5JDCC

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
237
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLPEEKDKWRRKVPLGRRSAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 237
sequence length 267
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcC00
1HDCA 3AOGA 4NBTA 5ENVA 1LLUA 4GKVA 4JBHA 2BGKA 4TROA 4M86A 5BSHA 3DBHA 3PQFA 1KEVA 1U3WA 2X86A 4ZHSA 5AVOA 1PQPA 1I30A 3OIGA 4R5HA 3U4HA 4B4UA 1KOLA 2NQ8A 4OIMA 1EE2A 3O38A 4IIUA 3LLVA 2JHFA 4J2OA 5JBIA 5K6AA 2B0JA 3M6IA 4OKNA 4HP8A 4G65A 4WOKA 3GDOA 3PFFA 1G0NA 5IAAA 4BNGA 3ETGA 1ISMA 3DBRB 3Q9UA 4B4VA 4CQMD 4GWGA 1B26A 4EW6A 1NFQA 2O23A 3AJRA 5AXBA 3PYLA 3ULKA 3L6OO 2PGDA 3JYQA 3AU9A 2IRWA 1R12A 2Y0CA 3RI3A 3V1YA 3IDSA 5KWEA 1QSGA 1E1MA 3KETA 3HFGA 2RH4A 3EK2A 3PHIA 1W8DA 1ZK3A 2OMEA 3I23A 2EXXA 1TVEA 2HK8A 3JD3A 1UAYA 3S2GA 4ND2A 5AOVA 1WDMA 3K31A 4LSWA 3W4JA 5F5NA 1TT5A 4O0LA 1I3LA 2YW9A 3X2FA 4UUOA 4YBZA 2VOJA 2VNAA 2X4GA 4EUHA 3SC6A 4BO1A 1D3AA 2Y1EA 4J91A 4YT2A 4NZ9A 2W8ZA 4A7PA 3DWFA 3WLEA 3V2HA 4E31A 3B6ZA 1NWHA 4F6LA 4ZGWA 1YL5A 3U5TA 1GAEO 2Q2QA 4PVDA 4XB2A 3E8XA 3QHAA 3OJ0A 3LSYA 2PZMA 2E82A 4LMPA 5IDYA 2JFFA 4J0FA 3PIIA 1ZEMA 2FPGA 3FPLA 3GGOA 5JW6A 2YJZA 4CV2A 2Y0EA 5IG2A 1ADFA 1EQUA 4XGIA 3ADPA 3PI7A 2OZPA 5DT9A 1O9BA 1UP4A 1XCBA 2XOXA 3AI2A 3D5QA 1UJMA 3N74A 4QQRA 2NVUA 1P44A 4YT8A 4HXYA 4M8SA 2O2YA 4NR0A 1DFHA 3OIFA 4Z3KA 2JAPA 1XU9A 2Y67A 4PLVA 4EEZA 3FHLA 3O9ZA 1U7HA 1BG6A 1WNTA 2VWQA 1LC3A 2VN8A 2GSDA 4JIGA 2QZZA 3ENKA 4N54A 4U6SA 1ISHA 4NHEA 2D4AA 1WZIA 2NU6A 4NFHA 1Q7BA 2BELA 3NRCA 1A27A 5ILGA 1GD1O 2VHVA 4CR6A 1YRLA 4UULA 4HY3A 1LA2A 3WQSB 4P4LA 3IUPA 4FC7A 3WWZA 1EMDA 3AUTA 4EITA 1XQ1A 4LSMA 2VYVD 4ESOA 4LVCA 3NTRA 4FW8A 4YJDA 1E7QA 2Q4BA 2DPHA 1NQTA 3QVTA 4UUMA 1YE3A 3DOCA 3LVFO 4KWIA 5KJ6A 1C14A 5TIIA 2NNLD 1BXKA 1R6DA 2CF5A 2NQTA 4OGWA 4OSOA 3R3JA 4O6VA 5ENDA 1QYXA 2EERA 3QVOA 3H3FA 5G2OA 4CODB 1SBYA 1NBOA 3GZNB 4KQWA 2Y1OA 3RWBA 4G81A 1DHTA 2AA3A 3L07A 2IEDA 2VWHA 3PYMA 5JMWA 3EDMA 3WTBA 2V65A 1NR1A 2F1KA 1NFFA 3WNVA 5KJEA 4WLNA 1CETA 4YEDA 1PGJA 3IIEA 4K1LA 3RIHA 1YJQA 2QX7A 4J4TA 1WPQA 1UZNA 3HUDA 4XJSA 4IDFA 3ABIA 4IIVA 2Z1NA 3RC2A 4CM1A 5I9LA 3WICA 1VKOA 4LK3A 4PG5A 1A9ZA 4A0SA 1JVSA 3EYWA 2PKQP 3RROA 1C1DA 3GG2A 3JQAA 7MDHA 2DBVO 4BGVA 3KYCB 4WCFB 5DZSA 2PGLA 3S2IA 4CLXA 3IQDB 3OHSX 5B4UA 4LN1A 3ADOA 3PDUA 1PQUA 1KEUA 4B8ZA 4E5PA 3FF4A 2ZATA 1IE3A 3L77A 4WECA 2SCUA 3SX2A 3UUWA 3WBBA 1HDYA 3GFBA 4CUJA 1SO8A 3IC5A 1I10A 1KETA 2HK7A 3ZH2A 4QFCA 2FWMX 3GEDA 5GZ3A 2PH3A 3F47A 1VJTA 4YQZA 1JWBB 3RSHA 3WBFA 4FOOA 3GAFA 4JLWA 4CPDA 3H3JA 4Z0TA 4RL6A 4OSPA 1GPDG 1EK5A 5C7OO 2B4TO 4CR7A 4R1UA 1F12A 4KUHA 4MJLA 4R3WA 1NVMB 5LDGA 3NDJA 1RM0A 3SC4A 4DIBA 2HMSA 5GMOA 1U5AA 5KTKA 2VCYA 1NQAO 4E6PA 4ZVVA 3AU8A 3FTNA 3GK3A 1HWYA 4F6CA 1U5CA 4IDAA 2FR1A 4BO6A 4ZQHA 4Z3DA 2GO1A 1PR3A 1MP0A 1EEHA 2C7VA 3DBHB 3JYLA 4ZRMA 3U62A 5F21A 5CDGA 6ADHA 1B2LA 2VRCD 3HDYA 2CUKA 1YB5A 5KVVA 2X0RA 1N1GA 3HN2A 3VH1A 3ZWNA 3IP1A 4P38A 2VNSA 3GUCA 4E2YA 5HBRA 3CMMA 3JSAA 3R0IA 5TC4A 2WWRA 4B4WA 1RM3A 3MJCA 5JAQA 1RM4A 1RWBA 4RZIA 4R69A 3F4BA 1FDVA 1VJ0A 4MVJP 4E5NA 3ZNOA 1S6YA 4BKPA 4WPGA 1DC5A 2FR8A 3L0DA 1ENYA 5T5QA 4YJGB 2E6UX 3K8ZA 2V6GA 1VKNA 4RVFA 5TT1A 3GQVA 1YGYA 1ZK2A 2ZQZA 4FFMA 3ZHYA 5A9SB 3KTDA 1ZK4A 5JLAA 4IJUA 3VH4A 3DOJA 1ZO8A 3C85A 3WYCA 3KEQA 3JQBC 4URFA 2BFOA 3PQDA 1DPGA 1O0SA 3VPGA 1JA9A 1CJCA 2GN8A 1C0KA 4CLRA 2OP1A 1FDUA 3DB2A 4ITUA 4TSKA 2R6JA 3GVXA 1YS4A 3G79A 2P9CA 2AE2A 2VZ9A 4E13A 1O5IA 3ZWOA 1LXCA 4JP2A 1TT5B 1U2DA 1WLYA 1ZK0A 5G0WA 3TZKA 2A35A 4RORA 4FFNA 3HSKA 2R00C 3PHGA 5FYDA 1PGPA 4BNUA 4LVUA 4LCJA 4D3FA 1L7DA 4Q3BA 3PZRA 4DA9A 4EYEA 5ITVA 1U2GA 3GMSA 5KVCA 3SEFA 1T25A 4UVIA 4XA8A 1A7KA 2GYYA 2Z95A 4UVGA 2VYNA 4LISA 4FGSA 4G5HA 4AJKA 1ZSYA 4YPOA 1MUUA 1IHYA 1EUDA 1VJ1A 4IMRA 2AQHA 1E1LA 2H6EA 1ULUA 3FSRA 3PRJA 1LLDA 3ITKA 1JLLA 1HZZA 2GPTA 3ANNA 5ICMA 4NBVA 5JXWA 4DPKA 3UXYA 1V3TA 1C0IA 4IPTA 5JE8A 1ZMOA 5DDIP 1NX6A 4OXKA 4ZQEA 2NVUB 1E5QA 5F5LA 2FHSA 2ZYAA 3WGTA 5B37A 3VHRA 1DIGA 3GUYA 4BKQA 5IXSA 2VZ0A 4YQYA 2VHXA 4IZIA 1PJSA 2O2SA 4TZTA 4I1IA 5IDXA 1EVZA 1DO8A 3EAGA 4XQEA 2X1HA 3H2ZA 1PSDA 4U8GA 5CEJA 3D4NA 5B12A 2NTVA 1ZMTA 3JQ7A 5F1OA 5EQDA 1R0LA 4BUCA 4XIYA 3K92A 4K9DA 1H9BA 3ST7A 5I9NA 1H2HA 4MVJI 3LC7O 3SVTA 3M1AA 1HSZA 3JQGA 4R68A 2BRUA 3QWFA 4EUFA 3K2EA 1A4UA 1HDXA 5CG2A 1A5ZA 2AG5A 2E49A 1DJNA 4ZJUA 2W90A 1N1EA 4FOSA 4GMFA 4D45A 1PR9A 1KC3A 1UH5A 5HS4A 2ZB7A 3NYWA 1WDKA 2GZ2A 4G2NA 1IUKA 4D3SA 4EJ6A 4J7XA 5L95A 4OM8A 1Y9AA 4DREA 1E3IA 4RF2A 3W6UA 3JTMA 3NTOA 4L4RA 1H9AA 3NDRA 1PJTA 4CM4B 1MGOA 2EW2A 3HJAA 4XQ9A 3KXDA 1K2WA 5KNLA 1GEGA 1Y9EA 3BZUA 5KKAA 4Q9NA 4X54A 4BO0A 5JDIC 4J1SA 3ZU5A 1QYDA 1SCUA 3PPIA 3JQAB 2EP7A 1MXFA 1XA0A 5U9CA 1HL3A 3RKUA 2DBZA 1B15A 3MTGA 5FI3A 1QKIA 1W4ZA 1Y8QA 3PP8A 5CFZA 1C0LA 5JCXA 1ZEJA 3B1JA 4IJKA 2EV9A 3C7DB 3GAZA 3BXXA 4BQRA 1MFPA 4EGFA 4RJTA 2JCXA 4N18A 4AICA 2X9NA 5JNLA 4BO3A 1BHSA 4R41A 2PY6A 3VC7A 1PS8A 1SNYA 4L73A 2W2KB 1PS9A 4MVJA 5TSDA 1FDWA 3AY6A 