3ILSA

The thioesterase domain from pksa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
265
Chain Sequence
LKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLIPHFTAVVDVMLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Hydrolase
total genus 84
structure length 265
sequence length 265
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilsA00
3IUNA 4DNOA 4X6YA 2Q0XA 5C8XA 3VVLA 4PSDA 1EDDA 1XQYA 4A23A 2HDWA 2CMFA 2QXUA 3AZOA 3KSRA 5HCUA 4DSAA 3GFFA 4L9AA 4LXIA 3RLIA 4UUQA 1YCDA 2QXTA 5AKGA 1LPAB 1GZ7A 3FYUB 3H1AA 3WJ1A 4ZRDA 2FUKA 4QNNA 3WK8A 4K6HA 1YAHA 4OPMA 4RGYA 3ESAA 5AM2A 2JF0A 5ALJA 2VQ6A 3F9CA 5EHNA 1N5MA 2DR0A 1PV1A 1W52X 4RE5A 4B81A 3DKKA 4BTLA 2Z3WA 4I3FA 1GPLA 5JATA 5AO9A 5DYWA 3LIPA 5JAPA 2I03A 2HFJA 1OILA 2OLEA 1XZBA 2WHRA 5DYTA 2VTVA 2AJBA 3ED1A 5A2GA 4QLOA 4BP8A 4WFIA 5AOAA 1R9MA 1AX9A 1DWQA 3H2KA 3CCBA 1RP1A 3VVMA 1TCAA 4EA6A 3OURA 1EA5A 5CT8A 4GECA 1C7IA 3IUMA 4AN0A 1VLQA 3OTQA 5AI6A 3O4JA 2H9YA 2R11A 4X91A 1CEXA 1F0PA 2WQZA 2X5XA 4Y2JA 2DSNA 4G8DA 5CT5A 2PSEA 2HA3A 3DOIA 1UK9A 4H7KA 5ALGA 5ALFA 1E8MA 1CUBA 3BXPA 1GQSA 3BF7A 4RPCA 2QTBA 1A8QA 5EHQA 2ORYA 2EDAA 5ALLA 3W04A 1P0IA 3A2NA 3U0VA 5DYYA 4EY8A 2YASA 3DEAA 2HIHA 2EEPA 3I1IA 4UFOA 5IVKA 1EI9A 4ROTA 2W22A 2HA0A 2RAUA 4PSUA 4K2AA 3TJMA 5LZ5A 3LLCA 3C5VA 3QM1A 1HKHA 4NVRA 4UHEA 3ICWA 1CUIA 3A70A 4XIIA 4X92A 4CIBA 3WZMA 1CUAA 2OCIA 2WUEA 3EBLA 4Y2UA 3K9BA 1EINA 2C58A 3BDIA 3ILSA 3H04A 4QWMA 4FFWA 2DFPA 2WILA 5BWCA 2XQGA 3STUA 2WTNA 3WKEA 1ORVA 4UHCA 1MX9A 4KJXA 5JYCA 1XZJA 4BAGA 5JANA 1AURA 5A71A 1A8UA 3STXA 4MEBA 1GPNA 4QA9A 5CT6A 1XZHA 5CMLA 2PM8A 3FAKA 2IITA 3E4DA 2XQFA 3W2TA 2ROQA 3WYDA 4Y9SA 4F0JA 2XQJA 1EK1A 1UOPA 4C01A 4UHHA 1J1IA 1TCCA 2FX5A 3HRHA 1ODSA 4G1FA 4MQMA 2OQVA 3N0TA 1F8UA 1FFDA 1CUGA 3D7RA 2Y6VA 3LIIA 5ALXA 5HZGA 2HU7A 3PFCA 2B61A 3VJMA 4CCWA 4AX4A 4KE9A 3WK5A 5T4EA 1CUXA 4X95A 2JGLA 4MYDA 2VSQA 1EHYA 5ALYA 3PUIA 5LZ7A 1IVYA 1FFBA 5HFNA 4W1SA 5CTAA 5DJ5A 2WFLB 1XLUA 2XMRA 1EK2A 2PSDA 3MVEA 4FKBA 1Q84A 5ALDA 2I78A 1Q83A 1U2EA 2VAXA 1EX9A 1S8OA 3WZLA 4UBOA 3G0CA 2PVSA 1CQWA 3R3WA 5FLKA 3DQZA 5HKAA 1SCKA 3V1NA 1BEEA 2DQYA 4PO3X 2I3DA 2Z8ZA 4Q3OA 4BBZA 2VAVA 5I7UA 2GZRA 3A2MA 4AO7A 5F4ZA 5CH3A 2PSHA 3HLKA 2BFNA 3CN7A 5BV7A 4H7EA 4WCVA 1GT6A 4BE4A 3VXKA 4AB1A 2QR5A 1H23A 1EB8A 4KRYA 2VJBA 3WWEA 2PU7A 1H22A 2BUCA 1K8QA 4B9EA 2AJCA 1ISPA 1DU4A 3O4HA 2WIJA 4H7IA 5JD6A 2HM7A 1LPMA 2Y2VA 2XUHA 5IVIA 4QZVA 2D0DA 3RARA 1VJ5A 5AOCA 1HLGA 4W9RA 5FKJA 4DSZA 3FVTA 5LZ2A 1QONA 1ZJ5A 3WK7A 1A8SA 4WJLA 3K2IA 3I2FA 5JIBA 1VOTA 3I6ZA 1DTEA 4NMWA 4MEAA 5CXUA 3O9VA 4W1RA 2WHQA 1CPYA 3V1LA 1THGA 1CUDA 5AI9A 4J0KA 2JGKA 4G9GA 4DLNA 2HA6A 1UK7A 1UT6A 2YXPX 4K6GA 1DQZA 3AJAA 3O9MA 3F67A 1JMYA 5K3CA 4X97A 4UBIA 2ACKA 5CT9A 1VZ2A 2Y6UA 3WI7A 2WUFA 1QIHA 3ESBA 1QIIA 4G4GA 3X3HA 3WK4A 2JEYA 1ZJ4A 2WG2A 5AIBA 1J07A 1XRQA 2K2QB 1WCYA 2BAGA 4H35A 1MX5A 3ZLTA 2WUDA 5YASA 1GQRA 1SC9A 2H7CA 1K5PA 1CVLA 2QUAA 4L72A 4KE6A 4Z49A 2AJDA 1ETHA 1A88A 4J0HA 4MWTA 4ZWNA 1Y7HA 4DIUA 3KWFA 3FVRA 4UBMA 2I3ZA 1BEZA 5I8PA 4H7FA 4OU5A 2BKLA 2XT0A 4KAAA 3U1TA 1VA5A 4GLBA 3C6ZA 3STVA 5D7BA 2WU3A 3BJRA 4AXBA 2J4FA 3TRDA 2OXEA 3UUEA 4W1QA 5BOVA 2DHEA 4Y7DA 4DGQA 1UWCA 1XROA 4H18A 2PL5A 3I1YA 4CCYA 4GEGA 4FWBA 3LCRA 5T4HA 1CQZA 5EIHA 1XLVA 4UBNA 4Y2PA 2RHWA 1L7QA 1PJAA 5DLPA 1SFRA 2DQZA 2WHPA 3FCYA 1L7RA 3H2GA 1QJ4A 3VJKA 3FCXA 3IURA 3IUQA 4C6HA 5ALEA 2Z8XA 4G5XA 2B20A 3PDCA 4X6UA 4FNMA 3PE6A 3G9XA 3IVMA 4GXNA 1IUPA 2VJAA 1VXRA 5A7HA 1MT3A 4UBJA 3IUJA 3WK9A 2JBWA 4TVKA 5JD4A 3BIWA 3OPMA 1WM1A 1IUOA 3WL6A 3BDVA 3FSGD 1X2EA 1Y37A 3FBWA 1QE3A 4B85A 2VF2A 1G5FA 4FTWA 1WB5A 4Y2RA 5ALSA 5JAOA 5FP0A 3NUZA 4N8EA 1TIBA 4OB8A 3S8YA 3CXUA 1MN6A 3G02A 1X2BA 4PW0A 1JFRA 2CBGA 5LLSA 5CURA 3KOOA 5K3DA 2XMBA 3W06A 5AK6A 2PSFA 3O4IA 4EUSA 5LP1A 3H17A 4EBBA 1EDBA 4RNCA 1ORWA 1TK3A 2OAGA 1MX1A 4LYEA 2O2GA 2YYSA 4CG3A 3FYUA 1F6WA 2FJ0A 2OGTA 4W63A 5EI5A 4DMFA 3WIBA 1JT2A 5DNWA 4C87A 1WHSA 2O7RA 2ZJ6A 3JW8A 3ANSA 3M81A 1MTZA 4K5QA 5AHXA 3GA7A 3H2JA 4Y2QA 2BUBA 3IULA 1W6RA 5HFAA 5AI0A 5HF9A 1QO7A 4PV7A 4HRYA 4DYHA 1YS1X 2Z3ZA 1VA4A 4JH0A 5AKEA 1LPPA 4QDUA 1FJ2A 1YASA 3IDAA 4N5HX 1LPOA 4UHDA 3E0XA 3QPCA 5EIEA 4FLEA 4LXHA 1MAAA 2J4CA 4UHBA 1JI3A 1B6GA 4WFKA 4J03A 4EHBA 1HQDA 3F8SA 2RGUA 4YASA 2WTMA 2WJ4A 3TEJA 1RYYA 4X00A 3T52A 4OYYA 4ZI5A 2HU5A 5AJHA 4AZ0A 1QTIA 4HZGA 3PI6A 1GKLA 4U2DA 1WB4A 5IVHA 2PU5A 3HACA 1W76A 1TKRA 3OOSA 3I2HA 4J7AA 3GZJA 1Y7IA 1N1MA 2G5PA 3R40A 1CUFA 4Q34A 5JADA 1P0PA 3G9TA 2XUPA 5E4YA 1EXWA 5AK4A 4BAUA 1DWOA 1R4ZA 1YB7A 1XZAA 5K5EA 1DX4A 3WJ2A 2AXEA 3D2CA 5E2IA 3Q0TA 4QDXA 3C5WP 4X90A 2HADA 4FLMA 1BROA 2CJPA 4F5ZA 4I4CA 1CRLA 4OUKX 2DHCA 4J0CA 3E3AA 5K3EA 4EY4A 1X70A 3WWCA 3QPDA 2RHTA 3AFIA 3CCCA 4G8CA 1TCBA 2GYVA 3UMJA 5ALVA 4QLAA 3B3QA 1K4YA 1BN7A 3PFBA 3C87A 4B84A 4C4YA 4HS9A 3TGLA 2XUGA 1CUEA 4LHEA 5ALKA 4QDOA 4PF1A 3KDAA 3G0DA 5JAHA 1LLFA 4MYSA 1AQLA 4UFPA 1XRLA 4Y2TA 2GBIA 1MNAA 5AK5A 3WL5A 1PFQA 5SYNA 4C89A 1J06A 2ECFA 5A7FA 3C8HA 1ZOIA 1XRNA 1IUNA 2BUAA 3G0GA 