2A6PA

Structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
RNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2
publication title Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2a6pA00
2P9YA 1DKQA 5PGMA 2GFIA 3FDZB 2QNIA 3F2IA 3LL4A 1K6MA 4PZ9A 2H52A 1QFXA 2P2YA 4IJ5A 1C81A 1EBBA 3D8HA 1C80A 1DKOA 3QPUA 4AROA 4IJ6A 2F90A 3BIFA 3K4PA 2OWDA 2ENWA 2YN0A 1BQ4A 1CVIA 2OWEA 5AJYA 4ARSA 3FJYA 5CX4A 5AJXA 2P79A 1FZTA 3GP5A 3HJGA 3E9CA 3D6AA 5AK0A 1BQ3A 1SK8A 1QHFA 1E58A 2DWOA 3O0TA 3PGMA 3IT0A 5CU7A 1XQ9A 3R7AA 3C7TA 1SKAA 3IT3A 2PA0A 3KKKA 1YJXA 1T8PA 4QIHA 1DKNA 4FDTA 2H0QA 2BIFA 2P6OA 3FDZA 3LG2A 3QPVA 5HTKA 1H2EA 4D4JA 3DCYA 4PZAA 4EO9A 2EOAA 1SKBA 1RIIA 2WU0A 4D4LA 2P6MA 5AJVB 4ARVA 5AJWA 5AJZA 4D4MA 1ND5A 1DKMA 1V7QA 2HIAA 1FBTA 2H4ZA 1UJBA 2I1VB 4E3WA 4TSRA 1TIPA 4GPIB 2EKBA 2P77A 4ARUA 1BIFA 4FDUA 3NFYA 4JOCA 2RFLA 2YN2A 1SK9A 1H2FA 4D4KA 3QPWA 2HPAA 3ZHCA 5HR5A 2DWPA 3K4QA 3GP3A 3LNTA 1C7ZA 1V37A 2IKQA 4HBZA 1RPTA 2A6PA 2ENUA 1E59A 2WNIA 3E9EA 3EOZA 3IT2A 4JODA 3F3KA 4EMBA 3GW8A 2P30A 3OI7A 1NT4A 2P9ZA 4ODIA 4PGMA 3NTLA 1IHPA 1YFKA 2P78A 3EZNA 1DKLA 2HHJA 4MA4A 1DKPA 2H4XA 4JOBA 3IT1A 4GPZA 2EKZA 2P75A 3DB1A 1RPAA 1ND6A 1QWOA 3MBKA 2A9JA 2P9FA 2P2ZA 3E9DA 1UJCA 5CDHA 2WNHA 2AXNA 3D4IA 3MXOA
chains in the Genus database with same CATH superfamily
2GD2A 2Y77A 2GUGA 2AJDA 4LYJA 4EOGA 2I7XA 1SM4A 1F4VA 1J07A 1YIDA 3LLVA 1L7BA 4UNSA 2GEJA 1US8A 1ZNYA 3NCTA 1YNSA 1U6KA 4X45A 1PU2A 3BTOA 3NHBA 3ZWAA 5JNRA 4IXTA 4N3NA 3KOWA 5KSZA 1WW3A 4URUR 1JLMA 1E2JA 3OKCA 4KAFA 4P8RA 4XWAA 1YKFA 5K3AA 4GWLA 4NF2A 1KE2A 4YRNA 4LRUA 5ALNA 4KPEC 3EEIA 4V0NA 3QX9A 1NBWB 2QMEA 1DOHA 3EZ7A 3PC6A 1WPQA 4GH5A 3CZ5A 4ZVNA 1RI2A 1IIRA 2NV2B 3LCMA 3U7EB 1VLLA 1V95A 5DPMA 3AR6A 3M2PA 2HR1A 3ZKWA 5C1BA 1ISSA 1G5QA 1P1KA 2QJTA 4TT3A 1KVUA 1A76A 2WM2A 4AUMA 4WJLA 1QGED 5J2TA 1R66A 2O2XA 3GIDA 3BSYA 6REQA 4IOMA 3CNQS 3NX4A 4L3WA 2Q8PA 4LK3A 4LX8A 5BPHA 5BQ5A 5L3VA 1SOWA 3VPCA 2PMKA 4Z4GA 3O2NA 3SWWA 5AHOA 1SKAA 4N3BA 4FOPA 1XF1A 3OLZA 4HQOA 5B57C 4M37A 2VK1A 1P29A 1OFUA 3VHRA 3FN4A 2KW5A 4YCMA 2V6IA 3LBHA 5IX8A 3D3EA 2VYQA 4XLTA 1GG9A 1ZNXA 3MIIA 4GX0A 4UAGA 3C3BA 4RZIA 3L1JA 1I14A 3Q3JB 1Y5IA 3OLXA 1OY1A 5GM2A 4FFLA 3TNLA 1XHFA 3T9AA 2BEVA 1A5SB 2ZIFA 1E0KA 5C5CA 2GCPA 2C83A 5B3JA 5SICE 2W83A 4DLRA 4MUNA 4W8OA 2C1EA 2DF8A 4WCDA 4CM6A 5ULLA 2XUPA 2ZRPA 5ARBA 3TWOA 1E1KA 5EIAA 3THSA 4DR1B 4LZAA 3VNBA 4R6XA 5KDLA 4LDPA 5SZIA 4FDUA 1VRCA 2IHTA 3QKSB 3UT0A 2A1TR 3P0FA 1WXWA 2RI6A 3WYGA 5JJLA 1E9RA 2HHCA 2QJWA 2QL9A 4RKFA 5IK2D 1SVKA 4WSOA 1QFZA 4EG4A 1W87A 2X0EA 5DO9A 1M6YA 1UAGA 3D7RA 3KR2A 1NP3A 3L8GA 1F60A 1GAQA 4MUBA 4OXRA 1J21A 3A6LA 4NV0A 4QTUB 5FTNA 1PR4A 1S1MA 3AEKA 3WI7A 5ICMA 2BFFA 2LPMA 4DA9A 2NYAA 2XEDA 4HWRA 4N0EA 3M33A 3SZGA 2X4IA 1IE3A 2NSLA 4U6SA 1R6DA 3T3HA 3HG7A 2A5GA 2C5LA 2JAHA 1RLUA 3GBVA 1NPDA 1NM5C 1XRNA 3ICVA 4IVQA 3HKBA 1IULA 4JBLA 4E2ZA 621PA 3EXG2 2FWPA 2FN3A 1PG5A 3O93A 3QFHA 2H2HA 5FBVB 3ET5A 3VR5H 4ENWA 2F1JA 3A6ZA 2IF0A 4CMJA 3WNVA 4XEHA 4R3WA 4GPEA 2I9PA 1AX9A 3RWBA 4GS5A 5E7MA 3ONEA 2OZLB 2F62A 3BORA 1A2BA 1U2SA 1UBEA 2DUMA 2PZEA 3GCWA 1A1VA 3GJTA 1WNFA 1JE1A 3ZDZB 1XQ6A 5EE9A 4ZDIA 3QTTA 3QV2A 1V1RB 1GPWB 5CH8A 1NXXA 5F76A 1JI0A 3AETA 4EQ6B 2RHHA 4E08A 1PDWA 5K8CA 3GUYA 3QWIA 2B82A 3HQ4O 1RRCA 4BLTA 3DULA 2MSEB 3TLGB 4DKXA 4F9FA 4MPJA 2CLDX 1EEXB 2X2EA 1MC4A 3AXSA 3GCXA 3OU2A 4DWWA 1TGYA 2PUVA 3A6GA 3E18A 3OY2A 3DMFA 1HYGA 5E9QA 4P31A 1OH5A 5KNDH 1YGYA 1XYGA 2W58A 3ANYB 3OOWA 2J5RA 3B6IA 3OIUA 1KQGA 1WP4A 1EVEA 4DUGA 4WZAB 3KZXA 2W2TA 4ND8B 1G8SA 1X7YB 4IVNA 1TYZA 2WIKA 1MDBA 8ATCA 4CUKA 1G4HA 3A4NA 3PFWO 1HG1A 5KREA 4QDZA 5ADWA 3OQMA 2NSHA 2V58A 1EVIA 4U7PB 5J2UA 5JDCA 3EEFA 1YE5A 5GOTA 1AU9A 1J0XO 1NRWA 3GDOA 1NUPA 3X44A 3EG9A 3ROTA 1K9SA 1NX9A 3WISA 1GGEA 2WWYA 1PJ8A 1MU0A 3VJKA 1IRIA 1QS0A 1DKNA 2XB6A 3EZGA 5AKJA 2CF5A 3UHFA 4MTLA 2JK0A 2ECQA 3O8BA 2R8RA 1LPMA 4ZVRA 4BPRA 3EXFB 4GHWA 4CWAA 1TPYA 1IY9A 3G59A 3HFRA 2RGGA 3ONFA 3T5TA 1M7GA 4Q39A 3K0EA 1ICIA 2BM9A 2W71A 3AERB 3GK3A 3DDSA 4QOSA 1CRQA 2C61A 2O0HA 3B51X 4Y1EA 3U7GA 2W43A 3A70A 2BGLA 4AKIA 1JPUA 3PRJA 3S7ZA 3ZWXA 1E3SA 4MH0R 4H6VA 4IQFA 4NU5A 3NONA 4FKBA 7AT1A 5JH7A 2RD2A 5IUJC 2C9OA 1Y5RA 1SOVA 2GAFA 1PUJA 2P2DA 3DF7A 3KSRA 4ZARA 1SWWA 4IS2A 4PPYA 2L17A 2BBOA 4EW6A 3MWKA 3U13A 1DRJA 2PRJA 5IJ0B 2EBFX 2QPAA 2JI6A 4OHBA 4D1YA 3KZKA 2O8DA 2ODNA 4QYIB 3NBMA 1Z36A 3WK5A 4MQEA 1J8FA 1JI3A 1KYVA 4LHZA 5ESXA 2JGMA 5HVNA 3NEPX 1IEVA 1EEHA 2GBGA 3PX7A 1M5RA 3OX4A 4IAOA 2JFOA 3IMEA 4H4CA 2R8XA 4GE3A 4PPQA 2QTVB 3D6UA 4V0OA 1XYVA 3D6FA 3FLBA 2FU5C 1VHJA 2PX6A 1PYDA 5FO1A 1NNSA 4ZAZA 3HDYA 2JGEA 1U5CA 1VYVA 3N8IA 1J2UA 1YRQA 3EUWA 3BEOA 3FTNA 5DHAA 3H4VA 4IIHA 1X9GA 1ZZEA 5JNWA 5DEOA 1TD9A 2OORC 2RIRA 1NSYA 4FC7A 2HQRA 2Z4TA 3K9LA 2JIZA 2R2AA 3L0DA 3PYLA 3ZNNA 4RTKA 2MYTA 4NS1A 2X0RA 5C1DA 3B13B 2ANCA 2OCDA 1K2VN 2GTPA 5EJ7A 2IXGA 2ZRCA 4GP6A 1O3YA 5E8RA 3P52A 4UKDA 1FRVA 2DVMA 3AV0B 1C9MA 3VYUB 2ZWAA 1P0IA 3A1FA 4G09A 