2A6PA

Structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
b'RNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2
molecule tags Structural genomics, unknown function
source organism Mycobacterium tuberculosis
publication title Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase.
pubmed doi rcsb
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2a6pA00
1YFKA 4FDUA 2P78A 2A6PA 5AK0A 3NFYA 4PZAA 3D6AA 1XQ9A 2BIFA 2P2ZA 1UJCA 3D4IA 3FDZA 3GW8A 3R7AA 1H2FA 2H52A 5AJXA 2P9YA 1E58A 2EKBA 3LG2A 1TIPA 2P9FA 2EKZA 2HPAA 2IKQA 4PGMA 1DKLA 3FJYA 4IJ5A 2EOAA 3QPVA 3EZNA 3E9DA 1FBTA 2P9ZA 2OWEA 4AROA 3NTLA 5CDHA 4PZ9A 2P75A 3C7TA 1BQ4A 1RPAA 4EMBA 1T8PA 2H4ZA 2WNHA 3KKKA 5CU7A 3O0TA 1RPTA 1H2EA 5AJWA 3IT1A 3ZHCA 2HHJA 2P79A 5AJYA 2WNIA 4JOCA 1BIFA 1DKNA 3GP3A 4JOBA 5PGMA 4GPIB 2DWPA 1QWOA 2P30A 3D8HA 2HIAA 3E9CA 1SK9A 3IT3A 4IJ6A 2P6OA 1K6MA 3IT0A 2I1VB 5AJVB 4ARUA 4ARVA 1SK8A 3K4PA 1E59A 3DCYA 1BQ3A 2YN0A 3DB1A 3OI7A 4ARSA 1YJXA 3QPUA 2OWDA 2AXNA 2H0QA 4FDTA 1C80A 2P6MA 4D4LA 1FZTA 1DKMA 4HBZA 1NT4A 3LL4A 3E9EA 1DKPA 3BIFA 3F3KA 4QIHA 2H4XA 4EO9A 1QFXA 2GFIA 5AJZA 1V7QA 2ENWA 3GP5A 2PA0A 3EOZA 1V37A 1SKBA 2WU0A 3IT2A 1ND5A 1IHPA 1EBBA 1DKQA 4JODA 2F90A 3K4QA 3LNTA 4TSRA 4D4KA 3MXOA 4D4JA 3FDZB 1SKAA 3PGMA 2ENUA 1UJBA 1RIIA 1C81A 4ODIA 5CX4A 2A9JA 1C7ZA 4GPZA 2YN2A 2RFLA 2QNIA 1DKOA 2P2YA 3F2IA 4MA4A 3MBKA 4E3WA 1QHFA 2P77A 5HTKA 1ND6A 1CVIA 5HR5A 4D4MA 3HJGA 3QPWA 2DWOA
chains in the Genus database with same CATH superfamily
5EINA 1W93A 2CGEA 2JRCA 1BFDA 4D8UA 4GT1A 4K2HA 1FU7A 1NKVA 3L82B 1RWXA 1USKA 3IIEA 3EGWA 3O8NA 2XCTB 2IY7A 5EP2A 4UTRA 1UJCA 1XKLA 3BTSA 1JR3A 3DDSA 2XWJI 2HJRA 3ZNNA 1Z5PA 4KRFA 1JEAA 5FO0A 2RAVA 3SX4A 4CR6A 2CMDA 1FMTA 4QARA 1B41A 1RADA 2C4KA 1AO0A 4GLOA 3DMHA 2V5VA 4QXPA 2EJBA 5KU7A 1VJGA 1X9GA 4KW7A 2WUFA 3F98A 1PHRA 5DTEA 4PR3A 2ZI3A 3RUFA 2VXOA 1D1PA 1V6SA 1XZNA 3HA3A 3EQ6A 2W6OA 1A88A 1MW9X 5J2TA 2DBQA 1GARA 3OJOA 3AMVA 3NH6A 1WCIB 4RKFA 4BV2A 3C3WA 2J6BA 2YYYA 1XTVA 5CM8B 3VOTA 3Q7EA 5ADHA 1N57A 2JCXA 2R6R1 4KYVA 5EIHA 3W5VA 3KYIB 4ZHQF 2OM6A 3KX2A 3UMGA 3E3AA 3C7CB 5AJWA 3IT1A 4GL4A 1E7SA 1L1FA 2H08A 2JA2A 1E4EA 1NKSA 4U7FA 2NO1A 4OLAA 2WVJA 3AOGA 1L5HA 2PUGA 3ZY4A 4AU1A 2JFBA 2PSJA 2BI4A 2ZIFA 4PXYA 1TGYA 1VZ2A 1ENOA 1HT3A 3IB3A 1ULBA 2DCUA 3KJZA 3ORQA 3P8ZA 3U56A 1UBFA 2G83A 2IIBA 3DLBA 1JR3E 4UJ3A 3V1YA 3ZIAD 3ZDYB 4D57A 1ZC4A 4MVJF 2VXCA 2YY5A 3Q0EA 2J5KA 4Q5IA 1E2GA 3C7AA 4UDXX 3V6LA 4XLTA 3AKYA 4C43A 4ZI3A 2H4YA 2OD2A 2QMYA 3WV5A 1G59A 2B6NA 5JY1A 4KQHA 2NO5A 4BWVA 4MWGA 2IYYA 5BXYA 4CL2A 4YO8A 1CQIA 2A0KA 2Q6OA 3IIMA 3LY8A 4B3GA 2OXCA 1XTJA 3CHYA 2WT8A 5BWBA 3DYVA 5AVZA 5MN6A 2BCGY 1LSUA 2BKEA 1L4GA 2Y2UA 4CEHB 2VIIA 1IN1A 3M5PA 3TR0A 1T34A 1XJ0A 2OY0A 3EXAA 3U26A 5K6AC 2BONA 4M3NA 2CDRA 1PFYA 3JRXA 4IIJF 4JQSA 4Q9IA 2PL1A 4QSHA 3PIRA 5D7NA 1K3TA 1RYMA 4JU8A 5C52B 1HXHA 2EX1A 1SKBA 1KP9A 1Q0LA 3VVBA 3H2HA 2H7YA 2QM3A 3WIBA 5C1OA 4P0TA 3HMKA 4RVHA 2WIKA 5FWYA 1NY6A 2HRQA 4AUMA 1QNLA 4MV8A 3WLQA 2PXCA 4Y18A 2IU3A 4US0R 5EKXA 1O97C 4QQ8A 5AM1A 5JO0A 1OBFO 4L5BA 3I6YA 3OCUA 2VWHA 1NZJA 4QJ3A 1O7JA 2ZUCA 3DDCA 1SVLA 3EXG2 1P9RA 2ZSEA 3NUZA 4MVJM 4L08A 2P4QA 2QVYX 5KYXA 3RBZA 2OYRA 3BE5A 1U1DA 2HUPA 2BFCA 2FLVA 5GZ6A 3ZWKA 4X62B 4ARIA 2B6HA 3MTJA 3QEMB 5AKGA 4OQFA 4XWOA 1ZKDA 4Z4HA 1PW5A 5MGNA 3H8VA 1C9YA 1SXJC 1VHQA 1DTWA 2VWPA 1YCGA 3MBKA 4W5WA 1PGJA 5L7YA 2H1FA 1N2GA 1EX7A 4FZ3A 2XYHA 3ESYA 4CNQA 1G9XA 3SVZA 5GZ1A 4Y9TA 3ELYA 4AJIA 1EQ2A 2IPXA 2JD1A 1LLCA 3WQBA 5K8IA 3GAMA 4P5PA 1X7XB 2Q8NA 4KEAA 4URWR 3G5AA 1T4MA 3FIUA 4PX2A 2E5FA 4NU5A 4B85A 3OZTA 3L01A 2V7UA 1Y48E 3K0FA 4OQMA 5D2CA 1OWPA 3UMYA 2ZUEA 2PGAA 3HB1A 2VAMA 5C5EA 1NY5A 1U0SY 1F2TB 4B74A 4ND5A 2R8EA 1R15A 3QWFA 5CBPA 4TV9A 2FETA 2ZUWA 4YAJA 1HY3A 2VRWA 2V0CA 3BWYA 4L9WA 5JFTA 1AHPA 5LP1A 3EZFA 2O8CA 2DRIA 2B5WA 1T1EA 1UXGA 4PXSA 3NYRA 1JDUA 1W35A 2PBZA 2OHHA 1UJ6A 3GLHA 4MGYR 4QUEA 2BZSA 2BF4A 5BV0A 1Z6YA 2BTEA 1CFZA 1R5BA 4AO8A 2G04A 2RJNA 5EHXA 1WP9A 3MXTA 3D8TA 1VI2A 3A1TA 5DEIA 3ZY2A 1BJKA 2PS9A 4MR7B 4Q48A 2HF7A 3ICQB 2I2CA 3JVEA 2P79A 1XEFA 3CR8A 4G2NA 1E79D 4FIDA 3WB1A 1G2OA 2GF0A 4YNBA 4JH0A 4BN5A 5A7FA 1Q15A 3LY7A 1K5GA 3I5YA 2NV0A 3MCUA 5TT1A 2VJLA 1NUPA 1U0LA 2QE6A 1HGXA 1VSVA 1JR3D 1XRQA 3S1LA 3TQQA 4GF5A 4FB4A 5JZVA 4EVIA 1JF8A 1EDOA 3HBMA 2XJ9A 4PTZA 2W6PA 2UAGA 4CUKA 2YWCA 3L0ZA 4LRXA 5IDWA 2VRCA 2WILA 1AQLA 2OXEA 1CY4A 4TYQA 4CUJA 5CX1A 1V0JA 2H9YA 3RAFC 3WL5A 4MS1A 2MT9A 4UBIA 2G77B 1EVKA 3O4JA 1K6XA 4JLDA 1E18A 4RACA 2YASA 4OYRA 5LA6B 3W2IA 1YSCA 1L5NA 1KZYC 1UKZA 1JHDA 5IMSA 3D6FA 2GYYA 1UOQA 2NXNA 4H15A 4XYMA 4XD7A 2BHLA 3IQIX 3R7FA 1VMAA 3IAAA 4B82A 4PANA 4BAGA 1FXUA 4BCDA 4QYSA 3P9CA 4PONA 5KI6A 2AQKA 1Z8FA 3AI7A 5BV7A 1L7OA 4LJ6A 4OM8A 1KSHA 4LV5B 3MINA 1NAIA 2YXLA 3K8OE 3BD8A 5AVVA 3CU5A 1K2VN 1E2FA 4YRRA 1ZGAA 3QU5A 4UQPA 4TZ6A 3NW9A 1ZCJA 1WU7A 4XFKA 2HI0A 5C8DA 1G18A 4RCYA 1AF4A 3STUA 3DHWC 2AJBA 2I4RA 2ZJ3A 1M2OA 3F47A 3PKIA 5E38A 1OBOA 2B4TO 3FF4A 4EI8A 1RYHA 3F6EX 1G291 2FPMA 