1DRVA 2P9GA 3H5AA 3ZNNA 5BT9A 3I83A 5L40A 1GTMA 4HFMA 3QVXA 4UAGA 1SEVA 7ADHA 4A73A 3I9KA 4XQCA 1E1NA 4CQLB 2GZ1A 3LZ6A 2NACA 4AJPA 1WMAA 1UDAA 3MJ4A 4J43A 5ILOA 1BGVA 1M6HA 3E9QA 1JQBA 4D0RA 1YL6A 2IYOA 1DOHA 2ZTUA 3ONEA 1PJ3A 2BKAA 4JCOA 1XU7A 1T2FA 3TOXA 3IL2A 5I8ZA 4AJIA 3M1LA 1XIVA 4IDCA 1QYCA 4CLEA 4UVEA 1HLDA 3JQAD 1ISJA 1IPFA 4Z6KA 4XYGA 3I52A 1Q1NA 4E4YA 2Q46A 5JC8A 1PEDA 2VHYA 2ZB4A 3I6QA 1ML3A 2YFHA 1DLJA 1LX6A 4IJVA 1EZ4A 4YTEA 4GGPA 2LDBA 1JAYA 4J1TA 3W8EA 2Y1DA 2QW8A 4JJGA 3GDFA 1U9JA 5CEFA 2I6TA 1NVGA 2G82A 3KSZO 4Z9YA 4BMSA 4DL9A 1B3BA 4DXHA 4PZEA 3HDQA 4XDZA 4PLCA 4Z9FA 5U4QA 1ARZA 3K30A 4EJ0A 3RUCA 2HMVA 1NYTA 2OL4A 1BW9B 1H6BA 4A26A 1BDBA 4Y98A 3OMLA 1HT0A 2C82A 4RO0A 4UVHA 1ZSNA 3CSDA 1T2CA 3FBTA 1J5PA 3G1UA 4YACA 2DTEA 5JDIA 1YQDA 1FJHA 3CZMA 4CLRB 3H65A 3BYZA 3ZWVA 3DHEA 1P1FA 4BNTA 3VPHA 1RYEA 3E03A 5CEEA 4BNHA 2NADA 4XWYA 3H4VA 4HV4A 2HAEA 4RVDA 1T1RA 3RUDA 4NBRA 1MX3A 2FPIA 1MG0A 3KLMX 5B4TA 4MKXA 3RQSA 2Y1GA 4FR5A 4AJEA 4ALIA 4KMSA 2NU9A 1LRJA 2J6IA 3GPIA 3VTZA 1F06A 1LSSA 4MO2A 2O50A 2AXQA 3ZV6A 1T26A 2B83A 1MFZA 4L75A 4B7UA 3GZNA 2YDYA 3WLFA 3BHMA 5IFLA 1HYHA 3W4IA 3ZDFA 4FC6A 4B79A 3H2SA 3DMYA 5A3VA 2NLOA 3BTSA 5GZ1A 1GQQA 1N7HA 3JQFA 4WCDA 3BMCB 1LTHR 2DBQA 2YUTA 3O26A 1WW8A 5KJFA 3WTCA 3PVZA 1E7SA 3P5SA 1VSUA 1FXSA 1KVTA 3KYCA 5ER6A 1I01A 3G1TA 4HUJA 4KP7A 1R4MB 5T67A 2BFMA 2VRCA 1SEPA 1P77A 4L4SA 3HFSA 2GERA 4MIEA 1QXSA 2JFGA 3CINA 4OOFA 1YL7A 5IZCC 4BNKA 2PR2A 2RHRA 3JQEA 4FGWA 4Z0PA 2ILTA 4IXTA 3RUIA 1V3VA 2F00A 4BMVA 2AEFA 5GY7A 4ZQGA 3Q11A 1YH3A 4PGFA 3EZYA 5JCJA 4QEDA 5BNFA 3AWDA 4MVJH 4R1NA 1ZFNA 4I5DA 4H16A 1JKJA 4BKOA 4CM3A 1TB4A 4CM9D 4CMHA 3K6JA 4DC1A 2WYWA 4NFYA 4H15A 5LDHA 1DEHA 4Q3EA 3DR3A 3RD5A 5EL0A 4WEQA 3ZW9A 2JD2A 2FSVA 3NV9A 2Q1TA 2PD3A 1JN0A 2YQ5A 3IKVA 4BIIA 5A02A 5JY6A 3EVTA 3I9NA 3OSUA 3S2EA 2P91A 3QV1A 4U5QA 4XEHA 1NP3A 5BSFA 1E3SA 5TJ9A 5TQVA 1PJ4A 2BMAA 1Z45A 2OBNA 4R9SA 2DU8A 3MEQA 1AXGA 3F4LA 5K0ZA 2OGUA 1E77A 4RVGA 5JYEA 2ZTLA 4RCVA 3GVCA 4WKGA 4RF4A 4FJ1A 4D41A 2CVOA 3SXPA 4BNYA 4HX5A 4NIMA 1K6XA 2UAGA 2C20A 5EIOA 4J7UA 3ZU4A 2VUSA 2I3GA 3NUGA 1U3TA 4PG6A 2X5JO 5DOVA 1D7OA 1FMCA 1Y8QB 1HXHA 1SMKA 2DTDA 3H8VA 2HRBA 1QRRA 3ROQA 2I66A 3LF1A 4NJMA 2ET6A 3GVPA 2OXIA 5IJZA 1X0XA 3LU1A 1LLQA 3JCZA 4YJGA 2ZCUA 4BNMA 3B1FA 2PA3A 1RYDA 1OFGA 1T4DA 2X22A 5A9SA 1NHWA 4ZRNA 3ZHBA 1AGNA 4R9RA 2UV8A 1PGNA 1J0XO 3LC1O 3ZWAA 4NH4A 3GH3A 1ZJYA 2X9VA 5JAZA 5I8WA 1MV8A 1E3EA 4BQPA 5L3ZA 4WLEA 3GLQA 1LDMA 4GPD1 2C2YA 1SPXA 3OQ6A 3UAGA 1GV1A 4QXMA 4IUYA 4DQUA 3PXXA 1DIBA 5J23A 2PK3A 4IY1A 4H3VA 4RPLA 2PFGA 3KHUA 1DAPA 4AG3A 5A4DA 5G0TA 5TF4A 5C37A 3TN7A 5IZCA 2VUTA 1I2ZA 3ETDA 4AJ2A 1XSEA 1I36A 4PG8A 4QSMA 3GF4A 2G5CA 3DAGA 4IJWA 4MDHA 3L9XA 2C54A 2HK9A 4YRDA 1DXYA 4L4XA 2VQ3A 2IXBA 4RF5A 3MJTA 3UH1A 1K0UA 3ZWYA 5C3MA 2FY8A 4A27A 5CP8A 1D8AA 4BNXA 2A94A 1QG6A 4MVJD 4R1TA 3UGKA 1GCOA 4TQGA 4Y6RA 3JQ8A 3K2BA 1VPDA 3FNEA 2CVZA 1NQ5A 4GKBA 4JX8A 4KQXA 1BRMA 4GH5A 2EW8A 1ZXLA 3DAPA 1VC2A 4UUPA 1I3NA 1VRWA 4GLLA 2OOSA 4NQZA 2GNAA 3I9JA 3H5NA 3QW2A 1OOEA 4OAQA 4WE3A 1WAMA 2BH9A 2DUWA 1KVUA 4PLPA 4IDDA 3P7MA 4KTVE 4IDBA 1B16A 3GRKA 4FD3A 2D5CA 1KY5A 1EVYA 4M1QA 3KYDB 4M55A 3JV7A 4R1SA 4J16A 1LRLA 1FDTA 5COBA 1YQGA 1HTBA 2Y66A 3PK0A 3STHA 3EW7A 4NI5A 4XR4A 3WMWA 3RUAA 2GUGA 5I7FA 1PJBA 1YB1A 1NXQA 3PIDA 3IAHA 4NDNE 5IDWA 3GY0A 1IHXA 1NPTO 3QVSA 3N7UA 3T4EA 1JTVA 1XR3A 3GOHA 4RLHA 4XDYA 5H81A 4K26A 4IMPA 3DFUA 3HNPA 1E5LA 4FS3A 2B4RO 5L4NA 4JJFA 3MJVA 1U3VA 1KBZA 3GPDG 1UXKA 1X7GA 1ADCA 3QRWA 3C1OA 4I9UA 1P74A 3NTQA 3ZW8A 2NVWA 1Q0LA 1E6EA 3MTJA 2B5VA 2GZ3A 5L4LA 3RFTA 2QG4A 4YJFA 4IQ0A 4BVAA 3ZV4A 2I9PA 4IS2A 4CM4A 3X2EA 2NU7A 2QRLA 3OA0A 3EZLA 4YCAA 1W6UA 1NWCA 1CQJA 2Q49A 1SOWA 1CWUA 4YXFA 3I5MA 3F1KA 3S1LA 2P5UA 4KUEA 1PWZA 1BSVA 1GQ2A 1F0YA 2BF7A 5DCUA 4ALJA 2VUUA 1RPNA 3UF0A 1QYVA 1V9LA 4BNJA 3D5TA 5I9MA 1KEWA 3ZWPA 2FOIA 4DBZA 4IINA 1NAIA 4TVBA 1PWXA 2HQ1A 3E5RA 4DPLA 5MGBA 5LC1A 4YAKA 4QT0A 4FPXA 4Y67A 1GYRA 4HBGA 2IZZA 3BMNB 4O1MA 4R16A 3FNHA 1VE9A 2W2KA 2Y1FA 4YAJA 3QQPA 3SLGA 2Y05A 4AVYA 4BO9A 3WDSA 3DBLA 5EINA 3RCBA 1YONA 1E7YA 3INGA 4XB1A 1XELA 1PJCA 2NTNA 4HWKA 2GRAA 4P4NA 4EI2A 5THKA 5BNTA 1BWSA 4YAIA 5KVSA 1KVRA 3PJFA 2XXJA 1PGOA 4CQLA 3A28A 5K9ZA 6LDHA 4FFRA 2O4CA 3PLNA 3IP3A 3LT0A 3GC6A 4QTZA 3ONDA 3EY4A 3LC2O 3DHYA 1XQ6A 4AJ1A 2ZK7A 2ZYGA 1F8GA 3D3EA 4GX2A 3VVBA 2O48X 4P8RA 1ZSVA 3GR6A 1HLPA 5C7IO 1XG5A 3GN2A 3JYOA 2JL1A 4AL4A 4DVJA 3BHIA 4RDHA 2C0CA 4BO5A 2V6BA 3I9MA 4DQXA 2A92A 5L7YA 2FZWA 3AK4A 2O3QA 5A1TA 4WASA 1E7MA 3INRA 2RAFA 1UAGA 4GWKA 5JDCC 2AQ8A 5A3JA 2PD4A 3O03A 1BXGB 1EK6A 1DLIA 3KLPX 3T7EA 3FCOA 1Z7BA 3FPCA 3ENNA 1MB4A 1HEUA 3KSDO 1EQ2A 5JFOA 2CNBA 3HADA 5FWNA 1OC4A 3E5MA 5THQA 1HF3A 1E6UA 3C1AA 1PIWA 5JCJD 1UR5A 3CXRA 4QX6A 4NJMB 4I08A 2BI8A 4N5NA 5A9TA 4M54A 5JO0A 1J4AA 1BW9A 1GU7A 1DC3A 1M76A 2YDXA 3DZJA 3ZWWA 4FJ0A 4XGNA 3TFQA 4MKRA 2VT3A 1Y8RA 3ZU3A 5ER9A 2O7SA 1PZFA 3AY3A 2Y68A 2VWPA 5CPBA 1NPYA 1IULA 1LDEA 4DIFA 3WYEA 3MCVA 4CM8B 