1VLZA

Uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title Uncoupled phosphorylation and activation in bacterial chemotaxis. The 2.1-A structure of a threonine to isoleucine mutant at position 87 of CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal transduction protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vlzA00
1LK0A 4O1IA 4WT7A 2YHBA 5EWJA 4N47A 1F4VA 2E4VA 3FFWA 3TB6A 4KPYA 3N0RA 4MQFB 3OO0A 2L19A 3ILYA 1P6UA 3OM1A 3CNBA 4YCSA 3O1HB 2HQBA 4G0MA 1ZY2A 3O21A 4WZZA 4G0QA 3M9WA 5JNUA 4Q6BA 3D8UA 2XDYA 5TQ0A 1EHCA 3OO1A 4MPTA 4Z4IA 4Z4FA 1SD5A 2FEWB 5JNSA 4N03A 4FB4A 2Q5CA 3NBMA 2A9RA 4MR9A 3QELB 4EYGA 1KGSA 4F8JA 3OLVA 4EVQA 3QX8A 4TLLB 1KRWA 3TD9A 2GBPA 3F6PA 2P9HA 1L5ZA 2IDMA 2MYTA 3A0UA 3RVSA 2F8SA 3MMNA 1NXWA 2P4UA 5CNJA 4XARA 4EY3A 2HJ9A 9ABPA 5EWMA 2HQRA 3QEKA 1BA2A 2VUHB 4RK0A 3ROFA 6ABPA 3RVOA 1PHRA 2IPMA 3HXMA 3HDGA 3KSMA 1USIA 2HSGA 4G0PA 2IPNA 1MIHA 3O1IC 3BBLA 3HCWA 3LKVA 4KMRA 4D6YA 3CS3A 3JPYA 3HS3A 2RJNA 1U8TA 5KI6A 3CZ5A 1Z15A 3H5VA 4LZLA 1JDNA 2MSKA 3UKJA 1Z2EA 2M98A 2QXYA 4QYWA 2WMYA 2JVIA 3SAJA 2B4AA 3CG0A 2FSPA 1VLZA 3LUFA 3QLVA 4RU1A 2W42A 1NXXA 3OMXA 2M1ZA 1ZESA 1JLKA 4Q6WA 1U0SY 4GNRA 2A9OA 4L85A 4RK4A 4ETNA 5TE9A 5FWYA 4NCAA 2IYNA 3T8YA 3Q9SA 3OLWA 3QLUC 1YMUA 3LUAA 4B09A 1NXVA 4LRQA 5TPWA 2BGGA 1JYEA 1XWWA 4PYRA 2X7XA 1APBA 4ZMRA 2LIVA 2QW1A 1EWTA 2WJWA 4OBBA 1SXGA 3LFTA 4RWEA 3SQNA 3FMVA 4KK4A 3JS5A 1YS6A 1RZRA 1GUBA 4IMIB 4YWHA 1DCMA 3H5TA 2H3HA 3I5AA 5IX8A 1QP4A 4KFCA 2IKSA 8ABPA 2A9PA 4KQCA 4QYMA 3A10A 4W5QA 1DG9A 3N0WA 4W5RA 1JWLA 4F3TA 1YK0A 2VK2A 3H1FA 5BQ3A 1QQBA 3VNBA 3JY6A 2FEPA 4RK7A 4MQFA 1UDRA 4H3KB 3RH0A 1NXOA 2LPMA 3H1GA 4UHKA 3HK2A 1ISRA 1NXPA 2JVJA 3OQNA 2IPAB 4JB0A 5C5CA 3N53A 3M9XA 2PUCA 1NXSA 3DGEC 4HYEA 2VYCA 1NXTA 1URPA 5D2CA 2VUIB 1R8JA 1Z18A 1M5TA 4EYKA 1DCKA 1ZDMA 1GLGA 4MLDA 4ETIA 3LUDA 1U2QA 3C97A 3MF4A 1E2BA 4PE5B 3CG4A 3GL9A 3H5LA 3O2JA 4RKRA 1QPZA 4DADA 4MAAA 3R0JA 3QX9A 5EWLB 2PUAA 3N6VA 4EVSA 1D5WA 1QO0A 1L5YA 4PICA 1RZRD 1ZHHA 3SY8A 1A0OA 2WJAA 1VKRA 1ZH2A 5BR1A 1E6MA 4OATA 2NUBA 2FQXA 1TMYA 3FGZA 1MVOA 2PLNA 4RY0A 2MSLA 1ZH4A 3Q7SA 1VRVA 4P1ZA 1Y1LA 1JBEA 1ZGZA 5IC5A 1QQAA 4MLCA 4YLEA 3JVIA 4S05A 4MQEB 1YIOA 1DRKA 3I09A 3HZHA 3OLZA 2CHEA 3HV2A 1VPWA 3MYYA 1BDIA 3URMA 3NNSA 2HPHA 3DBIA 2FMKA 1QKKA 3IPCA 4G86A 4HNSA 4RK1A 4RXUA 5B3JC 2L17A 4JAVC 4JASB 4Z99A 3FFTA 2WB4A 1A04A 3O2QB 4MS4B 5JNVA 3CLKA 2GI4A 1QO0D 1S8NA 1YS7A 3A3KA 3KYIB 4JB2A 4MR7B 4RSMA 4O1HA 3QEMB 2QV0A 3LUCA 4IMJB 1USGA 1Z12A 3K4HA 3Q41A 4Z4GA 3BRQA 3OM0A 3G85A 4QPJC 4G0XA 3ROTA 4LE2A 5JNWA 5KQLA 3KG2A 3N75A 4QICA 4RV5A 1DJMA 5TQ2B 3EJWA 2GKGA 3LTEA 2FW0A 2JCGA 1DBWA 1JFSA 3OQOA 1USKA 4N76A 4W5OA 3H75A 4YS6A 3BREA 1SXHA 5PNTA 5HKOA 1FFSA 5HM6A 4Z4EA 4UHJA 3C6QA 1TLFA 2E4ZA 4KZKA 1SXIA 2FMFA 4N41A 1RNLA 1LJUA 3UK0A 1H9CA 2L2QA 5KQGA 1JX6A 1ZVVA 4W5NA 3I42A 4D6XA 2PL1A 4D74A 2FMIA 1XHEA 4NICA 1RXIA 2PUBA 1FSPA 3LMKA 1M2FA 4N0PA 5JS2A 1ABFA 1HEYA 1LBHA 1LBIA 4JA2A 4MS3B 4XASA 3RVJA 4HNRA 4Z0NA 3CKMA 3GWGA 4KQ9A 2PJUA 4L4UA 4IF4A 1QP0A 1BVHA 1D4ZA 2QVGA 5EWLA 3IP7A 1B00A 4TLMB 3LOPA 4Z4CA 5IEJA 1ZN2A 3HUUA 4YRZA 4ETMA 3H6GA 4Y9TA 1MAVA 4IRXA 4RS3A 4RKQA 4MS1B 4WXEA 5TPZA 4RXTA 4KK3A 5HSGA 3L6UA 3QLVC 4FE7A 2FLKA 3TO5A 5DKFA 1CHNA 2E4UA 2FLWA 3JPWA 1QP7A 1D2AA 4H3HB 1OXBB 4PEVA 2PUDA 2E4YA 2RDMA 1Z17A 2WY2D 1JDPA 2CD7A 4M88A 4ZPJA 4LE0A 3SG0A 2FVYA 1NTRA 1OXKB 3NNDA 4E7OA 2TMYA 1XHFA 3Q7TA 1J56A 1P6QA 3RVMA 1BDJA 1MB3A 3EGCA 4Z9BA 1PUXA 4IGAA 2GX6A 2R48A 1TVMA 4IILA 5IEBA 3HUTA 3QELA 2WRZA 3H5OA 3KHTA 3KJXA 3MA0A 1DCFA 3LUHA 3C3KA 3N8IA 4EGSA 2HQOA 4MR7A 5CHYA 2PAFA 3QEMA 4E7PA 5IUNC 3IDOA 3LUJA 1K66A 3KCNA 5TPZD 3EDCA 3NHZA 3KS9A 5JNRA 3A0RB 3KYJB 3CHYA 5T3YA 3SNKA 5TQ2A 2FMHA 4XAQA 2RGYA 3HDVA 1SRRA 4MYRA 1P2FA 5FWXB 3T38A 4RK5A 3KTOA 3JVDA 1P8AA 5KQPA 4RXMA 1MB0A 1M5UA 3T95A 5IUJC 1ZITA 1KRXA 2FTKE 3C3WA 3RVQA 4PZ0A 3KLNA 3IP9A 4MRMB 3CZCA 3EULA 2FQWA 2RJOA 4KVFA 1U04A 1Z26A 3BILA 2QZJA 2JVKA 3LKBA 1BAPA 4MGEA 1BDHA 3ILHA 1QNLA 2NZUG 4WUTA 3RVLA 3RVRA 5TQJA 1Z25A 3M6MD 4YR7A 3IPAA 5IUKC 3F6CA 1ZAYA 3HJFA 4O5AA 4MS3A 3DZDA 2PKXA 5CNKA 3HM9A 2AYZA 1PEYA 4EVRA 1ZGGA 3EAFA 3RVNA 2E4XA 3RVKA 2JBAB 3KLOA 2B1JA 3NNNA 3JTEA 1C0EA 1M2EA 5HQJA 4OLAA 1D1QA 3P9YA 1T34A 1JHZA 2MYNA 3F73A 1DBQA 1PNRA 3DLBA 4JOQA 4ZYLA 3I45A 1FFGA 4MS1A 1ISSA 2H0AA 4MR8B 2OENG 2OQRA 3LUGA 4N0QA 4EYOA 6CHYA 1DC7A 2CWDA 2ID7A 4H60A 4F12A 3GBPA 1CEYA 2PUEA 5FBKA 4YP9A 3UUGA 2WWVD 4EYQA 3GBVA 3HO1A 5C5EA 1WETA 4KNYA 3B2NA 4NCBA 1TM2A 3F7NA 3EQ2A 3G1WA 3O74A 1E6KA 3QLUA 5DCLA 3T6KA 3OQMA 2QR3A 1JH9A 1EWVA 1I3CA 2PL9A 2ZAYA 1NATA 3E3MA 3CU5A 1K68A 2R25B 1F51E 1FFWA 3W9SA 2JRLA 3HVRA 3QLTA 4KREA 2IOYA 3H6HA 2MSWA 5EWJB 3K9CA 3OMWA 1YK1A 4EUKA 4JP1A 2J48A 3L49A 4LDAA 3RQIA 3GA5A 4G97A 4DQDA 4TMYA 3NHMA 1QMPA 4YV7A 4F06A 1RXEA 2CHFA 2LUOA 3EODA 4DN6A 4LX8A 3IP6A 3GT7A 1W25A 4Q7EA 4RK6A 2FKAA 5TQ0B 3VNAA 1AB5A 1DC8A 1NY5A 5CNIA 2PE5A 4WWHA 3IP5A 2FEKA 2R47A 2NZVG 3TX6A 4F11A 1EWKA 4ZMSA 3GRCA 4MR9B 