2A6PA

Structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
RNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2
publication title Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2a6pA00
1ND6A 1K6MA 3IT0A 3MXOA 4QIHA 2P2ZA 1C81A 5AJVB 1BIFA 3E9DA 1SKAA 2EOAA 1V37A 3FDZA 1DKQA 2ENWA 4EO9A 1CVIA 2OWDA 3FDZB 4MA4A 4E3WA 3K4PA 1BQ3A 2HIAA 2H0QA 3LL4A 1RPAA 2PA0A 5AJYA 1C80A 2WU0A 1H2EA 2I1VB 2P77A 2H4ZA 1E58A 4JODA 2GFIA 3K4QA 2P9ZA 5CU7A 4D4MA 2EKBA 1QHFA 1XQ9A 3BIFA 2P30A 2H4XA 2A6PA 3IT3A 3IT1A 5AJXA 3OI7A 1DKMA 3QPVA 1T8PA 1YFKA 3E9EA 5PGMA 4PZAA 3NFYA 4IJ6A 2WNHA 4FDUA 3MBKA 2P78A 3F3KA 2WNIA 5AJZA 1DKPA 1SK8A 2YN2A 2H52A 1FZTA 5CX4A 3DCYA 1SKBA 3PGMA 1ND5A 1TIPA 1QFXA 1UJBA 3LG2A 4AROA 4EMBA 4TSRA 5HTKA 1C7ZA 3NTLA 2YN0A 3D4IA 2DWPA 4JOBA 3GP5A 2ENUA 3C7TA 2HHJA 2EKZA 1YJXA 4ODIA 2IKQA 4HBZA 4D4JA 3QPUA 3FJYA 1QWOA 2P6MA 2A9JA 3D6AA 1EBBA 1BQ4A 1DKNA 5AJWA 3F2IA 1SK9A 3D8HA 3ZHCA 1FBTA 5CDHA 4D4LA 3EZNA 1H2FA 3LNTA 4IJ5A 4ARUA 3GP3A 4ARSA 4D4KA 4JOCA 3R7AA 3QPWA 2P6OA 1E59A 3O0TA 2QNIA 1RPTA 2HPAA 2P9FA 4PGMA 1DKLA 2P2YA 4GPZA 3KKKA 1DKOA 3GW8A 1UJCA 2F90A 2P79A 3DB1A 2AXNA 5HR5A 2OWEA 3E9CA 3EOZA 4FDTA 1V7QA 5AK0A 1NT4A 1IHPA 2P9YA 3IT2A 2RFLA 2BIFA 3HJGA 4GPIB 4PZ9A 2P75A 4ARVA 1RIIA 2DWOA
chains in the Genus database with same CATH superfamily
5DIZA 3DFMA 13PKA 3H4TA 3AESA 4YJGB 3QH4A 5JAUA 1E4EB 4YAGA 1E4OA 2YFYA 5HYVA 4U3JB 5A3JA 3DWEX 1TADA 4EFDA 3LZ6A 1MX5A 4M36A 4OGFA 4MDYA 1EFVA 3BREA 3BXPA 3K0AB 4R9UC 4BFLA 1E2GA 1URPA 1VE3A 1OF1A 4D6PA 4E32A 2W42A 2ZVPX 2JI6A 4LV6A 1MIOA 1AG9A 4H7DA 1BGXT 3RDPA 2G5TA 2H65A 2PSEA 2QJOA 2XAAA 4Q3NA 1TGYA 5AHOA 1K0FA 5REQA 2XE4A 1R6BX 1YL7A 3GGOA 2XNKA 2V7GA 1DXOA 3IVAA 2RH8A 3QG5A 4FHDA 4PRKA 5I9LA 1JR3D 1C3EA 3DDNA 2PUVA 3KSZO 3IUBA 3PFCA 4H4EA 4MXDA 2OZKA 4DBZA 2WJIA 3QU2A 4A0HA 4HZUB 1AGNA 1GCOA 1MDBA 1NHGA 2BFDB 3FF1A 2JEZA 3GT0A 4K8OA 4M1OA 1TDJA 2QNBA 4DMKA 5BP7A 2JKYA 4HH4A 4BX8A 3VNRA 3TFQA 3CRVA 4ZCLA 1L6RA 1EFHA 4C7XA 4I08A 3LQ1A 1Y3FE 5AFSA 3NORA 5E4FA 2XCLA 2C59A 3AC0A 3KPVA 2XE6A 3V7NA 3Q9NA 3TZKA 3IHKA 3FYDA 2PVSA 5AJZA 4B87A 2ZAOA 1JX6A 2C8KA 3FNGA 4GU5A 2OO5C 3FWPA 1A95A 1WIWA 1L1EA 2EFEB 1M6VA 2FPGB 1QJ4A 3PXBA 1J99A 3AHDA 4I50B 4OAPA 1JVBA 4BXOB 5FPTA 4GKVA 2JI4A 3VA7A 3G8CA 2A67A 2RKOA 4BQPA 4C03A 2WHQA 3I9V1 2E49A 1X15A 2R8ZA 4MV4A 4Q3DA 3RADC 1B0UA 3V4FA 3SHTA 1WP4A 2AMJA 4DYHA 1F5SA 2HOQA 3DZCA 4C01A 2WDZA 2JFYA 4DCPA 2QQEA 2E4XA 2H4JA 1U0JA 2SKCA 3I1JA 4OXQA 5DHFA 5THQA 4DCTA 2QTFA 3G2MA 1IUKA 2W9XA 3G8DA 3JQGB 4G81A 4NQZA 3TQCA 2REBA 1DC6A 1L4UA 2EWVA 3E22B 4HDNB 4P98A 2RHHA 1HOTA 2BM9A 5FPHA 3KUKA 4GLLA 1GR1A 1GILA 1IDN1 5TMPA 3LRPA 3PEEA 4FM9A 3GP3A 2O1WA 2Q41A 2O9JA 2PWBA 5CB0A 3JQ8B 4R6XA 3DLTA 4AICA 1D1TA 3CLVA 3KJNA 2HPAA 2EZ9A 5DJ5A 1J90A 1GDDA 2ZJ3A 3DZ8A 2CMKA 3OBBA 3WKDA 5BNTA 4KIWA 4AS2A 3X1DA 1OH7A 4MDEA 4EVRA 5ELXA 1JPNA 5H5JA 1G8SA 3Q88A 1U8ZA 1VFPA 9LDBA 1DJPA 2PKWA 1FBNA 4YDHB 1T4MA 3B1FA 2E4ZA 1KEZA 1MVOA 1NJ5A 2XNHA 4IDNA 4WRRA 1AXRA 1SBZA 5J40A 3VTKA 3GZNB 1AMOA 1EFDN 2FYTA 1H2HA 4ZANA 1UXHA 2X19A 4GYKA 3D4NA 1DVRA 1SWVA 1UAGA 1WXXA 2HY7A 1MD9A 2BIFA 2J5RA 2QT1A 3L0CA 1ABFA 5DYNA 4R51A 5IBQA 5C18A 5HQ3B 2ONJA 1VBMA 4B35A 5CA1A 4H1VA 2FQ1A 2R79A 3NFRA 1YA6A 1Y8AA 4EHFA 1V1RB 5D6NA 3WTCA 4MGZR 1UMCA 5K8TA 1GT6A 1O96B 1UEJA 1KEUA 2VPXA 4CL8A 1H93A 2EKDA 2HO5A 4HXEB 5JC1A 1LGYA 4PZCA 2C9DA 3RWMB 4OHKA 3F2VA 2EERA 3LL7A 3TRFA 1PU2A 4M37A 4GMDA 4CN9A 1Z34A 4K9QA 1LCIA 2Z2YA 2ETVA 4PXYA 4N8EA 3L8CA 2PJDA 3HP1A 1MB0A 3NONA 4WHMA 3RT7A 5J4YA 4TRRA 4CM4B 1P61B 2V7XA 2EWMA 2ZT8A 3LQ4A 4B3BA 1KMIY 3FSRA 2YVAA 1KBQA 2TECE 3RC8A 1NJ8A 2PN1A 2PYZA 2WHXA 3CRRA 3SVTA 1EP1B 2FSHA 3FVWA 4E70A 2NUPA 4GO1A 2C54A 3UV7A 2Z2KA 4DMLA 1B14A 3WP1B 1Y6GA 3BIFA 3LX4A 1DEKA 4UUAA 2AQKA 1J0CA 4XR4A 4U1RA 1KVRA 3CX4A 4OAQA 4N48A 1GG8A 2JGDA 4ZOQI 3UHOA 3U0BA 1FDSA 1VRWA 2O6LA 3AHJA 3N2YA 4GNKA 2Q4BA 4QQKA 3MIIA 2VQ6A 2IUUA 2OCAA 2WZCA 4ZO7A 3RS2A 4E31A 3FDIA 4GP7A 2JCXA 5DTEA 3ZNNA 3NRBA 2HKIA 3B5JA 4NCJA 3Q8WA 4DC9A 2NUTA 2V5VA 1CIVA 4V0OA 4QQNA 1LWOA 2C9CA 1E9RA 2XI4A 3BIWA 4HLQB 4G1EB 4LUCA 4YBRA 3S1SA 1CQPA 1VJGA 1RWNA 2OAGA 4UXIA 1B4DA 3MYYA 3UAWA 1SUSA 4D6YA 4PFSA 1XD8A 4GP6A 5HOEA 2I4IA 1QGED 3RS0A 5LZ4A 2H31A 3L6UA 4MVJI 1J8MF 4AFNA 4KK4A 4YUYA 4HYQA 2O05A 3E15A 3BB4A 2J67A 4YI3A 1U1CA 3TK1A 2G1JA 1T6ZA 1B1CA 1JHVA 5AICA 3G2LA 1XVVA 5LDGA 4C89A 4OTZA 3W4JA 3EMKA 5KKCA 2VRWA 2CLKB 3OFKA 2QLFA 2YTZA 4PZPA 4R41A 3ROQA 3BMOB 2AE2A 2ZYRA 1RZUA 2GAFA 3ANMA 3D8UA 2E85A 4L07A 5B4VA 1CF4A 4FYYA 3VU9B 4D8WA 4P8RA 2OCDA 3N2ZB 4YJ3A 1E5XA 1G9XA 1PGQA 2AUMA 1IOZA 3JV7A 3JX9A 4R54A 4KVFA 4YRFA 5AWFC 4KQXA 3ZV4A 3WL7A 1FYXA 2YJGA 2X5KO 1B8VA 2ZQ5A 5JADA 1W1WA 5KNBD 3RC9A 3CS3A 4N5LA 2G9RA 2HRRA 3DVQX 3UV6A 1LRJA 4TTAA 1B43A 3X1MA 2FG6C 4WMLA 1C3VA 2IHNA 1XD2A 3H5TA 3ZHZA 5I5GA 3DA8A 1XZNA 5FA6A 2R66A 1VKZA 2HWKA 2O2JA 2ZWIA 4KYTA 3SOPA 1CD5A 4NABA 1VJ5A 2HRCA 1L5SA 1HE3A 1B1AA 1ZL0A 2CXHA 1W85B 4AG3A 5LD2B 3RODA 4EG6A 