1C8VB 4B0OA 2F64A 3S4YA 2WFZA 1B6RA 3RU9A 3H7AA 5LB4A 5FUMA 4L4YA 5JW6A 1VRWA 3A0RB 4X3CA 5AK6A 4AZ3B 1T1RA 4NFYA 3W3ZB 5DN9A 1QH8A 1NU8A 3NUZA 2NU9A 1J4AA 3K3PA 3P27A 4NQZA 3CR8A 2XVMA 4X84A 5P8WA 4CEJB 3G5AA 2Q49A 3EQ6A 4LOKA 3ZVNA 3NWJA 4B5KA 4RDIA 3L6DA 2KHZA 1HUQA 1D4OA 2FPGA 1ZIXA 5E1BA 1MO5A 5G4KB 4AL4A 4B6EA 2VH2A 3RQIA 3UXMA 3ZPXA 4K8RB 1J06A 1NDQA 1NHWA 4EO4A 7GPBA 3DKKA 1TW3A 5KX5B 3I6YA 2W2PA 2X9LA 1J42A 1DPFA 2M98A 2W6OA 3D7LA 4IJ6A 3OURA 4BGDA 2D1YA 3KJIA 1H85A 1G8PA 1M8GA 4HLUC 1E3WB 2XECA 2BZSA 2ZCUA 1ZUIA 4PZDA 3AWIA 3CH5A 5AK5A 3ZCRA 2I29A 2P5TB 4DV7B 2CB9A 1CR2A 1E3DA 2HDOA 4P82A 5B1EA 3ZS9A 4BY9E 4BTLA 1PJQA 3DZGA 3CIFA 5TRTA 2R00C 2YDXA 4UQLA 3QYFA 3IT0A 3U81A 1B93A 1E2EA 2R8EA 1QC5A 3AESA 3C5CA 1V1JA 4QHYA 5KTPA 2C7OA 1FA9A 3HJAA 1PT9A 5D3QA 3H42B 5AT1A 2R6CA 1W4CA 2FPKA 4FFBA 3WC4A 3RVDA 3KUUA 2KB0A 1NF3A 4LE2A 7MHTA 4O4JB 3UFXB 4LJ5A 2VQ3A 1KEPA 2ZAMA 3CLTD 5B12A 1DX9A 3HVUA 1ADCA 1GDDA 1L5GB 2X0DA 3D0KA 2CYBA 4TUYB 4ZWNA 1U80A 3MWJA 3O91A 2JJ8A 4AJPA 1WXGA 1PR3A 3J81A 3C70A 2XMQA 2H1RA 3P2EA 3W9SA 2BGGA 5EZQA 1U7TA 1WVMA 1YZKA 2FPSA 4NYMR 1F5SA 4ZAYA 2REOA 3FF4A 3MK31 2DPGA 1Z2CA 4YRPA 1ZJJA 2FZVA 1NVMB 1KGSA 2QP4A 4TVKA 5FO0A 3VVLA 3AI1A 3V7FA 4U5QA 5FT9A 2JF0A 3IE2A 4BKUA 3P45A 3RSLA 4BJ3A 2AXQA 5AVUA 3DEZA 1HTBA 1PF7E 2X40A 3FMOB 1TQ8A 4DM3A 4YYEA 3C7DB 3L4BC 3V1YA 3KXDA 1EXDA 1JHAA 4ALIA 3FUXA 3AVWA 5EHQA 1PQWA 2NUBA 5EZ6B 2GK3A 1DV1A 1JFRA 1MH1A 4U2CA 3NC4A 1BN7A 1U04A 1MVNA 2YINC 4NCXA 4BLSA 3E5MA 3HCAA 4QUJA 3V8QA 1EUZA 1SCBA 3ANLA 5LC1A 2BP7A 1QB8A 3Q0EA 3LHKA 2IX9A 1N5OX 3WIUA 3B7PA 3DTVB 1UPFA 3DQPA 2V4UA 3ZDXB 5BOVA 4COOA 2DR2A 5EPUA 4E5NA 4LJ9A 2Z2JA 5HMLA 4R2IA 2RH8A 5LQKA 5IKXA 4CKCB 2ZJ5A 4BNFA 1UQRA 1ZHHA 2WPDA 3HXOA 4LN1A 4F12A 3WKCA 2P7IA 5CM2Z 3TLJA 3KZOA 4CMIA 4AYXA 3CPJB 2BCJQ 4KR6A 2I7DA 2Z8YA 3JQPA 3WLLA 4GXQA 2JIPA 3GCZA 2PGIA 1M6VA 3HYCA 5IC5A 4G1FA 2OFWA 1VTKA 2HBRA 2P2ZA 1H6CA 4DRZA 3EH1A 5AQ1A 1S7CA 1FP1D 1XKTA 4KTVE 4RFVA 4BNNA 4PAOA 2JVIA 1KP9A 2P3OA 2BCEA 2Y0DA 1LDNA 1D2RA 1FSPA 4A2QA 3GGDA 1AD2A 4ZEWA 5J3JA 2F59A 4PC3A 4TX1A 5DI3B 3EFOB 4O8ZA 5JSKA 4E2YA 5FAKA 4DV1B 3AHEA 1MO4A 1I32A 4PCLA 3K32A 5IJ9B 5TEVA 3WIVA 4HK4A 5FNZA 4U7WA 2R6R1 5U1PA 5AYVA 2G04A 2XCQA 2QD2A 2RBGA 3MMSA 3A1DA 3UZUA 1JBEA 2AS0A 2G5CA 1DZ3A 1T1SA 1DAIA 1TCBA 2QI9F 1PR2A 3PGVA 4L0DA 4E33A 6AT1A 2GD6A 4N3GA 3K0CC 4I1OA 2PNJA 1U63A 3GP5A 4EL5A 2WSMA 3U7IA 5TF4A 1CY6A 3E3NA 3STYA 3WKAA 4A15A 1J20A 5TMEA 4MO2A 5BWCA 1TMGE 2XCIA 1V8PA 2GEBA 2BTQB 2QQ0A 3PQ5A 1YB7A 2O9JA 5ED0A 3EPHA 4FFWA 3CA8A 3KQNA 2J30A 1Y9AA 3W7VA 2XTJA 3GVHA 3TNYA 2ACEA 4RCZA 4OQQA 3ZR4B 2XIJA 1EP1B 3EZXA 4DLAA 3I0MA 1V0JA 2BLNA 2ZB8A 2JZOA 2R68A 4WGGA 3U3RA 1W36D 4HFNA 1YMUA 4OY3A 2HJWA 1GSOA 3RS2A 5LD2B 1QFMA 4LMAA 2VR1A 1ZC3A 4LZZA 1SCDA 1W19A 3ZV5A 2WU0A 2I2BA 4FCWA 4X64B 1V5WA 4BE4A 2OZVA 3FOFC 2PV0A 4M38A 3IAHA 2ZBQA 1W6RA 3R24A 2NSJA 1N6RA 2BE9A 2FPXA 3D64A 1F38A 5FTMA 5JI3E 1F2VA 4C0WA 1N6IA 3AZOA 3DBVO 1AHHA 3Q6IA 2X3FA 3V55A 2RONA 3QVGB 4JL8A 3H9QA 4C29A 3PRHA 2HSJA 2NACA 2W37A 2CHFA 3OTOB 2CHVA 4AO7A 2XCRB 2V7UA 1CC1S 3IB3A 4UMVA 3ZHCA 5ILOA 3PHJA 5C8YF 1PS8A 4GP9A 5KQRA 1AQJA 4JP1A 4KFTA 1AQ6A 3ZU6A 3QEAZ 3PXXA 4DBLE 4DNQA 1V9CA 3ZNQA 1IN7A 1U8TA 2X42A 2BFNA 5GZ6A 3BJRA 4JUCA 3HNOA 3SOPA 1QRTA 2F1OA 3KXKA 3N3AC 1O0CA 3NOQA 3PWSA 2WJ3A 2OV2A 3RWOA 3JYHA 3QQ5A 4DMCA 5CM9C 4DXHA 1SZJG 1RMQA 3LDAA 1T5SA 2R62A 4FI3C 3B3JA 2F3UA 2V9ZA 1T9ZA 4KQIA 1RM3A 4QUKA 1DKLA 1DQPA 1WD7A 2D4HA 4J0IA 4NBKA 2ZUSA 3AJ9A 5CDUA 2EX0A 2PUGA 1IUOA 4ZRNA 3PNQA 5JMWA 2BAGA 3GZNA 1U1EA 1T9BA 1Q44A 2P75A 3NBYC 3BFXA 4R3UC 1MD9A 2OPBA 3PC8C 5BYAA 2BDTA 2OXTA 2CE7A 3ITKA 4J1QA 3B3QA 3BL6A 4WA7A 4TKUA 5KJEA 2AXPA 1V4BA 4EW3A 1S4QA 5HGJA 1VSTA 2Q3BA 2WQZA 5I5EA 4HEA6 2E1PA 2NQTA 5TQ2B 3OJXA 4XAQA 2SNIE 3UK1A 3LUFA 3TNDA 4CIAA 4PZ9A 4JQZA 4EG7A 2OCBA 2ZYAA 4PSDA 1Z75A 4IIVA 4WJKB 3LPMA 4M53A 4X8OA 4IG9A 2Q4OA 1QGUB 1SWVA 1WW8A 3GCGA 1SUAA 1Z83A 3FW1A 3M6IA 3HV0A 3MTJA 3N05A 1WL8A 2O2SA 1RM5A 1QGYA 1ZK1A 2EJCA 1E9FA 2PUHA 4HYYA 3RRBA 2WDPA 3CF2A 4TQ9A 2COKA 3E22A 5BRAA 1NMYA 2ECPA 3N6RA 2J3JA 3QGMA 5K0JA 3MJCA 4G0NA 1UBLS 4UDYX 1BQ4A 1W73A 5IAOA 5IVHA 3L8HA 1PEAA 1DC5A 4OFWA 1PHRA 3BXFA 2ERYA 3OPQA 4Z1MA 2W00A 4KBYA 3RPEA 1PFKA 3D6AA 4BLVA 3B9PA 2XXBA 5C7LO 5FWNA 4E1AA 1GGNA 1RZVA 2ACWA 1E7SA 4FEGA 1XP8A 4L22A 3D1JA 1Q16A 1N2IA 1PBTA 2R1UA 1NMEA 3T1VA 1FUIA 5BSFA 2OV4A 4A6EA 2ZYTX 1UBKS 3COWA 4NJMA 4YP1A 3NUGA 5I7WA 1PGOA 4TS9A 4YPFA 3PNOA 4F2GA 2AC7A 1YQQA 3TZBA 2JD0A 3FKSD 4YDHB 3SDSA 3UPUA 3CEJA 3NWPA 4MPTA 5CB6A 2AGVA 2BMVA 5BOSA 5IU6A 3ICEA 3SIXA 2C8LA 1GNSA 1JV2B 4FMDF 4GYJA 5DM1A 3CZQA 4Q15A 1PEYA 4BVFA 1Q7BA 4Y1RA 3GG2A 3AO0B 4I5DA 4EG0A 1NI3A 4K9KA 2HMYB 2GN1A 4DR4B 4XWGA 1SXQA 2O2GA 4BIIA 4AZSA 4B8WA 4DAEA 3GFFA 5LFAA 1N9ZA 2O06A 3GJ4A 4JI8B 1JEEA 5J4VA 2OMKA 3BGWA 4MB6A 1NJ8A 3IPXA 2IZ5A 3RJZA 3G49A 3L4EA 4IZIA 4LECA 4EWLA 3FTQA 4KPYA 4LCJA 4BLRA 4F86A 1CDDA 3C1OA 1IBCA 2X13A 2BR3A 1HDOA 1AKYA 4DWVA 2NZYA 