5JDCC

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
237
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLPEEKDKWRRKVPLGRRSAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 237
sequence length 267
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcC00
2B4QA 1FDUA 4BNYA 2PZLA 2GSDA 2X0NA 5A1TA 4BUCA 5A03A 3DBLA 1V9LA 1O9BA 3H3JA 1C1XB 4EZBA 2JD0A 4UVGA 1DFGA 2HCTA 3HWRA 1LUAA 1YVEI 2D59A 1F12A 2IODA 1YB1A 4CL3A 3TWOA 1UP6A 3AK4A 3LF2A 5IXSA 3V2HA 1HF3A 3RFTA 1UZNA 3WIDA 4DA9A 2GASA 2J5QA 4CMCA 5LCXA 1VSUA 3B1JA 4XB1A 3TRIA 4KOAA 4GBJA 1ONOA 4A27A 4J4TA 4CLHA 3ZW9A 2VWPA 5A5EA 3IP3A 3PWZA 3I4CA 3TZKA 3L6DA 4LSMA 2WTBA 4WE3A 2QYTA 3FCOA 1QV7A 5COQA 2QRKA 4IDAA 2DT5A 1CWUA 1M76A 3FNFA 4ZQGA 1K5HA 3NEPX 1HYEA 3R0IA 2D2IA 2CY0A 3RC2A 1I3NA 1R4NB 3BTUA 3DTTA 4Q9NA 2ZTUA 4WNIA 4JXKA 4WGGA 3BHJA 2HMSA 2FP4A 3RIHA 4M1QA 3OA2A 4FD3A 4BNNA 3WYBA 1DDOA 4YWJA 2P9GA 4WLUA 4K28A 4MP6A 3SX2A 3JQEA 3K6JA 4F45A 2R00A 3PJFA 5TJHA 3JYOA 2Q1SA 1NHWA 4QUKA 2Z1NA 1E1LA 1XDWA 2X1HA 4TVOA 3QA9A 2I67A 4AJOA 5CG2A 1AUPA 1PZEA 3AU8A 2WSBA 3WOHA 1B14A 4U8GA 3H9GA 3KSDO 3EZYA 3MJTA 4CUKA 3Q2IA 1K3TA 2YHUA 3GUCA 1NPTO 2XXBA 3D4OA 1H6CA 2GDZA 4IDDA 4NNJA 5A3JA 4XZ3A 1NQ5A 2P2SA 3LT0A 2ZYAA 1LBEA 3I6QA 3RUFA 1FF9A 2VN8A 3LC7O 4OYRA 3VPGA 5TSDA 5I9MA 4E2WA 4GWKA 3E9NA 1MX3A 4NJMA 3RUHA 4CM9A 1ISGA 4J3FA 3BYZA 1NX6A 4BS9A 2A92A 2VYNA 1G0OA 3ZN2A 5A05A 2BMAA 2CVOA 3HB4X 2PTGA 2A9FA 4PG6A 1CJCA 3RVDA 3BHMA 1RYEA 1Z6ZA 4CMGA 3GOHA 1UXKA 2YDXA 3SJUA 3A4VA 4CQMB 2JCXA 3RUDA 1LLDA 1N5DA 3GN1A 4NHEA 4YRDA 1QR6A 2EGHA 3DBHA 4HFRA 4HNGA 1U4OA 2IYPA 4TZKA 3GT0A 2FZWA 3I4FA 3E9QA 3GFBA 3JQ8A 3WMWA 1V3UA 4K9DA 3H2SA 2BFMA 4RVGA 4AICA 1UDBA 2Q1WA 4QT0A 2CDCA 4LISA 3INRA 3HE3A 1U2GA 2DVMA 3CZMA 3D5TA 3PZRA 4CLRA 1U1IA 5BR7A 1E77A 4YJFA 5C37A 1ZFNA 4Q39A 4NH4A 1FXSA 2RBEA 2P5YA 2V6MA 2YYYA 4D7AA 5ICSA 4XQ9A 2GR9A 1Q7GA 4BNUA 1WDMA 3MJSA 3JQBA 4CUJA 3ZI0A 5CDTA 4N5MA 3EDMA 4J4BA 1BWSA 2AQ8A 4FIZA 4WCFB 2E48A 1GTMA 2VCYA 3TFOA 4BO5A 5B4VA 2P9CA 1SBYA 3OJ0A 1ZBQA 2X7HA 1GZ6A 2VHWA 4IQ8A 2YHIB 5IDWA 1EQ2A 1N9GA 3GEDA 4LCJA 3PHLA 4N5LA 1IE3A 3CH6A 3O4RA 4J91A 2Q46A 1HDCA 3C1TA 1J4AA 1YQGA 4RF2A 1F17A 1R4MA 1V3VA 3MOGA 1MFPA 3S2IA 4AG3A 3ZHZA 4XYMA 1DLIA 1VM6A 3K5PA 2NV6A 3W6UA 1DRUA 3ICCA 3F47A 1P44A 2VRCA 3PZBA 1EE9A 1TB4A 5BSHA 3NTOA 4JJGA 2J3JA 3V2GA 2FMUA 1C1XA 4NDNE 5I8ZA 3O9ZA 3VH4A 5JXWA 3AWDA 1ZK2A 2A4KA 3O03A 2IZ1A 4FJ1A 3GVHA 1QYXA 5K6AA 4KDEA 4EJMA 4CM9D 3AM4A 3VAZA 1L7EA 3GN2A 2F00A 9LDTA 4RLSA 4BGUA 2AG8A 3UVEA 3H9EO 1GUZA 1N7GA 3DZKA 3WNQA 2Z1MA 1ZSVA 4UEJA 2B36A 2EG9A 2NSDA 4B7CA 1PGOA 2C2YA 2FRDA 5A9TA 4KUHA 3AFMA 1O89A 5KJCA 3H9QA 3F3SA 3JD0A 3K73O 4HXYA 3GPDG 1QYDA 2B5VA 2V65A 4I9UA 3RI3A 5EL0A 4B3HA 4YJHB 2BFOA 4D0RA 5A4DA 3CZRA 1PQPA 1YE3A 3MWDB 3KXDA 1A27A 2ZTVA 3FWZA 3GH3A 3SC6A 1YOVB 4BNKA 2EJVA 4C7JA 3WDSA 4YBZA 1E3LA 2BGLA 3U4DA 5U9CA 1JKJA 1UUFA 1UP7A 4QFCA 2HUNA 5DP1A 2GZ2A 3RKRA 2OBYA 3PIDA 3L4BC 5IZ4A 2DAPA 1F8FA 5BSFA 3FHLA 1I01A 1E0DA 1FMCA 4LRTB 3KLMX 4JJIA 1QG6A 2ZQZA 1D1SA 3U0BA 5CP8A 5TGDA 1WP4A 5B1YA 1EK6A 1DRVA 4J0FA 2I3AA 3GNTA 1A7AA 3PQDA 2G1UA 4URFA 1P9LA 5T67A 3KEQA 4XGNA 4KWIA 1PWXA 1D7OA 1DC3A 1XKQA 3MOIA 4J7XA 3I52A 1G1AA 3GR6A 5T5QA 1IL0A 4J43A 2EEZA 3VPHA 4RPHA 4YRAA 4II3A 4WLOA 3I5MA 2D5CA 2ILTA 1I2CA 4G65A 1WVGA 2JHGA 3DB2A 1SOWA 3K9QO 5MGBA 1NBOA 3QVOA 2VRCD 3DC2A 3EW7A 3NRCA 1M6HA 3GGPA 2Y05A 4R16A 5KJ6A 4ITUA 2NU7A 3L0DA 5F21A 1RJWA 2DBRA 2X6TA 1NR1A 4BMNA 2VHYA 2NU8A 2FPGA 3D4PA 3R3JA 4XX0A 3TQHA 4CQMA 4EI2A 5J23A 3C7DB 2VTEA 1X0VA 1HE3A 2JJYA 2VWGA 4K1LA 3IS3A 5JC8A 5I7VA 4HNHA 5ITWA 3U49A 1ZEJA 1I30A 3E9MA 3DOOA 3KYBA 4XCVA 4RZIA 1A71A 4AJ4A 3V2UA 1LRKA 2B0JA 4PLCA 1UXIA 2NLOA 1BXZA 1LXCA 2PWZA 4PIVA 4QECA 5B12A 4MKRA 1UP4A 4H15A 5DF1A 4XJTA 4ZJUA 1PS8A 3ICPA 2DU8A 3F1KA 4ILKA 5DP2A 3ZV5A 1O6ZA 5L9AA 4JCOA 3OECA 5H81A 2EW2A 4MKXA 2QZ9A 5U4QA 4I8XA 2AE2A 4BL5A 5L4SA 1XCBA 4II2A 1HSZA 3ZZNA 4IMRA 2GLXA 2ZTMA 4FPXA 3JQ9C 1LSJA 2JFHA 3LU1A 4WCFA 1Y9AA 3NTQA 3QJ5A 4ID9A 3P19A 1SOVA 4NMHA 3ENKA 2PKRA 1DHRA 3U9LA 3D3WA 2YHIA 1HDXA 4LGVA 4PN3A 1N7HA 1E1NA 1PR9A 4WPGA 1HZJA 5IDQA 3R6DA 1GCOA 3LC2O 4CR7A 4E0BA 3EAGA 1HXHA 4FB5A 1J5PA 3VH3A 2WYVA 4ZQFA 3UAGA 2ZJ1A 4OMUA 4IDCA 1W8DA 2UYYA 3L9WA 1QYWA 4MPDA 1ISIA 4A7PA 4MINA 3GRKA 3I9MA 3AUUA 3SXPA 2CUKA 1L1FA 3ZWMA 4PLTA 3OIFA 1S7CA 4ALJA 1ZUD1 4EJ0A 3WGIA 3NDJA 1DIRA 1BDBA 1YH3A 1WXDA 1NAIA 1I3LA 1LRLA 2X86A 3MEQA 3ZGYA 1PEDA 1VC2A 1MV8A 4GI2A 2J5RA 5IG2A 2I3GA 3I3OA 4CR8A 4IPTA 3WWYA 2AE1A 3CTMA 4CV0A 1M66A 4DIOA 5CFZA 1ULUA 1AE1A 2P4HX 4BO9A 3IL2A 4ZD6A 1PGQA 2OBNA 3OP4A 2EWMA 2GZ3A 4KUGA 2J3HA 3E18A 5A9SB 3KLPX 4YAIA 4R5MA 4XDYA 3PDUA 5IN5A 4MO2A 4RLHA 4KUEA 2D4AA 1N92A 1H6DA 3WIEA 4E2ZA 4AVYA 3ZV3A 4CLEA 2VWHA 3VH1A 3QWBA 1JU9A 2Y1FA 2DBVO 1CIVA 2YUTA 1EQUA 1YDWA 2O48X 4YJHA 3JYPA 4EUHA 2E37A 4MKZA 4Z0HO 1YOVA 3VPFA 3ORFA 1JKFA 1HDZA 4BO0A 4Q3CA 4Y6PA 1T2EA 2VRBA 4BKUA 4L73A 4RQUA 1ISMA 5AXCA 5CDSA 4NBVA 5DT9A 2PNFA 5F1OA 4J90A 2VYVA 