2FN8A 3FDFA 3S99A 1D1PA 2YHAA 1EAYA 1C4WA 1A2OA 2JB9A 3HSYA 5GQSA 1PNTA 4CBVA 5KC8A 2GWRA 3GV0A 3TMYA 5FWXA 1DP4A 4RZSA 1FQWA 2QSJA 1E6LA 3E61A 5EWMB 2L18A 3DLHA 4OG2A 5KC9A 1Z2DA 4XLTA 5DTEA 1EFAA 1CYEA 1YTUA 4MQEA 5DLEA 5FBHA 3O2SB 2AYXA 1ABEA 3KKEA 4LDZA 4MRMA 5F64A 1JFVA 3OLXA 3HEBA 1DRJA 3Q15C 4GPAA 1GUDA 3CRNA 1U2PA 1JF8A 1IIBA 3MM4A 4Z9AA 1GCAA 1Z16A 4NV3A 5BRJA 4NQRA 2NT3A 1LJLA 1KMIY 4RY9A 2QVCA 3BRSA 3MIZA 1JFTA 2PUGA 2V0NA 3C3MA 4RDCA 2PUFA 1JL3A 1YMVA 3FFXA 7ABPA 2LP4Y 4MS4A 4YGXB 5I4CA 1AB6A 2NT4A 5IULC 2FXIA 2LBPA 1DZ3A 3N0XA 4YO7A 5JNTA 4XXHA 1Z13A 2DRIA 4S04A 2I6FA 4ML3A 5CNMA 2KYRA 3H5WA 2JBAA 5JS1A 2O20A 2N9UA 4OTZA 4G0ZA 5FWYB 5KWSA 4OLBA 3O1JC 3DGFC 4G0YA 5ABPA 1RPJA 5GOTA 1JYFA 4RY8A 4XFKA 5E3JA 2F8TA 4HNQA 3RVPA 2MYPA 4MR8A 2FQYA 3MQ4A 3Q7RA 1W9HA 1YVUA 3QK7A 4LE1A 5TPWB 5T7BA 2JK1A 5IBQA 4KV7A 4G0OA 2IPLA 5B3JA 4ZJPA 2MYUA 2E4WA 3OLYA 4FE4A 2QU7A 2R4QA 4W5TA 3EQZA 3CTPA 3LUKA 3O75A 4WXMA 5DGCA 3H5IA 3H1EA 1DBPA 2FN9A 3SM9A 3GYBA 4Z4HA 1PEAA 2A9QA 5BRAA 4KRFA 4TN5A 1TJYA 2ID9A 2ZWMA 5ED4A 3CFYA 4P98A 5KQMA 3D02A 1GCGA 2PMCA
chains in the Genus database with same CATH superfamily
4N6NA 2HK8A 1RKQA 4O1IA 3TDMA 4BN5A 2IHTA 4ZIRA 2EWVA 2WG0A 1FMLA 1I2CA 2YYSA 4YO8A 4CI9A 1R9NA 2Y1FA 3AR2A 4RZIA 2J7KA 3CMCO 1JLHA 2P3LA 4RMJA 3RFCA 3ROKA 1ZP6A 3IMGA 4B4KA 4OQLA 5FOVA 4HEA1 4IH4A 2CUZA 3HKCA 3OZXA 3ZLJA 1GT6A 4G0QA 1K8ZB 4MWSA 2AMVA 3BMCB 3AL2A 1Q11A 3VH1A 4ZGBA 3GGPA 1MB4A 4C4AA 3ZCVA 4E70A 1MBZA 4OXNA 3I6YA 4EW2A 4PCVA 3AWIA 4JCOA 4FB4A 5IJ0A 5TIIA 3MK31 1L5GB 1M0EA 4LA4A 5B1SA 1R3UA 1A72A 2PRZA 3EOAI 3I01M 4N12A 3SEFA 421PA 4BQQA 3RIXA 1RYHA 5KWEA 1I9CA 5HEKA 1KRWA 1VGVA 4JJEA 3VM6A 4GUDA 1OCEA 5J23A 1F0PA 1QKJA 4ENRA 1F2VA 2PT6A 5CNJA 2C8LA 2PSDA 4QBTA 2ISQA 4C5AA 3FDXA 1K3FA 3BH7A 1OSNA 4RKYA 4AUMA 1PHRA 1G59A 4WOJA 3JX9A 4FDVA 2CNWD 5JASA 3VPSA 3BFVA 3MWJA 1OREA 3O1IC 4FC7A 4D6YA 3M83A 4IVRA 1VRCA 1PNOA 2Q3FA 3GZNB 4M9CA 3Q0IA 5DX0A 3CF4G 4A82A 3JD1A 2FJ0A 4WKPA 3TW0A 1ADJA 4N3AA 1Z2EA 3LDAA 5J9FA 3KETA 2X22A 3DBVO 2VN8A 4ER5A 3GLIB 4AN1A 3VI3B 3MUFA 4BNYA 1QQ7A 1UBOS 1YR3A 2D5CA 3MWEB 3H3FA 2ODBA 3IBYA 2AG1A 1T36A 3MAAC 2HMTA 4B4UA 2A9OA 1GO2A 2IA5A 3MGCA 4B6EA 1IXZA 1V8FA 5TJ9A 3UAWA 4NCAA 2ZJ5A 3IUYA 2PZFA 2JFWA 2H4XA 3PF9A 3JQRA 3RYHA 1CZHA 2QTGA 4YDRA 2NP6A 1SC4A 3ZHBA 1KAEA 3OF2A 3ME5A 1KVUA 1IWOA 1AT1A 4P6VF 1JA1A 1E2NA 1UFKA 1KXZA 1P31A 4HDKA 4FYYA 1GTZA 2X7XA 3CF2A 2B3DA 3GLUA 2FSFA 2ZLBA 3R74A 2EEPA 4AIIA 3CLSD 2G7ZA 4UPEA 1S8OA 5F73A 1DUSA 3BXXA 1PWZA 1ARZA 1T4GA 2OOSA 3DEJA 3FFBA 4B7XA 4A0RA 1Q1BA 4XOIA 3VR3D 4Q7QA 2CJXA 4X3OA 2VAWA 1TAHA 2PBLA 1QKIA 3WQBA 4JC8A 2GK6A 1YRBA 1F38A 1F2UA 1SIWA 3H5TA 5J4HA 1CPYA 3TX2A 4KFCA 1LJ8A 1PJBA 1XDBA 2EV9A 1GU0A 4EARA 1WMAA 1NVVR 3EXFB 3DBLA 4GGPA 3S29A 4LYAA 1C7IA 1I14A 1XZNA 3HA3A 4W5RA 4CM1A 3DHVA 1E4VA 4ARIA 4FC6A 4AJEA 4QNNA 3FYUC 4O4IF 4H4EA 4QBFA 3LP5A 1WD5A 2FRVA 4CV1A 4IW3B 3RJ9A 2EYQA 1GVHA 3E9DA 5KDDA 4HC4A 4INJA 3P9RA 3ZE0B 3QLEA 4AJOA 4OD0A 4FKBA 1JEQB 3DP9A 1GXSB 1BTOA 1GQRA 3L7LA 4HYYA 4JODA 2GXSA 13PKA 1MR3F 4D7AA 5AUOB 5HUJA 4KR2A 3BSFA 4RY2A 2AI3A 1NE2A 3HKDA 2QP3A 2BEJA 3JXEA 3W9YA 4B7CA 2D74A 3EF3A 1CULC 2I2DA 4U1RA 1XMSA 4CU5A 2G8LA 3RS9A 1A27A 2QAGA 3UT5B 2XTZA 3ZTTA 2Z6QA 3CEPB 2DQKA 4R1UA 3EHEA 3LV8A 3RV4A 3QPVA 1JLRA 4I55B 5BVGB 4OU4A 4MWOA 2ZUEA 3UOGA 4UJ5A 2P8JA 1H2RS 2EL9A 3UXYA 1W1IA 1QH0A 5LUAA 1CZKA 1YBMA 1IHDA 4XH9B 4UATA 2H0RA 1J99A 1RBZA 1TKBA 1W76A 1MORA 1X7ZB 2P5YA 3PF8A 5IM4F 4HWRA 4UM7A 3VTAA 3ACDA 4KQXA 4GKAA 4M6WA 1RJFA 2WP8J 3PKJA 1DV2A 1VL6A 3UW1A 3K1TA 2UZIR 1BD3A 3ZYZA 4QGHA 2NSLA 2PYDA 4ZOLB 2BZGA 2UZAA 3PK0A 1KEVA 1Q1GA 1U2GC 4MUHA 2IH2A 3UIEA 5L4SA 3N2YA 3COWA 3HO6A 2P75A 2C3MA 3I09A 1C9YA 2E82A 3AQ4A 1JIVA 1CJKC 2CLLB 3NWPA 3ROGA 3GJQA 3JVEA 1YRLA 4DCPA 5JV5A 2D1YA 3WXBA 3F97A 3PQ6A 3QHAA 4AZ3B 1Z4IA 4F5YA 4JVSB 1N2CA 5J5CA 4DDMA 4JKOA 3R8XA 4NARA 2H4JA 1KJYA 1OLUA 3E1SA 1CS0B 4RA6B 5F76A 4MCJA 4MKGA 3T7EA 3UV7A 2CFSA 3ZNOA 1U5CA 1T5OA 5EY5B 1V7ZA 2ZB7A 3M6XA 4G1EB 1KZHA 1W88B 3ONFA 3RG2A 3RUDA 1C1XA 2V6IA 1GOTA 1C1YA 1D03A 2QN6A 2Z4TA 3V4PB 1DO2A 4GLJA 4QNRA 1EJBA 3PS9A 4LYHA 5EMLA 3U1TA 4BVFA 5I4BA 2ZIUB 4D9GA 1IMOA 3RLFA 2BGWA 4OQPA 5E7QA 1RYMA 5CD1A 3DNFA 2HV9A 2V74B 1AD2A 1C2YA 5GV8A 2EFGA 2R8XA 4AJ1A 1TU4A 2VKQA 5CG1A 3NETA 2FZKA 2VEOA 4JVNA 4AJ2A 1BGVA 2G9QA 2X41A 5JSUA 1XVIA 2FSHA 3A9VA 4QICA 4NLLA 4B8ZA 5C7YA 1FYEA 2NV0A 1PZEA 4U0JA 4PN3A 2C2ZA 4YH1A 5BP7A 4XSVA 5DMHA 4H7IA 3F6SA 2P0AA 3QKWA 5DNWA 3GJRA 4V02A 4D6PA 4PWYA 1V9LA 1NF8A 3CH7A 4RHFA 4UHEA 3WL6A 2OGUA 3K8QA 2JIZD 3GFRA 1XVTA 4PC3A 4CKBA 1HOTA 3FWYA 1V7QA 1JSCA 4D46A 1P4RA 3A4VA 1WDKA 2QTAA 2FMFA 3DFUA 1FNBA 2P0YA 3WGTA 2IOFK 5SV2A 2ZZNA 1KEUA 1VBKA 3TZ6A 1SIBE 3I42A 2R6ZA 4HWOA 1U80A 3ROMA 5K3CA 1M76A 3TQRA 1U2TA 3O4RA 4PVDA 4FFOA 1S5PA 2HLNA 4XJTA 3P0IA 4EI9A 1FVOA 2ZAIA 5T8KC 3KUKA 5COAA 3IUNA 2Q0XA 2VAVA 4B7UA 1TRHA 4GLFA 3L04A 4DMUB 3B6MA 4F72A 3V4ZA 2KLHA 3VVMA 4WJLA 3LOPA 2RB4A 2VPYA 2VH2A 3V3TA 1GHTA 1OT5A 