3ILSA

The thioesterase domain from pksa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
265
Chain Sequence
LKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLIPHFTAVVDVMLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Hydrolase
total genus 84
structure length 265
sequence length 265
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilsA00
3NWOA 1XZKA 2XB6A 1JT2A 2HA6A 3W9UA 1HQDA 2VJCA 3VJMA 4C6HA 3RM3A 4UBJA 1VA5A 2JBWA 3QM1A 1MNQA 4J03A 3O4HA 5I7UA 5DWDA 1LPMA 3SWWA 5IVKA 5KBYA 2WFLA 1UOQA 2ZVDA 2PKYX 4KRXA 5AM1A 3ILSA 1XZEA 1B6GA 4UHEA 3DKRA 1AX9A 1LPBB 1CUVA 4Q1VA 1CUFA 4BRZA 1Q0ZA 3KDAA 3DD5A 3A2LA 1IMJA 4Y2UA 3G0BA 3ESBA 4QDZA 4OB6A 2ZJ7A 2JEZA 3D2CA 5ALDA 4BCBA 4KJXA 5AOAA 1U4NA 4BVJA 1QGED 4WDQA 1XZDA 2VT6A 5AICA 3V48A 2XUPA 3OPMA 2V9ZA 1JU3A 2BUBA 2C4HA 5FV4A 2FX5A 4BAUA 1F0PA 2Z3WA 4DIUA 5ALKA 3H0CA 3HABA 1CUIA 4BP8A 2B9VA 4GECA 4KAFA 2OQIA 3K6KA 2VJAA 3VKFA 1Q84A 1VZ2A 2JEYA 2BAGA 2OAGA 3RK4A 4ZGBA 3I28A 3FYUC 4QE3A 2WUDA 4UBOA 4DMHA 1UKAA 2WFZA 3L1JA 1E8NA 1QO9A 3ICWA 2BCEA 3K2IA 1UOPA 2J3QA 4W1SA 2WHRA 5CT9A 3C43A 3OG9A 1B41A 3I6YA 4DSAA 3UUEA 1QTRA 2DHDA 3IUQA 2B20A 2WHPA 1BCSA 3NOXA 4DNQA 1FFBA 3STTA 1HLGA 4N8EA 3WJ1A 3QPAA 5A71A 3R40A 4H7IA 4X7BA 3FSGD 1C7JA 1CFJA 3WYDA 2XMRA 3WWOA 4C88A 1CR6A 3IURA 5ALTA 5T4BA 7YASA 3GBSA 1WCYA 3QMWA 3Q0TA 1WPRA 4AZ3A 2VJBA 1G42A 1BN6A 1CUEA 2DHCA 3DCNA 2I78A 3JYHA 5AKGA 2ZYIA 2G4LA 1WB6A 1YCDA 4DM7A 1YA8A 1SCIA 4HXFB 1Q83A 2HA4A 1BS9A 3PF8A 1ZGCA 4EY7A 4MQMA 3BIWA 5E4YA 2NW6A 2HRQA 2Y2VA 3WL5A 1SOMA 1MX1A 4BDTA 1E66A 4QDUA 5JADA 3QPCA 1UKBA 2WIKA 3HI4A 1ZI9A 2AJ8A 4G1FA 4L72A 3DOHA 1E5TA 3KD2A 2AXEA 2XE4A 2JIDA 2VA9A 4H0CA 3VJLA 1VJ5A 4OYLA 5KREA 1UKCA 1ZIYA 1QOZA 3H2IA 1JFRA 3WWEA 1EDBA 3F8SA 4QWWA 3IVMA 1KU6A 4MQLA 1RWQA 2J4FA 3VISA 4KEAA 1AMNA 2ES4A 3FVTA 3T4UA 1H2YA 2QJRA 4NS4A 4C4ZA 4J0JA 3C6XA 3U1TA 4B7ZA 5AKEA 2GZSA 1GQSA 5AI5A 5LZ5A 4L3WA 4EY5A 4Y2XA 1QLWA 4Q3KA 4ZWNA 1WB5A 2OPHA 3ZV7A 5ESRA 3D7RA 3O95A 2WU3A 3BJRA 3DYIA 5FKJA 2VF2A 1DT3A 4GEGA 1IVYA 2YXPX 5ALNA 2FJ0A 3C5WP 1GPLA 4CCWA 1F0NA 3STWA 3DOIA 4CFSA 1OXMA 4K6GA 4ITVA 3PFBA 4B84A 1EI9A 3JW8A 4B6GA 4EBBA 1YSCA 2RHWA 2HIHA 3TGLA 3H04A 2PPLA 5A7FA 3QMVA 4CCYB 1DWPA 1XRQA 1BROA 4HS9A 4WCVA 1D07A 2W6CX 5CH5A 5AI4A 5K3AA 1JI3A 2WIGA 3PF9A 2V96A 1H23A 1R4ZA 3I1YA 5C81A 3WMRA 1QE3A 4QDOA 3B3QA 3WJ2A 3G0IA 2XT0A 3C8HA 1A8SA 5E4TA 1CUBA 5DLPA 3WL6A 2WFLB 1MAAA 3VXKA 5HQ3A 5EGNA 4B80A 4OU5A 3R3ZA 4EA6A 1PV1A 2WJ4A 4DNOA 4BVKA 4F21A 2CMFA 2H7XA 4IHAA 3QYJA 3DYVA 4J0HA 1QIJA 3ESCA 3TRDA 4X71A 1AZWA 1L7AA 2GYVA 4RPCA 3G0DA 4N5IX 5AI9A 4S0XA 3I6MA 3WQHA 4BTVA 1JMKC 3CN7A 4BAGA 3GUUA 5JZ9A 4KACA 5BWCA 4ZXFA 2Y6VA 3M83A 1DINA 1SCQA 4BYMA 4FNMA 2QT9A 2UZ0A 3C5VA 1VLQA 4JYMA 2OCLA 4B85A 5IH7A 4XIIA 2QXUA 1WHSA 3HSSA 3I2IA 2XDWA 4BC1A 5EHZA 3R41A 5JANA 4W1PA 1N5MA 4BCDA 4A5SA 2GZRA 3CCCA 5ALSA 2PUHA 1CUJA 5I9IA 3IUMA 3HXKA 3H1AA 1K6EA 5EI5A 1BRTA 1XZFA 1FFEA 2HU8A 4UBNA 3IA2A 4G4JA 3W05A 1XZJA 1XKTA 3DQZA 4GW3A 4KR0A 1Z68A 2I3DA 3PFCA 1RP1A 1XQVA 4OB8A 4N8DA 1CUUA 2EDAA 1JU4A 4W1RA 4EY8A 2WHPB 3EQ7A 3L1IA 4B9AA 5FPPA 1T2NA 4FTWA 2QKYA 1DT5A 3JWEA 3A6ZA 4Y7DA 5ALWA 3SC2A 2JGMA 5ISMA 5EHQA 5JARA 1LPSA 1EK2A 3WKCA 3R3VA 4G8BA 4YK7A 5A7HA 5DYYA 4HZGA 3BE8A 4KE6A 5ALGA 3VDXA 5AH0A 4QWMA 3LLCA 1YAJA 4XJVA 4AN0A 5AKKA 3TJMA 2HA3A 3FBWA 4PNZA 1GGVA 4FLEA 3EBLA 3F67A 5CT6A 4Y2VA 4CI9A 2JGEA 1ZD4A 3BF7A 4B82A 4WFJA 4FMPA 4DGQA 5AI6A 4GWLA 1RYYA 3MGAA 4BZWA 1EINA 1MO2A 2XUGA 1XLWA 3WKDA 2XUHA 1N5RA 4HRXA 3VVLA 3I1IA 6YASA 5LZ8A 4KRYA 4OD0A 2H7YA 1NU8A 1XZAA 2DSNA 4BE4A 1BEZA 2QOEA 3STYA 1LPNA 3ESAA 1FFCA 2ROQA 2WIDA 4Q05A 3T52A 4AQDA 3AIOA 1LPAB 2Z3ZA 4D9JA 5CW2A 1U8EA 4GBGA 2QRUA 1ODSA 1QIMA 4G8DA 4F60A 3WYNA 4BC0A 1JJIA 3C8DA 2HRRA 4P93A 4DMFA 5DNUA 3PDCA 2RIPA 2V97A 5AKHA 2QUAA 5FLKA 5SYMA 4KAJA 4PSDA 1ZI8A 4FWBA 4PV7A 1CUXA 1HDEA 4L0CA 3I2KA 1X2BA 1ZICA 1C7IA 1U65A 1XRMA 1P0QA 4Q82A 1ORWA 1Y7IA 4DMKA 4GHWA 4UHCA 2BJHA 2C5GA 1U2EA 4WFKA 4YASA 2WILA 4MEBA 2X8BA 4P9NA 2WQZA 3OOSA 1A8UA 1ODTC 4W1QA 1Y37A 1P0IA 1CUAA 1AKNA 4WY8A 2QXTA 4HXGA 1J2EA 4MWSA 1IUNA 3SX4A 2XUDA 5ALUA 4M0EA 5D3KA 1XQWA 3U0VA 5HCUA 4GXNA 1QIIA 5HQ3B 4WFIA 2HU7A 1VA4A 4A23A 1R3DA 1UK8A 4AB1A 2XUKA 2HA2A 2WLSA 2C0QA 2PL5A 2JF0A 1QFSA 3ESDA 4PO3X 5A7GA 4JEIA 5K5EA 1ISPA 1YB6A 1H22A 4FBMA 3LP5A 4C01A 4Z49A 3E3AA 1WOMA 2ZJFA 2G5PA 4F0JA 2QJWA 4CG2A 5I8PA 2ACEA 4J0CA 4ARAA 3HJUA 4ZRDA 4BP9A 2XQIA 1ODCA 5ALPA 3AZOA 4G4IA 3O9VA 4BDSA 1TCBA 2QS9A 2XUIA 4ZI5A 4I4CA 1A88A 3TEJA 3IBTA 3BWXA 5AKLA 2DR0A 4AO7A 5HKBA 5EIEA 3FYTA 2PM8A 5BV7A 2XLCA 1ZD5A 5LKRA 2GBIA 4J0KA 3D4LA 4UHFA 1GT6A 1GKLA 1VZ3A 2G5TA 1BCRA 4QNNA 1LBTA 1W76A 4LIPD 3IB3A 1QFMA 5AKIA 4X92A 3HC7A 4HXEB 4P92A 5ALOA 1J1IA 1R9MA 5JALA 3GFFA 3E4DA 3RKSA 3E1GA 1HKHA 4DYHA 5FOQA 2HM7A 1FSSA 4JYPA 4X93A 1UOOA 5DNVA 1TQHA 1J06A 2XMQA 4G8CA 1TIBA 4JH0A 3DL4A 2YYSA 1LZKA 5AKYA 3H17A 2D5LA 1QIDA 4UHBA 3LIIA 4X97A 5ALMA 4ZREA 1O6FA 3YASA 3EQ8A 1VXOA 4UBLA 2W22A 3WZMA 3MUNA 3C87A 1DX6A 4HAIA 2JGIA 