3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
3CPJB 4LPSA 3R7WA 1UADA 4N0EA 5AJWA 4JLDA 2V9PA 2OFXA 3LV8A 4URUR 2OO7A 3AVUA 1LFDB 2C5LA 2GF9A 2YINC 3KJIA 3ZJYA 1FW6A 4J0QA 4I1UA 5H68A 2C8VA 4G01B 1YHNA 1TUIA 1HTWA 2WJGA 2Z0MA 2FEMA 3LXRA 1OFHA 3CZPA 4XWKA 1G5TA 2J3EA 4N1AA 4NE2A 5DYIA 2G9NA 5FOTA 4R98A 3W90A 4GRAA 5IK2D 5EZ5A 4DSOA 2Q3MA 4B6EA 1BH2A 1NNEA 4DRZA 2BCGY 5FI1B 1P2VA 4A8JB 4C0SA 4DXAA 1TL7C 1T3SA 2HXSA 4GBMA 2ZRJA 4Q21A 1UKVY 4IW3B 4FMDF 4IEEA 2BM0A 1OF1A 2YNMA 1NLZA 2W6JA 4L8GA 2QMOA 4C0AC 1FP6A 2PX3A 3SYNA 1OH7A 1U9IC 3T5GA 3EIQA 4Q4AB 2DB3A 5EJEA 1CU1A 1VYTA 4RKFA 5SZJA 3SHFA 3EPKA 1IN8A 5IDVA 4ZCIA 3U44B 2KBFA 4GI7A 1W0KA 5D3MA 2CK3D 4B3DA 4HAXA 3TGPA 3LBHA 1VHLA 1D6JA 3VNUA 4JLOA 4DSNA 2ERYA 4BQSA 3C41J 1E79A 1JR6A 2D06A 5DHAA 3PEYA 3ZIAD 3JZMA 1JBKA 4A2PA 2XNDA 2JASA 3UXMA 2ZANA 4Z1MA 4MYHA 4AG5A 4AKIA 4ARZB 2FNAA 2FSIA 3TVTA 3P27A 1KSHA 5BN4A 3K9LA 1P2TA 3QPUA 5B2ZA 3QXSA 1F48A 3RVBA 1T5IA 5JI2E 2BMJA 4LHXA 1H8HD 2R65A 3WP1B 4DIEA 4DUGA 2IF2A 2HYIC 4NKRA 1SVSA 3GFTA 1WBDA 4KBFA 2NGRA 2QG6A 3BBPA 3RANA 1P61B 3NBYC 3OIUA 1UBGA 3LY5A 1NMYA 3NHBA 4MYTA 1Z6YA 4PPNA 4O0MA 4PR0A 2YWHA 3VR3A 2PX0A 3ZVMA 1FPMA 1UDWA 3K1JA 4M21A 5HTKA 1QHNA 4BEBA 2ZI7A 1G16A 4LX0A 1KI9A 1GNQA 2JJ1D 4V0OA 4EKDA 4JJKA 3R8FA 5K8IA 4JLJA 1BYUA 5UKDA 1YR9A 2QTVB 2CE2X 2E9SA 4S35A 2J0SA 3I5XA 3I32A 4P31A 2F9LA 2A5GA 2CHQA 3H2YA 1Q0UA 3A8TA 4CEJB 1LF5A 2IYZA 3LO5A 2NZJA 5FOUA 1KMHA 5H8WA 4RD3A 4X8LA 5DLQC 1J7KA 3LVQE 4BASA 3ZDQA 4OBEA 2KSQA 2V7QA 2Z6VA 4AWXA 1E69A 2OBNA 3CNOA 2J0VA 3U2QA 4O2LA 1OLOA 3RS5A 2QORA 1EFRD 5E95A 2NOAA 4A2WA 2KI5A 1Z47A 2FMXA 2ZRNA 4LBZA 5AUQA 1JQLB 2IK8A 3A4NA 4D0NA 3ASYA 1KAGA 2OLJA 2QMUA 2IYSA 2FJUA 4GOJA 4M1OA 4M1TA 4S2EA 1GL6A 1GL9B 4UJ5A 2I3BA 3ZGXA 4DLUA 1CJKC 5DN6D 1PJRA 2ZS9A 3MWYW 1G5PA 2V8OA 3K9HA 1A5TA 1FFHA 1KI3A 2BBOA 3SI7A 4CDGA 3SEAA 1NLFA 2BMEA 3MJRA 4KSCA 1ZIOA 2BEJA 2YWFA 2H16A 3R8CA 4LWZA 2QMEA 3DKPA 3TAHA 1OT3A 2GETA 3ZQJA 1NMXA 2ZITA 4KFRA 1C4OA 4HDCA 3KTAA 1Q12A 4U02A 2CCJA 2B8WA 5FL7D 2GCOA 2AWOA 4OQNA 2D3WA 4AYTA 4XH9B 2NG1A 4BLOA 5LDDC 4ABYA 2ZRGA 4NYIR 3U6BA 1JR3E 1S4QA 2MMGA 2V1XA 4HZUA 4IXNA 2W2VA 1ZU4A 3EA0A 1E2NA 5CLQA 1D2MA 3JVVA 1W44A 1UJ2A 2B6HA 2EQBA 4ACBA 1G19A 4ZV4A 2QP3A 3R9XA 2EVWX 2QAGC 2YC2C 1N0UA 3PENA 1NI3A 2RGNA 4EQ6B 4DKXA 2WSMA 3TW4A 1XF9A 1YZNA 2PH1A 2YZ2A 5A0FA 3VHXA 1TQ6A 2QUZA 4F7WA 2WHXA 3GLGA 5BQ5A 1YE8A 2A3RA 1CTQA 1R4AA 2C04A 5DYGA 5FR1A 3PUZA 4US0R 1GRQA 4PQFA 2G3YA 1ZINA 2ZPTX 3S1AB 2GEDA 3LNCA 3QPVA 4JL8A 3PXGA 1Z6GA 2O8BB 2OHFA 4GMDA 3WMEA 2IWRA 1QHYA 121PA 2EW1A 5EP2A 3D7MA 2NZ8A 4Q1FA 1E99A 4P3YA 3WRXC 4FD2A 1NVVR 2OFOA 2ZE8A 2QP4A 3BE4A 5JWOA 3M1IA 2C77A 3LXXA 1RJ9A 4V03A 4ESHA 3AP2A 1IBRA 3QKSA 1YZLA 2XZOA 2OE2A 3AF0A 3PG5A 1RPZA 1WCV1 3GLHA 4C2TA 1NY5A 1DARA 3BERA 5J4VA 2J9RA 5JS7A 5BXQC 3AKCA 5TB5A 1GNPA 1W4AA 2Z43A 3C8UA 3KKQA 4LYAA 1E96A 3Q85A 4TT3D 4HAUA 3IILA 5LB2A 4AURA 2QAGB 5P21A 4KO8A 1R8QA 1OPXA 2OXRA 4Q9HA 4R2HA 3RS7A 3T06B 1HYQA 5JCPA 5GJCA 1HA3A 3UMSA 3DVLA 3NH9A 3GJ8A 1PUIA 1US8A 4GZMA 4FMBB 3TR5A 1GITA 3RWMB 4QBHA 4A4DA 4EPXA 2JLZA 2ZS7A 2BJWA 3EC2A 1GAJA 2OCAA 5LD2C 2J87A 1OB5A 3AP1A 1IN7A 4B3FX 1EGAA 2JEOA 4A0FA 4LJ9A 3E2IA 4H1VA 4YLGA 4UJ3A 2ORIA 2J7PD 5HCIA 1N5KA 3ZD7A 3EW9A 3K0CC 4PC6A 5L8VA 2ZQ5A 4FCWA 3RRNA 2VF8A 3GLIA 1CR0A 4DJTA 1VG0B 2YV5A 2C9CA 2N42A 1YKSA 2WAXA 3EAQA 3DMDA 3FPAA 3QOFA 4MYUA 1KSGA 2B21A 2ZIAA 1CLUA 2JLWA 4RZ3A 1ZC4A 3V9PA 1VKJA 1XB2A 1HE1C 5KSOA 5HE9A 2GILA 2IUTA 2D74A 2CLDX 1D5CA 4XJXA 2BVNA 3BB3A 3IIJA 4KLZA 4KV9A 3T15A 5KSYA 2D7CA 2HCJB 3T34A 5EXXA 1BS1A 1O87A 3B13B 4FMCB 3IUYA 1M1YE 4Q5IA 1UPTA 5TV2A 4PSAA 3RYTC 1XDBA 2ZJOA 1NJGA 4HB2A 1GTVA 3VR2A 1GNRA 4Q02A 1FNNA 3B1YA 1VG9B 3QQ5A 5BN5A 5KU1A 3GPLA 3I5YA 4MDFA 2ZRHA 1BKDR 4JL5A 2ODBA 4DCTA 2BJVA 1M7HA 2DHRA 2R6FA 4UKDA 3PV0A 2OUKA 2YWEA 4B34A 4TSFA 2O8EA 1XP8A 4K46A 1UEIA 4DT1B 3OIYA 3W5IA 2IT1A 3ZQ6A 1NG9A 4JLNA 3CM0A 4RD2A 4ZIRB 2CVHA 2AXPA 2NO0A 3OIVA 1F2UA 4RZUA 4I99A 3VKWA 3VR1A 4QBIA 4A15A 4TZ0A 1SVWA 2R62A 5DGXA 1E2KA 3BH0A 4OI2A 1ZM2A 2FSGA 3KXKA 2YHSA 3KXIA 3A4MA 1W0KD 2ZSFA 3KKMA 3LLMA 3PEVA 3QUSA 3REGA 1E2DA 2ONKA 2JDIA 1NN3A 3IO3A 1ZBDA 3EZ9A 3FDIA 2A2ZA 4XOIA 5KOYA 3B7GA 2PMKA 2V6IA 3F8TA 2BBTA 1ZD1A 3DDCA 3SE0A 2ZXUA 3REFA 1WXQA 3TW8B 4Z1MD 3KQLA 3M0EA 1W2HA 3U7HB 5G53C 1II8B 3WMGA 1RYFA 3PITA 2J5XA 3FFBA 5FBVB 3DZDA 5KSPA 2WJYA 3ETLA 3QF7A 2WSSD 1LTQA 5L3RA 1E0KA 2WZQA 2O8DB 3B85A 1IY0A 2VTKA 1S96A 1RKBA 1SXJB 2C95A 2WKQA 1FQKA 4DUGD 1RE0A 3I3SR 3K0FA 4B3XA 3X1XA 4A82A 1HV8A 5L3SB 4Q4JA 1XCGB 4HDQB 4H1UA 4CEIB 3CKLA 3SJCA 4EFMA 4Q4LA 5CK5A 1R5BA 5JEDA 4PPFA 2ZM5A 5L3QB 2QRNA 2YYZA 4Q1AA 3JVUA 2AN9A 4FWIB 3AV0B 2LCFA 5IRCD 1XJCA 2FEOA 4Z51A 4M1KA 4W5WA 2C96A 1KO4A 4R9UC 1TX4B 1OXVA 2PMDA 1BYIA 3LRPA 3DKVA 2I1QA 5EXPA 1RRGA 4RCYA 3QF4B 1HH4A 2NO9A 4G1UC 3RRZA 3T12A 1W36B 2F1JA 2DY1A 1YQTA 2FFBA 1CRQA 1Y63A 2UKDA 3OZXA 4Q4HA 1V5WA 5FUYA 2DCUA 2F1RA 2YVUA 1EX6A 1R10A 3UMFA 