3UVEA

Crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
TGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDLAETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMFHTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
molecule keywords Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uveA00
4CQLA 3JD3A 3PYXA 1T2EA 1E5QA 5JLAA 4RQTA 1N9GA 1DFIA 1KVUA 4OO3A 3C1OA 4BO2A 1UH5A 1MB4A 3CE6A 3E9NA 4GMGA 4NMHA 3MJEA 3AUTA 4PLTA 4JN6B 2E48A 2PTGA 2WD8A 2W98A 1O8CA 4BNGA 4CQMA 5KJ1A 1DLJA 3L6EA 3RUIA 4TKMA 2Q1UA 4F6CA 3K92A 4RPKA 3LVFO 1GYRA 3GFBA 4FJ2A 4MVJH 4MVJG 5JO0A 5T8KA 1UZNA 2GZ3A 4B3IA 3DBLB 1W4ZA 3NJ4A 3DOOA 4JLWA 3BMOA 4E6PA 3CEAA 1FDTA 1KIFA 4YAKA 4GKBA 3SC4A 4BGUA 1PZHA 3DMYA 3GNTA 1XHLA 1HLPA 1QRRA 3PGJA 4CMCA 3SBOA 2EHDA 3PJFA 4R68A 3DL2A 1LLUA 3N58A 4H3VA 4WLVA 4E0BA 3HFSA 1W0CA 2OUIA 4ILKA 4GMFA 2ILTA 1QYWA 5DULA 2VHXA 2CDBA 3WGYA 1PQUA 3BMCA 5U4QA 4RVSA 3FBTA 4NFHA 4B7CA 1UXGA 1VJTA 2GRAA 3AFMA 3AM5A 1P31A 1GYPA 5BSEA 1R0KA 4IDGA 4R51A 5AOVA 3RC7A 1R66A 2RCYA 3FR8A 2Y05A 5KJFA 3GH3A 5AXAA 5TJ9A 5A05A 1ISMA 4FFOA 3WJAA 4XDZA 3K31A 1P0FA 4QFDA 3TOXA 4JK3A 3AUSA 2PZMA 3OIDA 4W7HA 5LCXA 3O03A 1JWBB 3RQSA 3ZNOA 1ORRA 1LDMA 4CQLB 1E7YA 2GUGA 2P9GA 3C7CB 4I9NA 4J91A 5I9NA 4RZHA 1YB1A 5C37A 3ORFA 4PLCA 4AJKA 2IYPA 1TT5B 3UCXA 3ENNA 1I32A 4MKZA 1K6XA 2PD3A 4FFPA 1RM3A 2O7SA 3JQAD 4DRYA 4CR7A 1EDZA 2AQKA 4BNNA 3F5QA 1EVZA 1KBZA 5F1PA 3E5MA 4FD3A 3W4IA 4Y9DA 4E2WA 3O38A 3H3JA 4KWIA 3WNVA 4E30A 1CERA 1D1SA 2HCTA 1PJCA 4GX5A 3HDHA 4U6SA 1SPXA 1H94A 4JXKA 3ROPA 4PZCA 4OGWA 2DAPA 3ROKA 2HMSA 3JQ8A 5EIOA 1ZBQA 3QA9A 1U3WA 3BMCB 5K0ZA 3G3EA 3IUSA 3H5RA 1ZH8A 4JQCA 3ZU4A 4A26A 4EUEA 3A4VA 1JWAB 2WD7B 3BTSA 4CLEA 4MP6A 1C1XB 2DUWA 4QUKA 3RC1A 4DC0A 5KJCA 2ZB4A 1RM0A 5L40A 1O5IA 1JAXA 5L45A 4CMBA 3AY6A 1EQUA 2DBZA 3RUCA 2WE8A 2NLOA 3ADOA 1GQYA 1LU9A 3VZRA 1LTHR 1IOLA 1IZ9A 5JY1A 1VKOA 4NPCA 3TL2A 3V2HA 5CG1A 4J1NA 3GLQA 5KIAA 3WFIA 3NT2A 2UYYA 1UXIA 1PZFA 2IZ0A 2JJYA 2Y1FA 8LDHA 4YRAA 5BSGA 3LC1O 1HSOA 5IG2A 4JCOA 4DTIA 5JAZA 2A94A 3GAFA 3PDUA 4CJXA 3RUFA 4XR4A 3JD2A 2DFDA 5GY7A 4OKNA 1XSEA 4M49A 