5JDCC

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
237
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLPEEKDKWRRKVPLGRRSAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 90
structure length 237
sequence length 267
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcC00
3GFBA 2Q1TA 3I1JA 3UAGA 4CPDA 4LMRA 5TX7A 4RQTA 1RM0A 4KUHA 4R1SA 5C7OO 3G0OA 5EPOA 1UXJA 4MO2A 4GL4A 3SVTA 3GAFA 1IE3A 4M8SA 4PLFA 2WD7A 4GVLA 1T2CA 3VH2A 3ETGA 3KTDA 3G17A 4CQMB 2PV7A 9LDTA 3ZU5A 1E7YA 4DVJA 5CPFA 2QZ9A 1EFKA 2P9GA 3I9MA 1NVGA 4LN1A 3F1LA 3LDHA 5DZSA 1SNYA 3KLPX 3IMFA 3L6DA 2G1UA 2P5UA 2V6FA 3GVPA 4CM6A 3GN2A 2NV6A 3SX2A 4QECA 5B1YA 2JFHA 2XAAA 1ZEJA 2ZJ0A 2IYPA 5DN9A 3JQ9C 3UW3A 1I36A 4E2WA 2HK8A 3T4EA 4I8XA 4IY1A 1ZK0A 3BYZA 3HFSA 1PR3A 5TNXA 4E2XA 1PQUA 5DF1A 5ICSA 2TMDA 1HDYA 3DTTA 4BO2A 1MC5A 4I9UA 5IFLA 3LK7A 4J49A 1PGQA 2C2XA 4YJHA 1GZ3A 3ZHBA 2W2KB 1ARZA 2C0CA 1YQDA 2BH9A 1BDMA 3NJ4A 4GLOA 5L95A 4HFJA 4AJPA 3S2GA 4DPLA 2HLPA 1E1NA 2PGJA 2RH8A 4NIMA 2HQ1A 2WYVA 2NVWA 3Q1LA 2GERA 3VH4A 4B3HA 3G49A 4MVJI 1BVRA 2C7VA 2PY6A 1G0OA 4YR9A 1H6BA 1GDHA 1MV8A 4YT8A 4Z6KA 4BNWA 5U9CA 4FOOA 2XOXA 4NDNE 5A1TA 1Q0QA 4K1LA 2PGLA 2X0NA 1JVBA 2Y67A 3JV7A 5I9MA 1B3RA 1BDBA 1I24A 1LDNA 3WG9A 5G0WA 4UAGA 1C0KA 1F14A 2BGLA 4M55A 2I99A 4I5EA 4ZGWA 3E03A 1YRLA 4CV3A 2P4QA 1WMBA 2Y1DA 1H2HA 4ND5A 4NG5A 3OA2A 2X7HA 4AFNA 5F1KA 1TA4A 4YPOA 4JGBA 3UFXA 1KY4A 2NQTA 2P4HX 3I23A 3GVHA 4HFNA 2SCUA 5GZ1A 3AM3A 4RDHA 4XJSA 4R1TA 3TN7A 5AVOA 3VTFA 1FF9A 2PD6A 4P38A 1P44A 3UGKA 3JQEA 3H8VA 5FFFA 3D7LA 2WD7B 1I01A 2FPIA 5KJEA 4NFSA 1LDBA 4KTVE 3VDQA 3PFFA 3Q11A 3ZCXA 1P74A 4CMJA 4C7KA 1CETA 3DBVO 2IE0A 4CMKA 4C7JA 3ZWBA 1E7WA 2ILTA 4YBZA 5ENVA 1ONPA 1U3TA 3QSGA 5HM8A 2QRJA 1XELA 2UAGA 2I67A 5HS4A 1HF3A 4YT2A 2VUTA 2ZIZA 1Q0LA 3C7CB 3TOXA 3I9OA 4U8GA 2ZCVA 1WXDA 2OOSA 3F5SA 4HUJA 2NACA 2Q1WA 1HE2A 2QW8A 5JPIA 3ICPA 1PWXA 1HDZA 1JA9A 2Z1NA 3GOHA 1T4DA 3HN7A 4OH1A 1XU7A 1U3VA 1EUCA 5AOVA 2CDAA 2P9EA 4RVGA 3RAJA 3EHEA 4L76A 1O94A 2HMUA 4NBRA 4IJVA 1UH5A 2Q4EA 4OYRA 4YJHB 2JAPA 2IEDA 1SOVA 1I5RA 2B35A 1O8CA 4XRGA 3ZH2A 2E82A 5JC8A 5MGBA 1W6UA 1FXSA 1IUKA 2OBNA 4WLVA 4XYLA 1PGNA 2IYOA 4MVJM 4YAGA 1U2GA 3NYWA 1O89A 4MVJA 4XYBA 2R00A 1F12A 4JJIA 3H4VA 2DU8A 2B83A 4G81A 1U9JA 3K92A 3QWBA 3R3SA 3WWZA 1CEQA 4E5MA 1E3JA 1NWCA 4ZQFA 1WLYA 2BGMA 2EKPA 4LSMA 4W6ZA 3RI3A 4W82A 2DQ4A 1XEAA 2ZB4A 3WGTA 1AHHA 1K3TA 1ISMA 3BMQA 1ZK2A 4OAQA 3L9XA 1JU9A 4L73A 5DT9A 5ENDA 4A5OA 3P5SA 4YA6A 4PG5A 2X9VA 2VQ3A 5JFOA 1UZMA 4BO1A 2J3IA 2BMAA 2ZQZA 3RC9A 5DBGA 4RVSA 2GPTA 3ROPA 3AI2A 1DIAA 5A5EA 2DBQA 4OO3A 4MIEA 3NGLA 3I6QA 3QWFA 2CDBA 4MKXA 4UUNA 3TQHA 3KYDA 3VHRA 3OP4A 4IM7A 1B7GO 2E49A 3KSDO 3U09A 1LDGA 1GYRA 3OJLA 1IZ0A 3ORFA 4MIOA 3W8FA 3MJTA 3QWHA 3H7AA 4TRRA 4FD3A 1VKOA 4FB5A 2W90A 3JQ7B 2Q49A 4RVFA 3ZZNA 3BMCA 2HU2A 3FBGA 3DHNA 5F1OA 4PG8A 1DIGA 1HL3A 2CVOA 5F5NA 1E3EA 2DAPA 3ZN2A 3D64A 4LCEA 3GHHA 3WNQA 3L0DA 1XA0A 1U5CA 4HBGA 3O4RA 1F8FA 3C85A 1C1DA 3D1LA 2FRDA 1DPGA 4OMUA 3ZHZA 2BI7A 3TSCA 4DIOA 5BSFA 3K96A 3L4SO 3JYLA 5B4VA 2YHUA 4ND4A 4BQRA 4OQYA 2NVBA 1ULUA 3JQGA 3RC7A 4BB5A 4IGEA 2VOEA 4J0FA 4E5KA 5L4LA 2AQKA 5IG2A 2C7GA 4ESOA 1ZIDA 2HMTA 3NT5A 3QW2A 3LT1A 4J7XA 3GVIA 4MKRA 3CZMA 1DJQA 4R1NA 5FYDA 5HS6A 3I9KA 1I33A 5C5IA 1B2LA 1I0ZA 1Q7BA 3DOJA 2PA3A 1P3DA 2VHXA 2EWMA 5JDCA 1O6ZA 1KS9A 5IJZA 4XGNA 4NU6A 2X23A 5JYEA 1R6DA 1SZJG 2C20A 3JD2A 2X6TA 1YONA 4B8WA 1NBOA 2HCTA 2YYYA 3ZWAA 8ADHA 3NDJA 1HDGO 5FI3A 4E12A 4J3FA 4OJNA 4FJ0A 3BMQB 4M54A 1LEHA 1T25A 5L9AA 4Z0PA 2JD2A 1OI7A 1U4SA 4NBWA 2QX7A 1PU2A 4U6SA 1T1SA 4YAKA 3GRKA 4CM9A 2FR1A 1F06A 1M67A 3PEFA 4GX2A 4RPGA 4BMNA 4BO7A 1PZFA 4DBVO 2GDZA 2QG4A 4Z3KA 4MVJP 3H9GA 2J3HA 3OEWA 1GADO 2Z95A 2VN8A 3D4OA 5I7VA 1V3UA 5C3MA 4ZQGA 2BLLA 2X4GA 4Y9DA 5TJHA 4CLEA 2TMGA 1ENOA 4PZEA 2CFCA 3OQ1A 4H15A 1DXYA 4IZHA 1AGNA 4EEXA 2GGSA 3FWNA 4M89A 4EDFA 2CVZA 4GX0A 5ICMA 4WJZA 3KYDB 3H5RA 3HB4X 5BT9A 1IL0A 3AY3A 2IZ1A 3EVNA 4BB6A 3I6IA 2C59A 2YJZA 2VYNA 4RPHA 2HSDA 3HUDA 4XIJA 3CPSA 1EUZA 2HJSA 1VE9A 4J91A 2WWRA 3EMKA 4XQ9A 1EQUA 4FFMA 3BMCB 2QYSA 3GQVA 5ITWA 2YZ7A 2Y1EA 3A1NA 4BNMA 3AUAA 3C7AA 2P5YA 2ZB7A 2O3JA 2PKRA 1C1DB 2YW9A 4JBGA 2Y99A 1QV7A 4BOYA 5L4SA 1TLTA 3K2BA 1VPDA 3JD0A 3WTBA 1RM3A 2X58A 3PQEA 2FR8A 3DAFA 3WQQA 1GFSA 3D4PA 4OIMA 4PVCA 4XR4A 4YVFA 3JQGB 4KZPA 1E7MA 2GZ3A 1YQXA 3E48A 1ZZEA 1ZEMA 2XXBA 3AK4A 2EJVA 3P2YA 1M6WA 4UVHA 2W2LA 3M2PA 4CLXA 2B69A 1G0NA 1E6EA 3VOSA 5KNLA 2WSBA 3DL2A 1CRWG 1RPNA 3NDRA 4NFYA 4XQCA 3ZWXA 4HX5A 1RM4A 2D4AA 5JLAA 3WYBA 4IDAA 4IBOA 5TLSA 1BWSA 4E31A 1Y6JA 1YJ8A 2AEMA 1WDKA 3VC7A 1I3MA 1NYTA 4FOSA 5G2OA 4B7XA 1DAPA 1R37A 3GLQA 2VHWA 4J2OA 3RUCA 2PGDA 1NHWA 2GNAA 3BMOA 4Q3BA 1EMDA 4TZKA 1W73A 1NQ5A 4J1NA 1BG6A 3GH3A 3HADA 3I9JA 3RUHA 3JTMA 3WBFA 1XSEA 2J5QA 2PK3A 2B4QA 2DTXA 1LDEA 5H82A 3IOYA 1SC6A 3U4IA 2J3KA 2DC1A 3HHPA 4XJTA 1ZK4A 2AEJA 2JL1A 4BNLA 4BHTA 1LU9A 1NTOA 1B14A 4WCDA 4P8RA 3SC6A 5BSEA 3F9IA 2JD1A 4BO9A 1N1GA 2GCGA 1HRDA 2OO5A 4TZTA 1CF2O 1ZMOA 