3U80A 2H2GA 2BW0A 1NOKA 2XZPA 2D5CA 4G84A 4IXTA 3WK8A 1OH5A 4OQXA 3T7AA 1WU8A 5EIHA 1MPXA 4DSUA 4OBBA 2DKNA 2FF5A 4UFNA 4QYIB 4YMTA 4AYTA 4TMKA 3IVGA 3AHEA 3EK2A 4Z9BA 4ZA2A 1APBA 2FWRA 4XD7D 3HCWA 6Q21A 5K45A 1B0UA 1FP6A 1Q3KA 3AESB 4KIJA 4DLNA 1JT2A 1OX6A 4AZ3B 1FLAA 4YFVA 1EUDB 5TB5A 2OV6A 4LFAB 4RKYA 3A6PC 1S8NA 4FD3A 2A9VA 4YJFA 1QHHB 1M34E 3FI9A 2FFHA 3OJLA 2MYNA 3C15C 1R4ZA 1OXUA 1RW4A 5EJAA 1VSQA 4S05A 3IURA 1Q50A 1FZTA 4UHCA 2OBLA 4IDBA 3OHMA 1H23A 1HE4A 2CN1A 1NBIA 2XA2A 3F7NA 1V71A 4XVUA 3L18A 4ARIA 2H2IA 3QKRA 4NS1A 4YBRA 4DN6A 2EKPA 2JJ1D 3JALB 2P8JA 4QIHA 4X7RA 4XWYA 3VDXA 1I2BA 3WFIA 4Y9DA 4BMPB 3G0OA 4C3UA 3SE0A 4E31A 5IJ0A 1CEYA 1C7FA 1EFPA 1QFXA 1Y80A 1HK7A 2ETVA 1M6WA 1R8XA 1DINA 2HA3A 2HIMA 4DLBA 3EISA 1Q0HA 3ZHOA 3K1AB 5BVGA 4RIHA 2B7BA 3ZWQA 2OKGA 4XWKA 3NBKA 4OKSA 1S01A 1GWNA 1RP7A 1GT91 3GEBA 4D0GA 1NMEA 3CG4A 4J7AA 4R6WA 1DUSA 1E4OA 1ORRA 2DBYA 3F49S 4QC2A 4CTOA 1G38A 3IUPA 2QAGB 1WP4A 3CLRC 4IOJA 3WL5A 3TW0A 4B32A 5BORA 4BNYA 3EF0A 3FNGA 4WCFA 2Q9CA 3ZWXA 1G4HA 2H18A 2NUAA 4LK2A 1AKYA 2E87A 8ADHA 1U0GA 4G6ZA 1MIOB 7ADHA 1XDZA 2I54A 3LO5A 3V8PA 2Q41A 2LGJA 1QV9A 5C53B 1QHSA 5IVDA 4MRVA 1Y1LA 1TKBA 5GOTA 2R86A 4ND2A 1B93A 3D3QA 5AI5A 3RAJA 3T7TA 3UJ9A 5JC1A 1H66A 1TEHA 2ADFA 2I4NA 1MU0A 1E5DA 4OQDA 2PVCA 4N6OA 3U3DA 1I3MA 2BLNA 1M5UA 5FRDA 2ZB7A 1OLSB 5KNCH 1CF9A 1YR7A 3S68A 1YRBA 3NUQA 4KO3S 4B3MB 4W7IA 1FDOA 1T0IA 2Z5LA 2X2EA 4M9UA 3PV0A 1CD5A 1E96A 1U2QA 4TMXA 5JW6A 2BH2A 4PX9A 1USGA 2J5BA 1LF0A 1U7DA 2IYFA 1SUIA 5CH8A 1UEIA 4G2NA 2QR2A 3IERA 4F7WA 2B0JA 4UVDA 5ALIA 1DJMA 1ZUNA 4KE7A 2HXSA 1JFTA 3QKSA 3DP9A 3GLKA 3V8QA 5FWYA 3FWPA 1X6VA 5DWQA 2Z3WA 3D6UA 3IAM1 1EX9A 3EH2A 3OIVA 3RB8A 3GFQA 1X2BA 1CIJA 3BG5A 4XAQA 5DYIA 2Y27A 1VG8A 3V4SA 3VTZA 3PNPA 4CF5A 2CF6A 2D54A 4MUIA 2J3MA 2FZVA 2GZMA 2YVQA 3KL2A 5DTEA 1ZO8A 3PCRB 3E15A 