2Z5VA 1GPUA 3H1GA 4MI1A 3RQIA 3DVAB 3TL3A 1I0IA 2R6FA 1GA4A 1JN0A 2CUNA 3GLFA 2PQMA 2CYCA 2XTZA 3OU7A 1EG2A 5I7FA 4IGEA 4A6EA 3C8UA 4XGKA 2OB1A 2QX6A 5K3BA 1F8XA 2H1VA 4MWCA 3REQB 3SGLA 4ZRNA 3D6VA 4E88A 3CBQA 2R8BA 3F71A 4M1WA 1ODIA 2BFFA 2X4DA 2HIAA 3BXZA 3C3EA 4KU4A 2M6KA 3VTFA 1KZ7B 2AZXA 4FKZA 1PT8A 3M3DA 5LXTA 1LY1A 1RQLA 2Y68A 4IVRA 4DSZA 3LT1A 4E4RA 1VP3A 2O8DB 1PWHA 1RE1A 2BFEB 3D8NA 5ELMA 4BOYA 1C1XB 2JLSA 5JNLA 1UBLS 1I7DA 4KUHA 4B6EA 2XMCA 2X0NA 3AFHA 3EIUA 2H7XA 3OQIB 4L3VA 1K6IA 3A1UA 4Q03A 3T34A 3Q1LA 5DX8A 3SJCA 1E64A 1TCBA 3QPAA 4GZMA 2W2KA 1LDNA 1LLQA 1GGHA 3ASYA 4CKEA 3Q3VA 4J1TA 4MPTA 3IO3A 2AZ4A 1AO3A 2P3OA 1EKXA 5DASA 1U0RA 1HDYA 2J5BA 1S0UA 4WKBA 5J5CA 3ITNA 4FFWA 5EXEA 5KUTA 2XKKA 5IM4A 4NBNA 5SY4A 1JU3A 1PV4A 5BW5A 1R12A 1W25A 1QGOA 2WWGA 5DRTA 1K0UA 1YBVA 1W59A 1NYRA 4D8VA 2V1UA 2PYDA 2K5UA 3WIBA 1PCXA 3GGDA 3GIWA 2IS2A 2QXYA 2G82A 1P1IA 4D8XA 5IN4A 5D8DA 1P80A 2Q4OA 2AN1A 2PGJA 3KKEA 3NM5A 4N54A 2Q9AA 1NQXA 1RPNA 1VQ1A 2QF7A 1WETA 1KEEB 4IZ6A 2QXUA 4DMCA 1I33A 4DYDA 5IT9A 5A4MS 3L6RA 3GJYA 4JH0A 3LWBA 3WGQA 3KWLA 3IQXA 3PJEA 4K26A 4AY3A 3N8NA 1D0SA 5JDCC 2R6CA 3ICPA 5K3SA 1M66A 1NPYA 1U99A 4RUKA 1IZ0A 1YCFA 3DDCA 1XTQA 3MMSA 2ZREA 4HH0A 2IVZA 2ZB3A 1FL9A 5HK8A 3SZ3A 3T5CA 2G1UA 3T95A 5J47A 3VC3A 2W2LD 3EQ9A 1EVJA 1XJQA 2EHJA 2PGLA 1A9TA 4DILA 2W6JA 3ABOB 1SBHA 8OHMA 1PL0A 5JARA 1DFHA 1NUPA 3W5IA 1QP8A 2H16A 1RSZA 3IAAA 4ZTZB 5BNFA 2WU3A 5KPDA 1F2UB 2AWNA 2J7PD 4OV6B 4ABYA 2IU4A 3I53A 2FFHA 4J90A 3AR3A 5J9FA 1C30A 2IP4A 1YIOA 2AL7A 4FMCF 1M1YE 2R11A 4X61A 1COWA 1N0VC 4M55A 5BSFA 4LPSA 2BAGA 3UK1A 3PNSA 1J20A 4GPZA 4KKXB 4FBGA 4MR7B 2D2EA 2QG6A 2BOVA 3KKKA 4G67A 1LBTA 3UHAA 2XGSA 3DXXA 1QO0D 3ZK7A 2RH4A 1ZR2A 1CNFA 2ZRCA 3MBOA 4EYGA 1PGOA 4RPJA 4MP8A 3ZWBA 4DSAA 1GADO 3KSAC 4U8HA 2I78A 2D2XA 3C7KA 1WZ2A 1BHSA 4YFVA 6AT1A 3M6VA 4RY2A 1U2DA 3G23A 1YK0A 1DX6A 1NW9B 2RFLA 2GJ9A 2J5XA 5BO5A 2D74A 2IZ0A 2X8WA 3B60A 3LY7A 3ZXIA 3TSZA 5JZOA 1IUPA 1HRDA 3P45A 4YAUA 4UUOA 2DUNA 3KKZA 2O2DA 1YHYA 4NMXB 1W5TA 1WOYA 1A2KC 4F96A 4Z4EA 1SVKA 2FB9A 4ALLA 2SECE 3JYOA 1PFGA 3MWYW 4OOEA 2P3SA 2W8BB 2FZ4A 3JPWA 4R1QA 5IUKC 4EG4A 2F1JA 3C6ZA 4KWEA 2DQSA 4RULA 2WKPA 4XSVA 4W5RA 2ZT6A 4W8OA 2J32A 2OXFA 4U9UA 5AJYA 3AVVA 2BPOA 1X7ZA 3FI9A 3TLXA 3ZWCA 2G88A 1ZRMA 2C31A 3BYZA 4H1UA 3L1IA 4MUMA 4KLZA 4QUDA 1N2JA 1L4KA 1JFVA 4XJXA 5IK2A 4GYWA 1T8YA 2ZUTA 1NVGA 4HAOA 2V9CA 4WOPA 1C1DB 4IDEA 1V1JA 1H2RS 3OIGA 3LW8A 3OX3A 4MWSA 3W6UA 1FTGA 1SBIA 2PL9A 3PC7A 3UK7A 3GEDA 4B3CA 2XH8A 4MYTA 3L82B 1FVHA 4P33A 4ECAA 1V3UA 2BUBA 4V1CB 1E3TA 1E1RA 4BMDA 3F6RA 3VU8A 3E9NA 2PQ0A 3WGGA 4LHYA 2D8MA 4J0QA 1H3FA 3A70A 3WHKA 2R0QC 4ZT5A 3FRIA 5TR9A 1H9BA 2O8VA 5A5EA 3SC6A 1G21E 1OA0A 2DCMA 2ZJ4A 1OYWA 1MUUA 4E08A 4TROA 3ND6A 1Q95A 2PNJA 3R8CA 5C8ZA 4OQEA 2XCSB 2OZPA 2ZRGA 1BX0A 2VJMB 2WT4A 2FSUA 1KMMA 4GQBA 5BVHA 1N32B 4FD2A 3H9BA 4R1OA 1Z5NA 2DMRA 3CV3A 3LO5A 4YLGA 5JS6A 2X0EA 2OORC 1R5OA 4L50A 4MDHA 3REFA 1TAGA 4KXQA 4NJOA 1Z83A 5EJMA 1FP4A 3RUFA 1LS1A 2YIVX 5EMMA 4JAVC 4AY6A 1GQ2A 3FUWA 4P2GA 3B7WA 4FE7A 1G21B 2ADMA 1L4YA 1O95C 1GP2A 3A2LA 3HDYA 4UU0A 1JWAB 1JAHA 2C07A 3KV1A 2GZSA 4U00A 4I1PA 4PZ0A 5FWXB 3H11A 2R97A 2GF9A 3JYQA 3QPWA 4AIRA 4PHTA 2IEBA 3MB8A 1PGPA 1NN0A 1X0XA 4XLZA 1TA9A 2HA4A 4WKPA 1WW3A 5KJFA 2ZSAA 2QEQA 1FNNA 3GVXA 3I2GA 1CQXA 3E2IA 3OU2A 3RVBA 4TTPA 4CU5A 2HWYA 2XE7A 4ZU3A 5FCDA 5FOQA 1IQUA 1XTPA 1TFUA 5BN4B 3TKAA 2VH1A 2DUJA 2ZCUA 4IJQA 3ZXUB 2VDQB 3AUYA 2PZMA 1FSZA 3KDSE 3AJAA 3NQ41 2BEKA 1IIBA 3KPYA 3W7VA 2HA0A 3DMTA 2Y66A 2F1OA 4Q39A 2XDQA 3ENVA 3QI2A 1MFZA 4C4YA 4OKSA 1WSBA 1T3ZA 5D85A 1LDMA 2OCYC 1JAXA 2N0SA 2VZLA 4RJ2A 3RTAA 1SUDA 2JLWA 4H08A 3UUFA 1P0QA 2QTAA 4DLAA 5AJTA 5FR1A 4B7UA 5HILA 2YVUA 3PI7A 1UFQA 4AXXA 4E1VA 1BN6A 4LBZA 1STOA 3HNOA 1SOUA 3OZXA 3IOEA 1QYIA 3CISA 3E5MA 3GEIA 3B1WA 1S4QA 1YQQA 3ANTA 3JSXA 1P7VA 3T94A 3Q8KA 2RGNA 3TSCA 2P90A 1CVIA 1T0IA 4JP2A 3K09C 3OHPA 3L1HA 2OXRA 1JQLB 5EZYB 3AI2A 1C0IA 2VA8A 2WJAA 3KU1A 4OA8A 4QDUA 3I39X 1C9YA 1N5OX 2I6XA 2QRVA 4IIUA 4P4GA 2HDNB 4R98A 1OLUB 3BF7A 3KOUA 1GTRA 1V3QE 3PDCA 4H3HB 1I3CA 4K9NA 4ARUA 3E70C 2R3SA 3RU3A 1EJ0A 2X7HA 3QELB 4X1OA 1RWOA 5CU7A 1F4PA 5DBHX 3IUQA 1NIJA 2P1RA 3BWDD 2RARA 1DC8A 1EWRA 1JYFA 4PX9A 3AW8A 4IPTA 4O4LB 4KGXA 2P2SA 3HKBA 3LK6A 1TO2E 3MERA 4JSYA 2E4AA 4FYJA 4PLPA 1C50A 5NULA 1J21A 3AOEA 3CKYA 1F3OA 1WZIA 4PLWA 4LDNA 4DV3B 2O3QA 2PLRA 3A1NA 3WS7A 121PA 1XPJA 1MTOA 2FUG6 4JCCA 5LP6F 1M2JA 2OBBA 2BHTA 4RDHA 2TS1A 3A2MA 4FFBA 1FNMA 3I6ZA 4RIEA 1TAUA 1S5PA 3MRTA 3RTGA 3WYCA 1D6NA 2CUTA 4LYEA 4NBTA 1G8YA 2PBZA 2HU8A 4RFLA 4CVNA 2Q5FA 3I6QA 4Z7OB 3U4CA 4H7FA 3LHSA 1JDBB 2GAIA 3AYZB 4XYLA 2LRHA 1UKEA 1VRCA 4WNIA 1E7QA 3KP1A 3F6PA 1NJFA 4MRNA 3HBFA 1DCFA 2C92A 4RZ2A 3W8FA 3OLQA 2H06A 1H6DA 4BQSA 1BG6A 4K9OA 5K6AC 1TTHA 2A35A 2AWOA 4N7RA 1ABBA 4GQIA 2AZTA 2GWHA 3HJFA 1YJXA 3MELA 3KJHA 2NU7A 3JVDA 4HBZA 4WPGA 3SKYA 3VYRB 1GPDG 3ZEIA 5CFNA 5C3UA 1CK4A 1O0SA 3E5RA 3LP5A 4WN9B 5AKKA 3H2KA 3VX3A 3AVTA 1NGSA 