5JDCC

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
237
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLPEEKDKWRRKVPLGRRSAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 90
structure length 237
sequence length 267
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcC00
4RZIA 4MJLA 3QA9A 2NU6A 3BMCA 3FR8A 1MA0A 3IMFA 3VPFA 4HNHA 3HQ4O 3H3JA 2O2SA 4UUOA 5JLAA 3ZHXA 1B3BA 5KVCA 1YL5A 2QX7A 1E5LA 5B4TA 5JYDA 2JL1A 4ZQHA 4R1TA 3V5NA 3H2ZA 3QWAA 4HWKA 1AUPA 1P74A 4D0RA 3DZFA 3GDGA 4PIVA 1N92A 2IXBA 1MUUA 4Y6RA 3JSAA 1PQPA 3OJEA 1IE3A 3K6JA 2GLXA 1ONPA 2VHXA 1P9LA 5JW6A 1MG5A 3DBLB 4Q3AA 4AJJA 2G17A 3VH1A 3IUPA 4FPXA 4J49A 1FDVA 3UCXA 4L74A 4TWRA 3PIDA 2C20A 2QZZA 1DSSG 3F5QA 3NV9A 6ADHA 3I6QA 5BR7A 5I7SA 1DC5A 3X2FA 4QFCA 4PLYA 1ULUA 4HFNA 4YVFA 2Y0CA 3R1IA 4PRKA 2O3QA 1U2DA 4J9UE 4EJ0A 1HETA 5JDCC 2FY8A 3VDQA 4Y8VA 1QYVA 1YQDA 4FOOA 2NQ8A 3ITDA 4PLVA 4NQZA 1Q2XA 3AK4A 2X5JO 3PHGA 4Q3BA 4JGBA 4DTIA 3AW9A 1DRWA 3GHHA 1F06A 4XYEA 5IAAA 1WP4A 2XXJA 3RUCA 3JD3A 3VZQA 1LSOA 3GVCA 4BHTA 1D4FA 2B5VA 1DIGA 3L4BC 4R1SA 1NAHA 4XQGA 3AM3A 3JYLA 1HDYA 1YL6A 3RU9A 3PPIA 3V8BA 5JO0A 5JDIA 4NBUA 2X23A 1NNUA 4UUNA 1BSVA 1HE3A 4WLOA 5DULA 1E3WA 1U1IA 1LBEA 5LC1A 1DAOA 3C7CB 2O23A 5CDYA 1M67A 4IDCA 2YQ4A 1IPFA 1B26A 4MVJG 3CMMA 4RF2A 5EPOA 4GX5A 3PHJA 4O1MA 3UXYA 4RF4A 3DHYA 3W6ZA 5DF1A 2DBVO 5EIOA 4MKZA 2AEFA 2VRCD 5L7YA 4CLOA 3ULKA 1LDMA 4L0QA 4DC0A 1LDEA 4YWJA 1PU2A 4EGFA 1A4IA 4R41A 2XOXA 2A4KA 4KTTE 1Q0QA 2I66A 1F8GA 1H9AA 4WOJA 2X0RA 4W9NC 1ULSA 2OP1A 4IJUA 3JYOA 2V6BA 5EJ2A 4IXWA 3O4RA 2J3JA 5FF9A 3RBVA 4MIEA 3AWDA 4GWGA 3KEOA 4JQCA 1O95A 1GUFA 3ZHYA 2D8AA 2Q2VA 1P44A 3PI7A 1I2ZA 1ZSYA 1YXMA 3UH1A 1YQGA 1E1KA 1JTVA 4CM8B 4IJWA 1C14A 1R4NA 2EKQA 3ZWYA 2ZTUA 4RQUA 1EZ4A 1L7EA 4YB8A 3KUXA 4U8GA 2ZJ1A 3ZWBA 4ND4A 3ROMA 1GZ6A 1N7GA 4JIGA 5TQVA 2Q1UA 3DQPA 5DCUA 1FMCA 1YH3A 3JQ8A 5B4UA 4UVDA 4PVCA 5TGDA 4PG5A 4D46A 1NVMB 1DHRA 2EF1A 4TZKA 2P9EA 2XXBA 3PHLA 3F1KA 3Q3CA 3QVXA 5TRTA 5IXSA 4DRYA 1K6JA 1JAYA 4H3VA 4TKMA 5COAA 1WMBA 4K6CA 4WCFB 1EQUA 3DDNA 8ADHA 4CM7A 1LTHR 1PGNA 1N1EA 1DIHA 2B37A 4JLWA 1YBVA 2V65A 3ZV3A 4CM9A 1C1XA 4GX0A 2UUOA 4HY3A 3G49A 1ZJYA 1B7GO 1WDLA 5I9NA 1DDOA 3WJAA 3DZGA 1VLLA 4LMPA 3ETGA 4XYGA 2OZPA 1ZK2A 2YQ5A 1C1DB 3BMQA 1EE9A 3MJSA 4J1NA 1VRWA 1NVGA 1KVUA 1U3WA 4DXHA 1M2WA 1GUZA 2OMEA 4HP8A 5ILGA 1NVTA 2B4TO 2OP0A 4XQ9A 1IYZA 4WCFC 1J6UA 1G0OA 4TZTA 4FJ1A 4IMPA 1KEWA 2PZKA 2AHRA 1MGOA 1H2HA 1YKFA 1BVRA 1B8VA 2P5YA 2YHIB 1GADO 1YB5A 1R37A 3MJTA 2IDZA 5B37A 3GFGA 3JQFC 4YT8A 4RF5A 1IL0A 1YONA 4HXYA 1C3VA 1RWBA 3C8MA 2PD3A 4J1QA 1ZSVA 3TL3A 2IE0A 2B83A 4QEDA 1T25A 5LDHA 3U3XA 4WNIA 3GN2A 3VVBA 1K5HA 2X0JA 1GZ3A 1WPQA 4J3FA 4J1TA 5JDIC 1RYEA 4II3A 4Z0TA 1MG0A 1SZJG 4QSMA 3S55A 3ZN2A 2OXIA 4MVJI 1ZFNA 1UDCA 3H5NA 1E7MA 3PDJA 1ENZA 2CVZA 3WFJA 2J8ZA 5K0ZA 4YJDA 1H5QA 3KYCA 4XYLA 1E1NA 2DUWA 1KC3A 2NU7A 3V1TC 1BXGB 1AXEA 1GV1A 1P33A 1UZLA 2E82A 4NIMA 4RO0A 4BV8A 4A27A 2RBEA 3MOIA 3E18A 4ALNA 5KCZA 4WGGA 1KC1A 3P2YA 3GG9A 4JNKA 3ST7A 3EVTA 4DLLA 1QORA 3FWNA 3R3SA 3AUAA 4UEJA 4JBIA 4CLRA 1PWZA 2PGLA 5U1PA 5GZ3A 5HWSA 5GZ1A 3KETA 4DQUA 1U28A 3ZU3A 9LDTA 5JY6A 4M8SA 3CEAA 2HRZA 3OHSX 1ZK3A 4ALMA 3TNLA 1SO8A 2VRCA 5G4KA 3WLEA 3KSZO 2FWMX 1X7HA 3JYNA 4MP3A 4Q3CA 4WLFA 1DAPA 1N9GB 1UXJA 2GUGA 2IXAA 1P31A 1BMDA 2HQ1A 3GDOA 5COQA 5JMWA 2DUUA 4M49A 2BLLA 1A71A 1BXGA 4XJSA 3B1JA 4OO3A 1YOVA 5KVSA 1HDZA 1T24A 4B4VA 3A14A 3SC4A 2GO1A 3PTZA 3WYEA 3RKUA 4XEHA 5KIAA 3C1TA 3CZRA 1TT5B 1EUZA 3BMOA 3ZNOA 3HDJA 2B5WA 4F45A 4XQEA 4PZEA 4OHUA 3RC9A 4D0SA 4BNNA 1PL6A 4W4TA 3S8MA 1DLJA 1CJCA 3K2EA 3TZ6A 1X15A 1VL6A 1IPEA 3BTUA 3DBVO 4GQAA 4Z0HO 1JVBA 2BGKA 1NPDA 3JQBA 3ANLA 3OSUA 5DBIA 4ZQBA 2PR2A 3RVDA 1B8PA 5JXWA 5IZCA 1JU9A 2E49A 2YHIA 4B8ZA 5G0WA 3D3WB 2PD6A 5FEUA 3TOZA 4Q39A 1SPXA 1W0CA 3PWKA 3WWYA 2HRBA 2VZ9A 2O3UA 2OGUA 3M1LA 1PTJA 1IUKA 1AE1A 1LDGA 1MXFA 2O4UX 4P8RA 2W2LA 5JYEA 1T2AA 4NDNE 1GEGA 4HNGA 3TWOA 4B3JA 4E5MA 1R16A 2HKIA 3M6IA 4F6CA 1OZAA 4TKLA 3VH4A 4ND3A 1JLLA 2OORA 5U9CA 4W7HA 2JD1A 3ZV6A 3SXPA 4FOSA 3FCOA 4AJLA 4CMJA 3E03A 4OH1A 5HS6A 2O2YA 2BFOA 1YS4A 3RJ9A 1P1IA 1LSJA 2IEDA 3D5TA 4WNCA 3U5TA 3TPCA 4YJHA 3MZ0A 1VE9A 4CR6A 2HUNA 2VTDA 3HFGA 1MP0A 5F3RA 3PJGA 2DTEA 3OICA 1YBAA 3QV1A 2YDYA 3E1KA 4NBWA 3K30A 4J2HA 4BNJA 4AJKA 3AOEC 4R68A 4XCVA 3ONEA 4LRSB 1ZSNA 3F47A 4ZQEA 3WIEA 3JQAA 3UF0A 2Y1GA 4DPMA 3D3WA 4JBGA 1E7RA 3I1JA 1NFFA 3RKRA 1LUAA 1DPGA 2I9PA 3HADA 3JQAD 2HO5A 1X14A 3WMWA 3O8QA 5H82A 4R51A 4BVAA 4YBZA 5TC4A 4ESOA 4G2NA 3HN2A 1DFIA 4FN4A 3V2UA 5B1YA 2X22A 2X4GA 3DMYA 4MDHA 2HJRA 2PNFA 3VPHA 3CSDA 3ZWMA 1HEUA 4MKXA 3MTJA 4J0FA 3IIEA 2BELA 4CM5A 3JCZA 3RD5A 5A03A 1QKIA 1EK6A 5IZCC 3ORFA 3WJ7A 1N1GA 3TDKA 4OOEA 4LVCA 2FRDA 5EINA 5ER6A 5GZ6A 1GCOA 1DFGA 1NBOA 4BNHA 1H94A 1NX6A 4TVBA 4WASA 3RAJA 3AOGA 3DHEA 5AYVA 4YQZA 3DOJA 3PGXA 2VWHA 5DBFA 4E3ZA 3Q0EA 4MVJF 4YT4A 3UCEA 4CLXA 3LLVA 8LDHA 3RC1A 2GDZA 4P4LA 3VH2A 5CHEA 4DYVA 1F0YA 1T4BA 4CODB 4CUZA 5I8WA 3JQAB 4E6PA 3PRJA 3Q9NA 