1VLZA

Uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title Uncoupled phosphorylation and activation in bacterial chemotaxis. The 2.1-A structure of a threonine to isoleucine mutant at position 87 of CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal transduction protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vlzA00
3FDFA 1JBEA 1JLKA 1E6LA 4G0QA 4RSMA 2M1ZA 3RVJA 3N53A 2O20A 3DBIA 3Q41A 3O1JC 1TMYA 3I5AA 4G0MA 4RK5A 4W5QA 2L2QA 3O2SB 1YMVA 1OXBB 1ZGZA 3N0RA 1Z18A 4RXMA 3TD9A 2LBPA 3TO5A 4RWEA 4DQDA 3T38A 4ZYLA 1QO0A 3C97A 2VUHB 1I3CA 3Q7SA 1NATA 3HVRA 4HNRA 1DCFA 5T3YA 3DLHA 3BRSA 2E4XA 3CFYA 1JH9A 1M5TA 3HO1A 4Z4IA 5JS1A 4XXHA 2V0NA 1D4ZA 2XDYA 5TQ2B 2WY2D 3O1IC 3KYJB 3HUUA 4G97A 2WWVD 1Z13A 1U2QA 1NTRA 2R25B 2GBPA 3O1HB 5D2CA 2JK1A 4N0PA 1CHNA 1EWVA 1BDHA 3IP5A 4YS6A 2R47A 4O1IA 1NXVA 4HNSA 5JNRA 2JB9A 2E4VA 5C5EA 2RDMA 4MR7A 1MAVA 5FWXA 2LP4Y 5IUNC 4H3KB 3CHYA 3CLKA 3R0JA 3VNAA 4YV7A 4GPAA 2L18A 1KMIY 1YVUA 3QELB 3H5OA 1P8AA 4LE2A 4O5AA 4QYWA 1VKRA 3SNKA 2W42A 4OLBA 2HPHA 5FWYA 4GNRA 5KQPA 2HQRA 4MQFB 4DADA 2A9RA 2MSWA 3TMYA 3GYBA 2PLNA 4MYRA 4PYRA 4RY0A 3DLBA 4UHJA 3LOPA 3QX8A 1DJMA 3C3WA 2E4UA 3QX9A 3HXMA 4IMJB 3LUHA 3OM0A 1M2EA 1YK1A 1GUDA 3EODA 1DP4A 2I6FA 3IP9A 1D1QA 3KS9A 1CEYA 1NXOA 1M5UA 1KGSA 3RVQA 3D8UA 4KREA 5BRJA 5IBQA 2R48A 1TM2A 3H5TA 3MIZA 4RY8A 4PZ0A 3RQIA 4W5TA 2HSGA 3CNBA 2QVCA 4MQEA 4F3TA 2YHAA 1AB5A 4ZMSA 1TVMA 5F64A 2X7XA 1QQAA 4KK3A 3CZCA 4RS3A 4D74A 2PUGA 3QLUA 3E3MA 2A9QA 2ZWMA 2Q5CA 1ZHHA 3UK0A 3LUJA 2A9OA 3N75A 1P6UA 3FMVA 3EDCA 3LFTA 4TMYA 2J48A 2MYPA 3HV2A 1D1PA 4FE4A 4QYMA 1NXPA 2FN8A 3O2JA 5TPZA 5BQ3A 4Z4EA 1YTUA 1LJLA 1SD5A 1ISSA 1Z25A 1XHFA 2P9HA 4ML3A 3F6PA 3GV0A 2VK2A 3H1FA 2JRLA 4RKQA 5EWMB 5IC5A 2JBAA 5IEBA 3IPCA 3VNBA 2QR3A 4Y9TA 4B09A 5B3JA 2QV0A 4EGSA 4FE7A 5T7BA 2F8TA 3LUKA 4OTZA 1WETA 1JF8A 1C4WA 1C0EA 1PUXA 2PUCA 2FEWB 1FQWA 3KJXA 1DBWA 3EAFA 3MF4A 4OATA 4Z9BA 1ZVVA 3KKEA 4KNYA 2RJOA 3G85A 3SG0A 2GKGA 4MAAA 1RPJA 4KFCA 2FEPA 5EWJA 1JL3A 5IUJC 4WWHA 3HDVA 3JVDA 2PKXA 3BBLA 5TQ0A 5KI6A 1H9CA 2PJUA 3LUFA 2B4AA 4MRMB 1APBA 3KHTA 3GBVA 1J56A 3HZHA 3H5IA 1Z2EA 5FBHA 4G0OA 2IOYA 1QMPA 1GLGA 4S05A 1LJUA 3C6QA 1W25A 2LPMA 3LKBA 1E6KA 3MM4A 2GWRA 3H6GA 4O1HA 3H5WA 2GI4A 2MYUA 1P6QA 5JNVA 4KV7A 4MR8A 3BRQA 3OLXA 1VPWA 2NT3A 4LDAA 1DRKA 1DCKA 3JY6A 1ZH4A 2PMCA 2KYRA 2ZAYA 4JA2A 1P2FA 1U8TA 4PE5B 4S04A 5JS2A 3HM9A 2PE5A 1FSPA 1DG9A 3Q7TA 5DLEA 1LBHA 2GX6A 3CU5A 6CHYA 2PL9A 2YHBA 3HEBA 5DTEA 4P1ZA 4W5RA 1PNRA 4HNQA 2FVYA 2IYNA 4LE0A 2CWDA 3LUCA 3JPYA 1M2FA 3KLNA 3Q9SA 1JYEA 1SRRA 5TQJA 1MB0A 2FQWA 3M9XA 1QP0A 5DGCA 4MS3A 3NNSA 4EYOA 4EYQA 3H1GA 2NZUG 2LIVA 3I09A 3UKJA 4L85A 2DRIA 5FWYB 4G0PA 1ZDMA 3SM9A 4ETNA 2FMKA 5JNUA 4MR9A 2JCGA 2P4UA 3QLUC 3TX6A 4N76A 4NCAA 3CTPA 3Q7RA 4EUKA 1YMUA 2M98A 3H5LA 2FMIA 1FFGA 1K68A 3Q15C 1GCGA 4F11A 4JASB 1ZH2A 4TN5A 2BGGA 1EWTA 5TPWB 3A0UA 5EWLA 3E61A 3RVRA 3NNNA 4YWHA 4G0ZA 3OLYA 2JVJA 1A0OA 2IDMA 4KQCA 4MQEB 1RXEA 5IULC 3ILHA 3QLVA 5B3JC 1QQBA 4F12A 4TLLB 1MB3A 4XLTA 5KC9A 1LBIA 4Z0NA 4RK6A 3NHMA 1JDPA 4Q6WA 3T6KA 2JVIA 2FXIA 4JP1A 3KSMA 1S8NA 2QXYA 3JS5A 4MPTA 4NV3A 4WXEA 1MIHA 5TQ2A 3DGFC 4Z99A 3URMA 2IPMA 4JB0A 1W9HA 4WUTA 1ZN2A 1ZAYA 5HSGA 3DZDA 3RVPA 4RU1A 4D6XA 3H6HA 4TLMB 3FFWA 3EJWA 4Z9AA 1PEAA 4EVQA 1JWLA 4N41A 1QP7A 1SXGA 2JBAB 4W5OA 3A10A 5BR1A 4LX8A 1NY5A 4RKRA 1A2OA 3GT7A 4YGXB 3ILYA 3SAJA 4RXTA 2WB4A 5ED4A 3MYYA 5KWSA 1Z15A 4JOQA 6ABPA 2FQYA 4KK4A 1F4VA 3O21A 3QELA 1U0SY 4YP9A 3MA0A 4RY9A 3N0XA 2NT4A 5I4CA 1K66A 4MQFA 4JAVC 2MSLA 4Z4CA 2FMFA 3QEKA 5EWJB 2NZVG 4N03A 4YCSA 2NUBA 5JNSA 5JNTA 3BILA 3OLVA 3M9WA 1FFWA 5KC8A 2IPAB 2ID7A 2E4WA 4E7PA 4RV5A 4MS1B 1ABFA 4W5NA 1F51E 1JFSA 1RZRD 2F8SA 5CNIA 5BRAA 1BAPA 4OLAA 3KG2A 3QEMA 3CS3A 2E4ZA 1DC7A 1PEYA 1E6MA 2WMYA 3NBMA 3HSYA 4MR8B 5HKOA 4KRFA 2IPNA 3FGZA 3SQNA 3HK2A 4P98A 4KVFA 5C5CA 3IP7A 1L5YA 2TMYA 4PICA 4L4UA 4YLEA 1TJYA 5IUKC 3H1EA 3OQOA 1BDJA 4EVSA 3RVNA 3N8IA 3CRNA 2QZJA 1DRJA 4WT7A 3P9YA 1B00A 4OG2A 1DCMA 2PAFA 3T95A 1RZRA 5KQLA 1PNTA 4RK7A 5IEJA 1HEYA 2FEKA 4QICA 1EFAA 1EHCA 1U04A 3JPWA 2R4QA 1AB6A 4QPJC 1QNLA 2RJNA 1USKA 4N47A 4MGEA 4RZSA 2E4YA 2CHEA 3RVKA 1NXSA 4EY3A 4Z4FA 1QKKA 3I42A 2FLKA 3KCNA 4N0QA 3QLVC 4MR9B 3JVIA 1Z26A 5GOTA 2WJWA 3O74A 2L17A 1JDNA 2HQOA 3OM1A 3RVLA 1BVHA 4Z4GA 1KRXA 4MR7B 5JNWA 4MS4A 5FWXB 3K9CA 4ETIA 1VRVA 1MVOA 1D5WA 4RK0A 1ZESA 5EWLB 1L5ZA 2RGYA 2LUOA 3H75A 3I45A 4H3HB 4MRMA 4IF4A 4RK4A 2QU7A 2FMHA 3A3KA 3N6VA 4Z4HA 1SXHA 1YS7A 2FLWA 1DBPA 3ROFA 4H60A 4IMIB 3LMKA 3TB6A 1XWWA 3QLTA 4WZZA 1JFTA 1CYEA 9ABPA 1JHZA 2FTKE 3C3MA 2WRZA 4D6YA 1GUBA 1DBQA 4OBBA 5FBKA 3GBPA 4WXMA 1NXTA 4CBVA 1A04A 2HJ9A 2PUEA 3EQZA 4UHKA 1BA2A 1Z17A 2N9UA 3SY8A 4Q6BA 3B2NA 4IILA 1EWKA 4RXUA 4YR7A 2VYCA 4EYKA 1IIBA 1URPA 1T34A 2CHFA 2WJAA 3IDOA 3JTEA 4LRQA 1XHEA 3A0RB 4RDCA 1JYFA 3H5VA 4LE1A 4ZMRA 3OLWA 5IX8A 3UUGA 4ZJPA 1ZGGA 3K4HA 1QPZA 4IGAA 4KMRA 3N0WA 4Q7EA 2FW0A 3KYIB 5CHYA 3S99A 2FKAA 3LKVA 3QK7A 1KRWA 1UDRA 3FFTA 3RVSA 3F73A 3F6CA 3FFXA 