3ILSA

The thioesterase domain from pksa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
265
Chain Sequence
b'LKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLIPHFTAVVDVMLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Hydrolase
total genus 84
structure length 265
sequence length 265
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilsA00
2Y6VA 1CUCA 4B84A 4J3JA 2QTBA 3BE8A 2HA6A 2Z3ZA 2IIVA 4D9JA 5A7FA 4QWWA 5JZBA 3V1LA 4C88A 1QONA 1QO7A 2XUJA 1C7IA 1P0IA 2G63A 3U1TA 1UK8A 1H2XA 1IVYA 4S0XA 4B0OA 1G5FA 3ESCA 1J2EA 2I3ZA 4ZREA 1JMYA 5KWIA 3MVEA 1E8NA 3K9BA 4P08A 4PSUA 2UZ0A 2VJBA 4BAUA 2ES4A 4QDOA 4BTVA 4B7ZA 5ALPA 1N5RA 3WWOA 1XRPA 2BAGA 5AIAA 1JFRA 2WM2A 1WPXA 1F6WA 4DTCA 5C81A 5T4BA 1SCKA 3E1GA 5FPPA 1WM1A 3H2KA 1JU3A 2CB9A 2XQKA 4X3CA 3G0GA 4FBLA 4IH4A 2QUBA 5ALXA 3WMRA 1XKTA 4FLMA 3IUQA 1YB6A 3H1BA 3QITA 4FOLA 3AIOA 2IX9A 5JZSA 1CUJA 3HXKA 2V97A 1JKMA 5EI5A 4G4JA 3BIWA 5JAHA 3B5EA 4GBGA 4Q05A 5CH5A 5BWCA 5AKEA 5CT6A 5ALHA 3HLKA 3WKAA 3IURA 1GGVA 5HCUA 3C5WP 2PUJA 1W76A 5EIHA 1B6GA 2QZPA 4IQ4A 4JNCA 2XMQA 2BJHA 4X92A 1O6GA 4GW3A 5I9IA 2OGTA 5CT5A 3O4IA 2WHPB 5C8VA 2VJCA 1H2ZA 3QYJA 4GWLA 1QIJA 4L0CA 1Q0RA 4X71A 1S8OA 2X8BA 1EXWA 4C6HA 4KE8A 1QOZA 3A6ZA 2ZYRA 4H35A 1DQYA 1W52X 3AIMA 4MYDA 2Y2UA 1L7RA 1GZ7A 2AJ8A 1TAHA 4OB7A 1GPKA 3WK9A 4PO3X 4ROTA 3DQZA 1EDBA 2WLSA 4MWSA 4HZGA 2DR0A 5ALIA 5HF6A 5K3CA 2X76A 4NS4A 4FFVA 4B85A 2O2HA 3EQ7A 5KREA 3ICWA 5C8XA 2BUAA 2Y1KA 1DTEA 5HFAA 3F98A 5AI9A 3QZUA 2VAXA 3KDAA 4J0JA 1UZAA 5T4EA 1AGYA 1EDDA 3QPDA 4QE3A 1EK2A 5A2GA 2R11A 5DTJA 4OYYA 3E4DA 4X93A 7YASA 4UHBA 3O9VA 1YSCA 3U0VA 1RYYA 1Q83A 5HF8A 4KR0A 4GI1A 2XLCA 3D4LA 1CVLA 2PSJA 4RGYA 5F4ZA 4UBIA 4U2FA 4J0GA 5CH8A 3OM8A 2B4KA 2K2QB 4KE6A 3O9MA 4OB6A 5JZ9A 1CUYA 1G66A 2PBLA 5DYWA 5FPQA 1YB7A 2PSEA 4W63A 4DNOA 1HLGA 2XLBA 5EHQA 4DLNA 5AI6A 3IIIA 4W1SA 1MPXA 1QGED 2BGRA 1UOPA 1CQZA 2BKLA 3VVLA 5HQ3A 2V9ZA 4N8DA 3HJUA 5JD5A 2C0PA 3WLAA 1P0MA 1UOOA 2D0DA 2VTVA 1EI9A 4ARAA 4PQEA 3F9CA 1MU0A 1RP1A 1E8DA 3R3WA 5JASA 4FNGA 1AURA 4B9EA 5DNUA 1GT6A 4C01A 3GBSA 4Q1VA 1IMJA 1W75A 2VT6A 4W1RA 4Y2RA 4DNQA 2Y6UA 1CUSA 4BCBA 3STVA 3WL6A 3S8YA 3RM3A 4K6HA 4HTAA 1MTZA 1XRQA 2HRRA 3C6BA 3D2CA 3LS2A 3C87A 2RHTA 5HFNA 1DX4A 4YPVA 5JARA 4GECA 1ZD4A 3WA6A 5AM4A 4C4ZA 3PF9A 5ALNA 1MNQA 2GZRA 3DDUA 4QDXA 3I1YA 3HABA 4MEAA 4X6XA 1N1MA 4W1PA 1NU6A 1OCEA 2EEPA 2PU5A 1A8SA 4X90A 2DQZA 1PV1A 4HRYA 2XMRA 5AP9A 2OQIA 4CG2A 3D2BA 4CIAA 1Q84A 3STYA 4BBZA 1ZI9A 3V1NA 4X95A 4J0CA 4EY6A 1U2EA 4KYVA 3NUZA 3G0CA 1BE0A 4FFWA 4XWGA 5AOBA 5DNVA 5D6OA 1CRLA 4CFSA 4HS9A 3I6YA 2GYWA 1DU4A 3WYNA 2HFKA 2VQ6A 3FLEA 3I2FA 4Y2QA 4KAJA 2AJDA 3WWDA 2B61A 2HFJA 3MUNA 4N5HX 2WTNA 5CT8A 4PW0A 1SCIA 2GYVA 4K6GA 1R9NA 1OXMA 3KWJA 3PF8A 4EY4A 3O4HA 3UUEA 3W04A 4U2BA 4AX4A 1WPRA 2C5FA 4UHEA 4UFNA 3WKEA 3HEAA 5AOAA 1LPPA 2WIJA 3FVRA 1VKHA 1XRNA 2WU3A 2FJ0A 2ZSIA 2QKYA 2HA2A 3ZPXA 5AKHA 3KSRA 3G9XA 1SC9A 1VZ3A 2ZJ6A 1WB5A 3FOBA 4H7FA 3WK4A 3N2ZB 2XUFA 4JYPA 5KBYA 5BWBA 3C8HA 4IH1A 3H1AA 5LLSA 4Z49A 5FV4A 5EIEA 1MX9A 6YASA 3BIXA 2JBWA 4HXGA 3FLBA 3IA2A 2YH2A 3JW8A 4DSAA 5AICA 1VJ5A 2W6CX 1MJ5A 1Q0ZA 4AMYA 4BP9A 1I6WA 3UMJA 1CUDA 5AKZA 5ALRA 3CCCA 1EVQA 1UFOA 5LIPA 2YYSA 2WJ6A 4MQLA 1J07A 2VJAA 3C8DA 3G02A 1MNAA 2CBGA 1X70A 3OG9A 5AI0A 1XQVA 3R41A 4M0MA 3SWWA 3A2LA 5AK4A 3H19A 4EBBA 5LZ8A 1MAAA 1ZJ5A 4LXGA 3W9BA 2O7RA 5K3FA 1ZI8A 3A2MA 4F21A 2C7BA 1YCDA 2JIDA 5I8PA 1FFAA 4GDMA 1HPLA 4BDSA 5D7BA 1JJIA 2J4CA 5CW2A 2XMDA 1CUAA 2FX5A 2QVBA 2HU5A 4K5QA 2HM7A 3PI6A 1Z68A 1T4MA 2WG2A 5A71A 1FFBA 1EH5A 4CG3A 4UBMA 3R3XA 3H18A 1B41A 2IITA 4QLAA 3I6ZA 4BRZA 1XZEA 1XZJA 4G1FA 3HC7A 1E8MA 3I2HA 1MN6A 3FBWA 3QM1A 2WFLB 1GXSA 4AO6A 2NW6A 1QIMA 3C43A 2WUEA 3FNBA 5FP0A 3I2JA 4OSEA 4BYMA 3FWHA 3LIPA 3ILSA 3HZOA 3FSGD 2VJDA 1YAHA 3GFFA 2ROQA 3TRDA 4LYEA 4U2GA 2ONCA 1UXOA 1XRRA 4J7AA 2RI6A 3WL8A 1XZDA 3WL7A 2HA7A 4MEBA 3BJMA 1CQWA 1EDEA 5DNWA 4RE5A 3QMWA 4B80A 3CN7A 4AZ3A 4MWTA 2WG1A 3AZPA 3DOIA 4M0EA 3FSGA 2OCKA 3PE6A 2H7CA 4DMHA 4UHDA 4DNFA 3W06A 4TVKA 1BCRA 5AM5A 1CUWA 4UBJA 1VXOA 3M83A 3LCRA 4ITVA 3V48A 3D7RA 5JAUA 1TQHA 3QH4A 1LBTA 1R3DA 2QR5A 5JADA 3WI7A 4B83A 2WJ3A 4UBKA 3DNMA 3O4JA 3F8SA 4P9NA 2WKWA 2GBFA 1UKCA 2DSNA 3TGLA 1SFRA 4JEIA 4JYMA 1EB9A 2WUFA 2DCMA 2H1IA 5YASA 2FJPA 2WILA 5T4HA 3R40A 2QXTA 4XJVA 1WB4A 5CT9A 3KWFA 3VVMA 4N5IX 4XIIA 4ZV7A 3VDXA 1XZMA 1ZGBA 5AOCA 1QIFA 4KE9A 1ZD5A 2BUBA 1R4ZA 5D3KA 3V1KA 2PPLA 4O08A 3PDCA 5ALMA 3HSSA 1QTRA 3C6XA 5LYYA 1GPNA 4WJLA 2BUCA 3G9TA 1TRHA 4G8CA 5LKRA 5K3EA 5E2IA 4DGQA 1XZLA 1MX5A 1K63A 1P0QA 1DWQA 1CUBA 2HRQA 2X5XA 3I2KA 1W4LA 1ZI6A 1AC5A 5A6VA 3ZV7A 3VKFA 3BXPA 4KE7A 1LGYA 5AKJA 4ETWA 3QPAA 1DINA 4YASA 3FVTA 1J1IA 3DJYA 1H22A 4KAFA 1XLUA 5JD4A 4OU4A 4JH0A 1EVEA 4CI9A 1YS1X 4FKBA 2WIFA 3BF8A 5DLPA 2LIPA 2OGZA 5ESRA 2OCIA 4LYDA 1W1IA 3C70A 3IVMA 2PU7A 1CLEA 3M3DA 2CKMA 5AIBA 3ANSA 2H7YA 4WY5A 4Y2JA 4Q3KA 5E4JA 4AQDA 4UFPA 4PV7A 1C4XA 5LP1A 4J03A 4E15A 5IH7A 4B82A 3WKCA 4FTWA 3O4GA 4P93A 5A7GA 2O7VA 1FFEA 1A88A 3HI4A 3ZLTA 5JAPA 