1B74A

Glutamate racemase from aquifex pyrophilus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
252
structure length
252
Chain Sequence
MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKSGAYQRKLEEGGADVFAKACPLFAPLAEEGLLEGEITRKVVEHYLKEFKGKIDTLILGCTHYPLLKKEIKKFLGDAEVVDSSEALSLSLHNFIKDDGSSSLELFFTDLSPNLQFLIKLILGRDYPVKLAEGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
publication title Structure and mechanism of glutamate racemase from Aquifex pyrophilus.
pubmed doi rcsb
total genus 75
structure length 252
sequence length 252
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b74A02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b74A01
3HFRA 1B73A 5HRAA 3UHPA 1IU9A 2OHGA 2JFYA 3OJCA 2OHVA 2EQ5A 2JFQA 3S7ZA 3OUTA 2JFWA 2VVTA 2JFNA 2DWUA 2ZSKA 3ISVA 3ISTA 5HRCA 2JFUA 5ELLA 3UHOA 2JFZA 1B74A 2DX7A 5EVCA 2DGDA 1ZUWA 1JFLA 2OHOA 3S81A 2W4IA 2JFVA 2GZMA 5HQTA 3UHFA 4B1FA 2JFOA 5HJ7A 5IJWA 5ELMA 2JFPA 2JFXA
chains in the Genus database with same CATH superfamily
2FMTA 4NPHA 2DF8A 1WHTA 1SC9A 3K9QO 2OHGA 4MPDA 3QYPA 4C7JA 2XRZA 4DDWA 3KTFA 1B7GO 5G53C 5KNDD 2PBZA 4L95C 3NBXX 2PRZA 2I66A 3K72B 5J2UB 2CNBA 5E9JA 3AP1A 1DIGA 3MWJA 1TVMA 1UK7A 4MVJE 3VPHA 2D06A 3HDQA 4MIKA 3ORYA 1N9KA 3TLJA 1L4FA 4BC1A 3FTFA 3NEPX 5LQSA 3INNA 4LY9A 1XROA 1C4OA 3M5PA 1EFTA 2O3RA 5C7IO 4KNWA 1R9JA 4MPRA 3HMKA 2OHOA 4BQOA 3TRJA 1U4OA 1XZLA 4LF9B 4QFDA 2RB4A 2C3MA 2DQSA 2EAUA 3L8HA 4RANA 5HMMA 4Z53A 2O59A 1EHCA 3SNHA 1ORTA 4YREA 4C3ZA 1BH2A 2GD2A 4J49A 3GW8A 4I50A 1IM2A 4PR0A 4DKXA 1Q7GA 2YWCA 3S2IA 2CNOA 3EVDA 4GVXA 2EKDA 2HPVA 3E9DA 4O02B 3UMGA 2X9NA 2WWIA 1FIUA 1AKRA 3P2KA 3K9BA 1C14A 3ADPA 4DA8A 1ESDA 1BRMA 3V2HA 2ZUSA 5FI5A 3VU0A 3CBGA 5JOQA 3N8GA 4RKEA 2VSOA 1U3TA 3TX2A 4L9RA 5FQOA 1FP4A 2C82A 2WJHA 3HJNA 1NM5C 3IMEA 2XE4A 3FUTA 4REQA 2HLNA 2AMVA 3C39A 1K3TA 1M2OB 2YWEA 4JLDA 1XZGA 4M0UA 1XDGA 3B6EA 4MWEA 5FL7A 3OECA 1TCCA 4N9QA 1LLCA 3CZPA 3TNLA 5BT8A 2MSKA 3O0TA 3FOBA 3ZHUA 3N53A 2YUIA 5CFNA 2V9ZA 1R4MA 2AFRA 4KAFA 5I4BA 2FUKA 3STTA 4PU0A 2G4CA 3WRVA 2Q3BA 5KJCA 2LPMA 4N18A 4D46A 1JSZA 1HE8B 3K53A 3CVYA 4NPCA 2VDMB 4YDHB 3IB3A 4EVIA 4PPYA 1FFXB 4GX1A 2JIQA 1KKLA 3H9EO 4IQ4A 3AU9A 2RIPA 2A0KA 2OYSA 4Z7QB 5IEBA 4WXEA 4A2WA 2HF9A 1PR9A 3LX8A 3KXIA 5FJIA 4PHGA 2QY6A 1N8KA 1X42A 2JIMA 4IVQA 4J0JA 4MINA 1NX6A 2VWHA 1X7WA 2H1HA 1Z45A 1CJMA 1R0BA 2ECQA 1QIKA 2H2GA 3DE7X 1QAQA 4XWAA 1NDHA 2XQVA 3UWDA 3ADOA 4HEQA 1Q0HA 1T6XA 5HR5A 3Q0EA 4JEUA 3HYCA 1ZSNA 3PNOA 4FIZA 5LA6F 2OTCA 1NW7A 2J59A 4Q24A 1IN6A 4CVNA 3K70B 1U0OC 2VO1A 2WKWA 3ICOA 3X1XA 4DCMA 2OORC 2OLEA 2CHGA 2YDXA 2GVDC 3A1TA 3ILYA 5HBRA 3VV2A 3QX9A 4CE6A 3T3DA 1JHPA 3ZHTA 1I1HA 2ZE5A 5EKDA 1CQZA 3IFSA 4M88A 4MZDA 3HKCB 3ZLBA 2ZPAA 3N6RA 2KLBA 2AR7A 4FDUA 4QPDA 4LKOA 2WFAA 1NUUA 4C78A 2XTMA 2AG6A 3D7MA 3DP9A 4OQYA 4TWZA 1NTRA 1DS6A 4MVJI 3U4MA 2HO4A 3R8XA 3ZE9A 2OT3B 1Q74A 2PRYA 3WK5A 2AMLA 3OLXA 1Z17A 2A1TS 4RV9A 5K3CA 4NYIR 5ALGA 1S01A 3G79A 3QLUA 5KI6A 2Q2VA 3TZEA 4B2YA 4K9RA 4XFDA 1NBIA 3WLHA 1Y63A 1JBKA 4B9AA 4FYHA 2X13A 4C2UA 3SX4A 3IR5A 3PD0A 4OHMA 1HTWA 2QYOA 3SF0A 1E4EB 2PKCA 2QMQA 4H77A 3WP1B 5C4MA 3EG9A 5IS2A 2V6BA 3NOXA 4JT2A 2OO3A 2G70A 3CNOA 4RHEA 2F64A 5CK5A 4AN1A 1JVNA 1YDMA 4BV9A 1CUYA 1JDBB 2Z8YA 4RVSA 4DWOA 1Y1QA 1RQGA 4KXQA 4DBLC 2QE6A 2BEUA 3H5OA 3E48A 1P0IA 1QHYA 2PO7A 2QTLA 3QKRA 4H18A 5FUQA 1AGXA 2JCBA 3M4JA 1V6CA 3FDZB 3JQCA 2HBZA 3ZTWA 1RJFA 3LP6A 4KR6A 1UPAA 3SF8B 4BMXA 4K03A 3VQTA 2EP8A 3CZ4A 4X61A 2KSQA 1U8ZA 3BGVA 2ISQA 3MRXA 4RTNA 3O92A 4K9PA 4DC0A 1NE2A 1O97D 1EP1B 2H2IA 1CUWA 4MUYA 1HYQA 2B8TA 2GBCA 4UQLA 5JD5A 2VWGA 2I6SA 3HCOA 4QODA 4ABYA 4OBWA 4Y1RB 3QUBA 5HQTA 2W2LD 2FN4A 4Y2TA 1I5EA 2XWPA 3DKIA 1R8XA 3C15C 3TDMA 4JITA 4KXLA 1RHKA 1LB1B 4OYLA 3X3HA 5IDYA 1L3BA 1TI7A 3O83A 5AKYA 1CY0A 1SD2A 2FVYA 2DPGA 1AJEA 3W8DA 2EU8A 3MQFA 3LWBA 1ORDA 1CYDA 3ZKWB 4M22A 2WSSA 1DKRA 1P7VA 1QO7A 2GD0A 3PX2A 3O03A 3TE7A 1LTQA 4MVJD 3OC6A 4ZVPA 2NTNA 3NHUA 2WIAA 3O8BA 3JRNA 5ECDA 1HFEL 5A05A 4CM7A 4O2AF 2AKYA 5KC9A 2M9MA 4UXJA 3UEOA 1GIAA 5CHEA 3L5OA 5ITWA 2C4VA 2R6FA 1EJ6A 1VKHA 2WZCA 4WRRA 3HUFA 1L0BA 2DFPA 6Q21A 1H2XA 3GT7A 1CXZA 1DKUA 5JFGA 3U6BA 4DLTA 4MB0A 4KFRA 3N8IA 4JC8A 3PNMA 3EGEA 3P0RA 3W2GA 1YS1X 4NBTA 1YBAA 3T7RA 2Z6UA 2WP0A 1SVIA 1NW4A 1RP7A 1XCGB 3CISA 1YCFA 3EZ7A 4CYMA 3FVTA 1KI2A 5AM2A 4YALA 2ZATA 3DBHA 5AM0A 1XSEA 2B61A 4LJ5A 4TKZA 3RSGA 3RYHB 1GDTA 2DHEA 1B23P 4JYMA 2IGBA 4L4XA 1KRXA 3PUYA 3UC5A 4A03A 4C7KA 1P6QA 4DPKA 4H15A 4PLWA 5EVCA 3GDOA 2X3YA 1DKLA 3ETLA 3PGMA 3R5TA 3DW1X 1TRKA 3H65A 3PKJA 4J3NA 4ZCIA 3O1IC 4LRUA 4BGUA 1QYXA 5KEIA 2CV0A 2WWWA 1QVWA 2IL1A 2LWIA 1C7FA 2ZVDA 3UGQA 1CQIA 2ZJZA 1V1JA 3PQ3A 1T8TA 4FYVA 4OA8A 4GKBA 4R8LA 5AI0A 1TYCA 4OYYA 2XB4A 1QH8B 2DUJA 2QX9A 4DR1B 4UM9D 2JZNA 4AJKA 1DFIA 1UDBA 4MUNA 3O84A 1JQJC 4FOOA 2XJ4A 4RZQA 1MMFB 2UVPA 2QZ4A 4HGRA 4M76B 4QHYA 2GCOA 3P9CA 5F51A 1B0AA 1F8XA 4JVOA 3UXYA 1CEEA 2H4YA 4KXWA 3TLEA 5KTRA 1TF2A 1NDQA 2QMZA 3QLTA 1CNMA 1JLSA 1FU7A 2I6XA 2G36A 1FMJA 5C8XA 5JYBA 2R7AA 1O0CA 2IS2A 4LTDA 2GEBA 1AHNA 1QLWA 