3ILSA

The thioesterase domain from pksa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
265
Chain Sequence
LKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLIPHFTAVVDVMLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Hydrolase
molecule keywords Aflatoxin biosynthesis polyketide synthase
total genus 84
structure length 265
sequence length 265
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilsA00
2Y6VA 1W4LA 2I3DA 4QZVA 2WIJA 3G9XA 4FBLA 1FFEA 3K6KA 5AHXA 1R4ZA 5AK6A 1X2BA 1L7RA 1SCQA 2H7XA 1QONA 3VDXA 1VKHA 2FUKA 2QRUA 2XQGA 3C6XA 3FNBA 3WQHA 2WHRA 1RP1A 2W6CX 3ZWQA 3OG9A 1DQYA 3FSGD 2PVSA 1DT5A 4H7HA 4PV7A 4OCZA 2QR5A 4DTCA 4DM7A 4DMHA 2EDAA 1KEZA 2RAUA 1PFQA 1AURA 2GBFA 2PUJA 2EDCA 4QLOA 1EB8A 4Y2RA 4UHEA 4YX9A 4DMCA 1XFDA 5I9IA 1LNSA 3C87A 1N8SA 2WLSA 4YPVA 1G66A 2Y6UA 2ZJ7A 2JF0A 1XZFA 1B6GA 2OCKA 5CURA 1R3DA 4BP8A 3PUIA 1XKLA 5EIHA 2XQJA 4LYDA 2CJPA 2BKLA 1TAHA 5FPQA 4DGQA 2QJWA 4GDMA 1UT6A 2ZYRA 1CUSA 1LGYA 1XRLA 4K6GA 1CR6A 5EGNA 3IA2A 3QMVA 5JALA 1VZ2A 3QITA 5E4TA 5FUMA 4CG3A 4H35A 2VTVA 3U1TA 4TGLA 3DOHA 4YK7A 1MN6A 3SC2A 2QXTA 4MQLA 1E8NA 3NWOA 2VSQA 3OPMA 4MYDA 2QOEA 4RE5A 2JGIA 1Q0RA 5JZSA 1IMJA 3IUNA 1ACJA 2G5TA 3LS2A 3TRDA 2OPHA 2WFLB 5EHXA 3A70A 1ODCA 5EHZA 1LLFA 2JEZA 1VE6A 1Y7HA 4IH4A 1DU4A 1USWA 4MWTA 3L1JA 1BS9A 1QIHA 2HU8A 4X6XA 2J4CA 5LZ5A 3HABA 4J3JA 5JADA 4X95A 3FCYA 4Q3OA 3F8SA 1M33A 4UHHA 2WHQA 3WK8A 4X85A 5YASA 3CCCA 4G4JA 2WFLA 2GBIA 4B9EA 1DX4A 3DYIA 3DD5A 4DNOA 2WTMA 3ZI7A 4W1RA 1TCAA 3HC7A 1ETHA 1H23A 4UBIA 3R3ZA 3GUUA 2OXEA 3A2NA 4B6GA 4W1QA 2JGLA 5CMLA 1GXSA 1BROA 2PSDA 5EFZA 1XZHA 1TCCA 2IIVA 1K5PA 5AKYA 4BAGA 3BDVA 4L72A 4FNMA 4BP9A 2C0QA 3S8YA 3WMRA 2QS9A 5AKXA 5AKZA 4ZGBA 5HCUA 3TJMA 1BU8A 4U2DA 1CVLA 3VJLA 1BRTA 3WK5A 4XVCA 5BWBA 3DYVA 2XUFA 3ZLTA 1E66A 5FXMA 1HQDA 1GPKA 5AI9A 1K63A 4Z49A 3RARA 4BAUA 1O6FA 3C6YA 3TGLA 5F4ZA 5FP0A 3R3WA 2PSFA 5KWIA 4Y2VA 2WUEA 4RNCA 3MUNA 3EQ7A 4IH1A 2WFZA 2GYWA 4WFKA 4INZA 7YASA 1AUOA 1MX9A 4J0IA 3AIMA 2I3ZA 1A8SA 3GFFA 1TK3A 4XIIA 1GPLA 1XZGA 3K9BA 1CUFA 1XZMA 5JYCA 1GQSA 3DL7A 1HKHA 3ILSA 2XUDA 2WM2A 2VA9A 2XB6A 2VQ6A 2WIFA 4QLAA 3G8YA 4LXIA 2PU7A 1XLUA 3WWEA 4A5SA 3WI7A 4B85A 2XUIA 1ZJ5A 4UFNA 3WKBA 3FYUB 2W22A 1EK1A 1XZKA 2XQIA 3WL7A 3T4UA 2RHTA 5ALZA 3AZPA 4N8EA 1XQWA 5IVDA 2HDWA 5J3JA 2J3DA 3FCXA 5LLSA 2YYSA 4AXBA 3I1IA 1QO9A 4ZXFA 5DYYA 3Q8WA 4X92A 4KE7A 5JARA 2B9VA 4X93A 1LPBB 5CT4A 4L3WA 4C89A 4HS9A 5K3DA 4MQMA 2WSLA 5HFAA 3I2JA 1DQZA 3STWA 1QOZA 2QVBA 1UKAA 4B9AA 1H22A 5AI4A 5ALPA 1DWQA 2DFPA 2BUBA 3WKCA 1YS2X 4Y2JA 2ZVDA 3OURA 2PPLA 1EK2A 5E4JA 1JMYA 1ZGCA 3DQZA 2R11A 4KE6A 2XMZA 4WY5A 2CB9A 1NU6A 3I28A 5AH0A 1SFRA 4FLEA 4OU4A 2XLBA 2JBWA 2BFNA 1U2EA 4OUKX 1WPRA 1HL7A 2DR0A 3DKKA 4G8DA 5DLPA 4DMFA 4E15A 4UPDA 4UHFA 3ANTA 3M3DA 5AKLA 4ITVA 3FVRA 3N2ZB 5T4HA 3OC0A 3G9UA 5T4BA 4X00A 1QFSA 5AM2A 1A8QA 3F67A 5CBKA 3O4GA 1W76A 1AQLA 1C7IA 2JEYA 5SYMA 2VJCA 2WIDA 3D5EA 5JZBA 1F6WA 4BCBA 5ALRA 1BCSA 4X94A 3ZLUA 1XLWA 4ETWA 4NZZA 4U2EA 2OAEA 2HU5A 1XRQA 5HZGA 1MPXA 2D0DA 2CUTA 2Z8ZA 3G0GA 1DT3A 2WHPA 1MX5A 1UXOA 3P2MA 5LZ4A 1EDDA 4F21A 1CUAA 3ED1A 4WCVA 4X7BA 5AKGA 2P8SA 4IQ4A 5D3ZA 4OSEA 3W9BA 1QIFA 4JUIA 2XLCA 4J0KA 2XQFA 3O4IA 5ALQA 1YASA 3PDCA 1IVYA 4LKOA 3ZV7A 1QJ4A 2AJLI 5HQ3A 4J7AA 1XROA 4CIAA 1MJ5A 2VT7A 1VLQA 3WA7A 5KREA 2DHEA 1PV1A 5K3CA 1BN6A 4RGYA 4EY4A 4GW3A 4H0CA 3WK6A 2EEPA 1XLVA 2YASA 1UOOA 4BDTA 4DNQA 1JFRA 3IB3A 1NX9A 1LPPA 1K8QA 3G9TA 3DLTA 3I2GA 4IO0A 4DMKA 4GEGA 5C8VA 1EVQA 4N8DA 1OILA 2PSEA 4C4YA 5LZ8A 5HF6A 5FOQA 4KR0A 2JGJA 3AZOA 1BN7A 3GROA 5ALLA 2HRQA 5LP1A 2XMQA 5ALXA 4J0GA 5AKJA 2QJRA 5LYYA 4UBJA 5AK4A 3I6MA 5AIBA 1UKCA 2GYVA 4DSZA 2IITA 3O4JA 4GI1A 1F8UA 5JD6A 1QLWA 2HIHA 1PJAA 1FJ2A 2VT6A 3STXA 2C7BA 1XZJA 3LIPA 4QDUA 2BJHA 2WFMA 1GQRA 3H1BA 1NU8A 1ZI9A 1L7AA 3RM3A 2OAGA 1JT2A 5FPPA 1DWPA 4CCWA 5HF9A 3ZPXA 4PSCA 1ZD5A 2PL5A 5HKAA 4X97A 1IZ7A 5ALSA 4AO8A 1EDEA 4WFJA 1N5RA 1MO2A 1YB6A 3FVTA 3DJYA 1C4XA 3AINA 5ALMA 4UBNA 2HA2A 4WDRA 4IHAA 3IUMA 1CUJA 3R41A 4ARBA 2ZYIA 3ESDA 3QPDA 3FLEA 4MWSA 5HQ3B 2VAVA 4C87A 3WWOA 5IH7A 4RE6A 4HXGA 4U2CA 4C4ZA 2WG2A 4HXFB 3DEAA 2DSNA 1W6RA 2H9YA 4BZZA 3G0IA 3BJMA 3G7NA 3KD2A 1I6WA 3FWHA 2CEKA 2WQZA 5JATA 3FYUA 4C01A 4ZI5A 2AJ8A 4Y7DA 4KAJA 4Y2UA 3QH4A 1AMNA 1XKTA 3F98A 4A23A 2FJ0A 4FLMA 1EI9A 2AJCA 1WPXA 5CRIA 3C8HA 1E89A 3H2JA 3I6YA 1LPAB 2X5XA 3PF8A 1AX9A 2HL6A 2FJPA 4FKBA 2H7CA 3STYA 3W05A 2C4HA 1YS1X 4ZRDA 1RYYA 3WWDA 1JKMA 5JAPA 2JGEA 1YA8A 5K3FA 1YCDA 3WKDA 1EVEA 4UHDA 3VJMA 3WYDA 4Q3KA 2WHPB 4UHBA 1UKBA 4C88A 2ZJ6A 3IIIA 4FNGA 4ZREA 3VJKA 5ALVA 3X3HA 5AM3A 2XUKA 3I2HA 3QZUA 1SCIA 3JW8A 3NUZA 5AM1A 5JAHA 5AM5A 2PKYX 2JIDA 5CT9A 3I2FA 5CW2A 4BRSA 1TKRA 3BWXA 2WU3A 3WK4A 4DLNA 2WILA 2HA3A 2B4KA 4Q3LA 5ALFA 3WJ2A 1C7JA 3K2IA 2RONA 2BUAA 3C43A 5ESRA 2WKWA 5ALOA 3IDAA 3UMJA 1FFDA 2XI4A 3EBLA 1QO7A 1EA5A 4LYEA 4A16A 1BE0A 1LPSA 4J03A 3SWWA 3G0DA 1U4NA 2H7YA 1GGVA 1Z68A 4ARAA 4E11A 4QDOA 1P0MA 1QGED 1DWOA 1LPOA 1GKKA 4J0DA 1Q0ZA 1ZI6A 2HFKA 4QA9A 1EX9A 1UK6A 3BL8A 2OG1A 