3PUWA 1DXYA 1UBJS 4C4TA 4ETMA 2YJ5A 4HPWA 1V6SA 1Z39A 2RKOA 5LB2A 1XPJA 3CONA 4GPD1 4L8LA 4MCIA 1OPRA 2OFOA 2QVXX 4MMZB 3T5CA 4DR6B 1E1QA 4OK6A 4YECA 3GLKA 4EJSB 1KRHA 5AQEA 2MTBA 4FDUA 4CG3A 3W6NA 3V4RA 1R0YA 3GUYA 1ZGAA 3L0PA 3S5JA 3DO8A 1GGEA 3AHEA 2QGFA 4R16A 4E5MA 4IPTA 1AF4A 2BCJQ 2E1PA 4J9UE 3WX0A 2E4YA 2O5EA 2C3PA 4XR9A 4X54A 2WJJA 3CRMA 2X7HA 2CD7A 2ZCJA 4UUPA 3R5FA 3N7AA 3SG0A 6LDHA 2P9FA 4JZKA 5KPJA 3B9QA 3RKRA 1IQRA 2TMYA 2K4MA 4X7RA 2OG2A 3WIUA 1FRZA 1JU9A 3R3SA 1SCKA 3I0NA 2I78A 4MQ4A 1LX7A 2V7QA 3MERA 4JYAB 3FUTA 2R48A 3MT7A 1IY2A 3CR8A 2O2YA 4WN9A 1LPAB 1I5RA 2BEKA 4MVWA 2PZBA 1RJ9B 2V96A 4ENVA 1ZOLA 3VAAA 1WX1A 4LDRA 1HT0A 1YB1A 3WWCA 1YHYA 5BVHB 5L4LA 1A9XA 3T99A 4DUYB 3D8NA 3GUZA 2Z30A 3TJMA 4MR7A 4LBZA 1XZJA 3KTAB 2HO5A 5AUNB 1AKTA 1OXVA 2OA0A 1ZNQO 1KR2A 3NHZA 3O1LA 5E1OA 5TRTA 3UHFA 2I2CA 5LDHA 3R5JA 5ALIA 3COVA 1GV0A 4I14A 4YJ3A 2QTCA 2IU0A 1RYYA 2VJAA 2WYOA 5D3MB 4G8CA 1ZRHA 2V7PA 1Y80A 2ZBPA 3O82A 1UF9A 1RJWA 4TQUS 4WCFB 1U5AA 2WPDA 1NVXQ 2RD2A 4HRVA 3DMNA 2Q7DA 1QF7A 2X13A 2ZRKA 1RZUA 3FCAA 3G9XA 1MF7A 3KKOA 1MB0A 1KMNA 1ZOSA 2R1VA 2Y0CA 1EM8B 4QVGA 1X7YB 2JFHA 4IUCS 2ZUTA 3SR3A 4M99A 1ITZA 3C1OA 4AMUA 3P52A 4AKEA 1FSGA 2C5GA 2UUAB 1ECBA 5BV2P 1NW3A 3DZFA 1JEYB 1YRWA 4BBZA 2XW6A 2FZCA 2UAGA 2A33A 2O7RA 5HIJA 1LF5A 1QHGA 4TTVA 2PX6A 2GPJA 3HP7A 3ILHA 4JL8A 1XO1A 2I71A 3C1AA 3EAGA 4NYMQ 1PAUA 4MRSA 4OREX 4Y18A 2XKBA 4D4MA 2EWWA 1GPBA 4IX1A 3ZDQA 1QGOA 4MS3A 1ESDA 1PEYA 1JG6A 2VSNA 3O4JA 4C0KA 4BNWA 4IHJB 4R2IA 4EG5A 1TF7A 1W19A 2YBDA 3F49S 5EIWA 1E79A 3PXGA 4PRKA 4EG0A 3VU1A 1Z5ZA 3K9HA 4GXRA 4RK1A 3GEGA 2JFPA 3BD7A 1W2HA 1CDZA 2VP6A 4ATNA 5FOQA 1VLMA 2G9RA 2NU9A 1GEGA 2GAFA 2O9JA 4Q9JA 4UM9D 3DLBA 3UV3A 3DULA 1F8UA 3I4LA 2ZKLA 1JXMA 1Z62A 3HJTA 3VFDA 3BIFA 1S2NA 1JJFA 2HL6A 3PFGA 4MW1A 5IXYA 1SOWA 1OW3B 2KQUA 2ZUSA 3IUJA 5U4QA 4BMPB 4X8OA 1F48A 1NJ5A 4GSKA 3K15A 4ZVNA 2CFIA 5C5EA 2O06A 5A02A 1ENOA 3CUUA 3EC2A 4IBOA 4K26A 1CEYA 1KFJB 2DR0A 1OIXA 4OL0A 1JH9A 4FGWA 1QE5A 3FD8A 2C7BA 1BXGA 4BJ1A 2H29A 2HR1A 1G21E 1HE3A 4M8KA 4FZRA 3T7IA 4XFDA 2H5LA 1Z7YA 3TD6A 4DLBA 3EVAA 1ZZGA 4FSHA 1G21A 2ENUA 5BYBA 2R25B 3IA2A 4N5HX 3GCXA 1IYZA 1H69A 1RYEA 4CQJA 4DMHA 3Q7QA 4AJHA 4BN0A 5MGNA 3HJCA 3OMWA 1N1MA 1JIKA 3A3NA 4OGKA 4YMSA 3RYCA 4CEIA 3UATA 3BXPA 1BMFD 3HBMA 4QSHA 3ZGOA 4LDAA 5NULA 3TQTA 3GJ6A 4HDRA 4BFLA 1QMPA 4RKWA 4FINA 4ZYZA 2R2GA 5HBGA 3GUUA 4BKPA 4X9XA 2QTLA 1GQFA 2OEPA 3FYUA 9LDBA 4Q9KA 2HIHA 3CBGA 5KOJB 3NGMA 3D7MA 2B25A 2FXVA 1CIVA 1YB2A 4N7JA 4E0BA 2APJA 1GITA 4CIDA 5C46F 5ALLA 4WV3A 1AK2A 1HYHA 2C99A 3FYDA 1FTGA 2Z3VA 4NS4A 1NMZA 1E1CB 4KXFB 5EXPA 3KPWA 4G9BA 4X45A 4LHXA 4U0KA 2IXDA 2Q4BA 2EIXA 2VATA 2W5UA 4FFBB 4F9EA 5KQRA 3OMLA 3PUXA 3GW8A 4BKRA 2QUIA 3I76A 3DLHA 2CXXA 2O3QA 3AJ8A 1GKKA 1BG6A 2CFRA 1CXZA 3I92A 4TL9A 5E8JA 3O2SB 2AYXA 1DQSA 4XZ3A 3PJDA 3FUVA 4LDZA 4M1ZA 1OXXK 4IDHA 5P21A 1DIOB 1MNAA 1XVLA 2W90A 1QFJA 2NO7A 3K2BA 4UFNA 1JF8A 2D5BA 1GCAA 1EEXB 2DWOA 4DJDC 1XA3A 2NT3A 2V7UA 4DW8A 1EUQA 5K51A 1FXWA 2YBEA 5LXTB 3INRA 2FGKA 1V45E 2RIRA 1U7WA 5DI9A 1PZFA 2VIIA 1PJQA 3D7NA 2GETA 1JL3A 4IKPA 3L6DA 1QAQA 1XTQA 2I34A 4YGXB 1AB6A 4FNOA 4HPJB 1KC3A 3WQQA 1V8BA 2MR6A 2D2FA 2ESRA 4PS0A 1RAFA 2DRIA 4YO7A 4EP1A 1NA5A 4GHWA 3WVNA 1CQIB 4D3ZA 1IN7A 1OFGA 3T5PA 3D5TA 3QYFA 1TT5A 3EUFA 3R5TA 1OLSB 2VNHA 3O1JC 3QOXA 4M1OA 2VHYA 1IEXA 1MX3A 3CH4B 3R9IA 3TZKA 4KJZA 1JYFA 1U2GA 4WECA 5D7BA 5CEJA 2C9OA 5FCDA 4RZQA 4XWWA 2JJ2D 2V8BA 1WOYA 4HNQA 1N6RA 4KODA 1EM6A 2J3IA 5DASA 5F4ZA 3Q7RA 2GR9A 1EDZA 1VHWA 3H13A 4YALA 5EIHA 3WO1A 5CA1A 1YL6A 3SHFA 3DZCA 5JQWA 4IY1A 5TARA 5DT2A 4C6SA 3W5BA 2AZXA 4WKNA 3NAGA 2Z6UA 5BQOA 3IQHX 2J6CA 4ZJPA 2V6MA 4BNUA 4LRYA 4E5VA 2XA1A 1JBKA 4FE4A 3S4YA 2ZATA 3VI4B 5AW6A 4U6QA 4ZCIA 2XUPA 2XT6A 4IIYA 4IDPA 4DNPA 1HBJA 3MMPA 1HSOA 1Q44A 2GARA 3KSDO 4YFVA 5C80A 1DE0A 1LQTA 2ACWA 5HNKA 4H6VA 1Z45A 4ZV7A 2QUKA 1XNJA 5KNDD 1C9MA 1FFXB 2Q3HA 6REQA 1NY6A 1E1KA 3QVWA 5MFZA 1OR8A 2GILA 1WAMA 2L19A 5K2MA 4N1AA 4MPRA 3UENA 1G5FA 4LRXA 5F5XA 2J85A 3CCBA 1QYDA 5G4KA 2YDYA 1JDJA 2CB0A 1JXOA 3IVAA 1Y4SA 4MQUA 5JATA 4ISCA 5BUQA 3V7UA 4NFLA 1E5VA 4KE6A 1EHCA 1KYVA 3R3VA 2VUTA 4FLFA 1LV7A 1RTTA 2GPTA 2I1VB 4XWOA 4EJ2A 3NHYA 1FBNA 1K92A 4M89A 4N03A 3DJYA 4W82A 3GFPA 1MZVA 3B6KA 3EC1A 3FKJA 5JJIA 4EHNA 3IJEB 4U2GA 3PUHA 1MJ5A 4H1WA 5CPFA 3VSCA 2OTCA 3K2QA 3JASB 4LSMA 3VJKA 2VHJA 4YXWA 4B71A 4DLYA 4TPKA 4EHBA 1RSZA 1ELOA 2OV1A 2QRVA 4RPCA 3X44A 3E05A 2J0QA 2PZLA 3P45A 3FE2A 3JVUA 2IEBA 1L8LA 5T8KA 2X15A 4Q39A 2H9AA 3FOFC 5CX4A 5FTMA 4RCVA 3NC4A 1T8TA 4P82A 1VYTA 4Y2TA 1KMHA 1N0WA 1Z07A 3QKSA 4UM9B 3K0KA 4HGZA 2WKSA 1GPH1 3BBLA 4MKIA 2V6BA 4S1TA 4DEYA 3JPYA 1M1ZA 3HXKA 5B4VA 1DU4A 5BR8B 1W5BA 1G6HA 3O8DA 4KC0A 5ALWA 3MCTA 2QSUA 4M0LA 4QYWA 4U9HS 4MKXA 2AQ8A 4BVJA 2DFDA 3UYLA 5JAHA 5BWNA 1D8AA 1L5HA 1J33A 4I1SA 1E1LA 2V0CA 4BKOA 2PXXA 4UDOA 1RXVA 3NTOA 2JLCA 1BCSB 3JQ7B 3BWBA 4XKJA 1OBOA 4YV1A 3NX4A 5EJFA 3IAEA 5AWFC 4QTXA 1DXQA 2JIPA 1NF9A 1T1JA 1J1UA 2YJGA 4LZAA 3I8XA 3RE1A 2UVPA 