1THTA 2NTJA 2Y71A 3HDQA 3LPNA 1JECA 5BSTA 4EGAA 1DJQA 1X1TA 5DNWA 4E5DA 2P9TA 3LUCA 4Z6KA 1NUHA 3G0OA 4M7RA 4TM8A 5BYAA 3OIUA 5I4IA 4XGNA 2IXGA 3NB0A 4DKXA 1F1JA 1WUKS 4CWAA 5DBGA 3SK0A 1LPBB 2A9VA 4JUAA 3UM9A 2B21A 4K3UA 3PD0A 1L7RA 2FSVC 4E07A 2DR3A 1HYBA 4H1WA 3BD9A 1NMSA 4ZOLF 3EUWA 5CA0F 3OPNA 1OI7A 4GPTA 1NN1A 3KFVA 1UOOA 3DBRB 5L4NA 4XYBA 3TH5A 2F7SA 3LPMA 4RZSA 4W5QA 3H99A 3QEJA 3SEFA 3BKWA 5DB4A 2V0CA 5BSMA 4A5SA 1PLLA 4Q19A 5BRAA 2BKUA 2ZJYA 4R8SA 2ZM5A 2W5UA 2XIJA 2YH2A 1DIGA 1EE1A 1TD9A 3QHPA 4HKTA 4ND3A 4D3SA 1J2YA 1NVAA 3EXHA 3THXA 1JSCA 4P7KA 4S1PA 1RM3A 2VSXA 3EZ6A 3SMVA 3A1EA 2BEVB 4QOEA 1PFWA 1QCCA 1Y1PA 2CDAA 1BXGB 1ZIDA 2DFNA 3FLBA 5F5NA 3ZCQA 4XXHA 5JFTA 2EJCA 4J07A 1JJVA 4C78A 5EZ5A 1AM4D 2DFTA 2HRQA 1KZ4A 2E18A 2EW1A 2Q3LA 4DRYA 4YO8A 3C4QA 3EY4A 2HYDA 3HKEB 2PD3A 1NT2A 4G9GA 5HS4A 5ALFA 4H6PA 3UMCA 3ZBQA 1XTIA 4I55F 2CB9A 2BFOA 3V4ZA 4E15A 4UQLA 1XEWX 4RV4A 4M83A 3FNQA 4F4FA 3OY7A 3VSEA 1CY7A 1ZMTA 3AL2A 3TPFA 1IFXA 1KS9A 1Q0QA 4EG7A 3KT0A 2C3UA 2I3GA 4R1TA 3B6JA 3SSOA 5HW0A 1V1MA 4U2BA 2VKTA 5IZCC 3G17A 4A6PA 5L3QA 4RK6A 3FNEA 2HV9A 1NBAA 2H3EA 3S70A 4BRZA 1XHFA 3DOCA 4FQ7A 4J1SA 4ZVUA 1IE3A 3K8YA 4JLBA 2WWWA 3A28A 5KYYA 5ICEA 5BSHA 3O7MA 2ZIZA 1ONPA 3OWOA 4N8DA 5E0KB 1J2TA 2EQBA 4DMHA 3A1WA 3DFIA 4S1NA 1DB3A 3QWBA 4FDUA 2ZB8A 3DBHA 3I76A 3P0IA 2WNIA 3I64A 4YJFB 5LZ7A 2JAQA 1G60A 2ZROA 3EG9B 1HLGA 4PHHA 1OWNA 4JASB 4WY5A 2VRBA 3WAGA 4RA6A 1JQBA 3WHLA 3KSRA 3SBOA 2RI6A 3Q40A 3HDHA 1XZQA 1CKEA 3ZWOA 2XNCA 1NPTO 2BCEA 3ME5A 4EMBA 3CUVA 4PQGA 1KA9H 3TAHA 2B35A 4N0MA 5B4TA 4Y6PA 1PDOA 1A1SA 3IVCA 2X9VA 4S2UA 4MQEB 4MK4A 1W581 2ATVA 3FTNA 2V7EA 1TYCA 3M6MD 4LDJA 4RELA 5IVHA 4H15A 1XCMA 3EPPA 5ENVA 1A9SA 2RHMA 4TUYF 5A2GA 3QXJA 3GNQA 2ZJ5A 3IB6A 1JG4A 3E5HA 5C81A 1L5RA 4N65A 5CDHA 1DEHA 1XEXB 1VIAA 3E3OA 1WBBA 3LSTA 3ADBA 4OIMA 5CCXA 3HVIA 1FDUA 1DI0A 3M33A 1NMZA 1E7MA 2ERYA 2Z98A 2J3IA 4M8NE 1I7LA 4LZZA 5DYTA 3IRUA 3RFVA 4UVHA 3EULA 1TJ3A 1NV8A 4QREA 3IPXA 5KMGB 4FEAA 2QAGB 2HT1A 2IY9A 3GH1A 2BGIA 1XN4A 4UMDA 3LX5A 3C8ZA 4WXYB 4XW2A 5EYPB 1KDZA 4B5KA 1FUEA 3RVLA 1Q19A 1WWKA 4GKAA 4JB8A 3SBEA 4BKPA 4B3MB 4XR9A 2VTVA 1M7BA 2PU5A 1Z3IX 2WVHA 1E2HA 1U3TA 1KK3A 3H1TA 3IP7A 3LY5A 3EGIA 3SFTA 3U7IA 3WRXA 4BMPB 3ON5A 3IAHA 2R1VA 2XGGA 3GMDA 1LPMA 1PTKA 2EFHB 3IE0A 2DQZA 3W79A 5TIIA 2Q1WA 2X8JB 3DDUA 5T57A 3KT6A 4LMRA 2YHAA 4ZVQA 2V3VA 4INZA 4TXLA 4GX5A 1M6HA 4LJ9A 4CMHA 2M6RA 4TVSA 3D4PA 2EEPA 3IT0A 4NVRA 2EBHX 4HK4A 1NMXA 3R74A 4FWIB 3PPIA 4RKQA 1HNXB 3SIRA 4RD0A 4PC2A 2ZI7A 4RGYA 4E4YA 2UVPA 3QEMA 5A9TA 1NNLA 2CDRA 5H81A 1GZ4A 1HH4A 2X5JO 3T3PB 5TT0A 2OG2A 2HQ1A 3AERA 3P9YA 1C7RA 3CLUC 2FMXA 3KE8A 5JMOA 2C77A 2WZQA 2JLUA 3DAOA 1C3OA 1BS9A 3D7SA 1G7RA 3AO0B 4N0PA 1R6DA 4GI1A 4OHCA 4ZPXA 3DEIA 3LQRA 5K6AA 4HDKB 2CZCA 4F2GA 4UM7A 4MWBA 4D42A 3DVRX 4AF8A 2QLLA 4L5CA 4JOSA 2GCGA 1HL7A 1GPLA 1H6CA 2JDID 2XMGA 3GDWA 1DJMA 5B1YA 1M33A 3RROA 4NQRA 3AM1A 4D9EA 2ODAA 2YV2A 3FGNA 2Z83A 4KLRA 4NHOA 1KNQA 2Q3DA 1V47A 2HU5A 3M6WA 1CC1S 4G1BA 4G1MB 3ZHOA 3QUCA 4PLHA 1YR1A 4WY8A 4RHTA 3GLGA 1PR2A 5FA8A 5EG5A 1A8PA 1BMFD 5FH9A 2EG5A 4TYNA 2FEMA 3AONB 1O97D 1KO4A 1BFUA 1NM5C 3E8SA 3N2NA 3KS9A 2XF2A 5DP2A 2G04A 2H52A 2AFIB 2VSNA 3B1ZA 3UJNA 5CP8A 2NP6A 3FHOA 3BIXA 4Q1FA 3NDBB 5I6DA 2F1KA 3U4QB 4CU2A 3LKDA 1W35A 2F1HA 1H2WA 2I2AA 4BU0A 2GYUA 1OXMA 1T5DX 4HAVA 1YB2A 3TMYA 1X8XA 5DO9A 5JALA 2GHTA 3K71B 4JJKA 5BY2A 3MC1A 2SNIE 1ZOLA 1D0VA 3N3BC 1YZNA 2ASEA 2X2FA 2JGKA 4CKCB 3PHGA 1VP9A 2RSLA 3LE8A 4HX9A 1TMYA 3O4RA 1ZINA 2H2GA 2BBSA 2C61A 2B8NA 3OOYA 4NBKA 4TSFD 3HTXA 5J2TA 1K06A 4ID9A 2J3EA 1YR7A 2DHQA 2WU1A 4KEAA 1A88A 1JG1A 1XVTA 2P62A 1RP7A 2DQKA 4LX0A 3Q0IA 3RSQA 3RTDA 3SS7X 4E2YA 5HHTA 3NT5A 5TT1A 1YFLA 3BMCA 4G09A 1QYDA 1RI4A 1RZVA 2JA2A 4JT4A 3DZGA 4G0PA 3AEQB 5CG1A 1NASA 4F45A 1Q1QA 1ENOA 2VDKB 5FADA 3UK6A 5K0LA 1AKWA 3IPYA 2CFIA 3M89A 4D3DA 2AXQA 2C2ZA 3K0HA 4UUNA 2Q0HA 3RBZA 4IH9A 1JALA 2C5SA 4BAZA 1YOVB 3ZI0A 2HO4A 5BN1A 5I8PA 2M6LA 5LQJA 3MWDA 4YJ2A 1MPXA 1P1FA 2DSNA 2P2CA 4HQFA 3C6MA 5EXSA 3NT4A 1AHHA 1Y4AE 3UXEA 3ZOZA 5JD6A 1Y8QA 3GUZA 1R6UA 4HAIA 5KQLA 2ZK7A 2WD9A 2B6NA 4C0JA 2X7XA 3E3NA 3HB1A 3ZV3A 4DBVO 3N0VA 1GKUB 1ZKDA 2BR3A 2ZYHA 5C9ZA 3STUA 3DOEA 4AM8A 1SY7A 3AR4A 4EPXA 4JI5B 4AP5A 2NU9A 3HHEA 3WOVA 3PQDA 4QEDA 4URUR 1J1UA 4FLEA 1A9RA 5H70A 1C4OA 3AESB 3ZCRA 4DWWA 4IRXA 1RYNA 3IMKA 4RV5A 1R74A 2GAAA 2PLAA 3RRBA 4JB0A 3QPBA 4FVTA 4URZR 4IH1A 1EFVB 1NXQA 3IOYA 4IYRA 3RS8A 5L3SA 3K0SA 1IM8A 2MHCA 5IARA 1TZMA 1YTLA 3MJCA 4O3FA 1TE2A 3HA2A 4Y1GA 3OZFA 1MKYA 5FFFA 4KR7A 2OUIA 3JVEA 1E20A 1MIOB 3FOEC 3ETHA 2FG5A 3TTSA 1M2NA 2QGNA 3SX0A 4HX2A 1KS2A 2W2XA 1CJTC 1IB6A 5ECDA 1ZISA 5REQB 4K46A 3RAFC 3CVVA 1I14A 4O33A 1P5FA 1YRWA 1Z4IA 2C78A 3AF5A 2A0WA 2ZYAA 1QS0A 1KP2A 3IT3A 1UQUA 4OQPA 3GDGA 4RHXA 4KBFA 4BFSA 2XWBF 1Y7HA 3UWSA 4D8UA 1G7TA 2JPDA 3IBCA 3R41A 4FX5A 4G0ZA 3OE4A 1AKTA 4Y6GB 2HXYA 2PMEA 5EE0A 1UBNA 3EXG2 3FMVA 1BEUB 2GZHA 4LY0A 5SY9A 4C7OA 2BLLA 4PYRA 4ASUA 5AKHA 1UJ6A 