1YDEA 3O5AA 5DGHA 3ANNA 3W5AA 5FL7D 5TX7A 3DZCA 2WPDA 4NBWA 2BKXA 3U7EB 2PX0A 4AJOA 3LPNA 1Z74A 1H8HA 1ZCJA 4H6VA 1Z6AA 1M9NA 1QZZA 2BFOA 1T25A 2G77B 2RH5A 1IXRC 4K3UA 3ANXA 4OG2A 5CRIA 1EEHA 2R1ZA 5ALMA 1W4BA 1VSUA 1U9ZA 2Q3LA 4I81A 1XO1A 4TLDA 3THOA 1YVPA 3D2LA 5DBFA 2FAXA 1A95A 2O8CA 3U0VA 4XM2A 1K27A 1VJ0A 3AUKA 3FPLA 3THWA 2R96A 2C5SA 2DFTA 4AX4A 3V33A 1M2VB 2BONA 4JJFA 4EUSA 1WDWB 1SZPA 4O4HA 3TDKA 1CUVA 4N0EA 5BSHA 1ZXLA 3Q6IA 4QZVA 3R7WB 3WLKX 4EKGA 1BHQ1 1H2HA 1H9AA 1K5PA 4F5ZA 5HX7A 2C7OA 2JGEA 4IY1A 3LRXA 3IULA 2I7CA 2Q7XA 4EF4A 1B73A 1IB0A 3R7LA 4DCPA 5BWNA 4FOSA 5IEJA 5ALTA 1AA6A 1QH0A 1JZQA 4BKMA 1KY5A 1H0KA 1ZC4A 2A8YA 5EHXA 3TRHA 3AUUA 4BRSA 4W6ZA 3OQIA 4YK7A 3S8MA 3DR3A 3EIQA 1GL9B 4ND8B 2LRHA 2GETA 3MIZA 3TW8B 1IBKB 2D5LA 3DKPA 4CTJA 4P2BA 2AVNA 4NZPA 4WNCA 2VDJA 3E7FA 4YX9A 3H4IA 3T99A 2R60A 1USKA 3U4DA 3WY9A 1WAMA 4QC2A 1VM6A 3EQ8A 4KE7A 4TSRA 3PX7A 4BFXA 4W9NC 1XVUA 4DSTA 1SKUA 1MAVA 1I32A 1QZUA 4XWOA 3EPJA 3FWNA 1XPRA 4DC9A 2F4NA 4YRMA 3D4PA 4V0OA 5EJ8A 2XUJA 1UJNA 1VYTA 3QIVA 5G0VA 3LRTA 2OESA 2MYPA 3H75A 1SC1A 4RMHA 1UM9B 1KMHA 2ZSFA 3NDPA 5EJFA 1OW3B 3UT6A 3TBKA 1J9EA 4P7GA 4MRVA 4ML3A 1P5HA 4ENSA 4YO7A 4F60A 2YHAA 5HZGA 4JUAA 1G20A 4DQXA 4H1VA 3AEUA 4Q12A 2BEWA 4GX0A 3NUGA 4G5SA 4MITA 4W63A 3S2EA 4FNOA 2V1XA 3DLTA 5CDGA 2DBRA 2QZPA 3DQZA 1X1RA 1NW3A 4RADA 2P0YA 4JQCA 3KKMA 2OC9A 1FLVA 1XGKA 4WDQA 5KAPA 3T35A 1JQBA 5HYVA 5CB4A 2W98A 3ANMA 4MR9B 1LNZA 1GVHA 1IHUA 2F17A 3DEZA 5CGZA 5DM60 1UBTS 1H2ZA 2NSLA 4YJ2A 1GGHA 5GGYA 4M60A 4O59O 4DG5A 3RAPR 4LMRA 4A8HA 1L5WA 1N6KA 1NVVQ 4N9WA 2XT6A 1D2GA 1B8NA 2Z2YA 2ZR9A 3KT3A 3OQPA 1OHHA 3O9ZA 3PRHA 5I8PA 1JJVA 2UZ1B 3D02A 3HDYA 3QV2A 2O06A 1GCGA 5K0NA 4BFTA 4GLOA 5JMWA 4PICA 5BVGB 4BMDA 2IZ5A 4C6SA 3ZE7A 3LL7A 1WUIS 2VDUE 4YB8A 4UXHA 4B4UA 1D09A 4ZMBA 3UKOA 3KQHA 2XNKA 1I2CA 4FYKA 2IE8A 3KVRA 3ID6C 3STUA 4ARZB 4LC0A 3W04A 5KYYB 5K9ZA 3TFOA 3WKDA 2ZETA 1BKSB 3PDUA 4URHA 4E2YA 2VIIA 2XY4A 2LCIA 5AJHA 4R1TA 2B8JA 5CB6A 3UK1A 3ZJVA 2OAQ1 2ZWIA 3ZE8A 4KRFA 4TTQA 1TEXA 2X4GA 5B2FA 1KVRA 2P30A 4D8VA 1NXVA 3JS5A 2VLIA 4XW2A 3JQGA 3GCXA 4XXHA 2J0SA 2QZJA 1W5TA 2WSSD 2GCEA 4CPDA 5JD3A 1Q1BA 4MO2A 4NV0A 4ZYLA 3PWKA 2PH7A 5E95A 2CEAA 2IHKA 2F59A 5D6OA 2LCFA 1BHO1 4IJ6A 4L7VA 2XADA 3N7UA 4NFYA 5FBVB 2LVBA 1JAIA 2YIDA 1FQKA 4XTRA 4ZAWA 5B37A 1V4NA 1EZZA 1H4VB 2YDYA 2QUAA 3MW8A 4ZKEA 3R7FA 3MHTA 2DT8A 3N9IA 3EW9A 3EXEB 3T5CA 1YF3A 4X1YB 2DR2A 2HA7A 2WYOA 4MWBA 5DMXA 4AY2A 3DTVA 1Z08A 2WLTA 3ELYA 1ZUD1 1KI1A 4ISBA 1F2TA 4EJMA 4YRJA 3ROKA 3MF4A 4LPSA 4Y1EA 4YMLA 2XNDA 2BFBB 1L6IA 3PE6A 2F3TA 1PG5A 3R7AA 4EX6A 2A33A 2BHNA 2HJGA 1NVUQ 4EATA 2IHBA 3N2GB 1YWGO 1ZW6A 3JQAA 5LB4A 1S9HA 2QUIA 2VJPA 3E6AA 3GZ4A 5YASA 4DDKA 5C8YF 3K1AB 2EFYA 4RZ3A 3IEPA 3W1WA 3ZDQA 2WNSA 1GITA 3R44A 2K7FA 2UUBB 1BJKA 4MYHA 1CVRA 1LSSA 2GXQA 2M98A 4H08A 4MVWA 1ENZA 1F4PA 1TAQA 3N74A 3RF7A 1F20A 2H1OA 4RAOA 4JOQA 5SYMA 2GSDA 1SQ0A 3B3AA 5A03A 1RRFA 1UINA 2Q0QA 4HLDA 5GY7A 2BJWA 3P9YA 4IPTA 4OXXA 3RV3A 3ZHBA 3D3WA 3AXSA 1PNTA 4BMOB 4ZRMA 1M6EX 4OP3A 1SFRA 4WN3A 4F96A 3KEGA 2YZKA 1VXOA 3TQCA 4YAUA 3HXKA 3V1KA 4EVSA 1MO4A 4BHTA 4KK4A 5JEDA 1JB9A 4N82A 3H05A 2H9IA 1WR8A 3VV3A 1P4RA 2HTFA 2Z8ZA 1E7SA 2XTJA 2RGGA 3BN3A 4NULA 3KEMA 5CP8A 2FUNB 2WUEA 4NC9A 5E4FA 3SDBA 5LYJB 3ERCA 3F5MA 3RSLA 3HE3A 2WPDD 3HP4A 3PXBA 1NR5A 1WRBA 2F2TA 2QTVB 3HC7A 3JQQA 3PHHA 4WUTA 3FPSA 3LK6A 4YJHB 3GFGA 1H8HD 5KHAA 5A3VA 3CUSA 2I3DA 1AS3A 2Z6VA 3SEZA 4BZPA 2GBIA 4CCWA 3Q8KA 1JJIA 1G8MA 1X39A 3OHPA 4G1CA 4DLSA 2CV1A 3I9LA 4P5DA 4C06A 3KPYA 3Q7PA 2FF7A 4II7A 2M6KA 4I3FA 2QNIA 3ZW8A 3VR4H 3E5HA 4MVYA 3VGPA 3MTDA 1ZH0A 1RBYA 3WK8A 3DDSA 2J3DA 2HEGA 2LNDA 2RI6A 1ZCAA 2VOEA 3AFNA 5CJ2A 4FM9A 3L18A 3RUDA 3V1UA 4EABA 1HDGO 1ZZGA 4UCXA 4L3VA 3IEIA 1QHFA 2JGLA 4XSGA 1YS4A 2OCKA 5LD2C 5HW0A 4OHWA 2LUOA 3WRYA 2OFWA 2WIDA 1GQ2A 3PC8C 1X80A 3EYWA 3U0BA 3DZGA 5AD1A 3TZ6A 5DNVA 4EG4A 5K3OA 4C7OA 4QG7A 4KQGA 3WSVA 4Q3CA 1S8OA 4MRMB 5KVCA 3PWTA 4O5AA 1KR2A 3U40A 4JI2B 2PZ8A 1HLPA 1QMPA 4G5OA 2QRPA 4B85A 1KI4A 3G5LA 4MP8A 1MJFA 4KSBA 5EHZA 4P86A 2FF5A 5K0LA 3HHPA 3W6OA 1USVA 4Q3BA 1J8FA 2FRDA 4IWXA 5LN1A 5FWXA 3HCFA 2REXB 2XGOA 4HJXA 1WBDA 3UHAA 4CM8B 1XWIA 5ALQA 5CEFA 3FVQA 1VPDA 3U6KA 2IEYA 1H69A 3TPCA 4D5EA 2I3BA 5FNVF 2GWHA 5HWSA 4AZWA 1EGMB 1NOJA 3QOWA 3RM3A 1AUQA 1RI1A 3DMHA 3K0KA 3MAJA 3W3AA 2HU8A 4YBRA 4A6EA 4MDYA 1QYRA 3NXKA 4C6RA 4KBFA 1JMYA 1L5NA 1RMQA 1RQNA 3TH5A 2QUBA 1E2MA 3O3MB 4YV2A 2AS0A 3LXUX 1UANA 1QFXA 5G02A 3X2EA 1CW2B 4L9WA 1LQUA 4MR7B 4RDCA 2IT1A 3E70C 3PHCA 3QMVA 4ZEXA 2D0DA 1H23A 5TMDA 4BFUA 3E0XA 4N76A 5CH8A 5TNXA 4F4FA 1N5JA 4HZIA 4KKXB 1LC0A 2XOKA 1EX6A 1T1RA 2GBFA 3EHEA 5GM2A 3ZQ4A 2QTZA 3OIVA 1ND6A 2VNJA 4HMQA 3KQQA 4RNCA 4RLQA 3LZ6A 4BNTA 4NMLA 3EC7A 3JALB 4PX5A 4IFEA 2UVDA 1KSGA 1SPXA 1R18A 3S2FA 3SIWA 4FOLA 5JS2A 4CEHA 3I9V1 3OJLA 2CVOA 2NUPB 4D99A 2YNMA 4DNPA 1M74A 4KITB 4NYJR 3P4UA 3LTNC 2M1XA 3J7TA 1M83A 1T1EA 4FYJA 4LXIA 3TG2A 3HGMA 3HACA 1GL6A 1KO1A 2ORIA 2QBYA 2PPVA 3DT6A 4ZQFA 3TPFA 1QCYA 1EFVB 3OT5A 4RK5A 5B6PA 1HYHA 5FTKA 