3PF9A 3D0KA 4J3JA 5AM3A 5LKRA 2C5FA 2O2IA 1N8SA 3LP5A 3DL7A 3BJMA 3MUOA 2PBLA 4INZA 2V96A 4MXDA 1TRHA 5DTIA 4BVLA 3WL7A 4ZV9A 2QUBA 5JD5A 1K6EA 1IZ7A 5IKXA 2WIDA 3JYHA 5KBYA 2RIPA 2WIKA 1VZ3A 4Q82A 1CUUA 2WFLA 2HA7A 3E1GA 4KAFA 3BL8A 3HABA 1U65A 2UZ0A 3DJYA 1NU8A 5JZ9A 1DWPA 3VDXA 4BTVA 5ALTA 3V1KA 3MUNA 5D6OA 3P2MA 5AI5A 4E14A 1H2XA 5CRIA 3R3ZA 1HDEA 3ZI7A 2LIPA 1NX9A 5HQ3B 1R1DA 4OCZA 3EQ7A 4HVTA 1CR6A 1QZ3A 2WU4A 1KEZA 3G9ZA 1P0MA 2JGJA 3FLAA 3I2KA 1GPKA 1QFMA 1JU3A 4X94A 3DYIA 1DINA 1H2YA 3WKCA 3A2LA 4LIPD 1YA8A 2HRQA 1UOQA 2W6CX 5AM0A 1UK8A 2HA5A 2X8BA 4AMZA 4IH4A 4EY7A 1QIKA 1QIDA 2ZVDA 3FYTA 1XZKA 2XMZA 4U2GA 3GBSA 1XKTA 2IIVA 1ACJA 4BCDA 2XMCA 4HXGA 4QDTA 2XMDA 3QMMA 4HXFB 1RWQA 1JJIA 3OM8A 3I2GA 1QTRA 4X7BA 5CW2A 2XUDA 1UXOA 3T4UA 5AIAA 5FUMA 4BZZA 4AO8A 4BCCA 2CB9A 3H19A 2XUAA 1E89A 2D5LA 3DL4A 1SOMA 5C8ZA 5AK3A 2ZSIA 4PQEA 3O95A 4KAJA 4B83A 4ETWA 4KYVA 3FWHA 1ZI9A 1XZMA 3WMRA 4C88A 4KR0A 1CUCA 1SCQA 1KU0A 4LYDA 3AIOA 5AP9A 5AKYA 4XWGA 4BVJA 3G0BA 2HHAA 4LXGA 3V9AA 1Q0ZA 2C0QA 4HAIA 3WA7A 2QJWA 5ALWA 1O6GA 4GBGA 2WIFA 1BS9A 3W9BA 1E3QA 4MJ3A 4UBKA 3IIIA 3C6XA 3D4LA 4BP9A 1P0QA 4AMYA 3HSSA 3WYNA 1T2NA 3M82A 1Q0RA 4U2BA 4FNGA 4ZGBA 3SK0A 1W4LA 5K3FB 5IH7A 1R50A 5JZBA 2OCLA 2QZPA 4Y2SA 4DNQA 4MQLA 3I2IA 4B7ZA 5K3AA 1QFSA 3LS2A 1CUVA 4P08A 2WJ3A 3M83A 5EIAA 3QMWA 5ALRA 1FFEA 4DNPA 2V97A 3D2AA 1CUZA 3H2HA 4F21A 3HC7A 2OAEA 4P93A 3G8YA 1CUSA 3DDUA 4B6GA 5ESRA 4TPKA 1XLWA 2ZSHA 3R3XA 4H7JA 4Q3KA 3OC0A 3D3NA 1XZEA 3Q8WA 2WM2A 1ZGCA 2C4HA 4OD0A 4PSCA 5LZ9A 1CUHA 2CEKA 1WPXA 3KXPA 3O4GA 1JJFA 1BE0A 4P9NA 1BN6A 5DNUA 3V1MA 2WSLA 4JEIA 2ACEA 1AGYA 1LPBB 4E15A 5AM1A 1N5RA 3WWDA 1HBJA 1QIEA 1LZKA 1ZI6A 4NS4A 2CZQA 1LBSA 3ZV7A 5FV4A 4IO0A 5DTJA 2ZYRA 5C7YA 4O08A 3FSGA 2JGMA 2ZYSA 2WHPB 4BVKA 3SWWA 3DLTA 3C6YA 5EHXA 2P8SA 3I6MA 2V9ZA 1C4XA 5AOBA 2QKYA 3DKRA 5ALUA 4ZREA 3VISA 3ESCA 4AO6A 1CUYA 2XI4A 4H0CA 1ACLA 1WOMA 1YAJA 2C5GA 3NGMA 3ZWQA 5LKAA 4HXEB 3K6KA 3B12A 3AUKA 4U2CA 2Y1KA 4FOLA 2B9VA 2Z5GA 2QMQA 1UFOA 5HK9A 2JIDA 4JYPA 1XKLA 5D3ZA 1JJBA 2NW6A 2XDWA 2ZYIA 4LKOA 3H2IA 1QIGA 5ALZA 2V98A 1QOZA 1K63A 5LZ8A 2XMGA 4U2FA 5FDFA 1ODTC 2J3QA 3M3DA 4M0EA 3STTA 5EGNA 4CG2A 4L0CA 4EB0A 2WG0A 3MGAA 3FYUC 3AILA 3F97A 2XUIA 2XLCA 5ALIA 2WKWA 3OG9A 5ALHA 5HKBA 3RM3A 4D9JA 3A6ZA 3YASA 4C4ZA 3RK4A 3L1IA 4BC0A 1DT5A 3HEAA 5JASA 3FLEA 1G66A 5AKZA 1HPLA 3L1JA 2WFZA 3SX4A 1E66A 2VT7A 3DS8A 4BB0A 3GELA 5HF5A 1UK6A 4FMPA 1M33A 1W75A 4J0JA 4WDRA 3HI4A 4I19A 3L1HA 3PICA 1B41A 2R8BA 3QH4A 1MJ5A 4H7DA 1XQVA 1MU0A 3NOXA 2WJ6A 2FJPA 1XZFA 4J0GA 4Q05A 1ZICA 3G7NA 4Y2YA 2O2HA 1XQWA 1XRRA 4MWSA 2JGFA 1IZ8A 1EB9A 5KWJA 5AKIA 4GDMA 1XZLA 3QYJA 1UOOA 3W9UA 2WUGA 2AJ8A 2BGRA 5JARA 1BU8A 1AUOA 2VT6A 1H2ZA 1MPXA 4CI9A 5A6VA 2H7XA 4AN1A 1QLWA 4BRSA 2ZJ7A 1SCIA 2XUOA 4FLFA 2WG1A 4H7HA 4B80A 1I6WA 1XZDA 5FOQA 4GW3A 4JYMA 1U4NA 1XFDA 4K6KA 3D5EA 1J2EA 1C7JA 1L7AA 5J3JA 2GZSA 5ALNA 1XQXA 3QPAA 4JUIA 5AM5A 1AC5A 4C4XA 5K3BA 2ZJFA 3ICVA 4KRXA 2ES4A 3EIOA 4BATA 5JZSA 3DNMA 1QGED 3F96A 1R9NA 4QDZA 1KU6A 4BRZA 2E3JA 3QITA 4EZIA 1WHTA 3WKDA 1VKHA 5A62A 5EHZA 5AH0A 2YH2A 2GBFA 2QT9A 5H3HA 1QO9A 2JEZA 4G8BA 1ZIYA 3EF3A 3PF8A 4DMKA 1VE7A 5AI8A 1FFAA 4QWWA 2DHDA 4OU4A 4UBLA 4L3WA 2PSJA 4B0PA 4BC1A 5AICA 5T4BA 4CFSA 4W1PA 1LPNA 1AMNA 5SYMA 4ZXFA 3WKBA 3WL8A 3QBJA 2QOEA 4G4JA 3BWXA 4P92A 3VJLA 2WIGA 4QE3A 3KWJA 1USWA 1MNQA 4DMHA 2RONA 2XQIA 4GHWA 5BWBA 4M0FA 3NWOA 3AZPA 4N8DA 5C81A 1DX6A 2C0PA 4KE8A 1ZI8A 5KWIA 1LGYA 2GBGA 4IHAA 3WKAA 3I6YA 1XZIA 4FHZA 3DOHA 5CBKA 1VXOA 4G4IA 4X93A 4DTCA 2VATA 1ODCA 2H1IA 4ZV7A 5EFZA 2OCGA 3WK6A 1UKCA 2GYWA 2ZYHA 4UHFA 3I28A 2VEOA 3ZPXA 1TAHA 3S2ZA 4F60A 1DT3A 1T4MA 4CG1A 3W05A 1ZD5A 1D07A 1JKMA 2XMQA 1LBTA 3R3UA 2QRUA 4H77A 3CN9A 4B9AA 1YA4A 4BZWA 2HFKA 2XLBA 3ZLVA 5KREA 4U2EA 5HF6A 1UZAA 1ZGBA 2RI6A 3KD2A 7YASA 1EH5A 4N8SA 1OXMA 3H0CA 2QS9A 3WWPA 2QM0A 4Q1VA 1CUJA 5HQ3A 2CUTA 4KACA 1GGVA 5ALMA 1BCSA 5AKLA 4WDQA 1YR2A 3IA2A 3O0DA 1R3DA 2OGZA 5LYYA 2HRRA 3BF8A 1YSCA 3STWA 3ESDA 5FPQA 5I9IA 2J3DA 2XUQA 1GXSA 4HTAA 5DWDA 1OCEA 5DNVA 4B0OA 2X76A 1CLEA 2B4KA 2XUJA 3C70A 3V48A 2XUKA 3IB3A 4WY5A 1FFCA 3EQ9A 5ALQA 1EVQA 1QIJA 2PPLA 2QVBA 5A7GA 2IX9A 4X3CA 3HJUA 4CIAA 1CFJA 5AKJA 4KEAA 1NU6A 4DNFA 3QZUA 5JALA 4X85A 4XX1A 4M0MA 4EY5A 4QEKA 3EQ8A 3STYA 4FDMA 4BE9A 5D3KA 4WY8A 3AINA 4KE7A 4S0XA 1LZLA 3WA6A 4OB7A 2O7VA 4FBMA 1Z68A 5ALPA 4BAZA 4X6XA 5CH8A 2HA4A 4IH1A 2Y2UA 3IBTA 2GBCA 3ZLUA 2OPHA 4OB6A 2XMSA 4Y2XA 4DM7A 3H18A 4XVCA 4UPDA 2QJRA 4YPVA 4TGLA 3WWOA 5CT4A 3BIXA 3FOBA 3PUHA 1AKNA 1IMJA 2OCKA 4AZ3A 3AIKA 1ZD2P 4BDTA 4G9EA 4OSEA 1E5TA 1E8NA 4E11A 2H7YA 2PUJA 2G4LA 4Q3LA 4N5IX 3WIOA 4UFNA 3N2ZB 1TQHA 2XQKA 2AJLI 1GKKA 2PX6A 5IVDA 4A16A 1THTA 2BJHA 4RE6A 4WFJA 3WQHA 2JGIA 2HA2A 3G0IA 2G63A 4GWLA 5FXMA 1XZCA 1YB6A 5T4FA 2VJDA 4XJVA 3R41A 1EVEA 1ZIXA 1CV2A 4GI1A 3R3VA 4IH9A 5K3FA 4IQ4A 1MAHA 1FSSA 2JGEA 3HZOA 4E46A 1JU4A 1QIMA 1F0NA 3C45A 3UUFA 5HF8A 1ZD3A 4YK7A 1O6FA 1U8EA 3AZQA 1MO2A 4ARBA 1VE6A 1CUWA 5CH5A 1YS2X 2OGSA 4YX9A 5CXXA 5JAUA 2ONCA 1XRPA 1R88A 3BE8A 1AZWA 4DMCA 6YASA 1UKBA 3SC2A 4NZZA 5ISMA 1E8DA 3FLBA 1EDEA 1H2WA 3H1BA 3C43A 3D2BA 5FPPA 3R3YA 2HL6A 4J0IA 1ZD4A 3HXKA 4JNCA 1HL7A 2OG1A 1XZGA 3I2JA 2XUFA 1BCRA 5C8VA 3QVMA 4CCYB 2XE4A 3C6BA 2VJCA 3DCNA 4ITVA 1UKAA 1LPSA 3ANTA 2VA9A 1WPRA 3FNBA 4AQDA 4B82A 2HU8A 3G9UA 3C8DA 3WLAA 4J0DA 4ARAA 1W1IA 1WB6A 2PUHA 4OYLA 2BGNA 1BRTA 5FRDA 4Y2VA 5AKXA 3DYVA 4A5SA 4BDSA 2G5TA 3JWEA 5ALOA 2CKMA 5AKKA 5AM4A 1LNSA 4FBLA 5E4TA 3B5EA 4V2IA 3D59A 2EDCA 2DCMA 3HYSA 2XB6A 5HK8A 3F98A 2OQIA 2PKYX 3R0VA 5AI4A 3VKFA 3GUUA 5E4JA 3GROA 1A7UA 4X71A 3DD5A 3QMVA 4BYMA 1XRMA 1G42A 1QIFA 4HRXA 4PNZA 4FFVA 1G4HA 2BCEA 4EY6A 2WLSA 4BCBA 2GYUA 3RKSA 3AIMA 5AKHA 2C7BA 1JMKC 5LIPA 5LZ4A 2WFMA 1CIJA 1DQYA