3UH1A 1OX6A 3EJ6A 2OCGA 2XVMA 3QXCA 4OJYA 3ZDQA 3SJBA 2FPOA 1UK8A 1NVMB 1XTKA 3C3MA 2GZDA 3DOIA 4KGVA 2CMDA 5KC8A 3VQTA 1E8MA 1Q12A 3S2UA 2CBXA 1M6VB 2JEYA 3UJ9A 1GNSA 2B4TO 1Q7GA 4GE3A 2IHZA 3L6OO 3TIXB 4I5FA 5DGCA 4AROA 1N5JA 1LLFA 2D3WA 1DAFA 4MPDA 4YALA 5B64A 4J9VA 5CB4F 1T13A 4F06A 1O94A 3IDOA 3JZDA 1QX3A 3AKEA 5KS2A 3VR3D 2OHHA 1YD7A 1WMFA 1ULAA 3I52A 5HFNA 4YMVA 4XDHA 3HZOA 1LPAB 2H63A 3LBFA 2XUKA 2A57A 3M5CA 3BH7A 4MUEA 4N9QA 4U2GA 5DHTA 5SZIA 3T3MB 1LPOA 3VKHA 1EQ2A 5B6IA 4MUFA 3H3JA 2IW3A 3FGOA 1UPTA 3KBBA 2HCJB 1KVTA 2WPNA 3MWJA 3VPAA 4GICA 1ULUA 3UFBA 1QH0A 5EIWA 3G8BA 5ALVA 5K0NA 2C1XA 1ZU4A 1D3AA 3MEQA 4HEA6 5EFOA 3O8BA 2G7MC 1FNBA 5ELLA 1M8GA 3VO9A 2C99A 3NIWA 4JJ6A 2KX7A 5HQTA 5ETJA 5SY6A 1B2LA 2GPYA 3UHPA 1K9SA 3H8VA 4XIYA 3RW9A 1RPTA 4D41A 1PW7A 1YNOA 5JZVA 2G71A 4WBNA 1TM1E 2V8OA 3A1TA 5BN5A 1QH9A 3PL5A 1KU0A 1NVDA 3FWYA 3OX2A 2QS9A 4GI3A 3W8EA 3OTIA 3NJ8A 1TL7C 4J0EA 2JCVA 1EWYA 2HADA 3IKLA 2CLSA 4RXUA 4BNIA 4DLZA 3DE6X 3IURA 4HDOB 2OKGA 3VV3A 3L8FA 3RK1A 4YMUA 4KR2A 2NWQA 4WA8A 2C2HA 2PL1A 1XRQA 4C0HA 4HF7A 4PO9A 5ALIA 4F46A 1A4IA 4KWHA 3WWCA 4EECA 3DFKA 3U80A 3STHA 5BW4A 3BS4A 1PG0A 2BUCA 2ZSDA 4BFXA 4DA7A 5JWOA 3LQ2A 3BWBA 1ABEA 4FQ8A 1GJRA 5FI0B 1ZEJA 1OHHD 2MSDB 1X7XA 3B3QA 2PKYX 1BQEA 4P84A 1E61A 5CA1B 2R47A 4QTXA 3H13A 5KQSA 5IEJA 5TLSA 1B8UA 1UMCB 3CLTD 3H5LA 2JHCA 2GJSA 4PEVA 3EIQA 3RLFA 5AM2A 4GLOA 1Y9JA 2QKYA 2POQX 2BRUA 3JD2A 1C8KA 4KMMA 4L4ZA 1DQNA 1YS4A 3OA2A 3GAMA 4DNQA 2PKQP 4FU0A 5THKA 3CUUA 3CB2A 4M0PA 1EFTA 1GDHA 4JQSA 4KWCA 2CJPA 3F1LA 3BAFA 5JAPA 1HG1A 4L3OA 1U2QA 4G9EA 4KDRA 1XLUA 5JXIA 5TC4A 4FZ5A 4QOGA 1XJCA 3NXSA 4AQDA 3FPLA 4QKQA 1V8OA 2GPNA 3IUYA 2NUPB 3LYUA 2ZXUA 1JV2B 4RENA 4B6FA 2XRYA 3KOWA 3PWSA 5F4BA 3URKA 1O58A 4LY9A 1JEYA 4DR6B 1X1QA 2O50A 1A7KA 4FNGA 2IHTA 2JGDB 1ZH6A 5DHPA 1S1CA 2AEJA 1KAMA 3X2FA 3EC7A 5AM4A 5JSYA 4MW2A 1MABA 2CV1A 4EITA 4MI6A 4CKBA 3UW1A 4MR9A 3W5UA 2HPHA 3VKUA 1JKFA 4W5NA 3DC2A 3DWFA 3RG8A 3SM3A 4BKUA 3A58B 5F12A 4XRGA 2I2FA 4FSXA 3K72B 2NUTB 4QUHA 1EXNA 1K5PA 2Z43A 4KITB 1HF3A 2R8EA 3PFNA 4X1IA 5AKEA 2QVGA 4C05A 1M6YA 1OGYA 3AJDA 1P1BA 3D3QA 4IMJB 1OAAA 1GZ5A 4A27A 4BATA 2Y6VA 4Q34A 1QQ5A 2ZI4A 3V4RA 2VDVE 5ALGA 1XU7A 1G5FA 1ZK4A 2ZS7A 3TR6A 1NFQA 3OPVA 2JGRA 3PDWA 1RMQA 3WQHA 1I6KA 5I7SA 2BJHA 2PX0A 3OX4A 3T0IA 5HKBA 4MW6A 4ZI3A 4P5PA 1QRRA 2JK1A 1IWBB 2NZYA 3AXTA 1BQ4A 3B53X 5LC1A 4AX4A 5AJWA 4W5WA 3JWHA 1OWOA 2WIAA 1SC6A 3ZQUA 1V25A 1F6WA 3FSGA 2PUGA 1OY1A 1QHGA 1Z6QA 2N9UA 2ORIA 1SQSA 3E35A 3ER9A 4JITA 5HKKD 3NHRA 1XZFA 1SXHA 1EEXB 4LFAB 3IKJA 4NL4H 4BX9A 3FKSA 4AO7A 1KEKA 1SZCA 4MEBA 1C5KA 2ONKA 2J9XB 4EGJA 2PRZA 1NG9A 1DG1G 4X91A 2CCKA 4YJ3B 5ABPA 2AK2A 3C3WA 3P0RA 4C0SA 4EHIA 3QFTA 1Y1TA 5CYPA 5GV8A 3D6TB 3TOSA 5E6SA 3GJ3A 4GBGA 3MIZA 4PNZA 3NNDA 3VXKA 2EL9A 2HK6A 3LUGA 3B6ZA 4TPKA 4F2PA 2R4TA 5TSDA 4EA8A 2GPSA 3ZD8A 1XCLA 1JXAA 3NTQA 4IDFA 3L6DA 1G3MA 1CY4A 1FF9A 3HUDA 2A9PA 1XD2B 3QXGA 3ODPA 1BZYA 2D7CA 3QRWA 1W6RA 2HEIA 1A69A 4L02A 5FI3A 4L2IA 421PA 4CTMA 1N2CA 4ZZ1A 1EX9A 2WM3A 4F97A 1S6YA 5IJ0A 1JW9B 1JLSA 1YV9A 3CG0A 1OLSA 4DM3A 1WULS 2V65A 4UEJA 1PQYA 3N8IA 1RLTA 1WU7A 3LTEA 2DERA 4MEJA 1W5AA 1BCSA 2HPVA 3HFSA 3GLFB 1ZGHA 1WS6A 1DKQA 1SHUX 1E9AA 3H9JA 2CVPA 2V7QD 2B2XA 2D5IA 3H87A 1Z6AA 2Y93A 4FOPA 4JI1B 3OE1A 4DLYA 4G26A 4E14A 5F7JA 1E0JA 3E58A 2BFFB 1XNJA 3VUFA 4I8XA 2E5FA 2O07A 3NHZA 1KMCA 4RJTA 3KVVA 1Q7CA 3NBUA 4UOZA 4O8ZA 1PP4A 5LXTB 4IJMA 1BXZA 3H0EA 1MQSA 1O8CA 2I71A 2W7TA 3Q5EA 3FPCA 2JFXA 1Z36A 1VXOA 1UPAA 2FFRA 2F1RA 3LK7A 3Q9SA 4IS2A 4J75A 4XUGB 5JECA 2ON6A 4AXBA 2CNOA 1Z5OA 2FZWA 4U9IS 3NBYC 4GMFA 1XZGA 2J5KA 1YFKA 1Z4PX 3QSGA 5U4XA 4CKEB 2WB2A 4HI0E 2D13A 1Z6YA 4UBMA 3AQ4A 4OLHA 3IQIX 3O90A 5PGMA 3IV6A 4QYWA 4FS8A 3CJRA 3LH5A 3ZWVA 1NVWQ 1JDTA 3AZQA 3K1AA 1ETHA 4WCVA 2CVQA 4H3SA 4JB3A 2EAUA 3A8TA 3DZBA 3QBTA 4DCCA 2G1AA 1O2DA 3AVPA 4G0OA 4N49A 4DMMA 2BGWA 3Q3IA 4IXTA 4Q21A 4W1QA 3TBHA 2F62A 1ZK0A 1QG4A 4L16A 2C4WA 2ZYSA 4R2JA 4ZYVA 4J8PA 2CL5A 2W6QA 2JLRA 2Z30A 1Q44A 1GTSA 3EFEA 1C8VB 1X1SA 3RTCA 4F1JA 1SUWA 2V98A 1Z18A 3U61B 4WW0A 4IX1A 1I1NA 1VI6A 1P9RA 3BK1A 4WNCA 5EIBD 4AG6A 1PFKA 2AS0A 5JHHB 3ICOA 1F48A 1ECBA 3ZNPA 4BC1A 3MJVA 2F4VB 4DXAA 3T3GA 4X95A 5CVVA 3EVTA 3N6VA 3MUFA 4R1SA 5JXJA 2CF6A 3EXFA 2BKXA 1S2NA 2GB4A 5J4LA 1GTJ1 2QW1A 5HF6A 1OH5A 1G18A 1MVLA 1NMQA 1SIWA 2CMGA 2JIOA 1A8SA 2QN3A 2XWQA 2ZSJA 3BUSA 1FNSA 1ORVA 2E1RA 4TTIA 4EELA 1VYTA 2Q2WA 1ZQ1A 2J3QA 3Q9UA 4ZVKA 3R7NA 4Z51A 4MWOA 8AT1A 4GKBA 1VDZA 4BNLA 4BV8A 3GD5A 2VLIA 2NG1A 1BYUA 3NH6A 1C30B 2VWQA 1CDEA 1XLWA 2J09A 3G5AA 1R5JA 2BH2A 3O7WA 1GRNA 4MW4A 1I4DD 3PYMA 5IC6A 1AV6A 3Q1KA 3ASUA 3JRWA 3LHKA 4JA0A 4NR0A 4PZEA 3ANXA 4HAUA 4IHJA 3S7TA 4JHLA 2FPKA 1WR8A 2J08A 4ZT6A 3R3ZA 1C9NA 5AW6A 2ZTHA 3W3ZB 2WKRA 3K0BA 3O4FA 2WWTA 3Q8MA 1BKSB 5AI5A 2HXSA 1TVKA 2Y1XA 3OLVA 1EDDA 3GFPA 4E5UA 3HJGA 4DIEA 4EQZA 4KQWA 1H1TA 2ZI9A 4KODA 2HMUA 1OTXA 1QZ3A 3EWIA 3VVMA 1EQUA 2X86A 1N4DA 2AQHA 2HPZA 2GCIA 4FZJA 4HHEA 4Y0VA 1HE8B 3EB9A 