1B74A

Glutamate racemase from aquifex pyrophilus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
252
structure length
252
Chain Sequence
MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKSGAYQRKLEEGGADVFAKACPLFAPLAEEGLLEGEITRKVVEHYLKEFKGKIDTLILGCTHYPLLKKEIKKFLGDAEVVDSSEALSLSLHNFIKDDGSSSLELFFTDLSPNLQFLIKLILGRDYPVKLAEGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
publication title Structure and mechanism of glutamate racemase from Aquifex pyrophilus.
pubmed doi rcsb
molecule tags Isomerase
total genus 75
structure length 252
sequence length 252
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b74A02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b74A01
5ELMA 5HRAA 1IU9A 2EQ5A 2JFVA 2JFQA 2JFYA 1JFLA 2JFPA 2DX7A 2ZSKA 2JFXA 2W4IA 2OHGA 5HRCA 3UHFA 2JFUA 5ELLA 2JFZA 1B73A 2DWUA 2JFNA 3OJCA 3S7ZA 5EVCA 4B1FA 2JFWA 3S81A 3ISVA 2GZMA 3UHOA 1B74A 2VVTA 2OHVA 2OHOA 5HJ7A 3OUTA 5HQTA 5IJWA 3UHPA 1ZUWA 3ISTA 3HFRA 2DGDA 2JFOA
chains in the Genus database with same CATH superfamily
4M53A 4PO8A 2ON6A 5LD2B 2PJZA 4Z53A 4CKYA 4NCXA 1T43A 5EWMA 4BKMA 1THTA 3HL4A 2VP6A 2BDTA 2NU7B 3E7PA 4H7DA 2X5KO 1FMLA 4R9SA 1Q0UA 4R9RA 1BW9B 3VR1A 1U11A 4RKWA 4RORA 4EATA 4TTRA 1ZI9A 2F00A 1T1RA 3CZRA 3PQCA 1I2MA 2HWYA 1XHFA 4D4HA 5B1EA 1NXSA 1KEEA 2OD2A 1RJ9B 2C1ZA 2QZPA 1D4FA 2ZTSA 4D96A 3H1AA 3NDIA 2Z83A 3AFOA 1FFSA 3VFDA 4LN1A 1P45A 1R6UA 2GN4A 2JJ2D 2KS6A 1L5HA 4CIXA 5JUWA 3NWPA 3UTCA 1AHNA 1NF8A 3IMEA 3X3HA 2N1BA 3LPMA 3E1KA 1ST3A 1BNCA 1GZDA 1RIFA 2IP2A 2J5XA 4P0TA 4JXZA 3WMXA 3OO0A 2JGJA 4EEKA 2WU4A 5JJCA 4DV7B 1QM5A 1ZNWA 5GJCA 1XG5A 4P5DA 3FLBA 4HZGA 2IYRA 1I0ZA 4N39A 5EZQA 1XRPA 1TZJA 4MWTA 4AZSA 1W5SA 2XUZA 1DRUA 3KNZA 4IP0A 2COEA 3IP1A 2D1QA 2XWQA 2I78A 2ZKIA 2FZVA 2IPOA 3SS9X 2J67A 3NIGB 1R66A 4TWAA 5GIOE 1R10A 2HL6A 3A27A 3LLMA 4JQOA 1VJDA 3MJSA 3T3MB 2CFSA 4BFLA 4DCVA 2HJWA 4FP9A 4C7VA 1NUQA 1TRHA 1V8FA 3QIAA 4TKZA 4DJJA 5KVCA 2A1TR 2YWEA 2IPXA 3BAFA 1PQPA 1X39A 2O7VA 4R40A 2RHGB 3OC0A 5ICGA 4ZV7A 4F56A 1AZWA 1JKIA 1CR2A 2C7GA 3TIIA 1Z74A 2RHBA 2PT6A 5BSVA 3K94A 4X3PA 2AOTB 4FHFA 1GKLA 4QAJA 2GDJA 2AFVA 2POQX 2XVAA 3HGMA 2GFHA 3LO5A 3V1LA 1ONBA 2GEUA 3NHAA 2Q4EA 4Y7DA 3GUUA 1OJLA 1OZAA 3K30A 2D7CA 1M1YB 2ZK7A 3U3RA 4ALMA 4I4CA 3GJSA 2NACA 5J5VA 5HP4A 5C1PA 1TUEA 4AWBA 1EHYA 1OY1A 2QTZA 5JJKA 3DC7A 3PEEA 2PU5A 4ITRC 5AKJA 1UR5A 1F8FA 4TQGA 4AJ4A 4MYRA 4F21A 3A1FA 4MA4A 1GZ6A 4ZZ1A 4RETA 4IIBA 2BFCA 4OKSA 5DLEA 4WESA 3K0SA 1WO8A 3IEVA 3P4XA 2YY6A 4LPSA 1XTIA 1V71A 5EHGA 1P3JA 1QGED 3BUSA 1GR1A 1DV1A 2C7PA 3DBLA 3AEKA 1K6IA 2WF9A 4W7IA 1VFPA 5J2TF 4IIGA 3DO5A 3FTFA 4MUEA 1QHYA 1L4LA 1ZL0A 3DULA 2ZJ3A 1IJEA 3KTFA 3JQQA 3L1JA 2QI9C 3R5JA 3WO1A 4LWQA 2WFLA 4YCCA 3DEZA 3PCXA 4GECA 3R7NA 3CLSC 1T9AA 4HNVA 8ABPA 3C6ZA 2VQFB 2DR2A 1J1IA 3ZXXA 5GJBA 1IZZA 1ONPA 1VGRA 2Q3MA 2PMWB 1M75A 4JQCA 4MW4A 4B71A 1LBEA 4C76A 3FVVA 2HFJA 1HOXA 3L6RA 5I4IA 2HYIC 2DFDA 1QAOA 1XLTC 1SG9A 2GN9A 4B84A 3IMKA 5EKSA 3T3IA 2XRZA 3PJRA 5EIEA 1R88A 4IQGA 4L02A 1IXKA 1SQSA 5AOBA 3NVAA 3ONDA 3KR9A 5EE3A 2FPMA 4NDNE 5EE9A 1USUA 4CCYB 1XNQB 3DHNA 1KP2A 1BQ4A 1T8WA 2VNHA 5BOSB 4LJAA 3QFCA 2IPMA 3A04A 3FPSA 5EP4A 3RDPA 4KZPA 3B1YA 1RMYA 2O5CA 3LO8A 3CZMA 1K7XB 3DBIA 1IBKB 4WXYB 3MUOA 5LUBA 3R0ZA 3RVSA 3W7AA 3NPMA 4TXNA 4HAIA 4HXEB 5H68A 1I80A 5C31A 4BVJA 3W5VA 4RUKA 2BGNA 3AQIA 3RT7A 5F1OA 4R0VA 1EFVB 5TE9A 2Q27A 4IY1A 2E4YA 1QO0A 3QOYA 1Z4KA 3DMYA 5C5IA 5K3FA 4BNIA 2D5BA 3LPNA 5JS2A 2PX0A 3CWCA 1KWKA 1YRLA 2IP4A 4DHWA 2B98A 4O4IA 2HLNA 4KO4S 4M22A 1XGKA 4WIAA 1HV8A 3R4VA 3SE0A 5LJIA 3DTYA 2QV0A 2A0UA 2IVZA 4LVUA 1N2CB 4YMVA 5M34A 2IF0A 1Q92A 4Q7JB 2WE8A 2R66A 3BD7A 5IABA 2I22A 3QEKA 3KAPA 4RK1A 5LBUA 4ZPXA 3RSHA 1QUFA 3SXPA 5CU7A 1EP2B 3CLTD 4DWWA 2GSWA 4W5TA 3QEMA 2X42A 3LQYA 4M6WB 1ZXBA 5D6NA 1MIHA 3CH7A 4YREA 1UWKA 2QX9A 4L4SA 3E48A 3T4UA 2ZQ5A 5BQOA 5I5EA 1Y6GA 3AH8A 3TF5A 4F3KA 3ZWQA 5BV0A 1XBTA 3WHIA 1YVPA 1DL5A 2VPYA 3X1WA 2IZ5A 1HA3A 4J7XA 2CFIA 3EIWA 2AL7A 2XDQA 2ZATA 3BZUA 4LNUA 4M76B 3A36A 3LXXA 3UMRA 1CWUA 3MHTA 1SBTA 3Q9UA 3X2EA 2CMFA 3PEFA 2D3TA 4F8YA 2ZM5A 4U2BA 3H5LA 1V5GA 2IT1A 3FCAA 7AT1A 5AW0A 4DB2A 3LX8A 1SXIA 3G1UA 2VLBA 1R6DA 3L8CA 1Z4NA 3JVVA 3RUCA 4TV9B 1X80B 1VFNA 1U9YA 4JOQA 4COOA 4YC7A 1QJ4A 3OIYA 4QTYA 2HYDA 1LXCA 3JQAA 4JSRA 2HU7A 4IXTA 4WLNA 3PDCA 4AYTA 4NOJA 1PZGA 4U5XA 3DF9A 4QPPA 4C01A 2Q3LA 4TPKA 3PD0A 4RS4A 5EJGA 1VCHA 4IVPA 2B3DA 1H3FA 4IGAA 1QBGA 2FN4A 3BXPA 2GPWA 3C6QA 4M9QA 2VTBA 1KMCA 3KZKA 1YFLA 1PX2A 2R6JA 3AF5A 3NTLA 4U7FA 4ILKA 1P5JA 4PTZA 2QROA 4XD2A 1YKGA 1C1HA 1KR2A 3FGNA 3C7CB 3H83A 2Q2QA 5AJUA 4DWVA 4EG3A 3MCVA 2J9ZB 3CXUA 3MMPA 2BSXA 3R3XA 1DZIA 2Y92A 4RJKA 3QF7A 4HO1X 1R15A 4OL0A 2W0MA 3DB1A 1FSFA 3M6IA 4AJNA 5BMOA 4BUJA 2O8EB 3IX7A 2B0CA 3N0TA 2F9MA 3SDZA 5J59A 1Z75A 1RMQA 1GR0A 2GZSA 3BZWA 3GRUA 4ZXFA 5JXJA 2BYTA 4BN0A 2WMYA 1NQ5A 2B1RA 3N8DA 3GFFA 2JLRA 1QHNA 3K9BA 3VR5H 1PDVA 2XWSA 3FYHA 2UU9B 2VAWA 1XRRA 5HTKA 3HO1A 5DYTA 2XH8A 5KKAA 3U7EB 1MNQA 5BNIA 4EZEA 2AIRA 1A76A 3IO5A 3RC8A 4AY2A 1XTJA 3ZN2A 4DA8A 1ZD4A 5K3CA 