2A6PA

Structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
RNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2a6pA00
1C7ZA 1QFXA 1QHFA 3D8HA 4ARUA 2P77A 2HIAA 1DKQA 2ENWA 4FDUA 2HPAA 4EO9A 1XQ9A 2YN0A 3LG2A 1BQ4A 3QPVA 4D4KA 4IJ5A 2BIFA 3HJGA 1YFKA 1C81A 2F90A 2AXNA 2HHJA 3KKKA 3F2IA 1CVIA 4JODA 2H4ZA 3GP5A 5AK0A 1RPTA 4D4MA 2IKQA 2A9JA 2P9YA 1RIIA 3R7AA 2WNIA 5CDHA 3MBKA 5AJXA 1FZTA 3FDZA 3GW8A 3DB1A 3PGMA 3ZHCA 4D4LA 1E58A 2QNIA 3O0TA 3LL4A 1H2FA 3D6AA 1SK8A 2P9FA 3DCYA 2P79A 4AROA 2OWDA 2OWEA 5CU7A 3E9DA 1SK9A 2EKZA 1K6MA 4EMBA 4PZ9A 3MXOA 3OI7A 4E3WA 4FDTA 2GFIA 1QWOA 3NTLA 4IJ6A 1RPAA 3NFYA 1BQ3A 4PZAA 2EOAA 2P9ZA 1ND6A 3QPUA 4JOCA 1IHPA 1NT4A 5HR5A 1UJCA 4HBZA 1SKBA 2RFLA 1DKOA 3BIFA 2WNHA 2P75A 3K4PA 2WU0A 3QPWA 5PGMA 1TIPA 2EKBA 1DKNA 3K4QA 4PGMA 1BIFA 1ND5A 3C7TA 4ARVA 5AJZA 3F3KA 1SKAA 1UJBA 3E9EA 1T8PA 2P2ZA 1DKLA 2P78A 5CX4A 2DWPA 1V37A 1DKMA 4MA4A 3FDZB 1E59A 2ENUA 3GP3A 3D4IA 2PA0A 2P6MA 5AJVB 3IT0A 4GPIB 3IT2A 3EZNA 4TSRA 3IT3A 4D4JA 3LNTA 5AJWA 3IT1A 2YN2A 1H2EA 2P6OA 2P30A 4ARSA 1EBBA 2H0QA 1YJXA 3FJYA 1DKPA 2P2YA 2H52A 4QIHA 4ODIA 4JOBA 5AJYA 2A6PA 1FBTA 1C80A 5HTKA 2DWOA 2I1VB 1V7QA 2H4XA 4GPZA 3E9CA 3EOZA
chains in the Genus database with same CATH superfamily
2X4DA 1GGHA 3R0ZA 1AS2A 1CY1A 4CG0A 2YDYA 2ZULA 4XIIA 1SXGA 1E2FA 1UZLA 1G8GA 3U4IA 1IY0A 1ISHA 1N9GB 1ONPA 3EIHA 4ONEA 4U6SA 3OM1A 5K03A 1OX6A 3ZV3A 5CEJA 4KR2A 2YXBA 4JJAA 2C4VA 1RQ7A 2DBRA 4MYHA 4FNMA 4UTZA 3WKEA 3QFCA 2OK8A 2YKGA 4U2CA 1E1CA 4LNUB 4MR9B 4TL8A 4UU7A 4WN9A 1JE0A 5GQSA 4OI2A 2V7QD 3JQCA 4L3VA 4NJEB 2NTVA 2VT7A 3BMCB 3Q10A 4ML3A 5FOVA 1MAWA 2G88A 3EVDA 3UY4A 1R3DA 1Z2AA 2IUYA 4HZIA 3IAXA 5D6NA 4M0DA 5C53B 1PYOA 2BP7A 3HC7A 3R0JA 1RC8A 1BS1A 3G2HA 5LMCA 2NZWA 4I55A 1FFCA 1DX9A 1H4QA 1C3JA 3DKIA 2CHQA 1GKKA 2WJVA 2OCDA 2C99A 3QU7A 2YOFA 1AT1A 1WLYA 3FSJX 3T3MB 4BVLA 3IEUA 2MSCB 2GGSA 4HD8A 3T7AA 3ZHSA 2O5RA 3CMCO 4E5UA 5BUQA 4JP8A 2Q6KA 2PBZA 4NESA 1AKRA 3JD2A 1JNXX 4GL2A 2GM4A 1PEDA 2OXRA 4FHFA 1Y1KE 3N8KA 4ZOEA 4ZDJA 3R40A 2XX3A 4GDMA 3G0BA 1XAIA 4HNSA 4UD6A 4YO8A 1WB4A 5BQOA 3CE6A 5FOQA 1D9XA 1R5NA 4E07A 4H15A 2Z6QA 2QTHA 1E2LA 1TCBA 3SYTA 3R09A 3UFXA 5HBRA 4CDMA 3AR9A 3AESA 3ROKA 3Q8WA 3DM9B 5HK8A 1ZITA 4MYSA 3BSYA 1RBQA 3DT6A 3Q5GA 4ILEA 4CF5A 4MB6A 4YBZA 4WLVA 3HRKA 4D5EA 2QLNA 1Z35A 2PUTA 2ZB3A 4FZ5A 4TL7A 2R8YA 4Q1DA 1U3CA 4L27A 4TLAA 4HAWA 2EKBA 5ULLA 5LXTA 1W44A 4AO8A 4GQIA 4DREA 2IODA 3N58A 4NAVA 4CG2A 3RSLA 5B1SA 1IONA 1NHGA 4XZ3A 1NDHA 5B12A 4WPGA 4AJ9A 4M99A 3SZLA 1LV7A 3DLHA 4KR7A 3D0QA 1CY8A 1VIMA 4LGMA 2WSBA 4UZFA 4E32A 2DJ5A 2ZYGA 2NUPB 2HSZA 1A50B 3NBMA 5IW8A 4DLTA 1JKJB 1KDRA 2GN1A 2PEYA 3QUTA 2PPVA 5AQEA 5TF0A 4DIOA 2H1CA 4PAMA 2AWNA 4QHYA 8ADHA 1FA9A 4LJ9A 2B69A 4RHUA 4HTFA 1DG3A 4B48A 2GEUA 4ITVA 2X0FA 4UEJA 1OJ7A 1ETHA 4OYLA 4Q66C 2OGUA 2J0SA 1KO1A 5FOSA 2C7VA 3T5BA 4P3XA 1F8YA 3WGGA 2QQFA 4N0DA 3KOOA 4MITA 4OU5A 5CMLA 4WCDA 4JOQA 4DJFC 3OZAA 3OZVA 2XUAA 2E9SA 2G1JA 2XUFA 3I12A 5EUCA 2PSFA 1LLUA 4PPNA 3TIGA 4DDWA 5HKBA 4BPBA 1E9AA 2JI7A 4NATA 3L40A 1V9LA 3DEYX 4JGIA 4JYBA 4MJXA 2P2SA 4L0MA 4BMZA 3H5IA 5JI2E 1DCTA 1AVTA 4RS3A 1QQ7A 1JKFA 1I13A 1TDJA 4FI3F 3P2OA 4PYKA 3K1AB 1O94C 2UUBB 1OX4A 4IGKA 4KAFA 2J45A 4YHBA 1NI3A 1E1QD 5BNZA 4JB0A 1NZJA 3H8VA 5DX8A 4XUDA 4D9FA 4CM8B 1MQ8B 3E3LA 2RKOA 1GPWB 3NYIA 4G0QA 3ZPXA 4BN0A 5K3OA 1RPNA 1U80A 3QLVA 1R2QA 2OHIA 3FMPB 4GM1A 4CKXA 5HEKA 2FZWA 1VYTA 2M6SA 5DSTA 3V46A 4UM9D 5IBPA 2Q8PA 1PL0A 2AK3A 3I5XA 3AHCA 1MT0A 4M8SA 4L78A 1KJWA 3WBJA 4Z6KA 1SQGA 3O8LA 2XZDA 2ZGVA 1M2JA 2CUNA 3K1TA 3PRJA 4JELA 3TQTA 2ZSHA 2VNHA 4JFAA 5DIFA 5L53A 4DV7B 1C8BA 1RS0A 3IQXA 4Q16A 4QBIA 2QMZA 2YYAA 3KYIB 3PU6A 4PNPA 1IB6A 1WX1A 2JFGA 4O2AA 4Q34A 1WW8A 2E5FA 3WAKA 4RTRA 1NRXA 1ZP6A 2VJYA 5JCXA 2OYSA 4AS1A 2QAJA 4DY4A 3GF4A 4CMAA 4XWKA 2Q07A 2WNIA 3DHEA 4L0DA 4WNYA 2REQB 4ITRC 1NF2A 1FNDA 4YJ3B 4NYIR 5DP2A 3SFVA 1SBIA 2I2DA 3OOWA 3IQHX 1KI6A 5DBHX 5A7FA 1FZTA 3BTVA 5I5GA 1EFPA 4A8JB 1EK6A 1ISPA 1PI3A 1UOOA 4EG5A 1GU0A 1W6RA 2QDXA 3IMCA 1CC1S 3GO4A 5JFGA 4PV7A 3WDLA 3S2UA 2VUUA 1OCEA 3KQNA 2CNKA 4OY3A 2IVFA 3H11A 4QUHA 5TMEA 3ADOA 2ZQYA 3Q8XB 4GGOA 5E8JA 2CJYA 2P3SA 2CLKB 1G8HA 3D2BA 5IM5A 3FGOA 3TEMA 1ZAKA 4CQMD 4U2BA 1XSEA 3IIKA 3L8ZA 2GWHA 2H7XA 2CXXA 1ZH4A 2X15A 3QLUA 4Q12A 4RHXA 1YASA 4U9UA 2CJWA 1SD2A 1AGYA 5C8VA 3KSBC 1ML4A 2P69A 3HG7A 4WIAA 4RV9A 1JAIA 3ROGA 1JHPA 3VSAA 2BM9A 4ZV7A 2PGDA 4KAAA 4N7MA 3TTUA 4PLVA 3R7FA 2QTTA 5KYYA 3HY3A 2NVUB 2Q4DA 3MD9A 1IMJA 5KYUA 1J70A 1QHXA 4R81A 3QITA 1Z74A 2PSJA 2V7BA 1M1XB 3HB4X 3I92A 5IJXA 4BHTA 4BUZA 3CN7A 2VNSA 4B35A 4RORA 3CVUA 1KQOA 5HA5A 1J22A 3EODA 4CU2A 4IOLA 4DXDA 1VGVA 1QVVA 3RKUA 3KYJB 1VKNA 5K3EA 5IAAA 3O90A 1CRLA 1ORHA 5TNXA 3TQSA 1C41A 2O4CA 4ZI5A 3GVXA 3OPXA 5CDFA 2PZ8A 1U28A 5CJ2A 3RFCA 2EV9A 1DL5A 4F1KA 5I9TA 4CG1A 1GY8A 4YMUA 2GLXA 4YP5A 3AM4A 5CBPA 1W581 4YRFA 4KXQA 2BM8A 3RIGA 1VSVA 3DOCA 5E2BA 3GRRA 3O4RA 2BMVA 2P6NA 4LWQA 3CNQS 4NBWA 4NENB 3UTDA 3WSTA 1O6BA 2M32A 