4F5YA 3GLTA 2PT6A 3PLAE 3WL6A 1NULA 1SJ9A 3VNSA 3EXEA 3KJFA 5FAKA 1MHPA 4R9SA 3L04A 3PTLA 4LC1A 2H9YA 2RJOA 4OHWA 4MV3A 4Y30A 1JLLA 2QTRA 3HNPA 4U39A 4Z9AA 5FYDA 3WC4A 4NYMQ 2QR2A 1QANA 3WSTA 4HDQB 2UUBB 4ND8A 3UJ3X 4XQCA 6Q21A 3ET4A 1WDTA 4OBBA 3HZZA 1X7ZB 2EF1A 2XMRA 5F3WB 1QVVA 2IIBA 1OJLA 3G6WA 5JS1A 1DADA 2QD5A 1KZHA 5BV2P 1M7GA 3GG9A 4JQZA 3A7DA 1K5DA 3LUJA 4U2KA 5AP9A 3B70A 4ID3A 1J22A 2G7ZA 3BXEA 1GFIA 5L3RA 3HYCA 2H5LA 4Q24A 3DH0A 4P0PB 1FU7A 1NF3A 2ZULA 3DWGA 5AKGA 2XKBA 3QA3E 4CDGA 1OBCA 1WMDA 3PRHA 4TTQA 1O0BA 3R8FA 4RK5A 3V2IA 4ZCSA 3O1LA 1WBDA 1I2CA 2NM0A 3ZZMA 4F6LA 4HFRA 4NE2A 2IU0A 4L85A 4D1YA 8LDHA 5T7BA 1UWLA 3RARA 2M9MA 2DBVO 1RRMA 1UK7A 2VH5R 3L9XA 5KHAA 3VM6A 4UAGA 1TYEB 1V6SA 5ENDA 3PPVA 4EFMA 4S12A 1QCZA 1JQ5A 1AKYA 4YMSA 3O94A 1P0CA 3C3XA 4KPUA 1CWUA 1PGNA 3OBIA 2RGDA 1N78A 1U2PA 4GR5A 1NKVA 5CVJA 4IUDS 4GWLA 5BVHB 4TL9A 1YCDA 3K2IA 4NG5A 3LO8A 4MCHA 3FDJA 4AJLA 4MO9A 1B8OA 5A4KA 4U2DA 4BQIA 3ZU4A 4YRMA 3VPDA 1WXWA 1SC1A 3KL2A 3CNBA 1LFDB 1FP4B 2MT9A 3G85A 2LVBA 1GTMA 3N7TA 4F84A 4ND2A 4BMXA 1GU7A 3EFOA 3BD8A 4Q3BA 3K16A 1GL9B 2AW5A 1E3QA 1I4OA 5EPOA 4MKXA 4MQ5A 1GTZA 1EFLA 2X4GA 1FYFA 2D7DA 1UDRA 2O1EA 2D0PB 2NMVA 4JJ8A 2B4YA 1JLRA 3H11B 4ZYYA 3MTQA 2IUSA 5F33A 2EC5A 5EP4A 1R88A 1UBHS 3ITDA 4LRWA 3BQNB 1E1LA 1V26A 4XKJA 1KGSA 2JCGA 2Z3WA 3BSWA 1U5CA 2WZBA 4K9KA 3L7YA 4YRGA 2XDWA 3OEEA 3T7EA 1W4RA 2PT5A 4WEQA 2J4FA 3SIWA 3PEFA 2X2EA 4MVJA 1U3GA 2J41A 2W11A 2Z4RA 4TKZA 2ZUEA 3R23A 1D6JA 3RABA 3D64A 1CJKC 4D9IA 4DLRA 4B4DA 4L8GA 4O0MA 3K7EA 3U37A 4IGKA 2XDQB 1S3SA 1GKYA 2IXAA 3NEPX 3IXQA 2E7ZA 4M88A 2OFPA 3RNLA 3WK4A 2XECA 4ZXFA 1IN5A 1EGMB 5AI6A 5AM5A 4DVGA 1Q0LA 2DBZA 3T35A 2AJCA 4AJHA 4HNTA 4GNRA 3CRNA 4I50F 4KRXA 2YFHA 1GAWA 2BFPA 2F9MA 3CX7A 3ZNOA 1JHZA 1OXUA 4NCHA 1YDEA 4BLQA 1OBVA 2HCRA 4P54A 5JTTA 4OLAA 1NQOA 3HYNA 1OROA 4LZLA 3OD5A 4GM4A 1E96A 3W5SA 1LQUA 1HQCA 3ZD9A 3ZTWA 5FBVB 5H9WA 4LQLA 5DLQC 4YASA 5T6BA 1PJBA 1G4UR 1J8YF 2R8YA 4PG7A 2O06A 1L4NA 2PWPA 2ZB7A 3GEBA 4PCVA 2NUBA 1AS2A 2IIPA 2ZDHA 1TXGA 1U28C 2YNMC 3KRTA 4OGWA 1EINA 1MBZA 5D7NA 2QRVB 5I5EA 1Y9ZA 2WJ3A 1ZDMA 1L7BA 4K9PA 2OKCA 2AN5A 4EY5A 1UK6A 1H94A 1DXQA 3PDHA 2VQEB 1GRCA 4QWMA 3ZWNA 2GGSA 5JJCA 2FEPA 3QEAZ 2VQ3A 2XKAA 1YB4A 3AGPA 2HMYB 3BFJA 3E8MA 3Q2OA 3HKBB 3C41J 2FVYA 1Q14A 4NZYA 3NAQA 4YREA 4AO8A 3ETNA 4LHVA 3OFND 5UKDA 4TL7A 2C58A 3A37A 1Y8CA 3B5IA 1QIMA 1YC2A 3G79A 3PKJA 4QRDA 4TLBA 1JWBB 2I3AA 4NMHA 3E6AA 4Q9KA 4BV9A 2JFUA 5EJ7A 3DV9A 2LV8A 2VQSA 3VYSB 4D25A 1ZMOA 2D1TA 4FFBB 4LXUA 1KDVA 3F8SA 3EIXA 3VGJA 2CBZA 3USES 2IEAA 3N28A 2AJ8A 2FW6A 1VBNA 3KPJA 2WILA 1VPEA 1TIPA 2LXNA 3EIEA 3OSZA 1N7JA 1QZXA 4TXMA 5I3CA 1OILA 1UC5B 1VE5A 4L75A 3N74A 3L6BA 1KQPA 5DF1A 2RI1A 1VKJA 2H07A 4LDPA 2DKOA 2ECQA 4WKCA 1W52X 3EF1A 4M0CA 2WM9B 3MMNA 4BNMA 4ZJYA 3GUCA 1ZUD1 1Z7EA 4N7MA 4D5GA 4ILKA 5HE8A 5ADVA 2QB5A 3IKMB 1ADGA 4DTIA 4ZO6A 1UCFA 3L7MA 5TS2A 1CLUA 5EIEA 4MRRA 2NU7B 2VSYA 3MTAA 4QA9A 1TPYA 3PXDA 5IJWA 4FI3F 2R6ZA 4OJKA 2PMDA 3IP3A 4F12A 2OAQ1 3R8XA 1S89A 1W0KA 2O52A 2V3CC 1QQ7A 2YXNA 1SG6A 3TLMA 3SQWA 2FJUA 4DN6A 1M1UA 1KI9A 2O4UX 2WE8A 4MTLA 2HREA 1YDFA 3PXGA 4C0BA 3U60B 3KEFA 1PK7A 2QXTA 2Y4NA 4UASA 3OEWA 5ALZA 2OLEA 3ONNA 2Q6VA 1RYFA 4DG5A 2ECOA 3ITEA 1MMFB 1EVIA 3QWIA 1JHPA 2HRDA 4EI8A 3O4GA 2YQ5A 2C9OA 3JQPA 3OJ0A 4QNMA 4G24A 4CF7A 4ZOCA 4F71A 4F8EA 5FPQA 4AZ3A 2H2WA 2CVFA 1M8JA 5TGTA 2IFTA 1QB7A 2FW7A 2HZBA 2MYTA 4KQ2A 1GPJA 1ZJYA 3Q7PA 2VP4A 1ZHHA 4IHQA 3E5NA 4Z4HA 3ANYB 4I1SA 4JLWA 2Q6KA 3KNZA 3OZGA 1RZRA 2O54A 1XKXA 4C21A 1FXWF 3EXHB 4JVSB 2GVDC 4JX9A 3THXB 4O2RA 1N25A 4ZCQA 1KJIA 3UWOA 3SXJA 1LJUA 1EK6A 2CNLA 2JH3A 4NYIR 4YX9A 3T99A 4F9TA 3H9UA 2HJHA 1KC3A 1BFKA 3MRXA 1G7SA 3RVJA 1EM6A 5HX7A 4OM8A 5EEHA 1P31A 2BGMA 2WMNB 4I6EA 4OI4A 5JR3A 1KFJB 3GNSA 1BDBA 3NP7A 3ROPA 1F2TA 2FPWA 3F7MA 2BSXA 1PR0A 2VQDA 2WJZB 3NUZA 4JIGA 5EVCA 1E79A 1U1DA 1GCUA 1MAWA 4F4UA 4YIHA 3O0DA 1YZUA 2GWRA 3O8LA 4JLNA 4B81A 2HTFA 2RGEA 4BNVA 3OEHD 1NUAA 4B6RA 2ZWOA 4YEDA 1IY2A 4XAQA 4ZVVA 1N0WA 2XB2A 1XDWA 2IXFA 1JG3A 2NZXA 1HKUA 5DM4A 3FCOA 3K2QA 1V1MB 1BWRA 2EYUA 1H2YA 1XZPA 5L3QB 3PUZA 2IVFA 2V6BA 1DHTA 1QV9A 4AJPA 3VAYA 5IT0A 5D00A 4X63A 3JXEA 1NRXA 3THSA 3OCXA 2DT5A 5ITWA 4H0NA 5FTMA 5KYYB 2EYQA 1H69A 1CY1A 4J0GA 3U1BA 4XDYA 3BT7A 4LCBA 1IOVA 1Y4DE 5CDFA 1NX9A 1PKEA 3KM0A 1KK0A 1XAGA 1P0FA 2DHEA 3VH1A 3JQAA 1G8FA 3ZZUA 3GFGA 3IXLA 5M7EA 3GG2A 2YRXA 5H1YA 3KJZA 4RCZA 3IO5A 5FWDA 4B4KA 4QGAA 3DBHB 1QK5A 2FZVA 5EA2A 1E4YA 2JFNA 2Z0MA 1JI0A 3I72A 3DWIA 3V80A 4D4IA 3ICWA 2FUG1 3EYAA 4PO8A 5DTJA 5FKJA 5FR2A 4Z4QA 3OHMA 1N8KA 4RA6B 1QRDA 3EF3A 3IQFA 4XIIA 4YFYA 5HJEA 1U8EA 2CC2A 2IXTA 2PZEA 2VDWA 1QHNA 2YIMA 3BH6A 5FIUA 4LFCB 5FUMA 5IXSA 5DBOA 1EUZA 3EUFA 1ESZA 3OZVA 1KQFA 2NTEA 1CZNA 3C3CA 4F6CA 2Q4DA 4X62B 3V97A 1OVGA 3GZTB 1N6LA 3ZE9A 5JAHA 1Y1SA 1D6SA 2ZS8A 5GINE 3CZ9A 3LFUA 1QRTA 3DTYA 1W5EA 3JQFA 3CE9A 4E2FA 2YY7A 2NXJA 2HNAA 2YHIA 3VDNB 1KFCB 1RI5A 1G6Q1 3KKQA 1I7QB 3TCXB 5LFAA 2GYWA 1H6AA 3L4BC 