4YDRA 2QYTA 4XYLA 3IKTA 4KWHA 4HNHA 3UFXA 4MVJF 5JO9A 4IM7A 1TA4A 4LMRA 1IYZA 3A14A 4W82A 2CF6A 1J49A 4BGIA 1EFKA 2VHWA 3QWBA 1R16A 1E3WB 4PN3A 1EVIA 4BO7A 3C3XA 1U1IA 4P22A 3SJUA 1U7TA 2OO5A 4I5GA 1P3DA 3DBVO 1IZ9A 1A7AA 1KEPA 4CV0A 4U7WA 3RKRA 3D0OA 5ES3A 2YYYA 1FK8A 4D79A 5L7TA 1IZ0A 1X14A 3NT2A 4PG4A 1DJQA 4CM9A 4D0SA 1ENZA 3GT0A 4Q39A 1LSJA 1T1SA 3CMCO 4CL8A 1PJ2A 5DP1A 3OIDA 1A4IA 2PTGA 3KZVA 4MPDA 4XIJA 4RQTA 5JPIA 4MOWA 4CMKA 1UUFA 2IEBA 3AUAA 1P0CA 3LLSA 4WUVA 1HYEA 3L4SO 5EESA 1NTOA 3KVOA 2RHCA 1LDBA 3KYBA 1AE1A 1LUAA 3JQ6A 2BFAA 2IXAA 4N5MA 1V8BA 1X0VA 1ULSA 2Q3EA 3BMCA 4FDAA 3F3SA 3KB6A 5G4LA 4RDIA 5BSEA 1EBFA 3JQ8B 1I32A 3KOUA 1ZBQA 2JCVA 3U0BA 4BS9A 1EUZA 1XYGA 1DDOA 2EJVA 1NASA 2ZB3A 4BV8A 1R4MA 4I5FA 4ZU3A 2HRZA 1CIVA 1QORA 4J49A 4R4JA 1E7RA 3OQBA 2BI7A 4FIZA 3RUEA 1OI7A 3BTOA 3OETA 3TZCA 5DBGA 3G49A 4HADA 2X6TA 1OBFO 4RF3A 3SBOA 1FDSA 2OORA 1QLJA 1XLTA 1ZXBA 4E30A 3FR7A 1QR6A 4PLYA 2YHUA 5KJCA 1PX0A 3NT5A 3I4CA 4CL3A 2GGSA 2DT5A 3BMQB 3IJPA 3OJLA 4WLVA 3BMOB 2W98A 1EDOA 1KYQA 4INAA 2NUAA 4ND5A 1ID1A 5DNAA 3U4DA 4NBUA 3WR5A 3ON5A 3IMFA 1GYQA 4YRBA 3G17A 5A9RA 2WMDA 3NX4A 3HDJA 2FP4A 3GZ4A 3JQBA 2DC1A 2J3JA 2ZJ1A 3TL2A 1WP4A 3PHHA 1XDWA 2AG8A 3PJDA 5EERA 8LDHA 1GZ6A 4CM6A 1M67A 2XF8A 4GI2A 4CV3A 1ZVMA 1ISIA 3OQ1A 1R66A 4YJFB 3TQHA 3VKVA 1DSSG 4RQUA 4KDFA 4BMNA 3IS3A 3VPSA 4PFJA 2QIOA 1YDEA 3RASA 1LDNA 4Q3DA 2R00A 4QUKA 5FFFA 5TGDA 1K3TA 3VZPA 4GSKA 1O8CA 4AJJA 3VDRA 4E0BA 1I8TA 1R0SA 2Y0DA 3WFJA 1ISFA 3AY7A 1GADO 1P1KA 1U8XX 4K6FA 1WXDA 1LNQA 2PNFA 1V0JA 2NU8A 5IN4A 1FF9A 4YJHB 3V8BA 4BNLA 5L53A 3NGLA 3JD4A 4XZ3A 4OL9A 4H7PA 2E4AA 3CIFA 4OQZA 2Q99A 5T8KC 2PZJA 4B3HA 2ZJ0A 3GN1A 3WGGA 1I3MA 1PS0A 3H5RA 3JYNA 3PWSA 4CLOB 3HG7A 4XD2A 4DRYA 2WM3A 5JAIA 4GSLA 5B4VA 3DBLB 4YYZA 1E3LA 1N8KA 2QHXA 3IUSA 3GNSA 3SLKA 3EMKA 3OP4A 3UCFA 4E5KA 4CM5A 4QECA 1LJ8A 1DFGA 3Q6IA 2VWGA 3G3EA 1UXJA 3DZIA 4MKZA 2Q2VA 4WNIA 2WJPA 1PZHA 2ZTVA 4W7HA 1X7DA 4GQAA 2E48A 4NK4A 5F1KA 3BTVA 3O4RA 1I24A 4A10A 2ZCVA 4B7CA 4PLWA 3H9JA 2C5EA 1NAHA 4D46A 3KUXA 1Q7GA 3TRIA 1HDGO 2FMUA 5EMHA 4TRRA 2W2LD 4JXKA 2J3HA 3A4VA 3AM5A 1Y7TA 4OHUA 3V5NA 2EGGA 4ND1A 5DOZA 4J90A 1N92A 3W4KA 1I0ZA 1O89A 3L6EA 3MJEA 3AM4A 3FNGA 4EBFA 2JKVA 4WNCA 1ZJZA 5JMPA 1KC1A 1P1RA 1PJQA 4J4BA 9LDBA 5KOIA 3NJ8A 2V7PA 2DFVA 3JD2A 3BAZA 2OP0A 2PD6A 1YDWA 1JU9A 3W8FA 5CAEA 2HJSA 3EGOA 4GX1A 4ALKA 2JD1A 2G0TA 1T2AA 3L6DA 4DMLA 4EDFA 5KIAA 4B8WA 5IDQA 4ZQBA 3E18A 2I5PO 4B3IA 3OEWA 3Q1LA 4PZDA 3ASUA 1PQWA 5AQ1A 4NU5A 5IZ4A 2GN9A 2DM6A 3F5SA 1L7EA 1SOVA 2VZ8A 4C4OA 4DC0A 3TL3A 2HUNA 3T4XA 1V6AA 4OXNA 2Z5LA 1Y8RB 2HJRA 2PZKA 3BA1A 1DC4A 3GDGA 4DLAA 5H82A 2NV6A 1WZEA 3D4OA 3INTA 3S55A 4E32A 2Y93A 4C7JA 1MG5A 2D3TA 1HRDA 3KYDA 3D3WB 1JVBA 1DAOA 3Q3CA 4OMUA 2JCYA 4R5MA 4ZQFA 4CMIB 5EPOA 5CHEA 4YB8A 1E6WA 2AEJA 1KVQA 3F1LA 1V3UA 4E5MA 3RAJA 2Q1WA 3C7AA 3UICA 5HS6A 4RVUA 2RIRA 4Z9XA 2D5AA 2HO5A 2ZQYA 4DLLA 2C07A 1KIFA 5T8KA 4L76A 4AJ4A 5HWSA 4UREA 3QY9A 3NEPX 4FFLA 4QO8A 4JK3A 4Z0HO 3RC1A 2C2XA 4IGFA 3TZQA 3H9UA 5BSGA 3BHJA 4JP3A 4XR9A 3WGHA 3ROPA 3RU9A 1YXMA 2TMDA 1QV6A 2CDBA 3I3OA 3K96A 2QQ5A 1QP8A 4DGSA 3TOZA 3L4BC 1AHHA 2HSDA 5CPFA 5K6AC 1W73A 4YRAA 2O4UX 4U0KA 3RVDA 3LQFA 1HDZA 2UVDA 4UEJA 3EC7A 1OMOA 3RFXA 3WGOA 3P2OA 4PLGA 3WG9A 4JROA 4PLZA 3U3XA 4JBGA 4R51A 3BTUA 1N2SA 1P1IA 5TLSA 4NK5A 1XEAA 3AW9A 1Z7EA 5FF9A 2HDHA 4FQ8A 2ZKLA 1EUCA 1GR0A 2JAHA 1PL6A 2X5KO 3BMNA 2VT2A 4GL4A 3ZWBA 2VOEA 2GF2A 5TT0A 3VTFA 3D1LA 1EDZA 4PRLA 4DLBA 2ZB8A 1D1TA 5F3RA 1MXHA 3KRTA 5BQFA 5DF1A 2ZTMA 4DWVA 2G17A 2YZ7A 1K6IA 2NM0A 3D7LA 3RBZA 1DC6A 5AYVA 4BV9A 3PTZA 2EKQA 3V2UA 1N7GA 3QP9A 1YBMA 2EIHA 1HSOA 4GX5A 2B4QA 2D0IA 2WD7A 4Q3AA 2W4QA 3AUSA 2WEKA 4PIVA 4MP3A 1ENOA 3HQ4O 1AXEA 2Q1UA 3I6IA 2AE1A 1HE2A 3WFIA 3HB5X 4OJNA 1JDJA 3UKOA 5A5EA 2HKIA 2H1SA 3FBGA 1MLDA 1PZEA 1PTJA 2WD8A 3PQEA 1G1AA 5L51A 2Q4EA 1SZJG 2C29D 4TRNA 5KVQA 4LRTB 3QWAA 3AM3A 5DULA 4RLSA 5TX7A 3TDKA 3VDQA 1BXGA 3GVHA 2P2SA 3WGIA 3HDHA 3VZSA 2YV2A 1H5QA 1UZMA 2D2IA 1K89A 1Z73A 4HFRA 3GHYA 4WOJA 4KOAA 3DZFA 4FFPA 5TNXA 1GUFA 2VTEA 3CZRA 4JGBA 3PGXA 4O5OA 3WGQA 3E82A 5ADHA 4R54A 4MVJM 2J5QA 2NWQA 4OOEA 4AFNA 3LT1A 2FZEA 4HKTA 5AXDA 1F17A 2I76A 1Q0QA 1CDOA 4FJ2A 4A03A 1HE3A 1LLCA 3L4BA 3R3SA 4L8VA 1PL8A 4RVHA 3U4CA 2CSUA 3DAFA 1U4OA 3PHLA 3U09A 4KZPA 4CUKA 1R4NB 2EEZA 2QZ9A 3COSA 4GLOA 4CM8A 1LSOA 2JD0A 3I9OA 2EGHA 1M75A 2NVBA 3BIOA 3DZGA 3RBXA 1BVRA 4GGOA 2QRKA 3B1KA 2IE0A 3OA2A 5HM8A 1C1XA 1E3WA 2DLDA 1RM5A 3GVIA 3NGXA 3UHAA 4BB6A 2DVMA 5CG1A 4E3ZA 1Y6JA 4XGKA 3P2YA 1UXIA 1BTOA 1BMDA 4J4HA 4R3NA 4J9VA 5DCYA 4CMCA 2UUOA 2GASA 3ICPA 3E9NA 3F9IA 1WVGA 1VI2A 2J3IA 3M2PA 3PHJA 1LDYA 3DTYA 3PLRA 2EKPA 2O7QA 1O95A 3QE3A 1GPJA 4CM7A 4DMMA 2CD9A 1X1EA 4OH1A 5A03A 5L4SA 2EWMA 1VLLA 4UEKA 1N5DA 1DRWA 3I9LA 1GZ4A 5G4KA 4BNFA 3D4PA 4EUEA 3NAQA 3PZBA 1T4BA 1A71A 3U4IA 5F1PA 1AN9A 1NFRA 3ZU2A 3R6DA 1HDOA 2I3AA 3Q2IA 5HRUA 4YR9A 2BLLA 2VTDA 3H9EO 1ZKMA 3WB9A 1Z82A 4NPCA 5G0SA 1LC0A 1IB6A 3WSWA 3ZCXA 2AHRA 2WE8A 1I3KA 4JJIA 