chains in the Genus database with same CATH superfamily
3NPAA 3WSTA 1KVSA 2X4DA 5IK2D 2OOSA 4QBIA 3N5CA 1QGZA 5COAA 4RS4A 1EFPB 1P2FA 1V96A 5TC4A 1U9CA 4ZFNA 1VQ1A 1KDRA 1QGOA 1E9EA 2C31A 1OT3A 4KXYA 3AUJB 3W5UA 3CY6A 2YWGA 1EDDA 4D6XA 2J48A 1T3ZA 2M6RA 1KY2A 3OWHA 4WX2B 3ZZUA 1P2GA 3OJLA 2C00A 1TM5E 1ZL0A 5HKLA 5TEVA 3KSRA 4BVGA 3E5MA 4C4OA 5LD2B 2VHYA 1QANA 2B36A 1IEQA 4DSAA 2LWIA 3DZCA 3LCUA 6REQA 2F4VB 3DCIA 3OKCA 3T9EA 5E9QA 4MUAA 1W4BA 2QXTA 1T0HB 1I2MA 3EMBA 1E6WA 3K7EA 1GZ7A 1M7GA 1VBFA 4UAJA 3REQB 4C6RA 5AUPB 5KSWB 1SU6A 3OQJA 4FD2A 4NE9A 3AFNA 2CLHB 5F9HA 3WJ1A 4K9DA 1NRIA 1QBGA 1RYBA 3WLLA 1GG2A 4H6XA 2OFFA 4ZOBA 4UQLA 1BX1A 2NM0A 2BOVA 1WHSB 1YL6A 4OPMA 2E4VA 5CUQA 3SZRA 1LLDA 4N3BA 2BZSA 2ZDQA 3AJ8A 3OECA 4QFMA 3ESAA 1QHEA 3OX4A 5F33A 1BYUA 4TT3D 5DZSA 3QF7A 3B1YA 1K8XB 5BW5A 5G4LA 1QQ5A 3F9CA 3GPIA 2QK4A 1N5MA 2DR0A 4HEA1 4OJMX 1CU1A 1YZHA 1E63A 1K66A 4AZWA 4YFYA 4I3FA 1GPLA 2FWJA 2XPCA 5AO9A 3V34A 4CT4B 1G3RA 2P6NA 3LGAA 3ZCSA 3IOCA 4RFSB 3I5YA 4Q3NA 4IFEA 2P9TA 2YVUA 1CRPA 1E3LA 2A5FA 2R6GA 2VJMA 5JAPA 2R1ZA 4EYSA 3M89A 2E4UA 3SDSA 3AONB 3OQOA 1ILWA 1Q20A 6CHYA 2JHCA 2WD9A 4ID9A 1THZA 2VTVA 3PEWA 2WSMA 2H2GA 4BFLA 1C29B 1ZC4A 3ED1A 2C7PA 1YU6A 4QLOA 1TZKA 1C1XA 3BSSA 3QFSA 1HSZA 1XPJA 3R9XA 3KE8A 3EVDA 4WBNA 1PU2A 5BRAA 1PQWA 1R6VA 2QG4A 1DO8A 5AOAA 3LXUX 1LSUA 2GJ4A 2XGJA 2JFWA 5AVRA 1QHYA 3H2KA 3G89A 1H5QA 2PH3A 2QXYA 2ID7A 2OCXA 4WLOA 3P9SA 3ZXSA 2OV2A 1RP1A 5IVPA 3ZDRA 3U49A 1FYDA 4D80A 3EH1A 3VVMA 1BRMA 3OHSX 2NSLA 5KYYB 1GG9A 2ZJ4A 4XRRA 3A32A 4EW6A 1F2TA 1EWRA 3IDZA 4YQYA 2WF6A 7REQA 1TTTA 2EKZA 3B3JA 2I76A 3L7AA 1RE0A 4AZ0B 4X20B 4HGPA 1MEJA 2K2WA 4CL0A 4ZZ1A 4O4IA 2X5JO 2PKWA 1PT8A 2QUZA 1TOAA 4AN0A 1VLQA 1YS9A 4WD3A 2WINI 3CWZA 3RUCA 3ZWDA 3NJ8A 1YQTA 5FOTA 5LU9A 2WYOA 3IR7A 4BB9A 3OMXA 5L3SA 1ABEA 3INYA 3ZW7A 5KZMB 2GAJA 3FN4A 2YC4C 2SHKA 4Y2JA 5JXHA 3N1UA 4TTQA 1EGHA 3DB1A 4FT2A 1HNZB 1BXGB 4B3GA 5CT5A 3SOPA 1PG5A 4OHXA 1L7DA 4P0QB 4GEKA 1TPYA 2FK7A 2NAPA 3IAUA 5AJTA 1XMPA 3MTQA 3T5CA 4Q9LA 3VSEA 4JJAA 5H68A 4OH1A 3GAFA 1Z5UA 5JSQA 4JX8A 1JDUA 2YR0A 4EGCB 1GQSA 5L3VA 4KN9S 4YRCA 1QE0A 5DTRA 5EJ7A 1DLJA 4B31A 3OTGA 2PMDA 5EKTA 3TW4A 2ORYA 1NFFA 2FNAA 1K5HA 2WA1A 5I9TA 2IA5A 4BRWA 4BEBA 3F2IA 4XTRA 4MVJG 5COQA 4L9RA 2AFHB 3WGGA 1RWPA 5CJPA 2HRBA 4IDCA 3G2NA 1N3YA 1U2PA 4AMVA 3WY9A 3O8LA 4B79A 3A06A 3O3OB 3A2NA 1MXFA 1TM1E 5DPMA 4B6OA 4ARCA 4ZZIA 4JI7B 1XPUA 3OM0A 1A2BA 4RMHA 3ETNA 3WG9A 3TBFA 2JGRA 4ZO4A 1AQYA 1FLNA 2YW2A 3WE7A 2P91A 5IVKA 1IMOA 3ZW9A 1JVNA 4ND8A 3H16A 4GP7A 3SR4A 4D3FA 1FW8A 5JXIA 4IL5A 3TJMA 4CWAA 4BWFB 4FCVA 4EYQA 3LLCA 1F8GA 1RVDA 3ENNA 3PQ7A 4OVKA 4ZICA 1OLSA 5JQGA 1R0WA 4MRPA 3BL5A 4GO1A 4EFNA 3PZBA 4XIIA 1PL6A 4Y9UA 3ENKA 1XTKA 4CHTA 4CIBA 2QGNA 4LQLA 1PSDA 4QU8A 4CL8A 3QK7A 3ANYB 1KTIA 3ZHRA 2I7TA 3GN1A 3SBEA 4JLKA 1I94B 2C9BA 1ZKMA 2FZ5A 4TLMB 3NIBA 5C1PA 3K9BA 1YZ3A 3IDSA 4FBGA 3M9LA 3DTTA 4FFDA 1T2EA 1EINA 1WDLA 2YXDA 3D3KA 3K9QO 4OLHA 4UDNA 4F56A 10MHA 4FFWA 3GDWA 2Z9BA 5GOZA 2DFPA 2WILA 3GNQA 2FN8A 3UJBA 2V7UA 1YVUA 4NBVA 5DBFA 2P9QA 4D44A 4HVAA 4PYJA 1WDWB 2XQGA 4TYWA 3OT5A 3OFJA 3AV0B 5LOVA 3OEHD 4GWKA 4Q4AB 3UT5A 3WKEA 5DM70 3JYLA 1XEXA 4L0QA 3ROGA 3SF8B 1R0SA 3L4SO 2ZUUA 5AOVA 1PJLA 4RF3A 2FEXA 3WDMA 4BKQA 2X2OA 4DLXA 5E6SA 4BFVA 1VG9B 2YQ5A 4UUBA 3CVWA 2IEZA 1XZJA 5BORA 1G2QA 2DQ4A 4LGYA 3QU2A 3ZGNA 5JANA 2F9LA 3GRPA 4D5GA 1AQJA 4F9TA 4HVCA 4OQEA 2KE5A 2QL5A 4AX8A 4UMEA 3GP8A 3RBVA 2JPDA 3T3GA 1W5AA 2CT8A 2AMFA 2PUBA 4N41A 4MEBA 1WVGA 3GFVA 1M8FA 4A7PA 4MV9A 5IU6A 1LA2A 3P0IA 1ZD1A 2R7KA 4JEHA 4OMUA 2OORC 3PG5A 1U6IA 4M89A 4HYTA 2JD1A 4QA9A 1XZHA 1UMDA 2X2FA 1K3TA 1A71A 1O4VA 5CT6A 4GYJA 5CMLA 2PM8A 1VHJA 1PWXA 4JYAB 4MIOA 1ZJYA 1KI6A 2XQFA 4L78A 3CUVA 2BTQA 3UC5A 3WYDA 4C3ZA 4GL2A 4LRQA 2YIMA 3TW6A 3N2IA 1BXKA 2QMEA 4G97A 3GDFA 1Q17A 1ZCBA 4UHHA 3MJEA 4G5QA 2EFCB 1HEUA 2VWQA 1TCCA 1MF7A 2VTKA 4OLJA 1E4VA 2J7KA 3TFOA 3NG1A 4JBWA 2CFTA 1BS2A 4Q37A 1G60A 1FBNA 5IZCC 1D6MA 5FL7A 1O5TA 2HZ7A 3MM4A 1GTMA 4JUBA 1DRVA 3MMPA 3OZXA 3PQ4A 4QRIA 1PK7A 3AB8A 3K0KA 5CDFE 4YAWA 4KI0A 2IXFA 4BFSA 1JQAA 5CK4A 3ZHUA 1DQNA 4MTCA 4KP7A 5T6BA 1HX7A 5HM8A 4JB2A 1E2PA 1EP9A 1E9SA 5LXTA 3T1TA 1JSZA 2ZIGA 1E5LA 2UU9B 3VAZA 2CNLA 4KVAA 1NJ1A 4AP5A 3URKA 2SBTA 4HT3B 2XITA 1W25A 1NRXA 4QJ3A 