4F7DA 3E3LA 5HKAA 3OZRA 4OLAA 4ZHQF 5BN3B 4DNPA 1WULS 1VLJA 3C8HA 1YZNA 5FHRA 1QLHA 4P7KA 2YV4A 5GP1A 1E61A 1N2BA 1ODJA 3WGMA 3VR4D 2P62A 1LVUA 2I33A 2BJVA 4RD2A 4WXEA 3VNSA 1R4AA 4C06A 4HNUA 5BXYA 4B3RB 2I8CA 3EVEA 1GCIA 2HMVA 1RHKA 4JH0A 1KP3A 4ME6A 1NFRA 5E6UA 1KFBB 4EB3A 2QZ9A 3I9V6 2CCGA 3JU3A 4CM9D 1T9AA 1CUIA 1QRDA 1W75A 5DTEA 3ZZMA 3P9KA 1KAOA 2K6GA 3JAWB 4HPXB 3RNOA 1CD5A 1L0BA 1CZNA 2DHRA 4OOFA 3NIGB 5ILQA 3WLIA 4F5EA 4OMUA 2XCUA 1UQTA 3CG4A 2HHLA 4BYGA 3LWNA 2J7PA 3CX6A 2JFGA 2B8WA 4GZLA 1WVGA 2ZYHA 5AW1A 3L05A 4HP8A 4LPSA 2A9JA 3IIKA 3LT2A 3OTWA 1C2YA 4R1NA 4ZGGA 5JSZB 1V4NA 1W5EA 2ZYWX 4KQKA 4LZOA 1EDZA 1EG7A 4HDKB 1RKXA 3A36A 3ZIAD 1QPBA 1DKQA 1UXOA 2FZGA 1E1RD 1C7FA 2W8ZA 3RJTA 1BMDA 4TKVA 3OA0A 4I36A 4C07A 2ARKA 4FGKA 1X87A 2ZDQA 2J5QA 5AI8A 5EZSA 1ZUD1 4NCHA 2XTNA 4WBSA 1YOBA 1G41A 1ABEA 2JIRA 3AONB 1G16A 2FUG1 3OJEA 3L8MA 1Z2PX 1P7YA 1YI1A 1NNEA 2EDAA 3H3JA 4Q4LA 4C01A 4UULA 4CKEA 3CTMA 4G4SO 3ZCPA 5FQOA 2XOXA 3QFCA 4ESOA 1NVVR 2OUIA 3UG6A 2VT7A 1SUPA 4HX5A 4Q1DA 2PCJA 2O0KA 2VJDA 1ZQ1A 1YIOA 2IW1A 3OOHA 2OFOA 3K96A 1RPJA 1EP2B 2GR9A 3F8TA 1CZRA 3GU3A 1OGIA 3OZFA 1JTEA 3OQIB 4H6PA 3QHPA 2QYTA 4LY3A 3NORA 4XUEA 4LGVA 3WA7A 2QAJA 5M29A 1I1OA 4QGSA 4PO1A 2Y6UA 4YREA 4OHKA 4LY6A 5C80A 5GQSA 3QLTA 3EVAA 5A0FA 1XQ9A 3WV4A 3P9QA 3ROEA 1D7AA 5DLEA 3K2IA 3ROPA 3A6FA 3HB7A 1ZUNA 4X1KB 1NG9A 2GRUA 3MOGA 4C21A 4KQCA 2QRNA 4CLRB 2FR1A 1S8AA 1KIFA 1W0CA 1RKVA 3LG2A 4MVJH 4XKJA 3WDKA 4GX1A 3D0OA 1H6BA 2Y71A 3VSAA 3QMMA 5FTJA 3UA3A 2BFPA 2QI9C 5BV1A 4DB4A 3PITA 4KDFA 4KAJA 5KSWB 3B6MA 2QRHA 3N8GA 4EGFA 2I54A 2KPOA 1IQRA 1FU4A 2J45A 2X8AA 3FYUC 1U2QA 5DHUA 2WJJA 4MICA 1JKJB 1XD2A 3H8SA 3FOZA 4O4HB 4NU0A 4XYEA 5BV8A 2QX7A 5IHXA 1LX7A 3L7OA 3LY5A 2VTBA 1VCHA 1SUIA 1NKVA 2OD9A 3OT1A 4MWZA 1E2KA 3GN1A 4OI4A 1H0RA 1I1NA 2A1TS 2ZJ8A 1TVEA 1TZ2A 1W44A 3C85A 3DMRA 5K8JB 4EYKA 1D2CA 3VVCA 1RZRD 4D02A 4J3NA 3PUZA 3Q2OA 1WQ4A 3C2QA 2BE7A 5EUQB 3TDKA 1Y8QB 3NBAA 4GG1A 3PIDA 4NP6A 4XX1A 3KQKA 3OX1A 1X80B 3G8DA 4L07A 2IVFA 3I5AA 2I2DA 5JAPA 3A2NA 2OHJA 3HPQA 2VS1A 2C4HA 3V7WA 3RS8A 2F43B 4HZGA 4UMDA 3TUIC 1XNHA 3GEIA 4DQLA 4R0VA 1YQUA 2ENUA 3FOBA 1YR7A 4ZI2A 1Z18A 4OM8A 5ED4A 3DEHA 1JFLA 1N3IA 3DLPX 3U1TA 3V4FA 3UQZA 1BVYF 3V4VB 3KPUA 4KKVA 2AHOA 2HA0A 4LF6B 1HGXA 1ORRA 4RVFA 2QS9A 5DYYA 4WNAB 1AO0A 2Y1FA 1YS1X 4G5OA 2WJ4A 5CA1B 2HTFA 4NOJA 4Y9UA 5CW2A 3UHPA 3EB9A 4K5QA 4BMNA 3ZE0B 2PH5A 3TIVA 1DT3A 1O87A 1X7WA 5LLTA 1LK5A 2H5IA 4A0HA 4NBTA 2BEJA 3LGAA 4C0QC 3I1IA 3I8OA 3BXHA 5DHTA 4I8IA 2X1VA 4YT5A 4NVRA 3PFHA 3MGKA 4KMRA 1MH9A 3KQPA 1C7RA 1HQYE 1B42A 1PSDA 3KT8A 4I6JA 4BHTA 2VYFA 4H77A 5LZ4A 2KLHA 3EQ2A 1I1HA 3IOCA 3ZHYA 1YJBA 4LF7B 4DCNA 2IYPA 1CUJA 3ZE6A 4UTNA 1HKHA 1YL7A 3I9NA 2IEIA 1QCCA 4TKZA 3VAZA 2R0QC 3JAKA 3S3TA 3QEOA 3SXUA 1FE8A 1UANA 4IIJF 2ZETA 3M6AA 4JGGA 4L95C 1XTBA 3AM5A 2R97A 1RW4A 5B36A 2FWMX 3L82B 1IWBB 3GI1A 1K63A 1P91A 4RLSA 5FNVA 4HDCA 3TQTA 4AY4A 1GQSA 4FD2A 3AR3A 5GONF 1S2GA 2JGIA 1BQEA 3KSBC 1SAYA 1ZGGA 4NOMA 3SR3A 1L7OA 5F7XA 5C32A 3N2KA 1PZFA 2ZE8A 1TEVA 3Q3IA 3GX1A 4OIFA 3IEPA 5ALTA 2ZYSA 5I9SA 3V9AA 3KKOA 5EXXA 1TU0A 1H2BA 1KHHA 1FFXA 3TN7A 3ZBPA 1TA0A 2FE1A 2A0KA 2E48A 4OJYA 4US2R 2GM5A 3ER8A 1U7WA 4EBFA 2OLEA 4RGQA 3BJMA 3I2GA 4P0PB 1DI0A 2BFBA 1K92A 2QN6A 1EWRA 2OAQ1 1P77A 4LHYA 3L0CA 1JXQA 5EIBC 3X43A 4X92A 1TCCA 4URZR 1OBVA 1MORA 1TQDA 3AVPA 2FN4A 4JI3B 4HDNB 2DUUA 4WK4B 4M0CA 4CLOA 4PZAA 2YZGA 5LCXA 1DE0A 3BH0A 1R00A 3TRHA 2VQFB 4JLWA 2XUIA 4JYCA 4C6TA 5KMGB 4KSBA 5IBQA 2CLFB 3UMCA 4BJ6A 1HF3A 4DV2B 4QUEA 3B82A 2V6FA 3QHQA 1PSZA 5AJWA 5F2KA 3NCHA 4J7CA 2IZ7A 3DDNA 5LM3A 1KMHB 4DDUA 3DWGA 1T3TA 4M54A 3VZRA 4DR2B 3O21A 4N18A 4X7RA 1HZJA 2R8BA 1IJFA 3IQZA 3U3KA 4UBOA 1DC8A 2A88A 2NAFA 1E0JA 3MTEA 4CM4A 2BI8A 2FZ5A 3ENZA 1QHGA 4MWDA 3AYXB 1OD6A 2JLYA 1KR5A 1XTTA 5JAQA 1U8ZA 3VTAA 1P17A 1E3MA 3H75A 3TD2A 3HTXA 1VG1A 5HOEA 3R20A 4QATA 3UJCA 1YZUA 1ZGJA 3C87A 3REQB 4AUNA 1OU4A 4ZQHA 1BXGB 4J03A 3U7QB 2D62A 3K2BA 1MOPA 1WUHS 1EFPA 2ZB2A 4XJSA 5SV2A 5KQPA 4PRLA 1HWYA 2PSSA 3HKDB 3EOZA 1L5HA 3TM4A 3U48A 1SC3A 1FX0B 5DOVA 4A4DA 5CXQA 5EXDA 3KE9A 1VL1A 1WQ1R 4BO1A 2JS7A 4D9FA 2A78A 4RIFA 3F7NA 4JA2A 1F20A 1SKQA 1RCTE 2OVBA 1ISMA 1YR1A 2ADFA 4WCVA 4B45A 4MRMA 3H9JA 1TVKB 2XCTB 2WJWA 3N0TA 4LTMA 3FDXA 2UUAB 1DLIA 1VQ1A 2A7XA 2IHKA 3GAZA 1FQWA 1ECBA 2G1JA 4J0HA 3HSSA 3GVPA 5H4HA 4WEQA 1Z5NA 3Q9NA 5J23A 1OV4A 2FFHA 2DYKA 1P72A 1UBSB 4P4SB 3KXLA 4KQWA 4QZVA 3AHGA 3DA8A 1HZZC 4AS1A 2IE8A 3QP9A 1MZVA 4ZZ2A 2X8LA 3KAKA 3FPHA 5IH7A 2Q5JA 3IBGA 1VSBA 4HTFB 2ID4A 5JZVA 1BX0A 2R9VA 1TF5A 2YWCA 1SD5A 4LV8B 3L7LA 5HF9A 5KJ1A 3I2HA 1Q2UA 3E84A 3D5TA 3EA5A 2BW0A 3DVSX 4DILA 2VP0A 3EGDB 2XLCA 2A0WA 3PNYA 2Y67A 4WZBB 2ZCJA 2AUTA 2JAWA 1G17A 4G6ZA 5DXJA 3V6MA 1E4EA 2CFSA 3HABA 2R4QA 1H23A 1KJWA 1RCUA 1OIWA 3IILA 4G4SP 2PMEA 4AROA 4B9EA 3K72B 4HTAA 5JR3A 4BEVA 3PUXA 2XXAB 2UXDB 2PWBA 1MABA 4UTOA 3ICPA 2CMGA 2NQ2C 4J16C 5FYDA 3DAOA 3VNQA 4BZXA 4I1IA 3JV7A 4MVXA 3HCEA 3BJEA 1CPYA 4DOMA 4NE9A 