3JQ9C 1LU9A 3KSDO 4BO7A 1J5PA 2HDHA 1WZEA 5DZSA 1E92A 3OQBA 4B8WA 4YRAA 3OF2A 2Y1DA 4OAQA 3UICA 3W4KA 1JA9A 3I3OA 3FNFA 4OKIA 4XIJA 1E7QA 3B6ZA 4CJXA 1XDWA 4A0SA 4BNZA 3HWRA 1Y6JA 4I9NA 2B0JA 4XB2A 1E3EA 5K6AC 4AJNA 1JWAB 4L75A 4BO8A 2GZ1A 1CERA 3JQ8B 1O94A 4FW8A 1GFSA 2HMVA 2C59A 2DFVA 4TRJA 4WKGA 5KVVA 5CDUA 4QO7A 3T4EA 4EUFA 1LRLA 1PS9A 2TMGA 3FBGA 3C85A 2VWPA 3FNHA 2JFGA 1HL3A 4DVJA 1I24A 5TLSA 1T2EA 1R4NB 1DRVA 5IDYA 3BA1A 1NM5A 2X7HA 2AQIA 1U2GA 1ZW1A 1B8UA 3AY3A 4J16A 3WXBA 4E21A 4J6FA 4AJOA 3LYLA 1F14A 2Y1OA 5COBA 1DXYA 4D7AA 4PVDA 5KWEA 4IDDA 3LC2O 4NH4A 1ADBA 1EDOA 1PSDA 3ETDA 1D3AA 4L8VA 3MWEB 1LC3A 3MTGA 5T57A 2BFPA 4BIIA 1YJQA 3ROPA 2C82A 2ZB4A 1VJ0A 4OQZA 4DREA 3NRCA 2JD2A 4DGSA 3QY9A 5AXBA 5TNXA 2C2XA 3RI3A 1YBMA 1QP8A 2VQ3A 4NG5A 4OJNA 1HSOA 1DIAA 3CZMA 1E1MA 4CM9D 1NQ5A 2WEKA 1DOHA 1M75A 4TRMA 2UVDA 3EW7A 1S7CA 1LDYA 5BT9A 3UW3A 4BMVA 2CY0A 3COSA 5KJFA 1PQUA 1QRRA 4Z6KA 1Y8QA 5C3MA 3M2TA 3TZKA 4EEZA 4AJPA 2G1UA 3UUWA 3OBBA 1CIVA 1HXHA 4BB6A 4ND2A 5BSEA 1PZFA 4N5LA 2V6GA 3GVIA 1GD1O 3FTPA 4MKRA 3PQDA 1RM0A 4OIMA 5TJ9A 4MVJP 3BMNA 1PL8A 1V8BA 3KV3O 4A73A 3NTRA 2DC1A 1JKJA 2VT3A 4CMEC 3VOSA 1R4MB 3D7LA 1VJ1A 4CQMD 1JDJA 4R5HA 1BW9A 3ANMA 3DBRA 3KB6A 4GBJA 4R1NA 1HDXA 3SBOA 5A02A 3O26A 2ZCUA 3LC7O 1R0SA 3WICA 4E5YA 5FWNA 4KUHA 4KP7A 3INRA 5G0SA 4BNGA 5JMPA 1WVGA 3RQSA 1H6DA 1PJ4A 2DVMA 1ADGA 3B1FA 3OA0A 4GH5A 4NMHA 3SLGA 4CMBA 4CUKA 6LDHA 4OXYA 4TRRA 1EEHA 3LK7A 4UVGA 1HDOA 4QFDA 4UAGA 5ICSA 4W7IA 3QIVA 1X7GA 4FFMA 2R2GA 2YV2A 3GGPA 1HKUA 3JQBC 2EP5A 3DBLA 1PS0A 4J91A 2NTVA 1Z7BA 1H0KA 4IXTA 4A5OA 3EVNA 4YA6A 4R69A 3SX2A 3TFOA 2CDBA 3TQHA 1SMKA 4IQGA 3CUKA 3FRJA 3SC6A 3GPIA 1XHLA 4DPLA 3STHA 1PX0A 1PQWA 2ZK7A 1UP6A 3GZ4A 3ZCXA 3W8EA 2VYVA 4D79A 3ASUA 5MGBA 2IYPA 4EUEA 5G4LA 3ZWXA 3D5QA 1R4MA 1RKXA 1ZUD1 2AQHA 3H7AA 1A7KA 2ZKLA 2Q1SA 5TJHA 2Y67A 2JD0A 4O0LA 2OFPA 1XYGA 3BHIA 1GTMA 1ISHA 4NFYA 2ZJ0A 1PEDA 1LSSA 1ZBQA 1HT0A 3H6KA 2JCXA 2P68A 5CP8A 2YJZA 4U5QA 2H1SA 4ZN6A 4GMGA 1LLCA 1M6HA 1PGOA 3C1OA 4HFRA 2EW2A 2LDXA 4E33A 4I08A 4JCOA 3L77A 3RUAA 4E31A 4MP8A 4WK6A 4PLCA 5AXCA 2EJVA 2W4QA 5F1KA 3T7CA 3WS7A 3EZYA 4CMEA 4D45A 1P0CA 3B1KA 1P1JA 4NI5A 3IP1A 3D4NA 4Z0PA 1YVEI 4QTZA 1ZH8A 5J23A 3O8QB 4YDRA 5TS3A 1KVQA 2G76A 4JN6B 1K0UA 1C0LA 4DMLA 3EDMA 3Q6IA 3JQ7B 1EUCA 5THKA 2Y1CA 4PG8A 4RQTA 4MP6A 1A7AA 3ZWVA 2PY6A 3PHHA 3RFVA 5KOIA 3N74A 4GX2A 4LCJA 4QECA 1ZXBA 4BO5A 2YUTA 2HJSA 1NQAO 1QSGA 2DBQA 1NTOA 2EKPA 2FP4A 3NEPX 5L4SA 2AXQA 2ZTMA 2POQX 2P9GA 2G0TA 3CH6A 3AM4A 2H6EA 2I6TA 1O8CA 2NVBA 2EWMA 4L4RA 2Z95A 3EYWA 4IDEA 3FHLA 2Q99A 4J90A 2O7SA 2NV6A 1E5QA 3MJCA 1NWHA 3S1LA 3PJFA 1C0PA 1E6UA 2X9VA 4CV0A 4PG4A 1E7SA 1Q0HA 3IOYA 3MOGA 4O5OA 1DIBA 1H2BA 1P45A 5C37A 2PZLA 2AE1A 2FR8A 3HUDA 2JCYA 1E6WA 1OC2A 4XGKA 2CFCA 4HUJA 4KWHA 4C4OA 3KHUA 1YB4A 4OM8A 2XAAA 3ZWAA 2PGJA 3QWBA 2J6IA 3UOGA 3IS3A 3KYCB 3QP9A 4YRBA 3UVEA 3FN4A 4JJGA 2OL4A 3RFTA 4A26A 3OP4A 3PZRA 3BYZA 3ICPA 3GRKA 2HU2A 4E32A 1DO8A 1G1AA 3KSUA 4XWYA 4JX8A 4BNVA 2W90A 4Q3EA 3AY7A 1V3UA 4GKVA 4O59O 5CDTA 4JJIA 4EEXA 3W1VA 2FPGA 1SOWA 1WWKA 2F1KA 3GHYA 4NPCA 5JPIA 3KYBA 2QYSA 2CUKA 4NU6A 3S2FA 1PL7A 3ZU4A 4U6QA 2HCTA 1N8KA 4CL3A 3ZU2A 2WE7A 1K89A 3OQ1A 4J9VA 1DRUA 3PYXA 4MOWA 2V6FA 2EKLA 3WB9A 4XRGA 2W2KB 5I7VA 3P2OA 3A1NA 5A9SB 3ZNQA 5CEEA 2WE8A 3U4DA 2EIHA 1VM6A 1R15A 2NVWA 4QQRA 4R5MA 3IJPA 3RASA 5IJZA 1LJ8A 1TEHA 1P3DA 1H6CA 1HZJA 2JAPA 3JD4A 4R9SA 3JTMA 1U5AA 2Q45A 4BNTA 1R0LA 1GU7A 2JJYA 3G0OA 2AQ8A 4IDFA 1DIRA 2D5AA 2PV7A 1D8AA 2OOSA 1HWYA 1ZMOA 3HHPA 3VH3A 1BGVA 4B4OA 1PJQA 4UVHA 1Y8RB 4E2WA 3RCBA 4Z3KA 1D1TA 1E0DA 1LQUA 1XQ6A 2QQ5A 2EGGA 1KVSA 4AVYA 4FFNA 2QIOA 3WYBA 3IL2A 4JBHA 5DOZA 3JQDA 5TX7A 1XU9A 1OBFO 4BKPA 4FB5A 3GEGA 3TRIA 3OMLA 2NTNA 1GR0A 3H2SA 3PJDA 4LSMA 4WLUA 3PK0A 5DCWA 2DKNA 4KZPA 2QG4A 3KYDB 3T7EA 2X0NA 3BAZA 3LT2A 3I9MA 3D4PA 4AJ2A 5CEFA 4K28A 2J3KA 1K2WA 4WLVA 3HSKA 2D4AA 2DTDA 3GZNA 4LRTB 4NBVA 3GZNB 4XYMA 4MIYA 1I2CA 5KNLA 3I9KA 5A3JA 4G5HA 3ASVA 4BQRA 3L07A 1QV6A 4FFPA 1QV7A 4K1LA 2HMUA 1U7HA 4MINA 1DC4A 5A04A 3HN7A 4YR9A 4JK3A 4L73A 4IINA 4ZQGA 1MV8A 2GSDA 2P9CA 4BNKA 4QUKA 4GVXA 3LVFO 2YFHA 1OAAA 2RCYA 1ZKMA 5JS6A 5CDSA 4IM7A 2EJWA 1PIWA 2FPIA 4CM1A 4PRLA 2OBYA 3OH8A 4U7WA 1HE5A 1Z6ZA 3F1LA 3WG9A 3BHMA 5IZ4A 3FI9A 1UAYA 1LLUA 3RUEA 3UGKA 4P4GA 1Q7BA 3GA0A 2NACA 1CRWG 1U5CA 4YXFA 2VHVA 4H7PA 4IQ0A 1YDWA 1TXGA 2GNAA 5DN9A 1Y9EA 2I67A 4MVJA 3W6UA 4XD2A 5CDGA 1C0KA 5AOVA 3L9XA 4R3WA 4XDYA 2WM3A 4Z9YA 5B12A 2Q1WA 3CKYA 4H16A 5I7FA 4JXKA 2VN8A 1HE2A 4KTVE 3KXDA 3RSHA 1L1FA 1LLQA 3CINA 2WD8A 4Q3DA 1XKQA 5A9TA 4GI2A 1E7WA 4BGEA 1BXKA 2E4AA 3CE6A 2IYOA 3ZH2A 1TA4A 2YHUA 1M66A 1PJLA 1I5RA 1TB4A 2R00C 3TZCA 4YTEA 4DBVO 1ISIA 4RPLA 4D3DA 3GK3A 1VSVA 2IZ0A 3IQDB 2VTEA 1P1HA 3H8VA 3IKVA 4XRRA 3RUHA 5A05A 3GUYA 1Y81A 2BHLA 1Z75A 4I1IA 1PJSA 2DQ4A 2JCVA 1XU7A 1JVSA 1OOEA 3UAGA 1R12A 3DWFA 1S6YA 2FPPA 1E3SA 4O6VA 4WLNA 1HE4A 1ZEJA 4NFHA 2V6MA 1PJ3A 3AUSA 5I9MA 5L45A 3V1YA 4B7UA 1UXHA 4I9HA 1A72A 2PKQO 4D3SA 4RF3A 2D3TA 