2EJCA 3VDRA 4CCWA 5JCOC 4RKWA 1CJMA 2IPMA 4UCQA 3WK5A 1T24A 4B4DA 5EJ5A 4J16A 1I6MA 2FF5A 1CUXA 4O4LA 4AQ7A 4HYYA 4MVWA 2JGLA 2P75A 4IF4A 4IX1A 1BVHA 1M1UA 3AH8A 1BYIA 3HFSA 2F64A 4KFSA 5EIFA 1A5AB 2I1LA 4GR4A 3TQIA 5ITWA 4IM7A 4OHYA 4YJKA 3RBXA 5HFNA 1UMBA 2VYNA 1PW7A 1BFKA 1XMSA 4IIYA 4O0MA 5EIWA 4UXJA 3I52A 3I92A 5U9CA 1EK2A 1GG5A 2YWDA 4Z54A 3BD8A 3D7MA 3NI2A 5FOWA 3ZK8A 3W4JA 4GE3A 1XTQA 2FP4A 5F78A 5CFLA 1XBTA 1T35A 1YZTA 2B98A 2B35A 1XTZA 3HR7A 5DASA 2WTUA 1MABA 2JH3A 4KPUB 3GJ5A 1ISRA 1CQWA 3KEFA 1XPRA 2QG9A 2DFKB 4OQQA 2PLRA 1TUEA 1SUPA 3AYZB 3OO0A 1QGDA 5FLKA 4DIEA 1USKA 1Z0SA 5HKAA 1I7QB 1N6RA 3U3RA 4DC0A 4DN6A 4KPYA 1BZYA 3EVAA 1UUFA 3T54A 1KP9A 2IYUA 3O0TA 4HWPA 3K32A 2DQYA 2I3DA 4LVOA 3BL6A 3ROTA 5I9NA 4TUYB 1U3VA 1PG0A 5IUKC 4RZUA 1YUMA 2I54A 2FX2A 4FQ7A 4ILEA 2O8EB 2JGDA 4TTRA 3QUTA 4BBZA 4LF4B 4LJ7A 5KJEA 1VYUA 1P33A 3I34X 5ES3A 5EWJB 3V7UA 4EG8A 1D4FA 4HGYA 4TMZA 3CH6A 2H2AA 2GPAA 2A1UB 2GEDA 2W2OA 3QPUA 2R1VA 3PVCA 4K9KA 4BVFA 4UJ3A 3U3OA 3WXMA 2XIJA 4AUMA 3UWDA 4GWGA 1U2QA 4HB2A 3V5NA 1RWNA 2QVYX 4DCTA 3OFSA 3U31A 1G63A 1YK1A 2GEFA 4P0PB 1DKLA 4RF2A 3ZVKA 5EKSA 2GZDA 3PCXA 5LVAA 5JNVA 4DUYB 1TC1A 2R84A 5C7IO 1DV1A 3I9JA 1RYMA 3CLRD 3VXKA 4AB1A 2XVAA 3AG5A 1HKUA 1EB8A 3HBNA 2O4UX 2DTXA 4MAAA 1MDFA 2VI5A 4R0NA 2AL7A 1XD2A 1VLZA 1K88A 1PNVA 2DWCA 4RHTA 3ZN2A 2AMYA 2VJBA 3B3GA 5KNBH 4G0QA 3WWEA 3VDQA 1EYZA 2ID9A 4XIYA 2PU7A 4XJTA 3M33A 4DLBA 1E0SA 3HV0A 2I1QA 2YN0A 1SU4A 3SIWA 1ZNQO 3DLBA 5JV5A 3OP4A 2X6RA 4OHWA 1K1EA 1ISPA 1TYBE 4YONB 4CTNA 1DU4A 2QZSA 3O4HA 5JD6A 1TJPB 2JH9A 4KKXB 3HL0A 3TRKA 1TM2A 4WAUA 3EFEA 4W7HA 3EGWA 2H3EA 1CP2A 2UDPA 4IGIA 5IVIA 2D0DA 3RARA 3QHPA 4J07A 4K86A 4HDMA 1HLGA 2RKWA 2IWRA 3VH2A 3ZIAD 4EVIA 2XH8A 1BOFA 5DI9A 5KHOC 4Q47A 2EZUA 5KNLA 3MWJA 4PYNA 3OPQA 4WASA 1Z07A 4XWKA 1ZJ5A 4W5TA 1UKYA 1GKIA 4PFKA 5IHPA 3HO6A 4Z99A 3DEZA 4NP6A 1A8SA 5M2QA 3RW9A 2ZUVA 1NQVA 3WIEA 1WZUA 1Y5NA 1VOTA 3I6ZA 4MP3A 3K6SA 3EXHB 3JAWA 3KS9A 4B6JA 3Q87B 2IHTA 4RA9A 3QE9Y 1Z6PA 2D74A 1U5CA 1TI7A 2AC7A 2V1UA 3GUYA 5EA2A 2XAUA 2TRSB 2WHQA 3RYIA 4BPBA 4MW2A 4NYIR 2PH5A 1L5MA 4ZEOA 1CUDA 4RSHA 1M66A 4R01A 2QE7D 3AJ9A 1MP0A 5EYPA 3WV4A 2HA6A 1N1EA 4DLNA 4DJJA 3RJTA 1GZSA 4JJ6A 2ZIAA 1UK7A 1UT6A 2YXPX 1SHKA 4Z4IA 4UNRA 4K6GA 1OLOA 2V3VA 1PSWA 3U62A 1FUUA 2FP3A 3UJ3X 5BWOA 4JUAA 6ADHA 3AJAA 4I8XA 3K1AB 2W42A 3ZU3A 1SVMA 3NX4A 1QG0A 1LB1B 2RJ3A 4N0QA 2XRFA 4QGBA 5MGNA 2JBHA 3OLXA 4H1VA 2EW1A 4FNAA 3F3KA 1CZOA 3W8RA 3HCPA 1X74A 3N2GB 2WICA 2V6BA 3AEKA 1T5SA 4YMIA 4P38A 3E3LA 3MNFA 4RETA 3WB1A 2YNMD 2C9DA 4RTRA 2QE6A 1E3WB 5D1NA 1J22A 4MIKA 3EAQA 3JD4A 3UB2A 1U3CA 1ZK0A 2P9ZA 1H93A 5PNTA 2XDQB 5THQA 1VCNA 4HLNA 3N76A 3NDRA 4MGYR 1G8AA 1Z17A 3HY4A 3TG8A 1UBUS 4BO8A 2K2QB 4FJ1A 3CX7A 3QXCA 4MKXA 4URYR 1Z28A 4CUZA 1U8AA 3VZRA 5AD1A 2VF8A 2Y99A 1XWIA 5JAIA 1IULA 1OH7A 2J0SA 1SC9A 2QY9A 2V6JA 2AEMA 2JIOA 3JQ7A 4G01B 5TSDA 5F23A 1CVLA 4RY8A 4U7JA 1R12A 1VLJA 2QTAA 1QLHA 4F4FA 4DV2B 3GGOA 4DXDA 3TR5A 1CJSA 2UUCB 3ORSA 2H11A 1NV9A 2NGRA 4Z49A 2EZ4A 2G0AA 2QZ4A 4U02A 2W5UA 1ETHA 1K8YB 2ICAA 2PS1A 1JDZA 4GBJA 5EHGA 2P5YA 4AROA 4EGQA 5KNCH 1NOIA 5E8RA 3SN6A 4M53A 3F9RA 2X8LA 3PR2B 2XCOA 2ZEJA 4HLCA 3FTDA 1H66A 3NHMA 2XR1A 2RGDA 2XF2A 1YJBA 4LUCA 3RVDA 4QQNA 3WWYA 4DIUA 4R7ZA 4BFYA 5P8WA 3ZBQA 1AXEA 3FVRA 4QUGA 4UBMA 2N1BA 3QKRA 3QKTA 1A97A 1HT0A 2CNDA 1BEZA 4WUTA 4H7FA 2AF3C 3ZCRA 3TLAA 3R0QA 4EHFA 3PGXA 1ZM4A 1MH9A 4LXYA 4EI8A 3AM3A 4IIHA 1VA5A 4QM7A 1GQOA 3CC8A 4TRNA 3GLVA 4UUOA 1I4WA 3B3AA 3RH0A 2PXXA 3SBOA 3C6KA 3STVA 3A58B 3L8CA 1FS4A 3BJRA 5EE3A 4WOPA 4UU1A 3PL5A 3M1LA 4X63A 5FR1A 2WJGA 3SHTA 3WMWA 1XL1A 1NWHA 2IZZA 1Z45A 4KN5A 5KTSA 3K70B 2Z3VA 4QYIA 3ZOKA 4D45A 2QRVB 1HT3A 4H18A 1KR5A 1HRKA 3DDZX 4HPXB 4RD6A 3GWGA 4DIBA 4DT1B 3D3QA 3EHEA 4EHJA 4CCYA 5IANA 4KITB 4CMJA 4YJ2F 2YJ6A 1JSXA 1R6XA 2QSJA 4QPCA 1EUCB 3OZIA 4ND6A 4KBYA 4YUVA 3H1FA 3FSRA 4CKEB 1V8DA 4DBVO 1EGVB 5EL0A 4QOEA 1TZBA 3HN6A 2AR0A 4Z9XA 1IZYA 1EWQA 3B9BA 1XRSB 1SUBA 4P86A 2HCBA 3TK1A 1KJIA 2QUJA 4RMJA 3UHJA 1SCJA 2V7BA 2P2LA 3HG7A 4EBFA 3G9QA 3AM1A 4Y2PA 3GH1A 3D8RA 8ATCA 4DCNA 1GA4A 1V5GA 1E18A 1L7QA 1XXHA 1PJAA 3AF2A 3K73O 1J5EB 1F2VA 4RK5A 1IM8A 2BP7A 2F1IA 3BMQB 3T4XA 1RXVA 1K92A 2GUWA 2WWWA 3Q4GA 4PCAA 4RD2A 1BG6A 3K70D 5AK0A 1UODA 1E6MA 3EIEA 3SZOA 3L02A 3A1CA 3VJKA 1HDRA 5B7QA 3QKWA 4ZN6A 2QMUA 3IESA 4N49A 5ALEA 2G08A 2Z8XA 2GD1O 5F7OA 1R4NA 4LFCB 4GZLA 2A33A 5LN1A 4IUCS 3PDCA 5KDOA 4LW8A 3SFVA 4MP6A 3G9XA 5H1YA 3VH4A 3OSZA 3WGKA 1CR1A 2AZDA 1IUPA 5EVCA 1U8CB 3RS5A 1VXRA 4RO0A 2F3RA 3RKUA 2QWXA 2VN8A 4RQBA 2HSZA 4XH9B 1ICIA 3IUJA 4Y6OA 3WK9A 4EY3A 1JG6A 2ALJA 3BIWA 3GD7A 4QELA 4XLLA 1SKYB 3AJEA 3IOMA 4F11A 3EDYA 2YY7A 3DTVB 2HH9A 2IVFA 3P9NA 3RUAA 4MIYA 3AIIA 1DBRA 2BYTA 3WL6A 3BDVA 3ABOB 1PD0A 4EI7A 3V4ZA 4GL4A 2ZB7A 2XXAB 3Q0EA 4PNPA 2VF2A 3DM5A 3L8YA 3PNSA 4WZBE 5KI6A 2O0MA 2ZBQA 4HNVA 3WGIA 2VBGA 3PEUA 1FEZA 3ACCA 2MSDB 1XVAA 3LD9A 1NOJA 2NAFA 1BH2A 5ALSA 4KUHA 3UWMA 3C5HA 3CCFA 3RSQA 1I3MA 4YV0A 3K8OE 4PZPA 1QVWA 1TTQB 3L8HA 2Q6KA 