1M2OB 2GJSA 1W48A 1KDOA 4D4KA 1DAMA 2D62A 2V7QD 2GXUA 3WHKA 4B75A 1N6PA 2ATVA 4HATA 4ACAA 3SFVA 4QGHA 2A5FA 1D8TA 3OEHA 2KWIA 2J0UA 2WWGA 1QG4A 2AD5A 2X77A 3CONA 4FN5A 4G5SA 1TADA 3IHWA 4BZXA 1WE2A 3SS8A 2CBZA 5IT5A 3THXB 4ZI2A 4BFXA 3VHLB 1E2IA 1KHTA 4JYCA 1KI4A 5AK0A 3KX2A 1G4UR 1R7RA 2BBWA 1Q1BA 1CKEA 3A1UA 3R9WA 2F7SA 5DO9A 1P9NA 5KPJA 4TMWA 2Q9BA 3ZH9B 4DCVA 3N70A 4URXR 1Z0DA 2F6RA 1JJVA 1NG1A 5F9FA 1R5OA 2RGAA 3EZFA 4AK9A 1YZKA 2Q6TA 1AK2A 4P4SA 4PSKA 2H57A 1VIYA 2R9VA 2FPKA 3BS4A 3NDPA 3ZD6A 1E0AA 4TTPA 2CHGA 3VKHA 2J41A 3I72A 3ZZ0A 2VBCA 4LGMA 3FVQA 2E87A 1KI6B 4C0HA 2IF0A 2ZR0A 2DWQA 1GZSA 3BC1A 4QOSA 4C7OA 3KJHA 3TKLA 3EC1A 1PZNA 5M04A 1E2JA 3PR1A 2A5YB 4IFBA 4IVQA 4YMVA 1L7VC 3CF0A 5C46F 2VSOA 1GKYA 1KMQA 4PO9A 3QSYA 4QFMA 3VR4A 2WJVA 1Q44A 3QKRA 5EE1A 5G40A 2V54A 1UKYA 1KDRA 1HEIA 3AM1A 1XTJA 2GK6A 1VDZA 2HV8A 2FPLA 1BIFA 2PJZA 2P0EA 4KBGA 2HT6A 3CO5A 4LHWA 4N0DA 1S3SA 3ZLJA 3R20A 4LV6A 1OH8A 3L0IB 3RAPR 3TQCA 1M6NA 4DLRA 5EZ6B 4ZDIA 1E1QA 2GRJA 4GDFA 2HF9A 2WJHA 2REBA 3M4YA 2OILA 5EE0A 3IEUA 4BEJA 1XPOA 3LFUA 4QHTA 1XJ0A 1XTRA 4LYJA 1XBTA 2F3RA 4TWZA 1K5DA 2QSZA 5G41A 3WRYC 2GJKA 1DELA 1Z07A 2IYUA 4NU0A 4O25A 5DH9A 4HI0E 4EIWA 4EJSB 2ZI9A 3K53A 1FP7A 1W4CA 1RRCA 2V4ZA 1A7JA 4XVRA 1OKKA 5AJYA 2VEDA 3RNLA 3AVQA 3I4LA 1U90A 4IOMA 3DPUA 2RKOA 3ZVNA 4XIGS 5L3VA 4IOKA 1XEFA 4PHHA 1G64A 4M22A 1KK0A 1IN5A 5AWFC 1Z29A 3SDZA 3A36A 2IHBA 4G5QA 3D8BA 4ZO4A 4NL4H 2QAJA 1KO5A 3NWJA 4AI6A 4CT4B 1G5RA 3IPYA 1F5NA 1WBBA 3LX5A 1QRAA 4BZPA 1ZNZA 2IXFA 1P2SA 2VP2A 4RD1A 3FMOB 1Z8FA 2DFTA 4OK3A 3B5JA 1NKSA 3O8BA 5AJZA 1NLYA 5AUPB 1FNMA 3WBJA 1XEXB 5KHOC 4PPGA 3I8SA 1A2BA 3RWOA 1L2TA 2GAOA 5F2EA 1D2NA 2VHCA 1KJWA 4Q47A 3WNDA 2ZRIA 4LK2A 1OFTA 2ZI4A 1HQCA 1EWRA 4ZDJA 3RLFA 3L0OA 1ZMXA 4KU4A 3TVDA 5FBRB 1RVDA 4XTRA 3ZYCA 3TSOA 1D9ZA 5JSZB 4PC1A 2A30A 3BH6A 3EIEA 3RC8A 1SKQA 3A1SA 3KKNA 3EG5A 4DLXA 2Q9AA 3LW7A 2O8CB 2BV3A 2IHYA 5CB6A 1LVGA 1F2TB 4EPTA 2GJ9A 1U2RA 4HEJA 4PFSA 4ASUA 4C0KA 3DMNA 2FF7A 3T1QA 4XD7A 3CH5A 3TMKA 3GFPA 1E2QA 2ODNA 4JKYA 4NYMR 3GJ5A 4IFEA 2JLUA 4G3XA 3U4QB 3VAAA 4WOPA 2Q0HA 1QZXA 3GJXC 3C16C 4WIAA 5GJWC 2ZRFA 3WHLA 4DDUA 1Q1EA 3CWZA 4IDHA 1SKYB 2RAPA 2N46A 2RMKA 4TSFD 5FPYA 3OE7D 1KJZA 3MWKA 2RGEA 5J4KA 3THYB 4Q00A 3I62A 4B73A 1OIVA 2DYKA 4V0MA 1W4RA 4JLAA 5TXGA 1VIAA 2IYWA 5DI3B 1KKMA 1UDXA 2IYQA 1QDEA 5J4HA 4DDWA 1NSTA 1XD2B 1PLLA 2EWWA 4BFTA 4KLNA 3RRMA 2OCYC 4JVNA 1G3QA 1G7TA 3RC3A 1AGRA 5GVRA 1ANKA 1K5GA 5GJVC 4TTQA 2JDID 4G5OA 3WY9A 5JBQA 1T0JB 1RZ3A 3FWYA 4UXHA 5FPKA 3Q7QA 4C9BA 4QL3A 4NBSA 2X2FA 1UAAA 1JI0A 5AUNB 1X6VA 2O0HA 2QNRA 3QVUA 4MDEA 1U0LA 2WIAA 2P67A 4BZQA 1NMZA 5FUWA 2VYFA 3IIMA 1XZQA 3OFNA 3MSXA 5FBWB 4US2R 3BJIC 4IOJA 5FTJA 2QROA 4F38A 2Q21A 4OHZA 1DO2A 2W83A 2NO6A 1G3RA 2KBEA 3DOEA 4FCTA 3RDPA 3BK7A 3GQBA 3BORA 2OESA 3NH6A 4PO1A 2UZIR 1UBFA 1XMSA 4X8OA 2QT1A 1NBMA 4AKGA 4XVQA 4BRWA 4D0GA 1Z83A 2VP9A 2GZDA 1G8YA 3IPXA 2OEPA 4B2LA 5A5GA 3VNVA 1BMFA 3VX3A 3CRQA 1EG7A 4TLDA 2FSHA 2FFAA 1G17A 3CF2A 5D3MB 2L0XA 3BIFA 4ERNA 2FU5C 4A8JA 4XWAA 5LBIA 3ZZUA 2ZJAA 2C98A 4KVAA 5EP3A 2XXAB 2AHOA 2QBYB 3AVWA 3K8YA 3GJ7A 4DVGA 5JJKA 3CZQA 5CB8A 1CF4A 1VCNA 3PIRA 2AKAB 2ZRMA 4PTLA 2EFDB 4Q66C 4EPRA 4PPQA 5C4MA 3AVPA 2CHVA 2AFIE 3K09A 3QIAA 2HLDA 1W5SA 4Q4AA 1SVIA 3K70C 2V6JA 4CT5A 2IL1A 3U3OA 4QM6A 1SVMA 4F4IA 3B1ZA 3IBYA 2VHQA 4TLAA 3M6AA 5G3ZA 1MRNA 4I81A 3U44A 2GKSA 1X8LA 2FN4A 4A0RA 4FWTA 2EFGA 1KIMA 4Q48A 2YOHA 3CRMA 3ONWA 3MG9A 3OEHD 3X2SA 5HZHA 3P32A 5DSZA 1Z6TA 2WOOA 5CM8B 1YR7A 1VCMA 4QJ4A 1EFTA 4LV8B 1FX0B 4IKEA 1E9EA 2GBLA 5JRJA 1DAKA 1YVDA 4PSVA 2ZEJA 3IQXA 4C0JA 4B32A 3QE0A 4LBVA 1GFIA 3TRFA 1LW7A 2F1HA 4B3GA 1FZQA 2WWWA 5E3HA 5IF9A 1KY3A 2ECKA 1YZTA 2H8KA 4NCKA 1QF9A 1KNQA 1UF9A 3FTQA 3MWJA 4WA7A 2WMNB 1A4RA 3C7KA 2FGKA 4JS0A 1FMLA 4YMWA 1JB1A 1TQ4A 4K8OA 1ZUHA 1UKEA 1ESNA 4OHWA 4NTZA 3VFDA 3PQCA 2XZLA 3A6PC 1W7AA 1M7GA 2RGNC 1HT2E 3CRW1 1VYUA 2XB4A 3X1ZA 5CDFE 4BE7B 3GJ6A 1P4SA 3W3AA 4QGGA 4M9XA 3PVSA 3DOFA 4KFSA 3AQ4A 5GVSA 2XX3A 2F43A 4PANA 2QA5A 3KJEA 2GXQA 2OM2A 4E5UA 4KFTA 2ZU0C 1MOZA 1M74A 3F5FA 2QENA 4NCNA 4CEJA 1TU3A 1NVWQ 1GM5A 2WKRA 2WPDA 2ZRAA 2D4HA 4MRSA 3O8CA 5JJLA 1ZU5A 4M9ZA 4NHOA 1GILA 1G3MA 1S2MA 4URYR 1XZPA 2C2HA 2CVFA 2GJ8A 4QBGB 5C4GB 5EXTA 4C0QC 3FOZA 3IEVA 3MMPA 2B8TA 4DCNA 3THOA 3HU3A 4IVPA 3FHTA 4U7DA 3I61A 4C2UA 4LJAA 2GCOB 2OSBA 2DFKB 2ZUCA 3LBNA 4P4TA 1Q21A 2ZVQX 4YDSA 1OKKD 2IYTA 4HZUB 5JECA 3PUVA 4EPVA 2OV2A 1IAQA 4JL6A 2DWPA 1GG2A 1FUKA 3LWNA 4MITA 2FFHA 3K0EA 4R7ZA 4XSHA 3T1TA 4CEHA 3QKUA 4HLUA 1KKLA 1SKYE 2HCBA 2ZJBA 2CJWB 4NDZA 1E9BA 1QVRA 2XJ9A 3OESA 1T6NA 2ZTSA 5FBQB 1U8YA 4DWJA 3AVVA 3DHWC 4M1SA 3CX7A 4HAYA 2QMHA 2NO7A 1DAIA 1GWNA 3B9QA 4LJ8A 1AS3A 1WA5A 4ESVA 1NSFA 1J99A 2GEUA 3HU1A 5J5CA 4WVFA 3Q3JB 1P75A 2F1IA 4GOKA 3ICQB 3WNBA 4M2LA 1UBCA 5KDLA 1T3LA 3KUCA 1MABB 1ZNWA 1OH6A 3ADKA 4OI1A 4LC0A 3ND9A 3BH7A 4F93B 3FHCB 3UANA 4EQ6A 2JLYA 1L4UA 1AKYA 3AF2A 4TL6A 2IYYA 1Y3AA 1S9DA 1ZJ6A 4G0NA 3U7EB 2ZR7A 