1W4LA 3FCXA 2G63A 1XLUA 5ALYA 1CV2A 2DFPA 4J7AA 4OYYA 2JGJA 1LPOA 4CIBA 4X91A 3C45A 5C8VA 2OLEA 3K9BA 3H2GA 2RONA 4H7HA 1H2XA 5AIBA 1WHTA 3WK7A 2WFMA 3V9AA 5AI0A 3RARA 5LZ4A 4X90A 5LKAA 4K6KA 3WK5A 3AIMA 5A62A 3A70A 3C6YA 1L7QA 3BXPA 4TGLA 5DTJA 4N5HX 1VE6A 2HA7A 3EIOA 1AC5A 2VT7A 4AX4A 2WUGA 3H2KA 1UK9A 5C7YA 4H7FA 4NVRA 4L9AA 4H7JA 3KWFA 3F97A 1AURA 5AIAA 4I3FA 1GXSA 5ALJA 3V1KA 3C6ZA 5HFNA 1CUGA 2ECFA 2B4KA 5AK4A 5HK8A 1N8SA 4TPKA 3OURA 4FHZA 3WWCA 3NUZA 1HPLA 2XUOA 3MUOA 5ALZA 1UK6A 2XQJA 1K4YA 3V1NA 2RGUA 1ETHA 5IVIA 3W9BA 1CUCA 5AO9A 3S2ZA 1GPKA 3G9ZA 5F4ZA 2OCIA 4IQ4A 1MX5A 5CURA 2WJ6A 2WTNA 3DKKA 4QDTA 2ZYSA 1TCCA 4INZA 2PSDA 4A16A 4YPVA 1KEZA 5ALQA 2FJPA 5JATA 4Y2SA 1M33A 1MN6A 5HZGA 4QLOA 2JGKA 5FP0A 1LLFA 5AK5A 1TK3A 4OCZA 1IUOA 1AUOA 3QZUA 5JAOA 5JD4A 3FLBA 4GDMA 2WTMA 1XRRA 4Q3LA 4BVLA 3HZOA 3IIIA 1CQZA 2XMSA 2J3DA 3ANTA 1OILA 3HEAA 2R11A 2QR5A 1NX9A 3X3HA 2VEOA 5EHNA 1G4HA 3V1MA 2BGNA 1MNAA 1BU8A 5ALFA 4BE9A 4K6HA 3DLTA 4G5XA 5CH8A 3WWPA 3S8YA 3STXA 3F98A 2BUAA 3IDAA 3D2AA 4XVCA 1DQYA 1UWCA 3CCBA 4WJLA 1XROA 1JKMA 2OG1A 3D2BA 1UXOA 5ALLA 1XRLA 4V2IA 1VXRA 4EY6A 5KWIA 4PQEA 1W1IA 1DU4A 2O2GA 4GLBA 3W06A 5KWJA 5AKXA 4PW0A 4GI1A 1CUSA 2VSQA 4Q3OA 2QVBA 5JZSA 4UBKA 5CBKA 3VVMA 4NMWA 4H7KA 2IITA 3ZLTA 1I6WA 4OPMA 1G66A 4DMCA 3ZLUA 2Q0XA 5T4FA 1ACJA 3KWJA 5CRIA 1ZJ4A 1BEEA 1EDEA 1YASA 4Y2PA 3QMMA 1EX9A 1VKHA 3BIXA 2OGTA 1CUDA 3EQ9A 4K2AA 1K5PA 4LYEA 3H18A 1MU0A 3OTQA 1JJBA 3KSRA 4KE9A 4UFOA 4O08A 2E3JA 2QM0A 5C8ZA 1T4MA 3AINA 1JMYA 3O9MA 3G8YA 1YA4A 1WB4A 1EVEA 3G9XA 4BZZA 3DNMA 3RLIA 1EB9A 2OGZA 1ZD2P 2HHAA 4QDXA 1A8QA 2DQZA 1TKRA 3D59A 3GROA 4H18A 5FUMA 1QIFA 4UFNA 2XLBA 2AJCA 1QZ3A 5DYWA 3LS2A 1E3QA 3Q8WA 4X00A 5EIHA 4X6UA 3WLAA 1H2WA 1ZI6A 4AMYA 1DWOA 3ZI7A 3FWHA 1UK7A 4U2BA 2XQKA 4LKOA 2D0DA 3HACA 4BCCA 1YS2X 4FNGA 3ZLVA 1IZ7A 3M82A 4UFPA 2XMDA 1J07A 1A7UA 3C70A 1K8QA 5AP9A 5T4HA 3QBJA 1E89A 5JAPA 2AJDA 1S8OA 1R9NA 4XWGA 1EHYA 3QVMA 3V1LA 1Y7HA 1MPXA 1JJFA 1SFRA 3GA7A 3IUNA 4UUQA 3WKEA 4LHEA 2IX9A 3B12A 4P08A 3G0CA 4B81A 4QEKA 1ZJ5A 2I03A 2C7BA 1QO7A 2CB9A 5DNWA 4MEAA 2O7RA 2XMZA 3O4IA 5JD5A 5YASA 5LP1A 2YASA 1USWA 3QITA 4C4YA 4DTCA 1XFDA 2ACKA 3H1BA 4EZIA 1HL7A 3AIKA 4FLMA 3AILA 2H9YA 2QTBA 1CUHA 4Y2TA 1GQRA 4E15A 3I2JA 5JAHA 2BUCA 3M3DA 4FFWA 1AQLA 2I3ZA 2ZSHA 3QH4A 2JGLA 3WK4A 3PICA 1E8MA 2LIPA 4E46A 2XMGA 3WK9A 1QTIA 5ALXA 1YR2A 2CJPA 1MAHA 4H35A 2HU5A 2GBFA 2X76A 5HF5A 4KYVA 2O2IA 5IVDA 1FFAA 1CLEA 1LGYA 2V98A 3PE6A 1XZIA 4KE7A 3D3NA 2WSLA 5H3HA 3PI6A 4DNFA 1P0PA 4JNCA 4M0FA 4C4XA 3H2JA 1LBSA 2OAEA 1THGA 2VTVA 2PSJA 4LXHA 3O4GA 2CEKA 2Y6UA 4PF1A 1XZMA 4Y2JA 5AKJA 2HFKA 4G9EA 5HF8A 3SK0A 4X6XA 2BKLA 2WG0A 3H2HA 3FNBA 1XZGA 1TAHA 2PVSA 4FKBA 3AZQA 5EHXA 3IUJA 3DL7A 4G9GA 1W75A 5LYYA 5LZ9A 1X70A 4I19A 2HL6A 5ALHA 1VE7A 4FOLA 1X2EA 2OQVA 2XMCA 4W9RA 1MT3A 1LPPA 3BDVA 1YAHA 1DX4A 2WIJA 4BRSA 1C4XA 5AKZA 5AJHA 1MX9A 1BE0A 5JASA 2FUKA 2PSHA 3DDUA 4KAAA 5FPQA 4LXGA 2QUBA 5K3EA 1QJ4A 1R88A 4RE5A 2VATA 4EUSA 2ZYHA 3W04A 2CZQA 1HBJA 4WY5A 2XUAA 2IIVA 1XRNA 1UFOA 5CXUA 1DWQA 4IH1A 2CBGA 5AK6A 2DHEA 1CUZA 3O4JA 4U2EA 4FFVA 5AM4A 2X5XA 4MJ3A 4QZVA 5LZ7A 3P2MA 4X95A 2VQ6A 1ZGBA 4TVKA 4G4GA 2H7CA 5SYNA 5K3CA 3FOBA 4AZ0A 1GKKA 2BFNA 2HADA 2VAXA 3FLEA 1TRHA 4PSUA 4ZV9A 3FYUA 2Y2UA 2R8BA 3G9UA 3GELA 2JGFA 4IO0A 4E14A 3WWDA 3N2ZB 1QIHA 4UBMA 1XRPA 5HF6A 4FDMA 3WA7A 5AOCA 2PU5A 3ED1A 2OXEA 1CQWA 5JYCA 5K3BA 1IZ8A 4XX1A 1TCAA 4IH9A 1CRLA 4OU4A 5ALIA 2WG2A 5A2GA 5AK3A 3KOOA 2HA5A 3CN9A 5A6VA 1F8UA 1THTA 2GBCA 5E4JA 2YH2A 4MXDA 1MJ5A 1CUWA 2C5FA 3DJYA 4U2CA 5K3FA 1ORVA 2ZJ6A 1XZCA 4QA9A 2WM2A 4BTLA 3B5EA 1WPXA 4OB7A 3E0XA 2HFJA 3AZPA 3BF8A 5LIPA 3WK8A 1QIEA 2DQYA 2WHQA 1OCEA 2Z8ZA 1R1DA 4Y2QA 5BOVA 5HK9A 2XUQA 1EK1A 2PBLA 1L7RA 3BJMA 2J4CA 3O0DA 3STUA 4AO6A 2P8SA 2O2HA 2EDCA 1E8DA 5AM0A 4CG3A 2K2QB 4B9EA 3ICVA 1QIKA 5LZ2A 1P0MA 1CIJA 3WL8A 4K5QA 2XQFA 3VJKA 3KXPA 3CXUA 3WIBA 4X6YA 4X94A 4H7EA 4QLAA 4AN1A 2XMBA 4OSEA 3WI7A 3HLKA 4FLFA 4RGYA 1WM1A 4RNCA 4NZZA 2AJLI 1CPYA 2C58A 1VOTA 4UHDA 2OCGA 2RI6A 3AFIA 5CXXA 2ZSIA 3A2MA 3FAKA 5AI8A 3R0VA 3WIOA 3F96A 5C8XA 4HVTA 4C89A 3D5EA 4ROTA 2VAVA 1W52X 5LLSA 3LIPA 3G0GA 2QMQA 3QPDA 4MYDA 2DCMA 3DS8A 2GYUA 4EY4A 5D6OA 5HKAA 5CT8A 1XLVA 4H77A 5AM2A 5EFZA 3R3YA 4J0GA 1FJ2A 5J3JA 5E2IA 5JAUA 1DQZA 4LXIA 5IVHA 1NU6A 4HTAA 4N8SA 3AJAA 3NGMA 1F6WA 1K63A 1GPNA 4BATA 5ALVA 4H7DA 3R3XA 5DTIA 3M81A 1H2ZA 4J3JA 5ALRA 1ACLA 1EH5A 5FRDA 4MWTA 4FBLA 1SCKA 4WDRA 2WKWA 5CT5A 5IKXA 1QONA 3H19A 5D3ZA 2HDWA 4YX9A 1QIGA 4J0DA 1GZ7A 3G9TA 4CIAA 4OUKX 4AMZA 4BBZA 5CMLA 2XQGA 5HF9A 1EVQA 3IULA 3A2NA 3UUFA 2VJDA 4CG1A 1G5FA 3F9CA 4HRYA 3I2HA 1LZLA 1BN7A 4UBIA 2AJBA 1XQXA 2PX6A 1UZAA 4Y2RA 4JUIA 4UHHA 2XUFA 4B0PA 4C87A 1XZHA 3BDIA 2CUTA 4U2FA 5CT4A 4EB0A 4M0MA 2RAUA 1AGYA 3PUIA 3I6ZA 5D7BA 3LCRA 2ZYRA 3AUKA 1IUPA 1PJAA 4W63A 1FFDA 1R50A 2OGSA 3D0KA 3R3WA 5AM3A 2PSFA 3G02A 1XZBA 3ZWQA 2XI4A 4BB0A 1EXWA 4DSZA 1N1MA 2GYWA 1CEXA 4B0OA 5T4EA 1SC9A 4MYSA 3MVEA 3PUHA 1W6RA 2XUJA 3FCYA 5ALEA 2HA0A 4ETWA 5DYTA 1O6GA 5HFAA 1ZIXA 5EIAA 1UT6A 1PFQA 3UMJA 5FXMA 5AHXA 3WKAA 5BWBA 2GBGA 1EA5A 4E11A 3G7NA 5DJ5A 2QZPA 3OC0A 2WU4A 2Z8XA 3HRHA 3I2FA 4BAZA 4AXBA 5JD6A 2PSEA 3FYUB 2ONCA 2Z5GA 1MTZA 2BGRA 1EDDA 4AO8A 1XQYA 4ARBA 4UPDA 2ORYA 3FSGA 3N0TA 4ZV7A 5JIBA 1KU0A 4IH4A 3WZLA 1YB7A 3WK6A 2WJ3A 1YS1X 4KE8A 4DLNA 5K3FB 4PSCA 1ZOIA 3ZPXA 3W2TA 2C0PA 4X3CA 1XZLA 5AM5A 2WUEA 3I2GA 2WIFA 4X85A 5AOBA 5FDFA 4LYDA 4DNPA 4J0IA 3WKBA 3C6BA 2RHTA 2OCKA 3WA6A 2PUJA 5CTAA 2WUFA 5K3DA 1XKLA 3DEAA 3FLAA 1ZD3A 3STVA 3L1HA 2B61A 4U2GA 2O7VA 3ANSA 3EF3A 2H1IA 5CH3A 3WL7A 4U2DA 1EB8A 3BL8A 4EHBA 3R3UA 1CUYA 2WG1A 4Y2YA 3GZJA 2EEPA 1CVLA 1LNSA 1DTEA 4Q34A 4Y9SA 3OM8A 4F5ZA 4B83A 4RE6A 1Q0RA 2PU7A 3FVRA 2Y1KA 4CCYA 5JZBA 2CKMA 3HYSA