3WGVA 2JVIA 1QHIA 4EF6A 3Q87B 2FRDC 2I1QA 4K88A 3VR3A 4IM7A 4AN4A 2D2FA 4EFLA 4TLMB 2AEMA 2Q5OA 3U9TA 2XRMA 5I47A 3ZWNA 5CVDA 1EUDA 2C82A 3Q3JB 4GRAA 3PNLA 4AX4A 4NQZA 2QRZA 3VR3D 2FPXA 1DCFA 4HDQB 3GFFA 3HJGA 3FDIA 4TUYB 4CKZA 4EG5A 2Q8PA 1QCCA 4I1VA 4RELA 4B6OA 3C87A 1A8PA 1NF2A 2ZU6A 5CLLA 4H6XA 2Z3WA 4JHLA 4CTMA 4O4HB 4R31A 1XHEA 3UMCA 1HDCA 3HYLA 1T35A 3A4LA 4PYIA 1BWPA 4RK6A 5JAOA 1W88B 1WULS 2JH8A 3L1UA 5EYPB 5KDDA 5LKRA 2X3YA 2Z2KA 1CQZA 4AIIA 2Y92A 1IG3A 2ZIWB 2ZM5A 5TEVA 2MSWA 4RC9A 3LT2A 5HZMA 4I4NA 2DWUA 4BO1A 4Q9JA 1EUDB 4QDJA 4UVHA 1OSNA 4RETA 3FNQA 2RHBA 1YHZA 1VJTA 2RCNA 1QV9A 3KOYA 4XQCA 1DPGA 4YFYA 2X4GA 1NLZA 3HDHA 3OLYA 1XLTC 4U9UA 5ICEA 2ADOA 1K8XB 1GVHA 2BZ0A 4QRHA 1UBUS 2EZ4A 4CV3A 5DNWA 2BZGA 3ZDQA 3TLGB 2WE8A 1M2OB 3NUGA 1IBMB 4GR5A 1F2UB 1ZN9A 3O8CA 4ZQCB 3NLLA 2XMCA 2R4UA 4KP7A 4ZI2A 3QMPA 3WNDA 4W5OA 1JEDA 3NOVA 4GMHA 4TQAA 3N75A 4ZZ3A 3Q1LA 1ZR4A 2DXIA 3CUVA 5AVUA 3R7NA 1EFHA 1L0BA 5LQRA 5A7GA 2Y27A 4KDRA 5JS8A 6ADHA 4W63A 4B34A 3SGLA 2PLAA 2MCFA 2QTFA 1R5OA 1UIMA 2ZYSA 4KNYA 2P3OA 1HPLA 3U7FB 1BJRE 3DGEC 5ED0A 5EWLB 4ER0A 3QZUA 4FX5A 4LNUA 4UPEA 2CEAA 5LU8A 4DV3B 4ZI7B 4F3RA 2CSXA 4Q4AA 3GAAA 1Q7EA 3K0BA 4XDGA 3HU2A 3UPUA 1EAYA 2NO7A 2B83A 1EFLA 1S3IA 4BQQA 2B69A 3W1EA 5AICA 4D8YA 1YMVA 5JQGA 3VRHA 1LS1A 3X1WA 2I4MA 2IDKA 1Q1QA 4OUDA 3U17A 4ER6A 4URVR 1W1WA 4QJ4A 2E4WA 3KEGA 3AQ4A 3L77A 1UP4A 2BW0A 3FN4A 3NBZC 3C8DA 1N0VC 3DEYX 2OHXA 2NM0A 2RGXA 2QK4A 2XGGA 3C5CA 3FNIA 3PHLA 4JLUA 4UM9D 1KO4A 1T5OA 2V54A 3FI9A 4N6NA 4WLEA 3IKMB 1MX1A 3CW2A 1M6VA 2ZSKA 5T41A 4N41A 1JXOA 1RAGA 1Z4MA 5JD5A 2XMSA 3K0CC 1B8OA 6NULA 5JXHA 3PFFA 1VFNA 3MRSA 2QM8A 1GU0A 1OJ7A 2X5JO 4O4HA 5LN1A 3MTIA 4QPDA 2EKDA 5BSHA 3RYCA 1H3EA 1G1MA 4H0NA 3N70A 3QBJA 4R8MA 3JTEA 5HSGA 1TJPB 4YMUA 2F3TA 4TUYA 4KRGA 2EQBA 1KVQA 3VYVA 4F5YA 2GBLC 2R8RA 3WSTA 3BB1A 3RUPA 3D6TB 4BNXA 4EKYA 3IAUA 3NTUA 4XVHA 2GN4A 1TRKA 1T3SA 1BNCA 1U0GA 5IJ0A 1K8YB 1C4WA 3TXYA 2V58A 4TV9B 5E6RA 1RZRA 1J8MF 4UM7A 4RF4A 1ECJA 3RYFA 5K4HA 3SHQA 5F3WB 4M7WA 3AW9A 2B4QA 1RTKA 2DE0X 4HQKA 4Q7EA 1U3WA 1GAJA 2VK8A 2PQ0A 5AVTA 5B64A 1U2GA 1NF8A 3N3AC 3E84A 3VGPA 5AUPB 4EELA 2AUMA 1QNFA 2C57A 3ICCA 3Q2KA 4XOUA 4C3VA 4EJSC 3QXCA 4Z49A 4EH1A 4RTSA 5JHGB 3H0KA 3LPDA 2VDMB 3M4XA 4M1OA 4LE0A 3A1VA 3CH5A 3I9LA 5DM2A 4MIYA 5J2TF 1UWLA 1JFFB 3NKVA 4MTLA 3Q3HA 221PA 3A6KA 3WTCA 4RPGA 3TZBA 3DDUA 4G5OA 4RDHA 2R79A 4EEKA 3UJHA 5A9SA 3AIKA 3WQSB 5JJ5A 3DTVA 2OWEA 1JJ7A 3QV2A 4G0ZA 2DX7A 1TW3A 4UTZA 5FFNA 4KXMA 4JLPA 4R7GA 1MZVA 1VPTA 2EKPA 3T5AA 2G28A 3E22A 4G4SP 3C74A 2YQ5A 5KC8A 3LCVB 3LP6A 1EZ4A 4TV9F 1FFAA 2OD7A 1TU3A 4BTLA 1FNCA 3FTDA 4NK5A 1CUAA 1NDHA 1X1AA 2GJKA 4FN5A 4ZKDA 2GCEA 4TQGA 3S70A 3EDMA 3UKDA 1NMYA 3KD2A 4BX8A 1LPPA 4YCNA 3CIOA 1CSEE 2CWDA 2ZRBA 5H02A 2QVCA 4BKMA 5DLPA 2G0TA 1US8A 5C8VA 2XXJA 1AX9A 1CXZA 4ZQGA 3RG2A 1NGSA 1UEIA 5HZKA 1SUSA 5KBYA 1UXJA 2JDID 2PMDA 5DX1A 1X8KA 3O47A 4DEXA 4DV4B 1YBMA 2C5LA 3EJWA 4ITUA 1TLTA 4CEHA 3KZNA 1DNPA 1MH9A 2GJ8A 4YREA 2CV2A 1NLYA 4GRIA 1QIMA 3QKRB 2WWVD 1ES9A 1FXWF 1GILA 3TD2A 1L4KA 4YCMA 1P1JA 4ICIA 4U00A 5GY7A 3AF6A 2GD2A 3O1LA 3HKCA 2FTKE 1Z88A 5BR8B 4PNPA 4WNYA 1UCFA 2VP6A 1NXWA 2IP2A 5TARA 3ZNOA 4V1CB 1E3MA 2JBWA 3HUUA 2WR8A 3CVJA 3M8KA 1H23A 1BVUA 1XZIA 5DTRA 4YH1A 5AHWA 1GQYA 4DLWA 3OZIA 1GWNA 5ED4A 3ROXA 5HUHA 4IIVA 1EX6A 1LNSA 2O4CA 2CFRA 4YAGA 1QMPA 1QTNA 4X3PA 3EY9A 5CBPB 4ZTBA 3VR6D 3EG9A 1PTJA 2OGSA 3O90A 3PWSA 1W25A 3BSYA 3ZK7A 2UYCA 5B6JA 4MKGA 4D74A 1OWMA 2IUFA 3BGSA 4MAFA 1S2IA 4CIXA 5HKOA 1A8QA 1ZI6A 4KN8A 3ZYCA 4HEA1 1GYRA 5HE9A 4BBPA 4A36A 3MTDA 3GLSA 1WCIA 1LVUA 2MINB 4G5XA 4ZN6A 3TOXA 5CT6A 5AKKA 3E81A 3GRAA 3WOHA 2PUEA 2NPFA 4E11A 1YBAA 1PI3A 1ISPA 3LHSA 3F2IA 4YS6A 2MOKA 4B73A 2REQA 1ZIYA 3E7XA 3AHDA 2O7RA 5F2KA 4I2VA 3SE0A 3UGKA 1KBQA 1IY0A 1CUYA 3NWJA 4W5JA 2C2HA 3VMFA 5J3JA 4LEIA 1W2GA 1AURA 1P6XA 1E3WB 1AZSC 4B4KA 1IY2A 4Z8XA 4D79A 1JN0A 4FSDA 5CHYA 4QEZA 3WKEA 4RY9A 1KRXA 3KSRA 5K7SA 3HP1A 4LFAB 3A9RA 3OX4A 1NBME 4CPDA 3IE0A 1FF9A 2A57A 2O05A 5G4KA 2HA0A 2QRJA 3DZCA 5JU6A 3UV6A 3L0OA 2Y77A 3FSRA 4EA7A 4O4LF 2IEYA 4ZK6A 5AKYA 3MPOA 5DW0A 4MGIR 1KS2A 4MQFB 4J0GA 1N6LA 3FZQA 3TI9A 3B6JA 2ZBQA 5JNVA 5KJCA 1I9GA 2EFYA 3L8CA 3D8SA 4G5QA 5LZ4A 3QVUA 1P8AA 4G1FA 3IERA 4MPRA 3LW7A 4AROA 2YWDA 5YASA 5BYKA 1KVUA 4COOA 2H3HA 2W2PA 4TT3D 4H18A 3DXYA 5CP8A 1YXMA 2WABA 4PRZA 1DRKA 2OZLA 3DBRA 3N86A 2CLSA 4IGEA 4XQ0A 2O7NA 3KKPA 1NTOA 2EP7A 5TQ0A 1KVRA 2V7GA 3FW1A 2F1JA 3C6KA 1QH1A 3QVMA 4HTFA 1UJ4A 3EGVA 3K94A 1R1DA 4XJSA 3ZHRA 2VEDA 3BDVA 4WH0A 1MIOA 1PJSA 4P81A 3KVNA 4HWKA 1II0A 4LVNA 2Y9PB 3FPEA 2VRNA 1W581 4KPGA 1REQA 2C58A 3USES 3VDXA 3A1FA 4UMVA 1G3QA 2IPAB 4AN0A 3DVAB 3U0BA 1P0MA 2IDJA 4G0QA 4HEQA 2FEOA 1WL8A 1D07A 4MUMA 3K30A 5SY4A 5J58A 1C4XA 3CS3A 1JT9A 2H2WA 3H1EA 1XEWY 4YDQA 3TZLA 2I2AA 3T7JA 2QE7D 1EUYA 5AKEA 2W90A 1Z2CA 4BKUA 1L5HB 3B36A 4R41A 1MA3A 2XOEA 2ZUDA 4KB5A 2JLXA 2ZJ2A 1C3XA 1C1XB 2HMUA 4MYTA 2WKSA 1F3OA 3LPCA 4K9SA 3Q9LA 2WFMA 3QPUA 2IEBA 3FRHA 5AW0A 3MRTA 4P0PB 