4UXIA 1QHIA 3CB4A 2VJNA 4AWXA 1MBZA 4N9WA 3PGMA 2W22A 1JTVA 5EJ6A 1DCMA 4UBKA 2GDZA 1MHPA 3WDLA 2QTAA 4BB9A 2IWHA 2HK7A 4C30A 2BKVA 3QMPA 2ABWA 1JFSA 2K87A 1COWA 1MX5A 3OEED 1PYOA 1S2NA 3ETEA 1KEKA 4GPTA 3QPVA 2QUKA 2GPTA 1XQYA 1P2DA 2E6KA 3BJIC 3G85A 1M1UA 4I1YA 5AKYA 2PKRA 5FTKA 1N8SA 1BCRA 1E96A 4Z3DA 3SC6A 3SDZA 2J67A 2IQIA 1ISFA 2GJ9A 2DPYA 2GHQA 2OO3A 3SQXA 3H11B 2EYUA 2ZTUA 3EUFA 1JLLA 4D4IA 2JHPA 1KZ9A 4NMWA 1LDYA 5C7OO 5TGZA 2PS9A 1I0IA 1IM8A 4H3HB 5CB8A 2I3GA 1NJ2A 3MVEA 4CT5A 5JZOA 2A9RA 4BDSA 3W1WA 4NFLA 3LZ6A 1J1ZA 3EXEA 3RYIA 2XA9A 1WW2A 1WUKS 3CX4A 4Y9DA 4E6EA 5KHLB 2DBYA 4OF4A 5GTDA 3D3QA 4H60A 2I2FA 1XGKA 3LQQA 1ZNWA 4MITA 3PLNA 4WXRA 4DDKA 2FMTA 5DNVA 1XBTA 2D7CA 1P81A 1IHOA 1LXCA 3GLHB 2Q5CA 2JJ1A 2DY0A 3DD1A 3GFBA 1HX7A 1M34A 5B2EA 4NK4A 1IZ8A 2ZGVA 3W2FA 1CQJB 5SYNA 4GOKA 3WSVA 4MVCA 1PW7A 3QWAA 4LF8B 3M6LA 3BTVA 4WGFA 2PXCA 4OHFA 2HZBA 2WKQA 1NI4A 4UHDA 4MV6A 1Q2XA 1JLHA 2D59A 1XDUA 4Y2UA 1AKRA 2GX6A 1WO8A 3EZNA 4BKQA 1ECPA 4YP7A 3ND9A 4BNIA 4DZTA 5LXTA 1JEYA 1DKPA 3GVIA 1V7CA 2BM1A 3TTSA 1XIVA 3FYCA 4J1NA 4P3NA 5EP4A 4WE3A 3L8ZA 3UUEA 3A6HA 2D1SA 5DW3A 2OBYA 3P5SA 2GCNA 3CUUA 3VA7A 4UM5A 2ZUTA 3EIFA 2WFLB 2QUBA 4H4DA 1KFCB 3QXJA 4AQDA 2AZXA 3Q7EA 4G0ZA 2A35A 2J0UA 3CZ4A 3OOJA 3VZDA 3N2YA 2QF7A 1JFFB 1IIBA 1OXBB 4B85A 3CBGA 4GI5A 5EWMB 5F2EA 4HRAA 4DEYA 1L8XA 1NC3A 4RC9A 1USGA 4Z9BA 3PTZA 2RHGB 2PL1A 1AS2A 2JDIA 2I7VA 3IQWA 1E5VA 2CVFA 3QVSA 2O50A 2YY6A 4JR2A 4DQVA 5JHGB 1D1SA 1MW8X 3VFDA 4OAQA 1Q17A 1CYEA 4IQ0A 4ESVA 1YHNA 3TBFA 4Q93A 3F67A 4I2NA 3WSTA 5AHWA 4F7WA 2H57A 2H4WA 1QPGA 3BC1A 3OQHA 4C6RA 2CLHB 2EEZA 4GU5A 2B6HA 1MOZA 3VPDA 1S2LA 3EVZA 3DAYA 3TXXA 1U2GC 2FDCA 4CNQA 2ZLBA 3SY8A 5BSVA 4RHCA 4GLBA 3AP2A 4CV0A 1Z3CA 5BSEA 5FWAA 5LP6B 3B6EA 5JPIA 4Y2GA 5IZCA 4OQLA 2HF2A 2XQVA 3VX4A 3I09A 1XMJA 1VJTA 2PD6A 4NU6A 3VC7A 4ZCPA 1E89A 2GPJA 3AF3A 2YWRA 1FP7A 1YZYA 2D5IA 1Y4SA 4M3NA 4OH1A 1T8WA 5E9AA 2Y1LA 3ZYZA 3DS8A 1AZTA 2D3TA 3KR9A 8ABPA 3I42A 4LBYA 1SBYA 5B1IA 4HGQA 1QIJA 4LMPA 4F1JA 2OZEA 4JI7B 1EXMA 1OWPA 2NUPB 3UTCA 3ADDA 2AK2A 3QE4A 1II8B 4G0VA 4PQYA 3TLAA 4AJ1A 3V42A 5J2TF 5KYYB 3HMQA 2ZTHA 2IKSA 4M1SA 5C3UA 5IFLA 3K5HA 4B3IA 2Z2IA 2ZJBA 3DL2A 2FKNA 4PFSA 2FEKA 4PYJA 5JE8A 3L7AA 5MN4A 2FFRA 4DIUA 4JBYA 5EAIA 1BX3A 3DNMA 1U8CB 3F90A 3RBXA 1PJZA 1SY7A 1IYZA 2WSSA 1J7JA 4B6PA 4BO6A 5CVTA 3TIXB 2F17A 3A7EA 3GYGA 5D3MA 2YMMA 1UKAA 2O48X 4Y6PA 2WQ7A 3ZJVA 4XTRA 1OC4A 2G3YA 3GPDG 4CR7A 1JEDA 4DCVA 4Z4FA 4B7CA 1LC0A 4DA0A 2C82A 2WC1A 1NBMD 3C1UA 3P0JA 4JP3A 1WHSB 4OHXA 1ZCJA 2UVPB 1P7VA 2FR0A 2YYSA 3GGJA 4ZK2A 2A9OA 4F9GA 2ZATA 2E5LB 2IUSA 2A59A 2R8ZA 3UJDA 3RSQA 3ZDRA 2XB9A 1FTWA 1KMMA 2OKCA 4BPBA 3MG9A 2GKGA 2QRVB 2QYHA 5A3QA 1VE7A 2UXBB 4S1WA 2V0NA 2BFDA 4GUDA 4YCBA 5GZ1A 5KNDD 5D01A 1YR3A 1QOPB 4V0LA 5HQ3B 4OU5A 2XOKA 3R8XA 2MINB 3C7AA 4GI1A 3VI3B 1BDIA 2Q2NA 3IT2A 4JI1B 2OZKA 2RB4A 3U9LA 1QIKA 4J1TA 3ZNOA 2Q9AA 3O73A 1N6LA 3TKYA 3NEAA 5HKKA 3QEJA 4TTPA 5JQGB 1V1MA 4DLLA 1NATA 4EB0A 1CX9B 1D04A 3GELA 4KWTA 1I7PA 1IB0A 2FMFA 1DAKA 3AB8A 3N0WA 3DKVA 3NEYA 2VAWA 4GL4A 2C3PA 2XKKA 3AM1A 4FYPA 4JBXA 3VO8A 5C18A 1N92A 2R5NA 3IQHX 2DRIA 3KQSA 2FXVA 3AM3A 2BONA 3NBKA 5DULA 4R9RA 1AURA 3ZH9B 4YT4A 2QXTA 4I3FA 5EZYB 1K98A 2Z9BA 3C16C 1JDBC 1RVDA 1LLUA 4YQEA 5D6OA 2VXCA 5FUYA 3T5PA 1NUTA 3FWZA 1SBZA 1BDJA 2YMLA 5AVOA 5A7HA 5C4GB 5K3BA 2VDOB 2O3JA 4BAGA 2EW2A 2QNIA 4OYYA 2ORIA 4ARZA 3WZ2A 3ZK8A 2X9QA 3LRXA 4HWSA 1A7UA 4QD3A 4FC6A 1LH0A 4MIKA 4CETA 4QU0A 3OJLA 2JAXA 2J3DA 4DC0A 1HFWA 4ZEOA 1GUAA 3FR8A 2FSGA 3CH7A 1BE0A 4DY6A 2BELA 3JQBA 3R0IA 5DLYA 2TMYA 5H83A 4CKXA 4HAZA 2EFJA 1BKYA 1EBUA 1VKHA 1M2EA 4ID9A 5H3HA 3VKGA 1KAHA 3JD3A 1QBKC 4TZTA 3BXPA 2R1VA 2W4QA 4FSXA 1USVA 3H97A 1T5BA 3EVFA 4AJOA 3P9NA 5LYJB 3VNUA 2JI4A 1HLPA 2WTXA 1TE2A 4B6OA 5L6MB 5LPNA 4NYIQ 2J9ZB 4JU8A 5FL3A 3X1XA 4ABTA 5T4HA 1S8OA 5J58A 2OCLA 4JBWA 4MV9A 5HTOA 3IBTA 1KU0A 1TTQB 4RNDB 1KI7A 2G0AA 2QAGC 2XYPA 2ZBRA 4L2IA 4BX8A 3JPYA 5DVZA 1TKAA 1V41E 3K9FC 3EDYA 1BH6A 4K05A 1VL8A 4IHQA 3BMOA 2AK3A 4WERA 3I72A 3WWDA 1AUPA 4K0KB 5BMVF 5CPFA 1NFFA 2J1LA 1RQGA 2QU8A 3OFND 3W3AH 3H5AA 5J2UF 2AXEA 3CUVA 3IE0A 1B00A 2Y2VA 1QHEA 2C9CA 1DEKA 2F3RA 2B7BA 1MX9A 4GZ6A 1BOFA 3RSSA 2FW1A 5A1JA 2DU8A 4AKSA 4NKRA 4ZVMA 3R9WA 1L5YA 2VATA 1SQSA 1K08A 5TR9A 4NYJR 3SR4A 1ST3A 1C9YA 2EKBA 1C29B 2UZ4A 3KE8A 2Q3HA 1QJCA 1O9BA 2RI0A 5DYWA 3K30A 1BDBA 2J87A 1L5OA 1QU3A 4W5HA 1H2FA 5HRCA 4YCSA 1SUDA 4JMLA 1LY1A 2GYUA 3A1WA 1MAUA 3SIRA 5CDFA 2OHFA 2XEXA 2I99A 1DQSA 3SE7A 2JGLA 4GX2A 5P21A 3TPFA 1X3SA 5A9SB 1H1TA 3NALA 1U0GA 3K5IA 5FUBA 1YQEA 5KQGA 4K88A 3U5ZB 4NENA 3W2TA 2ORED 3M3HA 4UZSA 4Z4CA 2D0OB 3PXUA 1TB4A 1G291 2PSHA 3LBFA 4N5MA 3IKLA 4L16A 2OK7A 2CUKA 2QN2A 5DE3A 1W6UA 3L79A 2C57A 5JYDA 5JAIA 1DC7A 4KVGA 1E2HA 1DT5A 1P39A 1NLUA 4X44A 1AGRA 3RVQA 1BWRA 5B1HA 3U6KA 2OAEA 2GCOB 2I4LA 4GPZA 3HEBA 4HAXA 1U98A 2W8BA 4IOLA 5A06A 4QNMA 1B0ZA 2OYRA 2Q7OE 2Q27A 2GO1A 4ZC1A 3ZIUA 1NE7A 2X6QA 2DLCX 1OYYA 1EHCA 3Q5DA 2ODPA 4NJOA 2Z6UA 