3NCHA 1T0PA 1E9CA 2A9OA 4BPBA 2RGBA 4IDHA 1OHHD 5EP4A 1EB8A 1JH8A 1LQ2A 3EXFA 3EZLA 4U9HS 1A8UA 2YVAA 2ZYSA 2ZJAA 4CLOB 3ZDDA 3H83A 1ZA2A 1WW2A 1U3DA 3LVQE 2FPSA 3GLSA 4XWKA 4ZT4A 4IDFA 2VDKB 3SXUA 3VPFA 3HXQA 4J3FA 3ZCXA 4YCBA 3A6DA 4PFJA 5BV2P 2NYAA 4Y2RA 3GBVA 4R81A 2QVLA 4E2WA 1J49A 2PUAA 5CTAA 1XTKA 1L5VA 3S1AA 1EWVA 1L7RA 5G3YA 4G85A 5CD9A 3HO8A 4ZV9A 4YWJA 1BEZA 5J5VA 1J2EA 2PKQP 4U00A 4MULA 1KC1A 2R66A 4RKRA 1HNXB 3DPIA 4UTZA 4X65B 5J2TF 4EVQA 4JCCA 5JZBA 3B89A 4ZTUB 1THMA 4GECA 2X0RA 3FNFA 4D1YA 1PU2A 5GJWC 2O3UA 3DL2A 3VR3A 1L5OA 3NGXA 4CMIB 3EARA 3PTZA 4ENRA 1HFWA 4ZXFA 5L3QA 5BXYA 3GO4A 3RB8A 5HHTA 4AJHA 4D81A 1Z39A 4B80A 5C2JB 2P9YA 4KTTE 4ZAGA 3GEGA 1U0SY 4JBGA 2XB9A 4UTVA 1JGTA 4MGHA 3L6CA 2RKWA 3M6XA 4U7TB 4XPZA 3Q9SA 2GM4A 4HH0A 5BXQC 4GGMX 3RBZA 3ZU2A 1XL0A 3DTVD 3L6EA 3GNLA 4JC4A 3PG5A 5CNJA 4X71A 1ZH6A 2YYYA 3EPPA 3ODPA 4W5JA 3T5GA 4LJ9A 4Q3LA 1ES9A 2XNDD 4OLBA 1W5BA 4UUBA 1JALA 1NLZA 2X2EA 1SQSA 1REQB 2QROA 3KQTA 3LDFA 2HJVA 4OJTA 1UOEA 4DCGA 3UA3A 4CKZA 4R2WA 1ORVA 3K16A 1TZJA 3WL5A 3JQAD 1GGVA 4E7OA 5B36A 2HCRA 2NUTA 4ZVUA 1R74A 4FJ0A 1GR1A 3HA3A 4N39A 4C3UA 1ZICA 4OF4A 2Z5GA 3IBFA 2V5AA 4L16A 1VYHA 3JR7A 2YY5A 4XX0A 1LH0A 4UZEA 2Z08A 1J70A 2IEAA 3A0RB 3U16A 4GL4A 3IIIA 1KOFA 2JH8A 3G1WA 3BPSA 4NY1A 2YN0A 4DARA 3W5JA 4CMGA 4JT4A 2QZ9A 1CDOA 3OBIA 1OB2A 2R7KA 2QUKA 2B5OA 3H87A 1AGPA 2PKYX 2ZXEA 1KQGA 3HBLA 1HSZA 4BNJA 2C5BA 1RKXA 1X7HA 2VAPA 2WG2A 3HL0A 3MYRA 4MIYA 4RIHA 1V11B 2E4AA 3UB4A 4JKOA 3MK31 4OAPA 1Y8QA 3E4DA 4D80A 5LA6B 1NUSA 3G2PA 1ZMTA 5EIOA 4AUKA 2YQ4A 2VDWA 2DWQA 2RAUA 5TMEA 3AFHA 2AXNA 3QPWA 3VAYA 4TMYA 5H9WA 1PV4A 3AVOA 1E3MA 4FJ2A 3QNMA 4DW8A 4F1JA 2XX3A 1E9RA 1E9AA 1ZRHA 1DRWA 1AGRA 3IELA 2E4UA 1ZOSA 4S2UA 3PPYA 3MN1A 1VIMA 1LDMA 1BE1A 1F60A 3EVCA 3ZIDA 5M2QA 3B1JA 3V4FA 1H2BA 5AI4A 4EY7A 1E6EA 4GW3A 1S89A 5ESRA 1YZLA 1YBVA 1LTKA 4KOEC 3WYDA 7YASA 4N54A 4MW5A 2FHSA 2XCUA 2WMNB 3D31A 4ITVA 1T1IA 4ZD6A 3ZJ5A 2FPRA 4N5HX 4G1UC 4H7IA 5FWDA 2EW1A 4L5BA 3GPBA 4JL5A 5A3JA 1T3SA 2EQBA 2VDPB 3PYXA 1OZGA 1XP5A 2H8KA 3D7RA 3P5SA 4HYEA 4LXQA 4RA6B 1OVGA 3ZI0A 2QM8A 3ZTYA 2J9ZB 2X0IA 2AF4C 1HZZC 1K6XA 2C9BA 3P9SA 4O5OA 4W8OA 3ZXSA 2WQ6A 2GDJA 1OH5A 3ODGA 4B3MB 3RARA 2NAFA 4GPD1 4HT3B 4IIJF 1C1DB 2I4OA 1Y6ZA 2VHUA 2VL7A 3VKGA 4MAFA 4OQMA 1MAHA 4NCKA 1A82A 2I7XA 2HI0A 1O6ZA 1FS6A 2K87A 4V39A 2Q49A 3A4IA 1ZOLA 1VPLA 2NO7A 2Y4NA 2YUTA 3DHNA 3BXHA 3INRA 1XIVA 3F98A 3I9NA 1MOPA 3CQ9A 4YUWA 1W7AA 2PX8A 2G88A 3LC7O 5CA1F 1AB5A 1LGYA 3UJ3X 1GPDG 3VNVA 1JR4A 4P32A 3BTVA 1KBOA 2ZTLA 1PJ8A 4H7DA 4QVKA 4X8HA 2DLCX 2HWWA 3FUVA 5AP9A 4MUIA 2ZJ6A 2WR8A 3THXB 1ESMA 1EFHA 4AYXA 3A1WA 3W3AD 5B3JC 1L5RA 4ZVNA 5KUTA 1FDWA 4TWRA 3TIGA 1T9KA 4BRWA 1Q5PA 1KXZA 1L3IA 1YONA 3VTKA 1DMRA 2O6LA 3M82A 2XIQA 4LPKA 5JZ9A 3TRKA 1VI6A 1SK9A 1FXUA 2QTBA 2RGEA 5BSFA 2QAGA 4KQ9A 4X1OA 3B9QA 3FOFC 4QJBA 5LJLA 5FA6A 3X1KA 3L0OA 1J5XA 2VA8A 2B35A 2XBUA 2XOKD 2QGNA 2XKAA 3CF0A 4MV3A 4BTEA 2RK3A 1RWMA 2QP3A 4UNQA 4G65A 3PUXA 3M7IA 1AXRA 3KWLA 1SC3A 1DO2A 4PPGA 4R9SA 4QVIA 5KJFA 4X92A 1KDTA 4POOA 1URPA 4LJ8A 5AVOA 3IOYA 3WLEA 1IUKA 3FH0A 3SVZA 5BMOA 2YNMD 2Z2KA 3HB4X 3OIDA 3GB9A 5FPSA 5I9TA 3OMXA 4NAHA 2CXNA 1A97A 3MGKA 3PUWA 1LUAA 3V2UA 1GUFA 1UXJA 1M2NA 2P6MA 2XYRA 2ZE7A 3KOWA 5K0FA 2B1QA 1LNQA 2W8BB 2J67A 3DXXA 1BCRA 4JLPA 4OGGA 3A06A 2X8AA 3R9IA 4UC0A 2GZSA 2LD4A 2DPHA 3BMQB 1SVOA 4R01A 3PSHA 5A3SA 2H17A 3WIOA 5FL3A 2FFQA 2VF4X 1ETHA 1XJCA 4AJ1A 4DIOA 4EFDA 3ZS9A 3CEJA 1LEHA 2W22A 5LU8A 4ESVA 1LSJA 1SOUA 1J25A 1PL6A 3VJMA 1YR3A 2RIRA 3GWGA 5C5CA 1FFAA 5SY9A 4TKUA 3G6KA 3ZU3A 4TL9A 2EZTA 3KD3A 1KAMA 2QMHA 4BB9A 5I7FA 1R4AA 1MRNA 2YWGA 3AFMA 4AFNA 3QU7A 2CYAA 2R4UA 3BULA 2DE0X 4JJAA 4ZC1A 2ZT6A 3WLNA 4DM4A 3NYIA 2B34A 4Q34A 2PV7A 3T41A 3VPSA 2A94A 5F1YA 1S0UA 5LZ8A 4BFYA 1CERA 1P39A 2XE6A 3LT4A 4W1RA 3QVMA 4YMUA 1FDSA 1NBHA 1XKLA 5CX1B 2ACVA 1L6RA 3UQZA 4DLVA 4AM8A 2FETA 4RDHA 2JFHA 3UK2A 1GILA 3A1UA 2AGVA 5KYXB 3AERB 1RXYA 1MV8A 3TPZA 3M4XA 4LJYA 2YWJA 3BD8A 5FUYA 1VPTA 1AURA 3PZRA 1NDUA 2YYAA 3JWIA 4PC1A 1L9KA 1P2SA 1VXRA 4ZTBA 3P9XA 4JUDX 5EN4A 1U2DA 2FXIA 2HADA 1YRLA 2PS3A 1DIRA 3GLRA 4XUCA 4EF5A 1A2QA 4HDSB 4BBAA 3ZZ1A 1B6TA 2YJ4A 1G3UA 1EK2A 3H2JA 4YHBA 5H5JA 5M3BA 2JLSA 2XRMA 1T9GR 1RFLA 3IS3A 3SC2A 5FLXA 3C3CA 4DZZA 3E5MA 1GUBA 5FA5A 2FZLA 2NO1A 4YBZA 3REOA 4GBED 4J4TA 2D0IA 3GFRA 4RKFA 4AZ3A 3NTQA 3MTEA 1KPIA 2DKOA 4OOEA 1HDRA 1UMCB 3R6WA 4H1HA 4LISA 1M2JA 4E2ZA 2PGOA 1KJYA 1E3DA 1G16A 1G8YA 3L8GA 1NV8A 3SE0A 3ENVA 1Z8FA 1CS4C 3FYTA 4LW8A 3TAXA 2FKNA 2H57A 4HRYA 3C3WA 4DDTA 4ZZIA 1QRUA 2JLVA 3WL6A 2GD6A 2W6ZA 2YVLA 3R0JA 4PAWA 2VDNB 1MX3A 1NXSA 2Y66A 3CG4A 5T41A 3CF2A 3IQDB 4Q7KA 3N2NA 4DAOA 2FSVC 4V0SA 4QPPA 3S3TA 4CDGA 1DAEA 3FMFA 4NDZA 5GOTA 5HF6A 2EQAA 3K6RA 4LKRA 5TY0A 6ADHA 1B41A 4CKEA 4URVR 4IHJB 3EK2A 2DXIA 3UAOA 4G0QA 1OXUA 2E89A 5H59A 3I04A 2L19A 1PWHA 3IV9A 4MUAA 3USZA 3HBNA 2VLBA 4UBKA 2X6RA 4X8OA 5AQ1A 5L51A 3A6LA 1USGA 4J75A 3WLMA 2VRCA 3TWOA 1Z0IA 1KJZA 1GCIA 2DYKA 3EQ7A 4RXTA 2XZDA 3KAJA 2VHZA 3GAZA 2YOGA 3KNZA 1QO0A 2O2EA 1VJRA 2P79A 