5JDCC

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
237
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLPEEKDKWRRKVPLGRRSAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 90
structure length 237
sequence length 267
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcC00
2NU7A 3UICA 5CHEA 5G0SA 1DDOA 4BNHA 4FJ0A 1UP6A 3PHHA 3KYBA 4WNIA 4D7AA 3PJGA 3HSKA 1U5CA 3H3JA 4GMGA 2ET6A 3I4FA 4EUHA 3HDYA 1I2ZA 4CMEA 1ONOA 4PLVA 1Y8QA 4E33A 5CDUA 3RUEA 1I0ZA 3ONDA 5TT0A 3LT0A 4NMHA 2ZATA 4HFRA 1C0IA 5BNFA 5JNLA 3KYDB 1DRWA 3ZWBA 4RPLA 2VNSA 4IJKA 4K6FA 1LDNA 3MTGA 1RPNA 1ZFNA 3GGOA 4HFJA 3OETA 2X1HA 1BXGB 4CMIB 1CQJA 2UDPA 1QP8A 1P1JA 5L7YA 3AU9A 3D3WA 3K9QO 3L4SO 1RM3A 2BRUA 4EI2A 1AN9A 3DAPA 4U0KA 4R1SA 3RFXA 1KEPA 4TVOA 2I3AA 3RUFA 1XELA 3AM5A 4DPLA 4CL3A 4PIVA 4YJFB 3QVWA 2TMGA 3AUSA 3ENKA 1YQDA 4CM1A 5C37A 4P38A 4TKMA 4ZRNA 4R9SA 2O50A 5DULA 2EJVA 3FNHA 3F3SA 2W2KA 1S7CA 1ZMTA 4J3FA 2I9PA 3G1UA 4DRYA 1PJCA 2BLLA 2I6TA 2WD7B 3INTA 3NAQA 1WP4A 3JYNA 4IZHA 5FI3A 4BGIA 3JD1A 1Y6JA 2WYWA 1M75A 3PYXA 2VHZA 3CMMA 1D1TA 1EBFA 3P5SA 3DBLA 3CPSA 4UEJA 2QYSA 3PIIA 3AI1A 1Y9AA 1WDMA 2XPCA 2O7SA 3CKYA 5T6BA 1IPEA 3W4JA 4DREA 5A5FA 1DXYA 1X1TA 3I6IA 3N74A 4KQWA 3OIDA 2NVUA 4ZICA 1SZJG 3W4KA 2FSVA 4D3DA 4Q3CA 1EUZA 3W6UA 4IY1A 2IEBA 1X14A 1BMDA 2Z5LA 1MUUA 4MO2A 4NFYA 1O94A 4YT4A 1PQPA 2Q2QA 3TQHA 4KWIA 2CFCA 2O3QA 4R68A 1R4MB 3FN4A 1GU7A 1YONA 2GZ3A 4E12A 4OQYA 4CLHA 5BNTA 4YVFA 2NM0A 4G2NA 4GVXA 2QX7A 2ZIZA 4FFMA 1PS8A 1Z7BA 4IPTA 1BW9B 1EQ2A 2Q45A 3MJVA 4RVSA 3GFBA 4XGNA 4UUMA 4IXWA 3E9QA 3JQBA 1J6UA 2VUTA 3Q1LA 1LDGA 4GPD1 4IDEA 3RVDA 5IZCA 5CPFA 2OP1A 4PG6A 4CM8B 3ZHYA 1CEQA 3OQ1A 5CAEA 1BXZA 3QJ5A 3RC7A 4DLLA 1E7YA 1ULUA 4S1VA 2GZ1A 3K31A 3OQ6A 3R0IA 3TZHA 1VJTA 2V6FA 2NU6A 2VWPA 5H82A 4YR9A 2X23A 3OH8A 5A3VA 5CDYA 4II2A 2V6GA 3DFUA 4A73A 3FTPA 3O9ZA 3NT4A 3FPLA 3ITKA 3KB6A 3PEFA 2UUOA 5HWSA 3PVZA 4RF5A 4DQXA 1LDYA 2X86A 3NEPX 1SO8A 4PLWA 1VI2A 5L40A 1XU7A 2D2IA 3UW3A 1HYEA 1TB4A 1E7QA 2OP0A 3JCZA 5A9TA 4YTEA 3K2BA 5T64A 2Y1FA 5JAMA 1YRLA 1JA9A 1GV1A 2PNFA 3W1VA 4ALLA 3COSA 3GVIA 3Q9NA 5CFZA 3G49A 1B2LA 4CLEA 2FR1A 2OZPA 2FY8A 4XR9A 4PZDA 5B1YA 4F45A 3QVOA 4AJNA 5B4TA 1DIHA 5ENDA 2HLPA 4D3FA 3WJ7A 3FTNA 4ZU3A 3WLFA 2AQKA 4KQXA 1X7HA 2YUTA 1RJWA 4LCEA 4MP3A 1UDAA 1Y5MA 3O8QA 4RVHA 4ZQFA 1Z75A 3DFZA 3I9NA 4FW8A 3D4NA 1H5QA 5TJHA 3AJRA 3DDNA 3ROQA 1MLDA 2VQ3A 1BSVA 1ARZA 5B4UA 1K5HA 3PJEA 2VZ8A 3L4BC 4B4UA 3NGLA 1YJ8A 5EINA 2AE2A 2XF8A 3H3FA 1P3DA 3U4IA 3VPFA 5F1KA 4KTVE 4PLZA 5IG2A 3OEWA 4TRJA 1LX6A 4RLSA 2Q1UA 2C07A 4BL5A 5CDSA 3BHMA 2Y05A 4KUGA 8ADHA 1QMGA 2FPPA 5TRTA 3SXPA 4PLHA 5U4QA 4NQZA 5G2OA 2VHXA 1MC5A 1ENOA 4RZHA 3KLMX 2ZKLA 1XIVA 1D3AA 1GQ2A 4JXKA 3WB9A 5ICMA 4RJTA 3VH4A 5JYDA 4D43A 3JV7A 1T1SA 1O95A 2EGGA 4MVJF 1DC4A 1T4BA 3WGZA 1GD1O 4NNJA 1E6EA 2RCYA 2ZTMA 2GZ2A 4PZCA 4U6QA 3RUDA 3ETGA 3FRJA 1H6AA 4XR4A 4LGVA 1CIVA 1PGJA 3KBOA 4L75A 3OSUA 5IDWA 2JD2A 4TWRA 2YQ5A 4AVYA 3BMQA 3LC7O 3H9JA 3TRIA 2Y1OA 4EUFA 5A1TA 1D4FA 2V6BA 3CMCO 1N9GA 3ZU4A 4BNGA 4FOSA 2HU2A 3KETA 1U28A 2VOEA 1P44A 3KO8A 5CEFA 5EN4A 3W4IA 4B3IA 2WWRA 3TF5A 4J91A 5CEEA 1DJQA 3D7LA 4XQGA 4FQ8A 4Z6KA 4DMLA 3TNLA 3QWIA 1SC6A 2V65A 4I8XA 5I9MA 2H9IA 3WQSB 5BSEA 3L9XA 2IYOA 1PJQA 5G4KB 3OP4A 2V7PA 4IDCA 2PTGA 3MJEA 4NK5A 4F6LA 2R00C 3WS7A 3IS3A 4E30A 1XKQA 3WFJA 1E1LA 3RQSA 2YDXA 4WCDA 1YGYA 1MGOA 1ZSNA 1Y8RA 2Q1SA 4CR7A 3DXFA 4E31A 3QHAA 4IQ0A 3GK3A 4YACA 2QIOA 3OJLA 5KKAA 2Y0EA 5JPIA 5T8KA 1UP7A 5HS6A 1VSVA 4QUKA 3FNFA 3G1TA 2W2LA 5T57A 4GH5A 3NKLA 1N92A 3DR3A 4NBRA 3ZZNA 1I5RA 2UVDA 1EBUA 4Z9FA 4RQTA 4TMFA 2A9FA 3RI3A 4CL8A 1FDTA 4IMRA 1U9JA 3AM3A 1PQUA 3RSHA 4EJMA 4CMJA 1E3JA 3ZH2A 1L1FA 1GZ3A 4W82A 5A9RA 2VRBA 1NPDA 1YOVB 5L7TA 1FF9A 1WXDA 4NK4A 3GC6A 1ZUD1 5KCZA 3EZYA 4ND2A 1Q0QA 5L51A 4I5DA 1NHGA 1E5LA 2F00A 2PZMA 4M49A 3IDSA 1L7DA 4DXHA 3D1LA 4EBFA 1AHIA 5AOVA 2B5VA 1QORA 3KZVA 5GZ1A 3HUDA 3DTYA 4E2XA 1C1DB 4W7IA 3QP9A 3VPHA 3WDSA 2DFDA 2C54A 1LLCA 4CV3A 2Z1MA 4LW8A 2GO1A 3JYPA 4FS3A 2ZK7A 1HYGA 3FF4A 4ZVVA 1PWXA 3U4HA 1HEUA 3H65A 1N8KA 3GT0A 4CLXA 1N5DA 3CUKA 3VTFA 4BS9A 1Q7GA 4CLOB 1OBFO 2ILTA 2NLOA 5EMHA 2HK9A 1K6IA 1VKOA 1ISJA 3W8DA 2X4GA 3JQCA 2E48A 1SB9A 1NPYA 3E5RA 3CTMA 5KIAA 3FR8A 1J49A 1Q7BA 1R66A 4FSHA 3SX2A 1X7GA 1XSEA 4OOEA 4BO4A 4I08A 3ZU5A 4MVJI 3ROMA 1PTJA 1SOVA 2O3SA 3F4BA 4BNFA 1LLUA 1FDWA 2DKNA 4YBZA 4XWYA 4MIYA 2YFHA 1PU2A 4YCAA 4B7XA 4FGSA 4BKOA 1DFIA 2HK7A 4BO1A 4WASA 4A2CA 4DQVA 3JQEA 3NX4A 2X9NA 2IXBA 4WEQA 5JYEA 5JO9A 1HT0A 1Y1PA 4I1IA 2GRAA 1ADCA 3RCBA 5COBA 3KEOA 1GR0A 1ZXLA 1ZXBA 3IJRA 4NBWA 4NHEA 1E1KA 1B15A 2FPGA 3I9MA 4D0SA 1T1RA 3N7UA 3PWZA 2FWMX 4FFOA 4BNYA 5TX7A 1GDHA 4AJHA 5ADHA 2EJWA 5COQA 3WYEA 4PLGA 3WXBA 1E6WA 1NVTA 4HUJA 1BW9A 3R6DA 4QECA 1YWGO 3RIHA 2H1SA 4KMSA 1I3KA 1LQUA 1VSUA 3DHYA 4OOFA 1UXKA 1UXJA 4HP8A 5JCXA 2HRZA 2BGKA 1V3TA 2X0IA 2QQ5A 4YDRA 4ZQBA 1A9YA 3DOOA 1EEHA 4AJJA 4PLPA 2EEZA 1EK5A 3Q2KA 4FCCA 4INAA 2CF6A 2IDZA 4CR8A 1A5ZA 4CUKA 4B79A 4NR0A 4WKGA 3K2EA 3GGGA 