3EULA 1DZ3A 4F06A 5HM6A 3GWGA 2AYXA 3F7NA 3GRCA 1QP4A 3OQNA 4XARA 1ZITA 1U2PA 3MQ4A 3GA5A 3CG4A 3G1WA 4NICA 2QVGA 3HCWA 4EVRA 4XAQA 5DKFA 2HQBA 1Y1LA 2FN9A 4XFKA 4KZKA 1FFSA 2L19A 3KTOA 4DN6A 5TPZD 4YRZA 1JFVA 2CD7A 2JVKA 3QEMB 1ISRA 2PUDA 5CNKA 1OXKB 5TPWA 2H0AA 1PHRA 4NQRA 5TE9A 3OO0A 3NNDA 3L6UA 5TQ0B 3CG0A 5GQSA 1ABEA 3L49A 2A9PA 3RVOA 3LUDA 1NXWA 1Z12A 2QSJA 1BDIA 2PUAA 1GCAA 2AYZA 1VLZA 2IPLA 3EQ2A 4XASA 1NXXA 1DC8A 3C3KA 3CKMA 4JB2A 5KQMA 4HYEA 4G0YA 4ETMA 4F8JA 1USGA 3RH0A 3LTEA 5CNMA 3D02A 1USIA 4PEVA 3DGEC 3OO1A 3LUGA 4MLCA 2PL1A 3OMWA 2FQXA 2PUBA 1SXIA 1Z2DA 3LUAA 4M88A 5ABPA 2B1JA 5DCLA 4G0XA 2MSKA 2QW1A 3O75A 4E7OA 1YIOA 3T8YA 1RNLA 3OQMA 3KLOA 4NCBA 4EYGA 3ROTA 5KQGA 4MLDA 3BREA 4MS4B 2ID9A 2OQRA 1D2AA 1LK0A 1TLFA 3NHZA 4KQ9A 4MS3B 4RK1A 4FB4A 1EAYA 1R8JA 3MMNA 2OENG 3HS3A 2MYNA 4ZPJA 2H3HA 3OMXA 5PNTA 2FSPA 1E2BA 8ABPA 7ABPA 5EWMA 1Z16A 2MYTA 3HDGA 3O2QB 3OLZA 1QO0D 3HJFA 2IKSA 1YS6A 1YK0A 5E3JA 4IRXA 2VUIB 3W9SA 4KPYA 4LZLA 4MS1A 3GL9A 3EGCA 3HUTA 5CNJA 4YO7A 3M6MD 5HQJA 1JX6A 2PUFA 1ZY2A 3IPAA 3RVMA 1RXIA 4LDZA 3IP6A 4G86A 3CZ5A
chains in the Genus database with same CATH superfamily
1HE2A 2AXQA 1Q2UA 4DHEA 3CZ4A 3KYCB 1ZWKA 3FNQA 3FWNA 3IKMB 3MBOA 3U3XA 2BFFB 3OU7A 3PHGA 2PGDA 4R98A 3DBIA 1Y3IA 2ZR0A 1QCCA 3DO5A 1E0KA 2CJXA 2PIAA 2D3TA 4N7RA 1QS0B 1A5BB 1T9BA 1YMVA 3CZPA 3TKLA 4KAXA 1GQFA 3NHJA 4N3NA 2Y1KA 1F2UA 3L7LA 4MXDA 5EIXA 3OURA 1Z4OA 2ZB8A 1Y3FE 1K0FA 3LL7A 3TKAA 3PXBA 4YHHB 4UMVA 1W1IA 2FZWA 4K9KA 1F3OA 2R6JA 4Q19A 5LLSA 4AG5A 3CFYA 5AJYA 5HBRA 4CIYA 5I9NA 1A9RA 4NCJA 3SZUA 3OE7D 4X1IA 3SJBA 5B4VA 5LP6B 3K9HA 4R71A 3HCAA 4MV9A 2BMVA 4MARA 3RE1A 2EW1A 1I51A 3IVCA 4KRXA 4NJMA 5ERGB 1EFUA 3C2QA 3FTEA 4UVHA 1CHNA 2CBXA 4P9NA 1JIKA 4OXIA 4MINA 1DQYA 1KS2A 1T10A 3Q85A 2H17A 4N9QA 2Q3FA 1NXVA 2JJ1A 3LGXA 3L7CA 3AM4A 5I8WA 2JB9A 5M5BA 5SYAA 5A9SB 5BQFA 2RBGA 3VOAA 5AHKA 1Q92A 3ET4A 3LECA 4GPAA 1KMIY 1YVUA 3B7WA 3LV8A 1PK9A 2X2FA 5LDDC 4GNRA 2HGZA 4BQNA 2HQRA 1YZ3A 2ZSKA 2HHHB 4A2PA 1U6JA 1XCGB 1D7OA 1PK8A 3OKCA 2RAVA 1GKYA 4BKOA 5A3JA 4ZI7A 3KQSA 3OJOA 1V5GA 3QITA 4ALIA 1DTSA 3PDIB 1JJBA 2DLDA 3B36A 2XOEA 3AB7A 4FZ3A 1C30A 1U4SA 3UV7A 1WVMA 1W4RA 1PCXA 1PBTA 4XD7D 3VX3A 5L7YA 1F0YA 5JT1A 1POWA 5HIJA 2ECFA 2HY7A 1C1XB 2ZWIA 1UZAA 3D8UA 3OI7A 4IOJA 4JWTA 4HNVA 2XSZA 4X64B 2I3DA 1TM2A 2G0TA 2YWHA 2ZREA 3KSDO 3MIZA 3PFGA 4ZI3A 4PCUA 3ZHXA 4X00A 1NV8A 3CUSA 4A2WA 3G5MA 5CAEA 1C7EA 1U1DA 3CNBA 4RTQA 1KMCA 4DXAA 2K4MA 3E3AA 2VRNA 3VHRA 3SVTA 5H16A 2WHPA 3D6UA 2YJTD 4P4LA 4I55A 2JLYA 2CF5A 3C41J 3MEQA 4TMKA 2WJ3A 1CY6A 1LS1A 4YR9A 3PITA 2GO7A 3HYCA 3RVBA 3UK0A 1Q0ZA 3WJAA 1ILEA 3SFTA 2A9OA 3MK31 5M2QA 5A0VA 2ZWVA 4KW7A 2BW0A 1EH5A 2JG3A 1AXEA 1GFIA 2PKWA 4FOTA 1C3JA 3CV3A 4IDNA 3PTLA 1SD5A 1JN0A 4LJLA 2R79A 4WCFB 4ZEWA 2A86A 5ALFA 3INNA 3ZZMA 4IKPA 4PS0A 4YAJA 5IC5A 2JBAA 1G3MA 3S8YA 1TFUA 2VDWA 3BF7A 1G7TA 2QV0A 2D74A 2V0CA 4X1OA 1PTKA 2IYFA 1KWKA 3DTVA 5ALUA 1P80A 2QTZA 1RQGA 4M8NE 3EY4A 4F97A 1EK1A 3ETHA 3M0EA 3OPYA 5IF3A 4C0BA 4DNFA 5JZBA 4EPRA 3CGWA 4DY4A 5CXSA 5EFOA 3BBLA 1D8AA 3UWPA 5CXXA 2VP3A 1MGOA 4FZVA 1EGHA 1B26A 4NYJR 3D0KA 4CCAA 1CQXA 1H5UA 3HZHA 3NPAA 4O5OA 5FPKA 1PAUA 3HM2A 3JV7A 4MKXA 4QFMA 3W8DA 4EKEA 3GLKA 2QXTA 1EGVB 4MLPA 3PR2B 1G1AA 1DI0A 1DX4A 3PDJA 9GPBA 4HGNA 2OAQ1 4MQ5A 3L1KA 1NZDA 4CV0A 1GXSA 4RV9A 3OLXA 4BIIA 4BMOB 1GTRA 1GD1O 1BMFA 3MC1A 2P90A 3JQFC 4NENB 2JD0A 1FUIA 2QLFA 5K8VA 3Q7QA 5CB4B 3W8RA 3BN3A 4IX9A 3ZHTA 4B34A 5IW8A 1QRAA 5J4YA 4XFDA 3WLPA 2GX6A 5G0VA 3CR8A 3EFEA 2IZ1A 1NHWA 3R9XA 4YT5A 3MAJA 1PNRA 3KOYA 1QIJA 3I62A 4HSEA 4OJTA 3SEZA 3AUSA 4R9NA 1AZSC 2DCMA 2V6MA 3VKGA 1QGOA 5CPFA 3TNLA 1RLMA 4UDOA 4Z9FA 4M60A 5EI5A 1MB0A 2Q1WA 1BEUB 1V39A 2VJNA 2A1TS 2IJGX 2PS1A 3HCDA 4FU0A 3SXUB 1C14A 1Y7LA 1N25A 2IUEA 5E95A 1C9KA 2CLCX 1GKKA 4MRSA 1G2OA 5LBUA 3VR6D 2C8KA 3K2IA 1MQSA 1NBAA 1M33A 4HS4A 2BH9A 2FUKA 2GZ3A 2ZYTX 4J4HA 5ALYA 3RBXA 2HLNA 1V45E 2TYSB 4J0IA 5CPBA 1NN1A 1OCEA 1FLDA 1OQAA 2FMKA 5BVHB 4DIEA 2W6ID 2X8LA 2K2WA 1WXDA 3FVRA 4P54A 3A4TA 1OOEA 4DABA 2IYLD 1H1DA 4LW8A 3AI7A 2NXWA 3V8QA 1KZ4A 3WRYC 1N2EA 1WCIB 1L3IA 2VJKA 3DDHA 3L0IB 3Q15C 4BLRA 1NRIA 2C7BA 2EGGA 4KWIA 1DEKA 1I2CA 3JQFA 3RAGA 1II9A 1OXVA 5DCUA 1LUAA 4RD2A 2QP3A 1GG8A 2FPXA 5T67A 3VH1A 2GF0A 1BHQ1 3CPHA 3LT1A 1RQNA 3LCMA 1PDOA 4CM3A 1ZNWA 1B6GA 1WDKA 1KY5A 1XF1A 3CGGA 4XUDA 4WDQA 3T5MA 5HRUA 3UB3A 3ABQB 3NHMA 1T36B 3NYIA 1HXHA 3NBKA 3LYLA 1TJNA 1EM8A 3DOJA 3BMOB 1MIHA 1DEOA 1DVRA 1PL0A 1HSOA 1KH1A 2WF5A 4AJOA 3DEIA 3CWZA 2GYWA 4D1YA 4EJ0A 5HSGA 2Z4TA 3OEEA 3W5BA 3E1KA 3Q3GE 1U9IC 3H6HA 4TLMB 4RZXA 4UW9A 1L1RA 1X9HA 4J2TA 3QFHA 4L9RA 3R7SA 5I9LA 1SJ9A 1T9DA 2J9FA 5A5EA 3UHJA 3VH2A 2OQ2A 5BWNA 4IRUB 1UOQA 1HE1C 2BF7A 4N7JA 3ILYA 3UJ7A 3ZX5A 1RLUA 4AX8A 4BYMA 1G38A 1YU6A 4WLEA 3LPLA 2ZM6B 3WRYA 1V8ZA 4JOQA 4G84A 1V7CA 4HUTA 3GJ4A 2H2IA 3R3ZA 2KLHA 3MA0A 4QXPA 2FCRA 1CTQA 5I4CA 3F7TA 1MRSA 4ZU6X 2C98A 3IUNA 1GDHA 2FMFA 5IC6A 2CUKA 2J9ZB 5K3DA 4DDWA 3PVCA 5B53A 3OPNA 5IH3A 1NX6A 1IJEA 1W1UA 