1YJQA 3HG7A 1K0UA 1H2BA 4G5HA 4WLEA 2NNLD 4UUNA 3PHJA 4R41A 3W8FA 3JD2A 5I7SA 3PK0A 3KYDB 3ANLA 1BXGB 1EVIA 1P1HA 2HJSA 4TRRA 4WEOA 5KJEA 3OSUA 3FNEA 5IF3A 4HFMA 4BQRA 2IYOA 1NFQA 4PZCA 3DMYA 3WR5A 4DLLA 5TJ9A 3WICA 3HJAA 4FJ0A 2SCUA 3CINA 5ILGA 2G17A 5C7OO 5T64A 1Y8QB 3ROQA 4MOWA 4J1SA 3DZGA 3GMSA 3GDFA 3H4VA 4J2HA 4D3SA 5C7LO 1Z7BA 4XDZA 1LQUA 2OUIA 2EGGA 4G81A 4YJGA 5EIOA 1G0NA 3S1LA 3S8MA 3U4CA 5JAIA 3NT2A 2JFGA 1QXSA 1XG5A 2X5OA 4E31A 1LLQA 1LU9A 3E82A 2I99A 4N5NA 4BNMA 4UEKA 4BKQA 1DJQA 1PGNA 4HX5A 2GGSA 2C07A 4EITA 3TOXA 2BI7A 1C0KA 2ZCVA 4ZU3A 2WWRA 1TT5B 4TZTA 1VJTA 4ND5A 3JD1A 2PA3A 5TT0A 1DSSG 1ADBA 1P1IA 4EYEA 4UUOA 1I2ZA 4BNJA 5JMWA 2VTDA 1IYZA 4Q3EA 1LDNA 1Z82A 2CSUA 4BO3A 1D4FA 5JDIC 4S3MA 1DLJA 5CDGA 5DBIA 1I24A 2JCVA 4R1SA 2PV7A 4BHTA 4P22A 4E6PA 2XOXA 2OMEA 1NPYA 3ULKA 1KY4A 3NGLA 4BV9A 1GQ2A 3PYMA 1AHIA 4R1TA 2Q2VA 4O59O 3BIOA 3GDOA 3QP9A 4QO8A 4CM8A 1KVRA 2Y0EA 4MVJF 2AHRA 4XEHA 1A9ZA 2PD6A 3W6ZA 4IJWA 3BA1A 3D4NA 4MVJG 3U4IA 4DIFA 4W9NA 1K89A 4TRNA 1U2DA 1YL5A 4Y9DA 4IGEA 7MDHA 2B4RO 3AM3A 4RCVA 2QG4A 4GX0A 3WJ7A 3GAZA 3FBGA 2H9IA 4DVJA 2YFQA 3WLFA 3L77A 1YGYA 3DHNA 1R0SA 1O5IA 2YV1A 4DIBA 2X9NA 1GZ3A 4R9RA 4TVBA 4RPLA 1KVTA 2AEMA 4IM7A 3ZWXA 4U5QA 2J3IA 1HYHA 3RAJA 2Q4EA 2GO1A 5TS3A 4PFJA 5DN9A 1BVRA 5JDCC 4LK3A 4JIGA 2Z5LA 1ENZA 2B69A 2ZB7A 1LJ8A 3DAPA 3DBRA 5JY1A 5GZ6A 3H9UA 1U3UA 1KVUA 1RM0A 1KEVA 3B70A 3D5QA 1T25A 5DZSA 1LLCA 2ZB8A 3I23A 4D45A 2O2SA 3IOYA 3JQAD 1F14A 2C0CA 4B4VA 5IFLA 1P1KA 3BZUA 4IIUA 4BKOA 1LDYA 1MC4A 5A9SA 2PGDA 1DIAA 5JCJA 3HNPA 1EUZA 4L4RA 3EVNA 4MIYA 1ADCA 4JBGA 1H6BA 5LC1A 5CDYA 1XSEA 4DQVA 3GY0A 1AXGA 4LRSB 4B4WA 4PG7A 4J1QA 4O5OA 2HO5A 2EW8A 5GY7A 1P1RA 4D3DA 4R68A 2AEJA 2IEBA 3RJ9A 4A03A 3FBTA 2O7SA 4NU5A 2P4QA 3WGQA 3TZCA 4W6ZA 3FTNA 4B7UA 3WGOA 2X0IA 1LSUA 1I33A 1BW9B 4DGSA 3T7EA 3HHPA 4CM7A 1B0AA 2DUUA 5HM8A 3GGOA 3TN7A 4RORA 3ZHBA 1GEEA 4RVSA 2HKIA 3A06A 4AJ1A 2W2KB 4DC0A 4M49A 4I9NA 5C5IA 1EVJA 4GX2A 3UCXA 1Q0LA 2H63A 2J5KA 2WD8A 7ADHA 1DO8A 4OSOA 2NM0A 1Q0QA 4B7XA 1JN0A 3K96A 3MZ0A 1NFFA 1U5AA 3DO5A 1MA0A 4BQPA 3B1KA 3M1AA 1BXGA 2BD0A 4XRGA 1MC5A 4B8WA 3SLKA 3P2OA 3VVCA 1QSGA 4E5YA 5JC1A 3IQDB 1R6DA 4YJDA 1A5ZA 4RPKA 1EFLA 1U3WA 2Z95A 5KKAA 5JW6A 3DZIA 1OC4A 1SEVA 4L4XA 5L7TA 2FWMX 4GPD1 4BO4A 3PFWO 3WTBA 1Y8QA 4MVJI 3OETA 3MJCA 3JD3A 4GKVA 5T8KC 4JROA 1LTHR 3VOSA 3ZCXA 4C7KA 5L51A 2HMTA 2FR0A 1D1TA 1ZXBA 2C82A 5JCXA 2O23A 1T4DA 1IPFA 1E7SA 4A73A 2R00C 1IUKA 1YONA 4CMEA 3DZFA 4FOSA 4IJVA 5DDIP 3NX4A 3Q2KA 3RASA 1I32A 1R15A 3BTOA 1ZZEA 4YAJA 3UN1A 1U8XX 4IGFA 3AM5A 2VUUA 3TFQA 1KEUA 4U7WA 1IOLA 1TT5A 3L07A 4ZVVA 1U3TA 3H9JA 1EBUA 2BF7A 1DEHA 2CD9A 4HV4A 1YWGO 4QSMA 2C20A 3HUDA 1B8UA 4FQ8A 3V1YA 1NP3A 4XQGA 1B3RA 2CF6A 4OAQA 4IDBA 4IDEA 4K6FA 5JCJD 4B3JA 4OKIA 4IQGA 2DFVA 3HQ4O 1V3TA 3F6YA 3VC7A 3D7LA 4IUYA 3VKUA 4RVDA 2AQHA 4KP7A 4R01A 3PEFA 5HRUA 4AJHA 1OMOA 2AA3A 1FDSA 1PJSA 3T7CA 1XYGA 4LSWA 1FDVA 3ADOA 1M6WA 1NNUA 2PFGA 4BNTA 4D42A 1YBAA 4A2CA 1XA0A 2VZ9A 4TMFA 4BO2A 4LCEA 4WEQA 3QRWA 4YACA 4R51A 4BOYA 3WBBA 5I9LA 5L4NA 3QHAA 2PH3A 1U5CA 2RHCA 2HRZA 3OM9A 3HFGA 3LLVA 1M67A 3CMMA 3PGJA 5DBFA 2Y0DA 2OOSA 4ZGWA 2EKPA 3ANNA 4M89A 1NR7A 1T2AA 4W82A 3W4JA 5TT1A 3AFNA 2Y1OA 3QVXA 4FC6A 4NK4A 5THQA 1NAHA 5ICMA 1LLUA 3F4BA 4BNVA 3INTA 1YDEA 3WXBA 4ZQHA 5AXAA 2B83A 3M2PA 4E5NA 1MUUA 2ZTLA 2PH5A 3JQBC 1V35A 1Z74A 5U1PA 4EBFA 5KJFA 4FR5A 1X13A 1E7MA 3RC7A 5DOZA 1BVUA 3L6OO 3NJ8A 4RDHA 3KYCB 4G2NA 3F4LA 1VL0A 3PIIA 4OQYA 4B4OA 5JNLA 2Y1DA 1AHHA 4GWGA 4RQTA 1O8CA 5CHEA 2W90A 4J49A 5FFFA 4GAEA 1P33A 3EUWA 2J6IA 3ONDA 3OIGA 3QWFA 3GQVA 3GRPA 3LT1A 4CM1A 1BXKA 3ADPA 3D1LA 3QWHA 1T4BA 4BNWA 4IMPA 2RH4A 4JK3A 1DFHA 3MJEA 3N7UA 4Z3KA 4R5HA 3UOGA 5FYDA 1D8AA 5KVCA 2OFPA 3IUSA 1ZNQO 4J6FA 4CUZA 3ON5A 1VE9A 3OJFA 3ZWCA 3LDHA 1K6XA 4A5OA 4QXMA 4P4LA 1P0CA 1HWYA 4BO7A 1BW9A 3EK2A 4GVLA 4UEOA 4Y67A 3F46A 4CMJA 1HT0A 2AQIA 1W6UA 2RHRA 1EMDA 1GQQA 2H6EA 2J3KA 2O4UX 3GHYA 2CF5A 4IIVA 2OXIA 1VJ1A 3RKUA 3BXXA 8ADHA 2W2KA 5K6AC 1I10A 5G0WA 2G5CA 4TKMA 4CV3A 2XXJA 3WQSB 5FF9A 3FNHA 2EXXA 4A0SA 1YRLA 1MFZA 1X7HA 2NTVA 4YT4A 1MLDA 1T1RA 4PLWA 4BB5A 3JQFA 1H9AA 4CV1A 2ZKLA 1HDGO 2NTJA 4WLVA 3QV1A 4DBZA 3BMQB 4Q3NA 1IHXA 4NBTA 4QEDA 3U09A 5DULA 4ALMA 3SVTA 4M86A 1YS4A 4Q3AA 5FWNA 1FDTA 1O95A 4L0QA 4XYGA 2FY8A 2O3TA 1BDMA 1CETA 2W2LA 1B8VA 4RPJA 2D3TA 5F3RA 3EC7A 1E1MA 4EJ6A 1B8PA 4Z3DA 4B8ZA 1JVSA 1IZ9A 1O0SA 3PVZA 3NAQA 1E3EA 4FJ2A 5KNLA 1H6AA 2IE0A 5EQFA 3C24A 4L8VA 2EIHA 4XR4A 2NACA 4JN6B 1GUFA 1QLHA 1J49A 1C0IA 2CFCA 3SEFA 4NBUA 2E82A 2VYND 4ZQEA 3QE3A 1C0PA 1KC1A 5ENDA 2VUSA 5I7EA 1HZZA 2B5WA 1VRWA 3KETA 2G0TA 3W1VA 1UR5A 2AEFA 3ASVA 1QLJA 1I3MA 2Q4BA 3RC1A 3V5NA 1SMKA 1CYDA 3E5RA 4YEDA 3MWEB 1R4NA 1P0FA 1DHTA 4J1TA 4GKBA 2BI8A 3PXXA 4I08A 3UHAA 1OAAA 1NWCA 3DONA 3W8DA 4F3YA 1KS9A 1LDEA 1W4ZA 2O3UA 2DTEA 5JPIA 1DAPA 4E2YA 4DQXA 3W4IA 1BRMA 3C3XA 4JBIA 3TNLA 3TDKA 4YT5A 5HTOA 3PHHA 3ITDA 2FSVA 2HRBA 5TIIA 1Y1PA 2B37A 4QTZA 3WB9A 4D46A 4WKGA 2CNBA 2D0IA 3DAGA 2CVZA 1Y5RA 