5H83A 3OEYA 3JD1A 5T57A 4O59O 4CMJA 1P0FA 4CV1A 5L9AA 4MIOA 1CRWG 5JAMA 2VRBA 3DO5A 1KY4A 1HYGA 1V35A 4XYBA 5IF3A 3EVNA 3UOGA 2AEMA 1Y5RA 4E2ZA 4LRSB 3MWDB 4PVCA 1B14A 2WYUA 2Z1MA 3I4FA 4CLDA 5LCXA 4J6FA 1M6WA 3DZKA 1ADBA 2OUIA 3BMQA 4JN6B 3BMOA 2UUPA 3AFMA 2P9EA 1JAXA 1KERA 1BVUA 4YWJA 2PZLA 3AOEC 3TZHA 3WXBA 3T7CA 1TT7A 2C59A 1P33A 3JQ9C 2GN4A 3VVCA 2HMWA 1YOVA 1MA0A 2BGMA 2UDPA 3PDJA 1BDMA 1E7WA 1U3UA 1U8FO 3W1VA 1YQXA 3DXFA 3MJSA 4EEXA 3CKYA 2GLXA 4OKIA 2DFDA 4II3A 1GDHA 2GDZA 3TPCA 4BNIA 3O8QB 1LQUA 1JWAB 1I2CA 2W2LA 4DQVA 2FN7A 1YWGO 3OICA 1X1TA 3AI3A 2PKRA 3KSUA 4UUNA 2ZIZA 2D8AA 1QYWA 3VPXA 1TLTA 2JJYA 2CZCA 4ALMA 4W7IA 5MDHA 4IDGA 4WEOA 3HN7A 3TWOA 3WWYA 4MP8A 2ZYDA 1RJWA 3NT4A 3OH8A 3P19A 1P45A 3C8MA 5KCZA 3RU7A 4YJHA 1H93A 2P5YA 5G0UA 1YJ8A 2RH8A 3LF2A 1IOLA 1DIHA 3GGGA 3C24A 5DCWA 4R01A 2P68A 3V2GA 4CLOA 4BB5A 2Y99A 3FI9A 3G0OA 3C1TA 3A06A 2EKLA 2Q50A 2YFQA 3IJRA 2YHIA 4WLFA 2POQX 2IZ1A 1GEEA 1T24A 4ND3A 3QA9A 4XCVA 3RFVA 5A05A 2I67A 1T2DA 1ZZEA 4CMAA 5JS6A 3WNQA 3E6AA 1WWKA 4KUGA 4LGVA 4W9NC 4Y8VA 3UN1A 4GVXA 4Y6SA 4HFJA 1MC4A 1Q2XA 3UCEA 4P4GA 3WOHA 1VL0A 1N9GB 4D3DA 4ONEA 4WLOA 1ZIDA 2J3KA 3GEGA 4K6CA 4Y6PA 2P4QA 2DBRA 4IQ8A 4TRMA 5EJ2A 4J1NA 3WIDA 4DYVA 2AQIA 1Y1PA 2O3TA 3CUKA 1XKQA 1L1FA 1PL7A 4PLTA 4D42A 1GCUA 1MC5A 2HMUA 3F5QA 3LK7A 1OZAA 2WD7B 2B36A 2EF1A 3MZ0A 3ONFA 4GBJA 4MIYA 4PG7A 1I2BA 4F3YA 4ILKA 1UDBA 1VL6A 2B69A 4D43A 3FR8A 2EJWA 1BXZA 3MOIA 3K9QO 1NPDA 5FI5A 4GMGA 3GNTA 1IPEA 3ZHXA 4UEOA 3VPFA 1IY8A 5JY1A 3KEOA 3Q9NA 4IXWA 3FTPA 4E2XA 3HB4X 4HFNA 3LT2A 3WGYA 2CVQA 1B8UA 1R15A 1H94A 3AOEA 4CMEC 3JQ9A 3GRPA 3PWKA 2BGLA 4FN4A 4YAEA 2BHLA 3FRJA 5IXYA 3DHNA 3CEAA 2CDAA 1EE9A 3OFSA 3PYXA 4BO4A 5I7EA 1UP7A 2UYYA 4PLFA 2C7GA 1YBVA 2V6FA 3KV3O 4NG5A 4ZA2A 1CF2O 4XX0A 1NR7A 3B70A 1QV7A 2JFHA 1HKUA 4S3MA 3CPSA 1PU2A 3FD8A 3VZQA 3WYBA 5G0VA 3L9WA 1A72A 3D3WA 5U1PA 2O3RA 3WGZA 3ETEA 3TFOA 4CMIA 3OM9A 4I9NA 2X23A 2Y1CA 3RJ5A 4NFSA 1H6CA 3NDIA 2FPPA 2XAAA 2X0NA 3ASVA 1W0CA 3FN4A 2RCYA 3OF2A 1C1XB 4M49A 3WS7A 2XPCA 3GMDA 1B8PA 1R37A 3NJ4A 3DC2A 1CYDA 4L0QA 3RC9A 1LBEA 4DUPA 3JYPA 4BKUA 1F14A 2JHGA 2A9FA 5EQFA 1AHIA 2IODA 2H63A 2X58A 5T64A 4WGGA 3HE3A 1GUYA 3H7AA 3RJ9A 4TWRA 4C7KA 1GV0A 1LRKA 1X15A 3RBVA 2FSSA 4MINA 1HE4A 4LW8A 4ALNA 2Q2WA 1K5HA 4W9NA 3H9QA 2QRJA 3OJOA 1C0PA 4BO8A 2J8ZA 1D4FA 1LQTA 5GZ6A 4IDEA 1KS9A 5G4KB 1I5RA 4KTTE 4XJTA 4D44A 2DKNA 3ICCA 3GHHA 3DL2A 4B3JA 1X13A 3F46A 4BNZA 3I1JA 3PGJA 3ROKA 4FBGA 2O3SA 4M87A 3AFNA 3S8MA 3ZHZA 1F8FA 1R0KA 2GD1O 3DFZA 1LEHA 2PGJA 5EN4A 3E9MA 4CR8A 4N7RA 1U4SA 5HTOA 4E33A 1DIRA 4B4OA 2GR9A 4IS3A 3RUHA 3HWRA 1LDGA 3W6ZA 5JDCA 1H2BA 4BOYA 2PKQO 3GNQA 4XYMA 5BR7A 2I99A 4ZN6A 4IZHA 4RVSA 1CEQA 3DMTC 2NTJA 4NNJA 4J0EA 4FB5A 3ZN2A 1P1JA 4CMEA 1Y5MA 3QLJA 1VL8A 2AW5A 1K6JA 2WDZA 2X0IA 1X7HA 3QWHA 3K5PA 1TEHA 3ZWMA 5JC1A 1E1KA 4OXYA 4RPHA 4W6ZA 1ZH8A 1DFIA 3WJAA 1UZLA 2DAPA 2IZ0A 3E1KA 3WSVA 1IL0A 3ITDA 1AUPA 4MP6A 3ORFA 2RBEA 5TJHA 2DTXA 3ZV3A 1NHGA 5DN9A 3NKLA 3VH3A 3ZNQA 1TI7A 5KJ1A 3OECA 3ZI0A 3OJEA 1YOVB 3Q0EA 4CQMA 4BL5A 3QWIA 2J5RA 4U6QA 5KKCA 4F46A 2G76A 1LSUA 1HZJA 1M66A 1GUZA 1B8VA 1VM6A 1JW9B 1SB9A 3EUWA 4HNGA 4OO3A 4IGEA 1UDCA 2Q1SA 1EVJA 3AUUA 4M89A 4I9HA 2CY0A 2AQKA 1DHRA 5FEUA 5I7VA 5A04A 2O3UA 4WJZA 3FWNA 3WX0A 1JKIA 4AJLA 5T6BA 3TSCA 1G0OA 2NSDA 2DPGA 3H9GA 5DBIA 1PGQA 2HLPA 3ANMA 4ID9A 4PRKA 5A06A 4TMFA 3CTMA 3OBBA 1LI4A 2CFCA 3VH2A 4FFOA 4F45A 5CDSA 1KVSA 3QVWA 3WJ7A 3H6KA 2WSBA 4IQGA 1DB3A 1GQYA 3LT4A 1DBVO 2YV1A 1E0DA 1SC6A 1CERA 4DYDA 2BFPA 3EHEA 1ZCJA 2O3JA 3FNFA 3HZZA 1ISGA 1C1DB 2YHIB 1H6DA 1ZUD1 3UW3A 3JQDA 1EFLA 1R4NA 4L9RA 4Q3NA 4DBVO 4ZICA 1SB8A 3DZBA 2DUUA 4JNKA 1QLHA 2OHXA 4L74A 4AJHA 1ENPA 1Z75A 1DRUA 3DBRA 4FCCA 4A2CA 2C5AA 1I33A 2CDCA 5ICSA 5JSFA 4CMBA 1HDRA 3ZNPA 4IBOA 4S1VA 4U0JA 3S2FA 5TRTA 3DONA 5HA5A 4YVFA 2IDZA 1CQIA 5ITWA 3QIVA 5C5IA 3DZHA 1ONNA 2AMFA 3LYLA 4E21A 3TZ6A 3QJ5A 1VSVA 3ZGYA 2YY7A 3CH6A 1O6ZA 2X7HA 3DMTA 4ROSA 1UP6A 4BGEA 4BGUA 4TVOA 1OC2A 4CMGA 4BNVA 4RZHA 2B35A 4K28A 5A5FA 3JQFC 4XQGA 2EP5A 4N5LA 1Y81A 1O94A 4DIOA 5JYDA 5AXAA 4ALLA 2VHZA 4WCFC 4Y9DA 1YO6A 4RPKA 2GN6A 2E37A 2VYVA 4BNNA 4YT4A 3RC7A 3W8DA 5BNIA 1H0KA 1WDLA 4RGBA 2WTBA 4CUZA 4LCEA 4BHTA 3Q2KA 5I7SA 3GEMA 1ZW1A 2XXBA 4PCVA 4XRRA 2WE7A 1YKFA 4RV9A 1B0AA 1P1HA 2G1UA 5L45A 1GL3A 4JQCA 2H9IA 2YQ4A 1YBAA 2FRDA 4CJXA 3UCXA 1A9YA 3A1NA 1UXHA 3K73O 4PZCA 3M2TA 3WQRA 3OJFA 1P9LA 1H6AA 3ANLA 1NM5A 3V1TC 4TKLA 4RPJA 1DIAA 5COAA 3F6YA 2PWZA 2X9GA 1ONOA 4BKRA 2I65A 3KM0A 1XWFA 4J1QA 1Q0HA 4JBIA 2HCTA 1GFSA 4TRJA 3SJ7A 2BD0A 2OFPA 4B7XA 2EHDA 3DQPA 4NMHA 4E12A 1PJLA 8ADHA 4FSHA 4W99A 3VKUA 4E5YA 5C7LO 3PFWO 4II2A 3ZV5A 3VAZA 4I5EA 2D59A 4Q3CA 3ROMA 1E3JA 3U49A 1HE5A 1B3RA 1UXGA 3C7CB 4UVDA 3ZWCA 4RPGA 3D64A 3WQQA 1JKFA 3DTTA 3O8QA 4OYRA 4WLUA 5IN5A 1ZNQO 4TZKA 3VZRA 4J7CA 1NQOA 4NJOA 2HMTA 5DBFA 4QFDA 3RUFA 4GVLA 1YVEI 4TKMA 2B37A 2P4HX 3V1UA 4YAGA 1OAAA 1U28A 1ORRA 4OQYA 2HU2A 4YA6A 3GG9A 1QMGA 4A5OA 4PLHA 3N58A 3KBOA 2WYVA 2Q45A 5B1YA 