1DEKA 1K6MA 1X3SA 2DFLA 2FPMA 2F55A 5CLLA 1KY2A 2A5DA 3A58B 4DLYA 2IYLD 4B2IA 3AUXA 3OF5A 2JCSA 4HAVA 1R0YA 1Q1ZA 2G0TA 3TLXA 2O8BA 1Q3TA 3KB2A 4AKEA 2FV8A 1JXMA 3WYFA 2RGGA 4BLRA 4ASUD 5FPHA 3E1SA 4JBYA 2FZLA 1KSJA 2H1LA 4XD7D 4OHVA 4QKQA 3AVTA 1NVXQ 1US8B 3C15C 1UKZA 3CBQA 4EDHA 4OQXA 4YXWA 4ITRC 2OBMA 1R2QA 4L9SA 2B7BA 4M9SA 1KYIA 2GF0A 1NN1A 1W46A 1T3HA 1E9AA 1XTKA 1KSFX 1YZGA 1WP9A 2ORWA 3CR7A 4HAWA 4UXIA 1MO5A 1FUUA 4UNNA 1SVOA 3LQRA 3BAFA 1EX7A 2QQEA 1YRAA 1Z6AA 4IHQA 4Q7MB 5JHGB 3GLIB 1YZQA 1E0JA 3ZVRA 1XMVA 3L8YA 3SJBA 4HSEA 4PZYA 5BYJA 4TMZA 5JS8A 4OK6A 4V0KA 4B33A 4I1OA 1MT0A 2G77B 3SZRA 3KXLA 1SHZA 3SC3A 1CJVC 1SVLA 3DM5A 3OEEA 4PQYA 5KUTA 2ZYUX 5FL3A 1D2EA 4BFSA 1DAHA 1SZPA 3SBDA 3WYAA 1ZYUA 4TLBA 2AKYA 3KZ1E 3G5UA 5LPNA 4JSTA 1J2JA 4BLTA 1A1VA 4HDOB 2NTYC 5HKKA 2AX4A 5FTKA 1R5NA 5CJPA 2SHKA 3UATA 4TMTA 2IYVA 3B1VA 2DPXA 3FB4A 3AGQA 4GNKA 5E7JA 2J0QA 1X1RA 2IXGA 4BUJA 2A78A 3OFND 3CRVA 2XSZA 1TF2A 1JJ7A 2GK7A 3QKTA 4LHZA 5FR2A 3UK6A 1XX6A 4LDJA 5LD2B 2CNWA 5JHHB 1RYHA 2OBLA 1AA9A 4L15A 4DDVA 1VMAA 3TBKA 4Q1BA 3KDSE 4FCVA 5F9HA 5GADl 2XEXA 2QTFA 3GCGA 1N5JA 4XWOA 1W2GA 3W9YA 2W6JD 1EFHA 4HUQB 4M53A 4HYYA 1CP2A 5FI0B 1RW4A 3A1TA 4PAQA 4D4JA 1G7SA 3EZ6A 1BMFD 4LUCA 1KOFA 3SQWA 2ANBA 1ZNYA 1TQ2A 2C03A 2J45A 2ASEA 4LJYA 4WXPA 1S1MA 3AB3A 1R0XA 5EQTA 4DZZA 821PA 5K8UA 2QI9C 1JQJC 3AVXA 1ZM4A 1AKEA 2MSCB 1X1SA 3WNCA 3WP0A 3W5JA 4YMTA 2QU8A 3NTUA 4GZLA 3AH8A 3ASZA 4RY2A 1E79D 1G3UA 2WMOB 2WV9A 1RC8A 5GJBA 1Z6XA 2ZETA 3QG5A 2P3SA 2ZI3A 5FPTA 1OIWA 4B76A 4ZIRA 2XNDD 1LB1B 4JSYA 2QGNA 2HLDD 3THWB 2MMCA 1DAEA 2YJTD 3FKQA 2HT1A 4JVSB 4OI4A 5TDHA 1W5TA 4D0LB 3J81k 3NC0C 3H4MA 2UVQA 2DFNA 1Z0KA 2AD1A 1GOTA 1Q22A 3V00A 1S0UA 1P2UA 2GZAA 4Q4JB 1TU4A 5KSZA 3K0AA 2LKDA 1I4TD 3X1YA 1JEDA 1AQUA 1AS2A 1VG8A 2R6AA 4AKHA 2VQSA 1F3OA 2AR7A 5E4FA 1LNZA 2DWOA 2NPFA 2XTNA 1U81A 5FH9A 4WBSA 4DB2A 1OXSC 4E22A 1CBUA 2PZGA 3EZ7A 1U98A 5EXSA 2EU8A 3B60A 4OI0A 4KYIB 2BHRA 2CE7A 3KFXA 2AL7A 4LRWA 3TNFA 4Q03A 3W6OA 2O8DA 3N2IA 1SXJA 3GLGE 2A5JA 4Q4HB 2QRZA 3H0KA 1J8MF 3CH4B 3HYRA 3MUFA 2W2TA 5K8LA 5L3SA 1EESA 2JLVA 4ON9A 4CEIA 1IN4A 2BCJQ 2OFWA 2W58A 3TK1A 4TYYA 1TF7A 2WWYA 2RGCA 2FOLA 1TUEA 4QNRA 3RABA 3UWKA 1B0UA 1CULC 2R6DA 4JJZA 5JEEA 5L3QA 3PEUA 3K70D 3P4XA 4QC2A 3FYHA 2OCPA 1XD8A 1TAGA 3QG1A 4DIDA 5KTYA 4M9QA 1N6HA 3HR8A 1Z63A 1E1RA 1RRFA 1VPLA 2P65A 2Z4SA 2ZSDA 5JI3E 1IY1A 4CW7A 4L5BA 4IDQA 4OHYA 3QF4A 3GLHE 2WKPA 1COWA 3ZIAA 4GMXA 5SZHB 4FMDB 5KDOA 1FTSA 1YR8A 3U3MA 5B64A 2J7KA 3GEHA 1YU9A 1ZM9A 1KK1A 1OHHA 2WPDD 3A37A 3B78A 1M34E 4I1SA 2HUPA 3DO6A 5D3QA 4BLPA 4WZAE 3EPHA 2RGDA 2P2LA 5H1YA 1Z22A 3CF6R 3QXCA 4RZXA 4UQOA 1NP6A 3BOSA 4LJ7A 5G3YA 4EFLA 2Z83A 1YZUA 4ZCLA 1G7RA 2FSFA 4TL8A 1J70A 3PCRB 1DOAA 2FWRA 1OE0A 5FOVA 3H86A 4GSYA 4OJKA 3G0HA 4Q7LA 1G21E 4HB0A 5KPDA 3LX8A 2QTHA 1S8FA 4C30A 1NL3A 5JMTA 3U3KA 1SGWA 2FX3A 1JPJA 4NCIA 4LHYA 1E9FA 4Q9JA 4B35A 2GCNA 2P6NA 2Q3HA 2VP6A 2ZYVX 2WWFA 2WWIA 3GLIE 4Q9LA 2QN6A 1N3BA 2YOGA 5CIWA 3UKDA 5FTLA 3EPLA 1KDPA 3NG1A 4LJ6A 3CWQA 3AKEA 4UNRA 1Z2AA 2ZR9A 2EYQA 3V4FA 1Q57A 4GOXA 4MA4A 4NH0A 5DNYB 2G0NA 3FMFA 1KI6A 3L0SA 3EX7C 3GEEA 4YQFA 4DB4A 5BWMA 3MFYA 4D82A 3ZZTA 1W1WA 3TUZC 3FKSA 4NP6A 3CUEF 1GP2A 1O3YA 4F91B 3HDTA 2LKCA 4TL9A 1G6HA 2WVJA 4O2RA 1AN0A 3U6KA 3U7GA 4PZZA 4RZ2A 4B43A 1LS6A 2D2EA 2QPOA 1AQYA 3PJRA 4Y0AA 3EXAA 4MUAA 4BFYA 1XPRA 1DO0A 5IHPA 5J47A 3K9GA 4Q7KA 1G291 4A0GA 3EZ2A 1AGPA 2XAUA 4JYBA 2RH5A 2ZRPA 4II7A 4NZYA 2GHIA 3T61A 2QZ4A 3GP8A 2IW3A 3LH5A 4I1VA 1TPZA 2REXB 4PAMA 2QY9A 4MGYR 4JBWA 1Z2CA 2XITA 2ZJ5A 4JKIA 3UIEA 3RS3A 4A2QA 2BIFA 3L82B 3LW8A 4QM7A 4M1YA 2CDNA 2OZEA 1N6OA 1XCMA 1LY1A 2FH5B 1XXHB 1TMKA 2OT3B 4NYJQ 4EJSA 5DIFA 3SJZA 4P4UA 4TMKA 4LJ5A 4GPTA 1MO6A 3MD0A 3NHAA 5HE8A 2DR3A 2H18A 4Y0VA 4QNMA 2ZU6A 1OW3B 3B2EA 3SNHA 1IM2A 1GRNA 2Y8EA 4LY6A 5TY0A 2IEYA 1B23P 1DS6A 2ZRLA 2JJ8A 2JLXA 3HP1A 1V43A 1M7BA 2JAQA 4AYXA 4D6PA 3CPEA 2P5SA 3W6PA 4MH0R 2GVDC 3GLFB 3RS2A 4M0LA 2ZAMA 2GXAA 3VKGA 4LCBA 1FL9A 1YRBA 3LA6A 1QHHA 3SJAA 3OIWA 1G3IA 4AD8A 1X8JA 5CYOA 1TNDA 1HY3A 4I4LA 3OEED 3U61B 4TYQA 4PHGA 4JT4A 2HJGA 4C3ZA 2C99A 1E2MA 4OQLA 5KYKA 4PC7A 4AG6A 4EFNA 2J59A 2W00A 2O8FB 4D26A 3NBFA 1A82A 5TMPA 3SFZA 1QBKC 4YMUA 1E9CA 2C78A 3Q8XB 1ZNXA 2ZSEA 2HYDA 5HKKD 1Z0IA 2N1BA 5CDFA 2W2XA 3QEJA 4KITB 4A1FA 4B6FA 3U7FB 2WWHA 1IHUA 1JEEA 4W5HA 5EE5B 3F0TA 2IA5A 1OJLA 2XSZD 3I8XA 4JLBA 2ZVPX 2UZ3A 1XEWY 3O8DA 3QENA 5FPSA 3GD7A 4KHZA 1G8FA 3N5CA 1II9A 4ZDWA 2CNWD 1N25A 1P5ZB 4TN1A 1EXMA 2AXNA 2ZE6A 2KE5A 3VU9B 1VCOA 2WBLC 4LJ4A 4C0BA 3EWAA 2IXEA 2O52A 4M1WA 1T4GA 4BLQA 4ZPXA 4RCZA 1ZUIA 2REOA 3UPUA 3BFKA 2GEVA 2GTPA 2AWNA 4W9MC 1VECA 3H84A 1XRJA 421PA 3R7WB 3B1XA 1Q1QA 1QHXA 1T5LA 4RFSA 2BOVA 4K81B 4A8JC 3U4QA 4AY2A 4ZKEA 4GFDA 4R71A 3GEIA 4F4JA 2GAAA 4URZR 1N6NA 3FMPB 1OIXA 1QHIA 1JR3A 2CLSA 1U99A 2QGZA 2QPAA 2ZSAA 2VLIA 1GRRA 2CCKA 1GKUB 3A1WA 4JVMA 1Z08A 1XMJA 2OCBA 4QBFA 4MRVA 4BPBA 3VTKA 3K09C 3CNNA 4TMVA 1XEWX 1AM4D 1NVUQ 3HJNA 