1XQ6A 4BGUA 1Y8QA 4ILKA 1IZ9A 1QYCA 1R66A 1T4BA 1VSVA 3WGIA 5A03A 3WX0A 3UH1A 3O03A 4BV9A 4DMLA 3RD5A 4FJ1A 4E2ZA 2PTGA 1B15A 3RJ5A 1LX6A 1BW9A 4A7PA 5L7WA 3X2EA 4B4UA 4J1SA 4KDEA 4TWRA 5BNIA 1V3VA 2O7QA 1LSUA 1OBFO 1TI7A 2C5EA 3RASA 4UREA 3WXBA 2ZTUA 4D45A 2O23A 2AMFA 4HWKA 4E0BA 5KTKA 1OC2A 2W8ZA 1HSZA 2DM6A 2LDBA 1HWYA 3GHYA 4ITUA 3FTNA 1ZXLA 4AJ1A 5B12A 3AU8A 4GAEA 2HMWA 1H2BA 3GPDG 4IIVA 4MVJG 4D43A 1PJ3A 3NV9A 1R12A 2FHSA 2Y1FA 1IPFA 3HNPA 1YL7A 4BMSA 2FSSA 3GRPA 1E5QA 5TT0A 4D3FA 5CAEA 5J23A 1YE3A 3SJ7A 1UXKA 2JFFA 1L1FA 4GX1A 4B4VA 2DTEA 4B8ZA 3OJOA 2CUKA 3ZHXA 3GY0A 2Q1SA 4PLVA 1ZXBA 1P0CA 2HAEA 4Y67A 3H5AA 3KRTA 3MJVA 1ZJYA 1Y1PA 3PDUA 3D5QA 2NWQA 3DMTA 3VDRA 1F17A 2AG5A 1DRUA 5COBA 1SO8A 2DFDA 1I2BA 3IC5A 1R4MA 2FPPA 2R00C 2YQ5A 5JNLA 5EESA 1YBMA 3TL2A 4DLBA 3KM0A 3HDYA 1E1LA 1MFPA 1TT5A 1YH3A 4R69A 4DC0A 4FFOA 1MUUA 2RHCA 5F1PA 2CDCA 3I83A 2X9GA 1ZKMA 5AXDA 3UCXA 3ASUA 3WSWA 1GYPA 4OXNA 2XPCA 1KVSA 2O3QA 2HK7A 3OQBA 3K2EA 3IP3A 5BNFA 1QV6A 3UOGA 1BGVA 1EUDA 1WP4A 3BMOB 1UR5A 1IULA 1K6IA 5JS6A 4RVHA 2YY7A 3OIDA 4YJGA 3ZDFA 3ZV4A 2X0IA 3ETEA 5COQA 5MDHA 3GEMA 2I66A 3FF4A 5JO9A 2EERA 4YAEA 4MPDA 3RBZA 4KQXA 1WAMA 4YEDA 5T6BA 1NHGA 4LVUA 3ZNNA 3VZSA 1Y5MA 3GZ4A 3TZKA 1X14A 4D41A 1IHXA 5ILOA 5KJ6A 4UULA 2PKQO 4BNTA 1U8XX 4ZN6A 4OSOA 3DTYA 3MEQA 1Y8QB 1U2DA 4B79A 4TVBA 1EVIA 3AUUA 4PLCA 2LDXA 5ILGA 4YCAA 2ET6A 4EYEA 4BO0A 2GASA 2RH4A 4IJUA 3TFQA 4CUKA 4TRMA 4BO4A 2FZWA 1BW9B 3I9NA 3V1TC 2EV9A 2X1HA 1XGKA 4MKZA 1KVTA 3E1KA 3GVCA 3ZWYA 1WZIA 2GZ2A 3AM5A 4BNGA 1Z74A 3BMNA 3CE6A 3HFGA 1X0XA 6LDHA 1HYHA 2HO5A 3NUGA 3M6IA 2ZYAA 2V65A 2ZTMA 4K6FA 2UVDA 3F46A 3ZHYA 2XXJA 1E1MA 2QQ5A 3UN1A 1YL5A 3TZQA 4RF4A 5DP2A 5L3ZA 5A02A 1QRRA 2I3AA 4X54A 2VZ9A 3ENNA 1GUZA 2VOJA 1JDJA 1BHSA 5LC1A 4EZBA 4RF3A 3EUWA 3DZJA 2CZCA 3QVTA 5T57A 4L0QA 1NPDA 1K0UA 3FPLA 3L9WA 3S8MA 2Y66A 4LVCA 5ER9A 3E9QA 1U7TA 5EERA 2OP0A 3WWYA 4HY3A 5A3JA 1B26A 4YT5A 2JFGA 3A9WA 1W4ZA 4NJMB 5A9SA 4CR8A 4H16A 2OMEA 2ZKLA 3VPSA 1R4MB 5DOVA 3G1UA 4AJ2A 5F3RA 2Q2QA 2X22A 3HDJA 4L74A 1SMKA 5JDCC 4E21A 4PFJA 3DWFA 4MP3A 3CTMA 4EUHA 2ZATA 2GN6A 1XDWA 3HB5X 1TT5B 1UZLA 3RKUA 4UVGA 2W98A 3ZU3A 5TF4A 4GI2A 3KV3O 4KWIA 1UJMA 5L53A 3WFIA 1Z45A 4WASA 3S55A 3JYPA 4GBJA 4NQZA 1G1AA 3EZYA 4K28A 1ID1A 1RYEA 1IHYA 2YQ4A 3IJPA 4YJGB 3ZWNA 2R6JA 3DZGA 1HKUA 3GNTA 4EBFA 1N1EA 3M1AA 1YBAA 1JWBB 4MOWA 4FC7A 4ZQHA 1QYVA 1I2CA 3COSA 1LLQA 1DFIA 4NI5A 3U62A 4PVDA 4FBGA 3DO5A 1H9AA 1A4UA 2D1YA 1KEWA 1LI4A 4R3WA 2EJWA 4ZU3A 4JLWA 4KUEA 4IQ8A 5L7YA 5H81A 1XQ1A 3JYOA 4UEJA 3IUPA 1J49A 4BKQA 3RIHA 4N7RA 2NTNA 1CQJA 4BNKA 1ZSVA 1YDWA 2PH3A 3R1IA 1PGJA 2Z1MA 4CM5A 4IPTA 3DQPA 2IDZA 1OMOA 1JTVA 3MTGA 5TT1A 1T2EA 4JX8A 2AA3A 3ZWWA 3GG2A 1YDEA 2NVUA 3DB2A 4NFHA 3KYBA 1EVYA 3GAZA 2AE1A 4LRSB 1EVJA 1RWBA 4DRYA 3BMNB 3Q0EA 2B5WA 3DZHA 2AW5A 4GX5A 3WBBA 1QSGA 4XYMA 3FNHA 5G4KA 1B16A 1C0LA 3QQPA 1LC3A 4J4HA 1QLJA 4B3IA 3ROQA 3TNLA 2OHXA 1LDYA 1EEHA 2DPHA 1UDAA 2HK9A 2EEZA 2JHGA 3KETA 2EW8A 4GSLA 3AUTA 4L4RA 1ZSNA 4HP8A 1X15A 4W4TA 2YDYA 3JQDA 4RDIA 2C54A 4J16A 5IDXA 1GEGA 1KY5A 3KZVA 4M87A 2HRBA 1P1IA 3DBHA 4S3MA 1EBFA 5A9SB 4UUMA 1XHLA 4WECA 3NKLA 2Q99A 4YQZA 1E7SA 3V1UA 1PL7A 3P7MA 4QFCA 4XEHA 3CKYA 3VAZA 1UUFA 3ICCA 4E4YA 5IZ4A 4E33A 4FR5A 1O95A 4BL5A 4G2NA 1PQPA 4PLYA 4KUGA 3WTCA 3CUKA 1IOLA 1EBUA 1P77A 4CMEA 1R15A 3LVFO 3GF4A 3A06A 3IP1A 3EYWA 3KO8A 2EXXA 4D44A 5K0ZA 3JD3A 5I9LA 3B1KA 4R3NA 4Y6PA 2PH5A 2D3TA 1W0CA 3S2EA 5EQDA 3ENKA 4J43A 4CMBA 1MXHA 1LBEA 1BTOA 4D7AA 1QKIA 2QYTA 1LRLA 3GNQA 4NU5A 4YWJA 3OIGA 4O59O 5JAMA 4EJ0A 1L7EA 3D3WA 5FF9A 4GLLA 1I30A 4IUYA 4W7IA 1IYZA 4YJDA 4GWGA 4PZCA 5TJ9A 3IUSA 2PD4A 2PWZA 2Y0CA 3MJCA 1SB9A 2X5KO 5KOIA 4RV9A 3O38A 5IDQA 1Y8RA 2DBRA 3F5QA 1V8BA 5JAZA 1ADFA 2OBYA 5G0UA 1BVUA 4OXKA 3JQ7A 1DC6A 2BD0A 1A9YA 1PZHA 4BIIA 1X7HA 4KOAA 4B3JA 4DMMA 1DC3A 3FSRA 4CR7A 4E5NA 4DLAA 1E3WA 2G17A 1P0FA 4LK3A 3TZHA 2B4TO 4HXYA 4UVDA 4CL8A 3E8XA 1EE2A 1PJLA 5JBIA 5A04A 1GL3A 2Q4BA 1A72A 2EGHA 4ZJUA 5JMWA 1LLUA 1GZ4A 1SOWA 2FPGA 2NVUB 1MLDA 4JP3A 5I9NA 3I9LA 1SPXA 1Q7CA 2ZYDA 4DXHA 4G65A 1VL6A 1KERA 1Z73A 3BTSA 1LC0A 2CNBA 1EK5A 1UP6A 2NU9A 2D8AA 5G4KB 3GZNA 4NNJA 4EGFA 2VNSA 5IN5A 1XYGA 3ANLA 4WLUA 4BMVA 4K6CA 3MJ4A 1Z75A 4Z3DA 5TRTA 3FD8A 1XG5A 3T7CA 3OJFA 3DMTC 3Q9UA 4GQAA 4O63O 4FS3A 4ZA2A 3ZWCA 2BF7A 1LDMA 2V7PA 5IXSA 4A10A 4R9SA 1FMCA 4RF2A 3WJ7A 4N18A 5THQA 1GCOA 3DBHB 2HRZA 4E5PA 1H93A 4F3YA 2J8ZA 2VUUA 4UEOA 2A4KA 1Z7BA 4Y6RA 3UF0A 1X1TA 4N5MA 4INAA 3OA0A 4K9DA 3B6ZA 3RUEA 4I5DA 2G76A 3MTJA 3FNGA 2GUGA 3DONA 1UXHA 1HYGA 1PL8A 1YB4A 4Y98A 1LJ8A 4WOKA 4ND1A 2JHFA 3ABIA 4TSKA 3TOZA 2V6BA 4GPD1 5I8WA 1KOLA 4L4XA 3OFSA 4J2HA 3FNEA 4R16A 1Z82A 2FP4A 4O6VA 1SBYA 3PK0A 1OC4A 5TSDA 2WDZA 2BFMA 4LISA 4IDDA 4XZ3A 2X0JA 1GPDG 1EK6A 3WGZA 1KC1A 3NEPX 4OHUA 3D3WB 4XRRA 1ZNQO 3WSVA 1XU9A 4QT0A 3AW9A 3G1TA 4N54A 1F0YA 1VRWA 1QP8A 2OGUA 4TRNA 2AXQA 2IEBA 1GQ2A 4XGKA 3GDOA 2NLOA 1B8VA 1LRKA 3PPIA 1GR0A 1Y8RB 1R16A 1MX3A 3HG7A 3RCBA 3LC2O 3OM9A 3SJUA 5AQ1A 4CLOA 