chains in the Genus database with same CATH superfamily
3WSVA 1KQPA 2X19A 3NWOA 5B30A 2XB6A 2EWWA 3PNYA 2XCLA 2X22A 2ID7A 3HEBA 3W7AA 3ER8A 5E7MA 4DQUA 1HQDA 1PG0A 4GKJB 1AKRA 1Z75A 1C4KA 3VJMA 2QTWB 1UMBA 2Q3BA 3Q3HA 4EG7A 4C6HA 3KNZA 4W5OA 2ZDHA 3F9RA 1RXWA 2EERA 2NUBA 1U7PA 2ZAGA 3UAGA 4ZJPA 2CDBA 3ASUA 4L27A 4UDXX 3WRXA 1R27A 5IJAA 3SOPA 5M2QA 3NWPA 3OZEA 2JCGA 1GZSA 2W2LD 2Z8YA 3QOFA 2Y1DA 4H3HB 3RVLA 2XKAA 3ZQ6A 3SWWA 1E96A 4JQYA 2HNAA 3QWFA 4I4IA 1ZJZA 1PAUA 2L19A 4J7UA 4A10A 3ZU2A 1G6Q1 3FF4A 1V3UA 4NENB 1C81A 5IJ9B 2E87A 1H3FA 4RD1A 3Q7EA 4B74A 1WMDA 3JQBC 2PKQP 3VM6A 4DCOA 2BKVA 2C1XA 2H5LA 4JWKA 3V8RA 3A6EA 3PA8A 3V9PA 3O03A 1QYIA 3OIGA 4QOHA 4MIYA 1LFDB 4MW0A 2ONJA 2QGFA 1HMYA 4UHEA 2YMPA 4PCUA 5THXA 2X5OA 5DE3A 4W5RA 2O54A 2COEA 1OAAA 2IOQA 3UN1A 1PWZA 1LPBB 3DTTA 3N3AC 4R6XA 3EDQA 2VS1A 4IRUB 1NUUA 2ZG6A 4LI0A 5HQTA 2FF5A 3CWQA 4MQ4A 1QK3A 4H27A 4P31A 3LQ2A 1DZ3A 5JTUA 3JWIA 3IO5A 2Q5FA 3M89A 4CL3A 3G2KA 5KYXB 5A4JA 3CW8X 2EHJA 2ZI5A 1AOXA 3L0CA 3N75A 3OJXA 1E9VA 2CXRA 1TQ2A 1X8XA 2JEZA 2PKQO 4E4YA 1YZLA 4TOIA 4RVNA 1VSVA 4AC9A 4X1IB 3SD7A 3JZAA 4C7BA 1S3IA 3JVDA 1WZEA 4XX0A 1ISJA 1YTLA 1GR0A 1O4VA 3H4VA 3MGBA 1U99A 4AU1A 2ZPUA 4JXKA 3D7SA 1GTJ1 3PSAA 3CB2A 2B6NA 4UOZA 5BNWA 4DQKA 3CNHA 5KNBA 1PGJA 2H1SA 3L8ZA 3QUQA 1JU3A 3AH8A 3S1LA 2BUBA 4OGWA 1M72A 3MTIA 3VAZA 2JZOA 5FV4A 4G1CA 3X2EA 4P98A 3DV9A 1WV0A 4G1VA 4ZC1A 5IVPA 3N2IA 1F0PA 2Z3WA 1U9IC 2AT1A 4P3YA 2CSXA 1KZ6A 1NVUQ 4JODA 4Q1FA 3SR4A 4DLAA 4JC0A 1CUIA 4DCGA 4ND1A 4BASA 2B9VA 4GECA 4KAFA 4ALJA 2ZI7A 1J0BA 3DMFA 1VI2A 1D2HA 2ZWIA 2PA3A 1R0CA 4P4LA 3AU9A 3OLVA 3VNRA 4ABYA 1HRDA 5EZ5A 4ENRA 4I14A 5EESA 3VKFA 1OLXA 4ECEA 1Y8RB 2I2XB 2WYVA 2O2XA 3RK4A 3DDZX 1ODKA 3WISA 4KV9A 4FD3A 1S2DA 2PLRA 1YI1A 3B1ZA 3I28A 4IDQA 4IV5A 2EJCA 1VLZA 3IAM6 4RSGA 4E1AA 2WUDA 2QJOA 5EJ9A 4ZT3A 2MTBA 2Z57A 2AN4A 4RIHA 5FWDA 3RFXA 4IDFA 4CLHA 1L7XA 4K40A 3IB6A 1UKAA 2OO5A 5KYWB 3WRYC 4IDAA 1GRVA 3IRVA 2GHQA 2Q62A 5JY6A 1NURA 4AG6A 2J3QA 4M0CA 5CHEA 3GO4A 4C06A 1NKVA 1D7AA 4W1SA 5CT9A 3FGPA 1YGYA 3KZVA 3W90A 2Y1EA 5C8DA 3FMGA 1NDUA 4V1CI 3ENQA 2PL9A 3PXCX 4WXHA 5CBPA 1QU3A 2MOKA 1TUIA 1FU4A 2B6HA 3ML1A 3NEJA 3RRXA 4KHPB 2OZLB 3QG5A 2XSZA 5I7EA 3OETA 2W6OA 3JAWB 3CBQA 3UPDA 4ESOA 1T5TA 2DLCX 1L7OA 2BMVA 4OHYA 3E8SA 2X0FA 3WL4A 2RKBA 4MVJI 1T6NA 2I2WA 3GLHA 2P9BA 4DSUA 2AFVA 2ERYA 3FJ1A 1S2NA 2XWPA 4IO1A 5F73A 3NOXA 1B2LA 4CV1A 4MNTA 1VYVA 1F12A 4G97A 1COWD 1JEQB 4N8EA 4QRIA 2SCUA 4OQNA 2O8BB 5H3LA 2PJUA 3QPAA 5A71A 2OMEA 2P5TB 2R1VB 4YXWA 2I4RA 3R40A 3I62A 1U8AA 3FPFA 2PUAA 1IK6A 3F74A 4C88A 3WWOA 4CMGA 4MV7A 3R77A 1QAQA 4RDIA 5E6SB 4ZEMA 4FYXA 4HNRA 1MVLA 2H2HA 3AEKB 7YASA 3L8CA 4BMDA 1Y4ZA 4HWTA 4AZ3A 1RAAA 3A6DA 2W58A 3ND6A 3R7DA 4B79A 2EJTA 2B8WA 4DCUA 1QVAA 1Q7BA 5B2FA 3VZCA 1G42A 3H6KA 4MQEA 3LCVB 1T9GS 2PZFA 3DCNA 1AMUA 1MOPA 4RF5A 1E6CA 2X5NA 5AKGA 1LD3A 2PR2A 2G4LA 2ZYIA 3ZCTA 4BMPB 3EXIB 3R3JA 1Z15A 5KWSA 1I13A 2HPHA 1NOJA 3ZJVA 1SCIA 3KT6A 4ATNA 4RKEA 1Q83A 3GWGA 3L9WA 1NMEA 2HA4A 2YV3A 3E9RA 3PF8A 1ZGCA 4KIUA 3EFEA 1D09A 3UB2A 1KEEA 3BT7A 2IS2A 4QYIA 2FWNA 3WGGA 3KZXA 4EY7A 4XUCA 3FTDA 1ZD8A 4YCCA 1RPJA 1VIVA 2AOTA 3EGIA 5E4YA 3BA1A 2QTVA 1M2VA 3NIDB 3ROMA 4B76A 4C7KA 4CEIB 5CPBA 3UJNA 3MMXA 1NULA 1SOMA 1EWVA 1MX1A 2XF2A 3CUTA 3EH2A 1G2IA 2Z2ZA 3ITNA 1A9PA 3IEKA 1NLZA 3Q6NA 4PINA 2F64A 1UDWA 2K6GA 5JADA 2AFHE 2QQ0A 5EMMA 2FWPA 1YBVA 4UEQA 5FTWA 3V7WA 4FYYA 1ISIA 1NF8A 2RCYA 4CPDA 3OESA 2H63A 1RYZA 1AKEA 1ZI9A 3FWYA 1T4CA 4G1FA 2RE8A 3UENA 1XAJA 3C3MA 1YRBA 4LXQA 3OMXA 3KD2A 3MJ4A 4OLBA 1DMRA 1M75A 1WMBA 2XE4A 1O95D 2JIDA 2Z08A 3ZIAD 2C54A 1J5EB 3DQQA 3M5CA 5L6MB 1IXSB 1LRKA 3MWKA 1X87A 2Q45A 2YMQA 1PJCA 3MYRA 4JBXA 5IDXA 2QAGC 5KREA 4I1PA 1AV6A 2NNLD 7ABPA 4WBSA 1UKCA 2JAHA 4DRXA 1M34B 4CKBA 4J0QA 3CVVA 3AL0C 1ZIYA 1J8VA 4UCXA 5CLGA 1I01A 3CLSC 2B4AA 4B6QA 5DOVA 1P5FA 2XZTA 3HVHA 2F59A 2YV4A 1CCWA 1SNYA 1DAHA 1TC2A 3DVAA 2HMSA 2QW0X 1W9HA 3Q3IA 4OMDA 1U5AA 1GPH1 3R6DA 1T9HA 3VISA 5A5VA 3JWHA 1B0ZA 4A8JA 1EWYA 3GLHE 2GA9A 2VPZA 3MTDA 3FVTA 2HRDA 4HDRB 3T4UA 5JSHA 2ZZNA 1I7QB 4DLVA 5AVKA 2YUIA 1IBLB 5GZ6A 1XHFA 2BGJA 1VE9A 2GKSA 3OU2A 1PEKE 4R05A 3IBFA 4LTMA 3MMPA 2O19A 3UG6A 4C4ZA 1T5IA 1XWWA 4AK9A 2F1RA 1LJ8A 1ESCA 2ZYDA 2R6JA 3A9RA 1TM7E 3REOA 5EUMA 4YACA 4ALKA 1H85A 