3B20A 4J2HA 5CDTA 3FWZA 2OBYA 4NU6A 4ZD6A 4BO2A 1E92A 3JD0A 4MVJE 3TJRA 1NNUA 2D1YA 2B5WA 3PJEA 1B7GO 5DP2A 3PEFA 1PZGA 4W4TA 3WMXA 1NVTA 4GX0A 2X0JA 1S7CA 3KO8A 3MWEB 3PJGA 4WCFA 4BNWA 3IOYA 3DEYX 4EJMA 1GYPA 2LDXA 2IYPA 1HETA 5CDYA 1LU9A 2X5OA 4MVJG 3WIEA 2QYSA 2PV7A 4YT5A 4DPMA 5L7WA 3HHPA 1ADGA 1N9GA 5TS3A 1TXGA 2J5KA 9LDTA 1GY8A 3A9WA 4XYEA 3VOSA 4O63O 2EG9A 1ZK1A 2CMDA 1SAYA 2GCGA 5AXCA 1RKXA 3GFGA 3JQ7B 2TMGA 4AJOA 4DTIA 3CE6A 1C3VA 3PWZA 3AI1A 5CDUA 3MOGA 5COQA 1Q7CA 1XGKA 2YV3A 3TNLA 3GA0A 4CQMB 1GZ3A 1YB4A 3TF5A 3JQCA 3JQGB 3E48A 1XHLA 2PLAA 2VYND 3R1IA 1WMBA 4J9UE 4XKJA 4ND4A 1ONPA 3U9LA 4EZBA 1J6UA 2H5LA 4WK6A 1M2WA 3QSGA 1D1SA 2PH5A 2DQ4A 4J3FA 3ZZNA 1Z6ZA 3GGPA 1EBUA 1G6KA 4QO7A 4AJNA 4XRGA 4KDEA 2V6MA 4I8XA 1T2EA 4NBWA 3DOOA 2FR0A 4E2WA 2A4KA 3LDHA 1P31A 4D7AA 2X8LA 3DDNA 4GAEA 3UVEA 2R2GA 4CLHA 3ZWXA 1Z74A
chains in the Genus database with same CATH superfamily
1JNYA 4NBTA 3SYKA 2JIMA 4U2KA 1ILWA 3HYNA 3LBIA 1FNCA 3RK0A 1AO0A 3COYA 4TROA 5BSHA 2LNDA 1H4SA 3DBHA 1GA6A 3O7WA 3PQFA 2F7SA 2YCLA 3LH5A 5CD9A 1I4EB 2X86A 3K8YA 4AKEA 4U02A 5AVOA 1I94B 4R5HA 4RTKA 1T1GA 4MGYR 3GXBA 3K9WA 4YR7A 4PNPA 3IHWA 1CEEA 2IK8A 2ZG6A 3ZQJA 3CH7A 1HBJA 2QY9A 3I6BA 3M6FA 1OWOA 3LLVA 1CDZA 1NBMD 3PEYA 1RYHA 4HP8A 4WDQA 3CVYA 2ACKA 2C5BA 2ES4A 2GSWA 2XITA 3O31A 4RIEA 3V9AA 3WLLA 1O0BA 4ZO6A 1CP2A 5CLFA 3Q9UA 4KITB 1RWQA 1Y6QA 1B26A 3A4TA 4GR5A 4ON9A 4RY0A 5BPFA 2DUNA 2FPWA 2V96A 3AJRA 3N5CA 4K3VA 5SYMA 3TR5A 3ULKA 4AO6A 4TV8B 2C88A 4CF7A 2QN8A 4AS1A 5DJ5A 1GLVA 2IRWA 5A71A 3VDXA 3RI3A 2IP1A 2ZTHA 2X7JA 5JWRA 4HGYA 4YGYA 5CB4F 1AM4D 5LQRA 3MMSA 4HGZA 3HFGA 5HIIA 4WX2B 5DEIA 3DMDA 2OT3B 3PHIA 5GQSA 3WA7A 1ZK3A 3H04A 3H42B 5KWJA 4DJJA 2CT8A 1QIGA 2KW5A 1HLFA 4D9JA 4G4GA 1UAYA 1IVYA 1NN5A 4ND2A 1IBLB 5AOVA 1OBVA 1RYYA 2O06A 5JAUA 2BM0A 3ZTWA 5K6TA 1GHTA 1TT5A 1I3LA 1P2BA 2YW9A 5D7NA 5AK3A 1G8KA 4UUOA 1C9EA 3WDMA 1BN6A 1VYVA 1L5NA 1XPRA 2VNAA 1JHQA 1EP3B 4R1PA 5EKSA 2FWJA 3BFPA 3CCCA 4J91A 1KR2A 4H1HA 4NZ9A 1P6XA 1MU0A 4YT2A 3KU4A 3DWFA 3MILA 4GUAA 1GA4A 3LC0A 4HAYA 3WMEA 5IBRA 1FNSA 3TSOA 3TB4A 4RACA 5H16A 5B57C 2V7VA 4B9EA 1HGXA 1SBHA 2OLJA 1IFXA 4TM7A 4Q4AB 4XB2A 2XI4A 5LVAA 5DYNA 4FYMA 4D3YA 4G5RA 1IQUA 3OT5A 3CH5A 4ZWNA 5IDYA 2O0MA 1CEXA 1DO0A 2BFBA 4J0FA 1V9CA 1C30A 4HDRA 2REQA 1IN1A 1E2LA 1NLUA 1GL6A 2QE7A 2ZBGA 4ISBA 2Y0EA 1ES9A 3W9BA 5IG2A 4HWRA 2H4JA 1RI4A 2ODPA 4XGIA 1CS4C 3LDAA 3KAKA 4LXIA 1JMKC 2OZPA 4HH3C 3HB7A 3UG7A 5KX5F 2XOXA 2QBYB 4ZXPA 1X87A 1YZGA 2NVUA 3TW0A 1NY5A 5D3QA 4YT8A 2Z8ZA 3FYHA 4HXYA 1D6MA 2ETXA 1TO6A 4ABTA 3HB0A 1Z4JA 1K3UB 2BUCA 3B3FA 4PLVA 3FHLA 5E2BA 4ZARA 3SR4A 2YYSA 1BG6A 3DC7A 5K0JA 4EMUA 4UHBA 4ZCIA 4BVHA 2VWQA 3HA7A 1ETUA 5CX1A 2R1TB 2G77B 1SUCA 3AHJA 3B1ZA 2GSDA 1SIBE 1POWA 2J3EA 2F3TA 2PXCA 1QHHB 3CSUA 3ENKA 3FB1A 1SBCA 4N54A 4NHEA 2D4AA 1WZIA 2NU6A 3IP9A 2BELA 4Q9JA 2QTMA 1G6HA 5B1IA 1N0UA 2DJ5A 2VDRB 4NAVA 4BWFB 4HY3A 1XMOB 3WQSB 1ZXXA 4DJAA 1HK7A 3INYA 4QGBA 4WRRA 3IUPA 4I9GA 4FC7A 2XGMA 2PX5A 2Q8PA 1DG3A 4L85A 1ZITA 4GNKA 1OVGA 3RIGA 4QGHA 4EITA 1U99A 1Z5VA 4AN0A 5IUJC 2QLNA 3GO4A 2ZZKA 2GEBA 4LVCA 1JB1A 4UAVA 2ZUSA 3RO7A 2QAIA 4N40A 3FHCB 3MC1A 3QVTA 1NQTA 3NBFA 5HNKA 3V00A 4FI3C 1C7ZA 1Z4LA 1AQLA 3A9VA 5I7RA 2R96A 1YCHA 3W79A 3MINB 4FDTA 3CKMA 2RKBA 4PFSA 4R9UC 2OK8A 4LQ4A 5JNVA 3KLOA 4ZCLA 4V02A 3G7SA 4HI0E 1T5IA 1NBOA 3RWBA 4F3NA 2HHHB 3L07A 3GFFA 2EFDB 4LIPD 3UTCA 1KDTA 2HX1A 4K1XA 1VQ1A 2F1KA 1VSQA 4N5HX 4P3NA 3WNVA 1ZJ4A 5KJEA 3ZBQA 3ZJTA 2FEKA 3KQMA 4Y2JA 2II6A 1K7XB 3C4VA 4IIHA 3ZLTA 5BXQC 4LC1A 1E20A 2DH6A 2PGOA 3OQPA 4I6GA 3ZY5A 3UHOA 1GAXA 5C8ZA 2Z1NA 1QO0A 2ZBEA 1H2YA 4FX5A 3VR4H 3WGNA 5SV2A 4LK3A 4PG5A 4OUKX 2W2MA 3IT3A 3N6XA 1V45E 3H11B 2CLEB 3OFJA 5CLGA 7MDHA 4PANA 2DBVO 4BGVA 3WDLA 5PNTA 5KMGB 3UJPA 1NURA 4UHKA 1DNPA 5DZSA 4GM0A 2IQ5A 3IT2A 3PGA1 1A4RA 2E21A 3VDMA 4JYCA 2AIRA 4WINA 4BE4A 4FUQA 4LN1A 2CMGA 2R25B 5CFOA 2WOOA 4DR2B 3MJFA 4JB0A 2IIBA 4FZ3A 1T5BA 2UVQA 5BN3A 3GLIE 5AVXA 4EFDA 2AK3A 3ZHVA 2QQGA 5BSRA 3FF4A 1KPHA 2ZATA 3WZLA 4EZIA 4ARIA 5KCMA 4B0OA 3AFOA 3EC2A 3DDOA 4QJ5A 4AZTA 1ST2A 4FSXA 2HF9A 4BX8A 4YMGA 4ZZIA 3GBVA 1BYUA 3UXHA 4AU1A 1UDRA 2GCOA 4K86A 2I29A 3R3YA 4UCFA 3TEMA 1G5TA 1I10A 1X3LA 2VK4A 2XUAA 1CJUC 4RJKA 2DKFA 3KXKA 1JWBB 1XZNA 2Y4NA 2HRQA 2HLNA 4X3PA 2CXQA 3WBFA 4MR8A 2ORWA 4FOOA 4N6NA 1VBMA 4MS4B 4S2UA 2J9FB 4C88A 2E4VA 1JIIA 3GQBA 3HBFA 3H3JA 1DIOB 1GPDG 1EK5A 5HQJA 2B4TO 2WK1A 2A0UA 4PXAA 1F12A 4MJLA 2NP6A 4R3WA 2N1BA 2C5GA 4Q1BA 1RM0A 1SBNE 2PRIA 3IHTA 4DIBA 1YTUA 2RGUA 4YCBA 5DK4A 3F74A 1Z29A 5DFAA 5GMOA 3VXKA 1E5XA 2ZIGA 4K7JA 3LCRA 2VCYA 5JAPA 4PO1A 4E6PA 1Z26A 3F7NA 1PK7A 2YYZA 4AUMA 4JELA 3H0EA 1I7SB 1YS6A 4IDAA 3R6TA 5E8RA 4O4LF 4V0OA 3LX5A 2VJAA 1MP0A 3SK0A 1EEHA 2ZSHA 1ZRHA 2C7VA 3DBHB 4YUYA 5KX5A 4EP1A 3U62A 2BBTA 4UM9B 3CEPB 3PHCA 1L7QA 5CDGA 1OV4A 6ADHA 5B2EA 3AG5A 1I51A 1Z0DA 1YB5A 2WJ6A 5KVVA 3DPSA 3D7KA 2A5DA 2GPYA 3ZY2A 1N1GA 3VH1A 2B98A 3BQNB 3ELBA 2G67A 3FZYA 4HOYA 2VNSA 3R7NA 3RHTA 4P98A 2YOGA 4P54A 4E2YA 