4GG1A 4BP8A 4Z4GA 3WC4A 1YC2A 1S02A 3PC2A 4D9MA 5TRTA 3BMNB 2C59A 3G0OA 4NBVA 2J7KA 4O2BF 4I9NA 1U5BB 7MHTA 3GPCA 3Q7EA 2Q5HA 1CQJB 2EFGA 4F72A 2CMHA 3F67A 4YIKA 1GNSA 2BRUA 2O0HA 2W2MA 3FR8A 4UATA 4WKNA 1GHTA 1SXHA 4OP2A 5LIRA 4NJOA 3P2IA 5BP7A 2I7VA 4GWGA 4RTRA 1KOGA 1L7NA 1SRRA 3W6PA 3QX3A 1YE5A 3GX1A 1Q0UA 5D84A 4EBBA 3KKNA 2NO6A 3RJMA 4REMA 5JPCA 3EIXA 1I24A 4PAGA 2OC4A 4OSEA 1X8LA 2Y27A 1Z56C 1UWVA 1KH2A 2ZW9A 3F3SA 2VDLB 3H84A 3NEAA 3H9BA 5JNWA 2FQYA 4WXYB 3I0NA 1P4JA 3HJTA 3PA6A 2G1JA 1TM7E 2QN3A 1HE2A 2Q9AA 1VBKA 4QXAA 5L3ZA 2ILVA 1EJ2A 2VT3A 2X9VA 3AM4A 5IDWA 4TL6A 5HEKA 3UWOA 4JU8A 3AGQA 4HY3A 3OF3A 2JG3A 3KT6A 4QLOA 1QZXA 3HEAA 2Q0SA 5BN5A 4BY9E 3TOZA 2RI1A 3B85A 3DZIA 3T5TA 4RULA 1RRCA 1XZJA 5DWDA 4MQMA 5E6SA 3EWIA 1CBUA 3VXKA 4QREA 1Z4MA 3TXAA 3Q8LA 1I7QB 1T2EA 1UOQA 3E1GA 2PYIA 1RYZA 5ESXA 3WBJA 2WYHA 5BNIA 1VA5A 2G8NA 2BKAA 2QD3A 3LUBA 4TLBA 3WS7A 2WLSA 2FV8A 3TI9A 1ZJ4A 3GJRA 5K8VA 3NOVA 3EGDA 4LRQA 1D07A 1NN3A 2PRKA 1KDRA 1O5TA 3IT0A 3W79A 4DZRA 1X1DA 4C9BA 4TS3A 1E7MA 2P0AA 4JBHA 5I8WA 1N2BA 1XN1A 4R2KA 1R2QA 5EKTA 4A1FA 3TZKA 2ZWVA 4ZI2A 3JAWB 1KARA 4TQGA 4E1VA 4KQ2A 4Q39A 4RGVA 5CT4A 3A26A 3ND9A 4HQLA 1AMOA 4IHQA 2ETVA 3TVYA 1QGUA 4AYTA 4R98A 3OZDA 1TKAA 5L95A 5AM3A 3MD0A 2OWEA 4TTJA 1UCFA 1MQSA 1WD7A 1YIAA 3JX9A 4GS5A 4MRRA 5H3CA 4EQ6A 5BN1A 2EJVA 1XHFA 2Z4TA 4FNGA 3W9UA 2JH9A 2X0DA 1O58A 4J6EA 1LI4A 1IY2A 2GK7A 2XECA 4TXNA 5TR9A 3KJIA 4U7DA 3MMNA 4KDFA 1Y4ZA 1U0NA 1LK0A 1XEFA 2IKQA 3NEYA 4YJGB 4Z1MA 5SZIA 2Z4SA 1BYUA 2WE7A 3BTSA 3W4IA 2F6RA 1KAHA 1U0FA 2H4WA 3S99A 3UJ8A 4BO6A 3PJFA 4C0HA 1JG1A 1A96A 5DIFA 4MS3B 2VJDA 4QM6A 1GGFA 3IBCA 2AN5A 3DBLB 1E6LA 2VPZA 3AOEC 2D13A 4XWYA 1JNXX 4ZEOA 4NLLA 3PPIA 1BVUA 2I54A 3NBKA 5LFAA 3VR5A 1T0HB 4OHFA 4BNFA 2FB9A 3R8CA 4Y2JA 3ZXXA 2O8BA 1YO6A 2OZLB 2OCDA 4ASUA 5C8YB 1VKOA 3NC1C 4LQ4A 1UOPA 3B1ZA 4JS0A 1L7QA 3GLQA 3QVGA 2BI8A 4MKRA 4OHOA 4ED9A 1BXRA 3RVQA 1ADCA 2NWQA 3E7XA 4NBRA 3S2YA 3VYSB 1U5CA 1V8PA 3F8TA 1Y8RA 4NBKA 4DAEA 3SP1A 3T3NA 1PGPA 4U1RA 4Z86A 3G2JA 2IYRA 2I4IA 2ON6A 3OIGA 4W1PA 5CVCA 1RPZA 1RSZA 1UP6A 3KAQA 5T4HA 1T2FA 1WV0A 1YK1A 2JIRA 3AM1A 1RPAA 2Q8PA 1L1RA 2HA5A 3SIRA 1LDEA 2VUTA 1VJDA 3FPBA 5T8KA 5FI0B 1A5BB 3AEXA 3OJ0A 3H5AA 1F1BA 4NIMA 1TADA 3V7WA 1EVKA 2ODQA 1E2JA 1YVRA 3N2IA 4ZDJA 3U7GA 3BL5A 4DCVA 2UXBB 4HAZA 3SD7A 4RETA 3IT1A 5ALJA 4ENVA 3C14C 3U2QA 1OX6A 1TA4A 1BW9A 2WJ6A 2ZEJA 3HB7A 4PC6A 5KOHA 4OQDA 2IX3A 2V5UA 4RJTA 3O31A 4RFLA 2IV2X 2OKCA 3KX2A 1ISIA 4G67A 2O0KA 3ZHRA 4P53A 1A9OA 2Q5CA 1CR0A 1JRLA 3REQB 1U8TA 2WZDA 1TPYA 3LH5A 5ULLA 1EE2A 1AS0A 5LQAA 4LECA 2WTBA 2J87A 3ZDCA 2ZUUA 4HAYA 4ALIA 2QA5A 2C97A 1YFLA 3RI3A 4X90A 4BU1A 1YQGA 2GK6A 5FYDA 1XTIA 4QG3A 1FJ2A 1P7YA 1TW3A 4Q4HB 1E3LA 3A9RA 4R2LA 2IWHA 1RXEA 2HSJA 5JARA 4I6GA 5JPDA 1KYXA 4DWJA 1MJGM 1KOLA 2GESA 3WJ2A 2H11A 1LDNA 2GHIA 3JQ9C 5ALPA 1JU3A 3UJCA 3JYPA 2J6HA 2XRYA 3CVOA 1Q6ZA 1QGAA 3GH1A 3TEFA 5L53A 3LY7A 2XE7A 3EFHA 2NXWA 3IQIX 3DBRB 1K4KA 5GM1A 3W78A 1T9CA 1A4RA 3DB1A 4R1UA 3KG2A 4LF7B 3NVKI 3VOAA 1MB4A 2VRCD 3PFWO 5JRDS 2BMEA 3I6IA 2IZ6A 4XYGA 3BL6A 2EG9A 2HCJB 1FCJA 1II8B 1QO0D 4PS1A 1P1HA 2HQBA 1K9SA 3RUFA 2Y1OA 4L9AA 2Q4DA 3T0GA 4BB5A 4HEA6 1QQ7A 2GX6A 1V1MB 2WIBA 2GPJA 1PJZA 4TV9F 2A0YA 5FNVB 1VL8A 2WYUA 1HDIA 1SCUA 1BFDA 4KQ6A 1U7DA 2Q50A 3CM0A 3LUGA 1U3GA 4KUEA 4LDAA 1J99A 3HSYA 4R84A 1YQXA 1S2GA 4TSKA 2ONJA 2A14A 4FWIB 3TTYA 1SKAA 1TD9A 2FWJA 1U28C 1C41A 1T2UA 1Z4IA 1H6BA 2ZBFA 2HM7A 1YRQA 3UAZA 1SVMA 2ODPA 1GNVA 1JHZA 5D1HA 4R83A 1QGZA 1Y8ZA 1NVDA 2VPWA 5DO9A 5TT1A 2QUHA 1Y48E 4JWTA 1ZR4A 1WEHA 4ZAFA 3QSGA 5EOVA 2ZRGA 2F48A 3ZWXA 3ZCSA 2HSZA 3KOZA 2R4TA 4EHFA 5IFKA 2A84A 2CXQA 2FQ1A 3L1VA 2OZPA 3T1QA 1XJ5A 4G24A 3DTNA 4Z8YA 4E5KA 3JWEA 5EWMB 2WUFA 3P96A 4G0YA 2JKZA 3II6X 4KGXA 1Z26A 1RIFA 1AO0A 3I6QA 1AH2A 1W1UA 1K75A 2QQFA 5C35A 5DVZA 4AMUA 1GZ6A 1ZXXA 3Q3GE 4D7AA 5F3DA 1F3LA 7GPBA 5EJ4A 2WTXA 3ETNA 5ARBA 3GIWA 4HP8A 2HRBA 1IL0A 3C4VA 4MUHA 1RBMA 4TX1A 5BSTA 1A04A 1FYFA 2OG2A 1PL7A 2OSVA 3N86A 3OFSA 4GM1A 4M9XA 1I7PA 1E1RA 1GN8A 1X7YA 3RS2A 4OQXA 4U7HA 3UOAB 5B7QA 2W42A 1Z06A 3HP1A 1R3UA 3QZUA 4E46A 1H05A 2Z3ZA 2OFPA 2P40A 1S96A 3NPMA 4MZXA 3UMYA 2DBVO 1Q1GA 5LDGA 3FE2A 3CR3C 3KQNA 1PLJA 3IDZA 3JZFA 3KWJA 1DWUA 3LUJA 2PYZA 5AJVB 2BBTA 2PS9A 4MQFA 4JEMA 1LJ8A 3CLTC 4NNOA 2ZXFA 4HGZA 1KY4A 1PJAA 1ZO8A 4BB0A 3ZG6A 4ZYVA 2Z6QA 4PX3A 1Q0ZA 2WWHA 1PT6A 4YROA 2XYVA 2A88A 2YX1A 5HS6A 5UKDA 2A0FA 1RJGA 4G5RA 4ER3A 4XIIA 4P4SA 4ZVKA 2O3QA 4JP8A 3G0HA 1JI0A 3ELDA 4NV1A 3DOUA 4A8JB 1P31A 1VJCA 4RY8A 2O2HA 4ENUA 3OZVA 1FQJA 1QFMA 3D8SA 2WG1A 5CFQA 4BVAA 5KKCA 3UT0A 4FFOA 1G59A 3DEJA 1C7QA 3PCTA 2YICA 3AM5A 2GSWA 4R71A 4LRYA 4QE3A 1NNLA 2I6TA 5JXIA 3K4QA 1YZUA 2PXHA 2X22A 4GE0A 4WOPA 4M9RA 4YDQA 2IS1A 1XX6A 1UMBA 1YXMA 1RLUA 2HQRA 3E0QA 2YZNA 3TZBA 4E2FA 1Y8AA 3PUIA 2P27A 3VDRA 1S5PA 4MWSA 2NXJA 3HDHA 2PLNA 3JVVA 5EVJA 4Z1MD 2OZEA 1XT6A 1DHRA 1EFUA 3GA5A 1NWHA 4L8GA 4D4KA 2HSGA 1J2RA 1AK9A 4WBNA 1Y0BA 3B2QA 1EVYA 1PJCA 2ZITA 4TS1A 3ACBA 4MLPA 3KDPA 3UW3A 3JWHA 3OKCA 4Q5IA 3DFMA 3JYLA 5B30A 