2I2BA 5SYAA 3GWZA 3TBFA 2IELA 4I9FA 4J4BA 1VJTA 3KQYA 2HV9A 1O94C 2C4MA 1SZCA 1GYPA 3AM4A 4MV1A 1A9XB 3H2ZA 3L93A 4XB6B 1PHPA 2FE4A 4PNPA 3LKDA 2VH1A 3DP9A 4ZVUA 1E4OA 1L8XA 1NHWA 1P2TA 1P7PA 4JFRA 4EHIA 4DMHA 3UY4A 1NAIA 1ID8A 4WY8A 1UMBA 1GL6A 5HOQA 2VHVA 4X7MA 2C04A 3JD1A 3PXBA 2WUVA 3SZMA 5K6RA 1FP4B 5FUXA 2EQBA 1JG7A 4IJVA 4A8PA 5LOVA 4JV5B 3E8SA 4QXMA 4CNQA 4OJKA 2VIIA 4EQ6A 1RHRA 3QKSA 4FIDA 2DPYA 2ZSDA 4NONA 4E1BA 2F1KA 4ZQEA 2ZROA 4BVKA 1JQKA 4YMHA 2ZS8A 1E59A 3ROPA 4UTRA 3M4XA 5AI4A 4QODA 4YRDA 1FFAA 4MAFA 3T5BA 3U80A 4X92A 2QTVB 3AF4A 4CKZA 2JB9A 2VQDA 2W6IA 3UJAA 2OT3B 4CL3A 1X0XA 5IAAA 2JGDA 5KQMA 3FPHA 3OMLA 1VCIA 3AJ9A 3C3YA 2ACKA 4M8NE 1QUEA 2DHEA 1N9GB 2R9VA 4NYJQ 3UT6A 3ZW9A 2IKQA 1E66A 1Z37A 5K8CA 4IGIA 1GFWA 4QJ3A 3B2NA 2P8JA 3B13B 1O0BA 3KQMA 1QCDA 3S1AA 3DD1A 2PKCA 3ZUGA 4DR3B 1TQ8A 4W5OA 3RSCA 1J8DA 3VC7A 1LTQA 3WADA 5JQGA 1XNRB 4KGDA 4YMIA 3DAPA 5H7XA 4AMUA 1A0OA 1XROA 3R3SA 1KDTA 3O47A 2XITA 2NWQA 3IQWA 4EM6A 4UC0A 4GEGA 1ZSNA 4EHHA 2PA3A 3ZH2A 3DQZA 2QT9A 3ZIDA 5CA1F 2GTIA 5DI3A 1KO4A 3G9TA 4I4TB 1QRRA 1JKJB 4CFSA 1ZYUA 3W8DA 4A91A 4D9MA 4EIWA 3T3NA 4FNGA 4UE2A 3DDZX 2QEQA 3H1FA 3JVUA 4JITA 2DHRA 4RESA 4Z3KA 3OLYA 1BE8A 3KP1A 1P2GA 2JEOA 1EG7A 5HJ2A 2FJPA 3V1TC 2CBZA 5KDOA 3N0RA 3RHFA 2ERXA 5AK5A 3VYVA 4QHSA 3FZGA 1OAKA 4PX5A 5ESXA 4ZU6X 2J6IA 3M34A 1F8XA 4BYGA 3UGTA 4ALKA 4NG4A 5F2NA 2DXIA 4MW9A 2MSNA 2NO1A 3LPDA 3DE0X 5EMMA 3ELDA 2CSUA 1SHKA 5FBWB 3RF6A 3ZZMA 4PS0A 2XYHA 2J3LA 3GEBA 3N8GA 4C0QC 3T52A 4F2DA 2AZ4A 1GU1A 5HZGA 5F7JA 1H2EA 3O75A 2GEKA 2G9VA 3NBUA 5B4VA 2HB6A 2V3WA 2LR0A 3C8UA 5IMSA 1UJNA 4CM8A 3WBJA 1GXSB 2PZMA 3RIGA 1PRYA 4DCSA 2WAAA 1BMTA 2BH9A 4RSGA 4XKJA 4YUXA 3DR5A 4X1KB 2AFIA 1XMIA 2ZZMA 3O93A 3FKQA 2C61A 3CNQS 3QJ5A 1JLLB 4NL4H 3WLPA 2GD2A 3IMGA 3O3MB 3K6SB 3CW9A 3QK7A 3QEAZ 2FN3A 1ULHA 1IXSB 3PXCX 4V0KA 4LXQA 5I9IA 1DQNA 3KLBA 4W1PA 3QKTA 4WAUA 3TN7A 4DT1B 1XMOB 3U7FB 1BGWA 3D7NA 1RVDA 2JFBA 5LUAA 3ICCA 1Z7YA 1MRNA 5LJLA 3D4PA 3IHKA 1U0JA 3QHAA 3H0EA 4J4HA 4N5HX 4YHBA 3OZBA 3TGLA 4HNUA 1DKRA 4FOPA 3LQRA 1YQWA 3IKVA 4X7PA 3D31A 3RRXA 3KYDA 3VR2D 2BL4A 1C3JA 5DM60 1ZIXA 3Q9LA 4D80A 2XZDA 2PRSA 3MRVA 1OAAA 1NT2A 3CUWA 1B3BA 1PAUA 1Y3BE 4GNKA 1CUSA 1UMKA 4L22A 1GO2A 5CVDA 1XUOA 2J4DA 1Q14A 3RKSA 2Q0XA 3BK7A 1QNLA 2Z1NA 1QV9A 4LGCA 1SXHA 3V5NA 4TSFA 3WNVA 4ENQA 4EGSA 4I50A 4ESOA 4HGZA 2VHQA 4WOCA 5BMVB 4BEWA 1W85A 4IWNA 5D85A 4JDUA 3U44A 1M2OA 1NBWB 4E2YA 5A3JA 5JISA 2XE4A 3L1VA 2HMUA 1ZXLA 5KTTA 5AM2A 2Z8XA 2VHCA 3MTJA 3ZDCA 2HCRA 5EAIA 5CNMA 4YAWA 3T7KA 4HP8A 3SC4A 4GC9A 4Z2AA 2E3JA 4FGSA 7ADHA 1XZCA 1P7YA 3WGKA 4DM7A 1OWOA 1BWQA 1C30B 4MGZR 2Q4DA 1E3JA 2FHSA 5DGCA 5HQJA 1U8UA 5KNCD 1NF2A 3ODGA 1JFVA 4Q48A 4RK6A 3O83A 3MUNA 4IDGA 3DJFA 3D3JA 2P40A 3NCHA 4KLCA 2QMEA 4QOIA 2VA9A 2GK6A 4AZ0B 5A6VA 2EW8A 1V0JA 4W7HA 4EYGA 2H0AA 4UJ5A 3SXUA 4V3CA 1TU4A 4Z1OA 4B17A 2VRNA 1TQDA 4U9IS 4BLWA 1MQ9A 1RC1A 4MR7B 1BEZA 3RROA 3UBTA 1JIXA 4D44A 1YOBA 3E22A 2HA4A 1LLUA 2V4UA 2X76A 2J4FA 1NV8A 5JCPA 4KRXA 4X1IA 3WL3A 4RTJA 2LPMA 4R1PA 2PQ6A 3L04A 3RARA 2V3VA 1KJIA 2PXXA 3AUTA 4UNPA 3G59A 4N0DA 2C7BA 3HN2A 1J2YA 3FZNA 1VLLA 4BFZA 1HTTA 1YGYA 2ZBFA 2JJ8A 3LF1A 3UUFA 2ID8A 3SKXA 4Z4GA 2DY1A 4P86A 3VO2A 1GGKA 2QPTA 3GDWA 2OBBA 2YJGA 2JAUA 2NUTB 2F1RA 3ND8A 3GO4A 4EG8A 2KLBA 4EJFA 1GLVA 3GJ5A 4QDOA 3CX4A 3ZCPA 2XTMA 4WCFB 4XJTA 1OPXA 3R40A 5IAJA 4QXAA 1GNTA 1U80A 3TCXB 4URUR 3BREA 3QLUC 2WUFA 1JJVA 4NBSA 5ULLA 3F2VA 1E0AA 3SHTA 4OF4A 1NOJA 3AOEA 3HBFA 4V38A 1KMQA 2XOEA 4RBNA 1PFKA 3U13A 3EY4A 4QVIA 1FA9A 2IUFA 3DFFA 5AM3A 4JU9A 2PWYA 3BB4A 4CM4A 3DBHB 3ZWOA 1DJOA 5FBHA 4L85A 1DMRA 2JAXA 3FOCA 5LDGA 4WLFA 5DYWA 3I45A 3SNKA 1OLXA 3D2BA 3FYUA 3PBKA 2N9UA 2NUBA 2PPLA 4A0QA 2PL1A 1P9RA 1SD1A 1EUCA 3DUWA 2G5GX 4HUQB 1OBHA 2ZRHA 3ZS9A 4BGIA 1RRCA 2YDYA 1DXOA 1F3OA 1KY5A 4I6EA 1PJCA 1JAXA 2QX4A 2VDUE 3BPSA 3GAAA 3QKRA 3RC3A 3AW9A 3T38A 3D7LA 4LSWA 3PL5A 2VJCA 2CWWA 1BMDA 5KREA 3IALA 2JIOA 4CDGA 2GWRA 2X7HA 3OIDA 4PXSA 5TARA 4DMKA 2O3QA 3MIIA 1E8MA 2ZYIA 3UCEA 3ANYB 4NCJA 1GOTA 3FPEA 3WGJA 5IC4A 4ABTA 1JAYA 1IMJA 5AM0A 5CBPB 4C7XA 2D5IA 3JAWA 4FSXA 2RB5A 5BSWA 1NWHA 4C4TA 4KXQA 5A62A 2ZM6B 4V0LA 2V7TA 2P6MA 5CLIA 4KR2A 1L4BA 2WQZA 3GT0A 2BR3A 4RF5A 2Z9BA 5IVDA 5A03A 1EJ0A 1BX3A 1F14A 2Q8PA 4AKHA 3OJLA 1QK4A 4OLAA 1KHHA 4OHXA 2ZUFA 1MO6A 1UOOA 1YJAA 1O6GA 3FTEA 3A1TA 4GX2A 3H86A 4O2AF 1GFSA 3G88A 4WKBA 4CV3A 4TZTA 1JAZA 5JIBA 1JDZA 2NZUG 1E1QD 2OBXA 3I01M 2WYUA 5DN6D 2OCXA 1JDBB 1U98A 1YOVB 2P6OA 2HHAA 1BCRA 3IA7A 5IHXA 3L8MA 5I7FA 3P45A 4NENB 3SWWA 2WB2A 1NU8A 3P9IA 2WSYB 1UIMA 1YH3A 2OP1A 4D56A 2I7DA 3NT2A 1N9ZA 5J4YA 4L4RA 3O0DA 1ORWA 2GNOA 1D04A 2OHIA 1RFLA 4FLEA 3VPXA 2NVBA 3PHCA 1HFKA 4G5GA 2HNAA 1OKKD 1QH1B 3Q10A 4F4CA 2E7ZA 5GZ6A 2P2YA 1FP7A 2HX1A 2ZRLA 2DBVO 1U3VA 3FBWA 2AW3A 4G0OA 4J91A 5BOVA 3TOZA 5LQCA 2I1LA 1IBSA 1USWA 3OJEA 4FVTA 3A6ZA 3KT0A 1Z62A 1QHHA 4IX1A 3GLGA 3DNFA 2WJAA 1K8XB 3DEHA 4EVQA 3HCOA 1J7JA 4U1RA 4EKDA 2F17A 1L3BA 4WLVA 4KE6A 2JK1A 2UZAA 3ECSA 3M1YA 5M29A 3PYMA 3ZLTA 3OTIA 1QR2A 2Q8QA 4WJZA 4IV5A 1LGYA 