3THYA 2VHTA 3HYTA 1OYYA 4PC3A 3SR0A 3D31A 4M8NE 2WOJA 2IX3A 3KL4A 4A36A 4CRWB 1Q3HA 5DI3A 4OYHA 4DLZA 4RSGA 1XU4A 1XD2A 1ZP6A 3QXHA 4P32A 4Z54A 1CS4C 1I2DA 2OAQ1 4OJQA 2ATXA 3KFVA 4KFUA 3PFIA 1DE0A 4TL7A 3LDAA 5FTMA 3RS4A 3KQUA 4V0LA 1ZM3A 2GBLC 1R0WA 2EFCB 3D3QA 4IDNA 5EP4A 3KQNA 2ONJA 1N2CE 2XZPA 4B3CA 1WRBA 2ZJZA 3DM9B 4O3MA 4W7SA 2RHDA 2B7CA 3Q72A 2WJJA 4CGZA 3TAUA 1J8YF 4LZZA 4V0NA 4JLMA 4LYHA 4OL0A 1C1YA 2QQ0A 1NRJB 4PHTA 1G6OA 1OB2A 2H17A 4IDPA 1N0WA 3AF1A 3SQXA 1NIJA 5DHFA 1IJEA 1SXJD 3UMRA 1G1MA 4DBLC 4B48A 2BKEA 3AUYA 3BD9A 4KCGA 2W0SA 2I4IA 4NCJA 4XSGA 3G82C 3CPHA 2VP0A 3ADCA 4D2IA 1RFLA 4D4MA 1ZAKA 2IBMA 2Z5FA 3PUWA 3TR0A 2PT7A 2QM7A 2ZJ8A 4HB3A 5E7MA 2IWHA 3U3JA 3EPJA 2JGNA 1PLKA 1MV5A 3WYGA 2ORVA 5EUMA 2ZREA 3UWOA 4BWYA 4PC2A 3QJYA 2DBYA 1FMJA 4HAZA 4FIDA 1ZUNB 4B47A 1E1RD 5F98A 1AS0A 1AJEA 2XXAA 2B92A 4DHEA 2QBYA 1KI1A 1XNJA 1DTSA 1QHGA 1W49A 1ZW6A 2ZS8A 4KVGA 4G5GA 4UNQA 1PV4A 1COWD 1N0VC 1OSNA 4NPHA 1QHSA 2ODWA 1W36D 1H8EA 1ONBA 4LV5B 4IEIA 1NY6A 2ZJ2A 1CEEA 2GA8A 2R2AA 3CX6A 4ARZA 1OHHD 1NN0A 1E94E 3W3ZB 2BC9A 2WSSA 3QBVA 4Q9IA 4XTCS 4B71A 3QPWA 1GKIA 2QP9X 3B6EA 5AJVB 5JCZA 1L8QA 1G41A 2ZROA 1TTTA 3KKOA 5CJ2A 1XJQA 3HR7A 4TZ6A 2GDJA 3ECCA 2WJIA 1G18A 3B82A 2JIZA 1HE8B 3NDBB 3C4JA 3ZS8A 5F3WB 1XXHE 3P26A 4OKSA 1KMHB 2ZI5A 2FE4A 1ZD8A 4Q19A 4RVCA 4WXRA 2XB2A 2GXSA 1U9IA 2IUSA 4QXAA 3GJ3A 4TYNA 3K70B 1FX0A 3F3YA 4TMXA 2BBSA 1ESMA 2ZYTX 3BGWA 1QG2A 4B74A 4HLUC 1EK0A 4LBWA 4URWR 4TQUS 3I73A 5CITA 5E7IA 5JLJA 4ZDKA 5CM9C 5EP1A 2F43B 1L4YA 4FXPA 2GVZC 1P60A 2WM9B 5FOWA 3GLFE 1HT1E 2JLSA 1S9HA 4QRHA 3WBKA 1KI8A 1OYWA 5BW8A 1E4YA 1H65A 3ADBA 2ANCA 3LQQA 4ZI3A 4NYJR 1DAGA 1NIPA 1P62B 3Q5EA 3B8HA 1JPNA 3OAAA 1E3MA 4KYUA 4NCHA 2ERXA 3FKSD 1XTIA 1E1QD 1K8RA 5BN3A 4DC9A 4UNSA 3IBGA 3MCAA 1Z0JA 1N6LA 1OFIA 3NXSA 5CIQA 1SHKA 3KTAB 4CZ2A 1XPUA 3HPQA 3QY0A 5J4LA 1IOZA 3MRSA 1KO8A 1NN5A 2ZE7A 1LS1A 3GFOA 3T35A 5KNDA 2EYUA 5AUOB 4L16A 2BMDA 3RSOA 3LAWA 4DDTA 5H70A 3BRWD 4DLVA 3VMFA 1E9DA 1U0HC 2PLFA 2X8AA 2V55B 1PVOA 2BM1A 2J46A 5A4JA 1E2EA 2MSEB 4CEHB 4PHFA 4IDOA 4IOLA 4Q7JB 2X2EA 3CR8A 2RCNA 3X1WA 721PA 1OH5A 2AK2A 4D25A 2H92A 4DLSA 2VP5A 1GVNB 2C9YA 4Q18A 4LC1A 3SHWA 4MKIA 4L4UA 3QEOA 5TARA 4OK5A 2ZRKA 4V0ME 3IO5A 3GLGB 3SN6A 3D6TB 1A2KC 1ZCBA 4AC9A 2R44A 4MYCA 1F60A 4YDHB 2IS2A 2ZI6A 2G88A 1CR1A 4IJMA 1OXTA 2GZHA 1KO7A 2VSFA 3SYLA 1IY2A 1MKYA 4H9GA 4HUTA 1NF3A 1UFQA 4NONA 4PZLA 2PCLA 2VSXA 4FI3C 2FFQA 2PEZA 4M1MA 5JFGA 4DEXA 2VHUA 3NIBA 4B2PA 4YONB 4OHXA 4EUNA 1CIPA 1II0A 4HB4A 3P1JA 1RJ9B 3QVVA 2IYRA 4HZIA 2CJWA 2WIBA 1N6IA 4GT1A 3QKSB 3TJZA 1CJTC 3TQFA 1TEXA 1Z0FA 5KNBA 2RGXA 4WW0A 3GLHB 4BFZA 5KO2A 1AIPA 4MKFA 4DCUA 4EAQA 4JBXA 2EWVA 4KI0A 1I2MA 4TQ9A 4BFVA 5B57C 2VH5R 1G7CA 1EFUA 3KQKA 2VIIA 1KI7A 3S1AA 3NC1C 4DEYA 1NBME 1UM8A 1ZC3A 4F4CA 3LLUA 8OHMA 1G8PA 1WQ1R 1MABA 2JA1A 2ZUDA 3WMFA 1ZVQA 1UEJA 3L2OB 1CXZA 1E4VA 2K5UA 4X8HA 2GCPA 4US1R 4RD0A 4EPYA 3NBXX 1T91A 3UG6A 3CRRA 4CVNA 2FG5A 2TMKA 3EARA 3SU8A 2ODEA 1P7CA 2XTMA 2JLQA 4QGAA 3QNUA 2VHJA 5DE3A 1IQPA 3KQHA 2HJVA 3FMIA 1OXXK 4P33A 3TSZA 3KUDA 1JAHA 5J4YA 1IJFA 4JLKA 1IXZA 1UBEA 2QAGA 2X1VA 4POAA 1N6RA 1G9XA 1Z5ZA 3FE2A 4D81A 5FTNA 3W6NA 1E0SA 3VR6A 2QM8A 2QE7A 1DAFA 4MKGA 2W0MA 4JMPA 4BGDA 3ZS9A 3R9IA 2VF7A 1JECA 2OAP1 3AF4A 1KAOA 3EASA 2V3CC 1T8UA 4LOAA 3OHMA 5DI9A 4B44A 1E2LA 4MGKR 3CLVA 3L8ZA 3QXXA 1JR3D 1X86B 1U8AA 2FA9A 3AP3A 4Z8YA 1P9WA 2OLKA 5J40A 2YOFA 1E2GA 3LVRE 1F6BA 2XOKA 2GWHA 4LI0A 1Z0AA 3MWLA 2CL6X 3TE6A 4BLSA 1E2PA 1T8TA 2WICA 3BFXA 3EA5A 4D4LA 1IONA 5B30A 5ELXA 5KDDA 3IGFA 2EFHB 2JJ2A 1I4DD 2CEAA 1GDDA 1KJYA 2HEIA 1W0JA 1CJMA 2XNSA 4PAOA 2O8EB 3TIFA 4M4SA 2G1KA 1P72A 3T1VA 3KB1A 1FTNA 1E9RA 2O5VA 2IUUA 1NBMD 2PEYA 4TTRA 3AF3A 2O0JA 3TUIC 2VO1A 1GL7A 3C5HA 4Q01A 1JALA 1F2UB 2BMFA 3SBEA 2JLRA 1JNYA 1M8PA 4PO8A 2ZRBA 3ADDA 1WDTA 4FINA 1R6BX 4YC7A 4TLEA 1FOEB 1HURA 1U0JA 5FUXA 4HLQB 4OQMA 2C9OA 3C5CA 2OXCA 4CF7A 3W8NA 3FFAA 3W8RA 1DADA 3UG7A 1SXJC 2RHMA 1XWIA 4MGIR 2BDTA 2W6IA 1MH1A 2IEZA 2J1LA 4CIDA 3OE7A 3VQTA 2FDCA 5HZKA 3CW2A 4MGZR 4DT1A 1XTQA 4GP6A 2A9KA 4HUQA 4JVLA 1RRPA 3K0CA 1G4AE 1G8HA 3N2EA 4U00A 2VRWA 2LWIA 4JIMA 2QT0A 1NJFA 1HQYE 1CR4A 1CRPA 2VL7A 5HR5A 1SVKA 3AGPA 3K0FB 2NPIA 5JWHA 3PUYA 1OXUA 3K0AB 4MRRA 5AR1A 1XTSA 3BWDD 1KNXA 1XD9A 3K0SA 1KK2A 4DLTA 3KJGA 1DPFA 1W47A 1W36C 4Q1CA 4B3BA 1P3JA 1KGDA 2CL7X 4EPWA 1E32A 4NYMQ 4UNPA 1H8ED 3E70C 5IK2A 3BXZA 1CR2A 2AK3A 4G5RA 3IKJA 5FOXA 2CL0X 3THWA 3O8RA 1II8A 3CB4A 4MRNA 2NMVA 2QPTA 3SYKA 1N5IA 1IN6A 3NEJA 3L43A 1DG1G 1SQ5A 3QBTA 4WZBE 1DG3A 2JIZD 4LYFA 2IS1A 1ETUA 3I92A 4LHVA 4ZCMA 1ZRHA 1GIAA 1C9KA 4QGFA 2CCGA 5JRZA 2PZFA 1N5LA 4MRPA 4UXJA 1OV4A 4TYWA 6Q21A 3W34A 4QJ5A 2F3TA 2PT5A 4TYPA 2Z4RA 3U5ZB 4C0LA 1YR6A 5AJXA 2CK3A 3IQWA 3QI2A 3AKDA 2PBRA 1XMIA 4YMSA 2J0UB 1KZ7B 4KODA 4MUBA 1KTVA 4FW9A 3HU2A 4MQBA 3CX8A 1EWQA 1GUAA 4CYMA 1S1CA 2E1RA 3EIHA 3HPRA 2GESA 2XGJA 1RIFA 5SZIA 4BECA 2YWGA 3OAAD 3U3RA 4A6XA 3I1FA 1PLJA 2NQ2C 1E9SA 