3JQ9A 5CEJA 4IDGA 1CF2O 4FDAA 3T4XA 1Z82A 3C7DB 2FSSA 3HB4X 2BI7A 1RJWA 1BVUA 4PLHA 4Z9XA 5DOVA 1Q7GA 2PKQP 3LQFA 1O0SA 2I3AA 3GNQA 3GRPA 4CM6A 2Y93A 4BMSA 1OC4A 1LRJA 4B7XA 2HAEA 5ITWA 3ZWNA 3NYWA 1HLPA 3GQVA 3KTDA 1BTOA 2ET6A 3PDUA 4BUCA 1ENYA 2WYWA 1UUFA 2JHGA 3LSYA 3ZNPA 3DZKA 4N5MA 5DNAA 5JCJD 3GR6A 2NSDA 3GGGA 3TZHA 3MJVA 5K6AA 1RPNA 3BHJA 5CPFA 5A3VA 3WDSA 4BO4A 4HKTA 5JCJA 1PWXA 4KUEA 4ALIA 3HDQA 1W8DA 4P38A 2Q3EA 4NJOA 3U09A 4J4HA 2D2IA 1E7YA 4YJGA 3WFIA 4RL6A 5CAEA 2EERA 3FPLA 4CM3A 2DBRA 3CPSA 3L6OO 3OJOA 4CMIA 4CV3A 1A9YA 1KBZA 4WEQA 3RWBA 4RLHA 5BNIA 1GQQA 1ZZEA 4UREA 4IUYA 5T64A 1V3TA 2NVUB 1CQIA 3ADPA 2DT5A 2W8ZA 2Q4BA 1YE3A 4RVDA 1V3VA 2C5AA 2ZTLA 1Q1NA 1QYCA 2JKVA 2Y0DA 4GSLA 3VPGA 2VUTA 2RH8A 5AXDA 2X6TA 3ZV5A 3WGTA 4OSPA 3PWSA 5FI5A 4DIBA 1JAXA 4DMMA 4XGNA 4WCFA 1BDMA 2GN4A 4DUPA 1DB3A 1WDKA 4QX6A 4NR0A 3D4OA 2B36A 1UR5A 3R3JA 2X5KO 4UEOA 2O3RA 4BNFA 1EMDA 1J49A 2WD7B 3FNGA 1SBYA 5C5IA 3PFFA 4XZ3A 1EQ2A 1BG6A 5I9LA 5ER9A 4CMAA 1ARZA 3OIDA 1I3MA 2O48X 2ZQZA 4IQ8A 4RPKA 3ZHZA 2VYNA 3NUGA 2WSBA 5L95A 2IRWA 3OECA 3WTCA 3AI3A 2E48A 1VJTA 4YJFA 2BF7A 2QW8A 3NDRA 3H4VA 3LDHA 4AJEA 3BMCB 4FFLA 1NAIA 3E5RA 1JW9B 3PIIA 4JJFA 2C29D 3KO8A 4N54A 4CLDA 1UZNA 5IDXA 3K96A 3D64A 3RROA 3I83A 3GAFA 4IMRA 3E6AA 5BQFA 3F3SA 3ITKA 1O89A 2ZQYA 3LT1A 2PZJA 3NX4A 1YOVB 4PLFA 4HBGA 4XDZA 2WYUA 5HBRA 1B3RA 4FD3A 4ZA2A 1XELA 5ES3A 1EVZA 5EERA 5EQDA 2B35A 3JD0A 2RIRA 2I3GA 4MVJM 5KJ1A 5KKCA 1U4OA 4TQGA 4RVGA 4BS9A 5G4KB 3GY0A 1MB4A 2Q2WA 2FR1A 3OJLA 3FBTA 1PJTA 4OL9A 4RPJA 3VZSA 1LXCA 4IJKA 7ADHA 3ZU5A 2GERA 3ZI0A 5IN5A 2AMFA 4Y6SA 2VHZA 3HJAA 2HMWA 3EK2A 3HZZA 2C54A 3ZZNA 4E5KA 3I52A 1EBUA 1GPDG 4M89A 2AG5A 1I32A 1KOLA 2J3IA 5GY7A 3I9OA 3WGYA 1ZO8A 4D3FA 5ICMA 4XKJA 1H9BA 4L76A 4ALLA 3LLSA 4KUGA 3I6IA 1R66A 2EP7A 2J5QA 3LC1O 4I5EA 4YT5A 1Q0LA 3PWZA 4D43A 3WOHA 4AJ4A 3L6DA 3B70A 1TT7A 3AJRA 3PGJA 1V0JA 2BD0A 4P22A 4R01A 4M54A 1A4UA 3VVCA 3ZDFA 1WW8A 4JROA 3Q9UA 1LDNA 4XQCA 1P0FA 3HFSA 1AHIA 2AEMA 5TF4A 4EJ6A 2QRLA 1B15A 3H65A 4D41A 4INAA 4EBFA 4PZCA 4BO9A 5JC8A 1U3VA 4FQ8A 4CLEA 2P4QA 3AFMA 5DBGA 1XLTA 5ENVA 2X58A 3DL2A 2GRAA 1QYXA 1UXIA 1SB8A 1I30A 1TVEA 1H6AA 4X54A 4J1SA 5LCXA 1PGJA 2Z1NA 3DC2A 1KEVA 2P4HX 3DZJA 3KVOA 3F46A 1NP3A 1I3KA 2AQKA 3FSRA 2CNBA 2YW9A 4AJ1A 4PGFA 1UDAA 1T1SA 4NBRA 1N2SA 1QG6A 2YY7A 2HMSA 4BMNA 5IG2A 2A94A 4A7PA 2ZB7A 3EAGA 1UAGA 3H9QA 3ONFA 2UAGA 3MJ4A 4DIOA 5A5EA 1YJ8A 1NQTA 3EZLA 4OSOA 5K9ZA 5BNFA 3A06A 2IODA 4TVOA 4H15A 5BSFA 4FGSA 4PN3A 1U4SA 1WMAA 3DFZA 1ZEMA 3P7MA 3S2GA 5IFLA 5AXAA 3ETEA 3E48A 5T67A 3F4LA 3OIGA 4PLWA 4GGOA 3RUDA 1LX6A 4J7UA 2P2SA 4J2OA 5C7LO 1N5DA 2QRKA 3GAZA 3GEDA 4RV9A 4GGPA 3SLKA 7MDHA 4Q3NA 1MLDA 3A28A 3WIDA 3M1AA 4IIVA 4RVHA 1F12A 3I9LA 1U3UA 2D0IA 3IDSA 4IY1A 1DC3A 2VT2A 3ON5A 3TF5A 3EGOA 4P4NA 4RVUA 4XGIA 5JSFA 3V1UA 4ZGWA 4ZU3A 1PJBA 4CMIB 3BXXA 2GD1O 3I4CA 5TT1A 4U6SA 3DEYX 4MVJD 1AN9A 5CPBA 2WDZA 3I5MA 2UUPA 2NM0A 2VYND 2Y1EA 3JYQA 3R6DA 1NXQA 3BIOA 4Y67A 3WTBA 2RHRA 2ZATA 4NU5A 2G5CA 1K3TA 4FR5A 4XR9A 2R00A 3F9IA 3ZW9A 5HS4A 1GCUA 1ISMA 3WNVA 5C7IO 3WQQA 1BW9B 3DBRB 4E0BA 3FF4A 3ICCA 1LNQA 3AUUA 1NR7A 1Y5RA 3OQ6A 5AQ1A 2OO5A 1HYGA 1HZZA 4PG6A 3QWIA 5L3ZA 3PQFA 2G82A 3FR7A 4B4WA 5KVQA 5ITVA 1XEAA 5T5QA 4FSHA 2Q1TA 5GMOA 3U49A 4I5GA 3BMOB 4N7RA 5G0TA 3UFXA 2QYTA 5A1TA 1AHHA 3GDFA 4ZD6A 5FFFA 4GVLA 5JAMA 4U0JA 3IP3A 1EVJA 1U8XX 2Q2QA 1FDTA 4YJFB 3WNQA 5C7OO 3UKOA 1GQYA 3I9JA 3CIFA 3NTQA 2C0CA 4NK4A 3WQRA 5G2OA 3QJ5A 4Y98A 4CQLB 1T26A 5L4NA 4LISA 4RCVA 4ZRNA 4YCAA 3KM0A 4EZBA 3AI2A 2I65A 1DHTA 1SEPA 4CMCA 2DM6A 2H5LA 1E3LA 4ID9A 3L0DA 1TI7A 3VPXA 4A2CA 3INGA 2AG8A 1SEVA 2Q46A 1XQ1A 3PXXA 3L4SO 2FR0A 1GDHA 1PJ2A 4O63O 2PGDA 2CDAA 3QSGA 4G81A 2X86A 3KEQA 3V2HA 2Y68A 4PLGA 1XGKA 3G3EA 4NK5A 4W99A 3C3XA 3DAPA 4DQVA 3HE3A 4YT2A 3PLNA 2PKRA 1Q7CA 3QWFA 4FFRA 3EY4A 1PZEA 3NJ8A 4FCCA 4W82A 3QVWA 4BGVA 4BNUA 1DJNA 1L7DA 3WGQA 4AL4A 1VKOA 1NQOA 2D1YA 2HSDA 1BDBA 5F5LA 4XA8A 4I8XA 1SB9A 4NFSA 3VAZA 4KOAA 2IZ1A 4BNWA 5BSGA 5ENDA 1UJMA 1NHGA 1FDSA 3HDYA 3ADOA 2NU8A 4CL8A 4CMHA 4DWVA 4KMSA 3WSWA 3AM5A 3K5PA 3ZV4A 2RH4A 1TLTA 4CV1A 1M6WA 4ZJUA 1PS8A 3JYPA 4NJMA 2EG9A 3WGOA 2YDXA 4E5NA 4C7JA 4F3YA 4UUMA 1YRLA 4CV2A 3GOHA 4WECA 4BGUA 4D44A 3IKTA 2CSUA 1ZCJA 5T8KA 4WUVA 4IPTA 3U9LA 3TSCA 4D42A 5I7EA 1HDRA 3GVXA 5L40A 3WBBA 5JO9A 3GEMA 4OQYA 3Q11A 9LDBA 4ROSA 1PZGA 3ENKA 4LK3A 1WZIA 3AUTA 4YACA 4HV4A 2WWRA 4F46A 3DBHA 2VHYA 5T8KC 2J3HA 1OMOA 3DR3A 3Q2IA 4YEDA 3G17A 1W6UA 1E77A 2ZB8A 1NPTO 1YQXA 4MIOA 1V35A 1UP7A 2QRJA 3A4VA 4U0KA 3TZQA 2JFFA 2NU9A 3GPDG 2YZ7A 4KWIA 4OXKA 3VTFA 2P91A 4QO8A 4YAJA 3V2GA 3VC7A 3H9EO 4GPD1 1DC6A 3WQSB 2DPHA 4RVFA 5JBIA 3GT0A 3W8DA 4URFA 1HSZA 2FZWA 5JAQA 1VKNA 3VKUA 3RBZA 4Y6PA 3RIHA 5A06A 2WTBA 5IF3A 3AFNA 3F6YA 4KQXA 4PG7A 2Q4EA 1I36A 2CVOA 3JQGA 1PGQA 4BOYA 1N9GA 3NT4A 5EQFA 1JKIA 1IULA 1UP4A 1LQTA 3W4JA 3Q2KA 1O9BA 1X0VA 1P1KA 1X7DA 3NT5A 3QVOA 4YQYA 3OETA 1B16A 4PZDA 2IZZA 4YPOA 4AICA 2JAHA 2GCGA 1P1RA 3BTSA 5F21A 1R0KA 3RU7A 3RJ5A 3PJEA 4IIUA 