4F60A 1UZAA 4Q05A 1HDEA 3DL4A 1VA4A 1OXMA 4P93A 3R3UA 1VA5A 1CV2A 4FMPA 1ZIYA 3C5VA 4I3FA 1LPMA 1Y7IA 1TIBA 2OLEA 5FRDA 3C45A 1CEXA 1XRNA 2O2HA 1CUWA 2V98A 1CLEA 4OB6A 4EA6A 2XE4A 3HRHA 5K3EA 5HKBA 1CUEA 6YASA 3C5WP 2WJ3A 5AKIA 1P0QA 2ZSIA 3QMWA 2CKMA 4N5HX 3WWPA 1ORVA 1QIJA 1FFCA 1AGYA 3RLIA 4BDSA 1JJBA 5DWDA 4TPKA 1CRLA 1ZD3A 4AZ3A 4CG2A 2I03A 1QIGA 2Y2UA 1E8DA 5K3FB 1HLGA 1XQXA 1P0IA 2ZYHA 5ALEA 5LIPA 3A2LA 3D2CA 3BIXA 5JZ9A 4FWBA 1W52X 3BIWA 3MVEA 1HPLA 5DTJA 2XMGA 1WM1A 3H17A 2O7VA 2VJBA 3F97A 3VISA 3U0VA 2GBCA 5BV7A 5DJ5A 3UUEA 1H2YA 3H18A 5ALNA 1Q84A 2G4LA 4QWMA 4GXNA 5BWCA 5C81A 4LIPD 4M0FA 5AK5A 1IZ8A 4MEBA 3H0CA 2GYUA 2J4FA 3H2IA 1ZOIA 1MNQA 5C8ZA 4BCCA 5T4EA 4Q34A 3BDIA 4FTWA 1SOMA 1XZCA 4UBMA 2CZQA 4H18A 3O95A 4FFWA 2PUHA 4AZ0A 2BGRA 5ALIA 5CT5A 4GLBA 1GZ7A 1FFBA 2HA0A 2OCLA 2HFJA 2RI6A 1THTA 2D5LA 2AJDA 5EI5A 4FDMA 1TCBA 1UK9A 4UBLA 1D07A 3ESCA 2RHWA 4NMWA 3H2GA 2FX5A 3BXPA 1JMKC 4QNNA 3PF9A 5AJHA 5LZ7A 5ALGA 3B5EA 1XZIA 3E1GA 3G0CA 1IUOA 3WL8A 5CH5A 3OTQA 1QIKA 4AB1A 5A7FA 2WUFA 4G9GA 4EY7A 1ISPA 3R3YA 4M0MA 1G42A 1YR2A 5HF8A 3GA7A 3O9MA 1YA4A 3AIKA 2VF2A 2OGZA 5JIBA 1CUXA 4DSAA 3R0VA 3H2HA 1F0PA 3AZQA 4PSUA 2DQZA 3FOBA 5AKHA 4Y2XA 1AKNA 1QFMA 3HI4A 1TRHA 3DDUA 5T4FA 4U2GA 4W9RA 1N5MA 2V97A 4WJLA 3O0DA 2WU4A 5FDFA 4BC0A 2K2QB 2WUDA 3IULA 4QWWA 4ROTA 1GKLA 3AFIA 1ZGBA 3EQ8A 1YB7A 4NS4A 2V96A 1RWQA 2HA6A 4JEIA 4BCDA 2WG0A 2OCIA 4QEKA 1LPNA 2DHCA 1FFAA 4AMZA 1VJ5A 4EY6A 4MJ3A 2QMQA 2UZ0A 2XUAA 1CQZA 2XUHA 4FBMA 1XZAA 4G8CA 4U2FA 1VOTA 3M82A 3QM1A 3AUKA 2YH2A 1ZICA 3PI6A 2XUGA 4Y2TA 1O6GA 4P08A 3IVMA 5K5EA 4HVTA 5CH3A 3EIOA 3O9VA 5AOAA 3A2MA 4D9JA 1KU0A 1VE7A 1ZJ4A 3HLKA 5H3HA 1UOPA 4ZV7A 3B3QA 4EBBA 3CCBA 1A88A 4PF1A 4EUSA 2JGFA 4G4IA 3D4LA 1R88A 1UK7A 1X2EA 5AKEA 5FV4A 3WYNA 4PNZA 3CN9A 4BZWA 2LIPA 2WIGA 1LBTA 5A71A 2RGUA 4G4GA 3R3XA 1BCRA 4KAAA 3H04A 4H7KA 5DYWA 3STTA 5ISMA 4X71A 3V9AA 4QDZA 4G8BA 1DINA 1DTEA 3NOXA 3D7RA 5ALTA 1G4HA 4AO6A 2AJBA 4HTAA 5K3BA 1UK8A 4BVLA 5JAUA 4KAFA 5JASA 1MX1A 3KWJA 2O2IA 4Q82A 4X6YA 4QE3A 3QMMA 3V1MA 4K2AA 5JD5A 1XRMA 4AN0A 5AI5A 3SX4A 2NW6A 4KJXA 4G9EA 4L9AA 1MAHA 1ODSA 1QE3A 1XZLA 4I19A 2QZPA 3KSRA 4XX1A 5AI0A 2E3JA 2Q0XA 4Y2PA 5K3AA 4OB7A 1QIDA 1WB6A 3W06A 3DOIA 4AMYA 1WHTA 1HBJA 5BOVA 3KWFA 1XZBA 4BTLA 3QVMA 4EB0A 1CQWA 3WZLA 5DNWA 4CIBA 3I2KA 4Q1VA 5EIEA 1JU3A 3G9ZA 2GZSA 1LBSA 3D3NA 5IVKA 3IUQA 4AX4A 1JJIA 1LZLA 1IUPA 5DNUA 1UWCA 1CUYA 2XMSA 1QZ3A 4ZV9A 3C8DA 3FAKA 3MGAA 3QBJA 1WCYA 3LP5A 3EF3A 3W04A 4GECA 4MXDA 2OGTA 4XWGA 3LLCA 1WOMA 1F0NA 3STUA 1LZKA 1ODTC 3D2BA 1VXOA 4G5XA 1ZD4A 2XUPA 1A7UA 4OD0A 3HSSA 1CUCA 2WG1A 1MAAA 2HHAA 2G5PA 4EY5A 4HRXA 2XUQA 4UBOA 5KBYA 4H77A 5CXXA 4X91A 1R9NA 1S8OA 1H2WA 5HFNA 3W9UA 2VEOA 3VVLA 1ZD2P 4X6UA 1QTRA 2QM0A 3ESBA 4KEAA 1P0PA 4KE9A 1YAHA 3JYHA 1ZIXA 3WL5A 4FOLA 2ONCA 3VXKA 2OGSA 1FSSA 2O7RA 1L7QA 3C6ZA 4UBKA 3WJ1A 2HA7A 1EXWA 4HAIA 4K6KA 2XMRA 1WB4A 2XT0A 3IUJA 3PUHA 3DNMA 5CH8A 2ACKA 4L0CA 3M81A 3PICA 4J0JA 1MNAA 4Y2YA 1JJFA 2QUBA 3UUFA 2PU5A 5FLKA 4AO7A 3QYJA 1AC5A 5ALUA 4PW0A 5D7BA 4O08A 4HXEB 4CFSA 2QUAA 3L1IA 4BBZA 4WDQA 5ALKA 3WWCA 5A62A 5I8PA 1N1MA 4B82A 4QDXA 1WB5A 5AOCA 2QT9A 3WK9A 3QPCA 4H7IA 3C6BA 3A6ZA 4K5QA 1E5TA 4W63A 4W1PA 5I7UA 2WIKA 3BJRA 2XUJA 3V48A 5EIAA 1K4YA 4BB0A 2HA4A 2QTBA 3CN7A 3WL6A 3ZLVA 5ALHA 1ACLA 5LZ9A 1U65A 5CTAA 5C7YA 3QPAA 1U8EA 5HK9A 2ZJFA 4BVJA 2WTNA 4BC1A 5LKRA 3FLBA 3W2TA 2CBGA 4RPCA 3F9CA 3KOOA 2X76A 3H19A 1XZEA 2GZRA 5A2GA 2XMBA 4P92A 3RK4A 3WK7A 4B0PA 3H2KA 1JI3A 4GHWA 4B81A 5ALYA 2B61A 4BAZA 1VXRA 4CCYA 5AKKA 2VATA 3KDAA 1CUUA 5AP9A 5JAOA 1VZ3A 1QIMA 3D2AA 5AICA 4C6HA 3JWEA 2QKYA 2VJAA 1MTZA 2VAXA 4BATA 3SK0A 3F96A 5E2IA 3KXPA 4H7DA 3R40A 5AIAA 3BE8A 2J3QA 2C0PA 4N5IX 3DCNA 3PE6A 2Z5GA 2XQKA 3FLAA 3AJAA 3PFCA 4OYLA 2HA5A 2Y2VA 3R3VA 4M0EA 5CXUA 2PSJA 3H1AA 1CFJA 4H7EA 2O2GA 1X70A 4X90A 5A7HA 3EQ9A 1MU0A 1G5FA 4E14A 3OM8A 5C8XA 1H2XA 4BTVA 4EHBA 4JH0A 3Q0TA 3LCRA 5ALDA 5AI6A 4WFIA 3E0XA 4K6HA 4G1FA 4U2BA 1GT6A 3V1NA 5A7GA 2ZYSA 2ZSHA 3IBTA 5DYTA 4P9NA 4Y9SA 4UFOA 3ICWA 4W1SA 2HU7A 4B80A 1T2NA 1EHYA 1QIIA 3FSGA 1EH5A 1Q83A 2PM8A 4GBGA 4UUQA 4S0XA 1H2ZA 1CUBA 1TQHA 1GPNA 1THGA 4FFVA 5IKXA 4YASA 3GZJA 2BAGA 2HADA 3L1HA 5CT8A 2DHDA 2BCEA 4B7ZA 1CUZA 5D3KA 2CMFA 5AK3A 2RIPA 4CG1A 4PSDA 2VJDA 4E46A 3V1KA 3FYTA 1T4MA 3STVA 1EINA 2I78A 1CUDA 4MYSA 3E4DA 2AXEA 3WIBA 4KRYA 2HRRA 5IVHA 3ICVA 3E3AA 4B84A 3BF8A 1UFOA 2PSHA 4J0HA 2WUGA 4UFPA 4AN1A 4LXHA 1JU4A 4Y2SA 4DIUA 4JNCA 4LHEA 2XUOA 4DNPA 2H1IA 1CUHA 4FHZA 1BEEA 1XRPA 5A6VA 1XZDA 1OCEA 5HF5A 3I2IA 4QDTA 2GBGA 2HM7A 5E4YA 1WHSA 4BVKA 3HJUA 1CIJA 3ANSA 2YXPX 2PBLA 3DS8A 1J1IA 3HYSA 3WZMA 1BEZA 5CT6A 2Z8XA 5ALWA 3WA6A 2C5FA 3WIOA 3AILA 5JD4A 2WJ4A 5DNVA 4LXGA 1W75A 3CXUA 3WLAA 1A8UA 4B83A 1ORWA 2ROQA 1R50A 2B20A 4F5ZA 5AM4A 4ZWNA 1EB9A 5AO9A 1K6EA 3B12A 1W1IA 4F0JA 3IURA 3VKFA 2DQYA 4CI9A 3NGMA 4OU5A 2JGKA 2X8BA 4BYMA 3I6ZA 3C70A 1CUGA 4V2IA 2XMCA 2WJ6A 1MT3A 5FKJA 1EDBA 4DNFA 3VVMA 4H7JA 1ZI8A 4H7FA 2ACEA 3HXKA 1AZWA 2ORYA 4UHCA 3WKEA 4TVKA 3M83A 3S2ZA 