3EWSA 1H8HA 1P73A 2VPPA 4QHYA 3NBZC 4P4SB 5LB4A 1VHTA 3NKVA 1TEVA 4DSTA 3BB4A 4ILEA 4QJ3A 3CNLA 1CJUC 3T5DA 3LBIA 1OFUX 4RFVA 1IXSB 2CMKA 2ZRDA 1NKTA 3FHOA 1R8SA 3THXA 4C7OB 2PL3A 3JZAA 4HLDA 4NMMA 4BRUA 2ZYWX 3AKYA 3E5HA 3NEYA 3NVAA 2JJ1A 1EFCA 2HXYA 1Z06A 3TSWA 2RGBA 4ZKDA 1LF0A 3DL0A 1E98A 2H5EA 2PCJA 3QKRB 2F9MA 4JZKA 1I4LD 1MO4A 2BWJA 5EUQB 4N3NA 1E6CA 4RKEA 4EJSC 3X1DA 2D2FA 4E07A 4D80A 4BFUA 2WAYA 4WZ6A 4Q1DA 4E09A 2ZRCA 4KXFB 1GSIA 3MGCA 2P6UA 4JLVA 2QL6A 3Q9LA 4C4PA 4LPKA 5CK4A 1LV7A 2A7QA 3V4RA 1W4BA 2OG2A 4OQFA 1EFRA 1XCPA 3H1TA 3PEWA 1YJ5A 3ZVLA 4JLPA 3IIKA 2HDNB 4MKHA 4X8MA 3BB1A 4IXMA 5TVKA 2G83A 5FFMA 5DN6A 3K9NA 3KKPA 3VX4A 1TF5A 1JAIA 2IC5A 3O47A 2VP4A 1BOFA 1VTKA 1G8GA 3RSLA 521PA 4HLCA 2WTUA 1BO6A 5C1BA 2KJQA 4PXAA 1XFAA 2AFHE 2R8RA 2RB4A 4KJZA 4Q1EA 3RRYA 4V02A 5C18A 1MR3F 3IDQA 4L9WA 5FUVA 1TQDA 2FGJA 3T1OA 4E03A 1MRSA 5FL7A 1X8KA 5EE9A 1U8ZA 4YXWD 1R0ZA 3GJ4A 1VG1A 1ZCAA 3P20A 3IHLA 4Q9KA 2IYXA 5CYPA 1VYVA 1D9XA 5JWRA 1KDTA 1DVRA 1ELOA 1WF3A 3BFVA 621PA 1KZGB 2ZUBA 3L0PA 4FMCF 1PUJA 3U60B 3AVOA 3AVYA 1HUQA 4QG7A 3TUJC 2H7VA 4JT2A 2R6GA 5C2JB 3GMTA 1FQJA 1QHHB 3Q5DA 4F92B 2HF8A 2QE7D 2ZAOA 2IS4A 2I1VB 1XXHA 5ANRB 4PQRA 4PX9A 3ND8A 2X19A 2XJ4A 4DLWA 5KNCA 2PLRA 1T9HA 3SOPA 1N6KA 2D7DA 4TLCA 1WMSA 1G20E 4XVUA 3MJHA 4P0TA 2JATA 2EFEB 1Q20A 1KO1A 221PA 1XEXA 1IXRC 2XOKD 5JJIA 1ZD9A 1S3GA 1P9RA 5DISB 1KI2A 2YC4C 2YKGA 2KB0A 3GLFA 3MAAC 4R2IA 3A4LA 1ZIPA 4RJLA 1ODFA 3TH5A 2P5TB 1Z28A 2Q3FA 3RS0A 2PZEA 4NYIQ 1P6XA 2FZ4A 5JSZA 4RD6A 2JJ2D 4A92A 4URVR 2NIPA 4GP7A 2IS6A 4TT3A 5HPYB 1SXJE 1W0JD 3B9PA 1ZM7A 4DCSA 3AEZA 3C14C 2WWXA 3DZ8A 2VA8A 4Z8XA 1WB9A 2O8FA 1E2HA 4LSGA 2QEQA 4WAUA 4AYWA 3A1VA 2O8CA 5JZVA 2PJRA 1F2TA 1T0HB 1U94A 2CXXA 5B58C 5FOSA 1AZTA 1KK3A 3CIOA 2ZJYA 4U5XA 4W5JA 1JXOA 4RFSB 4DSUA 5SZKB 1VCIA 2G6BA 4RD4A 3FGNA 4BFWA 1E2FA 4IRUB 4QHSA 1DBSA 4IVRA 3RHFA 2R6CA 2CLCX 4AIIA 1MO3A 5K8TA 2V1UA 4TQAA 3DEFA 2ZSBA 5EE3A 2Q9CA 3GJ0A 4LBYA 2XTZA 2P6RA 4A0HA 2NO1A 1QVAA 3B1WA 3P4YA 2O0KA 4A6PA 3LD9A 2GNOA 2GJAA 2W6ID 1NVVQ 2J7PA 3PUXA 1AZSC 4GL2A 3VU9A 3QXJA 4A9AA 5BYKA 5HCNA 3VR5A 3ICEA 4KSBA 3MLEA 2BEKA 2QSYA 3WXMA 2MSDB 4KAXA 1J90A 2ZE5A 1SULA 3Q7PA 3HWSA 2BKUA 1Z3IX 5FBLB 2G1JA
chains in the Genus database with same CATH superfamily
3CPJB 3PC3A 3EMVA 4LZOA 4N0EA 4B7ZA 3UA3A 5HIAA 5TT1A 4URUR 3LV8A 3OZTA 1LFDB 2C5LA 3FRHA 4BHTA 1OREA 1UH5A 2V5AA 4J49A 1GCOA 4C6SA 4F45A 3AR3A 2VS1A 2FKAA 3AFMA 4J0QA 4N5IX 2K87A 2NW6A 3JQ9A 4O2AA 3BRSA 1J5PA 4DUZB 4M60A 2ASVA 4EGCB 2C2KA 1NTRA 1UWLA 4P3PA 4JK3A 5DP1A 1SA0A 3JWHA 4KLRA 2VAXA 5ICSA 2G9NA 2XR1A 4MMZB 5B1DA 3NHYA 3TX6A 1ZJYA 3EVTA 4JB2A 5EZ5A 2WYIA 3PQ2A 1BH2A 5THKA 4B6EA 3GF4A 1ZHOA 3F7OA 2AUMA 3JVIA 4A8JB 2EAUA 4JUCA 3A2LA 4INOA 4OOFA 1XZBA 1PG0A 4DXDA 1TL7C 3UMBA 1QYXA 5EFZA 1UKVY 1LXCA 1QV6A 1JPUA 2BM0A 3CJRA 3E23A 3FAZA 3R4CA 4EW2A 2QRLA 1NLZA 5DNWA 4MPPA 2QL9A 1TZJA 3IUBA 1FP6A 1XL0A 1CE8B 1HT0A 1U9IC 4EL0A 2H63A 4L0MA 4Q4AB 1TAUA 2X7HA 3IJEB 9MHTA 1NXQA 1NSYA 3IAS6 3L79A 2VTDA 1AMUA 4XD7A 3SKXA 2PPVA 3SHFA 5CDGA 1A97A 1K97A 4AROA 1ZGJA 3EXHA 5EWJA 3RT1A 3VV3A 1MQ8B 1W34A 4A6EA 3PWZA 2F67A 2HMYB 1HEUA 3NGLA 2JKYA 4CMHA 4HAXA 6YASA 1JG3A 4GX5A 3A32A 4KOEC 1VPVA 4OP3A 3R7SA 4RW0A 1PO7A 1TM5E 3KUKA 3R9KA 1E79A 1UT8A 1CZUA 4G84A 4RHCA 4R84A 5K3BA 4W4TA 3ZIAD 3O94A 2PU7A 3JZMA 2XNDA 3UXMA 3Q11A 4AKIA 1U6JA 2CGEA 3DE2X 3M9WA 4BB9A 4EOGA 2AC4A 5KSWB 4M98A 2XQKA 1Z4PX 3EAFA 1WKCA 3TVTA 5B12A 1XAGA 3KB8A 2QX9A 2BTOA 4L28A 1M2KA 2QW1A 3B2NA 3DCJA 3QPUA 4KXXA 3V8NA 1EUCB 1F48A 4ZQIA 4E7OA 4ICIA 3T3IA 4F56A 3HK2A 1GRCA 4LHXA 4U4AA 3D1LA 1H8HD 4DIEA 3WP1B 3FR7A 2GVNA 2WTNA 2IF2A 2M1XA 3AUSA 3RASA 4CV2A 1N5MA 4CM9A 1SVSA 3H5TA 2P40A 5MF6A 2QTLA 1EI9A 1AXEA 5CVDA 1JDBB 4WNIA 1PU2A 3QLVC 3T3HA 3ZV3A 3NBYC 3RSFA 3OIUA 1VL2A 3LY5A 1NMYA 2CV2A 4MYTA 4DDKA 4NBTA 4M0FA 3DFIA 1F0YA 2L82A 4O0MA 3WK9A 2Q3CA 2ZJFA 2YWHA 4OHPA 4AF6A 4DW8A 2PX0A 5L95A 3ZVMA 5CT5A 4H0NA 4M21A 4ZI5A 2H7YA 4LX0A 3HN7A 2JJ1D 1N4AA 4HCJA 4Z9XA 1Z4KA 3U9LA 1YIOA 4RQAA 5K8IA 3A3KA 3HUEA 3LUDA 3GI1A 3C74A 2AOVA 4QQFA 3D4OA 4JJIA 4DRYA 4E4RA 5IKMA 3I5XA 3VYUB 2IXDA 2YXLA 1H0HA 3Q88A 4B81A 3JR7A 3MGBA 2R8XA 1Y4ZA 4QTXA 1W8DA 2IYZA 4HXEB 1K06A 1DDGA 4RYDA 3U3XA 1H0RA 3WJAA 5H8WA 5IBCA 2BE9A 1NBOA 1IIRA 3Q0IA 3RAFC 2PMWB 4RMNA 4XJTA 3VTFA 1GA4A 3LVQE 2J6BA 4OBEA 4FQ8A 1B6RA 1VGQA 2V7QA 3C85A 3SJ7A 3D2AA 2W2NA 3CNOA 1JLRA 1LJLA 4MNTA 4O2LA 5I9SA 1ID1A 2I29A 1OLOA 2E4AA 2FN7A 4IHJF 2NOAA 2KI5A 3H5LA 4LBZA 1JHPA 6REQA 5AKHA 2IK8A 3ORYA 5E38A 1GPWB 2VJLA 3RFUA 4BGEA 4D0NA 4MDYA 4KPUA 2ZATA 4EFNA 5KVSA 1J42A 4IDGA 2I3BA 3E22A 2EJWA 4LRQA 4QPDA 1DT3A 4H59A 2RGRA 1R6XA 4FOPA 4DLUA 1YVEI 4MLZA 4MYSA 2BFWA 1PJRA 4J75A 3IUMA 4CLRA 1IK6A 4W1SA 5DULA 2HK9A 3UK1A 4WGFA 3SI7A 1UXIA 1M72A 1NLFA 5KNCH 4KSCA 2AYXA 3R8CA 3TAHA 4MR7A 3HMQA 1F38A 3PLAE 1OT3A 1SKUA 2GETA 1YIAA 1C4OA 4U02A 5FPQA 2Q5JA 4O4HF 3N1UA 5DNVA 4AULA 2CCJA 4NZNA 2Q45A 4JBGA 5FL7D 1NZJA 5EMHA 2VZ0A 1KARA 