3E82A 5L4LA 1VC2A 2DTXA 5DCYA 2QHXA 4CMKA 3H3FA 2Z1MA 2J5RA 4R16A 3AOEA 2NLOA 5F1OA 3X2EA 1M76A 3KLPX 1Y7TA 3QQPA 4YAGA 1IOLA 2CVQA 4IJVA 1KY5A 4RDIA 4YJHB 1NWCA 1W73A 2DAPA 3JQEA 4L4XA 3WR5A 1LI4A 4AJIA 4F6LA 2CMDA 2HMTA 4XYBA 2ZYAA 1ZK1A 3NKLA 3S2EA 1I0ZA 2C2YA 1YWGO 5THQA 1RM3A 3P5SA 1CWUA 2E6UX 5HTOA 2RHCA 3E5MA 1U9JA 4ZRMA 5IN4A 3GMDA 3JD2A 1DLIA 4JP3A 2HK8A 1B2LA 3IC5A 2O4CA 3KRTA 1HF3A 1LEHA 3H9UA 1NFRA 1UH5A 4EJMA 2YV3A 1ID1A 3DTTA 1ZIDA 2H9IA 2I5PO 3FD8A 3IJRA 3DMTC 2HK9A 4DA9A 2VOEA 1EK5A 1X1EA 1ISJA 4J43A 4MVJE 4R3NA 4BGIA 4E30A 5JDCA 1Z73A 4BKQA 1SCUA 5ADHA 4NNJA 1X0XA 1UZMA 1FDWA 1VL8A 4ND1A 5TSDA 1YL7A 3ANNA 1PZHA 4HX5A 4L4SA 1EFLA 1J4AA 4LN1A 2TMDA 3GVHA 2E37A 1JKFA 1QYDA 4FGWA 1HLDA 2O50A 1ORRA 2C5EA 2EEZA 4B4UA 2Q50A 3CTMA 4E4YA 1MC5A 1UXGA 1KEPA 5JCXA 1WNTA 3O9ZA 1PJCA 3PQEA 3KZVA 4Z9FA 1I3LA 4CLRB 4HADA 2SCUA 4RPGA 4WJZA 3I4FA 4M1QA 4RJTA 2IEBA 5G0UA 1B0AA 4MO2A 3KLMX 4GSKA 1X13A 4UVEA 4LSWA 2LDBA 2A35A 3TJRA 3WX0A 2BI8A 5KJEA 4BO6A 4DL9A 2VUSA 2DPGA 1YDEA 1AXGA 2D5CA 1SC6A 5FYDA 3RBXA 1FK8A 2GN6A 3JQFA 4CLOB 2NQTA 3GN1A 1RYDA 3DONA 4IBOA 3OEYA 3QRWA 4BNMA 3QWHA 1ONNA 2NUAA 4GKBA 4UEKA 3FNEA 3DZIA 2BFMA 1ENOA 3JD1A 3WBFA 2BMAA 3NDIA 3WGZA 2ZIZA 2FSVA 5AVOA 1QLJA 1ZNQO 3ENNA 3UCFA 1V9LA 2VZ8A 3U62A 1CDOA 3DHNA 3GNTA 1XA0A 3RUIA 2C7GA 3NT2A 4UULA 5EN4A 1I01A 2VOJA 5JAIA 2GASA 2GN9A 4QT0A 1WAMA 3G79A 4J7XA 3MWDB 2V7PA 4K9DA 4Z3DA 4BQPA 1PR3A 3DTYA 1GPJA 4A03A 3QW2A 1EVIA 1KERA 2Z5LA 1BHSA 1HDGO 2PH5A 4CQMA 4DLAA 1OI7A 2VUUA 3C24A 2I99A 1EBFA 1TT5A 3L6EA 3ROKA 1ZK4A 3H9JA 1U8FO 1KS9A 4WLEA 1I3NA 3TN7A 3H9GA 1LA2A 2B4RO 3ROQA 4LMRA 3W8FA 2WYVA 3WGIA 2DFDA 2ZCVA 3R0IA 4J0EA 1T4DA 3I9NA 1WXDA 4J7CA 4RGBA 3VTZA 4TRNA 2X8LA 3DBHB 5IDWA 1C1DA 4XB1A 1ZVMA 5JE8A 4AFNA 2NWQA 4GLOA 1HTBA 4ZHSA 2AW5A 5TIIA 1QR6A 1Z7EA 5U4QA 1KIFA 2X0IA 1KVTA 1XG5A 1KEUA 2OHXA 2VNSA 4PLTA 3ZW8A 3NGLA 3WMXA 2GPTA 2VYVD 3MJEA 4DIFA 2DLDA 1DFHA 3K92A 1C1XB 4YYZA 4RVSA 3PVZA 3DZHA 4I9UA 4N18A 1A27A 1X1TA 4NHEA 1BRMA 2F00A 2BGMA 1R6DA 2BGLA 5LDGA 4EW6A 5BSHA 1GY8A 3K8ZA 2X9NA 2RAFA 1GL3A 4J4TA 4MVJH 4M87A 1O5IA 3F5SA 1EUDA 4OXNA 4K26A 4LW8A 3K31A 3K2BA 3PLRA 4YJGB 1XR3A 4BB5A 5FI3A 1A5ZA 4W9NA 2A9FA 4Y9DA 4BV9A 1ZK0A 4R9RA 4LVUA 1NR1A 2EHDA 3JQ6A 4IS2A 2AA3A 2NTJA 2XPCA 4B7CA 3RFXA 3C1AA 3PFWO 5JNLA 2ILTA 1EFKA 5JY1A 3DOOA 3IUSA 1Y8RA 1XSEA 2X9GA 3MCVA 4KDEA 3E9NA 5F1PA 5EESA 1MX3A 3OFSA 3LU1A 4BKOA 2BKAA 4LCEA 4HFJA 1WDMA 1E6EA 3Q1LA 1GV0A 4UVIA 3U4IA 3VPSA 4L9RA 4BNLA 4R54A 1DJQA 2FN7A 3KOUA 4CR7A 1LLDA 3A9WA 4OOFA 4GWKA 2VWGA 1Y9AA 1Y5MA 3MEQA 1LC0A 3ONDA 4OYRA 5DDIP 1GZ4A 5IXYA 2O3TA 1AGNA 2HLPA 1H6BA 4UUPA 4DLBA 4IS3A 4CUJA 2WD7A 2P5UA 4ONEA 2BRUA 4OGWA 4WE3A 4CR8A 2DU8A 3D3EA 1SOVA 3E9QA 3ABIA 3KBOA 4B3IA 2WMDA 4WOKA 3LT4A 3NJ4A 2ZTVA 3BMQB 1YGYA 2B4QA 2UDPA 3VZPA 5L51A 3INTA 4TROA 4B3HA 1IHYA 3AY6A 3P19A 4TMFA 2JHFA 4E2YA 4BKRA 2VHWA 5JC1A 1KETA 4CQMB 1GYPA 3PYMA 2X5OA 3PZBA 3QVTA 2AE2A 4MPDA 3SJ7A 2H63A 3QE3A 1F8FA 3JQCA 2W2LD 5EMHA 2NVUA 4WPGA 3QVSA 3L9WA 5L9AA 2UV8A 1G6KA 4FBGA 1GYRA 2CZCA 4E12A 4BKUA 2VRBA 1GUYA 3N7UA 1H93A 3WGHA 3ZNNA 2CF5A 3DB2A 1VSUA 4W6ZA 1MXHA 1N7HA 1P77A 1LRKA 1SAYA 1T1RA 4K6FA 2WJPA 4EI2A 4XJTA 3DXFA 2D59A 4EUHA 2I76A 4NJMB 3OM9A 4OMUA 4OKNA 2JFHA 3SJUA 4CQLA 3GUCA 1LDBA 1JWBB 5H81A 3WGGA 4CM8A 3DMTA 5ILOA 4A10A 5JFOA 4DBZA 3ZWWA 2OUIA 1NASA 5KJCA 1T2CA 3JV7A 4WEOA 3N58A 1ONOA 2GZ3A 5CFZA 4BO2A 5H83A 4GMFA 3GLQA 3PEFA 3FWZA 3HG7A 3SEFA 2GYYA 4I5FA 4GX1A 4BNXA 1HDCA 5A9SA 3JQ7A 4R1UA 4DC1A 4E13A 2Y99A 3BTOA 1ZXLA 3PP8A 1MFPA 1GEEA 3WLFA 2YYYA 3L4BA 5DT9A 4R4JA 4E5PA 2W2KA 3D0OA 3S2IA 5A5FA 3DAGA 2O3SA 4FIZA 2GZ2A 3OJ0A 5KKAA 3BMNB 4RORA 1UXKA 1IZ0A 2R6JA 1NFQA 2QZ9A 3WYCA 3EMKA 1ML3A 3O03A 4BNIA 3SVTA 4TSKA 4IZHA 2ZYGA 2FMUA 2BH9A 2CF6A 3E8XA 1D1SA 5CG2A 2Q49A 3M2PA 1WLYA 1P1FA 3NGXA 1E3IA 4ALKA 2PH3A 1E3WB 1I2BA 1Y8QB 4RLSA 3U4CA 4B79A 2AEJA 3C7AA 1IZ9A 4NZ9A 1RM4A 5EL0A 1YO6A 3OIFA 3DO5A 1BWSA 5F5NA 4XR4A 2DBZA 4IDAA 4GAEA 2PA3A 4HFMA 1I8TA 1EVYA 1UDBA 2CDCA 2Y66A 1I33A 3KYDA 1GQ2A 3LF2A 3I23A 5IDQA 3PYLA 4GL4A 3F4BA 3DZBA 5T6BA 4DQXA 3FPCA 3WSVA 4IGFA 2PLAA 5L7TA 3VKVA 3TL2A 1NPYA 4ND5A 4S1VA 1MFZA 3ZWPA 5KJ6A 2EGHA 3GMSA 4JP2A 2Y0EA 3K73O 2FOIA 5HA5A 3GFBA 2XF8A 1T2FA 2PTGA 1OFGA 3RUFA 1DBVO 4Q9NA 2OBNA 2BFAA 2O3JA 1HRDA 4QXMA 4IDBA 1QXSA 3PHIA 4M55A 3GG2A 3EHEA 1FJHA 4FJ2A 5I8ZA 4IGEA 1W4ZA 3VZRA 3B20A 1VPDA 2FZEA 1LSUA 1YB1A 2B69A 3TOXA 4EITA 3D1LA 1C0IA 4IZIA 3OEWA 3IAHA 5JAZA 3LT0A 4FS3A 2PFGA 1CYDA 1Y1PA 3G1UA 4E2XA 4BO0A 1CEQA 1EDZA 2VZ0A 2EW8A 4N5NA 3GH3A 1CETA 1XWFA 3H5AA 4S3MA 3LZ6A 3AU8A 4PFJA 4PCVA 1MC4A 5DP1A 3K9QO 3ZWCA 1B14A 2GGSA 3U4HA 3NDJA 4KQWA 1A9ZA 2PK3A 2EV9A 4CPDA 1BXZA 3BTVA 2EXXA 4FFOA 3AI1A 1U7TA 4BNYA 1T2DA 4XIYA 2PWZA 4PLZA 1G0NA 1CQJA 2PZMA 1IHXA 3GNSA 4FC7A 4CM4B 1F17A 3E9MA 3FTNA 3UN1A 2A92A 1NHWA 3U0BA 5A4DA 5KTKA 2W98A 5A9RA 1HYEA 3LF1A 1GYQA 3NAQA 4YAIA 3VHRA 3CMCO 1QMGA 4FJ0A 4G65A 1U3TA 4M86A 4ZQFA 5L53A 4ZICA 1ADCA 2YV1A 4RZHA 2X1HA 3WWZA 4EYEA 