4INZA 4EY7A 4Y2VA 4CCYB 4FWBA 4AMZA 4E46A 2OCLA 2YASA 1BEEA 3A2NA 2XMCA 1LPOA 3L1HA 3R3VA 2DHDA 2JEYA 2JGFA 4BZWA 2VAVA 1ACJA 1THTA 1LPMA 4W1QA 4DYHA 1H2YA 4ZWNA 1ETHA 5IVIA 3D59A 2CEKA 3G0IA 3O0DA 3P2MA 1CUXA 4J0IA 2GZSA 4EB0A 1VE6A 5IKXA 1CPYA 5HQ3B 5CBKA 1H23A 5A62A 1R50A 1LPBB 1C7JA 5EIAA 1K5PA 4DNPA 2XMSA 3BL8A 4AZ0A 4EZIA 1XZIA 4B81A 4AXBA 1AX9A 4DM7A 2WFMA 3SK0A 2EDCA 1QIKA 2XUDA 4TGLA 1VZ2A 1U65A 4OPMA 4V2IA 2XE4A 4H7KA 1EA5A 4DMCA 4Y2SA 1IUPA 2HU7A 2XUIA 3O95A 2WIKA 1CV2A 3CCBA 1MT3A 5JYCA 3F96A 3M81A 4L3WA 2HA3A 4YK7A 1PJAA 1TCBA 4UUQA 3EQ8A 2E3JA 2CUTA 3HACA 5JD6A 1VA5A 2XUAA 3B3QA 1MO2A 3DKKA 3TJMA 5FDFA 4HRXA 1G42A 1FSSA 4BVJA 4EHBA 2QUAA 3FAKA 3KXPA 1ZD2P 1TK3A 3AFIA 1GKLA 1XKLA 3RKSA 2I3DA 1LNSA 4M0FA 1R9MA 5LZ9A 1R88A 3OTQA 2RONA 2XUHA 3FYUB 3WZMA 3IULA 4U2DA 2G4LA 5AK5A 2Q0XA 3H17A 5ALWA 3ED1A 2CJPA 4PSDA 5FUMA 2RIPA 4N8SA 3G9ZA 5EGNA 1YASA 5ALOA 2Z5GA 3JYHA 5ALGA 1VOTA 2HA5A 1O6FA 4N8EA 1AUOA 1DT3A 1Y7HA 2C0QA 2HA0A 3DEAA 4G4IA 2XUOA 5AKXA 1QIDA 1MX1A 5EHXA 3C5VA 1QIHA 2ZJFA 5HKAA 1XROA 2RHWA 1CUHA 3ICVA 5AKIA 5LZ7A 2CMFA 3E3AA 3ZLVA 4TPKA 1UKAA 5HF5A 4G4GA 5HK9A 3AJAA 1HL7A 5IVKA 1JU4A 4WDRA 1QZ3A 2PX6A 4FMPA 1EINA 1TCCA 5AH0A 1EK1A 1K4YA 5AI5A 3FLAA 1PFQA 5AJHA 4DMFA 3YASA 1VA4A 4QNNA 5EFZA 3CXUA 3WYDA 4K2AA 5DTIA 1QE3A 2Y2VA 3LLCA 1XRMA 2Z8XA 3H2JA 4KRXA 3C45A 3MUOA 4GXNA 4FBMA 5HK8A 1CUGA 3AZQA 4RE6A 3MGAA 3R3UA 4OU5A 1BN7A 1BCSA 1XLVA 1ZICA 4IH9A 4BCDA 5K5EA 4Y2PA 2J3QA 2GYUA 5E4TA 4BE9A 1L7QA 4HXFB 2Z3WA 4FNMA 2ZYHA 3D0KA 3STTA 3I1IA 5DWDA 1DQZA 2JEZA 2XB6A 3GELA 5ISMA 2WTMA 5C8ZA 2JGMA 3VISA 2ZVDA 4X85A 3HRHA 4X00A 3EBLA 1WHSA 4QDTA 4J0HA 3G8YA 1NX9A 3LIIA 5AM3A 4PNZA 5ALFA 2XQGA 1CUIA 1KU0A 2WSLA 4CG1A 3ZLUA 4LXIA 1WCYA 2ZSHA 3VXKA 3DL7A 1K6EA 4NZZA 2WIGA 5LKAA 1TKRA 5SYNA 4AO8A 5K3FB 2O2GA 4KAAA 2WG0A 3DYVA 2JGJA 1FFDA 3GA7A 3WZLA 1T2NA 1EHYA 1CUEA 3GZJA 1MAHA 4BRSA 3DOHA 3R3YA 4X94A 2WFZA 3ANTA 3WJ1A 4YX9A 4LIPD 3IUMA 2P8SA 4BVKA 2QRUA 3R0VA 1XFDA 2DQYA 3I2GA 1SCQA 1CR6A 1UT6A 1VLQA 3AUKA 1VE7A 3L1JA 1JT2A 4F0JA 2HA4A 4I4CA 3STWA 3H0CA 4L9AA 3D2AA 3FCXA 2QT9A 3WJ2A 2OAGA 5AKKA 3S2ZA 4H7EA 1U8EA 4LHEA 5JAOA 2OAEA 1CUVA 2PSHA 2ZYIA 4WFJA 5AKYA 1ZIYA 3KD2A 3OURA 4BP8A 4GHWA 2ZYSA 4UHFA 4OUKX 1ORWA 1CIJA 1HKHA 3E0XA 3DYIA 3QMVA 1Y7IA 4Y9SA 2XI4A 1W6RA 3WWEA 1HQDA 3QVMA 5BV7A 4HXEB 4U2CA 4OCZA 1AZWA 3F97A 4AN1A 4Y2XA 4X97A 5CURA 2WHRA 3IB3A 2HL6A 1A8UA 2JGLA 4BB0A 1ODSA 4HVTA 4QZVA 1YR2A 2Z8ZA 1IZ8A 2EDAA 3WL5A 2I78A 3NOXA 1XZKA 3A70A 5AKLA 1UKBA 4H7DA 4G9EA 4HAIA 3OC0A 5HKBA 4Y2TA 5K3AA 1R1DA 5BOVA 1JMKC 3V1MA 5HZGA 1ZOIA 3IBTA 1ZIXA 1L7AA 5CH3A 2PSDA 2HADA 1ORVA 1OILA 3NWOA 2O2IA 3VJMA 3WK8A 3V9AA 3KOOA 4QDUA 2BGNA 4UHCA 5ALDA 1KU6A 5AI8A 4F60A 3IUJA 2V98A 5AK6A 4ZRDA 3I2IA 2PUHA 1XQXA 3WKDA 5IVHA 4Q3LA 4ARBA 1TCAA 5EHZA 3WWPA 2C4HA 2BFNA 2PVSA 2HDWA 2VA9A 2GBCA 5LZ5A 2AJLI 1WB6A 4U2EA 3R3ZA 2QS9A 3OPMA 1K8QA 1DWPA 1ZJ4A 1BEZA 4WDQA 2ACKA 2J4FA 2PM8A 4BCCA 5CT4A 1THGA 1HDEA 5ALZA 3WK5A 3SX4A 2VATA 1IUOA 4ZV9A 3Q8WA 3PFCA 3DS8A 1CUUA 4H7JA 1XRLA 2DHEA 4H77A 4A23A 2VSQA 2FUKA 4MQMA 2QXUA 5ALQA 4BAZA 2OXEA 4WY8A 1BROA 4J0DA 2XDWA 4B9AA 2AJBA 3WQHA 2QJRA 4FLFA 1D07A 3G0BA 1CEXA 1XQYA 1UK7A 2R8BA 4Y2YA 1QFMA 2VF2A 4AO7A 5JATA 1JJBA 2XQFA 4NVRA 2CZQA 4IO0A 2WHQA 3AZOA 1F0PA 3WIOA 3FCYA 1XZAA 3K6KA 2WUDA 3RARA 2GBGA 4G8DA 4W9RA 5T4FA 3N0TA 2OPHA 4F5ZA 5ALSA 4H18A 5AM1A 2XUKA 5ALTA 5ALVA 4Q34A 4E11A 4C87A 2WHPA 4AB1A 1GKKA 4BC0A 1GPLA 3HYSA 4H7IA 3PUIA 1UK6A 5K3BA 4B0PA 4BDTA 5AM0A 5AM2A 2OG1A 5CRIA 4RNCA 3ZWQA 3WK6A 2OLEA 3STUA 1J06A 2YXPX 2OGSA 4XVCA 3VJLA 2H9YA 4BVLA 3Q0TA 1CUZA 4Q3OA 5SYMA 5LZ2A 4JUIA 3OOSA 5HF9A 1N5MA 3FYTA 4C4YA 4X91A 3K2IA 3WA7A 4CCYA 5DYYA 2WQZA 1IZ7A 2W22A 3DD5A 4X6YA 1A8QA 2OCGA 3W2TA 2DHCA 5FXMA 5DYTA 2XQIA 1ACLA 3WIBA 3UUFA 1XZCA 3L1IA 1XZHA 4BAGA 1XLWA 1Y37A 3PFBA 4MJ3A 4WCVA 5D3ZA 4KEAA 3QPCA 4WFIA 1JJFA 5FRDA 3RK4A 5J3JA 3IUNA 1XZGA 1YA8A 3WKBA 1AKNA 4X6UA 1XZBA 5E4YA 1E66A 2HHAA 3D5EA 5JANA 2G5TA 4RPCA 4KACA 2QM0A 4KRYA 5AHXA 4G8BA 4UPDA 5ALEA 2OQVA 1AQLA 3GROA 2BCEA 3EIOA 4EA6A 3H04A 4CIBA 4I3FA 3WK7A 5EHNA 2RAUA 2XT0A 1DT5A 4UBLA 1TIBA 4I19A 4G5XA 3QBJA 2C58A 4DIUA 4E14A 3QMMA 2ORYA 1H2WA 1QIEA 1X2EA 1IUNA 1QIGA 4OB8A 4OYLA 5IVDA 4MXDA 3H2HA 4LXHA 5DJ5A 4QWMA 1BS9A 1N8SA 4FLEA 2ECFA 1ZGCA 1M33A 1E5TA 4EY5A 2QMQA 4PSCA 4C4XA 1QIIA 4ZXFA 5ALYA 3PICA 5FOQA 4P92A 1DWOA 3T4UA 2AJCA 4WFKA 4UFOA 5AKGA 1LPNA 4A16A 4BE4A 5LZ4A 1ODTC 3G9UA 3AINA 4KJXA 1FJ2A 3ZI7A 4H0CA 1FFCA 1F8UA 1QFSA 3EQ9A 3LP5A 3STXA 4QDZA 2GBIA 3FYUA 3NGMA 5ALJA 5ALKA 5ALUA 1XZFA 4G9GA 2HU8A 1UOQA 3H2GA 5KWJA 1E3QA 3BDVA 1YS2X 3DKRA 1QO9A 5ALLA 1GQRA 3ESDA 5I7UA 2AXEA 5AI4A 4BC1A 4A5SA 4UHHA 1F0NA 1KEZA 3SC2A 5A7HA 3W05A 5CTAA 1LLFA 2B9VA 1P0PA 3IDAA 4GEGA 1RWQA 4AN0A 4L72A 5C7YA 1QTIA 5JALA 4FDMA 1ZD3A 1EX9A 4NMWA 4Y2UA 4GLBA 3B12A 1HBJA 2J3DA 3AILA 5CXXA 1SOMA 2XUGA 2HIHA 3DL4A 4OD0A 2PKYX 1UK9A 4Y7DA 2PSFA 1G4HA 4BTLA 2WIDA 1GQSA 1CFJA 3C6YA 3W9UA 1XQWA 1DX6A 2C5GA 3TEJA 4DSZA 2B20A 2RGUA 2VEOA 2JGEA 1LZLA 3GUUA 5K3DA 5CMLA 4MYSA 4FHZA 4BZZA 5H3HA 4ZI5A 5AK3A 1U4NA 1USWA 3AIKA 2JGKA 4EY8A 2D5LA 3BJRA 3C6ZA 1LBSA 3G7NA 1QJ4A 1JI3A 4QA9A 3G0DA 3BF7A 1BN6A 3T52A 1A7UA 3WWCA 3DCNA 3VJKA 2WJ4A 2G5PA 2I03A 3ESBA 2XMBA 4QLOA 3BDIA 1WHTA 2V96A 2QJWA 3H2IA 1LZKA 4BATA 4H7HA 3FYUC 1AMNA 2JF0A 2PL5A 1LPAB 2XMZA 1NU8A 3PUHA 1QLWA 2WU4A 4ZGBA 3EF3A 3I6MA 4QEKA 2JGIA 3I28A 3CN9A 1BRTA 4UBNA 4DMKA 1VXRA 5CXUA 4B6GA 2H7XA 3M82A 1ISPA 4IHAA 2XQJA 2QOEA 4PF1A 4Q82A 3JWEA 4K6KA 3X3HA 4LKOA 1YAJA 2DFPA 2ZJ7A 1EB8A 2XUPA 4EUSA 1WOMA 1E89A 1BU8A 2ACEA 2XMGA 1UWCA 5FLKA 1X2BA 1LPSA 4X7BA 5JIBA 3F67A 3D3NA 4UBOA 5FKJA 2XUQA 3BWXA 3ESAA 4XX1A 2VT7A 4CCWA 5AO9A 4C89A 2WFLA 1CUFA 1ODCA 3DLTA 1YA4A 2WUGA 3RLIA 4J0KA