1XCGB 3CMMA 4MKHA 2A4MA 1I6MA 1RAEA 4S0ZA 4B4WA 1JZSA 1RWBA 4HDQB 4R69A 4RZIA 3QMWA 1XTPA 4MUBA 2PA0A 2ISQA 4E5NA 3BGOS 1S6YA 3ZNOA 5C35A 4OBWA 4ZOCA 3N0XA 3UB4A 1JXQA 3SNKA 3GEPA 2E6UX 2ZI4A 3NU1A 2EIXA 5CM9C 3SX0A 2WSYB 1T9AA 3ZBPA 1K5DA 3K8OE 4C2TA 1ZK4A 3O2JA 3VH4A 5CTAA 2O5VA 2C4UA 4FNOA 2XGJA 1ZO8A 2G9UA 4C3VA 3C85A 1Y3FE 5K2MA 3WYCA 1WQ3A 4DMRA 2VPXA 2X13A 3JQBC 1TQ8A 1CR0A 1DPGA 1OILA 1YB6A 1CJCA 2GTPA 3OIVA 3HVIA 1Y4DE 1JE0A 1FDUA 5DYGA 2HLDD 4EPVA 1UBFA 3LG2A 4E13A 1MTOA 1W19A 2JK0A 3D31A 3JZMA 3CX8A 4QBTA 1LXCA 5FUWA 4AQDA 2XTMA 1F20A 2GKOA 1TT5B 1U2DA 3NBAA 5AKYA 3SKVA 4OHZA 3ODPA 3GLIB 1ABFA 1ZOPA 3TZKA 2A35A 3TRHA 3KZMA 2DQKA 5FYDA 1UBCA 4PGHA 1V43A 1PGPA 3VR4D 4Q7QA 4LCJA 4RVOA 4HH4A 1R0YA 4X84A 3Q7IA 3FG9A 1OXMA 3PZRA 1IK4A 5ITVA 3GMSA 1X80A 1UFOA 3AERA 1FRZA 1XUOA 4LF8B 2QENA 4OVKA 4A16A 4D9MA 1T15A 3R6LA 1QDLB 1CRLA 2OM6A 2ZS7A 4FYPA 4MWBA 4PCLA 4RK7A 4G0MA 3M3DA 4Q7LA 3VHXA 1NOJA 1RE0A 2B61A 4LISA 4S1PA 1SVOA 2VPTA 4D9FA 2OOKA 1EUDA 1ZA1A 2AQHA 3FA2A 5AKLA 5FBRB 3BBPA 3HMQA 2R8RA 4P84A 3UPTA 2M6LA 1ULUA 3RVRA 2BFBB 4W1RA 3FETA 3UNXA 3IBFA 1IDN1 1C30B 1UWVA 2C95A 5EFOA 4MI3A 1FXWF 2REQB 4DG8A 2NT4A 1NU6A 3ANNA 2A59A 1THMA 3R09A 3PC7A 2QAJA 3P9ZA 3ITEA 1TD1A 2CZQA 2D1FA 1C0IA 3USCS 5ALVA 1RXIA 4GXRA 3OTHA 1EIWA 4LZPA 3HZOA 4FMDB 2VDMB 1E2NA 5DDIP 4JS0A 2GILA 2NVUB 5FWAA 1UPXA 3E1GA 3RAGA 1FYDA 3IOBA 3WGTA 3QPUA 1QDUA 2DQYA 2W6MA 1L4NA 3VHRA 1EHYA 3KOOA 4JC8A 3K9GA 2VA9A 2AR7A 4LAFA 4ARSA 4BKQA 2ZR8A 1AKRA 5IXSA 2VHXA 4IZIA 2O2SA 4J0CA 1PLJA 4TQ9A 4TZTA 1JH9A 5CX1B 3S6JA 3QV2A 5IDXA 1BCSB 1DO8A 1RWMA 4DMKA 3P26A 3H2ZA 4HNRA 3EEQA 2WKSA 2ZE5A 2RBGA 1M1ZA 5UKDA 1S2OA 2BWJA 4ZCQA 3TE6A 3ZE1B 3QFRA 5B12A 3TCXB 4C07A 1Q57A 1YDFA 1AZWA 1UK6A 1M8FA 3NHSA 4HNAA 1YJXA 4XIYA 5HCNA 4C4PA 1N3LA 2VBGA 3DLPX 2IYXA 1JFTA 2EZ9A 5IVKA 3KR2A 3M1AA 1TJ3A 1HSZA 4M6WA 4EA8A 3QWFA 4E14A 2ZQ5A 4F9TA 2F2TA 3EFBA 2QJFA 5CG2A 2COUA 4F6RB 2D0DA 3IAFA 5DN6D 5EVCA 1J25A 1DJNA 1JYEA 1KO7A 1LNZA 1MIOB 1VLQA 2J9RA 1GITA 1XJWA 4FUTA 2OXCA 4FOSA 4O2LA 4O4LA 1FNBA 1FU4A 3P2JA 4CU2A 2PUEA 2W2XA 4D45A 2HWKA 1PR9A 2D2XA 1FDOA 1F2TB 2NQ2C 5CGQB 4BN0A 1VXOA 3NYWA 4R2JA 1IUKA 1WXXA 3E7XA 3T1TA 1XPUA 6REQA 3K70C 3D2BA 1RR6A 4ZV9A 4F7WA 2BN4A 4JXXA 4Y7DA 1YS2X 4C4YA 4CIDA 1X7YB 5DTIA 4N48A 3EQ2A 3W6UA 3JTMA 4B7AA 1QH8A 3BOSA 1SCBA 2WP8J 2V4UA 3NDRA 3CVWA 2G5TA 2WJHA 3LVRE 4MA0A 2EW2A 2RH9B 1TQDA 3BIWA 1KK2A 3R0XA 1ZD8A 4Z99A 4YFYA 1WKBA 4X1IA 1Y9EA 3BZUA 3SZ3A 1HNXB 2GBGA 2LPMA 1M1NA 1N7JA 4NENA 5KPDA 2DKOA 4JEUA 2PDAA 3PPIA 4Y2HA 4QPDA 5EZSA 2F9FA 4Y0VA 2AN9A 3JARA 4EKYA 1OXTA 1B15A 1QH9A 2DBZA 3M6WA 4BC1A 3NWJA 1DX4A 1Y8QA 2GM9A 3HEMA 3PP8A 5FNVA 1VLJA 4D9BA 1ZEJA 5CFZA 3I8OA 1IEXA 1PZXA 1RLOA 3GAZA 1UBKS 4G86A 1N2HA 1YSCA 3OAAD 1N9ZA 4Q4LA 3BQMB 2PWYA 4L16A 3WWOA 3WLQA 1IPHA 4GBGA 1SD5A 3JY6A 3DYBA 4AICA 3BL8A 1U31A 2BEKA 2BBOA 2YINC 1DJPA 5TVGA 1ZJWA 4AXXA 5ALFA 4KXMA 3HB1A 4BJHB 2OYCA 4IQFA 2GCOB 2VIIA 2WUVA 2DWOA 3N39C 4EAQA 1CY0A 5L40A 2WWIA 1BAPA 3CN7A 5CXXA 3QUCA 1Q0PA 1U8EA 4UAGA 4YGXB 3TH5A 3THYA 1ZP6A 3EA5A 4MWGA 2E18A 4MR8B 4UTOA 4US0R 4LY6A 3FOBA 4XQCA 1L4MA 3MN1A 2ZYVX 3HHEA 3PNSA 1DINA 4C22A 3LFHA 2NACA 1JQJC 1A8PA 1J09A 1TMKA 5HMMA 4DZRA 5ILOA 3PC3A 1P2VA 2ERXA 4PIMA 3VM6A 1K7YA 3IRVA 2VQDA 1QPBA 2ONZA 2QPAA 1ECLA 1D4OA 3OPNA 3EXAA 4HEA6 4KN5A 3ZXIA 2PBRA 1N6RA 3IH5A 1AKQA 2C1ZA 2NPIA 5T3UA 1DOHA 2ZTUA 4IHJA 1Q3KA 4JI6B 3UW1A 3TUJC 4JCOA 3BSYA 4MJXA 5FKJA 2H11A 3DFKA 2VPIA 5I8ZA 4A0RA 4KOEC 1AJEA 1K7CA 1QGAA 3H2IA 1NMSA 4POOA 3HVRA 1FXWA 4XVCA 3VA7A 2ZAMA 2RGGA 4UU7A 1XZFA 2W6ID 3JQAD 4F5YA 1O9GA 3D4BA 5DHSA 3UMCA 2YV4A 4Z6KA 1Z2OX 5DM4A 3VHQA 1Y7PA 2Q46A 2D62A 2BR4A 5ALGA 1KP2A 2GAAA 4N3NA 3HXPA 2PL5A 4NH0A 3I6QA 3VV2A 3ZBTA 4AYXA 1S3SA 2VR1A 4O33A 1F3LA 5IVPA 4JWKA 1Z7YA 2A3NA 4XDGA 3KAJA 3W8EA 4XWGA 4LBWA 4UJ3A 4E09A 1OXUA 1OF1A 3IP5A 1IH8A 4HGOA 1NDUA 5FAKA 2QRVB 3BGSA 5CEFA 1AMOA 5GIPE 1NVGA 2XRMA 1NMYA 2GCEA 2IS6A 1CSEE 4WHMA 3OE4A 1B3BA 2B9VA 5T4FA 3IE1A 4L6CA 5CA1A 4PFKA 3TTTA 1N25A 4XDZA 4Z9FA 1N6PA 5FB3A 1I6LA 4RVNA 3QHQA 1RLTA 1VFPA 2AN1A 3P94A 4KKXB 3RUCA 3SQDA 2O8FA 5TPWA 3FVVA 3LM8A 3T4PA 3UGQA 1RPZA 1H6BA 2ODAA 4JT2A 4RTRA 2CB0A 3IFSA 3V8PA 3IUYA 4REOA 3C3KA 3G2HA 4PQYA 4C0SA 2Q5CA 4O1IA 3OMLA 4Y98A 5CT9A 3T38A 4RO0A 5JAHA 4UVHA 1O7JA 4IEFB 4D98A 5GINE 1SC3A 4K6KA 5CGZA 1T2CA 2PEYA 1BIFA 2QUZA 4EHDA 1OASA 4YACA 3V3TA 2DTEA 2JI4A 2JJ1D 3AYZB 4NRDA 5BQPA 4AMUA 2VQFB 3FFWA 3ZWVA 5KINB 2GMWA 1AKTA 3DHEA 4AURA 4BNTA 5A4JA 4IWNA 2PIAA 1EX7A 4ZREA 3R7FA 4EJSC 2MMCA 5CEEA 2NADA 1WUTA 4UBLA 1V41E 3WIUA 1ZHHA 4O29A 4HV4A 2HAEA 2GFIA 4C4ZA 4RD1A 1JJAA 1Z13A 3K20A 3CNEA 4F71A 4AG5A 5IUKC 4FEYA 3AUFA 4HMQA 3T5BA 3FYSA 3A4IA 5IT0A 4LXTA 2WG0A 1L6IA 4MYRA 3UAYA 3DE6X 3RQSA 1COZA 3DBOB 4ALIA 1BHQ1 3MD9A 4WT7A 1USVA 1W2WB 4XJXA 4KMSA 2NUTA 2OCBA 2J6IA 3GPIA 3W5UA 3PQ5A 4ZT3A 1IM8A 5CCDA 2VJMB 3SBDA 1IEVA 3T0GA 1SIUA 3V55A 3EWSA 4L75A 4DCOA 2QVGA 1IUNA 1SZDA 2NSHA 2QV7A 1J8DA 2J9ZB 4BLTA 4D82A 1JFFB 1H66A 