4LJ5A 5DM4A 3KT3A 1ND6A 1ISIA 1H2AS 2X1LA 5K99A 4P0PB 2B7CA 4IJUA 1XIVA 2QW1A 3MJ4A 3NASA 1OBCA 1JH9A 2ZGVA 5GQSA 3S29A 1XELA 4BVEA 4N9WA 1PT9A 3AP2A 2JI9A 2OK7A 2IYWA 4MRMA 3HN6A 5COAA 3ZJYA 5KTMA 2QUKA 5CVTA 2I7CA 1ZAKA 2EFDB 2H3HA 2RHLA 3C1UA 5EGSA 4B9EA 3QF4A 4MVJH 5JJIA 3KB2A 1VJRA 3SHWA 2DKOA 3EMBA 1X3SA 4UHEA 3TRIA 1H0RA 4CEIA 2CSXA 5IFLA 1OZ0A 1AK1A 2NO5A 1FYDA 2OP0A 2A58A 4YY3B 1IYZA 1T2EA 4PYMA 4OH7A 4CKWA 4DCTA 3DAGA 3MB8A 3RIEA 4BEVA 1MJ5A 2AQKA 1WSWA 1RXCA 4YO8A 5G0WA 4YR7A 4DR5B 1ZDMA 3QQPA 1TAGA 4QWMA 3W6NA 4BQNA 4XXHA 4NE2A 3GGOA 5F98A 2OHFA 2FH5B 2OFOA 4IQFA 3JQ7A 2YJZA 3LWBA 3EDMA 4KUGA 4OQ4A 3TTVA 3LG2A 1X8KA 5DNWA 5EHQA 1C1DA 2WWGA 1E6CA 3HLKA 3URMA 2IEBA 3GGSA 1DSSG 3PQDA 3T95A 3F4BA 3P9NA 3HJHA 4LXGA 1JHXA 2AN9A 2Q2NA 1FC0A 1UK6A 1PI3A 4EHBA 3A9WA 4GMFA 3ZCTA 1MXHA 1UBLS 2PWBA 2VF7A 4OG2A 5DGXA 2AWOA 4IDCA 4D4LA 3VAAA 3RLIA 4F45A 1KKMA 1QVVA 1E3TA 1BHO1 1RE0A 2H4HA 3FYTA 1XLTA 2WUWE 3L7CA 4GEKA 4OGFA 5DO9A 4B83A 3QHPA 3THWB 2OFXA 2IV3A 3STHA 4MPTA 4AWAA 3EXIA 5KOHB 3FSGA 3GXOA 1ZQ9A 2A1UA 4LTNA 4YMWA 3MBIA 5LZ7A 4AWXA 4KFTA 2AYXA 3OTOB 1P4AA 2BUBA 2IITA 5A4MS 1ZD5A 4WZAE 1GM5A 2EFCB 3LVFO 1DT3A 4XD7A 4ZAZA 3T41A 1JJBA 4G89A 1SCNE 4FILA 4I8IA 1IXZA 1D5WA 1ENZA 1R0CA 1VPDA 5TJ9A 5KYXA 1F8GA 3G9UA 2W6MA 3VKUA 1Z06A 4WKNA 4Q1FA 4AKEA 3T1HB 1QP0A 4WK2B 5CGQB 1UBTS 1PU2A 2Q4BA 3BQNB 3OZXA 1CUUA 3WKBA 2OV2A 3VU8A 2VJYA 2ZJBA 1G0NA 3E70C 3ND7A 4UD2A 3U3OA 5AESA 3E0QA 4JLJA 4GZ3A 2QVCA 3TAHA 4B82A 2XR1A 3GQBA 1R8QA 5HE9A 1BDMA 3LP5A 3KEFA 3E15A 3A26A 4JOCA 1EUQA 1L1RA 1XKQA 3KKQA 4TLDA 1U7TA 1CERA 1KETA 2P69A 4A10A 3M9LA 3FIJA 2WWVD 2H54A 4CCAA 4EGJA 3DTVD 1N92A 4GBMA 5KNDH 1TF7A 5GGXA 2B8WA 1UZUA 2INGX 3R1IA 2DTXA 2RGRA 2Q3JA 2BHSA 1FLNA 3IP3A 4RY8A 2P3SA 5I8PA 1CR4A 4KACA 1H3NA 3R23A 1Y4AE 4ZEWA 1BTOA 2PMBA 3KZMA 3K16A 2PS3A 3GROA 3VZPA 4HJRA 1W4LA 2W8BA 3FCEA 3IVGA 3NFRA 3T1OA 3ERCA 1SA0A 4B87A 2ZT7A 4B76A 4YUAA 3NTOA 3MSCA 3HKDA 3UA4A 3F6EX 3AEQA 4HNGA 3A7EA 4CYMA 3SQMA 4LZJA 1QKJA 1WP9A 3OZEA 5BSGA 3O91A 2FV8A 3FF1A 4C03A 3V00A 2H4XA 3REQA 3WL6A 2HIGA 2P6PA 4EL5A 4MVYA 1FSSA 3FG9A 3H9BA 4JUFA 1SGWA 1G4AE 3QV2A 3M7IA 1QP7A 2KWIA 3F6BX 4H4EA 4C87A 2XEDA 2VUSA 2ZVJA 1V9CA 1NMSA 1IFXA 4IFIA 5FQNA 1CG6A 2Y05A 1A9QA 2C77A 4XYGA 5DV9A 4DCPA 1GPAA 5DXJA 5J2TA 5KO2A 2WU1A 2LWIA 4IIDA 4PYNA 1E79A 1FNBA 4GBGA 1AO0A 3WK4A 4B3RB 4NF2A 1RYZA 1BSVA 1Q50A 4Y2HA 2VHXA 1Q2UA 2G17A 4MO9A 1ZEMA 4OYLA 3O4JA 5C7IO 1VRWA 3H8JA 2E49A 4MR9A 4OHKA 2CJYA 1ZIOA 3CT6A 5EJ6A 5KYYA 5INTA 2DRIA 1XP5A 3NI2A 4L51A 2PVSA 1N8TA 3AHFA 2OCIA 4Q1EA 1EGHA 3K35A 1ZUNB 1JEOA 2A5JA 2FWMX 1K7FB 4M55A 4UD6A 1DTSA 3O8QA 3RFFA 1IZ8A 5I9BA 1CRPA 5DDIP 4GGPA 4PPQA 5JXIA 1TU3A 1T0BA 2O2SA 1HK7A 3COYA 5B58T 5ILOA 1YD7A 3LBYA 1KK0A 2P9BA 5ECGC 2BTQB 2X77A 4B6JA 4BNUA 3R77A 5EMNA 4HR7A 4BNMA 1MB4A 1Y7PA 1UL1X 3VKGA 2Q9BA 2D5LA 3F78A 4KQHA 1A4RA 3ZIAA 1TEHA 3I8SA 3R7WA 4Y2XA 1ONOA 4BNFA 1ZUWA 3A1WA 1HGXA 4RGBA 1Q0PA 3T7IA 1KXJA 3PNVA 4FR2A 1J56A 2C0QA 4HWRA 3C4QA 3TD6A 4B2PA 1QIIA 4CLXA 4ZK6A 3EA5A 1HOTA 1NBME 2YZKA 3WZ2A 2QU8A 3H5RA 1FFEA 2B21A 2ZAMA 3A70A 3G7UA 4IW3B 4JEHA 4KE9A 4TS3A 1SEVA 4NEHB 5T8KA 4OXXA 3ZK7A 4DLXA 2GM4A 1C8BA 4UEOA 4ERNA 1N6IA 1WCYA 3R6LA 3ROGA 4IHJF 3FUVA 3KDAA 1NP3A 3RVPA 3FHTA 2X4LA 1RABA 1ZOSA 1O94A 2O52A 4IGKA 3FHLA 5JSYA 2HRZA 1TAUA 5ESRA 3NVMB 1DGQA 3WLNA 1QZXA 3BORA 1W0KD 3FM9A 3HWRA 4PE5B 3C85A 4PU0A 4PS1A 3EZ2A 3MTDA 1FUKA 1EDZA 2YIDA 1CUEA 1JNYA 3AUFA 4IDNA 4OLHA 1B93A 4LJ9A 4OJNA 4YS6A 5IYZA 3C24A 4NULA 1UAYA 4WKOA 4XX1A 1THGA 2R68A 1QHEA 2O06A 2OAQ1 1XD2A 4D0NA 2UUBB 4PNEA 1DC4A 1T36A 1ZVJA 2HLHA 2XHEA 2Y1FA 3A4NA 4V0SA 4J4TA 3VOBA 3IBTA 2H2HA 1MO5A 1KL7A 4JX8A 1AGNA 3FGPA 2GZRA 3PPIA 4MTCA 3LCJA 3OEED 4X85A 5FEMA 2J5KA 2POCA 2P67A 1QF6A 1D2HA 2HA6A 4J2TA 1U6JA 1LK0A 1RHKA 2ILVA 4RIGA 3T35A 2J45A 3KR2A 4YFYA 3MWFA 4OATA 3EW9A 1NJFA 4CKBB 2PSJA 2FPUA 2MMCA 1DG9A 2A30A 2DYKA 1XYYA 2ZB4A 2ZRQA 4NH0A 4Q9KA 2OENG 2IU0A 3CRRA 3G85A 3WMEA 4G09A 1A4XA 1E58A 1JQLB 2GXUA 2Q5CA 3BGIA 2I1VB 4MKZA 3ZDRA 4EI7A 1UEXC 4BP1A 1GUAA 3DPUA 1Z0IA 4YECA 4OJMX 4E3WA 2OM6A 3M6AA 2XGOA 1N9KA 1XQYA 1Q1ZA 2HSZA 1NW9B 4IDDA 5DW0A 5HW0A 3CVUA 2OD9A 3LUGA 1JIUA 1WB6A 2R6ZA 3VZSA 1RWVA 4CM9D 4GOXA 2ESRA 2QAIA 2VYQA 3FJ1A 4GQAA 4JIMA 4NU0A 2O7RA 1AZSC 5TPWA 1FU4A 1KRWA 3PNLA 1DC6A 2DQKA 1TC2A 2A88A 1T5IA 1YB6A 2WIGA 4KX5A 5LMNB 3FROA 1RAAA 3BFVA 3SHFA 2GF2A 4GZLA 4LDPA 4WZBA 4C7OB 3T15A 1Q0ZA 3ICQB 1JSZA 4JEIA 4XWAA 2IYPA 3FI0A 2FLKA 2GZHA 1ZIDA 5DLDA 1ECBA 3NBZC 5TQJA 3FN4A 1JB9A 1KZ9A 1FVFA 5JFGA 1YA6A 1EK1A 3L7AA 1K2WA 1NUHA 1PJ4A 4G5HA 1ZH0A 2XX3A 3LCUA 4ZOAA 1JNXX 1O5TA 1X70A 4AUMA 3MJCA 2OCAA 5SZKB 4INZA 3F6YA 1QGOA 5A4IS 5JLJA 4ZEVA 2PG3A 1MAWA 1NONA 1UFQA 5H9VA 3UZUA 4AFNA 3C8HA 3IELA 3E84A 4U6NA 4D98A 4Z4QA 3AL0C 3R9XA 1CETA 2VSYA 3HY6A 3A0UA 1GKKA 2LV8A 1RZUA 4WUTA 1FTSA 1ZCFA 3A3YA 3FWHA 2O07A 5HTOA 4PM4A 2VUTA 3KOZA 1L8OA 3EQZA 4ON9A 3AF2A 4ZVNA 2E4VA 4HF7A 1ZESA 4IBOA 3WLOA 4PCAA 1PK9A 1QSGA 2ZI6A 2XA9A 1ZVQA 2E21A 3THRA 3TS1A 1CJBA 1J8MF 3FY4A 4TWJA 3DYIA 4A6PA 