5IVIA 3FYUC 1XRRA 3HEAA 4JYMA 3G02A 3D59A 4N8SA 3AIOA 1SC9A 2PX6A 3PFBA 1YSCA 1UOQA 5AM0A 3O4HA 3ESAA 3GELA 5ALJA 3OOSA 3GBSA 1E3QA 4Y2QA 4MEAA 3TEJA 1CUVA 3DKRA 1R9MA 5HK8A 4KACA 2QXUA 2G63A 5SYNA 2IX9A 2Z3ZA 2OCGA 4DYHA 4BE4A 5EHNA 2XMDA 2OQIA 1KU6A 4BRZA 4CCYB 4PO3X 4NVRA 3RKSA 2BUCA 4WY8A 1B41A 4PQEA 3G0BA 4KE8A 2R8BA 1R1DA 1XQYA 3T52A 2JGMA 3LIIA 1CPYA 4HZGA 3N0TA 5LKAA 5DTIA 1J06A 3YASA 3HZOA 1E8MA 2V9ZA 4GWLA 5KWJA 5EHQA 4EZIA 4XJVA 3I1YA 5JANA 4KYVA 3MUOA 2ECFA 1CUIA 4OYYA 2BGNA 3HACA 4FLFA 3BF7A 3FBWA 2DCMA 5AOBA 1Y37A 1DX6A 5AI8A 4AQDA 1IUNA 4JYPA 4HRYA 2ES4A 4EY8A 2C5GA 4C4XA 1J07A 5LZ2A 3D0KA 5D6OA 2OQVA 1XQVA 2XDWA 4OB8A 1QTIA 1SCKA 4I4CA 2Z3WA 1YAJA 4KRXA 4J0CA 4OPMA 2C58A 4B0OA 4IH9A 2Y1KA 3V1LA 1J2EA 1QIEA 3WKAA 4BE9A 4X3CA
chains in the Genus database with same CATH superfamily
3IKVA 2M6RA 4YFVA 3QLJA 4XGIA 2O0MA 3PHLA 3GHYA 2HBZA 4P98A 3OAAA 4YCBA 3AJ9A 3GI1A 3Q6IA 4RCYA 3VNQA 4IIBA 5JG7A 3D3EA 1A71A 4EHLA 1N2ZA 4EEZA 1FFEA 1GN8A 5I9NA 4OGWA 5EJEA 5AK6A 3PC2A 4XPIB 2JFVA 1BX3A 1T8UA 2H7XA 1E1YA 1P1FA 1S02A 3JQDA 2ZULA 4LA4A 3TRIA 3VDXA 2X77A 4R2LA 4TYQA 3PYLA 1VKHA 2C5SA 2QRUA 1E1CA 1FW8A 5JS2A 4IOJA 3C48A 3HBJA 3ZWQA 4E31A 3FFTA 3N8DA 1G2IA 1NN1A 4PX9A 4REOA 1RACA 1ZN2A 3Q4GA 4DCMA 4TXJA 1ZC3A 3ZY5A 1FMFA 3EDOA 1Q14A 3PQFA 1DT5A 4H7HA 5AVKA 4URFA 5FFNA 2QA5A 2KE5A 4OCZA 3SYRA 4Z7NB 1M0EA 4DTCA 3F6EX 4CG0A 4DM7A 4W5TA 3O7MA 2IS4A 1KZHA 4N9QA 1VG1A 1XR3A 3EZ9A 2YRWA 3PENA 4G5QA 5F1KA 2VP2A 1ZKDA 3EDMA 3K6RA 5C32A 5EMKA 3D1JA 2YWRA 4ZO9A 2Q7DA 1T10A 3QXJA 4BLQA 1V6SA 2QL7A 2PT9A 1OX4B 4FMDF 3H8WA 4LRSB 1LDBA 4ZALA 3VYSB 4EG6A 5I45A 1W0JD 3V97A 1GG9A 2QX8A 1Y3CE 2H9AA 2Q9AA 4UHEA 4WK4B 4ZD6A 2QZZA 4YGYA 5LA6B 3WYGA 3ZCPA 3L4JA 4I4LA 4ALLA 2AC4A 1MVOA 1MOSA 1P7VA 2DC1A 4NAVA 4MW2A 4B6JA 1DC4A 4X1OA 1JEDA 2R4TA 4B7AA 3NNSA 8ADHA 1Z4MA 3L6CA 5L6LB 2JF0A 1UDCA 2NZUG 4JUAA 1B6GA 3RBVA 1VIDA 3EC7A 2CFRA 5LU9A 3K71B 1L4UA 4HWGA 4GI3A 2W2LD 3IESA 3PUIA 4DY6A 4LYDA 1M6WA 1OXSC 3GFVA 1SCNE 1VHWA 5AVOA 1NVDA 3IXLA 3QRWA 1E96A 2OA0A 3VDRA 3RFFA 5FPQA 2NXJA 1PR4A 4IHJA 2QJWA 1ZRSA 3KQOA 3VH4A 4B40A 2BEUB 2OMEA 4X63A 1J90A 3MNFA 3R8FA 1E20A 1X7ZA 4B3FX 1QWOA 4HNAB 1ZGZA 5IAJA 1M67A 2Q9CA 3T9AA 1PL6A 1YZYA 2G8NA 3M7IA 5DX8A 3MBOA 5BPFA 4DG8A 1CUSA 1XCBA 3FUUA 4K6GA 5EGNA 2JHCA 3K30A 2AG5A 4FX2A 2H63A 1C4OA 1KYYA 1RKVA 3LE8A 3MFYA 1GZSA 1H4TA 1BJRE 1YOBA 1SVNA 1NVXQ 1WE2A 3U1VA 4RV5A 3W8DA 2P6NA 4RTQA 2OO3A 1PK7A 2Q1SA 2VHUA 2VTVA 2ACWA 3IDOA 4JZKA 3TTYA 4RTKA 3DOHA 2NAFA 3HXQA 3B7PA 1NLFA 1RTTA 3FPJA 2G1JA 1KDRA 1Y5MA 4NBLA 4JLMA 3HXOA 1RI4A 3IP9A 3G5UA 3OLXA 4J3FA 2ODBA 1ODKA 3GG9A 4RVNA 4TLDA 5H70A 2VSQA 4DEYA 2PKQO 1U0HC 2XEDA 5FWNA 4EF5A 1G20A 1I4EB 4UTZA 2AZ4A 1AN0A 5IUJC 2JGIA 3GLGB 3RRMA 1ADFA 1QS0B 3C3JA 2V5UA 4WXRA 5L6MB 4OLFA 2VQFB 1WP9A 1XTQA 3DW3X 4DBVO 3D6FA 3EWSA 3P9SA 3A3PA 5AW0A 4W7SA 3ASVA 2YVKA 1DC7A 3EAFA 4UCWA 3PD0A 1VDZA 1T0BA 3N8IA 2CNLA 3BXHA 1LW6E 2J0VA 1QGOA 4AXXA 3OZDA 1LBEA 3VR3A 3COSA 1R18A 3HEMA 4C4AA 1M6VB 1ZK1A 3FI9A 1LK5A 1H5NA 1NASA 4XASA 1KVTA 1QHYA 1ODCA 2HMYB 3GH1A 3DUFB 3HCPA 4CTNA 4EI2A 5EHZA 1TEVA 2VLIA 1U0GA 2JEZA 3ABIA 3OMWA 1DJNA 4BRWA 2CE7A 2OUIA 3HZZA 1DU4A 2KJQA 3RTBA 1LNQA 3TKLA 2VHTA 4CR8A 4KIUA 1OH6A 1USWA 3DDCA 3GPCA 4H3KB 1XU9A 1VHLA 1U0LA 3OT1B 4QVGA 4OOEA 3KUUA 3VUEA 3L1JA 1CQIA 1QWSA 3TSAA 4DFDA 4DPKA 1SXQA 2E85A 2JIRA 5FFMA 2HU8A 2PT5A 3L6EA 1X38A 4X6XA 3KYCA 1X3LA 5LZ5A 3WLNA 4CMGA 4QGHA 1D8TA 2X7HA 4EL0A 3ETDA 3NM6B 4LJRA 4LCJA 4J8PA 5FBHA 1PYDA 3P7MA 4TSRA 1J9ZA 2C8KA 1J70A 5KEIA 4A8PA 2VTDA 1ICEA 1M2FA 2YXEA 2YZKA 3F8SA 4K81B 2VI5A 4Q3OA 4ZANA 4EVQA 2GB4A 3PXCX 1KMHA 2PVCA 3GRAA 4QAQA 4I3GA 4NOKA 3WK8A 2ESRA 2P30A 1R4NA 3L3BA 4Q03A 5YASA 3VR6H 3M9XA 1GFZA 3CCCA 3D3WA 4OTZA 2RK6A 4A2QA 1Y3FE 3MAJA 5LIRA 1Z6TA 3FCOA 2JZCA 1MIOA 5FT9A 4B9EA 5ITSA 2FZ4A 3DYIA 2AMLA 3EEYA 2AZXA 1E69A 1WJGA 2UAGA 4CR7A 3UJBA 2B4TO 1TTQB 2I3AA 4MRNA 4UU1A 4DNOA 5KC9A 5HWSA 3MTGA 5JNRA 1ICIA 5K09A 3IJRA 4TV9B 4RTSA 3EPJA 4NFYA 2AN9A 3MMXA 1ETHA 1H23A 1YZNA 2QTLA 2ZIZA 4DQKA 3DE6X 3Q7TA 1BXRB 3GUUA 3PI7A 2GRAA 2GM3A 1OLSA 1OWPA 2ZI5A 4B6GA 1RWXA 5JNVA 2D54A 3W1VA 3ZU5A 1DEHA 3TUJC 1Z73A 3JZAA 4R6XA 4AYTA 5EFZA 2IGTA 3UMVA 2A88A 5FHQA 1YVEI 2H31A 1X7XB 3N0XA 3DYBA 3OICA 1TCCA 3D4IA 4FGZA 4XIFA 3UOWA 4HNVA 2H52A 2FW7A 5AKYA 5ARDA 2KS6A 3BDVA 4GP9A 4BQQA 3VH3A 1NWHA 4FNMA 5JFGA 4IIUA 1NSFA 2HWUA 2CDCA 4C7MA 4RULA 5KTRA 1Y6ZA 1C3XA 2Q5CA 1I80A 2EEZA 3CRQA 3T1YB 3DUWA 1JPUA 1BU8A 1QV6A 4FONA 5F73A 4D26A 3OCUA 4I4NA 2W7TA 2R97A 1ZNXA 4WJZA 2CMGA 4CMEC 2MSCB 4NH0A 1BMQA 2DQKA 3SNKA 3TRFA 5BWBA 1IEQA 1M2WA 3EIUA 3Q3HA 3DZHA 4KK3A 3EAQA 4DWWA 2AEFA 4EA7A 2FMTA 4TV8A 3H5OA 1E66A 3OFKA 2FN7A 1XDZA 5FXMA 3GT3A 3E1KA 4OLBA 3IL2A 4Y98A 3FNGA 1X1QA 3HLYA 1P72A 2IYWA 1VLHA 3EVEA 4Z49A 1O94D 4TKUA 5I7RA 1PHPA 2R7KA 1NR5A 3K0BA 1YUMA 2FVYA 4BAUA 1SU4A 2IH4A 3LX5A 1KP3A 5FP0A 2TMYA 2VNHA 1GGEA 2B1GA 3O3OB 4QICA 4X5OA 5JV5A 5HIMA 5IUNC 4GFDA 1VCOA 2J5XA 2IYTA 1T5LA 1Y89A 3VVCA 3WNQA 4DUYB 5ETJA 3EQ7A 4LN1A 4URUR 