3Q8WA 3GFOA 5IM5A 3GLGE 1TW2A 4TTTS 1PTJA 2IIBA 3H2ZA 4Y2PA 3VR5D 4TZ0A 1YZQA 2JK0A 2BT4A 3EBPA 5LLSA 3T54A 3VKUA 1NMSA 4I2VA 1XZNA 1LLQA 1SU8A 3R5XA 1HMPA 3A04A 2LCQA 4ASUD 1PVDA 2Q5QA 5DI3B 1XTBA 4FWTA 3K7EA 2WF7A 1TQDA 4I3HA 4J94A 5JJIA 4CR8A 3ND8A 3T9CA 1AZTA 1DI0A 1S7GA 1YBHA 5AW8A 4KC0A 1AV6A 1NT2A 2IYAA 2NXCA 2RGYA 4N3AA 4UNRA 3KIPA 4LXUA 1XB2A 2DH5A 4O08A 4A16A 4YP7A 5LP6B 1GZHB 2YN4A 2Y1EA 4AUMA 2G8LA 3L7MA 4HVAA 2O2DA 1X0VA 2PA0A 3V6LA 1YBMA 3RSFA 5J47A 2HR1A 1NF2A 2VZ9A 1HLFA 3PPWA 4IRXA 3UJ6A 4JL6A 2XVZA 3CNEA 3MLEA 4IMJB 3B1FA 2WUDA 1LJUA 1TGVA 1WLYA 5F23A 3C74A 3J81k 1SCBA 1YQQA 3A6JA 2C31A 4MI1A 2QNRA 4A4DA 4JSTA 4JVLA 1ATIA 1AF7A 1JSRA 1WQ4A 2ANBA 4MVJF 1MQ9A 2GJSA 3ABSB 3O1HB 4M0MA 3AIOA 3JU3A 4Z0TA 2WW8A 3KCQA 1AKNA 3R9KA 5B1EA 2XSZA 2H1LA 4L2IB 2UDPA 4Q9HA 4D4IA 1O9GA 3B6JA 3UK6A 4IOKA 3MUNA 2FDCA 2FZVA 3WFIA 2AMFA 1X70A 4HWSA 4BMPB 1OE0A 2SNIE 4FFDA 3TR5A 2Z3VA 4OHCA 4FDVA 3VR6H 1XTVA 1RWPA 1YZVA 4GKKB 1HQYE 2FR8C 2XQIA 1A9RA 3SQMA 5LM3A 2P2ZA 2Q29A 3I53A 3R0QA 2XUGA 1V5IA 3FTDA 4O3FA 1E99A 1Q21A 4DE5A 4CG1A 1XZHA 1EI9A 1OQAA 2Q07A 4V03A 3OF2A 4MH0R 2PL1A 2HIMA 1NVMB 3CLHA 5FI3A 4LXHA 5A71A 1NUAA 2ENUA 4P31A 4QUIA 4DCSA 3TXYA 2VJMA 1Y5IA 4X00A 1RACA 4HPWA 1DAHA 3FZNA 3DFUA 2IHUA 3TFWA 1C0IA 3LC0A 3SQOA 5IZCC 1WOYA 3V9PA 2MSCB 2CHVA 2B21A 3QWFA 4IIJB 5AJWA 2QKYA 4HDMB 1YKGA 3KV1A 1BU8A 4AG6A 5PGMA 4LFBB 2ZUCA 3TCNA 1Y3HA 1S4MA 1YI0A 4ND2A 4KSCA 1V3TA 1T26A 4NOKA 1HYBA 3H5NA 1DKPA 4OJNA 2JD1A 2NTJA 3OOEA 3CB4A 1V7ZA 13PKA 4G37A 1EBUA 5T4EA 1OXVA 2R7MA 2VUHB 3BWBA 3RYCB 1FRFS 3EFBA 4B45A 5GQSA 3DVAA 3TBFA 1W4AA 4L50A 3C6KA 2JLQA 1XOIA 4KR7A 3FWKA 3Q9NA 2II6A 4LYFA 1VRCA 2YYZA 3IPXA 3LKZA 5F7JA 2W4QA 1QYIA 4I5FA 1F8GA 1ZD4A 4WTOA 2QL6A 1NLYA 5D3QA 3OG9A 3VSDA 1IUNA 2PL3A 2ZTSA 3LYAA 1RRVA 3UYKA 1OZFA 3R3YA 1BXZA 1F38A 5EHGA 5J2UA 2WFMA 3WISA 2MDTA 3LX4A 1MIOB 3VO8A 4LDNA 3K94A 1TKBA 4HC4A 1M2FA 2EYUA 3C8UA 3FX2A 3HB1A 1WU8A 1RI5A 1YRBA 2DY1A 2JFPA 3BE6A 2CLSA 3I37X 4B79A 1X92A 1LS1A 2WK1A 3F4LA 3ZGYA 4B35A 1UPFA 3AT1A 3PUHA 4FSXA 4IIVA 1NFRA 4E3ZA 4JKIA 3URKA 1QKJA 4RH0A 2IU3A 1BMDA 1UJMA 1BXKA 1IHDA 1T6ZA 4RF4A 5A6SB 4FCVA 3R7DA 3L79A 3RTEA 1ZEJA 3COSA 4MMZB 4HFMA 4I99A 1RE1A 1U7XA 1NI4A 2DR3A 3IYLW 4B6PA 3EQZA 2RHRA 5ENZA 4DWWA 4GPAA 1GSOA 2HJRA 5JBNA 4I5EA 3ITDA 2JASA 1SOVA 2UAGA 3K9GA 1IYZA 5JS8A 2F1KA 3N7AA 3K1TA 2EW2A 5T67A 4HH1A 3SZRA 4XD2A 1E1RD 1T1JA 1GG8A 2A9RA 2YMMA 5EGSA 5HOQA 5L4LA 4WGGA 3GRVA 5DGDA 2FGJA 2ZROA 1BMFA 1P4GA 2PCJA 3ETDA 3I52A 5DYIA 5BNTA 5AVTA 3AP2A 4TLLB 4B3XA 1JHDA 4TN1A 2FG7C 2P75A 3A4LA 3BH7A 2QNBA 1CRZA 1ZM9A 5G1NA 3ZGZA 4ESOA 3B1YA 2QPAA 1YR6A 3NKFA 3ES9A 2LDXA 2P2YA 3OUTA 3QVWA 4X20A 4AZ0B 4BBZA 5KJ6A 1PP4A 1AUXA 1PAUA 2HLPA 5B3LA 2ZUTA 1JR3E 2VYQA 3SC3A 5ICFA 3L6RA 4CQMA 1AUVA 1DARA 1Z4KA 2NT4A 2XNHA 4IIHA 3ZWPA 1FFXA 1WMEA 2QD2A 2V7BA 2VAMA 3H9CA 5AJTA 3WJAA 5LOVA 4DDVA 4CTKA 1EBFA 1SVWA 2BELA 1I4LD 1UBKS 1C4XA 3KOYA 5AHRA 2JGJA 5J1SB 3D0KA 1FF9A 1RRKA 1Z8NA 1ZH2A 1RI3A 4PYOA 2VJBA 3FCYA 4LE0A 1JS1X 3WYBA 1U2ZA 2EFJA 2EARA 2SCUB 2VCEA 3OA0A 5IAKA 4B2LA 2M6RA 1MZPA 2D0OB 2P9FA 4Z9XA 4ZZ3A 3BKXA 4TYYA 3IUPA 1G55A 2P3SA 1MQ8B 3KUUA 1KVQA 3MJRA 4M99A 1C30B 2QG6A 1AVTA 1D7OA 4KR3A 4CN8A 1DVRA 4F46A 1USIA 3T0FA 1GNPA 4NU0A 5EUQB 3WE7A 1DZ3A 3EY9A 2UU9B 5J59A 3UNXA 1ZBQA 3NG1A 3AILA 4QQKA 4C2TA 2B4KA 2I3GA 1N6RA 2E87A 2JHAA 3C3XA 3DCYA 3RUEA 3HKCA 5KTMA 3VYRB 2WUWE 2D54A 1VKRA 3AYZB 2ZR7A 5E7MA 2AOVA 1ISRA 1KDOA 4IIUA 3QLEA 3QPCA 1RKUA 3H11B 3MS2A 1DBIA 1JSXA 5THKA 3NC4A 1WUTA 1P9OA 1B26A 3DO6A 1U2QA 3N8KA 4S1TA 4WLUA 4UUPA 3OM1A 2P4UA 3UFXB 3MJDA 3TLBA 2F1OA 1S2DA 3QPVA 1UBHS 1YQWA 2KMLA 2R2GA 4CV0A 4FGSA 3U4AA 2BP7A 3FGZA 2PGAA 2ZFUA 3I83A 5BN3B 4Q7LA 4FMBB 1Z25A 4MVCA 4YRKA 4L3WA 4C2AA 3TAHA 3AF2A 3U48A 3ILVA 4JBWA 1E4EA 3ZV3A 3EA4A 2C9CA 1JTEA 5JT1A 1L7OA 1IZZA 3PC8A 3PFHA 1SWVA 1AXGA 3DE6X 3I2KA 2I7DA 1U9IA 5BV1A 1EK1A 2OPBA 1Z4JA 4PNPA 4CDRA 1COZA 2IOHA 3X1WA 4BVJA 3LWDA 3Q3IA 1KO8A 1S4QA 2X5NA 4GM4A 3U7QB 4EH1A 1EQ2A 2PLAA 4Q3DA 4EMSA 5IANA 5M04A 4ZDIA 1PJRA 2AUTA 4DUZB 3PJRA 1DIAA 4IINA 2WOOA 1LLFA 1II9A 3QEMA 1WD5A 4JP1A 1JIIA 2WJZB 2B78A 3AHDA 4M9CA 2H1RA 2H4XA 2YOFA 3SF8A 2XSZD 3JTMA 3M89A 2GN9A 5BRNA 3A6HA 4CIYA 1X7GA 5AH0A 1QB7A 2H5IA 3WDKA 2WJGA 1YUMA 2CD9A 2QXUA 4KAAA 1LBEA 4AKEA 2MT9A 4M2LA 3SGLA 3OP4A 4I4TA 1TM3E 2GXSA 3DUFB 1THTA 1KO7A 4Z7OB 3ADCA 3JQ8B 2NT3A 3LFHA 1DV1A 3TB6A 4YY3B 4PZYA 4Y1RA 2EFEB 1S8AA 1NVKA 1WM1A 4KMSA 4QWWA 4RPCA 5DF1A 1E3EA 2QWXA 4RXMA 1EQUA 4LK2A 4B74A 3QI2A 2VHTA 3UW1A 3V97A 4TT8A 2P3LA 5TXGA 1VKNA 5ITVA 3FJOA 5CH5A 4AU1A 3PE4A 1G3RA 4JU9A 5IUKC 2ZBVA 4MVXA 2YWFA 1ZD9A 3D6TB 3O8QB 3SSMA 4XKJA 5K3FB 3U81A 3E3AA 1T9ZA 4LXXA 2GVNA 4HJRA 4KK3A 4BECA 5JSYA 1RHUA 1EK6A 3FMOB 3P2OA 1T8UA 4HN2A 4HQKA 2PVCA 4F5DA 3E8MA 2QN1A 3OPMA 4R8KA 4EI7A 2G6TA 2PX4A 5FPHA 1HQKA 1V47A 1EUQA 3N0WA 3FNGA 5K8TA 3B7PA 3JATA 1J4AA 1FL9A 3R5HA 4WESB 2CF6A 5AI5A 5GV8A 4BJ5A 3CH5A 1CZOA 4JJKA 3LLSA 1E4YA 4P33A 1P91A 3NDIA 4HQ6A 4P35A 3LQ1A 421PA 2ZULA 4UW9A 2GFIA 3N05A 4WMLA 3I2JA 