1SB8A 2G1AA 1R8XA 2MMCA 2WINI 4H7HA 4JNCA 4XXHA 1L2TA 3THXA 2V7GA 2XXJA 1C3VA 2FPGB 4YY3B 2O8EB 3LXMA 1W47A 2MYTA 3AZQA 4JEUA 2WSSA 2ZATA 4MGYR 1D3AA 3RVMA 3HUTA 2OC4A 2UU9B 1TAQA 4NG5A 4Y2UA 4X8OA 5KBYA 4YXWA 1JH9A 1UXGA 3PLRA 1LVHA 1HL7A 1XLVA 2IUTA 3IPRA 3MCTA 3BCHA 3LWDA 3SLGA 3U44B 3KO8A 4Q7KA 1U2SA 5CDYA 2Y66A 3N2KB 1WLSA 3V6MA 1ST2A 3OIGA 3ZE0B 2OSVA 3LXUX 1CJMA 3HWX1 1M2OB 2I03A 4HK4A 4JLMA 4EHJA 1Z2CA 3JZDA 5KU1A 2O8BB 1HTWA 4O3FA 3W6PA 5L3QB 2J9FB 2CFIA 1WY7A 5EXTA 2EYUA 2I4NA 5EP1A 1XD2A 2EFEB 2C9MA 2VHEA 3LA6A 1IWOA 4TTSA 1XU7A 1JG7A 3OMXA 4BRWA 2YMQA 1PFQA 2R62A 3NOOA 2QTNA 2OKCA 2IYUA 4LN1A 2I1QA 3B7GA 3EZ6A 2ZJ7A 3Q98A 3X1WA 4BCCA 3UICA 4U2DA 4D41A 1JZQA 1NM5A 3IPYA 5L4SA 1G0NA 2BI4A 1WNFA 4ZIRA 1Y98A 1VMIA 2NVWA 3QMWA 2VP2A 1Z4OA 4LISA 3ZU2A 2CYBA 4S0ZA 1T34A 2DUJA 4IUDS 5K8VA 2HBQA 3RT7A 5BR1A 1JDJA 4PC2A 2DULA 2YJZA 4MW0A 1RVDA 3U60B 1MVOA 1EP9A 3EDMA 3FLBA 1A9YA 1T9CA 4J1TA 3A1TA 2R1ZA 5K0BA 4J0FA 4V0KA 2WSIA 2Q5OA 1V8BA 2PKXA 3ASZA 3QHPA 4MDYA 1JEYA 1LUAA 5TXGA 4EEZA 1JLKA 4QZVA 1I5EA 4WGGA 1HG1A 1ZUD1 3VH1A 3VH3A 1RJFA 3FSGA 1RFGE 3N70A 3OQVA 3UJ9A 3D0OA 4M0MA 4Y1RA 4E3WA 2P4EA 5JVDA 3P0IA 4Q1EA 2YQ4A 4XDZA 2ZSDA 5J2UB 1T2EA 2NSLA 3O47A 3WJ1A 5J23A 1L4MA 1JPJA 2JFNA 2VAPA 4OHZA 3GEBA 3V3KA 3R9XB 2HREA 1SHTX 4HLQB 1F8XA 2F62A 3CNNA 1HGXA 1HZZC 2ZAIA 1E5TA 2Q5HA 1HE5A 2ZZKA 1QU2A 1DIAA 1GD1O 1P73A 4V0NA 4WZBA 1BDHA 3KFXA 2P3QA 4FK8A 4A0SA 1EEHA 4JD5A 4WECA 2WJJA 2IXDA 3LUJA 3T95A 4LW8A 2RAVA 5FWYA 2OV6A 3TGLA 2QN7A 4IG4A 1T5BA 1KJJA 1ZYUA 1K7XB 4E5SA 1S2MA 3L7KA 4LY3A 3C7DB 4MGEA 1BC5A 3GH1A 4DMKA 1JG4A 1KBQA 2XD9A 3D3KA 2HAEA 5COBA 1SCUB 3HKCA 3FFWA 4OGLA 2Z3VA 3BXXA 1E3DA 5CVJA 2ZT7A 4E03A 5K2OA 2ZBUA 3E70C 4GR4A 1K08A 1BOOA 2C4NA 4NJOA 3K3PA 4PLPA 2E18A 4UNPA 3UG6A 3OTHA 2GKOA 5EMJA 1RWWA 2IS6A 1YUNA 3E61A 5JSZA 2E87A 2ZP1A 2VYND 1UFOA 2IYFA 1Q0SA 3E6AA 1KMCA 1MB0A 1XD9A 5AIAA 4AECA 3RH0A 2IEIA 4Y8VA 3KJNA 1T9DA 2HXGA 3WGOA 1PJLA 1V71A 1YJXA 4LXXA 1DWUA 1PVVA 4JT9A 4IFTA 2AQIA 1SHLA 3ZNNA 1I1OA 1PR0A 3CVWA 3MTDA 5I9LA 4J29A 3TTVA 2A9OA 3HLTA 3EZLA 2NZUG 4Q9NA 4Q9LA 3EF0A 1OXXK 2A35A 5ECGC 2R66A 5AKGA 3KQYA 2J9RA 4DWVA 4Z2AA 5KKCA 1MVNA 3GDFA 3IPXA 3TPFA 3VA7A 1YFLA 1W8DA 1C7ZA 1F4PA 4U4AA 1VJTA 2IP1A 2R85A 2YJTD 3VHQA 2XITA 2JGDA 3ML1A 3QVGB 3R3ZA 4ZT4A 3U3DA 2ZEJA 3PVCA 5E4TA 3B9QA 1BHO1 3WISA 1LK5A 3ZLUA 4KGXA 4ER3A 1K0FA 2EX1A 2RC5A 2XHZA 2QTCA 3QEJA 1VSUA 1A7KA 2AF3C 1PUXA 1TUGA 2OILA 1WKCA 2B1RA 2PTHA 4WXEA 2HF2A 1J20A 3E0QA 5IKPA 4N41A 3QPAA 2C9BA 3W5BA 3NYWA 3HKBB 4D0NA 5TJHA 4YRJA 2RJ3A 2XXBA 1T4BA 3DGFC 3KFLA 1TD9A 3KD2A 3D6JA 1M5TA 2JH3A 3NV9A 1JE1A 3AL0C 4JC4A 3ZW8A 2IHBA 1N0HA 3MBKA 4M4SA 4MK4A 2XUPA 4WN3A 1J8DA 2C98A 4MS3A 2YZKA 5HCIA 1XJ0A 3AL2A 1UPCA 4H7DA 5LDDC 2O20A 5KIAA 4CM7A 1U0FA 4E7OA 1SY7A 4Q82A 5ITWA 1H1DA 2Y3IA 4FJ2A 1M1YB 3G8AA 3ITNA 1GTL1 3UMMA 1URPA 1JDNA 3JAKA 4BKMA 4E4RA 3K6KA 2HSGA 3QELA 4O08A 3J7TA 3LGAA 3JXEA 3U40A 1C7RA 1S9DA 2H7CA 3TZ6A 2VQDA 3MMPA 4WUTA 3QXGA 3UEOA 4RFVA 4YV2A 5EJAA 1BCRA 4QARA 3K9FC 3VYWA 5C7IO 1Q0HA 4YRQA 3PEYA 4DZRA 1UK6A 1PVOA 1H6CA 4EVRA 1U90A 4LZOA 4IIEA 1C1XB 4GYYA 4MUAA 4PYNA 2FG5A 1IN5A 1JI0A 4IS3A 4EGAA 4G4GA 5ADHA 1ANKA 5IU6A 2DETA 3OZFA 1SU8A 5K0ZA 13PKA 2PX8A 4MKXA 5DPMA 5AM0A 1I01A 4PYQA 2OFPA 1NVGA 3V2HA 3VR1A 3WGHA 1K4KA 1VCNA 3LBHA 2JA2A 5JSKA 4EKYA 2P9JA 3NR2A 2X6QA 2VDUE 1RXSA 5CYFA 3L04A 4GQBA 4GZ5A 2WT4A 3EA5A 4KJZA 1C9NA 5BSTA 1ZINA 2VHUA 4MB2A 3VU9A 1R15A 3AETA 3DZGA 4EYGA 4CBVA 5I3CA 3OQOA 1O89A 1P5FA 2CLMB 2HRBA 2HU8A 2VF4X 2YMMA 3BILA 3PSAA 2YZ2A 2FKNA 1NU6A 3W9BA 1O08A 4K3UA 3TJZA 3T9CA 3ET4A 2HIGA 3MMNA 3CGWA 1GUAA 3OEWA 1LTHR 4J94A 3RUAA 1J5XA 1JYSA 3LYAA 4AMBA 5T3YA 3VGJA 1PHPA 3T1HB 3TVYA 3RJ9A 3EXEB 1RLTA 4CDRA 4J0DA 1E2UA 4EVSA 4YJGB 4D3FA 2QY6A 1E4EB 4QA9A 5EJMA 1N7HA 3F49S 3MFQA 1N2XA 2ZXEA 3NVDA 3PPIA 4N40A 4DJEC 3JZAA 4F3CA 3EZ9A 1L5NA 4RMHA 3OZUA 1L4GA 4Z8YA 1OC4A 4OPMA 2P5YA 4Z5XA 1GZ6A 4FYHA 2A6PA 3AHJA 5BMOA 1MH9A 4WRRA 4C06A 4MUEA 1TKCA 2EJBA 1ZH0A 3PDUA 2OLJA 1MD9A 3RSFA 5I4IA 3ZJTA 4JR0A 2BN4A 1OVGA 1YQEA 2VOEA 5AM4A 1MBZA 1OIXA 1N3BA 1XF9A 2YS6A 4KBFA 1WZIA 5LM3A 1M6WA 2XXAA 1ZGZA 2BEJA 1XMSA 1XYGA 3C3DA 3CUKA 4LXGA 4PLGA 3TH5A 1HDXA 5H3CA 4Z9XA 1U0EA 4X9XA 5CDSA 2BGMA 2C7PA 4D1YA 4XSVA 2I6XA 4G0OA 1ULUA 4UREA 3REOA 1HFWA 4XGKA 5DM4A 1K68A 3UYKA 1E1QA 4A0GA 3NFRA 2XCRB 1DUIA 4N5MA 3QPVA 4IPTA 3CZAA 1S3FA 2ZR7A 1Q2XA 4BMYA 1LTQA 2YIVX 3NDRA 4GSYA 2I3DA 3DULA 3EK2A 2ZRDA 2DPLA 3V55A 5CFOA 1VJDA 5HQTA 1DRJA 1MEEA 3GRVA 3LC7O 4MWEA 4D3XA 3R5FA 2C2XA 1KAHA 2JGRA 5J4KA 3M6VA 3A3NA 3CRVA 4MR7B 3H8WA 3HMQA 1L4NA 4G89A 3EWAA 3MC1A 3SXUB 2ZJYA 3U3JA 2OR3A 3EGVA 3ZN2A 2FK8A 3ZU3A 2WWGA 1ARZA 1TO1E 4BYMA 3IKMB 4RS4A 1TFUA 5JQGB 2CV2A 3NHJA 5FLKA 2P1DA 5ALRA 4YAKA 2YJ3A 5K3AA 3DE7X 3OTOB 3IESA 3RQSA 3AVYA 3QOWA 4L8YA 2NSDA 3R2JA 3PFHA 4Y2XA 1QVRA 3PXBA 4C7VA 2YWEA 2D1QA 5JQGF 3ZZUA 3PITA 2FSSA 1H6DA 4MAAA 2G76A 4P7GA 1K3TA 5FPQA 3ZGXA 2A9QA 4W5WA 2PMEA 1TM2A 4TXJA 4MVXA 