4D9KA 3K1TA 4B31A 3Q41A 1GNRA 3UA4A 1S2IA 3MHPA 3O3NB 1F38A 1P3Y1 3L1JA 3O75A 4GDMA 4LG1A 3FMGA 1KYXA 2RG1A 3RKSA 4QDOA 5FT9A 3RS4A 3BKXA 4XIGS 2WAAA 3L84A 5KWSA 4DOMA 1H0HA 2P9FA 4LI3X 3RYIA 2AN3A 2FPXA 4FINA 4JJAA 4OYHA 3F8WA 2FTKE 4URWR 3N59A 1X2BA 5G41A 1CJUC 3OM0A 1CUHA 2KQUA 2P0YA 4L4RA 3AOGA 3IA7A 4MWTA 3P9KA 2XJ4A 1E6UA 3NDPA 1P6QA 1AOXA 2B37A 4JLJA 1TW3A 3DL2A 3SHOA 2UAGA 2R1VB 3V8NA 5JC8A 2ODNA 3H5OA 1Q7BA 4TS9A 3KAPA 1Y1QA 2NVOA 1Z17A 4KI7A 2OXTA 5A9RA 5EXTA 2AE1A 1UIRA 3HMQA 5F1YA 1EUDA 5FNVA 5IVDA 1SUFA 2G5CA 4ZQIA 2P75A 1EZ1A 2XYGA 2Z5LA 3AVOA 1S9HA 4ZO9A 3ZZTA 4HLDA 5B2FA 1H9CA 1CZOA 4X20A 5IXYA 1JR2A 2ZM6B 4MS3A 4NZNA 5K0EA 3Q98A 3CUEF 3MLEA 4UTOA 1T2UA 2VG8A 5JSHA 2FKNA 1Z47A 2UZAA 4UQPA 4B44A 1G6KA 1Q0ZA 1VLQA 1OE0A 4KREA 3CURA 2ZJ2A 4CUKA 1U2EA 3E4DA 3P2OA 2UVPB 3NG1A 3QEMB 2ILTA 3O73A 2BL4A 1IMJA 3GLGE 2WU0A 4WDQA 1VB3A 3B51X 3ND9A 1Y37A 3JWJA 1B41A 1XEFA 2EJUA 1WPGA 3AERB 5T41A 1ONOA 1CUYA 3O8RA 5TNXA 1LZKA 2C9ZA 1IVYA 3U7RA 4RTJA 1ZD2P 3SE0A 3ND8A 2BM8A 1C3OB 2GSWA 2PK3A 3M5PA 5JCOA 2FP3A 3GCWA 3GGSA 4OHXA 5A7HA 3FG9A 1QHFA 4CFSA 4ZEVA 4IDDA 1V2GA 5D2CA 1C2TA 3JZFA 1XNGA 4HC4A 4K40A 2GRAA 3PNLA 5LU9A 4HRXA 1L1QA 4MV7A 3TM5A 3E9EA 4ZCPA 2W58A 4HGPA 3AUKA 1YO6A 4JJFA 5HS6A 2YY6A 1LBIA 1LQTA 3GLGB 1QYCA 4LXIA 1RWBA 1TQHA 2VHUA 2Z2IA 3LZDA 1S7GA 3INTA 2CJWA 4RL4A 1CIJA 1KYTA 3NDIA 4OEHA 4XOIA 5HFAA 4C0AC 1H85A 2QV7A 4PQEA 1NAIA 3WLJA 4YP0A 2QMEA 3VV2A 4B2LA 5COQA 2WUFA 2QJFA 1XTRA 1SVUA 3BCHA 3EMVA 3I8XA 5DGXA 3ESQA 4UE6A 5U1PA 3SCZA 3SWWA 2C7PA 4HQNA 2VF2A 4LSMA 2R86A 3EVBA 4PG6A 4URHA 4C4XA 2FUEA 1RWKA 2HDHA 4QZVA 1DBPA 3R7BA 3RAEC 2ZAMA 2RH9B 2V45A 3H5NA 3VHQA 3M81A 1B0ZA 3Q12A 1J42A 1F17A 2MSKA 2AD5A 3E0QA 2BGLA 3F67A 3HUEA 2IKQA 3Q3EA 1RKUA 2R00C 4M1ZA 4RADA 4RH1A 1R00A 3HXMA 1XRSB 4UE3S 1WPQA 1WNTA 4I9GA 1JXOA 3R75A 3GD7A 3U0VA 3U7JA 1VG0B 5TE9A 3UNXA 1YXMA 5J2TB 3U44A 4YYEA 4LXQA 3JTEA 4MZDA 1ATZA 1NN5A 3C3JA 4CM5A 2WSYB 4L9RA 4GSYA 5B58T 5JJKA 3P5SA 5IAGA 3D3JA 3OJEA 2VTBA 3AWIA 1UBMS 3UXMA 3BMCB 1JZQA 1U0BB 3O93A 2FUCA 1Q7RA 1SU6A 2LTAA 3R6LA 5IH7A 1IUNA 2H54A 2AYZA 4MB6A 5LB2A 3NHBA 4WZ6A 4EFNA 3UPDA 2AW3A 4Z99A 4XWAA 1KIAA 3IRVA 5B53A 3NHFA 3Q11A 5KAPA 1F4LA 2B2NA 3JQ9C 1DMRA 3QJ5A 2IP1A 3GW8A 3KLOA 4OH7A 5BUCA 4RPIA 3GGPA 1FJHA 2UYOA 1L1FA 2CHQA 4L0MA 4BMYA 3MWDB 1QKKA 2JI9A 2Y2VA 4KRGA 4Q18A 4YJ2B 2EQ5A 4ZOBA 2P8JA 4TZKA 3UUEA 4FGWA 5C53B 1P4HA 1DC3A 1Y8QB 2IGBA 3B6MA 4J7CA 1R9MA 2AJDA 2LR0A 2OHJA 1H65A 3BSSA 3IB3A 3A27A 1SUAA 1JIQA 3JARA 1VBKA 3P2IA 3QYJA 1E32A 4QSHA 5LYYA 3WGZA 1FFYA 4JIMA 1QZZA 2J3JA 4J2TA 2HM7A 3A9VA 1YS2X 1H8HA 1D5WA 1NQ5A 1VJ0A 1D2MA 2NU9B 4Q7KA 4RZXA 3W9BA 4RVDA 1F60A 3A11A 3V1LA 3W3AA 3VU1A 4XDZA 4V0RA 2WEKA 1PJZA 2X13A 3AHEA 2PGOA 4BRUA 2ILVA 3TLBA 4QO8A 4TLAA 4F5WA 2GBLC 2JLBA 1DAPA 3LL4A 5IMBA 3FCEA 3K1ZA 1XRJA 3JW8A 4BEBA 1AD2A 1L5QA 2WHPA 4V3BA 3VU0A 3GJ7A 4QNRA 5AR1A 3KALA 5BW6B 3ZE6A 3E7PA 4C6RA 2ZDQA 3T9DA 4L8YA 4BRSA 3HFGA 2PKQO 5DTIA 4CCSA 3DO6A 2O5CA 2XUOA 3E81A 3C7AA 1R8SA 4HPXB 4GYJA 2Z2ZA 2CCGA 1IDOA 1DS6A 2C94A 2ZS9A 2WMDA 3LCUA 1U94A 3RG2A 1ZH8A 3ID6C 3N75A 4NEQA 4RD4A 5JH7F 5JRDS 1QS0B 1PJ8A 2YWCA 1Y9EA 3AJRA 1IRIA 4QG7A 3AB8A 2ZJ8A 3HA5A 5HZHA 2OTCA 4BP3A 2YXEA 1LBQA 3OKFA 4G41A 4C4TA 3A31A 1NOKA 4B73A 1G3IA 2WLTA 2YZ2A 4ABTA 4OATA 3RQSA 4AW9A 5K51A 2PH7A 4C7OB 2RMKA 1KAQA 4FR2A 3SHVA 4GQAA 2GD2A 4ECEA 3DMFA 2N42A 2W43A 1C9MA 1GZUA 1Z8FA 2WIGA 3GI1A 2XSZA 4UPDA 3KAQA 5CH3A 4LYHA 3M2PA 3GN2A 3B7PA 2TMYA 3SFVA 1K8ZB 3IAEA 3OCYA 2WJJA 4BKQA 4B8YA 3IL2A 2W6JD 3RU2A 1FFXA 3GVIA 3HRHA 3K1YA 3N2EA 5EI5A 4WLNA 4DCVA 1W9HA 2FR0A 2J1LA 5TRTA 4KPFC 2QPOA 4NV3A 2EKLA 3MJSA 5HOQA 1JG7A 4R9VA 1M1NA 3QW2A 4BMVA 3DTTA 5MN4A 5J59A 3DZHA 3L0DA 3D2LA 2D59A 1HRKA 2QP9X 4Q12A 2WUWE 4EW3A 5HE9A 4CMBA 2P11A 4XEHA 1A71A 2AVNA 3QYPA 5AVWA 1COWD 1QWOA 3IQZA 3WIEA 4K8RB 5AT1A 2I80A 2OD7A 4OXNA 3WXMA 2D5AA 1EWVA 1L7XA 3PC8A 5FEUA 1F8YA 2BD0A 2O5RA 3BORA 1V48A 4ENQA 5B7QA 1VZ3A 4X6UA 5IKMA 3KV3O 3O9MA 2P2LA 5E2IA 1UM9A 3N2LA 4LQCA 1Z12A 1XQ1A 3WDSA 1QP7A 1IBKB 3O0TA 5F2OA 4XYMA 2PD4A 3WADA 1X87A 1MT0A 1ZW1A 4A6DA 4YHBA 1HV8A 2ZWPA 1T9GR 3PA8A 4J0FA 1WNFA 1B8NA 5K01A 3EZGA 4RCYA 2YWBA 3GEGA 4TLDA 3KR0A 2H5EA 4NAVA 1N6IA 1L5WA 4U2EA 4X7BA 4WBNB 3IS3A 1G8HA 3D0QA 2Z9DA 3MJ4A 4I14A 5BN5B 3ZJTA 5IP5A 1PVOA 4O4LF 2RB5A 5EWLA 1C7EA 1SHTX 1YDHA 3HVHA 2BGKA 2GI4A 3PUIA 4HUQA 4J7AA 2EDCA 3TZEA 3UJ8A 1EFRD 4HXYA 2D1SA 4NDNE 3OTOB 2RHCA 3DMGA 1PD1A 1HLFA 3IERA 1BJRE 1ZSYA 3EZLA 3IP8A 3ORSA 5AI9A 5EKDA 1H2XA 4R01A 4IS3A 5CXXA 1Z07A 4A2PA 2X40A 3FOBA 3FJ1A 4CLOA 4PLGA 1S96A 1QFMA 2WWXA 3QVLA 2V4ZA 3PHCA 1IN1A 2WI8A 3GEHA 5TS3A 2I5PO 3SVLA 4UW9A 1TCAA 2C3MA 4RVFA 2IYRA 3O3CA 5DLDA 1FDVA 1X7XB 4XYEA 3K35A 5AKLA 1KMHA 1UWCA 1T34A 3N7UA 1VPWA 1EM8A 5DBFA 1MAVA 3OPYI 1KPGA 2P41A 3DFUA 5AQEA 2JK0A 2C4UA 3CU5A 5AW2A 1JR3A 1Z0JA 2XMQA 3M4YA 4LRQA 4AJIA 5JZSA 2VNAA 2FMTA 3PKIA 2D1FA 3T06B 4RM3A 3QHAA 3TE7A 1G4AE 4YXFA 4ACAA 2F3TA 5EP1A 3LC1O 3BDVA 2Q5LA 3PUKA 4BKMA 