1VLZA

Uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords CHEY
publication title Uncoupled phosphorylation and activation in bacterial chemotaxis. The 2.1-A structure of a threonine to isoleucine mutant at position 87 of CheY.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vlzA00
3HS3A 1KGSA 1QO0D 4Z4HA 3MA0A 5BRJA 4HNRA 4G0OA 3Q7SA 1NTRA 3URMA 3A0RB 2ID9A 2F8SA 3F6PA 3CZCA 3NBMA 4YO7A 3IP5A 3O2QB 2IPAB 1P2FA 4JB0A 4LZLA 3KKEA 3KSMA 4G0MA 1PNRA 1A2OA 1NXVA 4KREA 1ZESA 4YLEA 4RK6A 1DRJA 3QLUA 4MS4A 4F06A 3D02A 1NXPA 1TM2A 1Z26A 3KG2A 3LOPA 3NHZA 4N0QA 3A10A 4Z99A 4Z4FA 2QVGA 4EYGA 4F3TA 3LUGA 4IMJB 2MSLA 2A9RA 4LDAA 3EULA 4Q6WA 2GWRA 3KYIB 3R0JA 1PEAA 1ZGZA 2LBPA 4MR8A 2E4VA 3IDOA 3C3WA 1DCFA 4WT7A 5TPWB 2PUFA 1U04A 1A0OA 1IIBA 1PHRA 4KVFA 3HUUA 4HNQA 1M2FA 3N0RA 5FWYA 5JNVA 3K4HA 5CNJA 1MIHA 4LRQA 3LFTA 3FFXA 1JLKA 4S04A 4Z9AA 3ROTA 1BA2A 1GCGA 2GI4A 4EYQA 5KQMA 1ABEA 2FMHA 2JBAA 3BILA 5T7BA 4YR7A 1NXWA 3L49A 3QLVC 4RV5A 5IX8A 4LE2A 1DRKA 4D6XA 3QX8A 4MR7B 4XARA 3LUKA 5FWXB 3LUDA 4IILA 1LJUA 3RVOA 1GCAA 4RS3A 2PUBA 1Z2DA 3QEMB 4MR9B 1URPA 1ZHHA 1Z16A 5TQ0B 3TX6A 2VYCA 4MS3A 3EDCA 1SXGA 2VUIB 3UKJA 1MB3A 1CEYA 3RVLA 2QXYA 4PYRA 3I45A 2FQYA 1UDRA 3H1EA 2E4ZA 4UHKA 2L17A 2QSJA 2PUDA 3LTEA 3RVSA 3DGFC 1YIOA 1XHFA 4NQRA 4IF4A 1BDIA 2PUGA 4M88A 4Z4IA 1KMIY 1L5YA 2B4AA 4L4UA 4CBVA 1JDNA 1OXBB 1QNLA 3EAFA 4MR7A 4E7OA 3EODA 4H60A 4MQFB 3RVRA 2FTKE 3N8IA 3CG4A 1AB5A 2H0AA 3KJXA 5FBHA 1ZN2A 4RK4A 4YWHA 3DZDA 4JB2A 1QP4A 2CHEA 1ZVVA 1JFSA 4NCBA 4TLLB 5T3YA 2JK1A 3GL9A 5C5CA 1DCKA 1QO0A 4TMYA 4P1ZA 1M5TA 1EHCA 4F12A 4QPJC 1M5UA 1Z2EA 3SNKA 3CFYA 4Q6BA 1ISRA 3H5LA 3KTOA 2R47A 2FN9A 4KQ9A 1BDHA 3OLYA 2WJAA 4ZJPA 4PICA 3OMXA 2NT4A 2RGYA 5KQGA 3CRNA 3N0WA 3RVKA 5HSGA 2L18A 4EYOA 1KRWA 2PJUA 3H5WA 1U0SY 4XXHA 2RDMA 3O75A 2FQXA 2QVCA 2P4UA 3HSYA 5BQ3A 3C3MA 1RNLA 4RKRA 2QW1A 4JOQA 5DGCA 3H1GA 5IEBA 3IP7A 3FDFA 1EWVA 4KK4A 2PE5A 5DTEA 4LE0A 2H3HA 2J48A 5JS2A 4LDZA 4KNYA 2O20A 3CS3A 4JA2A 3CNBA 2QV0A 3D8UA 4KZKA 1BVHA 1DCMA 1EWKA 2P9HA 5EWMA 3QELB 1F51E 1ZITA 3H75A 4JP1A 3NNDA 4L85A 1J56A 4RK1A 3RVJA 3LUFA 2AYZA 5CHYA 3KYJB 2E4WA 4WUTA 4B09A 1A04A 2WJWA 3IPCA 4NICA 5CNKA 3QLTA 1BDJA 4RK0A 1YS7A 1JHZA 2YHAA 3M9WA 1USIA 1USGA 3RVPA 1ISSA 1DBWA 1ZDMA 2GKGA 2FW0A 3CTPA 2JCGA 3O1JC 4G0PA 4LE1A 1P6UA 1QPZA 2GBPA 2ZAYA 2VUHB 5IC5A 2LPMA 3OQOA 1KRXA 3LKVA 4OLBA 4KPYA 3OM1A 1JX6A 3A0UA 2X7XA 4LX8A 5TE9A 1TLFA 1TJYA 3S99A 2FKAA 1D1QA 2GX6A 3MIZA 2HQRA 1U8TA 4ETMA 4RXMA 4NV3A 1JBEA 4KMRA 3NNSA 4ZPJA 1JYFA 3O21A 4EVSA 1QQBA 1VPWA 3H5OA 2PKXA 3OLVA 1P6QA 5D2CA 2FXIA 5F64A 3SG0A 2HQOA 3Q9SA 3HDGA 1D2AA 4MYRA 4WXMA 3HZHA 3IP6A 4RZSA 1RXIA 3SAJA 1LBHA 4F8JA 4EGSA 2FN8A 5KQLA 2AYXA 4H3HB 1Z12A 4MRMB 1XHEA 3KLOA 3OMWA 4RK7A 4YV7A 4PZ0A 2NUBA 3QLVA 4OTZA 5TPZD 3TB6A 3ILYA 2E4UA 3EQZA 3HVRA 1M2EA 5FBKA 4Q7EA 4Y9TA 3BREA 4YCSA 2FEKA 1PEYA 3HUTA 4P98A 2RJOA 3SM9A 4KQCA 1JWLA 4JAVC 4YP9A 5TPWA 3HXMA 3C6QA 1W25A 3KHTA 2QZJA 5TQ2B 2L19A 1JFVA 2FMKA 2FLWA 3GRCA 3O1HB 4RWEA 1E2BA 2XDYA 1HEYA 3EJWA 4RY0A 3LKBA 3H5TA 2N9UA 3IP9A 4N76A 1TMYA 2M98A 1P8AA 3RVMA 1CYEA 3JVDA 3JVIA 5DCLA 2R25B 1ZH2A 3HO1A 1C0EA 2TMYA 1JYEA 3P9YA 4RKQA 5HQJA 4ZMRA 1NXXA 2LIVA 5ED4A 1QP0A 3DLBA 1QKKA 5JNRA 1NATA 8ABPA 5DKFA 4RU1A 4W5RA 1RZRD 5FWXA 4EVQA 3F6CA 4Z9BA 2WY2D 1YTUA 5EWLB 3IPAA 3ILHA 3QEMA 4MR9A 5TQ2A 3UUGA 1D5WA 3G85A 5TQ0A 3GYBA 2CD7A 5IBQA 1JFTA 1USKA 4KV7A 2FQWA 1Z15A 3RQIA 4W5TA 3HV2A 4YRZA 3RH0A 5C5EA 1VKRA 2B1JA 4MQEB 5E3JA 4WXEA 1I3CA 3HDVA 3H1FA 4MS1B 1BAPA 3QEKA 4S05A 2E4YA 1T34A 1R8JA 3EGCA 3H6GA 3M6MD 4O1HA 2DRIA 5EWJB 1AB6A 2MYNA 5GQSA 3N75A 2MSWA 2IYNA 4GNRA 2R4QA 4MQFA 5CNMA 3JY6A 4QYWA 4OATA 5DLEA 4MLCA 1JH9A 2FMFA 4O5AA 1EFAA 3CZ5A 1TVMA 4EVRA 5B3JC 3CG0A 1JL3A 1DZ3A 3H6HA 3QX9A 2PUCA 1MVOA 2FSPA 2LUOA 3GWGA 3LMKA 1RXEA 2HJ9A 1NY5A 4DADA 1DP4A 1SRRA 3LUJA 1YMUA 5KI6A 4KK3A 1H9CA 4Z0NA 3N53A 4MGEA 3CLKA 4YS6A 2WB4A 2M1ZA 1VLZA 4PEVA 1DC8A 4MPTA 4MS1A 1LK0A 2IPLA 4DQDA 2MSKA 4FE7A 1K68A 3K9CA 3Q7RA 1XWWA 5BRAA 1NXOA 4RY8A 4QYMA 4OG2A 3HM9A 3GBPA 2A9OA 2FEPA 4G97A 5BR1A 2MYUA 1YK0A 3GA5A 1D4ZA 1JDPA 5TPZA 3GT7A 3O2SB 3Q15C 1APBA 1YK1A 4NCAA 3HJFA 1ZH4A 4Z4CA 1FFWA 1Z18A 1ZY2A 5JNWA 4MS4B 4FB4A 5JS1A 2NZUG 1QMPA 4XFKA 3MYYA 5IEJA 2F8TA 1MB0A 2FVYA 4OBBA 3FMVA 3TMYA 9ABPA 2PUAA 2LP4Y 2OQRA 3BRQA 3FGZA 1S8NA 2HPHA 1ABFA 1PNTA 3E61A 3LUCA 1QQAA 4N03A 4MLDA 3H5VA 4GPAA 4MR8B 3QELA 1Z25A 4WZZA 3NNNA 1GUBA 2PL1A 1JF8A 3G1WA 3TD9A 2IPNA 5IUNC 5FWYB 5CNIA 2L2QA 3L6UA 3W9SA 1MAVA 3OQMA 3Q41A 3KLNA 3T38A 5KWSA 6ABPA 3NHMA 2WRZA 7ABPA 2A9QA 4XLTA 4XAQA 2JBAB 3TO5A 1F4VA 3QLUC 3UK0A 3HK2A 2WWVD 1C4WA 3C3KA 4ML3A 5JNTA 1RZRA 1E6KA 3JS5A 5HM6A 5IUKC 4G0YA 2IOYA 3FFWA 2MYTA 3LUAA 2KYRA 5GOTA 3DGEC 4W5QA 4N41A 2JVKA 1SD5A 3M9XA 3I42A 1NXTA 4W5OA 3Q7TA 2PLNA 3OO1A 4RXUA 4N47A 2RJNA 3E3MA 3N0XA 4DN6A 3GV0A 2Q5CA 1OXKB 1ZAYA 3CU5A 1CHNA 3MMNA 4H3KB 2NT3A 3KCNA 3LUHA 4MS3B 2FMIA 4F11A 2OENG 4PE5B 3H5IA 4RDCA 4IGAA 4RXTA 3RVQA 4W5NA 3BBLA 4G0QA 4RK5A 1SXHA 