1OYWA 4C2TA 4IZ6A 1G16A 1RXYA 5KB3A 1ZNWA 1GNTA 1ZHHA 2AZDA 2R6R1 3ZY4A 2ZM6B 1PJRA 5FTMA 1R64A 1MB9A 1XZEA 2BLNA 2G9QA 3W8EA 2LDBA 3D7LA 2HT6A 1LBIA 1RKBA 4TUYB 2ECQA 4W6QA 5TPWA 3I52A 4DANA 4GYKA 1TMGE 1CNMA 3K4QA 3L92A 2HCFA 2RGUA 3CN9A 3MLBA 4GSKA 1GNLA 3U17A 1ZC4A 4TWZA 5TEWA 3E9EA 1P7WA 2IEAA 3I23A 4YR9A 1PG0A 3HGQA 2G80A 3LECA 1MO3A 4LWZA 1TW2A 4MI6A 5CLHA 4B3CA 3KHTA 3B9RA 3ZWBA 1B1AA 5HRCA 3UPTA 4OKIA 2QEQA 3BJIC 4I1UA 4UU1A 3QTTA 4BCBA 2EF1A 3HU5A 4C1NA 1VIVA 1GDDA 3HYCA 2GH1A 1ZGBA 1L0BA 1VBNA 2R9VA 2WPDA 1PO7A 4PYMA 4GOOD 4NBKA 5IS2A 2JLXA 4N3GA 2V3CC 1I3OA 2JH8A 4OX9B 3IT3A 4JXZA 1YT5A 1TA9A 3NI2A 1AA9A 2AW3A 3AB7A 2DF8A 3KOUA 3NIBA 3IV7A 3OU2A 4MO2A 2IYNA 5JNTA 1SHZA 1QS0B 3VNSA 4ZEOA 2Y1OA 3NM4A 4QUJA 4ZAFA 2IHTA 2BJWA 3BB4A 1IVSA 2BMFA 4FGSA 3UXMA 3PD7A 4EUFA 4RTMA 1JH8A 4O6VA 4O4JF 1H2YA 2ERCA 1EU1A 4BUJA 5H9WA 5H82A 4B8ZA 3IPCA 3HACA 1GP2A 3FRJA 2ONJA 4MVJG 3UMFA 4LNHA 4XCVA 4JU9A 3FKQA 4YQFA 2JVJA 2CVPA 4TWIA 3LOUA 5C8YA 3WBKA 4BLOA 3P2YA 1SQ5A 5TF4A 1B41A 2PLFA 2WU4A 3IURA 1ZY2A 4IIGA 1IXRC 3AKCA 5CW1A 1NJ5A 2MINA 3F6YA 3P9NA 1HT3A 1XHEA 3QXSA 4KO8A 5REQA 4EI9A 2H06A 1GM5A 4NV1A 4BZXA 3GLVA 2AYYA 4MPDA 3MTGA 4L5JA 3N0RA 1VI2A 2FDXA 1DKQA 3AL3A 1NYTA 1XTBA 4ZJZA 3OPYA 4ND6A 1Y5LA 1O9HA 3CNEA 5A3SA 1G9XA 1JQKA 4EY6A 3SEAA 4R8VA 3PR2B 2P0YA 2QG6A 4F6RA 3BWYA 2UUAB 1KNQA 4DQ0A 1H0RA 4ENTA 4FR5A 2C9ZA 2I4MA 4M46A 5AFSA 3U31A 1RLMA 2IOFA 4EG3A 4DILA 3K0AB 4AMZA 1LDMA 4FMPA 1R6VA 4QAQA 4X85A 2Q0XA 2L82A 2A3RA 2YVUA 1BMFA 2ZBEA 1YJ8A 1VJ0A 3H16A 1NVAA 3PDIA 5T64A 4C0JA 1RIIA 2VJDA 4D4MA 3RAEC 5LLSA 2XZTA 1SUPA 5GOTA 3MUEA 4UCQA 3RUCA 3L06A 1T24A 3DLCA 3JWHA 2HMVA 2V7UA 1FS6A 2ZIXA 3ZHCA 1E3MA 4MKIA 4H7PA 4RHTA 1NOKA 1OFIA 4IIDA 3WHPA 1Y1TA 2Z1DA 4D02A 4P3YA 4URVR 3MWFA 3WJ2A 1M34A 2WV9A 3LKZA 5F7OA 1F9EA 2X7XA 3P4YA 4RTLA 2JS7A 3AV0B 2QX7A 2UKDA 1J4AA 4ZEVA 1XVLA 4PN3A 2CMFA 2I8AA 2BLLA 3LBNA 2WJAA 2VF8A 1MXHA 3NBXX 4CT5A 3D6HA 2GZ2A 4UU8A 1AF4A 3JQ8B 1KYWA 1R6XA 2WPNA 2J6IA 1PHRA 2O0HA 3D6MA 5AW2A 5A4KA 1JZTA 3RIXA 2QTMA 2VP5A 5YASA 1XAJA 3H0KA 1P1RA 1EX6A 5CK4A 1FP2A 3F3YA 3E82A 1XQ6A 4B3GA 2PLNA 3OQPA 2JEOA 1J00A 4YLGA 2C4MA 4NJEA 3BMCA 1FSGA 3DB2A 3ENKA 1LPAB 2X0IA 3EEBA 4QYIB 2RB4A 3O03A 5E6RB 4FNOA 5G4LA 5JYCA 2XRFA 3CB4A 4JUBA 2KBEA 4DDHA 1VGQA 1USWA 3H5OA 4BLSA 2UUOA 4TZTA 3CRZA 1TJYA 1VLVA 3TIFA 2W6ZA 4IFBA 1P17A 3GJXC 2WHPA 1GO2A 2WFLB 4M1TA 1QQ6A 1UBUS 3LZCA 3DE2X 1UC8A 3MJHA 1ZRNA 3Q11A 3MBOA 4PWYA 3HEBA 4B31A 3DF7A 3S7TA 3IXLA 4HXFB 1V5FA 3V8RA 1EVJA 3OO0A 4PIPA 4WV3A 3BRCA 1F6BA 2PVCA 1SULA 3EAGA 3WOVA 3RAFC 4QULA 3PPXA 2M9MA 4DF3A 3L43A 1G5TA 1T4CA 1A76A 4UNQA 4AO6A 1ZBDA 1ZRHA 4F1JA 1KI7A 2F2TA 5HSGA 1KQ3A 1EVZA 2H52A 2QLFA 3DHYA 1RLUA 1RYBA 3JQBC 4UAJA 1P29A 5ALVA 1C50A 1N3YA 1R0YA 4IRXA 3F6RA 3HADA 5KU7A 1L7OA 3T3PB 2PIDA 3L9XA 4QYMA 3SYRA 3RFXA 1JAXA 4PS1A 2CW5A 5CLGA 5DX1A 3RF6A 3RG8A 3L4KA 3HO6A 1XTQA 2GX6A 4A15A 3GI1A 4BECA 4WZBB 5LMNB 2GESA 2IYAA 5HQ3B 1N2ZA 1KETA 1H2WA 4F4UA 3IUMA 3PDIB 4NBUA 4NRDA 5IVKA 4A6EA 4KLCA 4DCOA 2RIRA 2GYYA 1AH2A 4Y2VA 4A03A 4QU8A 4UTVA 1PR2A 2HLHA 1VMKA 4CEHA 2EJWA 3E5MA 3V7NA 1XAGA 5AR1A 5ALKA 4J2HA 1IATA 4KX3A 2IYYA 2JF0A 1MLDA 3OAAD 1VIYA 3VJKA 2PS1A 4POOA 2BIFA 5FUBA 4YDSA 1ZNYA 4EPVA 1PR5A 1JG3A 1UBOS 3K9LA 4YCAA 4X62B 4MI3A 2NXJA 4D8WA 2EJUA 3C5CA 1O87A 5K20A 4B3DA 2BCJQ 2PGXA 2FN8A 1SCJA 2JGIA 2HXYA 2OBBA 2UYGA 3AUFA 3OCXA 1KZHA 4YN3A 3F6CA 1UMDB 3ZNOA 1B7GO 2DQSA 2HQOA 4AUNA 3M4YA 5LLTA 1X1AA 3USES 4ZK2A 2JK0A 1XRNA 3H0EA 4QYSA 2QN2A 4CM9A 2Z1NA 3K73O 4X84A 2PH7A 2FUG1 1S2NA 1ZQ9A 2ADFA 2H59A 5TPZA 4DCSA 2A9KA 2G08A 3LFHA 2BF7A 3O91A 4WZAB 5BVGA 1MW9X 4ROTA 4DNOA 4ND1A 2V74B 3GLHB 1WMAA 2CLFB 2FSUA 2ID4A 3K32A 3A3KA 3BSFA 4RU1A 1R6DA 4R71A 4CE6A 3N86A 2VH5R 2J67A 3T1OA 1SVKA 3TSYA 3WB9A 1L5HB 3NT4A 1FSZA 1CUIA 2Q5QA 1SOAA 2P9CA 1NJSA 2R68A 1YDFA 1WSBA 5G0SA 1PX2A 3CU5A 1BXRA 2H92A 3FUWA 5DHFA 5IKOA 3PJEA 5L7YA 5ELXA 4DIEA 2EGGA 3M8KA 4G36A 1PWYE 3PHGA 2BSQA 1T26A 2W2NA 1OI7A 5D3ZA 1G3IA 1J1IA 1GNQA 1E8DA 1N3IA 1SG0A 1U04A 4EG0A 5A5GA 5AI6A 3T06B 2BE7A 2C54A 2OCAA 3GFRA 3U3KA 2JZOA 3B89A 4P98A 1H69A 1Z63A 5HM8A 2OB2A 4DLYA 3A9CA 2G8NA 5JFTA 4CGZA 1RM3A 4PTLA 1D0SA 1FP1D 1DQPA 1NYQA 5AKEA 5BN4A 2XODA 1CULC 3R3JA 5G1OA 3WNQA 1F3OA 1MJGM 1R3UA 2IOFK 4BVEA 4DIBA 2ZRIA 4FX5A 3MQ2A 3QUAA 4DVJA 5TC4A 3UFBA 4BNLA 5HZMA 3BWDD 3ZHQA 2NU8B 1SH7A 4I9GA 1P4GA 3P0EA 2VRWA 2WJHA 1F4LA 3IC5A 4KLAA 4Y2YA 3DMNA 2IH5A 1O77A 4DHEA 2W6MA 4D4GA 3OLQA 2O7SA 1KDYA 5F2EA 1GCAA 1UODA 3PTAA 5IJ0A 4HDSB 3DFFA 1YA8A 1POWA 4N54A 4N12A 5ENVA 3F97A 4OMFG 1B8UA 1N9GA 4HKTA 5DI3B 1Y1RA 2WF8A 3D3EA 5ILQA 3OWHA 4F9TA 3M1YA 5T6BA 1J25A 4M1EA 1BHJA 3LDUA 4DCVA 3U4QA 1KS2A 1CJBA 2YMLA 4DNFA 3AHDA 4LJSA 1XQYA 4XFKA 3ISVA 4BB6A 3DAYA 1UBHS 2L69A 4KZPA 1EFHA 2DSNA 4K9PA 4B7ZA 4Y9UA 5B7QA 1DLJA 1FFYA 2C77A 2VDNB 1IBRA 3SSNA 5KTOA 3O4HA 1HTBA 4FI3C 3PDCA 3K2IA 1CIVA 4V0QA 4N9QA 3ZX5A 1KGDA 4BRUA 3G68A 2JJ2A 3EMDA 5C18A 3F67A 2O6LA 4TL6A 4XGQA 2G67A 