2ET6A 2X8LA 1IPEA 1KIFA 4MVJE 4OOEA 5EESA 4FW8A 4DYDA 5KOIA 4DBVO 4UREA 2EERA 3V1UA 2RCYA 1DAOA 3WGGA 3ZHXA 1ZKMA 2P68A 3GF4A 3RU9A 1E5LA 3GLQA 1MG5A 5BNTA 5L95A 3CPSA 2VOEA 1R16A 3NDRA 1ENOA 4NI5A 4BKRA 3K2BA 1MXFA 2O50A 3PWKA 4D41A 4E4YA 4D0SA 5L7YA 5T6BA 3I9NA 1PX0A 2DBQA 1Q7BA 4Q3DA 3I9KA 3PTZA 4RF4A 3ENNA 4BV8A 3UXYA 3KSUA 5AQ1A 3ABIA 4XKJA 4A10A 3BMCB 3UH1A 3PJEA 4IINA 1YXMA 4WCFC 4K26A 5FI3A 1Q1NA 2DPHA 3IIEA 4A26A 4OKNA 1HLDA 4IQ0A 3GK3A 4KZPA 4O0LA 1IY8A 3TL3A 4NZ9A 3RQSA 1V8BA 3M2TA 4JNKA 3B6ZA 1GCUA 1R37A 5IAAA 2HDHA 2C7VA 1H94A 2YZ7A 3G3EA 1E3JA 4E12A 1WMAA 3KM0A 4AL4A 4YQZA 4LW8A 1KVSA 3DAFA 3E8XA 3E6AA 3A28A 3BMOB 3S2EA 3VDRA 4EDFA 3OEYA 2PZMA 4F6CA 4ND4A 5TNXA 1TXGA 1UAGA 1AN9A 1PJ4A 5HS4A 2JD2A 4PG5A 2HMUA 1IHYA 4I5FA 4BNXA 4YT8A 1VPDA 3DTYA 3GNQA 2EF1A 4ND2A 1H2HA 1I0ZA 4IZIA 5KKCA 4Z9YA 1XU7A 1Z73A 5L3ZA 2ZK7A 3WNVA 3FNGA 4PLGA 4DYVA 4JQCA 3C1OA 4BMSA 3S2GA 3UGKA 2BH9A 1PS9A 4PZDA 5THKA 3HSKA 1GPJA 4HUJA 1T24A 1F06A 2I76A 1VI2A 4ND1A 1PJTA 2GF2A 2FSSA 2JCYA 1NQTA 4IDFA 3BMQA 5JFOA 3BHIA 2VWQA 2Q49A 3A1NA 3DL2A 1M2WA 2Q1TA 1E3WB 4FOOA 1XQ1A 1OFGA 1UXHA 3EGOA 1A4IA 4UULA 3UCFA 1SCUA 2YY7A 3HDJA 4RJTA 3WBFA 2BELA 3L9XA 4Y6SA 3TZQA 4OXYA 2B35A 4N54A 5JO0A 3KEOA 2J8ZA 5G2OA 1IZ0A 3VVBA 4PGFA 1YO6A 1GEGA 4CM5A 3K31A 3QY9A 2NVBA 3W8EA 2JAHA 5EPOA 3RUAA 1BSVA 4XWYA 4ZQBA 5A06A 5JSFA 1B15A 4LN1A 2WDZA 2YDYA 2HAEA 3C7CB 3PYLA 5HS6A 4AJ2A 1BHSA 3NT4A 2W4QA 5G0UA 5IZCA 4YVFA 1KY5A 3NGXA 2YQ4A 3DFUA 2AG5A 4KDFA 2O2YA 2TMGA 1UDAA 1SAYA 3JSAA 3WLEA 3JQ9A 1LEHA 4FFNA 2NUAA 4BMVA 2NVUB 4CQMD 4LVCA 3X2EA 3IDSA 4FBGA 5ES3A 2FPPA 2WE8A 4RPGA 3IKTA 1DOHA 1GL3A 3AJRA 3AOEC 4ALLA 4RVFA 4J16A 4OXNA 4GH5A 4QFDA 2Q3EA 4E13A 4DMLA 4FC7A 4XD2A 3SBOA 3TOZA 2X0JA 1N8KA 5JYEA 1DBVO 1KEWA 1CQJA 4YAGA 4XGIA 4NBRA 1HTBA 1ULSA 4MVJH 3QW2A 1W73A 1JW9B 1ZIDA 4R54A 5B4UA 4NJOA 5BNFA 2C54A 4CLOB 2GPTA 4PRKA 4ALIA 1PU2A 1FK8A 3G49A 3V1TC 4EEZA 3E48A 4XIYA 4J4HA 4GX1A 2POQX 1PZGA 4AFNA 4XB2A 5A5FA 5AOVA 3ZU5A 4GLOA 4IXTA 2PGLA 3P7MA 1ZK1A 1QV6A 5TF4A 1MG0A 3ZWYA 2OORA 2DPGA 2O3QA 5G0SA 1CEQA 3ANMA 3OEWA 5IDXA 5JBIA 3OJEA 4INAA 4H16A 4GMGA 5DCWA 4DLAA 2P9EA 3DEYX 1HRDA 1LSSA 2DUWA 1E7WA 3C8MA 4DQUA 3IAHA 4OOFA 1XEAA 1LSOA 2O3RA 3LT4A 1UH5A 1OZAA 1UJMA 3BMCA 1YKFA 4E5KA 1V6AA 4I9HA 5JAMA 4U0JA 4W9NC 2HK8A 2HSDA 3KV3O 2B4TO 4FGWA 1PZFA 3ZHYA 4GSLA 1R66A 1NM5A 5TC4A 1QYVA 3FPLA 1VKOA 1X7DA 2C5AA 3H2ZA 1KC3A 4XYEA 4HWKA 3ETGA 5G4LA 5ER9A 5IN4A 5LDHA 3ETDA 4BO8A 5EJ2A 2Y99A 5JY6A 3GAFA 2QQ5A 3ZNOA 2HJRA 8LDHA 3LK7A 4WK6A 1QMGA 5CPBA 1LQTA 3BMOA 3RBVA 5IXYA 4RF3A 3ZNPA 5G0TA 2Q2QA 3ASUA 1A9YA 3ZDFA 2HMVA 1C1DB 4TRJA 5EERA 1EVYA 3PHGA 5JO9A 3RROA 3DOJA 3T4XA 1WWKA 4PG8A 1RYDA 2EKLA 3KHUA 3RSHA 4YPOA 4P8RA 3RWBA 3BMNB 1EK5A 4NQZA 5KTKA 4OM8A 4DMMA 3MCVA 3X2FA 1H93A 2BLLA 2D5AA 1QORA 3AI1A 4BKPA 1BG6A 1GQYA 2DQ4A 4IY1A 1LDGA 4GMFA 2AQKA 4WJZA 4M87A 4JJFA 2WMDA 4CODB 1JWBB 4E21A 1CRWG 4WOJA 1PL8A 2VYVD 2ZIZA 4FSHA 4EGFA 3JQ7B 1DXYA 1RPNA 4YYZA 3AW9A 3OMLA 1A7KA 5DBGA 2UVDA 3WSWA 4BB6A 1E3WA 1SNYA 1E1KA 3BAZA 3GGGA 1GY8A 3OJOA 3OIDA 3CUKA 1JDJA 1U7TA 4Z9FA 5ER6A 1E6UA 1HSOA 1PZHA 1VL6A 2QX7A 2CMDA 4RVUA 4TROA 3N58A 1VSVA 4IDGA 4Z6KA 1WPQA 3VH2A 4OHUA 2V6BA 1B3BA 1DC5A 1B16A 1MXHA 3OHSX 5DCYA 5BSEA 3PYXA 3QWAA 3FI9A 1EZ4A 4IZHA 4M55A 5IJZA 1GAEO 2OP0A 1GV1A 2RAFA 5I7FA 3JV7A 1ISHA 1RWBA 4DUPA 4PVDA 3FD8A 4P4NA 4CMHA 4FFLA 1NVTA 4NIMA 4R9SA 1YL7A 1E5QA 2YV3A 5HA5A 3JCZA 3MTJA 3I83A 3H65A 5DCUA 1NHGA 1XU9A 2O3SA 3GZ4A 2HK9A 4BO6A 2QRJA 2JL1A 1PJ3A 3A14A 1JKIA 2YQ5A 5GMOA 5GZ3A 4DXHA 4YCAA 4MP8A 4CM4B 1ZSNA 3LT2A 1X1EA 2X22A 5TRTA 2QRLA 3RD5A 1PSDA 4CMIB 4CMKA 4XYLA 5C3MA 1IB6A 1SC6A 2Y67A 3DBHB 3H5NA 1IULA 2PKQP 3RJ5A 3PHIA 4RGBA 4GQAA 4Y6RA 4LMPA 2AMFA 5DNAA 6ADHA 2JKVA 3ZU3A 1CDOA 5JS6A 1ADGA 2GN8A 2I66A 3C85A 3NJ4A 2GRAA 2ZB3A 2E4AA 3CKYA 4I5DA 3ROPA 5KWEA 5A04A 2F1KA 4HY3A 1NPDA 5CEFA 5JDCA 4CMEC 2W8ZA 2VUTA 4ZN6A 1EFKA 2OL4A 4KQWA 4NFHA 4CLOA 2IXAA 1JVBA 1LX6A 4Q3BA 3KYDA 2GN6A 5B37A 4J1NA 4LMRA 4RV9A 2P91A 3KSZO 3O38A 1SB8A 1Y5MA 2GUGA 4NK5A 4E5MA 3DWFA 3HDHA 4FN4A 2HK7A 4ZHSA 4E32A 2VOJA 1DFIA 3DZHA 3JYNA 1LRJA 4QO7A 1GYQA 4OL9A 1B2LA 2IRWA 2QZZA 1HE5A 2I5PO 4CQLB 1C3VA 1KBZA 4MDHA 1NYTA 4PG4A 5ENVA 1WLYA 5G4KB 4AJPA 2R6JA 1HEUA 4ONEA 5K0ZA 3GEMA 2OO5A 3M6IA 2BKAA 4GLLA 3EZLA 4XJSA 3EYWA 4XYBA 1C14A 4L9RA 2EHDA 4DC1A 2GN9A 2WE7A 3CIFA 1ZVMA 2NTNA 3RC9A 1HYGA 3GHHA 2GERA 1Y7TA 3I9JA 4DPMA 3IJPA 1NXQA 2CDBA 4N7RA 1Q7CA 1LDMA 4R69A 5CEJA 3BTVA 4IXWA 1HDYA 2X58A 1NFRA 5JMPA 1E3SA 3U4HA 2Y1CA 4RO0A 5A9RA 2PKQO 4RZHA 4KWHA 3JQDA 4ZRNA 2UV8A 1I36A 1KYQA 2PK3A 5ITVA 3NTRA 1I3KA 2FZEA 3O26A 5A02A 3RCBA 1N1GA 1WZEA 2P5UA 4BNGA 5L45A 2GZ1A 4HFNA 5JAZA 3EHEA 1DC6A 1LA2A 3IKVA 3HN2A 3U5TA 2NWQA 1U4SA 4J2OA 4TRMA 3D0OA 3Q3CA 5MDHA 3DMTA 4R4JA 1ENYA 1C1DA 1KEPA 2BGKA 3L6EA 2VZ0A 1H0KA 1K6JA 1PJBA 2VNAA 4EUEA 2C2XA 3BMNA 1HE2A 2I65A 3P5SA 2DKNA 3JYQA 1VLLA 4HFJA 1P74A 5AXBA 5T8KA 1ZXLA 1HDOA 2JAPA 2Y1GA 3WS7A 1EDZA 2NADA 3PJDA 1GFSA 3VZQA 2Y93A 