2HDHA 2I7CA 3KSZO 3K9NA 4HNAB 3FJ1A 1IFXA 2IZZA 5BN3B 1RC8A 4EPVA 4LRQA 4LCEA 4B79A 3CVUA 1DHTA 4YEDA 4EI7A 2ERYA 2ZYAA 5AHXA 1JB9A 1DKRA 1G6KA 1TJNA 2FWAA 4KUHA 2EJUA 5IKPA 1KQNA 4E2FA 2F43A 4RK7A 4B9EA 4IOMA 1XCBA 3CNHA 1DCMA 2QRQA 1KFCB 4GPZA 1FSZA 4KXNA 3PWSA 2QRLA 3WGIA 4CZ2A 3AR4A 2FY8A 3S1AA 4QYMA 4JT4A 3NAQA 5A9RA 5DNVA 1TNDA 1EUDA 4UW9A 4QPCA 4UAJA 1V48A 4EB0A 4XEUA 5BQ3A 1EVKA 2PZKA 3WHKA 5KQSA 1Y34E 3L6BA 1D6MA 4JS0A 5JJ5A 1E3MA 5MDHA 1ISRA 1ZW1A 3CQ9A 4O4HA 2YOFA 4NZPA 2QX9A 3AKYA 4CMHA 3NHWA 2Z09A 5F7OA 2YWHA 2XZDA 5BSWA 5CIYA 4RFVA 3RSQA 5IW8A 4BIIA 3GPDG 1YKSA 3D6AA 4AJ9A 1R6DA 4Z9FA 1TW2A 2TRSB 4POAA 3VKUA 1XPRA 3E2PA 2WA1A 5ECYA 3SOPA 4ETIA 4B3SB 1ZKDA 4FU0A 4OB8A 3U40A 1SHZA 1V0JA 3AF5A 4REQA 4P33A 2G82A 1QIJA 5LQMA 3ZWBA 1OI3A 1ZIXA 1KIFA 2Z58A 2ADOA 3IYLW 2VPQA 4Q47A 5EWLB 1NVKA 3AEQB 4FFNA 3TIVA 5J2TB 2JLUA 4CLDA 1E4EA 2G07A 1XYYA 1EG7A 4JWKA 1NUUA 1ZM2A 2VJBA 5FWNA 1ZHHA 1SKMA 3FWKA 1NKSA 3U5TA 4DNQA 1YB4A 1BKDR 1G55A 2FFHA 5FR2A 2ZBVA 3G2NA 4IGKA 4UE3S 2OCLA 4HQ6A 4LGMA 5ALRA 1PL8A 1P0PA 1P29A 3Q7EA 5GJWC 1CX9B 2I22A 3E3LA 1NHWA 3DKKA 1TIKA 4CKEA 3C14C 1VL5A 3ZY4A 4QXMA 4UEOA 1FTYA 1KY5A 1UBLS 2Q3CA 4GAEA 3H3JA 3U7HB 3Q7SA 2W2VA 1G7CA 1Q7BA 4UMVA 2Q07A 2P2ZA 1SUDA 2WIAA 3PDUA 4LXUA 1R16A 2KBEA 3JSXA 3PRHA 4HLNA 1ULZA 4NJMA 3JQDA 3ANLA 4YJ3F 3CNQS 1GZVA 3PTLA 2PY6A 1O9BA 3I2IA 3KHSA 2J07A 1MB9A 1EVZA 1YULA 2DBYA 5FTWA 1VBNA 1ML4A 4MAFA 1TMKA 4PPFA 3O7MA 2WLTA 6YASA 4E5DA 3WNQA 5LOVB 4YBRA 3QNWA 2ORYA 4DUZB 2R4TA 4QVIA 5CRIA 2C9DA 4OI4A 1KZ4A 2P40A 2BBTA 5TJHA 4KAJA 3JZMA 5FL7D 4YRGA 2FPPB 3KYIB 1QGDA 2ZSHA 3WO0A 3ZVLA 1QK4A 1VKOA 2ZRAA 2A92A 1SBIA 1VMIA 1XRSB 2I4MA 3I30X 1L3CA 4KYVA 4PAMA 5DYWA 3SS9X 1R8SA 1ZIOA 2ARKA 4BMXA 3Q8WA 2XMGA 3HSKA 4LE2A 1T6NA 1KEZA 3VV2A 3Q98A 1JPJA 1ZO8A 4K81B 3SEAA 2QTWB 4C01A 4R05A 2YS6A 4V0OA 3TLXA 1O2DA 4G65A 5AJTA 5E0KB 2QN9A 3SNHA 4C6RA 4FYPA 4ZO7A 3PSHA 1DEOA 1LDYA 2C78A 3TD2A 3V1LA 3U1VA 3DE3X 3IAHA 3ITNA 1WDLA 3GPBA 3E9QA 4FMDF 4OHFA 4F5ZA 3OFNA 4OGWA 2I6UA 4ZVUA 1JJVA 3LP6A 5PNTA 4O4JB 4DNOA 5CB4A 5HKOA 1RKBA 4U7PB 4N0DA 4UUBA 4CR8A 3SQWA 4TKVA 1C7JA 2C4WA 2Q46A 3OM9A 4KZKA 1N2GA 4HN4B 2BDEA 3USCS 4LDNA 4QOSA 3Q88A 5LFAA 4O0MA 4ZI7F 3FAZA 2OXRA 3KTFA 1XP5A 4FR0A 4NICA 1WMDA 4OP2A 1W73A 2YVUA 1Z8NA 4JBYA 1Y63A 4JN6B 4QDZA 3NHLA 2O1EA 5JS2A 4JA2A 5GJBA 4IVNA 3BJMA 3C3EA 1UANA 4Z0NA 1Z37A 4DDTA 3F3YA 4RIHA 3IS3A 1RS0A 3WBBA 6Q21A 1FLVA 1S02A 3LQKA 2DEUA 1JR2A 4MCHA 2C2OA 2QT0A 3R7FA 1G8GA 1KDTA 3NHPA 2FMUA 4MCAA 1XTPA 3RKUA 3BTUA 4DS3A 5C1OA 3KAJA 4Z4CA 1W6UA 1I2MA 2I29A 2D7DA 2VF5X 3F4BA 4QT4A 4ZEVA 5CVJA 1MXFA 2PYIA 4BB0A 1GPYA 3E7PA 1DO8A 4L8VA 1CE8A 2E5WA 3UN1A 1CERA 1WZ2A 1NYLA 1NW7A 4KK3A 1ONNA 3FPJA 3GJ5A 5HSGA 3DTYA 4FE7A 4PIVA 5DKFA 2ECQA 2D13A 2DKFA 3L84A 1TPYA 4XGIA 4FDTA 1EFPB 4OXIA 3AJDA 4OLJA 1WXDA 1JHAA 2MJLA 4URYR 1C7QA 1OZFA 4M54A 2B61A 3FBTA 1H93A 1W1WA 2GJAA 3R6TA 2IHVA 4WXPA 5AD1A 1TCCA 2R96A 4ZT2A 1UZMA 4GL2A 1NMXA 4GWLA 3FXAA 3TEJA 3PYLA 3UTDA 4EW1A 1BDJA 1IBRA 1YTLA 2AOTB 2VS1A 2WICA 4QU8A 1RVV1 4X44A 4CMBA 1XMOB 1TUBA 3FTEA 2WVHA 1T3SA 2RHRA 1KY3A 1L8AA 3BJEA 4C88A 5KYWB 4X65B 3K9FC 3G02A 2X4LA 4Q9AA 1C9JA 3A1DA 1DIRA 1WUHS 3KJXA 1FXWF 1JXQA 4D57A 2WWGA 2EFCB 2UZ3A 3C3KA 3UYKA 4CUZA 3AB7A 3SEZA 1K7CA 2FR1A 1Z34A 4YMVA 5BOSA 3NMUF 4Q24A 5TPZD 3G2IA 4CMIB 4NDNE 1ZHOA 1VJDA 1LRKA 1DVRA 3MTDA 4O2RA 1GRVA 4OHOA 5TQ2A 3IH5A 4YRMA 1SG6A 2C9ZA 2Q1YA 1W8IA 4IAOA 4MYRA 4PCUA 1YZTA 2AZMA 2WUVA 1Q3TA 1K6IA 2YQ5A 2SHKA 3MWGA 1FF9A 1I3LA 3O03A 1JAIA 3NVDA 4NENA 2GVZC 3AF2A 1N7JA 4LJYA 1QG0A 1F1BA 4DJEC 3N1UA 3BJZA 4B76A 3N07A 3FTCA 3PLRA 4X00A 1PR2A 1D4AA 3RSHA 1RE1A 4V1CI 4QU0A 1YU9A 3NALA 3VHRA 5KYXB 4KSYA 3NDRA 4D80A 1XWIA 3PENA 4KAXA 5K03A 3V4FA 4KKXB 3IUBA 4GC9A 5C34B 4DSTA 3ZDRA 3WYBA 2WHYA 1KO8A 1MT0A 2PWAA 4RVHA 5FQNA 4EM6A 2D0PB 4MV5A 1BWPA 1J1IA 1ZGGA 4GR5A 2E4XA 3Q6NA 4DZRA 4QQFA 1UIMA 3Q0TA 1UWKA 5JD4A 4X8MA 3EMKA 5AICA 3G9ZA 1K4YA 4YP6A 2CDAA 1DWOA 4BNTA 1SH7A 2BBWA 1J5XA 5IDXA 3LHDA 2P2GA 2YFQA 4JA0A 1ZR2A 2ONCA 2ZT8A 1KE2A 4P3KA 4J0FA 3HYSA 3I45A 4PZCA 5CJJA 5JRJA 1Q19A 2OZEA 4ZC1A 4C20A 2EX4A 1CS4C 2GD6A 4Z3DA 1NVUQ 1G17A 2J3KA 4N0QA 5CU7A 4ZVRA 3W7AA 5BR7A 4JR2A 2DUNA 4MUAA 1T8PA 1EFTA 2VPWA 3DVLA 1I1QB 2X9QA 3HBAA 3WLFA 5IF3A 5KYYB 2QN3A 5EJ4A 3UUGA 1KZ7B 2Q9UA 1UUFA 3BIOA 2OXTA 1O3YA 1X7WB 3OZ7A 2P2CA 3D4OA 3HO1A 1WIWA 1H4QA 3N8HA 3F7NA 2B8NA 3LRXA 2GEKA 4E5NA 5LKAA 5C8YA 3DW3X 2FX2A 3FG9A 3IAS1 2OO5C 3E3MA 4QA9A 1THGA 4GZ5A 5JAMA 5E8RA 5HZGA 2ZR8A 1NBWB 5EJMA 4FMCB 1T24A 1QCYA 4WXHA 1A2QA 2AK3A 4FN4A 4ZT7A 2F59A 2NNLD 2A30A 2GZDA 3LW8A 3NGXA 5HA5A 4R0NA 2OC4A 2O48X 3NOXA 4K6CA 1RBYA 3NCTA 4IEEA 1GNRA 4U2BA 1A1VA 1JG4A 1C3EA 1RC1A 1LNQA 3OIVA 2C0CA 1QIDA 1KFEB 3UXEA 4LX8A 3ZJYA 3JWPA 5HIAA 1S1MA 3P2MA 4V2UA 2B1RA 4URXR 5EJ2A 3GGSA 1E5XA 4DABA 1U1CA 5AKIA 4KSBA 5CNIA 3R0QA 4DJTA 5JADA 5H9VA 4U9UA 3N9IA 4RF2A 2XZOA 2ZB8A 4R1LA 3ZCSA 1XZPA 2WTAA 3BWEA 3F4LA 3ZU3A 1T15A 1U2ZA 2H16A 3LECA 3JWIA 1UXHA 4C4YA 2EGHA 2QL9A 4NG4A 