3K72B 3CXUA 4UPEA 3BE5A 2WW8A 2JFXA 2YJNA 2I99A 3ZG6A 3A3YA 3L93A 1QF9A 1VYHA 3EQZA 5LLSA 3DTVD 2W9XA 3KQOA 2PQ0A 3QWIA 3MMSA 4FYVA 4C0SA 3NZEA 4CR6A 5EE5B 2NSDA 3K5WA 1G20B 2FPMA 2NYVA 2OUKA 3HVJA 3ZE9A 4D4GA 4I1PA 5K4HA 3GRKA 4I50B 5GOTA 3WGZA 3IKJA 1E7MA 2VO1A 4GD3Q 4EO7A 4REOA 3PHHA 1X1TA 4AY3A 2IE0A 1ZBDA 3QG1A 4KXMA 3M4ZA 1T8RA 3GMIA 3KYIB 3CZQA 1UPBA 2YVQA 3H17A 4FHFA 4OMFG 1FPMA 4EP1A 1QH0A 4EBBA 1VPVA 1EDBA 4PIVA 1IXRC 4PSKA 4CGZA 3VR4A 4ZOQI 4RNCA 3VPAA 1QK3A 2XNSA 1AB6A 1L7EA 3OA2A 2FN7A 3ROZA 1M2FA 3GGSA 4RJTA 1M2HA 5K0TA 4NOKA 1GNTA 2QD2A 3HUTA 5EZQA 3W1EA 2QU8A 1F6WA 2FJ0A 1JHZA 3NKFA 2OLJA 5P21A 4MMZB 2A5LA 5CAEB 4KNVA 1P4SA 2IXDA 3Q9UA 1ODLA 4JB0A 4F5DA 2O7RA 1PV4A 3ES9A 1X7WA 2ADFA 2GX6A 5JYDA 4HWRA 1KBOA 3VOSA 2H51A 3LDUA 2XZTA 1X15A 2EP5A 1MTZA 2R00C 4V0MA 3UTCA 3FPLA 3HA2A 1AE1A 1GNVA 3EG9B 3NLLA 1G38A 2OV8A 1OD6A 1NYTA 3A1UA 1EIWA 1E20A 3NC1C 1U7OA 2D1YA 2DQKA 3O8RA 4YBRA 1JHYA 3SDBA 2AN9A 4MCJA 4NU5A 4PYOA 1ISIA 3IQFA 1QO7A 1T29A 4HRYA 1FFXB 4I08A 1X1DA 4BMYA 4Z7NB 3E8MA 5JZMA 5I7FA 2L18A 1O96B 2G1KA 2XRMA 1ABFA 1YS1X 4DYHA 3ESYA 2VHWA 1E32A 1N5JA 1VA4A 2HMAA 3DMRA 4JH0A 5AKEA 5CXSA 3DR5A 3ENVA 4L02A 3RTAA 3IDAA 1YASA 1A50B 3LQRA 3X1ZA 1KPHA 5KYTA 2GK7A 2ZE7A 4IJ6A 4OJKA 1LLQA 4ICIA 1ZGHA 4UHDA 4XDYA 3ZJVA 2G82A 4E5KA 3BRSA 2Q27A 4MPTA 4LXHA 1SKAA 1P31A 2IKSA 3BEOA 2HQOA 4PPQA 1T3SA 3HGMA 5BNWA 4D99A 1JI3A 5IC6A 3CG4A 1C2YA 4X1YA 3FOWA 3OCZA 1FP7A 4J03A 3AXTA 4WFKA 3TAUA 4EO9A 3OD1A 2E1PA 5D5QA 2HBYA 4RQUA 3U4CA 2PT6A 3TEJA 1E2UA 1RYYA 1UMCA 1H4QA 1E7RA 4OFWA 5A3RA 4QPDA 1MOQA 3DHNA 5I3CA 4CF7A 1E2GA 3T5MA 1A2OA 3KTDA 3LLUA 5AJHA 3MCZA 3V8MA 5CM2Z 4RMIA 4E4RA 2P68A 3GJ6A 1NC3A 1DL5A 1ZSNA 1J8DA 5K8UA 2Q5FA 2YFQA 1ZMBA 2YRWA 3PKIA 4D9MA 5KTPA 4RPKA 2HK6A 4TMXA 4U2DA 4XCXA 3IR5A 3UHPA 2BMEA 3CUUA 4B2IA 5IVHA 4FU0A 3N9IA 4DNXA 2ARKA 4OQFA 1MB3A 1E2KA 4MUJA 2FDXA 3GPCA 4IBOA 1KMCA 3REGA 2ORWA 3JAKA 4C1BA 1U80A 2DWUA 1SOUA 4JR1A 1QP8A 1JF8A 4WCFB 3W3ZB 2Y05A 4EQ6B 4QD3A 1DADA 2Q1SA 3I5MA 1N1MA 3GO4A 1CUFA 2IF0A 1AD2A 1PGOA 2PL3A 1KE2A 4LGCA 5F3RA 3JARA 4GZMA 4R68A 4NAHA 3D8TA 1K5GA 3DKVA 5JO9A 4AJPA 4D3SA 5JADA 5LQNA 4OLBA 2WU1A 1U0EA 4BO2A 4KYTA 5E4YA 3FAZA 3ZVRA 1AQNA 2P9JA 5CB4A 1N7HA 1I4TD 2P79A 2VKQA 2VOJA 3GB9A 3H65A 1XU9A 4D43A 2RK3A 3ICOA 3N6VA 1SVKA 3HJFA 1VDZA 3EVCA 4MGZR 1I3CA 2RHMA 1W88B 2AXEA 3CSDA 3S55A 1T4BA 1BXZA 3B51X 2PCLA 1FVXA 4CNBA 3GW8A 1I9GA 3M6LA 4YRQA 4PLHA 3T95A 3PPVA 4NU8X 3TRFA 1OQAA 3C5WP 4KXUA 1IHOA 5BQPA 3UAYA 5BVHB 4X90A 2HW8A 1M67A 1W0JD 2R6ZA 2VT2A 3ECCA 4HNHA 1NVVR 4OJYA 1C0PA 4I4TB 1DJNA 2IUUA 4DKJA 2X14A 2CJPA 5FIUA 1P6XA 3B70A 3ZVNA 2P90A 2PBRA 3MTJA 1P3DA 3R0JA 3W2FA 4MW6A 2H2FA 2VHVA 4WPGA 1I36A 3I4CA 2XGOA 3CUWA 1X70A 3MS7A 4YAEA 3KVVA 4AIRA 2J7PA 3EUWA 3R4CA 1GL7A 1RTTA 2F67A 2JVKA 3WWCA 4Y1RB 2HDHA 5SY9A 1Y33E 3LPAA 4KO3S 1KO7A 1LRKA 2FZGA 2H1HA 2QQ0A 2W58A 3GMDA 2GYVA 3Q6NA 4JI0B 2AXNA 2GTIA 4E09A 2IYSA 3EDOA 2YIDA 3AY6A 4A8JB 4YT5A 2WPDD 4B84A 3KEGA 3OFNA 3RIGA 1BDMA 4Z2AA 1ZIDA 5CFOA 4YQZA 2PYIA 1UBTS 1WHTB 5D01A 5KU7A 5DMHA 4JA2A 5EC8A 1TRKA 4CXMA 1FYXA 3WGUA 5IARA 4B3MB 3SJBA 4QXRA 3NXSA 4MVYA 4HLQB 5DLQC 2FY8A 2VK8A 1SVOA 1RABA 2FMIA 3B13B 1DNPA 3Q3IA 4PG5A 5CP8A 5TDHA 4BLSA 1RHJA 4JA0A 1Y8QA 1YQXA 3KKZA 4GX0A 2AX3A 4D4JA 2Z6QA 3G6KA 4U63A 4IJVA 1LLFA 4L5IA 3PXXA 5EQTA 2R2AA 3M4JA 3R8XA 3V7YA 3MWDB 3ZHTA 4UFPA 5A4FS 4QU5A 5GM2A 1M2OB 3KUDA 3M6FA 3LUFA 4LGMA 5HR5A 4JYZA 1Z18A 1DKNA 1E3EA 2BEVA 4FZ3A 4I0WB 5ERXA 4C5CA 4CU5A 5HXAA 1GUZA 1E2EA 1MNAA 2GBIA 4IDNA 1P9OA 1PFQA 3RREA 3OKFA 5CB6A 2VK2A 3PCTA 1UPFA 1UZMA 2I3BA 3PV0A 2QPAA 5L3QB 3EFOA 3O26A 3ZJ4A 3WAJA 1ZOIA 4CEIB 4UTZA 5A5DA 3CW2A 3HV2A 3O5AA 3HFRA 4RJLA 2BUAA 4LAFA 3KUXA 1LVUA 2GB4A 5E1OA 2OK8A 3ZYCA 5KJFA 4R1MA 1SBNE 1GNQA 3GDHA 1D6NA 1Q57A 5AM3A 2EHDA 5EJ6A 2EHJA 1T2FA 2WR8A 3M4YA 4RHUA 3S99A 3ETHA 3NBQA 4ARUA 4DLPA 4YJGB 2PX5A 3VHQA 2JFNA 1TIKA 1ZONA 1KOLA 5B58T 3BX1A 5M5BA 1CDOA 4LSWA 2ZM5A 4RY0A 4RD0A 2V54A 1X1CA 3BJMA 2I6UA 3USCS 4V0OA 4O4HA 4GP6A 1ZVQA 4G89A 4FFBB 5ENZA 4CIXA 1CS4C 7GPBA 4O3FA 2G1UA 1XXHE 4LRYA 1VIVA 1I10A 4INZA 1IG3A 3DZFA 4G5HA 4HH4A 4MXDA 4BO4A 4XZ3A 1KAMA 2HKIA 1TRHA 4E5MA 2CYAA 4AJ1A 1KJJA 3KKOA 5AVVA 3O94A 2ZI3A 3UO8B 3CWCA 1NYQA 1V1JA 3L05A 5K99A 3IPYA 1J9ZA 3Q2KA 5J40A 5GGYA 4D96A 2ECOA 1B8VA 1JN0A 2F9MA 2Y4OA 3L40A 5IBRA 3UICA 3SVTA 2C03A 1XDZA 3EH2A 3FZGA 5H02A 3NVKI 3HUUA 4RIEA 1KJWA 3ROPA 1GNRA 4E7PA 5FORA 2V55B 4YHBA 4MV0A 4PGHA 1KSJA 4HJXA 1SQFA 2D1RA 4FCTA 5LJLA 4TLAA 3H4TA 4LDQA 1CS0B 3NDIA 2AX4A 3DMTA 1FU4A 1WNTA 2XJ9A 3UOAB 4R1UA 3DV9A 1D03A 3I1JA 4UPVA 1J5XA 3L6DA 2C5EA 3NQ41 3S1SA 2V45A 2XKAA 4NBUA 5FADA 2IYEA 3REFA 4OL9A 1DEHA 3AFMA 5EKDA 2ANCA 1XDUA 4MPJA 4ZARA 4HAZA 4V03A 1II8A 2OG2A 4PYRA 2I2BA 1TJYA 3VR3D 3ZWPA 1NU8A 1AK1A 3PLAE 1EU1A 4EK9A 1T6YA 1UBRS 1T2AA 4NBSA 3THRA 1EM8B 2HNBA 3ZU5A 2OCDA 3MUNA 1X39A 2PUTA 3DOJA 3FKQA 4QXMA 5DGXA 1X19A 2R65A 4E14A 1DXOA 1JALA 2FLWA 4B46A 4E32A 1JV2B 2WT9A 5CRIA 2NUTA 4TM8A 1YOBA 1HDEA 2LIPA 2ZYAA 2YZNA 3L7NA 