3RU7A 4OH1A 5COAA 2ZYDA 1ZO8A 3JQ7A 4CL8A 5CEEA 5KJ1A 3WMXA 4AJJA 4U6QA 4D3FA 3H7AA 3DFZA 3DOCA 3ROKA 2UDPA 3EMKA 4R1NA 6LDHA 1WDLA 4FGSA 3WGZA 4FFRA 1ID1A 3GNSA 1OI7A 2FHSA 2OHXA 2WEKA 3TZ6A 3WQQA 1CQIA 1WDKA 4QQRA 4E30A 1U9JA 1J0XO 3K2EA 3TJRA 3RBXA 2TMDA 4F6LA 4MJLA 1XELA 2ZJ0A 4XIJA 3K8ZA 1V0JA 4CLDA 2Y66A 1GYPA 2HMWA 2HQ1A 3VZPA 3JYLA 3OH8A 3K92A 1SB9A 2X5KO 4OSPA 2WYWA 3SC4A 5L40A 3F9IA 3HB5X 4GGOA 1UXGA 3GG9A 4DPKA 2BHLA 3JQFC 4ROSA 2PZJA 4PZEA 3F1LA 4CMBA 3HADA 3NKLA 2EV9A 3AU9A 4CM4A 3IJRA 4CR6A 2ZATA 3K30A 3H5RA 4BGIA 2H5LA 1YB5A 1M75A 4CMIA 5I9NA 3N74A 2BFAA 3GVPA 4YT2A 4EUFA 1OOEA 3UCEA 3FSRA 3G17A 9LDBA 2WYUA 3GDGA 3WJAA 4JP3A 1TA4A 1EE2A 3JQGB 3UUWA 4D43A 3CXRA 1PJLA 4J7CA 1J6UA 5K9ZA 4UUPA 3U62A 1ZK4A 1LC3A 4FFOA 4XRRA 3AUSA 4TKLA 1PJ2A 3QVWA 1HETA 1SZJG 4PLFA 5IDYA 3O8QB 3VHRA 1H9BA 3TSCA 4OIMA 1NTOA 2PZKA 1W0CA 3HDYA 4HBGA 4W7HA 5T57A 1TVEA 3ZNQA 2OP1A 3FR7A 3JTMA 4FDAA 3ZV6A 2X0RA 1FDWA 1U8FO 3VZRA 1ZMTA 4CPDA 2X5JO 1GZ4A 3I6IA 4YDRA 3D3WB 4CQLA 1N2SA 3KTDA 2G82A 2NQTA 5G4KA 3I9LA 5COBA 2XAAA 3H3FA 4CLXA 1F8GA 3TZHA 3R3SA 4TQGA 2LDXA 3PRJA 5TLSA 3PQFA 4AJEA 5L7WA 4DL9A 1GD1O 1GPDG 4D44A 1NASA 4PRLA 1KETA 3WYCA 3BTSA 1D3AA 1U28A 4FCCA 3CE6A 3FPCA 3LQFA 4UUMA 3PPIA 4M8SA 1DRWA 2EP7A 1SEPA 3LF1A 4J0EA 3E1KA 3DHYA 1VJ0A 1XQ6A 2Y0CA 3NDIA 3GVXA 1QP8A 4UVEA 4MIOA 3T4EA 3RUEA 2Q50A 2RIRA 2EKQA 3QQPA 3W4KA 1JLLA 3NYWA 1F0YA 1X15A 2UUPA 2DFDA 3D3EA 4RF5A 1U7HA 5KCZA 4QX6A 1AXEA 1NQOA 3AY7A 4L75A 1E7YA 4YAEA 4ZRMA 2ZCUA 3LC1O 3ROMA 3Q9NA 1HDRA 1PQUA 5EQDA 3COSA 4H7PA 1JQBA 2X9VA 3DZJA 3VTZA 1PR3A 1SO8A 4WOKA 5A3VA 5KIAA 5F1KA 3SLGA 2X4GA 1XIVA 3A9WA 4YTEA 5JAQA 3PFFA 1TI7A 4IS3A 1YQXA 2YV2A 2WM3A 4ZICA 2O4CA 3IUPA 2G76A 1ZSYA 4DLBA 4RL6A 4MVJP 1NQAO 2BFPA 1X7GA 3GA0A 1E7QA 4XGKA 3ONEA 3QLJA 4L76A 3ZWVA 3B1FA 4XA8A 5CG1A 3L4SO 4MP3A 5LDGA 1UAYA 2VZ8A 2YW9A 1P31A 1U3VA 5F5NA 4J7UA 1E3IA 1KERA 4I1IA 2FOIA 1P77A 2A94A 4OQZA 4AJNA 3PP8A 1PTJA 4CM3A 2PR2A 4H3VA 4PLHA 2XPCA 5L4LA 5JYDA 3GFGA 4FFPA 4Z0PA 3FR8A 4IS2A 3GVCA 3AUAA 3ZU4A 1E92A 4BIIA 1P1JA 2QYSA 4RDIA 1Y6JA 1ZMOA 2IZZA 2WD7B 1WMBA 2W2LD 3CMCO 4X54A 5EN4A 4R3WA 1T2FA 5KVQA 4E5PA 1BMDA 3KYCA 4W4TA 3PQEA 3IC5A 4GVXA 3GUYA 3GZNB 3JQAB 5AXDA 3WWZA 1HKUA 1DIGA 2Y1EA 4XQEA 2C29D 3GG2A 2FR8A 3KO8A 3WFJA 4BGEA 4UAGA 4YJGB 4ALKA 3L4BA 2Q45A 4I5EA 1TEHA 5F1PA 1ZJYA 5JE8A 4Z0TA 3ZNNA 3QWIA 2VNSA 1ADFA 5H83A 3MJ4A 3Q11A 2QHXA 3WTCA 4KTVE 3KBOA 3S55A 3Q1LA 3ITKA 4UVHA 3RUCA 1XGKA 3F5SA 1NVGA 4JLWA 3JQCA 1ZW1A 1MGOA 2FPIA 1XR3A 2UAGA 4HP8A 3S2FA 1DIBA 4WECA 4F46A 1LC0A 1MB4A 3JQGA 1P1FA 2DTXA 4OXKA 5BT9A 3VDQA 4DRYA 4O6VA 4B4UA 5CAEA 3H5AA 3GVIA 5GZ1A 1E6EA 2VHVA 4B79A 2JFFA 3WQRA 1B7GO 1A4UA 4J9UE 1ONPA 2OZPA 4HADA 2H1SA 2DM6A 1HLPA 2W98A 3OJLA 4NFYA 1ZK0A 5IZCC 2HLPA 1VKNA 4NBWA 4OGWA 3O8QA 4CM8B 3HDQA 1TLTA 2DTDA 5I8WA 2IDZA 4XR9A 2C5EA 3KVOA 3KRTA 3SJ7A 1ONNA 2O3JA 4WNCA 4YRBA 3ZWBA 1GV0A 1YQDA 2IXBA 1G6KA 2PD3A 1Y8RB 1UXJA 1OC2A 1Z7EA 2AW5A 4W7IA 3IMFA 3E5MA 2QW8A 4BGVA 3ONFA 2V6GA 4JBHA 2EJWA 4U0KA 3WGTA 2Q1UA 1YL6A 4WLFA 1FJHA 2IEDA 4WASA 3ZWOA 1RM5A 3CSDA 1GR0A 2PLAA 4DWVA 1PJQA 1RM4A 4GX5A 1JWAB 1S6YA 1JA9A 1DIHA 3VPSA 5ILOA 2FR1A 1YJ8A 1K2WA 1LNQA 2LDBA 1MP0A 2E6UX 3DBRB 3STHA 1HE4A 3DZBA 4W99A 3VKVA 1T1SA 1X1TA 5HWSA 1O94A 5KVVA 5G0VA 3WFIA 1Z45A 3H8VA 3R1IA 4OJNA 5BSGA 4Z9XA 4AJKA 2Q99A 4E33A 1E6WA 2RH8A 3ZWPA 3AOGA 2VQ3A 2V7PA 3JD4A 5CPFA 3VZSA 1K6IA 4U6SA 3GC6A 5CDUA 5AVOA 3QIVA 1QKIA 1EDOA 4B3IA 1GADO 3ZV4A 1UZMA 1HL3A 2JD1A 2IZ0A 2YJZA 5TQVA 5L53A 5F5LA 3NV9A 3FF4A 3QSGA 3OICA 1CERA 4ALNA 1UZLA 4Y8VA 2C7GA 4GSKA 3OQ1A 4UVDA 3LYLA 2GYYA 1ORRA 1DC4A 4CM6A 1T2CA 4FS3A 2E49A 5H82A 1OBFO 5BNIA 5AYVA 3V8BA 1WW8A 1QYCA 3NUGA 2Y68A 1R0LA 4YQYA 3WGHA 3HFSA 2DLDA 3KUXA 4HKTA 1B26A 4XQCA 3I9OA 3WSVA 2PD4A 4CJXA 3OA0A 3PI7A 4PVCA 2UUOA 2DC1A 2ZYGA 1DB3A 5C7IO 2BGMA 3DDNA 2GCGA 2VT2A 3Q0EA 4AJLA 3ZWAA 1GYRA 4RVHA 1XLTA 3FTPA 2PGJA 3F5QA 3G0OA 4YB8A 5FEUA 3OBBA 1QRRA 3Q9UA 1PJCA 1PS0A 3AOEA 4S1VA 3VTFA 1R12A 1PIWA 2WD7A 3CEAA 4MIEA 1DJNA 4TSKA 2O7QA 3DBLB 4L4SA 4WUVA 1XWFA 2NU9A 1YBVA 2DBZA 4K6CA 5HBRA 1P3DA 2BRUA 4YA6A 3GZNA 3JQAA 1EUCA 4PLVA 4D79A 3PLRA 3INGA 3LZ6A 4UVIA 4C4OA 3RUIA 3GEGA 3OF2A 4OO3A 3UW3A 1WAMA 3NT5A 4YXFA 2PY6A 3HZZA 1Y81A 3GPIA 1A72A 4E2XA 4P38A 4BNIA 3EVTA 1DPGA 4IJUA 2VT3A 4GL4A 2NQ8A 3HN7A 4PLPA 4GGPA 1T26A 2JHFA 4YAKA 4BO1A 3H6KA 4NFSA 3OQ6A 2VHXA 1C0LA 4BNFA 5EINA 1LDBA 4Y98A 4BNLA 1ZCJA 3LVFO 3ZWNA 4KMSA 1ZK3A 4J9VA 4JP2A 4AJIA 1TT7A 3G1UA 4DREA 3G1TA 1Z75A 3MTGA 2NU6A 3C7AA 3KB6A 4DTIA 1X0XA 2C59A 1P45A 2R2GA 1ENPA 5FI5A 4JGBA 4LVUA 4PLZA 2D1YA 1I2BA 5ADHA 2AXQA 1I8TA 1N1EA 4JX8A 4MVJA 4ND3A 1ZJZA 2GD1O 4E3ZA 1EEHA 1NWHA 2OGUA 3ZH2A 1EVZA 4N18A 4NU6A 2Q2WA 2GN4A 2V6FA 1KVQA 3TF5A 3TPCA 3TL2A 1NVMB 3ETEA 4ZA2A 1PL7A 1ARZA 1Y8RA 4M54A 4CV2A 2GNAA 3PGXA 1ISFA 4PCVA 1JTVA 1PWZA 3AY6A 5JDIA 2A35A 4I5GA 1CF2O 3WX0A 4YR9A 1JAXA 1T2DA 2ZQYA 3QVTA 1BGVA 4NG5A 2QIOA 4R1UA 3M1LA 3MJVA 3KZVA 4NJMB 4NPCA 2FN7A 4WCDA 2X9GA 1WZIA 