5AI5A 2Y05A 2I6GA 2JFFA 5DEIA 4GKKB 3TPZA 3DR5A 4L9WA 4ZD6A 3GWZA 4L3WA 3M6VA 1V7PC 1TPZA 3DCIA 4TYPA 2IH4A 2DH6A 1SU6A 4Y2XA 2ZB4A 3B85A 4ZT4A 2VCYA 2EZTA 1KZYC 4LJ6A 1QLWA 2C9DA 2DP4E 4N0PA 4Q3KA 2OPHA 1G8FA 2V45A 4OHWA 1XRJA 5IABA 3DTVA 3GJZA 2WU1A 4IF6A 2V5AA 4IV0A 1GPWB 1T4DA 2PK3A 4IY1A 3BXFA 4LMAA 2P11A 5BQ3A 3GDGA 3DFIA 3C14C 3ND9A 3EG5A 1H0KA 4GYJA 3U6KA 5FKJA 1Z62A 3ANXA 3ZWYA 5BN5A 5A02A 4JSYA 5C37A 3GLSA 3BAFA 1SK8A 3BRWA 1I2ZA 2FJ0A 5F1OA 2F00A 1GPLA 3LV8A 4IAOA 5AVRA 4KIJA 4ZZ0A 3L7CA 1ZA1A 4CCAA 4L1KA 3THWB 4CCWA 2W2XA 4PYIA 4Q21A 1P6XA 2TYSB 4CFSA 4G25A 1GGFA 2Z4TA 1K6MA 2GCEA 4ALIA 3R2JA 2IV2X 2H51A 2Q1TA 4B84A 1NX6A 2K2WA 5EIFA 3BWCA 1EI9A 4UNNA 5TT0A 3ROXA 3ZCPA 2IHUA 2YVUA 4BMVA 4XWOA 3INYA 4N76A 4G01B 2GF9A 1YSCA 1V8PA 1AKVA 3AP3A 4URHA 2HIHA 4FILA 4F71A 1T1SA 3E27A 4MULA 2GN6A 5MN4A 1VJTA 2GQ0A 1C9NA 4X64B 1WZUA 3E22A 4PRLA 4WCFB 1ZVJA 2YWRA 4MPDA 2B8NA 3AERA 2JHPA 1NA5A 2L0XA 4F6LA 1XDZA 2FN9A 2L18A 4GPBA 1D07A 2BEWB 2H4ZA 4ZKEA 1G21B 3ZWAA 4MV5A 4RADA 3OOWA 1DFIA 4IQGA 1LF5A 5CH5A 3EIHA 1H4TA 2ZYUX 3JYNA 2ZPAA 3MAJA 3P52A 2IU0A 1E98A 3TOVA 5HGXA 2NQ8A 3ZBUA 3GN2A 2GK7A 4FNAA 1NR5A 4JASB 4EZBA 1AF7A 3FFWA 5FI0B 2W4IA 1PVOA 4GBED 2D7JA 3NETA 4OK3A 5DHUA 3D8TA 4PG7A 5T6BA 3MLEA 4NE9A 4BIIA 1Y4DE 2JI9A 3FZGA 1J25A 2WNIA 2ZIXA 1PFVA 1MO4A 3KJQA 2QX6A 4R9SA 3EEFA 5C81A 3SQDA 3B3QA 4NS1A 3WJ2A 4KH1A 2H08A 3PQCA 3ZH2A 4EFLA 3LL4A 2ID9A 5LYJB 3C8HA 2Q5EA 1RQGA 1J09A 2NGRA 2Q4EA 3PPIA 1VLLA 4R5MA 1CUBA 3KFLA 1QVWA 3DF9A 4JAVC 1RI3A 3LY9A 5A5DA 2WFLB 5EZYA 1T9GR 4PONA 3FMVA 2VR1A 4MW5A 3S81A 4YRRA 2C2MA 2Q1SA 4DR4B 3W5IA 4B80A 2IW1A 5J5VA 3O7WA 1KKUA 3DLCA 3L05A 2VBIA 4CKEA 2H59A 4JU8A 4EA6A 1KQFA 3QTLA 4D7AA 5HM6A 3NC1C 3T1NA 3EMVA 1K8YB 3LX6A 1TYEB 4L75A 5KHOC 2RJ3A 5JISA 3GB9A 3WQBA 2HZBA 3RKRA 2Q9UA 3TRDA 1G8JA 3H9QA 4OV6B 1IQRA 1AZWA 1BX1A 2XVYA 4X71A 4WLEA 5B1DA 2GYVA 2QN7A 2NYRA 2DWOA 1DCTA 5CDFE 1IUKA 1JEJA 1SCUA 4G5YA 3WHIA 4RPCA 5CVDA 3WXMA 2NP7A 4J3FA 4PQFA 4S0XA 5LD2B 3ZV3A 2VDUE 3D8NA 2Y9MB 2FU5C 1ZL2A 3FH0A 1L4BA 4JL5A 1GFWA 1JMKC 2XAAA 3IVRA 4G63A 2IS1A 3CN7A 1DEHA 3P9YA 3HJBA 4GLLA 4RHCA 3RFCA 3TZQA 1SURA 1NAIA 2P67A 4EHKA 4NXMB 3A4YA 3HGMA 3Q12A 1A8PA 5GIPE 3QEAZ 5BVGA 4ZAGA 5BSTA 4KPYA 1O89A 3WX0A 2YV5A 5DX0A 2QRVA 4TKLA 4BZPA 1TO1E 4P7FA 4JQSA 4D26A 4RGQA 2OCLA 4B85A 3TDKA 4XIIA 4W5NA 1QORA 2C9MA 3HSSA 3K32A 4YV0A 1V8FA 3THXB 4G5FA 4EG3A 1WXEA 1FNBA 3SBDA 4DG5A 1MGOA 1YGPA 2I2DA 5EHZA 2V7VA 3GCXA 4W1PA 3FDXA 3TIGA 1B2RA 4ESEA 4A5SA 4B45A 1ESEA 5CFZA 1FSPA 4JLSA 3ROEA 5A0VA 1M1NB 5B55A 1Z7YA 2PUHA 1HA3A 2VKQA 4O3FA 5HWSA 1YJAA 2HQRA 2JS7A 3IIKA 1HOTA 3QOYA 4D3XA 4PYLA 5J5AA 1NUQA 3KZNA 4FYIA 1MIOB 4NCHA 4PSKA 3FDIA 4TVOA 4ETNA 4PC1A 3H1AA 1YBMA 4I8DA 5CK5A 2FWMX 2VHQA 5KQPA 3CVWA 1N77A 1TEVA 1ZCBA 3TL2A 4C3VA 5KOHB 3RTCA 3QVJA 5BN1A 1UDAA 2PKCA 1TZJA 1NQUA 4RANA 3EVEA 3KS9A 3H5AA 2FPKA 1T10A 2GLUA 3Q3JB 1S9DA 1SQFA 1FW8A 2R6ZA 2IEIA 2DECA 4JLDA 4L3OA 1R18A 5CLJA 2A9VA 1FFEA 1F14A 5JS8A 3RIHA 5IJ0A 3IA2A 4G4JA 1QHFA 4K9SA 4DL9A 3W05A 1FP6A 5A4MS 4E7PA 1T2UA 4WZZA 1FLNA 4Y1RA 4DQLA 1SHZA 1CJMA 4D4MA 5JSUA 3T35A 5L3SA 1LB1B 1PWEA 1X1QA 2HBRA 2I3DA 2R6DA 3RVRA 2FWAA 3CJTA 4UVHA 1XL1A 2D5CA 1T91A 2X14A 3IXMA 4YQYA 4ZALA 5HUJA 2VXCA 5EJ6A 1MX3A 1NNI1 2Y99A 3K0SA 4NZOA 3KT0A 2WB2A 1QFJA 4OJKA 1TQ4A 4GSKA 4CTKA 4OB8A 4ODIA 1CUUA 4MO2A 2NXCA 4DKXA 5IT5A 1C1DA 2EDAA 4W1RA 1Z34A 3EQ7A 1BCSB 4RSMA 1TEXA 1SCNE 2ZYAA 5FPPA 2QTAA 4QBIA 3WICA 5B5SA 4C7XA 2Y77A 4C21A 3AF0A 1JTFA 1N1DA 4YCLA 4IX9A 3OCJA 4D3SA 5B1SA 3E9EA 4PAQA 1I2MA 1RPTA 4FFPA 4KGZA 3V8MA 4H3VA 4D8UA 1LPSA 3X1XA 2WHXA 4J1NA 2CUNA 4GP9A 4EJ6A 4JDUA 4PANA 3GDWA 5AJWA 3AEQA 7AT1A 3R3VA 4XR9A 4Y98A 4BNFA 5A7HA 1TB4A 1JRLA 2G70A 2H31A 3HL4A 4KI0A 3GH3A 4X44A 1YZKA 1FFHA 1VL5A 2JIPA 2P4HX 2ODTX 2QZ9A 3N0XA 3HUEA 2DZDA 3P9ZA 5ITWA 3L79A 1O6CA 5B3LA 1CE8A 3U4QA 1G9XA 1VI6A 2ZSAA 3RS7A 1L8AA 1RRKA 4R2HA 1JYSA 2BONA 2BM1A 4UCWA 3LLCA 2MDTA 3N8HA 1YAJA 2OBBA 4XJVA 1VHLA 1DQNA 3CUWA 4EX7A 2BBSA 1GRNA 3JQAA 2HA3A 1ZUWA 2AXPA 3HB7A 3I42A 3GVIA 5IEJA 5LA6B 4Y6OA 3UB4A 3EEOA 3D7MA 4GL2A 2IDMA 3HJRA 2M32A 4LZAA 4Q9KA 1C9MA 3F67A 4EEZA 1ZWKA 4FN4A 1IPFA 5DMXA 3L8HA 3S3TA 4CI9A 4JDPA 1MO3A 4OAPA 1FYDA 4EJSB 2XWBF 3SIXA 5BWMA 1FUKA 2JATA 3FFXA 4WFJA 5JSZB 1U5BA 2QX8A 4N1AA 4RTRA 3OP1A 4QTZA 4P3KA 4XPIA 3ORYA 5IWAB 1KMNA 2NU9B 4G2TA 3FRHA 4MIEA 4TQUS 4B3MB 3P2EA 3NRBA 3EVDA 1W4AA 3HCPA 4FMCB 4C4RA 1NG1A 3EXEA 1NHGA 1XMXA 3RVSA 2FEWB 1V71A 3MGAA 1JVSA 3PKJA 4BZWA 3JQDA 3ZQUA 2GCNA 4EARA 3QWAA 3RU9A 1JQEA 2DAPA 1XLWA 5KUTA 1OXVA 4M99A 1HDCA 2D2VA 3PNQA 2O8EB 1QAMA 5HRAA 1HC7A 1MA0A 4U7TB 3ZZTA 3I1IA 6YASA 1GCUA 1RAIA 3DE0X 5GAJA 2GSDA 4KO2S 4FOPA 1YRAA 3GYBA 2VRNA 4JOQA 2WEKA 4YJKA 3UF0A 2VPWA 2Q49A 2H7YA 2V1XA 3W4JA 3THYB 3CLTC 2VPYA 3SYTA 3FCCA 3BB4A 4M76B 1JDPA 4R98A 4RA6A 2WV7A 4Q39A 4PBSA 3B2QA 4TWIA 3H7IA 4IXNA 1NBAA 1THZA 1U7ZA 2RB4A 2Y9PB 2QOEA 3BWDD 4Q37A 2G36A 1OY1A 1TT7A 2Q1YA 1NPYA 3ZWXA 5GINE 4CV3A 1VDMA 1FFCA 1P60A 2GF2A 1Q0UA 2R1UA 3SEZA 4DPMA 