chains in the Genus database with same CATH superfamily
1P4SA 2VHVA 4QVKA 4AKGA 3EPRA 4LK3A 1J25A 2QYOA 1DKUA 3CNOA 1S5PA 4TMVA 1IBMB 2VYVA 2A9RA 2AWNA 3TZLA 4EHLA 1Q11A 1XTBA 4XGQA 2PWBA 2ZWVA 3UY4A 8OHMA 3ZVMA 3RTGA 3L7AA 4YCDA 2IIVA 1ODFA 2F64A 2R1TB 3JPYA 4R54A 1S8FA 1PYDA 4BMXA 1UM9B 3RAPR 1TK9A 3RFFA 4F4DA 3SGLA 1H3EA 1FDVA 1HE5A 2XTZA 1GFSA 3EVEA 1NOKA 3KOYA 4H0FA 4BLOA 1GPBA 5FPHA 4MRMB 5BPFA 1SHZA 4TZ0A 4LOHA 4OI2A 4EDHA 5AVJA 2FQQA 4FYMA 4YO8A 1J39A 1HDOA 4F3RA 4F8EA 4ZAWA 4O4LA 1UOEA 2G63A 5J63A 4B48A 4D81A 4ESEA 2X1HA 3SSOA 1X0VA 1WCIA 1RJWA 1UK8A 3G9QA 4N5DA 4RPKA 3LPDA 2RG7A 2ZTHA 4Z0NA 4ZV4A 1QHIA 1IVYA 1MA3A 1P4JA 4B0OA 5BRAA 2NSYA 4MUAA 4RA9B 3ESCA 3IILA 3VR0A 1G1AA 1YJBA 1A4IA 5BR1A 5FI1B 3D9QX 1QF9A 3TEMA 1E2QA 2QLFA 3I0NA 2HMUA 2X41A 2YHIB 4QGFA 4BO2A 1NVKA 1EUDB 1GGNA 1TQ6A 1U1GA 1JRLA 1I3OA 2VJBA 3SEFA 4QDOA 1HXHA 1WUHS 3UJ9A 1U0JA 1ITZA 2FPPA 1L7MA 1N5RA 2IUEA 5AHWA 1MIHA 3SD7A 2DHRA 3WOVA 1J0DA 1LBEA 2WWIA 3DMTC 3QTLA 2AF4C 3TIGA 2OZLB 3OX2A 1JFRA 4DREA 2FOXA 4EI9A 1FZTA 4GC9A 1EX1A 4OHBA 4ZARA 3ZCPA 5B6PA 1R0KA 5AW8A 3F8TA 3BD6A 2QLJA 3DJFA 3CR7A 3OPYI 4TTSA 4OJTA 4M21A 2Q7OE 3DLCA 4B7UA 4JWKA 4JBNA 4K88A 5B36A 1XU4A 4IPTA 4IIHA 2GXUA 2ZVQX 3AEKB 3A6JA 3L0YA 4DM4A 3FFWA 2F9LA 3H2KA 4OTZA 3OIUA 3E6AA 3KZXA 3MC1A 2XZTA 5C32A 3R9XB 4ZP1A 3SBXA 5EJ7A 2AEFA 3CXRA 5IBCA 3P7MA 1E6KA 1CX9B 4Z2YA 3WBKA 5KVCA 5LSAA 2UZ4A 1KEVA 3R1IA 3K96A 1JYSA 2VT2A 1KQNA 1DC4A 2QUBA 2TS1A 4X64B 1JNXX 1P1IA 2V9PA 4K6FA 5LYJB 1BXKA 4X24A 1H2FA 1DHTA 1ID1A 1KI6A 3K2QA 3T7DA 4ZO6A 2HHCA 3TUZC 1XKTA 3CSSA 3OQJA 4MWCA 1H1LA 2O48X 3A4NA 4ZYWA 1Z8NA 4S12A 1RC0A 5DI3B 2JIBA 1NNLA 1UC8A 1YVRA 3L0IB 4M8KA 2EJUA 4HDOB 4MR8A 1NYLA 3GAMA 4I2NA 3ZH2A 1QVRA 3U4GA 4BY9E 2A1TR 2YHUA 1JKMA 3CKMA 5EI5A 4FYWA 4RPIA 3BIWA 2HU2A 1ZKDA 2BM1A 2A9PA 2YYAA 3T35A 2QD3A 3DDWA 3RCBA 1E94E 3A1CA 2PT7A 3UVEA 5SYAA 4BQIA 1QG0A 1SZPA 4OXQA 2AKEA 1PJBA 3KHTA 1W30A 3LHKA 3LYHA 2FSSA 3FUTA 3K0FB 5CYPA 5AKEA 2BFMA 5K8TA 2GOYA 3L8EA 1NOJA 4GOOD 1GGVA 3M1AA 1GPWB 5HCUA 1U94A 3IXQA 1W76A 2FCAA 2WU8A 4XJXA 1Z5GA 3RUPA 4F1WA 1H1DA 1JKXA 3B85A 2Q9UA 5BRNA 1ZHHA 1OWMA 2QZPA 4ZJZA 4BXOB 4FCVA 2PZFA 1BMTA 4IICA 1IZZA 4X92A 4W7HA 5KTSA 4GW3A 3LCCA 5I9IA 2DT8A 1OX6A 2YMMA 2AE2A 1GN9A 5COAA 2AXPA 3O8OB 4WUVA 5DM0A 1FEZA 1RYHA 3FDIA 4YJHA 1BKSB 1Y42X 3EIWA 1SWVA 4JX8A 3OZBA 2O3UA 3N2LA 1MEEA 1P7ZA 1YS7A 2ZGVA 4DCUA 3R4VA 2IF2A 3FWNA 1RIIA 1S8OA 4R1LA 2BISA 4N12A 4NL4H 2YMQA 5IAGA 3KZCA 4JLWA 4P3PA 1EYZA 3DR5A 2G70A 3EAFA 5L6MB 3KOUA 3D0QA 5FI5A 2VP2A 4JI6B 1PFVA 3TW6A 3NVKI 1GAQA 2OD9A 2ZYRA 5DYGA 4XIYA 2OYCA 2RGEA 3Q7EA 4QXOA 2DJIA 5KTNA 4TL7A 1MGPA 1T1IA 1W52X 1EVZA 3RTAA 1GGJA 2QROA 2PJUA 3GMDA 3ORYA 1E58A 4OBWA 1MC1A 2QV0A 1VIDA 1X7ZB 3GEEA 4JYBA 4OHUA 1SUCA 3IHWA 4B7XA 1CVIA 5JS7A 5CIYA 4LF5B 3AL0C 1T8TA 4S1PA 4BVFA 1L7RA 2QI9F 3L01A 3OLZA 2DTXA 1QK3A 1IHDA 4ER6A 2QE6A 3IAFA 1I2DA 4YRRA 2J7PD 1ZGAA 4PO3X 4FCCA 4ROTA 3SXUB 4LVCA 4K9MA 1DCFA 3SJUA 4ZHQB 3DQZA 2OXIA 2HGZA 1EDBA 2O1EA 5K0LA 1XU9A 3TN7A 2XITA 1I4DD 2BEKA 5LQCA 1ZHOA 1WUKS 2DR0A 2NACA 3FMFA 2XOKD 4Q3CA 1XWWA 5CYFA 1Y63A 1HFEL 3GG2A 9GPBA 1XQ9A 3O31A 4EMUA 3ND7A 1NDQA 1UBNA 4E6EA 1V16B 4FDAA 3K2BA 3G8AA 3MZ0A 2WJIA 1OT5A 5TPZD 1OI7A 4KKXB 1OC4A 3UENA 4B85A 3EQ7A 1KYWA 1QLHA 2XDQA 3NUGA 3P0HA 4IDQA 1KJQA 2JLZA 3KVYA 5C8XA 2BUAA 5HE8A 2QPOA 1LK0A 2Y1KA 4MRRA 4OHXA 5H5JA 1VG0B 4JXZA 3HV0A 4MWEA 2HAEA 4KIWA 3QA9A 4IIJF 2V7EA 3IP3A 1OGJA 1P2VA 3TTUA 5M5BA 2J7PA 2ZU6A 4Q16A 3QKRA 2WZBA 5K45A 4N6OA 2GBLA 4KIUA 1SKQA 1GUYA 3KDAA 1IJEA 5GVSA 2M32A 3L1KA 2QTWB 5T57A 1TVCA 4NICA 3QPDA 2XOKA 3TMKA 3TTWA 1NFRA 4QE3A 3HKCA 1PT9A 4J07A 2H8KA 4Y2HA 1KXZA 3IHTA 2HSJA 2QUIA 3NDPA 2JCVA 3B38A 4QTZA 4HR7A 1BD4A 2C3YA 3JY6A 5TPZA 3H2ZA 2VP3A 2D4HA 3D7KA 1FMFA 4UHBA 2GSWA 2NXEA 5EQTA 3UMSA 5KVQA 1PKXA 2Z1DA 3ZWPA 4KR0A 2QBYB 4NDNE 2IZ0A 4IIGA 5K0NA 4OYHA 3LZ6A 3B70A 1II0A 1ZL0A 1MC5A 3D4LA 1DFGA 1M34A 3GLHB 1OI3A 5EHIA 2B7BA 2CHGA 4IP0A 4DIDA 1XYVA 3SQXA 1QS0A 4UBIA 4J0GA 2G28A 3OM8A 3UNXA 1ENPA 1G2OA 4REQB 1R4NB 2PD3A 5G1NA 3RTBA 1FE8A 3T06B 1HEYA 1QYDA 3K7EA 2E82A 4XB6B 3UQYS 1YJAA 4G0NA 1TJ3A 1FFYA 4ZMRA 1Y9AA 4YAGA 3IQXA 1CUYA 3GJ8A 4GE0A 1U9JA 1OAOA 1OUMA 3TLGB 5BXQC 4HDMA 2QLTA 4LJSA 9ATCA 2G04A 4V39A 4UJ3A 1CJBA 3T15A 2RSLA 