2BEWA 1DBRA 2GFIA 4GBED 3HZHA 4JLKA 1C14A 4DREA 1Y37A 2GO7A 4PIPA 2HU5A 3WLOA 3T1YB 1FFDA 1MO2A 3GWGA 9LDTA 1RXVA 3FOCA 1Y9JA 4QL3A 4TMKA 4PQEA 1O0BA 2ZIXB 5J5VA 3QKWA 3VMMA 3LUJA 5H59A 4AI6A 4D0SA 1C80A 1ADGA 2YZ2A 3NAMA 3VVMA 2DPXA 2F1IA 1OW3B 4A2PA 4JXJA 1OCEA 2NU8A 4Q4CA 1WR8A 4FCVA 3NJRA 1CJVC 3P0HA 4KR0A 3TOXA 4LW8A 3ZE9A 1VMAA 2UUCB 3ERCA 5H0IA 3LUPA 3UXYA 3G0CA 3R6GA 2GHIA 3X1DA 4BLUA 1M0TA 4BJ5A 5B64A 1DUSA 1D8AA 1G6Q1 1MKYA 1MP0A 3PQDA 5CUQA 4F2DA 2PUDA 2XWQA 1N2SA 2WD7B 3L9XA 4NS4A 2QEQA 3SC2B 2EWVA 1AK9A 1Q0QA 2VPQA 2YVLA 4BB6A 5LJLA 3BQMB 1XE3A 1PR1A 3MGGA 4ERXA 3MJTA 5ALDA 3AH8A 4YDSA 5IAJA 4YX9A 4LY9A 1SXJB 2OQIA 2GF9A 2I2WA 2QD4A 4JJAA 4X1YA 3IKTA 3ZZ1A 3V2IA 1ZMXA 3H86A 2BIFA 1FOEB 4YAWA 1HMYA 4ZOBA 5HTKA 2IUUA 3C48A 4PANA 1O4WA 4A1OA 5DM2A 2H65A 4P81A 3R5SA 1JEAA 4XB2A 1N32B 2Q4BA 1Z2EA 4QFDA 5IYZB 3T38A 5EIEA 3E70C 1F2TA 2ESRA 2VTDA 1E7YA 2XYRA 3H7IA 4RXMA 3UT6A 4EI2A 1H8HD 4S24A 4TMYA 5FPTA 1JSRA 4ZIRB 1E6MA 5ICEA 1A04A 1HT1E 1QMGA 2Q2VA 2VXBA 4U00A 5BUSA 2H9YA 4P4UA 5IBRA 2HA6A 4EEZA 2ECOA 2NZ2A 1OF1A 1OX4A 4LJAA 1AA9A 3T3EA 2XKBA 1GGHA 1V39A 3SS9X 2EL7A 4CG2A 5HRAA 4LGCA 3OZWA 3AFGA 2ID9A 2RFLA 1U6JA 3RQSA 5ICSA 4HY3A 1OMOA 3UF0A 1YACA 3NR2A 3AHFA 4FQ7A 1H1LA 4W7HA 1E2PA 1OTHA 5KPJA 3SSOA 1EDEA 3V4RA 1VKZA 2VAMA 3KS9A 4MS1B 2R6GA 4KC0A 1UH5A 3MWEA 4HLCA 3Q3CA 4G0YA 5LMUB 4Z99A 3DPUA 1VC2A 2ODWA 4X20A 3SX2A 5AW4A 2WA2A 3HYNA 2VPTA 4G1CA 5AI0A 5DBIA 3OE4A 2K7ZA 3N87A 3MWDA 1ONBA 5ALPA 2IP4A 4C7VA 4BQNA 2P9GA 4Z54A 1SHLA 2ZVJA 4Y6QA 4ALLA 2FHSA 3B6JA 1GILA 3DR5A 5IMBA 4A27A 1KOJA 1D2HA 1UADA 3M1AA 4ND1A 3IO5A 4K9RA 1QQ6A 3RFUA 3T3DA 1YS4A 4JJKA 4UHJA 2Q3MA 3I73A 3LH5A 4MV0A 4V24A 4DQDA 4BBZA 5LQAA 2Q5FA 4BO4A 4XB6B 1ND6A 4YASA 4LBZA 1Y6QA 3SXJA 5JYCA 1OLSA 4BNVA 5EJ9A 1RAGA 3RB8A 5TDHA 1AT1A 3D4IA 2RHBA 1PT7A 3MXOA 2Y68A 5ITSA 2H4FA 1QP8A 4EI7A 4R54A 3THYB 1K6MA 1KDPA 1PDVA 2CXTA 4M9XA 3VMFA 4Z49A 1IAVA 1CNMA 2ZIZA 3GPCA 4UNIA 3GLFB 1V6AA 2JARA 3IJEB 4OXNA 3U31A 2PJZA 1SC9A 1RRVA 2AQKA 4HKTA 4IJ5A 1T15A 3HB1A 3C3JA 4H27A 4LXTA 1R8SA 3BKXA 4ZT4A 2XVZA 2FMIA 3EWAA 3T52A 2J46A 2WFAA 3ZC3A 1XJ0A 3CLUD 2LZ0A 1IN4A 4S35A 1NF9A 2YWHA 4FUQA 5BY2A 1QIHA 1ZSVA 2RJ3A 4EG6A 1QX3A 3BAFA 4M83A 1LKZA 4KQ1A 2Q6VA 1UFKA 1F5NA 2YVUA 2GK4A 4W1QA 2QLMA 1PBNA 5AM3A 1O7JA 3RS4A 2DFLA 3D31A 5A62A 3EIEA 1R18A 3ST7A 3RSZA 1U9JA 3R7FA 4FWTA 3BK1A 2HGZA 1N5RA 1GGVA 3KZNA 2OGSA 3S8MA 1FPMA 4ND3A 4M86A 3O31A 4CMEA 1ZMOA 1NA5A 5J59A 1K7XB 3G8CA 3A26A 3G0BA 4MXDA 3U9TA 5JISA 1OH8A 3N39C 5FEUA 5FX2A 1Q83A 1EFUA 2Y76A 3ESYA 3ILYA 2PS0A 4PHFA 2JCSA 5FLXA 3M6XA 3V1NA 1A2QA 4UHHA 5F98A 2AFVA 1F7UA 3ZDAA 4DPMA 1T6ZA 1OAAA 1MOQA 4XB1A 4ES6A 2EBHX 3ISTA 4O0LA 1L6IA 3D7MA 4HS9A 4LF4B 5EJIA 2C5SA 1PFUA 5HPYB 1K6JA 3LO5A 4PE5B 3SF8A 1W4LA 1PL0A 2Z43A 3HCRA 5KYVA 4A8JA 4QVIA 4FIZA 3HJTA 5HJ5A 3KKEA 2PCLA 5DRYA 4CMAA 2Y2UA 2WKPA 2XQJA 5AM4A 4XGKA 1MUUA 1RXUA 3PEVA 4MYSA 1CRLA 2C84A 2H1HA 3ITEA 4WY2A 4JBNA 1XMSA 3TVDA 2JKVA 4GRAA 4KL8S 3EQ7A 4ZT3A 3OJWA 3CZAA 2FSVA 3PRYA 2O1XA 2UUPA 1RRFA 1TJYA 2Q6IA 3AB7A 4G1VA 5HR5A 3LNTA 3DF9A 2BR4A 2I6FA 4LJKA 4R1SA 4W8GA 4UZFA 1QDLB 1NVEA 1YE3A 1Z7GA 5DHQA 5ER9A 3VYVA 4OHOA 4DMLA 1XL1A 4HBZA 3HB5X 4QOFA 3BB3A 3EVBA 4K6FA 3LC0A 1A71A 5JDCC 3T4UA 3ENNA 3I6MA 3IJRA 3ZVRA 2LKDA 3BRCA 2DFNA 1D8TA 1SCNE 4C4YA 3RLFA 2PIDA 1E79D 5DGXA 4KX5A 1DWQA 1YIAA 4ALMA 2QP9X 5JCZA 2N46A 3G1WA 5CR9A 1M2JA 3KFXA 4MWSA 4MPDA 5F3RA 4C7JA 5KU1A 3IUPA 4HWPA 4WZBE 2H4XA 4GBMA 1HQCA 3FYTA 3D2CA 1U3DA 1P7CA 3LA8A 4WT7A 4F21A 5T3UA 3A1TA 3HCPA 1E6LA 2R84A 4R9UC 3FROA 1POWA 4CVNA 1E8NA 3NLLA 1KYZA 1WETA 1ID8A 3SZRA 2CHUA 4OO3A 2W2MA 5BSGA 1RADA 4EW2A 3A4MA 3M6WA 4D9CA 4PICA 4L02A 1QF6A 1FXWA 3IAUA 3VYTB 5DSXA 5HCUA 4AF6A 2XGGA 3GRFA 1FTGA 1F4LA 1KVRA 3AZQA 1M8FA 1SXHA 2QSUA 3P9PA 4L73A 4FNAA 1X92A 3E23A 4UREA 2EGGA 3FLMA 2QUZA 4BKOA 5HZGA 3HKCB 1B2RA 3RYFB 2VDKB 1QUEA 3VU9B 1BU5A 2IIBA 1PFWA 3LLCA 1AQNA 3T7KA 1E2MA 4DADA 1ZK0A 4NPCA 1DWOA 2OK8A 3ECAA 1K68A 3I1FA 1KSHA 3LX4A 1JJBA 3B9QA 3R9XA 4ZCSA 3QOXA 1JR3D 2NSDA 3LKDA 4WH0A 2Z09A 3LXUX 4C0SA 4PRYA 3WOHA 3RUCA 2UZ1A 3W9UA 5IT9A 1JYSA 2XQFA 4YWHA 1D2MA 1X15A 4OH7A 4PC2A 4F8JA 3FZGA 1EGMB 1NZDA 1REQB 2X86A 3DZ8A 4TMZA 2ERXA 3T9CA 4CG3A 2ZRGA 5FP0A 1PR5A 2X76A 5LNK6 3ASUA 3ANNA 4EUSA 1SCAA 3KPYA 4Z7OB 2VNHA 4Y7CA 4MR8B 4FYIA 1FEZA 3THWA 4JVNA 2FHPA 2G9RA 5JS7A 1IB6A 2BSAA 2ZRBA 1NL3A 5F3DA 4HLQB 3G7NA 4MUEA 1T9DA 5KCMA 4P98A 4UMFA 1U3UA 2FCRA 1L2TA 2OEPA 4K7JA 4AY5A 2ZP1A 4N7RA 4QEDA 4JL6A 2VTEA 2OY0A 4R3NA 4UUAA 3MWGA 4KODA 4CDRA 3S2YA 1GY8A 4D9MA 4J49A 4B74A 4CKWA 1B0UA 2AFHB 2CVOA 1N6OA 3IA2A 3LFTA 2IV2X 5A3RA 4PONA 5K1ZA 4ACBA 4B3DA 3FOEC 1H2ZA 1KTIA 4L4SA 2ASEA 4DCJA 4POOA 1UC4B 5DEIA 1G8MA 3RRZA 3VI4B 4F3KA 2PAAA 1TLTA 1A8SA 1OR8A 1T1GA 4B81A 2XNJA 3L5KA 2H4ZA 4NNPA 4ETNA 3N59A 4IDOA 3AKYA 3NHZA 4Q9HA 2G77B 3V7UA 4AWAA 4N0MA 3D4PA 4D3SA 2HRBA 4OK5A 1DEOA 3U3DA 1RS0A 2BCGY 5BQOA 3E35A 4K0RA 1CETA 1O9HA 1CR6A 2UYQA 2VSQA 3EZFA 3OECA 4NCBA 5I7SA 