5BSHA 2E4WA 3QIAA 4OMUA 5FBWB 3EVCA 5EMKA 4CN9A 1QYDA 2VK1A 3DMDA 3AP3A 4I2NA 4II3A 3II6X 2D54A 4OLAA 4OKSA 4HX5A 4IFTA 3HJNA 3QLJA 1QHHA 4FFOA 4EP1A 3K5PA 4EFKA 2NUTB 3S2EA 5D3KA 1U9JA 5ADHA 2VHXA 2FWMX 1ZCAA 2C5AA 3LQQA 3OJ0A 5JSKA 4EKDA 4G24A 1YAHA 2I4TA 1EDZA 1TJ5A 2QQEA 3BD7A 3I9FA 3ASYA 1N6HA 3U7RA 1U9IA 3NTLA 1Z9BA 3COPA 4JY7A 4BGUA 3AKZA 4A4DA 4KE7A 2NP7A 3OZFA 4ZT6A 4GFDA 1V1RB 1ZH8A 2P3OA 3QSGA 4OXYA 4K8OA 2P65A 1TADA 2TRSB 2JH9A 3G5AA 4Q5IA 4WT7A 1SOWA 1B00A 4HQOA 5BYBA 1GYQA 3D8BA 4GZMA 2ILTA 1IWBB 3P5BA 5BXQC 2ATIA 1CHDA 3O9ZA 4CEHA 2EV9A 4N54A 3KJGA 3INGA 1FP1D 2QX4A 5HMMA 5DYIA 5L53A 1EFAA 2H7XA 3NB0A 2DWOA 4I50B 5J23A 1DHTA 1LRJA 1QNLA 1Y8AA 4N47A 3EPRA 4JLAA 3EDRA 3E3OA 3FOEC 4HEHA 2PVPA 3T9FA 1TZ2A 1T5TA 3KT3A 1CY4A 1AQJA 4KO3S 4Z4FA 4E2WA 3INTA 4N0QA 1ULSA 4DMCA 3BOSA 3PC4A 4PRYA 1LNZA 2XVYA 2GASA 1E63A 2L17A 3K30A 1OZAA 2WWGA 3C6YA 3HCBA 3A1SA 3OM1A 4QT0A 3SS7X 3UAOA 4UOEA 2CZCA 5BV2P 4PIMA 2O8CB 1OGIA 1P5RA 3I72A 5CDTA 1GFWA 3GN2A 3L8HA 3BXGA 3UH0A 4ZO7A 4OK6A 2ENUA 3WQRA 2X5NA 3V1UA 4EFNA 2A92A 2C2BA 4F4JA 1CIVA 2Q8NA 2DB3A 4J0FA 5YASA 2ZPUA 4Z4HA 821PA 4HR7A 4AWXA 4H08A 1RWPA 1SBQA 1IEXA 4QVIA 2FAXA 3WMWA 5TXGA 4B80A 3W5AA 3QVMA 2DR2A 3DNPA 5AESA 1FRNA 3DE6X 3PGA1 3WGYA 3AR2A 2VJMB 5FQOA 1HDEA 1KU0A 2AG6A 2X76A 1W581 3QVGB 3M82A 3JQAA 3DKIA 5CVUA 2PUEA 1IXKA 4A5OA 1GITA 3M2PA 1DC4A 3AVVA 4XRRA 3S1AB 1V11A 2C3MA 4Q4LA 4HYTA 4EHDA 2O2EA 2JJQA 5KTTA 1VGVA 2GFHA 3HWRA 1BMTA 3MJFA 4J3JA 3GP8A 1CQZA 3O2NA 1VSQA 3F8SA 1T34A 3EGWA 3UC5A 1XTUA 4EJSB 3JQGB 1V6CA 4GMFA 3O4VA 1XCMA 2Q7XA 3CF4G 4PPYA 3G8DA 3WYGA 2KQUA 2BFDB 4L7QA 3AVYA 1RRVA 2G5CA 1T5DX 3F6SA 4HZUA 2GXSA 2BMEA 2A35A 3K4HA 4WNYA 4KMRA 4RF5A 2YL2A 1GG9A 2CFSA 3LSTA 1WZNA 3T1NA 1KL7A 3V4PB 5JR3A 5ALPA 4QXAA 1IXSB 3FFXA 3MWFA 1KY2A 3EULA 2QKYA 2O05A 5EVJA 5IZCC 3LE8A 1NJ1A 1D5CA 2OB2A 2VK4A 1QP4A 3SBOA 1EI9A 1W0CA 2X9GA 1TX4B 3CUWA 4IYJA 4XAQA 3GD7A 2CMFA 2YJ4A 3F47A 3MLEA 1PD1A 4DSOA 3N8HA 4K6MA 1LSOA 4BB5A 1JAIA 2GETA 1D03A 4H16A 2NUPB 1SVOA 1UJMA 5DNWA 5TPWA 5KMGB 1XYGA 2O48X 3EGVA 4PGAA 4PQRA 4DANA 4R2MA 2CNDA 2OMEA 1Z4JA 1BKSB 1K63A 1ZNQO 3AL3A 3FPHA 3AF0A 4L3VA 4XQ9A 5EIAA 3T1OA 1I7LA 3T5BA 3QVVA 1O6CA 2X86A 2V59A 3QVJA 2DCUA 3FZGA 1LV8A 4HDMB 4LWZA 5COQA 1KFBB 4L4ZA 4JL5A 1A8UA 3HYLA 3Q3IA 1F6DA 4ENWA 4O2AF 1L5LA 5B1HA 2G83A 3QUSA 4GOOD 5ECGC 2Z57A 4G4IA 5K9ZA 4O3MA 3GFFA 2O2XA 3OQ1A 1XEWY 4DY6A 3C3KA 5KVVA 2X0IA 1BTOA 1HDIA 3B3JA 4ETMA 3H0CA 3FJYA 2C5BA 3A1FA 3DEJA 3RH0A 2CNLA 3CNNA 1C7ZA 4V0LA 2HSWA 4PEVA 2J3DA 1K92A 1FTSA 2UVPB 1K6MA 1BXGB 4KQ6A 2KE5A 2BLNA 1NQXA 2OCGA 4CIWA 3FZEA 1YNOA 3D5EA 1ZKMA 4LZZA 5IZCA 3N58A 5KYVA 1KVUA 3PEFA 1O9BA 4PTLA 2WJVA 3ZJ5A 4P4SA 3PCTA 1K1EA 1UDBA 2HCFA 2R65A 4KVGA 1ESCA 1D2RA 3P2OA 2JD1A 1IZYA 2QAGC 4FYPA 3S6JA 1FBNA 4N8DA 5CDSA 2WDPA 4X45A 3FYCA 3TKYA 1QOQB 5LCXA 4MLDA 1JG1A 2GSWA 3Q98A 4BNFA 1FLNA 1GO2A 1PJBA 1SR8A 1Z2OX 2MSDB 2YZNA 2O3SA 1HE3A 2LTAA 2P62A 3H18A 4JT2A 5H3HA 1GGMA 2PWAA 3ZI4A 4ZPJA 4XWWA 3I6QA 4IX1A 3PPVA 3ZBQA 3EBPA 3M4ZA 5C37A 2EWVA 1JT9A 3ML1A 3VV2A 4HAYA 3HJFA 2PO5A 2YHSA 1YS6A 2BFNA 1MJGA 5D6OA 2YUTA 3SC4A 1TA9A 4RPCA 3EFBA 3E7PA 4N1AA 3P71T 1JA9A 5FOSA 1NF9A 1PJRA 4EPYA 1AY0A 5DI9A 5GPBA 4PNHA 1KJNA 1GSOA 2R8EA 5CMLA 1CDOA 2AG5A 3NUZA 2QR2A 4BP1A 4CMBA 1ULBA 2ZM5A 4A0SA 2X40A 1DAEA 3NWBA 3PPYA 4TV9B 4TQGA 3V33A 1ISPA 5A2QA 3PA8A 2AFRA 4IVQA 3F0TA 4BZXA 3LT5A 4MULA 5HNKA 5IVIA 4D9BA 4PZPA 3NIDB 4Q93A 3HYNA 3MINA 2YZGA 3TOSA 4JC5A 3RG2A 1MC1A 3B60A 3V8RA 2WZCA 2PU7A 3D1LA 2CLOB 3TX2A 3E1GA 1N78A 2CGEA 3B9RA 2ZYHA 1M6NA 5A0FA 3EEBA 1N5IA 3OT1A 4F2HA 3OJWA 1CF2O 4WLVA 3DYBA 3CKYA 2PZFA 1YDEA 2WYVA 2Z2IA 3PPWA 3N7AA 1G8GA 3HP7A 1VI5A 3P9RA 2VDUE 4NNJA 4FR2A 2IXDA 4U02A 4X54A 1SBHA 4LYGA 4PYNA 3WIEA 3WBJA 4HAXA 5B7GA 3VPHA 4ZHQA 1PJ3A 2DQYA 4BAGA 5J2UF 2A5LA 4YJDA 1BFDA 1C7FA 3M6AA 1KJWA 3KU4A 4YAEA 1KEZA 2X8JA 5EERA 3K9LA 5CLJA 4LCEA 5F5XA 5KQRA 3OC6A 3IP5A 3PI6A 1HYBA 1TI7A 2DPGA 1TPYA 4NNOA 3VKVA 1X6VA 1IG3A 3NFYA 3QHPA 4O1IA 1K5GA 3NHBA 4R2HA 2H85A 1NKVA 5IUNC 4UM5A 4ESHA 4H3KB 1E5VA 4JYBA 5AHWA 4A2QA 5T6BA 2Z0MA 5FI0B 4AMVA 4MVJP 5JZOA 5KYWB 3BTVA 1E62A 3G7SA 1P8AA 1ORIA 5A4KA 1S8FA 1PZXA 3SX2A 4HDSB 1SC6A 1VJDA 1YZLA 2JS7A 3DCIA 1G3RA 1WCWA 3OFNA 4RY0A 3TIGA 3LQKA 5K3AA 3SEAA 5AVOA 1QQ7A 4BKQA 3ZV5A 3KUXA 4DWJA 4W9RA 2F3TA 1TYZA 4RA6A 1A77A 3ENVA 2WFZA 4YREA 3IOCA 3AFHA 2P35A 4X6YA 3KS9A 1N5LA 4GNKA 1JXOA 4NFHA 3P2MA 3IBTA 1Z4IA 2IV3A 4LZOA 3O8NA 4C7OA 2IHNA 5FF9A 3WKCA 4UBNA 2O9JA 4UUBA 2J0SA 4K0KB 1W8DA 1TM5E 3WHLA 3F8TA 3Q5DA 2BI4A 3OLCX 2YHAA 2BFBB 3WGNA 1XZJA 5EP2A 4B8WA 1DIHA 4MV0A 4MUAA 2FI1A 2P4HX 2BF4A 3DE5X 4P5DA 4BRUA 4BX8A 3T5DA 1J2TA 2PUWA 4MCIA 4MPPA 5AKEA 1P81A 1VLQA 3DLCA 2G40A 3LX5A 3PL5A 4NABA 2FSHA 3FMVA 4G3XA 2GAIA 2DWQA 4HVAA 4MQLA 1MABB 4PFJA 2VQFB 4FM9A 2JJ2D 5AFSA 3HV2A 1RU3A 2ZR8A 5AW8A 2RK3A 3UY4A 3VNQA 3HP1A 4B73A 2WABA 2FN8A 1XUOA 5HQTA 3IE1A 5J4LA 1EXWA 4RD1A 3D3QA 1EFVA 2ZIAA 4YCAA 4AO7A 3MGGA 3RUIA 2QG4A 1WMEA 2OHIA 3H9QA 4J3FA 4EUFA 