5JY6A 4BGEA 1ADCA 4HADA 3JQBA 4RLSA 2B0JA 3ITDA 4MIYA 4QSMA 5L40A 3KOUA 3RFTA 3UCFA 2AG8A 3F3SA 3MOGA 5COAA 2VT3A 2QZZA 4FPXA 2DUUA 1E3WB 4ALKA 4GKBA 2O3RA 1PJCA 4NR0A 5JC1A 5G4LA 4OQZA 3WDSA 3GGPA 4I9NA 4HV4A 1PX0A 2UUPA 2DFVA 1HLDA 2WTBA 4MVJH 2ZCUA 4XR9A 1HE4A 1PSDA 2JCVA 2VCYA 3RU7A 3CEAA 2OFPA 1OOEA 2Q50A 2A94A 3G79A 3UVEA 5CG2A 1WNTA 5FI5A 1GV0A 4OOFA 2GLXA 1ENYA 1A5ZA 1NM5A 3GZNB 4FIZA 3K8ZA 1ADGA 4BNUA 3EDMA 3IAHA 1EQ2A 1PJSA 2Q3EA 4Z0TA 4PN3A 3HZZA 4A03A 4JK3A 5G0VA 4CM7A 2PFGA 1UXIA 3DMYA 3RBVA 1PZEA 3NX4A 4E2YA 4JNKA 9LDBA 3NTOA 3ZI0A 2IXBA 4XD2A 1Z7EA 1CDOA 2DKNA 4PRLA 5KJ1A 1ISIA 1VJTA 4UVEA 3KEQA 3RVDA 4WPGA 5DBFA 2E6UX 3MWDB 2GRAA 4IMPA 4A0SA 4CV1A 2WE8A 3ZV3A 5CP8A 4BVAA 3R0IA 3ONFA 4D42A 1Q0HA 1YB1A 3U49A 1DJNA 1A9ZA 1HETA 4RORA 4YJFA 1I8TA 1JW9B 1OZAA 2BKAA 4W99A 4DQUA 3DZKA 3D0OA 2D0IA 5IZCA 4KMSA 4D0SA 4HNHA 4CJXA 4NH4A 3U4DA 4U7WA 3AFMA 4Y6SA 2A92A 5EIOA 1NAIA 4XB1A 1T2AA 4J0EA 3V2HA 1E1KA 5JE8A 2VHYA 1C0PA 1ISGA 2RIRA 5JAQA 2Y1GA 3TPCA 3ETDA 1S7CA 1EFLA 4RVDA 4I5GA 1VL8A 3BAZA 1D4FA 1W8DA 1OFGA 1DBVO 3E9NA 3KUXA 4E30A 4P4GA 3RC1A 4CLOB 1VJ0A 1PEDA 1UDCA 3E82A 3AOGA 4PLHA 1PZGA 3PQFA 3PRJA 2ZB8A 3WQSB 4Z0HO 3WIEA 2WMDA 3VZRA 3E5MA 1PS0A 2FR0A 2GN8A 5U1PA 3G3EA 3WGYA 3JQ6A 3RROA 1HE3A 1J5PA 2ZK7A 1FDTA 5F21A 3JD4A 2O3TA 3KXDA 4BGVA 1GQYA 3FR8A 5EMHA 3ANMA 1KVRA 1NXQA 3CZRA 4OSPA 4DREA 3PHHA 4GSKA 2JAHA 5A06A 5KVVA 2CD9A 4FN4A 3LQFA 4OL9A 3V2UA 4DL9A 4ZRMA 2NU8A 2DBVO 5L45A 2BRUA 5LCXA 5FWNA 1GTMA 3GGOA 4JROA 1I3LA 4FGSA 1PS8A 3AJRA 1QXSA 3AFNA 3WLFA 1P1HA 3QE3A 2VWPA 3PYMA 4FFRA 1MFZA 1CYDA 1TEHA 2VRBA 1EE9A 1KBZA 4JJGA 4JQCA 2HMVA 4WEQA 4DPKA 3AUSA 3KEOA 1PJTA 3F47A 4CQLA 1BXGA 3RKRA 3EK2A 3ITKA 5KIAA 1G6KA 5GZ6A 4CMEC 4AJOA 3DDNA 2YV3A 2PNFA 2GYYA 1DB3A 3GDFA 3QWIA 1NQTA 5ES3A 2CY0A 1YXMA 1O0SA 4II3A 4NMHA 4YJFB 3NT4A 3ZV6A 3MZ0A 1KEPA 3KLMX 1PGOA 3K31A 1QORA 1YQGA 3PQDA 2IODA 1DIHA 4YB8A 3W4JA 4NBUA 3O9ZA 3MJSA 1YWGO 3AOEA 4EUEA 3FR7A 1MG5A 3PWSA 3QA9A 1H6AA 3B70A 2X8LA 2DLDA 3FI9A 1AUPA 3JQAD 4IXTA 1IPEA 1FJHA 4IQGA 4Y8VA 3IKTA 3ASVA 4I08A 1QYXA 3O8QB 4R54A 4WNIA 3WLEA 5JCJD 5IDYA 3QHAA 1DAOA 4TVOA 4XCVA 4GWKA 2ZQYA 3I3OA 5K9ZA 4TKLA 4BKOA 5B4TA 4KTTE 1DLJA 1DRWA 2RHRA 1AXEA 2VWQA 3ZGYA 4F6CA 1Q7GA 2EKLA 1NVTA 3EY4A 3FPCA 3R3JA 4ZVVA 3OHSX 4IDFA 3I5MA 3BHIA 4BNNA 1U4OA 4JJFA 4M49A 2BFOA 3LZ6A 3UUWA 5CDSA 4URFA 5ITVA 4ONEA 3U9LA 3OMLA 1X1EA 1RKXA 4Q3DA 2D2IA 1NR7A 2IZ0A 1K5HA 3V2GA 1ZVMA 4J7CA 1B8PA 4NK5A 3AU9A 1ORRA 1HDOA 5LDGA 4D0RA 3BZUA 3HJAA 3VTZA 4YT4A 4L8VA 1D7OA 4DQXA 2I3GA 5CEJA 3TL3A 2NM0A 1LSSA 4AVYA 4NJMA 2AQIA 2VRCD 3GEDA 5C7LO 5DBIA 4RGBA 3OIFA 4J7UA 4NZ9A 4CMAA 5DP1A 5ADHA 4TRJA 5EJ2A 2EIHA 3VVCA 5FEUA 2I9PA 1HT0A 3AY6A 3H9JA 4B4WA 1X13A 3A4VA 4LRTB 4CLDA 3ADOA 4MVJE 1GV1A 2O4UX 1GY8A 2YFQA 3VVBA 4CQLB 1BXGB 1JKJA 5C7IO 1YO6A 3HE3A 4TMFA 4BKRA 4M1QA 3Q9NA 4BNYA 3CH6A 3GNSA 3INGA 1GUFA 3NRCA 4O0LA 2DT5A 3DC2A 2H5LA 1ZFNA 4P4LA 2FN7A 3N74A 3SBOA 5DCUA 2GZ1A 1GZ6A 4FFNA 3CMMA 1GU7A 3EZLA 3GMSA 5DDIP 3PGJA 4CMIA 4DUPA 1E5LA 4CV2A 4QO7A 2VNAA 4IGFA 4N5LA 3FRJA 3SLKA 1DFGA 1PJ2A 1T24A 2JCXA 3UICA 2B36A 5DULA 1K2WA 1H9BA 1EVZA 2HDHA 2OZPA 1LUAA 3FNFA 1A7KA 2P2SA 3I4CA 3M1LA 4IQ0A 1X7GA 4R01A 1N2SA 1CJCA 1KIFA 3DR3A 3PZBA 5L51A 4WGGA 3GGGA 1RJWA 1YS4A 2AHRA 3ZNPA 1C3VA 1TVEA 2VUSA 3HSKA 3U4CA 3JQBC 3BA1A 4U6QA 3RBXA 1IY8A 1O9BA 2ZYGA 4AJNA 5I7SA 2YFHA 3D5TA 2J3JA 3L6EA 3O26A 2GR9A 1LSOA 3RQSA 3K6JA 1XCBA 5DNAA 3DOOA 1JLLA 2O2SA 1HDCA 3CXRA 3ONEA 1LA2A 2G5CA 2GN9A 3V1YA 4YAIA 1BSVA 3WNVA 1M2WA 4Z9XA 3PZRA 3T7EA 3DOCA 3IJRA 4BNZA 4Q39A 2H6EA 1ZK3A 1JN0A 4K26A 3QVOA 3JQ8A 5BSGA 5DCYA 3ROKA 1Y9AA 3DBRA 2OORA 3KB6A 2FWMX 2DTDA 2YHIA 3SEFA 4RCVA 1DEHA 4WK6A 4S1VA 3PIIA 4KDFA 4PRKA 5T64A 5JSFA 3ONDA 1U28A 1DO8A 4WLNA 1AHIA 4CR6A 2GN4A 1A4IA 2CVQA 2Q1UA 4A27A 3PI7A 3H3JA 2XF8A 1C14A 3CINA 3Q2IA 4DLLA 4YRAA 3M2TA 3UHAA 4W9NA 4LCJA 1NQAO 3OJ0A 3QJ5A 3AI3A 3F4BA 3ZNQA 1NNUA 2AE2A 3K5PA 3TZ6A 4YXFA 3W6UA 4E6PA 3N7UA 3PLRA 2PLAA 1PGPA 4R1UA 3L4BA 4R5HA 1MP0A 1PIWA 1UP7A 3LSYA 3A28A 3V5NA 4YACA 1ONNA 1DLIA 1I3KA 4NJOA 1DIBA 3HQ4O 5IZCC 4MDHA 1NASA 2PZKA 3B1FA 2DUWA 4N5NA 4IDBA 4CMIB 4DA9A 2DPGA 1R0KA 3C1TA 1QLHA 1NFQA 3LU1A 3LC1O 3C3XA 2JD0A 1ZCJA 1MB4A 2Q2VA 3KBOA 5HRUA 1M75A 3OETA 1ZW1A 2FMUA 2WM3A 3L77A 3WGQA 5H83A 4BNVA 2OUIA 1H5QA 1Y7TA 1ZK1A 4ALLA 3PJDA 4PGFA 1VL0A 5I8ZA 4CM4B 1N7HA 2NNLD 3GK3A 3MJEA 4NPCA 5HWSA 5L7TA 4DPMA 5GZ3A 1R4NA 3ON5A 3TRIA 2B37A 3QP9A 3H6KA 4CLRA 1UAYA 4J1TA 3JQFA 4R41A 5IN4A 1FK8A 4CL3A 1SEPA 3Q6IA 2YDXA 2O3UA 2X5OA 1VI2A 4L75A 3RFVA 3S2FA 4BKUA 3AM4A 2O4CA 3QVXA 3QV1A 3RU9A 3EAGA 1FDSA 4XIYA 1N9GA 5KVQA 3TDKA 5CEFA 1XIVA 4QTZA 5A9RA 3UKOA 5KWEA 1QYWA 4QX6A 4JCOA 2B4RO 5AYVA 3U3XA 2NQ8A 4ZQEA 3JQ8B 1NAHA 4CMCA 1HDXA 3DBRB 3QWAA 1WDLA 4LGVA 1TT7A 4AJHA 4EI2A 2YHIB 1JQBA 3JYQA 3LLVA 4DTIA 5JDIA 2A9FA 3GN1A 4H3VA 3WGHA 4YYZA 3D4NA 3INTA 1WW8A 4RF5A 2PZMA 3K73O 5K6AA 2AEFA 1HZJA 5TIIA 3U5TA 3KSUA 1I10A 1I2ZA 5TS3A 4CM9D 1I32A 3GFGA 4YRDA 2BHLA 1HE5A 3DBLA 5JXWA 