3HCFA 2Q1TA 3LYAA 1G7RA 2YVQA 5U4QA 1ZIOA 4B3GA 1XZGA 2LBPA 2PLNA 2RHLA 3SJUA 4CTKA 3ZHXA 4WHMA 4IIYA 1R9MA 4M9RA 2IU0A 4W1RA 1E1CB 4P86A 4QFCA 3ZHSA 1XFAA 2NZWA 2DC1A 3B20A 4BNTA 2PTGA 4NL4H 1XWFA 3PUIA 3PF9A 3PC2A 4YMGA 4YRFA 1A27A 1EX7A 2O8BA 1OOEA 1VJ0A 4PGMA 4XFKA 3UKDA 1T2AA 1V35A 821PA 5K7SA 3FGZA 1Z4MA 1NV9A 3WWOA 4M7WA 5F5LA 1M6EX 1YZ3A 3F6PA 3VZSA 3X0DA 2PPVA 2TSYB 3IC5A 3JQ7B 3RIYA 3ZWCA 1T3LA 1GL6A 3CUTA 4A0QA 4DIMA 4IFBA 3RU7A 4G36A 2II6A 4RMGA 3SK0A 3VSEA 3RCBA 2WWGA 5LQNA 4MVJD 3QF7A 4B80A 2VJLA 1JG3A 2PKQO 3KLMX 3R6LA 4Q3KA 4BJHB 4HJRA 2LVBA 4ASUA 4P3KA 4ZCIA 2ADMA 3DGEC 4TWIA 3FCEA 3TKAA 3MLEA 2E4YA 5A71A 5CA0B 3IOEA 3AEUB 5GPBA 2AKEA 3N3BC 3U44A 4FGLA 3K70B 1YJ5A 3SN6A 3VHLB 1UZAA 2FPRA 2DPLA 3I9MA 3OT4A 2JFVA 3DBHB 1VL5A 3PNLA 2WG1A 3RJ5A 4WBNB 3CX3A 3AR8A 2FZ4A 3O4FA 2FAXA 3IJ5A 1UZMA 1DO8A 1NQVA 1RBYA 5KTSA 4LF5B 1SVUA 4V1CB 1RWMA 3H1TA 1UMCB 4ZVVA 4H59A 1QONA 4UUQA 5E7IA 3DZKA 1LTHR 4EYOA 4G9GA 1Z6AA 1JHQA 3PDHA 4Y6SA 1DUIA 2ZSIA 1FDSA 4ZDKA 3TR5A 5KUTA 2FOLA 4UDNA 3OCJA 1H5QA 2X0NA 4XWTA 1CHDA 4ARCA 2ZKLA 3I4CA 2ZJ2A 1NY6A 3CVJA 1DCFA 4B3CA 2RK3A 4NNJA 3GL9A 1D1QA 1P7PA 5ITZB 1QH0A 1W94A 2FFBA 3JALA 5B1DA 2GTHA 3VC2A 1WY7A 3W2HA 1JR2A 3M4JA 3ZXYA 1JH9A 4QU9A 1NGSA 1ODLA 2FEMA 3L1HA 3M5WA 1U0JA 3TQQA 4RTLA 2VPPA 3OEHA 5I7VA 2PO7A 3ND6A 3E61A 4LXQA 2W6NA 1WU8A 2IP2A 2XDWA 2CFCA 2FEOA 2ETXA 3LFUA 4MOWA 1LK0A 3L8CA 4P7FA 4RBNA 5IEBA 3S2FA 5LWHA 1MRSA 3N2EA 4C3ZA 5FUWA 4C14A 1IPEA 2H4JA 2HRQA 2VPIA 3L4JA 3K6SB 1KNQA 2NTNA 1KRWA 4M76B 3P96A 2HADA 4ND4A 1C1XA 3EFEA 2YIJA 1OLXA 5IN4A 3VNVA 1F4PA 3QIVA 4YJ3A 3U61B 4FYVA 1UJ2A 1RWOA 4IILA 3DBOB 4YRMA 1K6IA 1UJNA 2VDVE 3K4HA 5E38A 2W2OA 2ANBA 4O0MA 2VRCA 2RK6A 1V16A 4H6WA 5A4DA 3P4UA 4LMBA 4ZO6A 3KYCB 5HOQA 3BZBA 4ZTBA 2IDKA 1XN4A 4GPIB 3QW4B 5I9IA 2QTBA 3GG9A 2IQ5A 1XVLA 3NS7A 5LDGA 1TT5B 1VKNA 4QAJA 4UEWA 4ZOAA 3ZNPA 4FHFA 3W1VA 2J31A 5JNTA 1TX4B 3NH6A 4FEYA 3HS3A 4PVCA 2NUTA 3JSAA 1JIQA 3GP3A 4RDHA 3G2QA 4UAUA 4BMDA 3B36A 5LOVA 5BYJA 3BXGA 4NCNA 1QFSA 2WUGA 2O0JA 5HIJA 1VXRA 2BH9A 4XI9A 2IXEA 3CXRA 3L01A 4TV8B 4UE2A 5H5JA 5TT1A 5LMZA 4E5KA 2XF2A 2HBZA 1WUTA 2HREA 1FFBA 2CDCA 3QNMA 4GL2A 3MIZA 1CEXA 1QCDA 4CMKA 4HDAA 2JIBA 1Z68A 4MZDA 4ID3A 1NYLA 2JBAA 4O5OA 3H2IA 3MT8A 3CRQA 4I3GA 3RYHA 4DMUB 4AMYA 4ZVPA 1H1DA 1Z33A 4CIWA 4UXJA 5DM0A 1E94E 5K0SA 1YCHA 3GFPA 2XYVA 5TPZA 3OD5A 3IUSA 5FR1A 3OPMA 1XHEA 4D96A 3X1MA 4JJ6A 1ARZA 4RF2A 4OGLA 4TM8A 1XCGB 1GT91 1VIDA 1UC8A 2NO4A 1A7KA 1SU4A 3CNOA 4FJ1A 3T7AA 4HUJA 1TYCA 3EGCA 3L7MA 4JENA 4XDHA 1NOJA 3F2VA 3ROQA 5JDIC 1R4NB 5L3QB 1V9LA 3GYBA 3KBOA 4R68A 5K3SA 5HJ2A 4AQ7A 2HN9A 2V96A 1T2DA 4I55F 5AH0A 5FXMA 3U4DA 1GGMA 4X71A 3OHMA 2VHYA 3GRVA 2Y1EA 4JCOA 5DBFA 2WKSA 3IV6A 3RWMB 2Q5LA 2PMDA 3EZ2A 1JB1A 1Q6YA 2YS6A 2NOAA 4TMVA 1Y42X 4NE7A 4X97A 4YUVA 1OWNA 4HGOA 3FHJA 1BMFA 1E98A 1R6VA 1L5MA 1PV2A 3ZWWA 2O8EB 5AJHA 2ZDHA 4EKYA 4UHKA 3K70C 2XGOA 4HYQA 4KDRA 4WDQA 4ZVSA 4RTNA 1Z13A 2FMXA 1Z6TA 2WF7A 4N39A 4I3HA 4CQMD 2PANA 3C8ZA 5LZ2A 1S96A 3FVQA 5EYPA 1SGWA 3JATB 4AP5A 4RIGA 3FSGD 3E2PA 3QMWA 1YI8A 4XIYA 3E9CA 3JD4A 2DWUA 5AXDA 1YKGA 2VP6A 5LVAA 1NJGA 2VH1A 3DHWC 1ZBQA 1KJYA 3EPJA 4C88A 1LBHA 1OH6A 4PBRA 1GTJ1 5FNVF 3TFWA 2DECA 4OQEA 3KQQA 2VBIA 1GZ4A 4M1WA 4D9EA 3OIDA 4WOCA 2WF5A 2H9AA 3GUZA 4AP9A 4L5BA 4E88A 2NTJA 3TNJA 3G82C 2WZQA 1VL2A 2IX3A 1CUWA 3FOWA 1VE3A 4U4AA 3ZI4A 4UVIA 5KNCA 3BT7A 1XNRB 2G83A 1AKWA 1XLVA 2O4CA 3H1BA 2I6XA 1ZH0A 3FPBA 3PNVA 5BNFA 3FTFA 3ZU2A 3MHTA 5CT9A 1VHLA 3T0GA 4DFDA 2D1QA 3N70A 4DYVA 3DEIA 3IPYA 2PLFA 1UKZA 1FQJA 1U3CA 3ZDQA 2QM3A 4DSAA 1J5EB 1OKKA 2X4DA 2VOJA 2P67A 4GE0A 3Q41A 3RBZA 3U80A 3B8EA 1LQUA 1D5WA 4RZXA 4BX0A 1T4GA 4MRPA 5FJIA 2WOOA 3KDSE 3KHSA 3AKZA 1OXXK 1X2EA 1XRQA 2OAP1 4LSZA 3B48A 4HAUA 4CKZA 1N5IA 4CEIA 4O4LA 5BXQC 2P5SA 1E7QA 4YJFA 3NIBA 2IYNA 1Z5OA 2P2NA 3IEMA 3KOZA 5MFZA 2XHEA 4M1ZA 3AY3A 3F3YA 4ZU1X 2YHSA 4KN5A 2DE0X 4M1TA 1MIOB 2VTKA 3GT7A 2FGKA 1SVLA 4L3OA 4QRDA 4NAVA 4M36A 3TZQA 3LQRA 2BKUA 1QU2A 3K0BA 2AF3C 4WUTA 3NHJA 1EJ2A 1QRRA 3QLUA 5UKDA 4QQKA 3RSOA 5EIBD 5DDIP 2WP0A 1OSNA 4JUAA 4S1TA 3LBYA 1XT6A 3BGSA 3PK0A 4HMOA 2AB0A 1IPFA 3ECCA 3JYOA 5ECWA 4IEEA 2IEYA 2MMGA 1BAPA 4WESB 2QY6A 1DAPA 4XCXA 2BC9A 2P91A 3IUYA 3R0QA 1JN0A 3CKMA 4PX9A 4M9UA 4UHCA 4TV9A 4RFSB 2AG6A 3PTLA 3FRHA 3QVLA 2PKQP 1X7ZA 3L1VA 4TMWA 2J3KA 1U8UA 2IFTA 2ZKIA 4BFZA 1Z63A 1H9AA 2GN4A 3PWZA 4OU4A 3UBMA 1NN1A 1QZ3A 4ARBA 4FP9A 1O96B 1DFIA 3IHKA 3NUQA 5DNAA 3GC6A 1P33A 1Z38A 3KEOA 3LNCA 5B4TA 4WK2B 2EATA 1H8ED 1TYBE 3WK6A 1EXNA 3IP9A 1SXJE 3R0VA 2Q4TA 1Q95A 4KWHA 5AM0A 5ARDA 4DIEA 1VA5A 4RZHA 5G1NA 3COZA 2R79A 3CO5A 3S44A 2M6LA 2O8VA 1KEZA 2D3WA 4WW0A 5D5QA 1D0VA 3P0EA 3WHLA 3AEZA 5KYTA 2JLBA 4XDGA 2XITA 4R69A 4DC1A 2O5RA 5K01A 2WD9A 2OBMA 2HA2A 3U49A 2FSPA 4DE5A 1Y7IA 2QDXA 1ZGAA 2Q6LA 3QKSA 4XXHA 1OBOA 1W59A 2QM8A 2HEGA 1DRWA 3PNBA 2RHOA 4JL5A 4NCIA 2EZ9A 3TXAA 5I3ZA 4DLVA 5KTOA 1GV1A 1QDEA 2J0VA 1RXWA 1GKUB 2O6LA 4IZOA 3U09A 4R2MA 3IJPA 1GUFA 4PAMA 2IZZA 3D6NB 