4X3OA 1ULAA 4IZOA 4PVDA 1Q11A 3UMGA 2XITA 2BUCA 5T7BA 4RH1A 1AKQA 2ZQYA 3FY4A 4U9IS 1NE7A 5IZ4A 1Z5VA 4EK9A 1JF8A 3AY7A 3L0BA 3AK4A 3RIEA 4I6EA 1RHQA 1TJPB 1M54A 4P0PB 2IYRA 3FCYA 2XCIA 3V4OA 1H42A 2HMWA 2W8BA 2PAAA 3L4EA 4D3FA 4KB5A 4YJ3F 5L3QB 1PZHA 3QWAA 2ONCA 4B6PA 3I4LA 4ZAVA 1SGWA 2HZ7A 2UYOA 3KHTA 1J97A 4Y6RA 1F0NA 4GVLA 5EZ5A 1NKSA 2OHJA 1ZK1A 1IM2A 4EZBA 3HJTA 2D8AA 4RD0A 1IDOA 4D46A 5B12A 1LJUA 2VSOA 2QL9A 4D6PA 1U2TA 2Z1NA 3AF5A 3KWFA 1ZC3A 3GVHA 3A2KA 2YV1A 4KX3A 4O1HA 1IWPB 3PIIA 1RJGA 3MWLA 3V1KA 4DYDA 1RYMA 4JN6B 3WKBA 3K70D 3NUQA 2VK8A 1X0VA 3LWDA 3IUEA 4KV7A 1EXVA 3IAS1 2CMHA 1XTJA 4CDRA 4XWYA 1DWQA 3DWEX 3FYHA 5F3RA 1G21B 2A0XA 1RKVA 5EZYB 4B87A 5B6PA 5JS2A 2K5UA 2PE5A 3W2GA 5F98A 3N5KA 3F71A 1ZU4A 5DW3A 3CU5A 4F72A 5BWOA 4DB2A 3A1NA 2R8ZA 1IU9A 2IH4A 2QN7A 3BMNA 4HNQA 4BMNA 4F3YA 1W4BA 5K5EA 2W2PA 1KH2A 4M9CA 3H19A 4MYUA 5E3HA 4B31A 1Q0PA 4ZVMA 1CQPA 3QF4A 3N59A 3G6KA 1A76A 1TC2A 1K7XB 4MW0A 4LPKA 4OFXA 5JYCA 3VKWA 2F8MA 4LXIA 2JBHA 3AP1A 4D41A 1QFSA 2DHEA 2Y99A 1E9EA 1QRDA 1WB4A 2GLTA 3AETB 4MMXB 4UCQA 3JWGA 4WQMA 1YR9A 4KN8A 1A95A 1EX6A 1P7YA 1JTFA 3GFOA 1OVMA 1VCMA 1YR1A 2YXBA 1RWWA 4ARUA 5HIAA 4D5GA 2QQFA 2VYVA 1THZA 4GQAA 1P75A 4CL0A 2I4IA 4FCCA 1WLSA 2XA2A 3A6PC 1EQAA 1Y48E 4H31A 4OQDA 4LHYA 2QLJA 1YDWA 3SLRA 4B75A 3TZLA 4U8HA 3CNLA 1T3HA 4LOKA 5KNCH 1Y6FA 1F4LA 5EWLA 3UOGA 2XH8A 3RVRA 4DC0A 1NJ6A 3WA7A 3WBKA 1G1MA 5T64A 2OZKA 2IDMA 5F2EA 2NTNA 2V9ZA 3QPBA 4ZARA 2CE7A 2NTYC 2Q4DA 1A7KA 5JO9A 4Q48A 1Q3KA 5KTYA 3P9XA 4V1CA 2QI9F 1PX0A 1T35A 2PR7A 4PCLA 1IZ9A 1GRCA 1JR4A 2VHVA 4LVOA 1G64A 2HTEA 1CFZA 3A1VA 4Z0NA 1HT3A 1JDPA 2ZFUA 1RC8A 3O8BA 2X3UA 2A3NA 4U2FA 2V6IA 1U9YA 3VHXB 5IC4A 1KDTA 4CI0B 1Z6YA 1DKMA 3DVRX 5C8DA 1GPKA 3TTVA 4L3WA 1D4FA 5FLEX 3SHFA 2WJJA 3TFOA 1CY8A 3U4HA 3VI4B 1NUHA 1TE2A 3K71B 1JHMA 3UB4A 3LW8A 1FYDA 3FYTA 3QH4A 1PEAA 1QUEA 1V5FA 3MTQA 3P9QA 1SVNA 4JT4A 1NLZA 3A9VA 5AIAA 1Z75A 1Q0TA 2ZE7A 4L5YA 2HJRA 1L7VC 4WZAA 4UTPA 4QO7A 3BHMA 1ZW6A 3OF2A 2REXB 2CK3A 2D2FA 2QX9A 3ZE0B 4JYZA 3U17A 4KV9A 1F4VA 4YP9A 5THKA 2VTBB 1B0PA 3P0IA 2WFMA 4DGQA 3ER8A 2O6LA 4L27A 4GBED 1TLLA 3AERA 4Q9NA 3KQLA 3IP3A 4HATA 1SXJC 2XQKA 2Q4RA 1U7HA 1XLVA 3F3YA 3EG9A 3EVZA 3PFKA 3H8JA 4FI3C 3E9YA 4KU4A 1OX4B 1BVYF 1MAUA 1TEXA 2QUKA 4G56A 4MS1B 3L8FA 4X7BA 2XRZA 2CN1A 1DKLA 1P9NA 1U3FA 2RSLA 4HHEA 5B55A 2IBTA 2R0QC 5IT9A 2H2FA 1VLJA 4JUAA 1YB6A 3RFUA 8ADHA 1GFZA 2QMUA 5I51A 3O84A 1V4BA 1MQ8B 4GE0A 13PKA 3VV3A 1PFQA 1PN3A 2WM9B 4UM9D 1BQEA 1KFEB 1L5YA 1L5VA 3C6XA 3H6KA 4M55A 3IJPA 2RKBA 5JD3A 4DMLA 4DT1B 4YQYA 1UP4A 4O4JF 2PD4A 3NWJA 4P3PA 3EIQA 10MHA 2AWOA 4B74A 3AEYA 4Q01A 1OXMA 3KKKA 2AHOA 3L06A 3VC1A 1KYWA 4B32A 2P78A 3EZFA 2ZQZA 3UFXB 1Y37A 3T99A 4ITVA 1XZIA 3SIPA 3EX7C 2RHDA 3B89A 3IAS6 4NONA 3MCUA 3DULA 5IFLA 2R7LA 2IELA 2QDKA 4DHWA 5EKDA 2O8FA 1Q19A 1CUUA 4PHHA 4Z7JA 2AKAB 2PQ6A 5IEJA 3B8HA 3VR3D 3NGMA 2IODA 2PLWA 4V0NA 1EHCA 2Q6VA 1BD4A 1DT5A 3JPWA 4GKVA 3SIXA 4CIBA 1YVRA 3I5XA 4K40A 4TRNA 4EA7A 4XIFA 3PXEA 1SXJA 4PBSA 2E4YA 4MWEA 2VHJA 5EHIA 3IC5A 4PXAA 4RSHA 4N5IX 3UK6A 3QLVC 5BN3B 1Z07A 4RHXA 5J1TB 5KB3A 2GD0A 5HJ2A 1JG7A 1VL5A 5J2TF 2QTNA 3OZTA 1NFRA 1KRXA 4DEVA 2A9KA 3ZDRA 1QBGA 1WWKA 2JGLA 3LP8A 3TPFA 3FYUB 4OXKA 3WMGA 4ARBA 2Q0QA 2IDKA 5DULA 1VRVA 1IY1A 4FQ8A 4Z3DA 1T8YA 3GDWA 3IUSA 4II7A 1I8TA 1ZRNA 2OBBA 3DZFA 3LYAA 4XZ3A 5BSKA 1C80A 1G17A 3JALB 4KI0A 2GN0A 2EGHA 2X1MA 3I01M 4LRTB 1UM9A 2A58A 4BCCA 4UPDA 1G98A 4DQLA 4GKBA 2B4RO 2XQFA 2AC2A 4R69A 3KJNA 1F3LA 4P7KA 3LMKA 3ERCA 1IFXA 4ZV7A 3EXEB 3KZ1E 3T41A 2RH5A 4FDAA 1L8LA 3KOWA 4ZHQB 1YZKA 3RAJA 1KYIA 3FNGA 4BIMA 2DQKA 2DEUA 1U31A 1Y9EA 4AZ0A 4IF6A 3DKPA 3V55A 2AFHB 4UTOA 1SHJA 4YTEA 2OCLA 2E48A 5A4JA 1A04A 4PNPA 2C31A 3UAXA 3FNEA 4LC9A 5F7OA 3AI1A 5KYXA 3BKWA 2Y05A 1QDEA 4OYRA 3CY6A 1IULA 3KCQA 1KK2A 3AF2A 4L8GA 3GDFA 3HN2A 1CRQA 3L7JA 4Q6BA 5EQDA 1KU6A 4B4OA 1Q7CA 2Q9AA 3DOFA 4LHZA 4WY5A 1EFKA 1U2GC 1E5TA 4WX2B 4D9MA 1Z38A 3IDSA 1QHYA 3QYAA 1H2EA 4RF2A 3K92A 2O4CA 4L16A 1ZIXA 3P0RA 2XBMA 4MB2A 1LBTA 2QTCA 5TARA 4DUGA 4YT4A 1RP7A 4BVKA 1JFLA 3FAZA 3KR0A 4BNIA 4W9MC 1A1VA 2SCUB 1FNSA 3HB1A 3V4VB 1J70A 4AFNA 4P3YA 4C07A 2Y76A 2IEZA 4BFYA 3WL8A 2IOFA 5CFOA 1YBVA 3H7IA 4NNPA 3BFPA 4LZPA 1CFJA 4GLOA 2XUKA 1KZHA 1T25A 4QHTA 5DT2A 2UUBB 3C8MA 4OMCA 4ZAZA 4Y9SA 2EJWA 3GRCA 3JX9A 4FYJA 3TI7A 1EU1A 1L5MA 1RPNA 1T2CA 3IDAA 1CUXA 3NC1C 4ND4A 4Q0MA 3V48A 4AS3A 1BCRA 3AHHA 3TLGB 4C21A 3ROQA 1S7GA 3G5LA 5E1MA 4CW7A 3ZCRA 5KSWB 3A1WA 2ZBGA 3K0FB 4B2YA 2VYNA 2WQ7A 3KPJA 1Q7TA 3DE3X 16PKA 1SCDA 1L8OA 1U28A 2ROQA 3QEMB 2GJKA 3QVOA 3FDIA 4N0MA 3WHKA 1JHXA 4BV2A 5HP4A 1YRBA 2R6FA 4Y18A 3RRJA 4BAUA 4E22A 1GPAA 1OKKD 3N6XA 2MHCA 2JGDA 4YBRA 5IBRA 5DTRA 4M89A 3AIKA 3PNSA 2B7LA 3I9V1 3OO0A 1EP1B 3CG0A 4M1TA 3RYHA 3L7YA 2AZDA 4N9WA 3RABA 1L5GB 4O25A 3I4CA 1E8MA 1ZINA 1FVXA 1B93A 1Z12A 2WF6A 3AXTA 3L7MA 4FTWA 4LXXA 1M1NA 4JKOA 2FR1A 4HFRA 5HUJA 1CRZA 1XTPA 4HB0A 1A9TA 4JB2A 1TT5A 4OGLA 1U3UA 2EHDA 4P0TA 1C29B 3W3AA 1LRKA 3Q72A 4X20A 1EB8A 1OLSA 4PPFA 