2HMSA 4FFLA 2VYVD 3P2OA 3BTVA 3DZIA 3MOIA 2WJPA 4KP7A 4R4JA 3E18A 5B4UA 2OXIA 5CG1A 1KC3A 3BTUA 1EZ4A 4A2CA 4CQMD 5KKAA 2Z5LA 3DAGA 1WPQA 3L6OO 3GG9A 1LTHR 2PKQP 1Y81A 3H9EO 3NJ8A 1NPTO 3OECA 3JYNA 4HNGA 3K9QO 2G0TA 3W8DA 2C2YA 4BNHA 3TFOA 2RBEA 3HN2A 4QO8A 5BQFA 1PL6A 4II2A 5HBRA 2WE7A 2OL4A 4IMRA 3QY9A 2NADA 1MG0A 4BO5A 1HSOA 1A71A 3PWKA 4XA8A 4J6FA 4PLWA 2E4AA 2E48A 4ALNA 2X9NA 4OXYA 5CDGA 3AOEC 1NX6A 4GH5A 5EQFA 3VPHA 4EJMA 4BQPA 2BI8A 4FCCA 4BNIA 1HYEA 2QRKA 2HJRA 2GD1O 4CODB 3DZFA 5EL0A 3GUCA 1FDUA 1HDRA 3EGOA 1BXZA 2UV8A 3GT0A 5KJCA 1ISHA 1J6UA 1Q2XA 1ISJA 3WMXA 4NBVA 5HA5A 4E5YA 1E6WA 1XLTA 2R2GA 3CIFA 1KEVA 1RM5A 3STHA 4D3DA 1DRVA 1EDOA 1UAGA 1ULSA 1I3NA 3PVZA 5T8KA 4D46A 1AN9A 1R4NB 3C8MA 3GVXA 1Y9EA 1YL6A 3WB9A 5L4NA 2H1SA 4R68A 3FTPA 4CLRB 4AL4A 5B37A 1DHRA 2DBZA 1WWKA 3HDQA 1ENZA 3WQRA 5CDYA 1U3WA 1DOHA 5KCZA 1GQQA 2PZLA 1JKIA 2V6GA 4R9RA 3DXFA 3PXXA 1E0DA 4XX0A 1N9GB 4YQYA 3ZU4A 1KVQA 3AY7A 4F6LA 1BRMA 1MGOA 1X7DA 4DQVA 3LT4A 5G0TA 3WGGA 4IS2A 4DIBA 4W7HA 2HUNA 1VSUA 5ER6A 2PZJA 2UDPA 3IL2A 3OF2A 3BXXA 4LW8A 2VZ0A 4LMPA 1R0LA 2CMDA 1JAXA 1WVGA 8LDHA 4PLZA 4RZHA 5KVCA 3WFJA 4EUFA 1ZSYA 4CUJA 2QRLA 4CM1A 1YGYA 4FJ2A 4FW8A 3DBLB 4IS3A 3RUAA 3W4KA 1PWZA 3ROMA 2O2YA 2Y05A 4BO8A 3IQDB 4IIUA 3I4FA 5TC4A 2ZTLA 3DFUA 4U5QA 4UUOA 3PLNA 2Y0EA 4E32A 4ZICA 5A9TA 3ZWPA 3FBTA 1TB4A 1GD1O 4GVXA 3H5NA 3JSAA 1PJQA 1YJQA 2BFPA 1YBVA 3QLJA 4I9HA 3WGOA 1ZBQA 4J90A 1ADBA 3HDHA 3NGXA 2NSDA 4NBTA 4BUCA 1ML3A 4U0JA 1YOVA 2GSDA 1JAYA 3H2ZA 3W6ZA 1LQUA 2C82A 3F6YA 1HTBA 4MJLA 1N92A 1J0XO 1NPYA 5DCWA 1T26A 3FCOA 4JP2A 4DGSA 3DEYX 3W1VA 4RLHA 5AXAA 4CV0A 4XGIA 5CEEA 4PLGA 4DWVA 4M86A 4ROSA 5BSHA 1DIRA 2JCYA 2I65A 3GUYA 4B7UA 5EINA 5G0SA 1GYQA 3OBBA 2O7SA 4OM8A 3WR5A 3RUDA 4BO3A 1C1XA 4Q3CA 4JN6B 4L4SA 1XR3A 3WYCA 2WYWA 3U0BA 3JD1A 3P19A 1N5DA 2PR2A 4CUZA 2J6IA 4IDGA 3WMWA 5I7FA 1HZZA 1NFRA 3ZWOA 3PGXA 4AJ4A 1SAYA 2H63A 2I6TA 5BR7A 3JQAA 3QVSA 4LSWA 4QUKA 1MA0A 4UEKA 2IRWA 3QVWA 4HFRA 5THKA 2PD3A 3KHUA 4YAJA 5JCJA 2QIOA 1E77A 4XWYA 4PIVA 4WE3A 1LNQA 4FDAA 3LT0A 1JWAB 1M76A 1QG6A 4WCFA 1E6UA 1WMAA 4YRBA 2Y1CA 4HFMA 4BV8A 2FY8A 4MP8A 2J5KA 2D5CA 4J9UE 5KVSA 4GKVA 4W9NC 1BXKA 4AICA 1XKQA 1DC4A 2X86A 3RFXA 1E3LA 1LRJA 2EG9A 3NAQA 2Q46A 3PHGA 4ZQBA 3S2IA 3ZWMA 1D1SA 3T4XA 5I7EA 3LYLA 1UP4A 3GA0A 3X2FA 1GAEO 2O3SA 2ZB3A 3L4BC 1U7HA 2BGKA 1PTJA 2EP5A 1U3UA 3ZNOA 3WYEA 1H0KA 4OOEA 3RC2A 3RUFA 1E92A 1JVSA 3CSDA 3TWOA 2VRCA 2UUOA 7MDHA 3PHIA 5IAAA 4J4BA 3PTZA 4OKNA 2Y1OA 3FN4A 3E6AA 4JBHA 4EEZA 2X0RA 1J4AA 3GDGA 1YOVB 5T5QA 4FC6A 2VHVA 1DHTA 1FDWA 1ZMTA 1N8KA 3PDJA 3O8QA 5AXCA 1P1JA 4Q3EA 1V0JA 2C29D 4WLFA 5HTOA 1GCUA 3C1AA 3F4LA 4I5FA 1NWHA 3JQCA 4DYVA 1ZJZA 4QFDA 3AWDA 1GEEA 3QIVA 4UVIA 3IKVA 4QXMA 5CPBA 4ALIA 4PLTA 2CF5A 3E5RA 4AJLA 5F5LA 1EDZA 1TXGA 4IXWA 1VJ1A 3GMDA 1V9LA 4JIGA 4J9VA 2WEKA 1B0AA 1P1RA 2IXAA 1C1XB 4QEDA 4CMGA 4ZHSA 2NUAA 1IB6A 3MWEB 3VPGA 3PWZA 3H9UA 3JQFC 5AXBA 3WIDA 1E7RA 2I5PO 3ANNA 1PS9A 1KYQA 1Y5RA 3RJ9A 3PJFA 4J1QA 4Q3AA 4OGWA 1KVUA 2Y93A 4IJWA 1K6JA 1R0SA 1PR9A 3JQ9A 1FDVA 2EHDA 4DYDA 2VZ8A 1NQOA 4CMHA 2BFAA 4RJTA 1Z6ZA 5JY1A 3PIDA 1E3IA 1YKFA 3JQAB 4MVJD 4DC1A 3D3EA 4A73A 1U1IA 1D3AA 4MINA 4XQGA 1PJBA 3EVTA 4RPLA 4I1IA 4EITA 3IDSA 4R5MA 4NK4A 3RSHA 5JDIC 1RYDA 3C1OA 4H7PA 4UUPA 5DOZA 1QR6A 3UCEA 2CF6A 5K6AC 3EC7A 1NVMB 4RL6A 5IXYA 1M66A 3L07A 3MCVA 4WCFB 3TF5A 2OP1A 3DHYA 1P33A 3PJGA 3HWRA 4BKPA 3KVOA 2EF1A 1P45A 1M6HA 4PG7A 3LF2A 4ND2A 3KSZO 2HKIA 3A14A 3LLSA 3C24A 4O5OA 4D3SA 4WUVA 1A27A 5KJFA 3SXPA 3H65A 2IZZA 1KEUA 4PZDA 2F1KA 4RPKA 3VKVA 4BNXA 2Y68A 2AQHA 5U4QA 4BS9A 4P22A 4E3ZA 4AJKA 5JAIA 2EP7A 3PHLA 1GUYA 4CM3A 4WLOA 4TKMA 2DVMA 3ADPA 3DFZA 4U0KA 4WOJA 3WS7A 1NFFA 1L7DA 4F46A 2X5JO 4IZIA 3ST7A 1H6DA 4ZRNA 4DBZA 1LSJA 3WICA 4RO0A 1B8UA 1CWUA 3K30A 2P91A 4PLPA 2QHXA 3W8EA 4BNJA 2D5AA 5JO0A 2D59A 3QRWA 5T67A 2BELA 4PG4A 1U8FO 1SEVA 3GR6A 1MXFA 3INRA 2JKVA 2ZTVA 5GY7A 2JJYA 4Z9YA 2FZEA 3VH3A 1NP3A 4IINA 3VZPA 1Q1NA 1V6AA 4E13A 3Q3CA 1AE1A 3PFWO 1P31A 3OSUA 3PYLA 4NHEA 3KYCA 3OJEA 2EGGA 5A5FA 1HEUA 2P9CA 4B7CA 3BHMA 4CM8A 3ZW9A 3LT2A 4XQEA 5T8KC 3NT2A 4XYGA 4G5HA 1UDBA 5LDHA 3FWZA 3W4IA 1SCUA 1T1RA 2VWHA 4AG3A 4KWHA 3B20A 1CIVA 1HXHA 3FHLA 2WD8A 3DZBA 3U4HA 1PQWA 2F00A 3GC6A 4RPJA 3S1LA 4O1MA 3GEGA 4EW6A 3TJRA 1DFHA 3PHJA 4XYEA 5EN4A 1DSSG 1DC5A 4WLEA 1XWFA 4FQ8A 2NU7A 1P9LA 3VPFA 1VKNA 2NTJA 4FFPA 4XDZA 3NTRA 4TQGA 5GMOA 4PCVA 4PG6A 1LLDA 3JCZA 4F45A 5A3VA 1BMDA 4OKIA 1CQIA 4XDYA 5JMPA 1O5IA 4ND3A 4WKGA 1ENPA 1QMGA 3BTOA 3R6DA 2Q2WA 4FGWA 2RAFA 3ZWVA 5CDTA 3H3FA 1V3TA 5KKCA 3IS3A 2VTEA 3VPXA 4R51A 2Y0DA 4QQRA 1LLCA 3N58A 4XKJA 1VM6A 3VZQA 1F8GA 1LXCA 1WDMA 2RCYA 4HKTA 4B4OA 1X0VA 1QYDA 3LC7O 4Q3NA 4XB2A 5IF3A 4YTEA 3OQ6A 1UXGA 2H9IA 4Q9NA 3ZW8A 1ZH8A 1H94A 1WZEA 3BIOA 1LQTA 4RQUA 4IDCA 4ALJA 1PJ4A 4ID9A 3C7DB 4AJIA 1HLPA 6ADHA 4CLHA 2EKQA 2E37A 4P4NA 4RZIA 1P1KA 1YVEI 3LF1A 3PJEA 4BNFA 4RVUA 2EW2A 3DHEA 2CSUA 2VYVA 4L9RA 3NTQA 2P68A 3CMCO 2NTVA 2VYND 2A35A 5JYDA 2VHZA 4WNCA 4CQMA 2FOIA 1CERA 