4Q01A 4A6DA 3DZIA 3I9FA 4NQZA 3C4VA 3GZ4A 2B0JA 2GDJA 3NBFA 4KSCA 5DLQC 4OFBA 4YFYA 5FWNA 1L5YA 1NP3A 2P4UA 5HOQA 3QU5A 1GSAA 1NAIA 2XQJA 3RARA 4H1WA 3SJ7A 5KQPA 2Y9PB 4OL0A 2VXBA 2FWBA 4HFJA 1TQ2A 4XWYA 4JLWA 4ZT7A 4AZ0A 1LX6A 1Q11A 2ZDGA 1LW7A 2CXSA 3NNNA 5T4EA 3HCOA 1U11A 4P33A 5FADA 3UUWA 4XA8A 3DZJA 4MIOA 4C4SA 4N49A 4TMZA 2C84A 3UQZA 4YWJA 1TYCA 2WIKA 2P9FA 4K9LA 1QIFA 3HA2A 4ER5A 4JYAB 2EATA 1NKTA 4JXKA 1X3LA 4NZYA 2VYVA 3FRIA 3AIIA 2VIIA 4OV6B 5EIWA 3SEZA 4I7EA 2VSXA 1DLIA 2JANA 2XKJE 1JVSA 4WJLA 5K6AC 5ESDA 5KQRA 4C6TB 4C88A 2O5CA 5A4JA 3H3JA 3BMNB 3PFIA 4EARA 1V7CA 1KU6A 1IY1A 3ILVA 1ODLA 5FDFA 3HXPA 2RGCA 5KINB 5KTSA 4MRAA 1PNTA 3AI2A 3WL8A 3A32A 3IODA 4IF4A 4B4OA 4H0NA 3TUJC 3ZS9A 1Z3IX 1W1WA 2WHRA 2QA5A 4JLOA 1ZMXA 5EJ2A 3RTDA 2W71A 3BTUA 5IX8A 3CBGA 4NE9A 1YI8A 4DS3A 1X2EA 1TIPA 4KWCA 3VJMA 2WWYA 1WO8A 4AQ7A 1VLQA 1FL9A 1E92A 1ZK1A 2VJKA 1J9ZA 3NATA 4IW3B 3RVBA 3AVXA 3F9IA 1J5EB 4JNKA 3BMQA 2H5LA 3C85A 2PUJA 1GKYA 3LVQE 3BUSA 3LYUA 4QOJA 4PONA 3ENWA 3RF7A 5EJ7A 5HRAA 3STUA 1KWKA 2XBLA 3PR3A 5DVZA 5GGXA 3KYCA 5B1EA 2I1LA 4ECEA 3C16C 2GN9A 3E0XA 3FVWA 1VLJA 1SWVA 1JFVA 2BFEB 3A04A 4TYMA 3RC8A 3DQQA 1DP4A 5CHYA 3K09C 4FYXA 1QFSA 1XVAA 3LLVA 3UWOA 1EBFA 1E9FA 1JIQA 1K2VN 1PIWA 3B7PA 3O0DA 3FCXA 5FEMA 3LUBA 1S2IA 3BXGA 4ICIA 5H9VA 1MTZA 4YRAA 4BNMA 4GC5A 1YQUA 3J80A 1Y3HA 1OD6A 2ZS8A 4BZPA 1W35A 2AG6A 2G71A 4DR4B 1SAYA 5GZ6A 3ORQA 4KO4S 5KJCA 3I5UA 3ADPA 4XFDA 4ZKDA 3IUSA 3MXTA 4Z4QA 2HX1A 3DOOA 1U6IA 3NU1A 1PE0A 3B3GA 3RUHA 3U0BA 4C7OA 3QE3A 2LWIA 5LLDA 1ZIXA 3IBSA 3G9XA 4YUAA 2WQ7A 2GETA 4JY7A 1NG9A 3GGSA 4KHPB 3S1LA 1UZAA 2D13A 3OFNA 4JJ4A 4L2IA 1W4BA 1FMLA 2COEA 2P4HX 3HHEA 1G5PA 1PW7A 3FSRA 2ZSUA 2KWIA 1IHDA 1XROA 1MDBA 2QROA 4UBIA 4ZAGA 2EP7A 1ZISA 2Q49A 3N2LA 4BO5A 2QP3A 1Z82A 3ED1A 4PIMA 4PWZA 3NLLA 4D0GA 2XQFA 2GCEA 1GV1A 2Z8XA 4F2PA 2IXTA 3T7JA 4H1TA 2B6NA 3HI4A 2XOEA 4HRAA 5E2IA 4B74A 3GFSA 3U44A 1CQWA 5IARA 1MCZA 2JFUA 3LCVB 3CO0S 3HJGA 3PI7A 1F4VA 2QTLA 3ELBA 4M8LA 1L4FA 5C1DA 4H27A 4MPJA 3K0SA 3DJFA 2PKYX 1EHIA 3IDSA 5JBQA 2IHYA 2JAXA 2XWSA 3U7JA 1LZLA 1OXVA 1SXJB 3P71T 4UVIA 1JKJA 2IHZA 4XQ0A 3W2GA 1F12A 3C43A 5FL3A 1WMBA 2OT3B 4WKPA 3E7WA 4E15A 4AP5A 2O57A 2FG7C 3C8UA 3ES9A 3PBKA 1A4XA 1P6UA 2ZBVA 3VO9A 2ZRHA 2I4OA 3ZVNA 4ZFNA 1K5DA 2ZIEA 4BMOB 4I4LA 5J43A 1Z0UA 2YHBA 1IM8A 2G5GX 4HGOA 4PG6A 3RANA 4CM6A 2FLVA 5F3DA 2P62A 1WCV1 3DBLB 4I6EA 1S2GA 4KZKA 3R8CA 4YAIA 2G3YA 2G4VA 1T5OA 2H07A 2VWHA 3GFFA 5JI3E 4GQAA 4E12A 4S12A 1LLDA 3M7IA 4BDTA 2QRQA 3PG5A 2WJ6A 1CQZA 4HSGA 4CR7A 1WCYA 4MRSA 3KG2A 1TAHA 2PL3A 3TLJA 3LT1A 2XW6A 1ZL0A 3QIVA 4UE2A 1FRZA 2V59A 4PLTA 3K96A 4N5NA 5CDTA 1EA5A 1NJ1A 4QDTA 4DRYA 1KPGA 4XE5A 4NOKA 3T7EA 2H2HA 1WJGA 2K87A 1BOFA 4ZDKA 3NWBA 4IJWA 4R8SA 1NI5A 4UU0A 3ER9A 3P26A 4XAQA 1L7RA 3WKAA 2DPMA 4L85A 1PJAA 4NAHA 2ABWA 2YHUA 2FRDA 2C8JA 1ESDA 1BO6A 1L8LA 1RW4A 3DWGA 4D97A 1OAOC 2PXCA 2FWMX 4O33A 3EAFA 3SHWA 4MROA 2ZYWX 3KLOA 3G8YA 3V4ZA 1NJ2A 3NDIA 3NORA 5AVTA 2H65A 2NVUA 1B0PA 4NU5A 4Q15A 5T5QA 5BWNA 1QGUB 1XZKA 1EWTA 4MYDA 5AJVB 3CVOA 4RA6B 3TOVA 5K4AA 1TKBA 4PRKA 4KV9A 3NBUA 5HWSA 7ADHA 2YN2A 2FYTA 5I8ZA 3G88A 4O02B 4TV9B 4R9VA 1LNSA 4G0XA 4K9RA 1ISSA 1Z33A 3WMXA 5JLJA 3UJBA 3HDJA 4IDBA 4O4HF 5DM70 2V3VA 3LD9A 3QMVA 1QH8A 3IERA 3INTA 4REQB 4DUGD 3N3BC 4G56A 2H1OA 1P91A 4N39A 4TS1A 5LQCA 2O2CA 5LWHA 2RI6A 1H9BA 3A3PA 3RSGA 1FRNA 1MJGA 4RADA 4Y0NA 4PG8A 2BFCB 3OEYA 9MHTA 4CEJB 1ZA2A 1GKIA 4CLHA 2XUGA 2IU4A 5DSXA 1T1GA 4J0GA 3X1XA 2W37A 2J3EA 1I1NA 3EYWA 4ND2A 1ECJA 1E7YA 2YWHA 5ALXA 4KOEC 5ABPA 4PANA 2OO7A 1ZESA 2W2TA 2HH9A 3F6BX 5DGHA 1U3VA 2VPIA 2HPAA 3UB2A 5IN5A 4HDMA 4IDEA 4CLRA 2NQTA 3FOBA 4OUDA 3K70B 2BSXA 1YIAA 2QDKA 3GJ4A 4YS6A 4GOLD 2FLKA 3W8RA 2OQRA 4GFDA 3MZ0A 4FM9A 3KKKA 4RY2A 4ETNA 4CM4A 3LT4A 4R1LA 2N46A 3RB8A 2VHYA 3BIWA 4G0YA 4GNRA 2XT9A 4EHAA 2ZPAA 4Q4HA 3M2PA 5FI3A 3SQDA 3PFFA 4H59A 3SFZA 3CIOA 1TMOA 3V2UA 5BR7A 1VLZA 1J0AA 1F60A 1YR6A 4FYWA 4L51A 2GOYA 4B2YA 3BZBA 2I3BA 2PZFA 3EZFA 4ZI3A 4M0PA 1RWPA 2UZIR 1WB5A 3JQRA 1AK9A 3SHTA 3GAFA 2QJTA 4GS5A 4UBNA 2Z6AA 4ZOLA 3S1SA 1RJ9B 3DOFA 3GMSA 1Z12A 4HNRA 3TAXA 4ZIRB 2IS2A 3I01M 2GZHA 2X76A 4EMBA 3L05A 4NBTA 4RZHA 1NP6A 5BQ3A 4BFTA 1DDIA 4IXWA 5A03A 3N8GA 1IHYA 1KJQA 4W8GA 3VV2A 2A0WA 3FGPA 3RS4A 5AKKA 3UAOA 1HY3A 4ABYA 1ZVVA 4GWGA 5BNTA 1JHQA 1SIBE 2ODWA 1U0SY 3GGPA 1G59A 1G4AE 3WLLA 4U7WA 3H1TA 1M1YA 2GBPA 2XMDA 1JLLB 1S8NA 4GICA 3ECSA 1I4TD 5FA5A 1Q2UA 3O8QB 3OCJA 4C3UA 1SXJC 2F7SA 2W2QA 1V6CA 4NNJA 5L3RA 3O94A 1H4VB 2YIMA 1G2QA 3IDQA 4HVCA 3OJOA 3I9V6 2GF2A 4HZUA 4A2WA 3NEJA 3ONFA 5KC9A 4BEWA 4PZCA 3LS2A 4Q3AA 3SYLA 2R1UA 3E35A 3LRXA 1MOPA 3ESYA 2NG1A 2CLIB 4ZI2A 5ALHA 2PBFA 1KVUA 4BO8A 4W5NA 4Y3UA 1C3EA 1X9IA 1NC3A 4W7IA 2DGDA 4RZSA 1YZQA 4HNGA 5GP1A 3IELA 2A94A 3N7UA 3B2NA 1PWXA 3QGMA 2A9PA 4OI0A 3GP8A 2I80A 5CP8A 1FZQA 1FXUA 5C5DA 3WDKA 3ZCUA 3HJCA 1T6XA 1A8HA 5IHPA 3GLFE 1JAYA 2GA8A 1XQXA 1CX9B 1JV2B 1O96B 2B2XA 4OB7A 4R9NA 4UVGA 1YB7A 3I6QA 3E9RA 4XEUA 1GAJA 