1FBNA 3VPSA 3R7FA 4F5YA 1CLEA 1E8MA 1X9IA 1AF4A 5G0SA 5JTTA 4C4SA 4D79A 3EDRA 3B7WA 4JEMA 4NYIR 4YJ2A 3MXOA 1JHMA 4ZEXA 5AUQA 1NXPA 3I2IA 3LCCA 3V2UA 4F6RA 3OTOB 4R41A 4W63A 3LM8A 4INZA 3W78A 2AG1A 1ZJZA 9ABPA 4UUOA 3GQBB 5E4TA 3OMXA 5BNWA 1USVA 2GN0A 3A3PA 3OFKA 4OLFA 3NM4A 2XUDA 4TQGA 1U5CA 1D5CA 2XOEA 4ZVKA 4ZHSA 1U2EA 4G1EB 4E5PA 1MVLA 4HAUA 1ZGAA 4JQYA 3VNRA 3KSBC 4KQHA 2WFLA 1SHJA 1DB3A 1TM2A 3T5DA 1D7OA 1WCV1 2IEZA 2OK8A 3B89A 4HQ6A 1NE2A 5FOWA 3REQB 2JASA 4K6GA 1GGMA 3EZNA 5A04A 4KPYA 2V6FA 4K3UA 2J0EA 1BE8A 2OZLB 3DAOA 4H7PA 5D85A 2Z3ZA 3D4BA 1AZLA 4W82A 5D7BA 1N0HA 3OIDA 4PCAA 4ZCQA 7REQB 5DCYA 4C5CA 1I2CA 4XGNA 3FUCA 3TMKA 1P31A 3BZWA 4RV4A 1W48A 1W1UA 1CR0A 2FE1A 3DE2X 3PCTA 4HB4A 4B2IA 2PRSA 3K0HA 1T0UA 4F4DA 3UAYA 1DCKA 4JLBA 4C43A 3EEIA 2YTZA 3OZFA 3HBAA 3HP1A 1N1GA 5EKUA 4PXYA 4IJWA 3HU3A 5KYWA 1D6JA 3IGFA 1LZKA 1O96A 2ERCA 3H99A 4BZXA 1F0YA 2DP4E 1R6XA 4J90A 3B6KA 4OFXA 1JHAA 2EQ5A 5IJ9B 3QY9A 4JL6A 4EG6A 4ZXFA 4L72A 1JA0A 5I7SA 4RTPA 3BSWA 1FLVA 2ZSIA 4WLUA 2F64A 5DCLA 1HR0B 2HJHA 2AR7A 4E13A 2D0DA 1HSZA 4PANA 5TGTA 2HSJA 5F2KA 3L02A 2QTNA 2I29A 3RJTA 4V0ME 3DH0A 3GEHA 2IIPA 4JXJA 2QD3A 2V7BA 4G81A 4Z1OA 2BGGA 1GZ4A 2NNLD 1EFVA 2J8ZA 2GHTA 2DLNA 2HBZA 5GIOE 4PZDA 4TTAA 4BZQA 5ITWA 1ECCA 1SC9A 3KJHA 4UDXX 2VJLA 2ZYRA 1Q20A 3BL5A 4AP5A 1CV2A 3L0YA 1AKUA 4BWGA 1ISFA 3DAYA 1M83A 1MW9X 4RADA 5DXAA 5EUQB 4XIIA 1QB7A 1LWNA 2DEUA 5LNK1 5GJVC 3ZBPA 1SWWA 5BNTA 4LY6A 3TTSA 1I0LA 2G0NA 2YFHA 1UMDB 1HY3A 4M83A 3REFA 2VPQA 1II9A 1RBYA 1P4RA 2P4UA 3WYDA 1VSBA 4FNAA 3OQIA 4EK9A 4MHOA 2AIRA 5K6TA 4JT2A 3I2GA 3SNHA 2YL2A 2EP7A 5JALA 5CXQA 4X1IA 5DX8A 3DFIA 1RAIA 3OZAA 4M53A 1NNLA 1P7VA 2VHZA 4EQ6B 4M1QA 1B6SA 1E1MA 2AF3C 3X2FA 4IY1A 2VAXA 4L15A 2FGKA 2PLNA 1RYNA 2PX4A 2ZRDA 3IJRA 3M2PA 4X64B 5FUBA 3VR6A 2Z1MA 3I9FA 3W8NA 4CCYB 5FI0B 4DTCA 4GZLA 