2EFYA 3CEHA 4XH9B 3FYUA 5DX8A 5A5EA 5KX5B 5LDDC 2ZRGA 2G70A 4Z99A 1EH5A 4HZUA 2P7HA 1UBHS 3A7EA 3TIGA 2W2VA 5LPNA 4DR7B 1YCHA 1YJCA 1OX5A 1L5FA 1MTOA 3CG0A 4ONEA 3LHSA 4PYMA 3R9XA 3OH8A 2R25B 2QAGC 4P5PA 1JG1A 2QLMA 5AI4A 1NE7A 1G5HA 2P5UA 2X0RA 1BMDA 1DXHA 1N2EA 3QU7A 2BDEA 2P4HX 4JROA 3SFTA 3TKYA 3WLKX 4NZ9A 1O58A 2RAFA 1A88A 3AM5A 5KYWA 2IY7A 1WXEA 1YZNA 3TECE 3T3DA 3VHXA 1A9OA 2QUZA 2P9YA 1JFVA 1KEUA 2XCLA 3PXBA 1R4AA 5FR1A 1BFKA 5IKPA 3I2JA 2REQB 3JWJA 4JJ4A 1ZINA 1WCWA 2ODTX 3GT4A 4Y2TA 1G63A 5ALQA 3UPDA 4JHLA 1UPXA 1EGHA 3C3DA 4JL8A 4MW2A 1Q6ZA 1CDEA 3KLMX 4C5BA 2O8BB 1FYVA 1SQ6A 3INRA 4K05A 5CH8A 2EDCA 2EKDA 4N0MA 1K9SA 1OU4A 3ZHOA 4P3YA 2ZE8A 3KZKA 5JWOA 4NY1A 2B7LA 3LXXA 3MGKA 3IIEA 5IBRA 1IBLB 1LZLA 1EWYA 4Z49A 2A5LA 4KNVA 2WT9A 2H2AA 4MUHA 4LHSA 3NUGA 4AXBA 1H5QA 2OE2A 3AF0A 3VJLA 2XD9A 1HYHA 1K5HA 3GLHA 4OUKX 4ZAFA 2WB4A 1NY5A 1PL7A 3BERA 3HY6A 3DBRA 3NBAA 4O2AF 1VLHA 5J4VA 5JS7A 3A3OA 1DWUA 1EHYA 1K27A 1PZFA 3BRQA 2PUJA 4LF8B 1W4AA 5EMLA 4EHHA 4N8SA 1E96A 1XJ5A 3P9IA 3Q85A 2AA3A 5K51A 3T9CA 4DMKA 2VNSA 2FPPA 4N82A 4CM3A 2GNAA 5I4BA 4ZAWA 5P21A 2HU7A 3F3KA 3JATA 1FDUA 4WZAA 5T4HA 4S2UA 4Q9HA 4H31A 1FMTA 2W98A 3RS7A 3PA8A 1BMTA 1KP9A 5A3SA 1X2EA 4EMBA 3EDCA 5GJCA 1E1DA 2GPTA 2DQSA 4RLFA 5P8WA 5MN5A 3OTQA 4NK5A 1P1BA 1WBJB 3W06A 4C1NA 3S2YA 2NWQA 1M2WA 1GITA 3EMBA 4ZN6A 2XNKA 3QU9A 4EPXA 1OWMA 1GAJA 2AEJA 2FZGA 3EC2A 1RYYA 4PZUA 4RLHA 5LD2C 4N3AA 3S3TA 1MX5A 3MT9A 1Z7YA 4N0QA 3DAHA 4GW3A 3BM5A 3SSNA 3C7AA 1JYEA 3NEAA 1CF9A 4FYHA 2YWDA 2B6NA 1ISMA 1Y7TA 4YPFA 1N5KA 3L4BA 3DAGA 3PL5A 2XUZA 3M4NA 3B9BA 3HCDA 4OMCA 2FQYA 2PKXA 2PYDA 4FCWA 2Z5LA 1R37A 2VF8A 3F71A 1GNVA 3SLRA 4DJTA 3BTVA 3G0IA 1NBEA 5C37A 1LK5A 2WAXA 2C2OA 3H7AA 1KERA 3DMDA 3FPAA 4G4GA 4MYUA 4RHEA 2WT4A 1N2JA 2BLNA 2P0AA 2PR7A 2ZIAA 3I04M 1T26A 4FMPA 1VKJA 4OUDA 5E9WA 1Z74A 4RK7A 3V4SA 4YV1A 4GWGA 3LLCA 4K3VA 5FNVA 2V3WA 2O14A 3TLBA 1TAQA 4BS9A 2G5GX 2O4CA 2RFLA 2FP3A 1J2YA 4RJJA 3M6VA 5KSYA 1V35A 1H6CA 3O1IC 5AESA 3P96A 1Z2PX 2BKAA 3RODA 3H8SA 4GDMA 5ICCA 3QXGA 4M9UA 3T94A 5HHTA 3RYTC 3QOWA 1V7CA 2V9ZA 2JC3A 2NSJA 3B3AA 2G17A 1GTVA 1UR5A 1JA0A 2X5KO 2HU2A 3G2MA 3B1YA 4ZOCA 1DV2A 5BN5A 3GXOA 3I5YA 1V5FA 4GM0A 4MDFA 1BKDR 3L05A 3GLQA 4OMFG 4QRDA 4YS6A 1DKPA 5THQA 2PIAA 1LGYA 2EJVA 4UKDA 1BEEA 2OUKA 3PV0A 2O8EA 4WINA 3V1UA 2QLBA 4TM8A 2PRSA 2YNMD 2IT1A 4R7TA 4JLNA 3HU5A 1E3QA 3CM0A 3Q3CA 4I08A 2VDMB 3FPJA 1OI7A 1MF7A 3GGPA 3JQRA 3LCRA 3VKWA 3VR1A 4DARA 1F4VA 4I99A 4EG1A 4HV4A 2VHZA 2NU6A 1H2AS 3ABQB 4KO4S 4GVXA 4TZ0A 3P5SA 2R62A 2E4VA 3FTCA 1EK5A 5M7EA 3ST7A 2ILTA 5KVQA 3VJKA 3RB8A 3JASA 2YHSA 4FC6A 5HRCA 3KXIA 4ECEA 5BYBA 5AW4A 3JQ8B 1Y5LA 1PR1A 4LDAA 1FQOA 1OTHA 2ZSFA 1P1CA 1V95A 3KKMA 3LQ1A 4O4JB 3QUSA 5CIYA 4HXGA 3REGA 4JV5B 2JDIA 1NN3A 1TMOA 1SCAA 3EZ9A 4JX8A 5EY5B 2A2ZA 5BV1A 5KOYA 4DG8A 1AB5A 5F7JA 2UYYA 4IFBA 3OLCX 2HTFA 4G85A 2GCIA 3KPJA 2DHDA 3IDOA 4JBNA 2ST1A 3TW8B 2ECOA 1A95A 3M0EA 1P17A 1QF7A 1W2HA 4X1KB 2OHXA 1V3TA 5G53C 1II8B 1V16A 1BAPA 2ODQA 4EAAA 2J5XA 1V6SA 5FBVB 1CK4A 4ALIA 1VJDA 1QHFA 1ZY2A 4GO1A 5KSPA 3T9FA 5FO1A 2WSSD 4IF4A 1H2RS 2BHTA 5IXSA 2YJ4A 3NTRA 3DZCA 1E0KA 4KH1A 1ZD2P 2MINB 2WZQA 2R1VB 5DNDA 2VTKA 1S96A 1SXJB 2C95A 2O7VA 1JDZA 3C3BA 3L8MA 4HK4A 2VXCA 3TI9A 5JDIC 1UOQA 5T67A 3H5VA 1YZ3A 1HV8A 3F1KA 1XCGB 3VNAA 1IN1A 4CEIB 5KAPA 4S0XA 5HIKA 4LJSA 3SJCA 3IAM6 4RKWA 5EZYB 3RTAA 4PPFA 1T8SA 2ET6A 4EKGA 9ABPA 1E66A 5L3QB 4RFLA 4Q1AA 3RC7A 5BT9A 5CMLA 3AV0B 2LCFA 1TTQB 4DIBA 2XXJA 1UQTA 4L50A 1QFYA 3X43A 5JYDA 4X84A 5IRCD 5GOTA 3L7LA 4KPEC 2FSVA 2PK3A 2C96A 1A9XA 1TGVA 2WQZA 3OD5A 1TX4B 3IEKA 5C4IA 1BYIA 3OMLA 4L6AA 4OYYA 3DKVA 2AVNA 2IXAA 5BSMA 3SQLA 1BC5A 3KM0A 4G25A 2UUOA 4JJ6A 2POCA 5HF5A 5H4HA 4YT5A 1QIJA 4G1UC 2XKKA 1YMQA 2PVSA 5DTMA 2OM6A 2EEPA 1CRQA 2ADMA 2QV7A 2X0EA 5FUYA 6LDHA 3W6UA 2OOKA 3L7MA 1FU4A 1SUDA 3HRIA 4F8JA 1R10A 5LLSA 1K08A 3ABZA 1IWPB 1W48A 3I52A 4HDRA 2OZLB 5IYZB 1FTGA 5DBFA 4EX6A 4HGZA 3LG2A 1BJRE 1P19A 1W19A 4NNPA 2AG5A 2NTJA 4EGAA 2OWEA 4BAZA 5JDCA 4Z4FA 2VP3A 3C3XA 3E48A 3GARA 1T4CA 4QU8A 3P9PA 3SFVA 4XPIB 4JYZA 4ARCA 1CVRA 2FPIA 4XCVA 4PG8A 2FLKA 2SNIE 1D8TA 3CUTA 2VLBA 2CUZA 3D6JA 3WL5A 2PVCA 5JDIA 5TR9A 1XA4A 4G5SA 3SS8A 3THXB 2FRDC 2WFMA 4YP0A 4ZI2A 1DEXA 1CY2A 4GQIA 3UXHA 3VHLB 1KHTA 2YWCA 3G6WA 2OZVA 1X7HA 1XT6A 2ACEA 4R9SA 3RRFA 1PJQA 4G23A 3EIXA 4QPPA 3BE8A 4U2DA 1Q1BA 1EE1A 3LUAA 1T1GA 3ZE6A 1DCMA 1U3WA 3EIWA 3R9WA 4KMOA 4TMWA 2Q9BA 2EKPA 4DCVA 3L4JA 4HQ6A 3BJMA 1ZUWA 1JJVA 5F9FA 4MV5A 4WXEA 4X7RA 4S1PA 3EZFA 2DKFA 4LS3A 4OEHA 4P4SA 5KQGA 1VIYA 1F8FA 3AHJA 4WD3A 2UUBB 1F4PA 1E0AA 4TTPA 2CHGA 4RNCA 3CRZA 4XX0A 4RTSA 5IS2A 1J4AA 1K3TA 3T54A 3TLGB 4G0WA 3EFEA 2E87A 2WW8A 4R1PA 3PFKA 4CKWA 4C0HA 1ES9A 3ZOZA 1SHUX 2O3UA 3DBIA 4BO2A 4K2AA 2DWQA 1GZSA 1QH9A 3BC1A 4C7OA 3EC1A 1Z5NA 3KOOA 4C43A 2A5YB 3A1FA 4IVQA 4ITVA 5M04A 1GQFA 3SC2A 1KMQA 2A0XA 3N5KA 3H6KA 4FKMA 1KH3A 1MMFB 2JRCA 3DOCA 3NR2A 3VR4A 3JQAD 1E59A 2HO5A 3SHTA 2IH2A 3MMNA 4P58A 