1UR5A 3ZV4A 4GX2A 2I3GA 4JBHA 2NWQA 2VYNA 2HRBA 2ZJ0A 4NH4A 4L8VA 3DZKA 3WOHA 4OXYA 1I32A 2YZ7A 5L4LA 1TI7A 2JFFA 1RYEA 2J3IA 9LDTA 4BNXA 1GCUA 4XYEA 2EKQA 4XQEA 1R12A 2V6MA 4TKLA 4YJHB 2PY6A 3AM4A 3JQAD 3PTZA 4XGIA 3ROKA 4R41A 1WDLA 1ENZA 1XWFA 4XZ3A 4O59O 4RV9A 4CV1A 4E5KA 1DHRA 3KTDA 4XIYA 3CEAA 1E1NA 2B0JA 4TRMA 1X0VA 3LDHA 3WLEA 1I2BA 2CVZA 2R00A 4I9UA 1R37A 3EW7A 3GOHA 1NX6A 4RORA 5ENVA 2RBEA 5G0WA 2B36A 3OJEA 4Q3AA 1VC2A 2D4AA 1QKIA 1ONPA 3WGHA 4Y6SA 3DBRB 1PGNA 3GLQA 2DFVA 4OXNA 4P22A 5EJ2A 4Q3NA 2IEDA 4GKVA 3FD8A 3IL2A 4XDZA 5MGBA 4ND3A 2QW8A 3GVHA 4D45A 1KEVA 1XCBA 1ZZEA 4IMPA 5JE8A 4MKRA 1X15A 3RBZA 1MXHA 3VH2A 1HETA 1H94A 4XRRA 3WTCA 1UZMA 3ZNNA 3AOEA 1ZMOA 5TLSA 2NTVA 2VCYA 4L9RA 5I8ZA 3F5SA 5KVVA 2C2XA 1WZEA 3D4PA 4CQLA 2VHYA 3K96A 4UUNA 4MINA 1DO8A 1KY5A 1OFGA 2B4RO 4A03A 1KEWA 1KVTA 4JGBA 2NU9A 3ZWCA 4NU5A 3AUTA 3MZ0A 5TS3A 1W6UA 4DVJA 3F5QA 1O5IA 3L07A 1ZCJA 3ZV3A 1C0KA 1B7GO 1P0FA 2UAGA 1T2CA 3DEYX 1UXIA 3TL2A 1WNTA 3H4VA 3OHSX 4HWKA 1RM5A 4MIOA 3NTQA 1AXEA 2VUUA 1HDGO 1W73A 4CQLB 4AJIA 3TFOA 4GSLA 2VWGA 3LF1A 3S2GA 3PYLA 3QY9A 4XYMA 2Y1EA 3GZNB 3DBHB 1LRKA 3TL3A 3I4CA 3F1KA 4RVFA 4BNNA 2CUKA 1HF3A 3PJDA 3BAZA 3OM9A 3ZWXA 2PKQP 1YVEI 3KSUA 4W7HA 5LDGA 1OC2A 4GGPA 3S2EA 1FDVA 1NM5A 1DIAA 1ZK3A 4LN1A 2G76A 4MIEA 1MG5A 1VJ0A 3AWDA 3GZNA 3ZW8A 3H9EO 4MJLA 1PGOA 4R01A 2SCUA 3E48A 4U0JA 3A4VA 2IZ1A 1ZK1A 1NYTA 3MWDB 2PWZA 1U2GA 3OIFA 4C4OA 1ISFA 1WAMA 1NQ5A 2ZJ1A 3F6YA 1A7AA 3E18A 3MJCA 4L73A 3JQAB 5EIOA 1CERA 4XJSA 3JD3A 3SEFA 3GPIA 4J7XA 1ADBA 2PGDA 1HDZA 3IKVA 3D5TA 1EZ4A 5EPOA 4UVIA 2WD7A 2D8AA 1Z82A 4OAQA 5BSHA 5C7IO 3TDKA 1ENYA 3DONA 4ONEA 5B37A 1FMCA 3L0DA 4J7CA 5DP2A 4URFA 3ETEA 3WBBA 3RASA 4Z9YA 3OFSA 1HLDA 4Q3DA 5B12A 3JQFA 5JCJA 5THKA 3PFWO 1OAAA 3TOZA 4PZEA 3QWBA 2PZLA 1Q0LA 5BR7A 1OMOA 1WPQA 3ZNPA 3PWKA 4LRTB 1YH3A 3NT5A 2PR2A 1GUZA 1OC4A 4M8SA 4XQCA 1Z7EA 3PDUA 1YL7A 4RO0A 1A9ZA 3GDOA 3PK0A 3HE3A 1KC1A 3WJAA 3RUHA 2GD1O 5THQA 4A5OA 3BTUA 3GAZA 3FWZA 2B5WA 3ZV5A 3ONFA 3MOGA 5HTOA 3OJOA 1LSUA 2FZWA 4PRKA 5IZCC 3KSZO 3WSVA 3DQPA 1R15A 3RJ5A 1EVIA 3SC6A 4LMRA 2X9GA 3E9NA 3G3EA 1U2DA 1F8GA 4M54A 5L9AA 1LRLA 4RZIA 1SNYA 1F17A 2YW9A 3PXXA 3Q6IA 3LYLA 4XDYA 1PQWA 2DVMA 3KYCB 5DNAA 4B4WA 5JAIA 2OOSA 2X9VA 1LSSA 3GQVA 2GUGA 2PZKA 4MKZA 5TIIA 3DBVO 5I9LA 1Q0HA 3KEQA 3GFGA 2HMUA 2BGLA 3ICCA 4ESOA 5LC1A 2NQ8A 2VHVA 4CM3A 1ZEJA 4WLEA 4Y67A 5ICSA 2I5PO 4E32A 4GAEA 1KVUA 5IAAA 2E37A 2FZEA 3UN1A 1VLLA 1QXSA 4J4BA 4PRLA 3AUAA 3RFTA 4HKTA 2PGJA 4YQZA 1O0SA 4RGBA 2PFGA 5FFFA 3TWOA 1S6YA 3WFIA 4AICA 3PLNA 4M89A 1T4DA 4EZBA 2O48X 1LU9A 1GEGA 2O3TA 5I7FA 1M6HA 1ZBQA 1A72A 1QYWA 3L4BA 4BNTA 5HA5A 4R54A 2WYVA 4QT0A 2CZCA 4OSOA 2HJRA 4KUHA 1KIFA 2CF5A 5F3RA 4IZIA 1UJMA 3S1LA 3WQQA 5EESA 1YE3A 5AYVA 1PJLA 1G1AA 3OQBA 5JSFA 1ZK2A 2ZCUA 3VZRA 2AW5A 2Z1NA 3BZUA 4OGWA 2EHDA 1MXFA 3UAGA 3O8QB 3RUIA 4U5QA 1X7DA 3BHJA 4FJ2A 4R9RA 1ID1A 2C0CA 3UFXA 4OSPA 1A27A 1VL8A 4A10A 3M1LA 1WMAA 3V5NA 4FGWA 2AXQA 4IUYA 1I33A 4XIJA 3C1AA 4RPKA 1BVUA 1B8VA 2DBZA 4MP8A 2Y1CA 3ADPA 3C24A 3ZV6A 1HDXA 4U6SA 3GNQA 4O1MA 4UUOA 1TVEA 5F5NA 2HQ1A 1NFFA 4N5NA 5JO0A 2AHRA 2GPTA 4HXYA 3WMXA 2J6IA 2OBYA 1NR1A 1TA4A 5ILOA 3PYMA 1GL3A 8LDHA 3U49A 4BB5A 3EDMA 1JVSA 1UH5A 3PZBA 3DOJA 4PG5A 3D3WB 4YAIA 4AJOA 5EQFA 4DIFA 3BA1A 2UV8A 5JW6A 1DC3A 2Y1GA 2GERA 2X7HA 3LT4A 3V1TC 1WMBA 5IXSA 1DIGA 2YV1A 2NTJA 5A9SB 1U7HA 4RDIA 2PV7A 1B26A 2CMDA 4H3VA 5ER6A 5DBFA 1B3RA 3F47A 5TQVA 1F14A 2DBRA 1F0YA 3TOXA 4CM9A 1CQIA 2YY7A 3RUCA 2JD0A 2C2YA 3KHUA 1P9LA 1PL7A 1PIWA 1JKJA 4NBTA 4GX5A 5CG1A 1KVQA 4R5MA 4F46A 3INRA 2QRLA 3L6DA 4ALKA 5G0TA 1PZEA 4YB8A 2J3HA 4R5HA 1XR3A 3PHIA 3Q3CA 2CD9A 2NU8A 4QXMA 5CPBA 2I66A 7ADHA 3GNSA 3KUXA 1XEAA 1JAXA 4AG3A 2DLDA 4NZ9A 4BNLA 1NFRA 3STHA 4JIGA 3RKRA 3NT2A 4WCFA 3WIEA 5H81A 2GF2A 4M55A 3WQRA 1HL3A 1NFQA 1XHLA 4E13A 3IUPA 1PS0A 3ZU3A 5U9CA 1YL6A 2I76A 4U7WA 4GI2A 4PN3A 3JYQA 4HBGA 7MDHA 3B1KA 1YQXA 1M2WA 2NTNA 5KKCA 3UCXA 1ZO8A 4XD2A 3OA0A 4OO3A 4TQGA 4L4XA 3T4XA 1MV8A 2JCYA 3QV1A 4NJOA 2OO5A 4J1SA 4RF3A 5T5QA 4IJUA 3EUWA 1X1EA 2TMDA 3RU7A 2VWQA 1U3WA 3P2YA 3QSGA 5DF1A 4ALMA 2DBVO 1I3LA 3D3EA 3EHEA 1MP0A 4PG8A 4CM6A 2Q2VA 1LBEA 3VH3A 4JQCA 4BV9A 1JWBB 2YDYA 1Z73A 3IQDB 4OMUA 1T2AA 1MG0A 2LDBA 1E92A 3ZNOA 4N5LA 1NHWA 3H5RA 1GPDG 3INGA 1U4OA 4EW6A 3CZMA 1LA2A 2YQ4A 3BMCB 3KOUA 1CRWG 5DOZA 1BXKA 5KJFA 3PHJA 2VYVD 3MJTA 4BMSA 1C14A 1IB6A 3L77A 4NFSA 3QLJA 3K5PA 4J16A 2HAEA 2YHUA 5MDHA 3DB2A 4DYVA 3B6ZA 3F1LA 4BKRA 4WLVA 3KSDO 5I7VA 1MX3A 5IJZA 1DBVO 2ZTVA 2PGLA 3T4EA 3GHHA 4CM5A 4BO8A 2FRDA 4M1QA 4ALIA 4XKJA 4IINA 5JDCA 1SEPA 1UAYA 1IHYA 1MA0A 4RCVA 4L0QA 5A4DA 2YFQA 2FSSA 4KDFA 1K0UA 4FFPA 3HHPA 5IDQA 4WPGA 2HJSA 2JJYA 4QFDA 4HY3A 1P1RA 5JMWA 1UZLA 1YKFA 2AQ8A 2RAFA 3WGIA 4DL9A 1I2CA 1PL8A 2JL1A 1Y9EA 4DTIA 4MVJH 5ITWA 3S2FA 4PFJA 1B0AA 1R4NA 4AJEA 3QWFA 1E0DA 1SCUA 3PHLA 4BNJA 1E3WB 1I3MA 2WYUA 3MCVA 3ZHXA 4CLOA 2IODA 1V8BA 4DPKA 2B4QA 1DSSG 1SB8A 3A14A 3WYCA 5TT1A 2JCVA 5JAZA 1V6AA 2GGSA 4M86A 4FFNA 1A7KA 1LTHR 5H83A 