4IDEA 4AS1A 1BA2A 3IUPA 4KMSA 1A4IA 1LVGA 4B7AA 4CEJB 5G41A 1DZIA 4EATA 4RHEA 3GLGA 4JCOA 1P5FA 2RHBA 5BR1A 3TO5A 1PTKA 1ZC3A 3KKKA 4YP1A 1UXHA 3VGPA 4Z5XA 3KKMA 2FSVA 3S2GA 1PFVA 4HDSB 1JMVA 3I30X 3BGIA 3RRFA 1FTSA 2L2QA 4NPCA 1QMPA 5FOXA 3VHRA 5KQGA 1KEZA 1QFJA 5F98A 2D0PB 2B8EA 5BW6B 4GM4A 2JKVA 2VWPA 3M6MD 1Y3HA 5KKCA 3FLAA 4ZV4A 3GEEA 4CL3A 3LHDA 2G4CA 1FXWA 3CA8A 3OQIB 3WRYA 4C7OB 3AERB 4X94A 5IJ0A 3C6QA 3HBFA 4P7FA 2A86A 5HGJA 4EG5A 3FB4A 1RYZA 3CIFA 3DAGA 5K0GA 3SM9A 5TEWA 1G20E 3CW8X 1YD7A 4AJOA 2WHEA 4IS2A 4EB6B 2F1KA 4EZEA 1JRLA 3NFYA 1ZJZA 4GF5A 3EF1A 1JA0A 4CMEA 3IIJA 1FDVA 1YA8A 2CVOA 3PXDA 4DM4A 2HRQA 3KXIA 1KQGA 2IQIA 3ZY2A 1JHXA 1C4WA 3VGJA 1KMQA 2W6CX 2B8TA 1IB6A 3RB8A 1UK8A 3D3WB 2L17A 4PY2A 5ELMA 1CKEA 4FGUA 3BFXA 2ZM6B 5IF9A 4AMZA 4XYLA 1ZZGA 3M5DA 3DWEX 3G2LA 4IH4A 2W4IA 3T5BA 5C8DA 2CLIB 5B12A 2VQ3A 1NVBA 3F3MA 3QXJA 2JFYA 4RDCA 1NN5A 2ZVDA 2RH5A 1XZKA 1T25A 2LGJA 2N1MA 2R7AA 2XMZA 4D9HA 4D42A 3R9WA 4K9QA 3QEMA 2R0QC 1OW3B 1PUJA 2COUA 3BGWA 3JQEA 2IIVA 1BGXT 1S7GA 1N92A 5KYNA 4NMMA 1U28A 2XYGA 4URWR 4HXGA 4ZDWA 4V0ME 4QDTA 5DW3A 4AMUA 4B3RB 2XMDA 1TLFA 1E1RD 4HDKB 4HF7A 4MWOA 2ZJ0A 4J4HA 3LC7O 4J49A 5DCLA 3L1UA 3COZA 1GARA 4KH0A 1GCGA 4UU0A 3L18A 3BAZA 1P2VA 3CRQA 2EJTA 2NG1A 3CMCO 3CRNA 2WJJA 4X3PA 3VU8A 5CW2A 3T61A 4JY7A 4HUTA 5FUMA 4MKIA 1OY1A 3S2IA 1OSNA 2NZXA 2EQ5A 4I8IA 3ZHVA 4BCCA 4YQFA 5HSGA 3K8ZA 3ANXA 2ZWPA 1NM5A 4KK4A 3USES 2ZVJA 4A82A 2XUAA 2PGNA 2BF4A 3EIXA 1E89A 2QTHA 3SP1A 1GPYA 1B15A 1BC5A 1P5HA 3AVYA 1L2TA 1UANA 4PFJA 4PPYA 3OCUA 3A1EA 3KDPA 1SXPA 3ROEA 4LYJA 3TINA 1OH5A 4AJKA 3A25A 5C8ZA 1QX3A 3CPHA 3KV1A 2Q2OA 3P2YA 2ZSIA 4QUAA 4JMLA 2G9NA 2JKZA 2ON6A 3AHFA 2VXBA 2VAMA 4ETWA 4KYVA 5A3QA 1JLLB 4D4HA 2PXAA 4E5PA 2NACA 4DADA 1BKYA 2GRAA 3DQPA 3EGOA 3P9XA 3N5KA 4R1PA 4AKSA 4ARVA 5A6SA 3NW9A 5I7AA 3I62A 1WDMA 2ZI7A 1UDXA 3HB5X 3AUTA 4IKPA 1KEKA 5H5JA 3AOEC 1CR0A 1CUCA 4NEGA 3T9BA 1M73E 1S7CA 5B3JA 1I01A 3UAGA 2BEJA 2QUIA 3AIOA 2N46A 5AP9A 4XWGA 1Z2NX 4ZU1X 5HZMA 3DEFA 4GLJA 4H6VA 1CK4A 1YDHA 4L5BA 1Q0LA 2A9QA 1NMZA 2C0QA 2Y0DA 1ND6A 3NBYC 4J2TA 4DTIA 5C32A 1HYEA 1KH1A 2DPGA 3CNOA 4EHNA 5BW4A 2QUKA 3WA7A 2G71A 3FWKA 5ALWA 3IBCA 4JUCA 5I47A 2QAGA 4PQYA 3QVWA 4BLVA 2A9OA 4GIBA 1HDCA 3G2HA 4J1NA 1PQPA 4WN9B 5DM2A 4RK1A 5F7JA 3RANA 3N2LA 4Z7QB 2NT4A 2XB9A 3KD3A 5HE9A 5G0SA 3R4VA 1L1RA 2QB5A 3T4EA 1GZUA 1PQYA 3FIJA 1PIWA 2JC3A 2B4QA 3G2PA 3C6XA 1XJ0A 4NJOA 3UG6A 2WUWE 5KYGA 2DTEA 4YDRA 3T35A 5E38A 1N2IA 1JDTA 1P0QA 1QK4A 2OM6A 2XWBF 3HVHA 4FJ0A 3NAMA 2EYUA 2O2SA 4TQUS 4YIKA 3T9FA 4BX9A 1DG3A 1VMKA 1KH3A 3BWEA 3W2EA 1YTLA 4IQ0A 5G1PA 1ZZEA 3M82A 3L1KA 4AJIA 4DR5B 1HORA 3PUWA 5A0TA 2QL9A 2XCUA 4OYRA 2R62A 4W8HA 4FNGA 5CBPB 4JSYA 3SK0A 4G07A 1H5UA 3KPJA 1R50A 4M98A 4K9SA 2X0DA 5JZBA 5ELXA 2PMCA 3JQ9C 4Y2SA 4DNQA 1W35A 2A30A 4L28A 1RI2A 2CXOA 3CB2A 5EMLA 1QP0A 3FOEC 3GC6A 3I2IA 4X64B 3DBRA 3FPHA 3T7IA 4MR7B 3W6NA 4BMNA 1QFSA 2YWFA 1KETA 4JT8A 3P0JA 5B58C 1Y9ZA 3DE1X 4CV0A 1WUHS 1PFKA 3LS2A 4P4NA 2PANA 4ZIRB 2GEUA 3LYLA 4YH1A 3X1JA 2XNJA 2VPTA 4QXAA 3DCJA 2F43A 4IFTA 3G88A 1E2HA 2GK4A 4YV7A 2H63A 2RIRA 5ALRA 2V97A 1EUZA 1BHSA 4K26A 1YCGA 1YZNA 4EKGA 3H2HA 1RRGA 1GTRA 3PX2A 1RVV1 5K2OA 2RFLA 1EWYA 2JJ1A 4X1IB 2OAEA 1Q44A 5B2ZA 4FOSA 4V1CA 4DQKA 1MPTA 5B3LA 4LEIA 4BFXA 1DHRA 3UNXA 3VTZA 4WH0A 4H7JA 2XRYA 2PRJA 1DJMA 1N34B 2PEZA 4LK3A 1NJ8A 4MAMA 2HJVA 5JEEA 5TQ2B 3CFYA 2XE7A 2HPAA 3ORFA 2VNSA 4KMOA 4NFSA 2NZJA 1UBGA 2JAWA 2UVPB 3KQVA 1Y1RA 1ZGCA 2C4HA 2C3YA 2O23A 3EAGA 1T6NA 2NUPB 1RHRA 4M99A 4DWWA 2CEKA 5H9WA 3Q7QA 4M0CA 4WKNA 1DEAA 4YT2A 1TD9A 5FNVB 2WWGA 1BCRB 1WPXA 3OTHA 1U5BA 3OE4A 1Q11A 2ZREA 1DSSG 2KLBA 3BORA 4N7JA 4P9NA 4W9NA 5JAMA 1KQFA 3SMVA 3VTAA 3V1MA 1QH9A 4BGUA 1RE1A 2A5JA 3X44A 2E4AA 5JW6A 1OHHA 2I4MA 3TLCA 2H07A 5GZ6A 1LPBB 4E15A 4LWZA 4G26A 2HBQA 4NX2A 5GINE 4UKDA 4XAQA 1BJRE 1XYVA 1HBJA 1MFPA 3QLJA 1LDBA 1ZI6A 4AD8A 1YE8A 1A4UA 1UDBA 1Z62A 1LBSA 3K20A 4MRSA 1R0RE 4LY6A 5E7JA 1KO4A 1Z4LA 1ZUIA 2ZUSA 3Q2IA 1N6LA 4IO0A 4ETMA 5DTJA 2IHYA 3GGGA 2FUCA 5FWAA 4K1LA 4DABA 4KN8A 1L7MA 3GT3A 1LK5A 1A0OA 1UPAA 1XWFA 3MK31 4HN2A 4NBTA 3ANMA 4NNJA 4B7CA 4DJDC 3EZ2A 5C37A 2ZYSA 1AG9A 1JWAB 1YS6A 3LFTA 1QH1B 3ZDAA 4FQ8A 1OHHD 4L5CA 1KYYA 2HCTA 5B6JA 3KRTA 4EG4A 1MJNA 3PFKA 2EZTA 1OV4A 1KARA 1SBZA 2I6FA 4LVCA 2EZ8A 1UWLA 2P4QA 3FMIA 4ASUD 4BQQA 5AOBA 3TR6A 1DC8A 2B2CA 3VR2A 2DETA 4HQNA 2QNIA 4UE2A 3VC2A 2XTNA 4YN3A 1UOEA 1OFIA 2FPIA 2WYUA 3E48A 4ZREA 1WVIA 1YZGA 3VISA 1EM6A 1G6KA 1BH6A 4AO6A 3K9GA 4LY0A 1FSGA 2I8CA 2XI4A 5DHQA 1GTL1 2H18A 4ZHQA 3DDHA 1VRVA 2AWOA 4UXHA 2ZI4A 1U7WA 5B5SA 2ZXUA 2BONA 3N8NA 2QYOA 4XGQA 3UTDA 3NGMA 2X6QA 5LWHA 2DLCX 1FU8A 3L3BA 1TA0A 1GU7A 5AJVB 1YE3A 1PLJA 4JL8A 4EKYA 2GETA 4HXEB 3K6KA 4G41A 2GAAA 4B09A 5JSZA 2ZJ8A 4LJ6A 1XTBA 2CHUA 3B12A 1YUNA 2J9XB 2UAGA 3ISTA 3X0DA 2PZEA 2A9KA 2H4YA 3IVRA 4KI7A 4YJHA 3K9CA 5HRCA 1O97D 3EY4A 2IBMA 1KFBB 1O6CA 1QQTA 3VI4B 4BLTA 4LTMA 4ZDIA 1DQPA 3CJRA 2NU8A 3TN7A 1UFOA 1QVZA 4E6EA 2O8BB 4GI5A 3QYFA 5HHTA 2HBZA 1K7XB 2G76A 3GJ8A 