3DXFA 4O63O 4WLNA 3VPXA 4DPLA 4FFMA 2YFHA 1Q0HA 3UF0A 3LLSA 3RFVA 4EEXA 4BNHA 2CVQA 2ZB4A 5BQFA 1SPXA 1GDHA 4PLYA 1H5QA 3RBZA 1VL8A 1AGNA 4CMAA 3U3XA 2NVUA 3E03A 3RFXA 1PL6A 1PGPA 3AUTA 4IBOA 3PLNA 4NR0A 5B4TA 2XF8A 3EY4A 3ZU2A 3WYEA 2D8AA 2WJPA 1RM3A 1Q2XA 2NVWA 3DBVO 5EMHA 4O1MA 2I6TA 1GU7A 4L74A 1ISJA 3JQ8B 1L7DA 2VHZA 3AI3A 3B20A 5TX7A 2CDAA 3DQPA 3UICA 3KOUA 3WGYA 2CZCA 3AI2A 3AY3A 3JQ6A 1UDCA 1PGJA 4CLRB 5DOVA 4YJFB 1ML3A 1PQWA 3OFSA 1WNTA 3QVSA 3I1JA 3GMDA 2X23A 1LI4A 4IJKA 3C1AA 1ZH8A 3Q6IA 1BTOA 1EBFA 1EUDA 4MVJM 3PJGA 1YB4A 3WG9A 4KQXA 1GUYA 4P4GA 1ZEMA 4KTTE 1I5RA 1YBMA 1E7RA 3PDJA 3DHEA 1X14A 3FWNA 4R3NA 1KOLA 3P2YA 5JLAA 3FRJA 1Y9EA 3ZW8A 1R0KA 1XHLA 1N9GB 3LSYA 1JAYA 3G79A 3ST7A 3DR3A 2I9PA 3IP1A 3OQBA 2EP5A 4MVJD 3FN4A 4EW6A 4TWRA 1RKXA 1R4MB 4BNZA 3D64A 4BVAA 2HU2A 4ESOA 3UFXA 3DMTC 3ZWWA 5KVSA 3UKOA 3PWSA
chains in the Genus database with same CATH superfamily
2ZBVA 2QLNA 5EEHA 1Q14A 3ZZMA 4MK4A 1N3LA 5DIFA 4KG7A 5A2QA 1Z62A 1KXJA 5DGTA 5A1TA 3IAM1 1PJZA 1A8IA 3H3JA 2JD0A 1ATIA 1NI5A 3OCZA 4UVGA 1L8XA 1F12A 5KDDA 3K9LA 1KJJA 4L7QA 4LV6A 5B1EA 2FFHA 3TWOA 2G25A 1EP3B 3MGAA 4IIFA 5T4HA 4UCWA 5DYIA 1UZNA 1DKUA 4R8KA 4YR7A 4CDNA 3T54A 4DDTA 5EJ8A 1PEKE 1Q0SA 1U5BB 2UZIR 2H7XA 1JL3A 2CFTA 3EAFA 3TRIA 3ZS8A 3RREA 1XP8A 5DM60 4GBJA 4JLBA 4A27A 1C5KA 2W2VA 3HJBA 4H7EA 4TTPA 5EE3A 1JNYA 4PBRA 3NBKA 3S4YA 1H4SA 1DG1G 1FRFS 3I4CA 1U2EA 1QOPB 4LSMA 4OYLA 3WNDA 1O1YA 4XM2A 3FSGD 5EXXA 1QV7A 1XD2A 2PR7A 4IDAA 1TUBB 1CWUA 1M76A 3FNFA 4L7VA 4LTDA 1K5HA 1BOOA 2GETA 1K5PA 1HYEA 5LL6P 4IZOA 2C78A 1NV9A 3G9QA 4YCSA 1Z15A 2BEUA 4UQPA 3VNQA 1NKSA 1UOOA 3DTTA 5KYGA 2IYYA 4QPZA 5JZBA 2ZSDA 4RZ2A 1KMCA 4MWCA 1W6RA 2HMSA 3RIHA 3N6VA 4EPYA 2IOHA 3LXXA 1UIRA 3R23A 4FD3A 4BNNA 1G4AE 4DA7A 3AB7A 1PQYA 5F35A 1O9HA 2XTMA 4G0YA 4REOA 4YWJA 5IT5A 2WTUA 4EGCB 4K28A 1C9KA 5KOHA 3BFJA 4N01A 1EEXB 1H8HD 2GAJA 3HWSA 3PJFA 5FBRB 3JYOA 4ZVSA 5TJHA 3RS5A 4EA6A 3VO1A 4ABTA 4FT4A 4QUKA 4NAVA 1E1LA 3UB3A 3DJYA 2PMDA 4ZYWA 1MV5A 2QQ0A 4P5DA 2FRVA 2CE7A 1PZMA 1ZM2A 4JZYA 3QBVA 2GXUA 4NE7A 3KSDO 1TCAA 3MJTA 4HJRA 4Y3UA 2XMSA 3T1TA 3Q2IA 4INOA 5DM0A 1T3HA 3S81A 2A5LA 1IK4A 2AD5A 1Y4DE 5LPNA 1OW3B 5K0CA 3B1VA 2GDZA 2BM9A 4HGNA 3QVKA 1NJFA 4LXHA 4TL9A 1QGYA 4OB6A 3LT0A 1QS0A 1LBEA 3I6QA 1C3XA 2QZJA 4ZT4A 4L72A 3JU3A 2GESA 1Z2OX 3LVBA 2CW5A 1YRYE 1XAGA 4E2WA 5JRDS 4G1VA 1TD1A 1A4RA 2R1TB 4GWKA 3SC2A 3ZJ4A 3C3DA 1H23A 1MX3A 3RUHA 1XFDA 5LR6A 1M6EX 2R8RA 4NULA 4QRHA 4C76A 3BYZA 2P2NA 3FFXA 2A92A 1YD7A 3QLEA 3PUJA 5EIBC 4M8KA 5ICFA 3WL5A 4FDMA 1T5DX 3HB4X 1ECFA 3UBTA 2A9FA 5C52B 1OH5A 1CJCA 4KXMA 3KQHA 1IVYA 3F6PA 4PE5B 3W5JA 1Y1SA 1PT9A 1ZNZA 3G8BA 4JKIA 1EG7A 1SU4A 2YWHA 3NPAA 4MKIA 6Q21A 2GAOA 2YDXA 4IFTA 2WKWA 3TW8B 5J5VA 3ZJVA 1E3TA 4KWCA 3GN1A 1YT5A 3JVUA 2PVPA 2PIAA 1QH8B 4G9GA 5F2OA 4TV8A 1E1QA 5E7IA 1DX4A 1SQ6A 2FLKA 4LGYA 3KSMA 2VF8A 1W0JD 5LLSA 5LQRA 3CGGA 3OLVA 1V3UA 1KOFA 1KP9A 2KS6A 5JCPA 3BWEA 4QT0A 2CDCA 3INRA 2P0YA 2QVYX 3A25A 3AIKA 2Z0MA 4NU8X 2AS0A 5LUBA 1EGVB 4LDQA 3D5TA 3PZRA 1SCJA 1JMYA 4XLZA 1U9IA 4DCJA 4DEVA 4M6WA 2DHDA 1E77A 3H1AA 3EQ6A 5C37A 2BUAA 1DQZA 4NH4A 5CXQA 4W5RA 3LOPA 2MINA 1XVUA 2V6MA 2YYYA 2DECA 3R0QA 4KXVA 4MCIA 5D86A 4D7AA 1B00A 5ICSA 2PS9A 4EGJA 1RXUA 4B73A 5JEEA 3FOZA 4Q1AA 1OTYA 2PRYA 3MJSA 2I91A 5DTRA 1CY4A 3PQ3A 5CDTA 2JPDA 1JDSA 4WN3A 2HNKA 2FN9A 1RWOA 2XUZA 4I4NA 1RI3A 1TKCA 1M2VA 3CEPB 3FCSB 1XTVA 2J3MA 1X7YB 4GO1A 5B4VA 1E6MA 4J07A 3BFKA 4LI0A 3WA7A 3GLGE 2X7HA 1EGMB 1RJDA 2XADA 1I4DD 2VHWA 4Q3KA 4TXNA 4BX3A 1Q57A 4HDSA 1T4MA 1YZVA 4KDCA 2RGNA 4Q6BA 4LCJA 1SUSA 3PHLA 3VR6A 1IE3A 3RYFB 2VP6A 2YFYA 4IFEA 3QKSB 5FPHA 3IP5A 5AVWA 1WHTB 5JMTA 2DQKA 1HDCA 3C1TA 4HYYA 2DB3A 1J4AA 1YQGA 3CX4A 3Q7SA 1F17A 1R4MA 1Z38A 1V3VA 1S7GA 1UBGA 1MO6A 4OHKA 3CE9A 1DXQA 2WJJA 5AKZA 3ZHZA 3K5PA 1FE8A 3OLQA 5J5AA 5E3IA 3IMKA 2VRCA 1XMOB 1C81A 3O4VA 3V7WA 1TB4A 5BSHA 3IEKA 1LBQA 5AHKA 3PUWA 2PFSA 3LNCA 2BFWA 3ETJA 3O9ZA 5FIUA 3VH4A 1FPMA 2YIVX 4RZ3A 3WGIA 2KYRA 2A4KA 1Z16A 2IZ1A 2E4YA 4FJ1A 2V97A 5CX1A 3ZGNA 3WWPA 1TJ3A 1RZRA 3MXOA 3GLIA 3IPLA 1GAXA 4UFPA 5DHUA 1TGYA 5CM9C 3VR2D 4KAJA 3GN2A 4PM4A 3PC3A 3PU6A 4RLSA 1DWQA 1UM8A 2VRNA 4HN9A 4BGUA 1WIWA 1ZLYA 1GUZA 2A0XA 3DZKA 2ZBRA 3MG9A 3PE6A 4C4RA 4U7TB 1I6WA 2H4WA 5KSPA 2NSDA 4B7CA 4EBBA 1QQBA 2P9FA 3GA5A 3NIGB 1MRZA 2VDWB 4PYRA 3LYUA 4FYHA 1VYTA 1JEQB 1X9GA 3GLRA 1GZSA 2HZBA 4BQQA 4C0BA 5KJCA 3TCXB 3CZPA 4BFLA 1VCMA 1NJ2A 2NUAB 1E2MA 2NUPB 4DA8A 7MDHA 2B5VA 5EVJA 4ZTBA 2V65A 5ECGC 1CU1A 1BQEA 3I30X 4H3HB 1XZEA 1NU6A 4RFVA 3U1TA 4B3HA 3RYCA 2BFOA 2W6QA 5LYJF 4BFUA 3MWDB 1R9JA 3C43A 1U0BB 2VPIA 2BFCB 4ECEA 4EO7A 4L5IA 4LKOA 2R11A 3CLRD 3TG2A 4WK2B 4BNKA 3P9KA 2EJVA 4R71A 4C7JA 3QW4B 3CUUA 2P9HA 2QRVB 3NVKI 1TUGA 4V0MA 3A6JA 4O2AF 5EXSA 4TLAA 4BUZA 5DXAA 4A8TA 1VL5A 2JATA 2ASVA 2GVZC 3LSTA 1J00A 1ZI6A 1CQXA 1HLFA 1I01A 1E0DA 4QIHA 2WKSA 4BATA 4G0ZA 4LRTB 1RZ3A 4K1XA 4R1LA 4WZBB 2EBWA 4DG5A 1NUAA 5JROA 3LBYA 1FYDA 5TGDA 3NPMA 5HCUA 1YZYA 3T0IA 1J9EA 5C8ZA 4H4DA 1T5SA 