3PLAE 4YPOA 4LDNA 3ZY6A 4MLZA 2QRHA 4J4HA 5BSRA 4AQDA 2VSXA 1RHKA 4UW9A 5JYEA 1ZLYA 3B6MA 3KVVA 5LB4A 1U8EA 3BL6A 5AOVA 1TM4E 4EW3A 2RGCA 2BFEB 5ESXA 3LAWA 1KK0A 4XQEA 1TM2A 3A9VA 4Y0AA 5IYZB 2OYSA 1G8MA 3IS3A 2W7TA 1H93A 3QYAA 4L08A 5FT9A 1OW3B 4P93A 3RJZA 1G3RA 4A5OA 4DMFA 3KJHA 3L1KA 4WLFA 1V3QE 3IHLA 3MGKA 1IBKB 3M3PA 4NG4A 2JGDB 1ZISA 2HSGA 3T5TA 1MORA 1PN3A 2DOKA 4GI7A 1BMTA 2RIPA 3L6EA 3R7AA 5K20A 4GP6A 3A05A 3G49A 2QUAA 1QJCA 1FFXB 2WD7A 5SYMA 2FQQA 3BD8A 5FQOA 5GZ3A 1Z5WA 2G6BA 2WAXA 1T3HA 3MLAA 1L4EA 4BN5A 5CB4A 1V37A 1W5AA 3OU6A 4AJLA 5HZMA 3KSUA 5ITZB 1BVYF 3EXG1 3THRA 4DAEA 5AUOB 4PV7A 5ADWA 3HBLA 4AWBA 2H4XA 1X7GA 2VTKA 3EC7A 3KEMA 1SBHA 5TQ2A 2XRZA 2CXQA 4PQYA 5C18A 4K3UA 4MTLA 4MWBA 3ZK8A 4YUZA 1ZICA 4NQZA 4YRFA 1C7IA 5J4KA 4M8SA 2QQGA 1FE8A 1H5QA 3PYMA 2ATEA 2XRYA 5ADVA 2KHZA 3G1WA 1YRLA 4TROA 1X80B 4DMKA 1GG2A 4DPLA 5CNKA 3G2QA 4ZCPA 3MK31 1YHYA 1R0LA 1H3EA 4OLJA 3VR5A 4GT1A 2OV8A 1VG1A 3TVYA 2AI3A 3HFRA 1XJWA 4RJJA 2J9ZB 1MW9X 4PZLA 4IDEA 3NGXA 4E2XA 3SHFA 5HXAA 5IHPA 1D9XA 2AF3C 3PKIA 1CNMA 4LHZA 2EJBA 1UKVY 1Z5GA 2UU9B 1ZD9A 3PPVA 4MEBA 5BP7A 3UHAA 3IEVA 1M2WA 3GFGA 3NTRA 4O2BB 4ZAVA 4Q4AA 3EG9A 1SBNE 1A8UA 4BKUA 2E9SA 1YI8A 1Y37A 1J2RA 3H99A 2V1UA 3CUYA 1FMCA 2QXTA 2Z2JA 4B3XA 3DZFA 4EPTA 3MMSA 3PPWA 1DBVO 2R6FA 4KK3A 3BXZA 3MPUA 3MD0A 2QA5A 1QQTA 1ZKDA 4B6SA 4KQIA 5AHWA 1H2FA 5HKOA 2P65A 3RWOA 1XL0A 1AZSC 1US8B 2OB1A 3T4PA 4MA5A 2HU2A 5H9VA 4F56A 1XWFA 2XHEA 5K6RA 2Q3JA 2C8KA 4HRVA 4R71A 5K0GA 3DE4X 5HCUA 4QOIA 4Q4HA 4UXJA 1TKCA 2W6IA 1Z3CA 4XASA 3UCEA 4V2UA 4B4VA 2OCDA 3MA0A 4IIVA 3FPLA 4MYRA 3SEQA 3U4GA 5KYUB 1QIIA 4Q9LA 3WMEA 4PXYA 5HQ3B 1RLJA 4R0MA 3JQ6A 1N7GA 3PR1A 4BNLA 3OCZA 2R84A 1YVEI 2XUKA 2HA2A 2J48A 4FCTA 3ZTWA 4MHSA 2WLSA 1W7AA 2V6GA 4FYJA 4NAHA 3A3KA 3K72B 3HR8A 4RVCA 2QL9A 1ZW6A 1QFSA 3C6MA 4JEIA 5K5EA 2JAUA 3AOEA 2FP4A 4A26A 4PIPA 1C1YA 4KR6A 1EGMB 3CPJB 2HQOA 2KE5A 2OV3A 3AF5A 5JBQA 4TTTS 4XRGA 1Z82A 2PXXA 1YB6A 4DKJA 2YJTD 2FPRA 2DFKB 3PRHA 1DC4A 1WOMA 4XSVA 4BNKA 4UVIA 5HPYB 5T67A 3OD1A 1Z35A 3V4ZA 3FHJA 1E2JA 5KEIA 1GGHA 1YIOA 4OQDA 2ZJFA 5DKFA 3GD7A 5FTKA 3WYCA 1HZZA 4NOKA 3H3XA 5BUZA 1UAYA 2V7EA 1EGHA 1EUCA 4JR2A 4OXYA 1QDUA 2PTGA 4IXWA 2R8XA 2UUCB 3C7TA 2GYYA 3GEPA 3GLGB 1XD2B 2F1KA 3F6RA 4I8XA 4Q7LA 1OBHA 1FXSA 2C9CA 1CS4C 1OSNA 1SQ6A 3EEYA 4UU0A 2NIPA 2PMFA 4DM3A 3Q7QA 2JCYA 3C1TA 3O92A 5H81A 4UDYX 4BP9A 4PN7A 1TK2A 2N0SA 2Z30A 3TLBA 2B0CA 3AZOA 1SVSA 4NCKA 5JHGB 3BVPA 2BHNA 3SSMA 4LHXA 4OX9B 3JWPA 3LNTA 3F8TA 4FK8A 4BVGA 5G40A 1P6QA 4B3HA 4A73A 4ZI5A 3TBFA 3ESYA 4YUXA 1R7RA 1P1FA 2MJLA 2SKCA 3CZ9A 4DR6B 3QA9A 1LVGA 5AKLA 4AO7A 3GLTA 1E1LA 3RBZA 3U62A 3ZDBA 2PBFA 1B6TA 1J8MF 2ZTMA 1TVMA 4CV0A 2PM8A 1FP4A 1IG3A 3ZKWA 2IDZA 3WNZA 5BV7A 5CFNA 5EQFA 2IVFA 3OE4A 1JE1A 4L6CA 5A4IS 4BX8A 3U16A 3Q3CA 2I6SA 2R4QA 3ZUGA 4RMNA 1W8IA 3DFFA 4XDYA 2GBIA 2PVPA 3IBCA 2GFIA 3LPMA 1RLUA 4HN4B 4UHFA 4YRDA 3R7BA 2RH5A 3RS8A 1NMXA 1GT6A 1BRMA 2FE4A 2TMKA 3CWZA 3LTEA 1Y6GA 2L2QA 5KDDA 3WB0A 5G4KB 2DM6A 2C2GA 1OI3A 1EDOA 4JC5A 1PR9A 1DTWA 4OFBA 3LUHA 4YPFA 2G5TA 1C9JA 2XKJE 2HT6A 1BCRA 1NY5A 2H4WA 4QNNA 3VPDA 4E4RA 2G1JA 2Z0MA 4DJJA 2ERXA 2JVJA 3AY7A 3NPAA 5BURA 5LR6A 3TZEA 4HRAA 4DZRA 3FZQA 5EJFA 4AG5A 1HE2A 4I1SA 1OLSA 2QSYA 1SC6A 3VR4A 3AW8A 1SHUX 3A2KA 1NVKA 3HXOA 4QUDA 3VX3A 4AX8A 5FADA 4DCTA 2REBA 2JFHA 3A4IA 3HC7A 3I4LA 3GVCA 1SHTX 4P92A 5ALOA 2JCBA 4MRMB 3UJCA 4G4SP 1U04A 2JZNA 3HP4A 4J90A 2ZRBA 4U3JB 2IE0A 3DPUA 1G4AE 3H7AA 3JQAD 3PDJA 2PRSA 3K15A 3IJ5A 1C4WA 5LBIA 2BLLA 3ZDRA 5KX5B 1I0IA 3FUXA 3NFRA 3U26A 2X23A 5JC1A 2B9EA 3EVAA 3MPOA 5E38A 5JROA 1W96A 1N5JA 1RLTA 4AUKA 3MTGA 2ATXA 4INJA 2GAFA 4ZOAA 1IZ9A 4HHEA 5DDIP 2RI0A 4DYHA 5FOQA 5DN6A 4A1FA 4X93A 1IAVA 3M70A 5CB8A 3TNJA 3ZE9A 3B8HA 1TQHA 4KQ9A 4DLRA 3AG6A 3QSGA 4JVSB 2XMQA 4G8CA 5A3QA 4B3BA 2I76A 4HFMA 3AI1A 1XALA 3TTSA 4B7CA 4IJQA 1I1HA 1OGYA 5DBHX 4G4SO 1GGEA 2X8JA 2R4UA 3O2QB 2VK2A 5CNIA 1OPRA 3TZBA 1QIDA 1U2TA 3OZFA 4UHBA 3NHUA 1Y6RA 2ZBFA 3IL2A 4WFQA 2YCLA 5IDWA 5C4GB 5D3MA 4FC6A 4LYJA 4IIBA 3RTGA 3VU9B 2BD0A 4MMZB 4DWJA 3U7FB 4LGCA 1NYTA 2X9LA 3EQ8A 3KEFA 1VXOA 1L4KA 4QUJA 1X1CA 1MZPA 3MUNA 2NU6B 1TZMA 4I9FA 3VHXB 4KSYA 3UJ7A 3ZH9B 1W4LA 3AKYA 5KQGA 1Z2NX 1I3LA 2G63A 3DBOB 4EEXA 3IDQA 4IJWA 3PRJA 3GLFB 1H0HA 1SKMA 2A5GA 2BEJA 3PC2A 4G0ZA 4ZHQB 2VP4A 3JVUA 3G2MA 2ZB7A 2BR3A 2IFTA 4J7AA 2OCPA 4OYYA 3G23A 3LBHA 2CHFA 1DOAA 3GJXC 4YJ3F 1S02A 4Q5IA 3TNLA 5AMXA 4YAWA 3PJGA 1Z4OA 4Q9DA 4RHEA 1LPOA 2J6IA 5FBVB 3OIFA 4CIBA 4RK6A 2XGMA 1N5DA 1E4YA 1RWMA 3NYQA 2PBZA 3X1ZA 2ZM5A 3PUJA 4IQ0A 4IJ6A 4US0R 4CF7A 4WXRA 2NUPB 2WOOA 3NMUF 5DNYB 5E9QA 4O4HB 1RM0A 2QMHA 2IUFA 5EL0A 2WPDD 4P0TA 2J46A 4BNUA 5DWVA 1GITA 3BCHA 1AKUA 5ETJA 3TR6A 2RGAA 4KFUA 2NVUA 3BMOB 3DKIA 4EYQA 1X3LA 2XEXA 1UBNA 1XPUA 4UXHA 2HUNA 3UA4A 2QLLA 3DP9A 4I4LA 4BKOA 3LA6A 1Y82A 4OJNA 3V9AA 3FVQA 4QXPA 3PDHA 1RTKA 2ZANA 2Q3CA 4LOAA 4G0MA 1ENZA 2H0QA 4NZPA 4YJ2F 2ZZKA 3E9DA 3GJYA 2GJ8A 1MENA 2CJWA 3VKVA 4K6KA 3WK5A 2EAUA 3CLTD 2QN3A 3KBBA 3W0LB 4ZDIA 1JNXX 2NZYA 4IGEA 