1Z7WA 2UZ1A 4O2BF 4DLNA 3FGPA 5KTRA 5TJ9A 5GZ6A 2H2WA 1MJHA 1VGRA 2A9JA 1MPXA 2IP4A 1IHYA 5GPBA 1GUZA 4Q4HA 2R6R1 1CQZA 5ARBA 2I6XA 3VVLA 3WLIA 3UK6A 4EA8A 3NV9A 1B15A 1Q1GA 2V9ZA 3EK2A 3M9WA 4XDHA 5H3LA 1Z4OA 2HXSA 4G36A 3ZKWB 4N8DA 3C98A 4L5CA 3QJYA 4GX0A 3HJUA 2JKZA 1A4RA 4CKWA 3RKUA 2ZRMA 3H11B 3M6XA 3BFJA 3IKLA 4IIJA 4RSMA 3WLAA 4DYDA 2O20A 1P0MA 4M36A 4IVPA 3WGTA 2UUAB 4RLHA 4PYMA 3ZDRA 2I65A 1EI9A 1FP4A 2PX0A 5FWAA 5HG0A 1QTQA 2XHZA 4L50A 5IJ0B 1NVXQ 1U7ZA 1XVLA 3RE1A 3RRBA 3UCXA 3QE0A 3EUWA 1RKUA 1Z5NA 3BRWD 4DIOA 4N41A 1DAHA 5A3SA 5I8WA 1NRWA 4TL8A 1AURA 4Q1AA 4A0SA 2AFHA 2PRJA 3FRJA 1GT6A 3VDRA 3ZDEA 1RJDA 3NCTA 1IN4A 1YS6A 4Q1VA 1QCCA 2PA0A 4GVLA 2Q9CA 1IMJA 1HYQA 1CF2O 4Y8VA 3DHNA 2VT6A 3X43A 2UYYA 3B3FA 5TS3A 2Y6UA 3GLIE 3THYA 1NDHA 4BCBA 1E3WA 3STVA 1LV8A 4DEXA 4L8WB 5DIZA 1TJPB 3VR3A 2Y67A 2Q9BA 5HXAA 4K7JA 5LD2C 5ELXA 4YIHA 3VHXB 4N01A 1LJ8A 3OCZA 1E6MA 1V39A 4HYTA 5DXAA 5ERGB 1Y6GA 1D8AA 5J58A 1JDBC 2HRRA 3C6BA 2B1IA 3D2CA 3LS2A 2YRFA 3I8XA 1OX5A 3F4BA 3TZHA 2R7NA 1XZQA 4E5MA 4GSKA 2QPTA 3IQFA 3UC5A 3BRWA 3FSRA 2R6AA 5IMBA 2FW9A 3DYBA 2YFYA 2HT1A 2KX7A 1NPDA 4JK3A 3B7GA 3UJCA 4HAWA 221PA 3FIJA 4D8WA 1BW9A 3A6DA 1ZD4A 3HV2A 1SCJA 2OHHA 5AVYA 2O8CB 2XZLA 5AJWA 2Q2VA 2X4IA 5KHAA 2XKBA 4LHXA 1TI7A 4O2BA 3KBBA 3PF9A 2XJ4A 4R83A 2GZRA 3L0ZA 1JIIA 1LX6A 1TU4A 1ZW6A 4BP1A 5F1YA 5HQJA 2YBDA 3E0QA 4JV5B 3QVGB 3RADC 1BVHA 3I1YA 3ZDCA 4OH7A 1QRUA 4QYIB 3AKYA 1HT3A 1JQBA 1Q0PA 1KKLA 1G55A 1JAIA 1VI5A 2AKAB 4FOOA 4IX1A 3OZTA 4X6XA 4B8ZA 5LBIA 4W1PA 4ENSA 1NU6A 4L7VA 5HIKA 1NYTA 2DFLA 1SG0A 2P7IA 1KL7A 3D7MA 3RV3A 3EXG2 4RFVA 5BMOA 5DWVA 1O58A 1FXSA 5JDIA 4P0QB 4EJFA 4RK4A 2OCYC 2XMRA 3HFJA 5AP9A 5C2JB 4MV9A 1E6LA 3FZQA 2OQIA 4J1NA 4LCEA 1JQEA 2UV8A 5KOIA 4HDQB 1C2YA 3AERB 4CIAA 1PVOA 1YUNA 1HOXA 4MPPA 1E62A 4NOMA 1BVRA 5IK2A 1ZI9A 2IGBA 2LCQA 3V4LA 4BBZA 4AULA 3C5CA 2YIVX 2IZOA 3Q3HA 2YZKA 2NG1A 2MMCA 3EDOA 4LE1A 5DGIA 4J0CA 5F2KA 3T38A 4G6ZA 4DCVA 3WGOA 5GIPE 1U2EA 3VU9A 3G0CA 2Q1UA 1E2GA 1BE0A 2CXUA 4HFMA 4I55F 4IDNA 4IQGA 4K3UA 4YGYA 4FFWA 1NGSA 2KB0A 1KNXA 2JFXA 5AOBA 5GTDA 3H8JA 1N33B 1KBZA 1OA0A 4LMBA 4W7SA 5CTJA 1H2EA 4RHYA 2C9BA 4E3ZA 2ZVPX 1P18A 2B7CA 4N0MA 4RBNA 2AK2A 2XGGA 3LUFA 2PZLA 3TEFA 4EQ6A 3OH8A 4IXWA 2VQ6A 2Z4SA 4OOFA 4YMSA 4O2AB 3LH5A 4Y2QA 4KAJA 1RHRA 2BFWA 1TFUA 3L8YA 4MO9A 4BNLA 2A92A 4YQYA 3E9MA 1X1AA 2DC1A 1M5TA 4UJ5A 3RUDA 5KEIA 1KAGA 1IY0A 2VHUA 4JU8A 2G17A 4KZKA 1AVTA 2I1VB 2HH9A 5D1HA 5CDUA 4DDHA 4XJTA 4N5HX 2WTNA 3C3PA 5CT8A 1D1SA 1Z0FA 3CX6A 3TBFA 5BVHA 3CINA 3GRVA 2V45A 2JBAB 1LDNA 4JL8A 1V37A 4WESA 2OSBA 1I3NA 1XEWX 3D02A 3HUUA 2EKQA 3FUWA 1P7VA 4K6GA 2C8JA 1R9NA 2P3SA 4MWGA 4TTPA 2PUVA 4F3KA 1OXMA 2AG0A 3ZIDA 5CVTA 3E5RA 3KWJA 5EXTA 4OQEA 2EJBA 2YQ5A 4EY4A 4MUKA 1Y89A 4CKZA 1JFTA 3VPGA 3K4HA 4JQOA 1KO4A 2YZGA 5HIAA 4G5HA 1GV0A 4NZMA 1JYFA 3BFVA 3N8GA 3VOBA 1KIMA 5LIRA 1A5BB 1Y6ZA 1H2BA 3L0PA 4P82A 5SV2A 1IOLA 1DDOA 2IY7A 1SELA 2GWRA 1NF8A 4UFNA 3BWMA 2CB0A 1DG1G 2WRZA 4HQOA 5GV8A 4DLSA 3WGJA 4BMOB 3U1BA 1VKHA 1XRNA 3H5OA 2HUPA 5T64A 5KOJA 2W93A 3LUCA 3HY6A 3WLPA 1I8TA 2WPDD 5KQSA 2OVBA 3KSRA 3C2QA 2GCEA 3C3AA 3IMGA 1ECJA 4KXXA 2QTNA 3KWMA 1RM5A 4Z4QA 1QYXA 3CJTA 3TCNA 4GKVA 3ADPA 4MMXB 4WXMA 3OD1A 3G1TA 2AYXA 1QUEA 4FINA 2C3OA 4IH1A 3PGMA 4ND2A 4I55A 1JG3A 4Z49A 4G4SP 1CF4A 2ZB4A 1FX0B 3KYBA 1CT9A 3OLVA 3DHVA 5KTOA 3L4BA 1K2VN 2GLUA 2FSPA 2NVWA 2JGAA 1SU7A 3BZBA 3AX6A 3CCFA 3T3EA 4HXGA 1W0KA 2QSZA 3CYFA 3D4IA 3FLBA 3IA2A 4M0LA 4PZYA 4YALA 2PXXA 5DHUA 4BUZA 1ZM9A 1T2FA 1DPFA 1JG1A 1RXSA 4EB6B 1JFFA 4O4HF 3FDJA 2JGNA 3GRZA 3GIDA 4HGPA 2WPDA 3ENQA 3L7KA 3QEJA 1ZUNB 3D31A 3F7MA 3IP1A 3UHPA 2R1VA 3HO8A 4D2IA 3HGTA 1SBIA 1EVQA 1H9AA 1T91A 3PHJA 1YOVB 3HFRA 4R8KA 3TOZA 2QRHA 2X0RA 4QFBA 4BLUA 3LRXA 1UPCA 2H4JA 3E81A 4FT2A 2OILA 1G6Q1 4FUQA 2H51A 3OJLA 2AB0A 1TKBA 1X8LA 1YKGA 4JT4A 4MMYB 1Y1TA 2WAOA 3BE6A 2F8MA 5KJEA 3TRFA 1ZA2A 1DEOA 4E1VA 2W70A 1X70A 1FS5A 1W4RA 2CZCA 4Y6PA 5JS2A 3ZBTA 4EJSA 4KXQA 3EPLA 3CX4A 1QH9A 3R41A 4H16A 3GPDG 3C5EA 4GIBA 2ZUTA 2J0SA 1KO7A 3ZQKA 2DPXA 4DV7B 3HDHA 3E3NA 5BRJA 1GFWA 3H19A 3ZD8A 2Q5JA 4EBBA 2YVQA 4EFNA 2EHJA 3B6IA 4F2GA 1CS0B 1YCFA 1I1HA 2X9VA 4YMTA 3W9BA 5BMVB 2IT1A 4LF8B 2O7RA 4MRSA 3NIWA 3PXEA 3A2MA 4NECA 5K3FA 3RUEA 4DYVA 2WMNB 3RSFA 5CVEA 4F21A 1FS6A 5JY6A 4GF5A 4F3TA 4IMPA 3HPRA 1E3SA 1HPLA 1PGJA 1XA4A 3O3NB 5D7BA 3R5HA 3P20A 1JJIA 1RKQA 4TSRA 3K6SB 2CV2A 1WU7A 4B35A 4AVYA 2OBLA 1KMNA 1CUAA 4HDKA 2Q2WA 4REOA 3SVTA 4U7DA 3KVVA 3C48A 4R8LA 4O5AA 5U9CA 1JAZA 2OWEA 4DR7B 3ZYZA 3H1EA 3KL2A 2PLNA 5JO0A 1J23A 4IEFB 1HMPA 1T4MA 1GRQA 1K0UA 5EP4A 1Z0JA 1FFBA 3MMXA 3IKTA 1N8TA 2AYYA 2JLQA 2RJ3A 3AOGA 4BO8A 4XX0B 2JCBA 3N3BC 1SUIA 4UBMA 4CG3A 5DBFA 3BA1A 4F38A 1CW2B 4TTTS 5CCEA 2HPAA 1EFRD 4LJ7A 3SEZA 1ECBA 2A78A 4PSAA 4MRPA 2IITA 1L4KA 3I6ZA 4D5GA 3R74A 1ZGHA 5BR7A 2H5JA 4O4HA 1YR8A 4IRMA 4TQ9A 2VG8A 1NMZA 1ZW1A 3KYJB 5DLQC 5DO9A 2QR2A 4YAUA 3CEPB 3PV0A 1AQJA 3SZLA 1Y82A 1YFZA 1KK1A 1MN6A 3EBOA 4ZC8A 4UE2A 3K70D 4I6EA 4NOKA 3CQ9A 1GXSA 1ZZEA 3HWSA 2AZMA 