1V8PA 3O4HA 3WLFA 3RRYA 1YUNA 4F86A 2WFAA 1O6GA 2WB4A 2Z6VA 5EXPA 4J76A 2VEOA 2ZIVB 2R7LA 1OWMA 1L4EA 2FPMA 4OKSA 3RARA 5A3VA 1K0FA 3DMYA 4ZT2A 1U94A 2NLOA 3AG6A 2IF2A 3E4DA 3O1IC 9MHTA 3B1XA 4OJYA 1N7HA 2CNNA 3ZWDA 1Y1LA 2CWWA 4G8BA 4JL5A 4YMHA 4ZRDA 1ZR2A 1LTHR 1QPGA 1IN5A 2YUTA 4IFIA 5FFMA 2AG6A 2ZT7A 4C08A 1A95A 5T5QA 1IWPB 3T3DA 1FXSA 1KVTA 2XDAA 3Q3IA 4OI1A 3A1DA 3G1TA 4KL8S 4PV7A 1IXYA 1XVTA 2A58A 1R4MB 3NYQA 4JJ7A 4KP7A 5T67A 5FOQA 2Y76A 2VRCA 2A78A 4CXMA 5CXQA 1IJBA 3D8UA 1JDPA 1P77A 4LHYA 5LMZA 5JV5A 2LTAA 2EJCA 4L4SA 4TMTA 4FLEA 5IZCC 4QM6A 4BNKA 2XJ9A 3HP4A 3GH1A 1BZYA 2PR2A 3B53X 4OHXA 4CKWA 4RH3A 5E2IA 1LCIA 2N75A 3ENWA 2F00A 4QXRA 4L3OA 4JC4A 5ALXA 5GY7A 4LGMA 2QLFA 2EBWA 4F2GA 2CKMA 2FX5A 4QEDA 5BNFA 5F7OA 2G83A 1FVFA 2H5EA 5K05A 4I5DA 4QM7A 2EEPA 1NONA 4UZFA 4EIWA 1V4BA 2WIBA 4M6WB 4CM3A 2ZI6A 4LNAA 3EPPA 3UMSA 4CMHA 2PPVA 3OE7A 1X74A 3DVRX 2QP3A 5HRCA 2C7RA 2H4ZA 3VMFA 1XZGA 3KJFA 3T3PB 2NUAB 3GJ6A 3SU8A 3H0CA 4OFBA 2JNWA 3F6PA 4M9RA 2VC2B 3RD5A 1BJRE 3KB1A 4O4LB 4WEQA 1GFWA 2ODQA 2FSVA 2Q1TA 1JN0A 2COEA 2YQ5A 1QKJA 4V0RA 3TBFA 4BIIA 3D7SA 3EIWA 1AQUA 1XX6A 2HSWA 2BAGA 5A02A 1Z47A 3S2EA 3QV1A 4AKHA 1XWIA 1K88A 1E3SA 2H1CA 3UYLA 2CB9A 6REQB 5TQVA 1HFEL 4P4UA 1Z45A 2OBNA 3EXFB 1RC1A 1KMNA 3LOPA 3IA2A 4KV7A 1Z08A 4LYFA 2OV1A 3K94A 4Y9UA 5K0CA 1P4GA 2DU8A 1AQ6A 4MI1A 4N3BA 1QH8B 4D6XA 4EJSA 4RVGA 1MA3A 4WKGA 2O7VA 1JHUA 2CL0X 1JZQA 3L7DA 4RF4A 4EM6A 5FPKA 4X1IB 2YJ5A 1THGA 2BGIA 2CVOA 3AEXA 2YVQA 2UAGA 4LXGA 5KTRA 3U60B 1M1NB 3WL8A 4J7UA 2H5IA 1EX6A 2VUSA 4HPJB 5DHTA 2MSNA 4PG6A 3JARB 2QL5A 2X5JO 1GNLA 2XHEA 1QYRA 5HMLA 1WF6A 5ETJA 1Y8QB 5FNVB 1XZJA 2H2HA 1O97C 4IKPA 1U7OA 1PDVA 2Z5FA 2I2BA 2I66A 3LF1A 5AIBA 3FMIA 2OXIA 3T3HA 1KAMA 4UBIA 4PO3X 1QH0A 3EVAA 3W6PA 2PA3A 1RYDA 3FMFA 5KYWB 1VKHA 1T4DA 2ZFUA 5A9SA 1NHWA 1NRJB 3FSGA 3ESCA 4TYNA 4B46A 2UV8A 1PGNA 3NEYA 3LC1O 3ILHA 2E89A 2HIAA 3GH3A 5G02A 1ZJYA 1C8BA 3ORQA 4DM7A 2X9VA 5JAZA 4NULA 2IU6A 5I8WA 2XGGA 1L8OA 3BGDA 1CUEA 1DCFA 1LDMA 3D3JA 4GPD1 1A7UA 1E2MA 2NW6A 1A2QA 1XCMA 2C2YA 3I62A 3OQ6A 1M74A 5FTKA 3UAGA 1E3MA 5IEJA 4YYEA 2WUDA 1VE3A 2C9MA 3CRNA 3PXXA 4YJ3B 3R2JA 3C6YA 5J23A 3PIRA 4IY1A 1XTJA 1Z38A 4PX3A 5HRAA 1KAGA 3KHUA 5E6RA 2YN4A 5FD8A 5TF4A 4BFZA 3SC2B 1PZMA 5AJTA 5IZCA 1PG0A 1Y9DA 3MGAA 2FSGA 4IHJB 1TF7A 1XRNA 2VUTA 1I2ZA 1ZNYA 1GTJ1 3ETDA 2IGBA 3EASA 3F4KA 5LR6A 4AJ2A 2GPAA 3EIEA 2KBFA 2Z58A 4ZALA 5K0NA 3DCYA 2R8XA 4EBBA 3MPOA 2NAFA 2XW6A 4IJWA 1EFPB 4LJ4A 2ZUUA 5LLSA 1YJBA 1U5BA 1FMJA 4TPKA 2C54A 1CFJA 4QGSA 1KDVA 2V1XA 3F73A 3UMRA 4L5YA 3COJA 2GF0A 4KFSA 1VG1A 2IXBA 4JI3B 3TKYA 1RI5A 4RF5A 3MJTA 5IK2D 3UH1A 2Y6UA 2VAWA 3R5KA 4FHEA 4G4SP 4HX2A 2FY8A 4ZVTA 4MGHA 3ZWYA 2A67A 5AW2A 2Z6UA 3O8NA 4GT1A 4KREA 3O1HB 2FSIA 1DP4A 1F2UB 4JB8A 3ZKAA 1QG6A 2C31A 1UQRA 4Y2SA 1CUSA 4Y6RA 5CA1B 3K2BA 3ZDCA 3FNEA 3R20A 4E5VA 2P8SA 3DH0A 2R5FA 4WXYB 4GH5A 2F8LA 4HB2A 4EQZA 1I3NA 2O8FB 3EGDB 4GLLA 2JLCA 2ZBDA 1R5OA 5HK8A 2ZYRA 3KSBC 4E46A 3AETB 2JBAB 4D92A 3CVUA 3AP3A 1G20A 3GJYA 5LPNA 2F1OA 3KQHA 1WAMA 2DUWA 4PLPA 4IJ6A 1UC4B 1C7EA 3N9IA 3PUIA 4TT8A 1QGYA 5IBCA 1KHTA 5DSTA 1B16A 1ULHA 2QMOA 2O0KA 4ZO4A 2PTHA 4HWPA 4Q12A 3AUJB 4RXUA 2OTCA 3A6KA 3JV7A 4R1SA 1LRLA 2N1MA 2QMZA 3ANYB 4KDRA 2V0CA 5BV2P 3EGEA 3K1YA 3WO1A 5BN5A 5DHPA 3ETJA 2Y66A 3PK0A 5CXSA 4NI5A 5P21A 3HCEA 4I0WB 3WMWA 4M0FA 5C81A 1PJBA 1PD0A 1WF3A 3I3SR 5HF8A 3D6JA 4D0GA 2A9KA 5B3AA 1H05A 3GY0A 1IHXA 1NPTO 1WMDA 3K4PA 1U8CB 3ENZA 5CW1A 3ABZA 3T4EA 3UXYA 2P40A 1MNQA 4RLHA 3H9BA 4QLAA 4BFWA 4BX3A 4DGQA 4LXHA 5KQGA 3SE0A 3HNPA 5L4NA 3FUUA 3JATA 3HPRA 5ALSA 1P91A 1CJMA 1OYOA 1UXKA 1OYVA 3T3MB 3DTNA 4KRYA 1YR1A 5JTUA 4Q48A 1YI0A 1RZ3A 4E7PA 3C1OA 1SVLA 4H7KA 4I9UA 3JAMA 1K5GA 1MQ9A 3UENA 2Q3BA 3A1UA 4TWBA 1E6EA 1X42A 2B5VA 1E62A 2GZ3A 3BB3A 4JZYA 3RYFA 2FGKA 4F7DA 1XD2A 5ALLA 2WUFA 2WU0A 4Q47A 2XBMA 3OTGA 3KFVA 2HDWA 3ZV4A 3AB8A 4BJ1A 821PA 2ZTSA 2CLIB 1J1ZA 2J48A 2QRLA 3OA0A 4B71A 2VDOB 3EZLA 2PRKA 4UOQA 1EESA 2IYFA 4LGYA 1NWCA 1CUDA 4AWBA 2Q9AA 3I5MA 5C32A 1JEOA 3AV0B 3S1LA 3VO8A 2P5UA 3KUKA 2HGSA 2XZOA 3OX4A 3GRZA 3WNZA 1BSVA 1GQ2A 1TECE 4B45A 4DSAA 1TMGE 2VUUA 2BJVA 4GPZA 1E6MA 3ZHTA 1QYVA 1V9LA 2CJYA 4CDGA 2UU9B 5DI9A 4PTZA 2ATVA 1INLA 2FQQA 5AI4A 3DWEX 1O08A 2XDQB 2WD9A 1G8FA 1NAIA 1PWXA 1D5CA 2HQ1A 2W6JA 1BCRA 1H9CA 5MGBA 3B6MA 1R0ZA 1W0JD 2RG7A 5KYTA 4IDHA 4Y67A 4HBGA 3TRJA 3LBFA 2IZZA 1EUCB 1R0BA 1Y4UA 3FNHA 2YQZA 3W9UA 4AZVA 5KTYA 4GL2A 1VE9A 3FYUC 3JWIA 1WZ2A 3QQPA 1O9HA 1XLUA 3WDSA 2Q6VA 2XB9A 2Y8EA 3O84A 3UMGA 1EK2A 2AOVA 3INGA 4XB1A 5C0OE 3ER6A 4HGRA 1H85A 4BC0A 3CLSD 1XVAA 4LWOA 2VP0A 3WGVA 4P9NA 3ZDYB 1MABA 1LKZA 1VGRA 1XRSB 2ZBRA 4R8VA 2ENUA 3ZIAA 2ZUTA 1RI1A 4HEQA 4PGAA 2ADFA 1O6FA 1KNXA 3GC6A 4HWOA 3K15A 4QTZA 5C5CA 4YROA 1VTKA 2WNSA 1K92A 1U9YA 3THOA 1XPOA 3QBJA 4NC9A 1XQ6A 5IJ0B 4XOIA 4AJ1A 4TT3D 2ZYGA 1F8GA 4K9QA 2W48A 4X3CA 4XTCS 3R4CA 4P8RA 3S5JA 2CFTA 2HBZA 1ZSVA 1V47A 1HLPA 2Q6IA 5ULLA 5C7IO 4KVFA 4I9FA 2E7ZA 2DCMA 3WKDA 2LP4Y 1SUBA 5F2EA 1RAGA 3F71A 4QNMA 