4CM4A 2O48X 4GGPA 4AJJA 1A7AA 4GMGA 2J5RA 4BO6A 1U5AA 1T2FA 3RUIA 3OH8A 2ZJ1A 3Q2KA 4A26A 5CHEA 5TGDA 3H2SA 2GF2A 1K6XA 2VWGA 2YV2A 1VC2A 3SLGA 1DDOA 1D8AA 1H6CA 1N7GA 2C5AA 4YDRA 3KYCB 3DAPA 3TZCA 2FSVA 5TQVA 4IDEA 3AI1A 3B1JA 4GMFA 4WEOA 3VH1A 4JBIA 1NR1A 4J4TA 3F1KA 4CM8B 4D79A 2O50A 3ULKA 1VLLA 4ALMA 2POQX 3OICA 1YB5A 2UYYA 3E9MA 3I52A 4FSHA 3GPIA 1OAAA 5BNTA 2W2LD 1ZO8A 4AJEA 3V8BA 1C0IA 1ONOA 4Z9FA 5CDUA 5A4DA 1T2DA 5A05A 1V35A 1S6YA 1UZNA 2G82A 2AQ8A 1K89A 2C07A 3SC4A 3ZV5A 4TROA 5C37A 1E3SA 2W2KA 4EJ6A 4MVJF 2I76A 4WCFC 1KETA 4JXKA 2Q45A 3WJAA 1ISFA 2NU6A 4ZD6A 2WYUA 3WOHA 5JCXA 1GPJA 4KQWA 1SB8A 2W4QA 3IIEA 4GGOA 2VTDA 3EW7A 3UXYA 2YUTA 5JW6A 3BHJA 1D1TA 4IJKA 3PP8A 2VT2A 3H9QA 3ZU2A 1MC4A 1ZUD1 3RWBA 1P1FA 1B3BA 4BGIA 2GO1A 4C4OA 3PYXA 3OEYA 4MP6A 3VKUA 1E7QA 1JKFA 5CFZA 2YV1A 7ADHA 4DIFA 2V6MA 5IDWA 3NDIA 2B5VA 1AXGA
chains in the Genus database with same CATH superfamily
4PHHA 2ISSD 2Q1TA 2H7YA 5K3BA 4A2QA 4FSDA 3TTYA 2Q9UA 4CPDA 4BVEA 1RWQA 4J7AA 1N2IA 1N3LA 1VDMA 3QM1A 4FBLA 4RQTA 1QK3A 2OBMA 4KUHA 3VRHA 3L7DA 5C7OO 3L05A 3PQ6A 3BRQA 4F8JA 1UXJA 3UWPA 1TO1E 3V97A 2P3SA 3F6SA 2YXLA 4F9TA 1K1EA 2ZRQA 5I01A 2UYHA 2R9VA 2XMSA 3K9BA 3LX6A 4M8SA 2VXOA 3W6NA 4R8MA 2UZ1B 1PFYA 4PLFA 4GVLA 1FLNA 4LY9A 3P0EA 1AGPA 1JG1A 3IIJA 4IHJB 3ETGA 3G17A 4TTIA 9LDTA 1PK9A 1ICIA 3RJMA 2H2AA 4TS1A 4A6XA 2BGIA 4B0PA 3CNBA 1QGZA 4B80A 2PGAA 1CZRA 1YE5A 1P17A 2FAXA 1SUCA 2VJBA 4IIFA 3UZUA 2IS6A 2PSFA 3GT4A 4GMKA 2G67A 4X66B 2HZBA 1XZHA 2ZPAA 3F1LA 1WCWA 3LDHA 3TKAA 1VPTA 3VMFA 5KQGA 1O0CA 3GO4A 1YK0A 2PMWB 4MQLA 1QO9A 4JL6A 3L6DA 4KYVA 3TRHA 4X63A 2G1UA 3UJ8A 2P5UA 2V6FA 1IM8A 4CM6A 3GN2A 4D6PA 5FUMA 2XUHA 2H8GA 3FTCA 1MJGM 1F6DA 3GL9A 4MQBA 4EECA 1SBQA 1F2UB 4KPUB 1T8YA 1MU0A 2JFHA 3K0EA 4PO9A 1ZEJA 3I45A 1VJDA 2QK4A 3UW3A 1NVEA 2XNDA 2GVDC 4UBKA 3VNRA 3KAKA 1G4AE 1Z6TA 1SOAA 4AZVA 4TYWA 1OIXA 4OH7A 2FVYA 1K3UB 2F3SA 4ND6A 1KYVA 4BN5A 4TXJA 1QU2A 4EMBA 3ISTA 1DJOA 2EZ9A 4ON9A 5DF1A 4EM6A 4QELA 4OHRA 1MC5A 4A0QA 2XYRA 5IFLA 2C9YA 2RJ3A 1PGQA 1ZVKA 4ABTA 1GTL1 1UBLS 4KLNA 3IX7A 2VQFB 3ZHBA 4COOA 3OURA 1WY7A 5HJ7A 1W25A 1DQSA 2FLWA 1EQAA 1U31A 2QLLA 1XDSA 2WMNB 4GLOA 1QONA 5DYNA 4RAQA 2BJHA 5AUOB 4FXOA 3S1AB 2ZITA 2HQ1A 3VBCA 4ZT3A 2ZXUA 4E2FA 2NVWA 1SVNA 2H4YA 2X1VA 3U60B 1SVKA 1BVRA 1RLTA 2W6ID 3IT3A 3DBOB 1E62A 4N9QA 4QPCA 1DRJA 1G0OA 4AY3A 1H6BA 2O05A 3AGPA 3SHQA 2HYIC 4IGKA 3SIXA 4MW2A 1RDFA 3R09A 4BP1A 3EWSA 4FOOA 3AXTA 2R5FA 3H5VA 2CXOA 2PGLA 2X0NA 3JV7A 3WIBA 5EQJB 1I24A 1LDNA 3D4BA 3KQSA 3V3TA 4UAGA 5TV2A 3TX6A 5CHYA 5FUYA 1KMCA 1Q14A 2BGLA 2MSNA 3HABA 5DYGA 2I99A 3UYLA 3I5XA 4LHSA 4DZTA 3KPJA 3E03A 1XMSA 2YOGA 5AK0A 5FP0A 2P69A 1QH9A 2PGOA 4GXQA 1MTZA 2DZDA 1NN3A 3OA2A 4AFNA 1HURA 5F1KA 4MWEA 1KY4A 4PFSA 1UJ2A 2NQTA 3GVHA 1JHVA 2AUMA 3ZHQA 3IERA 1SXPA 4UHHA 1QC5A 4HNUA 2Z3VA 1JDTA 3P4XA 1W7AA 2GLTA 3TTWA 1UPTA 4CEIA 4XJSA 3JAWB 1XD9A 3VTFA 1FF9A 1QHXA 1CU1A 1P44A 3SC3A 1N2OA 4I1YA 1YNSA 5FFFA 3ROFA 1SXIA 1V8OA 3H1TA 1XTJA 2FPIA 2P9HA 3H4TA 4F04A 4EF4A 4KTVE 3RS3A 4P32A 2CCKA 4PX3A 3WBKA 4B6PA 1O6BA 2PXAA 3ZCXA 5IWAB 3VO1A 3LPNA 2ZYSA 4P5DA 3SBDA 4C7KA 2AFVA 4LYEA 3DBVO 2A9RA 2NUBA 4C7JA 3ZWBA 2ILTA 4YBZA 2I33A 1L5SA 4MLCA 5LYJF 3USCS 4QNRA 5B1IA 5BQ3A 4IR7A 5CITA 1OBHA 1PBNA 3REOA 5IP5A 5FDFA 2I67A 3DEHA 1CHDA 1HF3A 1Q0LA 4LQ4A 5KX5F 1GTRA 4YMGA 2FJPA 4DBZA 2L17A 4IAOA 4YPVA 1AX9A 2E18A 2IEIA 4O1HA 3BB3A 3F5SA 3KHSA 4YJ2F 1P7CA 4G3XA 5AW2A 1HE2A 1BO6A 1UXOA 1FQOA 3HYNA 3J7TA 5DHFA 4EVQA 3BDIA 2Z1NA 3NPMA 2DE0X 1J56A 2XQKA 1UC8A 1RXCA 4OH1A 2F1RA 3RSGA 4BLUA 4F5WA 1RACA 5C8ZA 3RAJA 3EHEA 1FP2A 1Z22A 2GXUA 3GXBA 4L8GA 3OTQA 5B7PA 1ZJJA 3G02A 4PEVA 1G2OA 1KPHA 1UH5A 4DOMA 3SX0A 4AP6A 1C1HA 1NUHA 4U7JA 1IXZA 1SCAA 1BOOA 1E2NA 2FMFA 2IEDA 1SOVA 1GCGA 1I5RA 2AUNA 2IEAA 3EXHB 3LCMA 3ICOA 3GOQA 3CRMA 4M1WA 2O2ZA 1GQOA 2ZAOA 4G2TA 3RHTA 5MGBA 1F1JA 4PZ0A 5BUZA 1KNXA 3DNFA 4QE3A 1SHLA 1EXNA 2VF4X 4WLVA 4XYLA 5DN6D 4K88A 2C42A 1P6UA 2G8LA 5IT9A 1MBZA 1NE2A 4TL8A 3W2HA 1IWBB 5BQPA 4FNAA 2RK4A 1QU3A 4ZO8A 3S7TA 4EMUA 1VHQA 3REQA 1KJWA 1HE8B 1VG9B 4HUTA 3HMQA 5B3KA 2VJMA 1NBHA 3IPCA 1XL0A 2WJZB 3H4VA 3L18A 3L7IA 3MWFA 4K9LA 4MQ5A 4JLOA 3DDWA 4RXUA 1E3JA 1NWCA 2WWXA 4JC4A 4ZQFA 2BV3A 3H19A 2BUCA 2OZEA 4JUCA 4LSMA 4ETIA 4OHBA 1XUOA 2RKBA 4EB6B 1HYBA 4HT3B 5JCOA 4NYIQ 1ISMA 2TRSB 4CL0A 1JA1A 3QOYA 1IQRA 2PUVA 5E6SB 1QKKA 5EGNA 4OF4A 3FFTA 3RRMA 6ABPA 3FETA 4ZCQA 3K1AB 4WGFA 5LP6F 1JU9A 2GBLC 4UJ3A 2AVDA 1DV1A 2QTWB 3P5SA 3ZOKA 4HMPA 4ZVNA 2FYTA 1RD4A 4FYMA 4C87A 3DO8A 4PG5A 5JXJA 2VQ3A 2BBSA 1H3FA 1QE0A 2R25B 4N8EA 2PXCA 5F51A 1JL3A 2OILA 3KFXA 5DBGA 1YIOA 3RC9A 5CB4F 3KCNA 1OAKA 4E22A 1CSEE 4DN6A 4BY9E 2ZYVX 5CVCA 5HFAA 2DBQA 3KK0A 4LA4A 4Q48A 5D51S 5DK4A 5A5EA 5LOVF 2J5XA 3OPNA 2VYCA 3G85A 4P80A 2W9XA 1KAMA 4RABA 5LKRA 2CDBA 3VHRA 3KYDA 3SCZA 1UBHS 3OP4A 1FNBA 1E6LA 1Z13A 1NVAA 2FSVC 3SYLA 2E49A 3U09A 1H2WA 1J39A 4C0JA 5AW4A 1LDGA 4GXRA 3OLXA 3R5FA 3BT7A 2WYIA 3OJLA 1IZ0A 4PC6A 5K6TA 4XJXA 1T0JB 1CS4C 3TLMA 2PT7A 