3PU6A 2XWBF 2VQ3A 4N5MA 4BMYA 4DXAA 2C00A 3DE7X 2DT8A 2JASA 2VRBA 1H2AS 3NBKA 2FF7A 4PQGA 1Q21A 4OMUA 2IHNA 5ED0A 1WTAA 2VT7A 2XOKA 4WNCA 4XGRA 1F0KA 4OL9A 1Z4MA 3KYCA 2X0IA 3R3UA 2ZULA 4BZXA 3K1AA 4FDAA 5CLHA 2ZSFA 1Q2UA 1JFVA 2BUCA 3A6JA 3TZEA 2IP2A 1PD0A 3MMXA 4II2A 4Y7CA 3BKXA 1U2PA 1VI6A 3V8EA 2R1TA 1M1NA 1ZCAA 1RRPA 1NKVA 1LJLA 3CPSA 3GCDA 1MD9A 3G2OA 2D3WA 1I6WA 3K2EA 3LDUA 4TWBA 1XNGA 1QZTA 1YQTA 2ILVA 1MB2A 3AK4A 4MMYB 4P93A 4YRFA 4AMYA 4ZGWA 1Q0HA 1BX1A 1AQ6A 3AEKA 3PEYA 2AFIA 2P3SA 5LIPA 3EOZA 4WDRA 4JR1A 1O0BA 3VR6D 3H5WA 3OZWA 3RPEA 1N1EA 4AFNA 4Y6RA 3AQIA 1QIGA 4XJVA 1X94A 1HL7A 2ZTVA 2GPWA 5ESRA 3BDIA 1GN8A 1HTTA 4PSDA 1R6TA 4DBVO 1L4EA 3WA7A 1KP2A 2QVLA 2BV3A 3OQJA 1XZ8A 1JI3A 4XTRA 4EGCB 3RAEC 4CVNA 2VDOB 3HJUA 2ZZMA 3REQB 3R3WA 2D3TA 3NRBA 2BMJA 5CW2A 3KJGA 1I4EB 3PJRA 1E89A 2P1ZA 3O3CA 2V65A 4H1TA 4KG7A 4RA9A 2H18A 4RJLA 3WV4A 4H3SA 1EBFA 4XUGB 1HQYE 1MAUA 3QVMA 3FUUA 3PYXA 4HGQA 2A2ZA 2I6TA 3S2SA 4WLOA 2QU7A 1GCOA 2R8PA 1DV1A 3EQZA 1VLJA 4X93A 3IMKA 2DSNA 2ZVQX 4YB8A 5H16A 1YCFA 4BE9A 4L3OA 3I9MA 3C5HA 3CISA 3NP7A 4I1RA 2JLWA 2Y4NA 4RVCA 4ZHQA 1PT9A 4E32A 1RHRA 1VKNA 3D02A 1MA3A 5CVEA 2WHQA 5MF6A 3COJA 2B4QA 4EG6A 2G1KA 2UUCB 5BT9A 4A0SA 2G06A 3IEXA 3WMGA 2FFRA 2VYVD 1ADGA 3RUIA 2HT6A 4NOMA 1YR6A 2Z5GA 5REQB 2FX3A 1NBMD 4KQ1A 5T4BA 4DWOA 1XU7A 1NYQA 2DLCX 3NAMA 2SCUB 1YZGA 2Z2IA 1WUKS 2VRNA 5ICCA 5B58T 3ML1A 2XCSB 2XDYA 1X1AA 3TNJA 2CLEB 3ZXIA 1WSAA 2FEWB 4WACA 4X1IB 3WLKX 3B1VA 1UBEA 4N65A 4MVYA 1L8QA 5DOVA 3B12A 1X8JA 3GHYA 5EE5B 1FNCA 4MR9A 3QU2A 3QELB 4JVMA 4PONA 4DANA 4CETA 3VMFA 4MGIR 4TKUB 3RHTA 1MGOA 3IDSA 4KITB 1D2EA 4JI3B 3WDMA 2WF5A 3PJEA 2YMPA 1ZNZA 3FPCA 2XB4A 3MMNA 4PYQA 2YY5A 3PX2A 1YJ8A 2BMVA 2HSDA 3ZYCA 1V5EA 3N8KA 5EWMA 5B1DA 3THXA 1A96A 3A26A 1DRUA 1Z2OX 3E6AA 3WWYA 5FP0A 4LFBB 2QG6A 2O5VA 4R9VA 2VTDA 4Q3EA 1XF1A 1T9AA 1U90A 1ZGJA 3C87A 5KWIA 1H0KA 1JZQA 1TMOA 4RJ2A 2RFLA 3ZGZA 4N9QA 3CZ5A 3KTDA 3NC0C 1HEIA 1YRYE 2BEVB 3WA6A 1U1EA 2H59A 5TGTA 3TG8A 4RPHA 3ZHXA 4RGBA 2GZ2A 1NQOA 4RU1A 2AT1A 4L02A 4TS9A 2DPGA 4RMGA 3U49A 4X64B 4ZK6A 1WPXA 4LJAA 4JGBA 2D7JA 3MG9A 5A03A 1G1MA 3RU2A 2Z98A 4D4IA 3IPLA 1IY9A 3M1LA 4H0CA 4LZNA 5CB4F 1QAMA 3FNEA 5A6SB 4FUTA 3ZHQA 1B73A 1XJCA 5HOEA 1EESA 3QUSA 3BEOA 4WBXC 3CKKA 3OUZA 3Q5GA 4B6SA 4I4IA 3ZG6A 1THMA 3SC4A 2X8AA 1DEXA 5BSKA 3KK0A 2WA2A 1CUAA 1J90A 3WQSB 4L08A 4Q9LA 4BBJA 2GPAA 3U80A 3VU8A 5FOWA 2ZR9A 1TYCA 3EZLA 4L5JA 6ADHA 2HX1A 2O3TA 3QXSA 4HMQA 2FJPA 4YJKA 4ENWA 1PYOA 3I23A 4YDHB 3SJAA 3K0FA 2HXGA 2BGIA 2GTPA 5HFAA 1L7QA 5JQGB 3I28A 1XP8A 4ZHSA 1Y81A 1X86B 2VOEA 2IKSA 3MQFA 1G5QA 4HI0E 4G84A 1XTBA 2AN1A 3O8QA 3P7MA 3BGOS 3P19A 4P83A 2H7XA 1KZ1A 2G9ZA 4CKWA 3R4CA 4M60A 2ZYRA 3SICE 2VHCA 4B80A 5A9SB 4AICA 3H1FA 1KO1A 1RQRA 3SQDA 2DM6A 2ON6A 4EW3A 3J7TA 1C4OA 1AK1A 4FHZA 4M9SA 1YBFA 1LD3A 2YNMD 1NQWA 3G0DA 1QR6A 3I9KA 1J8YF 4LXTA 4TLDA 3R7WA 3GAMA 4M1KA 3DP7A 2GKSA 3U2QA 2P68A 4XDZA 4ZMBA 3MELA 4Y2SA 2I6GA 5E0OA 1PZMA 3CLUD 3TW8A 1HMPA 2VJLA 3CIFA 1RIFA 1DLJA 3BGDA 3CLTD 4GE3A 4QWMA 3VBCA 2QSYA 3GH1A 3W6ZA 4KI0A 3TL6A 2EF1A 4JXKA 3MXTA 4JX9A 2QNIA 3ELYA 4X3PA 4B7AA 3UB3A 3EXG2 4G5RA 3FNBA 2VLIA 4MUJA 3K1JA 4PNEA 1FJ2A 4IDQA 3JYPA 1EGVB 3I9JA 4A0GA 1YZFA 5C3UA 4DADA 4O8CA 3PBKA 1O89A 1XMVA 3EXIA 2PUAA 1GQQA 2OXEA 3N2LA 3K70D 1ZMXA 1TYAE 4FT4A 1R5BA 3BRWA 4TQGA 4P3NA 2PLWA 3STTA 3GPIA 4ZYVA 1L1QA 4F4HA 3ZV6A 4E22A 3DV0B 1M6EX 2A0YA 3H8VA 3INGA 4J7UA 4RJIA 2WT4A 3VDNB 4OGGA 4D3FA 4O4IB 4EZEA 5AKLA 1VE5A 4ME6A 1TMYA 3FGZA 3TRJA 1WMBA 5C18A 5JSZB 4JI2B 4NXNB 3UK6A 3I4CA 1FNDA 2GPNA 1TM7E 4GX5A 1MX1A 3W8RA 4FHDA 1X1SA 5TGDA 3WK7A 1Z4PX 2AZTA 5IHXA 1UOPA 4L8YA 3W79A 2NSHA 1EGQA 1SNYA 2Q1XA 4JLNA 5JRDS 1F14A 1SUWA 2QJFA 3EZ9A 4HEQA 5JQGF 1CP2A 3HB4X 4JLAA 2ZYUX 4JX8A 3RBZA 3SKVA 2NVUB 1OLOA 2V03A 4IXTA 4F97A 3AR6A 2XWQA 3OE5A 1NMQA 1PD1A 2XMQA 3PQDA 2VSOA 1NLUA 1BDIA 5KU7A 4DCSA 1ZEJA 3NNSA 3WNBA 4HNSA 3A06A 3IPCA 5HQ3B 2A78A 4BO1A 1FRVA 2F3QA 3W05A 4LV5B 2OO5A 2X7JA 1YQUA 4G0VA 2V5AA 3T4XA 4MS4B 3TSYA 4QUDA 3LUPA 3CUWA 1HX7A 3GVHA 2B30A 3EJ6A 2UXCB 3B78A 1YS7A 3CJTA 1JHUA 2JFXA 4JB2A 4KTTE 4N6OA 3T3GA 1HFEL 2BCGY 2HM7A 2RH4A 4R9RA 1USGA 4HDSA 4YRBA 2VBGA 1A77A 3WFIA 1DRVA 1XCMA 5IT0A 1XKXA 3KBBA 1WWKA 4HVLA 4JLVA 1WDWB 2WSLA 2I4OA 2PH3A 1JTEA 3EZXA 3KG2A 2C5EA 4DRYA 1FUYB 3IKVA 3U4CA 2QMZA 4D92A 1Z3CA 4HLDA 5LD2B 2FWIA 3LTEA 2WJ6A 2HF2A 3X2SA 8LDHA 2P7IA 4NKRA 2QTRA 2IP4A 1XYGA 3GQBB 2NMVA 3U3OA 5BNIA 2GO7A 2WF6A 1TM5E 3MPUA 2X0JA 3ONVA 4K03A 1KEKA 5BNWA 3QEJA 5KYUB 2DUMA 3OJEA 2BFCB 3VU9B 2M1XA 2RHWA 3RRYA 4ZU6X 2IY8A 3OKCA 4RF5A 3O9MA 1NI4B 4ZN6A 2CKDA 5EGNA 3LU1A 3B8HA 3QNUA 1JHYA 2QLLA 2W6MA 3R5KA 3T1HB 3GHHA 2BFEB 1EB8A 3F71A 3PRJA 3ZXXA 4YCNA 4QFMA 5C8YF 2FI1A 4MWEA 2C77A 3OJCA 3ZE6A 2WZCA 2XMZA 4XVCA 2YXBA 2G5GX 2WIJA 3F8WA 3AFHA 3LIPA 4NABA 5KTYA 1D8TA 2IU4A 4R1SA 4ZJZA 4YHHB 5BV1A 3D7RA 1CETA 1OTHA 1M66A 4N7MA 4L5AA 3L1KA 1TAUA 3DMYA 4JFAA 5FV7A 1SA0B 4DREA 3CUEF 4FM9A 4U63A 3ES9A 1X2EA 1S2GA 4R31A 2YJTD 5JMPA 4B7ZA 4LJ4A 4MS1B 