1NF3A 2BMDA 1TUGA 1K89A 1OV6A 2IGBA 5IEBA 4QICA 1VHLA 3DWFA 4YT4A 4RZIA 2JCYA 3TWOA 4YRZA 3NIGB 1T5DX 2CK3D 4KJZA 3PA8A 3UMJA 3TRDA 1BN7A 3DH0A 3JWEA 4MW6A 3L0BA 1A77A 4OKNA 4WXRA 3A0UA 3WLNA 1U4SA 1PNRA 1MGOA 3TPFA 3ORRA 3R5JA 4U2KA 5AOCA 5A0TA 2OECA 1BS9A 3BXOA 2QMOA 4K9QA 5CGQB 3JVVA 5TVKA 1HBJA 2C1EA 2ZYAA 3OPXA 2JASA 2JHGA 1U8XX 3IS3A 4MUFA 4KNWA 3SDSA 5I9NA 3ZGNA 2GA9A 4E5MA 3EQZA 3RSOA 5JADA 1Q6YA 1F8FA 1Y1QA 1V8PA 1EP2B 2X42A 4URYR 4DCPA 2RGNC 2J6HA 5K6AA 5IASA 4YHHB 3TD9A 3K4HA 4G63A 2IGTA 1QWSA 2OKCA 1P2FA 1JHXA 3QG5A 2QSJA 3ZKWA 2GASA 3OESA 1S2OA 5HJ2A 3A10A 3AY7A 4IIYA 1E1DA 2PKXA 3IBGA 1XPJA 3FFBA 4TRNA 3QVOA 5JUWA 4GO1A 1YQ9A 1LH0A 5DYYA 1CUSA 4DJJA 1YS4A 2J4DA 3NGXA 3GJ6A 2PYIA 1U65A 4TL8A 2YL2A 5FCDA 1R4MB 2JIQA 3G8DA 3I23A 1CJUC 4QRIA 8ADHA 2HOQA 1Z5OA 4PAMA 3BMQB 3T9EA 4KREA 2XE8A 1BEZA 4LVOA 1MABB 3QYPA 4IUDS 3I9NA 1GNTA 1U0JA 2P90A 3TBKA 4Q4HA 5K45A 3TEFA 4IH4A 3LO8A 4FGLA 2PS1A 5FOVA 1FYXA 4B32A 4MMXB 5FO1A 3MTBA 3C14C 2XXAB 4FFNA 1E2HA 1ZJ5A 1KERA 1IY8A 1WG8A 2O48X 2H1HA 3QKTA 4FU0A 4JB3A 1V47A 4MJ3A 4TTRA 1G3UA 1JJVA 1JSXA 1UDWA 1QQAA 1CF4A 3VKGA 4O2AB 3ONWA 2Z5VA 1FFSA 2XWPA 1V3UA 3IPAA 4LJ4A 2W2TA 2EWWA 3IHWA 4DABA 5BPFA 4CEJA 1E3WA 3L6BA 2VF2A 3EODA 1JNYA 3LHKA 3AV0B 4IYRA 3NKLA 1JHYA 4HH3C 5GV7A 2BTQB 1WABA 3I2GA 1OLSA 1KK0A 3SIWA 2ZLBA 1BDBA 2FN7A 4CGZA 4QQFA 3O6VA 3TZKA 4NZ9A 5C8YA 4KPYA 1GCGA 1JP7A 2WPDA 4HMQA 1LPNA 1SBHA 4M6WA 4OIMA 3FDJA 1BTOA 3BJMA 4P5DA 4CM9D 1SO8A 3WR5A 5ESRA 3WAJA 2D74A 2QRLA 4XVCA 1EGAA 2DWPA 5I4IA 1K88A 2DTXA 3GEGA 3C1TA 3VSDA 4NJEB 1BWQA 1I01A 3UCEA 4PLHA 1SWVA 1E0KA 2LCIA 3UGTA 2O2SA 2ACKA 2JJ1D 5JEEA 5LWQA 1XQVA 1C9KA 1A1SA 5DCLA 4AUKA 1U8YA 2EZ8A 3CZMA 1TYBE 3F7OA 4JAVC 3WA7A 2QD4A 1GSAA 4WGGA 2G9NA 3UQYS 3EOAI 1L7QA 3WNCA 3VV3A 4JLSA 5AHXA 3VH2A 4E2YA 1ZVMA 4R0VA 2QJOA 4OQZA 2AOTA 1FDTA 3PR1A 4PO3X 3VTFA 4AD8A 2P5SA 4LXTA 3B70A 4U2CA 3M9LA 3CZQA 5JD3A 1C7EA 3HKCB 1K06A 2J6CA 4I6GA 2C4WA 1SA0A 1IQ0A 3GFBA 4O63O 4NAVA 4WX2B 4D41A 5K09A 2KB0A 2FZLA 2W7TA 3EOZA 4FINA 1NZDA 2W2XA 1TTPB 1E2NA 4KLRA 4Z53A 1RYFA 2QIPA 1NLMA 3L04A 4K40A 4OHFA 3V2IA 2NZUG 2ZRJA 4Q6BA 2ZDGA 3KZXA 3OMXA 2I6UA 4Q7MB 3HL4A 1Y5NA 5IKOA 3F6SA 3TZHA 3VSCA 4A2WA 1KMHA 4RTNA 3TLMA 4KRXA 4NBTA 5FJIA 4OX9B 1JB1A 1UK6A 3REQA 4B7CA 4A82A 1PJZA 1TMKA 2EBWA 1YIOA 2O2EA 2FEXA 3I6ZA 4H16A 3TNFA 1DEKA 1Q22A 3VPDA 4Z4CA 5DHPA 4YRAA 1X86B 4C7OB 4OMUA 1M9NA 13PKA 1PS8A 1EWRA 1QOZA 1YT5A 4MV6A 3AB7A 1W19A 4O4IF 3L8EA 1I32A 3HA7A 1AK1A 4WZBA 1NN0A 3HU5A 4AAYA 2J30A 4MLCA 5AM3A 1ZGHA 4KO4S 4D25A 5ITVA 2YWBA 1WMBA 1ZM9A 3K05A 5ENVA 2JLWA 3QLVA 4TT3A 3ED5A 5D84A 4ZCMA 2CF5A 2QMUA 4MCIA 2HRZA 2XA9A 4I9FA 1HSOA 4RV4A 3FTEA 1XLTA 3TE7A 4FD3A 4MQEB 1ST3A 5DGIA 3YASA 3ZQ6A 3ZWVA 2WU3A 1VIDA 2PRIA 3D8BA 3DLAA 3LHFA 4ITRC 3RV3A 4A16A 5JBNA 1JJIA 1FFCA 3D6AA 2RGNA 3O1HB 4COKA 2DQSA 1XWWA 3KJFA 1JAHA 3E0QA 4E4YA 2I3BA 1YB1A 4LZJA 1J5EB 1Z6TA 3LXRA 4MRSA 4Q1CA 3RGWS 1N9KA 1QO0D 3RRZA 2ESRA 1YC5A 1RWQA 4GHWA 1JKJA 3KT3A 2ZKIA 1EFVB 4TQ9A 2O4UX 2WWFA 2JIZD 4Q66C 4BVFA 3SQOA 3B6KA 4CTJA 4QZVA 1TNDA 3WX0A 4NBSA 4HB3A 3H2SA 5A6SB 1TD9A 1NC3A 3HCCA 4PE5B 1UMBA 1W4RA 3TRHA 3MBOA 3PQ3A 3IP8A 4FFSA 3KR2A 1TD1A 3OX1A 4H2DA 4R1TA 5E6RB 4N5MA 3BTUA 1RJGA 2FFJA 2IXEA 4JI3B 2IUEA 4B3XA 3THOA 3E7FA 5HF6A 3H3XA 4LV8B 2GTHA 2IK8A 4A10A 2BCJQ 3BT7A 2VPYA 4OXNA 4HSEA 4RHUA 1CNEA 3LLMA 5B4UA 5JWOA 1G4AE 4Q1VA 5DNVA 5L45A 2LUOA 3GDFA 5ALZA 3CUSA 5JCOC 1NXQA 3P9QA 4RM2A 4J75A 2FG6C 3FYCA 1Q6ZA 2CL7X 3RIHA 3TX6A 2V3CC 4LCEA 2JLUA 2GOYA 1S2MA 2V9PA 3OX2A 5JDIA 1E32A 5T5QA 4AJLA 5HZGA 1S3FA 3HBAA 4JT2A 4S1TA 5M7EA 1AD2A 2UV8A 2OPHA 5KVSA 2AHRA 1GUBA 2P11A 1IHYA 2EHDA 4EKDA 4PF1A 3UJ8A 1O0SA 2PVPA 3BXFA 1NAHA 5EXDA 3BTOA 2ICAA 2XTZA 3THWA 3P5BA 1OFTA 3B6ZA 3QF4A 4LQCA 4D56A 4V0LA 4U2FA 4CLDA 5CT4A 4D9FA 1B00A 4IF4A 1NVXQ 1T9AA 1MF7A 1KI9A 5AW1A 4LYJA 1J9EA 1QGUB 3DVQX 3TVYA 2G07A 4F6LA 2C3OA 1V41E 4DCMA 1ILEA 4TTVA 4FKZA 4RHCA 3LQ1A 3WGZA 4J2OA 5E1OA 4B4UA 2QUIA 2X8JB 2PCLA 1B43A 3ZWMA 2NADA 3GVHA 1RJ9B 1DC6A 4BQNA 3WNQA 1L4UA 4MARA 2R6GA 1H0KA 1CR4A 4R5HA 4LNUB 4HVLA 5KJ1A 1I2ZA 5INTA 1UPCA 1DKRA 1G8KA 3KAPA 3OUTA 3ZH2A 3WA6A 2PUAA 2F8TA 4BNFA 4ZOQI 1V11A 4YMTA 1Q7RA 3BWEA 3WZMA 2IV7A 2RD2A 2Z98A 4GWKA 3WRXA 5B3JA 3L4EA 5GPBA 1E1LA 3AVQA 4CLRA 3Q5DA 4B46A 1YVRA 2Z6AA 2G17A 3FYUB 4GG1A 3A26A 1CVLA 1MEJA 4LXHA 4Q9HA 1IN6A 2O2HA 4EJSA 1XR3A 4KODA 3JZIA 4P54A 1N5MA 1LRJA 4BQRA 5T4BA 5FBWB 3QI7A 3L1KA 2ZIXB 1OLXA 2JGKA 4TTJA 3AR9A 4XX0B 3S2UA 2RGDA 3EE6A 1Q7CA 4KE6A 1F2UA 2I76A 3CISA 2I6TA 4NVRA 3SQDA 3S29A 5CB4A 1KFKB 1P2BA 3CT6A 2BKUA 1S01A 4PLWA 4PX5A 4CMKA 3EGCA 1TVKA 2VSNA 1UANA 2RIPA 4GECA 4ZEXA 5B7PA 1EEXB 2HCTA 2JGNA 3WI7A 3ESAA 3FMVA 4HB2A 2JCSA 4S3MA 3X44A 3MBIA 5JAHA 4NBRA 4LRWA 1NYTA 4HEA6 2A0UA 5H3LA 1ZIPA 1XTIA 3A58B 2HBRA 2WVGA 2VDOB 3K96A 3OIGA 3Q9NA 1K9VF 3FE2A 3TXXA 4KHZA 3V00A 3L79A 5BV8A 1VDZA 2BSXA 2HPAA 4IDDA 2R5NA 5ADWA 2HR1A 1T2CA 1W88A 2H00A 3NO4A 5D5HA 2E87A 2LGJA 2NTNA 2PXAA 3NDIA 3T06B 2GA8A 3F9RA 1QHNA 3GBVA 