5JNSA 2YHBA 4MRMA 2PUEA 4RY9A 1QP7A 1LJLA 3MM4A 3I5AA 3F7NA 4QICA 4EY3A 1D1PA 4E7PA 4G86A 2MYPA 5KC9A 2E4XA 1FSPA 3I09A 1GLGA 3OM0A 3KS9A 3EQ2A 4G0XA 3F73A 3T95A 4MAAA 5ABPA 5JNUA 2QU7A 2BGGA 2PL9A 2JVJA 6CHYA 2JRLA 3VNBA 5IUJC 2R48A 3OLWA 2WMYA 1K66A 4FE4A 3OQNA 4KRFA 3OO0A 1E6MA 1DBPA 3C97A 1YMVA 2IDMA 2PMCA 4HYEA 2CWDA 4IMIB 4O1IA 3HEBA 3N6VA 4Z4EA 3HCWA 1ZGGA 3OLZA 5IULC 1LBIA 1FFSA 1NXSA 4TN5A 5PNTA 4D74A 3JPYA 3BRSA 3MQ4A 3SQNA 3VNAA 2W42A 3O1IC 4N0PA 4KFCA 1DJMA 2PAFA 3QK7A 3T8YA 1PUXA 2ZWMA 5EWLA 3CHYA 5B3JA 4TLMB 4ZMSA 4RSMA 1Y1LA 3A3KA 4G0ZA 3SY8A 1Z17A 2ID7A 4IRXA 4ETNA 1Z13A 2A9PA 3FFTA 4ZYLA 4OLAA 1EWTA 1FFGA 2HQBA 4XASA 4MQEA 4HNSA 5EWMB 4WWHA 1RPJA 2CHFA 3ROFA 1DG9A 1B00A 3T6KA 3O2JA 1L5ZA 5EWJA 1YVUA 2QR3A 2IPMA 1U2QA 3JPWA 5I4CA 1VRVA 2V0NA 2IKSA 3GBVA 4ETIA 1DC7A 3DBIA 2JB9A 3CKMA 1GUDA 1EAYA 4EYKA 5KC8A 4UHJA 5TQJA 1DBQA 1SXIA 2FEWB 5KQPA 4YGXB 2FLKA 1WETA 2HSGA 1W9HA 1YS6A 1FQWA 4JASB 1U2PA 4Z4GA 3B2NA 2I6FA 4D6YA 2VK2A 5HKOA 1E6LA 3MF4A 3O74A 3OLXA 4EUKA 2JVIA 3DLHA 3JTEA 2NZVG 3RVNA
chains in the Genus database with same CATH superfamily
1PZMA 1TU0A 4LHYA 1BJKA 1E2DA 1QO0D 1VMEA 3DBHA 3H2BA 3K2EA 5CGQB 4Z4HA 3DZKA 4XB2A 1U7OA 5JECA 1S2MA 3BIWA 3JU3A 4HDSA 2PYDA 4K9LA 4WFIA 4M9CA 2YHIB 3ZNQA 4P5DA 2A5FA 4BUZA 5IXJA 5BYAA 1WZ2A 1HNZB 1PX2A 2A94A 1MO2A 1O9HA 3EXIB 3P9PA 5ELXA 2XB8A 3I12A 4YO7A 4J4TA 1DTSA 2VQSA 3UAOA 4NR0A 4XQCA 2Q07A 2BF7A 2EBFX 2IZ0A 1P2FA 3PI6A 2GCIA 1NXVA 1K5DA 5G1NA 5IJXA 4CIAA 1QLJA 4IDFA 3UJ8A 4QE3A 1DRJA 1UBLS 2F00A 3AT1A 2VHTA 3QLUA 1WPGA 2IZOA 4BFCA 1R16A 2XUHA 3NYRA 3SYTA 4LJAA 2A30A 1E8MA 4A6EA 2LRHA 2VHJA 5F23A 4L95C 2I66A 4Z4FA 3VR6H 5J2TA 1VB5A 1R9JA 3EEIA 2Z09A 1ZGCA 3TB4A 3LP6A 1Y4AE 1CP3A 1W29A 2O5CA 3WL8A 2FEOA 3BORA 3KYIB 3AW8A 3AJAA 1ZGZA 3FWYA 1NI4B 2ROQA 2J3QA 4LOLA 2E4VA 4O6VA 5AHWA 1F2UA 3PNSA 4EK9A 2PUFA 1OH7A 4DA6A 2WDPA 3IDAA 2RAVA 2J0UB 1XXHA 3F96A 4N3CA 4PCVA 5PGMA 4A91A 2ZOSA 2CGEA 3BE5A 3T12A 3KB6A 2WM8A 3UT5A 4TV9F 4A23A 1NW8A 3LZCA 1J9GA 2XT6A 5CBKA 1P5RA 1GCGA 4PXSA 3S27A 4UHBA 2AOXA 3FKQA 3GP3A 2WI8A 4YMVA 4KR6A 4PGGA 4IGEA 1RRMA 3CLUC 3ZCTA 3QLVC 1WXEA 3ZHBA 1P74A 3AVUA 1PL0A 4EUHA 3I83A 3WIOA 3FWNA 1NNLA 2BKAA 2HJGA 3LUKA 2EQBA 1GAXA 2WOJA 2IEAA 5HUHA 16PKA 5DLPA 1WCYA 3C8DA 1AQUA 4M1TA 4I55B 1RMQA 2QD4A 3VC3A 2ZBGA 3BK2A 4EATA 3HBAA 3IBFA 1VJ0A 2VYCA 5DGTA 4BVFA 2IYPA 2NX2A 2H29A 3BL6A 4TKVB 1V43A 3G8BA 4J2OA 4B3TB 5DLDA 3TUJC 2ZT7A 3C3CA 3PD0A 2FQYA 4M0CA 3W5JA 4YAGA 1VZ3A 3GX1A 5E7QA 2IDZA 1DVRA 1J0XO 2H07A 3JRWA 2ZYUX 4I50B 4PFQA 5B1EA 3VDRA 3P0HA 4CGZA 2CLSA 5L8VA 2P8JA 5CURA 2I3AA 3IT1A 4M88A 5T4BA 4BWFB 1Z5NA 4EA9A 1KPHA 4MKGA 3GT3A 2YWBA 1TAHA 3CG4A 4BGDA 2GILA 1JFLA 3MB8A 4CMHA 4P92A 3I1FA 2Z56A 5HIKA 1T6ZA 5CRIA 1X7XB 3CURA 4M7OA 1ZRSA 4JJEA 4U6NA 1JRLA 5GP1A 1OT3A 3PGJA 4DCGA 3O5AA 3VQTA 1EDEA 1M2JA 2QNRA 4MPPA 4XDYA 3QHAA 1JLSA 1XALA 4R16A 4XSHA 3ZDYB 4F0JA 2C04A 4U7JA 3AYXB 1NVTA 1DMSA 1MGPA 1T3TA 3SQDA 2GN9A 2NTEA 3S0JA 3F3YA 4AULA 4ER0A 2G6BA 2FKNA 4IDQA 4N8DA 2X8JB 1W93A 1NXQA 3G8YA 1FMTA 3P9IA 4LVNA 5EINA 3O84A 4EM6A 4D4IA 2V54A 4MVJE 2J33A 1GTG1 3FOCA 4OLHA 1ZM3A 2B37A 4DR1B 4R1SA 1AZWA 3W05A 2Z6UA 3U7HB 1UPXA 4RQBA 2K87A 2HREA 2W9XA 4H1HA 1F7UA 1FRZA 1YVEI 2ZJ5A 3ODPA 4EUEA 2OCBA 1HEUA 2GZ1A 4OQDA 5DTRA 3L7JA 1OFTA 3EOZA 5HW0A 5H1YA 3VR1A 2GYVA 3HZRA 4YV0A 5HJEA 3PFFA 4MP3A 4KVAA 5D00A 2ZAMA 1OLSB 1R66A 3PL1A 4B7CA 5FBQB 3VDNB 1XI2A 5JATA 2O3JA 1JPVA 1TB4A 3CXRA 2C8VA 2R2AA 2B20A 2FUKA 3VHLB 3IP8A 3LUFA 5LSAA 3DP7A 2W2QA 3I8SA 3KV3O 4IR7A 5CIQA 3YASA 5KNDD 4JYPA 4J0DA 2WJWA 2ZUTA 1KE2A 2Y3IA 4HY3A 4K9OA 1BN6A 3ZHSA 5E1BA 4CYMA 4FHDA 4DLLA 5JBNA 3MRSA 4DA7A 2I78A 3R5FA 2QL5A 4KRYA 1UPBA 1Z2NX 2RCNA 4NCHA 1Z0KA 4L74A 3FKSA 3BCSA 3R7BA 2FW0A 3WA7A 1L7PA 4M55A 5CDSA 3RSQA 3DWIA 3B8EA 3P9RA 4ALLA 4BVBA 4JI8B 1K92A 1SCBA 3MUNA 4OD0A 3VI3B 4AZSA 3QBEA 3VZCA 1FOEB 3JQ9A 3O3MB 3RU7A 3LVFO 2ZVDA 2GAOA 1D4FA 2AHRA 3IAS1 4HUJA 2UZ0A 4Y6GB 3B1KA 3RRNA 3WI7A 2WF6A 4P08A 4EX7A 3OE4A 4UEOA 1BO6A 3OX2A 2FSVC 3JYNA 3NJ8A 4KRGA 4KN8A 4RF2A 4Q4HB 5BR7A 5DLYA 2DQ4A 2PRJA 5ALQA 3U13A 4MIKA 1ZHOA 3QVXA 1YS1X 4G1CA 4DNPA 3I52A 3PUHA 2IYUA 2ZUVA 1T8PA 2VDOB 2IYAA 4BNMA 5C0OE 4JUIA 4JQCA 5AI0A 1U7XA 3TZCA 5HRCA 1M74A 3L7MA 2H4FA 3SQXA 7MDHA 2G9UA 3PIRA 3N28A 5TMDA 3RFVA 5ERXA 5DM4A 4DMUB 1OX4B 1V1RA 3EIHA 4Q3LA 4E30A 4IQGA 4KJXA 2Y0DA 1R18A 5TPZD 3V9PA 5EL0A 4EENA 3J7TA 2I8CA 1C0IA 1M2EA 3JYHA 2F43A 4TXLA 3K1ZA 4YQEA 3OZVA 1V8OA 1OXVA 3I3SR 4LK3A 3W4KA 5L3VA 1E9AA 1E0DA 3HUTA 4BOYA 4HLCA 4BB6A 4RMJA 3PFBA 5C4GB 3R74A 4YMUA 1DI0A 2YMQA 3DSRA 1CS0A 1J97A 4PYLA 4YBRA 5ADUS 1NX6A 4D8YA 1IHOA 5EIHA 2WYVA 3ZHOA 2JJ1A 2EEZA 4LEIA 4CI9A 5JADA 2H5EA 1C5KA 1P75A 4JLJA 4JSRA 2VPTA 3ZXIA 5EP3A 1VGQA 2K7FA 1BMTA 1HEYA 4O8CA 3IJEB 3PKJA 2ZJBA 3RTDA 4AN1A 4CLOA 1QX3A 3IP9A 4N76A 3HO8A 4TYMA 3OKCA 1TI7A 4RDIA 4HN2A 2OBBA 1Q0LA 2QIOA 4E51A 3GDWA 4EHHA 1I7PA 2WAYA 2X2PA 2HSJA 1YC2A 3C15C 3UGQA 1KWGA 5EI5A 1VDMA 1L1QA 2VOJA 2WT8A 3ANYB 4AW9A 4E2WA 