4LK2A 1GA1A 1MDBA 1I4WA 4IIDA 3C43A 1KFCB 2ZCUA 1JIUA 1GR0A 1N2BA 2JJYA 3FWHA 5JO9A 1GWNA 3HA3A 1G21B 1J0EA 4LA4A 2W6OA 4Q01A 3W1EA 2UUCB 5FTJA 3H1TA 1WZCA 1YAHA 2XDYA 3OF2A 4M0DA 2C2ZA 4JMPA 4R1OA 3PBKA 2UYGA 4LMRA 5C53B 4AJ4A 1EFRA 2BGLA 2ROQA 3GR6A 4EJ2A 3GJQA 2ISSD 2P27A 3QP9A 2SKDA 1PR6A 2LKCA 1DQRA 1GIAA 4U2GA 5TQJA 1XRRA 4KUGA 2GUGA 2RI6A 3S7TA 4WKOA 1R0YA 1TAQA 2HRCA 3ER9A 3G6WA 3MWFA 4CR8A 4DY4A 4EG6A 2FZ4A 3BJIC 5CVVA 4CRWB 3IOCA 3Q9NA 2JLAA 4TWJA 5KHOC 2OCPA 4ZAZA 2E6KA 3A9CA 3QMWA 1P1JA 4E2YA 4MRNA 3EMDA 5ENVA 2EBHX 2W11A 1PLKA 2WG1A 1S9HA 2GRUA 2CFOA 3DOIA 5I9BA 4M0EA 3TIXB 5FFMA 3SIPA 3PVCA 3CIOA 4ZIRB 5JHHB 1HG1A 4IIFA 1JDZA 3T4XA 3VDNB 3RIMA 4OI4A 3CNBA 2H7CA 1QH8A 1Y1KE 4UHDA 3T9EA 2YV3A 5D1NA 3VPXA 1I01A 3W06A 3W5JA 4UM7A 2HK6A 5EINA 3NTQA 2PJDA 2PMBA 4OMUA 3BXZA 4OM8A 1TM7E 1AE1A 4GR9A 2BELA 4D46A 1PQYA 1BDJA 3DZCA 1D0VA 3PDHA 2TMKA 1YFLA 1B14A 3IAM1 1EX6A 3KHKA 4BBPA 3FUCA 3R4CA 4MDFA 4ODIA 5BT9A 4B2IA 1Q1AA 3MJCA 1UKZA 2L69A 1II8B 2BGKA 4QG7A 3VA7A 1TQHA 3ICQB 4EVIA 4UCQA 3WC4A 4C1NA 3EQ2A 4GUDA 1ADBA 1DNPA 4YDSA 2DYKA 1YS9A 3OT1A 1QAOA 3OZCA 4HN2A 5KSPA 3AM1A 2WJ3A 4UBKA 4DY6A 1QFZA 5BUZA 4HUJA 2XA2A 3L8GA 4R6WA 1EAMA 3O4JA 5EXDA 4B3MB 5ECWA 5DHRA 1KJZA 3SG0A 3DHYA 3RIGA 1RPNA 1A50B 2GBFA 3WLSA 1UKCA 4BGVA 3Q8XB 4WK0B 1IB0A 3U3OA 3RS4A 2XCOA 2IYXA 4EL5A 1JWLA 3KM0A 1KZ4A 4WH0A 2IS4A 3SF8B 5K4GA 3FMPB 4MHOA 3W9YA 4A10A 3UCFA 4X62B 2O8EB 4M8NE 1M6NA 1EB9A 4J2OA 4HLUA 5AVKA 3L8MA 4JXJA 3BKWA 5T4HA 3NHSA 1ENOA 4LPSA 3R40A 1OOEA 2FI1A 2X4LA 5EJGA 1ZMXA 3KWFA 3K1AA 4BFWA 4YQFA 4Z1MD 1FRVA 1S0UA 4GRIA 4MGHA 5IPFA 4C14A 3JQGA 4BE7B 3DEIA 4TSFD 3TUIC 4C7XA 4JLDA 1BDBA 5AOCA 4KE9A 2BUBA 3F5MA 3BZWA 4FFPA 1R4ZA 3AM4A 2R84A 4B6FA 4IV8A 4JOCA 5D3KA 5G0WA 4A6DA 4EOGA 3COWA 2JI7A 3E5MA 3LLVA 1JR6A 3WVNA 4DMUB 4ZN6A 1NI4B 2PPLA 3PHHA 1Z56C 2KWIA 5DHPA 1XE3A 3INRA 4O08A 3MMNA 3PEYA 3V6MA 3C6XA 3V9PA 2P6UA 1W88A 4F93B 2VPWA 3CO0S 4NXNB 3I62A 4IDEA 3FG9A 2J5BA 4PZDA 4X8HA 3SXJA 2BUCA 4ZYUA 4M98A 1SQ5A 1OXTA 3ELUA 3TL3A 1N2CA 4IFTA 5E2IA 4ABTA 3D4BA 4RPHA 4Z1MA 1WQ4A 5DRTA 5SZHB 1Z7YA 1MX5A 2IVFA 3JRWA 1K63A 1IY1A 1P0QA 3L92A 3DLAA 2HRZA 2ILTA 3NYRA 1TYZA 4TSFA 3T41A 5C8YF 1JVBA 1CDOA 4PHCA 1DKNA 4MIYA 1SXPA 3TS1A 3I2KA 1MQ8B 1PL7A 4GGOA 1RSZA 4ZOEA 3TG8A 4GOMD 3PLNA 5BY2A 4Y3UA 4HNAA 1FVFA 1ZI6A 1WG8A 3D54D 3I1JA 2ZE7A 1J20A 2W2KA 1OT3A 4YT8A 3DMRA 4S1VA 4J3FA 4ARIA 3BXPA 3E9EA 2PTHA 4KE7A 3UA4A 2A3NA 2ANBA 5FTMA 4X1OA 3E53A 1WD5A 3QPAA 5LD2B 4YP0A 2O57A 2H2FA 1V41E 1YQWA 4B3IA 2O14A 1HKUA 1JXQA 2B2XA 3P19A 1PR5A 1JDBB 2BEUA 4R1SA 1C29B 2PEZA 3MTJA 4GWKA 6CHYA 1C1XB 4HPWA 1BHQ1 3IPYA 4OMFG 3WHLA 3PKJA 4NK5A 3EVTA 3K92A 5IBRA 3VPAA 3L6UA 1GSHA 1X13A 3IQEA 3MPUA 1W59A 1EM8A 1YS1X 3WGVA 4CI9A 7AT1A 3SJCA 4LY0A 1UBLS 3Q98A 3R77A 1OLUA 4NE7A 2EJVA 3BF8A 5DLPA 4ZI7B 3EVZA 3MPOA 3PXCX 4QVIA 3MXTA 1D7AA 2RK6A 3ANMA 1T6BY 3ILXA 3M6IA 2XJ9A 3M6MD 4MV4A 2CXTA 2YS6A 3Q6NA 1JDSA 1KEWA 1W5AA 4PYOA 4UMDA 1RWKA 4MQUA 4LYDA 1B2LA 2IOFK 5K4HA 3WMGA 5FULA 1G8GA 1TYEB 4IEIA 4QGBA 4OHZA 1E1RD 2HSWA 1X1TA 4MKFA 5CNIA 2X2FA 2AMJA 2FLWA 1UFRA 1DUVG 1DL5A 2H7YA 4ZVNA 4LC1A 4HT3B 1FDUA 2DE0X 1DTWA 3T0FA 4PV7A 2ZDHA 3KT8A 2QRQA 4J03A 4HGNA 1XQ1A 3OUTA 3IXMA 5DTEA 4H0NA 3ZCUA 4E15A 1UMDA 1A9ZA 1C3XA 1BAPA 1CLUA 2C9OA 2PVCA 4QUIA 1L5KA 2BGUA 4B82A 3IJRA 1V7PC 1NIPA 1AGPA 4JB2A 4C0QC 2GSDA 5C8YA 4ZQIA 1R6UA 1GNSA 1YRBA 3OMWA 5I7FA 5KVVA 5LVAA 4RVUA 2ZBFA 4XQCA 3HYTA 5I01A 1A7AA 2EKBA 4HN9A 2IH4A 2NUAA 3A9SA 3O6VA 3JZAA 3RC8A 2GVZC 3HI4A 1GRRA 2FV8A 4N3AA 1E1RA 4FGSA 1A0OA 4K9OA 4EW3A 2NZUG 1CJUC 1N5LA 3E9CA 5F21A 4QQFA 4CBVA 1ZSVA 2SECE 4C4OA 1FRNA 5IS2A 4KMOA 2ODPA 3D4NA 2BKXA 4JLPA 2H48A 2QE7D 3OBIA 3GLQA 1A27A 2QGZA 1AUPA 3RYIA 2OCLA 3ZTYA 2DBQA 3RUCA 3TO5A 3WRYA 1BEEA 1D2RA 5EJEA 1LPOA 4JIMA 3L1HA 3Q1KA 1CHNA 2JGFA 3DA8A 1NVVR 1X7DA 3DKVA 2EYUA 2X8LA 5AUOB 5K8VA 2GHIA 3C7DB 3DWEX 3ED5A 2HTEA 3F9IA 3HYRA 5F51A 1THTA 1T9HA 4DUPA 3KZVA 4U6NA 4LKRA 4KGXA 4PX9A 2P9CA 2GR9A 3N0VA 4LZOA 4V1CA 3K8ZA 4KMMA 3PWKA 4ND1A 1M7HA 2IYWA 3AF2A 3WNDA 2XXJA 2IZ5A 1EFLA 2B0JA 1Y81A 3TW4A 2XW6A 4L5JA 5D5QA 4MVYA 4JY7A 3WB9A 3ZY4A 1T3GA 1GAEO 1P2TA 4YS6A 5HRCA 4MQ6A 4UMEA 1SCDA 2QE7A 1CP2A 2H2IA 4G8JA 6LDHA 5FOVA 1UODA 1BKDR 3P2OA 2V8OA 4EB0A 4RGBA 4JAVC 1S1CA 1X9GA 1VE6A 1CPYA 1GHTA 1HWYA 3KQLA 2ZYAA 4YAKA 3QVSA 1AO3A 3CO5A 5A62A 3R7SA 4PPNA 1C7JA 4ND6A 3BEDA 4DNPA 2FZ5A 4P4SA 2NPOA 2YOHA 1X7XA 3NGLA 3T1NA 2F8TA 3PD7A 3TNJA 3AT1A 4AZ0A 2GDZA 3P4XA 4EZIA 1V45E 2FWMX 3LC7O 4B81A 4AKIA 1NUSA 3CMCO 3H8WA 3CY6A 2VR1A 1ODIA 3L0SA 4KGDA 1S6YA 4YAEA 5JSQA 4CXMA 3I9NA 1V71A 1K3FA 2YVAA 4S1NA 5HGJA 3CGGA 2O2XA 5DVZA 1FYEA 3Q8MA 1L5HB 3KAPA 3Q12A 2BM9A 1QIKA 2Q8NA 2JIMA 2WA1A 2V58A 1KP2A 3NC1C 1C7EA 3PSHA 5BR8B 2PGXA 1I14A 3D6AA 4ZHSA 2XUDA 1Z5ZA 2D3TA 4XLZA 3SYKA 1YNSA 4XUDA 2BFPA 1U65A 1Y4UA 3ZCTA 2EL7A 2P40A 2ZI7A 1O4WA 3IVGA 1HZZA 3B3AA 4FGUA 5IDYA 4TKVB 2J08A 3G5TA 1J8FA 1EIWA 4ZOCA 1EA5A 3LSYA 4XM1A 5JCOC 2PD6A 4XGNA 1MENA 3QSGA 1MIOA 5BYBA 2WI8A 4MGYR 4RKYA 3O95A 