3EIWA 3DCJA 1ZOIA 3MJEA 1DX4A 1B8VA 4IDGA 2FSSA 1AX9A 4PVCA 1CRZA 1M10A 1PP4A 2G1UA 3TXAA 4CKCA 2CJFA 1JLMA 3G3EA 4NX2A 1J23A 5EJ5A 5JZOA 4IM7A 3OPQA 2NP7A 1IUKA 4HH1A 1BOFA 1A2BA 1FUIA 5SYNA 2PZJA 3WDKA 3GD7A 3G8BA 3Q9NA 3RFTA 2P91A 3B7GA 1S2LA 5M5BA 5I4KA 2WY2D 1PGPA 1KJ9A 3LO8A 3KWJA 3VKHA 2WDZA 3I9NA 4M76B 1FNNA 2WT8A 1XOIA 1OXKB 2OVFA 2CF6A 1EX6A 2AXNA 2QE7D 5EEGA 2UYGA 3PQ7A 3Q7TA 1JPNA 3C3AA 3PHJA 4K9DA 4MWCA 5DLQC 1W9MA 4A2WA 2ZI3A 1Z9BA 2BMWA 1MV8A 3GMTA 1B0PA 1WV1A 2GX6A 4AQDA 4TRNA 2WJZB 2XUOA 3DO5A 2J5BA 2WJIA 4MI9A 2DKNA 2AN3A 1U7TA 2HDOA 1G9SA 1ADBA 3MBIA 3DE4X 5IPFA 1V5FA 5AKGA 1D4OA 1NR5A 2NZYA 5K0FA 1FP2A 2IYOA 5DYYA 1JB1A 2F4NA 2X3YA 2OBMA 1EFDN 1XA0A 5KJFA 4P80A 4XIFA 3DD1A 4D9MA 5I8ZA 1RAIA 4QFDA 5CFNA 4EX7A 1HE8B 4HAWA 2WIBA 1QGUA 3KCNA 4F5WA 1PE0A 3C7AA 1L5FA 5JIBA 1COWA 2J9GA 3TRDA 2LVBA 2QM8A 3ASYA 1NVFA 5CGZA 5GJCA 5G02A 5A2GA 1V9SA 1WR8A 2GFIA 1OFTA 1K5HA 3B70A 3GROA 4FW8A 2J0VA 3W04A 1PO7A 4Y6SA 1MMFB 3D4LA 1F1JA 2YASA 3VKGA 4WA8A 3OECA 4X95A 5DT9A 5EMMA 2J0EA 2VJQA 4PZ0A 4XDYA 3KLNA 3K70B 4DQXA 3UF0A 4BRUA 3IODA 4FFMA 1TADA 4KVFA 3STVA 4G89A 3BILA 1H94A 5EESA 1SUAA 5LLTA 2NTYC 4DJFC 4NR0A 2IW1A 2YV1A 2EJVA 1QO9A 5I3CA 4YJHA 4TVSA 8ADHA 1QNLA 3RVRA 4ZEXA 3EGVA 3R7BA 5E6RB 2HQSA 4PTLA 1R0RE 2QX6A 4X71A 1C80A 3HM9A 4LMRA 3DEHA 1C5KA 4FOTA 2XJ9A 4QKQA 1HV8A 4ZHQF 5C3MA 2GJSA 2ZBRA 4TMVA 1FUEA 2JBAB 2W22A 3RODA 3RFUA 1C0EA 4P22A 4OLAA 3ORYA 3FYSA 3Q8LA 2D00A 4YI3A 5JH7F 4HNVA 4ZTZB 5JPDA 1FVXA 2OFWA 2AE2A 1MJGA 1QVVA 1FFGA 1T0IA 2R6CA 4O2AF 2XYQA 4GOXA 3BL8A 1TJ4A 1U8EA 5HRUA 5BNZA 1MQ8B 2I7DA 4NG5A 2F55A 3OQHA 3PUIA 5CLIA 5E2IA 1T2DA 1WB4A 4DSZA 2Q7OE 2PUEA 1OTYA 4PLPA 4BCDA 4GVLA 2PMBA 3H9GA 4BECA 3Q3VA 4ALNA 3UOWA 2OHFA 1GDDA 2DHCA 2JIMA 2CXTA 3D8TA 5C4IA 1KERA 5JHGB 2AJBA 3PE3A 5U4XA 2AFRA 4D8XA 4LSZA 2V5VA 3ZDAA 1JAZA 2Q9AA 4Q4CA 3DMGA 1Y82A 1L7XA 3ROQA 2HA2A 3QVKA 1VIAA 1Z4QA 4P4SA 1K68A 3G59A 3ENNA 5DH9A 5MHTA 2ZT5A 4DLAA 2PO7A 2IOYA 1R2QA 4ZIRB 3U13A 2W00A 3A2LA 1XLUA 3WP1B 3KX2A 4HP8A 3KQOA 1Q16A 1AZLA 2OBBA 4JLMA 4A23A 4CLRA 5L40A 3SYLA 3I58A 2QTVA 3EBLA 4FD2A 5H3LA 3C7DB 1R37A 1XCOA 3HKCB 4LEIA 4BTLA 2XI4A 3EODA 2WAXA 3HYLA 5A4JA 1U8ZA 4MHOA 5KYTA 5TLSA 2GJKA 3JQ6A 3OJFA 1FMJA 1YCHA 4MQ6A 1SAYA 1CB7A 1WCXA 3ODGA 2YMMA 1U6KA 2JATA 2IXFA 3M70A 5FXMA 2XTNA 2RHJA 4F11A 1YFZA 3GRCA 5IJ0B 3X1YA 5HTOA 2A57A 4YHBA 4R2LA 2W2TA 1C4WA 4PS1A 3QUCA 2JD1A 3DHWC 4JUFA 2OCDA 1N0VC 2Q41A 3R4VA 3K5PA 1NVVQ 3NFYA 3L7JA 1Z4KA 1N5DA 2C59A 1Z73A 1I4DD 4BAZA 4YRQA 5B6IA 4X8LA 4FGUA 1HDXA 2SBTA 1D0VA 5D3ZA 3EZYA 4KGVA 4C21A 1HTBA 1Z2DA 3PI7A 1H6AA 1XVUA 1PN3A 4KIUA 1RC0A 1RE0A 2YWJA 3CEHA 1U1IA 2BZSA 2RK3A 4MW2A 2JLZA 2LWIA 3QFRA 4QEZA 2BHNA 3SSNA 1ORVA 1SCQA 4A6DA 4FYHA 3SQLA 3M89A 1E2MA 2GRUA 1SU7A 3FSJX 4E4TA 5FPYA 4OI2A 4MGZR 2QD2A 2PS3A 3MIZA 4MV9A 1CR1A 1U2DC 2GK3A 2PUGA 8MHTA 1CUIA 3GDOA 3RC7A 3EEYA 4GZ3A 1N3BA 2PGOA 5B3KA 1VA4A 2P41A 4LXHA 1AZWA 3AM4A 4A5OA 2BZ1A 3RUEA 1Y8QA 1V26A 2FPMA 2YXDA 2WILA 3BFKA 3L0SA 4YI5A 3LL4A 1CJUC 5K8UA 2VDPB 1FFHA 2F00A 2QR2A 5ER9A 5CB8A 2DF8A 2H2WA 1I6KA 3RYHB 3I53A 3ZXUB 4TLCA 1HETA 3GX1A 4EKYA 3WMEA 1EB9A 5E7IA 3AY3A 3OZFA 3FKSD 5CP8A 4E21A 4AKGA 4DAEA 3ND6A 5GVSA 2GJ4A 2Q5HA 3I34X 5JYBA 5T7BA 1XRLA 4RH3A 2B1IA 1BS2A 2R7MA 1G6Q1 2O0LA 1NM5C 2OAQ1 2X14A 3HXLA 1C3VA 5C35A 1N2XA 3NYWA 4D82A 3W2IA 3DMTC 1K7FB 4WY2A 4LFCB 2VHZA 4DNXA 3MOIA 5JFOA 5C53B 2PLRA 4W6QA 4S1OA 5JE8A 1FP6A 4Q21A 5DDIP 5C8VA 1F2UB 2YFYA 4HCJA 2Q2WA 3WISA 4DYDA 1EP2B 3E15A 4PC7A 4M8SA 3OT4A 1HRDA 5CFOA 3A2MA 4H7DA 3DBLB 2A5LA 4N8DA 4EOGA 5KQMA 1B15A 2OOKA 3DEKA 3NBYC 2XIQA 3B1XA 1EPUA 3N5CA 3QU4A 4XB6B 1V1JA 4BYGA 1DINA 1F4VA 5K6AC 3BGIA 3FFWA 1CLEA 4W63A 1E6CA 3SVZA 3V1KA 5COBA 4Z3OA 3CURA 4KQ2A 4KXLA 4IXDA 4J91A 1FU8A 3AU8A 2NU8B 5DCYA 3T5BA 3JZIA 3U7GA 1VCHA 2BHLA 3NR2A 4HZUA 4KO3S 3SJCA 4D44A 2V3CC 1Q91A 3M9WA 3U0BA 1A95A 4BP9A 1RRMA 3HUEA 1GU7A 2G28A 4YASA 3TF5A 4W99A 2WMOB 5BMVF 4XM2A 3HKDB 3NKVA 1T5LA 4LZZA 1MEEA 2Q5CA 2A9RA 3L7KA 4YJ2F 1T9HA 1X6VA 2XF8A 3GEMA 5L6LB 1Q20A 1X38A 1U8FO 3KL2A 1RWNA 5EQDA 1CUZA 1J0AA 2DECA 2XUAA 4P58A 3A0UA 1Z7WA 3D6MA 2AX3A 2CXOA 4KB5A 1H1DA 2JIOA 3PUVA 2JGIA 3GFQA 1LLFA 1SKBA 5KNCA 4KQGA 2HQRA 1QO7A 5IKOA 3ISVA 4UCWA 3T7KA 4EECA 5KTKA 5FFMA 6ABPA 2PUJA 1U7HA 3LXUX 3KAQA 4HBGA 1XLTC 1Y7PA 1GPWB 1AMNA 3BXHA 1POWA 2BR5A 2HMAA 2RJNA 2PH7A 4NFSA 1JDVA 3NW9A 2CLOB 4CDRA 3NANA 1QB7A 2WMNB 2QXYA 2W2LA 2O7QA 3AONB 3LQYA 3R3JA 5JCPA 4UMEA 1JDUA 1NI5A 2OUIA 3THOA 1EZ4A 3HZZA 2QTNA 1JN0A 2H1CA 3IAUA 1U0SY 1QQ5A 1HK7A 4GNRA 4J0GA 1P62B 1TEVA 2FH5B 3WZ2A 2LTAA 4X90A 3E1GA 4S24A 1SQ6A 1N2CB 1R7RA 1L5SA 1RMYA 4MIEA 2XMCA 5FWYA 2IYNA 4PFKA 5HS4A 1OLUB 1E8NA 3SJ7A 5AM2A 2NOAA 5K99A 2P78A 2QU8A 3QWBA 4B6JA 3P9IA 1W5TA 3CSSA 4HATA 4KH1A 4RGVA 4IO1A 5M34A 1C1XB 3GRFA 1KVQA 1DIHA 3O8CA 2BGGA 1TO6A 3TDKA 1ESZA 4FDLA 1ZC3A 1AQUA 3JQ8A 4NCHA 5KTNA 1OD6A 2H8GA 3VYUB 2QR5A 3O4GA 1ZR4A 1G18A 2PRSA 4BQFA 4A15A 2N1BA 4P7BA 3ZWMA 1JR6A 5C52B 3K6KA 2W8ZA 1MC5A 1W44A 1X1RA 