5F9FA 1JSXA 1G4HA 1MF7A 3K6KA 3UJAA 1EX1A 2CUTA 3PI7A 1DAGA 2YMPA 2VRBA 3PF9A 2GA9A 3QF7A 1W0CA 2Q4OA 5AK3A 3SIXA 1GZ4A 4LDJA 1H3NA 1T9GR 2IIVA 1JIIA 1Q1GA 4Z53A 3RKUA 1FS6A 4WNAB 3HCBA 1OTHA 3C5VA 4LXXA 2VJQA 1UMDB 4NI5A 5AVOA 4BP8A 1L7VC 4BO1A 1PR3A 3LYUA 3QVJA 2PL5A 3G5AA 3V1UA 4N0DA 3PNLA 2OO5A 5DN9A 1OVMA 2VC2B 2XXAB 2A2ZA 4RL6A 3R09A 2OP0A 2VF4X 3DCYA 3BMOA 1VKRA 5C5EA 5C81A 4QSMA 1P2GA 4EVIA 1CY8A 2IF2A 1SK9A 1RLUA 1BGXT 2IEYA 3GPCA 1XZKA 2FRXA 1JIXA 1BAPA 2WC1A 3JQGA 3L0ZA 3LIPA 5HFAA 4P4GA 3TLAA 4YRIA 1I94B 2XI4A 1TTTA 2MOKA 3WK6A 1JWBB 1AS0A 1AM4D 4GNRA 3LDFA 2HDOA 4WDRA 3URKA 4MKXA 3CKYA 4Y3UA 2HX1A 3AG5A 3QG5A 4HAZA 5DLEA 3SSNA 3V4RA 3AG6A 1Z0IA 4AY4A 3VYSB 2AOTB 1V9LA 1C7QA 2YY5A 3HH8A 1WNTA 3HMQA 1Z6PA 3QX9A 4K46A 4QGBA 1Z7GA 4KNVA 3REFA 4CKXA 2CLHB 3H4VA 4TTSA 2VHQA 5FNVB 1HQDA 2Y8EA 3LK7A 4KYVA 4YVFA 1NZJA 3FM9A 4CMGA 4GHWA 4B8ZA 2IIBA 4RO0A 4D8VA 2PL3A 2OCXA 3WLMA 1RBZA 2YJZA 2J5BA 4HI0E 3X1WA 1AIPA 1H8HA 1ZSVA 4RHCA 3AOGA 4YAWA 4C1NA 1E5DA 4GQIA 3CRZA 3D8BA 4UBJA 2PX5A 4XCVA 4D2IA 2PH1A 2VRCD 1X70A 2ODAA 4HDKB 4GOJA 4UHFA 1NTOA 4OJTA 5ALZA 3DVSX 1JW9B 1FA9A 1UT8A 3GBPA 4FNAA 2IRWA 3FFAA 1LRLA 1W85B 4FZ5A 5BR1A 1OBHA 2FPPB 4XTRA 4ZU1X 2SECE 1IY1A 4Z8YA 1D4ZA 4F86A 5DGDA 4EI2A 5CVCA 3NZEA 5AM4A 5IABA 5FUQA 1J0CA 7REQB 4PYIA 2OXTA 4DJTA 4YGYA 4NE9A 4UQPA 5JS1A 4R54A 1GNTA 3H8WA 4XFKA 5IEJA 2QUZA 1N2HA 4YJ3F 2FZLA 1RWPA 4BV8A 1XEWX 1X7ZB 2OQRA 5IG2A 1M6HA 1R4AA 4JBIA 4Q9LA 3WBKA 4NNPA 2BEWB 2XJ4A 5ALXA 2PZAA 4ZQHA 2PSHA 3CEPB 3E35A 4CQMA 3EZLA 1UBEA 3SR0A 2BFOA 3H2YA 1TCCA 2IHBA 2VXBA 3TD9A 4ZAFA 3TTUA 4M7WA 5JAZA 2V0GA 3INGA 2DJIA 2QDXA 2XUGA 4DR3B 2NYVA 1O3YA 2YDXA 3NCTA 3KLNA 3BRWA 4Y9DA 3EGEA 5AW1A 2EV9A 3T38A 3UPUA 3A6FA 2R1VA 1MOPA 2QYHA 3V3TA 2OFFA 4CVNA 3TCKA 2H5LA 4NHEA 4FYHA 2ZZMA 3CSSA 4IDNA 2BUAA 4EMUA 4FYIA 4EQ6A 4X65B 4IEEA 4KSYA 3OSUA 3TAHA 3PD1A 3SFTA 2D5AA 3JASB 3OOSA 2IOYA 4G0YA 2ATVA 5AW3A 1NSTA 3LGAA 4OM8A 3ZKWB 4DF3A 2C5AA 3WDLA 1HXHA 4C6TB 1IN6A 1KMHA 4HWOA 5CD9A 4YRCA 2QRGA 1C7RA 1DKNA 1USUA 3D7SA 3OURA 3HL0A 3VDXA 2ETXA 4L16A 2ENWA 3KP1A 3VC7A 2VPPA 1DOZA 5LQMA 1Z6TA 1ZU4A 3GV0A 4P3NA 2COUA 3PDHA 1KDTA 1OMOA 3E9CA 4HJRA 1PFQA 2AH5A 4Z0HO 4OYHA 4PC7A 1MZVA 4AO6A 4B7UA 1TT5A 2FG5A 4ZYXA 5HM8A 5CB8A 4MKFA 1ZIXA 5EHXA 5JVDB 4CV1A 1FXWA 3H87A 1A7AA 4XWTA 5HIIA 2NO9A 4JHXA 3F8TA 4Y6SA 1NHWA 4F5WA 3DLCA 3OT4A 4FKBA 3FOBA 4G37A 4XUCA 3ZCPA 1R4MB 1AK1A 5WRFA 1Z8HA 2QQEA 3WXMA 1NC3A 1E1QA 4JLNA 4X1KB 3R7LA 4Q37A 1JDUA 2IP4A 4W6QA 1QS0B 1RXYA 5K05A 1MHTA 4R5HA 4YT8A 1W30A 4CIBA 1E96A 1Z0JA 4FSHA 4RPHA 1TAUA 1DWQA 2JIBA 4D0GA 4XVHA 3PQ4A 2CNDA 2EOAA 3L92A 2C5BA 4CLRA 1E1MA 2G5GX 3AIKA 2JFBA 3N8KA 4HQ6A 2VO1A 2HBRA 2FZVA 1E0JA 2IXEA 2GHQA 2WYIA 3IXLA 1R0KA 3JR7A 5DM60 3I1YA 2OZVA 5D86A 4CF4A 3OOHA 5DNYB 1EP2B 2IA5A 4IRMA 3TINA 5D3MA 3LLUA 3QX7A 5HUQA 3IVMA 1XMQB 4BXOA 1GL6A 4OBXA 1LXCA 2CWDA 3BIOA 5C35A 5KNCA 1TX4B 1KFBB 4F7WA 1J00A 1F06A 2IBMA 3ORFA 1DMRA 3AZPA 4WD3A 4YRFA 2IOQA 2AVNA 4DQ0A 1AUQA 1GPYA 1YL6A 3AR3A 3MUOA 5L4NA 4O3FA 1RLIA 4BO4A 2F1KA 2PPVA 3VNAA 3ZWDA 4G2NA 1XVLA 5NLLA 1Y9JA 3OH8A 4N0PA 3PPWA 1J99A 1II8B 1KQPA 1TQDA 1IOVA 1QSGA 2YZMA 3GUYA 5E3IA 3V34A 2GN4A 5AXAA 3PUZA 5HCNA 1XLUA 3PDCA 1D1TA 1BKDR 4MRVA 3T94A 4X6XA 1UC8A 3NWPA 2AE2A 2OKCA 3GT0A 5K0GA 1LUAA 1T2AA 3K9HA 4B2LA 1J8VA 4DREA 3A1VA 5JE8A 1GU0A 1FFGA 3RFUA 2HNKA 4DABA 5LUAA 4DLBA 4O59O 4UXHA 2CNNA 2VPXA 6REQB 2WD7A 2G80A 5E4JA 4AF7A 3ENVA 4MSUA 2D2VA 1NL3A 1WLSA 2YFQA 4G1MB 5LDDC 3GRZA 3U4CA 2ZIEA 3IDFA 3MFYA 4EGAA 2GT1A 4ALJA 1GUDA 2K2QB 3KUXA 5TDHA 4BQPA 3K5IA 3P0RA 2VTVA 4A0SA 4EHIA 4PQYA 1NVKA 3TOVA 3AEQA 3OTQA 5IHXA 4W1SA 4QFBA 3LC7O 3K16A 4QAJA 1K6EA 4MYUA 1DC5A 3EK2A 2H1IA 1QGDA 1TDJA 1Z5ZA 4QECA 1DFHA 4RVFA 1T8YA 1JTFA 1H6DA 4YRAA 1HGXA 1KY5A 3T7IA 1WABA 1E2MA 1DBSA 4PCAA 1NUPA 5CH8A 1PFYA 3MJSA 1U02A 4GLOA 3V48A 4CWAA 3DEKA 4IVPA 5TGDA 3EZ9A 3BG5A 1L4FA 1KGSA 3AKEA 3HS3A 3GARA 4IO0A 4X61A 3AHFA 3TWOA 3PRKE 4EIWA 3LA6A 5BRJA 3HYNA 1CUDA 3VKUA 4P6VF 4XSVA 1QLHA 1YASA 2BE9A 5EJMA 1IZYA 1HDXA 1SOMA 1OF1A 3KOOA 5EUMA 5BUCA 1Z5GA 4BO5A 2X4LA 2DPGA 4JI5B 3UMJA 1VI6A 1DWOA 1OASA 4R98A 3OOYA 4MTLA 3N58A 2CLEB 1TAGA 3ZBTA 3ZK8A 1SG9A 3AVPA 3VYWA 2Y2VA 5JCJA 5AUNB 4YLEA 1ZS9A 4GX1A 4IGKA 1DKUA 4EABA 1XLTC 3VH1A 1H0HA 1NXPA 4N3NA 4NIMA 5B2ZA 3X2FA 1UKEA 3WGMA 3PE3A 3UAWA 2PRSA 2V7QD 2C0PA 1PFKA 4JGIA 4F3TA 1A77A 1RKBA 1UZAA 2NXJA 5CJPA 2BN4A 3V42A 1EMDA 2ZRHA 3R0JA 3FBTA 2WFLB 2ZUCA 3HHPA 2H1WA 4OF4A 3STHA 4ODIA 5JW6A 1HE3A 5TPWB 4PN7A 2O8CB 4R81A 4L8LA 1PHRA 2YWHA 4FFSA 1ODTC 2WZCA 2ZSBA 3DKRA 5FWYA 4LYDA 1X1EA 2PGLA 1GTL1 1Q0HA 1U1CA 3JZDA 4J6EA 3MJVA 3U17A 3GEEA 2OSVA 3W3AH 4MWZA 2YWRA 3ANNA 1YZVA 1TVCA 2O4CA 1UM8A 1ZKMA 2VRWA 3P26A 5G0WA 2CZGA 2FWJA 3UGTA 2X58A 2XUOA 4AJ2A 4ZI7F 1XCGB 3E9MA 5JRDS 1OYOA 3Q5GA 1R50A 5KVQA 2EVWX 5FH9A 3UENA 3U3KA 4ETWA 5HOQA 1P8JA 2FWRA 4KSCA 5L3SA 1PEDA 1U3CA 1BHJA 3G0HA 4YRBA 1KJWA 3HY3A 1OH8A 2BKVA 4GLJA 1IBKB 4DQXA 4KWTA 1R5OA 3J7AC 1YULA 4M9QA 2QL6A 4DSAA 4HFNA 