4E5NA 3OURA 3E9NA 4DUPA 1CE8B 4ZPXA 4B3XA 2ZB2A 5TMPA 1PDWA 3U62A 4LJ6A 1N5DA 1U8XX 2NO7A 4JB3A 3O5AA 4M1WA 3NDPA 1KJZA 2X4IA 3CPSA 3A9TA 3KV1A 1EB9A 1PT6A 2XKBA 1KYXA 3I39X 4FKBA 4X91A 3T15A 2EP8A 1I3CA 1M66A 3N87A 2JIZD 4XARA 2EQBA 3K71B 2RJNA 3DW3X 3FUXA 3K9BA 4JMPA 4GMDA 4AUEA 5LP1A 4B6OA 1IXSB 5FF9A 2X5KO 4I99A 4NHOA 4IDDA 3UAXA 3RSQA 4MLDA 2C59A 2BFFA 1GQYA 4KIGA 1T9KA 5GAJA 1MB4A 4QNNA 4E1VA 5TV2A 5KQLA 1N0IA 4MQ4A 1KO8A 2WIFA 2F90A 4R3WA 1IBSA 1G42A 1IC6A 4K1XA 4K40A 1MC4A 1YE3A 4B34A 1VYHA 4PC3A 3BH6A 5EKXA 3ZXUB 3N05A 4AJ2A 2A9JA 2PGIA 3D6TB 1WKBA 2DFKB 2G40A 3DXYA 3IBCA 5C4IA 1OOEA 1QIKA 1US8A 1H1TA 1XVTA 1ODJA 3VKUA 1GCUA 1E79D 1H05A 1VYUA 1GAQA 1MQ9A 1FEZA 3PGMA 2Q0HA 3AR6A 5DDIP 1UBFA 4AVYA 1QO9A 2HPHA 1P8AA 1J07A 1S89A 2OLKA 3C3EA 5GVRA 4XVUA 4H6WA 4B7AA 4LSWA 1N5JA 3I9V1 3E48A 2FPWA 3LQYA 1ZK0A 5JYBA 2HA5A 5H70A 2W11A 4QGSA 1YZKA 3E4DA 2B1IA 5EFOA 1OXBB 1PR1A 1UBGA 5JMTA 2ZJ5A 1LPNA 1NJGA 2D2VA 3IB6A 4I50B 1F51E 2BRUA 3NV7A 4PF1A 1EVYA 2HMYB 1I7NA 2KI5A 3E84A 2XHEA 3HQ4O 4NEQA 4KW7A 4PFSA 3SBXA 3VVLA 4B5KA 1PQ4A 3G0GA 4MNTA 1LS1A 2GN8A 2GSWA 4OUKX 4L0QA 5FWDA 1H85A 3T9BA 2C00A 2C4TA 3UA3A 4AQYB 3JVIA 5DYTA 3B3AA 3TNJA 1XF1A 3KNZA 3QFRA 4KQ2A 3SX4A 2JGKA 1XN1A 4N5DA 3I5MA 2ZBDA 3L4BC 4P83A 1Z0JA 5AJZA 4A0QA 4XLZA 3GUUA 2VPYA 3QU4A 7MDHA 4WESB 3EC2A 1JG6A 1KYZA 3OJ0A 4UHBA 2CXOA 5JE8A 5F7XA 2G8LA 2PWAA 3MRTA 1X0VA 3TX2A 2FMTA 2UUCB 3VDXA 3DOIA 3AR8A 3PHBE 3WSVA 3A58B 2MDTA 1B0AA 1LFAA 1XMVA 4BWYA 2RARA 2H18A 3IMKA 1TQ8A 5AT1A 1QM5A 4KWHA 1K6IA 4U63A 1E59A 3JCZA 3SGLA 3GRKA 3KPJA 3H19A 5BN5A 4FGKA 1MOSA 3L93A 2YRWA 2JLAA 5JJLA 5BV8A 1KI1A 2CY0A 3WYNA 4Q6BA 5DMHA 1XKXA 4G5QA 1KTVA 3CCCA 3T8YA 3CX6A 1SCDA 1PDOA 4ZYWA 5FUQA 2O5EA 3A1UA 1RAAA 3H3FA 4PSAA 3NTXA 4BQNA 2BTQB 3QBVA 3VR4A 5CNJA 4XYLA 2R4TA 1O6FA 2P7IA 3VZBA 2C3YA 1U3WA 1OJLA 1M73E 1M6YA 1A8SA 4NG4A 2VBFA 4I8XA 4NZMA 1H6AA 2FV8A 3KDAA 1ZCJA 4N03A 5DJ5A 4AJHA 3FWYA 3AHIA 2HHAA 3U1VA 1ZLYA 3ON5A 4BFWA 4K28A 1S96A 1E2EA 1R00A 5HFAA 1IVYA 2QRLA 3PHLA 4ZRDA 4Z3OA 4JVMA 5J58A 5F9FA 2PFKA 2J7KA 2QUKA 1C1XA 5HHTA 3S8YA 1X7YB 2CV0A 5KYGA 3AERA 3RD5A 2X9LA 3DT8A 2V4UA 4W5OA 4IKEA 1VL1A 5A4AA 2NT3A 1JR3D 2V5UA 1EWVA 5G02A 5AK4A 5JNSA 1UDBA 2UZ3A 5F76A 1LVGA 4CIBA 1BVHA 3E53A 1ETUA 3NJ8A 3O6VA 2GILA 2RH5A 3URMA 1I9CA 1UIRA 2FOIA 2N42A 1Z18A 1B00A 3A6EA 1TTPB 2XVAA 4XD7D 4EW2A 4MHOA 3QFFA 5EJ9A 2YR0A 3UVEA 4R3UC 4XPIA 1FX0B 2K2QB 4I1OA 2Y8EA 3AKZA 4HUQB 4OO3A 3QLEA 4KXVA 4MQUA 4RL4A 3FPKA 1ZRSA 2I78A 2D0PB 4YCMA 5BOSB 5IJ9B 3ICOA 3P9CA 3L7LA 3AR5A 2ZE6A 1TPZA 3FPFA 3K0AA 1XJCA 5FBQB 4CKZA 4BP8A 4ZHQF 1YO6A 1CW2B 3DTTA 3BRSA 4U2GA 5AW4A 1XE3A 2BKLA 1HLGA 2YNMD 4UHDA 3KUXA 2WIGA 5KTTA 1XCPA 1JQ5A 5BQXA 2M1XA 2CLOB 4PG7A 4Q9AA 2WSMA 4D74A 2ZCVA 4XWWA 1YB4A 3O84A 1BDMA 5ERGB 3AG5A 4CL0A 2GERA 4MJ3A 2CK3D 2X8JA 2OV8A 3HCPA 1IUKA 1HSOA 1WCWA 3HZZA 1P4RA 5E8RA 4R3NA 3WYGA 4BKRA 2XZOA 2IE8A 2B1GA 4F5ZA 3B5EA 5CVUA 5ALTA 2AMFA 4DDTA 2H0AA 4CEIB 2XYRA 3HN2A 1NMSA 2PD6A 3MWLA 3C70A 1B2RA 3LAWA 4MX8A 2WDPA 3JQDA 4UAVA 4UXIA 4YJHA 4E2XA 5A5DA 4TROA 2ERXA 1YUBA 1TJ3A 2EFGA 4GP9A 3SY8A 1W0CA 4D9KA 4EOGA 5GV8A 2O07A 1RYZA 2PWPA 3JQ8A 4AZWA 3PQ7A 3ZUGA 5JZMA 1QZXA 2HL6A 4QFCA 5T3UA 4FBGA 2HT1A 2P78A 4FZJA 1EFCA 1GU7A 2GBLA 3JAMA 4IIFA 2HCJB 2GM3A 3AVOA 1IJFA 1HH4A 2F3RA 2H2WA 2H9AA 3GDGA 4RNDB 1NPTO 2XB4A 2DEUA 3NC1C 3QV2A 1EAYA 1W52X 2Q5JA 1Z75A 2P67A 1FW8A 1SUEA 2CJPA 3QA9A 4Q19A 4LQDA 9LDBA 1U0LA 1V8OA 3QSYA 3PA8A 1NBHA 2XA2A 3QIAA 2HEGA 3O2JA 1QTIA 3IPAA 3PXDA 5JDCC 5JSHA 1QQAA 3HDQA 3KZMA 2I9PA 3L7BA 4O4LA 1W36B 3S3TA 4EFKA 721PA 4IIHA 1CUDA 3SXUA 3G8CA 5CT9A 3KKOA 1OBOA 4WJZA 4CT4B 1C2TA 1I24A 4HH1A 4TTQA 5JPDA 2OV1A 1NL3A 1FMTA 3C3PA 4RYLA 1XQVA 4URWR 1N2EA 3QLUC 2BISA 2JHAA 4URZR 4X0EA 4U39A 5ALNA 2V0NA 5IDQA 1YI1A 2Y1WA 1GLNA 3DMTC 2L2QA 3TQFA 2FEAA 2N9UA 1VHQA 2AEEA 3OEHD 4GPZA 3ZU4A 2OD7A 1SFRA 3PEVA 3PGA1 4TRMA 1P75A 5F3RA 4QQ8A 5EE0A 1NN0A 4EW3A 3KTAB 1ZS9A 3KK0A 4DVGA 5CVCA 1USUA 4IVPA 3G9ZA 4J0EA 3D4BA 1W5BA 4OP3A 4MRRA 4QWMA 4P4LA 3ZE7A 1P60A 2CCKA 4R98A 3V9AA 4NP6A 1E79A 1UBNA 4DQDA 1CBUA 1OZAA 2J5RA 3WHLA 4DZTA 4RVSA 1SC4A 4PCUA 3ZH2A 3PNMA 3WB0A 3X2FA 3AOGA 3GHHA 4YRDA 2XYPA 3UGJA 1XA4A 3CVYA 2ID9A 1R9MA 5BRAA 2QZJA 3EWSA 4OOFA 2QYSA 1N7IA 1VJRA 4YCDA 2BUCA 4QVKA 1QIIA 2J08A 3JD1A 3IIEA 1M6EX 4ZQHA 4EB6A 5K7SA 4MQFB 4G97A 4L8WB 3EHDA 4WVLA 3PDJA 4G2TA 4B2LA 1H2RS 1PGOA 2H8GA 4XLTA 2RBGA 1WY5A 2VK2A 2ZS7A 1YZNA 3Q2OA 5CM2Z 4CMGA 1E58A 1ZSYA 3CLRD 3H5NA 2Q1UA 4JWTA 4O4JB 4RZQA 4RF2A 4I5DA 4HDCA 1CY6A 3R44A 4P53A 1WL8A 4ZCIA 1WZNA 3IRVA 1MC5A 2J0UA 3HVUA 3ZHRA 1X1RA 3ZDYB 3ZLJA 2HHHB 3OT5A 3CH4B 4KOAA 3OQ1A 4PZ9A 3ZV7A 4BFSA 1G8SA 3PJDA 5TLSA 1QRTA 3GGDA 4M21A 1Q74A 2HLDA 5LZ8A 4NCNA 2A5YB 4P4SA 5F5NA 1TUBA 4KXNA 1UKVY 5EZYB 1GN9A 1YB6A 2CNDA 2ZIXB 2OHOA 3E9QA 3LCCA 4ZQIA 3T7SA 4KUHA 4ECAA 4YYZA 5K09A 4X65B 1E4YA 5MN4A 4MRPA 2ZRQA 3O7WA 5LB2A 4X63A 3SXPA 3DEIA 2WNHA 1NDUA 1OYVA 2WM3A 3TIXB 3KX2A 4AJLA 3PLAE 5AUQA 5BVGB 