3F6YA 5HGJA 1Q44A 4KGXA 1QHHA 4L07A 1PFYA 3A70A 3RQSA 3N0RA 3ZJYA 2JLAA 5B1IA 2YQZA 1L7QA 3G2HA 1LLCA 2CNBA 4R9VA 5C0OE 3U3DA 2FUEA 2OV2A 4U1RA 3M49A 2MYUA 5J2TF 3EZ9A 1VG0B 1Z5NA 2ISSD 3C3JA 4JI3B 4DILA 2A1UB 1JXQA 4R8VA 2VUUA 3U44B 2E55A 1UK9A 4IF4A 4MA4A 2D62A 5C7YA 1K5DA 4AT1A 2PT7A 1FU8A 2EZ9A 2Q6IA 3HA3A 3V1KA 1GXSA 2OAQ1 2ZTHA 1U3CA 3RI3A 1NI3A 4N0DA 3C6ZA 4RZSA 3HU1A 3IAM1 4TMYA 4AS2A 5BQXA 4B4KA 1Z8NA 1MH9A 2QX4A 3CRMA 5EZSA 1ZM4A 3W3AA 5BORA 3QTBA 4PU0A 4ZMRA 3A10A 3DDCA 1N8SA 1ZG3A 2EEZA 3E7DA 3L7NA 2VTBA 3DVQX 1LCIA 3T0FA 2FR8A 3NUZA 3X1MA 5BW8A 4NMLA 1HPLA 4NJMA 4L7QA 5ALZA 4CM4B 1RHMA 3BGVA 5EP4A 4Z7OB 3PXGA 1XTQA 1WSDA 3UW3A 3TVTA 1DPGA 1K4YA 3KOWA 1N6LA 1MB0A 4FGKA 2P91A 4BGUA 1PR3A 2ZIFA 3KKMA 4JB0A 4RY9A 1L7PA 2Q28A 3LWZA 4Y30A 5IVIA 3SS9X 5FOTA 5C1IA 3LWBA 2BGWA 3WRWA 1CUCA 4M7OA 3PRKE 1GPKA 2V7QD 3AHIA 5HBRA 1BE8A 2X77A 1R0SA 2CYAA 1FLVA 2LXNA 3P9CA 3QXXA 4R7ZA 4O2AA 2OCIA 2EW2A 3OWHA 1U7XA 2C94A 2ZAIA 3LBAA 3R44A 5GONF 4ADSG 2GWRA 5CURA 1U2GC 4LNUB 4C20A 4FYKA 5JH7A 2HR1A 4J8PA 1XMOB 4K03A 2NZUG 4RYDA 5LQCA 1WAMA 1CJCA 2IUEA 5EWLB 4R0VA 4QDTA 4DT1A 1B3RA 1SG9A 3DLHA 2QL7A 4IGIA 4J2TA 5K03A 4TVSA 3K6SB 5IZCC 3HHEA 4R5HA 3CX3A 3O31A 4MW4A 1EX1A 2QVYX 4INZA 3PX7A 4FKZA 4YR9A 2XRMA 3DZ8A 1E9EA 1SQSA 2AYZA 1KEZA 5IJ9A 1GRRA 2NQ2C 2XHZA 2IUTA 4II2A 1I80A 3BM5A 5JATA 3N6VA 1M33A 2GN8A 3TMYA 1MN6A 4HO1X 1M0SA 3A6HA 3OCXA 1AKYA 4QLOA 4MRRA 4FYVA 5F4BA 1L5KA 1NBIA 3AUYA 4CM3A 4GPD1 1KDPA 1H9CA 2CVOA 1OA0A 1J9EA 1TK3A 1UPXA 1J5XA 3COSA 3M6FA 4OCZA 4EKYA 5JZVA 2VOJA 4H16A 3P45A 4DY6A 4PHCA 2QLFA 4ECAA 2CXSA 3AOGA 1KNQA 5TEWA 1B00A 2IQIA 5D01A 3FLBA 4F2WA 3BK7A 1H94A 4GDMA 2HJWA 2VYFA 3T34A 1YZVA 2GARA 4Q4JB 1F2DA 3QK7A 4NV3A 3KOMA 4RK0A 5F2NA 1WDLA 1XRRA 3B7PA 4FFBA 1XZPA 1U0OC 5AWFC 3KO8A 1ESDA 3IELA 1CJSA 1YQQA 1CQZA 3HZOA 1EM8A 2XYPA 3GNQA 3M9WA 2ID4A 4BLQA 2FRVA 2IYPA 3NT4A 5COAA 1I5RA 2C8LA 3ANTA 1Q7CA 4M2LA 3IQIX 1RCFA 3N3BC 4Q1DA 2QR5A 1QH8A 1G4HA 3UC5A 2BDTA 4TTSA 4GVPA 2QD5A 2NT3A 1NQAO 4FHDA 4KUHA 1BW9A 4LBVA 3UNXA 2JJ1D 1W85A 4BE9A 1F2UB 4M8NE 1XELA 1GAWA 3W6ZA 1K97A 4G5XA 3B7WA 3WWPA 1JR3A 2I3BA 2GPYA 1RMYA 2R60A 1MQAA 1P1KA 1U28C 1GDDA 4R1PA 4EA8A 3A27A 3E3MA 1HLPA 3MWJA 4MUMA 2G82A 1A9RA 3KOYA 1T5DX 5E0KB 1WXQA 4NLLA 5EJ7A 4L6IA 4MUYA 1AK2A 3SM3A 1OGIA 4BFSA 3BE4A 4KXWA 1ZNWA 3HJTA 3PEVA 3FZNA 3HBMA 3KB8A 4D4KA 2WF5A 1VL8A 2I7DA 3G8BA 3G2NA 4HSEA 4MAFA 3ZK9A 4F8EA 1NIPA 1BMQA 2JVIA 1P2DA 3GGSA 1UXOA 4WWHA 3MG9A 3ER6A 1E3WA 2QN6A 2QK4A 1ZJJA 2RBGA 4NKRA 1I1OA 4PZ0A 3VSBA 4EY6A 5KWIA 4QYWA 3UJ3X 3WTBA 2DX7A 4NAVA 1TVEA 5A4AA 5FR2A 5ADUS 1JDBB 1Z8DA 3IV6A 5ESWA 4C03A 4G81A 1FTWA 1SUCA 2ZTUA 5KWJA 3ZQJA 3CNLA 2V6JA 4COOA 3NJ4A 4ZQCB 2GT1A 5B3JA 2AKAB 4GI1A 4DLTA 4RHUA 3ASYA 2L17A 3DMYA 2AMLA 2VSQA 3MTQA 3NKLA 3OTHA 4Q3OA 3ZN2A 3SGLA 4Y6GB 5FLYA 5CBKA 2X3UA 3VVMA 1E1CA 2PZBA 3IV7A 3DMNA 3DHNA 3ABSB 4BVAA 3DUFB 3ZLTA 1I6WA 4OUDB 3FOZA 3ICPA 3NBYC 1G66A 5AXCA 5IK2A 1EESA 2BT4A 1T2VA 4NBNA 4QL3A 1UBOS 3HCWA 1R6AA 1I33A 4D3YA 3WLFA 3AHGA 4XUGB 1AGNA 2ODAA 3MCWA 1EVLA 1XVUA 4R2MA 1CTQA 1JIKA 1I8TA 3HVKA 1YRHA 1OE0A 2W90A 3B1XA 3VYRB 1ZJ4A 1B0PA 4XCXA 3MCUA 5E3HA 3F5FA 3JRWA 3NBMA 4RWEA 3N6XA 1PZFA 1WMEA 2B2CA 3SZGA 4TM7A 1R0KA 3GL9A 3IMFA 2P7IA 3FTEA 4WJZA 4AKIA 1XVIA 1EX9A 2EFDB 1HYQA 3MT9A 1VKHA 4MB6A 3JVVA 4ER0A 3ESRA 1YRQA 4UU1A 5HUHA 2VHEA 3HCRA 4B44A 2QEQA 5P21A 2PZAA 4MHOA 3L4BC 3EZLA 4LYEA 4TKZA 1NRIA 1QTNA 3FTNA 3OTQA 1TYDE 1JT9A 1CDZA 2BBOA 1Y8QA 1QRTA 2E3JA 4RMHA 1SB8A 4N5DA 4MR7A 2KX7A 1CP3A 1EZ4A 5DLYA 3T9AA 4NPAA 2XDQA 5FJIA 3ORRA 2E4VA 3EXIA 2W2PA 3HUTA 1OWLA 1YA4A 1QB7A 1EVEA 1TM3E 1PS8A 2DETA 4K0KB 4FMDF 3FCOA 4F5WA 4YIHA 3PEFA 3GEMA 1K86A 1ULBA 4TN1A 2FG7C 4DUGA 3JR7A 3LUBA 3RLIA 5AJUA 4CIXA 4JT2A 1EB9A 4QEDA 3R75A 1DKUA 2JKVA 3EX7C 1CU1A 1UAGA 4WVFA 1A96A 1A8QA 2NSJA 4FWIB 4HAXA 5EJ2A 3HTXA 1Y0BA 4B09A 2ECKA 1T8TA 5JPIA 3UHOA 1DKRA 4EVRA 3ONDA 3TLCA 3FSEA 3QW4B 3X2FA 2ZB3A 2QSZA 1JKXA 2HMTA 3G1UA 3W8RA 2UYQA 1GL6A 2Q8PA 1OC4A 1T8RA 2WW8A 2XTJA 3P94A 4X00A 1CULC 1DNPA 3O90A 3PTLA 4G8JA 4IWYA 3VNSA 3INTA 1SUEA 4PGFA 3D6VA 3NRCA 1YCGA 3HDTA 2X3FA 1C3EA 4N48A 2B2NA 3TSYA 1D5WA 5HBGA 1T0IA 3RS0A 1VLJA 1ZK4A 2C7GA 4ISBA 1ZI6A 1A71A 2DBYA 4KTVE 3ZI7A 1UJ2A 4LZPA 1U90A 5IN4A 2C4MA 2I34A 3DEIA 4AJIA 4MS3B 2ZULA 1XEAA 1UXJA 4KJZA 7MDHA 1FJGB 4S24A 4BNWA 4BNGA 4BCCA 3JPYA 1WXGA 1YS2X 3C3PA 3M6IA 3FNHA 4CIVA 2VSNA 2W4QA 4HN9A 4ND6A 1IZ7A 4WA8A 5BYBA 3M82A 2O8CB 3ZXYA 1HFEL 1EGQA 1L5MA 1WR8A 3IQXA 4MIKA 2XMDA 5DU2A 4UFPA 3OJWA 1RKUA 2XH8A 1J07A 4IIJA 4RVFA 3CZ4A 1EXNA 3BD9A 3QFSA 5I4KA 1SVLA 1KMQA 2YC2C 5AP9A 4ZQEA 2A3NA 4AUEA 2F8TA 1B7GO 1R9GA 2WJHA 2DFVA 2AJDA 1S8OA 1BZYA 4TWJA 4M9QA 4XWGA 3EZXA 1WS6A 1XDUA 3MQ2A 4GBJA 4TZTA 1EHYA 4P4TA 1AE1A 1MPXA 2FLVA 4HYQA 4TLBA 5DXAA 4YV2A 2DQKA 2IX9A 4P08A 1RT9A 2ZJZA 1TNDA 3QX7A 4FXOA 1DCMA 4G5SA 4C4AA 2I03A 3ZR4B 2CB9A 2VQFB 3FSJX 4R1QA 2AN3A 3T7SA 1B1AA 3CZQA 4FQ5A 2FFJA 1IM5A 4ZCSA 1Z2EA 4MX8A 1OBVA 4JI8B 2FMHA 4WZAB 3WG9A 2WD9A 3QLJA 2W83A 4BECA 3GJ5A 