5TNXA 2X5KO 3BTVA 4DPMA 3GH3A 4CM7A 1R4NB 3CH6A 3ZWVA 2GLXA 4CLRB 4CMCA 5KOIA 1GQQA 2P91A 2WD8A 3KXDA 1RKXA 2AMFA 2VRCA 4Z3DA 1I30A 1UUFA 4KP7A 3BMNA 4B8ZA 1DC5A 3PQEA 3UXYA 3I9LA 1LXCA 1XQ6A 2A4KA 3NDJA 5FYDA 5A3JA 3VHRA 4BOYA 1E5QA 4UVDA 3X2FA 1TXGA 1UXGA 1NAIA 3ENNA 5L53A 3GEMA 3OMLA 3QW2A 2X22A 5F5LA 3ASVA 3E03A 2X8LA 2ZYGA 5L4NA 3UF0A 5CDGA 3PHGA 3K92A 4L74A 1P74A 4CMEC 4FOOA 4MDHA 5COAA 3UCEA 3JD4A 3GMDA 2GYYA 4DWVA 3O03A 3KRTA 1U8FO 1P45A 1N7GA 1DEHA 4K6CA 4RPGA 3HDHA 3KYDA 2VNAA 1VJ1A 2DTDA 3BHIA 1XGKA 4PLCA 1GCOA 1PEDA 1R16A 3KM0A 2XXJA 4BKPA 1NXQA 4TRNA 3GN2A 3C85A 4MVJM 4F6CA 4P4GA 2AQIA 2Q99A 2EXXA 1HRDA 4ROSA 5JDIC 1JTVA 1N9GB 1PZHA 1HTBA 1NQOA 3IC5A 4H7PA 5F21A 4Y98A 1R0LA 3CZRA 3ZWPA 1EMDA 1PL6A 2QHXA 3OIGA 1EUCA 2C5AA 4IDAA 4QO8A 3LVFO 1U3TA 4W6ZA 1PJBA 2D5CA 1T2DA 4OKNA 4EYEA 5KVCA 2PD6A 4PG4A 4XJTA 4J0EA 1B8UA 3W6ZA 5I8WA 1SBYA 3FBGA 1GZ6A 1ML3A 1QYDA 2H6EA 3M6IA 1G0NA 2D0IA 2Q1TA 4EDFA 1D1SA 2J5QA 2EP7A 1SMKA 1LLQA 3NDRA 2JAPA 1FDUA 3ANMA 4CQMD 3UCFA 3DZIA 2HMWA 1A4UA 3HFSA 1XU9A 4MPDA 3LT1A 2AEMA 5KJ6A 2E6UX 2J3KA 3VVCA 1LQTA 2WEKA 5KJCA 2P68A 3RBXA 3O4RA 1ZW1A 1DLJA 1GYQA 1YBMA 5FF9A 4HADA 4LISA 3DAGA 3PPIA 1N1EA 4O0LA 2O3JA 3L6EA 3WBFA 1JLLA 3DBLB 4YRDA 2P5UA 4GGOA 1K89A 3NTOA 1GYPA 3HWRA 4J9UE 1K6XA 5EERA 5KTKA 5EL0A 1W4ZA 3C7CB 1GPJA 4UEOA 4GX0A 5AXAA 5F1PA 5BT9A 1GFSA 4XCVA 1WW8A 3NJ4A 5DN9A 1VL6A 2IXAA 1V3UA 2GCGA 3I9KA 4RVGA 4GQAA 1P31A 2YV2A 4ID9A 1VPDA 1H2HA 1ZJYA 4QX6A 2PK3A 4J7UA 4IDDA 1VL0A 1NR7A 2CNBA 2W2KB 2X0RA 4NJMA 5IZ4A 2NSDA 4DA9A 1EDOA 1R4MA 2EIHA 4J9VA 1BVRA 2Y1DA 3GNTA 4IDFA 1IY8A 1C0PA 4IJVA 1KC3A 4WE3A 5B4VA 3RU9A 2LDXA 4PCVA 3U4DA 3DL2A 1A71A 3UH1A 3DOCA 1NNUA 4A7PA 4YYZA 1JDJA 3BTOA 2AA3A 4MKXA 3SC4A 2I99A 2Q1WA 3AI2A 4K9DA 3VH1A 2IZ0A 2EWMA 1AUPA 1Q1NA 4ZHSA 2YHIA 2JCXA 4AJ1A 4CM8A 5KWEA 3I6QA 3QWAA 1AGNA 3EK2A 4F3YA 4BNMA 4MVJD 1E7RA 2Q50A 3OA2A 2JHGA 5G0UA 2QZZA 2HO5A 3P19A 5T67A 1HDOA 4E5NA 5JMPA 2VZ0A 1ISGA 3WNVA 1HE4A 1F06A 3NRCA 4G65A 3FWNA 1WLYA 4BO6A 4N7RA 2RH8A 1ISMA 4CLDA 3H6KA 3GZ4A 2P5YA 4PVDA 3ON5A 2NV6A 1QLJA 3WG9A 4DBVO 4FD3A 2W4QA 1LDBA 3ICPA 1BG6A 3VPSA 1IL0A 1HSOA 2EW2A 2RHCA 1H0KA 3PWSA 1D7OA 4DLBA 3JQ8A 2VYVA 1NQAO 4NFHA 2EG9A 1LRJA 2D5AA 2VZ9A 3RBVA 1ZSYA 3OJFA 3DWFA 1CWUA 2VRCD 1KY4A 2DBQA 4IBOA 4J49A 4UREA 1U3VA 3JQFC 1V9LA 3GF4A 4O63O 4FN4A 2Q4BA 4K28A 1JN0A 4E21A 3BMOB 2OMEA 1FDSA 3AFNA 2AEJA 5LCXA 4Z9XA 1GQYA 3H9UA 4AJLA 2ZYAA 1Z6ZA 3VVBA 3VZSA 4BHTA 1ORRA 3DZFA 5HM8A 3PI7A 5L4SA 2Y66A 4OKIA 3ZWWA 2ZTLA 1PJTA 4GLOA 2X5OA 3JQ9C 1P0CA 2BMAA 5CEJA 3WIDA 9LDBA 1O89A 4CMAA 2X5JO 2E49A 3R3SA 4MP6A 2QG4A 1DC6A 3P2OA 4GKBA 4R3NA 4BGVA 2G82A 2P9EA 2P9GA 4E0BA 2VN8A 1B8PA 5I9NA 1YBVA 5FI5A 2FR0A 2PH3A 4J1TA 4P8RA 2VHWA 4C7JA 3FR7A 1U8XX 3GEDA 5JCJD 5JY6A 3BMCA 3F46A 4KOAA 4LK3A 5BSFA 4OIMA 3UUWA 3S8MA 3H2SA 4HV4A 3JQ7A 3UGKA 3T7CA 3BYZA 1ULSA 4BO9A 1LNQA 3GRPA 3I3OA 1DFHA 4BVAA 3H5AA 4B7UA 3ASUA 3BXXA 2OL4A 4HNGA 2DQ4A 4I5FA 4RVDA 3FI9A 3NTRA 3RROA 1ZH8A 1M66A 4YJHA 1WVGA 1JQBA 4WLUA 1G0OA 4PVCA 2DM6A 5L45A 3NUGA 3WX0A 1QYVA 4GLLA 2IE0A 4BO5A 1PZFA 3LF2A 4M87A 3FCOA 3QRWA 2JKVA 3OJ0A 1U1IA 1UXHA 4ND1A 1LC0A 4HNHA 1X13A 2GN6A 3AOEC 2BF7A 2P4QA 3ZHBA 1U5AA 1O6ZA 4DYDA 1M6WA 1ZKMA 5A04A 1HKUA 1EVYA 2VT2A 2ZQZA 1EE9A 2GN9A 1NQTA 1G6KA 3C3XA 3W8FA 1BXGA 4CMIA 4E5YA 4H15A 4BO3A 1KETA 1KS9A 3BMQB 2AEFA 3LLVA 2QRJA 4TROA 4B3JA 2G0TA 1HDRA 5CG2A 5EQDA 1KVRA 2G17A 1NWHA 2D59A 3GPDG 4RF2A 4N5MA 1QR6A 5JAQA 1Y81A 3SLKA 4WLFA 2E82A 3DZBA 5IXYA 4AJPA 2UYYA 2RIRA 5GZ6A 4JJGA 2FPIA 4BNZA 2P2SA 2D3TA 1GZ4A 3O38A 2NVBA 3V2HA 1QV6A 3AY7A 1QLHA 4OXKA 2A94A 4JBGA 3JTMA 2Q46A 3K6JA 3R1IA 4TZTA 3DHEA 1H93A 4OQZA 3VDRA 4CUJA 3GMSA 1B16A 4FB5A 1YS4A 2WTBA 5DOVA 4EEZA 3I52A 2CVOA 4LMPA 5JS6A 5KJ1A 4GWGA 4NBUA 3UKOA 3PP8A 4BIIA 3B1JA 5JC1A 3WGGA 1LSOA 1Y8RB 4ZQGA 1L7EA 5T8KC 4ALJA 3LC2O 3OICA 3UOGA 4IDGA 3HG7A 3ONEA 2BGMA 5I7EA 5F1OA 3GN1A 4XX0A 3O26A 4WLNA 3NYWA 3GUCA 3PFFA 2Y99A 5TC4A 2ZB8A 1TT7A 2GDZA 1GADO 1PR9A 1CYDA 1DLIA 1ISIA 2W2LD 1QYXA 1PGPA 3T7EA 5JFOA 1HSZA 1YDWA 2NUAA 4FDAA 4JBIA 3KYCA 1HE3A 4Y8VA 3HN2A 1HWYA 3GDGA 4PLTA 4R16A 2C5EA 3JQAA 1Q2XA 4NPCA 1I8TA 4YRAA 3PGJA 1PWZA 4ZRMA 2GNAA 5TSDA 2Y0DA 4AL4A 3CIFA 2J5KA 2PKRA 3ZWNA 3SLGA 1PJ2A 3NJ8A 1K3TA 2YJZA 4DIOA 4YRBA 4E3ZA 4YXFA 1BTOA 4Z0PA 1SAYA 5IDXA 1TT5B 4UULA 1BRMA 1MC4A 1I3NA 3LU1A 1WWKA 1SPXA 1TEHA 3B70A 1VE9A 1DFGA 4WCFB 1ZSVA 3WGTA 3E8XA 4OL9A 4RQUA 4BKUA 3AUUA 2H5LA 5ER9A 2BH9A 5AXBA 1EDZA 3E6AA 1F8FA 4G5HA 4QTZA 4MVJA 4UAGA 5ES3A 1Z45A 3BTSA 3GVCA 2Q4EA 3ITDA 2O4CA 4DBZA 1MFZA 3BIOA 1R6DA 1WZIA 2AG5A 5IFLA 1JWAB 2XXBA 4J2HA 4OH1A 1TT5A 4B7CA 2B4TO 3I5MA 3IKTA 3QVXA 2FR8A 2P9CA 2O2YA 4EUEA 4R1NA 3KV3O 3E9MA 4BGUA 1XQ1A 4WECA 1LJ8A 3WR5A 4LRSB 2ZTUA 5DBIA 2HK8A 3BMOA 2JFGA 5JXWA 4TRRA 1OI7A 1AE1A 2BKAA 5TF4A 4L4SA 5I7SA 2P4HX 1GUYA 1IULA 3HADA 3PRJA 2AG8A 1KOLA 2HMTA 5L3ZA 4FPXA 1UDCA 2WM3A 4GSKA 4K26A 1UDBA 2G5CA 1IE3A 5AQ1A 2CVQA 2HSDA 3B20A 5HS4A 4YA6A 1H9AA 2CDAA 4JX8A 4Z0HO 1T2EA 1YDEA 3V8BA 