2WFZA 2GYWA 3DFUA 2P4HX 3SZUA 1AGPA 1U80A 4INZA 3LKVA 1A9ZA 1PGPA 4PM4A 1H5QA 3UAYA 4J0IA 4MR8A 4RMNA 4L28A 1WMAA 2BHSA 1Z26A 3IBSA 5FJJA 1QGAA 1ZD9A 4UMVA 1JQBA 4YAKA 3GFFA 3PDJA 5HHTA 1DAGA 2BONA 4XIIA 2GN6A 4F3KA 3CT6A 4MV9A 4L85A 1Q20A 5CU7A 1Y4UA 2YW9A 2ZOSA 1VSBA 2CSXA 2BTQA 2W6QA 5FLEX 1JECA 1BWRA 2D4AA 3K9QO 3BXGA 2IPOA 1EK0A 1YR8A 3BD9A 4NLLA 4A2PA 1GQSA 1TYEB 2JFGA 2XUDA 4PTLA 4WZBE 1BDIA 5G1NA 1M34B 2XB6A 1OC4A 5FAXA 4XWKA 3U3DA 4DJAA 4DB4A 1ND5A 1XHEA 2VQ6A 3PC8C 3E3NA 4QLAA 4RXUA 1S0UA 2PU7A 4WGFA 2FN3A 1X1AA 4QEZA 3WWEA 1KH2A 1MA3A 4A5SA 3WI7A 1NZJA 2JFBA 1JEEA 3PQ2A 4FP9A 4PG5A 1H4SA 3LD9A 4L8WB 1M66A 4MI1A 4S1TA 4Y9DA 4WKOA 3TW6A 4ZAGA 1ZJWA 4KOEC 4B85A 1U7ZA 3U1BA 1WA5A 3WKBA 2AR9A 2IZ7A 2QPLA 3X1ZA 5A2QA 2NG1A 4MLZA 2JRCA 1VPWA 4QPJC 3VR4H 3N3AC 1XZKA 1SKYB 4WD3A 3ZX5A 4CKZA 1C8VB 4MHOA 2VHWA 3WL7A 3EVDA 4IICA 2CVZA 2M6LA 3Q0IA 3C1UA 5IHXA 3K7EA 3RE1A 5ALZA 3PLNA 2V5VA 4JQZA 4KQ6A 3OO0A 3B20A 1BGWA 1JT9A 3GZ4A 4U7GA 4ARVA 5IVDA 2P4QA 3OQPA 1VE9A 3K5IA 3WAJA 1Z0DA 3E9MA 1NR1A 1ZM3A 3EN0A 2VPWA 1JV2B 1FZQA 5LLSA 3W78A 4PLFA 1N2CA 3FTFA 1BVRA 4UVEA 1FNSA 3V7YA 1Q3HA 3AV0B 1S9DA 1CIPA 3ROKA 2B9VA 4NMLA 4HNGA 5GONB 3L5OA 4TTJA 2ATIA 1LPBB 2IOFK 4DADA 5B55A 2O5CA 1VI2A 4C89A 4HS9A 4BE7B 4V03A 2O3RA 2WSLA 3L04A 5IBRA 4Q4AB 2DM6A 2J46A 3D7SA 2O6LA 4OHYA 5JYEA 1W93A 4AKIA 5BSTA 3L5KA 3STWA 2PYZA 1QP4A 3B1ZA 2H2AA 3C4VA 3M6FA 3L0PA 4HH1A 2XGJA 2ZU6A 4JLPA 4KR9A 5IF9A 3C24A 3LTNC 1UKAA 3GMIA 3JSXA 4B9AA 1KIMA 1FRFS 2VP3A 2X9QA 3ST7A 4CLOA 1FS4A 2CF5A 3P4XA 4LJ9A 1U0EA 3EZXA 4UMFA 3GUZA 3SBOA 2HF9A 4D3ZA 2DFPA 1DTWA 1WZUA 3C7CB 2FFHA 3JQPA 1VPTA 1LVHA 1FYWA 2PPLA 3WLIA 4V39A 4GKVA 4QPZA 1QQTA 2E4AA 4YRTA 4BVFA 4IG9A 4PHHA 4L76A 1DHTA 3OKAA 1UAYA 1MIHA 4MUJA 3AP1A 2GLTA 3FOCA 1IIRA 5DN9A 3T34A 2PA3A 3BA6A 3DV0A 3TZKA 2QIPA 1W47A 1SQ0A 4KE6A 4ALJA 2XMZA 2EFJA 4WY5A 4AY2A 2OECA 3O31A 3PRYA 4LVNA 1NU6A 2ZBQA 2NO9A 4JI5B 4DIEA 1SFRA 3ASZA 3GA0A 4FGLA 1UDXA 2H51A 3RU9A 4KJZA 1VDMA 1C29B 2O7SA 1PGNA 2I33A 1A9PA 4ND2A 5IF3A 5EJ8A 1OXUA 2WF9A 3VO2A 2YV5A 2HEGA 1IM5A 4MP6A 2OM2A 2AN4A 3DVLA 3T3MB 3DV0B 1VB5A 4R05A 4OF4A 2OKGA 4R2HA 1W25A 3LLVA 4FT2A 4UPDA 4UHFA 1AT1A 3TNYA 2UYYA 1JXOA 3MTIA 5AW4A 4FMCF 2PO5A 3N2ZB 3NCHA 8ATCA 4U7HA 3JRXA 3HKBA 2GXUA 5ENZA 1QLJA 1XMJA 1FYXA 2V7WA 4JEUA 5D84A 5LNK6 2JJMA 4HFNA 2O50A 2VSFA 3LA8A 3Q8MA 3SKXA 5T4BA 3DKVA 1BRMA 1C1XB 2JIZD 2CB0A 4JFRA 2RHJA 4UHJA 2P9ZA 3WGVA 2KB0A 4TV8F 4I6JA 3HS3A 3OIFA 1GYRA 1RLOA 3PVZA 4IMRA 1P7ZA 2TYSB 3PQEA 3VYWA 3AUJB 3H9EO 3DE2X 4JT8A 4K9SA 3IMCA 2GZ3A 3CHYA 5K2MA 2B8JA 4CDRA 1Z35A 4KBFA 5BRAA 2VJCA 3OESA 5HVNA 4MV0A 4DM3A 3F8TA 3DCIA 2WINI 3ORSA 5H4HA 3ZU3A 1UPBA 5DHUA 3ZDFA 1KMHB 1JUDA 1OFUA 2A0UA 2FK8A 2JVIA 3DP9A 1ENZA 4R3UC 1F38A 1C4WA 4HUQB 3ZE1B 4JK3A 5H9WA 5I48A 1BA2A 1X3SA 4X8HA 1XJCA 2A5JA 3SXUA 4U2EA 2YIMA 3CG0A 4LQ4A 4BGUA 4DAOA 5HZGA 4PYJA 4XRRA 4N0PA 3L8ZA 4DXAA 4E6EA 1JRLA 1E58A 3ZQKA 5DMHA 5F7ZA 4YRLA 1BE1A 4JUCA 1NDQA 1UBEA 4B2IA 5KYXB 1GA4A 1A5BB 3OT1A 4O4LF 3P2MA 1OGYA 4GKAA 5AVSA 3I4FA 4X7BA 4JGIA 1AO3A 1I9CA 4WCVA 4E4RA 3L43A 4RMIA 3KT8A 2NTJA 1QHHB 1RHJA 2P8SA 1X14A 1D1SA 3ONFA 2F48A 1S2LA 5CG2A 2BLNA 1L5YA 1GQYA 4FDLA 1RM3A 3ZXXA 4UAVA 4ENVA 4BNHA 1IZZA 3ZIAA 2QLBA 4D7AA 2IHYA 4UU7A 2W6JD 5DT2A 1KZ9A 4L2IA 1V3VA 3QNWA 3LCUA 3VSDA 4EPRA 5AW1A 1O0CA 1QQBA 3V46A 1TECE 2XQFA 4DLVA 2O48X 1PF7E 2W4IA 1PG5A 4HCJA 4R8MA 2DWQA 3PPXA 3PHGA 4YLYA 1YASA 3ZHBA 2PHZA 1TPYA 1IVYA 2QVZX 2QNBA 3TFWA 3J81k 4Z53A 1U3CA 1V8FA 1ZYUA 3BFVA 1NFFA 4YT2A 1BCRB 5JQWA 2I4NA 1N9GA 2Y3IA 3CUYA 4IGAA 4QAJA 1QJ4A 3CF6R 2AJLI 3V8NA 4TWAA 5LP6B 2CXRA 2I7CA 2OTCA 2Q5FA 1HE1C 3ICOA 3LRTA 4YGXB 4CQJA 4EYKA 3QW4B 1R12A 1JQAA 4JP2A 4LZLA 1CJTC 2HCBA 3EEQA 4RGYA 3MMSA 3G2LA 4GW3A 3E9QA 4ZAWA 2P2NA 3PL1A 4HR7A 5BNWA 2JI4A 1XLVA 3G0HA 1J25A 2AOTA 4JYBA 3AL3A 1YDHA 3BBPA 1QR6A 2PX0A 2ZITA 1BKDR 4LQDA 4BDTA 2AZDA 2JDIA 3KAPA 2FW8A 1JFRA 2J87A 1ZONA 3FLMA 1JXAA 1BIFA 4JCCA 4Y6RA 5F2KA 5HR5A 1T3ZA 4KMOA 3B9QA 1GOTA 4RK4A 2PA0A 4R2WA 3W2EA 4FYPA 1UC9A 3TLXA 3DOCA 1JR3A 1JXMA 3GPLA 4UJ3A 3DLTA 3VOAA 5TMEA 3B5JA 1KEEB 1DX9A 3WOVA 4IO0A 5FR2A 4O5AA 1LBQA 4DMKA 4GEGA 3M34A 4LJSA 4NX2A 3ADCA 3LP6A 1UAGA 2QY9A 4N0QA 5TMPA 1OSNA 2J3LA 1J5XA 3RI3A 3NLLA 3COVA 1EVQA 4QO8A 4BX8A 1RMYA 2F1OA 2OKCA 1AKVA 4HQNA 4I1VA 4YWHA 3NWBA 3ZYCA 5BN1A 5FOQA 5ERXA 2DYKA 4RJKA 4KN5A 3U40A 3ZQ4A 1AN9A 4IILA 3BZWA 4INJA 1K4MA 2WD7A 1VG8A 1VHJA 5ALLA 3LGSA 3H1PA 5AJVB 5LP1A 4JBXA 2XMQA 3ELWA 5KWSA 4CTJA 3ENNA 2P2CA 4IIVA 4BVHA 5U9CA 4D9HA 4QBFA 5AKJA 3THXA 3BMQA 1ILEA 5CJPA 1UKYA 5FJIA 4FWTA 3QEJA 3W3AA 3ER6A 2RB4A 3MWGA 2W6OA 5TVGA 4D3SA 5AIBA 3N2EA 3R7DA 3O26A 3MTAA 1A4IA 3C3WA 1ZPDA 1K66A 4TMTA 2XA9A 1L4YA 1X9IA 1Z4IA 4RKYA 1Q1ZA 2G77B 3V8EA 1OH7A 4OQNA 2V0CA 2IITA 3B48A 1PNTA 1LV7A 3P4YA 4FW8A 2NUBA 3D4BA 4QOJA 3UK7A 5J2TF 1Q3KA 1DIOB 3H42B 2FZ5A 4OQXA 3ACDA 3EZGA 4QUJA 4TSKA 3TSYA 1CQXA 2Y05A 3SS7X 4CMAA 4NYJR 2CHEA 3PC8A 3RC9A 2QE7D 1V3UA 1EHIA 5BYBA 1E3IA 2H0RA 4X1KA 1DC8A 1A04A 1FJ2A 1GUAA 1VCHA 2WKQA 