4X45A 2R1VA 5DBOA 3W8NA 4F8EA 1W75A 2B20A 3EQ2A 4LYFA 5GADl 1RZRD 4LF8B 2BEWB 4G1BA 4UUBA 4AZ3B 3PNQA 4IV5A 4NYIQ 4HGQA 2UZIR 4LOJA 4F9EA 4R8RA 2AFIE 5BYJA 4X1YB 3RCBA 3UFXA 3NORA 1V8FA 2RAPA 3RVMA 3DZIA 1C5KA 4MRMB 1LFAA 3LI2A 4N8SA 4RGYA 4O5OA 4Z7NB 5JNRA 3HXOA 1TTTA 1USIA 3GMDA 3WVNA 3ULKA 1SBQA 2O8NA 1XROA 2VQSA 4ZDIA 5LP6A 5A4AA 2PJRA 3ANSA 3MJHA 2JIPA 4AF7A 4HEJA 5K3CA 1FFDA 4MTCA 1WW3A 5FLKA 5LQKA 1Z12A 4IJUA 1W49A 2W22A 1O6BA 1DIOB 4X1KA 3ITEA 1K4MA 3G0IA 1XJWA 3K1TA 1Z6GA 5HG0A 1LK5A 1WHTA 2JBAB 2WMYA 4GLFA 3PCXA 4JBGA 3EVGA 1DQPA 4OQXA 1RXWA 4D3DA 3SF0A 1T6NA 1SQ6A 1GZ7A 2CE7A 1U98A 1YFLA 1XXHA 4KXYA 2H5LA 2NU6A 3LX8A 1DLIA 4NCAA 4CTOA 4XLLA 1Z0KA 5DZSA 1PJLA 3MCTA 4BVGA 4D5GA 3NWBA 4JOSA 3QKIA 4FLEA 5SYMA 3K1ZA 3QEOA 4F4CA 3ILHA 1KMNA 1TCBA 3JZFA 3O31A 4IHAA 4TMKA 2QVGA 2Q99A 2ZSUA 5B1SA 4WASA 1ZGBA 2VJQA 2AG5A 2IHTA 3BWCA 2YZNA 5B4TA 1GITA 2A7XA 1GAXA 4EOGA 4AQ7A 3OAAA 5BT8A 4RA9A 3JCZA 3STYA 2WD8A 5FWDA 1IZ8A 2J9YB 2PH3A 4YMIA 5HJEA 5E9QA 1V7ZA 1JEOA 4A2PA 3DWIA 3T7RA 3WFJA 1YDMA 5FBHA 2KWIA 1MDBA 3PEEA 4URZR 5I3CA 2PK3A 2BMEA 3D2LA 2E4YA 1JVNA 2QTLA 2HAEA 2W6CX 3GDOA 1XZJA 2OBBA 3MJTA 3NAZA 3Q3VA 2V7WA 4JT9A 4DR2B 3D31A 5IJWA 5K20A 3JQRA 3NHSA 3HFSA 4IXMA 1QX4A 1UP7A 4O4HF 3RHFA 3N58A 1EUQA 4KR3A 2GK6A 1M5UA 2Z3VA 1RE0A 3ETJA 4BYMA 3BJEA 4AJJA 2CK3A 3F4LA 4F56A 1IBCA 3LX5A 3G5LA 3UPDA 4BMPB 4RCZA 3OPMA 2AGVA 2VJNA 2VNKA 2MWMA 1HKUA 4ZO4A 4JP3A 4ZGGA 3DMGA 3L7MA 3DTTA 1L5LA 4PGFA 3ZWQA 4C0HA 3Q98A 3K16A 2O0LA 1JR2A 2C9MA 3NRCA 4CDGA 1KEZA 3NDRA 5D8DA 2WFZA 4JLBA 2HWUA 4Q0MA 3JQDA 3F96A 4HZIA 1GPAA 3KYCB 1VYVA 1AMUA 1U8ZA 2ODBA 5FIUA 1U1GA 1OBCA 1QCZA 2ONYA 3O8OB 4ATNA 1R0CA 3K0FB 4IJ5A 5CFZA 2H1OA 3SIXA 1A7AA 1DJOA 3AV3A 3EW7A 1GP2A 3SJAA 4FOTA 4O3FA 1JU9A 2GM5A 2W2LA 1FBTA 1D7AA 1VJ0A 1UH5A 1O54A 2D62A 2YRFA 5BSEA 2E9SA 3A1UA 2VNHA 5IVIA 3D7RA 1D2MA 3AWIA 1A9PA 1WUYA 2C5EA 3L02A 3S2YA 2I4LA 3R6DA 1GADO 3ZE8A 4DQDA 4KR9A 3FOWA 1EA5A 3AEYA 3C5EA 3WFZA 3WWDA 2R8ZA 3AUYA 4LECA 4Z9YA 5T3YA 3UC5A 4AX8A 3JU3A 3B13B 3OLCX 3QEMA 1OOEA 2VP5A 2NUAA 1IAVA 2WWTA 3HS3A 4QPPA 2BFCB 4BCCA 2XQJA 3VJKA 5K4AA 1QPBA 2AK2A 4I50F 5BYBA 1LBEA 5DHAA 2IYOA 3G0GA 3DWGA 4C7VA 3H83A 3PBKA 1OR8A 5CB8A 4AS2A 2HD4A 3VO2A 1FEZA 2Z5GA 2XWBF 1A8SA 1X7YA 1TK3A 1EK5A 1B0PA 3N39C 4LBVA 4WJKB 5C7OO 1FIUA 1ESEA 4DLYA 5I7UA 1D8AA 3UT5B 2EFDB 4G8JA 3NHUA 3BN3A 3OSUA 1P5FA 2P9JA 2XUAA 4BKOA 1WVMA 3LW8A 1GKLA 3P5SA 4ZOLF 3HH8A 1WSWA 5LC1A 1V1MA 3ASVA 4Y98A 3ZE9A 2RC6A 4X3CA 2IZOA 1FSFA 4A6EA 4R7TA 1IEXA 1NQUA 3AHEA 2IW3A 1PR2A 4HXFB 4ZCTA 1CFJA 4EGSA 1PVVA 2ENWA 4G4GA 1B6SA 4KIGA 1NVKA 5BQ3A 3DHEA 5HRUA 1F06A 3EVEA 4KQKA 4HAZA 2CV1A 1IZYA 2PSSA 2Z83A 4M9XA 1L5YA 4MEBA 2J9GA 5H80A 4QUKA 5EEHA 4WZ6A 5EE0A 4KO8A 4PEVA 3IX7A 3PJFA 3KKEA 3WMRA 1E5DA 3VDQA 1KNXA 1R2QA 3N9IA 3L6CA 4IVPA 3ILXA 4LTDA 5I9SA 3DOEA 2FRVA 2JFFA 3OFNA 3SZGA 1MG5A 2AUNA 4L8VA 1ACJA 4F21A 2O2CA 2CNNA 2YHBA 3IMGA 4M88A 3H2GA 4EY3A 4NMLA 2BLLA 5KYYB 2WU8A 2Z5LA 1E77A 2A88A 3H5WA 3F6CA 1OPRA 4KXNA 1W46A 4KPFC 3PCTA 4PQEA 2CL6X 2P2YA 5EIBC 1E4EB 4NDZA 2AB0A 1GKKA 1GRQA 4B7AA 1NFRA 2CYBA 3KKOA 4RIGA 5JHHB 3L41A 2PKWA 4D9MA 4I08A 1XP5A 1DC3A 3EGOA 4U7JA 2XVMA 3IEKA 4C5AA 3ADCA 3AI1A 4OGLA 1DIBA 3CB4A 1NBHA 4BVBA 4FC6A 1TYCA 5E3JA 3AI2A 1Z4LA 2X58A 1ZJ6A 3LUKA 1HDRA 2VH5R 4TVBA 2FEAA 1NXVA 1M2KA 1N2JA 2ORVA 3GEEA 5IF9A 3NFYA 2GN6A 1H4SA 4OGGA 4L3OA 4DY6A 4G09A 1L8XA 4NWIA 4WL0A 1HF3A 3EJ6A 3ZJYA 1MA0A 4MRPA 1XWIA 5CRIA 2ZWIA 4L9SA 1BHJA 2OUIA 3AX6A 2NT3A 2PKCA 3UOAB 4RTKA 3TS1A 3M3DA 2J0SA 1NUUA 5AXAA 1B2LA 1QFZA 4N3NA 4U39A 2QXUA 1OX4B 5FJJA 3MQ4A 3SDBA 4ALNA 1PN3A 5HQ3B 1W76A 4LISA 2NTVA 3KYDB 4MPPA 4TWIA 2QM0A 2VK1A 4BUZA 1TAHA 2F6RA 1T8PA 3PE6A 2ZRKA 4EYQA 1MRSA 4Q4JA 5D3QA 4AWXA 2D2IA 3MHPA 2GCPA 821PA 4XM2A 1QDLB 4J0HA 1EFRA 5B4VA 3WLKX 4L7QA 3T4UA 5M29A 1QH8B 3QENA 4LF6B 2DR3A 3HBNA 2JC3A 4MV0A 1LB1B 1QGYA 4A5SA 2YC2C 3DTVD 4BO9A 4GYYA 4EHFA 4DCNA 1P75A 1Z6AA 3ZHZA 3KT6A 3I2HA 2QSUA 3L0PA 2YRWA 4KWHA 2CLMB 5HILA 2WPNA 3BVPA 3IAM6 4PLGA 3TSAA 1SBCA 2OSVA 4LA4A 4LE1A 4Q3BA 5LYYA 3BXGA 5AIBA 5C9ZA 2F9MA 1K27A 4PG8A 4N6OA 2DQKA 9LDTA 4O4JB 4IZOA 4BNYA 4I5IA 3N6XA 2FPOA 1E3TA 4D0SA 2ZS7A 3MB8A 1IH8A 1ZO8A 5A5DA 4KTVE 1SXJB 2HV9A 1T2FA 3QFFA 5LP6F 5A7HA 4DY4A 2ODEA 3D3EA 1PYOA 4DJEC 4POOA 1KKLA 1NXXA 1V9LA 4JMLA 3FNGA 1YB5A 2DPXA 4FGSA 4IGAA 3RT9A 2O6HA 1HL3A 1JQDA 1PRYA 1QRDA 3L06A 3AIOA 5JMOA 1E2KA 5DE3A 3OH8A 3WRWA 1FBNA 1UXKA 3F4KA 4KQIA 4ALMA 2JATA 1RBQA 3FMOB 3I32A 5U1PA 1NOIA 4RFLA 1BVRA 1E96A 1XZBA 2NVWA 3AHJA 1LGYA 4HLCA 4KDFA 4QQRA 4ZO9A 4ZZ2A 4DCTA 3AILA 1MV5A 3FMPB 3WLTA 1XXLA 5F3DA 1JAZA 2PXXA 1E94E 1LPAB 2CFIA 4RQTA 3U7EB 4E14A 5FV4A 1HA3A 2MR5A 1RWOA 4LW8A 3P26A 3AXSA 5JAPA 2QD1A 2VG8A 3FDZB 1IBRA 3IV6A 4MYHA 5KTNA 2A5JA 2HA6A 2AYYA 3K5IA 3ANTA 1BMFA 4RTQA 5EP3A 3L1VA 2RI0A 2XVAA 5DHRA 3R9IA 1AKUA 5TQ2B 3QVTA 1LWNA 4DBLE 4WXYB 5JJCA 2WHPA 2ZDQA 4XCXA 3U31A 5C32A 3LOQA 2FDRA 3HN2A 2W70A 4BU1A 4WK4B 2G1AA 2EYQA 5KOJB 3ICVA 3NHYA 3P9RA 3PF9A 1O6GA 1Z08A 4N48A 