1LJUA 3O7WA 4RS3A 4JT8A 3QEMB 1G3MA 2H2FA 3FJYA 4JKOA 3T5GA 2W6ID 2J3MA 3BQMB 3MS4A 4V24A 3CLHA 1PS9A 3DYIA 4EO4A 4RQUA 3BMXA 3FUWA 3I45A 4LJLA 4O4HF 2RGNA 5AHXA 3R9KA 4PRLA 1T36B 2JJ2D 3NBQA 3PJRA 4ZANA 5DNAA 3CUVA 2H7CA 4LYHA 2EP8A 5JLJA 2HJSA 1UAYA 1Z2PX 3PC8A 4KO4S 2P77A 4XI9A 1AO0A 3GF4A 3OJWA 3EAFA 2TRSB 4NBSA 4WFJA 2FX3A 5BN4B 4GXQA 3RAPR 1PR0A 4N3GA 3IVGA 1KJJA 2C7RA 1UJ4A 3NRCA 1K7CA 3L7KA 4WN9B 1YS9A 2NTJA 1SC4A 2HAEA 3ASUA 3V1LA 1GPAA 1I3OA 1DBRA 5AKHA 1JFSA 2YJGA 2ZRAA 3GL9A 4F92B 5KHLB 3P4XA 2PZBA 2X42A 3RRFA 3U16A 4DCSA 3Q72A 5ALWA 3GPLA 2PD3A 4F56A 2V7VA 3K6SA 1QYWA 5BNIA 4JC4A 3MK31 4Q12A 3ZDDA 2ZRGA 4MRNA 2AZDA 3KEGA 3PU6A 4PPFA 3JAWB 1ORHA 1UADA 1KOLA 3UV7A 2XNHA 4OV6B 4RH3A 3STUA 3OQ1A 1L5RA 1ECBA 2DGDA 2FN3A 2PGOA 1Y80A 2WG1A 3ACBA 4WXHA 2ZXUA 3WGZA 2QLFA 2HHHB 2EDCA 3V8QA 3TS1A 4XXHA 4BPBA 4J3JA 1VP3A 5D5PA 3MMSA 4HAIA 2P5SA 1QYXA 1P73A 3C3MA 4MX8A 4Q39A 5C3UA 3WY9A 4AT1A 2ECKA 3MWFA 1ARZA 2WTAA 1FC0A 2MSCB 3OF3A 5BV2P 2W2PA 2HDNB 4ZD6A 4A2CA 2G7ZA 2BBWA 3TQSA 4BMDA 3W8NA 4YRGA 1UJ5A 4GGOA 2ZJ4A 2J48A 3EGWA 4KO1S 2YYZA 3JQPA 1YQQA 2HCRA 2VS1A 5IYZF 4RGQA 3WB1A 1IHXA 5BV0A 1FX0A 2O20A 4LK2A 5EIXA 1Q0RA 3R7FA 3KU1A 5FPTA 1TUBA 4KQ6A 3ZJUA 1ND6A 2OM2A 3E2IA 5IVDA 1DB3A 3CMCO 5J4HA 2V9PA 4L85A 1MJGA 3B9RA 3JQ7B 1AHIA 3NW9A 1M1YA 4D81A 2DHRA 2X2OA 1VL1A 4DPMA 2YJ5A 4E32A 1E7RA 5J9FA 2VHVA 4PYOA 4WCVA 1BDJA 3FPFA 2EGGA 2H2HA 2VAPA 3JRNA 3O8OA 4RV9A 2GESA 3BMCB 1KU6A 1ZRNA 4X63A 2B92A 5IF3A 4BU1A 1P18A 4IJUA 4B3FX 1NVGA 4CI0B 1QAMA 1M67A 2B0JA 2ZAYA 4HZUA 3DP9A 4P3YA 4JOCA 1P1BA 4PZCA 2FE1A 3ZZ1A 5EN4A 1YDGA 3WYGA 2ONZA 1WXQA 2WIGA 5TE9A 5KSWB 3OWHA 1JR4A 3QKUA 2RGWA 2VR1A 3KKOA 4R8KA 3JZFA 2GNAA 1MMFB 1N3IA 4EY6A 1AZLA 2IYEA 2PWZA 2EQ5A 3NNSA 1JYFA 3CW9A 5LA6F 2ODEA 2DT8A 2BPOA 2DZDA 4FFMA 1YRYE 3IA2A 2FHSA 2O14A 3N74A 4HB0A 1K2WA 4RHUA 2HA0A 1F8YA 1VI5A 2GTIA 2ZDGA 4RJIA 3TXXA 3HR7A 4GM0A 2HQOA 3WWEA 1ZMOA 2C42A 4P4SA 4ZOCA 4IDEA 3SKYA 1LBHA 5YASA 1SVLA 2XQFA 3SF8A 1A5AB 1CXZA 2PH5A 2EFCB 5HPYB 1R0SA 4WCDA 4XR4A 3TR5A 5JJLA 1FFHA 4YV7A 1YS2X 4LHEA 4IX1A 5EJ4A 2BGIA 1QCDA 4HNHA 4Q4CA 5JJIA 4FX5A 2CYAA 4JHLA 4PGFA 4QDTA 4CMEA 1DUSA 1PWZA 2P7IA 2YMLA 2WSYB 1GIAA 5J2UF 1TECE 3BCRA 3OVMA 1T6BY 1ZQ1A 3ENNA 3KYDB 4NE7A 1Y7LA 2BJHA 1IY9A 4WW0A 2DFKB 5EKTA 4ZT7A 1Q3TA 1NVDA 1ULAA 3S2UA 1GNQA 3CH5A 1GA1A 1CNFA 3NONA 1CQIA 1J1IA 1TRKA 4YEDA 3AP2A 1U80A 1VL8A 2GNOA 4MDHA 4QQNA 4D45A 4YT4A 4EB6A 3W7BA 4Q00A 3VR2A 5B3LA 4PC3A 3E8SA 1OTXA 3DD5A 2G83A 2OHGA 3P45A 2XKKA 3W1EA 1LBQA 4JBYA 2FUG6 2MMCA 2NIPA 2Y4NA 3HKDA 2ZBPA 3T7RA 3T4UA 1L7XA 1PFVA 1NXXA 4N01A 1QP0A 4YR9A 3W4JA 2YFKA 3RTAA 4BZQA 2PUTA 4WLEA 4ZAXA 3IEMA 1KVUA 3NETA 4HRAA 4PIMA 2QB5A 4QEDA 4DZZA 5HF9A 3C5EA 1V9SA 3F6CA 3Q9NA 2OXRA 4EVQA 3O94A 4AM8A 4CQMB 3BMNB 5E9JA 4K6HA 4C4OA 4RTPA 4EDHA 1N4DA 4CCSA 2QTAA 2AMJA 1GTJ1 1L7MA 2WQZA 3KC2A 3EFOA 1OPXA 2VF5X 4DQUA 2WJJA 3REGA 2JLQA 1VDZA 4MVJG 5M2QA 5IZCC 3PE6A 2BDTA 4YRZA 2P9ZA 1FX1A 3H2HA 4MI9A 1D2CA 2J5RA 2JNWA 4HZGA 2P0AA 2VVTA 1X1QA 2FW7A 2XA2A 3KDPA 4OPMA 4ZREA 4BL5A 4EPRA 2V4UA 5JDCC 3K72B 1U63A 5C5IA 2DFPA 4H35A 2E4YA 3S40A 1R8JA 4L0CA 1GNSA 1W2WB 3BE4A 3S8EA 1VMDA 2XODA 5CNMA 1BCSA 2QN2A 3R3HA 4O2AF 3II6X 4UKDA 5JQWA 2M32A 5KVSA 2P90A 1E0KA 1Z0FA 1T2DA 4FYXA 1CT9A 2PANA 4YP7A 4PAGA 2H4WA 2VPIA 3LMKA 1WW8A 4K40A 1KO5A 1NQUA 1RXEA 3MCWA 3D0RA 3PFHA 2OAP1 2Z8YA 4HH1A 3Q3CA 5DYYA 1OV4A 3HSKA 5EXTA 1O0CA 1YMUA 3T3GA 4CKCB 3OY7A 4Z0NA 4DCOA 2EKBA 3DAHA 4D02A 2UUAB 5K3CA 2QTWB 5GWXA 5KNLA 3UAZA 2VNJA 1BRMA 4A26A 1GZ3A 1C3OA 3DZFA 4CUKA 4BATA 5L4LA 3KIPA 2ISCA 1X38A 4X95A 1LVHA 1V1JA 2XHZA 4IVNA 1OW3B 4J0QA 3JYLA 1WU8A 2PX2A 1HDCA 3OX4A 1F0KA 1ZM9A 3QV2A 2GPBA 3PJDA 2PT5A 5ENDA 3C24A 2V97A 3AI7A 2BMFA 1OAOA 2B3DA 2VSOA 3OLCX 5IF9A 4J2TA 2GD0A 5DGHA 2JASA 3HB4X 1GFIA 1XQYA 3LQYA 1EQUA 3W2IA 3X1JA 3PPXA 2P91A 5IH3A 3GOQA 2YIMA 2IQ5A 4UMVA 2UUCB 2GF0A 1DT3A 1IVNA 5J5CA 3LPMA 5CVEA 2PVPA 3DTNA 1CCWA 2QRQA 3BRQA 4TLBA 2Y0PA 3HN2A 1QYVA 1TJ5A 5DCWA 4RE5A 3GLTA 4JXJA 4LHWA 5CLIA 2JS7A 5J3JA 4EI8A 3PC7A 3AR2A 1REQB 5KSYA 2EBHX 2X6QA 4TT3D 4PBSA 1W1WA 3D5QA 2X8LA 1NQXA 1WOMA 3I04A 5KJEA 3E5NA 1N9GA 2J6CA 5CVVA 6LDHA 5HP4A 2OYCA 1QANA 4DQVA 2BGRA 3F8SA 4G9GA 4ZVLA 3TNLA 1Z7BA 2C20A 1HMYA 1Z7YA 4KACA 4I4IA 1I7NA 1E18A 1W6RA 3H2SA 2BZSA 2P35A 2VZ8A 3LSTA 3H1BA 3NHMA 1GG2A 3GELA 1R10A 4PZYA 5AJZA 3GCXA 4FSDA 2QQFA 3O0DA 4QC2A 3DC2A 3VJMA 1NIPA 1IBRA 2FRVA 3B3QA 1HX7A 4CNBA 2AF4C 3QVGB 4E2YA 1GP2A 2ZVQX 1V5FA 4O02B 4X91A 3EARA 3WFJA 3CH7A 1XCPA 4Z1MA 1G8HA 3TJRA 3W4IA 2ZRBA 5JQGA 4DV3B 3DUFB 4CETA 4RENA 3VYTB 1GFZA 3K20A 2BSXA 1IHPA 1YQ9A 3E53A 3C5WP 4H1WA 2OZPA 2IXAA 1T9CA 3AEUA 5IPFA 3N0XA 3D2AA 4DCTA 4OJQA 4QZVA 3PQ8A 1UMBA 1GXSA 5CAEA 3VR6D 4H3KB 1IM2A 1FPMA 1EGMB 3BL5A 4GFDA 2N1MA 3CT4A 3HE3A 2AKEA 4NU8X 4IOLA 3M6VA 1I33A 2Q4TA 2Z08A 5DWQA 4B75A 1PS8A 1Z8DA 4DLXA 4B3SB 4OHYA 3UCXA 1OIVA 1PWHA 1XCJA 2GN8A 2J3DA 2RIRA 3F7NA 1DAIA 1E9SA 3DXYA 4GXRA 2AN3A 2ORIA 3BUSA 1D1PA 4MV4A 2NQTA 1NJ2A 4OFWA 1JHYA 