2I6QA 1Z18A 1DRVA 2VHJA 3VYVA 4E3ZA 1J1UA 2A5JA 2VKQA 3E3MA 1OFVA 4J0FA 2IEIA 2G1UA 1KZYC 2WVAA 2ZJOA 2C4TA 5LBTA 4EAQA 1P9LA 2GARA 1L4MA 3BCHA 2NZYA 1QVAA 1XKQA 1KFKB 3IYLW 4J7XA 3BE6A 3IHWA 1G1AA 2G07A 3LG2A 1MF7A 2AR0A 2SCUB 2RHWA 2XJ9A 1V5GA 3NHSA 4QPPA 3SSAA 5KBYA 1FNMA 2VLIA 2XGSA 3QFFA 4RPHA 3RWOA 1MB9A 2ENUA 3NDBB 5F12A 1PK8A 3ACBA 3AHGA 3NANA 2HT1A 2J46A 3ESXA 1WVGA 2JHGA 3DB2A 1SOWA 1V9SA 1JHPA 4I6JA 5KYVA 4AN1A 5MGBA 2WJYA 2CL5A 3DC2A 1OZGA 1IWOA 2AX3A 1M6HA 3IOCA 3K0KA 4I50A 3EDCA 4MWZA 4R16A 3STXA 4G5OA 1YVUA 1DBPA 5F21A 3TRFA 1C9YA 1RJWA 4MS1A 1HA3A 2H7YA 3IFSA 2VHYA 3Q3VA 1I5OA 1P1CA 2FPGA 1X87A 2ISQA 1HE8B 4L6AA 3TQHA 4BRSA 4BQNA 3P9RA 3K9BA 2VWGA 3RIGA 2WSMA 5TQ0B 3IS3A 2XB9A 5JC8A 2A57A 1MAUA 2XCLA 1L4NA 3TPFA 5I7VA 3DLCA 2C5BA 5C0OE 1G3UA 3U49A 3IQGX 1I30A 4EFLA 1YNSA 2ASEA 2I2DA 5BO5A 1P2TA 2PMCA 3DOOA 4AX4A 1KYYA 3LHSA 3Q7IA 4IVPA 7ABPA 4I81A 1YJAA 5ARCA 5JH7F 4KKVA 3U4QA 4PLCA 4WKCA 4FDVA 2C9YA 1JQJC 1BXZA 4PC1A 5JPCA 3FGPA 4OSEA 1MD9A 2DU8A 4LWZA 5L3SB 2H1LA 1R8QA 2OK8A 2F62A 3JRWA 4X8HA 4JCOA 4K6HA 3MHTA 4PINA 4KXNA 821PA 1UC8A 2EW2A 4OY3A 3LGSA 1N34B 4YRPA 3FKSA 2CD7A 1XCBA 1CVLA 2R86A 4V24A 4IMRA 1NP6A 2ZRDA 4KR0A 1Y9AA 2RKOA 2WM8A 1FUUA 3NTQA 4HGYA 4RYLA 4WY5A 5TGTA 2WF8A 2YWFA 4D9HA 3HVIA 3KCQA 2PKRA 1U3FA 4X94A 1VYHA 2YHIA 3GWZA 1JJVA 3AUKA 4LGVA 3DCJA 1C4XA 2A1TR 3KG2A 4ZYUA 2WSSD 1IG3A 1PR9A 3CJTA 5AW2A 1MO2A 3UA4A 1EJ0A 4QTUB 4E0BA 2M1XA 3KX2A 1W36D 3IE0A 3FXAA 1W7AA 4G1MB 1W5BA 2IITA 4ML3A 4FB5A 1XROA 1YIDA 1TUIA 1CJKC 2WYVA 3MBKA 4G86A 4ZQFA 2I2XB 2BTOA 2XAUA 1NN5A 3L9WA 1QYWA 3KEMA 2IDJA 2XE8A 3DVQX 3GRKA 4A7PA 4ARUA 1VJCA 2CVFA 1QR2A 4LWQA 3ANSA 4X7RA 1L1FA 4ARCA 2QY6A 4PLTA 4ALJA 1S7CA 4CIWA 1USIA 2JCBA 5J63A 3UB4A 4R9NA 3W1WA 3ZIAD 2A33A 4BBJA 5H3HA 4MGYR 3HCCA 2WILA 1JEJA 3AUYA 5FUYA 1CV2A 3Q9SA 1MV8A 2BKEA 3BWYA 4LC9A 3RDPA 1GNLA 4ILEA 4NOMA 4IPTA 4FCTA 3CTMA 1G5FA 3M4ZA 3HU5A 4BLVA 4CV0A 4IWXA 2AT1A 3QPDA 2CMKA 5CFZA 1P4GA 2QU8A 2P4HX 4QHTA 3IL2A 5DW3A 3DUFA 4HRVA 3T1OA 3OP4A 2EWMA 3UJCA 3T3NA 2J3HA 3E18A 4M1KA 2X0DA 5LU8A 3DKVA 4YAIA 3KD2A 2FUCA 1KKMA 2IBTA 3FTDA 2ZT8A 1MQAA 4MO2A 2WFZA 1XLTC 3H6HA 5KI6A 3X1YA 4CLEA 1EFVB 2V1XA 3L4EA 3QWBA 1JU9A 3S2IA 1E3QA 2DBVO 3R6WA 4W1QA 4EVQA 5KC8A 1GTRA 4Q3LA 4OJMX 4Q9DA 4A0RA 1YDWA 1U04A 2O48X 3JYPA 3TLBA 1Z26A 4YWHA 2GBLA 1ZD4A 1LWOA 4URUR 3GBVA 3VO9A 4BMXA 2OCDA 4WKBA 4Z0HO 3VPFA 3MMSA 4E08A 1GHTA 5ELLA 5EJGA 2FSPA 4DCCA 2AGVA 1UZUA 5CFMA 1BX0A 5CU7A 5AXCA 3DE3X 3NAGA 4NBVA 5TPZA 2F64A 3KKOA 2YWGA 4N47A 1PV2A 2JFZA 4FDTA 1XCPA 2GAFA 5DK4A 2XZPA 4J90A 5F1OA 4CG1A 3QFCA 1IY9A 3R3XA 1IH8A 4TLBA 1FMJA 4S04A 2QD5A 1W47A 1H2BA 1O6CA 4RSMA 2GPBA 2A88A 2H85A 4R41A 4ER3A 2LKCA 3NR2A 1KI2A 3K0FB 2P2ZA 5HQJA 1OXBB 2AFIB 2JDIA 3TLKA 1YR3A 4OQQA 1UKEA 4ZEOA 1ULBA 3ANLA 3WGMA 2AF3C 1KAGA 2MYPA 3ET4A 4UNSA 2HC9A 3OIWA 5KX5F 3D7RA 1ODJA 3SK0A 3AYXB 3OSUA 4LFAB 1BCRA 2V7TA 3TMAA 1I2DA 3WLPA 2HA6A 2IYOA 2XRZA 5AKYA 2JFYA 2ZRMA 3DMYA 1GPMA 4GR5A 1DE0A 1RJEA 3OQIB 5TJ9A 4F5DA 2HBRA 3WICA 3CINA 4N5HX 2G17A 4POOA 3W5AA 1YQTA 1YA6A 4ZOCA 2OMKA 3D8TA 2GS9A 3L8CA 4MCJA 5ALXA 1QVRA 3GDFA 1WP9A 4M0MA 3VMFA 2IHBA 2OUIA 2EGGA 3S1LA 2UYQA 1WOYA 4BRWA 5JAIA 3KTAB 3K1JA 3NT2A 1J8DA 3EVGA 4KB5A 4DV6B 1ZI8A 1II8A 3BXEA 4U2DA 1NR5A 1SXHA 3CLTC 4ZQCB 5FTJA 4NCXA 1FVFA 1GDDA 2KM1A 3Q10A 1X74A 3T1HB 2XWPA 1LU9A 1LLQA 1ZCZA 3EWAA 4GYWA 4N5NA 3DPSA 3V4OA 4BKQA 5LLDA 3EYAA 2Y92A 4EITA 3L0BA 2ZCVA 4JL5A 4ZU3A 1JEAA 1O94D 3SBXA 5HK8A 1IONA 4G0XA 2JLCA 2PSDA 1Y5LA 5BOVA 4UUOA 1KF0A 1NGSA 4TMKA 3T0GA 5TQ2A 3IXQA 3NYIA 4S24A 2C9CA 2CSUA 1Q50A 3OX4A 5DTEA 2OCIA 3THXA 4M1OA 5DBIA 1BHJA 1GAJA 1I24A 2FPKA 4R1SA 4RY8A 1V48A 1P8AA 2DWOA 5IVIA 3SZOA 1XMXA 2DBYA 2VH1A 4BV9A 2HV8A 1JG4A 4D8WA 2I8LA 1RJ9A 4IDHA 4P3OA 5EMNA 1TZMA 4PNPA 4R1TA 3ZKWB 4KLCA 4O59O 4N0MA 1MEJA 1Z2AA 1Q11A 3PXGA 3M6LA 2VJKA 4FWIB 2HBYA 2I6UA 2R60A 2Y0EA 2WDPA 3LHFA 2X15A 4Y1RB 4BQSA 2RHGB 3UWMA 3KZXA 5BSRA 2YC2C 3CWCA 4EQZA 4H18A 1I3OA 2IU6A 2W6CX 4B3XA 4EZIA 2QV0A 1U2DA 3NC0C 1YL5A 5EP2A 4Y9DA 2F1RA 2B4RO 2CHUA 4L6CA 4R2KA 1L1EA 1NE2A 1ZMBA 4MV9A 2QG4A 4GX0A 4WIAA 5IEBA 5JSYA 3WJ7A 3GAZA 3N2GA 3IQXA 4N0QA 3AEUA 3V8QA 3NP9A 4LJ6A 3WHLA 4HYTA 3SSNA 4PZZA 2V59A 1R0SA 1O5IA 4XVRA 4URVR 1XTQA 3SHOA 5DTQA 2W8BB 3RFFA 1DCFA 3ECCA 4EHLA 2FW8A 1E1CB 3AGPA 3ZWXA 4ZDKA 3B6MA 4BEJA 1HYHA 3LL4A 4B3FX 2C3YA 5K2MA 2B5OA 3W3ZB 3IDQA 4M53A 3A2KA 2Q4EA 4X8OA 3DV0B 5TS3A 1NQUA 2WYHA 3PCTA 3OPXA 4PFJA 4UNQA 5DN9A 2QI9C 1BVRA 5LUAA 5JDCC 1L4BA 4LK3A 3ABRB 4Z5XA 1QQ5A 2QAGA 3AKEA 2X1LA 5EYPA 4DQKA 5HR5A 3DBRA 2IXEA 5CW2A 4H1WA 1FTQA 3PA6A 1I7LA 1U3UA 1KVUA 2HIGA 1IZ8A 3W79A 3X44A 3MFYA 1T25A 4D8XA 4YRIA 3C3EA 2ZB8A 3HWX1 3D9QX 2R7NA 3E5NA 2H3HA 4MARA 3MERA 4B34A 5TMEA 4HDMA 2ACWA 3JQAD 1X7ZB 3RVNA 4BQFA 3BN3A 1ZISA 5FUWA 2C0CA 4B4VA 4CHTA 1OHHA 1W1IA 5AVVA 3LPDA 4MRRA 1JDUA 3ESAA 2VR1A 3SHVA 3TTTA 3VSEA 1IHPA 4IIUA 3N8GA 1GAQA 4MWEA 1LDYA 3H9BA 3IP9A 2OZLB 3TK1A 1MC4A 1DIAA 5CT4A 5JCJA 2FG5A 1JT2A 2B34A 3A6DA 