2IHNA 3MJTA 1ODSA 3SQXA 4PRYA 2XUPA 4PYOA 4CG2A 3C4JA 2F7SA 3JQ7B 3ODPA 2O8FB 4RELA 2WY2D 3PICA 4ESHA 4UNSA 1O77A 3BXGA 2F3RA 4CBVA 3T7DA 4HNTA 1FRFS 2PCJA 1P0MA 1E3EA 2DAPA 5F5NA 2GPSA 1F8FA 2QUIA 4A1FA 4BFXA 4EQ6A 2II6A 2XGSA 4G25A 4TV9F 2FRDA 4TSFD 1V1RA 1EUCB 5LKAA 1O95D 4BLPA 5JJCA 2BFCB 2QAJA 5EEHA 2J6HA 3JYLA 4UE2A 3HJFA 5B4VA 4MDEA 4EHAA 3OQJA 1KFJB 4OQYA 1ULUA 3J7AC 1PZNA 1ZONA 3FCYA 1HYQA 2QR3A 3PEUA 4IGEA 2VOEA 4M98A 3OIVA 3T95A 3AO0B 3I61A 1W35A 2C7GA 2ORVA 4ESOA 1NLMA 5IU6A 4Y2HA 3F5MA 4M9RA 1X70A 2NVOA 2B1JA 3GVIA 3PE6A 4NZOA 4R1NA 2Y1WA 2Y27A 3I9KA 4ZI7B 2HU7A 3JY6A 3VV3A 3ID6C 4ZJYA 2AK2A 1S96A 3DOJA 1CUXA 1LW7A 3COYA 3GLGB 2VHXA 2NSYA 4QPZA 2HRCA 1GZDA 2WBLC 2PUWA 1U8ZA 1Z4KA 1C3XA 1NC3A 1X94A 1H69A 1XTIA 4XGNA 4EK9A 2V96A 4EHIA 3ZJTA 2C20A 4ZI7A 2G6BA 4YO8A 1WSBA 5KYTA 2YYYA 3ZWAA 1YIAA 1YCDA 3ZY5A 1NZDA 4QEKA 2JDIA 4DQKA 5JSZB 2WU1A 5C1BA 1OTHA 2OKGA 3FB4A 2W7TA 4Z0PA 1U4SA 3ZG6A 1I4DD 4W8GA 4AD8A 2QX4A 1WMEA 2FR1A 1M67A 1DT3A 4FVTA 1LS6A 1I6KA 3NHAA 2XTAA 1ZH4A 1JIKA 3STTA 4DBVO 1HKHA 2JHCA 2OECA 1N36B 1E3DA 2GDZA 2QG4A 1GN9A 3ESRA 1JQEA 3MGGA 4MVJP 3H9GA 2PKWA 1T5TA 4TM7A 5HDBB 3VKWA 4BX3A 2J3HA 2Z95A 4IIGA 4P7GA 1T8TA 4UE3S 3E2IA 3CNOA 3BK2A 1V3UA 3IPAA 4DJAA 2KBEA 4LC9A 1POXA 3FPHA 3T12A 2X4GA 5C3MA 3MTIA 4M8NE 1D0IA 5KDLA 4PSUA 4HPJB 3VC2A 1ECLA 1FUEA 5DHUA 1DXYA 1Y89A 1H22A 1KAQA 2XYGA 2QBYA 1HR0B 5KYYB 1PE0A 2JAUA 2VG8A 4IZHA 2V5AA 4AMYA 2X2FA 5H3CA 1KP2A 5FWYA 3EJWA 4WHMA 3O47A 3IJEB 3DV2A 3RSSA 3O8RA 3NTVA 1AHNA 4XM2A 4EG4A 1XXHE 2M1ZA 2OHGA 2B2NA 3DKPA 3EVNA 5F5XA 4ANFA 4BB6A 4ZYUA 4GL2A 2D74A 2C99A 3FFWA 3IE0A 4PX5A 2J6CA 4CT4B 2RGCA 3K7EA 4NPAA 3CPSA 1FX0B 2HJSA 3BXZA 3INNA 3N6RA 2WWRA 3F3MA 4HZGA 3ACCA 1EWVA 1AKMA 1FE8A 4CIDA 1J09A 4IDNA 1MJNA 1H2FA 2QGNA 5JQGF 1GN8A 2Q5HA 3GQVA 1YFJA 1V11A 2P35A 3RS4A 1L4BA 3SOZA 4YY3B 5C52B 2UYCA 1C3EA 5HSGA 3L0BA 4MQFA 4E5UA 2O59A 4HVAA 4US2R 5EPEA 5KC9A 2UVQA 3TNYA 2Q5OA 2OBBA 2PKRA 3GRAA 2ZIEA 1CY2A 1OZ0A 2X42A 2QQFA 3LFUA 3R4VA 4IW3B 4E7OA 4Z1OA 4JI7B 3M5CA 4GOMD 5KX5A 3CF4G 5AH0A 2X58A 3Q5GA 4YJ2A 3GPCA 4G8DA 4DLXA 1N9ZA 1ZICA 3V8MA 4C7XA 1SQ0A 3D4PA 3R3WA 4OIMA 4Z8YA 2OYCA 3RT9A 3T38A 5AVJA 4GM4A 2GZ3A 2RONA 1HDIA 5G40A 2TMKA 2XF2A 3S2UA 1EXWA 3FUCA 2FNAA 1ZEMA 4ZVUA 1GT91 2PPVA 4DV3B 1KI8A 2FEAA 2MYNA 1PNVA 4HAYA 4U6NA 4UVHA 3TTSA 4DLTA 3THXB 2D00A 3VOSA 4KXQA 4V1CA 1G16A 3II6X 3JXEA 3NV7A 1P4AA 1C2YA 1CEYA 3ZWXA 2AZ4A 4HQOA 4TMVA 4D02A 5JLAA 3T9DA 4XWKA 1M83A 3LW8A 3O2JA 5HJEA 5AJXA 4IBOA 5EXPA 2H0QA 5TLSA 2AUTA 1KK1A 1BWSA 1NMXA 2FB9A 1Y6JA 2QVGA 4A6DA 1TYEB 1WDKA 3WIUA 3WK7A 1NYTA 2A3RA 2X4LA 2XGGA 1KBOA 2QJTA 2ROQA 4ENPA 4KHPB 1DAPA 4ND7A 3ZXSA 3L7AA 4OU5A 4MW1A 4JUBA 4YV7A 1GQFA 1Q6ZA 3F3YA 1R0XA 3KKNA 2Q62A 4BTVA 1VCOA 1EMDA 3FMGA 1T15A 3AY0A 1PZXA 1NQ5A 2FRVA 3ACDA 1SOUA 3CUVA 4KL8S 5AHKA 4UFNA 3VYVA 4DDUA 4J0GA 4RV5A 1RW4A 3WBFA 4RKQA 4UQOA 4F6RA 1HOXA 2BL4A 4R71A 1XSEA 2BMJA 2J5QA 4FHCA 4F38A 3B9QA 4X8OA 1SC6A 1NMSA 2J3KA 4TTJA 3DCYA 1F0KA 4DWJA 1TAUA 1NTOA 4L2IA 2FJ0A 1B14A 3COJA 4P8RA 4I4IA 5KNDA 2VDOB 2IHUA 2VTBA 4BO9A 5IMBA 5B1DA 2XIQA 4TZTA 3BKWA 1A9OA 1ZMOA 3D3NA 1CUIA 4LRXA 4ILKA 2YRWA 3AILA 4PFQA 1IZ9A 1QYCA 1JHRA 2ZXEA 2P9BA 1CUJA 2Z30A 1FFYA 3OZ7A 3ND7A 4JMLA 3O03A 1NXTA 2HA7A 4RADA 3UH1A 5LP6A 2P78A 5HW0A 2FXIA 3QI7A 2IIPA 1Z34A 2H4HA 3L6BA 5AP9A 3AEUB 4BRSA 3EGVA 2P0EA 3VJRA 2RGYA 1JT9A 2WJGA 3DM9B 1YZQA 1YR2A 3QKIA 1LX6A 3AT1A 2QAGC 1N6IA 5EIBC 5EZYA 1JSCA 3HP1A 1RXVA 2CKMA 2RB4A 2I29A 5L7WA 1C9YA 5AJWA 4B4UA 1V3VA 1ICEA 2O7QA 1TI7A 3PEWA 2P2CA 3L8MA 3PUZA 2O23A 1X3LA 2AMFA 4HWKA 4C22A 4QUEA 2WA2A 3E9CA 5LOVA 4ITUA 1HWYA 2FPRA 2VKQA 3GHYA 3SF8A 1R88A 1JR3D 3OLYA 4QWMA 1QHNA 4HS9A 3MQ4A 1BDJA 5B12A 3LPDA 3BFJA 2HMWA 5FBWB 4RD1A 3HB0A 3R40A 1O94C 1Q0UA 1DEOA 1GXSA 1PF7E 2RAPA 4IIVA 3NV9A 2CXSA 1R12A 4HNSA 2Y1FA 2ZULA 3GWZA 4KDCA 4B2PA 1AKQA 3D81A 3P4UA 1UJBA 4NOJA 5EOVA 4B32A 4Q4CA 1GO2A 2QRGA 5AT1A 2JFFA 1W87A 3FBWA 1L1FA 4GMHA 4B4VA 2DTEA 3UJCA 5K7SA 3CNQS 4YO7A 1M73E 4B8ZA 3OCCA 3Q8MA 3ZKWA 1JLHA 3HA3A 4PLVA 4YCMA 5CB8A 8GPBA 4L1KA 4Y67A 3H5AA 1ISSA 1YTUA 4Y2JA 3PNPA 3EPPA 4GBGA 1UPCA 5AK6A 1N5RA 3TRDA 4ZT2A 4ZU1X 2NWQA 3HDVA 4R2IA 1F17A 4TV9A 3ZGZA 2MWMA 3UYKA 3GDHA 4O4HF 1R4MA 1JJVA 2R00C 2YQ5A 3AESA 5JNLA 4NCXA 5AVVA 3HPRA 2ACKA 3HM9A 5LMNB 2O54A 2OCAA 4DLBA 1M7BA 4UCFA 2CHQA 2H08A 4WZBE 1QH8A 1X80A 1YZUA 3HDYA 2YN2A 4KWTA 3SYKA 1B0ZA 4DC0A 2JIBA 2ZRFA 4R69A 3FYHA 4FFOA 1NJ6A 1YI1A 1K63A 1M1NA 2OGSA 2RHCA 3GLHE 4RA9B 3A6EA 3CKMA 2WJ4A 1XBTA 5AXDA 3DHWC 1G8FA 1QH1B 1CBUA 4K6KA 4NCKA 4FNOA 1KVSA 2GJKA 2VLIA 3BB4A 4LUCA 4JV5B 1KH1A 2HIHA 3OQBA 5BR1A 1CX9B 1BN7A 1QV6A 3P45A 3RRYA 2YZ2A 3MAGA 1HT2E 1Q16A 2HBRA 3O73A 5SZJA 3UOGA 5F7OA 3BMOB 5JXIA 1K6IA 2WIBA 1JQJC 2R7NA 3A1FA 1G8GA 2P40A 4MX8A 2VDUE 5LIPA 3ZH9B 2W6IA 2HDWA 2I66A 2ZIXA 4DCNA 2C7PA 4JVOA 2EW1A 3RBZA 2YWHA 4TMYA 4DDMA 2PUAA 4MKFA 5JSKA 2QZSA 4KQXA 1RRCA 3IOEA 4G67A 4HGRA 2YINC 3KALA 4MGYR 4YREA 1ESEA 1IHXA 1M2KA 1KXJA 1JWLA 4K9QA 4EB8A 4GPIB 5DTMA 