3RVLA 2XV1A 4YVFA 3GIDA 1P91A 3PNOA 2GZ1A 5HUHA 2GF9A 1K4MA 2WZQA 4PO3X 3G2PA 3QUCA 3KWFA 4G5RA 4OK6A 2E89A 3TMYA 3DDUA 2BDTA 2OB1A 3A1FA 3EWAA 1OJ7A 2OKCA 4BJ5A 1XTUA 3GUUA 4BE9A 3ZI7A 4FNOA 1P2VA 4O0LA 4DDUA 3G2LA 4BB5A 3FGPA 3KSAC 2M1XA 3AGQA 4KREA 2FRXA 1CUBA 1I0IA 2QF7A 3PKZA 5CLIA 2QRUA 3U5TA 1U5BA 3H5WA 4IV8A 4MO2A 4OU4A 5YASA 2Y6VA 4YRNA 4ZEVA 3TOVA 4RTQA 3LY9A 3TLBA 1WS6A 4TRNA 3H7IA 4OGFA 2GJKA 1Q7TA 5ANRB 1FDTA 5KSOA 3T5CA 1GSAA 5AM5A 1FQOA 1FP4A 1C0KA 1K2WA 2JJMA 3QPAA 4CLXA 4KQMA 1HFKA 1KP9A 3MJRA 4YRLA 1UJ4A 4WCFC 3SHOA 1VPWA 3LVBA 2X8BA 5DYTA 2YQZA 5FPYA 4G1BA 1TVCA 4E6PA 5LLSA 1JB9A 2O7NA 4B3IA 5BQFA 5LMCA 3WLFA 5C9ZA 1XZBA 1P6XA 1XEWX 3PJEA 2W9XA 4GX5A 2NWQA 4RF4A 3EBOA 5B36A 4QEZA 4Q1FA 5AVYA 4FCTA 4AF6A 2WHQA 1PYDA 1CYDA 3ZQ4A 1E2MA 3E9MA 1EVZA 3L7YA 4PYNA 3NVAA 3ZE8A 3TGPA 4BCDA 2PFKA 4JYZA 3E9CA 1HBJA 1CP3A 4OQLA 3DOCA 4PXSA 4HATA 4EX6A 3H2YA 3TQHA 1EFCA 1RS0A 1NI5A 1SCKA 2J9XB 3HVHA 4D41A 3U61B 4P38A 4YIKA 3RTDA 2O3SA 3VBEA 3V80A 4ZV4A 1E66A 3GD5A 1T2EA 2J9RA 3B70A 1GA4A 3GAZA 3KXPA 4K9DA 4QXMA 2I67A 1DI0A 4YCSA 5LXTA 3FSRA 2RIPA 3KJEA 1JQ3A 2Z9BA 3RR2A 4ENWA 5DTRA 2QTGA 2GVZC 4OB8A 4Y8VA 4G1CA 3PNKA 3NPAA 4Q02A 2IYLD 4IYRA 4RC9A 4C6SA 3IX7A 1Q3HA 3LD9A 4V2UA 2PQ0A 3QFTA 4AJEA 2H9IA 3LWDA 4P7GA 1MV8A 2ALJA 3GOQA 4JHXA 4DMUB 3QELB 4W5HA 5CVEA 4ENSA 4AP9A 5L8VA 1A7JA 5LKAA 3JATB 5BSEA 4S24A 1EVIA 1ST3A 4H77A 1JFLA 4Z4IA 5FEUA 1RHQA 4Q4JA 1PL8A 3D0QA 4B6PA 5A4FS 1IUOA 5IASA 1FS6A 1T9GS 4N5HX 4UARA 3TG2A 4EB6A 2EL7A 2YZ7A 2FETA 2VT2A 2JIPA 3F1KA 4QGHA 1F1JA 3G68A 3IPCA 3AF3A 4TWBA 4JJ7A 3H3XA 4B17A 4UTVA 4W1PA 2FY8A 4Z9AA 5FO1A 1BTOA 1W94A 4DR4B 1RMTA 1WQ3A 3QITA 1O6FA 1QRAA 1WOYA 1QVVA 1S8FA 3LKDA 4EYEA 5ICCA 4BO8A 1ZONA 2H48A 3AEQB 2W2TA 1IATA 4QBKA 4MKXA 1FRZA 5H0IA 2XTMA 4EJSA 2WRZA 3IEVA 4KAXA 2QP3A 1R2QA 2BR3A 2OCXA 5LC1A 1X19A 