4UNQA 3ND7A 2J6HA 4FYYA 4JR1A 3CLRD 1SUFA 2CEAA 2F8MA 4O2AF 4QIHA 4JI6B 2FUG6 3Q8LA 3WFIA 4XSHA 2L69A 4IYRA 4LIPD 4TS3A 3M5DA 5D5PA 2ZB7A 4RH0A 2QENA 3PIRA 2RGYA 2YXDA 3HZOA 3C15C 5JSYA 4BXOA 3QE2A 2W4MA 4ZYTA 1DQZA 1RYYA 3QQPA 1QH9A 1I51A 1Z9BA 1KI1A 4EEKA 4CXMA 2Q3JA 2ATXA 3HJFA 4RQUA 3SYMA 1EH5A 1N4DA 5AUPB 2CB0A 3QWBA 5DFAA 2R1TB 1QHHA 1SA0A 3WYFA 1Z8HA 1ZD8A 3GUUA 1GQQA 4KDCA 5IASA 1ODIA 4PZZA 2YNMA 4CQLA 1A5BB 1DIOB 2JD2A 4KITB 2WWXA 1RCFA 2EKQA 5HS6A 7MDHA 2R86A 1IY0A 5HK8A 2Q2WA 1BMTA 5KJCA 1V1RA 4XDZA 4E31A 2QRUA 1P7WA 4ENSA 3DE6X 1N34B 4P58A 2AL7A 2PFSA 4MHOA 3U0VA 2VBCA 1Q1BA 1XL0A 3GGCA 5AVTA 1RPTA 4F56A 1WTCA 2WZBA 3TLGA 1V8DA 2XMPA 3PIIA 1RLTA 1EFCA 4TMXA 2VHTA 4HQ0A 2WR8A 2PBZA 4RVCA 5CFRA 3PE4A 5DMHA 2VF5X 4RK1A 3GMIA 3GLFE 2Q07A 3C6BA 1R5OA 3IV7A 3QBEA 4I5GA 4WXMA 3RF6A 3LOUA 4BQRA 3ETNA 5C35A 2C2YA 2A30A 3O3CA 3UJ8A 5LQRA 3JWJA 1E69A 1X7YA 4RFLA 1WOYA 2GD0A 1GKIA 4OGWA 4XOUA 1AY0A 4AMZA 4LFAB 2ZTMA 2VT2A 3MUOA 2RHMA 2GZ3A 2NV0A 2IK8A 3URKA 3IP5A 4ETWA 2HA5A 2WE7A 1YRWA 3QKUA 5CNKA 1NXPA 1H2HA 5C5IA 4K28A 3LW8A 3W8RA 3F5SA 5LXTF 1LFDB 4EYQA 1POXA 1E2BA 1R3DA 4W9RA 5DX8A 5I7OA 2BM8A 3EYAA 1BG6A 1T0HB 1NYRA 1Z5WA 1X1RA 5IN5A 3ZEAA 1GRRA 2D0IA 2WWHA 4ZOCA 5H4GA 3AERA 1EK1A 2FLWA 3GP8A 4GOOD 3SHTA 3W77A 1GYRA 3MF4A 2ISQA 4ZJZA 2P2LA 3ETJA 3DP7A 4OHWA 1R6AA 2VK8A 3QKTA 1RE0A 4FINA 1Z34A 1DOAA 1KK2A 1SZDA 1CE8B 1PVDA 2K5UA 3KV1A 4M9SA 1HYEA 4UARA 4WWHA 4E5VA 3PEFA 4CL8A 3MRSA 2GWHA 1GYPA 5EPEA 3FR7A 1N2HA 4G5RA 4RY8A 1MJGM 3I2IA 5IJ0A 3ZD8A 1UJ5A 1T35A 3H99A 4WOBA 4BLPA 2Z8ZA 4QYIA 3KYDB 3DMNA 3EY4A 2MSKA 3DHNA 2I67A 4RY2A 5T7BA 3VUEA 1KY5A 5H16A 4KH1A 1N1EA 4HLNA 5CCEA 2H5LA 3HJCA 3DZDA 4M9CA 4BGUA 1JL3A 4C4PA 5AJTA 4D6XA 4RM2A 1A9XB 3K0FA 3OUUA 2MYUA 4Q1AA 1V8BA 4QUDA 1BXRB 1Q0SA 4C4TA 3GRAA 4EY7A 1DMSA 3SZMA 1WZCA 1WZEA 1ZA1A 3LF2A 1IRXA 3DFKA 2ID8A 1UKCA 3ELUA 3NAGA 4JLOA 3QU2A 4D4MA 1C9EA 5E9JA 4AIRA 4D57A 5CB4B 3WNZA 1MENA 4MDEA 3LY9A 4EHFA 3IAM6 4PZUA 1LSUA 2I4IA 5FHQA 4Y67A 3EMDA 3EUEA 2JC3A 4INZA 4KUEA 4R2LA 1R16A 4YV1A 1QR2A 3NWBA 1PJSA 4AZ3A 4C6SA 4EYGA 3EJ6A 1T8RA 2GCIA 1K7SN 3KG2A 3TFOA 1GPYA 1J22A 1L5QA 3D8TA 3AGQA 3VR6D 5LQDA 3QXGA 1FFAA 2ZTLA 1Y1LA 2KMLA 3TH5A 2BGMA 2OSVA 3ILHA 3N0RA 1MXHA 3SZOA 3CNEA 2O5CA 1J2YA 4FBLA 3Q11A 4F2PA 3ZWNA 1PTKA 1A9RA 3L46A 1NW3A 1TQ4A 3W7BA 2OBXA 4EX7A 1VYTA 3U4AA 3QK7A 5KX5A 1O57A 4TLEA 5JY1A 3TLXA 1ZN8A 2H1FA 3PGA1 4YROA 3RHTA 2H00A 4QM6A 1YVPA 1NJSA 3O38A 5TLSA 2WIGA 5IEJA 2YRXA 4L6CA 1W88B 4EI8A 1RD4A 1Z29A 2XIQA 5CDSA 1BWQA 1FLAA 3FIJA 1WDKA 2FW7A 1PR0A 2ZJ6A 4HEQA 4LOAA 3RK0A 3GUCA 2QM0A 4GRDA 1P1JA 1V96A 3ZK7A 5TJHA 3R1IA 2IEGA 1EQUA 4PHTA 5EFOA 1YA6A 1MJNA 3UWOA 5ITVA 3G2MA 3NGMA 4NATA 1E2LA 3OC6A 3QX8A 3CX8A 3CIOA 4G24A 4GKVA 3HI6A 2HIMA 5DGIA 3VPAA 2GBPA 2W6JA 3DDOA 4YO8A 4DVGA 3HXLA 5A2QA 1QKKA 1YL6A 2EQAA 3DVAB 4B33A 4GLOA 2ZRMA 3U4GA 1AC5A 3IKVA 4YAUA 4O4JA 4HAIA 2RIPA 4PFQA 4C0XA 3K9WA 4ZYLA 1XCLA 1A72A 1KY3A 3IMGA 5IXSA 2PL3A 5JSHA 2IYVA 5NLLA 3A4LA 3C4QA 3KAJA 3UPDA 3YASA 1YONA 3CJTA 1BHJA 5E2BA 4K9QA 2Q3DA 4AP6A 2AT1A 1RDFA 2J9YB 4I4CA 3X2SA 2ZAYA 3KYBA 3DVLA 2B1RA 3CNLA 5AIAA 4RJIA 3RTDA 1XTSA 3E8SA 3V00A 1G8YA 4KUHA 5AJYA 2HK6A 3FCYA 2X9GA 1K4YA 2C0QA 2POQX 2XA2A 2Q9BA 1ORVA 3UGKA 4YRGA 5IDXA 4X6YA 1JP7A 2JCYA 2UV8A 3IHTA 3FYSA 3NEJA 3Q3HA 2WUVA 4YK7A 5AKLA 3ODPA 3FSJX 1PJ4A 1PP4A 4OUKX 5K45A 5K3FA 3S70A 2EEPA 2DWOA 3O0TA 4N0QA 2QE6A 4WPGA 3NBXX 1YK0A 3JQ8B 5TC4A 3TI9A 5AUOB 2J9FB 2V7XA 4UTZA 3L0PA 2SKDA 1Q0TA 1VM6A 5AKZA 4N6NA 1RACA 2FK8A 3L8YA 3V33A 1JKMA 5M5BA 1WB9A 5CFMA 2J5XA 5EA2A 5HKOA 2ZI4A 3DTVA 4NR0A 3NASA 5HUQA 1G8HA 4QPPA 5DNEA 4LG1A 1U4NA 1DRVA 1JDUA 1MAVA 1ZCZA 2NG1A 3K0HA 3ORYA 4I9HA 1U3VA 1TO2E 5JWHA 2D5AA 4BBAA 3CVWA 1FW6A 2IIPA 2CJWB 1RHJA 1YA4A 2JGDB 3ANTA 4E5DA 1U2TA 2Q3EA 2WD8A 2IXDA 1JG6A 3MC1A 3RT1A 4TL9A 1DLJA 5I5GA 3OBBA 3IURA 3ZY3A 2B98A 3OKPA 4PQRA 4YMSA 2NO7A 2PL5A 1XEWY 3C39A 2BEKA 2B4QA 1S7GA 5KOIA 3GUVA 1KERA 4L8VA 4PCAA 2QUIA 5A04A 4RTPA 2D7DA 1VHDA 4Q4DA 2ATCA 4FZVA 4IF4A 5FWDA 2Q3FA 3KT6A 5EOVA 5HUJA 2YZ7A 3HY3A 3GJZA 1Z4KA 4TYPA 4XE5A 1SK9A 1M8JA 3JRWA 4M6WB 1UWLA 4HGRA 5AVWA 3DDWA 2HPAA 3B5IA 4IY1A 1KDTA 3E6AA 3HUFA 3CW8X 3KKZA 4AUEA 4BNKA 4RTMA 5CVCA 4KEAA 1KHTA 2I4OA 3BWBA 3RFTA 3WMEA 4F71A 3FYUB 1F1JA 5IC4A 5AI4A 2EBWA 1CP2A 5C7YA 4D8XA 3WO1A 1S4MA 2ORVA 3DQQA 4F38A 1FUKA 2ZFUA 4YLEA 5FOSA 4BDTA 5KINB 4JUIA 3VXKA 3UGJA 3AKCA 1FFCA 1W36C 1UP4A 1USWA 2N3ZA 2G9VA 3QFFA 4W5QA 3LY8A 3V1LA 4EZEA 1X3LA 1GL7A 1VYHA 3ADOA 5EMJA 1QE0A 5DM60 4LHWA 4JEUA 1UBFA 4X7BA 3GXBA 3IGFA 4DJAA 3T4EA 2CNLA 3C5VA 4P7GA 2V7QA 1X9IA 5IPFA 5BYBA 1QIGA 1TQ6A 3AR5A 3LDUA 3MD0A 3QJYA 2PUTA 3E7WA 5HK9A 2XNDD 2P9QA 2O3UA 3I6ZA 1E66A 3SC3A 2TMDA 2IF2A 3F6CA 2P40A 1EMDA 1QYXA 3OKFA 5EMMA 4DPKA 1QVRA 3VKVA 3SEFA 2RCYA 1DBQA 1GVHA 3WIDA 5MDHA 1Q57A 2EFHB 4LCEA 3KYJB 4C3VA 4JB3A 1I2CA 1XTPA 2B2NA 1X7XB 2WWWA 2ZJAA 2RBEA 3DMYA 3HA7A 4Y2RA 3NBZC 4DQXA 4JMPA 3HB0A 4WD3A 3CN9A 6ADHA 2O7QA 3UB2A 4LJ7A 4ZI7F 