1P0MA 5C46F 2FWAA 4Q01A 3GUYA 4EY5A 1IRIA 1I3NA 1PD1A 1YR1A 4HAVA 2PYDA 1QG0A 1Y7LA 1ZD8A 4E1AA 4WPGA 4V1CI 4RH3A 5FOXA 5A04A 3AMVA 4AK9A 5TQ0B 4HGYA 1X2EA 1CF9A 5EUCA 1ZMBA 2IXFA 4MW9A 5BSMA 1RKVA 1N57A 1TL7C 2A9QA 1Y9DA 2NG1A 4GF5A 5I9BA 2NZWA 1LW6E 5A62A 3VU1A 1MB9A 3I4CA 2F67A 2WTEA 1ODLA 2ONZA 5ENVA 3QRWA 4QOGA 4UHKA 4K40A 3T9AA 5FH9A 3C1UA 2IHYA 4KWIA 4WKOA 3OQJA 3DL0A 4YP6A 1W0JA 1POXA 3SJAA 2OD2A 3BZBA 3SC4A 2J6CA 2PPLA 4O4HF 1T1GA 4U6NA 4IEIA 4ZAZA 4CT0A 3ZLTA 3HJFA 1CX9B 3FYUC 3K0CA 4PE5B 3V80A 3KKZA 4GP9A 1DC5A 3MD9A 5GAJA 3R7BA 4JL8A 4CL2A 4BX8A 2UYGA 3KQMA 1KYVA 1VQ1A 3CHYA 4Y6RA 1DKQA 1DG1G 3H6HA 5IBQA 2XXBA 1Y7IA 3NTOA 3DO5A 2GEFA 3L8MA 4HLNA 4C89A 3IKTA 4N5LA 1W87A 4DQUA 1O8BA 1PKEA 3NHJA 1UXOA 1BMFD 1SUEA 1YHNA 1T29A 1E79A 4KV7A 3EYAA 3LQKA 1MX1A 1FFSA 1M33A 1PWYE 5E9QA 3H16A 1X1SA 3UJPA 4D4MA 4G8JA 3G5MA 2WWTA 1KO4A 2JAQA 4M38A 4CNBA 3MERA 2XBMA 3P2JA 3KZCA 3IE1A 3CNBA 4O63O 1Y3DE 4ZZ0A 2CJPA 4JYPA 4ZO8A 8ATCA 1G5RA 4EYEA 1DRUA 1SOMA 3M0EA 4GE3A 3EPLA 5AXAA 3NTRA 5EXXA 1ORHA 2I9KA 2CYBA 3KLOA 4QDKA 3SHOA 3BRCA 3JW8A 3MRTA 4A0SA 4ODIA 4ALLA 3GDHA 4CQMD 3FUWA 2VRBA 4UUQA 1JIVA 1UADA 2VPQA 1ULUA 3F6CA 2OOKA 3FRJA 1QU2A 4HADA 4G9EA 3BXOA 6NULA 2GK3A 2EOAA 1DJNA 1M2VA 2FX2A 3I1JA 1RQPA 4PCVA 5CLGA 3C8HA 5J9FA 3STYA 4IG4A 3WZLA 4FKZA 4UPVA 2CSXA 2B5VA 2VPXA 1EVLA 3B5IA 4P5PA 1QV7A 1TUBB 4Q7MB 2NV6A 5J43A 5LL6P 1D1QA 2QHXA 5E0KB 2XUKA 1MO6A 1ZK2A 3ITEA 1WXEA 1EUZA 1DEKA 4F3RA 4L76A 3OWHA 3WXMA 1DXYA 1K2VN 2WJAA 1SXJC 2L17A 3E7PA 1ZU5A 3HJAA 3JQ6A 4KFTA 5JCJA 2NPOA 5KTOA 1T1SA 5LLDA 4H7EA 2C2KA 4PG8A 3K70D 3VAAA 2I99A 2JCGA 4AIRA 3L6BA 5LQNA 4YMTA 1EVEA 2QN2A 4ND8A 2Y3IA 2PR2A 4OHBA 3MJHA 2WM8A 4PS0A 3ZI7A 2LXNA 3FCUB 3RABA 2RGRA 5CB4F 2CBZA 3T7KA 5DTRA 1ISFA 3TIXB 4ZICA 1CJSA 3N75A 1NYLA 2EATA 4RWEA 1XAGA 3F9IA 4H3KB 4OB6A 4YJ2F 4ZTZB 3E9QA 4J0IA 3VKHA 1QF6A 2IZ7A 3X44A 5C1PA 4IOMA 2G67A 3VC7A 4PXYA 1XMXA 1GD1O 1W47A 4BKUA 2NSYA 3B6IA 1CP2A 1KTVA 2XDAA 3DMTC 5CVJA 4JR2A 3HFSA 1FRVA 3HV0A 1UM9A 3VBCA 2VTBB 4JX9A 3QWIA 2JLAA 1JKMA 3RG8A 1YIOA 2ST1A 4DCUA 2RGXA 1JAZA 2BEJA 3EULA 5DV9A 3AOGA 3K32A 1OAOC 3LQ2A 3WX0A 3MNFA 3E35A 1U63A 2OHFA 3EBOA 1NT4A 3G1UA 4PYRA 1J5EB 2WYWA 5CHYA 3LQQA 4FX5A 1DLIA 1N2IA 2V54A 4KZKA 2IY7A 5COQA 3ZZUA 2VKQA 4BE7B 4MR9A 4DJFC 4BQQA 4FFWA 3V7UA 3O2NA 1V37A 4W8GA 1E8DA 1LI5A 5FTWA 2EL9A 3TSZA 2HCTA 2OA0A 1IG0A 1E7YA 1L8AA 4QATA 1JYFA 1BQ4A 4NKRA 4AULA 1X9IA 3JY6A 2Y1DA 4NFLA 1ZIYA 4X41A 3ZWMA 3ZJYA 4TV9B 1BCSB 1C9NA 1Z5UA 1NRJB 2ZYHA 2UZ1A 3MPUA 4Z0NA 2WDPA 5KYWA 4F86A 1A7UA 1OGYA 2QYSA 5BVGA 5EPEA 2J4DA 5JTTA 1SD5A 3H5LA 4K9DA 2PUTA 1J0AA 2PMDA 3AJRA 5EWJB 5FV4A 3L1JA 3DCIA 4C0AC 3E58A 3WMRA 4AQYB 2FEWB 3NH9A 1LVGA 4MVJH 4WKCA 5NULA 1FSPA 1CUGA 3FFTA 4DIDA 4ARZA 1RYEA 2ZAIA 4YRTA 5FPTA 3JTEA 4UHEA 2O8DB 4EPRA 4YCCA 2GAFA 4F6CA 2NAPA 2VP9A 5EP2A 4CV1A 5JNSA 4XB1A 1EE9A 3WLIA 4B3FX 4RGQA 2GJ8A 1RW4A 5K8UA 2VTDA 4OX9B 1WU7A 1D2EA 3T1NA 1DFGA 1E0SA 1LBIA 3RASA 1FVOA 3GOHA 3MILA 3F7MA 3RFTA 5A5VA 2W2XA 4RU1A 5C52B 1SXIA 4LZZA 3CW2A 4GWLA 1BD3A 2FSUA 2X8WA 3STVA 3HP7A 2XUDA 2EV9A 1DJLA 2X5JO 4N01A 1NATA 4WGFA 5HQJA 4C0KA 4B3IA 3B12A 4R8VA 3HZZA 1C8LA 4JZYA 5E8JA 4R1LA 1BWSA 4B7ZA 3QFFA 3ZU4A 4HQ0A 1FUEA 3G3EA 1E3QA 1UDWA 3WL3A 2G9VA 3EXEA 4X1YA 1DAPA 5C1BA 4CEIB 1N92A 1J23A 1Z33A 3FSGA 3V7YA 3BG5A 3T06B 5JSZB 1EP9A 1KK2A 3EGCA 3FAKA 3HB5X 3I23A 4G1EB 4KLCA 1KE2A 3S28A 4EA6A 2W4MA 4EZIA 4M6WB 2VQSA 4Z9FA 4CETA 1OX4B 2BFBA 4BLRA 3OO0A 1NY5A 2DJIA 4XPIB 5JDCC 1XXHB 1P44A 4FCWA 4XSVA 3SN6A 5KHLB 3UUWA 2XZPA 3QFHA 4DNXA 3I1YA 3KKQA 2O8FA 5J5CA 4O3MA 4YCDA 2F43B 2XEDA 5AI8A 4B4DA 4RD0A 3WGTA 2BEVB 1N6NA 3I9KA 1HG0A 3D8BA 5K51A 3OA2A 2OZKA 1B8VA 1I4OA 4Q4AA 1NAHA 1WG8A 2FW9A 2KPOA 1V0JA 1YT5A 2C1XA 4LDJA 2I33A 2GF9A 2L2QA 2ZBGA 3NALA 4NK4A 2DWOA 1E2HA 1FS4A 4R5MA 3D6MA 1AZSC 1UJ6A 3CRW1 2CVQA 3O3CA 4GPZA 1Z29A 1NQTA 1U4SA 2ZJ7A 4EEZA 3H8JA 1W0JD 3PICA 3QPUA 4I5GA 3NHBA 4EVRA 4IMRA 1MJHA 1SCIA 3VR2A 1FC0A 4HLUC 4LCEA 3VZBA 3JARB 2YY6A 1YS2X 4MUXA 4OQFA 3M2TA 2PQMA 4FMPA 2ESRA 1QZ3A 2N75A 3TVDA 2FFJA 3BREA 4PLPA 4RLFA 3YASA 1G4UR 5B7NA 1VSBA 3N70A 4NABA 5BWLA 3C3EA 4JKYA 2ID8A 4OJMX 4E5NA 3R5JA 5LYJA 5LPNA 2JI8A 1T15A 1E79D 1ECLA 1GDDA 3OLZA 4JIMA 3TMAA 5FOUA 5IABA 1BN7A 2PZKA 5H83A 4WT7A 1PV2A 4EEXA 1I10A 1Q0SA 2IK8A 2YR0A 3JZDA 2PS0A 2YWDA 4YJHA 5COBA 1G8JA 1PYDA 2QOEA 1BOFA 2B0JA 1KORA 4GXTA 1J0CA 1DTEA 1IHYA 1QQBA 3ON5A 1EINA 1M2KA 2CKMA 4CTOA 2HA3A 3LQFA 3LCVB 5H70A 1G8KA 3SLRA 5KDDA 1AQ6A 1ISJA 1Z18A 2E6UX 2GN6A 4H7KA 4MKFA 3DM9B 4AY4A 1F2UB 3CB2A 5AW5A 4TLAA 5CM2Z 1N0WA 4GR5A 5CT5A 4OM7A 4UU7A 3P0FA 4DR3B 5BRAA 5D51S 3TB4A 1Z6TA 4GLBA 4DA4A 3D9QX 1CIVA 2ZQZA 3PJDA 1YULA 4KW7A 4LJSA 4V0QA 3V3KA 3WLLA 5IXJA 1Q17A 3HWSA 2CCKA 4QNNA 5C53B 1N2CB 4QFMA 3F9RA 4MV8A 4FVTA 1KJIA 3K96A 3HN7A 2PEYA 1ECFA 1SUFA 1FNSA 4ZGBA 1ZNXA 1VYUA 2QDXA 2YV5A 3EAFA 4JXZA 5JCJD 3V8RA 5KVAA 2RH4A 3COVA 1SRQA 4E5MA 4UHDA 4KE9A 4UE2A 3L1UA 3OCWA 4D3SA 3FHLA 1QVAA 3T9EA 4K6KA 1H6AA 4AUEA 4R05A 1PJLA 5LWHA 4CM8A 3I5UA 4X85A 3L06A 1V43A 3N2LA 1G4HA 