2IHVA 1P4RA 2PKXA 2V98A 1L1RA 4HO1X 1PNTA 1H0SA 1U8XX 1FW8A 2BWJA 3CKKA 3DTYA 3EDOA 3KQMA 3PXUA 1W9HA 3QLUA 4OSOA 3FPEA 1IXYA 4CHTA 2XXAA 1A98A 3CW2A 2WWIA 3EBPA 2LDXA 5ILGA 3AF6A 4YCAA 10MHA 2OFWA 2ET6A 3OX4A 4N0MA 5EGSA 5KQRA 2RH4A 1JJAA 3NASA 3DGFC 1RMQA 4X20A 5BVHA 2G9ZA 3KJQA 4AN4A 1RQGA 2FZWA 1H1TA 1EPUA 1Z5WA 4KR3A 4MTLA 5EIXA 2JFNA 3E7PA 1XGKA 4QFBA 3E1KA 2ZBFA 4U9UA 3TEMA 3W9BA 4EYKA 1T3GA 3ZWYA 5J3JA 1WZIA 4CGZA 1MPTA 3AM5A 4AULA 1JE0A 3CE6A 4L50A 3HXLA 4Z7QB 1KJZA 1X0XA 5CH3A 3PT9A 1DELA 2Q3DA 4D9IA 1QRDA 2GNPA 4N3AA 3SK0A 3M6XA 5HQ3B 2UVDA 3HH8A 3QOXA 4YP7A 2V97A 5DP2A 5L3ZA 1GA1A 3I12A 5SY4A 3EZGA 1N2CA 2I3AA 2YV4A 4QJ4A 4X54A 1OHHD 2VZ9A 3M3PA 4KB5A 5LC1A 1EVEA 3LTNC 2E0IA 3CUWA 4LVNA 4RF3A 1PFGA 3EUWA 2F1JA 5BYJA 1N6RA 3MS2A 5T57A 1NU6A 3CZAA 2VXYA 1T9AA 2C0PA 4MZXA 4DA7A 3I37X 2OP0A 4I2NA 2GUWA 1V16A 2A5FA 1XX6A 1A2KC 1P5HA 2AN1A 3M6WA 3QYFA 4HY3A 4F4FA 5A3JA 1U9IA 3W3AH 1XKXA 3ZX4A 5IH7A 2ZUUA 4NESA 1EX6A 5DCLA 4H16A 2I7VA 3GLIE 2JFOA 4GI7A 3VPSA 2FPPB 5EZ6B 1T9DA 3G1UA 3C4QA 1OGYA 1T1GA 4Q01A 5DEIA 1P0IA 4GLFA 3SKYA 3ZGVA 4B3SB 4JYAB 1CFZA 3CTMA 4Z4GA 2QY6A 2GN6A 5F3WB 2JLQA 3HB5X 5D01A 4PGAA 1UL1X 1E9EA 4MIKA 4MQ4A 2C2MA 1TZBA 5BN5B 2C04A 1K9VF 4A91A 1UJMA 4C14A 1U0JA 2BR3A 2JCGA 4U02A 3WFIA 4EW2A 1Z45A 2MINA 4WASA 1T5LA 3JYPA 1RXSA 3K0FB 4B46A 3VDMA 4NQZA 2RHBA 5DN6A 3Q7IA 3R6LA 1UC4B 5IVHA 1BOFA 1RYEA 1IHYA 3PVSA 3HJCA 2YQ4A 4YJGB 1KE1A 2R6JA 3DZGA 2YIDA 5HCUA 2JJ2D 2Q3CA 3F96A 1RCUA 1NI5A 3DFMA 4BQIA 2W6QA 1TGVA 2FEOA 2VZLA 1R4ZA 3M1AA 1JWBB 4IJ5A 4MOWA 1UDRA 3WY9A 1ZU5A 1WB4A 1IVYA 5E9AA 1IUNA 1IXRC 1N3IA 2JLRA 3KZNA 1LLQA 1DFIA 2FPSA 1K4KA 4PVDA 4ZXPA 1H9AA 4HH0A 3GCGA 1V7QA 3TW0A 4RHFA 3ZI4A 5MN4A 2JLYA 1QHHA 2EJWA 2Q0XA 4JLWA 1WXWA 5H81A 4Q4LA 3DDHA 4TQ9A 1XQ1A 3JYOA 5JHHB 3SF0A 2FUG1 1Z8FA 2NYVA 3RIHA 3TQOA 3UC9A 1JPJA 1EM8B 5M3BA 4D3YA 4FLEA 2NUTB 4MVXA 3VSBA 2QD1A 4Q7QA 5BURA 3DH0A 1QM5A 4TYNA 4F86A 3R1IA 3UT5B 4CM5A 4WNYA 5G1NA 3IV9A 2OOKA 4BAGA 4HAZA 3Q7TA 5EP1A 5ENZA 2FVXA 2GN0A 3MTGA 5GJVC 4KN9S 1Z26A 1VIAA 1JG6A 4WJLA 4P7BA 1UKAA 3ZWWA 1J33A 1YDEA 3DB2A 2X40A 3BM5A 2FQYA 4FEEA 2JLWA 5EIEA 1EVYA 3AERA 3IDOA 1YQQA 5LJIA 1EVJA 4IHKA 4M7OA 5BSKA 1VXOA 4M0MA 1UMCB 4TKVA 4NXNB 4EGSA 2VAVA 3CC8A 4DW8A 4I2VA 2PUFA 2HQOA 5CGZA 3TXYA 3LHDA 3L4KA 2CNDA 3FHCB 3RYIA 1B16A 2BR4A 2K7ZA 2QNIA 4N6OA 4I4NA 5FIUA 5K4AA 1Z35A 1U0LA 1Z6QA 2CFTA 2OHXA 2Y77A 4LF8B 4Q34A 4KREA 1UDAA 4HLCA 2FR8C 3KZKA 2CL7X 4DDHA 3BULA 3L8ZA 2EW8A 1Z8HA 3I04M 4ZJZA 5FUQA 4YRPA 4AZ0A 1NLUA 3I2KA 2YIMA 1X15A 4HP8A 1NN5A 4JXJA 4W4TA 4MW5A 1XTBA 3AYZB 1JECA 3KLOA 3LS2A 4BIMA 3C41J 4LZPA 3UG7A 3VDNB 1KY5A 4ZYXA 1WTCA 2GZSA 2HRBA 1ZUIA 3AEXA 1RAAA 3A1EA 2FLVA 4DIDA 3DBHA 4DKXA 3EVEA 4DCGA 1EBFA 4I55B 5A9SB 1B1CA 3HZOA 4WECA 2I4IA 5C8DA 5IBCA 1RAIA 4Y7DA 5A5GA 1KZ7B 3QOFA 4TSFA 1UUFA 2OZLB 1EHYA 5GJCA 4E4YA 4E33A 1O95A 4LI0A 3WK4A 3HL0A 4PLYA 5GONB 1ITZA 1EBUA 1RYZA 4J0DA 3C6KA 2R68A 4GYKA 3LVFO 1K5DA 4RE6A 4NABA 1ECBA 4WDRA 4O4HA 3AR2A 3KO8A 1MF7A 5MGNA 1UIRA 2HMYB 4G1CA 3T8YA 1VMAA 1X1CA 3KD3A 1K88A 3NTUA 4IV8A 4CNBA 4L5IA 4F56A 8MHTA 2D3TA 2AFIE 4J43A 3MT8A 4BMOB 4WXYB 1LBEA 2VAXA 3A70A 5JFGA 4D7AA 1QKIA 1VHJA 1LRLA 5JAMA 3MAAC 2CE2X 3OIGA 1P60A 3LWBA 1N75A 1AKTA 3TLGA 3K71B 4Q47A 3ZE0B 4GLLA 4W7IA 3LQKA 4Y7CA 1L4KA 3LDAA 4EG6A 4GWGA 3V8VA 4PZCA 4GUAA 3AVOA 3U7GA 3EGIA 1T0PA 2QF7A 3Q0IA 3QKRA 2PJZA 2YWCA 2W2MA 1Y8RA 4DV6B 1V9SA 2DBRA 2Y71A 2ZROA 3F5QA 1Z88A 4EX6A 1ADFA 3P0RA 4H1TA 3R3UA 3HI4A 3TQRA 5LD2B 2FWRA 1N0HA 1PZHA 4LHWA 3FZGA 1BH2A 1CQJB 1NW9B 3PFBA 2RI1A 4K9MA 4B3JA 4HNAA 2WWHA 3FSRA 2XB6A 3BCRA 3E61A 3FVTA 1RPAA 4RYLA 3ZVNA 4OMFG 1DBRA 1RJDA 1P0FA 2OCDA 3OOHA 1BROA 1C29B 1X7WB 4G0QA 4LK3A 3TZHA 4CL8A 1E58A 1M72A 1EE2A 1AQLA 1PJLA 3ONVA 4CKCA 1GL3A 1WUHS 4FINA 5A04A 4ZJUA 5JBIA 5HNKA 2V3CC 2CLKB 2P6NA 2BP7B 1COWD 3E3LA 3L1UA 2NVUB 3DZDA 1MLDA 3NUQA 2XZOA 2NXCA 1RWOA 3VDXA 5IT5A 4LXXA 1CV2A 4MCAA 2TECE 4G26A 1UMBB 3S68A 2YQZA 1HNNA 4RJ2A 1CT9A 1EK5A 1MB0A 2CHFA 2SKCA 5EJ7A 2PWPA 5G4KB 1G7TA 4HEA6 3NHKA 2QTVA 1NU8A 4EGFA 1KDRA 2JVKA 3MGAA 3QV2A 1MVLA 4GZMA 4OUKX 4W1SA 4WLUA 3SFZA 1Q12A 3L7MA 5IUJC 3MJ4A 3BEOA 4UTXA 2O8CB 5TRTA 3PC7A 3O1JC 3PE3A 2CCJA 3DYVA 3JR7A 5ALFA 3RVNA 3FFBA 2A5LA 3D6UA 3V7YA 3T7IA 2PX8A 1DTSA 1XPUA 4ZA2A 4TKUA 3EWIA 2F64A 3K1TA 3HBAA 5BWMA 2V7PA 3TLXA 3ELWA 4OBXA 4A10A 2C83A 1P3JA 3QZUA 1FMCA 1TKCA 4R9SA 4RF2A 4U2DA 2XGJA 4R8LA 1TVCA 3O2QB 4D8UA 3IUBA 4X62B 1H93A 4RA6A 4BASA 2VUUA 3S7ZA 1Z0JA 1Z7BA 4Y6RA 1YNOA 1CTQA 3A4MA 1UQUA 4INAA 3CS3A 4RNCA 5EWMA 2ZR9A 3BGDA 2VNIA 2QU8A 3B6ZA 4MUNA 1H1LA 1Y1QA 1ZMBA 2Z08A 4I5DA 3MTJA 3Q3HA 4F9EA 2NAFA 1MX9A 2ST1A 3DONA 4H6PA 2WVGA 4CW7A 1ECCA 1PL8A 1YB4A 4Y98A 4DZZA 5HCIA 4IIJA 3IV6A 5BSTA 1XZBA 1KIMA 3V46A 1KI6B 4TSKA 5ITZA 4O0MA 3TOZA 4GPD1 4HYQA 3IQHX 1KOLA 5B30A 2ERYA 3TSZA 2QD3A 2BMVA 3ZIDA 2C2WA 4PPNA 4KVGA 1ZL2A 2WFLA 2P9ZA 3EC1A 4G5SA 4PPFA 5CA0B 2K4MA 4QQKA 5DH9A 1OE0A 4MTCA 4OQPA 2WDZA 3EIFA 5TSDA 3RE1A 1X86B 3AX6A 2UVPB 3CLUD 2F2TA 