1KDRA 3PHGA 3HBMA 3H87A 1FFXA 2V97A 1VDZA 2VRCA 1EXNA 3EF3A 4X24A 2P79A 4YCDA 5JSUA 2PJZA 1S3SA 4YRTA 1NBIA 3CH6A 1GZDA 3H83A 5IYZF 1QPZA 1E2BA 2F64A 1PHPA 2VDRB 4J0JA 4B85A 5HQ3A 1GGJA 5B3JC 1TFRA 2JIQA 3P52A 5EZ6B 1E3TA 4UCWA 3B12A 4E5SA 4NCXA 3TTTA 1TVCA 2VSYA 3IEUA 4Q3NA 3CSUA 5A03A 3TRJA 2OHHA 4YRZA 2O54A 1XJ0A 1SJ9A 1DQPA 1XTRA 2C2YA 2F3RA 1SUWA 2O7RA 4I9HA 5CR9A 3U1TA 4UBOA 1Z4LA 1A8IA 2IHKA 3C8HA 1Z07A 2IYUA 1WXGA 1BS9A 1NXTA 1Z8DA 1I7PA 5FNVF 5AKKA 4ZGWA 4ZU6X 4QULA 2V4ZA 1A7JA 4MQEB 3ZE1B 2VEDA 3AI2A 3EAGA 4ZT7A 1QLHA 1CHDA 1CJCA 4WSOA 1WXIA 3ZI4A 1QIEA 2I6GA 3DZHA 3AK4A 1KEZA 1ZD3A 2ZB4A 1WLSA 3AR4A 4R31A 4IIYA 4PHHA 1VE7A 1G64A 4YGYA 4EY6A 1O77A 1U2GC 3AHIA 3RKUA 1XPJA 3BJZA 3R44A 3ISVA 3D8BA 3WOHA 3OETA 4N76A 4PLHA 3OCCA 4FSXA 3NWJA 4BP9A 4CT4B 2J9YB 3M8KA 5ICEA 3WZ2A 1G5RA 3W0LB 2PJUA 3VYVA 4ZYTA 1HSZA 3K8QA 1NQVA 1F5NA 1NFQA 3GZJA 4CDMA 4XB6B 4GKBA 3RSQA 3AXSA 3EIUA 3FSGD 4L5YA 2IV2X 1ZFNA 1GR0A 2VPYA 2C9MA 2VT6A 4M0DA 2IOYA 4RZHA 3RE1A 3W77A 4F12A 4DIFA 5KDDA 1Z8FA 1U9ZA 4FYYA 1ND6A 3DJYA 3CWCA 3KKLA 4OK3A 4L8LA 4Q3LA 4EDFA 1RT9A 1Z5PA 2Q3DA 3ICPA 5GPBA 2ZAGA 3EYWA 3MRTA 1L7EA 4CI9A 4EFDA 2VNJA 3RWOA 5TF4A 2FEWB 5JR3A 4S1TA 1D2NA 2VHCA 3JRXA 4ND7A 4Q47A 2QKYA 2QZSA 4LK2A 3KT8A 3TZQA 1O4WA 1EWRA 4YCMA 1ZJWA 3PZBA 4ECAA 5JIBA 1ZMXA 5AVRA 3S44A 1KDVA 1Z56C 1RVDA 2RSLA 2VFAA 4XTRA 1QIIA 3ZYCA 4CLHA 4ZJUA 4CMBA 1C30A 4GYJA 5TJ9A 4ZJPA 4TPKA 5ALVA 4YRSA 1TVMA 2A30A 1ZXBA 2Y77A 1SKQA 2GNPA 1JSLA 1EK6A 3L77A 3EG5A 3OPVA 4JU9A 3GOHA 4DR1B 4X62B 2X0NA 2D3TA 3LW7A 1M2JA 5CB6A 4KXMA 5B55A 3ODGA 3B5EA 1F2TB 1JQ3A 2C1EA 3O8QA 4ASUA 5F64A 4EPTA 5IG2A 3Q1LA 3DMNA 4C0KA 3G0DA 3GRYA 3EXFA 5H9WA 1IZ0A 1E2QA 3S81A 1PJZA 4NYMR 4UZSA 3HCWA 3UJAA 4BNXA 2JLUA 1FJXA 3D9QX 3VAAA 1X13A 5C46F 4IRXA 4IUYA 4PFKA 1WF6A 4PCAA 1XZKA 1DIBA 3IXMA 4WIAA 4Z4IA 3EGEA 3H1AA 3JQ7B 2GO7A 4NPAA 3ZW7A 3N8GA 4NENB 2ZYGA 5K2OA 4LC9A 4HOYA 2EJCA 1DIHA 4X3CA 3CWZA 4QPNA 1U7ZA 4EG0A 2VNIA 4ZPJA 3OE7D 1KJZA 3HQ4O 4DCOA 4ZMRA 1JZSA 3FDJA 2R97A 2O19A 3R7NA 5CYGA 2HJRA 2FEXA 1L5WA 2DYKA 4BKQA 1DBWA 2WFAA 5HA5A 3GJRA 1VIAA 3KUXA 4JI8B 3PJEA 1Y4AE 1VI6A 4DAOA 4B6RA 1QDEA 3HZOA 4DDWA 4I1YA 4K87A 9ATCA 2OKCA 4O8CA 1J07A 1GSAA 3DBHB 2OCYC 3DYIA 4M6WB 2W4MA 4Z3DA 1LBHA 1AQLA 4Y2UA 4D9MA 4BMOB 1SKMA 3EQ8A 2OV1A 1ID8A 1T0JB 1RZ3A 2Q7XA 3UGKA 2CBXA 5CJJA 4LFBB 3NHFA 4NBSA 4CG1A 5I01A 4ZOLB 1J2EA 1JI0A 5AUNB 2FB9A 2EX4A 5A5DA 3QVUA 3WLSA 4XX1A 3HY4A 4ADSG 1E5QA 2OR3A 1I5EA 1JLKA 2BF7A 2BFOA 2HNBA 3G1WA 1PT8A 5FUWA 3WO0A 3P19A 4BZQA 5KJ6A 2GRAA 2D0PB 3QUBA 2P9GA 4NEQA 3MSXA 4D46A 1QJ4A 3RVPA 1U6KA 1D1QA 1X14A 5FTJA 3DO8A 4F38A 2Q21A 4OHZA 1UT5A 5JSHA 1P0PA 5LVAA 3EVAA 1P2BA 1G3RA 1C3EA 1OWLA 1GN9A 1SU8A 2KBEA 2CFRA 3GQBA 3I42A 4MP3A 2Y6VA 5HFNA 3RJZA 3OP4A 5BP7A 3LTEA 1SUFA 1AN9A 2P9TA 2QT1A 2V7EA 1CPYA 3WQRA 3CSSA 3WDSA 4FFBB 5BSUA 1VGRA 4NLLA 1Z83A 4IMPA 3LFHA 4KPGA 3G23A 5HIIA 2R3SA 4MWGA 4D0GA 4PWYA 2VF5X 2VH2A 3EJ6A 4KR0A 5CTAA 3MBIA 5A5GA 5I8ZA 5K3FB 4DIUA 4BMXA 3GJYA 3ILXA 1QIGA 2O48X 2R5FA 1EG7A 2FSHA 4GXTA 2L0XA 3BIFA 4ERNA 3F73A 4QPZA 4A8JA 1AQ6A 5CT4A 5EJMA 4ES6A 3ZQ4A 3KVRA 5C8YF 2CMDA 3IMCA 2ZJAA 3D6HA 3PQ6A 2C98A 5E8JA 5FLYA 4XYLA 2AHOA 1QCCA 3T1NA 2ODAA 5D86A 3OPNA 3W8DA 4MV8A 1BROA 1F8XA 3NT4A 4IFIA 2AKAB 4PTLA 3ZLVA 4EPRA 4PPQA 2J5RA 2VJNA 4DDMA 3H9UA 4BX2A 1AB6A 2I2XB 2CHVA 2XYPA 1CE8A 2AFIE 2J09A 4C4TA 4J43A 3AL3A 3O4JA 4Q4AA 2XXBA 4MB0A 1GYRA 3KQQA 4GX1A 1D0VA 1RKQA 2WF6A 3E3LA 5DYTA 4ESOA 4Z3KA 3K70C 4QM6A 1E62A 2Z2JA 3B1ZA 3G2KA 4F1WA 1CUCA 4Q05A 5I6DA 2VHQA 4TLAA 1NU8A 1M5UA 2FOIA 2ZULA 3OE5A 3EH2A 3ZJ5A 2MJLA 2R7AA 5IN4A 5JQWA 1X8LA 2FN4A 2X8JB 3BMNB 4MRMA 1KIMA 2ENWA 1XRSB 2YOHA 4ZP1A 1L5RA 3MG9A 3E9CA 3VR4H 2ZBFA 3DPSA 3P32A 3ZJTA 1QLJA 3PI6A 3NV7A 2AI1A 4JGGA 1VCMA 5CM8B 4BNDB 3ZY3A 1HOTA 1NNI1 2JEYA 3DA8A 1M1YB 4FYMA 4LV8B 4X64B 1YVDA 4N39A 3IAS1 3DLAA 3E5NA 4CL2A 2Y9PB 1D8AA 4ZVVA 2GPBA 4Q9NA 2Y1XA 4KDCA 1O6FA 1Z6QA 2QUJA 2VJDA 3GRVA 1EUCA 3N8IA 4HGQA 3PQFA 2TRSB 3GDHA 2ZG6A 4GBED 4KQGA 4Q3AA 4W8OA 5DP2A 5FEMA 3S2GA 3A9TA 2CUTA 1DCKA 4IHAA 2EV9A 5LMZA 3G49A 4KLAA 3RGWS 2WMNB 1U7OA 1QAMA 1A4RA 4LDQA 5ERGB 2O3SA 3E9EA 4JS0A 2CD9A 3COWA 4JIGA 3Q7EA 1TQ4A 5A06A 3IERA 2QYSA 5DM70 1ZUHA 1MDBA 2Q3LA 1A4IA 2A6PA 4J0CA 4OLAA 4TTJA 1K7CA 1SHJA 3A6PC 1GPNA 1YHZA 2AN5A 3BUSA 3CRW1 1HT2E 2B1QA 2JI4A 2E6UX 2XB4A 3STYA 3DLIA 3QVGB 1L1EA 3W3AA 1V6CA 1DC6A 4P93A 2AT1A 4MQLA 4KFSA 4YECA 4F7DA 4C7MA 2CYBA 2XX3A 4PANA 1GT6A 2QA5A 5CVCA 5EGSA 2PNJA 2V59A 2OM2A 4E5UA 4KFTA 1SHLA 1MOZA 5ESRA 4NCNA 3T3PB 1ZI6A 5IZCA 4DBZA 1JLSA 5B6IA 2YHUA 5K4GA 1VI2A 2D4HA 3O8CA 4NDNE 5JQGB 1PQ4A 4N6NA 1RI3A 3DEAA 1GILA 1G3MA 1KJIA 3DHEA 2PGOA 4QBGB 1J00A 5B7QA 2D00A 1NOKA 5EXTA 3UJBA 3MMPA 1B00A 2B8TA 3THOA 3BN3A 4BXOB 4IVPA 1NDHA 1XALA 4C2AA 4U7DA 3VU3A 4A26A 1IE3A 1N7HA 2DFKB 4BO4A 3LBNA 4J16C 4AT1A 5CFQA 1Q21A 2I76A 2ZVQX 5EIEA 5J1SB 4YDSA 5I8WA 4WEOA 3ZWKA 1XA3A 2OV2A 4UATA 4YMHA 4ENWA 4YXFA 1FRVA 1AU9A 4GX2A 3HKDB 5BVHB 