3OEHA 3WGHA 1L4MA 2VT6A 1MOPA 1ZIPA 4KTTE 4BS9A 1Y8CA 4HLCA 3K9GA 4NULA 4TX1A 5CCBA 1DIRA 3X1KA 2TECE 1E2JA 4N12A 1UJ2A 3V2IA 4CLRB 2PUBA 4BOYA 4M9QA 3LUAA 2ASVA 3I0ZA 2J59A 1IHPA 1BU8A 1Y1SA 1Y7TA 2P4SA 3B7GA 3HZZA 4L50A 4EHJA 5H70A 3QI7A 3WB9A 3KUCA 2QW1A 4TUYA 4MDYA 4TZ6A 4JI3B 1Q3TA 1W49A 2ZJOA 3D8NA 3QE4A 5D00A 1U0TA 2VF2A 2GJSA 4YRRA 4TKUB 1CS0B 2XPCA 3EIHA 3BREA 3PZRA 3SOZA 4LY0A 3PEUA 2C97A 3OWHA 4IQ4A 4YRQA 1E0AA 1RJWA 2OENG 1Z0DA 4FR5A 4CMIA 2IQIA 3OMXA 4YJ2F 3WWEA 2RH8A 7ABPA 1M6EX 1JW9B 1PLJA 2C7OA 1PR3A 4RTJA 1CJKC 4UHCA 3AR4A 3JU3A 2PRZA 3D3WB 1JQ5A 3BHNA 2F3UA 3PP8A 3O38A 3I1IA 4KQKA 3ITEA 3NBZC 1QGYA 1M1YA 2B8JA 2JCSA 1UXGA 3EF1A 5ICMA 3MHTA 3H9GA 1E3MA 2Z1DA 5BOSB 2FG7C 3DHYA 1YNSA 2AN3A 2QRUA 3A2LA 4NZ9A 3DEZA 4PZCA 4DM3A 3DT9A 2IHZA 1KNQA 4YDSA 1NQTA 5EPUA 2DT5A 4GBJA 4BTEA 4DDTA 4ZK6A 5BR7A 2GVDC 1UPUA 3EZ9A 1KMHA 4RSMA 3ZYCA 3VNVA 1B2RA 1VKNA 3HFJA 3O1JC 5BVGA 5LFAA 4G0MA 4BGEA 3TRJA 1Z37A 4KIGA 5JJLA 1FFDA 1V25A 1Y7PA 1GFSA 2O4UX 4AQ7A 1UXOA 2X13A 5F12A 4G07A 4CMHA 1E2IA 4RZUA 2N46A 3CUYA 5KX5A 2JKYA 5DWQA 2VIIA 3RNLA 4DYVA 5HCIA 3RS9A 3D2LA 3ESCA 1SQ5A 3EGOA 1P9OA 2O8EB 4WXRA 4J29A 1IVYA 2HJHA 1G20B 2XYRA 3I9OA 2B5VA 4Y9DA 2P6OA 3ZQKA 1PLKA 2XI4A 5E2IA 1R4MB 2GN8A 3DHEA 5TR9A 4MPDA 1MC8A 1T9GS 1UUFA 1MVLA 2ZBVA 1QUFA 2JLRA 4F4DA 3UATA 3TRKA 1M7GA 5A6VA 4OH1A 1RACA 2O1WA 2PT9A 2H52A 3HQ4O 3LT0A 5F5NA 2X0NA 3W8FA 4C05A 4J7XA 1R6BX 4B6EA 3FPLA 3K72B 2JIQA 5AOCA 3DPIA 4EG7A 2QPOA 2I71A 2WTEA 1R5BA 3OX2A 3VSDA 1YASA 4CMKA 1KZGB 4MO2A 5JD6A 4E5KA 5JNRA 3BDAA 1I7DA 4PBRA 1FTYA 4A9AA 5C1BA 2PWZA 3UWKA 4CF7A 3ZC3A 4DNOA 1NNEA 2J0UA 1K8XB 3R7FA 1E18A 2B3DA 3CSDA 4W63A 1O2DA 5EIOA 1XAGA 2IE8A 1KOFA 3THSA 1EJ0A 3I2KA 4E09A 4B3HA 3G2PA 4D45A 4EMSA 4MYRA 3BIFA 3DLBA 3E9CA 5EY5B 2H1RA 3H2IA 1V3TA 1E4EA 2FPUA 2HDWA 3L4KA 3AVPA 3NS7A 4R8SA 4DMHA 1FX0A 1L1EA 2GZ2A 1IY2A 4WV3A 4ZVKA 3IMGA 4PC6A 1U5AA 2F55A 2RGDA 4JP5A 4CCSA 4CTNA 1AUPA 1C5KA 1BGVA 5E0OA 3X2SA 4AVYA 2I55A 4MKHA 2F90A 3I9V6 3HE3A 3AW8A 3EXFA 2ZATA 3PWSA 4QARA 1C9MA 4C3ZA 3OD1A 2AT1A 3HBAA 1OB5A 1P0QA 3C7DB 4LQDA 1Z74A 2I78A 2A5GA 4BN4A 1PR2A 4FHGA 3NBUA 3ZWNA 3OQIA 1Y3BE 2H16A 4K86A 2XAAA 4MVJH 4Y7DA 4RKEA 4IHJF 1SCKA 5FTNA 1IH8A 1W29A 2FW1A 1COWA 1N0UA 3N8GA 2DTEA 2PSSA 1FK8A 2I1LA 1E96A 1K3UB 3DZKA 4IJWA 4P2GA 4DDUA 5C8YF 5K0TA 3E4CA 4XD7A 3GLQA 1NXPA 1N8KA 2ZRMA 3H3XA 5LDHA 3AG6A 3RC2A 4WZBE 3GRZA 5EJAA 2IVZA 3O2JA 3PEVA 1KSJA 2Q3HA 3PRHA 2B36A 3GD5A 1U3WA 1BD3A 4X44A 2XDAA 4OUDB 4HGRA 2P9HA 1KVTA 1JPJA 5JY1A 1D9ZA 2XQGA 4IEEA 2ZAIA 4FW8A 4D99A 1NT4A 2X0FA 2D2XA 4IUDS 4Q3KA 2YWCA 5TGDA 1O0SA 1JWAB 2UXCB 3L7DA 2IUTA 1PJQA 3IEMA 1EUCA 1TRHA 3SPXA 2V9PA 3G0BA 1O8BA 2AIRA 3ZZ0A 2CSXA 4QGHA 1S02A 2GZ1A 3A6DA 1E1MA 3KKEA 1EDBA 1TTTA 3G85A 1ZVKA 1YQEA 4B6QA 4M9XA 3TSCA 1AGPA 3TQSA 4L1KA 2PKXA 4C14A 3SEQA 5F9HA 1H9CA 2H4HA 2YIJA 3IO5A 3W2HA 2IS6A 1JLLA 3F2VA 2ZI4A 1OGYA 5ALLA 4JKYA 3GBVA 5I9TA 2QBYA 3H5IA 1JPVA 4G0OA 3FOZA 5HF8A 5E2AA 3CJQA 4IUCS 4BNVA 1K3FA 4WOJA 2GTPA 2GRJA 4JROA 3I73A 1U8FO 4ZCTA 3R8FA 1D0SA 4NY1A 1PEKE 4IGFA 1CULC 2Z5FA 3PUVA 5B1YA 2HEGA 1BJKA 1MOZA 2QVZX 2RB4A 2A1UA 2AW5A 2LWIA 1ORHA 2VZ9A 1HYEA 2E1RA 4KQIA 4XCQA 4QBIA 4TS4A 4JA2A 1FSSA 2IUSA 5EJ6A 5JSYA 1Y33E 3WYFA 5FR1A 3ONNA 2W9XA 1LW7A 4PLHA 5T4BA 3CB4A 3AT1A 3WLFA 4P1ZA 3CONA 2CLSA 2V5UA 5KNBD 5J2UB 1R4NB 2CWDA 4QIHA 2AFIA 2O7VA 4I8XA 4HXFB 3GPLA 5ESDA 2YWBA 4A8PA 4CM6A 3M9XA 5EHNA 1BC5A 1P74A 3SOPA 4G5XA 3ZE1B 1YV9A 3L8DA 4RKFA 3U4CA 4BTLA 2NZUG 5I7UA 3N7TA 3NAMA 5B3LA 2IK8A 1XMSA 3B6JA 3T12A 3ZCTA 2CCKA 1O8CA 3M6FA 5L3RA 1ZDMA 2XCOA 3KJZA 1KETA 1QH1B 2W00A 4LPSA 4NESA 4B3CA 1CT9A 2QIOA 4DM7A 4KITB 3RYCB 2WSYB 1CNEA 2V58A 2HXSA 2ZSHA 2OM6A 2ZYVX 3FE2A 3MS4A 2VP9A 3QW2A 4N76A 2H0RA 1RM0A 1T2DA 2VDOB 3U3JA 3LCVB 5K8JB 2VUSA 2QTAA 3ZH9B 5BUCA 4JLUA 3JQBC 1RZVA 3PTAA 3NP9A 4Y6OA 1NBWB 1RWKA 3TE6A 4E08A 1RPZA 3PQ7A 3S8EA 4UQLA 5ILGA 3KQNA 3TIXB 4LDRA 2Y0BA 3WYAA 4MI3A 3R7DA 1V1MB 3B1VA 3MJHA 1F1BA 1W19A 1ICEA 1YACA 5GJVC 3ZG6A 1QCDA 4CHTA 2KI5A 4D9NA 2DBZA 2F9LA 3MD0A 4MQEB 5C9ZA 4HLUA 3AR8A 2JI6A 3GNTA 4DC1A 2OD7A 1G5RA 1QQBA 4IZIA 1EZ4A 1BYUA 2W6IA 4MVJI 1U7OA 1M83A 4ZOEA 4BVFA 3QBDA 2QW8A 4Q1EA 2J3JA 1UANA 3WMXA 3IALA 4Z1OA 5JARA 3EQ7A 1CLUA 1Z0FA 6ADHA 4YROA 2BZ0A 3DP9A 2W6JD 1NBME 4AN0A 4LXYA 1IN8A 4HUJA 2R751 4BFZA 4KPEC 1ELOA 2BJVA 4ZV9A 5JY6A 5CEFA 3GGJA 1ZN2A 4BASA 3DZDA 3FSGD 3LQFA 1SG0A 1P4AA 2QY6A 3LK7A 3ZD9A 4EAAA 1YKGA 4PSAA 1IK6A 5CDHA 5ALTA 2CFTA 4W1QA 3BJMA 3FBTA 2P6NA 1K6IA 3H9BA 2XHZA 1SD1A 2O8BA 2VNKA 1RYNA 3GO4A 4LX8A 4GT1A 2RGUA 3FUCA 1U1IA 1Z5UA 4YP5A 2BHTA 5CJJA 2PXCA 1OWLA 5B1IA 1O6ZA 3DMYA 1GPDG 3JQBA 1ZUWA 3LQ4A 4J76A 1P4GA 4Y6QA 5HKAA 1TTQB 1E8DA 4NBKA 2R6CA 4Z5XA 2LZ0A 4J49A 4KXMA 4MQFA 1FLAA 2GS9A 3RHZA 2PGNA 4TZKA 5KQSA 4AZVA 4HNHA 3U16A 4YCSA 5HJ7A 3SHVA 4OL0A 1B0ZA 1SWWA 3BILA 3DZBA 4HEJA 4JCCA 2Y1GA 2V3VA 3AOEC 3GWZA 3TZBA 3W04A 1M8FA 2CXNA 4W5NA 5D51S 2ZG6A 1YIDA 1B74A 4HBGA 2D62A 3VYTB 1RZRD 2VHUA 1JGTA 3GEDA 5FFFA 5FNZA 1ESNA 5A4FS 