3CT4A 4WZAA 1KH3A 3M6AA 5JT1A 3QNUA 1IZ0A 2C7BA 1E2PA 2L0XA 3VO9A 1QOQB 1SKAA 3CBQA 4CCSA 5HS4A 2BZGA 2FGKA 2WFMA 1GQRA 4EDHA 3U60B 3H1BA 4PFSA 1ZI9A 1L7AA 1JTVA 3KELA 4BNDA 1QBGA 4ERXA 3R5JA 2FEXA 1F14A 3LBNA 1A9YA 1GU7A 2H2WA 3DBLA 1DCKA 4CN9A 3RSHA 2QLNA 3ULKA 1DEAA 4NRDA 2VTBA 1YZGA 1QYXA 1ZD5A 4RO0A 4DWVA 3LRXA 4B8YA 4JYZA 1V9SA 3IEKA 3EGCA 5TARA 4O4HB 3DZKA 2BLLA 1WW2A 3PE4A 4RDHA 3RVRA 2GPYA 1N5RA 4J94A 3SSAA 3UKJA 4YRBA 4OSPA 4HUTA 1C4XA 3ROGA 2FPPB 5ALMA 1ZU5A 3E9NA 3FROA 4G86A 2CDBA 1NRXA 1DEOA 1XL1A 3HB7A 3SOZA 1PW7A 3PFIA 1R4MA 3HJGA 1VRWA 2FR1A 1PFWA 3EK2A 4PPGA 2FG5A 2P67A 2Q8QA 4IV0A 1CUJA 4BN0A 3UGQA 3SJZA 1JIKA 1H93A 4XX0A 1L9KA 1ZOLA 2MSWA 3OWOA 3WNVA 3EASA 3KIPA 4ARBA 2VDWB 3ONVA 3ESDA 4NK4A 4KQFA 3DZBA 1I3OA 3FLEA 3KP1A 3ZTYA 3TIFA 5HQ3B 1NJ8A 2H2IA 4C87A 1HT0A 1R5NA 2ETVA 3ZCQA 4HN9A 4PXSA 3DTYA 1YJQA 1P91A 4AJHA 4P7JA 1L2TA 4BO9A 3GG2A 4M21A 3R9IA 4C4ZA 2B6NA 1YL7A 3NOVA 3OI7A 4JLSA 4RKQA 4BUCA 4HVLA 1MJHA 4IUBS 4ZCMA 1RYDA 2YFQA 3SHTA 2JHAA 1VLVA 2B99A 1W6RA 2ORIA 1QHIA 2OVFA 1GU0A 2PKCA 4MYHA 5E7JA 5EXDA 3RIXA 1N6IA 3G0IA 2FG6C 3BJMA 3QVOA 4KQHA 5DYIA 1G8AA 3G7NA 3A3OA 4BMCA 3QI7A 3TTUA 3RS4A 3V3TA 3K0AA 1DC6A 1I6WA 1VMIA 4FEYA 5DHRA 4B31A 4BKOA 3V7WA 1Q7CA 4JLDA 1GTL1 2FRDA 5JATA 3AFGA 5LDGA 2ADMA 3WQQA 3GJTA 5B1SA 1U0OC 4DSNA 4F85A 5FOWA 4HLQB 4Y0NA 4BX9A 3A4MA 2BFOA 3VPXA 4EWLA 1WHTB 3BTUA 1T0HB 2Y0DA 4LJ5A 2R8YA 4ONEA 4Y2GA 2IZOA 4JVMA 1AMNA 4JBLA 2YY5A 1QV9A 1XDDA 5EIFA 1XKTA 4FFDA 3SDZA 4QVIA 2B30A 4IAOA 2A9PA 4A23A 2FJ0A 4ZT6A 2QMEA 5F21A 2GARA 1EI9A 2A84A 4HEJA 5JZMA 1DOZA 1KC3A 1J0AA 3C7DB 2C9CA 4PC2A 3VAAA 5AW2A 1JDPA 1ORDA 1SXJA 2RGGA 2V3WA 5JBQA 2FRXA 2JIMA 2GUGA 2NZJA 1C3OB 2RKWA 4ZEXA 5CXQA 3TOVA 4DDUA 3N8HA 3EDYA 1WDKA 5E3JA 3LX4A 3P26A 1ADYA 1SU7A 3TQRA 3RAFC 2Q5OA 3PDIA 3H2JA 1RTKA 3W8EA 1LPAB 2QM7A 1F4LA 4BJ3A 1TPZA 1J00A 1E9BA 4X8OA 3HGQA 4RW0A 5EWLB 1ZHFA 3V7UA 4PC7A 5HMLA 3CW9A 5JNLA 2FJPA 2HHLA 1HZZA 3K9WA 1I3LA 4GPAA 4B45A 3MT0A 2FOXA 4MQEB 3LQYA 1KJZA 1Z06A 3W05A 4QYIA 1FRZA 3QFFA 3EIFA 2QRVA 3RYFB 3O21A 1ZHOA 1HGXA 3HP7A 2QD3A 1ITZA 3ZCSA 3CE6A 3PR1A 3NHBA 3LVQE 1Z0AA 2EKZA 1RYYA 3ICCA 3VPSA 4DJEC 4LF9B 2EVWX 1RXEA 4MDYA 3WWDA 4BFWA 1D8AA 2I2XB 1PKEA 2NPOA 2H7VA 1OWOA 2LUOA 2R5NA 3DB1A 1JBKA 3NYRA 4BJHB 4BQIA 4HC4A 2NPIA 2IHUA 4RK5A 4JZYA 1YA8A 1ZJZA 5K3FA 2WNIA 3ZHRA 4URXR 4R8RA 4RKEA 1EVEA 4ZYWA 2BHNA 5HKKD 1WU7A 4K8RB 3SVLA 1O95D 1Z18A 2QRHA 1AQYA 3E9EA 4MIYA 2C84A 1M1NA 2VDJA 1GZVA 2I7TA 4HDKB 2ZJ6A 3NV9A 4D3FA 2QV7A 3IOYA 4G4SO 4IEIA 2ZCJA 2YMLA 3VJKA 5ALVA 5FQNA 5CLLA 1M1YA 3X3HA 1ZHHA 1GTMA 1NIJA 5AM3A 2V9PA 5LJLA 5IC6A 1G6OA 2P77A 3OJLA 3W34A 3QZUA 1E5XA 1ULHA 1E7RA 1NI3A 3WQSB 1UPTA 4IL5A 5AM1A 3LQ1A 5IASA 1F9EA 1S2NA 4FXPA 3SQOA 1O03A 1VIMA 4IJQA 1INLA 3ETNA 3PLRA 4ENRA 1G63A 2BBOA 3QV2A 3UW1A 5CW2A 5I7AA 2GCOB 3DZCA 2OLKA 2WVAA 4LHSA 3VNVA 2O1WA 2WM9B 3CGWA 1SIBE 3F9RA 4ZRMA 3TB6A 2N3ZA 1NN3A 1B8UA 1T4DA 3CLKA 3IE2A 3LYHA 4DLNA 1TVEA 1ORRA 3AESA 1HYEA 5DNAA 2OV1A 2EW8A 1PG2A 4E12A 5H16A 5BNTA 1TEHA 2HA3A 2J9XB 5EYPA 2CXOA 2I7DA 5ALFA 1CJKC 4YONB 3U4IA 1USVA 2CLFB 4A8TA 2C61A 3WJ2A 4LWZA 2WB2A 1Y4AE 3LWBA 2ORWA 3K2IA 3P9RA 4ZCTA 1T34A 6ABPA 2H3HA 2Y8EA 4P31A 1F5SA 4N3BA 3C7AA 2X41A 5C18A 4KWCA 1Q7TA 2WT4A 1DIHA 2YC4C 4WIAA 5BQXA 3U61B 5ALOA 1UDWA 1QFXA 4LV8B 2OSVA 1S5PA 3GRFA 4EUKA 4D9KA 1L3IA 2R2AA 2UYCA 2ZJZA 1JEQB 1TYZA 3UTDA 1BE0A 4A16A 4CKEB 1UEXC 4OYRA 2PKQP 3G0DA 2Z6VA 3FHCB 2QE6A 4ZTUB 3I62A 3FDFA 2I3GA 2I6XA 1QH1A 3MT9A 2H7YA 2BH9A 3IPAA 3NB0A 2W6IA 5D3QA 5DTRA 4CM8B 4ZJPA 1AIPA 3EPHA 2Z8YA 4ZOLF 5I7OA 2G88A 2ISQA 4FR5A 2DHQA 1GKKA 3UG6A 4O1MA 2R8RA 1XI2A 2VKQA 5GWXA 2PMKA 4HDOB 4DARA 2PQMA 1YCHA 2GO1A 3KVVA 4G89A 2QTVB 2YWEA 3AEUA 3A1WA 2CVQA 5IC4A 3BL8A 3SC6A 2DRIA 4F60A 5GAJA 1EVLA 2HSDA 3AHFA 1S1MA 1YDGA 4KREA 1VHDA 1A7AA 2AXNA 2PLRA 3NH9A 4Q3KA 4LXXA 3DL4A 1C14A 1RYNA 2V7QD 5F1OA 4R4JA 3R3UA 5CEFA 1CV2A 1JKIA 1VL0A 1ZIYA 1R16A 3P9XA 4DANA 3VSBA 1P2SA 3KVOA 1L5WA 4PO9A 2X6TA 4CYMA 2OLEA 4W7HA 1SOWA 1CR4A 4XJXA 4ZEMA 1XDGA 4ZZ2A 4C6RA 1GGMA 4AW9A 5FRDA 4XLZA 4HAWA 4J90A 4ETMA 3PV0A 4GPEA 3WLFA 2HC9A 4URVR 3SN6A 1RRFA 2BEUA 4ZDIA 1XRNA 3M5PA 3JRWA 3RRNA 4I9GA 1Y9EA 4B17A 4MR9B 3KQVA 4Q9NA 4PAMA 4V24A 4DR3B 2OESA 1AXEA 5EQFA 2V98A 4NJEA 2EL7A 2H4YA 1T9DA 3CNEA 1PZNA 4KI0A 4TYPA 3GR6A 4ZQGA 3FMFA 5AJXA 4QG3A 5EJ6A 1C1DB 1GUDA 5HKBA 1CUEA 1H3EA 1OX6A 2FETA 2A0XA 2P5UA 4CL0A 5LXTB 4RF4A 5AKIA 1JLLB 3U2QA 2L69A 1PJSA 4DVJA 1MB9A 2ZTMA 4AKEA 2DR3A 1KSGA 3L1VA 4O2BA 4PYMA 3WWPA 4REQB 4CIWA 1QIJA 3D1LA 5CHYA 3C5EA 3D6TB 3K35A 4OG2A 4TM7A 1FFCA 2ODNA 3F5DA 3I0NA 4RD6A 5LA6A 1J24A 1ZOOA 5IN4A 4CFZA 1JJBA 1QYRA 1RBZA 1IL0A 2Q2NA 3HUEA 5E1OA 3H8SA 3OUZA 1O57A 6GPBA 2BH2A 3DOOA 3ETEA 1WX1A 4XVUA 1CZKA 3URKA 3X1XA 1DARA 4ZU1X 5A0FA 1Z7YA 1EQ2A 4NIMA 2I03A 2VNKA 4GR4A 1A0OA 1RXIA 1V35A 1S2MA 3R7FA 3K0FA 3GXBA 4G0PA 1HUQA 3IC5A 4S1VA 3KOXA 5BNZA 5EHIA 1HLGA 3HR8A 1P0IA 1WIWA 2XHZA 4JP3A 1L4GA 4NS1A 3D2CA 4QUGA 4BUZA 1XEXB 4LJKA 3QKSB 3FTDA 1W52X 2Y77A 1Y9AA 3JAWB 4MHSA 