3AFOA 4JEHA 2D5CA 4DQDA 2JAPA 3T5BA 4XSHA 1JVNA 2VDPB 2HCBA 1JWAB 4G0MA 2NTNA 2FR0A 3V2HA 1QVRA 1QGYA 1S7CA 1TXGA 2V6FA 3CLTC 1I5OA 5C35A 3KR2A 4DWJA 4UEWA 1J2UA 1XGKA 2WHRA 3FOWA 3OURA 5FNZA 4N8DA 4B82A 4B3MB 1NZFA 2NO7A 2PUGA 2NNWB 1WVGA 4LJ8A 4YRLA 1WV0A 3OO1A 4MQFA 5JD6A 2GEUA 2C7PA 4NX2A 5KX5A 2BFDB 4UHCA 1O95A 1Z45A 4KGXA 4WVFA 4MQ4A 1CNEA 3EOZA 4GOKA 4ZOBA 5KDLA 1E1KA 1X7DA 4TLLB 2COKA 3AMVA 1MABB 1U3DA 1UZNA 5KU7A 2NVUB 4V0QA 5BSFA 3IA2A 5EAIA 4L75A 5G4LA 3BMCB 2GJ4A 5CU7A 4G4SP 4OI1A 2PGAA 3ZWVA 3LC0A 4F93B 4UREA 3BXEA 4ZOQI 1O5OA 1OGYA 2JLYA 4JI1B 3HADA 4DA8A 5KYWB 2O57A 3X0DA 3VR5H 1Y3AA 4KZPA 1S9DA 2HRQA 1EB8A 4G0NA 4ZAYA 3U7EB 4E31A 1KJ8A 1BX3A 3MOGA 1K6MA 2Z2KA 4TXNA 4RTRA 2F55A 3QYJA 3G2PA 3BG5A 5KQPA 1RWKA 3A58B 4D9GA 1SR8A 4PG6A 4DLYA 3PKJA 1KXJA 2IYLD 1SQFA 3CNEA 4YT4A 1GADO 2ACKA 2DWCA 3S7TA 4DS3A 2GN4A 4KXWA 4MW5A 4QVIA 5DKFA 2XQFA 2O8BA 3K6JA 1Q3TA 4ZU3A 3EIFA 4C7BA 1OC4A 1V5GA 1GNSA 1VE1A 5JAHA 2G72A 4R1TA 3WYFA 2P0YA 4F5DA 2Y2VA 3QFRA 2DECA 2Z5GA 1X1EA 2FWMX 5F1YA 2AQIA 2FZLA 4QKQA 4AN4A 3C15C 3IDZA 1LBEA 4EDHA 4K6CA 2QV0A 4E14A 2LD4A 3BFPA 4BCBA 2OBMA 3F49S 5GONB 1H2BA 4E3WA 1JEYB 2D5BA 5FJJA 1NURA 5M29A 1KYIA 2PX6A 2W43A 3WKEA 2JA2A 4F8YA 2PDAA 1IM5A 3G5AA 3L6OO 1XTKA 3MFQA 4QREA 5EZQA 5CAEB 3WHIA 2RGYA 3IP6A 5DPMA 1WV1A 4KXYA 4ND6A 3OM1A 3FZGA 4ZD6A 4RVFA 3UICA 3WGNA 4HAWA 3HFJA 4L73A 2W6PA 1DZ3A 1Z4MA 3VZCA 3IDAA 4KN9S 2FYTA 5LNK6 1EX7A 2J5BA 4Q7MB 1TD1A 4TWRA 1DTWB 3B53X 5JHGB 2QJTA 2P2YA 1X1QA 3AIKA 1YZQA 3L1JA 4J9UE 1XMVA 1E6MA 1V39A 4QRIA 1H3FA 2V6BA 4PZYA 4CV1A 4V0KA 4I1OA 3BSWA 1SHZA 1ZNQO 3SC3A 4EVRA 1B7GO 1Y9JA 3DM5A 5EMMA 4B09A 3F9CA 5LP1A 2QJFA 3L6EA 5JROA 3NLLA 1V6AA 4OHCA 4Y2YA 2UZ1B 2WTEA 4B40A 3RSCA 3WYAA 4BNLA 3DUWA 1UZMA 4Y7DA 4TLBA 5FWAA 2E4XA 3GFSA 4JSTA 1A1VA 1QZTA 1VP3A 2R87A 5IFKA 3PEWA 1WVMA 1ZK0A 2XGOA 5DK6A 2VHEA 1AHPA 4KTVE 1H1DA 1YS1X 3OM0A 3DH0A 5AT1A 1WR8A 2IYVA 3B1VA 3Q41A 1V2GA 2B9EA 1DRJA 3AGQA 1DUIA 3FB4A 3NM5A 4GNKA 4M8LA 2IXGA 4I55B 4U6NA 3TFQA 3LX6A 2A78A 3OFND 2V9CA 3S40A 1TF2A 3WS7A 1J06A 5CB4B 3L7CA 4N4AA 3QKTA 4LHZA 3HY3A 4CQMD 5E1DA 1UJ4A 2JW5A 4LDJA 4ZYZA 3CT6A 3KHKA 3GN1A 3NAGA 1RYHA 4PYLA 1AV6A 2BZSA 1AVTA 1KH2A 1QP8A 1XTUA 3TBKA 1U5AA 2QTFA 3GCGA 1MG5A 1N5JA 3FWPA 5IT4A 1W2GA 3KBOA 2B1GA 4HUQB 4PBTA 3VV2A 3I37X 2AFHA 2QJWA 2OYSA 1FA9A 2JVJA 4ER0A 3KSUA 4PAQA 4Z6KA 2H4HA 4D4JA 4YPVA 1HZJA 1YTUA 4U5QA 4A23A 2A3NA 2AYZA 4CM4B 3QIVA 1TQ2A 2C61A 5HFAA 3RV4A 2J45A 3LGXA 3OPXA 2OMKA 2Q6KA 1MOPA 2HGZA 4ZAZA 1HLFA 4BIIA 5EQTA 1R0XA 1EPUA 5K8UA 2QI9C 1JQJC 1XZAA 1CUYA 1CG6A 1X1SA 3CT4A 3E5MA 1NAIA 1MVNA 2WR8A 3PQEA 3QA9A 5ALGA 4ER6A 1W94A 2QQ5A 1TAHA 3GG9A 3AH8A 3HJTA 3ASZA 3FWNA 3NTUA 5EKDA 5HZGA 4RTOA 3RKSA 2EARA 3ZI7A 1Z6XA 3OTIA 3TG2A 4CKCA 2ZI3A 4B76A 2VJCA 1GPLA 2XB8A 4WVLA 2QGNA 5EL0A 2HLDD 3MTQA 3I9NA 2OVBA 4RF3A 1DAEA 3THWB 4MDHA 2D1RA 1KRXA 4D02A 4BKPA 2J9ZB 1W5TA 1V71A 1NW9B 2VI5A 4HRVA 3GLUA 1YXMA 3Q3GE 4B7CA 3C5WP 3GLVA 2EJBA 1EM8B 4F72A 2PY6A 2DFNA 5JH7B 4FFNA 2AD1A 3JQ8A 4O4JA 2YH2A 1S0UA 2GZAA 4OMUA 2FR8C 1GTG1 4ZV9A 5B36A 2LKDA 3O7MA 1BQ3A 2Q27A 1VG8A 3V32A 3OKCA 1F3OA 1QPBA 3WYNA 1QH8A 5E4FA 1LNZA 1PYOA 2MYNA 4WV3A 1LI4A 4PRLA 2AQKA 2OV6A 5FH9A 4YH1A 3TW8A 1M1ZA 3EZ7A 4DTCA 4X1KA 4E1AA 4MEAA 2DQKA 3PCTA 1KZHA 4B3TB 2OAEA 3LBAA 4LIPD 3QHAA 4OBXA 4MA5A 4R0MA 3WDKA 1QGUB 3K2EA 2IPOA 2MINA 1S6YA 2R1VA 2XWPA 5AVKA 1DAOA 1SXJA 2A5JA 3P94A 4NK4A 3M5WA 4WA8A 1TUBB 3BREA 3PF9A 5K8LA 4LYYA 1C7ZA 4BPRA 5KBYA 3QPBA 1ZXXA 4ON9A 5JJBA 4CL0A 1G5IA 4CEIA 3TK1A 4LE1A 2WLSA 4GC5A 2GZ3A 1GPAA 2HFKA 5EZYA 5KTRA 2RGCA 2FOLA 3RABA 3UWKA 5L3QA 1B0UA 4AL4A 1XAIA 4K9DA 3ENVA 3L7DA 4BN4A 4UTNA 3G68A 13PKA 1T4BA 1W85B 5HOEA 2GB4A 4JLUA 3V1NA 3ZK7A 4BP3A 4DIDA 3QG1A 4C29A 3KKEA 1TB4A 2WZCA 5HKBA 2IZ7A 4B45A 2FI1A 2C2MA 2DFPA 2Z4SA 3A9WA 4HAOA 1I8TA 3S8MA 4CW7A 4L5BA 4J1SA 4OHYA 2WKPA 4G63A 1ZMTA 1KP3A 2Q5QA 5DBGA 1YR8A 1GVHA 1PGNA 2ADOA 1YU9A 2IV7A 1NM5C 3IR6A 3KHUA 4MWBA 2G5CA 2O06A 5LYYA 2Z2IA 4RPKA 5NLLA 2QNIA 3A37A 5HM8A 2YJ5A 5HJ5A 1DX4A 1JHAA 2R8ZA 5DF1A 3IVGA 2OZLA 3F97A 1CS0A 3I83A 2O6HA 2B3DA 4BLPA 2P2LA 3BGIA 1KY5A 1Z22A 3B1FA 3Q0TA 3S6JA 2VT2A 2YIVX 3CSDA 3JALB 3TR6A 1VJRA 3QXCA 1VKZA 4ZARA 1NP6A 3BOSA 5G3YA 5ERXA 2ZBRA 3BHJA 4XPIA 4J3FA 4OGGA 1YL5A 3OT1B 3V7YA 4EFLA 1G6KA 4ZCLA 4BLUA 1CRWG 2HV9A 2XGMA 3D4PA 1DLIA 1DOAA 1V26A 2FWRA 5ESWA 5LIRA 4FFPA 3KJXA 1Z35A 4Q7LA 3R0JA 3JSAA 2HZ7A 1X7XB 5GV8A 3SYMA 5KPDA 3BTUA 3LHFA 1FK8A 1XVIA 4J1QA 2A4KA 1P4JA 1S8FA 2O23A 1NL3A 2Y0CA 1HG0A 1R0CA 3MXOA 3U3KA 2FX3A 3VVLA 1JPJA 3MT7A 4TX1A 3USES 2J9FA 3C6MA 4Q9JA 5KWEA 2GCNA 4BJ5A 5BPFA 3MWDB 5A7FA 1JIIA 3UFBA 4UUBA 2D54A 2V0CA 4XIIA 5CDTA 4Q9LA 2QN6A 3DT9A 3FPFA 1CZNA 4HC4A 1U1FA 1XDDA 2FHSA 1UAGA 1X1BA 5EA2A 3W2HA 4G1CA 4UNRA 3EA4A 3MXTA 2FX5A 2Y67A 1HL7A 3C24A 1Q57A 1NC3A 3I5AA 3V4FA 4PF1A 3TLGA 5JXGA 4IIJB 1AOXA 1YDGA 1RQ7A 3L0SA 3AU8A 5IJAA 4YQFA 5HS6A 1S01A 1POWA 2Z04A 1W1WA 2FHPA 3ZZTA 1IL0A 4HYQA 5KJFA 4LWOA 3AR7A