2OHXA 1NHGA 4JX8A 1FDUA 2HU2A 3JYOA 3W8EA 5J23A 3B6ZA 4CQMB 2PA3A 1YBVA 1P1FA 4P22A 1NQTA 3GZNB 2LDXA 3FRJA 4IXWA 1SAYA 1XDWA 4R1NA 1GUYA 1P45A 2YZ7A 3B1FA 1HDOA 3LLSA 1EZ4A 5ES3A 3LF1A 5FI5A 2IEDA 1KVRA 1AXGA 4E21A 3VZQA 1MC5A 1D1TA 5F21A 5A9SB 5ITVA 4Q3NA 1YL5A 1RYDA 2X9NA 4P4GA 3L9XA 4IINA 2O3UA 4C4OA 2UV8A 2Q2VA 3WYCA 1HE5A 3P19A 4C7KA 3SVTA 4J49A 4DL9A 2C5EA 3RAJA 2ZCUA 4FC7A 5JYEA 1F8FA 1QORA 2HJRA 1C0IA 2DM6A 1P1JA 4I9UA 3PTZA 2EERA 4EYEA 3LQFA 2J6IA 2NVUA 3VH1A 1KY5A 4CUJA 3CZMA 2HSDA 3GRPA 4KDFA 3RFTA 4QXMA 1ZFNA 2GLXA 5COAA 2ZJ0A 4L0QA 3ZCXA 3GDFA 3OBBA 4QQRA 4ALIA 4YAJA 4YT4A 3C85A 4MPDA 1Z45A 3C24A 3W8DA 1Y8RB 3OP4A 4XQGA 5KJEA 4KTVE 5MGBA 2X1HA 3R1IA 4OYRA 3GGPA 2Z1MA 5F3RA 1E1LA 1YOVA 3ETGA 3PFFA 1DSSG 1EVJA 2QRKA 5ENVA 4CV3A 2WWRA 4B3HA 3V2UA 2B5VA 2FSVA 4YQYA 4D45A 6LDHA 3M1AA 3MWEB 4I5FA 2HDHA 3GC6A 3KHUA 2JFHA 2B69A 4Y6SA 3UCFA 3IKTA 4UVHA 3JQDA 3NGXA 5JNLA 5HS4A 1E77A 4CM5A 5MDHA 1DIGA 2RHRA 3FTPA 4HX5A 4OHUA 4QECA 4CQMD 3HDYA 3WXBA 4ESOA 4CMEA 1F0YA 2EKQA 3AFNA 4GWKA 3PJEA 4N18A 3PQEA 3NV9A 4K9DA 4PVCA 1H5QA 1ZK3A 3UUWA 5C7IO 5F1OA 4R16A 3I9LA 2RHCA 1KVSA 5BQFA 2I65A 2EG9A 3PFWO 1IULA 2Q99A 1FMCA 5EMHA 3ZN2A 2AHRA 3F46A 3EZLA 3HE3A 4EGFA 4YJGB 5FI3A 1RM4A 1I2ZA 5JYDA 2B83A 1F8GA 3MOIA 4D7AA 3F4BA 2C2XA 4PLPA 4CM8B 3JD1A 3ITKA 5TT1A 3JQ7A 1N8KA 3PQFA 2ZTLA 3VKVA 5IDWA 1ZXBA 4MVJF 2VUUA 3KLPX 4EEXA 1HEUA 4G81A 5CHEA 1TT5A 2QRLA 3GMSA 4MINA 5G4LA 4R01A 4XD2A 2Y1EA 4P4NA 1YQDA 2WYWA 2YJZA 4II2A 3VTFA 4DUPA 1NFFA 5CDUA 1Q7BA 4WJZA 3O4RA 5AXDA 1IUKA 1FF9A 4QEDA 1VLLA 3GDGA 4PG5A 3N7UA 4M1QA 3O26A 2YUTA 4XDYA 3BZUA 1E7SA 3L4BA 1T2DA 4Z0PA 1GD1O 3KXDA 1GZ6A 4ZQBA 5DZSA 3L6DA 1M6HA 2Y66A 4ZQFA 3DZFA 4EI2A 2EV9A 3BMNA 1Y7TA 2PV7A 3H7AA 2V6FA 4BUCA 1EEHA 2Q3EA 2VHYA 4D41A 5FEUA 1H2BA 4ALJA 5ILGA 1BW9A 3AI2A 1P33A 1I33A 3EY4A 3MJ4A 2DFVA 4E5MA 1DAOA 3GA0A 2IODA 1UP6A 5L9AA 4BL5A 4B4OA 4RVHA 4TRNA 2D0IA 2WM3A 3I6QA 3GPDG 4RPGA 3IP1A 1E3LA 4FGSA 5DOVA 1M75A 3RROA 3PHLA 5EQDA 3EW7A 2W4QA 3SLKA 3JD4A 4N54A 3V1YA 4CV0A 2VN8A 2AG8A 2VT2A 4BMSA 2EP7A 1MFPA 2Z95A 1IL0A 1LDNA 2C59A 2PD4A 4W82A 1SMKA 