3O4FA 3BXXA 3QTTA 2PD6A 2D1SA 5FWYB 5D3ZA 5TPZA 5K6AA 1E6LA 4W9MC 1VJDA 3AWDA 4WTOA 4N3GA 1KNQA 3WIVA 2D4HA 2EGHA 2IHKA 1B43A 3EVGA 3UFXB 4YMVA 2DH5A 1OJLA 3J7AC 3ELBA 4PX9A 1PFUA 3AR4A 4K9RA 1QIGA 2D4AA 1CNEA 1E58A 4HFNA 5I7EA 1QOZA 4MS3A 5AVXA 5HOQA 1VRCA 3DBLB 1Y1QA 2ZRLA 2RH8A 4WJKB 3RLFA 5B3AA 4R7GA 1RQ7A 2MTBA 2RAFA 3BCHA 5FDFA 1ODTC 1ZNWA 1TF5A 1JPJA 1XDBA 3KHSA 2C2MA 1H3FA 1H8HA 4UNNA 5J4LA 4ISBA 1RJEA 1V7PC 1RP7A 2MYNA 4TKLA 2HHLA 2GCOA 5IP5A 3UAVA 1NFRA 2C8JA 5TPZD 2WG0A 1GGKA 2FOLA 3MGAA 3RJZA 3MHTA 3FYUC 1YRBA 2GXUA 1LS1A 3AILA 2G28A 3F97A 4B2PA 4KBFA 2IL1A 2ZS8A 3FUUA 5HJ5A 5DNYB 3ACDA 4ZVKA 3RVLA 2YWRA 3G79A 3WDSA 2OCAA 4AM8A 3OFVA 5MN4A 121PA 3RAGA 2AG5A 4DDKA 4HRVA 4D9JA 2P1ZA 3RUIA 2UYQA 2UUAB 4D8WA 4LTNA 3L8FA 1A9SA 1Q1QA 3A6ZA 3NWEA 4GVLA 3RAPR 5KU1A 4GXRA 4WLFA 3MT7A 1M0EA 5AHKA 3PFWO 4YJ2B 1UM9B 3PNVA 3OFKA 4KZPA 4YWJA 3TIXB 3VSBA 1Z4NA 5JASA 5B55A 4G23A 3O1LA 3S40A 1OREA 3F4LA 2G1PA 1KAEA 3EWNA 5DT2A 1G66A 1T3HA 1H85A 1Z7YA 2GERA 3GRZA 1H2RS 1AUPA 1WCIA 2GJ9A 1ENPA 3AEQB 3ED5A 1HPLA 4L1KA 3ZKWA 4LMPA 5A0FA 4E5YA 5EE0A 4ZCQA 4JVNA 3W6UA 4JC0A 5DKFA 5MF6A 1AUVA 1IIBA 1PX0A 1YVRA 5BQOA 4FFSA 5IFLA 2I6XA 3D8SA 1MC8A 4UTOA 1F12A 1F0KA 5ECYA 2EP8A 3ZEIA 4BB0A 1BAPA 1ADCA 4CQMA 4DA9A 2ZUBA 1HNWB 5HF5A 2JFVA 3LC0A 4FMPA 3VKGA 2DECA 5F51A 1RMTA 5I5EA 4N7RA 1GAWA 3VA7A 3QKSA 1LSOA 4JYBA 1Q7BA 2AB0A 2C5BA 4BV9A 2A9VA 1QV6A 3DULA 1V2HE 5BUSA 4WDRA 2Y77A 4BUZA 3HI4A 5DV9A 2DJ5A 1WEKA 5A1JA 4JDPA 2ZIUB 1RZUA 3H2ZA 1XOIA 2ZBVA 4V0RA 1G55A 4M0PA 3FZQA 2AR9A 5D51S 4MW1A 4DCOA 5DP1A 5U4XA 2AMJA 5IBPA 2FW1A 3FOAA 2K7ZA 3A3OA 3DFZA 2AIRA 2NTJA 2PQMA 1D2GA 2M1XA 4H4EA 2XYPA 4LI3X 1Y6ZA 3PXAA 4XQEA 3A4LA 2O2HA 2OKGA 1XQWA 1YDEA 4DW8A 4MVXA 4CMIB 3BCSA 3FHOA 2IT1A 3BKXA 5AKIA 4D57A 3DF7A 5JXJA 3LCCA 4PZDA 3G17A 2FPRA 2WUGA 4W8OA 4Y9TA 2CXXA 1B3RA 2VRWA 1QHHB 3FROA 5EESA 1OFGA 3JQQA 4DCUA 4NFLA 1M34A 2B69A 2PQ2A 2Y1GA 2C2HA 3C8ZA 3W34A 3MTEA 4J0QA 3NC0C 3AI1A 3LNTA 2QRLA 4B4UA 5KX5F 3JSAA 2H7XA 4KREA 1K6JA 1SC1A 2X8JB 2RH4A 2I2XB 3E7PA 4LZZA 3EJWA 4PINA 4LYYA 5AJUA 3ZV6A 1FJGB 3FHTA 1GTJ1 5DBHX 1K4MA 1QO0D 1RHQA 2Q6LA 3REOA 2DFTA 2ZRQA 3SHWA 2O5CA 3TLMA 3LXRA 2P27A 4PLGA 2IZ7A 5JD3A 4B80A 1A76A 1Q7CA 2A78A 1DAOA 5JZOA 5FI0B 3KSMA 2V8BA 4QQRA 4V38A 1XMOB 5AKZA 2FDCA 3DHVA 3Q40A 1GUAA 4Q9IA 4CF4A 1N57A 2E7ZA 2GCPA 5DI3B 1SD5A 4JYMA 1XFDA 4C30A 3EGXB 3H75A 1DBQA 1J2EA 1QQBA 1KNXA 2Q0QA 4OHBA 1G5PA 1H6AA 1TF2A 3M6AA 3R5FA 3W7AA 5J3JA 1BQ4A 3FCUB 3VJRA 2I2WA 2RHCA 5AM5A 2VL7A 1GT91 2CLKB 3IPXA 2A67A 1AC5A 5EOVA 3IQWA 2BZ0A 5BQ5A 3FFAA 4M54A 4MHTA 1ZVMA 2V65A 3COWA 1T9DA 2AOTA 3F6PA 3PQ8A 2UUPA 2RGNC 2BM8A 1S4QA 2ACWA 2HMYB 4ILKA 2ZJFA 4OXQA 3QE0A 3FR8A 4Z1MA 4BO1A 2W2LD 3QUAA 4L27A 1KO8A 1Y4ZA 3WO1A 3F96A 3JYQA 1R9NA 3MZ0A 5HFAA 1RM5A 1EIZA 1SIUA 1WF6A 2JCYA 3DVSX 4BRZA 1TGVA 3BMXA 1KRHA 1JKJA 3BBLA 1O0SA 2GN1A 4AYWA 4K6MA 4PTZA 3S1LA 2DAPA 5EZYF 4Q4AA 2H1WA 3SLKA 3RIEA 1T1GA 5LNK1 5A62A 1EE2A 1U9IC 2D2FA 1MB9A 4HS4A 4N12A 3I5UA 2IEYA 1LCIA 2BHSA 2VDLB 3WYAA 1A1SA 1Y8RA 2DUUA 2APJA 4LDAA 5H3HA 4F5EA 2C8VA 1QO9A 4YMGA 4KWIA 4AG5A 4ER7A 4Z1MD 4FX2A 4M36A 3GZTB 1N2EA 2BBTA 3Q85A 4FSHA 5JBNA 1PG2A 2VHCA 5SY4A 3EF3A 3I1FA 4PWYA 3ITDA 4G1EB 2PCJA 1DHTA 2PGOA 3HFJA 5EUQB 1FFAA 2JHPA 2XCIA 3BCRA 1G8SA 1X7YA 1Z5VA 2IZ6A 2ILTA 2QRHA 2ISSD 4R16A 3W78A 1CETA 1K68A 3SQMA 2BV3A 3ZHXA 2VF7A 3FNRA 4UVDA 3FJOA 2YHBA 5FEUA 3UBTA 3ITKA 1DE0A 1EZZA 1IBCA 2IXGA 4MPPA 3SDZA 3VZCA 1A3CA 1RQPA 2HDNB 3SI7A 4QSHA 3BB4A 4IICA 4G84A 2YMLA 5FBZA 4H9GA 4W1PA 2I4IA 1RPJA 3GQBB 2OORA 3HZRA 3BSWA 3OOEA 3WMXA 4RWEA 3E6AA 3CXRA 5EQDA 4CKWB 4IF6A 3QBJA 4GT1A 4TWZA 2ZFUA 2QOEA 3E9YA 1NR1A 3GLFA 2FAXA 1J24A 5EKXA 4V0KA 4P3OA 3HP4A 3IKVA 2VDMB 3L6RA 4IOJA 4L95C 1E59A 2O3UA 4HL6A 1P1HA 4ENQA 5LR6A 3S28A 4PXYA 5DTMA 1QGUB 1EFUA 2Z6AA 3H3FA 4O2BF 5C81A 3RKRA 1ZI8A 2GBGA 1F14A 2X3FA 3H3XA 3VOAA 4IKEA 4D4KA 3I6YA 1XI2A 2AYYA 5TQJA 2V6IA 3ZXIA 4BMXA 1IRXA 4ZYUA 5IZCA 1WXFA 2C1ZA 4FMCF 2G04A 1RT9A 2W6PA 3N86A 4JLJA 5KVSA 4MI9A 5D85A 1PQUA 2VPWA 3T7JA 1IHUA 4CW7A 4E2YA 1RDFA 4GYKA 1OZ0A 4IJKA 4JWTA 3TB4A 3U56A 1K2WA 3EXEA 4FB4A 1VXOA 3A6JA 5JPIA 4G4IA 4XRGA 1IUKA 1QHIA 1VJ1A 2M6SA 1ITZA 3N0VA 3X1WA 4DTCA 1M6VA 1Z5OA 4EVSA 1WMBA 3GGPA 2H1IA 1A9YA 3H6KA 4OHCA 5DBGA 3RRBA 2R4TA 3V8PA 4KFRA 3WK6A 3DMFA 4Z4GA 1F7UA 4HAYA 3MHPA 2YIVX 4IIBA 5JCOA 3V7WA 3RBZA 2WABA 3ZC3A 1JDJA 1QORA 4J7UA 1V6CA 4DLRA 4UHFA 2EC5A 1JDNA 1KK1A 3V80A 1PYDA 2HAEA 3W05A 1TU4A 4JLVA 1D2HA 4LHYA 3VO2A 3VNQA 3DBVO 1LWOA 3DO8A 1GZVA 3GIDA 2P8JA 2B7LA 4DM3A 1SURA 1JKMA 1UC9A 2VNJA 2ZP1A 2VYCA 3KJEA 3R3UA 1W36B 2W37A 5A5EA 3IRVA 3SJCA 3IV7A 1A8HA 4H77A 4OH7A 3JATA 4KW7A 3OA0A 1SG6A 3RVKA 3T7DA 5I4BA 2OYCA 2PMWB 4ZI7A 5KREA 2JD2A 1ONBA 4XEUA 2M1ZA 4U2EA 4QBHA 5ER9A 4E70A 4URVR 1OWOA 1J8VA 2FH5B 6NULA 5DK6A 5C5EA 1UZAA 4Z6KA 3TZCA 4Y18A 1XQ1A 3KD2A 3E18A 7YASA 2UZ3A 3RAJA 3U09A 1AHNA 2HF8A 4Q9AA 3UK1A 4PC2A 2J5RA 4QG7A 1X42A 1CF9A 1I3NA 4CODB 2CUTA 1YZVA 4PZLA 3DBHB 1AO0A 2WKPA 3RU7A 1GGVA 3ZIDA 4LECA 3PUKA 