4X93A 4JLVA 1SBTA 1ZH6A 2BAGA 4TTSA 1TYCA 4JVSB 5E38A 5ICFA 5BYAA 3DC7A 1X77A 3N2GA 1FYFA 2IDJA 1EFPB 3MS7A 1I2DA 3VH3A 1S2LA 3WICA 2HWYA 1IJBA 3F5DA 1ZP6A 3HK2A 3R6WA 5C5CA 3K0SA 1RRMA 2B4KA 3IEXA 4DQXA 4EGAA 1GTSA 1S8OA 4DUPA 3AUJB 2LGJA 1UDCA 3FOAA 3OCUA 2AD5A 2QVYX 1TUIA 1ZNYA 5C7OO 1HL3A 4EVSA 3N2ZB 4G5GA 1VGRA 3ZJYA 3TOCA 4Z0HO 3CRNA 5J9FA 1U9CA 3ICPA 1R5JA 1B3BA 1IEVA 2EP7A 2FPMA 3ILVA 3QU4A 3EH2A 2VA8A 3IMEA 4KGZA 4OLJA 2ZWPA 5D01A 1YCDA 4Y2SA 1F4PA 4DBLC 1UCFA 4QE3A 1E2NA 3M6XA 1HOTA 3DQPA 2XUPA 3IA7A 2Y27A 1P44A 4C2TA 1PNTA 4XSVA 4XX0A 1XEFA 3GLFA 4E70A 3ZWYA 4WFJA 3PQ2A 1RLJA 1SM4A 2HV9A 2ZI9A 4KLRA 1A5ZA 4MEAA 2DFKB 2FDRA 5LMCA 3K7EA 4RIHA 1M0SA 221PA 4QOIA 2JAOA 2QLNA 2AB0A 4AUEA 2ZUCA 4QDUA 4PPNA 4RGYA 2B2NA 5CX1A 2RBEA 1AXGA 3BQMB 3W77A 4R0MA 1XRPA 4K0RA 3GLGB 2X9LA 4K7JA 4W5HA 2AG1A 2YTZA 2AL7A 2PU5A 3QE0A 2H4WA 3QU2A 3RUEA 4OQEA 3E18A 5KHOC 1YQGA 1Q15A 3TZHA 2C29D 5FEUA 4QODA 5BMOA 3IPRA 3JSAA 4YRSA 3RSFA 3VI3B 2H7VA 5HR5A 4PLPA 6AT1A 4MRMA 3RFXA 3ADKA 3UMSA 2O5VA 3PG5A 2JFVA 3F4BA 3ROFA 4HT3B 3WL3A 2J9XB 3GVCA 4BGVA 4D4MA 4FT4A 2WYIA 1E3IA 1GG2A 3RTEA 1VECA 4C2UA 1B41A 4S1OA 3EVDA 3ZI0A 3HXOA 2HJWA 4R6WA 4Q3OA 4MEBA 1JEQB 1YRHA 1YFZA 4LHSA 4GXNA 1FTNA 4R2XA 4BNDB 2FOLA 2YXLA 4GMGA 4IIXA 4ENVA 1TQ2A 4Y1FA 4CDGA 3UWDA 4IJMA 4KKXB 2FFQA 2GPWA 4NJOA 5JWRA 2FE1A 4OHBA 3DYVA 5L45A 2B7BA 3SWWA 4O0MA 4KZPA 3IQGX 4EYKA 3AKYA 3UJBA 4A10A 4AAYA 4Q3CA 3T5CA 3UHFA 1XBTA 5K0BA 2CJWB 4G0UA 4E2YA 3USZA 1Y1KE 1RRPA 1YMQA 3H5VA 2Z9CA 1LW6E 3T06B 3GFPA 2CKMA 1HK7A 1NVWQ 4U3JB 4COKA 3HXPA 4B6GA 1B8PA 4LF6B 4WBXC 1ISGA 2JIBA 5KKCA 4CEIB 3M5DA 3HPQA 4NBNA 3RS4A 1MG5A 1QRTA 4HH4A 3SQXA 1UBNA 2F1JA 3AZPA 3B8EA 3JAWB 5TX7A 1L5HA 4ZEXA 3ETNA 3CG4A 4EMTA 1NAHA 3WIDA 2UZ1A 5K7SA 1LEHA 2I3BA 1RZ3A 3G0GA 4W4TA 4UNQA 1DAKA 5IBPA 3MUNA 5B1EA 3BFVA 3W34A 8OHMA 3L84A 4WY2A 1TUBB 2CD7A 1W5SA 1KKUA 1HTTA 1WCV1 3T7JA 1JZQA 1USVA 4HDRB 4F5DA 3DR5A 1KHHA 2K6GA 1BO6A 2BGKA 3GEHA 2QSUA 2I7CA 2IXGA 2XTJA 1PI3A 3L46A 2ZSUA 3ZEIA 4NDAA 1HQYE 1ZCJA 2FR8C 1WL8A 3QWHA 4XPZA 1DQPA 5TMPA 1MIOB 2PUAA 1ECJA 2RHWA 1VZ2A 3FAKA 4R1NA 2YZKA 1OYYA 5A9TA 5HCNA 4F8YA 2X9NA 1NU8A 2QTTA 3IUQA 4M87A 3WNVA 4JFRA 4YXFA 3CEJA 3EG5A 3LCJA 4ZJZA 2H65A 3BKXA 1USIA 4OGKA 4CLDA 2BKEA 4R7GA 3U7JA 1RAHA 1CUFA 3LQRA 4PQEA 3PQ3A 2ZIZA 1Y34E 2QTGA 4LC1A 2WF9A 2YYZA 5K8TA 1AK1A 1Z5OA 4J16A 4MJXA 3PNQA 2NTVA 2OL4A 2WR8A 1CDEA 1SB9A 2BZGA 5DCLA 1VSBA 3U7QB 4YA6A 3V8BA 1RXYA 2VKQA 2YJ3A 4HAIA 1UFKA 5ICEA 4G1MB 4GMKA 4QAQA 1RI1A 2YV4A 4ASUD 2DSNA 2AFVA 5FBRB 3UMRA 3UJHA 4MS4B 1U1CA 1W5TA 2G77B 4KXVA 1EAYA 4XWGA 4DLSA 1F2TA 3KZMA 1R0SA 2F43A 4L5AA 4O0LA 4BPBA 1KEWA 2O7NA 3O8OB 1TECE 4Q3BA 4U2EA 4UU7A 3AFOA 1MUUA 5JI2E 1NLYA 4W7HA 3TLZA 3WDLA 4B1FA 2FR8A 3ADDA 2Y1XA 4CJXA 1AHHA 3P27A 1WNTA 1KDPA 4OLHA 3RIHA 1EXDA 1JX6A 5MDHA 4IR7A 3HCPA 3RFFA 4D9CA 2C58A 3DTNA 2PJZA 1NJFA 3WLEA 5GGXA 2R6R1 1QF9A 3RKUA 1VBKA 4B2PA 1G8MA 2Q7DA 4WVFA 3PZBA 1JBEA 3NDJA 3C4VA 4U7TB 4G0QA 1XD9A 4MQBA 3UZUA 2ANCA 1U8ZA 3ZJVA 4G65A 2KBEA 1LDEA 1XFDA 4X6LA 4JT8A 3JVVA 1QHNA 5FTKA 3SFZA 1A9XB 2NSJA 1KEEB 2L2QA 4WTOA 2QTVB 2WIBA 1GSAA 4GX5A 5DIZA 2R5NA 3LLVA 5CT9A 5ER6A 5K09A 5CG2A 3TO5A 2O2HA 1C0LA 1W9MA 1OHHA 3D31A 3LBFA 4UZFA 3R8CA 1KZ1A 1P17A 1TT7A 3AL2A 4DIFA 1FX1A 1JWLA 3VJRA 4I99A 4MX8A 4KDEA 4Q3DA 3RHFA 4ESVA 3C7AA 2PX3A 2PWPA 4OKIA 1IPEA 2J3EA 1WXGA 3TBKA 4D96A 4AZ3A 3TQIA 4YAFA 1JIXA 5SV2A 2CDAA 1JDSA 2Q6LA 2WSMA 1VJ1A 3GJSA 4PHCA 1H66A 5FOXA 3WLIA 3ZEAA 5B3KA 2FRXA 4FFLA 1EFHA 3P7MA 3RIYA 2MIIA 1ONNA 1PZGA 2PLFA 3KL2A 5DYTA 2X1LA 2C8JA 2VPXA 2XBLA 3G8YA 4ZDWA 4AM8A 5AM5A 1QYXA 2OXEA 2O07A 1S6YA 3S55A 4QA9A 2BTQB 3RTGA 4Y2RA 5AXDA 1YQTA 4FONA 3R5JA 5FTLA 4A8TA 5A62A 2ONYA 1GTL1 2P0YA 3DR3A 5K05A 4Q05A 4J9UE 3K15A 1QG6A 3QFFA 4GI1A 3HJCA 4L15A 2WUDA 3BSFA 4H7EA 1VKRA 3SNKA 1OC2A 5MN6A 1A4XA 1KJZA 2ZZKA 1EE2A 3H0EA 2QUJA 4ERNA 2QRVA 1E5DA 1JIVA 2AN5A 2BFWA 3AH8A 3PUJA 3DDZX 1EE1A 1FSGA 4YJHA 4YRKA 1JHVA 3HXMA 3LUHA 5A05A 2Q99A 1YZVA 1YK1A 1GUDA 3EODA 4JR2A 4CL8A 2WQZA 4DV1B 3VZCA 1F5SA 1U6IA 5TDHA 1V9SA 3RC8A 5EEHA 4EFDA 1IM5A 1PDWA 1CEYA 4WN3A 4O63O 4BC0A 2YZMA 3ESXA 1DIAA 4A7PA 5EUBA 2Y1OA 4LGCA 4CM4B 3F3KA 3KOMA 4YRIA 3U5TA 1DJQA 3G7NA 3WNCA 3I05A 3WSWA 5HA5A 4XPIB 5JRDS 1Y89A 4HUQA 1NN3A 1FRFS 2HO5A 5C8XA 2OK8A 4B2LA 1T4CB 1QIKA 1C81A 1US8A 4IHQA 4BGIA 5MN4A 2JD2A 1B0UA 2ZUUA 2FOIA 4HO1X 1LBSA 3JQPA 3KEQA 1H4VB 2YWXA 4NCNA 1Z4KA 5BSWA 3Q8LA 1PR4A 2WDZA 1VCOA 2CHGA 4DCPA 4IKEA 3OZCA 2C9ZA 4GOMD 1C8VB 5HK8A 2KB0A 5HE9A 7MDHA 1QFMA 3GLRA 3GFGA 2XA9A 3VXKA 1YT5A 1A8QA 3SQDA 5EXDA 3IO3A 3TMKA 2HDOA 5KTPA 4MV4A 1KP3A 2OILA 4C43A 4DMKA 5I6DA 5JAHA 1NOKA 5AMXA 2FSVC 1E8NA 2ZSDA 2H9AA 1TD1A 5JDCC 5L6MB 4E31A 2PO7A 1J9GA 2QA5A 1PD0A 1A88A 2GPNA 5LSAA 1X8JA 4M8IA 4Y9UA 5F7XA 4OO3A 3VNBA 4PU0A 5D5PA 3C3BA 3KXLA 4OBEA 3IULA 4A8JC 1D0IA 5COAA 3IELA 3K53A 3TIIA 4BKPA 3TQHA 3OQPA 1G2QA 5ANRB 4WIAA 2H1SA 3V1NA 3FVQA 2ZR7A 4Z54A 1E99A 3MF4A 4LECA 3ZQJA 5JYBA 2MDTA 2J46A 1E3TA 3BMQA 3R5HA 1K88A 