1H6BA 4EJ0A 1X0XA 4RLHA 5TGDA 2X6TA 3JD2A 4JNKA 5CDTA 3L6OO 3U0BA 2ZCVA 3RFVA 3TJRA 1YO6A 1PS9A 1IHXA 1H9BA 2IZZA 3IMFA 3KVOA 4UEKA 1Y8QB 3WICA 3I23A 1E3EA 3AOGA 2DUWA 4YPOA 2O3RA 3W8EA 1DIRA 1U7TA 4CJXA 4JJIA 1LI4A 1T26A 1P1KA 3TN7A 1HDYA 4BMVA 3D5QA 1ZK4A 3M2TA 5CP8A 5A03A 5J23A 3ZWOA 5LDHA 3H8VA 2BFMA 1B14A 1BDMA 2BHLA 4AJKA 3JQ7B 4LSMA 3A28A 3VOSA 4IIUA 1ADGA 1F12A 1HYHA 4KUEA 4JCOA 1YBAA 4WEOA 4B4VA 3WGQA 5JLAA 5BSGA 4NDNE 1O9BA 2QZ9A 3LC1O 3N58A 4O5OA 4XYLA 3HNPA 4G81A 1A4IA 1IYZA 5K0ZA 4QO7A 3FHLA 1JAYA 3JQ8B 4A26A 1ZK0A 2JFHA 5DCUA 5IN5A 3SBOA 5C3MA 1OZAA 4P4NA 1DRUA 2IYPA 3DHNA 1OOEA 3IJPA 4BNWA 4BGEA 2NADA 3GY0A 3IAHA 3WGOA 1HLPA 3EVNA 2J8ZA 2C82A 1ISHA 2GASA 5DCYA 3MWEB 3RD5A 5IN4A 4CQMB 2CDBA 1YJQA 2X0NA 2Y93A 3A06A 3E1KA 2EF1A 3F9IA 3HN7A 1NVGA 4OM8A 4FR5A 5A05A 4E2YA 1Y7TA 4WNCA 1IZ9A 3Q11A 2A35A 3ULKA 1O8CA 3AI3A 4RVUA 3H2ZA 2BD0A 2Y0CA 3ZW9A 5G0VA 3OEYA 1IUKA 1MFPA 1P1IA 4GBJA 3BMNB 3I9OA 4IGFA 4AJ4A 1M76A 1CJCA 4BO7A 1HZJA 4GVLA 1YXMA 3LZ6A 4L76A 4IGEA 1JW9B 2PD3A 3CSDA 3ANNA 4R1TA 3FBTA 4KDEA 4QSMA 3S55A 3IP1A 3Q0EA 3ZWYA 1YL5A 2NACA 4D0RA 2Q2WA 4NJMB 4H16A 1JKFA 2PA3A 4CV0A 4TZKA 5AXDA 1J4AA 4R3WA 1DAPA 3FNEA 4W9NC 3RC1A 2AQHA 1E7WA 3RAJA 2OXIA 3HZZA 2X58A 3IOYA 2DU8A 3ST7A 3U9LA 3DMTC 1H6DA 2X0JA 1V35A 1JU9A 1W8DA 4CM9D 4EEXA 4W99A 4MVJG 1XYGA 2BFAA 3VAZA 4RPHA 3MJSA 5GMOA 5JBIA 3DBHA 2XOXA 2HMVA 1LEHA 3HB4X 1V3VA 3AK4A 3KLPX 4J90A 3M2PA 1ZNQO 1QG6A 2YHIB 2Q49A 4LVUA 3GEGA 3VKVA 2HUNA 3M1AA 4UUPA 5DBGA 3ZN2A 1W0CA 1YB4A 1VRWA 2J5RA 1Y5RA 2DC1A 1N2SA 2CDCA 1AHHA 4BNKA 1E7SA 5HRUA 4NBVA 3RKUA 2W98A 1T25A 2VYND 4J43A 4R69A 3OF2A 3TPCA 1LLDA 2EERA 4YAKA 4I5EA 2DPHA 2NNLD 4XGKA 2VOJA 2BFPA 3VC7A 1QV7A 4IQ8A 1NP3A 3LQFA 3LT2A 1B3BA 3PQDA 4CR6A 2NVWA 2PH5A 1YB1A 4XRGA 4D42A 4FBGA 3ZWMA 4FFRA 4EJ6A 1V0JA 4A0SA 4CODB 3AY3A 1D8AA 3IUSA 2CY0A 3SJ7A 1XA0A 1P77A 2W8ZA 2BI7A 3FSRA 2ZB3A 4Q3BA 3WWZA 4LSWA 4CPDA 5JC8A 1GYRA 4ZQHA 4DMMA 4PGFA 4D41A 3VKUA 3ZCXA 1PJ4A 1LC3A 2DTXA 3GG2A 3K8ZA 4S3MA 3EMKA 4Z0TA 3TSCA 3EC7A 3ZWAA 4N54A 4RDHA 3PJFA 4YQYA 1E7MA 4MOWA 4BO2A 1FXSA 4LVCA 4I5GA 3CE6A 1UZNA 4PG7A 3LK7A 2AE1A 3MOIA 4D46A 4CV2A 2DAPA 4LCJA 1I01A 4MVJE 4AFNA 1I10A 1JVBA 2NQTA 2WDZA 2HDHA 3RC2A 1N7HA 5BQFA 1P1HA 1C1XA 3JYOA 5DT9A 4K1LA 4EGFA 1E6UA 3U5TA 3GDFA 4Q3EA 4MVJP 5JY1A 3ZDFA 1ADFA 1KERA 1GAEO 1HDCA 3ABIA 2DPGA 2NVUB 1PGQA 4BQRA 2C7GA 3EY4A 1T2FA 3RC9A 2VTEA 4Q9NA 4YAEA 1C1XB 1ENPA 5JDCC 1LDEA 4ILKA 1UP4A 1EE2A 2ZB4A 3L9WA 1QRRA 3DZJA 4YJGB 4J1QA 5AXCA 2PZJA 1HZZA 4W4TA 2HCTA 3EYWA 3QWHA 2ZQYA 3EVTA 1VKNA 3ZNQA 4BNVA 2WE8A 2QRKA 3UVEA 3RJ9A 3EAGA 1PR3A 4ND4A 5KNLA 4J1NA 1PJSA 4O6VA 4TSKA 3TZQA 3LSYA 4KTTE 4TVBA 1EUDA 2BELA 3ZGYA 1ZIDA 4IQGA 2O23A 4E2WA 4II3A 1PSDA 1U4SA 3IIEA 3H9QA 3JQGA 3PLRA 1E77A 1QYCA 3PQFA 4YJDA 2Y67A 3WGYA 3GG9A 1C1DA 3PZRA 4GX1A 3P7MA 3ZHZA 1WDKA 1CETA 3NGXA 1Q7CA 3GR6A 2RH4A 3JQDA 3ETDA 3I1JA 2OORA 3C7AA 1GV0A 4KWHA 4Q39A 3R3JA 3GVXA 3HFGA 2OGUA 3AW9A 1GY8A 1GTMA 1GUFA 1PJ3A 2PD4A 1DIBA 4CMBA 1IPFA 2C59A 1BGVA 2E4AA 3JQGB 5C5IA 4CLRA 5IF3A 4DIBA 2GSDA 4HFMA 5G4LA 3D0OA 1I36A 1BWSA 2B37A 3GUYA 3ROPA 4CM4B 5DDIP 3RWBA 4E6PA 2JD1A 2FHSA 3VPGA 4YJFA 2DUUA 2R6JA 1K6JA 3H9GA 4ITUA 5C7OO 5K6AA 2RHRA 4X54A 5C7LO 4W9NA 1PX0A 4DC1A 3K30A 3B1FA 3AY6A 3MTJA 4E2ZA 3GVPA 4UVHA 4Y6PA 3C1OA 2FOIA 2JAHA 4DUPA 1KVSA 1LUAA 3A9WA 4L4RA 3A1NA 1IZ0A 2BFOA 3K73O 5KJEA 1NBOA 4YAGA 3LLSA 4NIMA 4JLWA 1YB5A 3HDJA 1PZGA 5GZ3A 4Y9DA 1DOHA 3GRKA 1XG5A 4IDBA 3V2GA 1EFLA 5FWNA 4ZGWA 2R2GA 3AFMA 3GGPA 3PIDA 3QIVA 1H2BA 1E3IA 2I65A 1KBZA 2HMSA 4FFLA 4WGGA 2OHXA 4DGSA 5BNIA 3EGOA 4E5PA 4RF4A 4C7KA 4XYGA 4B8WA 2O4UX 2OFPA 5AVOA 6LDHA 1DAOA 1EK6A 1Z74A 2VUSA 1VM6A 3ADOA 2EV9A 3MJ4A 4FIZA 4JN6B 5IDYA 4B3HA 1IOLA 1I24A 1ONNA 4ZD6A 5U1PA 3DTTA 4PLYA 4ND5A 4YT5A 3WWYA 4A27A 3EZLA 1TLTA 4D3SA 3HJAA 4BNIA 4E5MA 1HE5A 1H6CA 1LSJA 1MB4A 5ITVA 3VPXA 2HKIA 4QEDA 3IP3A 1YOVA 2C20A 2GR9A 4NI5A 3WTBA 5JDIA 3HQ4O 1XLTA 4N18A 3V1UA 4IXTA 4WJZA 4GWKA 4DC0A 2ZYDA 4I9HA 2XAAA 4R51A 2Q3EA 4OYRA 2H63A 1FK8A 4CMHA 4ZN6A 4J2OA 4JK3A 5A06A 5L7WA 3TZCA 4R1UA 1NWCA 3G17A 5A02A 1AXGA 3FPCA 4J4HA 3SJUA 4YAJA 4XB2A 3PGXA 4OHUA 4XB1A 3S2IA 3H5NA 4BMNA 2ZB7A 1P1FA 3ANLA 4IIVA 4KZPA 3JD0A 4WCFC 1DRVA 4J6FA 4IM7A 4D44A 1RYDA 2J3JA 3JSAA 5A9SA 4BO0A 1EQUA 4NG5A 3RUAA 4WUVA 3U3XA 4E4YA 3JYLA 3GA0A 2GN8A 2JHFA 2YYYA 1EVZA 2OBNA 2F1KA 3E5MA 3V1YA 3QE3A 2EW8A 3ORFA 4B4OA 1NPTO 2B69A 4JJFA 3DMTA 3DZGA 4NU6A 4Y6RA 1N1GA 4ZA2A 1E3SA 4J0FA 5GY7A 4YT8A 2WE7A 2Y68A 1SEVA 4JROA 4HFNA 4WOJA 5DZSA 2VT3A 4BUCA 1P33A 3HDQA 1KEUA 2D1YA 1UAGA 2DT5A 1J0XO 4IS2A 4GMFA 1T24A 3C8MA 3DMYA 1JKIA 3QVTA 3C1TA 2WJPA 4BQPA 3VTZA 2EKLA 4XYBA 4R4JA 1CDOA 1C3VA 2WSBA 5TJ9A 1BHSA 1EFKA 1DB3A 4HX5A 4YWJA 3Q2IA 3JQBC 3WYBA 1NAHA 3JQ6A 4XA8A 2QYTA 1BDBA 3AU8A 1E1MA 2VWHA 1ZJZA 2WMDA 3NDIA 4FJ1A 4RPJA 4U8GA 3D4OA 1RM0A 3QA9A 2OUIA 3OBBA 3OECA 3MEQA 1EVJA 3UHAA 2B83A 4YEDA 3TZ6A 2PLAA 2FMUA 1DPGA 4BB6A 4DLAA 3VDQA 3U09A 4QFCA 2B35A 3TFQA 4UVGA 4DQUA 2EGHA 2YV3A 3CXRA 