2PT9A 2X0IA 1Q91A 2F3TA 3G13A 3GFVA 1CV2A 2G9NA 4IXMA 1XTSA 3FNQA 3SJBA 2JAUA 1VLLA 1GCIA 2JI9A 2VRWA 3DGEC 3F96A 4W5JA 1X9HA 2B4RO 5JV5A 4R1MA 5LFAA 1ESDA 1VKOA 2WJGA 2FSIA 3BCRA 4R3NA 2QUKA 2XRFA 4RQUA 1FYFA 4BL5A 1TJ4A 5G0UA 1I80A 1OMOA 4P3OA 2HBQA 4KXWA 4DBZA 2I62A 4KPEC 1YJCA 2VEDA 1XJ5A 1VA5A 1T36B 3L02A 4J91A 1TECE 1MO2A 2X8WA 2ASVA 3NKLA 4U02A 4KQGA 3TJMA 1EP3B 1K66A 4HAVA 4JGGA 5BNFA 5FLXA 1G42A 2AUMA 1S2MA 4R2JA 3PJRA 4D8VA 2BP7A 2HMYB 3FAKA 2QTTA 5ILQA 4EHBA 1S8NA 5CB8A 3S1SA 3ZDYB 2VDUE 1GGFA 3LFUA 1DJQA 1KY3A 1TZKA 2F6RA 2ATXA 4BV9A 1OZHA 2H4YA 4M6WB 4JNKA 3K4PA 1AKUA 4AAYA 2F9MA 5BNZA 2XXAA 2RHMA 3MWDB 1JSLA 1NTRA 2OSVA 1XPUA 3VNUA 1W73A 3RLFA 1WXIA 5B4VA 1R9MA 1A9YA 2GETA 2JAPA 4IJ6A 4OHMA 5B3LA 4TZTA 4EKIA 3CLSD 4HJXA 4N7BA 4TRRA 4BNKA 2PL1A 4NZYA 3T7EA 2GN9A 2XUHA 5LQDA 2VUSA 2ET6A 2A0XA 1PYOA 3WZMA 1Y6RA 1JAXA 2HPVA 1JB9A 3KE9A 5TEWA 2AFRA 4K0KB 2ZIUB 2VHQA 3LPCA 3SR3A 2G4LA 1ZVVA 1W4ZA 3H17A 3L6EA 5ALWA 1CDZA 5IKEA 3OO1A 3KD3A 3OJ0A 1R9JA 1KOLA 3BTSA 4ER5A 2YRWA 7GPBA 1SCUA 4X7RA 2XT6A 5G40A 2H5IA 2R62A 5IDVA 3H9UA 3T3HA 5FNVB 2A1UA 2G40A 3CKLA 4QHSA 4LRWA 3JYHA 3WE7A 4GDFA 3JQ8B 3PYXA 5FQOA 4XIFA 1O6FA 3DAGA 2JVJA 4N8EA 1Y8ZA 1ZIPA 1DT3A 1PK7A 4BLWA 4I14A 1EBFA 3BD7A 3FWZA 1K97A 2C0QA 5HIIA 4KVGA 4HUTA 4G4IA 1QIDA 1KDPA 1MX1A 2OM2A 3PUWA 1K88A 1SUAA 1QIHA 2Q07A 5BQ3A 3RC9A 2QTVB 1W4BA 1UXKA 4KLNA 4RZQA 1RZUA 2OXRA 2RHWA 3ICVA 1A2BA 5AKIA 3SZ3A 4V0OA 4G0MA 2CMFA 4FYVA 2ZWOA 3E2PA 1UKAA 4TPKA 4YRLA 2XKKA 4NX2A 2Q8PA 2HO5A 4G4GA 1N9GA 3GPBA 2JKVA 3AJAA 4XR4A 5LBUA 2CMKA 3RYCB 2C03A 5EHGA 3MIZA 4DIBA 2AZXA 2ZYDA 1QZ3A 4U1RA 5JNWA 1DJMA 4UASA 3C6MA 4FMPA 5JNSA 3F7NA 4PC3A 5FWDA 4DC9A 5CDYA 1RJFA 1PFQA 2ZS8A 1FLDA 2E5FA 4NQRA 5EY5B 1L5FA 2B3DA 4UTVA 2E6UX 3PT9A 4GMFA 5ITZB 1VA4A 3CXUA 2XNSA 1RYMA 4C0BA 2YW2A 1DS6A 3HDYA 2I7CA 3IAS6 5DTIA 3FETA 3KLMX 3MCTA 3N87A 4Z4FA 3ABQB 3PNMA 1AU9A 3R7FA 3HH8A 5EKXA 3OECA 1Y0BA 3GRPA 1FU8A 2C5LA 3C45A 1WW8A 3WYFA 1YOBA 3BB1A 4MLPA 1B6RA 1CUGA 1RLUA 3AZQA 1SGWA 4GOLD 1XXHE 4N1AA 2C5AA 4Q15A 5TDHA 3HP4A 2TECE 3KZOA 3EDMA 3OEED 2EP7A 2J7KA 1XLVA 1H9BA 1ZICA 3LCJA 3UGTA 4KQFA 4BCDA 2DPLA 4Y2PA 3GNLA 1SVIA 4C0KA 1GZUA 1R9GA 4YRPA 4CV2A 1GNLA 2AS0A 2J3QA 2II6A 4K6OA 2XA1A 3CVWA 4QUJA 2VKTA 1ICIA 4BB9A 2Q41A 2Z3WA 3E82A 5JQGB 2JJMA 4DNXA 4HDCA 2Q1SA 1F7UA 4EP1A 4XDZA 4JI3B 4F5DA 1AMUA 4YHBA 1T5DX 1Z83A 1P9LA 4NKRA 3D1LA 3F90A 1FDOA 2DUUA 1JGTA 2ZIXA 3CONA 2JEZA 3B6JA 3OUUA 4R98A 4C2AA 5ULLA 3NKVA 3KU4A 1GFZA 5DTQA 3K9QO 1Z6XA 2QG4A 3KPYA 3VH1A 5C8ZA 3HXTA 2GLTA 3OEEA 1TA0A 3W5UA 2CHUA 4KRFA 3TCXB 1OWOA 3PJGA 4OP1A 1T8RA 3GYBA 2FEWB 3HRHA 4X00A 3CZQA 1U6IA 3BB4A 1TJYA 3HN7A 4C3ZA 2DBZA 2OBNA 1EWTA 3DDCA 2OPBA 3T5DA 4ZFNA 6ADHA 1X92A 3UV7A 3WBBA 3W8NA 5BN3A 3OSZA 1OWPA 3PR1A 4LJLA 3L0DA 2FSVA 2WE7A 4PNZA 3U48A 3VZSA 4FI3F 3MAGA 5FX2A 4DR4B 2N9UA 2NUPA 2P35A 1CUIA 3NR2A 3RSLA 3HR8A 2MMGA 3H99A 1PX0A 3GEHA 1B1CA 4R9VA 3CLKA 3OFSA 1VP9A 2ZSHA 5KNDH 1U28A 2Z6UA 1KQPA 1T9BA 2QP4A 3HU1A 3NAZA 3OOJA 4WASA 5JMPA 3DL7A 4DRXA 4NQZA 1N78A 4PHTA 1YJXA 2QZ9A 5HM8A 4KQEA 2IS2A 2O8BA 1E2FA 3NAMA 2WIGA 2XXBA 1TKRA 2PBFA 4MVJM 3M34A 1U8CB 1EUCB 1EJ2A 3CNEA 1P7WA 2J6IA 3U49A 3QV2A 1KDYA 3QXXA 3DE1X 1ZSNA 2VJMB 3MRVA 3C1OA 2O2GA 3OZVA 4DR2B 4QJIA 1I0LA 1I6KA 3EGDA 5FOSA 5HUJA 5LMZA 2WG0A 4OM7A 1SPBS 3DYVA 2GYYA 3T5BA 3ND8A 4GPEA 1QQAA 4IGKA 1MXHA 3EXHC 1T2NA 2GTIA 3RJ9A 3U0BA 3NHWA 3C3WA 2FUG1 3OJCA 1HRKA 1K8XB 2FFBA 1XRJA 3W3ZB 2J5RA 2ZR9A 3GT4A 2ETXA 2KPOA 3HS3A 1XYYA 3JAKB 3PFNA 2CCKA 2CFCA 2GD6A 5AVZA 2D13A 1KI8A 4GMHA 1D9ZA 1V6AA 4BQSA 2Z2YA 4BGDA 4GSLA 1M54A 3L8FA 1ZP6A 2VWHA 1EGHA 4OP2A 4UDOA 6AT1A 1NLFA 3L7BA 4L3VA 1XZ8A 3NVDA 2I3BA 3ORRA 4W8HA 1WF6A 3ANTA 3C3DA 3QX9A 2PPVA 4F85A 4Z2AA 3L49A 4NPHA 4GZLA 4GPTA 4JWTA 4AYXA 3DTNA 3IUMA 4EW6A 2YKGA 4HGOA 2PZGA 3KXLA 4JQCA 3IP7A 2X9LA 2QRUA 1PZGA 2W6ZA 2A67A 2Z3VA 4HDAA 5F3DA 5H02A 3X1DA 2IELA 4LNHA 4AUMA 4MPTA 2Y1GA 5TMPA 3DQPA 1NXOA 2FMIA 1JLMA 1E7WA 1OGYA 1FNDA 1Y1SA 3EIEA 3FROA 1WMDA 2FRVA 2BH2A 1VE7A 3VDMA 4GPIB 2I4TA 3Q3IA 2GEKA 1ESCA 5IARA 2HLHA 4F0JA 4F4HA 4I4CA 5IJZA 2P6RA 3U2QA 1P8JA 2A8YA 2YCLA 4YJ3F 5CDFA 2XCIA 4CMEA 1U8AA 2HQ1A 1G9XA 3PFGA 5CX1A 2QTLA 2HRDA 2VTEA 5HE9A 4JUBA 2QT9A 2ZSJA 4O4IF 5JFGA 1YDMA 4R7ZA 1BFUA 2AZDA 4CT0A 3UT6A 4H7EA 5A02A 4QGGA 1DUSA 2XNCA 3A06A 4QOFA 1QGUB 4BIMA 4BQRA 1GZDA 1G3QA 1PJSA 4H6XA 4OK5A 2VZ8A 5DM4A 5FWYB 1KMQA 3V7UA 1RAAA 1AF4A 3KCNA 2JZOA 2J30A 3MWEB 4IYRA 1RPTA 4K26A 4XXHA 1GTRA 1V11B 2ZYSA 4LE0A 2YIDA 4GR5A 5DHAA 5FT9A 4OUKX 1TT5A 2FR8A 1ORWA 2QPLA 1HQYE 2WYVA 1CIJA 5F5LA 1M2FA 1HKHA 1ZVQA 4OHYA 3DYIA 3QMVA 3FB4A 3RVMA 2GNPA 2XI4A 1JKIA 5KC9A 2ACVA 3MRSA 3UFBA 2CSXA 3AJ9A 3Q8LA 4CKEB 1BC5A 1KZ1A 1TYAE 3TQSA 2O07A 3EQZA 3AHGA 5U4XA 2C8KA 5BV7A 5FI0B 1VJ1A 1VCMA 2GZ3A 4QRIA 4U2CA 3RSCA 1TZCA 1P0CA 5BSWA 2XCQA 3ABZA 4DVJA 2OZKA 5K8UA 4O5OA 3V32A 1AZWA 3HB4X 4QBGB 4BNWA 1NQWA 1E63A 1GVHA 1U8XX 2FW7A 2L19A 2WAYA 2ZRGA 3GRFA 4KPGA 3MN1A 2PH1A 1DAIA 2NM0A 2Q6IA 4W4TA 1B8OA 1ZSYA 1RW4A 1Z4LA 2RGWA 