3AU9A 1Z45A 5BNTA 3QLJA 4ITUA 3G1TA 3HB5X 4CLHA 3DFUA 4FC6A 1JN0A 3UHAA 3TFQA 1HYHA 1V6AA 3GC6A 1ZJZA 3OJFA 4DYDA 1J0XO 1FF9A 5CG1A 4KDFA 2NADA 2C07A 3QHAA 1E1LA 2FHSA 1K6XA 1XCBA 3ZWOA 4YAEA 1VI2A 1I10A 2Y1FA 4CMGA 4GLLA 5G0VA 2O7QA 1IB6A 2PD4A 1ADFA 1DEHA 1K6IA 3BZUA 4ILKA 3W4IA 4BO3A 1QYWA 4YRDA 4AJHA 2GN8A 1ZMTA 5B4VA 5HRUA 1JQBA 3GGOA 1GAEO 4EDFA 3GF4A 3EUWA 1EE2A 4I5DA 2VCYA 1ENPA 1FXSA 2VWQA 1KY4A 5DP2A 1O6ZA 3RC7A 4NBTA 4DPKA 3OA2A 5MDHA 4BO1A 4RPHA 1IY8A 1D7OA 1E3JA 4C7KA 3DAFA 1VL0A 3ZHBA 4WCDA 3VDRA 4ZVVA 3JQGB 4RDHA 1SNYA 1XIVA 5HM8A 1NYTA 1ISFA 1PR9A 2ZB3A 3GVPA 3NTOA 2GR9A 4XX0A 4AG3A 2VNAA 3RC2A 2HK7A 1RM5A 1KYQA 3EC7A 4BL5A 3HDHA 3HNPA 3H5RA 5L7WA 2YFQA 2CD9A 4LGVA 4ALJA 2Y05A 4YAKA 4E2ZA 3DOCA 1ISGA 4II2A 1QLHA 4CM4A 2UYYA 3O38A 1FDUA 4J4BA 2J5KA 1KVRA 2ZYDA 2C7VA 2NNLD 4PLPA 3CXRA 1PGPA 5TT0A 2GF2A 3ZGYA 1Z74A
chains in the Genus database with same CATH superfamily
1ZAKA 4XM0A 1NI5A 3IUNA 1RXIA 4RZIA 4LKOA 3ZDXB 3FR8A 4ZO6A 4ECEA 5K3FA 2P8SA 3PEVA 4HNHA 2QEQA 2A30A 1N3LA 3M83A 1MENA 1E5LA 3VVLA 1C1YA 1HY3A 3BERA 5EWMA 1W0JD 3K6SA 1GZ5A 4R1TA 4WXEA 2X9QA 4WXMA 1P74A 4FT4A 2PGXA 1N92A 2HZ7A 2IXBA 1V8PA 1U6KA 3PB3A 3NWEA 1QKKA 5HF5A 1U7DA 1YFKA 2W2VA 4FHGA 1IE3A 2GLXA 1E4YA 1MIOA 3Q5GA 4K9SA 1MDBA 4NAUA 2RGUA 4MI3A 3V7UA 5E6UA 3L8FA 4AX8A 2BUAA 4W1RA 2IHVA 2YWDA 2JGJA 2OZVA 1FDVA 3LUPA 2P9FA 3I1IA 4NYMR 4L74A 6GPBA 4TWRA 2AJDA 2RSLA 2QZZA 4CTKA 4OHOA 5BR7A 5I7SA 3X2FA 1JDSA 1G16A 2ATVA 1ULUA 1GQRA 2Y0CA 1JEQB 3CZQA 3THYA 4ACBA 4PRKA 3K4PA 4HLQB 3VPAA 1C9NA 1SIWA 3NTVA 1N2ZA 4R84A 1QX4A 2BM1A 2J5XA 1HETA 2OXCA 2YR0A 2FF5A 4Y8VA 1QYVA 1Z6AA 3MBOA 4LNHA 3JRWA 1J42A 2PHZA 3OTIA 1KARA 2G3YA 2QP9X 3JATB 3JXEA 2I7DA 2WKQA 2WU1A 2FUEA 3AW9A 4DTIA 1DRWA 2A0FA 1F06A 4C7VA 1WP4A 1ZJ5A 2PQMA 5B6PA 5IAAA 5E6SB 3KQNA 2QMHA 3RYIA 2A5JA 3GVCA 4BHTA 5HR5A 2ZWAA 1FQJA 2B5VA 2ZT7A 3L4BC 3K0SA 2Q9UA 4D8YA 4YMHA 4F2DA 4U7PB 3B3QA 3AM3A 3JYLA 4KRYA 3ZJ5A 1CUSA 1NMZA 3PPIA 3V8BA 5EWLA 1EEXB 5JDIA 2ZUUA 4EYQA 2Z4SA 4RD3A 4F2GA 5DULA 2WK1A 1U1IA 2Q9AA 5FAKA 2HK6A 4DSUA 4P84A 3SFVA 1SBZA 3QKRB 2OZKA 3NPAA 3MRTA 4ZT7A 1XD2B 4BJ6A 4QGSA 1IPFA 1B26A 1HRKA 3FGNA 4JJAA 4MVJG 5EPOA 3SICE 4BV3A 4EG3A 3PHJA 3T54A 4RF4A 5ALWA 1GFZA 4GBGA 5CDFA 4D8TA 2VP6A 4RV4A 2GK4A 2HADA 3GRZA 4DDUA 5GJBA 1YRQA 3BBPA 3AEZA 4CEJB 1JIKA 2E87A 1NVFA 1T2VA 4OD0A 4XWAA 3SZGA 4YWJA 4AO6A 1LTQA 2J9YB 2AFHA 3X43A 1A4IA 4R41A 1KNQA 2Z58A 3FUCA 3RVNA 4BQEA 4P3XA 4A92A 5A3QA 4YI5A 2I66A 5BR8B 1H9AA 3SDBA 5AUOB 1ULSA 4IKEA 3JYOA 3V1NA 2H3EA 2KLHA 4MUIA 2J45A 3O4RA 1NJSA 4Q4DA 3RBVA 4MIEA 4RD6A 3NONA 4P3PA 4UMVA 2IH2A 1KQFA 1O95A 4QIHA 1GZSA 1JBKA 1GUFA 2FPWA 4HAWA 1XEFA 1TGYA 5E8JA 2R5NA 2OCLA 3O95A 1PD0A 2Q3MA 3IAM1 4LNUB 5SZJA 3EIEA 2R1UA 1JPVA 3EZXA 4IGKA 5FOXA 4BFVA 3E22A 2EQ5A 3CLKA 1ZSYA 3TJMA 4O4LA 3UH1A 1XZCA 3LI2A 4XEUA 2FEKA 3VSDA 3TEFA 4N5HX 4HAVA 1NW3A 4OK3A 3R6GA 4A0HA 4IJWA 2Q5OA 2XZDA 2Z57A 4I50A 2WFLB 1EZ4A 2I8CA 4RHEA 3ZD9A 5ICFA 3ORRA 3THSA 3R3VA 5DASA 3ROMA 4DQ0A 3UB3A 2BGNA 3EIFA 3D7SA 3EDOA 2PPLA 2A0YA 3BBLA 3IVGA 2Q1UA 2NZ8A 2WLSA 3DQPA 4I1SA 1E1RA 5DCUA 3VM6A 1YH3A 3PFHA 3JQ8A 2G63A 4EK9A 3DMRA 2BR4A 2VJAA 3CG0A 3RJMA 4OHBA 5DNUA 1X92A 2NSYA 1DHRA 1N4DA 3A1CA 4BCBA 2ZIEA 3QVXA 3PUWA 2PX3A 1JAYA 2YN0A 3THOA 1GPMA 3K0CA 2QN8A 1EQUA 4WCFB 5ALGA 4CM7A 4PYJA 2P5SA 5KTOA 4JJ8A 5DGHA 2GPSA 4CBVA 3TUZC 2B37A 3ZV3A 2FKNA 1IY0A 3BGIA 3L7JA 1C1XA 4PZZA 4UOEA 1EXVA 2VXCA 4HATA 1YQ9A 1SU7A 4B0OA 4HWSA 3G49A 1ZJYA 4KXUA 1WDLA 4MWTA 4OY3A 2ZBEA 1N5JA 1F9EA 3RR2A 4A0RA 5I9NA 4AQ7A 2QUBA 3WJAA 4Y7DA 4HDSB 3W6NA 4YLEA 1IUNA 3MFYA 2L2QA 3HVIA 4GI7A 1EX1A 4RY0A 1ZK2A 2YQ5A 4HDRA 2G04A 4S1PA 3REFA 2P65A 4PYNA 3ZOZA 3CBQA 3TE7A 4HLUC 3EGDA 1UKYA 4JU9A 3OT1A 5SYAA 3PKZA 2OFXA 2CLMB 3W2FA 3DDOA 5J47A 3KOWA 1QONA 5AJXA 1L4FA 5ILGA 2QDXA 2ZFUA 4BQOA 1XWIA 2GTIA 3LDGA 1KKUA 3QBTA 2IXFA 4RMJA 2WJJA 4C4TA 4QPNA 2IHUA 1DV1A 2CCKA 3OLXA 1KEWA 4C2TA 2AHRA 1DELA 3CZ5A 1BVRA 3MK31 3H42B 3TXXA 3MJTA 3VR2D 1FYEA 1YB7A 3ROFA 3V6LA 1A50B 4NCXA 2OQ2A 4IO1A 3T9DA 5HJ7A 2RIPA 1H2WA 1C3VA 1YDMA 3EIXA 1M74A 2PD3A 1OFUA 1P2FA 4J1QA 4NPHA 1PDVA 1JZSA 4AZVA 1E2QA 4ETWA 5AVJA 2XUGA 2ONJA 2C96A 4NE7A 4QEDA 3T5GA 5ALUA 1AN0A 3QNUA 1KI3A 3R6WA 1IIRA 3AP2A 1F3OA 5TPZA 1NRWA 2R44A 4M83A 4WZBB 5H7XA 4EGSA 2ADOA 1BJKA 3KJHA 1YNSA 3VVBA 3UPDA 5JDIC 3R4VA 5DM60 4J1TA 3OTQA 1TA9A 2A9KA 2QMZA 3IKLA 3MTQA 4TS1A 4F93B 1K7SN 1MHTA 2JFUA 3DD5A 1SZJG 4PAQA 5H0IA 3VAAA 2H16A 3S55A 2EW1A 1BDJA 1X9IA 2QRHA 5EYPB 4XD7A 3VI3B 1XWWA 3GFOA 4MVJI 3VR5D 1SIOA 3H8JA 1UDCA 1KDTA 5BW8A 5E2BA 4D26A 3WA7A 2CVZA 2IEIA 1H5QA 1IN1A 1AXEA 1O87A 1P33A 2E82A 4RO0A 4BV8A 4AKHA 3FWYA 2NXEA 2ZI7A 3MOIA 3BS4A 5KCZA 3ADDA 1UZAA 3CZAA 1L4UA 2Q5QA 1KC1A 3NRBA 3LCRA 3P2YA 4PGGA 3G2KA 4AURA 3GG9A 3LXMA 4QYXA 3HJGA 3IMEA 3TW8A 4RIFA 4DLLA 1QORA 2G8LA 2ZVPX 3AUAA 3FWNA 4JX9A 4JBIA 4KQMA 4MJ3A 1KH2A 4IH9A 5CIQA 4EIWA 8ATCA 1FQOA 1K06A 3D7MA 1XZPA 5GZ1A 5GZ3A 3ZU3A 2WWWA 9LDTA 1JQ5A 1XMPA 1U7OA 2HRZA 2RFLA 3CFYA 