4G1UC 1CB7A 1RRPA 3KXDA 3MVEA 4I14A 1XCPA 1GNPA 4MV4A 5DTJA 5EERA 3L0BA 2A9KA 1B0ZA 1KBQA 5AHOA 2QBYA 1KZ4A 2H4ZA 3QTBA 3F97A 2CCJA 2ISCA 2H5JA 4JOCA 2XQVA 3CLRD 1MJFA 2DWCA 5LBIA 2Z2YA 5AXDA 3U0VA 3ZXIA 5B6IA 5CAEA 4F04A 3NBZC 4ESVA 1KS2A 3QYPA 4PRZA 1C0EA 3CX4A 1PGQA 5SYAA 2XRYA 4NU8X 2G4LA 5GJVC 4QWMA 1TM7E 4GXNA 5E3IA 1X7DA 2WSSD 2YOHA 3CKLA 1FNDA 3I04A 4J2OA 1LLUA 2GVNA 4LQCA 4H6WA 4UTRA 1MJNA 2HBYA 2PV0A 3MOIA 4MWGA 4EKIA 3LYLA 2B98A 4WZBA 3U3KA 4MEBA 3WQBA 2GPAA 2GYUA 1YBAA 3LGXA 4C0LA 2J4FA 2FMXA 2BMDA 3QUBA 4LJ6A 5EQDA 3T99A 5C8ZA 4BCCA 4ZPJA 2YTZA 3IHWA 4Q34A 2G0TA 5CPBA 2YMQA 4WEQA 3KQQA 3PU6A 2D7DA 1XZCA 3AUUA 3JR3A 1WQ4A 3MZ0A 4EEXA 3JASB 4HH4A 5EMHA 4AJ1A 4M8KA 5L3SB 1PT7A 2EFDB 4MV8A 4YCCA 2C4WA 3BORA 3F6RA 3TW0A 1WBDA 4E33A 1ZK3A 4W6QA 4AZ0A 1U02A 3FDXA 4Q9IA 2V6MA 4J3NA 5K8TA 4HB0A 4B3MB 2C04A 3G6KA 3DA8A 3I37X 1EBUA 2C9DA 4Q66C 4XCQA 2HFJA 2PZKA 4H4CA 2XEXA 2RI6A 1KHHA 4XX0B 3TEFA 3LV8A 3GVXA 1FUIA 3AEYA 4IX1A 1QZTA 4WN9B 4A8JC 4DQXA 1H8HD 3B3FA 3Q72A 2ZIFA 3UFXA 4E0BA 5K0EA 1TCBA 5TY0A 1V8PA 1WTCA 1B1CA 3OZRA 3GCGA 4UBLA 3FNRA 3ITDA 5AR1A 5K8UA 1CT9A 4WVFA 1A69A 4D0NA 3H1GA 1XP8A 1ISFA 3AXTA 4PFQA 1RYEA 4AWAA 3HCCA 3NW9A 4GMHA 4AF7A 5JWRA 1GJRA 4ZOLA 4BFVA 2WWIA 2FX5A 3EFOB 3IIKA 4CEHA 1O3YA 1P1HA 5ECYA 4F4FA 1X0XA 1Q6YA 4MVJG 2RGBA 1TL7C 2EBFX 2PAFA 2VIIA 5K7SA 1XZIA 3M3HA 2OILA 3KETA 3ODPA 3DO6A 2DFLA 4NULA 5BNFA 2KWIA 3DGEC 3DVQX 3WL8A 4LNUA 4P34A 1IVNA 3FFWA 1Q92A 1E9AA 2YKGA 1XD2A 2ODTX 2K4MA 3WWYA 5MDHA 4B2YA 1SVOA 4IR7A 3CX7A 2KLBA 4LOIA 5A5GA 3CIFA 2ZJAA 1D2GA 4D9CA 1Q77A 1G64A 2C59A 1FNNA 4M0DA 2WUFA 4H0FA 2EP7A 2EATA 4PLHA 4OAQA 2PV7A 3KEMA 4WZAB 2GMWA 5TX7A 2WJAA 3KQPA 1XTKA 2EERA 3W5UA 2Q50A 3TFQA 4BP8A 3OZWA 4DR6B 2BYTA 4F8JA 3VRHA 1QVZA 3OD5A 2CXNA 1Y3DE 2I2WA 3BH6A 4N12A 3TMKA 3WLLA 4DLPA 5K8CA 2PGJA 4F5EA 1FEZA 2YFHA 4U6QA 2FE1A 1YA4A 1HT3A 1E4VA 1UJ4A 2YR0A 3UWSA 3FA2A 2IF0A 2G9UA 1SVIA 2OM6A 2VF2A 2OGZA 5F1YA 5K1ZA 2QPAA 4YCMA 2B3TA 3IELA 3PXAA 3VNBA 5IMBA 4DSAA 3R0VA 3H2HA 2ZTLA 4I8XA 4XM0A 1F0PA 4LOAA 1FQJA 4AJ2A 4EQZA 4YDQA 1OH5A 4WK0B 4OAPA 3L8CA 4FYHA 3WFIA 1YT5A 4CDGA 1GN9A 1K0FA 1CXZA 3ZJTA 5LB4A 1YVDA 3EE6A 3G6WA 3N5KA 5FEMA 1XXHE 1JQ3A 1H0HA 5FPKA 1XNRB 2L42A 1U8XX 3A2KA 1PZXA 1E1NA 2ZRJA 2W8BB 2KBEA 3V55A 3HI4A 4UATA 3TCXB 3LL7A 4K0KB 3BSFA 4MMYB 2OEPA 4AMBA 4B6SA 3ZZNA 4E5KA 2BR3A 3WNDA 3WDLA 4U2GA 2K7FA 3VYVA 4F46A 2VXOA 4FKZA 5K20A 2OUKA 4HGOA 4NK5A 1E1DA 2IKQA 4AY5A 1IBMB 3BAZA 3I53A 2AKEA 1IY9A 1LX6A 3GT7A 1Z33A 3WQRA 4B73A 5KHLB 3UB3A 3FSRA 4C0KA 2ZB7A 2WU4A 4RY8A 5FDFA 3AL2A 2LKDA 3LC1O 2D06A 2K2QB 2WUDA 3IYLW 1QYVA 3PHIA 4K0RA 4JKYA 4W5WA 4ZTBA 4ERNA 4F7WA 3DO5A 4IBOA 2BGJA 2XWBF 3WA7A 1ZGBA 3GJ4A 4HNRA 5DN6A 4US1R 5DPMA 4QM6A 1ISIA 2YMMA 3OJWA 5JE8A 4NS4A 3FWZA 1Z5OA 1VJTA 2Q4OA 4XR4A 2J7PD 5T64A 4O0MA 4PZAA 2CW5A 3WGGA 4TWRA 5G0WA 3TNDA 3KYIB 2DSTA 4U0JA 1GQQA 2ZIXA 1PL7A 1HO3A 1Y1PA 2OCIA 3A10A 3O1JC 3RIGA 3DF9A 3UM9A 1JHRA 2QRVB 2QSJA 3H13A 1O54A 1FFAA 5CBPA 3DDOA 3GLKA 3RRZA 3Q8KA 3B85A 4G5FA 5GV7A 2J7KA 2W2OA 4M0CA 1XOIA 2XUAA 1PR2A 1CQZA 3EGWA 3CURA 1WQ1R 3QHPA 4O8CA 4JT2A 3BHJA 4G8CA 1VOTA 4ACAA 5JRZA 4OMFG 4ZMRA 5FI0B 3MAAC 1JH8A 5HX7A 3CV3A 3BJZA 3PI6A 2PMFA 1E94E 1JHYA 1SR8A 4G67A 2W42A 1PJQA 4FZRA 4I2NA 4JLAA 3VDQA 3W4KA 4I66A 3QPWA 2YYYA 3PVSA 3A9UA 1E5LA 3AJ8A 2L2QA 3IKMB 4FR2A 1NBWB 2CNDA 3L0DA 3RS8A 2V6JA 5LP6F 1LF5A 4GOKA 1SHJA 1X13A 3ZHVA 3AKDA 3EIOA 4CTKA 3P27A 2QTMA 4PAOA 4PG8A 4NEHB 4MICA 4HWKA 1VE7A 4K7JA 1ZX1A 1FTQA 1JHMA 5H3HA 2F8TA 1X1RA 2Y1CA 4NENB 3PQ7A 2Q7OE 4MRSA 1ENPA 3OCCA 3Q7PA 5JSUA 3AEXA 2BKXA 3BGWA 4EMUA 4HWTA 2BFCB 3ZI4A 1SXJE 2Y0PA 4OL9A 4PF1A 1G6Q1 2JGFA 1LDYA 5EKXA 1USGA 4X7PA 5EP3A 2G1KA 4G5YA 4QJ4A 1TZBA 1NGSA 1XV5A 1Y1SA 5FL7D 4E09A 5AKEA 1LRLA 5F33A 4MW7A 5DIFA 5BSUA 4IZ6A 5KX5B 2H4WA 1J2TA 3FPKA 3EZLA 3JYNA 2BFAA 4PNZA 1YKFA 4Y18A 4E4TA 1TA4A 3OEEA 4YRSA 1CR0A 5D5QA 1OE0A 2B21A 1L3CA 3CN9A 3FRIA 4K9QA 4CMBA 4D4IA 1CETA 4YRQA 4KB5A 1Z2NX 1YHYA 1A8PA 1XELA 2R5WA 4BZWA 3HM2A 1TFUA 1E79A 2D0IA 1J9EA 2QSZA 2W2KA 3EGDB 1KOFA 4ND5A 2RGUA 4G4GA 2V7BA 4O0LA 3BPSA 1R0YA 1ZC4A 3A4VA 3NDJA 1Z4LA 2I4IA 5HFJA 2E49A 1QZZA 4CQMD 2QLLA 1P61B 1VJCA 2E55A 1YZVA 1QG6A 5D51S 4BNFA 2GT1A 1F2TB 7REQA 2QRMA 1RPNA 2IEZA 3DEZA 3H04A 2CZCA 2FLKA 5ISMA 2H4FA 2E1RA 1CCWA 2W4MA 2TS1A 3M6WA 2E6UX 4HD8A 4WNAB 5GINE 3HKBB 4MV6A 4DG5A 1MOPA 3A06A 4Q39A 1GCUA 5LU8A 3IDFA 1DINA 1DTEA 1GA6A 3I72A 3O2JA 4M1WA 3NOXA 4N7RA 4O4IA 2ZRGA 3MUEA 4WY2A 2J0EA 1F2VA 7AT1A 2R84A 3L18A 3JSAA 3QVGA 2P65A 2HRDA 3GLVA 3OPVA 5FBWB 2AOTB 2Q4BA 5TGDA 1PQPA 3T3HA 4ZCLA 3ANNA 1XQ9A 8OHMA 2C5LA 3R8XA 4ZO4A 2ZT6A 1D1QA 2C1EA 2X9LA 1KO5A 4PCVA 3VX3A 2Z4TA 3KTDA 2QZ9A 3CJQA 3P5SA 4RIEA 4UDXX 1L7XA 2V4UA 3AR8A 1K4KA 2O2IA 1GGFA 3MRTA 1EVYA 3FYDA 3DT6A 2NTNA 4RTLA 2NZ8A 4QQRA 4RSGA 1WZIA 1N9ZA 4Z4IA 5JFTA 721PA 1V2GA 1XLTA 3PNKA 1FFXB 3LM8A 4QTTB 3QX3A 1FVOA 4QVKA 4EAAA 1PIWA 1U5BA 1XYGA 3CF4G 1EJBA 4G2NA 2JBAA 1C3JA 2QTWB 3SX4A 1ZISA 1YIDA 2ZBGA 4Z0TA 5IT9A 1L7NA 1ABEA 3E61A 1RYBA 3AF3A 