4IS2A 4Z7NB 4ARCA 3W2EA 4NE7A 1E8MA 3BK2A 3U3KA 2GNAA 1KEWA 4OQDA 5IAAA 1RU3A 2XE6A 4D9EA 3TIIA 4DMCA 2POCA 1ZD8A 1QB8A 4M7RA 4M0PA 1KK3A 2WZDA 3UAZA 4CM7A 3OHMA 2Q8QA 2RGNC 4ZOQI 3FIJA 3UMYA 1G5HA 5D5QA 1SCDA 1I7NA 3TQCA 1LTQA 2A9VA 1UBFA 2QJWA 4MB6A 4CKBB 3NIFB 2W2QA 2YVQA 3Q1KA 4OX9B 1CRQA 4LBWA 5CURA 1RCFA 3WZMA 4DY6A 1XQ9A 1XT6A 5KHOC 1OKKD 1QGAA 2O05A 1L1RA 2AX4A 4KHZA 1M1UA 4MPJA 3JVVA 4GH5A 4BOYA 1ISIA 3EQ7A 1XDWA 4OFBA 1CUSA 1O95C 4A7PA 3KELA 5IC6A 2Q6TA 3LUDA 4JLDA 3G2LA 1PUJA 3ZTWA 4ZQEA 4HBZA 3W8FA 4NULA 4UULA 4X92A 3H5LA 5JDCC 2ASEA 4DR2B 5JU6A 4JQSA 5F9MA 5HJ2A 1VJ1A 3D0QA 3W9BA 3TL3A 3N6VA 2ODNA 5AKZA 3R24A 1B6GA 4EUSA 4FQ5A 4K6OA 3L0OA 3S0JA 5BQXA 2OLKA 1E9BA 2H4ZA 3DDWA 4F21A 3K5HA 1R8QA 1TQHA 3EMDA 1AV6A 1OQAA 1UQUA 3H18A 5BURA 5DGHA 2V6GA 3U7QA 5K7SA 4MWZA 1W0JD 3A37A 2JNWA 4GQAA 4JELA 3D8SA 1ZONA 1AZTA 2XA9A 3M1YA 2ZSUA 3R0VA 1QTNA 1JBEA 3WRYC 1CT9A 1ZGZA 1ATZA 2NXWA 2ZJYA 3OEED 2UYQA 1QPBA 4MLCA 2MWMA 1J2RA 1SUFA 2WJHA 3K70C 1EFLA 4EGJA 2VRCA 4LS3A 1Q92A 3MQ2A 2DFKB 2VG8A 4O29A 4MJXA 4BE7B 4ZPXA 2X9VA 1VHTA 3IUEA 3HMQA 5T4HA 5I8PA 5JD6A 3AKCA 1CQZA 4PCLA 2H65A 2C97A 1FUKA 1Y3DE 2NAFA 3MAJA 4C2TA 1PQWA 2X1HA 4O63O 1JH8A 1J42A 3R8FA 1Y6GA 1XK7A 2Q27A 5LMNB 3M4XA 5BSGA 1A71A 3R5HA 4BPRA 1ZI8A 1A9XB 1GAWA 2HSWA 3V1NA 2JDIA 1EK1A 1C3LA 3RJ5A 1CNMA 5AVSA 1T26A 4MR7B 4EB3A 1NP3A 1W4CA 3KVRA 4TT3A 1U9YA 3ZOKA 2YZ2A 5J2UF 4W8OA 1RR6A 3HE3A 4IOLA 4RFLA 5D86A 3RGWS 4RWZA 2VP2A 4HRXA 4G4JA 2PZEA 2KI5A 4U5QA 4IYRA 4Z0TA 1ZI6A 5T6MA 5DGIA 2VI5A 2OXCA 4HGOA 4UHBA 5H68A 4NE9A 3A6FA 4L27A 4M1WA 5KDLA 1BWRA 4YJ3B 4FBGA 2EKDA 4C4SA 1JVBA 3MCZA 1H8HD 1XZCA 4TOIA 2FW0A 1UKBA 4WZAE 1Z6AA 5FR1A 5BNTA 3FM9A 1WDMA 5J4KA 5JAOA 4AROA 3EWIA 2R1VB 4H16A 1Y6RA 3I9LA 3IIEA 1BEUB 4YS6A 1SXHA 1BHO1 1FFSA 3KLBA 2FMTA 4B87A 5A3JA 4UHJA 5AVWA 1VOTA 1TLFA 1JU4A 4XQCA 5AVQA 1RHJA 1FNSA 3EMBA 2IP1A 5L3SA 4W5NA 3WLQA 5G1OA 4GOMD 3VO9A 4D74A 3CVXA 4MX8A 3HEAA 1GTL1 2W9XA 3IVCA 5JLJA 3LMKA 1KS9A 3QM1A 1M75A 4MS3B 1LBHA 4UNNA 2IRWA 2OZKA 4TZKA 1PEKE 1AIPA 1S9HA 2AXPA 1R64A 2QS9A 1E3IA 2XX3A 3DVSX 2A35A 2JH9A 4XJSA 4FN5A 1SHKA 3QU7A 3JRXA 3PXUA 3IOYA 1U2DA 2NU9B 3LK6A 2PD4A 2MSDB 1LLCA 1PS9A 2OV2A 3J81k 3JZAA 4OY3A 3SXPA 4YJDA 3X1KA 4UARA 1OB2A 4Y0NA 4DSOA 4U7DA 4LKRA 4FMDB 1XJ0A 1LDEA 3O6VA 1W0KA 3QG1A 1UPFA 1LFAA 1XXHE 2C82A 4ND6A 5EUBA 1CZNA 2VPTA 3IQXA 3COPA 4F3KA 1XXHA 1S3FA 5F78A 1I13A 4EJFA 3Q7PA 3C6YA 3AR9A 3ODPA 3PCXA 3SP1A 2WQ7A 2REQA 3EEIA 1I6LA 6NULA 2FN7A 1U94A 3WP0A 2D5AA 5AOAA 5IYZF 1BXGB 3F5QA 3G5AA 1U9ZA 3BC1A 4OHPA 1EXMA 2JKYA 5DHTA 3W5CA 3T3OA 2IPXA 1NM5A 2XUQA 2PV7A 3QTBA 2B5VA 4CF4A 1J56A 5ALOA 1ZMRA 1GPAA 3RRMA 3DMTA 3TM5A 1R1DA 3I83A 5EFZA 4R71A 3KQQA 1N6HA 4RETA 1KTIA 3RYCB 4M36A 4CEIB 4BLRA 1DFHA 1O8BA 3KU1A 4MI6A 1F3OA 1KBOA 1USWA 1NVGA 1Y8RA 2NUAA 2VZLA 2XTAA 5E1MA 4QJ4A 4IIJA 3K4PA 1E96A 5AJVB 4CGZA 1QP8A 3KRTA 4HS4A 1G8FA 4KACA 1AUVA 2YUTA 5CHYA 1XELA 5FUXA 1I2BA 3KFVA 1NV9A 5HZHA 4GO1A 3FYUB 3ZKWB 1RRFA 4MUEA 3FCOA 5K6AA 2AR0A 3T7RA 2IE0A 3FWZA 4WN3A 1EFUA 2Q28A 5EKDA 4AZTA 3FTQA 1ZBQA 4O2LA 4WZ6A 3SNKA 1UK9A 3JD4A 1SC6A 2VTKA 5FFNA 2XKKA 3RYTC 2EW2A 1YOVB 4A1OA 2I7VA 1HLDA 2EU8A 2NYUA 3DL7A 3EUWA 4M7OA 4TGLA 3UTCA 3ZV4A 1W2WB 1ZNYA 2GSDA 1CYDA 1ZAKA 2YIMA 3AG6A 2B9VA 3A1NA 3JVDA 2HTEA 4RD0A 1IOZA 1M5UA 2GBIA 2PH1A 4BNLA 1FMFA 4R2HA 1XFAA 4L57A 1LRJA 4ZXPA 1XRMA 4NFYA 5C7LO 1UDAA 3PSAA 3BD6A 4B3MB 2ERXA 3CIOA 1GRRA 3QUAA 2PSFA 5KJ1A 1FYDA 3C6XA 4O3MA 1KNXA 2O14A 1R9MA 3AIMA 4KWEA 1PWXA 5EG5A 3WYDA 2WU8A 3MD9A 1BQEA 4MTCA 1YZVA 3BTSA 3F5FA 1YJCA 4E3ZA 1F2TA 1XLTA 1KJZA 1MUUA 4OFZA 3NT5A 2I99A 3PE4A 4AXBA 5EHIA 1J07A 1E62A 2HA0A 2K5UA 2OM2A 2XNDD 5F33A 2RCNA 3M33A 4AKTA 9LDTA 4WPGA 1J24A 1TT5B 1UJMA 1YONA 4A26A 2XRYA 5ICGA 2AMYA 2DY0A 5BUZA 5HF5A 3VPHA 4X1KA 5FO0A 3F73A 1PNRA 3H5AA 3NHAA 5IH3A 1OY1A 3VISA 3MYRA 3W0LB 4NATA 2FHPA 2MU1A 1XZGA 1M6VA 3LF1A 3UJ9A 4MV8A 2AEEA 5CA1B 5IJXA 4RZ2A 2WM8A 4DSAA 4H60A 2YHUA 1DOZA 1QK3A 4B1FA 2HZ7A 2Y4OA 3D4BA 1AVTA 1R8XA 3QOWA 1QG4A 4OHBA 1OA0A 3FROA 4CXMA 1MHTA 2J3QA 1WZEA 2I62A 3DAYA 1WMFA 2J67A 1E5TA 1Y5IA 1V95A 3UT6A 3HPRA 5JC8A 3JARB 2PL9A 3KQMA 2POQX 3O5AA 4C0WA 4EVIA 4J7CA 1Z63A 3AFGA 5FPTA 3E3OA 2BEUA 3TCXB 2ZCVA 3DC2A 3KKNA 2OM6A 3DOEA 4QBKA 4OI1A 4KREA 1A7UA 1MO6A 2IYFA 3CWCA 2QENA 3TSCA 1IEVA 6REQB 3K9CA 4YVFA 1O94C 4MVJP 1FLAA 4JP1A 4RADA 4UMFA 2OESA 3F9RA 5IN5A 1TQ4A 1HG1A 3QITA 1YRHA 1Z68A 3L43A 3NWBA 4OHXA 3RQIA 2VO1A 2M9MA 1Y3CE 2PUTA 4L3VA 1P7VA 1KY4A 1ZL2A 3PHGA 1R6VA 4CV0A 2ONYA 2OUKA 2TYSB 3L3BA 2GYWA 5B58C 2RGNA 3GNQA 3GT7A 3QXHA 4ZGGA 4URFA 5D3KA 3ESXA 3F3KA 3TB4A 3TLAA 4KYUA 1JDBB 1XMJA 1IBMB 2PO5A 3S28A 5JYEA 3U0VA 2FEKA 4P35A 1EWKA 3P2IA 5DBFA 4K88A 3L8DA 2YHAA 2QMHA 2HXYA 4D2IA 3EXG1 2W0SA 1N78A 3TXYA 3RJZA 2GCOB 2H1VA 3IHLA 4MWGA 5F1YA 3K30A 1MV5A 2QRVB 4R8MA 1MPTA 4Z1MA 4OH7A 4YX9A 2Y8EA 3BK1A 4XYEA 1P2GA 4TTIA 2IF2A 1EDEA 1ULUA 2I8LA 2Z2ZA 3B3QA 4LZOA 1NN5A 2QSJA 1E6LA 1LW7A 1L5LA 4MEAA 3DT8A 1JNYA 4QUHA 1YTUA 1SCUA 1W4AA 3DWGA 3I5MA 