4LWOA 3Q9LA 1GPDG 2HU5A 4B43A 3NEPX 1ZI8A 2DCMA 3IVXA 2NT4A 3D3WB 1JF8A 1I5OA 1ZNQO 4R1MA 4XRRA 4ASUD 1XTKA 1GFZA 3WSVA 2VXCA 1LNZA 1JHUA 4KQFA 3F3KA 1K6EA 2V54A 3SIRA 3B89A 4RL4A 1GRQA 4CU5A 1EGVB 3MBIA 1RS0A 2AXQA 1U2DC 2IEBA 1QIIA 1R9JA 3LDGA 1G20E 4PXSA 3RLIA 2NLOA 4BMCA 1ZGBA 3KPUA 3NCHA 1I1QB 1KHHA 1R16A 3HS3A 4I4TA 4X1KA 5CMLA 3KJGA 5FHQA 3OM9A 3RPEA 3UK0A 3ZY2A 4CLOA 2BEVA 2AYZA 1XA4A 3DVSX 1ADCA 1P4HA 3JQBA 1FTYA 2ACVA 4HXGA 1IY2A 3ITDA 4PIMA 1OFIA 2VT7A 3E9DA 1T36B 3ED1A 3JS5A 2AG8A 2CJPA 1H2XA 2B92A 5T41A 2WM8A 2XT9A 2QZZA 4QDJA 4HNVA 2VQ6A 1NVVQ 4GKBA 4DBLC 1DWPA 1V47A 2WD9A 4LTMA 3H04A 3K1ZA 5G4LA 3WNDA 3QK7A 4OQZA 4I9NA 4EG5A 2R8OA 4G0OA 2UUPA 2DFVA 1HLDA 4MVJH 4NU0A 2NO9A 2YXDA 4ZEWA 3R5HA 1U2ZA 3RU7A 4F4JA 5EEGA 5EKUA 2OFPA 5TQ0A 1OOEA 3KQWA 1TJ4A 1GKIA 2A94A 3HVHA 1EJ0A 1U99A 3UVEA 3AW8A 3NVMB 1F2TB 2JGMA 3FZQA 1WNTA 2VDPB 3U81A 5A0FA 5PGMA 5AOAA 1GV0A 1J1ZA 5KCMA 4XXHA 2QVBA 3GZNB 3PRHA 2BSQA 4PHFA 5P21A 4FIZA 1ZDMA 3T9EA 1ADGA 3EDMA 3IAHA 1EQ2A 4TXNA 2H9AA 1OWPA 4RH1A 4ENWA 4A03A 1JHMA 1YACA 3EVCA 5CB6A 1E2UA 1V39A 1L7XA 2XUFA 1T0BA 4G86A 2WHQA 3N0XA 2HRRA 4UUBA 5T6MA 2QX8A 3P97A 5K3AA 1ZW6A 2JK1A 3GFTA 3GGJA 4O8CA 1JR3A 1OB5A 3A0RB 1Z7EA 1KI9A 2GBGA 1RWPA 3N6VA 4QEZA 3VR4D 4ZC8A 1ISIA 5EMMA 1F5NA 1UPXA 2I7DA 3PD7A 5DBFA 1L7MA 3OF3A 3RT1A 3T1VA 3ZY4A 1KZ6A 3DVAB 2VPXA 2X6QA 1XMIA 1EJ2A 3RJTA 5TS2A 3FPFA 2WE8A 1VHLA 3L6UA 3ZV3A 1KSHA 3O75A 3R0IA 4BVAA 3VZCA 3PWTA 1QZUA 3ONFA 5TDHA 3EIQA 3U49A 1JU3A 1CJUC 1JFVA 1HETA 1L5QA 1NUQA 1PDOA 2HDNB 2ZETA 3DEJA 4RORA 4UBOA 4E94A 5LFAA 1I8TA 1JW9B 1OZAA 5LZ8A 1D09A 1Y42X 1JHOA 1Z0ZA 2LKCA 3ENWA 3WDLA 2YS6A 3RVJA 1QIGA 4D0SA 4C1BA 3VZBA 1EGMB 4DAEA 2BFEA 2O14A 1WG8A 1GPNA 3HJGA 3U4DA 2FP4B 5BP7A 4AYWA 1TQ8A 2CLMB 2C58A 4QUGA 1L7PA 2A92A 4HWRA 4F7WA 4BPRA 5EIWA 2WSIA 3KEMA 1RI2A 4RY9A 5JE8A 4EZEA 2GEFA 4HEA1 4Z3OA 1ISGA 2RIRA 1JJ7A 2A1UB 3FMOB 5JAQA 2QTRA 1S7CA 2ZRGA 3BWXA 3SXJA 4CF3A 1CR1A 3HA7A 4I46A 2DFKB 1D4FA 1W8DA 3KQHA 2BIFA 1OFGA 1SURA 5K3DA 1GVNB 1W1IA 3CPHA 3M34A 3UV6A 2B8TA 3KUXA 4FNMA 4AUEA 4DV0B 1XZFA 4JJ4A 2C5LA 4UHKA 5DSTA 4E30A 4EKEA 3LOQA 4CEJA 4FT2A 1DGQA 1VJ0A 3EGEA 1BHO1 1MH9A 3AOGA 1PZGA 3KXPA 3PQFA 3UT6A 2ZB8A 3KQLA 4YRJA 1OH7A 4DRZA 5AW5A 3WIEA 1JHPA 1A2QA 2XMPA 3SQWA 3MCUA 3NYRA 4X8LA 2MSEB 1PS0A 4JKOA 4MQUA 1CZLA 2GN8A 2HLHA 5U1PA 4Q00A 1JH9A 1XJ0A 3G3EA 4RQAA 4QG3A 5FH9A 5AM0A 1P7YA 1L5RA 2H7CA 3RQIA 5K0GA 4KLRA 3EZ6A 4P7KA 3O8CA 3A1WA 1NL3A 3PD1A 3VKGA 4QDZA 1JPUA 3KXDA 4XWGA 4X71A 1GQYA 1YC5A 3FR8A 4RLQA 3ANMA 4HX2A 4IH4A 5EMHA 5J2UB 2Q0HA 2PKYX 2J9FA 3RIGA 4L9AA 4ND8B 3TM4A 2WM9B 1Z63A 4I3FA 4EFLA 2VQSA 1G38A 5AM4A 4M1TA 1XFAA 3ITEA 2CD9A 4LWQA 3HCWA 3ZHSA 1KHTA 1JYSA 4OL9A 4B6SA 2OCPA 4KV7A 1URPA 5HKBA 5GOTA 1FDOA 1GWNA 2BM0A 5BR4A 2WZDA 4L0DA 1PS8A 4UJ5A 1O97D 2PBLA 3HMKA 1QXSA 4GXNA 4RFVA 1P1HA 4KO4S 4WI1A 2ENWA 2IU4A 1LWOA 2XUZA 1CYDA 2H1FA 4ZT6A 4IXDA 1KBZA 4F2WA 3GFPA 4WEQA 4DPKA 3SSMA 1GZHB 1IXKA 2ZIAA 3A2NA 1PJTA 3AUSA 5EJAA 4DUZB 1OQAA 3P9ZA 4JENA 4ISCA 4KW7A 1EJ6A 4OXRA 3UXEA 3VHQA 2R47A 3EK2A 2EFCB 2JLCA 3AFHA 2PZ8A 3WDMA 3DZCA 4DEVA 3K5HA 5KIAA 3WGKA 1OHHA 4Z9BA 2FEXA 2M6KA 3DOIA 2YV3A 5DTQA 2HWUA 2G1PA 2V3VA 3PNYA 1OA0A 1DB3A 5D1HA 3GWGA 1YR6A 2GA9A 3QWIA 1NQTA 4B2LA 4DNQA 3VOTA 2GCPA 3LA8A 1R74A 2OTCA 3ZKAA 1GT6A 2J9XB 3M49A 2IZ7A 1KU6A 2ZUVA 4TS4A 4A16A 1DBIA 1KEPA 1PGOA 2XUDA 5FNVB 5DTEA 3NORA 3CLVA 4OQDA 2P0YA 3N5CA 3JRXA 2O9JA 3FCAA 3W4JA 2NPFA 4GBED 1UFQA 3O9ZA 4OHZA 2EWVA 3MJSA 1PL0A 4R0NA 3WZ2A 1NVFA 1PT7A 1BJTA 2HU8A 2ECFA 2IUTA 3AOEA 3GUVA 3PWSA 4EUEA 3FI9A 3GA5A 1AUPA 4K0KB 4DB4A 3JQAD 1KR5A 3RRXA 5C46F 1GP2A 1QVRA 2CNLA 4IQGA 5ES4B 3KFVA 3RRBA 4H3KB 1U2SA 4L16A 2WJYA 4R54A 3DE7X 3KQTA 1MN6A 4X45A 1SVUA 3VU0A 3K6RA 3DF7A 4WN9B 4TVOA 5FO1A 3AI7A 4XCVA 1Z38A 4GWKA 1NQVA 5GVSA 2BFDA 2P11A 4TKLA 1XDBA 3KPYA 4FGLA 2VWQA 1AXEA 5A4KA 3G8DA 5L6MB 4FMDF 1NVTA 3FPCA 1G5HA 1LBQA 3AJ8A 3MWYW 2JJ2A 2N9UA 4QXQA 1N3BA 3PNOA 4XGQA 3I5MA 2CEAA 4BNNA 4PXYA 4JJFA 2X19A 3BE8A 4G41A 3WWOA 3UUWA 2L42A 2DHEA 5J4VA 4URFA 2PVPA 3I9V6 4LDNA 4IF4A 4ONEA 3IILA 4WOPA 3UQZA 5ITVA 4L0MA 5BW8A 4OI4A 5TPZD 4Q3DA 1JFRA 1G3RA 3PNMA 1K8YB 2D54A 3A11A 3NC0C 1CUYA 4J7CA 3MC1A 3NRBA 2B3DA 1KORA 2YN0A 2LR0A 3AU9A 1YMUA 3S2ZA 3VR3D 4HD8A 1P80A 2VIIA 4L8VA 4CKWA 2FGKA 3V32A 2DHCA 1EXVA 2H1OA 2I3GA 1YI0A 4B6FA 4ZVTA 2P77A 3UPDA 2P4EA 1E4YA 1ZUHA 4TGLA 3TL3A 3TQSA 1P61B 4AVYA 5JBQA 4UZEA 2H2HA 2AL7A 3B5EA 1JX6A 5C7LO 4RK5A 3DVQX 1XDZA 2J7PD 3PT5A 2I71A 4IJQA 4KCGA 2IVFA 4ZI5A 3PQ2A 4CMAA 3KL4A 1XF9A 5DP1A 3EEOA 2LNDA 4DLYA 4KE8A 4MV5A 1TUEA 3ZY6A 2I9PA 3TCNA 2FI1A 2Y6UA 3EW9A 1UT5A 2Q7OE 5BRJA 1O1YA 1VKRA 3SS9X 1O6FA 1U9YA 2RD2A 1X13A 4N7JA 4FQ7A 5EKDA 2I03A 3C6MA 1PLJA 1HLFA 1EEXB 3CA8A 1NNEA 1NW5A 1X8JA 1YCHA 5K3FA 4C4PA 2O4UX 1NNLA 1GSAA 1L9XA 1QBKC 3SR3A 4EB3A 2QNRA 1MIOA 4P7JA 2R2AA 1NOIA 3NOXA 3TH5A 1YO6A 4BKRA 3GARA 1KZHA 1WHSA 3SZOA 2X3YA 1JDBC 2R66A 3M9WA 5AWFC 5HMMA 2CZGA 2XCIA 1IC6A 3NHSA 4NNPA 3ZIUA 2FK8A 3ZK9A 1Q20A 3I9FA