2PVCA 5FV4A 1SQ0A 1Z6YA 3F6SA 2EQBA 1MV5A 2Z1MA 1ENOA 5HQTA 2EC5A 3A4VA 3IR7A 4UNPA 4ZYZA 3DE7X 4Q6WA 1N7IA 2XWSA 3D59A 1M67A 3DMDA 3KB6A 3V3KA 3HU1A 4M0KA 3V8NA 1N2ZA 3BIFA 3LSYA 1ADJA 4C20A 2C2XA 3HFJA 1SR8A 3VQTA 3PKZA 4XRRA 4KR2A 4YR7A 2QW8A 3H9GA 3I39X 1NMQA 1JSLA 1TF2A 3O8OB 1R0WA 4OM7A 2V74B 3AVOA 1KO1A 3OA2A 4QODA 3TDMA 2R8OA 2PRYA 2VWQA 2YZMA 2H5JA 1P31A 1DFHA 2OP1A 4LMRA 5HGXA 3DW1X 1NXTA 4UM9D 2ZR0A 1VBFA 3GDHA 2QZZA 3GUHA 2OFFA 1C4OA 5K8UA 1DJPA 1H2EA 1KYQA 5FL7D 2JHGA 3O82A 4YJ2A 5BW6B 3ASVA 3DQZA 1ZBDA 2RHTA 2CMHA 1EFRA 4UXHA 1ICEA 5MN5A 3UFBA 1XPJA 4JLNA 2C0PA 3QTBA 4D81A 4JKOA 5JASA 3M7IA 3FLAA 2O1WA 3A10A 5BR4A 4QBHA 3D8SA 2A9PA 2YWJA 1Z5ZA 3UAOA 3SHFA 1N2JA 3IFSA 1Q0HA 2GFHA 1QDUA 5IMSA 1M2WA 2ZR7A 4LRQA 3NHSA 2YIMA 4LFCB 5HXAA 1JHVA 2RI1A 3Q85A 4ZALA 1ITZA 4UVEA 1QO0A 3KNZA 1MG5A 3DXFA 1RHUA 4OX9Y 1ZCAA 1BVRA 1KMCA 3PENA 4HVAA 4D80A 1RYMA 1WSDA 3PX3A 4Y2VA 4JVLA 1FDIA 1DC3A 2BH2A 3WIBA 5IZCC 5IKEA 4WL0A 4G5FA 4YALA 2FPIB 3TX2A 3B6ZA 4KIUA 5HFJA 2H63A 1Z2AA 3DWIA 3NHWA 3VR3D 5ERGB 2WUFA 4WCFA 2I65A 3BTUA 1OI4A 4U2GA 1ID1A 2VZ0A 4UUMA 1MFPA 1NRXA 2OR3A 1DAEA 1O08A 4IEIA 1T3HA 2P90A 4AN1A 4CODB 1Z06A 4HWTA 1E9CA 4RZUA 4CI0B 3OH8A 3TECE 1YRLA 4WY5A 1J2JA 3RK4A 4ZT2A 3CEHA 1MEJA 4DV3B 5AI9A 1WQ3A 2DQ4A 2YCLA 1NHGA 4H3SA 3SHQA 3UAXA 3TR6A 1C1HA 1RWQA 2E89A 4IM7A 1GPAA 1PDOA 1K5HA 2B4YA 3ELDA 3NHUA 2OD7A 4S1PA 2QRQA 4MB0A 1YT5A 1KL7A 3DZBA 1L5ZA 3L84A 2JLAA 3H1AA 1UWCA 3INRA 3CH4B 3FPFA 1MOSA 3UT5B 2FPMA 2OP0A 3GA5A 5CDHA 2B8NA 2G71A 4KYVA 1ENPA 1IOWA 2NUAB 3SHWA 3L2OB 4DJTA 4DJFC 2PGAA 4HSGA 2RGXA 3U4MA 1U9YA 4N41A 3H9CA 2R6AA 2GBLA 4R1QA 2ZBDA 5LUAA 7ABPA 3TW8B 3GROA 4PAWA 1FDTA 4TT3D 1FMFA 3DOOA 5I4IA 2F8SA 4EG5A 1NP7A 1T4DA 1F7VA 3PS9A 2B3DA 2V8OA 4F4HA 5E7QA 1QB7A 4K26A 3CZPA 3K4PA 3SFVA 2XWPA 1XCJA 1SQFA 4J1TC 3BMNB 4QDTA 1RJGA 4TLMB 5DBGA 1C41A 1P6XA 3K05A 3KPVA 4MI1A 4ED9A 4YRZA 4MJXA 4MROA 5JWOA 2P8JA 2QD3A 2J6IA 4P5DA 5E0OA 3KWFA 2UZAA 1AHPA 2PZLA 1I5OA 3MN1A 4HNQA 4Y2QA 4OCZA 4A03A 3BXEA 3TD6A 5B3KA 4QLBA 4JVSB 4KK4A 3TTUA 4CQNA 1Q3HA 3J7TA 2E5WA 1LQTA 1NFQA 1XZHA 2VQDA 4LNUB 3EGOA 2O23A 3SS8A 2OO5A 2ZYUX 2FZKA 4K9SA 4W7SA 1KIAA 5A9RA 5DNUA 3UH0A 4BNJA 1HEUA 3EQ9A 1E6WA 2IXTA 4G81A 2K4MA 1XZKA 4BX3A 1W5SA 1UK8A 4MJ3A 3K31A 2YOFA 1BFKA 4MUKA 1ENZA 1OWLA 2XADA 5L4SA 3A28A 4IPTA 1Y7LA 4QPJC 3M6VA 2E21A 1OA1A 1LI7A 1CNFA 3OHPA 3K1TA 5NULA 3LUDA 2HNAA 1U11A 3O9VA 3WLRA 1RMYA 3JAWA 2VWHA 1GLGA 2ZZKA 3EMKA 3IBCA 1EIZA 3FVWA 3Q9SA 2FMKA 2IYOA 5AJZA 5EL0A 2HSEA 5I48A 1E3TA 4NZYA 3IMCA 3LK7A 4CUJA 5JTUA 1CQIB 2B5VA 2AN1A 1TM2A 4K2HA 1KO5A 1J90A 3L1UA 3JQBC 1RI4A 1A4RA 4TSRA 1TIPA 5EP3A 5B6JA 5L4LA 2ZM5A 3U60B 1RNLA 3QKRB 3P9SA 4RIIA 5JSZA 5LIPA 1G0OA 1ZH8A 2IDMA 4TWBA 5FWYB 4EX6A 3C7CB 1FVHA 4GLFA 2E37A 4H7IA 4HDKA 6Q21A 2PUBA 1YOVB 3N53A 4TMFA 2I6SA 2ZBVA 4FONA 1U7DA 1D1TA 1J09A 3U3XA 3H3XA 2OBFA 3KAPA 3FPJA 1WCYA 3RIXA 1NPYA 1V2GA 2Z95A 3AF0A 3U40A 4OXIA 3ZS8A 2H1IA 5TMDA 4BV9A 3WRXA 1TA9A 4KSCA 2AA3A 1YU9A 3QX7A 2V3VA 3ELYA 2QTRA 3NV7A 3LP6A 5JEDA 2Y4OA 4XCQA 4AF8A 3D7KA 3VPHA 1GQ2A 1SIUA 4GKKB 2PY6A 4LFBB 1TUGA 5CIYA 3P9XA 2GYYA 1ZXXA 4DC9A 1YFJA 3G17A 5HA5A 4CKYA 4DG9A 2OHGA 2X9NA 3NTXA 2LNDA 5JMOA 4HDQB 3NXSA 2AX3A 2QB5A 1BFUA 2QVGA 2DFKB 2W0SA 3OQVA 3QNWA 4KGZA 2FWAA 1Z0SA 2Y9PB 2YC4C 4TM7A 3DV9A 3W6PA 3L77A 2HNBA 2XTZA 3DPSA 2PS3A 4FMCB 1UXKA 4DHEA 3OM1A 3IHWA 1EVYA 4X1KA 1T5DX 4RSGA 4B46A 1GEEA 3JQAB 2QMQA 5KWSA 3U16A 2VZ9A 1EUCB 2G7ZA 3LUHA 4O3FA 5L7WA 4WVLA 1SUSA 1N8NA 1KK1A 5KHAA 3FDFA 1O5OA 2CJYA 4W99A 5CVEA 2ZI3A 1N6KA 4DUGD 4ZYWA 1MPXA 2PVSA 1PX0A 4H7JA 3BILA 2EIHA 1QIDA 3BK2A 3ENVA 3UWKA 5GVRA 2Q4DA 4DMRA 1ATZA 4LJRA 3LXMA 1YRAA 4DGQA 1JKJA 1XMVA 3D1VA 4LYAA 5KYKA 2YN0A 3A6EA 2IYLD 3DYVA 2GARA 3QLEA 2P6UA 4GPBA 3WDSA 3TRFA 3ZHBA 1E2DA 1O54A 1UT8A 1YNOA 3BZWA 4IGFA 2PZKA 4ZFNA 3G88A 4MGYR 5HX7A 3QBTA 1C0EA 1HURA 4P4NA 1GNTA 1E58A 4QWWA 4EJSC 2P2SA 1X80A 3RS9A 1G5FA 1EU1A 2HFKA 2VCEA 4DBZA 5KYXA 1HG0A 1IG3A 1S2MA 4AJ2A 4O2BB 3BD7A 3RGGA 2H0QA 3PHBE 2B94A 2NPOA 5H68A 2KBEA 3R4CA 1NRIA 5BSHA 5K3OA 2I8AA 3PPYA 2OC4A 2HHAA 3B8HA 3IO3A 3TSWA 1OX6A 1P9LA 4PO9A 4G65A 4HEA1 3WGNA 2CD7A 1ZD4A 4KI0A 1E3EA 2EOAA 4PX3A 2XBLA 4EENA 3KKQA 9ATCA 1NYTA 2SKCA 3W34A 1QH1B 3BJZA 4HAVA 3ZE2B 1TM1E 2O7VA 2ZM6B 5CA1A 4FEEA 3FNEA 4QO7A 2A0UA 2JFBA 4RNCA 4U2FA 1G8FA 1BGXT 2OHXA 4LK2A 1VE1A 5DBEX 4D3DA 3RJ9A 4QFMA 2H8GA 3O92A 1R4MB 2RH4A 3LL7A 1WE2A 3FGPA 3RT7A 1WMBA 2EHDA 4YXFA 4RA9B 1Z5PA 13PKA 4O4IF 2CNWA 4PSKA 4WLOA 3ZDFA 5JALA 4ARUA 5IVDA 4MR9A 3OF2A 2Z5FA 3AP3A 1ODSA 4IXWA 1A5ZA 2VBGA 3DBIA 4K6MA 2WOJA 4MKHA 3COVA 5KTKA 3EVNA 1YZFA 1W2WB 3I9KA 2WNSA 4AMUA 2F2TA 2JIZD 4K6GA 5ALMA 3L7KA 1GPNA 2QQGA 4S12A 1V8FA 2QVCA 3ROKA 1XA0A 5AW2A 3DCJA 5LKAA 2Q9UA 2CXNA 1DG9A 1OXKB 3BXZA 3PUJA 4O1MA 3ACDA 3L0YA 5I8PA 1CJUC 1QOQB 4HFRA 4FHDA 2FP4A 5FEMA 16PKA 4ZD6A 4DBVO 4L50A 5IT4A 3JX9A 2CDRA 4HXGA 1ZICA 4WXYB 2PMCA 3GEPA 3MYRA 1N77A 5U9CA 1SFRA 2C07A 4RV4A 4NG4A 3RW9A 2OL4A 2KM1A 2WVHA 4KOEC