4RQTA 4YO7A 3RRMA 3ZXXA 1G8YA 3CT4A 1SZCA 3D8BA 2AR0A 3EGEA 1J24A 1P61B 4QT0A 3T3PB 2D1QA 1YMUA 4BB0A 4QZVA 2POCA 4PCLA 4GL2A 3DONA 3LX5A 5EZQA 5LQAA 2J3EA 4LF9B 5DBGA 1IZ8A 2EDAA 1AM4D 2V7PA 2ODWA 2I5PO 5HTKA 4M49A 3AI7A 2SHKA 5G4KA 3U7QA 4CIWA 3NTUA 1CZRA 2JI8A 2K87A 1WXHA 2W7TA 3PUYA 4LW8A 3PEFA 4XDGA 2VP0A 4OGLA 2HI0A 4ZZIA 2P2CA 1VLMA 4BVEA 4F04A 2QRVA 1FDIA 4OHCA 1CY0A 2GJSA 3IBFA 3KUCA 3ZGYA 1YZHA 4R6XA 2DLDA 4B4DA 4KCGA 3E70C 4JDUA 2ZAOA 3PHGA 4WQMA 5JJKA 2I2AA 4YJ3A 3V1MA 4XSVA 5HP4A 2AX3A 1AKYA 2NZYA 4HMOA 4WIAA 3W79A 4BYGA 4Z3OA 3CZMA 3EZ7A 3KV1A 2LW7A 1ANKA 3A4IA 1YDWA 4O4IA 2G1UA 2Y4NA 4TQAA 4G01B 2UUOA 2XNKA 3LP8A 5J4LA 3E2IA 2DWCA 1RKXA 4OIMA 1EA7A 2PO7A 3FFAA 3ROQA 1L7AA 5CH3A 4EGJA 2P2GA 2PSDA 1B1AA 2ON6A 3AP2A 3BXXA 3HKBA 1KH1A 2P5SA 2QL7A 4KBGA 1PZHA 5MN5A 2HADA 1YDEA 3ZJ5A 3AUJB 2HSZA 1K0FA 1UAYA 1VE3A 4W7IA 3NWOA 4EG1A 2B92A 4LTNA 1BKYA 1FQKA 2BEVA 5AFSA 1E5QA 1ZESA 4DSTA 2WJWA 4PAQA 1VMEA 4GKBA 1Q3TA 4PCVA 1YQGA 1F38A 2AG8A 3MT7A 3VJMA 4DXHA 4F4IA 4M8IA 1ZR2A 1NULA 2CV0A 3V9AA 4PSVA 1N6PA 4BEBA 3GP8A 3OQ6A 3B1WA 4OBEA 2BD0A 4RZ3A 1FMJA 2P1DA 1QR6A 1RXEA 5ALDA 3V2IA 3OHSX 3PC2A 4F60A 2F48A 4IOKA 3S1AA 3KKPA 2QL5A 3QVJA 3DG9A 2V98A 3I2IA 4MP8A 2PUHA 1X19A 5THKA 4XARA 3UMYA 1FBNA 5COBA 2R2GA 4P4LA 4MIOA 4HLNA 1KC3A 1H1LB 1WZ2A 1N32B 3JWPA 5IVHA 5EXSA 1PD1A 4Q3LA 2IGTA 1AA6A 3DOUA 4ARBA 3NX4A 3QFRA 4AJJA 2A6PA 5DXJA 1VJ0A 5TSDA 4MR8B 1FLVA 1LLCA 1EQUA 1JG4A 2P6MA 5CD1A 8LDHA 1MG0A 4YLEA 1GSAA 2ZVJA 3JQQA 1GP2A 2C4HA 1DG9A 2BFNA 5FTLA 1NT2A 1J49A 2OD2A 4K6MA 3MJTA 4M53A 4MOWA 3VC2A 4MW4A 2JI4A 2EQBA 3KUUA 3O91A 4M9CA 3ZZTA 1G19A 3MRXA 1Y48E 5F2OA 5I6DA 5F98A 2AJLI 1RYBA 4C5AA 1Z0UA 3HJAA 4YY3B 4MK4A 2QS9A 4FE7A 4TWZA 3N6XA 4G24A 621PA 1U2GA 3I39X 1ZCAA 3DCJA 3T3IA 4RULA 2BSXA 3ZD7A 1J8VA 2HLPA 1KPIA 4B34A 3Q4GA 3SF0A 3T94A 3LPNA 1M5UA 4P31A 2IEGA 2PM8A 4YONB 2PZKA 2B1QA 4BCCA 3R3JA 1PVVA 2ZANA 4LWPA 2O7NA 1UJMA 1N0HA 2CLFB 4ZJPA 1V1JA 4WNYA 2IZ1A 4R8VA 3DDOA 3SX4A 3ZV3A 4B3HA 3KQOA 3OPYA 1ZU4A 3ENKA 1SAYA 1X14A 1IUOA 4PRYA 4WMLA 1QK5A 1EEXB 1Z0IA 1NJ2A 3HP7A 2XWBF 2ODEA 1FX1A 1ESNA 1O97D 2V7WA 1E7SA 4K9PA 4MHSA 3DS8A 5KNBH 4BFZA 1A9RA 3QPUA 4FM9A 2J6BA 2Q9AA 1QM5A 2JLBA 1BJKA 4H7JA 3LBNA 2DHEA 5DGDA 4IDDA 2GCNA 1SR8A 3C1TA 3D3EA 5DV9A 4DJAA 2OLJA 5KKCA 2A5JA 4OAQA 4PZLA 1PTJA 4A23A 3QUSA 3IVCA 2OV8A 2E4VA 5B53A 1N9KA 2ZUWA 1PQPA 3B1YA 2HYIC 2VHJA 1FSFA 4Z99A 4O25A 1ZUWA 3PPVA 4WY8A 4KH0A 3JSXA 1BROA 3KZMA 5B1IA 3W7BA 4EK9A 4A5OA 2OGUA 1BE1A 3L3BA 3L6RA 3FLMA 2H63A 2AJBA 1KJJA 1GZHB 2OK8A 2QJRA 1D07A 2JJQA 3OM1A 2UXBB 5SICE 1MEJA 5IUJC 5FOUA 4DLVA 1EJ6A 1TT7A 4CM4A 5ED0A 1B42A 4FFSA 1NT4A 2RH8A 3ILYA 4JR1A 4TKUA 4DWVA 2O0HA 1QFMA 1EVLA 2JB9A 2GK3A 2VF2A 4PIMA 4F9EA 1TUEA 3GGDA 5JATA 3A4YA 4GZMA 1DQSA 3NM4A 2OM6A 2W6ID 1NATA 1QHNA 3DB1A 3B2NA 4NVRA 1FUIA 2CZQA 3COZA 5ES3A 4CQLA 5AW3A 4Q00A 1SHJA 4WK4B 2RC5A 3AZOA 2FZLA 2REXB 2D1YA 3K6KA 1LDMA 2BH9A 1WAMA 2YIJA 3HB0A 4D8XA 2VCYA 2AW5A 2GBGA 2X40A 4N49A 3RARA 2XADA 3QKRB 3O8DA 5FEMA 3SBDA 4RDHA 1JLLA 2JIZD 2O7SA 3DVSX 1OHHD 2PS1A 3N0TA 1MZPA 1OYOA 4KO8A 2DP4E 1Z2NX 4F5ZA 2Y4OA 1MJGM 1E2LA 3GRUA 2PZBA 3ZDXB 4QGAA 4G2TA 4U6SA 2MR6A 3LBIA 3WHIA 4DFDA 1LK7A 2C57A 2XUKA 4IUBS 1QE0A 2VBIA 5TC4A 3WYGA 2PQ0A 3BHNA 3ZHOA 4L4UA 4E11A 2W6IA 2RKBA 5E7JA 3PSAA 3VZPA 4L2IA 5F3WB 1TCUA 2JIOA 5K6RA 3LDGA 1R3UA 1TM3E 4LJ8A 3EG9A 2ZSKA 3KR1A 4YDRA 4ENWA 3BJZA 1U0TA 4AKHA 3AEQB 5EWLB 2ABWA 4K81B 1GKKA 1G5RA 4KXVA 2CVOA 3TLMA 3VKHA 4X84A 5A6SA 3ASZA 3RI3A 1WTCA 2DQ4A 2PQ6A 4C08A 3F3SA 3F1KA 4NR0A 1Q92A 2JIZA 1LDEA 2ONZA 1OHHA 3JSAA 1JDNA 2HMVA 3HZHA 2YC4C 1CRZA 3HGMA 3HI6A 4BDTA 2GM5A 3GJTA 1P9RA 4DLLA 2QAGA 4IILA 3GDFA 3LW8A 2V54A 2ZE8A 2H3EA 4N03A 2JRCA 4M0KA 4HQ6A 4RD3A 4RNCA 1ZO8A 4L8VA 3AW8A 4B3FX 3MLBA 4CG0A 4FFOA 2JHAA 1YXMA 1Q16A 4OFXA 3ZWQA 1HNNA 3C4VA 4QBHA 3WK6A 2OLEA 5P8WA 3T3NA 2BFDA 2QD5A 2P9QA 1ZCZA 5CGQB 1J06A 4KDCA 2EQ5A 3GFBA 3JV7A 3ESRA 1QPGA 2GHQA 2IYOA 4XVCA 1S2DA 4HPJB 4IJUA 2G9ZA 2Q7DA 1GDHA 1P8AA 2H9YA 2AXQA 2PKQO 5KYTA 2W6QA 1COWD 4UEOA 1JXOA 4JA2A 3GLGB 1CUZA 3E7FA 1I1NA 4URZR 2VPYA 3V4ZA 2Q5LA 4GX5A 4TYQA 1D03A 4EUEA 3HCCA 4EYOA 5L4LA 3Q3VA 2ZSUA 1V3QE 1US8A 3FYTA 1JA0A 3ICOA 3NC4A 3PR2B 4IIJB 2HMWA 3EZXA 4QPDA 2C98A 2W2LD 1QAMA 2XNDD 3K09C 4X91A 3R75A 3RHTA 4AWBA 5JSFA 3D8UA 2EEZA 4GICA 1L3IA 3N2EA 4C2TA 4UNIA 1V2HE 4M7PA 4A26A 1FP4B 1IEWA 2HJSA 3DE3X 3IUBA 1C3LA 2CLIB 3K2IA 3LDUA 2R6JA 4LN1A 4Q21A 2WQZA 4CCYA 4DQ0A 4A2CA 1IPEA 1YZNA 2FPGA 2PR2A 3MFYA 3O8QB 3DD5A 4CDRA 5EMLA 3G2HA 5BQFA 2ZCJA 4IS3A 2I7VA 2HIAA 1O7JA 4RADA 4UUBA 4D3DA 4F97A 1L4YA 3EN0A 1UFVA 1Z82A 2AHRA 3C7TA 2RHLA 3N8KA 3HCDA 4I81A 2FWBA 1QSGA 4U3JB 1YZUA 2D1FA 1E1MA 2OCGA 3JYPA 3H6HA 4FBGA 3LF2A 2QN7A 5B58T 3BGWA 1COWA 2C7VA 4ECAA 3SHQA 2XQIA 2Q62A 3U4AA 3UUFA 1XZCA 2QYTA 3L1IA 3G2KA 2GBPA 2G09A 2R5NA 4PAMA 4NF2A 4ZCPA 5GINE 2AX4A 3VR3D 4XIJA 4MCIA 1ISFA 2QGNA 3OCVA 4IZ6A 4BAGA 3GA0A 5KZMB 2QQ0A 2W2LA 2XNDA 3DDNA 2VZEA 3CUWA 3N1UA 2DTEA 4KU4A 5EZSA 3V8EA 3F74A 4UAUA 4YRKA 1XLWA 