3TTTA 3RV3A 4B8YA 1PZHA 2YWJA 2AYXA 4QJBA 5LQAA 2JI9A 3RT9A 3WBBA 4D9BA 3U1BA 1QE0A 5FO0A 5HGJA 3ZGYA 5F98A 3H2ZA 2GPTA 2XGMA 4RGQA 4KWEA 4Z53A 4R69A 5AVKA 1QO0A 2E4YA 2IEYA 2QX9A 2WZBA 3K2EA 3IXLA 3KHTA 4R2HA 1JHUA 3IDQA 3NTOA 4WERA 2DLDA 1F0PA 1W34A 3AP2A 5FFMA 3QV1A 2QSZA 4FGLA 1SUFA 3LZDA 4RESA 4NI5A 1JKFA 4Y6SA 2Z0MA 3O2SB 1P39A 2IHZA 2C57A 5ARDA 3ET4A 4D9EA 3HY6A 1NT2A 2BN4A 1RYYA 2FPGA 2JFPA 1S7CA 2GAIA 2ZIFA 3IUYA 3PDWA 1AKTA 3Q9LA 4ND6A 4O4JA 5JE8A 5AVTA 3EXG2 4LSMA 3WRXC 3JS5A 3DEHA 4PO1A 2Q6VA 2ODBA 3ZVMA 2ZETA 3A9SA 3EC2A 3LXXA 2W8BA 3IUBA 2VOJA 2R44A 3WQRA 1L6RA 2JJ2A 2WVHA 3JZDA 4HR7A 4EA6A 2YFYA 4MRMB 5BN4A 1Y3FE 2UYOA 4DMHA 4QBHA 1OWPA 1GGEA 2P4QA 2X9GA 1WXIA 3DCYA 3BCHA 1E3TA 4N0DA 5JAUA 2G4CA 1KE2A 1PSWA 1IEXA 1HNXB 1ABEA 1Z33A 2XDQB 1H2YA 3BD9A 3OUTA 4JOSA 1S96A 4M7OA 4WMLA 3ZY3A 3ENNA 2YKGA 2CLIB 1C50A 1DDOA 3HJFA 3PFIA 1KYWA 5ALMA 1JG7A 1R6DA 3S8EA 1OH6A 3PLNA 1SJ9A 3UAXA 4E4TA 4E3WA 2A0YA 4Y0NA 1U8XX 5JDCA 2ZSKA 1G4UR 1RHRA 5BV2P 2UVPB 1MB9A 1HG1A 4OLJA 1Q77A 3HHEA 4Q05A 3RASA 4PGHA 4X8MA 4HH4A 2PYDA 1LNQA 1E8NA 2PEYA 2A5LA 3NYRA 1NX9A 2IOHA 2YXDA 1DIBA 3QIAA 2Z04A 1IJFA 3ZOKA 4AKEA 5FI1B 1K66A 9LDBA 1UKYA 1BQ3A 3I1IA 3QW2A 4RK1A 1G60A 5HRAA 3LQ1A 1CY2A 4L27A 1X1CA 5ALQA 4TTQA 4NJOA 1QFMA 4MVJD 3MT8A 3I42A 3KOMA 2B4RO 3Q0IA 3TVTA 4DLRA 1HKUA 1N6IA 3ISJA 1HLPA 1L9KA 2EGUA 2WKRA 2ZZKA 2GKOA 3UFXB 2G09A 1N6RA 5TNXA 3WKCA 3NTXA 1ZOLA 2YHSA 3C14C 3E4CA 4LC0A 4UBIA 3RDPA 1Y6FA 5J23A 3PTAA 4OHBA 2VHCA 5ICEA 3W04A 3JR3A 3OTGA 3L0IB 3LUCA 3LW7A 1KQ3A 1Z6AA 2P69A 4QLAA 3GD7A 4C05A 1IONA 3GLSA 1XWFA 1ZIYA 4KQ6A 5TQJA 3ZNQA 4RF2A 4JVMA 5HRCA 3UMJA 4IIXA 3IJPA 5AJWA 5K0ZA 3AKCA 3LT5A 2HNBA 3PNSA 5FHRA 5HA5A 5KYYA 2RJNA 4TYNA 1C7ZA 2H65A 4YTEA 1ZIPA 4MUBA 1Q1ZA 2D8AA 4AMVA 3NANA 3QKIA 1HURA 1Q17A 4ZTUB 5E8RA 4NBRA 1EVJA 3RVKA 5E4YA 1X3LA 4DE5A 