4DA6A 4MWDA 2KLBA 4J0IA 2X0FA 1IN6A 3ELUA 3IXMA 4F91B 3WV4A 5ISMA 5LBIA 3UMJA 5DK4A 2KBEA 4LQ4A 4IDGA 5IDWA 4M1YA 4Q3AA 3PENA 4ND6A 2Q7XA 1VC2A 2BFAA 3F5QA 1ZCBA 3VH2A 1PEYA 1NV9A 1QHYA 1TEZA 1SOMA 4WKOA 3T7JA 3AUFA 4TTTS 4LF5B 4KQHA 3WKCA 1JEYB 4LF7B 4YDRA 1ZW6A 4MJXA 1YE8A 2WF9A 4MV9A 2P78A 2JAWA 1DKPA 2VC2B 5JAMA 4QQ8A 5ESRA 3DYVA 1GOTA 1W5BA 3IODA 1MABB 3OM1A 3AP1A 4CKBB 4CMCA 4MR9B 4G2TA 1KQOA 1K4YA 2GN6A 2Q1SA 5DWQA 4LRTB 2EDAA 5TQVA 2EIXA 1YONA 1HLDA 1K7YA 2CZQA 3KAJA 5CPBA 4AECA 4DC0A 1QZUA 2ZRLA 4HRVA 4KOEC 3NTLA 2QQFA 4YPFA 4POOA 1YF3A 4X1IB 4M53A 2I76A 2OHXA 3WB2A 3PTAA 2FXIA 3BWVA 1GPBA 1E99A 2QSYA 3UPUA 5E2BA 2X76A 1LTKA 3DSRA 3GFQA 3ONFA 3HXOA 3A1VA 1XSEA 3I6YA 5FTWA 1LNSA 4IHAA 4FT4A 2IF0A 3HVUA 4MCAA 4OXRA 2PRKA 4DUGD 1LDBA 1O87A 2JGLA 1E2IA 4QUAA 1BMDA 5JXGA 1IOLA 2CVHA 3OCWA 3OZTA 4IM7A 3RT9A 3F4LA 1DBRA 2OV3A 4PYNA 1IAVA 1U4OA 4FSHA 4K05A 3KO8A 4TKUA 3ZQ6A 4HCJA 4P08A 4LF6B 1JXQA 4CR8A 4QFCA 4OSOA 1DWQA 1YR9A 1N2BA 2Z3ZA 2BV3A 3U4HA 1O9GA 4UTVA 3PPYA 1AGXA 2PJRA 3GLUA 4IILA 1N2CE 1XAJA 3IPCA 3T1HB 1WG8A 2ZB4A 4O6VA 2H1OA 1TT7A 1M2VA 1XQYA 4HP8A 1N2OA 3AX6A 9MHTA 1I3NA 1TA0A 4HWKA 4Y3UA 4NCIA 3WB9A 5HJ2A 3COJA 1CNEA 3A7EA 3RVNA 3TYXA 4JI4B 3NRJA 3ZH9B 4Y9UA 4XIFA 3NETA 4PE5B 5E6SB 1K98A 3WIVA 3ZUPA 4QVIA 3WYEA 3I5UA 4XH9B 2C4TA 1J0EA 1J25A 1SCUA 1HM5A 4BPRA 3IR7A 5HKOA 3ABSB 1ECJA 3CKLA 1QONA 2C4KA 1IHPA 2ATIA 3ZW8A 1P81A 3TCKA 5K03A 2HWUA 3FR8A 5I8ZA 3T7RA 3OTQA 3WGKA 4CDRA 3Q72A 1V8DA 4X7RA 2W2QA 2BF4A 3CZMA 3BCSA 4NFSA 1CF2O 2DWOA 4L2IB 1N2CB 3S2YA 4JBXA 5IJ0B 3IEVA 1D03A 5HBRA 5JO9A 1OLSB 1R0KA 1WHTA 4CF3A 4G0UA 1IK6A 4MUJA 1OGIA 2IA5A 3H05A 4L57A 1XL1A 1CUZA 4XQEA 2X1HA 2GF0A 3VZPA 4C22A 2EFYA 1NXPA 2Q46A 3I9NA 1TU4A 5CEJA 1UWKA 3UAOA 4KAXA 4LV8B 1JBQA 3THRA 1G5PA 1FFCA 1NR5A 2PAFA 1U9IA 4RXTA 4YV7A 4PANA 1A1VA 2ZIUB 3OMWA 1WVGA 2ORVA 2PCJA 4ICIA 4E5NA 1GZSA 1Z6ZA 1PZEA 1EDBA 3F1KA 4PV7A 3IDAA 2ZE5A 2ZYTX 1YR2A 5LQRA 4K03A 2FMUA 4UTRA 1JIXA 1L5OA 1RLMA 1W0JD 2X9QA 1THGA 2YJ4A 3GBSA 4QBIA 1DC7A 1Y6ZA 2I66A 4UEKA 5IDYA 5AMXA 3VR6H 4X00A 1IJKA 1PNQA 4RY8A 4EEKA 2IJGX 1TTQB 1YS6A 4ED9A 1SG9A 1L4MA 2D5BA 3QBDA 4Q6BA 4QXPA 5ITVA 1FX0A 1YAHA 1G66A 1U2TA 1Q83A 3GQVA 3FWHA 1XELA 1QK4A 3HCNA 3ZWAA 4C20A 1MAHA 2PXAA 3ENQA 4PZAA 4ACBA 1VL6A 5BOVA 1XVAA 3T9EA 3MBKA 3ZV6A 3DAPA 1N5DA 3MQ4A 4HB4A 1C0PA 4P80A 2JD1A 2EATA 1JS1X 2GASA 2B8JA 3K1AB 4CM7A 2F9LA 3K0CA 2GX6A 1DOZA 3QTTA 1TYBE 4R2HA 4HH3C 1UP4A 4CG2A 1KNXA 2ZBVA 1VL1A 3EGOA 3HO6A 4G65A 2BWJA 2OZVA 4KMRA 4TXJA 4XFJA 3ZPXA 5I4BA 2C7OA 2A1UA 1CR0A 1D09A 1X92A 1Z38A 4PFJA 4C1NA 1BVRA 4NY1A 2INGX 3F6BX 3OD1A 5JQWA 3DLCA 4MH0R 4AKIA 3TJZA 1NP3A 2JFHA 1MB9A 3AF2A 1DP4A 1JTEA 2WUVA 3HB7A 5BQ5A 3U7QA 4QODA 1T25A 3QKRA 4BNXA 1OMOA 1R4ZA 2E21A 2VSOA 2IS1A 1IATA 3EWSA 2JFZA 2YWEA 4PCAA 2GDZA 4EIWA 4JS0A 2PS0A 1QDEA 1TFRA 3EXFB 5IDVA 4K2HA 1FC0A 4BTEA 3V4VB 3SC2A 1U0NA 2YDYA 3Q7TA 1TZCA 1ODSA 4Y8VA 1U4SA 2EF0A 4R2XA 1E9FA 5KNBA 2VF7A 4KZKA 2B5VA 3QE2A 4BRWA 4YCMA 1LZLA 1CT9A 2WU4A 1U6IA 3ZXYA 2HIGA 1GV1A 4QX6A 1MB3A 3U7GA 4JXXA 2P8SA 1D6MA 1KY2A 1AZLA 2GCOA 2GEVA 4HJRA 1Q0RA 4M76B 1E77A 2FR1A 3F90A 4WK2B 4YQZA 1RWMA 4HX5A 1GYQA 1YE5A 5IKPA 4R8LA 1N5LA 3I6IA 2NLOA 2V7UA 5COBA 3BCUA 4IHJB 4AMUA 3PE6A 4DGSA 2YY5A 3HM9A 1SNYA 1FPQA 1XPRA 5I7VA 1NZFA 5ERYA 2L0XA 1G63A 3OFVA 1JHYA 4I1YA 1TVKB 3U31A 3WWDA 3WWYA 2FETA 5EXXA 3PTZA 3TOZA 1SCIA 3UYLA 4B32A 1XJ0A 2VJNA 4I0WB 3UV3A 4HN9A 4CLDA 2PUAA 3A0UA 3O2SB 3RS3A 3QU4A 3LXUX 1V43A 1RRCA 4BU1A 3EIOA 5LR6A 3KLBA 4FOSA 4W6ZA 5LYJA 4KCGA 3EXEB 3TW8A 2JD0A 4AS3A 2BONA 3CVXA 3D3EA 3V55A 3DR5A 1JFLA 4XCQA 2YS6A 1QHSA 5CM9C 4CV3A 1RAAA 2N47A 1LXCA 1JLLB 2AF4C 3DHWC 1VE9A 2IHYA 1W76A 2JD2A 3BTOA 1VJRA 3COZA 4OKNA 1L8OA 2Q4RA 3D1VA 4D0SA 3ZJ5A 2RK6A 1PYDA 2ZPTX 1LLCA 1TK2A 1B7GO 1QPBA 1YZYA 5KI6A 2B1IA 1R4NA 1XR3A 2QN8A 1ZN7A 4KIFA 1ZXLA 3SR0A 1Z68A 2DXIA 1X1BA 1GAEO 1W49A 5EJ8A 5IVPA 5EKTA 4FFLA 3UF0A 4R6WA 4DADA 2JZNA 3GY0A 2CLOB 4LVCA 4UHDA 3HKCA 1KYYA 4P81A 2GN9A 3QNUA 1ICEA 2CHUA 4IOKA 1BKDR 2LW7A 2XUJA 4RF2A 1A76A 4PM4A 1B3RA 2Y05A 4REMA 4H7JA 1L5HA 4DS3A 4IO0A 4LSWA 1R3UA 2FVXA 2PQ2A 4TV8A 4OBXA 1JFRA 1UOEA 5K2OA 5KYWA 2XE8A 3MTJA 2ECKA 4CTJA 5IAAA 1X3SA 1GLGA 3ADPA 1R7RA 1WCWA 1BX3A 3C6YA 1Z7YA 3R7WA 1ZI6A 2WJVA 1ZCFA 5AJUA 2HLDA 4S1OA 3VR5H 5AQ1A 8ADHA 4OAOA 3ZCUA 4KPUB 2PH1A 2AFRA 1A0OA 1SC9A 4RTPA 2RB4A 2W2LA 1G5TA 3AIIA 2QTVA 1SXJC 3ST7A 2YS7A 3F6CA 1I01A 2ZWMA 3EHDA 3GELA 2G5PA 3QV2A 4CMAA 3JR3A 2C9MA 4UCWA 4W99A 5B57C 2WTEA 1DRVA 4QLOA 4RIFA 4ZO8A 2NO7A 5F35A 3LXRA 9LDTA 4WT7A 1TF7A 1UODA 5E6UA 4TRJA 1T2CA 1RAFA 4AJNA 3BIOA 3OFJA 3ZDFA 4DQKA 5IYZA 1ZAYA 4I4IA 4ZT2A 2NXNA 1DRUA 3RBVA 4EJMA 4YBZA 4DQLA 1FDOA 1K7FB 4ZQCB 4QL3A 4L8FA 2G80A 3NATA 2QX4A 2REXB 4MVJE 3G2NA 1T2FA 3EFOB 1QFYA 5EFZA 4J4BA 2G07A 4NOJA 3EG5A 1ZJZA 1CERA 2O2XA 3K9CA 1ZM7A 3C48A 3AETB 3WJAA 3VDRA 4ZD6A 4TMWA 1X80A 1QO0A 4FIDA 1DPGA 1MQ9A 1Z5PA 2EWWA 1SB8A 3O21A 5AHRA 4B47A 3K9QO 4OY3A 3HYRA 4MGHA 3HJRA 3TOXA 1SZDA 