3G79A 3CINA 6ADHA 2O7QA 4I9NA 4OJNA 4ZQEA 3ZU2A 1R0SA 3GAFA 2W90A 5K9ZA 2O2SA 3D64A 4XQ9A 3E82A 4YJGA 3VZQA 1E3LA 1E3WA 2BI8A 3SVTA 4AJ2A 3HB5X 4Z3KA 4EITA 3ZI0A 1U3UA 4PLFA 2EP5A 1M67A 2VTDA 3DO5A 3WMWA 4YT2A 2PKQO 2FN7A 3WNQA 5ILGA 5FEUA 3Q9UA 1NASA 4JP3A 3G0OA 5DP1A 1KYQA 5HBRA 3X2EA 3GHYA 3DC2A 4P4LA 4CMKA 1XDWA 1SOWA 4WLOA 2IRWA 4IJWA 3PDJA 1NTOA 4CQMA 3DAFA 3I83A 2A92A 1J5PA 1HE2A 2Z95A 1CF2O 2G1UA 1R0KA 3QVSA 3WSWA 4ALNA 3F4LA 3I9JA 1DJNA 4QQRA 4ZJUA 3U62A 1GEEA 2GN4A 4CMGA 1QSGA 1K2WA 3VZPA 4JP2A 4BV8A 5KVSA 1ZEMA 4UVEA 4WOKA 3JQ9A 1NVMB 5K6AC 3C7DB 3DBRA 3FNGA 4XEHA 1ZVMA 4CM4A 5G4KA 2POQX 2C29D 4BKQA 1RM4A 2EKPA 4BNUA 2O3UA 3TZKA 5A5EA 1C0LA 3NV9A 5L95A 4FC7A 1HXHA 3V2UA 2FP4A 1FJHA 2C7VA 2I67A 3U4CA 1YQGA 4WK6A 3H7AA 3DZHA 4FC6A 4GL4A 2DTEA 4RL6A 3QQPA 4J4TA 5KVQA 4D79A 5DCWA 1DHTA 1RWBA 4CUZA 1LDMA 4IS3A 2CSUA 2UUPA
chains in the Genus database with same CATH superfamily
1RXIA 5G0SA 8ABPA 2JGKA 3FGOA 4D7AA 1W94A 3ZXSA 3PJGA 1SHTX 1JFTA 3NHJA 2ET6A 4JITA 4UBMA 1U90A 4EUHA 3A9RA 1FP4B 4KDCA 4TUYA 2A58A 5EE5B 2G63A 3RUEA 3ONDA 5FBVB 1JDBC 3GJ3A 2P90A 4WVFA 4CG2A 1D5WA 4TMYA 4LDAA 2FPSA 3DL4A 1TAGA 2PUTA 5JSZB 2G1PA 4GUDA 2OBXA 3KE8A 3NOOA 1DJPA 2XHEA 4IJKA 1LDNA 4JCCA 4ER7A 2IS2A 2IC5A 2PXAA 3LYHA 5F52A 3NVMB 1VA5A 4IOKA 4BCBA 2R11A 3OETA 1XPJA 3MTAA 1CQJA 3HCBA 4BVLA 3G2KA 1PWEA 1QP8A 3RTEA 4RTPA 4BRZA 1WX1A 2IPAB 3V80A 1LPNA 1P1JA 1QANA 3C43A 3QBDA 3OBIA 2CT8A 3L7OA 2VDLB 1T2VA 1VL1A 3FYUC 1SBHA 2XCQA 3K9QO 4Q1FA 2FFHA 2ODQA 1XQXA 4ZHQF 3UT5B 1YZFA 3P20A 3S6JA 1FMJA 4QYIA 1VE7A 2GTHA 3DAYA 1CLEA 3CZ4A 3N5CA 4TKZA 2QL5A 5F9FA 4R9VA 3N0XA 1XELA 1E8DA 3OX4A 5LYJF 3S8EA 5I5EA 3LPDA 4LJSA 3S81A 4YJFB 4B3DA 4L3WA 1L8OA 5K6RA 2ZRAA 3QVWA 2TMGA 2F62A 1W5SA 3LY9A 2GPWA 1ESMA 1YZQA 3G82C 1K8ZB 4O2AF 4CM1A 2BR3A 4NCIA 4E07A 2Z30A 2O7NA 1A7UA 2VSQA 3LCCA 4EQZA 2NUTB 3FJ1A 3F3SA 2W2KA 1GG5A 2NN3C 3OTWA 4ZOCA 4B6JA 4BUJA 5GVSA 1M5RA 1W88B 2P6NA 1FYEA 2I9PA 4MRSA 2V4ZA 2BLLA 2I6TA 4EB3A 2WD7B 3INTA 1RKVA 2A4MA 2OD7A 1WCV1 2OCGA 2WJAA 2J85A 3T3EA 1KPIA 1TNDA 1CX9B 2CL0X 2VHZA 1EGQA 5ISMA 1DEAA 3M9WA 3SZUA 1RRMA 3CPSA 4UEJA 3DCYA 4M0CA 4IUCS 2QYSA 4DR2B 4CEHB 3PIIA 4CL0A 1Y9AA 3ZD6A 1ICIA 1RDFA 2V7QD 2XPCA 3WWOA 3CKYA 3BPSA 1UBNA 3EG5A 1QQ7A 2DOKA 5T6BA 3UFXB 1Z8NA 5A5FA 1SXPA 3WDMA 1JKMA 1SZJG 2E6KA 2FSVA 2OESA 3CUEF 5AHOA 4FT2A 2EFGA 4JLMA 4X9XA 5CA0A 1EUZA 3W6UA 2QLMA 3OF3A 4L02A 3WLTA 2ZJ2A 2Z5LA 1SBIA 4UHDA 2VPIA 3BQNB 3OUTA 4KWIA 1JDNA 2CFCA 4NMWA 1K8QA 1PEAA 1QFXA 1VTKA 2O2XA 2FFRA 3WV5A 1R4MB 1CP3A 5FQNA 4F1KA 4HDSA 3LZCA 1GU7A 4BB9A 2DUMA 2CWWA 2OGWA 2R2AA 4LY0A 3WNZA 1YKGA 5B58C 1OLXA 2Z9CA 2ZRIA 4HN2A 4ZEMA 4RVNA 2RGAA 1CUAA 4IPTA 1JI0A 3MJVA 1VFNA 2P62A 3GFBA 1GM5A 3G0HA 4FHDA 5DHSA 1OE0A 1O6FA 3JQBA 2JHCA 4YS6A 1L8AA 4MYUA 3V8VA 3BC1A 3N28A 3RF7A 4OI4A 1M8JA 4V02A 3LI2A 4HYEA 1ZCBA 3NS7A 4DIDA 4BZWA 2A5YB 3H5LA 4FYPA 2D4HA 3RU3A 5CPFA 3A6ZA 1UM9A 1YMUA 4PZLA 1QNFA 5L8VA 3DLBA 1CJUC 4CM8B 2ZXFA 1CEQA 1CJTC 3OQ1A 3GJ8A 3I4LA 3ZCPA 3QJ5A 4CT4B 1ZR2A 4MS3B 2QN6A 4DLLA 2WHEA 1ULUA 4K6OA 4PR3A 1KQNA 3W6OA 2ON6A 4O1HA 3GP5A 3RIGA 3SU8A 3UTCA 4S1VA 3OQ6A 3TZHA 4LDPA 5AKIA 1SKUA 2E9SA 2EL7A 2WA2A 1LNSA 2V6FA 4ZAVA 5ECWA 5H82A 5BWMA 4Y1RB 3EF0A 1ZM3A 2X23A 3WK6A 4GS5A 3G5TA 4F0JA 4DV0B 2X5NA 3NC0C 2HNBA 4ZEVA 1TCAA 3HBFA 2DHEA 3ZS8A 3A36A 4BVEA 3ITKA 2UUOA 3L8CA 1NGSA 4LJ4A 2BPOA 3G2LA 1SY7A 4RF5A 2E4XA 3NEPX 2X86A 3GWGA 3V34A 5CB4F 1SO8A 2CL5A 1VI2A 4CVNA 5L40A 2V7BA 4LYHA 3UW3A 2JRCA 5LNK6 4DR5B 3KQKA 1UM8A 4M1TA 1FQJA 2CDNA 4GEKA 5A9TA 4JOSA 3U6KA 3SM3A 3VV3A 3E8SA 4NTZA 1SUAA 1GPMA 5CX1A 3Q4GA 1Z39A 3PDIA 3VPBA 3S4YA 1LH0A 4NONA 4ARZA 2ZAIA 3I3SR 4EECA 4RTKA 5PNTA 3EGWA 4CLEA 1FXWA 4P0QB 1WP9A 5HRCA 3F71A 4XR9A 5IWAB 1JZSA 2KQUA 1QQTA 1UF9A 4MUFA 5B1YA 2NGRA 4D3FA 4MQUA 1N9KA 4GMKA 4HDNA 3O0DA 3ZHCA 1MW9X 1UOQA 3WLFA 2AQKA 3HV0A 2R86A 4EY4A 2YUTA 2C42A 3PEWA 2AS0A 2H2FA 1QIGA 1YRQA 3EYAA 1C9NA 4MP3A 4CI9A 1Y5MA 2XNDA 3DMNA 4RVHA 4B44A 3NH6A 2TMKA 1GN8A 3Q2OA 3U3ZA 3UGJA 2VP2A 3VGJA 4L4YA 1BN6A 2VQ3A 3NWPA 4IV0A 1FDIA 1ARZA 5B4UA 1JIXA 2GXAA 1JT2A 3T5CA 4HVCA 5K01A 4NG4A 2Q6VA 3W8RA 3L0SA 4BVHA 4BZXA 2IIBA 4ZALA 4QEKA 4ZYLA 5EINA 2XF8A 5DH9A 1RLTA 2YIVX 3GUUA 4EGSA 1IRXA 4PLZA 5IG2A 2HV9A 3ZQKA 1D2CA 4TRJA 1E63A 3EXEB 4FP9A 1LK0A 2Q1UA 3GA7A 1SK9A 4QICA 4BL5A 5CDSA 2YYZA 2HOQA 2Y05A 4P08A 2WPNA 5TRTA 3SXPA 3QF4A 1UBHS 2EATA 1M0TA 3O3OB 4E5UA 3CKMA 2PV0A 3U4MA 1ENOA 2E4ZA 2FSGA 4O4HB 1XIVA 2HB6A 3M33A 5EMNA 5B3JA 2YS6A 4RJTA 4KITB 5ICMA 4N3BA 5JYDA 3AFHA 2EGGA 1NTRA 3N0TA 2C77A 2O2JA 1GD1O 3LVQE 3OU2A 4QATA 1T43A 2YVAA 4BAUA 3QIAA 1OBOA 2G3YA 5KNCD 1Y3BE 4U6QA 3I45A 3RUDA 3ETGA 2XR1A 1QS0A 2IXEA 1H6AA 5DSTA 3BH0A 3SEZA 1UT8A 2C84A 2WIDA 1D09A 1CIVA 1E94E 2N9UA 2C78A 2PQ2A 3ZDBA 2A1UA 4L75A 2SBTA 4P5DA 2NXNA 5HTKA 4LE1A 5A71A 1WQ1R 2B92A 2ZUCA 3BMQA 3TRIA 4AVYA 1WETA 2Y1OA 4Y9SA 1XQ9A 2YZGA 1L5FA 3B3JA 4JLSA 2D7DA 4BNGA 3FYDA 4BWYA 3ESCA 2DWPA 2OK7A 3AETB 2BOVA 2B20A 4A2WA 5LU9A 1EWKA 3KO8A 1NNEA 