1E2IA 4ZU1X 3ZVLA 2AQHA 2ZIUB 4L74A 1QU2A 1XZMA 1SKUA 3GRFA 3IA2A 3P0FA 1KSHA 2ACWA 2Q46A 4WFJA 4YJFB 4YBZA 5DLQC 5HF9A 3WGTA 1BX1A 2GYYA 2KQUA 5EP3A 1S89A 2W6JA 4IDOA 4A26A 3DNMA 1K5GA 2NVUA 4ISCA 3G59A 3N9IA 4F45A 2P9FA 4YV0A 1G2IA 3K0AA 4ZYUA 5KAMA 1I1OA 2ZBVA 2F9MA 1XTRA 1X9HA 5ICGA 5LQRA 1J1IA 1Q57A 3WLQA 2PFSA 3AUSA 4EHLA 4GMXA 1TM7E 1S2OA 3R5KA 4FYJA 4Q9IA 1MCZA 3DNFA 3QLTA 3QKRB 4NECA 3WADA 3ZLBA 1IRIA 1YZYA 2PZJA 1DTEA 2I2AA 2YFKA 1IHUA 3N74A 1TYEB 1WHTA 2W6ZA 1CZUA 2WSMA 4OP2A 4CN8A 3C6QA 4N7JA 5IJ0B 3I01A 1NXSA 3DE6X 1WVMA 1EFPB 2W98A 4P83A 3FCUB 1WZCA 4NMMA 1CC1S 2RFLA 3M4ZA 4EZEA 5JAZA 3CO5A 3OPYA 5CT4A 4EYOA 3S2YA 1TTPB 3IP3A 5LB4A 1P7CA 1NURA 4ATNA 1E7QA 4U7WA 4RD6A 4A2QA 1P0QA 1Y5IA 4RORA 3ND5A 2XB6A 3DBIA 4EZBA 2MSDB 3QBEA 3G5TA 3FKSD 2LRHA 3LFTA 2BMVA 1N2SA 2FW7A 4WCFB 3WFZA 1Y9ZA 4QU8A 2FPKA 4YT4A 1VI2A 1FTQA 2VSXA 4BEVA 3TNYA 1YS2X 4E5YA 1RLIA 1N8KA 3PF9A 1FYVA 1AZWA 3KKMA 1W36C 1U2TA 3CR8A 2QTBA 1A4RA 1GILA 4DM3A 3PPVA 2R47A 3ENQA 2M6RA 2GA9A 5C35A 1DJNA 1PDOA 2G40A 2OQVA 4JSYA 2G07A 3OWOA 4L7QA 5IEJA 1MT3A 2H4YA 1CWUA 1EWKA 1OXBB 5FPKA 3MW8A 3D5TA 5A0FA 1M1YA 1YBAA 1MB3A 2VH2A 4FUQA 4H16A 1G66A 4LTMA 4DY6A 4LK3A 4PE5B 3J81k 3RV4A 5J4YA 4D8UA 4WKGA 3NNDA 5FTMA 4CM9D 2D74A 2YMPA 2D7DA 3HK2A 3EGIA 3D8SA 3HCCA 3Q41A 4RD1A 3VRHA 3K35A 3SXPA 1R6AA 1NC3A 1RKQA 2PMFA 1M5RA 2JIBA 1O95D 4IIUA 3WOHA 1I30A 2QRJA 3QKSB 2G9QA 1L4NA 3KJNA 2TSYB 4HBGA 3TFQA 1UKBA 1I5RA 2BISA 2E85A 2HL6A 3CRZA 1HDGO 5HS6A 1YBFA 5A9TA 4F3KA 5DN6D 4J9VA 5KNBA 3ISVA 5A7GA 4CMHA 2QLTA 3W8FA 5ALGA 3EGDA 2HSZA 1ONSA 2HTFA 4O08A 1YDMA 4DADA 4DFDA 2FUEA 4MLDA 4D6PA 5JNTA 1C8KA 1T26A 1F2UA 1SA0A 4PHFA 3WDSA 1QE5A 2O06A 1OXXK 4O1MA 3Q5GA 2C42A 4GOMD 3ZBTA 2HMAA 3ZYZA 1OLOA 2BBSA 4YJ2B 3GEEA 4Q16A 3PHIA 4FEEA 2PUCA 4JP1A 1FNMA 3GAMA 4B3SB 4LTNA 1XZHA 4TV8F 1YOBA 4LSZA 