3L6RA 4J4HA 1IFXA 1EFPA 2E4XA 3E48A 3O90A 3WYEA 5GTDA 3FAZA 4KOAA 5FYDA 1FSPA 2ZETA 4A0RA 1GLGA 3QUQA 4BMSA 5TEVA 1W5AA 4F4CA 2VPYA 2Q1SA 3HJCA 3A26A 3HKEA 3RIGA 4BZXA 4EKDA 4RIEA 3AF0A 4WLUA 3I0MA 3U4GA 2AK2A 4CL0A 4CKWA 2QRVB 3V5NA 1FFCA 1QE3A 2V5VA 3CVJA 5H82A 3RS0A 3UAGA 3UMCA 1SNYA 3QFSA 4UEKA 4BDSA 1VHJA 2AV6A 3H4IA 3QI2A 5BSEA 2QGNA 1JPJA 2IYZA 4IJKA 1KIAA 3IB6A 3E2MA 3GXBA 4ARAA 3DDSA 1FFSA 4PAOA 1XKQA 2AWOA 2YTZA 5CLQA 1F17A 1T5SA 3HJUA 3SLRA 3PVSA 1SM4A 2YX1A 4QBFA 3WIUA 3ER8A 2VT2A 1J23A 5B3JA 3X1YA 2BM0A 4BRZA 1OGJA 4XDHA 2YV4A 2ID8A 5FLEX 3SY8A 3COYA 3ZLUA 1OH6A 3W5UA 2F55A 2Q6TA 3MJDA 1P45A 1RJ9B 3Q5EA 3S29A 3FFTA 3UXEA 5BW4A 4D8XA 3H2ZA 2RGBA 1PG5A 3RG8A 1XPUA 2AOWA 4M8SA 3ZE0B 4DDMA 1G7RA 4WWHA 2PX3A 2QW8A 2XCRB 1VHTA 2FYTA 1EFHA 3HRKA 5ISMA 2GAIA 3EVCA 4AUKA 1WVGA 2WV7A 2QM3A 3CEHA 2RHOA 4GPEA 5D84A 3VR3D 4WVLA 1XZAA 5L6MB 3LQQA 4LZNA 5JAQA 3VAYA 4MVJF 3NBXX 3QI7A 2JATA 4RD3A 1W9HA 3CNQS 2D1QA 5KOJB 1YS6A 4AAYA 4DEXA 1W36D 3UMFA 3FHCB 1QO7A 1VA4A 3OJLA 3GUZA 2ZUUA 4FXOA 3EYWA 3KEQA 4EECA 3WSVA 4HCJA 1LK7A 5E7MA 3UYKA 3U3OA 2PZLA 3FZGA 1P7CA 2PY6A 3IEIA 2A33A 3GGOA 3G5MA 3JTEA 1O77A 3DMHA 4I55F 1K9SA 3HP4A 1USVA 2BGKA 2VCYA 3OPMA 4PQGA 3ZHQA 1J2YA 1JEYA 3E9EA 3PCRB 2DKFA 4K9SA 1KAQA 3HJNA 4HNRA 1XEWY 4IS3A 1NE7A 3DKPA 3E18A 4V2UA 3F7OA 1C7EA 2FZ4A 1SUCA 5JCOC 3EIXA 5AKXA 1T2UA 5CFMA 1Q77A 4JL8A 3JCZA 3NWJA 4H16A 3C43A 3KRTA 2XPCA 4I50F 5LP1A 1B43A 2ECFA 1U3VA 1WXFA 1GRQA 3GRPA 4KIGA 4MS4A 4BX9A 2D4AA 2JI6A 3SC3A 1QU2A 5UKDA 2NXEA 1VPEA 2H0RA 3ORYA 4B2YA 4ZZ0A 1KBOA 3VYVA 2F3UA 1E1RD 1IDOA 2YOHA 4FCWA 5K1ZA 5AW2A 1Q19A 2VK1A 3V1YA 1CJKC 4WOCA 1ND5A 4UOZA 4HT3B 2E18A 1C3LA 1JEEA 3I9V6 1OAAA 1Z7WA 1CE8B 5ALJA 3E6AA 2DT5A 4KVFA 5EEHA 3A4VA 2HMTA 1GPH1 1SKAA 1SXJA 2CJWB 1JHAA 2O0KA 3PQEA 3WK5A 5JMWA 4BKQA 2BJWA 1VLVA 3HB1A 3QF4A 3OFKA 4I4LA 3VVLA 3WRYC 2QTTA 4S04A 3UBMA 2RGAA 3HCDA 3GLIB 4R6XA 3LBFA 2F48A 4RFSB 2WUFA 4EO7A 3KPUA 4N7JA 3EWNA 1PZFA 2DG2A 2I7TA 2RI0A 2GPNA 3EIWA 3VGJA 1TFRA 2PBLA 1WMSA 4MVYA 4YCNA 4N5DA 1JKJB 1O4WA 5L7YA 1DEXA 1HLDA 1W94A 4IOKA 4ZIRA 2Q3JA 1QF6A 1G0NA 3AI3A 5D6NA 1KMQA 3PSHA 1JJIA 1SHJA 4FBLA 5KKAA 1AA6A 2CVOA 3TX6A 1ORIA 1UZUA 2PZEA 3SQOA 1DL5A 3IAS6 3SZ3A 4BFUA 2JRCA 4R2JA 2H1OA 1MB3A 2P9EA 3KQTA 2OBXA 2QXYA 3DCIA 5KCZA 1FLDA 3R4CA 3HV0A 1DX9A 1MFZA 1UKCA 1GAJA 2G82A 2PDAA 4TTRA 2EQAA 5D51S 3H1EA 3Q3GE 1UR5A 1KK3A 2E4ZA 3AB8A 3L6DA 3QPUA 4FFBB 4HC4A 4JZYA 4LJRA 2PUGA 4BVKA 2HA7A 2XZOA 2FLVA 2PD6A 1KKUA 2ZJZA 3CCFA 4YV1A 1DRUA 2VJBA 1PSWA 3E22B 3SM3A 2AC4A 5AO9A 4K0RA 4NNOA 3RVRA 2Q3DA 3DR5A 5LYJF 4G5XA 3G79A 2Q21A 5HS6A 4DLUA 4YWHA 2DX7A 4EB0A 3C39A 5CH5A 5B6JA 1O03A 1QUEA 1Y3HA 1CRWG 3LLSA 4IIFA 3VOAA 2E5LB 4TLLB 1Z73A 2SHKA 3F9RA 3ZY4A 1GNPA 4B3RB 1HY3A 4WKGA 2Q5JA 4P33A 1YBMA 1X77A 3LBHA 3MLBA 4MV8A 2V9CA 2NQ2C 2XUKA 3A05A 4ND8B 5ALOA 2AG1A 4CUJA 1GDHA 5EIBC 2XBUA 4I5IA 3MT8A 3U4IA 4P32A 5IT0A 4YPVA 1Z35A 4ITRC 5JD3A 2NM0A 3ND7A 2YVQA 3M83A 3P9ZA 2QPOA 3T0IA 1ISGA 1KO4A 5F7OA 2FQXA 2GXUA 1T43A 3TTYA 4G8JA 2GPAA 4W9NA 2WTUA 5FOTA 2QUHA 2V7GA 1NC1A 4JOQA 2V45A 3AONB 3P94A 3Q7QA 5DGCA 3SF0A 1XMXA 5CXQA 3QZUA 3IP7A 4MUAA 3RD5A 4EGJA 3BD9A 1W2HA 1YC5A 4H18A 4I9UA 5F3RA 4GYYA 3IP3A 5TX7A 3U48A 3OICA 4LCBA 2OBLA 3Q2OA 6AT1A 3DO8A 1T2EA 1BA3A 3TOZA 4PYQA 4F3NA 4QXOA 4PSDA 1XC7A 2O3SA 2R86A 2OZLA 2VJMA 3RJ5A 3ZGYA 2ZBUA 1G2QA 1VFNA 2W22A 5J1SB 5HFJA 1YR2A 3GUHA 2X1HA 4LMAA 1R00A 5JIBA 2R84A 2HWKA 1XJWA 2HJRA 4GLBA 1KQ3A 3MXOA 4H27A 4NG4A 4KH0A 5EJEA 5ALDA 3BWVA 4L2IA 4EPXA 1U9CA 5H3HA 5G02A 3GJXC 3D3JA 3G13A 1P7VA 1SEPA 1ORRA 4QUEA 2RGCA 1V4BA 1JXMA 1VM6A 1Q7TA 2YXLA 1IY2A 4MPJA 5CT9A 4CIWA 4KV9A 5GVRA 1SXQA 3BE8A 5H3LA 2VJOA 4OA8A 3Q1KA 4CEIB 1A1SA 3VI4B 3QA3E 5K3BA 3PDIB 3GNQA 2R1ZA 1T8TA 3BSYA 3LVRE 2C07A 3Q3VA 5ELMA 1P6UA 3PX3A 4HDNA 1O1YA 2GBPA 3MGBA 4HMPA 2EZ8A 2GEBA 4TMVA 5E3HA 4BNFA 3UANA 2PYIA 5F35A 1PWXA 3GGCA 1P9RA 2VDNB 3VZSA 4QGSA 2YFHA 4KPGA 3THWA 1AKVA 1RLOA 3CPSA 3CLTC 3EVNA 4I6GA 4ZKEA 4DCCA 4QDXA 2VSXA 3WB2A 2FKAA 2ZJ3A 2PBRA 1ULTA 5IAGA 2JI4A 1CFJA 5IJ9A 1WL8A 3X43A 2WILA 1QONA 1JEOA 4GP6A 2D2FA 4OXIA 4EL5A 5I9LA 2VF8A 5FJJA 1I6KA 2PZMA 2WJGA 1U5AA 1HDZA 2NO4A 2GSWA 2YNMA 5DU2A 3W34A 4U9HS 1T9HA 2PKEA 1XDZA 2X2EA 5JYBA 5LZ2A 2DOKA 3BJMA 3GVPA 4NV1A 5FPQA 2KHZA 3A37A 4JIGA 5IJ0A 5JJKA 3O93A 5D5HA 1OGIA 1KI6B 2AR0A 3D3WA 1UMKA 2CDCA 1P2BA 2RHTA 3TFQA 2RG7A 4LJ7A 1XVVA 4M8NE 1LBTA 2GEDA 3ER6A 4MB2A 3BHJA 2E87A 3NEJA 4ZAZA 3GVCA 4OSPA 5BQPA 2XIQA 1G18A 4CMCA 1KSJA 3OQPA 2JCVA 4A6XA 1DHTA 2WJ4A 5FNVF 1POXA 1JWLA 2DM6A 3VPDA 5ALHA 4RA6B 3CMMA 3V8PA 4ON9A 3ZD6A 3STTA 3E1SA 3GVXA 1A95A 3Q9UA 3IJPA 1CF2O 1PZEA 3GRCA 3HVUA 3R41A 4YP1A 3TJMA 1F8GA 3N2YA 4NOJA 1E2BA 3NP7A 2AX3A 3ZCRA 3HTXA 4YRLA 3WIDA 3CVWA 2V7PA 4ZO4A 1H65A 2FWMX 1JH8A 4LF4B 1UBUS 3HU5A 2JFQA 4JLAA 4K88A 3GT4A 3EUWA 4RV4A 1JEDA 2JIRA 3E9QA 1C0EA 5CT5A 3CGGA 4FE3A 1M0EA 2XQIA 1Q7EA 4EB8A 1BWSA 4FVTA 2UZ1A 3H0EA 5AJWA 4AICA 1O6GA 1HOTA 2N0SA 4WUVA 5CYFA 1E9VA 1XELA 1YNSA 1J06A 3GEGA 3KXIA 