4DYHA 4LMBA 2HXYA 5EWJA 1ZD9A 2OV8A 3DONA 1EVLA 3BMXA 2WAAA 4P4UA 5GONF 2IUFA 1Y6GA 1X87A 3ORQA 5BSMA 1S1MA 2IOYA 1F17A 1GLGA 4RVNA 3PCRB 1J2EA 4QBKA 1FJ2A 2WIDA 1HFEL 2HIAA 3SN6A 4P32A 3ZW9A 2PQ2A 1VP3A 1W36B 1CQJB 3NH6A 5FUQA 3DMPA 1N9KA 4LF7B 4DSAA 5LYJB 3QPWA 2FEAA 4R2JA 3BRQA 3A3YA 2X8WA 1BN7A 4NAVA 3V4RA 4IFBA 1GZ6A 2G9NA 2XECA 1LLDA 1F48A 1F8XA 4JYCA 1LPNA 2ORVA 2PT6A 1KPIA 3PVSA 4M6WB 5C4GB 3T94A 2ZB7A 4FW9A 3F46A 1ESDA 2AUTA 1ZEJA 2LE0A 4GU5A 1QTNA 3OJFA 3SYKA 3V7YA 5I7HA 5LR6A 2BSQA 2ZVQX 3D6FA 2GEUA 1E2HA 1Z7BA 4IDEA 1XEAA 3IVRA 3Q0IA 5AJTA 1A8PA 2IU0A 1XMVA 5CDFA 2CVPA 5EQJB 5JZSA 3WRWA 2MWMA 1QLJA 4P58A 3V2UA 4OA5A 1FMJA 4TWZA 2DE0X 2IPXA 2F3SA 2XE4A 3IVAA 3LY7A 3M8KA 5SYNA 1XCJA 3L8MA 4CLHA 3ZJTA 3UMFA 3BWBA 1Q1NA 2VQSA 1UAGA 3WWYA 3WV5A 4EYQA 5D5HA 3ESYA 4L28A 4CF6A 2GAOA 4B3GA 2WVGA 1N2XA 1OBHA 2V7QD 4HB3A 1OU0A 5C80A 1ZFNA 1DWUA 4KAJA 4MR9A 3C4JA 2P4UA 4IOMA 1HKUA 4HAOA 2V97A 1S0UA 5EJIA 4EW6A 3KQTA 1KS9A 1JHYA 3IX7A 4EG8A 3UAZA 2X42A 1S5PA 2WJIA 5DYGA 4AP6A 4MB6A 3RSHA 2CNOA 1A97A 1OWNA 1UQUA 1RD4A 1RBYA 2AEJA 2EVWX 4ISBA 2IUYA 4X1KA 5DK6A 4L8WB 3N07A 4C2AA 2BEUB 1WZ2A 3P9IA 3RC7A 2UU9B 4UUQA 4BBZA 4CEJA 3ASVA 2HKIA 2XVAA 2W2QA 2ZCVA 3PQCA 5FP0A 5DASA 2MR5A 4O4HF 3FSJX 3C48A 5DK4A 1H5NA 2B5OA 4X7RA 1JBKA 3WFJA 4EG3A 2GPYA 2C00A 2ZJ5A 3NALA 4TLLB 3UJ9A 4C06A 2R1TB 3GCGA 3X1ZA 4BFTA 4QPPA 2CJFA 2BCEA 3DE1X 3IUYA 5IHXA 1M8JA 2CC2A 2JVIA 2JW5A 4JP1A 2Q3LA 4M22A 5ALXA 3X1MA 4P31A 4C7JA 4KNVA 3F6EX 3GPBA 3SR3A 5CK5A 4MWCA 3RJMA 4MVWA 2X5OA 2ZTLA 4K6OA 4XIIA 1SKQA 3A31A 5C8YB 3MWJA 4Y2HA 1P5HA 5ESXA 1HT1E 3JVUA 2DTDA 4JDPA 3KYDA 1G9SA 1JQKA 3S5UA 5DPMA 1KJ9A 3K1ZA 5CB8A 3EZ2A 1YSCA 4RIGA 4RPJA 1UFVA 3R0ZA 1R9MA 1M2WA 2FK7A 1CV2A 1KQFA 4D25A 2Y0CA 1JVNA 3H9UA 4QM6A 3KVRA 1THTA 3C7CB 2HIMA 3A7EA 3RWOA 3UTDA 4ER5A 3HBJA 3V4ZA 4PSCA 3V3KA 3N5CA 2XJ9A 2OORA 2C5SA 3UCFA 1AHIA 1TFRA 2Y6UA 1Z22A 4IH4A 2XXBA 4V2IA 4F91B 2NT4A 2LD4A 4K1XA 1PZMA 1ZOOA 2CXRA 3RI3A 1H4QA 2ET6A 2NO0A 4UVIA 4MHSA 1VRWA 1FCJA 1VOTA 1TF2A 2IE0A 4JYAB 4RV5A 2JAPA 2PBRA 2PLAA 3EYAA 4IO0A 5JBIA 5DMXA 4M1YA 2ZSEA 1LQUA 2GM3A 1I33A 1N0WA 1JXAA 1LXCA 2WF8A 2ETXA 3B13B 3BGWA 4MRAA 4R5MA 4FFWA 5AW4A 3CVJA 5B4UA 1FQJA 5T8KA 5AVZA 1E3QA 5FTWA 2Z8ZA 1CR4A 5CA0B 3EVAA 2AV6A 3PRYA 4HVLA 5GIPE 3PGKA 4BYGA 3VYSB 4I66A 3OPYI 1A9ZA 3BA1A 1L5RA 4OQZA 3MB8A 1U5BA 4INJA 3M2TA 2CFIA 3PL1A 2NPIA 4KX5A 3UCEA 1DLIA 5BYJA 5FPYA 1N5OX 3G2JA 5JQGA 3DAYA 3PD0A 4I5IA 4DA8A 4U6SA 1YL6A 2QZJA 5A5GA 4DKJA 3L1VA 1ZLXA 4M9UA 3AUFA 2AWNA 1G55A 1CEEA 1NBMD 1QE3A 1DPFA 4Y2UA 1KOLA 4AJEA 2CB0A 5CXQA 1GPNA 5KYKA 4C30A 2UDPA 8MHTA 4RCYA 1PNOA 1E1DA 1WU8A 1U8EA 3D6VA 3OETA 3TTWA 4OREX 3RBVA 4B2IA 1USKA 3OC0A 3GMDA 4MGEA 5JBNA 2P69A 3ELWA 3IV6A 4YX9A 3U2QA 2Y67A 2CL6X 4ZQCB 1F0PA 1QYWA 1L0BA 1W6RA 2ZUSA 1RWMA 2VFAA 3E15A 1O0CA 3O74A 4MWDA 1H6DA 1J0DA 5HRAA 3L5OA 3G0OA 3R3HA 1TAUA 2XZTA 2SICE 1BVHA 2EKDA 4FX5A 1G5TA 2FXVA 4G8JA 1UJ4A 3NM4A 4UBIA 4DREA 5A9RA 2XBUA 3F3MA 5FNVF 2J07A 1OXTA 2PGAA 4MUEA 5LP6C 2PT5A 1D5WA 4BMZA 2V7UA 4CQNA 3T0GA 2AI1A 3ZDYB 2AGVA 3K6SB 2IVFA 3GAZA 4O4LF 1NJSA 3A3KA 4JHXA 3FROA 1SXHA 3AM1A 3KXPA 4HVTA 1TKRA 2D2IA 4IMIB 1ZMBA 3K35A 4ZCIA 4GM0A 1T2UA 3DB1A 2NMVA 3P2IA 3KSUA 4JXKA 1EK2A 2QNRA 1ZD1A 3DOUA 3IDFA 3IJRA 1SCUA 2XADA 3N2YA 1E66A 2CZGA 2OECA 4OL9A 3H7AA 2DUJA 5CBPA 4G01B 3KYCA 4YECA 3RSZA 3N2KB 4K6GA 3IB3A 4ZVOA 4DA7A 5K45A 4HF7A 1TPZA 1C4XA 2UZAA 2VSXA 3D7NA 3DAGA 3G68A 4JZYA 4O2RA 4NPHA 5EFZA 3TLJA 4BMXA 3DHVA 5BMVA 3AV3A 1ZGCA 4J0QA 4E03A 5BWCA 1V5WA 1HI9A 4KRGA 1NQUA 3HY4A 5DM4A 4GZ3A 5AVUA 3DO8A 3E9QA 1HDRA 1K6XA 4OJKA 3Q3EA 3QKSB 5B1DA 2GJ4A 3IAEA 4H35A 4RGVA 4ZU3A 1AXRA 4CI9A 2WK1A 3ND9A 1DMSA 4EOGA 2I1VB 3IP8A 4CTMA 2I8CA 4N3CA 3LVFO 3PE3A 1TAQA 1A4UA 2Q8PA 2ZP1A 3DJYA 3H9EO 3PB3A 1OFUA 5CHYA 4QTXA 2G80A 3VUEA 1KYYA 3LKVA 2EFYA 3V8NA 1T9GR 1XAHA 2DR3A 3DL0A 3RTBA 5KTOA 3TAXA 1G8FA 4KRYA 1BNCA 2PS9A 1N9GB 5HM6A 4I81A 4NE2A 4P3OA 3OQNA 2CV0A 1S7CA 2XTMA 1BKDR 3JYNA 5C1IA 1LV7A 3CR3C 3VM6A 4F9TA 4YRDA 4WECA 4BJ3A 3IPYA 1DWPA 2M2IA 2QTFA 5A9SA 3DEAA 3J7TA 3TRDA 1GNRA 2C4KA 1V35A 2XVMA 3BFXA 1QV6A 4KSCA 5I7VA 2F1RA 3JARB 4NLLA 1XQ1A 1LNQA 4M7RA 3OOWA 4M7PA 1IK4A 1L5OA 1X7WB 2A78A 1ZD3A 2ZYIA 4L4XA 4WCFC 4D0SA 1OV6A 4FKMA 4NS4A 1GGHA 5FPTA 4C5CA 3T5TA 2DKOA 1XD2A 2PKRA 1E9CA 1V6SA 3S1LA 1TM4E 1UBGA 4W1PA 4PX3A 3TTSA 4C6HA 2EC5A 3I53A 2H59A 5L8VA 2BPOA 1EG2A 3OZ7A 3SZLA 2Y9PB 3PDIA 4DZZA 1GCAA 1R16A 4G81A 5DV9A 1VFPA 5JMTA 1GN8A 3NXSA 1A82A 2H63A 1OAKA 4IGIA 2ORED 2Y2VA 3EGXB 4BVEA 3UPTA 1KK0A 2JIRA 1EBUA 2NSYA 3IILA 4HYEA 3IUPA 4R81A 3IMKA 3WK9A 4BO1A 4F8JA 2O7RA 4FWTA 1KOGA 3B1YA 3H2SA 3QEAZ 3B53X 1LPMA 1GWNA 2HDNB 3LUGA 5LA6B 2J5BA 3RIXA 1BGWA 2BBSA 4PNZA 1OKKA 1E7RA 2V5VA 3F2IA 2PZ8A 4UAGA 5ALEA 3WYBA 4MLZA 3TUJC 5C4MA 5K3BA 4MNTA 1HEUA 4UXJA 2C5FA 1ZI9A 3AIOA 1TCBA 4AUNA 2G1AA 4HL6A 3ZWBA 3WGTA 4BLSA 1L6RA 1IMJA 3WS7A 4LCJA 1A9QA 4BO2A 4TS3A 4QRIA 3QE9Y 2FCAA 3ORSA 2X19A 5CT5A 4JQCA 5FL7D 1FSFA 2Q9UA 3EXIB 3FPSA 3NHPA 1NI4B 4UHBA 