2AFIE 2M1XA 3HPRA 3ES9A 2I91A 4RK6A 4IYJA 5G4KA 3I09A 5I3ZA 3KR9A 5C5DA 4MP3A 4JKIA 2WHQA 1DAPA 1L5OA 3PC8C 4G25A 1XDDA 3EDRA 4ZKEA 2JLYA 1HKHA 3EBOA 1TUIA 3FAKA 2XBMA 1TM3E 4G1FA 1CF9A 4P0QB 1GLNA 1SURA 2Q6VA 4JSRA 4QSHA 3UAXA 1NDUA 4N48A 4OO3A 3X3HA 5AJYA 4B4VA 2LBPA 3I2YX 2C57A 4RFLA 3RC3A 3TCXB 1JQKA 3RSGA 3BSWA 3KKNA 3UK1A 5KIAA 1NLFA 1EUZA 1EGVB 1AX9A 3ZNOA 1EUCB 4DLXA 2H2AA 2B5WA 5BW4A 2JIQA 3RC9A 2X6RA 4BNNA 1Z0AA 1DLJA 4X44A 1Z06A 1Z29A 3H2GA 3W5JA 1S2GA 1HFJA 2Q7XA 4QYSA 1S1CA 3DMGA 3RAFC 4MWOA 3C5HA 2PMCA 1VKZA 1XZLA 5F52A 2H2HA 1JXMA 2WIGA 4GQAA 4F1KA 5FWXB 4TMYA 3FE2A 2VEDA 1QUFA 3OSUA 3V4SA 5FHQA 1XTVA 3ZGZA 1M0TA 1W2GA 3LWDA 4GXRA 4ZQBA 3IAXA 2X0FA 1F2VA 2PEZA 3PL5A 4K8RB 4EY4A 3I5YA 4N5DA 4LEIA 1NUTA 3RVDA 2HT1A 1XNQB 5DB4A 3PA6A 1NM5C 1WABA 4B8ZA 2G36A 3D3WB 1L5WA 2JJ1A 2PD6A 5FEUA 1SUBA 5E7IA 3ACDA 3V8EA 2PT6A 4P0PB 1SPXA 4HPJB 4R2JA 4WJLA 1W0CA 2QVGA 1IBRA 1S01A 3WV4A 1K4KA 1GGJA 2GD0A 2J9ZB 1BH2A 1A7UA 1XHFA 1Q1ZA 5GOZA 3WWYA 5J4LA 2HRBA 2OGUA 1X39A 5IUNC 4JY7A 2CMFA 3F97A 3MS2A 3P45A 3UPTA 1LDGA 4UBJA 3WGMA 3CBGA 1YJ5A 3GQBA 1L5RA 4P8RA 5DW3A 1GEGA 4B3JA 4E5MA 4R40A 3FOWA 3GBPA 2ZDQA 3WKAA 4EVRA 1VIDA 5T6MA 1F0KA 1ECBA 1G2IA 1OZAA 1PCXA 1LBIA 1TPZA 2QN9A 1C0EA 3VH4A 2OORA 5U9CA 2VH1A 2WG0A 3ZV6A 4JELA 2WABA 4TV8B 1K0FA 1MZVA 1XLTC 5EP4A 1JTFA 1I6MA 2VBCA 5CLGA 5TQJA 2BFOA 2X19A 1GTG1 1VYUA 2H06A 3ND7A 4M53A 5B2EA 3E81A 3M6LA 2AMJA 3I42A 3T3NA 2HSWA 1UBKS 2IEDA 1KJQA 3U5TA 1ECJA 1K8RA 2XRMA 3ESZA 5LZ8A 1YHZA 4DCPA 1IDN1 1BEZA 4ER5A 3TPCA 3SNHA 1G7SA 3KXLA 4F5WA 1UC5B 1M8JA 3CLRC 3UMFA 2F90A 3IAM6 4FM9A 5M04A 2H18A 4MRRA 3FGOA 2B8TA 3HFGA 5JTUA 2PT9A 1UQRA 1TJ4A 3FCXA 5BVHA 4DY6A 2JI7A 3QV1A 1EINA 3BIJA 4NBWA 4AY5A 1E20A 5EE1A 3AOEC 4XCVA 1C8KA 2NU9B 2H4WA 3BCHA 4TUYA 1UPUA 1L5HB 4OQLA 3F47A 2CNNA 3JQAA 1U3FA 2G71A 3UF0A 3WIEA 2OO7A 2Y1GA 3EWNA 4DPMA 3HLTA 2EZTA 2J6BA 4LPKA 3RKRA 3THYB 3HADA 1LPNA 3T5PA 1BS1A 1E60A 3O8QA 4OQEA 5JWOA 3SZMA 3HEAA 3FLEA 3M6WA 3G9XA 1DFIA 3O2NA 4FN4A 4G2NA 4ESOA 4TTPA 2X22A 3I2FA 3T35A 4OUDA 2JEOA 3T7AA 3ZDRA 3EJWA 3ZWMA 1HEUA 3MTJA 2AOVA 2J9FA 3TQTA 1NSFA 2HC9A 4UQPA 5J5VA 4FZRA 1XZAA 1OIXA 1K8XB 3RT7A 3PBKA 3ZKAA 5IZCC 2YHBA 3WJ7A 2P9BA 2IPXA 4UU7A 2KM1A 3SMVA 2JI4A 5EINA 3K09A 2P1DA 1Z2CA 4PRZA 1OUMA 4BNHA 3DBOB 1OA1A 4WASA 2O54A 2IXDA 1VHJA 2JIBA 3M5CA 2V6JA 2VTVA 5BXYA 4CETA 3DHEA 5AYVA 5KKNB 5KNBH 3ZDZB 3AR5A 2G7MC 5HGJA 4JJEA 4RJIA 4C43A 4C7XA 4E3ZA 1NU6A 2HU5A 1FUKA 3GQBB 3Q0EA 1F48A 3M9WA 2CW5A 4YT4A 5C81A 4AP9A 5SZIA 3IDFA 1E0KA 2WJ3A 4I9GA 1XC7A 4P4LA 1SKYE 3VH2A 5CHEA 1LKZA 3QJGA 1RMQA 1HPLA 3JQAB 5AKXA 1ZIYA 4LV6A 1XDSA 3KSDO 3FNBA 1CKEA 2RGXA 1YAHA 3DE7X 2H1IA 2Q29A 3DWIA 4RY8A 1Q7TA 1JR3E 1LJUA 1W96A 3HI4A 4O2BA 3R8XA 1TO1E 4AK9A 4DLZA 2OHFA 4C3UA 4RMIA 2FPXA 1N0WA 1JA9A 1E2GA 4L5IA 1LPBB 3E5NA 2HWKA 2HFJA 4C4PA 1EM8B 3B6ZA 4LV5B 2O2ZA 4EFKA 1EFRA 4IHJF 4BNZA 4Q24A 3HWRA 3RTBA 4QICA 1XTBA 2ZYRA 4ENPA 5JISA 2OC4A 3DAOA 5TB5A 5HJ2A 2QKYA 3L49A 5AK3A 3RS3A 2JKZA 2E7ZA 2GA8A 3OO0A 4ZYLA 1RAHA 5K6AC 1Q6YA 3U3MA 5EXDA 1O94A 1LH0A 2HLNA 2C92A 2MMCA 1EU1A 3AEUB 3CE9A 2FK7A 2JIRA 1GFSA 3KCNA 4FW8A 3SE0A 1WCWA 2CLKB 4TLBA 3SZLA 2DFVA 2WFZA 3GLRA 5KYVA 2C2GA 5JWHA 5CDUA 1D2HA 4QO7A 3SS8A 3TMAA 4DN6A 3EC1A 3AFHA 2V59A 2XGGA 3G5UA 3FNHA 3R5KA 1JZTA 4R81A 1W35A 4ZWNA 3FCAA 4LF4B 2Z2KA 5K0EA 1RRKA 1KHHA 4FSDA 3M9LA 2A8YA 3B2EA 1MJHA 1NRXA 5LIPA 1RRVA 3DL4A 1VCHA 3BG5A 4GOJA 1G21A 2VATA 2C8JA 1U2GA 1ZW1A 1B8UA 5KYWA 2WG2A 1TQ2A 4TXHA 3A27A 1LF5A 4B87A 1OW3B 4DNFA 5E6UB 3WXBA 1P4JA 3CUSA 1FUUA 3LYLA 2IW1A 4LJ7A 5COBA 3T3IA 4D7AA 5LQSA 1KBOA 2ESRA 4YIKA 1JL3A 1VBKA 3SXJA 4U9UA 4PYIA 3RE1A 2VHTA 1EDOA 3K0AB 3REOA 4UCWA 1D3AA 4HQRA 2PKXA 3ORQA 3MWEB 3K5HA 1D9ZA 1II8B 1QG0A 2VDLB 2W9XA 4Q9IA 4TKVA 2FWJA 2JJ2D 1YJQA 5EWMB 3ROPA 3M8KA 1FX0B 4I55B 5TARA 4MV0A 3BGDA 3DDWA 2IOFA 1G2QA 3AYZB 3KYIB 3R23A 4DGSA 5FNZA 5TNXA 1CY2A 1QP8A 1I1HA 2HXYA 3L0OA 1ZNZA 5HIMA 1HSOA 8ABPA 1KSHA 3FYSA 5F4BA 4NL4H 3VNQA 2NP6A 3S4YA 1ZGAA 4W63A 1DOHA 2FN9A 1AZTA 4JC4A 2UVDA 4TVKA 3B3GA 4Y9RA 5EUMA 5M3BA 2O2HA 1LDYA 4JVSB 2GEKA 3COSA 1GUBA 2WVJA 5KJFA 1XQXA 4D6PA 1U2EA 3IXQA 1PV2A 4FGJA 5FDFA 2V7WA 1WUKS 3M2TA 4RK4A 4EEZA 5AD1A 3OQMA 3BT7A 2I6SA 1XLWA 4BEJA 2HIGA 3VV2A 1FS4A 2G1UA 1EE1A 4KO4S 3FHOA 1QH8B 1KZYC 4X1KA 3UUWA 2AK3A 3OBBA 5GM1A 1CIVA 1Z0SA 3VR6A 1HXHA 1TADA 3CA8A 5AK0A 1T6BY 4N5LA 2Q4RA 3GVIA 5EMJA 4EB0A 5MFZA 3FTPA 2D2VA 3EVAA 4X91A 4YXWA 4RTKA 5FJIA 1WHTB 4UEQA 1KK2A 1V8BA 1Y1LA 4E88A 1N36B 3NTRA 4CQMD 2VAMA 2VT3A 4CMEC 3VOSA 3DEJA 5LYJB 1SKYB 3OZSA 1E2PA 1JDJA 1MNAA 3DBRA 3WK5A 1B0ZA 2OBLA 4HDOB 3K5IA 4XSVA 4DEVA 5A02A 1Q3KA 4PYOA 1U9CA 1TU0A 3LC7O 1I4DD 1PFYA 3WICA 4E5YA 4QODA 1LQ2A 4BNGA 3G1WA 1BN7A 5JMPA 1ZBDA 2QTHA 2XUZA 1H6DA 3RQSA 2JLUA 1B6GA 4NMHA 4CMBA 1WBJB 1LWOA 1XTIA 1GPYA 1IHUA 4INOA 4U7FA 4QDJA 1CHNA 1QHHB 2ISSD 1ZY2A 1HDOA 3FFBA 3NAGA 4IL5A 3LBAA 4QJ5A 1X7WA 2VJDA 1VG1A 3FOCA 3M6UA 4QPPA 2ORYA 4U7HA 3QIVA 1X7GA 2IP2A 3ZEIA 5ICSA 3A3PA 1CXZA 3PF9A 3GGPA 1NJ1A 