3EWAA 3WJ2A 3ICOA 3CCFA 3PDWA 1IPFA 4D97A 3QVOA 2BWJA 4YJ2B 4CKEB 5B58C 1ILWA 4UUMA 1TAQA 2ROQA 2VH5R 1ESCA 1QFMA 1K4MA 3E9ZA 3PT5A 5AI0A 2AMYA 4DG9A 2XVXA 1I7QB 1VE3A 1S3SA 2YV3A 1PR2A 3C8ZA 1LKZA 4Q4AB 1QTNA 1ZK1A 4RD6A 1XDWA 2X58A 2QHXA 1GRVA 5IZCC 3DMFA 3P5BA 1XU9A 3QZUA 4MCIA 1KAHA 3SJUA 1GAEO 1CZOA 1YB1A 3K5IA 4Q3CA 3I9NA 5EWMB 2GA9A 2TMKA 3K1JA 5TY0A 1I3KA 2UVQA 3ZU5A 5ALUA 16PKA 2ZB8A 3I6QA 1ZGJA 4LY6A 2GPSA 3CJTA 2IYYA 1KEEB 2HA0A 3AKEA 4ND8A 1OXUA 5JS6A 3SSNA 4JJ8A 1Q7EA 5AKZA 3WIUA 4YRMA 2SECE 5HJ7A 3LD9A 4X3CA 2Z5VA 1M2JA 2I4RA 3LGSA 4N82A 4R2XA 1BQEA 1IWPB 3AXSA 1N78A 4KIUA 1OUMA 4G0ZA 4YUZA 3DGEC 4GPTA 5CK4A 4N3CA 1XQWA 3GPBA 5L6LB 2B1QA 3VPSA 1O9BA 3FLEA 3D3WA 3BSSA 4UARA 1V25A 1ZMXA 2DQ4A 4MS4A 4RF4A 2ZJYA 4WMLA 4EARA 1AA6A 4MDEA 1WVIA 4N65A 1T35A 4YYZA 3LZCA 3G5LA 4P93A 4BMNA 2VZLA 3I8OA 4K0RA 2H07A 4U3JA 1WTCA 2Z1DA 5DP1A 1A9PA 4J07A 1JG1A 1HEYA 4U9HS 1YDWA 4KWIA 2Y1KA 5FHRA 1OIVA 1M34A 2VWHA 3IFSA 4MH0R 4NOMA 2ZULA 4XWWA 1P1FA 2JARA 5HBGA 4HQLA 1GGJA 3AJAA 3PFIA 3RSOA 4AD8A 3AR9A 1Z9BA 2JIZA 2IXGA 2QTHA 2XUIA 4LRYA 3R7SA 3V8NA 3ZQJA 1QYXA 2GF9A 4KR6A 3WICA 3ZWMA 4YRPA 5FDFA 2J0UA 1R0SA 1YA8A 2YN0A 3EQ6A 2VPIA 1EFRD 3ENZA 4RPLA 4XDHA 3OIFA 4NIMA 1HFEL 4B3HA 5AQ1A 4M7OA 3N5KA 4BDSA 2ZI5A 4U7GA 3QBTA 1H66A 4YMUA 1JHQA 4MRVA 3Q7SA 4Q82A 4XDYA 3WTBA 4QUDA 4K6OA 2WF6A 2QAGB 5BO5A 3QUBA 2P7HA 3BXHA 1EWTA 1R4MB 3KHSA 2VHEA 5FI1B 3AKYA 4EUKA 3FOBA 1KI8A 2AR0A 4HMQA 4JSTA 4Z1MA 1N33B 5IDXA 2JAOA 2YVKA 1O54A 2O3UA 3STVA 4FOLA 2BBWA 3ZH9B 2BFCB 4B6FA 3GFPA 2XTNA 4WESB 4DLYA 5BRAA 4OCZA 4F86A 4OK3A 3KWFA 5I51A 5DNYB 5KAPA 4DV1B 2FSGA 3O21A 4TUYB 3LH5A 1R64A 4U7TB 1GNQA 3QKWA 2GCEA 3MMZA 4TMVA 3DBLB 5J63A 3AEKB 2ZTHA 3PX2A 5G4LA 3R20A 1ZFNA 3DVRX 4Y6QA 1EVEA 1XA3A 4WOJA 1HZJA 1PTKA 3B12A 1JU4A 4QGSA 5HIMA 1XAGA 1AT1A 3KJGA 1QO9A 1N1DA 3FOWA 1Z4QA 3OLXA 3RFCA 1B23P 2BIFA 1UP4A 1JZQA 3SJ7A 2P9QA 3QLUA 5KJCA 1KQGA 3ZE8A 4BNXA 1BDHA 4JJKA 4FD2A 3U81A 4ZVLA 1MEJA 1BYIA 1TT5B 3V7FA 3DL2A 3CRNA 4A36A 1VC2A 1GGFA 1MU0A 2CEAA 1J6UA 1T1SA 1V3QE 3QVSA 5ALWA 4WV3A 5JS7A 1I0IA 1WXEA 1PWZA 3VR5D 2B8JA 2QF7A 2DC1A 4HXFB 1FDVA 1IY0A 2GM5A 2B92A 4U7DA 3T7DA 1YZLA 3I23A 5LQUA 1AKEA 3EF0A 4XGRA 1N5KA 1DUIA 2I8LA 3UJ7A 1TCAA 1O95D 3ZVNA 4JLSA 2QGFA 3FWZA 3IOYA 3RYTC 2O54A 4ZT5A 2Y27A 2X9VA 4GF5A 1FUEA 2I3AA 2A86A 2ONCA 2ZYRA 4M89A 3INRA 4Y2GA 4AICA 2CXRA 3ZV5A 1NW7A 1MUUA 1UXKA 4HDSA 4ZJYA 4FX5A 5KNBH 1XTBA 2GEFA 3JWIA 4ZTUB 2A7QA 4GSKA 1LRJA 3TD2A 5FOUA 1RE1A 3E3MA 2C8KA 2GRJA 3QTBA 4AS3A 1C9KA 3HB4X 4O4IB 2IPLA 2WU3A 3SZGA 1E6UA 3E9RA 3W9UA 1M74A 5E1OA 2N47A 1SQ6A 3IULA 1DKPA 2OXRA 5KSYA 4INOA 3WSTA 1COWA 4PSKA 2C5GA 4RDXA 1CNFA 4D9FA 3HHPA 3X44A 3SIRA 4Y2TA 1UK8A 2HO4A 4X6XA 4WDQA 3JTEA 4ZZ2A 1ADGA 1IZ7A 2CL7X 2G1JA 2VNKA 3EJ6A 1X1EA 2QLLA 2QWXA 3FUCA 1KI2A 3QEMB 3HXTA 3QNWA 2JLUA 3SQDA 3AB3A 3KQOA 1DARA 3ID6C 1WJGA 4BB5A 3SC3A 4B7ZA 1JWLA 4YV2A 4ARCA 2CNKA 1KNQA 4DMFA 1X7ZA 2HPVA 3NGXA 3W3AH 1QX3A 2ZTVA 5LDHA 4L4YA 2XDQB 4YT2A 4LNUB 5DSXA 4JX9A 1B0PA 1XZHA 4R83A 4Y6RA 3H5VA 2V8BA 3L8EA 5IXJA 5K2OA 3BSWA 4A8JC 3K9LA 4KQ2A 4PC2A 1MVLA 3QFSA 4X00A 3ZWXA 3CQ9A 2AN4A 3PXDA 1T2AA 3NEAA 4LC0A 5HIJA 1P75A 4RU1A 3W4JA 4ASUA 4JYPA 5CX1B 2GUGA 1NJ2A 2I62A 4ENSA 1TMGE 2I33A 2QLJA 2PM8A 1FDRA 2AJTA 4MUGA 3ZY5A 3ZI0A 4D0LB 2QN2A 1WUJS 1QCYA 3JQAB 5D2CA 4YA6A 3AL3A 1BXGA 2ZWVA 1JDTA 1V4BA 5KMGA 1BJKA 3E81A 5BSUA 3KZNA 3AI1A 5CMLA 5EEHA 3KOXA 5T57A 1XZGA 5ITVA 5F3DA 5B4UA 4QICA 2IA5A 3QVLA 4G86A 3WYAA 1ZITA 1UXOA 2C82A 4B2YA 3EVFA 1JQ5A 1KMIY 4YAJA 2CNNA 2C8LA 4JT9A 4LMAA 4AKGA 3BMQA 1ADCA 4K9QA 2QE6A 2O2DA 1HTBA 2VT2A 4NSNA 3I04A 1J5EB 1GEEA 2R7KA 1E8NA 1K97A 5AJWA 3ZZUA 3BERA 4AJKA 1MC1A 3PGVA 1D4AA 1T6BY 3U4GA 2B7LA 2OVFA 3TQIA 5CEEA 1OI7A 3MRTA 1LVGA 4E70A 3C3JA 1PT6A 4LHSA 2AUTA 3R5KA 1BH6A 1OGJA 1UBHS 1VSUA 4I9GA 4C7KA 2PLAA 4F4JA 4LWOA 1YJXA 4ZAWA 3WYGA 3UGJA 4RMGA 1ZH2A 3GA5A 3EC1A 2UYGA 2X8JA 4GVPA 1UINA 1KU6A 3PQ4A 4EHLA 1OAOC 2C4TA 3BD6A 2C9CA 4QATA 2GASA 4RCZA 3ZY4A 2H1FA 4I3FA 3NTUA 1OPRA 5K8UA 3U5ZB 3G5TA 1SUPA 2D6FA 1N6HA 3U4AA 2UXCB 2FA9A 2BLLA 4BHTA 3E27A 4IINA 4IIXA 5TF0A 1EB9A 1GSOA 1RYHA 1WXHA 4W1RA 5E6UA 4HPWA 4UEWA 5EIXA 3E7XA 3NHLA 2O8BA 1RJEA 5D8DA 5C37A 3TVYA 1X1AA 3F1LA 1P2UA 2EFJA 3L1HA 3R5TA 4B6OA 2WAYA 1DJNA 1YDMA 4CEJB 1CUFA 2F8MA 4G67A 1Z6ZA 2B4AA 1ZGHA 5K0GA 2B4QA 3K92A 5ECWA 2W83A 3UW1A 4EY8A 5CITA 1KPIA 4G36A 4IJ5A 1EGVB 1NW8A 1AHPA 3SK0A 3CONA 9MHTA 2E55A 4FI3C 5K0CA 3ZI4A 2W42A 1PVVA 3JQFC 1QHIA 3P9XA 1UBFA 5LOVB 2CUNA 4MRAA 5H80A 5CB4B 4P0QB 4OSOA 3QELA 3UJBA 4QHTA 1E7YA 4QGBA 2GJ9A 4D4IA 4YCMA 1Y80A 1J09A 3JASA 3CPEA 3ORSA 2GK7A 5AWFC 3IVRA 5AVSA 2AHRA 3VPFA 1Q3KA 3IPLA 5J1SB 4YI5A 2WYWA 3SLKA 3I52A 4RIIA 1JLSA 2AVNA 2FZ4A 2JGDB 1HLFA 2DWPA 1M8GA 2Q6LA 4U2EA 5A71A 2JKVA 1WBBA 3EUAA 2NW6A 2BMEA 1PIWA 1WHSA 2BSAA 3GVCA 2UZIR 4DYVA 4JYAB 5GZ3A 4DR6B 3I12A 4AUNA 1KRXA 3IP6A 4N12A 3KT8A 4UNRA 4LPKA 5DRTA 4MVXA 1W4CA 3S1AB 5FPKA 2G3YA 2H2WA 4LE2A 5ICCA 1Q7GA 4YGXB 1UJ4A 5CA0F 2JG3A 3JZFA 2GK3A 2N42A 4PAQA 1WOMA 1OLUA 5AHOA 4MVJE 1U2QA 5C32A 