1HORA 3EVNA 3HLYA 3RU3A 4MIYA 4L78A 2QVXX 4RJLA 5LC1A 3VNAA 2I2AA 1YJ5A 3GPLA 4J1QA 1OROA 4HXGA 1P0QA 4ZCSA 3PUKA 5JAHA 4R68A 3ND6A 3RJ9A 2B61A 3O8BA 1TTTA 3SBEA 5DNDA 1E3DA 1SU6A 3WDMA 2H1OA 4MMYB 1RYBA 4ZGGA 5JWRA 1QE5A 1C7FA 4B7UA 5JWOA 1DAGA 3TBKA 3PWTA 4AUEA 2OV8A 3L01A 1QH9A 3R7WB 4DGSA 4KRGA 3A2NA 2Q27A 2PQMA 4UBLA 5GJVC 1U2RA 5HM8A 2P1DA 3GGOA 2WG1A 3GFFA 4GOMD 3TN7A 4CKBA 4RVSA 1W75A 3E9DA 5FBWB 4BEBA 4MZDA 2PWBA 2DQYA 3GFTA 5C5IA 1X7XB 1EVJA 1XC7A 5LXTA 3L0SA 2Z5FA 3NM6B 1DO8A 2X8WA 4MLDA 4OSOA 2NM0A 4B7XA 1IM8A 3MZ0A 2LXNA 3ODGA 5HX7A 2RGYA 3DO5A 1KDVA 1MA0A 1ZMXA 3M1AA 1BXGA 1Z0IA 5CBPA 1G98A 3GGJA 1T3SA 3HYRA 3SC3A 5BVHB 5JSZA 2YIMA 2CVHA 3AERB 4DW8A 3L3BA 2GPSA 1BMFD 4X84A 1YQ9A 4CIVA 5DMHA 3HTXA 2IF0A 5KKAA 5JW6A 2F8TA 4L4XA 4Q48A 1UMBB 3PFWO 1PBNA 1DRJA 4F9FA 3BFVA 4B46A 1N6HA 2JEYA 3L46A 3OETA 3G7UA 3EODA 4GKVA 1TMGE 1Y5NA 4JROA 3KOXA 4C7KA 3ZCXA 4OVKA 3UK2A 1TKAA 2V9PA 3KSAC 2O23A 1T4DA 3HXLA 1IPFA 3DOHA 3KVNA 1Q7EA 3MWKA 1RCTE 4H35A 4UMDA 2R7LA 3WY9A 4A9AA 5KYUA 4BX0A 4MUBA 4U7JA 5JANA 5FUVA 1TC1A 4OHOA 3GFPA 3WIVA 5IHPA 1FP4B 3C3YA 4MEAA 5DM4A 3UN1A 3SR0A 3I72A 3LDFA 5ITSA 4Y9SA 2QXYA 3EIQA 5ED0A 3AM5A 1BVHA 4KVGA 4FK8A 1OPRA 1N2CA 1U3TA 1COZA 5IARA 2BF7A 5KOJA 4MB2A 1DEHA 1M0TA 3CA8A 3FIUA 4PHCA 3OD1A 3HUDA 1XRNA 3V1YA 2ZAGA 2P69A 3M70A 2NTEA 3QPCA 4XQGA 4AS2A 5IW8A 4IDBA 2FWPA 1UOPA 3A6KA 4JLSA 5T3YA 4B3JA 4KHPB 3EISA 1J20A 4IQGA 1SCQA 2ZM6B 1Q0UA 1LVHA 2WHYA 3KUDA 4IUYA 2O1WA 4PXSA 4KP7A 4R01A 4RVDA 3X1XA 4BPBA 4AJHA 4WGFA 3C5VA 2AA3A 3HY6A 1PJSA 2HEIA 4UDOA 3T7CA 3BSSA 4LSWA 4M4SA 1U2PA 2YXPX 3BRWA 4AECA 3A27A 3A05A 1YBAA 1OYVA 1XA0A 4IYRA 4LCEA 1T10A 1U7UA 1VHJA 5IUNC 1JIUA 2MSEB 5F78A 1JJ7A 4OB8A 2HRZA 4MI3A 2QVZX 5BP7A 4DBVO 3PGKA 4O2AB 1SD1A 1ZVQA 3LLVA 3WNZA 1IC6A 3CMMA 5F98A 1Y63A 5JRZA 1EU1A 4JP8A 3RSSA 1KYXA 4ZGWA 2EFJA 4MQFB 3MINB 5J2TF 1EFTA 1KI3A 2GJ9A 5CT5A 4EI7A 1QGAA 1WB6A 5FKJA 2IP1A 3V4VB 1U9IC 2R8YA 4MWDA 1THGA 4H0CA 3U7QB 5JNRA 1H9CA 5FPKA 3HKDB 3F4BA 3INTA 3OC0A 4WOPA 1XK6A 2GEDA 1MABB 3G85A 3FCYA 1Y1KE 4A6XA 4M1ZA 4E5NA 5DHRA 2QA5A 4X93A 3W05A 2JFUA 2WKQA 3OMXA 4O4LA 2PH5A 2OXTA 4AMYA 4D1YA 2PRKA 1A82A 1OD6A 4ZOLB 1D6JA 5U1PA 4DN6A 1V8PA 4RD0A 1ZZGA 2WP8J 4RGYA 1X13A 2G9ZA 3GP3A 4MYCA 4X1YA 4WWHA 1CXZA 1EHCA 3KYCB 2C94A 3FOWA 4RK1A 5FLKA 5FT9A 1L4EA 2LIVA 4Q4JB 3ZOKA 5B36A 2J87A 3H4IA 3VR4H 3H4TA 3IR5A 4I0WB 4KVZA 3ZLJA 2ZBDA 4YMIA 1O8CA 3FM9A 1JZTA 2W90A 3HVJA 3JR7A 4KO8A 4LXTA 2VH2A 3IDFA 3MWYW 3OIGA 4K6OA 4R31A 4RBNA 4X1OA 4DLXA 5AM2A 4PZ9A 1DKQA 2BVNA 3EH2A 2M9MA 2PUCA 2RH4A 1DFHA 4EL0A 1F3LA 3Q8KA 4U6NA 4R5HA 3UOGA 4ZYVA 1J2EA 3FHTA 4DLTA 1D8AA 2C7OA 1SXJC 2OFPA 3O31A 1ORVA 1N9ZA 3A32A 3FI0A 4CUZA 3NXKA 1OJLA 1MBZA 2ZTSA 1F48A 3LDHA 3OTQA 3QELB 4MV5A 1TO6A 5J40A 1FX0A 3QENA 4KFUA 2RG7A 2Z83A 3DKKA 4QXMA 2CBZA 3I92A 4DR3B 4IYJA 4N40A 1A9XB 1BW9A 3PNLA 1M5UA 4RIFA 5EXEA 4EQ6A 5LDDC 3W6PA 2AQIA 1OA0A 3UK7A 3QG1A 4CTMA 2WUWE 3REOA 1CNMA 2Z3VA 2H6EA 2J3KA 2O4UX 3GHYA 3KPUA 3F8TA 5HFJA 3VXKA 4DIUA 3M8KA 3WKCA 1I10A 3WQSB 3T9EA 4JDUA 1WTCA 4ZHQB 3E0QA 3HM9A 5FL7D 1BAPA 1X7HA 1ZD8A 1EFPB 1LPPA 1T1RA 2QLLA 4CV1A 2ZKLA 3HCOA 4DBZA 3A6PC 1OX5A 1P4RA 1SQSA 1UKVY 1NXPA 4UU0A 3NWJA 4DCUA 3BAFA 3I5YA 1GPUA 1Z25A 2B0CA 2QGNA 2R79A 4DUZB 1CUBA 3F74A 5KB3A 4L08A 5ALZA 1WSWA 1YS4A 4NPAA 4Q19A 3R5XA 1O95A 1M2NA 1RPJA 3Q3HA 2FY8A 2HPAA 3OM8A 4P7JA 2W2LA 2XVXA 3K1AB 4XYGA 4MUXA 5E2BA 5K3CA 3EC7A 1ZM7A 3PL5A 3RVMA 3LLCA 4F2GA 4F9GA 3PX7A 3QNMA 3NYQA 3PVSA 1WD5A 4B8ZA 3NNDA 2GVDC 3K05A 3ZQUA 2YWXA 1E3EA 3NAQA 2VA9A 4FJ2A 4JBXA 2BGIA 3SR4A 2HLHA 1DBSA 2IDKA 2OO7A 2WOJA 4C3OB 1QQAA 3U6BA 5IJXA 4L8VA 4NOLA 2YFKA 2IHNA 2NACA 2VJAA 1U5BA 1QLHA 4RUKA 1J8FA 1C0IA 5KC9A 3C4QA 1KO8A 4M7PA 1L3BA 2VYND 3WL4A 3QE3A 1JAZA 2QM0A 5H1YA 5BN5B 1K66A 1X92A 3E1GA 5KTYA 4F8EA 2PL3A 1P73A 1PVDA 5ALEA 3KETA 1TUBA 2G0TA 2QORA 5EIXA 1ZD2P 1OV4A 1UR5A 2OVFA 4CTOA 1QLJA 2G77B 4AX8A 4EJFA 4NENB 3R77A 4MHTA 4DCNA 4MPPA 3E5RA 1N2EA 4QBHA 1LLFA 1JR2A 4RXMA 4YEDA 5E7QA 4NCKA 3VVMA 1RU3A 4RDXA 2C84A 1GARA 4J1TA 3VR4A 4F3CA 3PXXA 1NXWA 2C3OA 1NWCA 1E69A 1C3LA 3GO4A 4F3YA 2O19A 4XQ0A 1NW3A 1JEDA 2IWRA 1U0OC 2PHZA 4R2LA 4KDRA 2YQZA 1T5IA 5JPIA 1DAPA 1JYFA 2QJTA 1PX2A 5T4BA 3UJ8A 4DQXA 1XZBA 2PAFA 3W4IA 1Y7LA 4HLNA 3PNMA 3AZPA 1XRRA 4EG0A 1NOIA 4YT5A 2IC5A 3GRRA 3D7KA 4FX2A 5LNK6 2FSVA 3KQPA 4QELA 4ZZ3A 1G2PA 3AUXA 3IIKA 3WB0A 4O5AA 4DE5A 1EP1B 1N6PA 1P81A 2O2HA 3BS4A 1Y5RA 2X8LA 3AR7A 1TIKA 3LI2A 3PG5A 1IPEA 4KLNA 4MVJE 3BT7A 4OP1A 3BGIA 2OPHA 5T6MA 3BA6A 3LKBA 5KOIA 3AETA 2NO1A 5EJAA 5K0LA 1MX9A 2P6MA 4NYIR 1RAGA 4U7PB 3D5EA 3WGGA 3ZHXA 2OSVA 1DAHA 3B7PA 4H7HA 5DN6D 4X65B 3GF4A 4LZWA 1CY8A 1GZVA 2HPHA 4J0JA 3C6XA 1L5OA 5BNTA 3QUQA 4MR9A 2VTBB 2VOEA 1R16A 4C7OA 2JJ8A 1MC1A 3PGVA 3ZV7A 4RHXA 5FH9A 1CUVA 1IK6A 3FVTA 4BKRA 4ENTA 3LY5A 4NRDA 4E4YA 4ZI7F 3DXYA 1B8NA 1FNDA 2AK3A 2KLBA 3LP8A 3N8KA 5T6BA 1PX0A 3KS9A 1BEZA 1Q7BA 4GP9A 4Q4AB 2QROA 5KX5B 4BWYA 3UGJA 2Q5EA 3K9GA 2XTZA 3PF8A 4FWTA 1QV9A 2Q29A 3AP2A 3C8UA 