3OUZA 5EUMA 1PLJA 2KE5A 3ELWA 2DWOA 3P9ZA 4YCCA 4OHXA 4RABA 5CH3A 4X41A 5EHGA 4B45A 3IE1A 1C9EA 4IGKA 4A27A 1KZGB 1NRXA 4KQ1A 4O59O 4GMGA 3VYRB 3UYKA 3IAS6 4ETIA 2OZKA 5HM6A 5KX5B 4F0JA 1UBKS 2ONZA 3G5TA 1DFIA 4IIJA 4ALLA 2IYTA 4E6EA 3M33A 3QOYA 3KFVA 5LNK1 1OB2A 5D6OA 5TE9A 3BXHA 4FNOA 1E1QD 1CS0B 1ORVA 1T0HB 3GJTA 4K26A 4JI1B 3JWHA 1D9ZA 4BNHA 3T4XA 1FFYA 1DG9A 3GF4A 4XEHA 4L2IA 2XZTA 3OTIA 1QIDA 3BEOA 3DAPA 3ZC3A 5DCYA 2Z5FA 1RZ3A 4HOYA 3PGVA 5D3MB 4KHPB 1Q5PA 2K4MA 3UAGA 1LK7A 4HUQB 2KW5A 3SLRA 3QHQA 2ARKA 3OTGA 1E2JA 4JX8A 3VJLA 4B31A 1Q1ZA 1N7HA 3A4VA 3F49S 3OD5A 1GNSA 4G89A 4P98A 2C4MA 2H4ZA 4NQRA 1QBGA 4YRCA 1XA0A 5L4SA 1R9MA 2OV3A 3HSYA 3ODGA 3SYTA 4MV1A 4WQMA 3IH5A 3V7WA 2K7ZA 4J1TC 1OC2A 4X90A 1EDDA 5FBRB 2XCRB 1UL1X 2Y6UA 2IVZA 3IE2A 4MR9A 5GZ3A 1HYEA 2OZEA 2GETA 4M4SA 1IXKA 4MHSA 4U8HA 3FB1A 2CXPA 5KSYA 5F76A 4R7ZA 3W0LB 5LZ9A 2F55A 2NZ8A 4D44A 3O2NA 5EE3A 4AY3A 4ZVUA 1C9NA 4YCJA 3LKZA 2ZAGA 3W9YA 3DOOA 4ARUA 2J3KA 1Y6ZA 2AZDA 1WQ3A 3V8QA 1Z62A 1RBMA 1DAEA 4AJ4A 4ZOBA 3DW1X 3OTHA 3AUSA 3DE2X 1JPUA 4XZ3A 1NW9B 2C96A 5TF0A 2NYRA 1P91A 3CRVA 2JI4A 1C2YA 2EERA 1DAHA 4YV2A 2ZYDA 4Z8YA 2ZPUA 1XDUA 3X1MA 1KK1A 1UBJS 1LPMA 1U0HC 1IB0A 2JGAA 4UOQA 3HCEA 3IP7A 2HCJB 4MNTA 3TZ6A 5B3AA 2XGJA 2ZU0C 1V4NA 3FRIA 4QXRA 1NUQA 3BXZA 1WZIA 1TA9A 3C2QA 1GYPA 1K7YA 1U8UA 2X7HA 2XKBA 3G2LA 3PFGA 4FMDB 2OQ2A 4PG6A 4EATA 2FOIA 1FDUA 1GG5A 2LXNA 1WDMA 2OO5A 4OQEA 3UJ7A 4HRXA 1NMQA 4BECA 1THGA 3SS9X 4GEKA 4GPEA 4N4AA 4X97A 1HMYA 2O1SA 4YACA 1EQAA 1EM8A 3LDUA 3AP1A 3M70A 2BN4A 1FX0A 1KKUA 1IMJA 3CFYA 5A04A 5IAOA 5JJLA 2GYVA 3FWHA 1G3IA 4GOOD 4BLWA 5KB3A 1YVDA 2PUWA 3U7QB 3TLYA 4G1MB 1NN1A 4ZREA 1ZK0A 3E9ZA 2P9HA 2F00A 1ZRMA 1EB9A 4PN3A 3GRYA 4INZA 1U4OA 5IUNC 4GI3A 1P0QA 1UBMS 3SHTA 4G81A 3WLOA 4BLVA 1SKYE 3O8QA 5F5LA 4NE9A 3R9WA 4KR6A 3CCFA 1GR0A 2XB2A 4HJXA 1L4BA 2D5CA 1GAQA 1Z4KA 3B82A 3HKBA 4HGOA 4K9DA 4WV3A 2X0RA 4Y0VA 1YFKA 3IHLA 1R66A 2QAIA 1I8TA 4DIFA 2IEDA 4D42A 4PZUA 3SMVA 4TN1A 1PJ3A 5JNUA 2BFDB 3AJ8A 2IX9A 3U62A 1N9GB 1EWYA 3OQOA 1XQ6A 1M73E 5ALVA 2DUJA 2F59A 1RM4A 1XTBA 2NTYC 5HYVA 4XRRA 3N0RA 2HPZA 2X9LA 1P1CA 3HLYA 5B5SA 3I28A 2Q5HA 1F8YA 1RFGE 3DVSX 4BZPA 1PGPA 1YWGO 3HYSA 4I4CA 3D3KA 3BQMB 4CJXA 2JJYA 1N5LA 2OP0A 2IYVA 3B52X 1RKQA 3HY4A 4EENA 1P7WA 2COUA 5JAUA 4LK2A 3ZU6A 5TY0A 2AOVA 1N5JA 1UMDB 2K5UA 2JJ8A 2RBGA 1X87A 4G1EB 3ZCPA 4G9EA 1RAEA 1GZ5A 2CWWA 2FE1A 2WF8A 2Y0DA 4KK3A 1UFQA 5DV9A 3WK9A 4D43A 1SULA 2CJWB 5JAZA 1I7DA 3E05A 2PGXA 3Q8LA 2P69A 5GGXA 3JQ8B 1LV7A 4KBYA 3DNFA 1T4DA 1MJHA 5JASA 1U7ZA 2O8DA 4L8LA 4G0PA 2Q6KA 1QF9A 1SKUA 3ZHUA 4MWOA 3HV0A 1GTRA 3SKYA 1RSZA 1JAIA 3MMXA 4EUNA 3ZGOA 3I2YX 5J23A 1TT5A 1CUJA 1GPWB 2O2YA 3M2PA 4UEKA 5TIIA 1AC5A 1SD2A 2PH7A 3AEXA 3AUJB 2P2GA 2HGSA 4LRYA 3QIAA 1HTWA 5JDCC 5CA0A 1TECE 2C5SA 2XADA 3ASUA 3BHNA 2Y0EA 3LBIA 1OLOA 3GEIA 3RARA 4OJNA 4XWYA 2VNJA 4I1OA 3B78A 4YGYA 3FOAA 5EXXA 3VHXB 4BL5A 1SVMA 5EXTA 3GLFE 4RZQA 3V8NA 4BMCA 4F5ZA 1A8IA 2VQDA 1B8NA 3D0RA 1L8OA 2FUEA 3IUYA 2JAPA 1EXWA 4OCZA 2ZJ4A 3JZMA 3LVFO 4FCVA 1FFXB 5JARA 3WGNA 3LH5A 4MWTA 4O8CA 1BDJA 1G17A 2LVBA 4UQOA 2M2IA 5CXXA 5GTDA 2QUHA 3TW8A 4AFNA 3MHTA 3K70D 4JKIA 5B53A 3JQ6A 2NAFA 4P7GA 1H94A 2OORC 2XQIA 3RYCB 1G63A 3W6UA 1NWCA 3Q2OA 3GNQA 3ROZA 1C8BA 1R6XA 2CJFA 5G0TA 1U8AA 4CLOB 1K97A 1QK4A 4KWTA 1SWWA 2X5NA 1J0AA 3CWZA 5L7TA 3A6FA 3I8OA 3GXOA 2PA3A 3UATA 5KEIA 2VZ9A 1XFDA 2PRZA 1SHUX 1J5XA 1TA0A 2HQSA 3FTCA 4N1AA 1HRKA 1JQBA 4TKZA 3IPCA 2PLFA 2ZCVA 3TMYA 3WLMA 2OT3B 4YQEA 5AK6A 4J6FA 4O3MA 5CA1B 3BK1A 2EIXA 1T8TA 1RXSA 2Y1LA 3PA6A 1ISHA 4B3MB 1PG2A 2ZE8A 1YUBA 2IHBA 3O9MA 4IQ8A 5CX4A 3ERCA 3ILSA 5TC4A 5A3RA 2A78A 3NAQA 1XAHA 4PZZA 5B58C 3HJFA 4P58A 3RRFA 3RVSA 1XK7A 3WLEA 1TCCA 5DXJA 1BX1A 3CZ9A 1M3SA 1N8KA 3ELBA 1MMFB 4FR0A 5ALTA 3PLAE 3I1FA 1LTQA 2FR0A 2O6LA 5JW6A 4UXJA 4CM1A 3FCCA 1YQGA 2BGLA 2IEGA 2MJLA 4YDRA 3DZFA 1OA0A 4EHHA 4PCUA 2PSDA 2FZCA 4HTAA 5BVGA 2GNAA 2IELA 5DEOA 5E7QA 3AEQB 3RIMA 3U80A 2GN2A 3O3CA 4QYMA 4IZHA 1Z06A 1N5DA 3KOUA 3LUPA 4QTTB 1RXYA 5HIKA 1XZHA 3LKVA 4QYXA 2AMVA 2GDZA 4UPDA 4PGMA 3ZIAA 3GGPA 3WADA 5HW0A 2ZFUA 1HL7A 5DB4A 1CYEA 4MICA 3OD1A 2I91A 4LRQA 1XHLA 1EZZA 2QQEA 1J7JA 5KVVA 1ABEA 3ZI0A 3JTMA 1NF9A 4UU1A 2VH1A 2HJHA 4BBZA 1F7UA 1RPAA 4TRMA 2ZI6A 1QIEA 2EDAA 2WG2A 3TIVA 3Q6MA 4CIBA 1EK1A 3S1AA 2JEOA 1D6JA 1VIAA 1AV7A 1TADA 1DXYA 2Q0QA 1IYZA 1BXGA 2Y9MB 1ZL2A 5H70A 3KQUA 1M7GA 4KQ2A 4LJRA 4C89A 1C7JA 4CF5A 1PLKA 1F48A 3T3IA 3KTFA 4X20B 1JHOA 3AFNA 3LLVA 1T3HA 3PR2B 2PD3A 4L85A 5K0JA 3A6PC 4YROA 1M8PA 3A14A 3LPAA 3L18A 4IQ4A 1WBDA 2CNKA 3E2IA 3E15A 4C5BA 4HI0E 2MMGA 3D0KA 4PAWA 3RC3A 1P77A 4C1NA 2G9ZA 2W11A 2YHSA 4D3SA 4BATA 1XKQA 4YALA 5K3EA 3ZV3A 4GP6A 1H6DA 3ME5A 1XQ1A 2PCJA 4ARSA 2H07A 1V48A 2PUJA 1KGDA 4R1OA 4P2GA 4PYMA 1E1YA 4C29A 2FP3A 1SXHA 1L3IA 1ZW6A 1DBQA 1IOVA 1G2IA 2IEAA 2W4IA 3LXXA 4LRSB 5FL7D 1GL6A 5TLSA 1E9RA 3PIDA 5EQFA 2AKYA 4BQSA 1XVTA 1ZX1A 2CHFA 3P45A 3RVRA 3T3HA 3IYLW 1GN9A 5DXFA 5L51A 4BRUA 3AUAA 3C4QA 1DTSA 2JAWA 5IXJA 2OCDA 3SC3A 3WWZA 