5C81A 1M1ZA 1P0CA 3KWLA 1SRQA 1PDOA 4M54A 1JR3A 2WVAA 4DSAA 5IT5A 1H2WA 2RJOA 4F60A 1ABEA 1J49A 1YQDA 2A5FA 1JEYA 2G71A 3JD3A 5HQTA 5JD3A 2H5LA 1SCUA 1W93A 1JWBB 3ZDZB 2PVCA 1QCZA 3NH6A 1HI9A 1E7MA 3VPGA 2AG1A 1SD5A 2H8KA 5DI3B 3WSVA 4BTVA 1U3CA 3ZG6A 2VPPA 5IG2A 2NO0A 1XE3A 2BKLA 4J7AA 4J6EA 1YZNA 4X1YA 4C4PA 1QZTA 4CGZA 1UBEA 5TQVA 1ODJA 2C42A 1II9A 1O9HA 1A7JA 3D8RA 1BD3A 3FWNA 1VJ5A 1AX9A 1H8ED 1TJ5A 4P4LA 1QHGA 1RBZA 1KNXA 4RD2A 4NZNA 2NP7A 1DXYA 2F43A 5C8YF 3UXMA 2RK6A 2J5RA 4UBNA 3ZGXA 2WC1A 3C7TA 4I55F 5BUQA 1JLHA 2YICA 3H2HA 4GWLA 1Z5UA 1BU8A 4O8CA 4RKYA 5MF6A 1VL0A 4OUDA 3AK4A 4JJ6A 4IXWA 1U9ZA 1ZK2A 4R1MA 1B7GO 4O4LB 5LA6A 1A5TA 2AX4A 3BB1A 4EYEA 2QW8A 3H11A 3M81A 2Q7XA 4E03A 1IVSA 5JMWA 4AX8A 4PTYA 3BSYA 3VSAA 4YRZA 3GCGA 2LE0A 3D6VA 1ZM9A 2JCYA 3DR3A 4HVAA 4CM8B 3E9EA 2CEKA 1T15A 1DS6A 3RUHA 4BO5A 4DMCA 3FYCA 3UXEA 2RGAA 4I1RA 3EE6A 1YDHA 1WA5A 1Z68A 2CK3A 1LBHA 4ND3A 3UMGA 5K2MA 1QG4A 4BO7A 1F06A 5FPQA 3H9JA 1DP4A 2VCEA 4E14A 1G8YA 1X9IA 3F97A 3CVJA 3HV0A 5LYJF 1BS9A 1RQ7A 2H1CA 4ARAA 1VL2A 1DEXA 4J7UA 5DSZA 5FORA 3B7GA 5CB0A 2XXAB 4PGFA 2YY7A 4NBWA 1QVAA 1H0HA 2I6TA 4C6HA 5AW6A 1YJ8A 5K3SA 3BFKA 1GN9A 3B85A 3DKPA 2V0CA 1HRKA 3K09A 3GLSA 2MYPA 1P19A 4OJYA 3VXKA 3BULA 3C7AA 3F2IA 4KOEC 1TZ2A 2EBWA 4UFOA 5JTUA 2ODEA 1F60A 4MQEA 4O08A 3EZ9A 2YV5A 5CXUA 4WXHA 5A5EA 1MJFA 3B7PA 1OFUA 4BJ3A 2GZ3A 4LSGA 1UDRA 1MJGA 1DCKA 5EESA 1X7YA 3F7NA 3EVDA 3L02A 4KV7A 4QAQA 3U17A 1G19A 3PHJA 4A4DA 4D46A 1QYCA 1W85B 4IDHA 5BR4A 1QIHA 2NTYC 4RH3A 3U44B 1M2OB 1XPUA 4GZ5A 3FKJA 4UTNA 2M32A 3JYOA 1KDOA 3NMUF 1LWNA 4Q34A 1G21E 2J87A 3FTDA 4FSHA 2FAXA 3UAWA 1ORHA 3ANXA 3P8ZA 2UVPB 2H11A 5DGTA 4CQMB 1JQAA 1YR7A 3QNMA 3FOAA 1R74A 4A8TA 1UDCA 5KCZA 5EI5A 3EZYA 2B82A 2G08A 4B0OA 3PWSA 3JQ8B 2AZXA 4K81B 2BEWA 1ISHA 5SV2A 1YB4A 5CVUA 2I9KA 3EGXA 2I6UA 3DKIA 1X7XB 4PPYA 3PJDA 1FS4A 4L8GA 4PZZA 3DEAA 3G8CA 2ZI3A 4O2BB 3FB4A 3KU1A 1KY2A 4EOGA 4GM4A 4YJ3A 3ZDEA 3R9XB 3IKJA 4IFBA 4OHZA 4B4UA 1F0YA 2FGJA 2FQQA 3SXUB 4LJSA 3M6FA 1DJLA 2XT0A 3ENNA 5E9AA 1R0XA 4PX3A 3V42A 1EYZA 5D87A 1YRWA 1N1MA 2XKBA 3NM4A 3HA7A 5JY1A 5K0ZA 3LQQA 3Q3IA 4H6PA 4L5IA 4K87A 1M0WA 1PJRA 2YHBA 3E22B 3A06A 4DQDA 5J58A 4M1TA 1ISRA 3K5PA 4IUDS 2QZJA 4X1IB 1DELA 1CQJB 4GPEA 5K4HA 1YE3A 4C0HA 3N0VA 2FEXA 4XAQA 2XQJA 5ALDA 1NJ6A 4Z6KA 2EP8A 2Q5EA 4CIDA 1L5QA 3RSQA 3WGNA 5HFJA 1YKSA 2P5YA 4H7PA 4LZNA 3SNHA 4J0FA 2Y71A 4P54A 2P4QA 5FH9A 1QG0A 3T7AA 1OILA 1W9MA 3WYCA 1HLDA 3ZXUB 5LXTB 4EFMA 1IVNA 3OT1B 5GPBA 4BTLA 3QUQA 4I46A 4DY6A 1FIUA 1PO7A 1RLOA 2VAXA 2B4RO 4IV0A 4KBFA 2W70A 4DY4A 4G9BA 5JRZA 4TN1A 2ZYGA 4ZREA 5AM5A 5EERA 2EKPA 4AYXA 3STXA 2V6BA 2ZIUB 4RVFA 3ZBQA 5CFOA 3SGLA 4V1CI 4I2VA 5HJEA 5E0KB 1GNRA 1HY3A 1Z5NA 1ZNXA 2GNPA 1Z36A 3CZ5A 1LBIA 3M3PA 3AVVA 4OAOA 1CEYA 4US1R 5L4NA 1CHDA 4KN5A 5KHAA 2YXEA 4B45A 4OA8A 1AKQA 1MORA 1E1CA 1MAAA 2VDKB 1P3Y1 5B1HA 2XB4A 4WN9B 2HPHA 4A9AA 2A2ZA 3CE6A 1OLXB 3AJEA 3FYUB 4ZQIA 2MHCA 4UNNA 5IN5A 3LRTA 1BKSB 4RVHA 3Q40A 4FZJA 1EUCB 4MGEA 6PFKA 1U8XX 1R1DA 4UKDA 2QMQA 2WKQA 1TCCA 4DJFC 4PLCA 2MYUA 1Y3IA 3DG9A 3GRPA 4J1TC 4KXUA 1FQOA 2IW3A 3FRIA 4CMEA 4KH1A 4N8EA 1H05A 3R6GA 1RPJA 4PONA 4TVKA 2V55B 3H9GA 3IL2A 4GP7A 1NUAA 3RJMA 4ISBA 3GPCA 3AWIA 4HQFA 4JVLA 3K6RA 1I3MA 2R8PA 1Z4OA 3F9CA 3FNEA 4ZYTA 1KJNA 4LYFA 2AC2A 5AXCA 4PC6A 3CJQA 5DBFA 5C8ZA 2JD2A 3C6MA 2QM0A 3FI9A 3JAWB 5JPDA 5CH5A 4HVCA 3CMCO 5LU9A 3CLRD 4IHJA 4QYWA 1N6NA 1RKQA 1NF9A 1QQ6A 2XIJA 5CTAA 1L4UA 2W6CX 1FPMA 2GJSA 2HMAA 3OQIA 4EJSB 4PHFA 5JBQA 2ZXFA 1SZDA 2XAAA 4PXAA 4QL3A 3ROXA 1NVBA 5A5VA 3CG0A 2VWQA 3CW2A 3IAS6 2PGAA 3B1ZA 4ZWNA 1Q21A 3MVEA 5A5FA 2R4UA 4S1TA 1YU6A 2C2BA 4F2WA 5IZCA 4EK9A 3AFMA 1JS1X 4K6FA 1LLDA 1BCRB 4PPGA 1GLGA 5CLJA 2CW5A 3ZQ6A 2JATA 1J5XA 3I3SR 3LNCA 4ITVA 5FHQA 1D6NA 2MR6A 4P4SB 2MYTA 1XRMA 3SQOA 3MJHA 3G2OA 4B6RA 4BJ1A 5I4CA 1W6UA 3KOYA 1GEGA 3DKKA 3MJFA 3I9V6 3SFVA 9ATCA 2WSBA 4D4MA 1IIRA 4GE0A 1I4LD 3A3OA 4EHJA 1Z4JA 4UMVA 3D5QA 3B6JA 4BAUA 3GLIA 1Q0RA 3JRWA 3RAFC 4NICA 5LZ5A 5J47A 1HFJA 1DBWA 1JYFA 2ZJFA 1C3LA 3CX6A 3KOMA 1H4QA 4A92A 2G7MC 3KZXA 2ICAA 4RA6A 1VIYA 2VBGA 1QHHB 5F7XA 3GLGB 3B5JA 3H87A 3OTQA 3O4VA 4HHEA 5E9QA 5CVVA 3UH0A 4BL5A 2IH4A 1VMKA 1DEAA 1JPUA 2IW1A 1EBFA 1E63A 2QN6A 3HUTA 4HWGA 1C0KA 1CFZA 1KXZA 1VGVA 3X1MA 4YDSA 5DB4A 4YP7A 4LSZA 3DOIA 3SC2A 5HCIA 3RBXA 1WQ1R 2GYYA 3UMFA 1UWVA 3ABZA 2BKEA 2FMUA 2IYQA 4KAJA 4Y67A 4H2DA 4V39A 4WASA 1AK9A 2WRZA 3IB3A 2V03A 2X86A 2RC5A 4FDVA 1P0FA 1RLJA 3WKDA 4BVAA 5BR1A 3ROEA 3CZ9A 1O57A 3LBNA 4YUVA 3BN3A 8OHMA 4B6QA 4H1VA 3VJLA 4BWGA 4IJ6A 4WLUA 1LQTA 3ER6A 2LCIA 2Q7OE 3WGTA 3OIUA 5EIBC 3CIFA 3RUEA 2YHAA 2O8FB 1JA9A 2IYZA 2PKQP 2CZQA 3QOWA 4WNYA 4XB1A 1G2PA 4Z4FA 4MICA 2G8LA 1OWLA 2P11A 3LUPA 3DTNA 1GL9B 5AKXA 3D64A 4K46A 1BX1A 3L6EA 4V0QA 4Z9XA 2X0DA 3H5TA 3T4PA 3TEJA 1XTTA 2E4UA 4ACAA 1GUDA 1RHJA 1MC4A 1KU0A 3EVZA 2ZYHA 3HJRA 4J1SA 1Z07A 4KMOA 1T9BA 4L6AA 4Q9NA 1X7WA 2IS4A 2DLDA 3TPFA 2CV2A 2JFOA 1BKYA 3X1YA 5HOEA 2HH9A 1KTIA 4D9JA 5JCJD 5FL3A 1UC4B 2QN1A 5AW8A 4BXOA 1R5OA 1Z0KA 4C20A 6YASA 3OKPA 5BWNA 1SK9A 2JBAB 