3UY4A 5JQWA 1YZYA 1JHVA 3DV0A 2YASA 1R12A 3TINA 3HCBA 2DFNA 3NYWA 1I2CA 3RHSA 3QITA 5KJEA 5JXWA 4JI4B 5IF3A 1DDGA 2ZRQA 1YE8A 2VLBA 1KDOA 1XFDA 2FZVA 4Z0TA 3H3JA 4KPUB 4YDRA 1E1KA 1TW3A 2ACKA 2OV1A 3LQYA 4HV4A 1E2FA 3H1BA 4G5OA 5LOVF 2V4ZA 3K1ZA 2QTGA 4C43A 1NW4A 5EEGA 5NLLA 4EZIA 2ZUCA 4LQ4A 1P1BA 1GGKA 2R65A 3FKSA 4YGYA 3ZNNA 1A9YA 3OICA 3KAPA 3AILA 5DGIA 2C1EA 2UZ1B 1FP1D 3LC0A 4RZIA 4TKMA 5LP6A 1W73A 1WOYA 4LZOA 2FK8A 1ZUNA 1XVVA 5J63A 2HJHA 4K6CA 1R3UA 3TSWA 2BPOA 2ZRMA 4Q24A 4PO8A 5A9TA 4B3DA 1HDRA 4BBPA 1XP8A 1LDYA 4PGAA 4E15A 1UWVA 4RK1A 2R7KA 3F4LA 4H1HA 2FFBA 4FFWA 4U7GA 2GEJA 1AQLA 4RV4A 5T8KC 3BTVA 2P9YA 4K1LA 3BYZA 3O2SB 1VSUA 2I3ZA 3KTAB 3A4MA 3QV2A 4M3NA 4Q1CA 2GMWA 4JBLA 3QEOA 4H6XA 4JZKA 3ZV4A 3FF1A 1V4NA 2AUTA 1FRQA 2IWRA 1G21A 3I5UA 4RK7A 3HP7A 3PICA 2I6QA 3PV0A 3QUBA 4R84A 4C0QC 1NQWA 1IHDA 4GXQA 5AQ1A 2ONZA 3NIWA 3GOHA 2QUKA 1XXLA 4A0GA 2F1HA 5ALXA 2R1TB 2CJPA 3FNEA 1MAHA 1HFKA 1Y6QA 2QWXA 3OAAD 1GDTA 1B93A 4HDKB 5EMLA 4MUJA 1DX9A 4D1YA 3K09C 2PX0A 1RS0A 4M7WA 4RDHA 4WK2B 1CR0A 4BLVA 2XXAA 2QROA 2YZKA 1FFAA 1YZHA 1DZIA 5IKOA 3RUIA 4C07A 1PE0A 3FFBA 2D5IA 3PE6A 4K1XA 1J8DA 2C31A 2YX1A 1K5HA 3KSDO 3PHLA 4JLNA 1C3LA 2I99A 1Q0SA 3MQFA 3ROTA 3TPCA 3ZWVA 2PZ8A 2WSLA 4UM7A 4DNFA 1JG4A 1UEXC 4M86A 3D7NA 4V1CB 3UANA 4M0FA 1KI4A 1RBQA 1JR3D 3LDUA 4ZYUA 4LF8B 1C9YA 1N2XA 2O5VA 3L6DA 1CF2O 4TL6A 1JR2A 1LBSA 4MWCA 1U31A 3CR8A 1M2EA 4XDGA 1YHZA 2W6PA 3WDSA 1JIQA 1UZUA 1P7PA 2WJWA 1JNYA 3QBVA 3WGZA 5KJFA 2VYCA 2ZQ5A 3P2IA 1APBA 1VRCA 2FPUA 2PUTA 3AKDA 1EP9A 1T9ZA 3EUAA 1WQ3A 1Y3AA 4TLDA 3H9BA 5JRDS 4OBBA 1TMGE 1FPMA 2C78A 3OOHA 3Q0EA 4G9EA 3SK0A 4GP7A 1NZJA 3ONFA 4HAOA 5ITSA 2BKLA 2BM8A 1NYQA 1TI7A 2WG0A 4L6AA 3M0EA 4PICA 1MPTA 3BWEA 3H2HA 1PSZA 3EJ6A 4CMIB 4F85A 4KQEA 3F6EX 4XLLA 3UPUA 4FKBA 3RBXA 4B7AA 2O6HA 1IRIA 3FE2A 2PGXA 3H84A 1YVPA 1A2KC 1T1IA 4QBGB 2NUAB 5EHXA 5H4HA 3CZMA 1J0DA 5ESDA 1OFGA 4M60A 3QLUC 3OJCA 2XWSA 3DL7A 2GEVA 3L0YA 1PJBA 1IHUA 1DC5A 3AQIA 3MJHA 4HGNA 4RVUA 3HYNA 1W75A 2G4VA 5LYYA 5CCDA 2JCVA 4EX6A 4ZANA 4XFDA 5EA2A 5CJPA 5I3CA 4KMMA 3VH3A 5IDYA 4D8TA 5TF0A 3EPJA 4R4JA 4FINA 4RPGA 1E62A 2OQVA 4NK4A 2BFFB 3TIXB 5SY9A 3SSOA 2PRZA 3HVIA 1BDIA 2OCYC 2IXGA 1YIDA 5IDVA 3USCS 2B8EA 4D6PA 1A9XB 1LPPA 1JSXA 4GKAA 4D81A 1E3MA 3BDVA 2GD2A 3E9MA 1WSBA 3WFIA 1C4XA 2REOA 3TCNA 2GHRA 2PL3A 3LNCA 3PGVA 1DBPA 4M9XA 1Q15A 3C2QA 5AJHA 4D9EA 4X3PA 1G8KA 4ENVA 2JW5A 1G21E 3RW9A 1C9KA 4N65A 2P90A 2BFOA 3RDPA 1L8XA 2FZGA 1P4JA 4CMEC 1TLTA 1Z74A 2ZIUB 1ZNQO 2CMHA 1LJUA 1WW2A 2C4UA 2PSHA 2PGLA 4RW0A 3RYIB 5BRAA 4J1SA 4AY2A 1DAIA 2RJNA 5FPQA 2FW0A 4EKDA 4LXGA 5KNLA 1XJ0A 4A36A 4X84A 1Q77A 2QUBA 3MN1A 1OT5A 1K2WA 4BQRA 2IYAA 2JBHA 3LQKA 4R1TA 4C0HA 4Q4CA 5L4SA 1PNQA 4NU0A 5CGQB 3CPSA 2RK6A 2ZYHA 3GRCA 3IP6A 2G1KA 1KR5A 3V3KA 4Z51A 1ZO8A 2GZMA 3LQFA 2CZQA 1HBJA 3EF1A 3FVWA 3MRTA 1VECA 4PAMA 2R48A 2ENWA 1K98A 1XRNA 2IXEA 3E9QA 2AOUB 4MI1A 2MINA 2D4HA 2QORA 1WL8A 1XAGA 3HU5A 3FMOB 4RD2A 3SHWA 4ACBA 3LDHA 4B6OA 3FPBA 4L8WB 3NGLA 1A50B 3WNCA 2DHEA 1U3GA 3UZUA 1CUZA 2IZ6A 4AVYA 4UTPA 1EDZA 3T9EA 3RV4A 1C7ZA 2OZVA 3QQ5A 1DRJA 4X20A 2X5XA 4MJ3A 3ZHVA 2DWCA 4H3SA 1FUUA 3JQQA 1RM3A 1R2QA 1L7DA 1KBQA 3OJEA 3A1UA 2CW5A 3X1YA 3QPBA 4HS4A 1DEOA 1DKNA 5ANRB 2YV2A 4R8LA 2PGIA 2J87A 1S0UA 5CLQA 2XNKA 2JFNA 2VPTA 3CQ9A 4UVDA 3EZ2A 3TWOA 3RRNA 3FUTA 4EVIA 3BGIA 1RWNA 3GNTA 1GKUB 1E9CA 3NBQA 3RVBA 4CIWA 2XGOA 3VOSA 4FE3A 3Q8MA 5DRYA 1UINA 2EGUA 2VAXA 1JE0A 1UWLA 4PSUA 3WNQA 3BFJA 4JOCA 2R7NA 3FYUA 2VUHB 1C7FA 4QU9A 3VPFA 3D5TA 2JFXA 1ONOA 1YR9A 3GELA 2JGFA 2ZJ3A 4IXTA 4QATA 1T3GA 1YQXA 3LFUA 1XRPA 5AVTA 4EFMA 1K2VN 5CA0F 3TXYA 1Q0HA 4ZHQF 2UVQA 4GC9A 4P81A 3L41A 4S2UA 4JT4A 5K3BA 4EHAA 4O0LA 1NP3A 1JHOA 4KO8A 3AUFA 4F5DA 1TCAA 1DQSA 2I6TA 1SWVA 2ODNA 4IH9A 1WCWA 3LBIA 5JDCC 4M6WB 1CRLA 4LVOA 1C9EA 3U7HB 3RIGA 4Z9YA 5A2GA 4HC4A 4R8KA 4TYYA 2I65A 1J56A 3KOOA 3F6PA 3NQ41 3SXJA 4TZKA 3CX8A 3AJEA 2TSYB 1X9IA 4PSVA 4AP6A 2HO5A 4BTEA 5A6VA 3LPNA 1M2KA 1V16B 2YH2A 1KJ8A 2QHXA 5AW9A 3CIFA 4MXDA 3SS8A 3G2JA 3PENA 1P7CA 2YS6A 3DKVA 3UHPA 2EFGA 3QX8A 4WNCA 5TGZA 3DXZA 1YA6A 2H8KA 1K1EA 3PFIA 1SKUA 1XZCA 4C6TB 4DJTA 3MWDA 4C3UA 3MC1A 1C2YA 1XA3A 3B5EA 5DCLA 2B4RO 1Z2PX 2NU8A 1NKTA 2PLWA 3EBOA 4ND8A 3FYDA 2CN1A 3UBTA 1BDJA 4BQSA 1EE9A 2PTHA 2CNNA 2JAXA 1ZRMA 1B73A 2WSSA 3A1WA 4KLRA 3WAKA 4BNMA 4DIDA 2V7XA 1QK5A 2QTNA 4DA4A 3DPSA 5J2UA 3MWFA 5IFLA 3WK8A 3H1FA 1QM5A 4J16A 4B3TB 1W0JA 5FNVF 3FUVA 1LS6A 4IIEA 2JG3A 4K88A 1Z88A 1OROA 3ICQB 3PWZA 4QPDA 4ND5A 1WETA 5HK9A 3LW8A 1L7RA 4PO9A 5JCZA 4LY3A 2KW5A 3TAUA 4BB6A 2C07A 3N2EA 1EBBA 4YRGA 2EDCA 3MLBA 4YMUA 3RS3A 4RTOA 1NXSA 4LTDA 3CKMA 1CRWG 4B9EA 2YZMA 3K5IA 1V8DA 3ZWCA 5BUCA 3L0SA 5I9MA 2IS6A 1OWNA 3OPYB 1AO3A 3ICVA 2XA2A 4FMBB 4WLNA 4CM9A 2UZAA 1W9MA 3F5QA 4O59O 3U7QB 3ES9A 3WL8A 5HP4A 1MO5A 2FQYA 3JQ8B 4R2LA 2DTEA 3OEYA 4J9UE 2PJDA 3JYQA 5DP2A 3C5CA 3KVNA 5I7RA 3CXUA 2H1RA 2GXUA 2BFDB 3V2IA 1RQ2A 2Z04A 3UMCA 3ZBPA 2XJ4A 2VH2A 3R8FA 2B8TA 2PX3A 4RH0A 4AN1A 4ZYWA 1V3VA 2PG3A 1M2NA 1LI7A 3IOCA 4BFVA 