5ALMA 4E5UA 3CU5A 5BO5A 5ANRB 2CD7A 2OE2A 3P19A 5BT9A 4EX6A 1T34A 1YR2A 1W36D 3O0DA 4XEHA 3AF0A 3GGCA 3VSDA 3NHKA 3WTBA 1N2ZA 3ESDA 3KHTA 3KYBA 4I9GA 2GDJA 4MZDA 4JI6B 1XA3A 1E0AA 5AVYA 2V6GA 1IHYA 1FSPA 1UC5B 5I9IA 1FOEB 1W4ZA 1VKOA 4PNEA 2GLUA 1P74A 4HTAA 5DWDA 4N0EA 2CD9A 1NVFA 3C7CB 3K0EA 1LU9A 2NWQA 4XD7A 1TM7E 1IJEA 4I4IA 4X61A 1C0EA 3WFZA 5HEKA 2B4KA 3HKEA 1ISJA 2KWIA 3NETA 4KN6A 2HOQA 3LYHA 3SSOA 2ZU0C 3COPA 4NYMQ 2Q1WA 4EECA 2QD1A 1P2BA 5JE8A 3E2PA 5GVSA 1CR4A 2ZUEA 1S3GA 1O54A 1PBNA 2WAMA 3I2YX 1GU0A 1FFCA 3M6XA 3JWPA 4ETIA 1LDNA 1UPXA 1NFQA 4CKCA 1GILA 1W7AA 1SVNA 4FZ5A 1NJ5A 2AHRA 3LYAA 3OO1A 5FFMA 3V7NA 4Y0AA 2QVBA 4MS1A 4EF4A 1SZJG 1Q95A 2RGWA 1PKEA 1SBQA 4X3CA 5JJ5A 4CIAA 2ZAIA 2I6GA 2ZTMA 3M9XA 1JKIA 1J0DA 5AKJA 1GLVA 2NV6A 4XM0A 3OUUA 5FF9A 5T57A 4KQ2A 1K7CA 1CERA 4X85A 1Z2AA 3DYBA 2P9YA 3O8DA 4M0MA 3UH1A 1DRWA 1L7PA 1A9QA 3DZDA 2B1RA 3R74A 3STYA 4HZUB 2XMPA 3MB5A 3A1VA 4YXFA 4QRHA 1QG6A 5IH3A 2WJHA 5AJXA 4FEYA 5B4UA 1LZLA 1XTVA 3UGJA 4GC9A 4L3OA 3TLZA 2ZB4A 4TSKA 5AYVA 1R8YA 5ALPA 4EHKA 5IG2A 4IVPA 1E5XA 1NBEA 2PMKA 5D5HA 1IXYA 2Y2UA 4FWTA 2YV4A 1TZ2A 1HV8A 2RE8A 1FNBA 4DQDA 4KR7A 2WVAA 3FH0A 1RBMA 2XWSA 3HLYA 3L5OA 1PLLA 4FYKA 4NQRA 5EAIA 3UJAA 1QVVA 4C07A 1S2OA 3D6MA 1VL8A 3H18A 1RJDA 3LBNA 3KJNA 4ZANA 3A6EA 3TL3A 3S8MA 3TOVA 1VCIA 3OHMA 3A6LA 3QU9A 4U7PB 3F6YA 2H57A 1CZUA 4MDFA 2QJRA 1US8B 2MSEB 3I4LA 4XUGB 3VPHA 3CX8A 5CT4A 1AK2A 5EKUA 1TEHA 3MCWA 5GWXA 4ZCMA 5FA8A 1YU9A 3MYRA 3PEYA 1AKNA 3E5RA 3VBEA 1VGRA 1U3WA 3IVGA 3V3KA 3ZDFA 2C96A 4EDFA 1F4VA 3AUSA 2V59A 3KQSA 1PO7A 3FKJA 5DWQA 4AZ3A 1NGSA 1ZAYA 2VDUE 2HRZA 4UEQA 5HM6A 1ZD2P 1JXAA 1VE1A 1YOVA 4G3XA 4OATA 3WNZA 3L77A 2W6JD 1PRYA 1SGWA 2PX0A 1K27A 4OMDA 1E8NA 3AKEA 4ZAVA 3MRXA 1CQPA 2ODBA 2ATIA 3WBJA 2D5CA 4UU8A 1PT6A 1XMJA 1X7XB 1U0LA 3O2SB 1SWWA 3OCJA 1R6TA 4GPAA 3LC2O 2AJLI 3TLYA 4H3HB 4BMDA 4P4GA 2ZWAA 4EVQA 3ZR4B 1IY8A 3U4DA 1J90A 2BJHA 2VHUA 3KV3O 5AVKA 4AXXA 5C1IA 4V0QA 3N0WA 1L1FA 5CA0A 2O9JA 4JZKA 1CSEE 4HFJA 4OQYA 2I9KA 1O95C 2Y9PB 4UAVA 2OHGA 1E3MA 1LTKA 1UC4B 2XECA 4WIAA 1O0CA 1ECFA 1H8EA 3HDQA 4EUEA 3QLEA 2VJDA 1JR3D 4XJVA 4MV3A 3R41A 1ZIXA 2WJYA 3AM5A 5JPDA 5LUBA 1CV2A 1DG1G 2ZBFA 4BQSA 3WV5A 3PRYA 2O8FA 4D3DA 4L2IA 2NVUA 5G0UA 4ZQHA 1CLUA 2FPLA 3G0OA 3K31A 3QLUC 5M3BA 4FZVA 3VH3A 1PX2A 2WHYA 4MSUA 2O5EA 2O7SA 3AY0A 3GLIA 2P62A 1L5HA 4INAA 2ZRHA 4GXQA 1QIMA 4DHEA 1F0NA 3GY0A 3FTEA 2Z95A 4K3VA 3GFRA 4F9GA 4AYTA 1G5QA 2EJUA 5TF0A 1QS0B 1RQXA 1LK0A 1R0BA 4MB6A 5LA6A 4M1EA 5F1PA 3N6RA 3H1GA 3RD5A 3SIPA 2WZDA 3M2TA 3KOYA 1ZUWA 1BA3A 3AZQA 4JR0A 1MO2A 1D2EA 3JRWA 2FSPA 3KDSE 1RI3A 3DO5A 4G1UC 2GWRA 1AHHA 2E37A 1YS2X 3N58A 1IZ9A 3FG9A 3B1WA 5CLHA 1QYDA 2Q3CA 2UVDA 5E8JA 4Z1OA 1XAJA 2VH1A 1XRPA 2GAIA 3BE8A 3KALA 3MCUA 4U7HA 1DWUA 4M1TA 4EA7A 5CFNA 5K8LA 4QDKA 4DUGA 6YASA 4IJWA 2P1DA 1TYCA 3FZNA 3OJ0A 3SC2A 2OBYA 1QYWA 4NZZA 3NV7A 1FFHA 2X23A 3OLYA 3BTOA 1E8DA 1MBZA 3HO8A 1RLOA 4OBWA 3TQSA 3H1BA 2HQRA 2DP4E 5BUCA 3M49A 4LMRA 1M83A 3C43A 5AW7A 3D2BA 2QRVA 1PZGA 5CXQA 5TQ0B 1Y0BA 2BLLA 2J5KA 3E9RA 3U4IA 3AU8A 3PNOA 2GAFA 4YRIA 1P1CA 4J0IA 3USZA 4JD5A 1K06A 3JQ8A 4XR4A 2H16A 3P4UA 3B8HA 3DDCA 3R8CA 2ZYDA 3HXKA 3TYXA 3BN3A 2OG1A 3AHJA 1XZGA 1VPEA 4R1OA 2YJGA 4RIFA 2ZZKA 1ZW6A 1IXZA 5C8VA 3DXFA 3QNUA 1KMHB 3B6IA 3DE4X 3RVOA 4PIMA 3TD9A 1WXWA 4PG8A 1NW3A 2VJCA 1P1BA 3E9DA 3BJEA 2IYAA 3DCNA 3MS4A 1X7DA 2PRSA 4RQAA 3WGLA 2ETVA 4MJXA 3U81A 1UKAA 4BLOA 4UTPA 3I6QA 2GTHA 3KSBC 1UJ6A 3TQRA 1SELA 1WZNA 3G8BA 3C7DB 2VA9A 4X54A 1ABBA 4NENA 3VI3B 2GPBA 3PDIA 4RVNA 4U3JB 4HATA 1EFLA 2GEBA 2PO7A 1M0TA 1A5BB 2JDIA 1I8TA 3C8DA 4J0DA 3S2EA 4Q7KA 3A9RA 4MOWA 5IEJA 3EE6A 2QP3A 1G2PA 1WB6A 2FW6A 3INNA 4S1VA 2V0GA 1WD7A 4OYLA 4ZC8A 4ZQEA 2BGNA 1QDLB 2J0EA 3R6TA 4OK6A 3NJ4A 1QYRA 3C5EA 3MWEB 2O2EA 4Y2VA 3ROKA 3KTFA 4Y9DA 3RPEA 3OPYI 3S1AB 1P77A 3FPSA 4ONEA 4WMLA 1UDRA 3DFKA 1V41E 3JWEA 4DA8A 5A04A 2H1OA 1M2NA 1XG5A 2OXTA 2WQ6A 2CKMA 1O94D 2PPVA 3G5UA 4HAWA 4RLQA 5LNK6 5AM4A 1SOAA 4D81A 4YMHA 4AJ2A 3VYSB 3K1ZA 3LAWA 4LVUA 4B2LA 4P54A 4TQ9A 3TIIA 1UFVA 4YV1A 3B5EA 3D59A 1S3IA 2DUJA 2EDCA 1IM5A 3KL4A 3HB9A 2JDID 4ITRC 2WC1A 5EP4A 4ZPJA 2QTCA 3RWBA 3HYSA 1SG9A 1I0IA 4OK5A 1U3UA 1U9ZA 1W59A 4LVNA 2CB0A 1NYLA 2CWDA 1B73A 2WWTA 2YMQA 3LSYA 2YICA 4M60A 1C3OB 3HBJA 4GNKA 5FULA 1UKEA 3KHUA 3UOWA 1PR6A 1S0UA 2Y1XA 3AQIA 2G1AA 3THYA 2FE4A 3P20A 2WTAA 3GLUA 3P97A 3CLKA 3QI2A 3TNYA 1UAAA 1L7VC 1OLUA 5D87A 5HUJA 5ELLA 4NHEA 5C80A 2FGJA 3PUYA 1JHUA 3U7IA 1L4FA 3KOMA 2QMYA 2QVXX 2A92A 3B1JA 2CLLB 2ZQZA 3IAM1 4NJMA 3LF1A 4RGVA 4XFKA 1P9RA 3ET5A 3VKVA 4E5DA 5A4DA 4AJLA 3THWA 2ATVA 3LU1A 5FUWA 4EJSB 1OVMA 3GROA 3OM9A 4HEQA 5DM0A 1NNEA 4X71A 4YHHB 3KPWA 4HB4A 1ZRNA 4KBGA 3DD5A 4BYMA 4DJAA 1SUSA 4DUPA 5BNTA 2ZE6A 3B89A 5AWFC 2Q5HA 1QIFA 2XNDA 5FBQB 1C9EA 4JFRA 3O82A 4HRXA 4JQSA 3GCXA 4MLDA 4W7SA 5JECA 2WTXA 5LUAA 1KERA 1DKUA 1L3IA 2WZQA 2BCEA 2VDWB 4H59A 1NXXA 3EB9A 1BMFA 3LK7A 5CR9A 4YX9A 2II6A 2R47A 4QXOA 2NV0A 2BGTA 1WMSA 2X58A 1A72A 4X8HA 4AWAA 1RWBA 3EYWA 1UMKA 1ZQ9A 3L43A 1Y8CA