1UBUS 4KUHA 5FUBA 3VDNB 2O2EA 2WTMA 4U02A 4AY6A 5EGNA 2PVPA 3KJHA 4QU5A 4P3YA 3DZGA 4KPFC 1HT3A 4QREA 1RI1A 4PNHA 3JQ7B 5LMZA 3GH1A 1Y8QB 2EC5A 3EVEA 3OZTA 1JQJC 1GT91 1RC8A 2EAUA 4IS3A 5EXEA 4WERA 1Z3CA 4TQ9A 3B1XA 4IOMA 5E4FA 4LFCB 5BYKA 1DWOA 4D9IA 1KMHB 2RGCA 3DMRA 3QSGA 2GB4A 3U39A 1GILA 2I4TA 1YTLA 4OXYA 5ALMA 1XFDA 2FSIA 2B7BA 4MLDA 4YAUA 3PDUA 1D2MA 4F72A 5ALXA 4TXLA 4Q7QA 1O08A 2PX4A 4AO7A 1YQGA 3GRZA 1R6BX 2XODA 5I5GA 2EG9A 3BRWD 3W6ZA 1DMSA 2VWGA 4BIIA 1EB8A 2XAUA 1CUVA 2P91A 3BB3A 4PYOA 3K0FA 3AVTA 3BFPA 1NLMA 1KOGA 2NXNA 4L5YA 3W2IA 4F5DA 1Q57A 2A1UB 1W0CA 2QQFA 5DGDA 5EINA 4ER7A 3G2JA 3OX2A 4CG0A 1XO1A 4C0BA 4C7BA 2BKXA 2F9FA 3D1JA 3MD9A 1SVKA 2P9YA 1SXQA 2OA0A 5IDVA 5H81A 3MERA 3V4FA 4LJYA 2PMCA 5K8LA 4B3MB 2XUDA 2PR2A 3GCZA 1E60A 2GKOA 1DJQA 3I2FA 4GE3A 4MUKA 4ROSA 4E09A 4PX2A 2H7XA 2ZI4A 1VXRA 3WRWA 3WQHA 5A06A 3X2SA 1KQ3A 1P1KA 2B30A 5LMUB 2D13A 2ZBDA 3KPWA 3SSAA 3TOVA 3W9YA 3PKJA 4UBMA 1D7OA 3AINA 3OMXA 5AVKA 2WKWA 3AYXB 1P4GA 2B5VA 2FP4B 2I7VA 4JBNA 4TN5A 3HG7A 2CVZA 2Q6TA 4RQAA 2D1YA 2GM9A 1NFFA 1YBMA 4J0DA 4LRTB 5AW4A 1IVYA 3T1QA 2HCBA 4MULA 1JYEA 1X1QA 4XFJA 5JD5A 2R1TA 5F12A 1BRMA 3DFMA 3RU7A 1AKNA 4H15A 5ELXA 3NBYC 3MPUA 1XTVA 2H85A 1RLMA 1SWWA 2A5LA 3HWSA 3L4BC 3E35A 1VHLA 1XA4A 3R6WA 3LMKA 4XWYA 4RVOA 3UF0A 4EA7A 2W8BB 1SA0B 1A9RA 1AVTA 4G41A 4EMUA 3NUGA 1XPJA 2P4HX 2NVWA 3ZR4B 4LNHA 3C8MA 1KQPA 1V8ZA 5M5BA 1XHLA 4AMGA 4FYXA 4E2ZA 3VYTB 2O2JA 4WBNF 4PZLA 4O4JA 4XGQA 4AXBA 2J0SA 1C7JA 4HNQA 3FGZA 4G5FA 4HC4A 2J6HA 3LUJA 1CJCA 2X40A 4LYJA 1TE2A 2ZUTA 2JFGA 5E2IA 5JT1A 5T7BA 1C1XB 1EE2A 4A0FA 4D3FA 2M1XA 2P30A 4ATNA 2P9HA 1G66A 1U2TA 1N2XA 2HQ1A 4YT5A 3RYHA 3W6PA 3F7TA 4U0JA 4RTLA 3KQHA 2OCKA 3QLVC 2FUG1 2FPIB 4O2LA 3F49S 4JHLA 1ST2A 3A6KA 5J2TB 3ADDA 1ZJZA 5H9WA 1IB0A 2FTKE 3MINB 1A9OA 5JZ9A 1ZW6A 3FSRA 3V8QA 5K4GA 4A7PA 2P6RA 1O97C 1TJPB 3B38A 2G0AA 4NPCA 4MYHA 1M2VB 4UULA 5LQSA 1NM5C 1RI5A 2DFTA 2EKQA 1QYDA 2VDOB 3REOA 2NG1A 5HCNA 3SF8A 5EUCA 4YP9A 4W63A 3TLAA 2XMPA 4LTDA 4CDRA 5ITZA 3ZD8A 1G55A 3Q3GE 1QVWA 6LDHA 5E3IA 1FJ2A 3VRHA 4HRYA 4GGMX 2RIPA 4LF9B 3WKAA 3LKZA 4ZYUA 1TNDA 2R1ZA 3ISVA 2OV4A 3G2HA 3PS9A 4TL9A 3RG8A 3H7AA 4ZVRA 1UPBA 4L3OA 1T0HB 2X9GA 3W5BA 3CT4A 3N6XA 3NZEA 3BHNA 4M0KA 1BWSA 4DA7A 4YRAA 2E5LB 3R7WB 4KR7A 1E6MA 1Z5VA 2MSDB 3I2YX 1G98A 1KR5A 5DM2A 4NNJA 1QLWA 4QC2A 5BRNA 3PUHA 4OKIA 3W9SA 2O8DA 1I14A 4RXTA 2QQGA 5GVRA 2I67A 4BX0A 3U16A 1MW9X 2J59A 3PP8A 3ZJVA 2YVQA 2RH9B 3EHDA 1FMCA 1QK5A 3C70A 4LYDA 3WGVA 1HH4A 4YRFA 2BGTA 1V5EA 3TQFA 2GYVA 2GT1A 4K6KA 2ZBUA 3PL1A 1E2KA 3DV0A 3ZW7A 3SKVA 2BF4A 4KR0A 4FINA 4TYYA 3KLOA 3U7JA 2OGTA 1GPDG 4K2HA 3CXRA 3I0MA 3H2SA 2B25A 5L53A 4ZOEA 1G8GA 1X8JA 1XWFA 2GVDC 3GD7A 3H1PA 3JQ9A 3NV7A 3PGXA 2DWUA 3GZTB 4HZIA 5DHFA 2CGEA 1O8CA 1HT0A 2F62A 5D3KA 3VO8A 2WOJA 4F2HA 1EVIA 3EJWA 3SEAA 3NALA 1WZUA 3D0QA 1KFKB 3K9HA 1I1OA 3L0DA 4Q66C 1WXWA 3UB2A 4QQKA 1P2FA 1W36D 2H4FA 2CL6X 2Y8EA 1G42A 1FZQA 1T9GS 1G1AA 2QL7A 3VNSA 4A0GA 2BEVA 4UNQA 3VJKA 2F2TA 2HSJA 3M5CA 5DXAA 4B75A 4M87A 3T3GA 2I91A 5DM1A 4MA0A 4RABA 3V1YA 1BAPA 2I1QA 3BL8A 2FMTA 2WBLC 4LCEA 3NIDB 1MDBA 4JT2A 4MV9A 1E9RA 4G0NA 4UFNA 3DM9B 3OICA 4RK4A 2DKFA 1DX4A 1YVDA 1Y3AA 3ACCA 4MPRA 4RS3A 2H7VA 4LKRA 4RTQA 3LWNA 3HYTA 3KL4A 3QE0A 5E0OA 5A3VA 3RSLA 1TZKA 1FDSA 3H17A 4WY2A 3WK6A 4PCVA 5BORA 2AFIE 1SKYE 1TADA 2CFRA 4HATA 3EMVA 4IQ8A 3C1TA 2HZBA 2QSZA 3N2LA 2B5WA 5J4HA 3W6UA 3T7TA 2IE0A 2V7EA 5DGIA 4ENVA 2V65A 4U00A 1Z22A 1HX7A 1DADA 3T3DA 3OQMA 4WZBB 4OH1A 3WRVA 5CXQA 1ADBA 4Z7QB 4W5RA 3LWZA 3RS8A 2FP3A 4FEYA 1SFRA 2IYNA 2QLMA 3BWDD 1UFVA 1B15A 3L7OA 1BXZA 1YU9A 3ZZ0A 5EZYA 3WAJA 4EF4A 4HDNA 3U4HA 1XCGB 4UU7A 1E7SA 1MV5A 1DIAA 2AMJA 2LNDA 3RSZA 5LPNA 2VTKA 3L8DA 4IIJF 5THXA 4UVIA 1WV0A 2IXTA 4ENTA 1U9IC 2XI4A 1F12A 3WWCA 4DEVA 3AKZA 2VJBA 3G17A 3WLFA 1MC5A 2R11A 3M9XA 1Z7EA 1Z45A 3QX9A 2J7KA 4G1EB 4J7CA 4ZO8A 2JDID 1U0RA 1H1DA 1Y8RA 2VJNA 4GT1A 1F5NA 5KUTA 3EVNA 4NABA 4TMZA 3FWYA 5FB3A 3GLQA 1Y7IA 3CHYA 1NSFA 1IBCA 1L5LA 4KE8A 3RODA 3EEQA 3TFQA 3B60A 2QG9A 2ZDQA 2RBKA 3Q7PA 3W5UA 5EYPA 4I1PA 1VL1A 3DO8A 5CFNA 3X0DA 4OBBA 2R7LA 4DAOA 3W8RA 1XD8A 2B2NA 3D6TB 5HKKD 3FHJA 1AQUA 1G20A 1S3GA 4N40A 1WF3A 1Y6QA 4O4HA 4CHTA 2ZU6A 2P2NA 1ONSA 4LAFA 4PRYA 1RHMA 3GLFB 1Z5ZA 1FPQA 1B8VA 1T1JA 1HBJA 3AFNA 4L50A 1RM5A 4WXRA 5FFNA 4OK5A 4YPOA 2C83A 1J8FA 2EF0A 4ETIA 2AI1A 2G0NA 3MGKA 1DB3A 2IYXA 3KQTA 3OO1A 3Q87B 2EF1A 2JAHA 2WA2A 1P33A 4Z8YA 4YWHA 2C4HA 3UJCA 3OZ7A 3BVPA 2ZS7A 1V39A 3CEPB 3FWKA 3IEUA 3PFHA 4AYWA 3EPHA 1H2HA 1H2ZA 2FUCA 4O0LA 2YWJA 1E2LA 4ONEA 4ZCIA 4CG2A 2REQB 3UMCA 1VIDA 4ND8B 2C9DA 3R76A 3RK1A 2IK8A 4JL5A 3UFXA 3JQEA 3G5AA 1C80A 1FFDA 3MF4A 3U9TA 3T6KA 4A26A 2ECPA 2ZSEA 3EPRA 3QOXA 4LVOA 3UUEA 4L73A 1YF3A 5I7RA 5TGTA 3P0EA 1IEQA 1VLVA 3HKCA 4QOSA 1Z56C 3E1GA 3GHHA 4XCQA 2Q5QA 2W2XA 1V7QA 1QC5A 2GZDA 3B7WA 5EVJA 4D41A 3UCFA 2X5OA 2Y4OA 4MS4B 4QA9A 3RD5A 2LKCA 2DT8A 2ZT6A 3O8CA 3OWHA 2G4VA 4JP1A 1RWBA 4ZT2A 1HYEA 4IL5A 5HKLA 3UKDA 1W44A 4RELA 5JFTA 2VP2A 2VWPA 1M34B 1P2BA 1P6QA 4RVUA 5EE0A 1F2VA 1LX7A 3PITA 1WVGA 