4FNOA 3G0CA 1PL7A 2H08A 4J1NA 1MC8A 3M7IA 4Q7QA 4RTKA 3LY8A 3IESA 2ZUSA 1JH8A 1SCQA 1H1LA 3B6KA 4GLFA 4PTZA 2OWEA 4KRFA 1PJAA 1JSXA 1HTTA 1WM1A 3CTMA 5M29A 1FX1A 4ZYZA 4XIJA 2H1CA 4KO1S 4MPRA 1FTYA 3CJTA 3B78A 4FOTA 3WVNA 1M8PA 2VUHB 2JL1A 5ES4B 3FTFA 4O1IA 2IPOA 2PIDA 2XWPA 1NU6A 1I6WA 3PDJA 5JMTA 1SOAA 1USKA 4B6OA 5C7LO 1KSFX 3FLEA 3KQTA 4OQFA 4W5JA 5JNVA 2UVDA 1N8SA 3HCEA 1KDRA 1Z82A 3FPFA 3NWEA 2ZE8A 2B9EA 3AEZA 2V8BA 3DHEA 4GL4A 5GJWC 3ZTYA 4K6HA 2A0FA 5MHTA 2WC1A 4TZ0A 1L6IA 1PT7A 3OZRA 2CDBA 4UBIA 3GJ5A 3DBOB 4ZC8A 1JA9A 1PEAA 2RHOA 5IWAB 4BB5A 1M2HA 1KRXA 1T1JA 4EYQA 4INOA 1LD3A 5FPYA 1HZZA 3GGGA 3PXUA 3RTEA 3AHHA 2Z1NA 5TF0A 2NZ2A 3SZGA 3MGCA 3C3AA 2Z9BA 1C9EA 4UVEA 4LOHA 1M8KA 2BGTA 1RAEA 1R9GA 4TL6A 2CFTA 1X38A 3K0FA 1OIVA 1PT5A 3HADA 1CQJA 5DSXA 1E2LA 5E6RA 3UJCA 2VHWA 2J0VA 2WE7A 1XO1A 4PIMA 4AP9A 1GUBA 1YGPA 2X4IA 4E0BA 3LKVA 1WB5A 5DT2A 2TMGA 1E1QD 1MGPA 1PAUA 1FSPA 2IHKA 4JA2A 1EX6A 2NZJA 5B58C 2XZOA 2REQA 3U3MA 1MT3A 1DQYA 3UMRA 1G0NA 1E1KA 3I3SR 4FCCA 3P2JA 4M87A 3I2JA 2P9EA 5ICFA 3T3EA 2CEKA 2C2XA 4FYVA 1IM2A 1KMNA 3A32A 4IIEA 2R7KA 5P8WA 1IK4A 3P96A 2V4MA 3RB8A 5J2UA 5FTKA 1U3WA 1JHXA 4YRDA 4IW3B 1I2DA 2ZT5A 3LD9A 4O4JA 4ZVTA 3FPAA 2FF5A 4KI0A 5KTTA 4DR7B 2GCPA 4IYJA 2EGHA 3FIUA 1NI3A 1VM6A 2XUIA 4J49A 4YRSA 1BXKA 3G1TA 5EXPA 1UBCA 1QYWA 4NFYA 4RX1A 3S5JA 4BQNA 4YA6A 3BJZA 5DCWA 3QPUA 4OHZA 5CTAA 4DLBA 1JYEA 2P68A 2POCA 1TZBA 1QFSA 3BK7A 1EP2B 1JAYA 2DPHA 4BP8A 4MTCA 5CA1F 4W5TA 4JUDX 3AL3A 4ISBA 2F6RA 3COVA 4FR0A 1IY9A 1DDOA 4QDXA 5FUBA 3C1AA 1JXMA 3ENZA 4LZOA 2YJTD 3V8RA 3KOOA 2C2OA 3DLBA 1YUBA 4CMJA 1RKVA 2YVLA 3L8ZA 4OFBA 1VSQA 1QIFA 5A4IS 5TJHA 3T4UA 3TLEA 1DG9A 2GH1A 2X8BA 3IC5A 3W8DA 3H1AA 5JJBA 4MUIA 3OZEA 4QFBA 1YUMA 1FE8A 4OHBA 3C5EA 3R24A 1L3CA 5DEIA 2D2IA 2R6R1 4AZ3B 4EB3A 4ZQEA 1UZNA 2BTOA 2V6MA 3TSYA 5KVSA 3UTCA 1A9QA 1VFNA 1BHQ1 2IHUA 2QGZA 3R7DA 3Q7IA 2DHRA 4F21A 3UBTA 3KLMX 3UH0A 2BUAA 2CVZA 2J30A 5KJCA 2WLSA 1NUQA 2QL9A 3DBIA 4Y9RA 4A82A 5K0JA 8MHTA 3DEKA 5EJ4A 4OHPA 3FETA 4CI0B 5CFMA 4L4UA 2VUSA 1U8AA 3ZLVA 3NJ4A 1VE6A 1RE0A 1VZ2A 2BHRA 2YHUA 5EESA 4EO9A 1QIDA 1NIPA 4BB6A 3UMYA 1C7FA 3AGQA 3N7AA 3SBDA 5D5PA 1N0IA 3F0TA 1O6ZA 1FY2A 4E3WA 1XZ8A 5A03A 1F2TB 1MEJA 2FZGA 1P2VA 2ODBA 4ILEA 4M6WA 1K2WA 5CDFE 1NVUQ 1K1EA 4R1NA 4ZV4A 2I6QA 3UMBA 4JVOA 4OPMA 4JLPA 2MMGA 1SHKA 3MA0A 1UXJA 1V7CA 3U7EB 4KYIB 1QVAA 3ABRB 2H57A 5JBQA 1GZ3A 2QUZA 1YBAA 4MKRA 1JHAA 3DKRA 2PM8A 5A3RA 4BX3A 1XFDA 3FHTA 3EGCA 4KQCA 3IVGA 1DKUA 2RBGA 3DP7A 4U7FA 3DV2A 4YJKA 2VCEA 3BL5A 4RTNA 2YDXA 5CHYA 4YGXB 1A9YA 4I1OA 4BFYA 3AY3A 3OZSA 2YIDA 5JRJA 1O94D 2WD7A 1GD1O 3HYSA 1TCVA 2DBYA 1R50A 1ZP6A 4D5EA 4P36A 5E1BA 2C7BA 2IGTA 3OLXA 3DT9A 3B1XA 1XG5A 1XX6A 2R6JA 3JQAB 4YJ3F 1QRAA 3KTAA 3KZCA 1D7OA 2WB4A 3PD7A 4QHYA 1Z6XA 2Q9UA 5CLFA 3W06A 5EQFA 3ONVA 4HXFB 4R31A 1JLMA 1XWFA 3EW9A 4ZYUA 4QDKA 1EGAA 2V54A 1S2OA 3GAZA 5DI3A 3VPHA 1US8A 2G8NA 3IMEA 3ILVA 2OHFA 2CFCA 2I55A 5HTKA 2FOLA 2VDWB 3QYFA 2IOHA 4BNWA 3TRIA 3NV7A 3PQFA 4UFNA 4CV0A 3RASA 6ABPA 2PSJA 1L8AA 4KBGA 1ZUHA 1OZAA 1YRBA 3QXSA 1RBMA 1JJAA 2X5NA 3UYKA 1X1CA 3K53A 1N3IA 1Y5LA 4LXHA 1I7NA 3E7XA 4Y1FA 5FL3A 2WVJA 4JJZA 5BQFA 2CLFB 1DKNA 5L95A 4JROA 3CH7A 4K5QA 1ZVMA 2BMJA 3U3DA 1E63A 4RIIA 2YHIB 3PGA1 3WGJA 4E51A 1G5HA 3CZRA 1PLJA 3NPAA 2QORA 4R4JA 1Z62A 3U39A 1EFCA 4Z9FA 2HA7A 3GH3A 5EUBA 2G63A 3ZHRA 4HNRA 4IXDA 2AQ8A 1I3KA 1L8LA 3BD6A 4L5IA 3KVNA 5LXTF 1YR8A 4KQGA 1ZD5A 1WZCA 4MUKA 5TQ0A 1K8YB 3ZDXB 4DV2B 4M4SA 3O26A 3AU9A 3RYIB 1CZUA 3PC3A 3WGUA 5LP6C 4Y7CA 4G8BA 4Q4DA 3GARA 3KB2A 5BWNA 1K27A 1WHSA 1IZ9A 2A4KA 3D4OA 4EHLA 4GH5A 1SUEA 2FSIA 3BWYA 4LJAA 4RYLA 5DGIA 3T61A 4B84A 4EO4A 1XOIA 4Q9JA 4B17A 3DT6A 2Q0XA 5E7MA 5FI1B 5BSVA 3U4AA 3IPLA 1JR4A 1MV5A 1JSRA 2IXEA 4GVPA 1G291 3RUCA 3BXGA 5FNVB 1E0AA 1UOPA 3LKZA 1EUDB 1Z37A 2D5LA 4JUIA 4BECA 3JYLA 5GY7A 5IM4F 1XT6A 1WCYA 3FUTA 4LOJA 5MGNA 2DR2A 4X20B 5JPDA 3AINA 5J63A 2VT6A 4MS3B 1USVA 3FA2A 3JQ6A 2B1GA 2A7XA 1OD6A 3TZ6A 3H16A 5DPMA 3ORQA 4IIGA 5BR8B 5E3JA 1Q11A 2J3HA 4WI1A 1POXA 1G55A 3TOVA 3BERA 3LOUA 4RTLA 3WLTA 3S1AA 2H0AA 2AA3A 2AG8A 2QAJA 3AM4A 2VYND 5A7GA 2PRYA 3JVVA 4JODA 3ZWYA 4UVIA 3OZ7A 5CK5A 1FTWA 3FZEA 4PAQA 4HTAA 4AT1A 3LPAA 2PUJA 4ZRDA 4KTTE 4LZPA 1A50B 5FLXA 3UGQA 4M0KA 4YUAA 2IYPA 1T6BY 1YR6A 1Z0DA 2Q49A 3FCXA 3PQEA 3QX9A 2HSEA 5IWCA 2XQVA 3R76A 2G83A 4NBUA 1RCFA 5DNEA 2VUIB 3HY6A 1TLTA 3BB3A 3M4XA 1HDZA 1ZCJA 3UAZA 3GLRA 5EKSA 3SLGA 2FSPA 5EPEA 1A7JA 3W78A 3WLRA 2BTQA 3BH0A 3L7KA 1KU6A 2GTPA 2H9IA 4HB2A 2CJWB 1U3VA 2GF2A 5FO0A 3C74A 1YZTA 4B3GA 9GPBA 3MUEA 5A3VA 4LE2A 2X41A 3DTVD 3MMZA 1QJCA 1KEVA 3PNBA 4KV7A 2KE5A 3VO2A 3DE1X 2I6SA 3ZQ4A 4C7VA 3FSGD 2WAMA 4HGQA 3OEYA 3G5LA 4ZEMA 3ZGNA 4XE5A 2JLQA 2Q3HA 3GZJA 5I3ZA 1Z2NX 3C7TA 3FKSD 3PA6A 1PJTA 4QRIA 4EPRA 1E3LA 3LT2A 4ODIA 4CE6A 5A6SA 3GEPA 4I8DA 4URXR 2GXUA 2WR8A 2Q99A 4C6SA 4HPJB 4Q1CA 1H4TA 4YY3B 2B7LA 4M0FA 1OFUX 1PGJA 2OCBA 1MC5A 2ZDGA 3R5KA 1BKYA 3L0BA 4AJ2A 4HAWA 2X6RA 4B6SA 3VR1A 2X58A 3SSMA 4JXZA 5CD9A