2DBVO 2R8OA 3NHMA 3STXA 2YV4A 5CVTA 5KSZA 1XAIA 3E35A 3RHSA 3EDYA 1ZK1A 4HLDA 1V5EA 1JLKA 1ZNZA 2ZJZA 3TTWA 2YFQA 2GEFA 3AERB 5TPWB 3RVDA 1N0UA 1KYWA 5IZCC 4G8BA 4YAKA 1P9LA 1DFGA 2XUOA 5ELLA 2QLTA 2XR1A 2FX3A 5EJ8A 3BK2A 1GM5A 1Q21A 1F51E 3R0QA 4PBTA 2R4QA 3GMTA 2C83A 5DFAA 1ZGJA 1ACLA 2O14A 2M9MA 1WUHS 1UWVA 5ITZB 2H4WA 3R7DA 2VOJA 3A3PA 4E0BA 1JQLB 1J0CA 4UCFA 1U2RA 4MA5A 4YXWD 3GLIE 2ZJBA 4IFIA 3KE8A 1LA2A 4F6RB 3LVBA 4BNVA 4AURA 1PG0A 2CLKB 4MKXA 2INGX 1P45A 2VK2A 4FYMA 1CUIA 4UFNA 1NBIA 2C5HA 4WD3A 5L8VA 1KC1A 1EDZA 3HVJA 2NU8A 2GAIA 3W5DA 5KIAA 4EGCB 121PA 2HXYA 5CAEB 3FGNA 3ISVA 3R5HA 1C7IA 2BGIA 2J4CA 4TQUS 3URKA 5B2EA 3DUFB 5CGZA 4LSZA 4NOJA 3QWAA 1J8QA 3LPLA 2GO7A 4P8RA 2XMRA 2DR0A 2CUZA 4Y2RA 4CG0A 3GA7A 3JQ8A 3KPWA 3LC7O 3HXQA 2J32A 1ZJJA 3GFVA 4PRLA 5LOVF 4OSEA 1GQSA 4H3HB 3UBTA 1SVOA 1JSRA 4XM1A 5F52A 1E6LA 4I8XA 2GQ0A 1BFKA 1JLLB 2YHIA 4KMSA 4MGZR 3P0HA 1GQFA 3F6RA 2Z6UA 3AEUA 4C2BA 4RWEA 2R48A 2OGZA 1PF7E 2MSLA 4EYOA 2C0PA 2G08A 4C0QC 1KVSA 4QTXA 3GIWA 2GKGA 1Q0PA 3O73A 4KYTA 4OXXA 4R84A 2P3LA 4JL5A 4CM6A 2I29A 1QH9A 3P4UA 1OU4A 1ONOA 4AL4A 1Q83A 1M83A 1NWHA 4MJLA 5ALIA 1WY7A 2FKNA 1ZAKA 3E9CA 4I9GA 2JLRA 5G0UA 3OTOB 2M6SA 1DWPA 4L6AA 2AL7A 2GHTA 3DE6X 3EVTA 5FPHA 2FSIA 4UCQA 2RHOA 5B2ZA 3VR5D 4DW8A 5C7LO 1XRNA 5M04A 1SK8A 4RS4A 3OSZA 3UGQA 4PN7A 5C4GB 1U4NA 2DG2A 2O52A 4ZJYA 2FPLA 4GUAA 1KEKA 1NYQA 3ZNPA 3R3JA 4NK4A 4HN2A 3ECSA 1DXOA 4WADA 4CT0A 5CDUA 1FUEA 5DNYB 1QS0B 3FZGA 2ZULA 4OQNA 4MUEA 4ZKEA 1U7HA 4IGIA 3RD5A 1Z13A 4PC1A 4CN8A 5B3JC 5C81A 4KR2A 3I04M 1Z29A 2GPAA 3F46A 4QULA 1SIWA 1YVUA 1XZQA 1XCMA 5HE8A 1SCDA 1A0OA 4Q37A 3T61A 3QU2A 3DDWA 1MC1A 1NJSA 3F3KA 1VMEA 1EX9A 1YUNA 2FZVA 1CIVA 2VJYA 2WG0A 2HIMA 1G7RA 2X7JA 3F5SA 4LZZA 4P7KA 5EAIA 5FL7A 1RI1A 4BKPA 1XVIA 3RIYA 1EVIA 3UMSA 4I5EA 2W83A 3ABIA 4D02A 1X7ZB 4H7JA 1MT0A 2SCUA 1W1UA 4AJ9A 1FX0B 3NWOA 2ILTA 2YFYA 2ONCA 3B48A 3HJTA 3RU7A 4F7WA 2YNMD 4U1RA 3W06A 1BYIA 3DOJA 1YRWA 2RGAA 2CZCA 3VPFA 4B75A 3I9KA 3RIEA 1QG2A 2HQRA 5KPJA 3TR5A 1AKEA 5KVAA 3KBOA 5K0NA 1XMVA 2CZQA 2QLNA 3NRJA 4FX2A 2OO7A 1N5IA 1Q91A 3OM1A 4Z4EA 4X65B 3HKDA 1CR6A 4I0WB 4A8JC 5HTOA 4QUBA 1PQWA 4AQYB 1ZR2A 2F3SA 3KAQA 4AP9A 3T1VA 5F9FA 2HF2A 3COWA 1ZBDA 4N39A 1Z38A 1JKXA 5IZCA 4GOLD 4CKEA 1CB0A 3R9KA 1RQGA 5AUOB 2HTFA 5FNVB 5KNBD 5A3VA 1T5LA 3SM3A 3ABZA 2BBSA 4GKVA 1XO1A 5KOIA 4DV2B 4RJJA 4JA0A 2YBDA 1ZA2A 2YWRA 4AKTA 4E32A 1Q7BA 3QITA 4NATA 6YASA 1EVYA 3TO5A 4CQLB 4L8WB 3LG2A 3VO9A 2EHJA 3QVJA 5BN4A 1WB5A 4OJTA 4MMYB 3OPYA 2NVBA 2IKQA 2XF8A 3FJYA 4A15A 4FWBA 1U0BB 1MG0A 3SEAA 1R9GA 4C4ZA 3PS9A 3SM9A 2I2FA 1U5BA 3K9WA 3A28A 1MB0A 5K2OA 3DM9B 1NZFA 1P6UA 4TYNA 2L0XA 3MWGA 3R24A 4KTTE 4UZEA 5GIOE 1QGOA 4Z1OA 2B8TA 4R2JA 4E30A 4K81B 2PKQO 1DP4A 1T3GA 4MW0A 5D3MA 3W6ZA 2ZM6B 4I9NA 4NJMA 5EVJA 3A6ZA 3WK7A 2ZETA 5KAPA 1Y4ZA 2H4FA 4FQ5A 4J0DA 5A5GA 1KJYA 4H35A 4IUCS 1ULAA 3L6UA 4NHOA 2O0MA 1AS0A 1H2RS 2DHDA 2Z0MA 4DJDC 3EOBI 2HFJA 1SPBS 3R0XA 4ENQA 3ZCQA 2GPTA 3WQRA 4ALJA 2XWQA 4B4VA 2WTMA 1YDGA 1W30A 2A33A 3G68A 4R2HA 3OQJA 1IEVA 5T57A 3LDGA 3ES9A 1TJYA 4ZOCA 4OBEA 1ZL0A 4KUEA 1RWPA 3RPEA 2X1MA 2F1IA 5JIBA 1FTGA 4F2PA 4IOLA 3GEPA 4BNDB 4ENTA 2D1FA 2D8AA 1UIRA 2EGGA 2UVQA 3WRYC 4B43A 4EDHA 2WHPB 4JBLA 4PAQA 5CJPA 5ICGA 2C04A 1R50A 1X80A 2P6NA 4GSYA 2CCKA 3C3BA 4QU0A 1J2YA 5IDYA 2Q46A 5AXBA 3NEYA 5GJVC 2IHVA 3TLJA 4UREA 1E1QA 3RYIB 1WV0A 1OFGA 2GFIA 1OTHA 1F4PA 3OJCA 4A4DA 1FNNA 1VXRA 2EVWX 3B8HA 2OC4A 3DF7A 1IUPA 1E63A 2RG7A 2YVKA 3CZ5A 3HADA 1IZ0A 2IE8A 3FNBA 3KB2A 3O8BA 1ND5A 4G1VA 5J59A 5J5AA 3HU1A 4W1SA 1AE1A 1E2UA 1QG4A 3LNTA 3OEHD 3I4CA 5EP4A 4IS3A 5I9TA 3DYIA 3H2KA 2OCXA 1ESCA 1J1IA 2NNLD 2ZI7A 3LQ4A 4Z3OA 1Y6QA 3HFRA 2QS9A 3DA8A 4FMBB 2EC5A 2H7VA 3BMCA 2GFHA 5HUQA 1BCRA 1H3FA 1NJ5A 2YXBA 3G0CA 1G41A 2BLNA 3O7WA 3S2GA 1WX1A 1W0JA 2Q1YA 3R7SA 3B6MA 2XPCA 4GVPA 4WKPA 5CLIA 2AZXA 4RIHA 4GWGA 4LF4B 1OF1A 5AIAA 1L7PA 2XA1A 3R5FA 3D6VA 3FWYA 1XT6A 7REQA 2PMKA 3OPVA 5JATA 5IUKC 1WKBA 4DLTA 4FNAA 1YL7A 3ED1A 5K99A 2E5LB 3S2IA 3JD2A 3JARB 3L8HA 4HFJA 5HM8A 1YK1A 2FZKA 3B5IA 1XQ9A 2ZJYA 3IRVA 4LMPA 2JKYA 1V95A 2VYVD 3BXXA 4EPXA 3CRRA 1ZONA 3JRNA 1I2DA 3FUTA 3PVZA 3RRJA 5KHLB 2DPGA 1ISRA 3L6EA 5ECYA 1RQ7A 1TJ5A 1RD4A 2VUUA 5G3YA 3H0CA 1ZOPA 5B2FA 3LP8A 5BW6B 2WIJA 5IJ9B 5J5VA 3HABA 2REBA 1OHHA 2GCIA 3MQ2A 4QYTA 4Q4JB 2WF6A 5JT1A 1APBA 2NOAA 1DIHA 1FC0A 4RTMA 1TZKA 1XF9A 2WMOB 5JS6A 5ETJA 4C76A 5HIIA 2IA5A 3WG9A 3MGAA 3CSUA 3B1JA 4P3KA 1HOTA 3CUWA 4JR2A 1LW6E 2A0WA 4G0XA 3DR5A 1OX4A 3TSZA 2GO1A 1FDVA 3LUHA 3GROA 4YR7A 2IOFA 2G9VA 1X7GA 1RM3A 3C3JA 1R4AA 3PEFA 4ZV4A 2ZT8A 4TVKA 4ESVA 2E55A 5JQGF 1PDVA 4G0UA 2NSHA 2PTHA 4GX2A 1UT5A 4S1NA 2Q5LA 4FNMA 1QORA 5IK2A 3AUTA 2VPXA 3L1JA 5HK8A 4JP1A 1P73A 5JAQA 1L7DA 1U3CA 1F9AA 2Y68A 1MB2A 1Z83A 3IOEA 4AJ1A 1W5EA 2BMJA 4X95A 4EEZA 5SYNA 4DR7B 2HXSA 2OCLA 4IIEA 1KJJA 3OTWA 4AWAA 1N4DA 1OAOC 2GN0A 4L4RA 4XGIA 3EWIA 2CLIB 2PWAA 2AW5A 1PZMA 3HY3A 3JD0A 3MS2A 5HPYB 3K20A 4HNVA 1XV5A 2FYTA 1ZP6A 5K6TA 4BJ1A 3H87A 3ZHSA 1NXPA 1XNQB 1MB9A 