2IUSA 2QP3A 5DM2A 5J59A 2ZKIA 3HLKA 1TVKB 3E3NA 4BO9A 1YQGA 4GFDA 3W6UA 2CFOA 2P0EA 5DHRA 1Y3DE 4AKTA 4AUMA 4FSXA 3L7JA 2DJ5A 2ZU0C 4DLSA 4JVMA 1UBJS 3BERA 4YCBA 3GUCA 1FNCA 3JSXA 1Z17A 2FW1A 4ME6A 1YF3A 3B89A 1CPYA 3CH7A 2C58A 3DM5A 1VOTA 4Q9JA 3KUKA 4D3DA 2K7FA 1ZHOA 1M1UA 2HK6A 2RI6A 4BEVA 4GICA 3TN7A 4AZVA 5AI8A 3SSAA 3TLKA 3SE0A 3R4CA 4YJHB 1Q92A 3WIOA 4ARCA 2HK7A 2IY7A 1IOWA 3IOBA 5DBOA 4C89A 1H6AA 1JS1X 5C8XA 1ADFA 1ZCFA 2AZMA 4B5KA 4ROTA 1NSFA 3HRKA 1WUIS 1W52X 2GBLA 3LIPA 4GZLA 3THOA 3UXYA 1KVRA 4RZQA 5ERXA 3X1JA 2GLXA 2Q1WA 3QFRA 2DCMA 3I01A 3DS8A 2GYUA 3GDOA 1TQDA 4MS4B 5F1PA 4EY4A 1DJNA 1M2FA 4CKYA 1F48A 1WU8A 2BTOA 4XCVA 5D6OA 3OZSA 4YROA 1G2PA 3M3HA 5JCOC 1OXUA 4HDOB 1J99A 2ERCA 5CT8A 1JPNA 4BHTA 2MCFA 5IT4A 1JXOA 1XLVA 3F90A 3HKBB 4H77A 5CAEA 1XK7A 4LN1A 1DSSG 5AM2A 1JI0A 5EFZA 1BU5A 2H48A 1SD1A 5K0BA 7ADHA 4X45A 3VVBA 2I91A 1YR1A 2MU1A 3AY0A 1P72A 2AI2A 3M6AA 4YCNA 3R23A 2YOGA 3V4SA 1A5ZA 5LIRA 4CKCB 3RF7A 4EVSA 5IVHA 1NU6A 1Z47A 3L7LA 4N8SA 4BJ3A 4KZPA 1BHO1 1BE1A 2E4XA 1CF9A 1JXAA 1CSEE 5EP1A 3WJAA 1GYQA 2VTDA 4R9UC 5ALVA 1NVXQ 3R3XA 5DTIA 3M81A 3S44A 1WXFA 2RHLA 1ZK1A 4J3JA 1GGNA 2JRLA 3IAXA 5DTQA 4Y8VA 3HJFA 1GCAA 1JYEA 1MV5A 1U8TA 3GQVA 1CVIA 5FRDA 2ZYWX 3QVWA 3CIOA 1KQ3A 1YS7A 2BTQA 2HN9A 3FN4A 1I0ZA 3PNMA 3PD0A 4G0NA 4Q6BA 3WQQA 3D43A 5BWNA 3O21A 4FBLA 1BJRE 1SULA 4WDRA 3BFPA 1MT0A 2WKWA 5FWYB 3HDQA 1E20A 4S1PA 3LUPA 1G2QA 3HQ4O 1SHKA 5D3ZA 1G8AA 1NI4A 4RCYA 2XUZA 3N8IA 2J5XA 4OY3A 4YX9A 2GJKA 3AR4A 5ECGC 5BV0A 4FWTA 4RABA 3HLYA 1M8FA 1QV6A 3PUWA 1JECA 4FHCA 1RHQA 3HGQA 1GZ7A 1CJVC 3E5RA 1RR6A 3G9TA 2OXRA 3E9YA 4PPGA 4UEJA 4RY8A 3LWNA 1QGZA 4BMOB 3COVA 4IRXA 4MKIA 4HEA6 5KTMA 4NH4A 4UMDA 2Y71A 3OZWA 1JFLA 2UYCA 4RDCA 4GGOA 2EF0A 5CMLA 1WUKS 1TEHA 2RIRA 4Q15A 4X8HA 5C1BA 2P30A 2XBUA 3A32A 2O5EA 2PN1A 1SG0A 2MWMA 2TMGA 3DLPX 1SKBA 3JWGA 4WOCA 1Y3BE 1QHSA 2H57A 3G2PA 1MOQA 4G23A 2CB0A 1HE3A 5K09A 3IAHA 2QTFA 5BSEA 5ULLA 5B7PA 2V74B 2FN7A 3ST7A 4CG1A 1OI7A 2P9JA 2HLDD 2W2KB 2GEKA 2VJYA 4GE3A 2X7HA 3ZZ0A 4NE7A 4KFSA 2WJVA 4HRYA 3HPQA 4UBIA 1J2YA 3TTTA 5AVVA 1XQXA 1ND6A 3ZCRA 1ZVKA 3P9KA 4W5QA 5FI1B 4GYWA 1YCHA 1X7ZB 5COQA 1HX7A 1B74A 2WWRA 2RCNA 1BWQA 5A3JA 5ICEA 5TGTA 2PNJA 4D46A 3HKDA 2XUFA 2Q29A 1M0WA 4R68A 3RAJA 2GD0A 1OZFA 3ZHRA 5JEDA 3KOZA 2O7SA 1EJ2A 4P2BA 5DGCA 5KQLA 1NZDA 3BDIA 3T7DA 4LAFA 4M1MA 3VV3A 1GZ6A 4BV9A 2NO9A 1LDEA 2IQ5A 3U3MA 1BXRB 3RS2A 4H17A 3ZWNA 4LJ4A 5KTRA 2VJQA 2J3KA 4HX5A 1OH5A 4IGKA 2GJAA 4X60A 1GWNA 1MBZA 2G88A 4CEHA 2QPAA 5KO2A 4MS1B 2EV9A 4FR2A 1X1EA 1CB7A 1HF3A 1NPDA 3K30A 4GOOD 3CUEF 4HQLA 1D2RA 4WOKA 3TLJA 1LK7A 5A2QA 2Z9BA 2R2AA 3T4EA 5JT1A 3UKOA 2O8FB 1F0YA 3T5CA 3DLIA 1IQPA 1PJAA 1ZOPA 1R4AA 1EG2A 1Q2XA 3C0KA 1EHCA 1R50A 2N42A 4MP6A 3NBAA 4MVJM 3AHDA 3R3WA 4NCXA 1IEXA 4BQQA 3ZWQA 4BEWA 3CISA 2OY0A 1T25A 1W30A 1J2UA 2HDNB 4DLUA 4UM5A 2AHOA 4AYWA 2GYWA 1B15A 1O2DA 5KINB 2ARKA 3E18A 2I7CA 5FJJA 3EHEA 5GJCA 1GV1A 4I4TA 5EQJB 1UJNA 2FHPA 5DSTA 3DXXA 1Q5PA 5ALEA 2ADOA 1DUSA 1YKGA 2FPIB 1E6EA 4TL8A 2ZUVA 3WMFA 1BYIA 1NE2A 2V9PA 2XAUA 4O4IB 5HIMA 4P0PB 3E8XA 2J8ZA 2GB4A 1O6GA 1SKYB 5BMVA 4TN5A 1AJEA 3KRTA 3HM2A 3G89A 3LRXA 1GAEO 4Q16A 3R7WA 5ECDA 2FN4A 3PT9A 2JFOA 5AHXA 3QEBZ 4WHMA 4C0SA 2Z2XA 5JCPA 4LYFA 5HE8A 4F12A 2PCLA 2OVBA 2GBGA 2OYRA 1KK3A 3OEHD 3VU0A 2CXXA 2ETXA 2MSDB 2XB9A 2UYHA 2AOWA 5DJ5A 1M5RA 3JTMA 1NFQA 1J90A 1JEOA 2QZPA 1C7EA 1R74A 3FPSA 3OC0A 5F33A 3TKYA 2Y4OA 5CVCA 5HZHA 4BAZA 4N6OA 1KYVA 1QH1A 1ZM9A 4GPZA 4GZ5A 2PSEA 4MR8B 5FWYA 1O4WA 5JD6A 4YCDA 3DE5X 5E8JA 2OXIA 3U48A 1QP4A 3WAGA 2DC1A 2VIIA 4HUTA 5JFGA 3D6TB 1G0OA 1EDDA 2WSSD 1RMTA 2Z6QA 4DB2A 5KTPA 5AJTA 1GAJA 5ER6A 1QWOA 1O57A 4XDHA 3U7EB 1M73E 2VLIA 1GKIA 3HHPA 3VU9A 1OC2A 4L8FA 1SUSA 4UPDA 1HFJA 2I4NA 1VMAA 5C46F 1U6IA 3N0TA 4K9OA 1H66A 2AD1A 2PXHA 4OYHA 2I55A 3ROQA 5JAIA 5JIBA 5A6SB 5HR5A 3WZLA 1Z0JA 6GPBA 4IZIA 3NWJA 1A5SB 2V3WA 2E6KA 2A58A 2G6TA 3JD0A 2WTBA 3H6GA 2D06A 4ZHQA 1U98A 3GP5A 2VUIB 2OK8A 2XOEA 4L5JA 1IY9A 3WFZA 3MMZA 3ANLA 1RWXA 2XY4A 2IYFA 2WJ3A 3PGMA 2BISA 1YS1X 2HBQA 1ZESA 2TMYA 4CM9D 1P39A 2ZT7A 1SXJA 5IT9A 1ORTA 1R15A 4KE8A 4RD6A 1LBEA 3I6IA 5K3FB 5NULA 9LDTA 4PSCA 1KSHA 4Z4GA 4J6EA 3UJBA 4Q9AA 4QSMA 4EJ2A 1FJXA 1LQTA 1HM5A 2V4MA 2GR9A 2OECA 3X43A 3B78A 2FA9A 2A6PA 4XZ3A 4L76A 3SQMA 3CPHA 2O0JA 1M67A 2HEIA 3BMXA 2WSMA 2C0PA 1PO7A 4X3CA 1XZLA 421PA 3LI2A 2WUEA 4UOEA 2WIFA 4X85A 1N6IA 1JILA 2B25A 4KDRA 4CKZA 3EXHC 2QQFA 1UBMS 5KPJA 2C29D 3O83A 4RH1A 4PTYA 2RHTA 1P4RA 3N39C 4PAWA 3SXUA 3GJTA 1L4LA 3C3YA 3MJEA 4G0PA 2XB2A 3O74A 4Y6LA 5TE9A 3T6KA 4JQCA 2OBFA 2MYTA 3FROA 4RLHA 5C8YF 1ISGA 4PZ9A 5FL7D 4QXOA 3JWJA 3QTTA 3WNDA 5KAMA 4DSOA 2R6GA 4C22A 3DEAA 4R83A 4P4GA 3GQBB 1SVMA 3G5AA 1QHXA 3L1VA 3M4XA 4PS0A 2P1RA 4OBWA 1ZD3A 2IYSA 1U3VA 3BHIA 3CTPA 1KP3A 1T6ZA 1G7TA 3K20A 1C0LA 3IR5A 3NUGA 1J0CA 2NM0A 4Y2GA 2WUVA 4RTQA 3LKZA 4F5EA 1D1PA 4G84A 2CMDA 1GOTA 1RZVA 3IP8A 3D2LA 2FR0A 2FPGB 3KE8A 3COPA 3QU5A 3PEWA 1F06A 2A1UA 2GERA 3AESA 4TRNA 1KK1A 2IGTA 2F55A 3CPEA 3U1VA 3I0ZA 5IAAA 4BL5A