4RF4A 3D6VA 4KIWA 2FPOA 4RJJA 3UXYA 3KSUA 5AQ1A 2OBLA 1J0DA 3ESYA 4MDFA 3F9RA 1US8B 1ZR4A 4QTYA 1GGHA 2NZJA 4KMOA 4M2LA 4IINA 2J85A 2DPHA 1MORA 1SXGA 3BKWA 4EH1A 3FHJA 3EZXA 5EQJB 1WY5A 4EY8A 2YINC 3IT1A 4WSOA 1IY8A 3ZTYA 2WM9B 4NZ9A 1SIWA 3KZCA 3P9XA 1G5RA 3K70C 1T9AA 3V1KA 2IY7A 4JXZA 4HZIA 5EJIA 3EARA 1LF5A 3GEPA 1QAOA 1S8OA 3W3AD 2HDHA 2JLVA 1BKYA 1H94A 2R7KA 3JASA 4QQFA 4E12A 1G16A 1PEYA 3KM0A 3LH5A 4YQZA 2QRGA 3H86A 1KVSA 3DAFA 4N8EA 3BMOB 1YHYA 5D5HA 5EA2A 4EDFA 2D0OB 3OEYA 4YALA 4V1CB 1UAGA 5BMVF 1WUJS 1XLWA 4KYTA 10MHA 3CLHA 1PJ4A 1K8RA 5HS4A 3BWBA 3H04A 1B1CA 5BN3B 6CHYA 3VU3A 3ZDDA 2RJ3A 3GNQA 1RYZA 1TIBA 1H2HA 3UT0A 3CHYA 1DBWA 3QHPA 4O4IF 2QRZA 4PLGA 5K0BA 4HQKA 2BGWA 4JT2A 1SVMA 1AURA 3UGKA 3JAWB 5THKA 3W8NA 2BCEA 2ZR7A 4QZVA 3QXHA 4M3NA 4YQFA 1D0VA 2I76A 4OJTA 1F5SA 4ZMSA 4CTNA 1PR4A 1UPXA 5JNSA 1VLHA 2Q9AA 3QKSA 4ND1A 1NVKA 3MWJA 3D8NA 3GUVA 5D3MB 5GM2A 4TUYA 4LXIA 4Y6OA 3NTLA 4YV7A 3RRMA 1H2YA 2GTHA 3KV1A 4DB4A 2Q49A 3DL2A 4D4HA 1M2WA 2NSJA 2A0FA 3VR5A 3EJWA 4FOOA 4Y2HA 1AA6A 3K3PA 2ZYIA 3P45A 1EWKA 1VFPA 2W58A 1SCUA 3HDJA 2CL7X 1SCNE 2IY9A 3L93A 3PUXA 1FJ2A 5D1HA 3F97A 2NYRA 3KXKA 2PT6A 1DQRA 3T5BA 1W93A 3GT4A 3GA7A 4B71A 4OXYA 8ATCA 2B35A 3OZVA 4FVTA 4N54A 5JO0A 3KEOA 4JODA 2F9MA 2PGOA 1XPRA 4PGFA 3VJLA 2WF5A 3IBGA 1Z28A 2J6CA 3HKEB 3VNBA 2RJOA 4CM5A 3K31A 4G0OA 3RUAA 4XWYA 4XIIA 4YAWA 5JSFA 1NURA 4IIJA 2XKKA 2VSFA 2WDZA 5CURA 1COWA 2HAEA 2ORYA 2Z8ZA 3C7CB 4G9BA 1N2ZA 5HS6A 5IAJA 1GG2A 1BKSB 4LQCA 1JF8A 4QXRA 2D2FA 5K51A 4KPUB 1CJVC 4YVFA 3M3DA 1N1MA 4HI0E 2NMVA 1NVAA 5E0OA 2YQ4A 4KQ6A 5HKKD 3FDIA 1XEXA 2VDWA 3MCWA 4IRUB 1L7QA 3JSAA 4WFIA 2JJ2D 2JGRA 3TOSA 3I01A 4FFNA 1BOFA 2NUAA 4JLAA 3NBUA 3R76A 4BMVA 3KJHA 4B4KA 1WSBA 2Z6VA 2FSGA 1QTQA 4HR7A 4LMBA 3W5HA 3QEMA 1VE6A 4TTAA 3K1TA 1TLLA 4YMHA 5JTTA 1FFCA 1GL3A 3QYFA 2ZRCA 3U9SA 2ZBFA 4FQ7A 4ALLA 1P19A 4ZO7A 1Z4KA 3LW8A 4PCLA 1GXSB 2FW6A 4J16A 2HRDA 1G5QA 2JGNA 3O21A 4D4JA 3DE4X 4P2GA 4GT1A 1QONA 4WZ6A 1C1YA 2XB6A 4Q66C 3SBOA 3TOZA 1F6WA 3CF6R 4W6QA 2A9PA 3CZQA 3UV3A 1NT2A 4JVSB 1CQJA 3ZLUA 1ZOPA 3NUQA 5ALWA 1QHFA 4FXOA 1TD9A 1ZN7A 3WHKA 2OCGA 1G8MA 5KSOA 4WAUA 5HBGA 3TZBA 3HMQA 4WZBA 5B4UA 4BEWA 2IYTA 2FHPA 2J67A 3I2HA 1Q84A 1XEWY 4TQ9A 5D5PA 4CW7A 3PEVA 3G49A 3D43A 5EGNA 5IWAB 4UW9A 4G1BA 1ZCBA 1HNZB 1KO4A 1QVWA 1RWVA 1T4GA 2POQX 1PZGA 3RVJA 2MSWA 4MEJA 3Q7TA 2Q8NA 2PKCA 2PU5A 4LF7B 2F3TA 2FE4A 2OCPA 3ZU5A 3MPOA 4KH0A 2BW0A 4KPFC 2I6SA 4JY7A 3P7MA 1AV6A 3JARB 3RFUA 1H1LB 4IJMA 2QZSA 3RV3A 1MG0A 4IJ6A 4B85A 4ZJZA 1NT4A 5K2OA 1OILA 1EB9A 1YDMA 4G36A 2GHRA 4RTNA 2ZSAA 1CEQA 3HA3A 5ALNA 5IDXA 2AOTB 2W9XA 3OJEA 4INAA 3DR5A 3KKEA 4HGOA 1N5KA 5JEDA 1J2YA 3SWWA 1FQKA 5IP5A 2Z8XA 5E1BA 4HQRA 1V71A 1Z4IA 2FXIA 3IIJA 1HRDA 4FYXA 4G0UA 3BWDD 1RBMA 3RE1A 2VJMA 4A6EA 1JJIA 4BGDA 2CKDA 4LYEA 2P79A 3C8MA 3ORRA 4A2PA 4DQUA 1D4AA 1YFLA 1LSOA 2ISSD 2JK0A 2O3RA 4CI0B 2OHOA 3BMCA 5JAMA 4NXMB 2IIVA 4B6EA 2HK8A 2HSDA 2OCYC 1U2DC 1QDLB 3ZHYA 1ZIYA 2A4MA 3UJBA 1Z4OA 3A37A 1QFJA 5TQ0A 1W5SA 4MQEB 5DFAA 2WAAA 2VQEB 1BD3A 2C5AA 1VKOA 3H2ZA 3W5DA 4M8LA 1DQNA 4XYEA 1WXQA 3O47A 4TKZA 5IBPA 4IEFB 2X3FA 4GOKA 2PBFA 3B38A 3FCEA 4M37A 5IN4A 3CBGA 4B32A 3ETDA 3UOAB 1JZQA 2P2CA 3LFHA 5J47A 5EJ2A 4YUWA 5KDOA 4EECA 4NKRA 3ZNOA 4CKYA 1YUBA 1NMSA 1Z08A 3TLGA 4PS1A 1QMGA 3FY4A 2WPDA 4D8UA 2FMIA 1ODLA 3RS8A 4R2HA 3ZNPA 1VA4A 5L3SA 4EW3A 4DR7B 2PT7A 4RKRA 1V4VA 4OHPA 4N3GA 1ZUNB 3HB9A 2O8BB 1DWOA 1C1DB 4TRJA 5EERA 1U9YA 1MB3A 2EX4A 1XCJA 5KHOC 1CSEE 1WWKA 1CD5A 2H4XA 2WWHA 2EKLA 2K87A 3D6TB 3T4XA 3RSHA 4EGSA 3BMNB 2HHAA 3PT5A 4FT2A 1GTVA 4G0MA 3H16A 4C06A 4GSYA 4I1RA 3LXUX 4OM8A 4WXPA 3W6OA 1D1PA 2HRRA 4MGEA 3X2FA 3TUIC 1R0WA 2EF0A 1P60A 3BM5A 4BX8A 1N78A 1F4PA 2VHCA 2GPWA 2I1QA 2IA5A 2V3VA 1C4WA 3LQ2A 2BR4A 3ZGXA 4CEJA 2QZ4A 2RONA 1ODCA 4B3SB 2BMFA 4ZMRA 1PR2A 1RBQA 3KOOA 2ETXA 4EGFA 3U9TA 4YP5A 3K4QA 4YYZA 5JHHB 2BP7B 3VX4A 4NICA 5DBGA 1JFRA 1E3WA 1ZVKA 4CDRA 4QYIA 1E1KA 3GGGA 1BS9A 1I2MA 1EDEA 1NSTA 1N2BA 1RT9A 2Q62A 2VDQB 1SKYE 1U7TA 3ETLA 3OIDA 3ONNA 3ZQ4A 4MWTA 1LPOA 3B48A 1FEZA 1VSVA 4EX6A 1TVKA 2X13A 4ESHA 2V6BA 1DC5A 3EQ2A 4NH0A 5DCYA 4ETWA 2DX7A 3CF4A 4NE9A 2QTHA 3PYXA 5BSEA 1M2OB 1TM5E 5CYFA 1TECE 1VB5A 1NOJA 1JIIA 2A14A 2PL1A 1TU4A 2EYUA 3V1NA 2WQZA 1IXKA 4G84A 3UMCA 5I7FA 5J2TB 2DWQA 4DUPA 2VA8A 4K05A 3WRYA 5C81A 4P4NA 4G25A 4LY9A 3DTVD 3IH5A 4G0VA 3IBFA 2WF7A 4FEAA 4WADA 3JCZA 3MTJA 4DDVA 3I83A 2AJDA 4H17A 3GRUA 1YDGA 4U8HA 5EJ9A 2HK9A 4N65A 3CKMA 2BH2A 4BO6A 2CV2A 1G21B 1K88A 4ZV4A 1BWPA 1U81A 1JKIA 2N3ZA 2GD0A 2L82A 3G02A 3KB1A 1HE1C 1NXSA 3KLNA 4IRXA 1AX9A 3C3KA 4H9GA 5K4HA 3GROA 1S0UA 4RPCA 5E6UB 4JI8B 1HFKA 1IB6A 1QTRA 1SC6A 2Y67A 3DBHB 1QF9A 4BP9A 1SG9A 3PHIA 1G8KA 1YUMA 4UEWA 5DGIA 3UPTA 3U31A 4DMCA 2ACEA 2AMFA 3ZU3A 1CDOA 3AVOA 1CW2B 1OIVA 1MJ5A 3COPA 3FPEA 3R3HA 4K46A 2WIFA 1AQYA 5AK3A 3DDCA 2GN8A 4H1HA 4HDRB 4OHMA 2XBLA 4AIRA 2ZB3A 1QMPA 3I3SR 1ZONA 5DBOA 1J8YF 1ESMA 4GC5A 5CEFA 1NUPA 4V0ME 1H2RS 1PWYE 1ZAKA 2B25A 3DM9B 4JI7B 2OL4A 5TY0A 2IW3A 4JLPA