3EGDB 1QHHA 2QE7A 1P5JA 2NTVA 3HBJA 4HZIA 4HRYA 5AQEA 3UFXB 3EVNA 4S1NA 1FMLA 1S02A 1CZRA 3EDCA 1AHPA 5IS2A 1W36C 4IQGA 1FU8A 4O2RA 3SC6A 3VU1A 4YJ3B 3SE7A 1JHUA 1XHLA 1RXEA 5KC8A 1LI5A 3GZ4A 2W6CX 3PRYA 1KI8A 3W8EA 4NYJR 2MHCA 1G1MA 1WB6A 2WB4A 4NZOA 2IYPA 4JFRA 4LZNA 1P3JA 2IYTA 2VJKA 2AQHA 3H7AA 3ZDDA 2ZKLA 2Q1SA 1EX6A 2UZAA 2AJLI 1N5IA 2XOKD 2Y67A 3RK1A 2RBKA 5A3SA 4O0LA 1D2GA 4IO0A 1B0PA 3Q7RA 3TX6A 2HR1A 4Y9UA 3AIIA 3AYXB 1G5FA 1NGSA 1U2RA 3BHIA 4FYXA 4NFYA 3ZDEA 4AY2A 2ZJ0A 2ETVA 2NSJA 4GNKA 1A8SA 5DWDA 2X0KA 4U00A 2JCXA 1TAUA 5TQ0B 4ZVQA 2K7FA 2ONKA 5CP8A 2YJZA 1A9XB 4MARA 3DXZA 3RHTA 4GMGA 2IKQA 1M6HA 4L5AA 4TKZA 2DY0A 4WH0A 4ZN6A 4DUYB 4GT1A 2EW2A 4LQ4A 4I08A 2RONA 2F9MA 3UYKA 2QZPA 4UCXA 3F8TA 4JLOA 5IKXA 1S2IA 2AJTA 5CTAA 3W78A 1LBSA 4HJRA 4C0XA 4QBTA 4P3KA 2B1GA 2QRUA 3ZBUA 1R18A 4H3HB 3TNFA 4FR2A 1T4MA 1CIPA 2FWAA 3RSSA 4C14A 3IP1A 3Q8KA 1IXSB 3CYFA 1VCOA 2FZ5A 4CL2A 2ZITA 1I1NA 4Q4AA 1OB2A 2PQ6A 3CUWA 2FG5A 2QD3A 4YRCA 3UJBA 3TW0A 3Q6IA 2BV3A 1JHOA 5E95A 3KJFA 1JLLB 2HRCA 3P27A 2V54A 1YU6A 4JLMA 2Y1CA 1S8FA 2WU8A 5FCDA 3M1IA 5FWYB 4KO1S 3RV3A 5JUWA 3ZWVA 3RFVA 4L6IA 4MTLA 4UMEA 4OI2A 4GX2A 4UCFA 3TAXA 1ZXBA 4C9BA 3F4KA 2YUTA 3TW4A 3WGNA 4MRSA 5CBPB 2J4CA 2YZNA 1BXRB 3NEPX 5D3ZA 4W5WA 5LD2C 2VKQA 1VDMA 2DE0X 1RW4A 2WBLC 1M8PA 2F59A 2GYUA 5C7YA 4B6QA 3BA6A 2POQX 1MW8X 2Z2ZA 4WAUA 1S8OA 3CCBA 3K8OE 3Q3HA 1N8TA 2QI9C 1OPRA 2HJHA 3H04A 1V96A 2Q41A 3ZIAD 4C0HA 4C06A 1Q12A 1FTNA 1O57A 4BZPA 3R7WB 4J16C 1N25A 4DLAA 1GPBA 2WWFA 4H7HA 1Z6TA 3RBAA 1Y3HA 3AF3A 2PZLA 2FR8A 2BMDA 1ETHA 1E6WA 2I4MA 2O52A 3AHCA 3R5SA 1QOZA 1U6JA 1NI3A 1ZRHA 1IZ7A 1DZIA 4OM8A 4UHCA 4AS3A 1LWNA 2XAAA 3JYHA 1RDFA 2XCLA 3U40A 3FMIA 4ZPJA 4A1OA 5HUHA 2AKYA 1Z5NA 3UOGA 2SKEA 3CUVA 3KYCB 2FEPA 2FJUA 3AFGA 1EWRA 3RYFA 4JJGA 2OL4A 3RFTA 2PRJA 3AQ4A 3U31A 4C7MA 3P9RA 5CR9A 4HQLA 3VR6D 4JVNA 4DMKA 5J4HA 1X3LA 1B73A 4E32A 2BJWA 1DO8A 1YCFA 2ODTX 1CU1A 2W6PA 4XWKA 4JT9A 1JYEA 4JX8A 1YQEA 5H59A 1V3UA 3BPSA 3QUCA 5GPBA 3SAJA 3P9CA 2YIMA 3W1VA 1LI7A 1K8YB 3WK7A 3MT9A 4C30A 3OCXA 2R4TA 1V25A 3FMVA 1ML4A 1SWWA 2CUKA 4UEWA 3S2FA 1PL7A 1YJXA 1RBQA 3C15C 4OH7A 1US8B 3W05A 2GYVA 4G1MB 4CL3A 1H3FA 2BVNA 4EA7A 2WE7A 2AUMA 3OQ1A 3PIRA 4KFSA 1L2TA 1OH8A 3PYXA 3WIUA 3HO6A 1PW5A 2DUJA 4XRGA 1YZQA 5I7VA 1IHOA 3A1NA 4HEQA 3I0NA 5AW4A 3ZNQA 1Z8FA 1XPRA 3U4DA 2ZRFA 1S8NA 3RASA 1JG1A 2DF8A 3QMPA 3FYUB 4IV5A 1H4VB 4LYFA 2FE4A 5TMDA 3JTMA 4CIBA 1N2IA 3ZE6A 2QD2A 3U4QA 3CRZA 1GU7A 2Y76A 3LL4A 1IQPA 4WKOA 1LCIA 5ETJA 5AI6A 2W6OA 1SUEA 1TQ4A 5E2AA 5TPZD 2YVQA 2D5AA 3PDCA 3NM5A 1HWYA 2ZBVA 3ESDA 2IPNA 1KRXA 4O4HF 621PA 2J3LA 4E2WA 2A6PA 3MMXA 3RCBA 3CONA 3GRCA 1ODLA 1S3IA 5FPYA 4D9EA 1TKAA 2Q5CA 2EGGA 3EH1A 2ONYA 3M5PA 2QM8A 5FTMA 3O8RA 4RETA 1FW8A 2QIOA 3OX1A 4C4YA 1NG9A 3JQDA 4MJ7A 5TX7A 3TD2A 4FB5A 5CT8A 3ZDBA 3GEGA 4JT2A 3OMLA 2P67A 1CP3A 1QOQB 2NTNA 3KQVA 3PJDA 2EATA 1GJRA 3VO8A 1CUBA 1EX9A 5KOHA 1P1CA 3IEPA 4ZPXA 2XYVA 1NW6A 3BK2A 1CQIB 3LT2A 2XEDA 3D4PA 4C29A 4RK1A 3KWJA 5A5GA 3BUSA 4OHRA 3I53A 1DWUA 3SQNA 3EPRA 3P32A 3QE4A 3OCVA 1V7ZA 4P53A 2OG2A 2BGIA 3WGUA 5HRAA 3IV9A 3GUVA 4PO1A 2IPOA 2PSJA 1SXJD 2Z5FA 4KLRA 2HHCA 5D01A 3ED5A 4DLWA 3V33A 4JU8A 4FFPA 3ZLVA 1EDDA 4K1LA 1GRVA 4IUCS 2ZJ7A 2TECE 1Y5IA 1NG1A 1PT7A 1I4TD 1VRVA 5I4CA 3HYNA 1J06A 5FEMA 3H1AA 5B58C 3OZIA 4F91B 3KYJB 4GZMA 4R6XA 3R24A 1TTTA 1YTUA 3GEBA 4IG4A 1ZKMA 4XASA 3RRFA 4IM7A 3VU0A 1T4GA 1PIWA 2LWIA 2WDPA 4CM1A 5HQTA 1XFAA 3F1LA 3W0LB 5HFNA 1P9NA 1SBNE 3GH1A 1W30A 1IXYA 3GV0A 3I0ZA 1KJIA 1LLUA 3HJRA 3OLYA 5KAMA 3OOWA 2K2WA 4F7DA 1QG4A 2V0GA 5LSAA 4AU1A 3HGMA 5D00A 2O8CB 2D1FA 3AETA 3DV0B 3PSAA 1U5CA 2VHVA 3I92A 5AKGA 4OHZA 2AF4C 5HZMA 4IQ0A 2ZIUB 3I45A 2RHWA 5F77A 1T5TA 3DP7A 3LIPA 3SK0A 1BS9A 3G82C 2L69A 2V7GA 3HUTA 4RBNA 1C0KA 3SSAA 3L9XA 5CDGA 4ERNA 4F04A 4ITRC 1T4CA 3TTWA 2FMHA 2J0UA 2R8PA 5CNIA 1KI2A 1EBBA 4KTVE 4BMCA 1SCAA 4Q03A 1YS6A 1L1FA 1QLWA 3CINA 3RSHA 5KYXA 2VF4X 1POXA 5I51A 4BMPB 4BGEA 2H0AA 2VHJA 2ZS9A 4B33A 5IM4A 1XMJA 3CE6A 2IYOA 1TA4A 4Y1EA 3QQ5A 4MR7B 2X2FA 4MGIR 4CCWA 3KZ1E 2OCIA 4QARA 1V45E 3BGSA 1E9RA 3GFQA 3KQMA 4PZPA 5DTEA 3AR3A 1K3FA 1PG2A 1XEXB 4F71A 5JMOA 1Y5LA 3W9YA 1PV1A 3ROZA 3K70B 3OQVA 4ZVPA 2L82A 2P3LA 4EA9A 2QN7A 3FI0A 3A58B 3C3PA 1T0PA 4HDMB 3PFGA 4POAA 2Z8XA 2FPSA 4IX1A 3RV4A 5FULA 5C1IA 1P6QA 2CXRA 1Y7IA 1SBTA 3RVKA 4E51A 4UTOA 5KSWB 2JCVA 4OLBA 1G42A 1OOEA 4FHEA 2QTBA 5C1OA 5EJ5A 2HLDD 3DWFA 2H0RA 4MQ4A 2VHCA 5C0OE 5EXSA 2PQ0A 2VSNA 5U4XA 1JQ3A 1L5KA 2YRFA 4G0ZA 1XTTA 1ZEJA 2V6MA 5WRFA 4YCSA 5K8CA 2W2MA 1Z5UA 4HUQA 1L4YA 4BYGA 3EFHA 1RVV1 5I9MA 3U48A 5L45A 1YC2A 3W3AA 4ZJYA 1EP3B 4TSFA 2H17A 3VZDA 4A8JC 2G6TA 3K09C 4BLPA 3BWBA 2VAXA 4HOYA 2PKQO 2YC4C 3KT3A 4ND6A 5AUQA 2XIJA 2WF6A 5CEJA 1TCAA 4IDGA 1CF2O 4TT8A 3T4XA 4PFSA 3SQXA 4KIUA 3HL0A 4ZOBA 4MNTA 4FEYA 1QNLA 3H83A 4MXDA 1PVVA 4PLHA 2J48A 2IF2A 3TSWA 2BJVA 2IS1A 3MINA 1BOOA 4X45A 1CUJA 1VYHA 3WY9A 2NP7A 2I7CA 3I2GA 1N7IA 1PFGA 3GRPA 3LKZA 4Y2RA 2VDOB 4PNEA 1BU5A 2QZ4A 5EPEA 2P6RA 1LRJA 4H7DA 