3W4IA 1JKXA 5KOHA 2J9YB 1AF4A 2ORVA 4B3IA 5LSAA 3TF5A 1PYOA 3L7CA 3RVRA 4I3HA 4XQGA 3O8OB 4R0VA 2WA1A 4NYJR 2HHAA 1X8LA 2MSLA 1C7JA 2FEOA 3M3HA 2EL9A 3A1SA 4QDJA 4RXMA 4DLNA 1RXVA 1SIBE 2V65A 5CCXA 3E53A 4MX8A 1OA0A 3R7DA 2H9IA 4HTFA 1DEKA 2NXCA 4R9NA 4D8WA 4KNYA 3WQSB 2XVYA 3K9BA 1MZVA 3BFVA 4MYHA 4JLUA 2AOUB 3AHGA 3TLYA 1L5VA 2IYOA 4GP6A 4RK0A 4MMXB 1CJKC 3C3PA 5G4KB 3H8SA 4NE7A 3ZY6A 4RJ2A 2P6RA 1KAGA 1RVDA 3NASA 1P29A 5EHNA 1XKQA 3CLHA 5MN4A 1E1LA 2A5FA 3PDWA 1SC3A 4PWZA 5BN5B 1YGYA 4UD6A 4XE5A 4FU0A 1L4YA 1J8YF 4UDXX 3DXFA 4QYWA 4E31A 1B6TA 1L7BA 3QHAA 3L0BA 2GKGA 4GHWA 1V7PC 3JSXA 4QM7A 3FWKA 1KI7A 3PVCA 4V1CI 4RE5A 2H1FA 1UBKS 4GT1A 4O4IA 1ZCAA 1UP7A 2BCJQ 2PX8A 5C1OA 2QN1A 1KJ8A 1ZH6A 5HS6A 4V1CB 1NMQA 3QLEA 1YVPA 2HA7A 2G06A 1AHNA 2A0FA 3KLBA 3NBQA 3Q98A 4ZCTA 3CVOA 3LWDA 1ZM4A 3DR3A 4UBJA 4KIFA 4MAFA 1KE2A 2A9FA 1H4QA 3WLRA 1FDTA 2Q5JA 4CF5A 1U9JA 3AM3A 1PQUA 2JLZA 4IXDA 2YRFA 1FQWA 1PZNA 1TQHA 4YQEA 4CMJA 3I5XA 1E3JA 1V47A 3AX6A 4CTJA 4F8JA 2B4YA 2UXDB 4X20A 4HB3A 3T95A 1YOVB 3TO5A 1WVMA 2P6UA 5CIWA 2QTBA 1NC3A 3HCDA 3GC6A 3IOCA 4NK4A 3S1AA 2ZYSA 3KFLA 4RD2A 4MGIR 1EUDB 2F00A 2SECE 5LMNB 2ID9A 4FX2A 4JSRA 3RYIB 5JWOA 4BRSA 3IDSA 5JQGF 1S4QA 4EHLA 4V0LA 1X19A 3IPCA 3MWDA 2Z3WA 1WY5A 3D1LA 4EBFA 1HEYA 2B5VA 2O07A 3KZVA 1TOAA 3HUDA 2ABWA 5BQOA 1SZDA 1RQPA 4HZIA 1J8VA 1C1DB 1NOJA 3QP9A 5DMXA 4E70A 4KPUB 1S9DA 2R96A 4XDHA 1EFAA 3SR3A 3KCQA 3FSEA 4HGNA 1Q3HA 1DKQA 2XUHA 1A8QA 2GO1A 4LW8A 2G1AA 4NU8X 1E1RD 2VSOA 4JEMA 4UNPA 1M1YA 1JE1A 2CLKB 5BN4A 5K0LA 4RY0A 1MOSA 2ZK7A 3KHSA 4PW0A 3PUXA 1YASA 3QEMA 4FYXA 5CK4A 4B7ZA 1YZHA 1U1GA 5D85A 2POCA 4OGKA 4B2YA 4C7VA 1MBZA 3H05A 3CUKA 4BS9A 1A0OA 3KOWA 1TRKA 1OBFO 4KG7A 2ILTA 4BKMA 2HK6A 2HTFA 4KPYA 2HK9A 4C03A 1JR3A 2QVBA 3BGWA 3VU9A 2IYSA 2ZSBA 1NPYA 3MGKA 4ECAA 2UU9B 3CTMA 4Y18A 4HQFA 3NUQA 4GYKA 1CQPA 4HXFB 1C3LA 1CG6A 1T3ZA 2HTEA 1ORTA 1Q7BA 4NARA 3QI7A 4LWZA 3WYFA 5LXTF 4IIJA 4OOEA 4YCMA 3BXFA 3NG1A 3N87A 4JD5A 4BO4A 3ZU5A 2VDRB 4MVJI 4AF6A 4D81A 1W36B 5GWXA 1PTJA 4RIEA 4LF9B 1AQYA 3P8ZA 5JQGB 1APBA 1P4HA 1Y9JA 4BNFA 4E22A 4DMUB 2F67A 4ON9A 2EC5A 3OVMA 1N5KA 2G6TA 3P9SA 4YCAA 3TTYA 2JASA 4B7XA 3A04A 1DFIA 4S1OA 5GAJA 2TS1A 1NJFA 4WASA 3AEUA 2FPKA 4L50A 4JR1A 2FQQA 2AI3A 2CNKA 4DQVA 4D97A 4YUYA 3ELWA 3NBMA 1NBIA 4F4CA 1CUWA 1QHYA 4QHTA 1JE0A 1HT0A 1Y1PA 4I1IA 1G2QA 4PC7A 1J56A 4C5CA 5COBA 1MV5A 1LTKA 1ZXLA 2GHQA 2R1VB 3IJRA 3KEOA 2P5SA 4G25A 3P0IA 4V3CA 4JC5A 3EXIB 1E1KA 4JT2A 1OFHA 3AFIA 4GRDA 1J8MF 1SBTA 1O1YA 1Z29A 1H05A 2VJAA 4JLVA 4LCBA 5T4FA 1TYZA 3U31A 3GROA 4RTSA 5KWIA 1Y8ZA 1V95A 4HG2A 1HOTA 3WYEA 4KPGA 4ENQA 1CP2A 3I53A 1JHZA 1NVTA 4D9EA 1BW9A 2CFSA 4KQCA 1YWGO 4KMSA 3KYIB 1LQUA 3P9ZA 2A14A 2F90A 5ALFA 1NW8A 2BGKA 2X0IA 3MYRA 2TYSB 3FDZB 3A58B 4JASB 3I5YA 3DOOA 2R1ZA 4KODA 1HEIA 1JGTA 4PLPA 4YGXB 4AJJA 2EEZA 4P2BA 4ZYZA 3KQOA 2IDZA 3F6PA 4CUKA 1M2JA 4JFAA 5AI5A 5JSQA 3ROEA 3CNLA 4RLQA 3K2EA 3NTUA 2ST1A 4YUVA 5LBIA 1Z56C 4JJAA 4DTCA 5AK4A 3L7NA 4GX2A 2KE5A 3K1YA 3ZV4A 2CK3A 3RRMA 2YMQA 4KCGA 4DT1A 5KTYA 3R76A 2NWQA 2VYNA 2W93A 1D8TA 5EJ9A 2XUFA 4RHFA 1YJBA 1QGUA 1I32A 2YZ7A 4JQZA 4D4GA 3IOEA 1TI7A 1E2BA 3D4BA 3UG7A 4BX2A 4WZBB 4MWSA 2QN9A 2WUEA 2HMAA 4L1KA 1UT5A 3UK2A 3O4VA 4XQEA 3PWTA 1Z33A 4TKLA 3D1VA 1F8UA 2PY6A 4NV0A 4C6RA 2W6ZA 1AN0A 3AM4A 5HDQA 3ROKA 4INOA 3LCRA 3U4QA 2QG9A 1ENZA 3EFHA 2GZAA 1HV8A 1XWFA 1E9SA 5BW5A 4XZ3A 3ZQJA 4LOKA 1QPZA 1QONA 3T5GA 2IQIA 2QV7A 3DEZA 3KTDA 1E1NA 1WUJS 2B0JA 3A2LA 1D7AA 3DKKA 5M04A 3BIJA 2VF8A 1X0VA 2F3QA 1QLWA 4RWEA 3WLEA 4WV3A 3SQLA 4OHYA 2I2AA 2R00A 2W6JD 4A8PA 2BTEA 2ZJBA 3Q7PA 4C87A 3MCTA 5AUOB 1M0WA 4NVRA 4WJLA 5ENVA 2O8NA 2PJZA 4Q3AA 3MVEA 1HA3A 3X1MA 1QKIA 3FE2A 1KMHB 4XUDA 1ONPA 2PR7A 5DO9A 5A5VA 4ENPA 5JNTA 4ZEXA 1UEXC 2PH7A 1RMYA 2DFVA 1AA9A 1K63A 5EJ2A 4FFSA 3ACBA 1OROA 3A6PC 3FD8A 1P8AA 2OWEA 5DRTA 2C7QA 2JEZA 1TCBA 2R47A 4DR6B 3FCUB 4TZ0A 4P5PA 2QW8A 2K4MA 4RE6A 3GBPA 1YTLA 2IZOA 4EIWA 1C81A 4IMPA 3B5JA 2YY5A 4CRWB 1NA5A 5JE8A 3RYTC 5AW7A 4DLUA 1TO6A 3VH2A 3KJZA 1MXHA 3LO5A 1HETA 4RIIA 4B43A 4QNRA 1W2WB 1UZMA 1E20A 3AHEA 3AOEA 3I28A 2FPOA 3HO8A 3N07A 3ZNNA 5TLSA 3PCRB 1ZZGA 2FWAA 1L0BA 1QX3A 4FS8A 2C2XA 4FGLA 3SJUA 4DADA 2OWDA 3OX1A 4DW8A 3K96A 3WGVA 1H8ED 2F43A 4XIGS 3W2HA 3CCBA 4MINA 2JAXA 3NM5A 3ZWCA 4E5DA 3RAGA 2V7EA 4NU5A 1ZJ6A 4X92A 3E05A 4HDSB 3X0DA 1KJWA 1IHOA 1O5IA 2AF3C 1ZCJA 2OFOA 5AOAA 1C0KA 2FKAA 1T2CA 5AI4A 2R5WA 3DEYX 4FDUA 4LNUA 3LQKA 4TXMA 2L42A 3K6SA 3DCIA 3H4VA 3I9V6 4YIHA 4MIOA 2NUPA 1DTEA 5BSWA 2XLBA 4RX1A 1W73A 2FGKA 2J48A 3OZBA 4JV5B 5DLPA 1QCDA 2C97A 3MQFA 1L5KA 3MCAA 3BA6A 3W8NA 4AJIA 4D6XA 4W1QA 2W2QA 2GDJA 1H66A 3S2GA 4FWIB 1QHSA 2C3MA 1ZUNA 5CNKA 1XRPA 2QRQA 5JECA 3TL3A 3AL2A 5ERYA 3FZQA 3F1KA 1OYOA 3QPAA 3KOYA 1RXWA 4QUHA 3ZE2B 1D9ZA 2WYOA 3BAZA 1WABA 5IFKA 1QQ6A 1TTQB 1TVKB 4UARA 4X84A 2PKQP 4K3UA 3UV3A 1ZH4A 2E4VA 1E4EB 5LDGA 1OC2A 1S8AA 4DXDA 3R3UA 1G8SA 2A2ZA 4AUNA 4BLUA 1G5RA 3CEHA 4G85A 1QF6A 4J0QA 5D84A 3TBFA 1ZPDA 1MG5A 1J00A 3AWDA 2IPXA 1U2SA 1PGOA 2W00A 