4MYTA 4AL4A 1PWEA 4QELA 5AVJA 5TVKA 2HSZA 2IVZA 3OA0A 4WLVA 3LDAA 2BKAA 1E1CB 2ZYVX 3O1IC 4CM8A 1X1EA 4PC1A 8AT1A 1FPQA 5G02A 3RUDA 2IHJA 3FOWA 3CGGA 1TAQA 2GASA 3RSQA 5AI0A 3L7AA 5F12A 4X20A 1NJGA 2JI9A 2I2BA 3MINA 2VSNA 1RXSA 2PX8A 1G16A 1P4AA 1ZH6A 2OHIA 3C5CA 4JUBA 2OZEA 3KKZA 3K4PA 5UKDA 4Z9FA 4CMEA 1JLRA 3BQNB 4YP7A 2W2MA 2HPAA 4HB4A 3REQB 3Q0EA 4YALA 2VUUA 3FHJA 3VR4D 1K68A 1Y98A 3FFXA 4RS4A 1RM4A 1L4MA 1W85A 1N0WA 3QVMA 4WOBA 1N1GA 1Z0FA 2HK9A 1NNLA 2XTAA 3GNQA 1BXZA 4YAWA 1TZ2A 4KRFA 4GIBA 4TL8A 3DCYA 3DPIA 5I9SA 1OA1A 1J1ZA 4IEEA 4Q5IA 2PGXA 3I2KA 1FP4B 2E4UA 3A1CA 1ZN8A 4HZIA 4QOEA 4LYYA 1PWYE 4YAJA 2I4OA 3OCYA 4KTVE 4V02A 3VHQA 5JS1A 4I1OA 1MEOA 1YIOA 3G9ZA 2XADA 2GZSA 4MRAA 4BKQA 5BQOA 4M1EA 2RH9B 5FWDA 3ZQJA 1Q7EA 1L1EA 2XE8A 5DGIA 1TJ4A 4E51A 4TQGA 1LDGA 2QUIA 4Z86A 5FLYA 5JVDB 2ZU0C 5AW5A 1G8JA 2VHVA 4LRQA 1ZUIA 4Z2YA 2Y71A 1YDWA 2VBFA 4I1UA 4MX8A 3MGAA 2GJKA 5A4AA 3LQFA 5AQEA 4AKTA 3O75A 4MI6A 5EESA 4NC9A 1XEWY 3LWNA 3IUSA 1SOAA 3SC2B 3NAGA 4YYEA 5IJXA 3SSMA 1RWKA 4YMUA 1IK6A 1QB8A 5IDVA 3F78A 3K5WA 4FD2A 1GP2A 3PA8A 1QTNA 4QBHA 3K9NA 3LLCA 3NAQA 3OTHA 4DJTA 4NBUA 1M9NA 1KEWA 4BB5A 2K5UA 1QO0A 2ZFUA 4ETNA 5L4LA 1LZKA 2IE8A 4E5PA 4R68A 3H7AA 2JA2A 3L0SA 5CCBA 4H6VA 1IPEA 4CM9D 4MJXA 5FBVB 1ZVVA 1FMJA 3MJDA 1WOYA 2X3UA 3MWFA 4BMXA 2XVYA 3SQMA 4AK9A 4C4SA 3CPHA 3B1FA 4RYLA 3FZGA 4BO2A 1OXTA 1T91A 3ZY3A 1T5HX 3RRBA 4CE6A 1AK9A 5HUQA 3Q1LA 1RQRA 5TV2A 3ITKA 3IO5A 4K9KA 4MR8B 2IYAA 4PN7A 2HHAA 1W48A 4YJ2A 4CEJA 3F3KA 1PDVA 1TF2A 4HJRA 4BQPA 2C07A 4PPYA 3ZJ5A 3PGKA 1AUPA 2EZ9A 3B1KA 4MVJF 2XUQA 3CKMA 3TZEA 4OREX 4UBOA 2O19A 4U39A 1WWKA 2F90A 4X91A 3HU2A 1R9NA 4GGPA 4BNJA 4OBEA 1BS1A 3ZBTA 3CW2A 1TCUA 3K4QA 3A6FA 4EYEA 5DNCA 5HFNA 1T9GS 2B35A 1K9VF 5MFZA 4IFEA 1E9EA 1IE3A 2AJTA 3CW8X 2GAIA 2WKRA 1TMGE 4Q4AA 5AXCA 4PZDA 5JPIA 1GGJA 1QTRA 1VYTA 2ECQA 3BMNA 1TM2A 3MCTA 2QRGA 2FW0A 4F1KA 2O8BB 4XAQA 1N3LA 4BNNA 1T36B 1G21A 1P0PA 1TD9A 1WTAA 4ZO6A 4KE9A 5EJ2A 2Z56A 4KPFC 4M0PA 3IAM1 1FMTA 1ZIXA 1LNZA 3TAXA 2EFEB 5BXQC 2I4TA 4ND1A 2ONCA 3COZA 5I3ZA 1J5EB 5JDIA 3G1WA 5DFAA 1MG0A 3PVCA 4P8RA 3SJUA 3UBTA 2OGSA 2G40A 5DHAA 5CTJA 2SCUB 4LZWA 2FRDC 2I9PA 1FSSA 1YXMA 2Z2JA 3MMZA 4UPEA 3GK3A 4YR7A 3T7SA 3C6ZA 5T6MA 1EXWA 2IZ0A 2YNMC 4RUKA 3BFPA 3RIEA 3OZUA 4UXJA 1S96A 1Q5PA 3EFHA 2HGZA 4HAIA 5IC5A 2EU8A 5BSFA 3WGIA 1E9VA 2VHJA 3TI9A 9ABPA 3OM1A 3LFTA 5BT8A 1E3JA 1N6HA 2Z8YM 1TUIA 3AEUB 4GZ3A 3L7NA 1KZ1A 1RWVA 4GDFA 5IDQA 3HP1A 2VK1A 4ZOQI 4RKFA 4D8UA 3MBIA 2YHBA 1EZZA 3DWIA 1MF7A 5D00A 3ZIDA 4Z1OA 2BP7A 4URWR 4A6XA 2ZB8A 3MIIA 3P96A 4MRMB 2C4VA 3IKTA 2VDWA 4WLEA 5BMOA 3K5HA 1IN5A 5L3SA 2CGEA 3GEGA 1L4KA 4AKHA 3L7JA 4LNHA 5G4LA 4TQAA 2ZRKA 4W8OA 3LC7O 3E9YA 3CKYA 2C9BA 2JI6A 2EIXA 2O1EA 2QVXX 2DKNA 3PHBE 4QEDA 3W77A 2OVBA 3LHDA 1AZSC 4YRIA 3GRVA 3NWJA 3WGTA 4PYNA 3GLHA 2IJGX 1ISGA 3A4NA 1DLJA 4C2AA 5JJCA 4DJDC 4AO7A 3QYJA 3JQGB 1XIVA 4L7VA 1F17A 4GG1A 1NOKA 5HNKA 1T3LA 2LKCA 4Z54A 4EO7A 1NUUA 4EDFA 2WYVA 1QPBA 1G2QA 1O94A 2W48A 2ZS9A 2FQ1A 3L1IA 4KLCA 5DI9A 4RVOA 4WDQA 4BBZA 1NYTA 1YJBA 4PO8A 2B4YA 3TSZA 3BM5A 3FNIA 5E6SB 4F4CA 3DCJA 4QBGB 4ESEA 3RR2A 2JJ2D 3LOPA 1VG9B 4N82A 4N65A 2IW3A 2ZBFA 3FG9A 3JQ7B 4P7KA 1ZCFA 3QPCA 5AOCA 5JSZA 4QJIA 4RA9A 1JA9A 5G40A 5HKKA 1OBFO 2H11A 3FR8A 3E7FA 4L9RA 1KQNA 4IO1A 1KL7A 1YR6A 4AZSA 4F2HA 1P17A 1KJIA 1JLSA 1KXJA 1RJFA 2WIKA 4XPIA 3T3EA 4ZT5A 2LP4Y 3KJIA 3V48A 1JKXA 1IHUA 1CLUA 3R3JA 4JBYA 4HT3B 5C5DA 5EIAA 1K4YA 4B3JA 1H4VB 2O07A 1D2HA 3E7XA 4I1SA 5LJIA 3RSCA 2FWNA 4GT1A 1DFHA 3CH5A 3WL6A 3ZLVA 1G8SA 1ACLA 1C9YA 2FPIB 1ZXLA 4MGKR 5GQSA 4FB4A 2WV9A 2QLTA 4LWOA 1B15A 2A4KA 3K8OE 1Z7EA 2DH6A 1LC3A 1PT9A 2XVMA 4JJ7A 4JOSA 4Q93A 4YT5A 4B6OA 1SQSA 4II3A 4X7MA 1ODJA 1OV6A 1T35A 1VCNA 2WTNA 2QK4A 2ZJFA 3DE3X 3FLBA 3HVUA 4BC1A 3KKKA 5BSGA 1EWVA 2CBGA 4RPCA 3WYFA 4EW3A 2XECA 1XVVA 4D25A 2NU7A 3ABQB 4XWYA 2HN9A 1COZA 5EIWA 3UB4A 1N8KA 1LJLA 2XMBA 3RK4A 2VJLA 3E48A 4KIWA 1RRKA 2Q2VA 1VLZA 2GF9A 3EODA 3T7AA 1E1RA 1P5ZB 2G25A 1TF7A 2PBFA 1Z16A 3H6HA 1WUYA 2AG1A 1JI3A 3H2KA 4OLJA 4DMLA 2VNSA 3PC7A 1JFFB 3I52A 4FMDB 5ALYA 5KOHA 1C30B 3U7QA 3CG4A 1EUDB 1EP1B 5F64A 1Y8AA 1M8KA 4UQOA 1YZLA 1CUUA 1NVEA 2A33A 2C9YA 3QVTA 5J2TB 1QIMA 2HYDA 2O7QA 4UTPA 4ND8B 1Z82A 3P45A 3WBKA 3AI1A 4MPJA 2VAXA 1JYSA 4ZYTA 3V80A 3NIWA 5DULA 3IEPA 2OC9A 3F96A 2HIGA 1IBRA 1DO2A 1UDAA 3RTAA 1N5IA 1YUNA 3VH2A 3WLQA 3AVVA 2GXSA 3R40A 5I7FA 1HR0B 2VJKA 5AIAA 4YJ2F 4W99A 2DEUA 4WKPA 5F52A 1XVIA 3BEDA 4B4WA 3UJ6A 3ZDBA 1P5RA 2ALJA 2C0PA 2AF3C 2NO7A 1G41A 1IJKA 2XJ4A 3PG5A 5FR1A 5LUBA 1R5OA 5AW8A 1AKRA 5KYTA 5TQ2A 3PFCA 4OYLA 1I4DD 4DCTA 1IQRA 1ISJA 3CRZA 3F6PA 3E53A 4B6FA 1SN7A 2XDQA 2ONKA 1B00A 3PQ4A 4MNTA 4DQVA 1PR6A 2FV8A 2AFRA 2JAXA 3PHJA 1E1RD 2EC5A 4CT4B 3BIFA 3A25A 4LXUA 2XWPA 1H2EA 3I5UA 3MCWA 3ROFA 1XPOA 1N75A 3UPTA 3OFNA 2FH5B 4LV6A 5CXUA 1ONNA 2MSDB 4RVSA 4N5NA 3HV2A 3GLFE 1CFJA 2WLTA 2GHIA 2DP4E 2O2GA 5T7BA 4MB2A 1EJ0A 4URZR 1Q1AA 1E6EA 2GFQA 3K0AB 3INRA 2F9LA 4FPXA 4KI7A 2X0KA 5C8XA 5LCXA 4H59A 4BTVA 1KIFA 1NZDA 4EH1A 3GHHA 1JLKA 