1CE8A 4BCDA 2HAEA 5ITWA 1J5EB 1NOKA 1PO7A 4FKBA 5BSTA 4QDKA 4PHTA 3BF8A 3N07A 1V16A 1EX7A 1S9DA 1XTUA 3EF1A 2A67A 3VDXA 1FFSA 2JJ2A 2ET6A 1EAYA 3CUTA 2WYWA 1NF8A 3ZCTA 2SICE 1X7YB 3ESBA 4US0R 2OYCA 1KZ1A 3LSYA 2IY9A 2M6RA 3M6XA 4B09A 3KZCA 2JCSA 3GR6A 4L2IB 3C4JA 1GAJA 1TTHA 3GGGA 3REGA 5K6AA 1AU9A 1RPNA 3BHJA 2G9RA 3OU2A 4JUFA 5A3VA 3U9SA 4J1TC 1PWXA 4BO4A 1P5FA 3HBNA 3PKJA 1FVOA 3I04A 3T9FA 2CEKA 1EA7A 4YJ3A 3D6AA 2LCQA 4Y1RB 3H1BA 2Q3EA 1C9MA 4NJOA 1JT9A 4YP9A 1I2AA 1PJRA 2O8FB 1CLUA 1YV9A 1O7JA 3K16A 4OFZA 2DGDA 2XNHA 4RL6A 4C76A 3LVQE 1PFWA 1UBLS 3CPSA 3L6OO 4M8KA 4J0HA 2O6LA 4Q18A 1A9YA 2O5CA 2A1TS 2AVDA 3A1TA 4WEQA 1GCAA 2WA2A 3N2YA 4YALA 1QE0A 2J4FA 3T1VA 1E5TA 4QDXA 2WP0A 2ZUBA 4NF2A 5T64A 3S2ZA 3WAKA 2W8BA 5F2KA 4Z54A 1V3VA 2MR6A 4E09A 1KMNA 5D1NA 5A4IS 2VUTA 5LUBA 1D03A 5AXDA 2HPAA 3NNDA 4KQ6A 4OFWA 2Q07A 3ZK7A 2X6TA 2VDWA 1BFDA 2YQZA 4KQJA 4EGCB 1FMFA 1LV7A 2I22A 4ZCSA 3BFKA 2JGNA 1J22A 2P2YA 3PC8A 3QYPA 4WCFA 4XGNA 2C4UA 1RYNA 1P4HA 1KOJA 1TYAE 2XUJA 3A1DA 3CWZA 4QX6A 5FKJA 5KMGA 4YQFA 3MFQA 3CWQA 5IT9A 3D4OA 3L8HA 2R5WA 2V45A 4AF7A 1Q22A 4M9UA 2QAGA 3V4OA 1IQRA 2JJQA 4FFWA 1DKQA 1NE2A 2XA1A 4UEOA 4UTVA 1HOXA 1CUZA 4MYSA 4Q3LA 4GWLA 4BNFA 1N6LA 4X1KB 3H5TA 3FNGA 4KGZA 3LSTA 1CY4A 3KKMA 4UTPA 5CFMA 1L4GA 3RO7A 1R8QA 2ZDGA 3R0XA 4QPJC 3GRFA 5ALTA 3RS2A 5KI6A 3H2IA 1NOJA 2C97A 5DK4A 3QEBZ 2PXHA 4PCUA 5ER9A 3K4HA 5K7SA 3E2IA 3CNQS 1Z8NA 4IQ8A 3ZHZA 2X8JA 4RPKA 3RK4A 2O5EA 2OENG 3UJ8A 1WTAA 3C4QA 2W2XA 3AHGA 3NLLA 2IRWA 3OECA 4BC0A 5KDDA 1HFWA 3DF9A 3QFRA 1XI2A 2H85A 2OBFA 2OXRA 3AI3A 4MRPA 1VJTA 4YJFA 2XIQA 2BF7A 3IAUA 4YPVA 3U2QA 3KB8A 3KS9A 3V7NA 2OWEA 4F9EA 3LDHA 4FFLA 2PX8A 3DKVA 3HB7A 3JWJA 4JP1A 4MB6A 3PIIA 4N54A 2C29D 2FEWB 1ZM9A 3G8YA 3KO8A 4ZOLF 2Z09A 2H00A 1NJ2A 5FD8A 3K96A 3D64A 3MGKA 3F49S 3OSZA 1DGQA 1ZN9A 3I83A 4IMRA 2VF2A 5ARBA 3N2IA 1JMYA 2CHVA 1ORWA 3FYUC 5KU7A 4JASB 1LV8A 3IPXA 1WU7A 3EVZA 3B52X 2ZQYA 1E6MA 3DV0A 3F7NA 2Q0HA 2VI5A 4UUBA 4RK0A 3F67A 2C42A 4XW2A 3OOHA 5EKDA 1E2NA 5AT1A 1OI2A 1KQGA 4XB6B 4PSUA 4NBSA 1N34B 5CU7A 4XDZA 1X1DA 2JH9A 2C9CA 2P0EA 5HBRA 3IRUA 5TXGA 5FUMA 4TV9F 3Q5DA 4C6HA 1GT6A 4S24A 3KU4A 5DKFA 5EERA 4S0XA 1O95C 3EZGA 3JD0A 2J0EA 3UJPA 2XRZA 3NUZA 4M6WB 3UK0A 4JWKA 4Q05A 1O3YA 4OYLA 5DM1A 2IYSA 3GY0A 3HMQA 3PS9A 4JOBA 4C04A 4CEIA 1GZHB 2Q2WA 3MD9A 4HRAA 4EKNB 3CLHA 3FBTA 4BP1A 4DLUA 3GBVA 2QY9A 1IIBA 4IJKA 2GK3A 4TL9A 4NCHA 4QOIA 5H02A 2GERA 3ZU5A 4FB4A 1ZN2A 4AMYA 4D9CA 3UT0A 2C54A 1L7XA 4M89A 2AG5A 2GD6A 1GNTA 1RE1A 3ESAA 1MABA 5GY7A 3DT8A 2OFFA 4EJSC 2YOHA 1YULA 2JCGA 3EULA 2VF8A 3JRXA 4XKJA 1TUBA 4WBNA 3BEDA 3N2GA 3QF4A 5CLLA 3RODA 3EZ9A 4KUGA 1R66A 4YT5A 3TZBA 4EG0A 1PT5A 1QE5A 1Q0LA 1OH5A 4Y0NA 3WOHA 4B9AA 4LKRA 4AJ4A 4K0RA 5C9ZA 2P0AA 3B70A 3HU1A 4M0UA 1GGVA 4RSGA 3QLVC 5DU2A 3OCUA 1XCPA 4F21A 3QXXA 1W5FA 2IITA 5JJIA 2VBGA 3Q9UA 4XQCA 3USES 1P0FA 1HYQA 3AP1A 1FZTA 1FXWF 2ZJ8A 3IERA 2OYRA 4EJ6A 3S0JA 2VP9A 3HR8A 1NJGA 1L6RA 1PBNA 1FP4B 4I50B 1RPZA 1HE1C 4JS0A 1Q0SA 1MB0A 2DETA 3OPYB 3ZHQA 1ZKDA 4BO9A 4B2LA 3V2IA 4W5QA 3BGOS 3KUUA 1T6YA 2CZGA 3IQFA 3DVLA 4BKMA 3S1SA 2GN1A 4O4LB 3TFWA 2P4QA 1N8NA 1A0OA 1ZD4A 5FL3A 4A1FA 2X8BA 5JH7A 5DLDA 3DL2A 4RZQA 1QYXA 1WSDA 2AG0A 1V7CA 2WZCA 4NCBA 3AFOA 3HRIA 2R96A 4LZJA 4X54A 3SQLA 4KRGA 2F9FA 1ELOA 4RVNA 4U02A 1AV7A 1OWPA 2Z43A 3FIUA 3FUWA 1FU7A 3O7MA 2P4HX 4BECA 2GF9A 3KVOA 5A2QA 1NNEA 2W2NA 3H0EA 3H0CA 2V4ZA 1U9IA 3P0HA 1Y9JA 4NNOA 3E84A 2C04A 2H2IA 2YW9A 1YQTA 2QQFA 3I2KA 3KTOA 3NV7A 5C35A 2O59A 4PGFA 5JXIA 2PXCA 1GTL1 4NBRA 1N2SA 1V1MA 2WF7A 2ZB7A 3TQSA 3UT6A 3WL7A 3AI7A 3ONFA 2UAGA 2QTCA 3MWLA 4WBSA 1V9CA 4CFSA 4DIOA 1I94B 1R50A 5CVJA 2GJSA 4EQ6A 4FW9A 3LTNC 3WMFA 4J7AA 1NRJB 4HH4A 3T38A 3E8SA 4ENTA 1GQFA 3DFZA 1QHGA 4QBFA 3SJCA 4E4TA 2QG9A 4FVTA 1IBMB 2O0LA 3DV2A 3EFBA 4JL6A 1PZMA 4NU0A 2PYDA 3MS7A 4L5JA 1J00A 4J7UA 4P54A 2QL7A 1ZH4A 4EHDA 4D8UA 4ZDJA 1E2IA 5C7LO 4L3OA 5DH9A 2WJYA 2G1PA 1J07A 5EWLB 2C3PA 4CEHB 3M1AA 4IIVA 1KBQA 3FWPA 3OIYA 1F12A 2HEIA 4H0NA 1U3UA 3VGPA 2VDQB 3QFTA 4IF4A 3TF5A 1ZHOA 1XCOA 1YR3A 1XZGA 2CXPA 2IZ6A 1BVYF 3B3AA 4J03A 4P4NA 4X8MA 1O97D 3LPCA 4XGIA 3TD9A 1U9YA 3AX6A 4XI9A 3N3BC 3OIWA 2GKGA 2HZBA 3JATA 2IK8A 3IP6A 4CMIB 4DLRA 3QU2A 5BT8A 2B1RA 5I01A 4WBNF 4F4FA 1V95A 3BJZA 2GZMA 2X3FA 3I4CA 3ME5A 1MMFB 4G9BA 4KYIB 2REQB 1G20B 2PLNA 1AN9A 2N3ZA 3CTPA 4HGNA 5LZ7A 4ZZ0A 2XRFA 2OCGA 5JFGA 4AG5A 2UVQA 2Y1EA 3JYQA 1ISSA 2PLWA 4L27A 4MV5A 4B4DA 2V7QA 2VVTA 3SF8A 2G5CA 1XLUA 3S5JA 4FR5A 2OXFA 1OJLA 3HM2A 5FTNA 5DN6D 4IMIB 2OO3A 3R9XB 3IEXA 5HKBA 2GBCA 1RHKA 3WNVA 1ZJ4A 1BW9B 1XQVA 4RCZA 3FDJA 3KUDA 4MVYA 1THZA 4ZMRA 1LS6A 1NR7A 2OO5A 4YRJA 1SXPA 2NO7A 1F9AA 1FFEA 2XX3A 3AEQB 3OLQA 4Q37A 4RLFA 1PV4A 2IH4A 5BP7A 5L3ZA 2B94A 1JIQA 3FX2A 2BFEB 4I3FA 3TUIC 2GPBA 2E4WA 2BSAA 3CG4A 4HLUA 4F3TA 3WWPA 4DIEA 1TZKA 4FI3C 3HDVA 5HTKA 2QLJA 1QFSA 4LQLA 1QTRA 4I5GA 4N7RA 3TB6A 3TR0A 2QYTA 1Q77A 3UANA 2AYYA 4M0EA 1Z0KA 4GVLA 4F9GA 1EVJA 1U8XX 1FDTA 3CW8X 1E98A 1YE8A 4YJFB 3ZZ0A 3GUZA 3UKOA 1JIIA