2WHXA 1Q1EA 4M9SA 2ZYRA 2C4WA 5FWXA 2W5UA 3PGKA 2V7WA 3LECA 4GR5A 3VTKA 3QGMA 4YJGA 4GP9A 3FTCA 1L3IA 1JHOA 5TQ2A 1WV0A 1QGUA 3R9WA 1EDDA 3RTBA 4DYDA 1H2EA 3MCZA 3R6WA 2A92A 1G8MA 3AEKA 3I2KA 3WZLA 3DE6X 4Q7JB 2XADA 1DWUA 4OK6A 2VBGA 1GPWB 1TXGA 4ZVTA 3IOEA 5DV9A 5B37A 3WKAA 2PQ6A 1C9YA 2IYQA 3HGQA 2JG3A 1SUWA 4U7DA 1C7FA 1RWBA 3QOWA 3L7DA 1J0EA 1ZMXA 2IKQA 3H6GA 3PA6A 1L5WA 2VF7A 2FG6C 1I5RA 1Q7BA 3B3JA 2EW1A 3ZHYA 3FE2A 3GEBA 4P5PA 2O0LA 2Z6AA 2M6LA 2UYGA 2FX5A 1O5IA 4OH1A 2XUIA 5EERA 1NQ5A 4A2QA 4IIHA 4QVKA 5JHGB 3CJRA 3EZ2A 5KOHB 3CR7A 3GG9A 1DZ3A 1OI2A 3FSEA 4NS1A 3CZ9A 4ZOLB 1U5BA 4UBNA 4PHGA 4IQ8A 1P61B 3MCAA 4XB1A 3HVIA 4XJSA 4BRUA 3IAFA 3FCEA 4LOIA 3TGLA 4M7PA 4JKYA 4TVSA 1EVLA 1IE3A 1BSVA 1I0ZA 2ZTLA 4Z8XA 4BNDA 1TGVA 2VP4A 4YH1A 4FOSA 4KQGA 4Z1OA 5C31A 4QJ4A 4G1VA 3V9AA 4TV9A 1QFSA 3VFDA 3U60B 3TEMA 1XWWA 1KBZA 1O58A 2VFAA 1VIVA 2NXWA 2X15A 3FPEA 3PWSA 3FAKA 3NU1A 4YX9A 5J59A 1YKGA 3FZEA 4Y2PA 4MA5A 3BJIC 3I28A 4ND7A 4WKPA 3OJOA 3H9QA 4HZIA 2OFWA 3HM9A 2VK4A 3BHMA 2GMWA 3DBRB 4CMIA 4N4AA 3H65A 3RB8A 3TLCA 3DMDA 3GG2A 4AZ0A 4ZI5A 5KYKA 4S0ZA 1YK1A 4XDGA 4YJKA 2OLEA 4OHRA 3WKDA 4Z4CA 2QVBA 3WLPA 1Y9DA 2DSTA 3CINA 1VE9A 3WQBA 1R6UA 2NSDA 2OZKA 5ICSA 2D3WA 4H0CA 3HACA 4PM4A 1G6KA 1X86B 2BKUA 4HWSA 4FFNA 4KRXA 5BXYA 4XTCS 4DT1B 2CNKA 3I5XA 3G8AA 3CIFA 4KITB 3H5VA 4NTZA 4XIIA 4F93B 4DGQA 2ZSDA 1NASA 1YRHA 3SLKA 3U6KA 4I81A 2DPXA 3OU7A 3FXAA 4GMGA 3L1HA 2MTBA 3M6IA 5D3ZA 1Z88A 3HPRA 3VO9A 4UARA 3S3TA 5A3JA 3RAEC 1O4VA 1QFYA 3A6JA 4NKRA 1WQ4A 5DN6A 1MAVA 2ON6A 2P5YA 4FYWA 1Y4ZA 2LZ0A 4KR7A 4FD2A 2PV0A 4BX2A 4H3VA 2J9XB 4PX3A 3H99A 2XW6A 3E7FA 2GJKA 1VXOA 2A9QA 1B2LA 1VKNA 3WKCA 2FZGA 3D6FA 4UTPA 3H2JA 4MEBA 1IZ8A 5A3QA 5BN3B 3HM2A 2W6CX 1SUIA 2QVYX 3PEEA 1ZL2A 3PNYA 2CVFA 1SHUX 1C3JA 4TRRA 2IVFA 2ERCA 3HU3A 1FTQA 3PHJA 1AKWA 4ZZIA 5LOVB 3VKHA 1FK8A 4RX1A 1TRHA 3BE6A 3B3FA 4UM9D 5JJ5A 2HRCA 5KYUB 3M6LA 4RXUA 3MVEA 5I47A 3WRVA 1NJSA 1R0RE 1PIWA 1ZAYA 1VSVA 4AZWA 3KK0A 3LUHA 5FUMA 4AJHA 2ZGVA 4BNXA 2WOOA 4OAQA 1LZLA 3BFVA 3HBLA 4X5OA 3QBDA 3C45A 5AI6A 5B6PA 3OFJA 2H4HA 3QE4A 4R9UC 2FW6A 2C3PA 5CH3A 3A9WA 3V8NA 1TW3A 2JGDB 3MNFA 1JQ3A 4D43A 4RDXA 1NG9A 3OZSA 4P22A 2L0XA 4BNJA 2Q5EA 1NLFA 1GUFA 4MYSA 4RY9A 1QP7A 2ZK7A 3MM4A 2IZ7A 1V3VA 3HUFA 3VPFA 3WRYA 3RHFA 3EX7C 2WMDA 3LGXA 2WKRA 2PR7A 2QJRA 5EJGA 1RPTA 4G86A 4YUYA 5HFNA 3W3AD 4KN5A 4KU4A 3QPWA 2WBLC 2WM9B 3SXJA 2FW8A 5ALRA 4I1VA 4C4AA 4N9QA 4F21A 2C5EA 3MELA 5I9NA 1K27A 3K35A 5IUJC 1PQUA 1FFBA 2R48A 4FE4A 2W2NA 4RZUA 1E6MA 4D0LB 1MJNA 3UBTA 1SA0B 4X7RA 1IAVA 3B6JA 4QFMA 3VSDA 2ZJ2A 3FLAA 3I34X 4K6MA 3S7ZA 3ZPXA 4TMKA 1HE1C 1ZRMA 3GI1A 3QU5A 2Z6QA 2FGJA 2GCGA 3GLGB 4RESA 3U09A 1W0JA 3TTXA 2H16A 1TO2E 4OMFG 5CXSA 4MARA 4OP3A 3TPZA 1JKFA 4HDOB 5KB3A 2AHOA 2OQ2A 2O57A 4X6UA 1LTQA 5EESA 4CF6A 1HETA 1WNFA 4I0WB 1DJMA 4Q02A 1PUXA 5EWLA 2W8BA 3DT6A 3V32A 3ZUGA 4RD4A 2IJGX 1JU3A 4R1MA 3P0FA 4OKNA 5E6RA 1B0AA 2DUNA 1ONOA 5I9BA 3KM0A 2D0OB 2V58A 4DV6B 1Z17A 4NS4A 2HJHA 3QUSA 3OJXA 1TUGA 1U8ZA 2WHEA 3G02A 4IGFA 2J0SA 1E6CA 1DJQA 1QH0A 2DE0X 2PUJA 1NVMB 4J29A 4J7XA 5ILQA 3UHOA 3BZWA 1CUHA 5EWMB 3SR3A 1D4OA 1BC5A 1N0UA 1BH6A 2WR8A 3NDJA 5DEIA 3HJGA 1O2DA 2BR5A 1H4VB 1SIWA 1K5GA 1L8LA 3D8HA 4G0NA 3VNRA 3F9IA 1Q15A 3JPWA 4RMHA 3TNJA 1NM5C 2JB9A 4P36A 2P9YA 3FOWA 1K3FA 4U5QA 1DZIA 1WAMA 1JG6A 2F1JA 5I8ZA 5SZKB 3BXXA 1O7JA 3NUGA 1EFUA 2HA2A 2W11A 1HFKA 1SXIA 4M53A 4ARSA 2AG8A 5TEWA 1DAOA 2XE7A 4RF4A 1HQKA 3ZV7A 4ND4A 4AC9A 3LUPA 4R2XA 3O03A 4TN1A 5EMNA 1RRKA 5GVSA 2WUEA 2XDQA 5JD6A 5AVUA 5JZMA 1M34A 1CUIA 3U7QB 1SGWA 3UMGA 1E3TA 1Z4QA 3EQ9A 4CKEB 4G5OA 1E3DA 2JVIA 4PS0A 1FJXA 3L1UA 2XD4A 3F3MA 5FO0A 2V03A 1D5CA 3K2QA 4NFHA 1OGYA 4AYTA 5J1TB 1FDOA 2Q0HA 3BAFA 1L7AA 3OIDA 1J1ZA 2W70A 5FULA 4ZV4A 5I6DA 3W5BA 1KIMA 5JYEA 3C1TA 2HRZA 5AI8A 4GR9A 3MTBA 2C9CA 2PPLA 3NT4A 1TC2A 2P1ZA 2CLOB 2XAAA 4H3SA 4FD3A 5JZVA 1P0MA 3JD0A 4Q1AA 3VV3A 4RJTA 3PNKA 4GIBA 2ZT8A 3CM0A 1E2PA 3W79A 1A2OA 1R12A 1TKRA 3GLGE 1YONA 1UEJA 1R37A 2ZANA 2VNAA 3HY4A 2H2WA 3JW8A 1MENA 3W2TA 4KJZA 1FYXA 2IYVA 2QTRA 2C61A 1YZYA 1YIAA 2DBVO 3G2PA 3QW2A 4HVAA 1UBCA 2CVPA 5FXMA 3F4KA 4ENPA 1O95C 1PEAA 4QBIA 1ATZA 1K97A 3PWKA 1FSSA 1NGSA 1DCFA 5AKEA 3QV1A 3WLQA 4D4HA 4BE9A 4D4KA 3KQKA 1A0OA 1TF5A 1ZISA 3C4VA 3OZRA 3JD3A 2VTEA 1E3WB 3WNVA 2GZ2A 1MIHA 2F8MA 2WAAA 5GZ3A 1JNYA 1JKMA 2FXVA 2XT9A 3V8RA 4BBPA 1AK2A 4I8DA 4LJSA 4YMLA 2GI4A 4EYQA 4AKIA 4D4MA 1MQAA 3O4VA 1ENPA 1JKIA 1QFZA 1UK6A 1YBAA 2QWXA 2WFAA 4TTVA 1JVNA 4Q1EA 3DMTC 7YASA 4ZDJA 4JJIA 1T4GA 2VJDA 4D6XA 4D92A 5JV5A 5JTUA 1SPXA 5KTKA 1NMZA 3Q11A 2K4MA 3LUDA 2NP7A 4LQCA 2CV1A 5ALEA 1P9LA 4P86A 4OQ4A 2C2XA 1PJBA 1Z2DA 3A6ZA 4MVJI 2VDQB 5ILOA 4LBZA 2GRJA 2HRBA 2CHGA 2A84A 4KAXA 4KAFA 4U7PB 4MS3A 4U00A 1SXGA 4BBAA 5KJ6A 2VT7A 2NYAA 3GB9A 3DF9A 4KNWA 5F4BA 1XD2A 4BUJA 1A97A 1V47A 1L2TA 1Y3FE 2C4KA 2H17A 3OE7D 4IXNA 1NWCA 5EHQA 1XJQA 2JAUA 1IDN1 2OK8A 3EFBA 3PKZA 1ODKA 2ZRJA 5F5XA 5KHOC 3EQ7A 4I9HA 2JLXA 3GUUA 2ATIA 2I3ZA 3MWLA 4LYGA 2EJCA 4QASA 2NSYA 