1LTQA 2VQ6A 3I9MA 4RKFA 5F77A 4B17A 4BO5A 5KVAA 3ZZMA 5FLEX 3ICQB 4AMGA 1FIUA 2FDRA 5A1TA 2ZDQA 3ZW7A 2WAYA 2C7PA 3C5VA 1E7MA 4OQXA 3CB2A 2Z5GA 1NR5A 2FZGA 2RAFA 4JYPA 1SN7A 4GHWA 4EJSB 4GWKA 3D0RA 1NE2A 2C5SA 1GDTA 3R40A 3RSCA 1FFWA 2OORC 3T1YB 2XECA 3HKEA 1BS1A 1PI3A 1XLTC 3OTWA 3SBXA 3FCOA 2DFTA 4ZZ1A 2FWRA 3FPCA 3NWOA 4E5SA 1HEUA 1HOTA 1V5IA 1ZD9A 2R8ZA 2X5XA 1U1EA 3RRJA 3OY2A 1UQUA 3QGMA 4GOXA 4BJ6A 3U61B 1P29A 2QLJA 4L95C 1HF3A 4FDUA 1EFUA 4DMGA 2EKZA 3QKWA 4RZQA 2WAOA 5JCJD 3CXRA 3T7SA 1RCTE 2ZRDA 3VOAA 4I08A 1GQFA 1FUEA 1T29A 4YAWA 2NX2A 1I1QB 1GU7A 1M76A 2HA4A 5B3KA 1Z5GA 2IYTA 3ACBA 4PC6A 4RY2A 1JV2B 3KQOA 3ZWWA 2X5NA 1QK5A 4K9SA 4KE8A 4N5DA 1T35A 2FW0A 3WRXC 4M60A 1KQGA 3CPEA 1O2DA 1W29A 2VWPA 2OA0A 5A6VA 1PWYE 5ALEA 3KQQA 1G291 3EG5A 3H75A 1WOMA 4EQ6A 1LZLA 3GNLA 3H2YA 5ALPA 3RREA 4R7TA 4WTOA 4YDRA 4M1SA 3SHOA 3NB0A 2N0SA 4TN5A 1IG3A 5J4VA 1PWEA 1AUQA 4IM7A 4MDEA 1TA4A 1N6OA 1IYZA 2QRGA 3PRHA 1SQFA 3Q7RA 5ENZA 1XU4A 1WMFA 2ZXFA 4KWEA 1R16A 4DABA 2NIPA 3M4NA 4EI8A 2A7QA 3C3XA 1U1IA 3HWWA 2H2IA 4LYYA 1SR8A 1QS0B 2W83A 3SJUA 4BDTA 5JD4A 1CD5A 1T6YA 4I1VA 4Q4DA 1IZ9A 1KEPA 4B34A 4CV0A 4W1PA 3OZSA 1IN4A 2AFHA 4NTZA 3FYUA 4Q9HA 5B2ZA 3SHVA 3LCJA 2A9OA 5CH3A 5DM70 4DJEC 1DJQA 1AA9A 3GT0A 1LSJA 4HK4A 4V38A 4Q6WA 1ZUHA 1T1SA 3PE4A 5TV2A 5FH9A 4QTUB 4FT4A 2YOHA 3KZVA 5BR4A 1K66A 1WV1A 1A69A 1D2HA 3KBBA 4JP5A 3RTGA 1CRPA 4C7VA 2YJGA 5JPIA 4EX6A 1P0CA 1J06A 2G25A 3V7YA 1JYSA 1NTOA 2XIJA 1H2AS 1BFKA 4KH1A 5GONB 5JNUA 1XOIA 2BFAA 1YK1A 2P62A 3WHLA 4BVFA 2PAAA 5AW3A 5K0TA 4AUNA 3BMCA 1C3OA 5K6RA 4LWQA 4RDIA 3H6GA 3LD9A 1I32A 1Q0RA 4C3UA 4IHKA 3C6MA 1ZBQA 2JCVA 1QV9A 1HYQA 1OW3B 1DDOA 1XYGA 3ZQ4A 1NASA 3A36A 4LXQA 2W70A 3UK0A 1US8A 4F38A 4YCMA 3JSXA 4OMFG 2QVXX 5DEOA 1GGHA 2BF4A 2QA5A 1VE5A 5HFAA 2I03A 4N0DA 2HRZA 2R1VB 2BM9A 3TAUA 2XCRB 3VJRA 4R4JA 4C2AA 2BI7A 1DPFA 5KI6A 2ZIWB 5FOSA 2QRHA 3MYYA 5HZHA 5IJAA 4Q82A 3D8TA 2JIRA 4RF3A 4UW9A 3I5XA 3UGJA 2OORA 3H13A 2ZAOA 4MW5A 2OFOA 2X1LA 1XLTA 3BD6A 3IPLA 3KEGA 3OQVA 4IIYA 1X7WA 4P80A 1ZXBA 5K1ZA 3UAOA 4PZUA 3GDWA 3NTXA 2C96A 3FR7A 3ZGZA 1QR6A 2WW8A 3U4AA 3OCZA 4RA6B 2JBWA 3DOEA 1PQYA 1IC6A 3G2KA 4I19A 3VKWA 2GGSA 4BE9A 3REQA 3KQLA 2OZEA 1QC5B 2DT5A 3OJLA 4WLVA 1QFSA 2H06A 4JWTA 2UYHA 5FBZA 4HRYA 1M1YE 3UMVA 4BVLA 1U02A 3A1CA 3GWZA 3FH0A 4RMHA 3RVBA 3HR7A 1PCXA 1Q1GA 1XEXA 1KI4A 3ON5A 1GYQA 3LYUA 3DV0B 3JATB 1O57A 4BZPA 1QOPB 2C4MA 2JZCA 4M9UA 4OHBA 3LGSA 3R77A 2WSIA 2FP4A 1CJTC 3I64A 1RJDA 3Q5GA 4EY6A 2MJLA 2RONA 3HU1A 3IT1A 4FBMA 3B5IA 3R75A 3TL2A 1WP4A 2DY0A 1NXWA 4C2UA 4FGUA 3RYFB 1U3GA 3EZGA 4CM6A 1FW8A 3GLGA 2V45A 2GO7A 1SHKA 3CJRA 2FWNA 3N05A 1ZVMA 2C3OA 1ISIA 2M1XA 3ONWA 2P1DA 3OQ1A 4NCIA 2NP7A 3VKVA 2IP2A 3PC6A 2VHCA 3G9XA 3QXSA 1VYHA 1DELA 5FULA 1EFHA 1DCMA 1YDEA 2QIOA 1FRVA 3QFFA 3L1IA 2R00A 4GOJA 3A3NA 4B2IA 3F5MA 4OK5A 1W5BA 1K3TA 5TGDA 2PUDA 1O8CA 4BUZA 3VKFA 3DV9A 4E0BA 4KO1S 3BJEA 2FSFA 2DETA 1LFAA 2Y0DA 1CUYA 1XXHE 4Y3UA 1LNQA 4KGXA 4KVAA 1SHZA 4YJHB 2XMRA 5L53A 4WERA 1CR2A 3QNUA 4XZ3A 1P9WA 3R5SA 1BCRB 4G09A 4GZLA 1AS0A 3AC0A 2Q99A 3QMMA 2ATIA 2PZJA 1O96A 5DMHA 3GN1A 4B8YA 2C8VA 2PJDA 1MF7A 3L7OA 1I3MA 2HF2A 1JPNA 2X6QA 3JYNA 1GZ7A 4G5QA 3HG7A 4IV5A 4J0KA 4RELA 3RTBA 4DRYA 4F4IA 1BGWA 3QVGB 3VOBA 4GSLA 4EHNA 4IV8A 1JECA 2JI6A 4GMDA 5EKTA 1E3LA 1DX6A 1N8KA 4QJ3A 4FYIA 4YYZA 3GNSA 2JANA 3L0BA 4GPEA 4GKKB 4TL8A 3OP4A 4MQUA 4WFKA 4KXUA 4C0KA 4QECA 4OTZA 4CM5A 2Y77A 4E5KA 5JHGB 1EWQA 4N9WA 3Q6IA 4DY4A 3DZIA 3QLEA 2Q2VA 4D3XA 2WJPA 1D2NA 1G98A 2A1TR 3LY7A 1HNZB 1Y7LA 4HAIA 2Q7XA 1W76A 2NO0A 1AT1A 1JHOA 4NK4A 3OZCA 4B9AA 1HA3A 4A10A 3D2CA 2BDUA 2CXSA 2ZCVA 1K6MA 4H7EA 4XI9A 4IVNA 5B3LA 1E1QD 3H9JA 2C5EA 3GLFA 4YMVA 2QSJA 2YOFA 4DCVA 4RDXA 1K8XB 3E9DA 3OLYA 4KXYA 3WP0A 2FMUA 4K9NA 1GNQA 2W2LD 3JR3A 1JQKA 2PSSA 2J3HA 4YDSA 1DAIA 421PA 3ET5A 3V5NA 4OMDA 4JVMA 2TRSB 3QA3E 4H31A 4J0DA 3NP7A 4GW3A 3RFUA 2IYSA 2VCHA 2YWJA 2A0FA 2XNDA 2QS9A 4UFPA 1E5TA 5JXJA 1G9XA 1GTSA 1E0AA 2GZRA 2PEZA 4IXNA 3WE7A 3KKMA 1JDSA 2RI1A 3GCWA 3IIMA 4QATA 4EG5A 1JX6A 3MAAC 1B42A 3URMA 5HIKA 1BX1A 2Q5HA 2PKEA 9LDBA 5KOIA 1FFCA 3A1EA 3BAZA 2OP0A 1OFTA 2PD6A 4S05A 2WM2A 2PS1A 3LXUX 4XIGS 3QEMA 4ALKA 2Q3DA 1R6VA 4UNPA 5AHRA 3P9CA 1W5SA 4CIXA 4C7XA 4MAFA 2P9FA 3E18A 4ZQBA 5IDQA 4E08A 3OEWA 3H2JA 3ESRA 2FMHA 1PQWA 4PZDA 3SOZA 3T1VA 1VLMA 4XFDA 3UWKA 3VR0A 5INTA 4PBSA 4PC3A 3VYSB 2GN9A 1KI8A 1N2CE 3FLEA 2Z8XA 5H4GA 5IXJA 2VK2A 4AS3A 2CHVA 5KOJB 3TL3A 1QZ3A 2J30A 1V6AA 1JQDA 2WWGA 1YZYA 2Z5LA 4XUEA 2HJRA 3EGCA 2JPDA 1DC4A 3GDGA 2IHTA 4DLAA 2NV6A 3QOXA 4YRMA 2I3DA 3INTA 3S55A 4DSOA 3U6BA 3VSBA 4DVGA 2D3TA 1AMUA 1G64A 4EQ6B 1KYVA 2ZJ3A 3U7IA 4EWLA 1IM2A 1T4CA 4W5QA 3DNFA 3ZC3A 4R5MA 4B80A 4M7RA 2HGZA 1E1YA 5CHEA 2KE5A 2M6KA 2RHTA 4E5MA 3D3KA 3VBEA 1DJLA 2V7BA 3TZBA 4C14A 4V2UA 2EWWA 2IYAA 5MFPA 1N4AA 1D4AA 1NF8A 1UJ5A 2ZQYA 2WAAA 1KIFA 3R41A 5EI5A 1E1RA 4AJ4A 4LVOA 4A36A 3IAM6 4JXZA 1KSJA 1V96A 4G0OA 3QY9A 2IA5A 3FYUB 3ZJYA 5AHKA 1N6NA 4QO8A 4Z0HO 2AHOA 3RC1A 1WY7A 1YZKA 3OF5A 2GZSA