1Z25A 1LC0A 2OOKA 3HA7A 1BE6A 3KCQA 3QOXA 5D3ZA 1FMLA 1WUIS 3U61B 3W3AD 4IKOA 3C0KA 4H15A 4LDJA 3RK4A 4EW2A 5JAZA 5J3JA 1HRDA 1PFUA 1VBFA 1XZGA 1ZD1A 3NNSA 3EXHB 5GM1A 2HYDA 3AF3A 2G6TA 4Q47A 3QBEA 1E9VA 4HNRA 5JOQA 4AM8A 5BYAA 5CB0A 1RYZA 3PYLA 4FFMA 1BW9B 3NVMB 4FT4A 4WCFA 1YZVA 1E1NA 4F56A 1Z4NA 5D3MA 1NG1A 4LV5B 4O2BB 1GZVA 1GV1A 2GT1A 2BZGA 4Q24A 3NV7A 1EUQA 2AG1A 2WMDA 2RHOA 2FZWA 2AQHA 2HGSA 3MMSA 4IFIA 4JC5A 4LI0A 4QQRA 2CDBA 1C7RA 3LQ2A 4V3CA 3V1UA 4AG3A 1QGAA 5HJ7A 1MQ9A 3HDGA 2E1PA 2OQVA 2IX3A 3F4LA 5B55A 2WSIA 3AR3A 4KVAA 3GROA 1IFXA 2BCEA 1A2OA 3EIOA 4HUQA 1NJSA 1JAHA 1CZKA 1N5DA 4LVUA 3W3AA 2JS7A 1FUKA 3D1JA 1AY0A 1Z26A 5IDQA 2WP0A 2RAUA 3IUYA 2JG3A 1LI5A 1VCOA 4QC2A 1DT5A 1DTSA 1UDXA 4IV5A 4UBLA 4YJKA 3FYHA 2UZ3A 1DV2A 4I19A 4RABA 3IODA 3HUTA 5A5DA 3IEPA 4I4IA 3PZRA 3FTQA 1KA9H 3GJSA 4BNFA 2GF2A 1B73A 1O54A 2VPIA 3AHCA 1Y80A 2VNJA 1R8JA 5EL0A 4E14A 3L6DA 1H2WA 2ORED 4OHOA 1IUNA 1QIGA 4M3NA 2NQ2C 3RFTA 1USIA 2BFOA 4OB8A 4OYLA 5IVDA 3I0MA 2X9NA 4KOAA 3G5LA 4RD1A 4MXDA 4E2XA 1XAJA 3KJFA 3NASA 1ABFA 3VU9B 2F2TA 1BS9A 4LAFA 1NNUA 2RBKA 1FQJA 3OJOA 1AK1A 1N8SA 4FLEA 4BMYA 5KSZA 2ECFA 2AHOA 1M33A 4LHYA 5B2EA 3T1VA 2FHSA 4QFCA 4UXJA 1QIIA 5JSUA 4D3FA 4EI8A 3IDSA 3DE2X 4G89A 4F1JA 3T4UA 5HTOA 4M37A 3N7AA 2XVMA 3DUFA 2CL6X 1F0KA 1IHOA 1NUTA 4BKQA 2Z6QA 4PZCA 2IOHA 3GRRA 4N3GA 1SUBA 4RK0A 1IK4A 2EKZA 1O95D 2NXJA 4KJXA 4YRQA 1FJ2A 5E95A 2C9DA 1WLSA 1XJWA 3Q40A 4Z4GA 4RTNA 1ID8A 1YBAA 3WSVA 2YDYA 2OHGA 1B23P 4XLLA 1E0AA 1VRVA 1OYYA 3CTMA 4IJVA 1DFIA 2J3HA 2R87A 3IV6A 2VLBA 2ZT5A 5SY9A 2G0TA 4QDZA 3NGMA 5ALUA 5ALKA 3BUSA 3LDFA 4HFNA 1XCGB 3QBTA 1WBBA 2JVIA 4JROA 3M6LA 3O82A 4M99A 5A4KA 3OIWA 1YBMA 3MINA 3WMFA 5B58C 1KRWA 4B6JA 4CMAA 2I2XB 2V0CA 3NH9A 3EZLA 4YCMA 2ZJ3A 3C41J 1GM5A 4KN6A 4EB3A 3ODPA 1OFHA 4ZCSA 1A97A 1S2GA 3H9EO 5TF4A 2NU7A 5J4HA 5J47A 2BZSA 4DDKA 3GLVA 1PZNA 5JY1A 2HSDA 1H5QA 3IH5A 4PC1A 1O95A 3GH1A 3H2GA 5KWJA 1D5WA 1E3QA 3FE2A 3R9WA 1JPUA 5HOEA 5IKMA 2NZWA 1SQ0A 1YS2X 3JQRA 3OZSA 4W9NA 2C2KA 2R8OA 4O0MA 4MUNA 4ANFA 3FFTA 3B1XA 1JKFA 2FDRA 2HQOA 4FFRA 3ROGA 1GQ2A 4MEJA 2HN9A 4RVOA 2C4KA 1KZYC 4DE5A 1JSXA 4BC1A 1T1JA 4EL0A 2YQ4A 4NBNA 1M72A 3K05A 5JJIA 4DSUA 1KEZA 1IEQA 3SC2A 3VH3A 5TGZA 4TVSA 4CETA 4IX9A 1LLFA 3IXLA 1TM5E 2B9VA 1GYRA 1YS4A 4FMBB 3AGPA 4IDHA 4GEGA 3CLTC 1C1HA 1NF2A 4BO5A 5KQLA 3MJFA 1CK4A 1QDLB 1RWQA 3VNBA 2EERA 3DOEA 4AN0A 1NRJB 2WP8J 4FDMA 1NI5A 5FNZA 1BU5A 2ZDQA 4FHGA 3S2FA 3WQBA 4Y0VA 1F6BA 2ZBGA 3B12A 2NO0A 1VKNA 2G8LA 4F2WA 2R1VB 4JVMA 4I1UA 4W8OA 3RS8A 5AESA 3FWPA 1Z4JA 4BX3A 4QX6A 3SU8A 5BQXA 3P2YA 1PW5A 4II2A 1DBQA 1RMYA 5CXXA 1WSDA 5GOTA 1MA0A 1BH2A 3DEKA 1R4MB 1T3HA 3FHLA 5JZMA 4KFSA 1G4HA 2WIDA 2E4XA 2G9RA 2Y66A 4Q02A 1GQSA 4Z9YA 1WXWA 1Z8DA 4GO1A 2G71A 2VHTA 3D3WA 1CP3A 4INJA 4DJTA 2CLKB 1TO2E 2H57A 1YGPA 4FNAA 1ZK2A 2AI1A 4WXYB 3RVKA 5I4KA 5LMNB 1DGQA 3N53A 1QYIA 3TQOA 3ZVLA 1D4AA 1FP6A 2PUFA 3V5NA 1ST3A 4KRGA 3BRCA 4WA7A 1BE8A 3JQ7B 1D6MA 1RAFA 3W9UA 2F1HA 2B0CA 4F92B 4E7OA 4RX1A 4P83A 3H4MA 4LQCA 2ZS7A 4DSZA 3AKDA 3GLKA 3WTBA 5K6AA 2RHGB 1CR2A 4IQFA 4BO9A 5GGXA 2A5DA 2VEOA 3LX4A 1YH3A 5CVCA 3H6KA 2D1SA 1T26A 2RGCA 2WD9A 3KQWA 2JGEA 2ZP1A 4L16A 4IDFA 4DCSA 2R8RA 3TAHA 2CLMB 2ZIAA 4RC9A 3TI9A 4NH4A 4BJ3A 4CMHA 5BUSA 4YHHB 5BNWA 1I4TD 3ACBA 2MU1A 4L5IA 3EDRA 4MYSA 4X8OA 4JZYA 5DNEA 3O2NA 4J0EA 3WLFA 1F2TB 4LGMA 1G7TA 4BWVA 4ZI5A 5LJLA 2YOGA 5CLHA 1Z6AA 2PIAA 4L02A 2QAJA 3W2IA 2IA5A 4MROA 1USWA 4PTZA 1VLJA 2JHFA 3IGFA 3ROXA 1DELA 2QTRA 3KNZA 5LUAA 5ICFA 1JVNA 2D5LA 3BJRA 1A72A 3C6ZA 3ESZA 3KUKA 3FMIA 5F77A 1PD0A 3QKSB 3IUEA 3VO8A 1JHOA 1I1QB 1PK8A 2UVPB 3NTVA 4I8XA 5TF0A 3UJDA 1T35A 5JT1A 3AM5A 4DMCA 3G0DA 2C5BA 3P9YA 1F8XA 4MYUA 4X20A 3PJEA 2FFQA 1F4VA 3T52A 3LWNA 5LMUB 1RHUA 4JOSA 1UBRS 3U3RA 5F73A 3D3KA 3EA4A 1VCHA 3OU6A 3VJKA 3I0ZA 2WJ4A 5K8JB 1KVSA 4V02A 2G5PA 2P91A 2R8ZA 4RTMA 1V2GA 2PLRA 3OZGA 3A9UA 1QJCA 5IDWA 1WF3A 2PZAA 4C7OA 1GXSB 3M7IA 2V96A 5L53A 3MHTA 2VWPA 1ELOA 3JVUA 4EI7A 1H94A 4TRMA 1S1MA 1EFPB 3O3MB 4U7WA 1E3EA 1XSEA 2QJWA 1NXWA 2YV1A 1FDTA 1IXZA 1NQ5A 1Q77A 3MLAA 3G2QA 3QK7A 4LCJA 2H85A 4YJ2F 3BC1A 4BNDA 4HJRA 4TXLA 5FL3A 3RSGA 1H6CA 4ERNA 4MW0A 2YV4A 4H7HA 4RIEA 4W5WA 4UNSA 1U2DA 3FYUC 2C2HA 1AMNA 1OU0A 3II6X 1DBSA 1RWBA 4IKEA 4EY3A 4YJGB 1NURA 2ASEA 4ALNA 3PQ5A 5JC1A 3RV4A 3HR7A 1MORA 1KI3A 2JF0A 1PCXA 2W2VA 1DXOA 1P7YA 2ZJZA 4AP6A 2GNAA 3JVDA 5IXSA 3D8HA 3UKDA 1E7YA 5I3ZA 3BWEA 2PL5A 4FSXA 2GEBA 3I5UA 4YN3A 4BMSA 3TKYA 3H5LA 3AR6A 3VSEA 4EFDA 1JHYA 3C39A 5BORA 1WWKA 2X3YA 3VTFA 3FGOA 5BYJA 3I6MA 3GLIB 2GXAA 2Y9PB 1LWNA 4PIVA 4O8CA 4RK5A 4EJMA 5KSYA 1SUDA 1F2VA 3PQ2A 1BRTA 1RFLA 2V74B 3QV1A 4NCKA 5HQTA 3TG2A 3VOAA 4UM5A 3DFIA 4D99A 1X7HA 2R79A 1A69A 4PRLA 1VXRA 2SNIE 3I53A 3A9VA 4ZEMA 1XD2B 1VLVA 3A1NA 4I0WB 2ECOA 2Q3MA 3F6RA 2NV0A 2H7XA 521PA 3UICA 4F46A 4AKEA 3AJRA 1G8FA 2AOUA 4MW7A 2Z83A 2C94A 3PDIB 3AUTA 4I46A 4JCCA 2JIRA 1KMHB 2G9QA 1FW6A 4Q82A 1YU6A 1L8XA 4Q4AB 1XVUA 4RK6A 1TQ8A 3X3HA 1M0WA 2GDJA 3BE4A 1MMFB 1OFUA 4LKOA 4MA4A 3QENA 4TVBA 4K6CA