1J24A 1KVRA 1WXDA 2DUJA 3O4HA 4U4AA 1BDIA 1UDXA 3IV6A 3JWIA 2I4MA 3TPFA 4QQ8A 4R9SA 4BFVA 4C0HA 3ECCA 1IZZA 1U9IC 3N8IA 4G5FA 4HS9A 3KJXA 1P4RA 4MXDA 2QM7A 2ZZKA 3NJRA 4WCFC 4DRZA 3VU0A 3AVTA 2B25A 1RKQA 4YJ3A 1YHYA 2WF5A 4IG4A 4PSAA 1TVKB 4LF8B 1QIMA 1TD9A 2A88A 5BSHA 1W5TA 1SXPA 4JL5A 2APJA 4NCBA 3DE4X 3MWKA 1P4HA 4C0WA 1EFDN 5JOQA 2BMJA 3FPGA 4HGPA 2MIIA 1UBHS 2Y9PB 2PA3A 2AOVA 3EMBA 1KQNA 4CG0A 2CNWA 3QWAA 521PA 5K0BA 1EUYA 2VJAA 3P9NA 1M9NA 4MV6A 4O2LA 3H5LA 3PGLA 5LP6F 2UYCA 4AQYB 1XZNA 1P60A 2HCTA 3OMXA 5KQGA 4RTOA 2COEA 5U9CA 2WF7A 3D0QA 2XB4A 1IWBB 4H59A 2B7CA 3G1TA 4G56A 2SBTA 3C48A 2OHIA 4MQ6A 4X8MA 2FMUA 4WA7A 5BWCA 3V4OA 3DM5A 3CUKA 1EQAA 2IZZA 4AXXA 1MNQA 1SC1A 1Y8QB 2GCNA 4J0KA 4C0BA 3PTAA 2QN7A 3LWBA 1B0PA 1KI8A 1V5IA 5JH7B 3PHLA 3OJEA 2PUDA 5T8KC 5DK4A 4YRTA 3EA5A 5DBHX 1RKXA 2ZRMA 1Z0SA 3AGQA 2I6SA 1A8PA 1AZTA 2R8RA 1YMQA 3N5CA 4WV3A 3GEHA 2M9MA 1FP4B 2QRPA 3NTLA 3EQ8A 5CGZA 5K3OA 5LLTA 3IPRA 4XW2A 5KQSA 1Z6YA 1P19A 1QRUA 1MX1A 1PUIA 5IM5A 2XWSA 3EMKA 1Z8FA 1ZITA 4RCVA 2CCGA 4OYRA 2AC7A 4YALA 1ULBA 1V8BA 2A4KA 4YQFA 1J56A 1Q7CA 1CQJA 3FJOA 4Z86A 2C4NA 3C6KA 3KYJB 4HQ0A 4ARUA 4WINA 5GONB 2O2IA 4KQFA 2OCPA 1GKIA 3SHOA 4V0OA 3NXKA 2RHWA 4F1KA 1XJ5A 2P9QA 3ZG6A 1VLQA 3M9WA 3ZX4A 4I36A 1ZUIA 2RB5A 1MJ5A 3LM8A 4GKVA 5JASA 1EK2A 2G25A 1K4KA 4N7BA 3DT8A 2TS1A 4E4TA 3TG2A 3R0ZA 1HSZA 1TZ2A 5H5JA 2B2NA 4AIRA 4OLFA 5CTAA 1KRXA 2XNDD 3LKVA 7GPBA 2ZYIA 2JCYA 4DV0B 1XVUA 4F46A 3F6BX 4YRNA 4LOHA 2VYND 1BMDA 2WA2A 3VVMA 4YT2A 4UEJA 5KOIA 1KJ9A 3Q6NA 1S9HA 3N8NA 4ETMA 1D6JA 2QTHA 3SN6A 2IYOA 5AW4A 3OESA 3CVYA 5JFTA 3PD7A 2W4QA 3D6TB 4V38A 3RS9A 1WQ3A 1EXDA 4PZLA 4ZPXA 1P6QA 1BCRB 2H48A 5ALVA 5K2MA 1ETUA 1UBMS 2XB9A 1CUGA 1T6XA 3KWJA 5DIZA 1NBOA 1YHNA 2NVWA 3IHTA 4MYRA 5FLYA 4EGSA 3A9RA 3KJEA 3P71T 4WAUA 2H8GA 2P6NA 1XHEA 4ARCA 1KQFA 2O52A 3CH4B 5LQCA 3TB6A 5FEMA 3DHNA 2NGRA 1TC1A 5FB3A 2Z30A 1IQ0A 1G2PA 2KE5A 3CF4G 4MQLA 5JY1A 3KKLA 8MHTA 1YACA 4PHCA 2FZ5A 3FZQA 5HF5A 3M3DA 3SJCA 1QB7A 1O8CA 2V98A 2H18A 3U1BA 3TX2A 2H08A 2XCTB 3HXMA 2CV0A 3ELDA 1KZ6A 3DWGA 3KYCA 1NP7A 5EYPA 1BX3A 1A8SA 3EH2A 4CT4B 2AJ8A 4MW1A 2E85A 2NPOA 4I2NA 5AW5A 3U80A 5C9ZA 1Z4MA 1NFQA 3F5SA 3ML1A 4HYQA 4HFRA 1HDRA 1C14A 1F38A 2XMSA 4OA5A 3B36A 2G1AA 3WP0A 4A8JC 3K0FB 4RFLA 2J9FA 4RACA 5DI9A 3TQOA 1TA0A 4FX2A 3TSYA 4BGIA 3SYKA 4HVCA 4NJEA 4UREA 4EO9A 1SVOA 2TMYA 3HBMA 3L1JA 4GZLA 4DBZA 3RHTA 2IS2A 2WU3A 5FUBA 1QCCA 3DLBA 2IHYA 4BQOA 8ABPA 4C7OA 4RU1A 3R5XA 2P6OA 2YN4A 1RZRD 2CXOA 2ZTVA 1YTUA 4G67A 5GOZA 5GV8A 1BDBA 3FUTA 5EUQB 3IAXA 1MOSA 4QO7A 1TAQA 5CPBA 5DOZA 2QRKA 2K5UA 4CLDA 1SCJA 1FNMA 2LCIA 4W99A 4EEKA 4FMDB 2IU4A 3K94A 1EUDB 3A3PA 2REXB 3V6MA 4NCNA 4J7UA 3O4JA 1K63A 5JAIA 3MTIA 2PEYA 1GT6A 4NHOA 2VH2A 3KFLA 1B3BA 4RPIA 1AURA 2XKBA 3NHYA 4KLCA 5ECYA 5AVSA 1YZQA 2HMUA 2JLBA 3VISA 2Q2QA 3U40A 1KY4A 1RQ7A 2DFNA 3JY6A 3A4IA 4LISA 4U5XA 3KJGA 4ASUD 2YN0A 1QPBA 2GM5A 2IYFA 4HQRA 4IZ6A 4UU7A 4YJFA 4AN0A 2B82A 4TXJA 5BV1A 4GOMD 4IJ6A 4NJMB 3NWBA 2R97A 4Q9AA 2F1RA 5EUBA 1BXZA 2ZSFA 3AGPA 2BGMA 4JB3A 5ALGA 3QBJA 5HCUA 3DFMA 1VKZA 2XBLA 1RIFA 3KUKA 2R1TA 1GL3A 1KI7A 3ODGA 4KQHA 2PT7A 4FYYA 1EZ1A 1FDUA 3N53A 4WXPA 3CLKA 3ZIDA 4LV6A 2QGZA 2FU5C 2VWHA 1A5ZA 1QVRA 3L1IA 8AT1A 2WIAA 1DNPA 3FPSA 1BVUA 3NDIA 5LZ8A 4PLHA 4ZI7A 3UW1A 4U02A 4OBWA 5CEJA 4UBIA 3PX2A 3GROA 2IU0A 4G97A 4HB2A 2YR0A 2YZ7A 1V25A 3D4BA 4O25A 3NEYA 3WDKA 1SHLA 1ESZA 4V0SA 4RGYA 1KYXA 1N7GA 1P4SA 2J3EA 4WNCA 3TQTA 2D13A 1KDOA 3GDFA 2Q9UA 5AVXA 1DINA 3OFND 5TC4A 3L8FA 2JCBA 3JATB 4OU5A 3VPAA 2QTLA 4B7ZA 2HT1A 2W6NA 1I9CA 1VE1A 1HPLA 1NLYA 3A6HA 3X3HA 3VO1A 1RQNA 3MINA 1ABFA 5TRTA 4D41A 1II9A 5ITWA 2HMVA 3E0XA 1UJMA 2DFLA 2V6FA 4MR8B 1E4EB 4FKMA 4O4HA 4LGYA 5IK2A 4DYHA 4KR0A 4JGBA 1A9XA 4JITA 1ZVKA 4QLBA 1I3LA 4N7MA 5DDIP 3S2ZA 4BVLA 2IPNA 5CNIA 1HT2E 3A7DA 4FZVA 4D4JA 1L4MA 5H16A 2R6ZA 3I5UA 4Y6OA 1IOWA 2E6UX 3WNBA 3VHXA 1OKKA 2GEVA 2HWYA 2FCRA 4YT5A 3OEED 1MU0A 1FUYB 1C9EA 1ONPA 3RYIA 5K8VA 4FR0A 1T91A 2WTXA 5IKPA 5LZ9A 1I01A 1U98A 4RJJA 1FJGB 2GBLC 1BD3A 1Z07A 3UYLA 2DHDA 4DNXA 2NZ8A 1HG1A 4F9GA 3MRXA 4O4JB 2YWCA 1JJAA 1MT0A 1QM5A 2I80A 1UKYA 2WIJA 4I7EA 4L57A 1TMGE 5GIOE 2PBFA 4EHKA 3GFQA 3OFVA 1EX9A 5ESXA 4EA8A 3CU5A 1DUIA 2GZHA 4NXMB 4JDPA 2ZWOA 1R27A 2FN4A 1Y5LA 1ILWA 5DNWA 2A58A 1TM5E 3V6LA 5K45A 3F46A 3G5UA 1ZBQA 2NU8A 5KYXB 1ABBA 3EG9A 4XVCA 1ZXBA 3G17A 2WJHA 4QTTB 3KB8A 2PRKA 1PG2A 1U8FO 4ZAVA 4HG2A 1IRXA 1UP6A 2OOKA 1K6JA 3LQ1A 4QXAA 3UOWA 5F2OA 2MINB 3I4FA 3QWFA 3HVHA 4NBTA 1E98A 2YW9A 3O8CA 5LBUA 4BVAA 3I37X 5FOSA 5IYZA 2GKSA 2OM6A 2NAFA 5IJWA 3I09A 3T5MA 2EYUA 2GDZA 2GFHA 4HN4B 3OOWA 2X19A 4QM7A 3HXQA 3J80A 1Y6GA 4KODA 3Q10A 2ATCA 2QYTA 3OZEA 4YN3A 1U1FA 2HPAA 4M4SA 1ANKA 2X0RA 1OIWA 4R1PA 4ZP1A 1N0HA 1RACA 1E5XA 3ELUA 3JAKB 1K6IA 3KVVA 3QPAA 5U4QA 5ALIA 4BLOA 2GUWA 3IIIA 3I92A 2V7EA 3MWDA 2GQ0A 1DTWB 1VFPA 4XR9A 5A7FA 1IHYA 2RK4A 3VM6A 1PT5A 3L04A 1IXZA 4IHAA 3RUCA 1I13A 3TMAA 1H6CA 2JHAA 1G4AE 1JILA 2VEOA 2BFCB 2VNSA 4RPKA 2XVMA 3D3EA 1IXRC 2E48A 3HCWA 