4YP5A 3HMQA 2CBGA 3WGJA 2IZ7A 3H2YA 4IYJA 4OY3A 4GKKB 2IYFA 4I99A 5KYKA 4LHSA 1WB4A 4C4XA 1Y3AA 4MYDA 2JCGA 2HHLA 1IRIA 3RRNA 1YONA 1TB4A 4X91A 2WUEA 3SZLA 2ORED 2D8MA 1KR2A 3VH4A 1G20B 1UWKA 3WICA 4JP2A 4ZT7A 3NWPA 3OOSA 2I2XB 4ZTZB 2X76A 2QJWA 1N5RA 3V9AA 3COSA 5K3AA 4HHEA 2COKA 1NSYA 5ARDA 2WOOA 4UUMA 5KTOA 4B7XA 2AWOA 2FLWA 1RC1A 2HMAA 3KZVA 3FHJA 3OZ7A 4FC7A 5ANRB 4O1IA 2VN8A 1JDZA 3ESBA 3UV7A 3W05A 3W5BA 3MMZA 3FPKA 5DVZA 1Y5LA 4CFZA 4EA6A 5F2OA 5F33A 5D00A 1XPRA 1GUAA 1P31A 1AT1A 4CDNA 3FTPA 1NX9A 4P82A 2WAYA 4R1NA 4EL0A 3LZCA 4H3VA 2AG6A 3S7TA 3B9PA 2XTAA 1U81A 4CKWA 3PB3A 1QF7A 5CIYA 1G6KA 2C2YA 4F6RA 1V96A 1NASA 1KS9A 1GFSA 1P7PA 2V6MA 4YWHA 2X0FA 3RRYA 5C5DA 5HR5A 4IIFA 2QN1A 3K9NA 2YS6A 4REQB 5HRAA 2NVUA 5DISB 4B4OA 5GJCA 4C08A 4EK9A 1NBAA 4P08A 4UU0A 3A06A 4NXMB 1XBTA 4FR2A 4LBZA 1J99A 2OGTA 1M1YB 1E6KA 3EW9A 3I0MA 5DBIA 2Y0BA 3OO1A 1F8XA 3R20A 4KDCA 4A6DA 1Z8HA 1WCXA 2ZJ8A 4QUDA 1BKDR 5B6IA 3DEAA 2NU9A 4JCCA 4RPLA 3X1JA 1FJGB 2NUAB 5JTUA 2UKDA 2WJAA 4OBXA 4BEVA 5HVNA 2GKOA 1LJLA 3FPAA 4KH1A 2FWAA 2GCGA 2FMKA 1LDNA 2VHJA 3CLUD 4IXWA 3NBUA 3KEOA 5CPFA 2H2AA 3LUDA 3OZVA 4Q9LA 3MD9A 5K3FB 5BN5A 1EBFA 4UNPA 2GZAA 4LI3X 3ESQA 4LBYA 4RQBA 3EEOA 2EJWA 3EN0A 1J24A 4IW3B 1UINA 4R01A 5AKJA 1QE3A 1ZLXA 1Y33E 4L22A 3EQ7A 3C70A 4UHEA 4H1HA 4B2LA 2ZBEA 3WC4A 1C9DB 3TD6A 4HFNA 3O8RA 2BMAA 3L7IA 2YJTD 1VG0B 2LNDA 4KACA 2VP0A 1E3LA 4M38A 4OQPA 3UWDA 2XUHA 3ENNA 3GUUA 4R1QA 2A5GA 2QAGC 1TVEA 2QY9A 3F1LA 1JAXA 3GJ3A 4J9VA 4KN5A 2UXBB 5DLYA 4TYWA 1FZQA 2W6ID 3CG0A 3I5XA 3IT3A 3OJLA 3FXAA 4RXMA 1I6LA 4XIFA 4HGYA 1NVDA 3JVDA 2CN1A 2QD2A 3FZNA 3E1GA 3KTAB 2RSLA 4RANA 4W6QA 4ZP1A 4B3BA 3E2MA 4EQZA 4CEIA 3HEBA 5KVQA 2I6SA 1C1DA 2QX7A 5ERYA 3AKDA 1JI0A 4DMMA 5JECA 2IHKA 1DC4A 2EFCB 3LLCA 4BNJA 5C46F 1VCHA 4H0FA 5LDHA 4QATA 4QGBA 3DOUA 5IMBA 4C05A 4XWTA 5H3CA 4A0GA 1WCYA 2Q1TA 2YJ5A 2CLFB 1ESNA 4KPUB 5FRDA 3R6TA 1PZNA 1G5FA 4OHVA 3EEYA 4P6VF 3RLIA 1Z5GA 1YJ5A 4IH1A 4AKSA 4XIGS 4Q7KA 3C4JA 2G82A 2PGOA 2YMMA 2PD4A 3MJDA 3TL2A 1TU0A 1LVGA 3GJ4A 3H11A 4LDZA 4RDXA 3EXFA 1JG2A 2WT9A 4ME6A 3UTCA 5LU9A 5IG2A 5LVAA 1PSWA 2P0YA 4S1PA 1OWOA 1U3UA 4UHKA 1TI7A 5BQPA 3T12A 2K6GA 1DKUA 3B38A 2HDHA 2ISCA 1XA3A 4HWTA 4UE3S 4K05A 3SK0A 3TDMA 2X9VA 4DNPA 3AEQA 4FW8A 1DAOA 2V8OA 4JWTA 5THKA 1SXJE 3DLHA 5BVGB 3G2KA 3QVKA 1R9JA 4J0KA 4X7RA 4EY6A 5J2UA 4LY0A 4YBZA 3QX8A 2Y76A 4NLLA 4J94A 4M53A 4NYMQ 4MUHA 4IHJF 5J5CA 3WYAA 4GZMA 1UJNA 1Y0BA 2V6JA 2LIPA 5BSGA 2QRKA 4F06A 4QKQA 1I24A 1G7TA 4XM0A 4YP9A 3BXPA 2GBLA 4X63A 1TW2A 4UZSA 2BGJA 3FMIA 3TKAA 2YN4A 4BJ5A 5DK4A 3VR5H 1W34A 2MSNA 5CUQA 1M7HA 3QEJA 2R84A 1E98A 4DC1A 2LKDA 1O94D 1WHTB 2C9ZA 4DV0B 4YT8A 4OA5A 2A0YA 1CR2A 1FUKA 4J3FA 3WLPA 1R6DA 3MYRA 4NV1A 5CA1A 2VHZA 3FHOA 2NZJA 1FUYB 2DQ4A 1TQ8A 3DDHA 4B83A 5BUSA 2P3QA 2AD5A 1M6NA 1YKSA 4GI7A 4BPRA 2IYWA 2IPMA 2W71A 5JJIA 1GD1O 1IOLA 2H5JA 4JNKA 3GQBA 3LGSA 4UNNA 3COPA 1KEVA 4K6OA 4RGBA 2CXHA 4TL6A 4W5TA 4OLHA 2IWRA 4ZCPA 1NJFA 2H0RA 3OETA 3ZHTA 2I2WA 4IDPA 2PE5A 3L4SO 1BXRB 1J2EA 1T36B 3EASA 4WXPA 4LGMA 5IVDA 2Z9CA 4ZV7A 1WTCA 1EPUA 3FHCB 3Q7SA 4K46A 4LZWA 2O0HA 5E0KB 4ZVRA 2F4VB 1CUVA 3I1IA 1JJFA 5LA6F 3AIMA 4AKHA 3I9FA 3BBPA 1TM4E 4E2XA 4EMBA 2J8ZA 4UHDA 4TGLA 3KKKA 5BSRA 1MJNA 3KJXA 3CVYA 3QEAZ 1VXOA 2V3VA 1B0ZA 2TS1A 1KHHA 5EHQA 2CVQA 1N6HA 3I42A 2CUKA 2NXEA 3L7DA 4WXMA 2DUMA 1XCJA 2HSEA 3AP2A 4ISBA 2XNCA 3S2FA 1USGA 2DJ5A 1DQRA 1J9ZA 1ICEA 2ZK7A 2EL7A 3FCYA 5BN1A 2VTBB 4M55A 5AM0A 1Y81A 2QXTA 5JCOA 3DBVO 3WLJA 4LJ9A 2FJ0A 5DK6A 4JI4B 3V5NA 1V71A 1K6MA 3NBMA 4J4TA 1GO2A 3EPRA 4GXQA 3N7AA 3TK1A 1DBSA 2NW6A 3A2MA 4TXHA 1FFGA 4YASA 1U80A 3VR4H 3GDWA 2J7KA 5CNJA 3WGGA 1G9TA 2JGRA 4C3ZA 3GGOA 4UTPA 5JDCA 4RNCA 3L8MA 3HO1A 1QUEA 3I9JA 3PQEA 4QL3A 1ODFA 5HOEA 2R6HA 2F4NA 3ZU4A 5MFPA 3QYJA 4YAOA 5I5EA 1OLXB 1KRWA 4FSHA 3EK2A 3FTFA 5GQSA 1FX1A 2I7DA 4PYLA 1PK9A 2L19A 1UMDA 2WQZA 2YWHA 1LPBB 3BM5A 3JATA 4ZU1X 1J33A 1R0WA 1TO6A 2XCIA 4P35A 2FI1A 2KS6A 1D1TA 1SU8A 4KFSA 2QG6A 4I1SA 1K5DA 4PG4A 3K2BA 5H4GA 2WU0A 1PYDA 4FZVA 3VNRA 5H9WA 4F71A 2CBZA 3AJRA 1KYVA 2FEMA 1WXHA 4REMA 4F93B 4LC0A 3S27A 1FTWA 2IBTA 4ARZB 1SFRA 4GC5A 2IC5A 5AO9A 2A35A 3UT0A 4GNKA 2O2JA 4OHBA 1ESMA 4LXGA 4CQNA 3KSAC 3K5WA 1BEEA 1VRWA 1ZUHA 1EJBA 1AUOA 4UE6A 3WJAA 3U39A 1UZMA 3RC9A 1IOZA 1CE8A 3ECAA 4BE4A 3MJ4A 2PLNA 4DLZA 3HGQA 1KJZA 5LMZA 3AVXA 1C1HA 1PL6A 4KX5A 5EEGA 1IFXA 5HDQA 3W9SA 3N8NA 4AVYA 1M0EA 4LXYA 3OJXA 4XVRA 4Z99A 5EZSA 5J63A 1NBOA 1F0KA 1NNSA 4TV8B 1UMCB 3BGIA 5AI0A 1GGEA 2JD2A 3NP7A 2EDCA 4K9MA 5ALQA 2QKYA 1ZWLA 2QX8A 4ILKA 5G40A 4JI2B 2G9QA 4CM7A 5IDQA 4PZLA 4N47A 5E95A 3AIIA 4OHMA 3T7TA 1HNXB 5ESDA 3H05A 4F3TA 2DGDA 1EEHA 1FK8A 1MGPA 4MW9A 1P5ZB 3A0RB 3O74A 3UENA 1NE2A 1DWUA 2FPGB 3B5JA 1I4TD 1MX9A 3EPPA 3TQCA 4Q1EA 1YNOA 2PTGA 2ZSJA 4ZAFA 2IYZA 4D9KA 4WBNA 3IA7A 5KUTA 1K5HA 2IOFK 3D81A 2DFDA 3FD8A 1VSTA 3DLCA 3EQ9A 1G5HA 5FOUA 4H6WA 2W2OA 1NV8A 2XKAA 2ZVDA 1VLZA 1F2VA 3U3XA 3K8QA 5B1IA 2WHXA 2XODA 2EKZA 3KQMA 3GAZA 4LJSA 1DX9A 4ZOLA 1QR2A 3WSWA 4ENVA 2UYQA 