1L4UA 3VAAA 3JS5A 3NTVA 3PYXA 5KX5B 4AJJA 3RO7A 1S8FA 3UAGA 3N0VA 1NUQA 5DHRA 5CCBA 1E99A 4H6VA 2HJ9A 3G5LA 4IZIA 1O5IA 5B57C 2PUEA 2Y4NA 3U3ZA 3I0NA 4RPIA 2VDMB 3CKYA 2X2FA 1Q6YA 1F38A 1Z4PX 3BAZA 4AUKA 1XDBA 4A8JA 1L7XA 4JGGA 4OJQA 3BH0A 3D4IA 4Q4JA 2O4UX 1EVQA 2PAAA 4ZEWA 3PZRA 5D3KA 3FLMA 2DLCX 1HG0A 1UZUA 1E18A 3CC8A 3F0TA 5AJWA 3ILSA 2GK4A 1M5UA 3C45A 2QYTA 1U0JA 3AP3A 2Q6VA 4BFXA 3P2EA 1P0QA 1ZCBA 2V7WA 4MWZA 3ER8A 1PR6A 5LKAA 3OT4A 2AD5A 2A92A 2AZ4A 2YZNA 1T29A 1WVGA 3G8DA 4QQKA 1ZGCA 3FWZA 4H4DA 4U7JA 4Y67A 1CJCA 3I2GA 4LPSA 3A4IA 2D3TA 3PYMA 1M67A 1B42A 3JAWA 1HDOA 3ZWCA 3SX0A 1JG2A 4QASA 4CF7A 2EZTA 3OKCA 1H4TA 4MMZB 3L6EA 1PZFA 3HBNA 1P5ZB 2VYQA 3FPEA 2LTAA 5E7MA 4OXXA 4EM6A 1RKVA 2ZSJA 4ISBA 3E15A 1DI0A 2Z5LA 3TI9A 1SCBA 1V26A 2ISSD 1RQGA 1JR3E 1U0TA 1I0LA 2C2BA 3AYXB 4M1SA 4V0LA 4X6XA 4YJ2F 3EIEA 4IWYA 3ZXIA 121PA 1RACA 3JQAA 5AVQA 2Q29A 2Z30A 3QW2A 4EIWA 2P6PA 2WHEA 4IOJA 3Q7PA 3LZ6A 1O0CA 4JASB 3WL3A 1Z5WA 3SYMA 4PX3A 3AUSA 3M1IA 5JDIC 1TCUA 1CFZA 2PZKA 2V8OA 4MINA 3P9QA 1A8UA 1Y9EA 3R1IA 1PRYA 4OHRA 2F17A 3KDPA 2EDAA 1ZIOA 4H0CA 5LZ5A 1PLKA 3THSA 2OBYA 3VU1A 4Y2RA 2FQXA 4DRZA 4Z9AA 2Q0SA 2ATXA 3EFEA 1A0OA 1T5LA 2LV8A 4AMGA 4LRQA 5IRCD 4XASA 1CUGA 5L51A 1Z4QA 3BMOB 2JRLA 2AH5A 4DMCA 3ZEIA 3ZE2B 2FRVA 2GMWA 2RCYA 3QKSB 5KMGA 1QRSA 2ZUBA 2Q3BA 4G84A 2AOUB 2K5UA 4HTFB 1SXPA 1AU9A 3QHQA 4WDQA 2O2HA 2P6RA 1L4KA 1QAOA 3RWMB 3TOCA 3IB3A 5CGQB 2WSLA 5IMBA 1G60A 3TUZC 2R60A 1AZLA 3AWIA 3SEFA 1YGPA 4ILKA 3FYTA 1X8XA 2J3KA 3QNMA 1CUVA 1NLZA 3OIWA 4JHXA 5AM1A 2DAPA 1BWRA 4G9BA 5KQMA 4QYWA 3L49A 4EH1A 3F46A 1K8QA 2BF4A 4OH7A 1U31A 2ZIWB 3CZMA 1XELA 3L0DA 4MEJA 2WB4A 4OJNA 4Z1MA 5LIPA 1OXTA 2QMHA 2IITA 3TQIA 1J0EA 1PLJA 4XCXA 2V7EA 3WLTA 3SZGA 4PSVA 3C8HA 2BH9A 3TVDA 4B7CA 1L9KA 1FMJA 3QHAA 3WGKA 5H1YA 5JSZB 2HW8A 1TZ2A 1BFDA 3D5QA 5G0TA 2WKRA 3V9PA 3GR6A 2Q8NA 4KCGA 5FAXA 4B6FA 3G0CA 1MF7A 5CBPB 3FCCA 4RD4A 5FFNA 2NXEA 4FONA 3HB9A 1Z0DA 2BBWA 1E3TA 3INNA 3VI4B 4B85A 2MSWA 1JBKA 1VC2A 3AEUB 3GLIB 2D5IA 3UK1A 1XXHE 4ZVPA 1Q57A 3F74A 3DAFA 1YOVA 4JENA 4IIUA 5ALDA 5ALJA 4ENPA 2PU7A 1OPRA 4OMCA 1TZMA 5JAQA 3TZQA 1KZ6A 5TT1A 1GA1A 3SVLA 2IH2A 1J0XO 1J21A 1I36A 2H31A 3JSAA 3DTYA 2CXUA 3FWKA 3CH6A 4RHCA 3TFQA 4NU6A 3K0EA 4OQLA 1UM8A 1YZ3A 3NNSA 5HK9A 5JH7A 2R5WA 1L1EA 3NVMB 2VWQA 4DDKA 2XT0A 3G13A 3GJ3A 3QA3E 5DNYB 4RTJA 5CUQA 5A4MS 5AUNB 4LG1A 5CA0F 3DHWC 4WKBA 1N25A 2X9QA 3BWXA 3DP7A 4H1VA 4CQNA 3KKLA 3P9KA 3QKTA 1ADYA 1E6MA 4ODIA 2QOEA 4EX6A 5A6SA 1MQSA 2XCTB 2CNNA 3HA7A 4BNFA 4M87A 4MPRA 3DR3A 1U9IC 5I8PA 2FPSA 4CIXA 4GPAA 2MR5A 3RNLA 3TJRA 4LF8B 1G8AA 1V7QA 2R00A 4MV4A 2ZUVA 2WM8A 4TRRA 5DWQA 5GGYA 3DC7A 2ZUWA 1WXWA 2PRZA 3PRHA 1QHFA 3EY9A 1XV5A 4XWOA 1ZOOA 3P45A 1H1LB 1CG6A 1GRNA 2YWRA 2YINC 4KL8S 1XXLA 4KE6A 5H7XA 5TMBA 3MWEA 4QG7A 3SM3A 2FETA 4GMXA 4I4NA 1LPPA 3ROTA 3W0LB 3RSCA 4QLAA 2ZAGA 1N8NA 3U9SA 2O06A 2JAWA 2OO5C 1RP1A 2HCTA 2QYOA 1NXQA 1YAJA 1IK4A 3L5KA 2XKKA 3PUVA 5C1OA 3FTQA 4XSGA 5HF9A 4RE5A 5DW3A 3PX3A 4W9MC 4KQXA 5CM8B 3KR1A 4RKYA 5KYVA 1KZGB 3FN4A 4PS0A 2OAGA 2DJIA 1FBNA 1OBVA 2QQGA 3FLEA 3M6IA 3BSWA 4KGDA 4A8HA 2I55A 3WBFA 4ZYZA 3L8YA 3MLEA 3U4GA 3VSEA 4OHKA 1Y5IA 1Y6ZA 2GEKA 1A9ZA 5FNZA 2FW8A 2D00A 3IEVA 2Q3JA 2PO7A 4ZCQA 2X9GA 2O0MA 3VNUA 2HJHA 4B17A 1BMFD 5BUSA 3OCUA 3PC8C 2QD3A 3HFJA 5FORA 3ZTWA 2HDHA 3OOHA 2R6AA 4UTXA 3VR2D 3DV0A 4AF6A 1HPLA 1XMQB 3V4PB 2C8LA 3K94A 1GEEA 3ZDCA 2YS7A 1VTKA 2YYYA 4IJUA 1PJBA 3KLNA 1U3DA 1XMXA 4KJXA 4ZU6X 3U4QB 3D7KA 5L40A 4UE6A 3ZJ5A 1DHTA 2DFPA 4XB2A 5KMGB 2O8NA 2XWBF 2RHRA 3IE1A 1RBMA 4GVPA 4JI8B 1M0WA 4M98A 3FDIA 2C57A 4FU0A 3KIPA 1BHSA 3SC6A 1KI3A 4HN4B 1Z28A 2AX3A 5DTMA 4FDLA 4ZYXA 3C8ZA 4UVDA 3DDUA 3NTOA 1ADJA 1YS6A 4BZWA 3BFKA 2O8CB 1YBVA 4BNWA 3CWZA 4EY7A 1TVMA 2PUDA 1NG1A 2W48A 4CI9A 3EXIB 4QJ3A 3JQPA 3G0IA 3KZXA 2XYGA 1EJ2A 3RC7A 4DMHA 1AD2A 1CDOA 3BULA 2G70A 1QFJA 2JJ8A 3O8OB 4HYQA 4ZI7B 3OZXA 2JFPA 4Q47A 1T1JA 2REOA 3IT0A 1P8JA 2VPZA 2WVJA 4TMTA 2XRMA 3SNKA 4EYQA 3IV9A 5FV7A 3BWVA 1D1SA 1TJPB 1F7UA 2XECA 2WG0A 1T13A 3E81A 4ZQGA 4C14A 3PCXA 4XB6B 1LXCA 1IAVA 1MC8A 1PTJA 4RZ3A 5ITZA 2GAIA 4ARSA 2PUAA 3LPMA 1R18A 2PGJA 2H0QA 2AOUA 2ZDQA 2FLWA 5AW5A 3T3DA 1N5IA 3HPRA 3SS7X 2A9VA 3R6TA 4YMHA 1JWLA 2X9VA 1AG9A 1ZIYA 4X6LA 4BGDA 3A4NA 5J4VA 1NJ8A 3AJRA 3MINA 5EP3A 3F98A 4YRBA 1VXRA 4FOLA 4U3JB 4UMFA 5BSVA 3P0JA 2G9ZA 1GZUA 1X87A 2FFJA 1LJ8A 2FPXA 2PDAA 3PSHA 1SKYE 2XR1A 3COJA 3K6RA 2I3GA 3UMRA 2FPPA 4LZJA 1XTRA 1XEWX 3ZC3A 3N2IA 3OUTA 5EGNA 4DIFA 4YRIA 5C32A 1S1MA 1I30A 4W7SA 3RSZA 3KJFA 3DZFA 1PLLA 4GVXA 4KQKA 2RH4A 2A67A 1V16A 4MZDA 1K8XB 4PGFA 2FQYA 2XMQA 1ZH6A 2H29A 1KO4A 3OHMA 2VJMB 1CUCA 521PA 3B8EA 3U3XA 1C0KA 4EGJA 4H31A 3ELWA 4BXOA 5JCZA 3E9MA 3B53X 5A04A 5EJ8A 4LJ5A 4LRYA 2HMWA 2VSQA 1JDSA 2B8TA 1JEJA 1R0KA 2NNWB 1UFQA 3DW1X 4N65A 2QD1A 2ZYSA 4GRIA 1Y8ZA 1CVIA 4RBNA 4GMGA 1MJHA 4IJQA 5ADWA 1YDEA 1JHXA 5FTJA 5C4GB 3T1YB 5G3ZA 5JASA 2ZANA 1SEPA 1S5PA 3NC4A 4LSGA 3EXG1 4LJAA 2B3TA 4RHEA 4K0KB 4L9AA 2GPYA 3O9VA 