2SCUA 4YI3A 4ZO6A 1OLSB 3G2QA 4G0MA 1NYTA 4DLXA 2XJ4A 3ZDZB 3PFIA 2OYSA 3HCEA 3OIFA 4Q03A 2X8WA 3HXPA 1ISFA 1IXRC 1J8FA 1YR3A 2ZJ1A 3T9DA 4YUXA 5IC4A 2XWQA 3E18A 4L73A 1JHPA 5BVHB 2HRQA 3ORSA 4JU8A 2OFXA 2QZJA 3RSZA 2QT9A 1Z12A 3IDQA 1YULA 3JD3A 1EZZA 4XJSA 4YBRA 4QA9A 4AT1A 4NAHA 4DYHA 2PGDA 1HDZA 4F91B 2ZE5A 5A0FA 3EGDA 2VP0A 3AERA 1F2UB 4HF7A 1Z82A 2EHJA 9ABPA 2D2EA 3EQZA 5AVTA 1P9OA 1VGVA 2BI4A 1VPTA 4EVRA 3F74A 3FUUA 4QBFA 2D1QA 4Q3DA 1JH8A 2F6RA 5GGYA 3QX3A 3LTNC 2QAJA 4WOPA 5THKA 2QTZA 1UMBA 3H5TA 3UWKA 1OAAA 3TOZA 4PAQA 4AN4A 1ZOLA 4PZEA 3WLOA 4BMZA 1Q0LA 3NTLA 4V0RA 1ZM2A 4G23A 4OHBA 3DGEC 3RFCA 5TGZA 3UJAA 1HKHA 3VZCA 1P2BA 4AD8A 3PWKA 4LRTB 3EJWA 3NT5A 4ER3A 1OC4A 2PUVA 3FYUA 4Q4AA 4NKRA 1Z7EA 4TLDA 5T3YA 2DY1A 2WLTA 1DV2A 2EWWA 1J7JA 1YL7A 3GDOA 2IPNA 2WIAA 1JXMA 4L3VA 2GD1O 2XMPA 4OHMA 3VR5A 4OREX 2XRZA 3PT5A 2H2DA 4ZMBA 2XUDA 3T0FA 1XRLA 3QX9A 3NAZA 1M6VB 3GAZA 1NUPA 1GUDA 3K0FA 1H2YA 1JL3A 1VGRA 3T5DA 3DLHA 3IPYA 5HTOA 2DJ5A 4YPFA 4PFKA 5DRYA 4PRKA 5IZCC 3QOFA 1JMYA 1VPVA 3H5WA 2HDNB 1XXLA 4FZRA 3ZYZA 4ABTA 1HL7A 1R15A 1KYVA 2GJKA 4PYQA 3SC6A 1Y33E 5LQSA 5CVCA 4YRCA 2INGX 2I03A 3A32A 2OECA 1NZDA 3ZDDA 4H17A 3IQZA 4BP9A 1BHJA 2A88A 3K70D 1I5OA 1LRLA 3N05A 2RI1A 5IWCA 4MQLA 3JWIA 1GRVA 4XDYA 1SQGA 1OLUB 5KYUB 1PQWA 2DVMA 2JBAB 1X87A 4CKEB 1U9ZA 4RSRA 4B4WA 2OOSA 1LSSA 2H4HA 3GQVA 3MJDA 2GUGA 4DJ5X 1ZONA 1XZFA 1Y5LA 5P21A 1NQVA 4X1YA 4L7VA 3R6GA 4OFWA 3GFGA 1BEEA 1E79A 3UAVA 3KB8A 4CGZA 4AK9A 1WPRA 3B2QA 2Z8XA 5LC1A 3BJZA 3Q3GE 2B82A 2WWGA 4M9XA 4DLTA 4MW0A 4TYWA 1ZW6A 4ZMSA 4DSAA 1P4JA 3OZVA 3DOUA 1I7LA 3MUFA 2C5GA 2QTNA 2HWXA 2NO5A 3RHZA 1XVVA 1OFVA 1JMVA 1P7WA 1U2QA 2WPDA 4MEAA 1ZR4A 1R6VA 1JBEA 5IAAA 2E37A 2DHDA 3UN1A 2OLEA 1LJUA 3D43A 1N2ZA 2KLHA 2WJJA 1EGAA 4UU0A 3L4KA 2QJOA 3Q9LA 4HNSA 5BWCA 4KIUA 2Z2ZA 5JS1A 3C0KA 3ZXYA 1CF4A 3AG6A 4Y2QA 4RGBA 3IQGX 1PUXA 5FFFA 3RV3A 3SCZA 1S6YA 1U2DC 4TM7A 1C8LA 4EZBA 2D1TA 4U8HA 2PUDA 2V96A 2BE7A 3NIDB 4F6RA 5JVDF 1QYWA 1WHSB 3L4BA 3WQBA 2ZB2A 1C9JA 3NM6B 3LXRA 2F4VB 4F1WA 1A88A 4HR7A 1KIFA 1MPTA 1NVAA 1QIDA 1U11A 1UZAA 2CF5A 1S8OA 2BM1A 3F3MA 1GPH1 4IZIA 5EESA 4WXEA 1HT3A 1YE3A 1E2GA 1G1AA 1ORIA 3IIMA 1F9AA 3OQBA 2ZUFA 3NHUA 4IP0A 4MRMA 1BQ3A 1WCWA 3LBHA 4B9AA 3ANSA 1IIBA 3CGGA 1YUMA 4OGWA 3O8QB 3SZ3A 1JT9A 5TEVA 3RYCA 4U5QA 2V8BA 5J5CA 5CCDA 1NNI1 2HRCA 1M2OB 3ELDA 4MV7A 4MUIA 3RG8A 2B5OA 1SC9A 3IHWA 4BECA 4OSPA 1JQLB 2ZRQA 5LJIA 2OYCA 1KR2A 1E2QA 3V5NA 4FGWA 4HAOA 1I33A 3C1AA 3D6AA 1BVUA 3P0HA 1GU1A 2MOKA 2DBZA 2XWSA 3EZ9A 4CTOA 4LQ4A 4MP8A 2Y1CA 1A8IA 4G1BA 3SF0A 4B33A 5LQCA 1VBMA 4F3RA 1TCVA 1KO7A 4O1MA 5ALNA 4LYEA 1TVEA 5JEEA 5DYYA 4GL2A 4EJFA 5JO0A 1I1QB 2G9NA 3O8NA 2GPTA 3WMXA 2RGCA 3WMGA 2J6IA 4AULA 3HPRA 3LWNA 4DSOA 5MHTA 4DQLA 1GL3A 4NP6A 3ZDXB 2FQWA 2C2HA 3U49A 4DDUA 1NXPA 2H92A 2Y1WA 3DOJA 4FI3C 4GBMA 4C7BA 5J63A 4K6HA 3BA1A 1YFJA 2RI0A 2WFLA 3EOAI 3GH1A 4R98A 3T5BA 5JPCA 2GERA 2EARA 2P9JA 3LT4A 3OM8A 5ERXA 2QVXX 2F8TA 2I3DA 5EC8A 4EW2A 1W48A 4JR2A 2PV7A 3H16A 4JT9A 1Q44A 4ZMRA 3PT9A 5ER6A 4C20A 5TQJA 2MHCA 4WA8A 2NUAB 4QL3A 5B2FA 1A8HA 1QO0D 3F47A 2DBRA 3SZMA 4B6SA 4C3UA 2OD9A 2Q8QA 1IG3A 1L7RA 4GXNA 2C2YA 1L4GA 1BMQA 3KHUA 3ODGA 3OZFA 4H6PA 3AQ4A 2OCXA 4JLBA 3UA3A 2Z6UA 2VP5A 2H1WA 2QTWB 1KVQA 2UVPA 2PCLA 4YB8A 3I30X 5FUBA 3MCWA 3I2JA 4R5HA 4DR3B 2ZM6B 5CYGA 5MN6A 4D25A 3E1SA 2AKAB 1UC4B 2I66A 3KZOA 3KUXA 2J6CA 4X6YA 1KMNA 4DARA 1RZRD 1JHQA 3GZTB 4LDNA 4LYAA 3GJXC 4DZTA 1NUUA 1ODLA 3FUVA 4WCFA 3ZVMA 2JEYA 3IEKA 1G8KA 1XHLA 4E13A 3DTVB 1OU0A 3CZ9A 3HBJA 3O90A 3ZU3A 1O96A 5K09A 4PN3A 4PHGA 2PL5A 3DDWA 3FPBA 1F4LA 3T94A 4F4JA 2ZRPA 4WESB 4PXYA 1JYEA 4HBGA 1BE0A 3IFSA 4ZPXA 1MIHA 1NDUA 2IU6A 1JP7A 4CCSA 3E5HA 3QITA 9MHTA 5FAXA 4ZI5A 5KKCA 1I1NA 2AF4C 3FCSB 1VMIA 2PKCA 3NR2A 4HJXA 2PTHA 5EZSA 3DWIA 1PTJC 4PO9A 3VJLA 2PWAA 3U7RA 1V5IA 1YZVA 4QPPA 1PJZA 3LKZA 2Z04A 3HJCA 3KE9A 4NJOA 2Q5EA 1SXQA 1T9KA 5T5QA 4IJUA 1S8FA 3EUWA 1AKMA 1HZZC 2WKPA 2EJCA 4GC5A 1EP3B 1BC5A 4ALMA 5AVVA 2HC9A 1I3LA 3EHEA 3KAQA 3P4XA 4WINA 3ELBA 2OHIA 5AMXA 4RTNA 1QFZA 3NKVA 1LBEA 4XXHA 4POOA 4JQCA 4LZWA 2L69A 4UCXA 1YCHA 3AW8A 1EKXA 1T2AA 2FETA 1XTQA 2QK4A 4Y6GB 4BMPB 1E92A 1QH1B 2ZANA 3WMRA 3T3GA 3ZNOA 4F5WA 4B6EA 1ACMA 3TM5A 4EK9A 4QDTA 4DV7B 2H1HA 3CRVA 5KMGB 4RCYA 1D04A 4JYBA 1DAFA 1ZI9A 2NPOA 2XB8A 5KJFA 4JYCA 5DHTA 1ZAKA 1I1HA 2QMEA 4NFSA 3UAZA 5K0SA 5JMOA 4M53A 3ENWA 1WY7A 3ZGLA 4EO4A 4S1TA 3B6ZA 2CJWB 2FMKA 5I7VA 4OGFA 5FOXA 1COWD 1A5SB 1DBVO 2AYYA 3A9CA 2PGLA 2Q5LA 1WZ2A 3H2JA 5FO0A 1QHXA 1QHFA 3GHHA 3MWKA 2OE2A 4N6OA 2ACKA 2OHVA 3L1UA 4GKJB 4ALIA 4XKJA 4IINA 2XYGA 1UAYA 2XNCA 3ZIAA 5JH7F 1E3MA 1DO2A 1MA0A 2N0SA 2G0NA 1ESNA 3AEKB 3DCJA 3OMWA 2YFQA 4WXRA 3RJTA 2H5JA 4W5RA 1P9WA 4B83A 1K0UA 5HW0A 2PSEA 2BDTA 2HJSA 3G0IA 3U6BA 4BZQA 4A36A 4RSHA 1VCMA 1YKFA 4DV1B 3PDHA 4DL9A 4QQFA 5K45A 1UJNA 4HX9A 3N2IA 4IH1A 3J81k 2OSBA 5I01A 3S2FA 4J03A 4AJEA 2PAAA 1NBME 1E0DA 1X7YA 2WV7A 4HDMA 3ICQB 1I3MA 4J1TC 3PFNA 3MCVA 4DMFA 3PXDA 4CLOA 2IODA 3FFWA 4HO1X 4IIEA 5FKJA 