5KDOA 1DIBA 3EGDA 3PGMA 1BDJA 3FRHA 3JATA 2GZDA 2IY8A 2Y66A 2C8LA 3CQ9A 4NH4A 4RMJA 4ROSA 5CFZA 1P74A 3O2SB 2EJUA 4WFIA 1O7JA 2FCAA 4HS4A 2CL7X 3NP7A 4RLFA 3V8RA 5I4KA 4LFAB 1WSAA 3RYCB 2EKBA 4D4MA 4G01B 1UT8A 3CZPA 3EXHC 4G1FA 1MEEA 4IZHA 4U2BA 4BU1A 4CL3A 3S99A 2HLDD 3IBTA 3LC0A 1QE0A 4LI3X 2BY4A 5BWLA 2V3VA 1W5EA 3GIWA 3DE4X 4MCHA 3I73A 1DOAA 1OKKD 2GD6A 3EZ7A 4DR5B 1YK0A 4JV5B 1G3QA 3D0OA 1HI9A 3HL4A 3NTXA 2FEMA 2ZVQX 3A6KA 2ZETA 4AJLA 1REQB 3RHTA 2HJVA 3L0IB 3ND6A 4FIZA 2WY2D 3VAZA 4YRDA 2ONZA 4B80A 1LRJA 5EZYF 3HKEA 1VL1A 4OP1A 1CWUA 1D2MA 1BVUA 1CDZA 1EH5A 1LTQA 1KJNA 2E37A 3DOEA 1GA1A 2OBFA 3C1TA 3MLAA 3NASA 1I7NA 4GBGA 4GVXA 3Q11A 3O8QA 4HDSB 2YJTD 2CFTA 3RVDA 4E6PA 1ZM4A 1CUBA 4PYLA 1GPNA 3DXZA 3GLIE 3O82A 3TTWA 3E1SA 3OMLA 4BGVA 2NMVA 2LCFA 2RGDA 1I7PA 4GUAA 3RDPA 1KHTA 2P7HA 1R9GA 5G4KB 4LF8B 1R64A 4V3CA 3JYOA 2BCEA 4B7ZA 2GERA 3TFOA 4R16A 3QF4B 2FRVA 1L5HB 1JVNA 3OD1A 5AK3A 3NHPA 1U6IA 1WKCA 3DT9A 1RIFA 1ZNQO 2HY7A 3HSYA 4M9UA 3GCWA 4CG1A 4GQAA 2ZI6A 3WR5A 4BNDB 4PSDA 2ZPUA 3VBEA 4D46A 5I6DA 4FOSA 4MIOA 2GFIA 3FYTA 1I94B 3OOJA 3PA6A 1QAOA 1CUDA 4KXMA 3UH1A 4BP1A 2AXEA 2TMKA 1OYWA 1Y5IA 5E9QA 1UZLA 2HRRA 2WJYA 3LXRA 1T9GR 4HMQA 5IVHA 1L5HA 4CMIA 3BF8A 3JVVA 1JEOA 3ZE9A 3D3WB 3FY4A 2DMRA 3VNSA 4NPAA 2ZAMA 2G4CA 2D5AA 4X6LA 4E07A 2D1YA 4D44A 3KSDO 4P2GA 1SELA 4C5AA 5A5VA 2ZYWX 4LJLA 4MRPA 2BR5A 2Q6LA 4DLXA 1ISHA 3NHUA 4GMFA 3KQWA 4X7RA 3WAKA 1DKPA 4DNPA 3FZNA 3SS9X 2C9OA 1WS6A 3SZ3A 4B32A 4EJMA 4NBSA 2R6JA 1UH5A 2J5BA 1XRPA 4GMGA 5JU6A 5JSYA 9LDTA 2D3WA 1SKQA 2WP8J 3KKEA 1ZK2A 4PAWA 4YJGB 4Q9KA 2Q3LA 4D96A 4YRZA 1TUBA 3H75A 5CGZA 1SH7A 5LNK1 5M29A 2JLVA 3VR5A 2HJGA 2I9KA 3SYNA 2R9VA 2FPKA 1EM6A 2HX1A 1J09A 2NXWA 1YHNA 5GZ1A 3A14A 3FGOA 2GBGA 1M2HA 2OZPA 4LRYA 3Q87B 4ITUA 1WHSA 4LOLA 2P3OA 3MRVA 5TT0A 4N6NA 4L1KA 4MPPA 4HAZA 1YMVA 2DGDA 4L15A 1GPUA 1CIJA 4C7OA 4G41A 1CY8A 3SLKA 1Q0HA 3O8RA 3JQAA 3BD8A 2P5TB 3DS8A 4NJEB 3U49A 1BGVA 4C7KA 2ZIGA 3WMWA 5EVJA 1X39A 2F1IA 1DRWA 1OLOA 4F6RB 1X80A 4J2TA 1F0KA 1EU1A 3WV4A 4LSMA 2F67A 3S29A 1E2BA 1SVMA 4Q4CA 1CE8B 3D3QA 2G04A 4LXTA 2Q1YA 3VPBA 2PRIA 5DGCA 2JKYA 1N1EA 5D85A 1KO7A 3AILA 2GGSA 2P69A 4JN6B 4R98A 1KS9A 3PNOA 1O87A 3SQXA 3FJ1A 1U0SY 3AI7A 4NZOA 5FTKA 1ZJ6A 5KWEA 4EF4A 5TIIA 5DNVA 5J23A 1HDGO 1POXA 1OFVA 2FR0A 5JQGB 1NFRA 5AJYA 5HM8A 3PNBA 2XDQB 3E2IA 3SYMA 2BEVB 2QB5A 3AEKB 3TIGA 2XZPA 1IB0A 2QY6A 3VDNB 1SG6A 4D5EA 2JGRA 5C4GB 2XOKA 3VU9B 1WZCA 3WLAA 3I6BA 4RDXA 3O94A 3TWOA 3WHPA 4BEJA 3VR6D 3C3XA 4E7PA 3AW9A 4B3CA 4C9BA 3GLHB 4IY1A 1E18A 1NW8A 3ENQA 4FE3A 4ZWNA 5PNTA 1EB9A 4UULA 4OKIA 3WLPA 3HQ4O 3HXMA 2VAWA 2QVLA 5AO9A 4ZRNA 2QL5A 4BEWA 2BMJA 5C1DA 2HT1A 2V45A 3GRKA 1ZZGA 3O8NA 5BV0A 1VYUA 1N7JA 4US0R 4OK6A 4KXUA 1P1CA 4KH1A 1SA0B 2XW6A 3L7IA 3O74A 4FYIA 4JJ6A 3N6VA 1I13A 4MQFA 2E9SA 2PPVA 4MR7B 2LIVA 4FD3A 2XBUA 1A2KC 1DS6A 1WY5A 5KNCH 3ZJVA 3HYCA 4OJYA 1FU4A 3B53X 1BMDA 1AMOA 1Q7GA 3ZLBA 3MB8A 1TJYA 1U0NA 4U7TB 1HTBA 4XGKA 4ZVQA 2VAPA 3E35A 3TQQA 5E9AA 2IYUA 3C70A 1CUGA 1MOZA 2XOXA 4IOLA 4M6WA 4C05A 3RREA 2Q2QA 4KQXA 4F4IA 1SQ6A 1ZL0A 3R6DA 1I2DA 4ZVVA 1QVWA 1VPEA 2DAPA 4G3XA 3VVMA 4DNFA 2XOKD 3CLTC 4CLHA 3WJ7A 4Z5XA 3OQ6A 4AICA 1ZI8A 3GJ6A 2P4SA 3VX4A 4B74A 1S4MA 4H7FA 1GVHA 3L8YA 5B3JC 2DTDA 4ENQA 1GDTA 3K9GA 1ESEA 1NKSA 2J85A 1Y42X 3AF5A 4NJMB 2VHXA 3AY0A 2FP3A 2J9ZB 1T0JB 4JC0A 4Q1BA 4WK2B 4DRZA 4TVKA 3M83A 3OPNA 3NYQA 3S55A 1O58A 3VC3A 1N2JA 3O9ZA 3W1EA 4RTOA 1NQUA 2E4ZA 4GS5A 1LFDB 1LU9A 1O6ZA 3MW8A 1RQXA 4X60A 5CITA 3OU7A 1QQ5A 3JYLA 3AM5A 5IN5A 4XDGA 3SHVA 5K3SA 3AIOA 3G59A 3QJYA 4B7XA 3NVAA 2OCBA 4JBGA 1KI6B 1HLDA 1WF6A 1F6BA 3IUYA 1YSCA 4QNRA 5HE9A 1LQUA 4ZDJA 4MKHA 4UHKA 5JC1A 2C5HA 2W2LA 3AR7A 5AM0A 4H17A 3VMFA 2F17A 4N18A 1NBMD 3GVPA 4R01A 2YV4A 3NM4A 2BOVA 4DQ0A 3KS9A 3FI0A 3FPGA 3NOQA 4B6QA 4U4AA 4HZUA 1E2HA 1XHFA 3S2UA 3D8BA 4MUYA 4LDRA 3AF2A 3QU4A 3BTVA 3DKRA 3S40A 3SG0A 2II6A 4JQYA 2XV1A 5HK8A 3JQBC 2G63A 2QZSA 1OXVA 2Z3ZA 1MQ9A 4YJKA 4DYHA 4BBAA 3ZI0A 3TXAA 1WV0A 1Q2XA 3UAVA 1OMOA 1P62B 5EHNA 4DMUB 2B7CA 4U9IS 4N3AA 3OIGA 3AKCA 4MP3A 2AF4C 2R47A 5MGBA 1XVTA 4TT8A 4AJNA 4B35A 5IZCC 4UM7A 4PO3X 1C3LA 4KR3A 1T2AA 4BFUA 2IP1A 2DWOA 2BM1A 2WWRA 1DTSA 5TPZA 1G3IA 4LXQA 2RHDA 2KSQA 2GS9A 1U2PA 3LY7A 4UEWA 4KW7A 4Z9AA 5NULA 3ROEA 2CUZA 3T35A 2VDUE 3KJZA 4WY8A 1NY6A 3OZEA 5IYZB 3QA3E 4KYIB 1W36B 5CFQA 4KCGA 5ICEA 3MJVA 4WMLA 4HH0A 2Z9BA 3S1SA 1FNCA 4XUGB 2H00A 2IHTA 4NV1A 5FEUA 1TM1E 4BBPA 2R8BA 1K6XA 1VRCA 1R4AA 1S1CA 4TV9F 1PYGA 1XQYA 4HL6A 1D6SA 4Q3AA 1G7TA 1U3DA 1WBJB 4TS3A 3RRFA 3VTAA 4DLZA 1K88A 5BR7A 1AH2A 1EXVA 2PXCA 3N0TA 4PQYA 5DTIA 1RWMA 1J06A 5KTKA 2G70A 2MYPA 3R24A 1C9KA 1MQSA 5AVXA 3TJZA 3H9UA 5E1BA 4IKOA 2AFHB 2R1TA 3KJQA 4PZ9A 4C30A 5KWJA 3AEKA 1I4TD 4CMHA 2WTBA 4JROA 2RH8A 1ULTA 3M5WA 3LK7A 1J49A 5JANA 3I30X 1AXGA 1NVVQ 4OYYA 2BGNA 3R0JA 1R3UA 1POWA 3BF7A 3M89A 2HGSA 5KYYA 5DHSA 5KOYA 2YL2A 2YN0A 3FBWA 2HV8A 3LXMA 1U5AA 3AM3A 4RXMA 1N92A 1IUNA 4JJ4A 1BFKA 1O95A 1G5RA 1GIAA 2ES4A 1J99A 1ZEJA 2C4KA 3LT0A 1N3BA 1U4SA 2OZKA 3PDIB 4EY8A