2A94A 3S7ZA 1T34A 1XXHB 5CA1B 1Q0LA 4NXMB 4JLMA 2WSLA 3DMDA 3ZHSA 1XQXA 3AIOA 3PNPA 3I64A 2BZGA 2BFPA 3DOFA 2J0UB 3UV6A 3ZXYA 3JVIA 3MWLA 3OZRA 4QD3A 4FB5A 4ZDJA 1HXHA 3B3JA 4GOOD 3INGA 1JXQA 1RTKA 1LBSA 4A1FA 4EX6A 5C2JB 5IM4A 3U1VA 4K28A 1ECPA 1HT2E 4S05A 1MA3A 2ERCA 2PV0A 2RMKA 5K3AA 5KYUB 1L8QA 3G68A 5L40A 2P2SA 1L4HA 3S1LA 1TQ4A 5BXYA 1B41A 2JEYA 3BDIA 4GD3Q 4U8GA 3ADPA 2RCYA 2Y77A 4PLHA 3TFOA 4D9HA 2YZ2A 4UCWA 4QE3A 5BV2P 4HB4A 1LS6A 1C9EA 2BEUA 2QP4A 1O5IA 4FHDA 2CJWA 4ND1A 4BUCA 4C0LA 1VJ0A 3NM6B 5EJIA 3O3NB 4NHOA 4QUEA 4BNTA 2X14A 2D00A 2Y99A 3GFBA 3UXYA 2BW0A 2F6RA 3UPTA 5JANA 4OGGA 2Q3DA 1HSZA 3ADKA 1QH0A 3WMGA 4X3OA 1HTWA 5HMLA 1NQXA 1Z5OA 1L6IA 2B99A 2LDBA 3KU4A 4W6QA 4M0EA 4LG1A 4YCJA 2PQ2A 2EW1A 3HYLA 2QUHA 2J31A 2J9GA 2GBIA 1VG0B 4F38A 3DVLA 1FJXA 2ZB7A 4B4WA 4A16A 4IIYA 1U65A 3HVIA 5AKGA 4KP7A 2PUAA 3WO0A 3GNSA 4GKJB 3AHGA 2C7VA 5I7EA 1YCHA 4EPYA 5B55A 4N9QA 4TQUS 2BGIA 2ZJ5A 3IUQA 3ZZTA 4PVDA 3TECE 5KVQA 4O1MA 1FTWA 3PPVA 4GLOA 4EBFA 2QSJA 1TJ4A 1DTEA 3GLHB 3BMNB 4AUKA 4NH4A 2IEIA 4OKNA 2TRSB 5H02A 4ZQFA 3EPJA 1TVKB 4CV2A 3KTAB 4FJ0A 1FXSA 3DWGA 1DBQA 4JBWA 3T7RA 1TJYA 5JO9A 3PLAE 1RRPA 5ETJA 2XDWA 4E08A 3HXLA 2LD4A 4UVGA 5LQKA 5H1YA 2YIJA 1A5ZA 4J1TA 4B40A 3DBVO 5DKFA 3IA2A 3OCVA 1TOAA 4FMCF 1E1YA 2EGUA 4XSVA 1DOHA 3FDZA 2PA0A 4Q6BA 4XVCA 1EWRA 4MITA 3N2NA 4GPAA 4QEDA 1D1QA 1H2BA 2WD8A 5P21A 2M6KA 2OV3A 3MG9A 2J7PD 3WLTA 4EAAA 3E4CA 2FN7A 1W75A 2W5UA 1YQUA 3HCCA 3UMBA 4NP6A 4DL9A 5AIBA 3BD8A 3ZDBA 4A15A 1I0LA 1UT6A 2HF8A 3N86A 4IO1A 4PYJA 1RM4A 4FDAA 4MGKR 4R1QA 5C8YA 5TS2A 2H65A 3F46A 1JZSA 2C4NA 3BWEA 4NZYA 1JXOA 2E1PA 2VDVE 1XJQA 4M60A 3PX7A 4TSRA 5KZMB 1L5GB 4OYHA 5FWYB 2FRDC 3RS0A 2R97A 4MA5A 1QRDA 1AQLA 1SU8A 2O1SA 3U4QA 2IHVA 4BFTA 2ZWMA 5LU8A 2HNBA 3FUUA 2EZUA 1WOYA 2Q5OA 4CF7A 2XBLA 1UJMA 3DOOA 4WA8A 2H1WA 4DLLA 2HLDD 1OBOA 5DM70 1FBTA 4OQNA 3OE7D 5EP3A 3WHPA 1GPYA 4MKHA 3W2TA 3PA8A 4Q9LA 3N59A 3NRCA 4DJ5X 1JBQA 3IJ5A 2BI7A 1QYRA 1JU3A 1YJQA 4CCSA 2WKSA 4UVDA 1Z8DA 1E9DA 2BZ0A 5CT9A 4XIJA 4NYMQ 5C80A 1Q0SA 4RKFA 2DX7A 4QULA 2I2WA 3QUSA 4Y6LA 1Z39A 4P22A 2YJTD 1XPRA 4MP6A 1E2NA 3PK0A 4RPJA 2RGWA 4FB4A 3PLRA 1BH2A 1BXGB 2D1TA 2GGSA 2XMDA 3AVPA 3W04A 2ORWA 5TQ0A 3ROKA 5KMGB 3I39X 2WE7A 4MV6A 5FBLB 3EIOA 2REXB 3C48A 1CJMA 1GADO 3EDQA 3O7MA 1Z5GA 4NK5A 3TVDA 4YQEA 2FEMA 3T99A 4DNPA 5B4TA 4RTOA 1L0BA 3ZDDA 3BFJA 3IJPA 4TZKA 2A9OA 4W1SA 4XI9A 1O6CA 5ALSA 1OYOA 1HDOA 2G4CA 4Q9AA 5A6SA 2VS1A 5HMMA 2IHJA 3R9IA 3BMQB 5T3UA 2AXPA 3GD5A 4IIFA 4DQXA 1Q91A 5IXYA 5TEWA 1U7XA 1BOFA 1KERA 3EVGA 4KFRA 1E99A 2PSHA 4KQ6A 1MFPA 4KAXA 1MP0A 1GQQA 1PKEA 2G6BA 3CA8A 3PR1A 4OEHA 4QT0A 3H4VA 2FXVA 4LJLA 2XJ9A 3TQQA 1NVXQ 5EMKA 4PRLA 5KTNA 2QG4A 3FMGA 3ZDYB 4LYGA 1RADA 3A1UA 2FPGA 4L07A 1SIWA 2ONZA 4R0NA 1EFUA 1G8MA 1K8RA 2CYBA 3M83A 4NNPA 3V3TA 3U4MA 2AZDA 1HR0B 1IAVA 4HNSA 5DCLA 4ZCSA 3IR6A 5TGZA 3UQZA 4KFUA 1VLJA 1UPAA 3K2BA 3Q85A 4KE7A 1UFRA 4OK6A 3RYIA 2X9LA 3TYXA 1N6OA 5FA5A 1KEVA 3BHMA 3G6KA 5TMPA 5E6UB 4G2TA 4ARUA 4C07A 2XCSB 2OZLA 4MVJG 2FR8C 1P6UA 5BR8B 1JIIA 2AZTA 2Q4TA 2Q07A 1M10A 4UDXX 2GCNA 1SD2A 5CUQA 3AHCA 4E4RA 3USZA 1TKBA 3TG2A 1P9OA 1Q7RA 2NZJA 1TLLA 2FOLA 4S12A 2DQZA 5IWAB 1J21A 3GJ7A 1UIRA 1E3DA 2GERA 4LDAA 4DQUA 4MX8A 4AJEA 2PXHA 1JXAA 1W2HA 2EFEB 1LSUA 3HK2A 4NNOA 3AMVA 3G79A 4GXRA 2XMQA 1Q3TA 4WOBA 4BLUA 4O2AB 4ZTZB 2BONA 3T0GA 3RRNA 3TEMA 1DXQA 4DSZA 4EUEA 5FWXB 1ZD3A 2F3PA 2WK1A 2CMKA 5CD1A 2H0RA 1AO3A 2WVGA 3HYNA 1BXRB 4M8SA 2CNWD 1NHGA 2ZIFA 4CQJA 3ED1A 1TF2A 2KW5A 1S2MA 3MGGA 4G6ZA 4P9NA 1I4EB 3PQ8A 3OEHA 3P9ZA 4R1UA 5GONF 2J46A 1Q6YA 1Q44A 3H5OA 1LU9A 3ZLUA 1TA9A 4DBZA 1FK8A 5AW3A 2UYYA 5KS2A 2JW5A 4FONA 2NUAA 3K8YA 1IJKA 4H17A 1V35A 4KQCA 5AICA 3OX1A 5HE8A 3ZJ4A 1EMDA 3FTPA 1VE5A 4HFNA 3VZRA 1DAOA 5L9AA 2JFZA 3M3HA 1ZJ4A 4ZCLA 2AG5A 3HRKA 1N2HA 1FMJA 3DMHA 5DT9A 4A3SA 5JSFA 3O0TA 3A4MA 4YVFA 3JZAA 4EO7A 1SOWA 3S70A 1TQ2A 1MC8A 1PUIA 2NP6A 3HKBA 5IBQA 4CQNA 2PUTA 3TTXA 1KC3A 1MF7A 5DNAA 1AKRA 1CQWA 1GQFA 1R8XA 1LK5A 2HMWA 2HO5A 1E1RD 2DU8A 1EFDN 4AY5A 4F7DA 3HYRA 4QYIA 4X61A 4C5CA 1AGPA 2OGUA 1YRBA 3BXZA 1GCAA 1UBSB 1FX0A 2VAVA 3R0VA 4KYUA 1FRZA 5KYVA 4EB3A 2NO7A 1E9CA 2BHNA 1UJCA 1DBPA 2JFFA 3K9FC 1ZINA 1YRYE 2ZWAA 1P4SA 3EODA 1FDTA 1P1BA 1SCUB 5JNLA 3AY0A 2A0XA 1DEHA 1ONNA 3GDHA 2O4CA 5J4VA 1C2TA 2OCLA 3WB9A 4O1HA 1GAJA 2GEVA 1AHIA 5AK3A 1WD7A 4X63A 5KTOA 1TAHA 4X1YB 2ZOSA 4ZHQA 2C2HA 5U4QA 5DYGA 3MK31 121PA 3K5WA 1M9NA 2W2PA 4KXLA 1Z2CA 2EARA 4KG7A 4N18A 4NMXB 2VSOA 5ENDA 2ONJA 3GEMA 1KE2A 2C8JA 4HB3A 4YB8A 1RYDA 5JNTA 1CUBA 2QV7A 3ANNA 1E3WA 5E7MA 2F43B 3HSKA 3D43A 1K5DA 4F6CA 4NLLA 3OFSA 4NBVA 4I1YA 3FB1A 1K7EB 2HCTA 1QFJA 1V1JA 1YWGO 3EXFA 2AJLI 3HACA 4K03A 1NUPA 5IP5A 2WZDA 1L5WA 3K1TA 2C2GA 4ID9A 3SZUA 5LA6B 1MGPA 3V4PB 3BKWA 3SVTA 1N2BA 3P2MA 2IV2X 4CKCA 1FMFA 3R5FA 1ISMA 1IY9A 1J0CA 1MKYA 1ZN2A 3MLEA 3OUZA 1RDFA 3H11B 3ZHTA 1TEZA 4ND7A 1JPNA 3LLVA 4NV0A 2Q6IA 4KXNA 4MDHA 5REQA 1UBGA 4KKXB 5FI5A 1PNQA 3HB7A 1N0HA 5IT0A 2R4TA 5L7TA 1DKNA 3QPUA 5L95A 3CJRA 2PMDA 1R12A 4HNRA 4P3NA 1OF1A 1Y63A 3K2IA 1AKWA 3KHKA 