4WA8A 3PQ8A 3FDZA 5GOZA 3GZNA 5L4NA 3ADDA 2EFHB 5PNTA 2QM0A 1NNI1 1RDFA 3ZWMA 1VKZA 3RW9A 1LF0A 1QIGA 2Z8ZA 3FHLA 1RYNA 1U7TA 3CNHA 5LQJA 4QXOA 2NUTA 3RRXA 1R27A 2VZLA 3Q3GE 3HCWA 1KFJB 1SC6A 2PQ6A 3A9SA 4PPQA 5HMLA 4YX9A 3ZGOA 1GT6A 3G9TA 4LC9A 3DLAA 4OF4A 4X3CA 1AE1A 1UDCA 1Z8FA 4LQLA 1D5WA 5EUQB 2BD0A 5ARBA 3SJAA 2RD2A 4F7WA 4XIJA 4LI0A 4L08A 4C6SA 1MOZA 4U7PB 4RIIA 3SX2A 4BEBA 5GV7A 3RBZA 5ED4A 4BPRA 3UMYA 4B84A 2PMCA 1ZN7A 3B2EA 2GEFA 3FVVA 1JB1A 3PGJA 3FNBA 4HVAA 3VX4A 1IHUA 3V1KA 3T3HA 5JT1A 5K5EA 3AF6A 3FY4A 5HF5A 2M6KA 1SN7A 5G0UA 3BL8A 1U3FA 2X8BA 3C6BA 2WOJA 2YNMA 4PAQA 1HMYA 1CF2O 3OECA 4S1WA 4UPDA 4XPZA 5DWVA 3RYFB 4Z0NA 1ZUHA 2AUTA 3A6LA 2Y1EA 4HPWA 4GBJA 3B1VA 4YBRA 2GEBA 4HSEA 4R2LA 3MWEB 4WNIA 1Y33E 2GD6A 2ZYRA 3R6LA 4RGYA 1LSJA 1JEOA 1PFYA 2XMGA 1V35A 3HCAA 1ZMRA 2AI1A 3U4DA 2XE6A 1SPBS 1RRPA 3MERA 4IXTA 4C4AA 1XU9A 1CQPA 2VWGA 4TLBA 4UBLA 5BNWA 1N0VC 2OXFA 4DYHA 4R54A 3A27A 1NQXA 1ZBQA 2Y6VA 3OIFA 4WI1A 5CHEA 2QP9X 3BC1A 1JPNA 2EVWX 1KQPA 5HXAA 3ZHBA 4FE4A 2P6OA 1T2AA 2GLUA 2XDQB 2H3HA 2HNBA 3TDNA 3UJ6A 4Z4FA 2JKVA 2QTFA 3CPHA 3I0MA 3GNLA 3HNOA 3QRWA 4HXGA 4BO6A 2YV4A 1K89A 1QR6A 3UV7A 2AFIA 5C37A 5L4LA 4O4IF 5AVRA 1HI9A 2RHTA 2K7FA 1SBHA 3ROXA 3WY9A 4QIHA 1E3LA 3BFVA 4X93A 4KNWA 3LTNC 1ISRA 1AGPA 1LKZA 5HE8A 4P7KA 3JAKB 3IO3A 1R9NA 3VR2A 3BHNA 5EJ4A 3S8EA 1HNXB 4LJKA 3CNBA 1IDN1 4LYGA 1R0RE 3QBEA 3QX8A 3MF4A 2OGWA 5FP0A 4DPMA 1I80A 2J33A 3CLSC 4CUZA 5JBIA 1UXKA 5KJ6A 1OIWA 3HBAA 1EX9A 2QL9A 3DAHA 4PXSA 5D2CA 1Z5VA 1YNSA 4FDMA 4MLPA 1AIPA 1AO0A 2E5LB 2B98A 3JZMA 3Q3JB 4EO9A 5JD5A 1JA1A 1RNLA 3KOYA 4AO7A 3FNIA 1BQ4A 4QBHA 4RV5A 4K6MA 5I7WA 1Q20A 3C98A 2I7TA 4BC0A 5K8IA 2AMLA 1CF4A 4RCZA 2DXIA 4J2OA 4J6EA 3WWYA 2D7DA 4HQKA 4LYDA 1FK8A 4RK7A 3U16A 1KH2A 4A4DA 1AA6A 2ACVA 1DIOB 2Q62A 3ENQA 2E89A 2LRHA 4TLLB 5K51A 5T4FA 3WBBA 4B3TB 3PNYA 3QVJA 4P0TA 3ZCTA 5AJXA 1YC2A 2CJFA 3ZG6A 5JAOA 3COSA 1PT7A 2Q2NA 1ZK2A 1ONOA 2CD9A 3LHKA 1A3CA 1F0KA 3VISA 3VR5D 3TG8A 2C7OA 3QF4A 5JMWA 1DRVA 5KDOA 2NXWA 5AKXA 3SWWA 1KMNA 2YIDA 2CEKA 4A92A 5K0EA 2P79A 3ANNA 3DEFA 5DBOA 1TJNA 5EP2A 1KFBB 1CNFA 2HR1A 4EGCB 1H0HA 5K05A 1Q0RA 1KVSA 1XZHA 1L8OA 3BB1A 1N1MA 5BN3B 1T36A 1JXMA 5BNIA 2JLYA 1P4AA 3M1AA 1B6RA 4WFQA 2BYTA 1UPFA 4C0HA 4HDKA 3TQQA 3W6OA 2OESA 2I22A 2DY0A 3GN1A 4B8WA 1GTG1 4JL6A 3EUFA 3SVZA 3STTA 3X2EA 4WOPA 4HBZA 1UT5A 3PDWA 1R9GA 4G01B 1B8OA 1JL3A 2P68A 2E4VA 2NUTB 1ILWA 4RTOA 1IQ0A 2QN6A 5G53C 2LUOA 3HNRA 2PX4A 4L3OA 2DERA 3WFIA 1QAQA 1G38A 2QVGA 1YQDA 4QUAA 1HX7A 4YAEA 1CHNA 2JEZA 3Q3HA 1ND5A 4RSGA 4CQMA 3KOZA 4I1VA 4LGYA 4J76A 1FOEB 4Y0VA 3RRMA 5JYDA 1FPMA 1JQBA 2L17A 4S1PA 3UMBA 3AIMA 1MABA 4LHXA 3DDOA 2R96A 5E9AA 3RIHA 5LBTA 4QYXA 1MG0A 2CEAA 2C5SA 4LTNA 5DOVA 1P1CA 1JJ7A 2FMUA 4W9RA 2GEVA 4K8OA 3RTEA 1UJ2A 3GCGA 3KT0A 3FA2A 4BNJA 5DV9A 4Z0HO 1QYCA 1ZXLA 4L8VA 4C7BA 3L8EA 1HEYA 1TUEA 3I9OA 1L5SA 4M9ZA 4ZO7A 1M3SA 1NN3A 3BBLA 2Z08A 2YH2A 1E63A 4L1KA 4QFMA 3VTZA 1ODIA 4G8DA 5JZVA 4BMSA 2ZSIA 4AY2A 4W1QA 4WE3A 3UT5A 2XNDD 1YFJA 2XTZA 2G1UA 1GILA 1EQ2A 4MV6A 1Y6FA 2WEKA 3K15A 3QYJA 4YB8A 1COWA 1H23A 1IDOA 3GBVA 4O25A 2QUAA 2W2PA 3GUCA 1G7RA 3V7UA 3V1YA 4J1NA 1BS9A 4KQEA 3RHTA 1W1UA 3RFTA 1RCFA 4KTVE 1KC3A 1GQSA 1NBIA 3T38A 4AJ1A 1NI4B 4CU5A 2WYWA 3GVCA 1AC5A 1TU0A 2MOKA 2QWXA 3TW8A 1EWYA 2GBFA 1ADCA 3ZE1B 1UR5A 4IDOA 3MM4A 1B4DA 4AN4A 1CE8A 2ENWA 1SO8A 3BRWA 1KVTA 2R25B 3OFSA 4H4EA 4EGFA 1H2XA 1J8FA 2XUDA 1JFTA 1MAAA 2D0DA 3LG2A 3HMKA 3NEYA 4FIDA 3I42A 4J7AA 3VC1A 1GA6A 2CUZA 1BEZA 4FFMA 5FX2A 4UFOA 2NQ2C 1RAIA 4RL6A 5CA0B 2OORC 4R6WA 1MIOA 3ZHYA 5ALYA 1G8FA 4EFNA 5A5EA 2IKQA 3JARB 5H02A 5DYIA 2ACWA 3L1IA 5ICFA 2HDWA 1Z6ZA 3DOJA 4WACA 1KL7A 1GARA 1YZTA 2ZIGA 3R0QA 5KWVA 3G5AA 2W43A 3REQA 3VZPA 1D1QA 3BF7A 4XYMA 4ZRNA 3T7RA 5JWOA 1I6MA 1V4NA 3B38A 3UAVA 1YJBA 3WLQA 3O2SB 3WL6A 4YMGA 5IUKC 5ALQA 2HBYA 1Q3KA 1R6AA 3H2BA 5FYQA 4YJKA 2RGXA 2ZTUA 3U7QA 3TPCA 4FEAA 2IX9A 4RJLA 1AV6A 2XNJA 3TL6A 4Q4DA 5DNAA 2YX1A 5LQUA 2R1VB 4JQOA 2WC1A 1U2EA 3GRCA 4CUJA 3I83A 3VX3A 1EXDA 3WRXA 2GNAA 4XDHA 1WXHA 4JT2A 1TVKB 1RI4A 3PX7A 1T91A 1RQXA 3QF4B 2IEZA 5HR5A 2E4XA 4AJEA 5HYVA 2JVKA 2B83A 1I4WA 2W2OA 2WWRA 4J0KA 3DV9A 4A0FA 3K4PA 2OBNA 3HB5X 3HXKA 4JQYA 1DC7A 3VU0A 2CHGA 3DE5X 1M8PA 3S7ZA 2JJMA 1XZQA 3A11A 1UJBA 1EVIA 2CBZA 3IMFA 3LC2O 4FYMA 4PLZA 4BGUA 1Y9ZA 1K6JA 5ER9A 1C9EA 3CV3A 2RAFA 3BICA 6YASA 2XCSB 4BU1A 4XM0A 4DL9A 1G4UR 3GYBA 4BKQA 4XI9A 2QM7A 4J0QA 3TRJA 3FH0A 1C9KA 4AI6A 1Z4MA 3A2MA 4P9NA 2BEVB 3NBQA 4KPYA 2DHDA 3GP3A 5B1IA 3BHJA 5EUBA 2ID7A 1VG0B 1XZBA 3AILA 2UZ0A 2Z9DA 1NXWA 4BIMA 4Z1OA 2B34A 5ICMA 1FFHA 1NC1A 3KQQA 3T94A 4D8VA 4JGBA 1IUPA 3FZEA 1R5JA 3H18A 3QJGA 3ZZ0A 3FMGA 3ILYA 1LU9A 4KE8A 1TZKA 1DOHA 1I5RA 1VP3A 3ZWKA 4BTEA 5DHPA 2JLRA 3E58A 3DDCA 2RG7A 2PMBA 3AEYA 5AWFC 4QU9A 2Q1YA 3HBJA 2D2XA 1FDWA 4LXYA 3SR4A 4NEGA 4NNOA 1GSHA 4YDRA 3U3RA 1G7TA 3WLAA 4LXHA 1S4QA 2HN9A 2OQ2A 1SVIA 4ZARA 3T34A 1VPWA 2X0JA 4L4UA 4N8EA 1ZJYA 5KYYB 3CX4A 2NW6A 1FFAA 4JSTA 1W4LA 3DMGA 5JRDS 