4GOKA 3NBYC 3SBOA 1EINA 2IRWA 1UDXA 1YU6A 4UASA 5FWNA 3HSKA 2H4JA 1YRQA 2QVZX 4XRRA 2A4MA 2P9QA 1OC2A 2W2LA 2OD9A 1Q7BA 2WFLB 3LXMA 4HRYA 1A04A 3DZ8A 2A1TS 5I8ZA 3LT4A 1ISHA 4P7JA 4KO1S 4PNHA 3QXHA 5B3JA 2HQBA 2IKSA 3TI9A 2AC7A 1AY0A 3TLXA 5EHXA 3TDNA 3OZSA 1IHXA 4MGYR 2CHQA 1PNOA 3AETA 2PZAA 4WY8A 2VL7A 2ZRLA 3E7FA 4DRZA 4PX3A 5E38A 5BUZA 2X7XA 4PICA 4ZDWA 1Q1GA 4G9BA 2OO3A 5U9CA 3K0SA 2CJYA 4GVXA 4BVJA 1Q0LA 3PFNA 3ZPXA 4BV8A 4R5MA 3DVRX 1ECLA 3INGA 1WZNA 2JS7A 4BQEA 5FBZA 5DHPA 5JLAA 3PQEA 3UK6A 1OAAA 1TEVA 2TMGA 4MHTA 4TT3D 5KYWB 3AI1A 2YWEA 4C6RA 3MCAA 4C4PA 5BSKA 1RR6A 1O96B 3EQ2A 4NZOA 5L95A 1PJZA 1VZ3A 1GCUA 3DE0X 1ESDA 2BKVA 3SZLA 2J46A 3AINA 4IRXA 4EYKA 3RRJA 3AH8A 2PX2A 3RRNA 1N0IA 3PU6A 5JDCC 5LR6A 5HNKA 3C8MA 1LX7A 3NM6B 2AWNA 4F4HA 3JPYA 1VG1A 2Y92A 5EOVA 1O8CA 4J43A 3U62A 1XZPA 4IINA 2JHGA 3OJWA 2I78A 3EEBA 4YRRA 5TPZD 3NBMA 4LF7B 4JI0B 3ESCA 1GD1O 5CGQB 3BHNA 2QZJA 1RI5A 1EFVB 4HEA6 5TEVA 4B2LA 1KQFA 1CUJA 2ONCA 1XWIA 3BGDA 3RBXA 5DNEA 3FIJA 3CUVA 1QFJA 3HWX1 1UWKA 4YMIA 3ZD8A 2G5TA 3H2IA 3QE3A 4G0XA 1F60A 2RKBA 3E0QA 5AJHA 2P2NA 3IR7A 4LNAA 4M54A 3AVVA 5ILQA 5AJUA 5KO2A 1XYGA 5IK2D 4OFZA 5BPHA 4E51A 3HTXA 1SQ5A 2YWRA 4KX3A 1BH2A 1HFWA 3B48A 4JEUA 5E3IA 1R0SA 4CHTA 5MDHA 2EVWX 2Z6AA 5BN3A 4RZ3A 2VWHA 3AW8A 4LFBB 3NPMA 3ZEIA 1F8UA 3LVFO 4AU1A 1W75A 3OQHA 3OQIB 3WNBA 2A14A 1ML3A 1XIVA 3EFEA 4AT1A 4ITVA 4E5VA 1Z8DA 5IJAA 4H1VA 4X1IB 3ZWKA 3MMSA 2QW1A 2WJAA 1XQXA 1QPGA 2ZGVA 1PZGA 1YCFA 2VA8A 3HFGA 4QL3A 4Y98A 3RC2A 1EESA 3ASZA 2GK7A 4LWPA 4J0EA 2PUJA 2PMBA 3PKJA 4FZJA 4DV3B 5MFZA 2CLLB 3C4JA 1J06A 2BGJA 4XUCA 3CLUD 3SX0A 2JCYA 1L5RA 2PGLA 2VZ8A 4KXMA 4NAHA 2UXBB 1Y1KE 1H69A 1NQ5A 5IYZA 1WCWA 3H42B 4N7BA 1NNSA 1CJBA 2O48X 3GNQA 4DQUA 3QBDA 2P11A 4KXXA 1IRXA 1YMVA 2VHEA 1EDOA 1P5HA 2V9ZA 2GEUA 4CMCA 1OIXA 3B9QA 3MJ4A 1IDN1 3PPYA 4YUZA 1UT8A