3HS3A 4QUJA 2MYNA 3PUXA 5ETJA 4NYIQ 3UXYA 4B82A 1WSAA 2I4RA 5K01A 2MYTA 2VRCD 5ES3A 4C03A 1IQ0A 1FTWA 3W4IA 1GUYA 4TLEA 4C9BA 4DCVA 1TIPA 4OXQA 3N86A 1Y82A 3GL9A 3EGCA 4L02A 2QLLA 1U65A 2WT9A 1CJSA 3R3XA 4Y67A 4BB6A 2Z6QA 2GD1O 3KFXA 4BMPB 3P97A 3M70A 3WL4A 5A6SA 2XZLA 1Y8RB 2O2GA 4H7DA 1WEHA 2FPRA 3RVMA 2LDBA 1WMAA 2OBNA 4RFVA 4JLKA 4PZLA 4WH0A 2DLNA 2G5PA 1XGKA 4BKUA 3GQBB 3GYBA 1KP2A 1AUVA 4GR9A 4LGMA 5JTUA 4QM7A 1CJUC 2ONZA 1GVHA 4TQUS 3V46A 4TL8A 4A1OA 2G4CA 4ZJUA 1TMYA 2CYBA 1FYXA 1N6LA 4MUHA 4NF2A 1NE2A 3EJ6A 1B3RA 1EUDA 1U5CA 3BJIC 3BDVA 2C59A 1QKJA 3PI7A 1AURA 1I3CA 4KKVA 2JGEA 4MW5A 1HPLA 3A1TA 3LCRA 3VZRA 5LPNA 4G1VA 4LYYA 3OIFA 2E4XA 1SBCA 4YXWD 5KWJA 2IHKA 3MW8A 4PR3A 1AKVA 1JEAA 4F96A 4U7DA 4Z4IA 4NL4H 3E9NA 3QMPA 3KDSE 5DJ5A 1KVSA 1WQ1R 1EEXB 1FW8A 1C3OA 3JQEA 4J43A 4TOIA 4A0QA 5CB4A 3O47A 4M8SA 3QV1A 1JR3E 3K8ZA 3L6DA 3U80A 2G4LA 5CFRA 1JS1X 4MGIR 1B16A 2QF7A 1N8TA 5KHAA 3W7AA 5K3CA 1T8PA 4Q00A 1PS0A 1XK6A 1YZNA 2R4TA 4Z49A 3GHYA 2H5LA 5D1NA 1SEPA 2JH8A 3HCEA 4KNWA 2A1IA 2ZAGA 4S35A 5ITWA 1KFKB 1NNI1 3O90A 4GOND 4F7WA 2CLDX 5IJ0B 4WHMA 1MAVA 3B52X 3DXYA 3OZRA 3Q9NA 1RAGA 4YRTA 5JZMA 1XDWA 1O03A 4JXJA 4NZMA 4AI6A 1OV4A 3REQB 3SXUA 3I2FA 4YV7A 2WOOA 4QYWA 2BFCB 4RQBA 1QO9A 2Q5OA 3OQBA 2J0EA 1X7XA 2XTAA 3T34A 8AT1A 4RDIA 1TGVA 2KX7A 5BNZA 4V02A 1SHLA 2VJCA 3OAAD 4IQ0A 2VP6A 3LOPA 2BH2A 2EFJA 1RM5A 2IFTA 2JFNA 1RAEA 4IVPA 1SC4A 3FPBA 3UOAB 4EB8A 1M2EA 3CYFA 4ZU1X 4U6NA 1N2JA 5DGHA 4BE9A 3R3JA 4URVR 1TUEA 1JKJB 1SQGA 2R7KA 1J07A 1YB1A 2I2BA 4Y30A 3Q6NA 2GFIA 1KI1A 3ETJA 3FMPB 2E89A 5CA1B 3HLYA 1JXQA 1MJNA 1UZNA 2V7TA 3A4LA 5D5QA 4BQQA 5BRJA 3JQ6A 2JZOA 1IL0A 2RGNC 4RY8A 1MEJA 1Z2NX 1M1XB 3Q87B 5D3QA 2GK6A 3ZKWB 4PYJA 4BDTA 1E0JA 2RIRA 1N33B 2ADFA 3RYFA 4EG0A 4JI8B 3R40A 1IB6A 1J8FA 1KK3A 3ZY6A 5L95A 4R1UA 3CZCA 4RS3A 5JS6A 4U5XA 1E9BA 2WNHA 5LKRA 2QP9X 1O97C 2JLSA 5G0TA 4LOAA 1B8VA 1VPVA 1EFRD 3CRW1 3FR7A 4PV7A 3W5DA 2P2LA 3OIGA 3CKKA 3HU5A 1HKHA 1X19A 1HETA 2X7JA 4QNRA 3BMOA 2VJOA 1R64A 2ZYRA 1WULS 2BGJA 3CX4A 4MB0A 4A0FA 1YTUA 5CM9C 4G0VA 1TU4A 2G9RA 4C4TA 4OHWA 1ISSA 2D2EA 3ENKA 3VYRB 1Z25A 2WMOB 1XHFA 3PDUA 1I1HA 2JFBA 3WLRA 4YRMA 1M5RA 3DC2A 2QX7A 3PC8A 1MNQA 3GRUA 4PPQA 1IN4A 1Q44A 5JFTA 2DBRA 3G2HA 3BZBA 1RXWA 1CVLA 4Q18A 4QQNA 4NU0A 1KFCB 4JMPA 4QEDA 4RD6A 3NT2A 5D6NA 5BORA 2WP0A 2GOYA 1ETUA 1V41E 2FUEA 2ZIWB 3AF1A 4EB6B 1FQWA 1JDZA 1EA5A 1ONOA 3PSAA 1A69A 1N2CB 2ACWA 2OQIA 4Q4AB 4YCJA 3RS5A 3GN1A 4RGQA 2J5KA 2GKGA 4IWYA 2UUOA 2FEPA 1JL3A 4IIGA 1CUCA 4RMJA 4CV1A 5ELXA 3RNOA 3C87A 4QEKA 1RHJA 5I7FA 1RE1A 2P9BA 2P2ZA 1ZUD1 2F4NA 2FFJA 2P1ZA 4BV8A 4XRGA 3FMGA 2UXDB 4QUDA 5T57A 3C6QA 3UKOA 4PAGA 1PS8A 1E6KA 2C20A 2Y66A 4HRYA 4Q9HA 4Z7QB 1NUAA 1J25A 3DT8A 2ZRJA 2NUTA 1IC6A 4ZEOA 3ROKA 3KSAC 4PYOA 4PLGA 3LP6A 4KXQA 5E6RA 1B8UA 3L02A 2P7HA 3VPSA 3QMMA 1NGSA 3LHIA 3OE5A 1V16B 1Y9DA 4G5HA 3VH4A 2O8DB 2W58A 3MGCA 5DW0A 5HUHA 1UZUA 5LN1A 2HU8A 2WKWA 3VR4H 5GMOA 1V1RA 2C42A 2YHBA 4J94A 1H4TA 3A6HA 3RFCA 2HK8A 2O3TA 2QZZA 3QFCA 2DBQA 3T3PB 3KUDA 5C1OA 1JYEA 1WDLA 3KTAA 2WNIA 1CJMA 4FMPA 4ZRDA 5TQJA 4DQVA 1DXOA 4OQ4A 2RB5A 2VXBA 2E4AA 2OOSA 4H0CA 3MXTA 5DOZA 3AVWA 1TMOA 2XKBA 4CKWA 4PQGA 4I50A 1NW9B 2P3QA 4D97A 1QE5A 4CLXA 4YONB 1FC0A 1TW2A 4RORA 4MTLA 2AQ8A 4LOJA 4R9VA 5FD8A 121PA 1DKPA 2QUIA 4JJIA 3CXRA 4ESEA 1ACMA 3EFOA 4EJSC 5KOJB 4IDCA 5H0IA 2DQZA 2JCGA 3U3OA 2GFQA 5IK2D 1ZWLA 3T1HB 1P2VA 1Y8QB 4NDZA 2NYAA 3Q7PA 5ELLA 3HJHA 1PBNA 1RLTA 1VKOA 2QUHA 2J6IA 3LBNA 4FDTA 3LX8A 1QVZA 4K9NA 4WK4B 1J5EB 1FFGA 4DMFA 2O8CA 1K68A 4GD3Q 4HZIA 5AR1A 1PS9A 1ZH2A 1U0HC 2BGGA 1T3TA 1F7UA 4E5UA 1C9YA 1N1GA 1ZD2P 2MOKA 1GTVA 1ZSVA 1AIPA 3QUQA 3QEBZ 3WBBA 4P35A 3DVAA 4RPKA 4RZHA 1NBHA 2DY1A 2X8BA 2VAMA 4CFYA 2VDQB 4I1SA 4BLVA 1P73A 4R1QA 3GARA 3FM9A 3UAYA 1VI6A 5IULC 2RKWA 4BO0A 2I3AA 1A1SA 1PG2A 3D6TB 4BU1A 4OB6A 3O9MA 4RK6A 5TMBA 1D09A 1KIFA 3QVGA 5AVXA 4IDHA 4D0NA 3U7FB 2RK4A 2EFCB 4UULA 5ALIA 2QXYA 3DD1A 3FVVA 4FMCB 4P93A 5DT9A 3S1AA 3VISA 4BP8A 2BGWA 3WGQA 2V6FA 1K2WA 2SNIE 3H42B 4I55F 3OZBA 4O8ZA 1VHDA 4RMIA 2JKVA 3RR2A 1DRVA 3AB3A 3GEPA 4DLZA 5JNLA 1OFUX 2LIPA 4XJVA 3EK2A 3KT6A 5DE3A 2GTIA 2NZ8A 1HDCA 3HEMA 4RMHA 5F2NA 2ODTX 1O58A 1J2UA 5DYWA 4ZVNA 4JV5B 3G82C 3V42A 4QOFA 1VHJA 1Y8ZA 1SKYB 1T8TA 2Y0DA 1QIGA 1MA0A 3QVUA 5A7FA 5FOQA 3BGSA 4JXZA 1I80A 1XXLA 3MYYA 4PTYA 5KWSA 4QDXA 3JQ9C 1ND6A 1E9AA 1UZLA 2BFEB 1MN6A 2C9OA 2ZJ0A 2ZRIA 3INRA 3O21A 3O73A 4EG5A 3JASA 4ZFNA 3RUFA 1PT7A 1FYWA 2P5SA 2C4TA 4H3SA 5KSPA 1Z7YA 2FWNA 2YZ2A 3K5HA 3QHQA 4G25A 3VPXA 3WLTA 4PHGA 3CBGA 4N03A 4KXXA 1UDXA 1ZXXA 2BKVA 2DPXA 2HN9A 2PZMA 2VBFA 3B82A 3EEQA 3D0RA 3FPEA 4OI1A 3ZS9A 2A5YB 5KC8A 2BSXA 1ACJA 3P5SA 4OYYA 2EX4A 1ZQ9A 1O9GA 2YWDA 1GZUA 2C84A 1CJBA 3FX2A 4EATA 4N0DA 3TBHA 5HM8A 1TKAA 1MGPA 2WTNA 4UNPA 2V3CC 2GUWA 3I83A 5BRAA 2EJBA 1HV8A 4I9GA 4AJ9A 1T5IA 4ZICA 4IIJF 4H4EA 1RKXA 2NUPA 4L76A 2J4DA 4MAMA 1XZQA 2ORIA 2XMGA 2V4ZA 4BFVA 5E6SA 5INTA 1KBQA 1QH9A 3RS8A 1FJHA 5BYKA 3T1VA 4JX9A 3TJRA 4RCVA 3ZNNA 3QWBA 4E46A 4HDMA 1YC2A