3WIDA 4KFRA 3UMJA 2WU8A 3R5TA 4LVNA 4MVYA 2IH4A 3GUHA 3U49A 1I2BA 2NAPA 1E69A 1NRWA 1OHHA 1QVAA 3PZBA 3CPEA 4GR5A 4CHGA 4ARCA 2REQA 1G5HA 2R48A 3QQPA 3PQ3A 4ZJYA 3C0KA 1QZZA 3SZMA 4MWDA 2QM8A 4K81B 4YHHB 1PYGA 2BI8A 1O03A 2NU6A 1R88A 3DEZA 4II3A 1OLSB 3H9JA 4KVZA 3SIRA 1V47A 3TSZA 1YFKA 2J09A 1ADFA 1PKXA 2BHNA 1L4EA 1QG6A 4FUTA 1D4FA 2YFKA 2JB9A 4Q00A 3I9MA 3PWTA 3SZUA 2DE0X 3KEOA 4S05A 3HCCA 2FK7A 4DAEA 3UKOA 3NCHA 3EIXA 1HYBA 2HMSA 2YXLA 3LQFA 5EJ5A 3O4FA 4ALLA 5AOBA 2NSHA 1B26A 2EHDA 1OGYA 4MCAA 4C9BA 3LT2A 4X1OA 4I5GA 2ZUEA 2OD9A 3RAPR 1AKYA 2XQIA 2PR2A 4RMJA 2Q5LA 2JIBA 5I7EA 4EJ2A 1N5MA 2AQKA 2LCIA 3DTVB 3TG2A 3JAWB 5HZHA 2ONYA 4W5TA 2IOQA 3B70A 3RFFA 1ZJWA 4OMUA 4BGEA 2V4MA 5JAUA 5BT8A 3QW4B 3P4XA 4XWGA 4DV2B 4EUSA 3H5LA 4P34A 3OMLA 1AUQA 5FO0A 2P9HA 3O75A 4KPFC 3JYNA 4KYUA 3VO1A 5HIAA 4E46A 1G21A 1LJLA 3LGSA 5BPHA 2GA9A 3AF0A 1OREA 2J0VA 5BN4B 1UQTA 4PG5A 4LJ4A 3FJ1A 4FKZA 1NASA 4HAXA 4HF7A 1V48A 2HLDD 2HMUA 4FUQA 3N2GB 4KI7A 5DTIA 1KRWA 3WB1A 4HGPA 4KN8A 1JLRA 4FKMA 4FYPA 4PTYA 1DKNA 1HLPA 2O0LA 4RQBA 2WP8J 2QMOA 2IYRA 2YOGA 4CT0A 4EEKA 3GLTA 2K2WA 4JR2A 4B3JA 2VDVE 3PCRB 3WYDA 3DFMA 2Z8YA 3TXXA 1EEXB 1JDVA 1WF6A 2PQ0A 1ZUWA 5K01A 1AQLA 4JHLA 4LOKA 3NW9A 3RROA 5LXTF 4G85A 3R7BA 1WNTA 4UQPA 4B09A 2HQ1A 4OSEA 4Q05A 2QVZX 1Z7EA 4MA5A 3QOFA 4LYEA 2OQIA 1GEGA 4PAWA 2IQIA 2DUNA 2I6SA 3ZLBA 2XB2A 3GPCA 1NBAA 5FFMA 1QTRA 2JIQA 3WZLA 2SKEA 4JS0A 1GDHA 1EJBA 1WHSB 4OHFA 2HF9A 4K87A 1MAVA 2XH8A 1VHDA 4LZZA 4R5HA 4WBNF 3BE4A 2D1FA 2QR2A 2PKRA 5K4GA 2VDQB 1G7SA 2QL6A 1AKTA 2IYXA 1QE5A 2NVOA 4IOMA 1YU9A 3ADKA 4X41A 4FLMA 4BNGA 3UG7A 3WNZA 1KXZA 3P9ZA 2O3QA 5K8CA 1JMKC 4MLZA 1QE0A 4AS3A 5KWSA 2J32A 1I4OA 2GK3A 2BGNA 4NX2A 3GUZA 4EABA 1G3QA 3GLHA 1ZI6A 2HKIA 3GDWA 4AL4A 1E7MA 3ZX4A 1N32B 1J24A 3PP8A 4EHHA 2RHOA 1K7EB 2Q4EA 4G09A 2CXRA 3AEKA 2VXYA 5B30A 1U7UA 4ZVKA 2VQ3A 2I4IA 4BAUA 5KKNB 3IOEA 5MDHA 2POQX 5THXA 4B87A 1P2TA 1ID1A 5DBGA 5M3BA 3N6VA 1C8KA 4F5DA 5LKRA 1EGAA 3VVBA 4YV1A 4P81A 3U4AA 2D74A 3RT1A 5HUHA 3OT1B 2QMYA 1P0CA 3IS3A 3SDSA 1CHDA 1J0CA 3KJGA 5HZKA 2R8PA 2PRYA 1I3MA 2GO1A 4O1IA 1FQKA 3FBGA 3P27A 4O2BF 3BE8A 1FDSA 3VDQA 4X6UA 1EFLA 2IUEA 3EBPA 2HYIC 2P6UA 2XMZA 2AG0A 2P9YA 1EG7A 2G0TA 1HFKA 3HR8A 5DBIA 4GECA 3G2OA 5TQ2A 1PJ3A 2B61A 3LVBA 5HDBB 3WK5A 3K4HA 2D1RA 4YPOA 4HWOA 2FN9A 4PCLA 3IVRA 3VTKA 1N0UA 1U63A 2A5DA 3UK6A 4DEVA 4IILA 4LIPD 1UEJA 4KR6A 4ARZA 1YK1A 5JLAA 3WI7A 3AFMA 1RBZA 3NKFA 3UPUA 4H16A 1P1IA 2YWFA 5CYPA 1PZGA 4HPXB 2QX9A 4RHYA 5M04A 3ED5A 4R2XA 1NURA 4EG1A 1GPNA 2JIMA 3NG1A 3ESZA 3GXOA 2B7BA 2G5CA 2Q9UA 2J9ZB 3A28A 4BQSA 5FWYB 2F8SA 1OY1A 4N0EA 2CLLB 2OHFA 4RJ2A 4M8KA 4UBMA 1W87A 1HE4A 5EIHA 1EFVB 3GB9A 2ZWMA 3M49A 2EOAA 2XDAA 3CS3A 1HEUA 3E7DA 4IH9A 1WR8A 1CR4A 3WLOA 3TD9A 5HUQA 5KNDH 6ADHA 2ATIA 2Y1FA 3V1UA 2N47A 1QYWA 4UNRA 2J85A 5IJWA 1WXEA 1L7VC 5KOIA 4CTOA 2OBMA 1I7SB 2A88A 3DXZA 2OFOA 3OICA 1KI8A 2Z83A 2RMKA 3OC6A 2JFYA 1I6LA 1UJNA 1ULBA 1W6UA 2WUEA 4DDMA 1UFVA 2I6TA 4PGMA 2J6HA 4ARVA 1CT9A 2HZBA 5FLXA 3PL1A 5J2UA 1MQAA 2GCOB 4NYJQ 3IP7A 2VNIA 5GINE 3CVVA 3ELUA 3EMVA 1RAGA 1DO0A 2RONA 2EZUA 2C58A 3LPDA 5AKYA 5BYBA 2B30A 4L28A 2B4YA 4J7CA 3GQVA 1KJ8A 2I3AA 2R6CA 2QMUA 3M81A 4J43A 4JLUA 3SOZA 5KHLB 2Y05A 4WXHA 1TK9A 4FW9A 1P1HA 4BBPA 1I1QB 3TGWA 4KWIA 2FEKA 1IULA 1KIFA 2G17A 1I2DA 4LYFA 4OAPA 5K8JB 3NHAA 1NJ6A 2X1LA 3UYLA 1IXYA 1NY5A 2VTVA 3DLTA 5DXFA 1LBHA 4M6WA 4MSUA 4GUDA 2LNDA 1T8WA 2GJAA 3KKQA 1ESNA 1GFSA 1BWQA 1IAQA 3P5SA 1RRVA 2EIHA 5FI0B 4Q93A 4R0MA 4X1IA 3EW7A 2W0MA 3D1VA 4DA8A 1XD2B 4ZI7F 3NMUF 4OIMA 4ACBA 3S8MA 3VPAA 1BKYA 1N3LA 1T2FA 2CF5A 3AF4A 3TOSA 5B1DA 1RMQA 2AN1A 3PC7A 3Q6NA 3VR0A 4E7PA 4CIWA 4WCFC 3EOZA 1PS0A 2OO3A 3KQMA 2OV2A 3L6OO 5FOUA 3OCWA 1GYPA 1Q16A 1PJ2A 2J3IA 3FM9A 4C08A 4DNQA 1LV8A 3ADCA 4FGUA 4CM9D 3O8DA 4G5GA 1RYFA 3OA2A 3QV1A 4P54A 1N6HA 3WWOA 1XK6A 3BKWA 4RABA 3EXHC 5FL7D 4TOIA 2PMWB 4OGFA 4KLRA 4MQ6A 4XM1A 4AKEA 4AKIA 4ENRA 2VUHB 1B0UA 1P9LA 3R7SA 2NZVG 1XQ9A 2C20A 2H63A 1WUHS 3JV7A 3SIWA 1SBTA 1U3UA 1RM4A 1PBTA 4GM0A 3C5EA 2Y77A 2B78A 3EJWA 1GPBA 1T5HX 2AN9A 1L5VA 1TYEB 3FETA 3NGXA 3UJ8A 5DRTA 1W49A 1ABEA 2H4ZA 3JVUA 221PA 5CX1B 1JEQA 3EA4A 4B4VA 4MVJA 2R7LA 1HURA 4YJFA 3WMEA 1G5FA 2V9CA 4HRXA 2YJ5A 4NR0A 2KSQA 4QJBA 5DHUA 4BUCA 2EJVA 1IEVA 5ETJA 2WVGA 2PMFA 1ZFNA 3H6HA 1LQ2A 2A9RA 2W2LD 2BHTA 4FEGA 4H3VA 4O1HA 1EP2B 1V95A 3DVAA 3PQEA 2BR5A 1RJDA 4HXYA 2JLZA 4EW1A 4DWOA 3K8ZA 2IP2A 4IQ8A 4J9UE 3Q2IA 2OEPA 1KXJA 5EWJB 5H3LA 4GGPA 5LP6B 3E3AA 3KVYA 3QWBA 4PSDA 1X1SA 2I66A 1IUNA 4RKQA 5C8ZA 2BHSA 2QVLA 4RD3A 4DQUA 1BX0A 1NUUA 2I71A 3MTAA 1Z17A 3INYA 3WFZA 4K9OA 3H1GA 5CIYA 2FQWA 3VPCA 2XXAB 3CBQA 4QELA 4U2EA 3FKSD 3W3AA 1RPAA 3LSTA 1P39A 3ITDA 5CRIA 1II8A 1L7PA 2QI9F 4OGWA 3ADBA 2VAVA 1F2TA 3Q7TA 1EAMA 2VP9A 2JCBA 3DMDA 1UPBA 4EITA 4YAUA 1VSBA 3HDHA 3CX7A 4K0RA 5D7NA 2JGFA 2XB6A 2JD0A 4LNAA 4OUDB 2LR0A 4IL5A 2WYIA 3K0FA 4EPWA 3PHHA 2OOKA 4BWFB 1YK0A 3DMYA 1X9HA 4JBYA 4M7OA 1QBGA 2FSGA 1JDZA 3DYVA 1A71A 3H84A 1C9JA