5TR9A 3VH3A 3VU1A 1QJCA 4Z0PA 5JXJA 4MCHA 4TN5A 2XWQA 1EE1A 3WMWA 1CUBA 2HZ7A 3JALA 4F72A 1X7WA 3AFGA 4TS9A 1PKEA 3B5JA 2NVOA 4W7IA 4B6GA 4EG4A 4WBSA 3OIGA 4XKJA 5FL7D 4C2TA 3OUZA 3WL7A 3ELWA 1LC0A 2OSBA 5EJ7A 4RSMA 3EC2A 3TLJA 3WLSA 4GLLA 3THSA 1AMUA 2FF7A 5AXDA 1GPUA 1C1HA 3LQRA 3E9ZA 3LSYA 4MUGA 5LA6A 4NCXA 3RUDA 3I9MA 4LZZA 2QROA 1LS1A 1Z8NA 1LV7A 3P32A 4WVFA 3VU3A 4ETNA 4YDQA 5AVYA 2ZSHA 5E4YA 1E92A 1GRRA 1XB2A 2ZRFA 5JD4A 5KNCH 1ILEA 5JSZA 3GRVA 2HYIC 1PT9A 3AY0A 2ZS9A 1IEXA 3OUTA 3PFWO 4RC9A 1TTHA 1DG9A 1J7JA 2DQYA 4FC6A 1UPAA 2IUEA 5DXAA 2WHPA 2IPMA 3T1OA 3R7NA 1Y3IA 1VRVA 3C3DA 3L0SA 2MT9A 3RRXA 3WB9A 3CR3C 1PFUA 1QC5B 5AWFC 3K0CA 3VZRA 3DQQA 1CBUA 1XEXA 1EGVB 3ELBA 3FDIA 5AKKA 1SUFA 1SELA 4YJ2B 2Q6IA 3EW7A 3QE2A 4ASUA 3PXAA 1J0DA 3ZHXA 4DCMA 2CXXA 1Z74A 2Q2OA 2C99A 5EUCA 3CV3A 5HG0A 3ZW8A 6NULA 5EE3A 5IFLA 3GFOA 3SEZA 3O74A 4G85A 2Y76A 4UUQA 4A36A 1ZCFA 1FFYA 3NTOA 2R0QC 2PS1A 4M1KA 9MHTA 4M0PA 4RKYA 1WPXA 5IVHA 4HP8A 1VCHA 4POAA 3GLHA 3IIEA 3CEJA 5G0TA 5LIPA 1N32B 1WQ1R 2H5JA 3KZXA 1C8BA 5K4HA 1OAKA 5KMGA 3VV2A 3CRW1 1NJ6A 3ZI0A 4CTOA 2YIJA 5TGTA 1WM1A 4BFTA 3K9WA 2ZE7A 3UICA 4RTSA 3ZLJA 4GP7A 3SFVA 4GVPA 3H7IA 3UGKA 421PA 721PA 1FU4A 5AW6A 3I6BA 1ZESA 3NPMA 3P9KA 4L0MA 5IAKA 4KREA 2QN3A 1LRJA 3PFGA 3BXFA 5AP9A 4CCWA 3UH0A 4A5OA 1L3CA 1ZJ6A 5DGXA 1M8GA 2OCAA 4EKNB 4REQA 4M87A 2C4TA 5AYVA 4R71A 3CJQA 1CEXA 1IB0A 4E5NA 4KTVE 4Q18A 4WERA 4R31A 4BQRA 2MSLA 1MH9A 3U4MA 2AG6A 3QE3A 4DUGA 4OHVA 3E15A 5IKMA 4BAGA 1G21B 4KO2S 1F3OA 4WLNA 3C3WA 2C57A 4N6GA 4BJ5A 5BPHA 3IQDB 3OJCA 1LV8A 1HDGO 3I30X 4NATA 3AETA 2Z9CA 1T3SA 3LBNA 1RP1A 2UAGA 4K6KA 3RYHB 4II7A 1BMFA 4Q3OA 5MDHA 3ONNA 3FW1A 1TYBE 1RHJA 1P7PA 3VPBA 1JLKA 2AR7A 2GZ3A 4DXAA 2O0HA 2Q0XA 3WAJA 5F98A 2B61A 1T6YA 3ZWWA 1P81A 1MEOA 4O2AA 1WVMA 2M6RA 2CN1A 3ZNNA 2GF9A 4N1AA 2GVNA 1GCUA 3C1AA 2CMHA 1H9AA 4DSTA 1XAJA 2WP8J 4PQEA 4YRRA 1DRKA 4RM3A 3AWIA 4MR7B 4DIKA 2R66A 2ZQYA 3T9EA 3R6TA 1W59A 3RC8A 3E9DA 5DMXA 2GPJA 2VT3A 5IDQA 1EG2A 4R7ZA 4RJKA 4EW1A 1DXYA 3AERB 1C8KA 3TPCA 1BXRB 1E2HA 1YA8A 2BFDB 1XRMA 1ZD5A 2G76A 2O0MA 2OB2A 2YIVX 3LO8A 4JQSA 4OQQA 4RWZA 5TQ0B 3SJAA 1Q0TA 2B1GA 3EDCA 1Z33A 1ADGA 4F2DA 3GP8A 4BPRA 2E0IA 3PJGA 4AS3A 4F85A 1V4VA 2B94A 2H11A 2I55A 2KQUA 4DJEC 4F9FA 3HCOA 5ETJA 4G1BA 1SN7A 2JL1A 3L9WA 4LSZA 2NV2B 4KE7A 1G5TA 1YQXA 3PUYA 5DX0A 1CTQA 1UDCA 3A6DA 2MSNA 3EZ7A 1PCXA 3NHRA 4GBJA 2X6RA 4IIVA 4DY4A 1ADYA 1GPDG 2WPNA 9ATCA 4M0LA 4CL3A 5A03A 3MBKA 1Y8ZA 4J9VA 3G82C 4XM2A 3NEPX 2JAXA 4LHSA 4M0KA 4LTNA 4QODA 4YRSA 1JPUA 1BNCA 1IXSB 3LC0A 2CXHA 4TS3A 1YUNA 4RK4A 4L5JA 3VR4A 2W90A 1J21A 2FP3A 4A4DA 1B8NA 1E1CB 4OHWA 3GIWA 1KARA 1AD2A 3D81A 4GE3A 2B4TO 2XSZD 4FFPA 5K09A 1G3QA 1B41A 3BJRA 5A06A 3BB3A 3SZMA 4BNIA 5BQOA 4CM5A 2LGJA 4L78A 4UDYX 4F2HA 4UOEA 1DHRA 2ZIWB 4GMHA 1XK6A 3CFYA 4WN3A 4Y2GA 5HKKD 1RPAA 4HOYA 3DBVO 4BXOB 3LWDA 3D8TA 1JFFB 2O2DA 2WJAA 3OLYA 1E9BA 3ZV5A 4EFDA 4DJFC 4EPWA 4IDHA 1NBME 1NYQA 3BSFA 2OO7A 2Y1EA 4Q9DA 2RDMA 4J0FA 1ZMBA 4K9KA 4EMTA 3HSYA 3MTGA 1Z5PA 1RNLA 3QWHA 1LH0A 2FW9A 3ZGNA 2Q49A 1U0NA 4ZMBA 5K6AA 1YZNA 3A1SA 4DTIA 4OI2A 3KEFA 2CBGA 2GPSA 2PWPA 2DXIA 3GLSA 5TF0A 5LNK1 4OGFA 3B48A 5DTEA 3BMQB 3TG8A 4ZAYA 1WE2A 2AFHA 2GJ9A 3ED1A 4BLSA 2GJAA 3DFFA 1JLHA 1ZICA 1YJ8A 4H9GA 3S5UA 1UKAA 2P9BA 1GTMA 1MBZA 2LR0A 3A4TA 1X1RA 4Y7DA 3T3HA 4BKPA 4Z4QA 4WDQA 3LE8A 3AFNA 3EEQA 3HN7A 5IT4A 3KT6A 2M6KA 1YJXA 3LW7A 2Q0QA 1M6WA 3WIEA 4EI7A 1U2RA 2IXDA 3E23A 4H2DA 5DHAA 2X9GA 5SY4A 1IUNA 2C7BA 4TV8B 3GMTA 4AJNA 4Q4AA 2DWQA 1LBSA 4UXIA 3R8XA 4D9NA 3WL4A 5CNKA 4RK0A 3AF2A 4PX9A 4WFQA 4XH9B 3LCUA 3TRIA 3BEDA 4CM4A 4YAUA 1AT1A 2ZDHA 3R24A 4YAFA 5JARA 4JC8A 4ENRA 4IOMA 2Q3HA 4LDPA 1O94A 4YCDA 2UZIR 3QITA 1WBDA 2NV0A 1W4RA 1TYZA 2VUHB 1TM1E 2C3YA 2BFAA 1DQNA 2FWNA 3LGSA 2QD1A 3AI2A 4XGNA 3RUIA 4BJ1A 4ROTA 1JX6A 4C3OB 5P8WA 3G9ZA 3M1YA 2WUDA 1YVRA 4JI4B 2WWIA 1W1UA 3FVVA 1TLFA 3LPCA 4KBFA 2GEFA 3W5IA 4JLVA 4OHUA 4J91A 3WHLA 4P31A 4CL8A 1YI0A 1XVAA 1EUCB 2IY7A 1LWOA 2HMSA 2R60A 3WMRA 8LDHA 4HPXB 4QGHA 1XFDA 5IHPA 2CVHA 2NADA 4J03A 3KKQA 3F9CA 3V8VA 1KU0A 5F1PA 3VPHA 5MFZA 3EXIA 4MUIA 3SX4A 3KZVA 2L82A 2A5JA 2IYLD 1XLVA 3HZHA 3R0IA 1JECA 4UTOA 1UDAA 1F5NA 1V9CA 1W4LA 2W00A 3INYA 4NBRA 5KVVA 2ZWIA 3QPBA 1VMKA 2AYXA 4J16A 3T61A 4D5EA 4PLFA 2IE0A 4OUKX 4WACA 2VK8A 5BURA 2O50A 5B7QA 3WDSA 2HNBA 1RXWA 4URYR 2JLCA 3KKKA 4F96A 2YXDA 4M6WB 1NQVA 2H7YA 3RROA 1EP3B 4ZOLF 3N2IA 4YCSA 1LX7A 4XFDA 5T6BA 5HIAA 1KIFA 1GZ5A 1NI4A 4L9SA 1R0CA 5DWDA 4WKCA 1L4EA 3A1CA 2XE8A 1CG6A 1W25A 2MCFA 3WGUA 2I5PO 4NPCA 4TLDA 2J0UA 2NO5A 1IM5A 2L19A 4QTXA 5DBEX 4RLQA 2Z2JA 2V74B 3HN6A 3ISTA 2BC9A 3ZGZA 3P4YA 1I4OA 2R87A 1UJNA 5JI2E 4Z7JA 1N7IA 1A7JA 5FI0B 2XF2A 5GY7A 1RYBA 4KB5A 1KP3A 2P3OA 4GC9A 3ROXA 2XMGA 1T5BA 1MP0A 3JVIA 2H1RA 3N9IA 4MVJA 2FPUA 1ZX1A 2ZB4A 4I5FA 4S2EA 4P82A 4X0EA 5DE3A 1N5LA 1FLAA 2QZ4A 3FMPB 4XIGS 4YRJA 4R84A 2AEMA 1C7IA 4WZBB 1DKLA 1TTQB 1H1TA 1QCYA 1QGOA 3RQSA 2FEAA 3BK1A 2HL6A 2VEDA 2CDNA 3LOUA 4HX2A 4X54A 4BVEA 1CUCA 3A14A 3AF4A