1GGNA 2EFJA 4YPFA 4ERXA 5JZOA 4Z54A 1T13A 3MJSA 2ES4A 3LS2A 1H6AA 4CG3A 3DP7A 1DVRA 1HQDA 1MQ8B 1DG1G 2PZJA 3WO0A 2LDXA 2PRJA 1NBMA 2AMYA 1OAAA 2UDPA 4W8HA 4QAJA 3UIEA 1UKAA 1SGWA 1XAJA 4FI3C 4GIBA 1A5AB 3ZN2A 3TUZC 4ZCSA 2WRZA 3IPXA 4FMDF 3KHSA 4MUBA 1XTKA 1JBEA 1VE6A 4TS9A 1UDAA 3KRTA 1TVMA 3EGIA 2EEPA 2R1ZA 4AJNA 4GP7A 3MN1A 1Y3FE 1JHPA 3NUQA 1IVNA 4IOKA 4DMCA 3MVEA 1QZUA 4GPIB 2M1XA 2NUPA 3M81A 3ZCXA 1M5RA 3IQEA 4EYSA 1HI9A 2WSSA 1X7WA 3N7TA 1EVLA 4QXOA 2AEEA 1WMDA 2G4VA 2Q9BA 3NIWA 3O3OB 4MI1A 3MOSA 2XB8A 1QANA 1DOZA 4JD5A 1ETUA 4YDSA 5JS1A 2QRVA 2B1QA 1EXNA 4CM4B 2JBHA 2I6XA 2PKYX 4WXHA 3SQNA 4FGZA 3U48A 1MKYA 4DM7A 5BNWA 3T0FA 3I64A 3BA6A 4I50B 3UG7A 5L3SB 5AH0A 3UUFA 3PPIA 4F97A 4EB8A 1EUZA 2NP6A 1I7LA 1BEUB 5CXQA 4MR8B 5FTMA 3A3YA 3ADPA 1T29A 1DUVG 2QGNA 3DLPX 1E9EA 5EESA 2BRUC 2YMQA 4PPQA 1QO0A 1ZD2P 2H1LA 4GC9A 3KU4A 5EKDA 4RK0A 2ZJ7A 1EWTA 1Z8DA 3ROKA 1EP3B 5K51A 2CLDX 2UUOA 1PFKA 3JALA 2PJZA 3MYYA 3QVGB 5L3ZA 2XKJE 2X4DA 5LBUA 4C7KA 1OVMA 1NULA 1Q3KA 3SBOA 1H93A 4I5DA 2XQKA 4MW5A 2JLSA 1E1KA 5BN3A 3B1ZA 1CRPA 5EZYA 4V03A 5ICMA 2Y4NA 4PG5A 4ZYWA 2NO6A 2W8BA 3TGLA 2C84A 2I1LA 3ZLVA 5IFKA 1O6ZA 3WNVA 2VSFA 1XDBA 1JZSA 3ADKA 4HWOA 1KQ3A 1P0FA 3GG2A 3RVLA 3UBMA 4GMKA 4KG7A 8LDHA 3BBLA 3P0JA 2A9OA 1TDJA 1NLFA 3AU8A 3CY6A 4HL6A 4JZKA 4MP8A 3CVUA 2CFTA 5BSTA 3U3JA 5CVJA 4PLPA 5IPFA 1XRJA 4FYJA 3WWPA 2JLZA 1CRZA 2W0SA 5BQFA 1SVSA 2HHCA 1WVIA 8OHMA 2ZRQA 1KJWA 4LZPA 2DAPA 1RWBA 2IYPA 2NGRA 4N5NA 3U49A 4ANFA 3IXQA 3SLGA 3AU9A 4C87A 4EHAA 2FR1A 3Q3IA 4PWZA 4WZAB 1N6OA 2FUCA 1ZFNA 1GPDG 1Q1EA 2HYDA 2OBXA 3MWYW 4HGZA 1NVAA 1E5VA 2BTOA 4IDBA 4QDUA 4RYLA 3HSKA 5TQ2A 2ZRPA 1T2AA 5KNDH 1IJBA 1YOVA 1N1GA 4YCLA 3ZHOA 2W98A 3UMRA 3NC1C 1PDWA 2B8WA 3FMGA 4JXKA 4OG2A 1S4MA 3FDZA 4LHEA 3V1TC 4NJEA 4ECAA 1K3UB 4MRRA 2WV7A 3GZJA 4UU7A 4XXHA 5DBFA 2D06A 1JHAA 3VNQA 5LMNB 2OV6A 3ZJTA 4GDFA 4NU0A 3SICE 3ZZTA 1EP9A 1ZN8A 1N75A 4R1UA 4TWZA 1FXSA 4DSAA 4F4JA 1H8HA 3MSCA 4PYQA 2AYZA 2BGGA 1E3DA 4X3OA 4B3CA 3K9FC 3UB4A 3KXIA 1XXHE 1VCMA 2B34A 4MW1A 2YWFA 4FR5A 2WVAA 4CMCA 2OEPA 4IKPA 4L6CA 1UBGA 4CCYA 4CMJA 4CZ2A 3SSOA 2DEUA 1TQHA 3G49A 1P5RA 1ADJA 4RGQA 1QO9A 3RSLA 1VE5A 2PEYA 4JJ6A 1JXMA 3NATA 5BMVF 2REXB 3PRJA 1KAHA 4NZOA 4O2AA 4QU8A 1RPTA 1F38A 4DXAA 1THTA 4O02B 3AF2A 4PC2A 2R68A 4YHBA 4TX1A 2QZ9A 3DZJA 3OWXA 2W4QA 3OLXA 2IF2A 4P53A 1SBNE 5DT9A 1UDXA 3AETA 2NO0A 3Q8KA 1K98A 1Z18A 5EJGA 2QAGA 3GJZA 5IYZB 1V5GA 4KAJA 5LPNA 3ADBA 1KYIA 2F9LA 2V7BA 1WE2A 3JVIA 4Q39A 5ALXA 3X1XA 5ELXA 4GAEA 3EAFA 2XD9A 4D9NA 4INOA 2D1QA 3RYHB 2Q4DA 2QN2A 1QRUA 1FLDA 1MX5A 2O3JA 1SC1A 2QLLA 4UOZA 3TTYA 2R87A 4YP1A 3K1AA 5DTJA 3PJRA 2ONKA 3H0EA 4D6YA 1ONBA 3AGPA 3FH0A 1WDLA 1T2EA 4B7ZA 4PM4A 5JY6A 4LQLA 2ODTX 1U9ZA 1ZICA 2QTRA 3SSAA 1NRJB 3KP1A 1IUOA 2PR7A 5ULLA 1C4KA 1GT6A 1C80A 1R6VA 1W5SA 1MX3A 1S96A 2Y1XA 3N59A 3OM9A 4PXAA 3RJ5A 2A1TS 2IHZA 1TQ2A 1KO1A 2X8LA 4J0QA 3K8ZA 5I9BA 4IV0A 1KDPA 2HA2A 4DXHA 721PA 1HMPA 5J2UF 4Q34A 2AE2A 4FOSA 3LDFA 4B6PA 4DMUB 1XJQA 4LWPA 4B4DA 3IEMA 4D3XA 1ZDMA 1YIAA 4LJ7A 2CDNA 3HYRA 1HG0A 4LMBA 4WCFA 2QW1A 3VTKA 4DB2A 1UJ5A 3IP5A 3TQFA 1CCWA 3TG8A 1V8DA 1JEJA 4RZ2A 2NMVA 2B4YA 4LXXA 3H9CA 4QLOA 4PO8A 3RAGA 5K8VA 2A9RA 1ELOA 2ZWMA 5KHOC 3ZIUA 4DIEA 1N6KA 2R6ZA 2VJPA 4MVXA 1BMTA 1I0ZA 4OXQA 1XN1A 4IRXA 5BQ5A 3R3YA 1X6VA 2Q62A 1D6NA 3BXEA 3EGXB 4WPGA 3DSRA 3DBLB 4NFHA 1RWKA 4Y67A 4XAQA 2BP7A 4XQ9A 1J0EA 4I9HA 3IEIA 1RYEA 3LA6A 5AVYA 3DZDA 1KYQA 1XPUA 2EQAA 4HFMA 2IV3A 3INGA 1XTPA 2QRPA 1UK7A 4KJXA 4J43A 3T5CA 3FSGA 5KMGB 3FCOA 3U9LA 4EPWA 4N3GA 1RAAA 4X71A 1QHSA 3C3YA 2RK6A 2HIHA 2VK4A 3LUFA 3PEVA 3RVOA 3JQAD 3EVNA 5KYYA 1U3VA 2FW1A 1R16A 1I4LD 2H06A 1W5BA 2WAMA 2WJPA 3EUAA 1T5IA 1KF0A 2HKIA 1TIKA 5CCDA 4C0SA 3BMXA 4BX2A 3DVAA 3UHFA 2BBTA 4Q00A 1E60A 1PHPA 3B3AA 4R05A 4INJA 3DEKA 5BSWA 2WM2A 4WVLA 1O9BA 1KI4A 1QKIA 1P1KA 2VDKB 3ET5A 3GARA 1EHYA 3KZMA 3RODA 3C45A 5KU1A 1YHYA 2GJ4A 2QORA 3I76A 5A2QA 1MZPA 1MOSA 1XUOA 3VR4A 3G8BA 1P1BA 2X1LA 1K92A 3D2BA 3PSHA 2WZBA 1D1SA 3O9VA 3QMWA 4M49A 2CSUA 1G2QA 4DJ5X 2C8VA 3MJEA 1H2ZA 3WIDA 1BQ4A 4O1MA 1QVRA 1O96A 3FVRA 3C3DA 4ZYLA 2L42A 1RLOA 5KTMA 2FMTA 4NU6A 3VR6H 1SUWA 3AGQA 1MAWA 1RLIA 1T10A 1UFVA 4G5SA 5EJAA 3ZZMA 9GPBA 5DM0A 4Y8VA 2BD0A 1Z8NA 4MW2A 5EXPA 3T5TA 4WKCA 4ZYYA 2ZUSA 2PX5A 2DWQA 2ZPAA 2BFFA 3AVVA 2RH4A 4R9SA 3DV2A 3ESCA 4K9LA 3S8MA 2QR3A 4DLKA 5THXA 3ENZA 1G0OA 1NP6A 3OZGA 4AECA 2ET6A 3QPCA 2O8FB 4U0JA 2L82A 5KYUB 3PF8A 1A76A 4DCGA 1BMQA 1R64A 3OHMA 1XCPA 4CMIB 4QM7A 3F73A 3L92A 3X2FA 1XC7A 3A32A 1DTEA 3RAEC 4LVUA 2AX4A 4LVCA 1Z73A 3H2BA 3GK3A 4EL5A 4HAYA 4UD6A 4XDYA 1FP6A 2IBMA 4AO7A 2VF8A 5HFJA 4MWBA 5LLSA 1K5PA 2R85A 1W5TA 2AFRA 2RGGA 3J81k 3IUNA 3I72A 1JHUA 1QQ6A 2HNBA 2OBFA 3A11A 4U2BA 3ZG6A 5AESA 3KQQA 5I8PA 4R2XA 1SHJA 4HDOB 2OHOA 3EBLA 4KL8S 5FR1A 3SXPA 2C0CA 1T8YA 2ECKA 3M6FA 2IEZA 3VI3B 3W2GA 3WKCA 1KDTA 4H7HA 5JVDA 1YI0A 4KRYA 1VPDA 1DZIA 3AR3A 2VPWA 4U02A 5C3MA 2P8SA 2IODA 4UARA 1B14A 1YCFA 4X8MA 1JEEA 4TLDA 2HPHA 4XIIA 3RG8A 4X66B 1AGRA 4IH9A 2H4JA