4ROTA 2B4QA 3DUFA 4U3JB 3A14A 5DHFA 3H7IA 2CNDA 5AJTA 3R5XA 5JAHA 2JCVA 1REQA 5FTJA 4QZVA 2GBCA 1KI1A 2ZS8A 5H83A 5TNXA 2Q3FA 2X5KO 4C4YA 3IT2A 5KQPA 4CM7A 1R4NB 1FPQA 2Y71A 3HXQA 3CH6A 3PLAE 1TUIA 4X63A 5KINB 5K8VA 1R5JA 5J1TB 1S2OA 2IEIA 1T36A 3KXDA 2VRCA 3N8GA 2J4CA 3ZUPA 1DKRA 4UM9B 1PYDA 2HSZA 2LCQA 4B8ZA 4K87A 3F90A 2NW6A 4K9RA 4MYTA 5EZYF 4YMHA 3I9LA 1KK2A 2GLUA 3AY0A 3X44A 1LWNA 5E0OA 5EJFA 5A3JA 1E5QA 1Z8HA 4UVDA 1E2HA 1PKEA 3DLPX 3ENNA 1PHRA 2AMJA 2Q2OA 5L53A 4EGCB 1J25A 2HZ7A 1U4NA 2X22A 3SLRA 1E6KA 2ZI5A 4LF6B 2X8LA 3EIEA 2R84A 3IH5A 3TGLA 1MT3A 2GX6A 3WDLA 3Q8KA 2OBLA 3E9YA 2C9DA 2IYZA 4I9FA 3T3OA 1T2NA 1UKZA 4RUKA 3UMBA 3UCEA 1I6WA 2GILA 2J46A 3VNVA 4OP2A 2NYAA 3HR7A 1KHTA 3HA2A 1NUTA 2OD2A 2WUGA 1IHUA 2NAFA 3HDHA 3KYDA 1A2OA 2IWHA 3S7ZA 3OCXA 4YR7A 4A2PA 3L7AA 3GLIA 1ZG3A 5GJCA 4L28A 5AW3A 1R16A 3WGNA 2VEOA 4ZODA 2I6GA 4A2QA 2H1OA 3HP1A 3NOQA 3LTEA 3U44B 1QUFA 3GLTA 3GN2A 4F6CA 2GCEA 4KAJA 4P4GA 4RULA 4LNUB 2AQIA 1C7QA 1PDOA 3SBDA 5IAGA 5AJWA 1ZNYA 1V96A 3AKDA 4WNAB 4L4UA 4LZLA 4Y2GA 3U0VA 5JDIC 1EFHA 1N9GB 2DHCA 1HTBA 3H5VA 1FP2A 2H52A 4MWBA 3ETHA 3QXCA 5EVJA 1Z38A 5IUNC 3P5BA 1R0LA 2Q9AA 2BMJA 1ZD5A 5HZHA 1EUCA 2RFLA 2ZIWB 3NHAA 2G9RA 2X76A 1FFSA 2ZI3A 3CE9A 3C8UA 5I7OA 1NJ5A 1IXKA 4OKNA 3T1NA 2CHQA 4Q00A 3TR0A 4PG4A 5KVCA 1Q0ZA 3N8NA 4KO2S 1LW6E 3T9FA 2HXSA 3PDCA 5I8WA 3TVDA 1GZ6A 5FDFA 3FCXA 5AO9A 2NYVA 3V4OA 1W36C 1V71A 4QU9A 1D1SA 2Q3DA 3ND5A 1RQLA 2EP7A 3NYRA 3NXSA 4G0YA 2GK7A 1BEZA 3HA5A 4YUZA 4CQMD 1NLZA 3DZIA 3HR8A 3HFSA 3KHTA 4Q82A 2AEMA 1NUQA 1C9MA 4PZPA 1I94B 3TIGA 3MJFA 1OYWA 1FY2A 2J3KA 3OKCA 3K1AB 4FX5A 1AD2A 1IB0A 2P68A 3RBXA 4OYYA 1N5MA 1ZW1A 1DLJA 2FCRA 1YBMA 2Q0XA 3AEQB 4LISA 4O2AA 4QXOA 3LYUA 3VBCA 4O0LA 1GKKA 4D26A 4GGOA 1MH9A 2QPAA 3NTOA 1I4TD 4YALA 4YMIA 3C7CB 5B53A 1NE2A 4F12A 1XEWX 4R2WA 5BT9A 2YHSA 4Q9KA 1BWRA 4PY2A 3HKCB 2XTNA 5K5EA 4HGOA 1VL6A 2IXAA 1RT9A 2O0KA 1EG7A 3OEEA 4RVGA 1EXVA 3AVPA 3HYLA 2NSLA 2HBRA 3FLMA 3ROFA 3C5VA 4Z1OA 2PK3A 1MEEA 2W2KB 3FPGA 4RXTA 4D9KA 1TIPA 1J33A 2VG8A 2NSDA 3VSEA 5LWQA 4TYYA 3FOFC 1VKJA 1ODJA 4MQ4A 2CFIA 2BCEA 4F8EA 1IY8A 1DKMA 1II0A 3AJAA 4MXDA 1L7QA 5AVUA 3NW9A 4QOFA 2ZTHA 4IJVA 3V4PB 1ORHA 3ZTWA 5SZIA 5TPWA 1KC3A 5B4VA 3CVUA 2CV1A 2PUEA 3RU9A 3IODA 3U4DA 5KAPA 2A1TR 2IHTA 1IJEA 1L7OA 3BE4A 3DOCA 3H75A 4RANA 2XD4A 1KZ4A 4YYZA 2RGGA 4NPHA 4HSEA 4RV5A 3BTOA 2O20A 2A9VA 2AW3A 1KEEB 4MKXA 5DI3A 3M81A 3K0FB 1D1QA 3EH2A 4OBWA 3SC4A 4IX1A 3VH1A 2GSWA 2IZ0A 3PNMA 5LYYA 4Q9IA 1A5AB 3IAFA 2J9FA 1IXYA 4AJ1A 3EEQA 1DU4A 3K94A 1E69A 2X6QA 3BB3A 3DJYA 1M7GA 2ZAMA 1Z13A 3DLAA 4MVJD 4F3YA 1JLRA 2BUBA 5EJ5A 2XE4A 2QVCA 1ZD3A 2JHGA 2FE1A 4RZQA 5FTKA 1FYXA 2M32A 2QZZA 5DN6A 4M1MA 1MRZA 1E6CA 1PSZA 1Z2AA 3DYBA 3NHYA 4ASUA 3E0QA 4E5NA 3H1TA 3GCWA 5JMPA 5AVXA 2WRZA 4A91A 3WNVA 4F06A 5JNVA 1HE4A 1F06A 3NRCA 3OC6A 5IKMA 2ADOA 3FWNA 2JFPA 3G85A 4HAIA 1SM4A 4FBLA 4NZPA 1V6SA 2IXDA 2P6MA 4JJEA 4YO8A 1R9MA 4F7DA 3RVLA 3BILA 2YWCA 1ISMA 5JJCA 2P75A 4X1YB 2OG1A 3B53X 3AIMA 3C39A 3KPJA 4PVDA 3I92A 3F7TA 4IYRA 3E3OA 4URHA 4M6WA 3GGSA 3OZXA 4MGYR 1NQWA 2ZJFA 3VPSA 3SN6A 4ETMA 1ZVKA 4HLUA 5KTPA 2EW2A 4ZAZA 1H0KA 2XVMA 1KZ9A 1Y82A 1NQAO 2XUAA 4KE8A 2EG9A 1LRJA 3EDOA 1ZM9A 3G5LA 1DAEA 1C7RA 1A9TA 2XRYA 2FWRA 1TGYA 2WAAA 3AILA 3WV4A 4N48A 5F4BA 1XMVA 2VRCD 3KPYA 2WU4A 2FFJA 1AK1A 1G4AE 3L6BA 1U3VA 4ILEA 1H3NA 2QR2A 2JFBA 3HACA 1VIDA 1S0UA 3OPYB 3QF7A 4MEBA 2I6XA 3FG9A 4ND8B 2FLKA 5KX5B 4QGSA 1FDSA 1NJSA 1VIVA 3AFNA 5LCXA 1VLVA 4Z9XA 3H9UA 4JX9A 3IQEA 4N5DA 3B38A 2JAQA 2V03A 2HCRA 3DM5A 3VZSA 1UOOA 5AHKA 1ORRA 8AT1A 5HM8A 3PI7A 4J76A 4DMGA 2QU8A 3UWOA 1IZZA 4KJZA 3I01A 4FWBA 1W34A 3IT3A 4OKIA 2ZTLA 1PJTA 4GLOA 1XNRB 4MUAA 3ESRA 2JJQA 5LD2B 2BMAA 1A82A 4P98A 5I4KA 3WIDA 4PTZA 2B9VA 2XB6A 3DD5A 3KFVA 2W2PA 1CUVA 1G8PA 1T15A 3B6MA 5TEWA 1DTWB 5B36A 2ZJOA 4UOEA 5AW2A 4KGVA 3OLVA 2E49A 4RZXA 4BNDB 4D82A 3JAWB 3QNWA 4FFBA 4HAYA 2NSYA 2YV4A 3GU3A 4R3NA 4X1KA 3SR4A 2RE8A 1A1VA 1EUYA 1XLTC 1PFKA 4Q24A 4B3SB 1Y34E 5JANA 3HCCA 2ZQ5A 1B8PA 1SBQA 1YBVA 3WLLA 1PFGA 2V45A 5KYXB 2FR0A 2PH3A 4HH1A 3WQHA 3HCPA 3DEIA 4G97A 4UCFA 2AFHE 3FR7A 1U8XX 3GEDA 3BHNA 5JCJD 1SWVA 1G2PA 3T41A 3UY4A 5BSFA 3U7HB 5DPMA 3UUWA 3NDPA 2R3SA 3JQ7A 3QBEA 5AKLA 5CFLA 4NCJA 3CVXA 5JJKA 4BO9A 5KNBA 1QYRA 3P9CA 2VTBB 2E87A 1G5HA 2IBTA 3EEOA 2VYFA 3BXXA 1U2PA 2OL4A 1PNOA 3DV0B 4JDUA 1MB9A 3R8FA 3UXMA 3ZYCA 4XPIA 3FI9A 1Z34A 2GCOA 2QMUA 4ZVOA 3RROA 3ZHOA 1O03A 5EJIA 2PYZA 3P2MA 4YJHA 4E6EA 3L0CA 1G0OA 2X2FA 5JNRA 2CYBA 3RV4A 1LBSA 2DM6A 3EQ9A 5L45A 1BS9A 3D2AA 3VAYA 2H1VA 3BRWD 3RC8A 2ZXEA 2DUNA 3KVRA 5C8DA 4PIPA 4BO5A 5JYBA 4QBGB 3LF2A 1OWMA 2X40A 3QRWA 3IEMA 3GWZA 3C5CA 2IFTA 3H3XA 3G23A 3HCNA 4OCZA 4BX9A 1SQ5A 1L6RA 1LC0A 3R9KA 3ND8A 3KR1A 1X13A 2VQEB 5FJIA 1W44A 5LA6A 4DJEC 3CRNA 3AOEC 4NE9A 3ME5A 1JPNA 1DX4A 1U5AA 1M6WA 1ZKMA 4GLBA 3TSOA 2YN4A 2LTAA 1HKUA 4CKCA 2VT2A 5ALXA 1UBMS 1W46A 3GO4A 1T5BA 1G6KA 3C3XA 1UBRS 1VG1A 2CBXA 4GWLA 2AYZA 1MZPA 2F3TA 1G7RA 1PV1A 2Q8NA 2WU8A 4FE7A 1BXGA 4GW3A 3GJ0A