3FPKA 3LVQE 4FFBA 3N7TA 3QLEA 2PANA 3TIXB 3UOAB 3VNVA 4IDAA 4FFNA 3JYPA 1JZTA 5DTRA 1YL6A 4ZZ0A 2O1WA 1B14A 5DM0A 4MWGA 1DDOA 3B48A 3NKVA 3IT1A 1U1EA 1LLCA 5CG2A 1B6GA 2AFHE 3DOHA 1NM5A 1OKKA 2K4MA 4I1IA 4J0EA 4TWIA 1UKAA 3ENVA 5EKDA 2RE8A 3SAJA 1JG4A 1XLWA 1MPXA 3OF5A 4JJZA 3BWYA 3F3SA 13PKA 4H0CA 3KL2A 1OASA 4OI2A 5TT1A 5A04A 3TRJA 5JJLA 3RSGA 4QECA 2AWNA 3FZYA 5JATA 4CMIB 4M9RA 4MEBA 1F0KA 4C78A 2MINA 2UUAB 1U8ZA 1RXYA 3UK6A 5FLXA 2VP3A 4CLHA 3ZD7A 5IJ0A 1DKUA 1I01A 4C0SA 1PZMA 1G8FA 1WULS 2R8OA 3GNQA 2GO7A 4HLQB 1BA3A 2D3WA 3FF4A 4V2IA 1DIRA 2C92A 3KD2A 4LI3X 3EEIA 4ZAXA 3QW2A 2Q99A 3LVBA 5JWHA 5TPZA 3DE1X 4HBGA 1EPUA 5CYPA 1X94A 1FJGB 1BE6A 2W6ZA 4DA4A 1D6SA 2O0LA 3EXHA 1JEAA 3OE5A 4ZVSA 5JDCC 1M66A 1CYDA 1YXMA 4M37A 2DB3A 3ZXIA 4LECA 1DXHA 3KEOA 3V6MA 3K0EA 4GI5A 2BEWB 4U7WA 4E51A 5CX4A 1KFEB 1LUAA 5AM4A 1VPWA 3JPYA 4MXDA 5KVVA 3B6EA 3UH1A 1J42A 1Z6GA 5H70A 4YJ3B 1T1GA 2SICE 1DO2A 4WINA 3G2QA 2FG7C 2Q5HA 1HETA 4HX9A 5A9TA 1B1CA 1EUYA 1DIHA 3N6VA 4B4VA 1ZGCA 2JHAA 2ZIEA 2FQXA 3M8KA 5FIUA 3BE6A 1AKTA 3AIIA 1NVGA 2F4NA 3I5YA 4RA9B 2GBCA 3W8FA 5L3RA 4EA8A 4Q7EA 1AUXA 1XCPA 4M3NA 3WS7A 3OKCA 4B33A 5IKEA 4F8JA 2P35A 2COKA 1MH9A 1JUDA 4TZ6A 3ETCA 1VDMA 4LOIA 2RH8A 1YAHA 4H7IA 4RKQA 3UA3A 4WBNA 1P81A 1JJAA 1PR0A 2OLKA 2GEJA 1I9CA 5DGHA 4UM9B 4HQRA 4GAEA 2FPWA 1O9GA 1LPOA 1KIAA 3HVUA 4HQ6A 2ZRMA 4AG3A 4P2GA 4B79A 2BP7B 4LZPA 4BX9A 3ZY3A 5G4KA 1ETHA 1KEPA 1XQ6A 2QRPA 3I4LA 1SO8A 1NI3A 3GUCA 4CTOA 2YYZA 3PXXA 1UFOA 1U3UA 2X6RA 3D8NA 3Q9SA 4WRRA 1W49A 2H51A 2QORA 2WIKA 1E2HA 2ZJ8A 1P1CA 3BE8A 3IIKA 5AMXA 5AVJA 4Z54A 4DTIA 4E88A 4ZFNA 1LF5A 2JGMA 4RTPA 3GRKA 4HNTA 3QMWA 4NOLA 1CJVC 4F3NA 1SURA 4DIMA 4L76A 2H18A 3GG2A 5T4HA 1D6JA 4EUSA 3DW1X 1Y1RA 2YWBA 3FVQA 3LGXA 3NAMA 4K1XA 3CRQA 4LRUA 4PZ9A 4BVGA 4MAAA 4RGYA 5E1BA 8ATCA 1E1CB 3QWHA 3ZXSA 2BJVA 2XUAA 3UAGA 3WKEA 4GS5A 2FF7A 3BXGA 4NDAA 4MI6A 1NG1A 2ORIA 2VRCD 3MTQA 3QMVA 3OCJA 4MKXA 4XUEA 2G8NA 2VZEA 1KVRA 1QIEA 1YL7A 2L82A 3I2GA 1G3RA 2J3MA 1ZA2A 2YFQA 1L3CA 3ETLA 3KKMA 5IARA 2A1TS 2QNRA 2I4LA 4CMGA 2PRYA 1ABBA 4B3CA 4OY3A 4ER5A 3H1GA 1ZSYA 1U9IA 2JHCA 2DVMA 2OCGA 4FFWA 1YHNA 3TPZA 4C2BA 3ITNA 2DOKA 3VX4A 1CZUA 1GV0A 2BFDB 2W2NA 2HK7A 2LZ0A 4HJXA 5AK0A 3R7FA 3AG6A 4PCLA 3PC2A 5F23A 4HWKA 2H0QA 4C4RA 3DT6A 3VR6H 3QEJA 3TINA 1DG1G 3PWTA 1OCEA 3A9TA 1FDIA 2UZ1B 3CPSA 3V1UA 4EG1A 1RWKA 1AN0A 1QGUB 1VE7A 3JD2A 4IHJB 4BKQA 4IWXA 4F11A 5DULA 4A6XA 5JD6A 5JOQA 3CN9A 3PFBA 1I10A 4TRNA 2H2AA 3JALB 2UUPA 4NWIA 1P0MA 1MD9A 2AYZA 3CNEA 4UMDA 4BUZA 1CK4A 4TQAA 2NMVA 3FTNA 2VJQA 2DCUA 3A6LA 3ZWAA 1A8QA 4BO2A 4ES6A 3HFSA 4OO3A 1YI8A 4URHA 2BM9A 4AC9A 1N2EA 1H8HD 4EF5A 1V47A 4NBNA 6REQB 4WNAB 3HM9A 4F9GA 4DDMA 3MHPA 5KAMA 3PNOA 4OFXA 3TQCA 2QL6A 4PLPA 2YY5A 1KOLA 2IEDA 3BGWA 2PXCA 1Z15A 2WW8A 3UICA 4DV3B 4CUKA 3RIXA 2QMYA 1FTGA 4JC4A 4FWIB 2IGBA 2ZB3A 3OZWA 2GD6A 5ADHA 1Q1EA 5CDSA 1UEIA 1T6XA 2AN3A 2WSSD 3QPWA 4CDMA 4XVRA 1PR9A 3RVRA 2HREA 4Q7KA 3WWEA 1TTHA 2G70A 4RJ2A 4ED9A 2OZEA 3GLIB 4L15A 2AEJA 1KOFA 1XN4A 3O4IA 4UASA 3EC7A 3R8XA 1A4UA 1G3MA 5IUNC 4FBLA 3LUHA 5TDHA 1V1MB 3U7GA 3KCQA 2V4MA 2XT6A 4EUFA 2G5TA 1JH8A 2GCIA 5CD9A 4UQLA 2Q4OA 2GETA 1AQ6A 2HU2A 4RA6B 2YC2C 4DCUA 3AB7A 1U5CA 1E2EA 1XXLA 2X1HA 1L7QA 4JFAA 3WB1A 2CLOB 3ZNPA 3UN1A 3PF9A 4OLJA 3JAKA 4M1SA 4HN4B 3BWCA 1DX6A 3O8BA 1H5QA 1SXJE 4JLOA 2O14A 1EBBA 1UFKA 3ANSA 2AF3C 3H13A 4M7RA 3GEPA 4Q1AA 3T9AA 1YS7A 4UCQA 4L08A 4PTLA 4C3UA 2NTVA 2AOWA 3OI7A 1ECGA 3LK7A 1E2DA 2DULA 4CDNA 3HCFA 1YZUA 4Q02A 4WHMA 2I5PO 3IE2A 4WKCA 3PFKA 3FBTA 4GOMD 4HLCA 2AD5A 4TMKA 4IICA 2GCOA 2ZJ4A 3GBSA 3SF0A 2VKTA 3QA3E 4OMUA 4UU1A 4J0IA 5CFRA 4HVTA 5KOJB 3HCWA 2VPQA 3OZCA 5CDGA 2P62A 1VBFA 1W73A 1E3QA 3Q7QA 3LL7A 4IIJA 4RJIA 4UCFA 2AGVA 1AQIA 1NYQA 2W4MA 1W0KA 1HEUA 2NQ8A 2ZAIA 1T6ZA 1KDYA 2WAXA 1U2DC 3AHEA 5TB5A 4DQLA 1X14A 5IAEA 4KGXA 4B2IA 4OHWA 1Z17A 2P9CA 4PG6A 5F9HA 3I05A 2HSDA 4C22A 4ZZIA 2B37A 3H5IA 4Z9BA 3AI3A 4DPKA 3VTFA 4Z3DA 2HLPA 1EM6A 1B43A 3CZAA 3NATA 4DLKA 4MQ5A 5DU2A 1J00A 2ZJ2A 2K2WA 1HE4A 2D2XA 1MIOB 3HJUA 4QU0A 1QGYA 4Q16A 4OBXA 4Z51A 5FUQA 5K01A 3E6AA 5CJJA 1WY7A 2BGLA 2O5VA 3TIVA 1YK0A 1QE0A 3CNOA 5I8WA 5FYDA 5AH0A 1V8PA 2RHMA 2D5CA 4ZIRA 1OU4A 3VNQA 3EC2A 2I3BA 1SOMA 2QRNA 1E6LA 3KKLA 1FYWA 3FVWA 3L0ZA 3IQIX 4X0EA 4CIBA 4YRKA 3L0PA 4D4GA 5KYGA 3MCTA 3ASZA 3I9OA 4DIUA 4GZMA 4CWAA 1W47A 2QM3A 3KFXA 4WZAA 5CVCA 2FKNA 1TZCA 3PJFA 3WLMA 2VI5A 3K0FB 3TLCA 2W6JD 4UXIA 4F4HA 2I71A 2QYOA 4HGYA 4O6VA 4KQXA 3LQFA 4QPJC 4CM9A 3Q7EA 2J1LA 3JD0A 5JAPA 4KBGA 1DAPA 2I65A 4A5SA 4PN3A 5IWCA 2NQTA 5AI6A 1IOLA 1I6MA 1JVNA 2GHRA 1DWPA 2ZEJA 3OSUA 3P2OA 1H65A 4BNZA 4TKVA 5JVDA 2JIDA 1UQRA 4H1WA 2KYRA 4MW1A 2OGZA 3BIOA 2DMRA 3PRYA 4D45A 1JP7A 1VG9B 4GR9A 3TGWA 1G3QA 2V98A 4FDLA 4UCXA 3SX0A 1Y8CA 3KKNA 3URKA 4QDUA 1PG5A 2Y1WA 4WGFA 1D2GA 1ELOA 1GG5A 2OAGA 3CLUD 3F5FA 3SYMA 3VDRA 1RRGA 3L40A 4FDTA 3FPCA 4HRXA 4KBYA 1YI1A 2H5IA 4L72A 1QG6A 3S4YA 1EH5A 1VG1A 2WICA 1CUAA 2R1TB 3GOHA 1QIKA 2WHYA 3N1UA 4RPKA 4D8YA 2N0SA 1BHQ1 2AKYA 4ARIA 2VRBA 4RZ2A 3PTLA 1RU3A 1ZOLA 3SBDA 2XDAA 3JQ6A 4D