4Q4JA 5SY9A 5JDCA 1KMHB 1UR5A 3QKSB 4AULA 3RADC 5JBQA 3HJHA 4J3FA 3L0DA 1EK0A 2ZB2A 1PR9A 3OLXA 4LXXA 2Q5LA 1TYEB 4WBSA 1PZNA 3E48A 3CRNA 221PA 1U1FA 5BV0A 4LK2A 1IHYA 3QE9Y 1QV7A 1IVNA 5THQA 3DBHA 2QVCA 3I04M 5FT9A 121PA 2ZAGA 1JFTA 4L51A 2OECA 2CDNA 3WLJA 3PTZA 1O57A 4R8RA 4HWTA 2XR1A 1QCZA 5COQA 1VE3A 3H9CA 4JQOA 3AVPA 5DHAA 5AM4A 1W49A 1L5HB 3T7SA 1BROA 1UH5A 1Z13A 4PGHA 2ZS9A 4V0KA 4DY4A 2FFAA 1X80B 3WRYA 2N9UA 4BJ6A 4QTYA 4M1TA 1GEEA 4QE3A 4II3A 1FYWA 1MO3A 2JA1A 3A6HA 3RC2A 1SVWA 3LPDA 2ZJ4A 2CKMA 2H6EA 4JGGA 4RUKA 2UVPB 1CF4A 1XMPA 2CGEA 2WJ4A 4C2AA 4FYMA 3AJRA 4RPJA 5AM0A 4G6ZA 4CUKA 2VDMB 4XWYA 2ZPTX 2D2XA 4CCYA 4KN9S 4JBWA 3ZK9A 2O5RA 3MWYW 4G8BA 2HCTA 3C2QA 1ZD3A 2X58A 1K97A 3SCZA 5T57A 4YY3B 1CQJA 1Z5NA 1YE8A 2H85A 1JAHA 2VFAA 2F43B 2MYUA 2YRWA 4YYEA 5HP4A 4LF8B 4ND8A 1AQIA 2NO5A 4IHKA 5CG2A 3F9CA 2AMJA 2QRZA 5DU2A 3AVUA 4WZBB 2O0JA 2WINI 3P71T 2PZMA 4WXMA 4FHEA 3BQ9A 3DL2A 4GRAA 5IVIA 3S1AB 1PEAA 3THYA 2YV4A 4BMDA 2QX4A 3FZQA 1DXOA 1EUDB 1YS2X 4P4UA 1A8UA 3TRHA 2YHBA 5EWJA 1NLMA 1H2HA 2F8LA 3N0RA 3UJAA 3VR4A 3AV0B 2B6HA 3KOYA 3F1LA 3OJWA 3FOZA 3HKEB 1NHGA 2VTVA 3HCPA 3HZOA 5FYQA 3F90A 1JBQA 4OHCA 1G6OA 3C6BA 1YE3A 1ZY2A 3I1JA 4R3WA 4YCLA 5JT1A 3LYUA 2QKYA 1A5AB 3D6UA 4XCVA 1PHPA 4G5FA 4UM5A 3ST7A 1DUIA 3AXTA 4GMHA 3A58B 4Q01A 2I03A 2ZITA 3IL2A 1H8EA 2V9CA 4GPIB 2IHBA 4WH0A 1FLDA 4F8JA 3I9V6 3AUKA 4DCJA 4XPZA 2AOUA 2ZYHA 3BD9A 5K3DA 3L1UA 3TD9A 2FSIA 5CCBA 3QFSA 3VYRB 2MYTA 3ANNA 5CFZA 1E4EB 4Q3LA 1I8TA 4HQFA 4N48A 3P0HA 3OTIA 3DYBA 1OIWA 2F6RA 4E2ZA 1V9CA 2IPMA 2PXHA 3WNCA 2HDWA 4QPNA 4BLOA 2IIBA 2DFVA 3BCSA 3MW8A 3LKVA 1JKFA 2B2XA 4HSGA 4CDMA 3ILVA 2C7QA 3P2OA 4A03A 2RGRA 1A4UA 1C50A 4NJMB 2H8KA 1DKLA 1S7CA 2ZIGA 1JE1A 2Q0SA 4EENA 5BWOA 4G4SO 4QU9A 1X1DA 2O07A 2WWWA 3HCCA 2F17A 3OMXA 2KE5A 4TQAA 2AL7A 2XYGA 2PU7A 1V2GA 3H2JA 1Q17A 4MB0A 4AIRA 4E1AA 2IODA 4MNTA 5LBIA 3DT6A 2ZTSA 4GM0A 3WGOA 5AOCA 4ZOBA 5KJ6A 2J3MA 5FORA 1WBJB 4ZQIA 2XE8A 1F8FA 1GWNA 3HGMA 5FNVF 2A1UA 4N54A 4LISA 4QUAA 1XJQA 4DM3A 3PX3A 1BO6A 4BO5A 1JG7A 3LUAA 4E94A 3OZCA 2V7EA 3KBOA 4NF2A 3R7SA 4H7FA 3LA6A 3A1VA 4Q4LA 4FS8A 4WVLA 2Y1WA 4ZCLA 3S2GA 4EMBA 1KPHA 1AKWA 4AJJA 3R6DA 3ANSA 4ZEOA 1W59A 4BRSA 3D6TB 1KJWA 1TK3A 3E5NA 3AR3A 4NE2A 4CM5A 2ORED 2ZJAA 2P2NA 4OKSA 3TEFA 3VBEA 3ITEA 4KQKA 2X0FA 5B12A 1MEJA 3W4IA 3V80A 4BNJA 4AW9A 3R7LA 3G0GA 4OHUA 3FOAA 3BS4A 2QN8A 3A4MA 1E0AA 3S2FA 1QTRA 3HH8A 5A4MS 4XWGA 3JD3A 1WCIA 1FDTA 1VE6A 2IXTA 3GRAA 2V45A 5CB4B 1KKUA 1PZHA 2WG1A 4LKOA 4W1SA 4B43A 1KO7A 1GZHB 2VDWA 4DIDA 3RH0A 1TUGA 1T25A 2G5CA 4TKVB 1M2HA 1TCUA 1U4OA 3K1ZA 3SYKA 4C4OA 2K87A 1SXPA 5EZQA 4Y98A 3P96A 2JFYA 4HYTA 4ETWA 1U2EA 3PJFA 1URPA 2NAPA 3HGTA 3GZJA 1QU3A 3MAGA 3TTUA 3WBJA 3SX2A 4B0PA 5BMVB 4IQ4A 4B3CA 2A6PA 3VZDA 2BOVA 2C4UA 1Q1ZA 1TZMA 3SS7X 1MOPA 3AM1A 4RTSA 2R60A 3NKLA 3O2JA 4NMHA 1DBIA 1E5DA 2CD9A 1PJAA 2ZS8A 2HIMA 3PFIA 4G01B 3LPCA 1B93A 4AJ4A 1KZ6A 2CUKA 4RYDA 1V4NA 1KWKA 1U3CA 1M8GA 2VNSA 3M5PA 5AMXA 1H2BA 3K2IA 1ETHA 3ZBQA 2C04A 4PR3A 5JI3E 1UFRA 1A0OA 3C5WP 4DV5B 3LQRA 1H2YA 5G3ZA 4IIJF 4RJKA 1CE8B 1G1AA 2I54A 2VNAA 2GF2A 4PAOA 1CRPA 3VTFA 2PTHA 2FQXA 4X91A 5CCEA 5BT8A 2EKLA 1M0SA 1L6IA 2YWFA 3SD7A 3ZCTA 1L7BA 2JCSA 3HNOA 4LNUB 1JEEA 1DJQA 2P67A 3FMOB 3UMVA 5FO1A 1F6BA 1KI8A 5EJIA 1TKRA 1Z8DA 2IEIA 3CLVA 3RT9A 3ICEA 4IINA 2ORVA 1SUCA 1WPGA 4S0XA 3HJNA 3W2TA 3HVUA 4Q82A 5KKAA 1WBBA 1JVSA 3IUSA 4WTOA 1DRKA 3AIIA 3KD2A 1FIUA 3VKVA 4XIYA 1TTPB 3HU1A 4DE5A 4KE8A 2CHEA 2X5JO 2XVZA 4BQPA 1VPWA 2Q62A 3OEYA 1XDDA 1TF2A 1ZA2A 1TUBB 2W2XA 4BZZA 3HCAA 1JDSA 4FFPA 4F3NA 5IXJA 1QK5A 4RXUA 1T9GS 3RAJA 5A0VA 1H23A 5LQKA 2WB4A 3UJBA 1MCZA 1NJ1A 5IKMA 2QRGA 4LGCA 3MPOA 2M6SA 3QOYA 3V8PA 5CYGA 1Z5UA 1G7RA 4PSAA 4R1PA 2X1LA 4LZPA 1GAXA 4OX9Y 3LUCA 1XJWA 3U60B 1CFZA 1O94A 3M81A 4LJ6A 4UQOA 5BOSB 1W85A 4LXQA 3OZTA 3EK2A 1KBQA 3A9SA 1WVIA 3C43A 4ESHA 3N75A 4UZEA 4MVJM 1K06A 5AW7A 1QE3A 2LDBA 4OMDA 5TQ2B 3HRHA 2HZBA 4RESA 4AZVA 3T3HA 4CFZA 4D99A 2QPLA 1LX6A 2E85A 2HY7A 2C4KA 3HA5A 5DLYA 4IEFB 4KIGA 4DXHA 4NOLA 4ZO8A 5FI1B 4FFLA 3NM4A 2DC1A 1T5HX 2EG9A 1YR7A 3GCWA 5EFOA 1GILA 3AR7A 4NENB 4G8JA 1GRNA 4N76A 4TXMA 3PVSA 3WJ2A 4Z0HO 2ZDQA 4DB4A 5EUMA 3G7UA 1J21A 4QTZA 2PKQP 1KJIA 2WE8A 3BWDD 4O5OA 4PBTA 4Y6OA 5DN6A 4DARA 6AT1A 1KHTA 1UBUS 2E4ZA 3L0YA 3DDSA 4BMOB 2P0EA 4WNIA 2L2QA 4LSWA 4O6VA 3GLFE 3H2HA 4HTFB 4TS3A 4V0ME 1IH8A 2NTEA 4M8IA 1WP9A 4TKLA 4DCUA 3R9XA 3IP8A 4U6NA 1OILA 2A7QA 3THRA 3EBOA 4FFWA 4V0MA 4KX5A 1PGQA 1RQLA 1JWAB 1UPBA 2B1QA 1QH1A 4KXVA 3UWSA 3CKMA 3IMEA 4L73A 3GXOA 4EYSA 3W9UA 3B36A 3SKXA 4FW9A 5I6DA 3LDHA 5LL6P 2V0GA 1XE3A 3SFTA 3EXHC 3VC3A 4ALLA 2REOA 1G5TA 4WK6A 4G23A 5BSVA 1WV0A 4XD7A 3OBBA 5BW5A 5GINE 1X2BA 1ORDA 4EGAA 4ZJUA 4JH0A 2SECE 3LX8A 3PGKA 3QWHA 4YRZA 3FDZB 3TQFA 1IWPB 3OZIA 4I3GA 5DM60 4WXEA 3WY9A 3RYIA 3ELUA 2VJPA 4GMGA 5J59A 2NXJA 2DKOA 2NV2B 2P27A 4P9NA 7GPBA 3HLKA 3AU9A 3QLVC 1KZGB 3QIVA 1T29A 1RIIA 3U4MA 3U4IA 1IUNA 2Q4EA 4QOGA 4QU5A 2QVZX 1IONA 1VRWA 4C29A 3TUJC 3BDVA 2X8LA 3IAFA 4LHVA 5IAEA