2C9YA 2OD9A 1IBLB 2GYVA 4DIBA 1V5FA 3PHIA 3R4VA 3GJZA 2FRXA 3A2MA 4UOEA 1RM3A 3SM3A 1N6IA 5ALVA 1NJ6A 1US8B 1G38A 1Y4SA 1FYXA 3CUVA 1MT0A 1C3XA 2G1PA 1ICIA 1N7JA 1I9GA 4NHOA 3BS4A 2R8RA 3DMGA 3SX0A 1UL1X 5BR1A 1CQPA 3ZY4A 1S2NA 3MLAA 5DT2A 1N4AA 2WRZA 1WHTB 1VB3A 4MR7A 1YGPA 1BHSA 1XPOA 3BCHA 1J6UA 3V42A 5JZSA 5DFAA 3D7KA 2QGFA 1N75A 2CVPA 5EIFA 2XYHA 3O2QB 1T3LA 2WF9A 1ZSYA 4FI3F 3U3OA 1SBTA 2A86A 4BNYA 1FPQA 2TS1A 1JG2A 4KDEA 2W2KB 3B9RA 5TB5A 3JALA 1AGNA 3FPHA 1KRWA 3HSKA 2PUDA 1P73A 4FDTA 5JQGF 5EIBD 2NUPA 3QNWA 3ZE2B 4AF6A 1AQJA 1Q3HA 3P45A 5HZHA 3MS7A 1EFKA 1ZG3A 3NCTA 3ZVRA 2GN2A 3JVUA 3IIMA 4K9MA 2D1TA 3BX1A 3UANA 2PK3A 4UM9B 2QX8A 3KCNA 3N5CA 4L75A 5FTLA 1TIKA 4U02A 1V1RA 4CCYA 2ZP1A 3GFTA 2C7GA 4H3VA 5FTMA 1PUIA 3O94A 4A1OA 4GMFA 1NGSA 4Q4LA 5I9SA 1U3FA 4Z0HO 1U8YA 2P9QA 1G6Q1 1XK6A 3D1VA 3HGTA 4LJLA 3O4GA 3DUWA 4REQB 5HQ3B 3IX7A 3ZHCA 3HV2A 4WADA 1HH4A 2D4AA 1CZLA 1UJCA 2LGJA 4MR8B 1R12A 2ZJBA 1SG6A 4QUKA 1KPGA 1R4MB 1P6XA 3P71T 2ATVA 4DMMA 5IAAA 5BWOA 4UEWA 3ISVA 1JQDA 1KBZA 3D0RA 3KPVA 3X1DA 4LMBA 4MKZA 3AM3A 1T4CB 3BXFA 1DO0A 2FSFA 1A5AB 4ZI7B 1XA4A 1QDUA 4LDRA 3TZHA 1BDBA 2VI5A 4X45A 5U1PA 2ZRQA 3P26A 4UZFA 3WSTA 1XU7A 5I7OA 3FFXA 2R7LA 1GNTA 3EDYA 3LW7A 3QVVA 3UWPA 5A5EA 1KAQA 1KS2A 4H60A 4CMIA 5IAGA 2WWGA 3WGYA 2BTEA 5D85A 1KVTA 3V4SA 5T4BA 4OI1A 4OMCA 3LL4A 1A71A 4H3HB 1C1XA 2GEVA 3IOEA 3KXPA 5U4XA 5HKLA 3GYGA 2Q6OA 4BXOA 3C6QA 3VHRA 3LUCA 3L7JA 4ZGWA 3QG5A 1MHTA 4F7WA 1QG2A 4ZV4A 3VR4A 5K8CA 3FSGD 2FR0A 1MPTA 2KYRA 3AIIA 5BQ3A 2UXCB 2IU6A 5DTJA 3OTGA 1GTSA 3OQ6A 4DHEA 2V55B 5KSZA 4M1OA 1X14A 1JLKA 1Q44A 4GOLD 4YJKA 1WTCA 5FWNA 1REQA 5JDIC 1PW7A 1FJHA 3KUXA 4BVGA 4CKXA 3DF9A 5TMPA 2BGGA 3Q1LA 4OBXA 3HCNA 4LJ6A 4G25A 4MWZA 2JJYA 2FPKA 4E32A 1RIIA 3VJKA 2C2MA 3GP8A 4LYEA 1BVYF 4N47A 3KOUA 2OXFA 1R16A 4WW0A 5L6MB 1MB3A 4ND4A 1SAYA 4RQTA 4J0GA 3QFRA 1CUDA 1GFIA 1MB0A 3GELA 3PFBA 3S7ZA 5K0TA 3MQ4A 2PJDA 5HFAA 4P0PB 2TYSB 2WSIA 3KBOA 4G41A 1A7KA 1PE0A 2CLFB 1TYZA 2O4UX 4CRWB 2IH5A 1QFZA 1LX7A 1SVKA 4G4IA 3I8SA 3QLVC 1MORA 4A2QA 2EJCA 4PNEA 2CD7A 3RU7A 1ZN8A 2DKFA 3DD5A 2BWJA 3F2VA 3K1ZA 4MA4A 4UQOA 3VR2D 4L5IA 4NG4A 4DKJA 3WVNA 4CFYA 4KIGA 4MQLA 4P3XA 1NUPA 1M67A 4TXJA 5LA6A 1ISMA 2WBLC 4V3BA 4EO7A 1W9HA 1JSCA 3QJGA 4FONA 1NXXA 4KUHA 3OLVA 3E7DA 4GOND 1QFYA 3C87A 4MW1A 4Y0VA 5D86A 2VNIA 3AHIA 3BZWA 3UBMA 2BM9A 3TM4A 1YJ8A 5CIQA 1VMDA 1VP9A 2PUWA 3LA6A 3X0DA 5IWAB 2XCSB 3M33A 1I1OA 3ESRA 3SSOA 2BEUB 5KB3A 3R8FA 4OKIA 1GYPA 4D0GA 2B25A 3PV0A 5CBKA 3ISTA 2ZBRA 3KV3O 5AJZA 3DE3X 2VH5R 1PK7A 5LDHA 3BFJA 1AUPA 4NEGA 3ZGVA 1TIBA 1J21A 3HRHA 3W4KA 1PQYA 3ETEA 2VBGA 3UBTA 2HGZA 3P94A 1W2GA 3DULA 4C0LA 4EY6A 1NZFA 2BUCA 3GJYA 2C9MA 1YVEI 3V3TA 4GNRA 4DLZA 1A1VA 2HFKA 3IH5A 2QVYX 4D4LA 5K0ZA 2X4IA 4RA6A 5G4KB 3WNVA 4GI1A 1G9SA 3RIGA 3RVNA 4U6QA 1QOZA 4FHGA 1DAMA 1FX1A 1HE3A 1NP6A 3CLVA 4ZODA 1YGYA 3CYFA 3T38A 3WKBA 5DXAA 1IZ9A 5EE9A 1P5RA 5MN6A 2PD6A 2E82A 5I4CA 2X15A 3CLRC 3PT9A 1SCJA 3GARA 1G8FA 1WXFA 3WGNA 1RCUA 1U8FO 5TVKA 3SCZA 3AF5A 4HMPA 4LC9A 3V1LA 5IZ4A 3B3JA 2ZBEA 1X1AA 2OGUA 3QXCA 5JVDA 1O6GA 4MMYB 3K5IA 2ODWA 4UM8B 3HNRA 3U3XA 1EXVA 3X1JA 3I5XA 2E7ZA 2VF8A 1CV2A 1D4ZA 2G4VA 4QXMA 5HIKA 3ND5A 2QSYA 3G9UA 3P0EA 3UCEA 2ECFA 2C99A 5KWEA 8MHTA 1MP0A 2FZCA 3ZVMA 1CWUA 2WFZA 2YFKA 4Z2AA 4AKHA 1FQOA 3EEOA 1G5QA 3DZ8A 1KAGA 4RKYA 5HFNA 4WIAA 1OOEA 2GEDA 1N9ZA 1RPJA 4CU5A 3KB6A 4PLCA 5JNLA 1DELA 1W0KA 4IX9A 3VZRA 2ODEA 2HPHA 1MC4A 2FZ5A 4KTVE 3L8YA 1ZISA 4PIMA 2BFNA 3HCCA 3OFJA 1CEQA 1DUVG 3W6NA 1E1YA 3VUEA 4FYMA 3HYRA 1U28A 3O4RA 4TMZA 5LSAA 1L4GA 1M6NA 1XEWY 4FILA 3WNCA 3GLFB 3EJWA 3K9WA 3DBHB 3L9XA 3TRDA 4DR6B 5JAZA 3GLKA 4YAEA 5KO2A 2G9NA 1MVNA 3SZ3A 2TECE 4CM1A 1Y1TA 4PLGA 3FPCA 2J46A 2NXEA 4GXNA 1YS7A 3LDAA 3RKRA 3DAHA 3MUOA 4WOCA 5ADHA 5JAPA 4FS8A 1Q6YA 5DASA 5IBCA 3OO1A 3VVMA 2RB5A 4MXDA 1SBYA 4S1OA 3Q11A 1BWQA 1UBCA 4GPTA 1N5MA 3IVCA 4EA9A 2WNIA 4QUHA 3HU5A 4KVFA 1OJLA 2HXSA 3OX2A 2EP7A 1HE4A 1ZQ9A 2CLDX 3CZRA 3L9WA 4K9SA 2G9QA 4UZSA 5DEIA 4IQ0A 5I45A 4Z8XA 1C7IA 1EP2B 1RWVA 2IIPA 2UVPB 4M7RA 3VDXA 4PIVA 2GCOB 3M4YA 4LX0A 3EF1A 4DV2B 3LKDA 1EGAA 4B46A 4JR1A 3H97A 1W36C 4B7XA 1JHYA 2Z5FA 1DUIA 3S5JA 4TZKA 1C29B 1R66A 1G18A 3E9ZA 1ZRMA 1BYIA 5SICE 4B34A 2MYTA 1EMDA 1NMQA 2FSHA 1N3BA 1RT9A 2H08A 2XTNA 1D5CA 2HL6A 2IV3A 3IP6A 1W88B 4TWBA 1B2LA 2GJ9A 4M55A 1RC1A 4HUQA 3H2YA 2A58A 1SELA 2VUUA 3BE8A 3HCRA 4KN5A 1HYEA 4LYHA 1DOAA 1H5NA 4DV0B 5F1KA 3F1LA 1NHWA 1Z5VA 2P5TB 1XEXA 2H59A 4YRAA 5CX1A 4H0CA 4EKIA 4TVKA 3LT2A 4IJ5A 1QGED 5E7JA 4G4SO 2DSNA 2GM3A 3INTA 5CDUA 4Y30A 3LHFA 4MW2A 1FMLA 3HZOA 3KSBC 1LDYA 4LOAA 5F78A 3LBAA 1I7SB 1UAAA 1UQRA 2JLWA 2BGIA 5F52A 3S0JA 2H1FA 4JUCA 2OHHA 2ZRAA 9ATCA 4ZMRA 1GRRA 4GNKA 3I2FA 1ODIA 2WDZA 1QM5A 1EDDA 4GMGA 1RD4A 2J48A 5KPDA 3PNVA 5JR3A 3LAWA 2IYYA 1K7EB 2PBRA 1K92A 4X6YA 4WK0B 4D42A 2CL0X 3OTHA 3CKKA 1EVIA 1N2EA 3VR4D 3WWPA 2QYTA 1RYNA 2M6LA 1QIJA 1RM5A 3OQBA 4F8YA 3HR7A 4U8HA 2CNLA 2JFFA 3U5ZB 2BKLA 3ZBUA 3EWNA 3F6BX 4MEJA 1RU3A 2PZGA 4K6OA 4R8RA 1UMCA 5LNK1 3FB1A 3BA6A 3R0IA 3VC2A 3RC9A 1JTVA 4E70A 1KGDA 4FXPA 3O4FA 3U7FB 1XC7A 5TJHA 1AGYA 1RMYA 2A7QA 3CLSD 4AMBA 2ABWA 4RJKA 5C32A 2V4UA 2JLXA 4TKLA 2HT1A 2ZDQA 4M4SA 3AR2A 3O75A 3JWGA 2J0UB 4RZXA 3SKXA 4XVHA 2HRZA 4V2IA 4CM4A 4FT2A 3SKYA 2OLJA 3DWEX 4RJJA 3WGOA 2FW6A 1LSOA 5M34A 4E1BA 4MWOA 1XQWA 3C8ZA 5AMXA 5LQMA 4IHJA 3WIUA 4HWRA 3ESBA 2WWFA 3SXJA 3B6KA 3FR7A 4FHEA 2H8GA 2D5CA 2E3JA 4U0JA 4D8YA 4ERXA 3BB1A 4ND6A 1TDJA 4XWGA 3AEUB 3I12A 4E3WA 1V8DA 3HMQA 5FR1A 3UMFA 1P77A 4ZEVA 2CT8A 4BYGA 4BQFA 5KJ1A 4IWYA 2IYTA 1DOZA 1MNAA 1M76A 4MRSA 1AQYA 4TM8A 4R1SA 1G5PA 1T3HA 4W1QA 5M7EA 5KDOA 3M1YA 2OXTA 4JI8B 2J1LA 4HWPA 4QUGA 4ZEWA 4YCNA 3BMNA 3IUMA 4BIMA 4YUXA 4MDFA 4U2GA 3VM6A 4Q37A 4OHVA 1FRZA 3EMVA 4CMAA 1J7KA 1OI4A 4OIFA 3OJEA 4YJ2B 1UAGA 3ST7A 3E2IA 4U7JA 1CQJA 2OCPA 2P68A 2XMSA 5FTNA 3JZMA 2BFCA 3I01M 4DR2B 2A0XA 3KU4A 1M0SA 1JDNA 3H2KA 1WUHS 5AM1A 2D2XA 3PQ7A 3P19A 1YAJA 2UKDA 3RU3A 2FR8A 5JO0A 4KN8A 1BHJA 5CFLA 1IXZA 1PGNA 2OBNA 2QJWA 4TLCA 4X8LA 2VPIA 1VLZA 3LO5A 2HOQA 1TA0A 3OIWA 1YDFA 4ZWNA 4PO1A 3HG7A 4FKBA 2WICA 3R20A 3RS9A 1GT6A 5JU6A 3GK3A 3UA4A 1NMEA 5J4LA 4LWPA 4NVRA 2YMQA 2X7HA 1FP1D 5IZCA 1RI2A 2J5RA 2GPTA 5J63A 4M53A 3QVOA 1AD2A 1F9EA 3CUEF 3WDLA 3ZUGA 3OPXA 3WMEA 2FKAA 3ZVNA 1DTSA 4QSHA 3OP1A 4DHWA 4LWQA 1ZOPA 1FNCA 2YZ2A 2QPOA 3DLCA 1OCEA 1ZUNB 3LKVA 2CF5A 4Y6QA 2XWJI 4GD3Q 2ZUWA 4DVJA 4EB6B 1CETA 4FSDA 4D26A 2FPIB 1Z6GA 4B6EA 4BLSA 4DSZA 4GBMA 1ZMOA 4L07A 4XR9A 7ADHA 1T4GA 1W0KD 4JSYA 4QEDA 2C0QA 2D2EA 4LBZA 3M3DA 5HOEA 3MM4A 1ZL0A 2ZI4A 1D2HA 2I22A 3HLKA 3MXTA 4QOJA 5F1PA 3VI3B 4DSNA 5IFLA 3FYDA 1P1RA 1ZWLA 5AT1A 3I64A 3OLQA 1JEYA 3TLMA 1WMAA 4UVGA 5IVIA 5K05A 2NIPA 4R6WA 3PQ8A 1OTXA 5FYQA 3GLIB 1KMCA 1MAUA 2MSLA 3D7SA 5CDTA 3OWOA 2ZYGA 5ES3A 5KSOA 1V35A 4ZJPA 2B83A 3JQAB 4GAEA 4P2GA 1PHRA 2AG0A 3UG6A 2Q1SA 2QX6A 3QU2A 3H6KA 4NS1A 1P4AA 2E37A 2EBUA 4KIFA 3T5DA 5C7OO 4DMUB 3CH4B 4J7CA 1RJ9B 3HVHA 4XGNA 2JAXA 3KYJB 1ZOIA 3Q72A 4XYMA 1PR0A 3AFOA 3PVCA 1C80A 1AOXA 3FI9A 1E1QA 1LBQA 4YAGA 2KQUA 1K6MA 4OU4A 1ZI6A 3H9JA 2VF5X 4TZ6A 3ONEA 1L8XA 4W4TA 4DV1B 2O5EA 1PZGA 4UFNA 1MABB 4JI1B 3FXAA 2CL5A 2B8NA 2O7VA 3KUDA 3NBAA 4OIMA 2VCHA 2P35A 4MX8A 4PZZA 2GUWA 1WA5A 3KWFA 4QDTA 3FDXA 3S6JA 4R9VA 3WGZA 2ZWPA 4HAUA 3AVUA 5JATA 4PZCA 1P2UA 4R40A 1FP6A 1JFVA 1K4MA 2RH8A 3DBLA 3QTTA 4M8KA 5B64A 4JBYA 2ZVJA 3I2IA 3W8EA 5EMKA 1OA1A 4KR2A 1RYMA 4IHAA 5KYWB 3GJ6A 5T3YA 3K15A 1RXUA 3WIBA 1ZP6A 5DLQC 2D1QA 5U9CA 3JQEA 1C8BA 2O2GA 3HBJA 4QLAA 5ELXA 4BO8A 5AXCA 5IARA 1FW8A 2BFPA 1E62A 3OJWA 4GMDA 1SOAA 3UAWA 2NACA 4CI0B 4MQEB 4WKBA 3KE9A 4RTLA 1SO8A 4QU5A 3RUIA 4CUJA 4RCYA 4LWZA 5GGXA 1QIHA 1JKJB 3EGOA 1OC2A 1C7ZA 1JQKA 3P4YA 3DG9A 1Z2AA 5AKZA 4B4OA 4OQNA 1VRWA 2F3UA 2COUA 2L0XA 2P78A 2OYRA 1JG6A 3E3MA 1DCTA 5J40A 4F9TA 2CFCA 3ICPA 1NW9B 3HY4A 5BSRA 4DJEC 4IJMA 2XCTB 3Q7IA 1E7RA 1UWKA 4AJ9A 2RHGB 2H7CA 1GAEO 2G0NA 5ARCA 3MJCA 3HY3A 4C7OB 4INJA 1EM8A 4EFNA 4LYDA 4Q9NA 3ZBQA 4JJ6A 3S1LA 1J09A 2YN2A 5HDQA 1AE1A 1FLNA 1T35A 4XH9B 1SHJA 2X5XA 3W77A 4GHWA 4YXFA 4WCDA 3VC1A 1PS8A 1IVYA 3K09A 3PDHA 3NC0C 3BJIC 3GRFA 3G8AA 4Q1FA 5FWXB 5L40A 4YRBA 4LZPA 3WB0A 4JODA 2O14A 4X93A 4D74A 3F2IA 1JHOA 2GPYA 2BY4A 2F90A 5EESA 4HG2A 3REQA 3BQNB 3VO2A 5A4FS 4YPFA 3AG6A 2XCRB 3K8OE 1PS0A 3FMVA 3W9BA 3CPEA 3O91A 3VTAA 1NPYA 4RHUA 1WBBA 3W34A 2IQ5A 3A0UA 4FB5A 2JFNA 2EERA 3L8FA 3OEHA 4JB8A 3W6UA 3GCZA 5KWVA 5FBZA 3H0CA 4YIHA 4FZ3A 4OY3A 2D6FA 2K6GA 3CLKA 5JWOA 3OOWA 3RIEA 3RRXA 4MEAA 1BRTA 3QELB 4ILKA 4B73A 5I9NA 3NV7A 1NJSA 4EHLA 1YCHA 1FFYA 2GZHA 3P4XA 4J0KA 3T3GA 3ZC3A 3CVWA 1PQ4A 2E85A 4PAOA 2HMYB 2EIXA 1Y98A 3BILA 3OKAA 4U7PB 3NDRA 2ZWMA 4WJZA 4YP0A 2A5DA 3NKLA 5JLAA 4ESEA 1E0AA 5FPQA 1YQTA 4PHFA 5FUMA 4Q7QA 5B4TA 1DU4A 4CEHB 2IVFA 1P7CA 1Q7BA 1SBNE 2QS9A 2VJNA 3FHJA 4RX1A 4YMVA 4UVEA 2H07A 2EBHX 3JD2A 4RK6A 3W5HA 3EZ9A 5DYNA 1V1MA 2ANCA 2G3YA 4H59A 4ZT3A 5FNVA 1DBWA 2SECE 3VNSA 4D8XA 5IKPA 3ZHSA 1KDZA 4AP6A 1K5HA 2C2BA 3CJQA 1YCGA 3AEKA 1T5HX 3P0IA 2Q6VA 3ESZA 3WWDA 3ZWOA 1ZK0A 1D1TA 3MWKA 5C5IA 2X2FA 5BURA 1YJAA 2A3RA 3CRZA 4M1ZA 4HYTA 5I6DA 4FW8A 2CEKA 3B3FA 5AVVA 3LFUA 1QNLA 1ZN7A 1A5TA 3S27A 2Y8EA 4HSEA 4YT8A 4IDBA 3MWLA 4QU9A 1C8KA 3L41A 1XLWA 2OY0A 3L4BA 4TGLA 1A9PA 2C9DA 3SXUB 4JAVC 2PL9A 1A9YA 2Y1WA 4FQ5A 1LS6A 3JQPA 5FWAA 1AV7A 2YJNA 1EU1A 1KU0A 2VK8A 1VB5A 2Q5IA 1C0KA 4Y1FA 3CPHA 5JAQA 3CWCA 3UFBA 4M9UA 5CW2A 2Q3JA 3H4MA 4CMJA 1G8SA 1N3YA 4GBJA 4WUVA 3VC3A 3ZXIA 2F8LA 4GEKA 1XELA 1TTHA 2HY7A 2JNWA 3M1LA 3DLAA 4HB0A 3BSSA 1AN9A 4HPJB 3KK0A 4I1YA 5DX8A 5GJVC 3USES 2Y4OA 3KVNA 2GF0A 2H29A 2VTVA 3DTYA 4P34A 3T9BA 1D2NA 1ZCFA 1U1EA 1JWBB 1LJLA 3A9VA 2B4TO 4TL7A 4YAFA 1H4QA 2EZ8A 3LKBA 4RYLA 2Q4BA 2COKA 3EZFA 3FVRA 4N6GA 2Q46A 2ZAYA 4R7ZA 2ODBA 2ZRPA 4FOTA 2VXCA 1GPUA 1KI8A 2VUSA 5B12A 4OQPA 2HYIC 3U5TA 4Y0AA 4CIVA 2CJYA 1RP1A 2AQ8A 2GH1A 4CM9A 1FE8A 2WHYA 4WBNF 4HKTA 2AHOA 1E92A 2AN1A 1E89A 4CUKA 2PMCA 2VJLA 1OU0A 4BWYA 3NASA 1YCDA 2VHVA 4KQHA 4CGZA 2CK3A 2G9UA 3Q2KA 3SAJA 2QR3A 3LBIA 2MIIA 4XDHA 4NXNB 2V4MA 3AP3A 4ZVQA 4LOHA 3P9ZA 1VECA 4KPUB 5I51A 1RWKA 2P77A 4L4UA 1Q50A 2NUTB 2I1WA 3DVQX 2BI4A 2XUIA