4J4BA 4GAEA 3ONFA 4XB1A 3ABIA 4W7IA 3WQSB 5CEFA 4R5MA 4BMNA 1EQ2A 4XQCA 4CM9A 4R5HA 2X5KO 1HE3A 3AUAA 4U6QA 1KY4A 4MVJI 2CMDA 2OP1A 3S2GA 1I01A 5B4VA 1SO8A 3M2TA 1LSUA 2PZJA 1LLCA 2AEFA 1K6JA 2DTXA 4N7RA 5CAEA 4UUPA 3WQQA 2VWPA 3LK7A 3COSA 1UR5A 4JBHA 1U1IA 1CETA 2GZ1A 3AI1A 1ONNA 1YVEI 2DBVO 3Q2IA 3C7DB 2PNFA 1UZLA 2VT3A 3GRKA 4LRTB 4GX0A 1ZJYA 4IIUA 1J6UA 3WJ7A 3AI3A 1U28A 5L7TA 2F1KA 2AXQA 2NQ8A 4L8VA 1WMBA 5BNIA 2EIHA 3BHMA 3KLMX 4I5GA 1BXGB 5EPOA 4TKLA 1IYZA 4WKGA 2QW8A 1X0XA 1U8XX 1GZ4A 4BNYA 3E03A 2E82A 2WMDA 2X0IA 3QV1A 4BNUA 5HRUA 4OAQA 3H9UA 5CDTA 2D1YA 2UDPA 4GQAA 4TVOA 1WPQA 5JCJD 1KS9A 3IL2A 4IQGA 3BTUA 1HXHA 1MFZA 4XYLA 1CJCA 3ZV4A 1G0OA 1JKIA 4WEOA 2I6TA 3ZU2A 4RVUA 4HV4A 1GFSA 1WW8A 3OA2A 1ZEMA 2J8ZA 1PSDA 3ZZNA 1AHIA 4ZD6A 3RC9A 1EFKA 4GX1A 1KOLA 2VWGA 3DQPA 3ULKA 4BNWA 1I5RA 4J1QA 1DIAA 3D64A 1PQPA 3WB9A 3RUHA 1ID1A 3H6KA 3QJ5A 2W2KB 1E3SA 4D79A 1MXFA 1Z6ZA 4DLLA 4TROA 4F3YA 3DAGA 4TRJA 3DC2A 4XGIA 3MTGA 4CM4B 3RI3A 4RL6A 3OIFA 4ZQHA 1U3UA 4CL3A 1AXEA 2Z1NA 3UOGA 4FFNA 2XPCA 3LT1A 3AOEC 3I9OA 2ZKLA 2PWZA 3PIIA 1LBEA 4RF3A 4UUOA 1N5DA 1OC4A 1TLTA 3HDJA 3WS7A 4PFJA 2EEZA 4PLHA 4IM7A 3M1LA 1VL6A 1DC3A 3D3EA 3WNQA 3RKRA 3DBHB 3A14A 5EESA 1VJ0A 4O1MA 2NU7A 5FWNA 3DB2A 3ZH2A 4EJ6A 3PYMA 1SB8A 1HWYA 3W6UA 3LU1A 5DP1A 3JYQA 2B4RO 1GYQA 4BB6A 4E13A 2BFMA 2ET6A 2FY8A 3FD8A 3HN2A 3AU9A 1B8UA 4FCCA 1Q1NA 4DMLA 1DOHA 4PG6A 2CVOA 2OP0A 5I8ZA 1T4BA 4YDRA 4DBVO 4BB5A 3EK2A 1YL7A 2CF5A 2FPPA 2GASA 1BXKA 1XQ6A 3NYWA 4Q3DA 3WBBA 3DXFA 3GVIA 1D4FA 3SC6A 4CM6A 2WSBA 8ADHA 4GLOA 4BKRA 3CPSA 3I23A 4OOEA 4JBGA 3NDIA 4WEQA 1F12A 3E8XA 5G0WA 5IZCC 1KERA 1R4MB 1UAGA 2Q46A 3ZNPA 3HZZA 2XXJA 4W9NA 1HYEA 1AHHA 2JCYA 4CL8A 4M89A 1EBUA 1J0XO 3JYPA 2DUUA 5G2OA 3ZNQA 4BGVA 2GERA 4B4WA 2WTBA 2NVBA 4BV9A 1U3VA 3KYDA 1XCBA 4CM1A 5A5EA 3ZU5A 2G76A 2ZTUA 2DC1A 1T2CA 4NBWA 4X54A 3X2EA 2W2LA 4YAGA 1K5HA 4CMHA 1VL8A 4UVGA 2D59A 1PJTA 2DT5A 2HRZA 2IYOA 5KVQA 1PJLA 2GD1O 3PGXA 4BKOA 3LT4A 1IPFA 2OOSA 3VZSA 5G0SA 4RPLA 5TT0A 5JDIC 4MIEA 4J90A 5IF3A 1ISFA 1HDYA 4J43A 1H0KA 4NFYA 3FI9A 3O9ZA 3ZGYA 1B2LA 4IXTA 3UF0A 4AJNA 2B35A 5T64A 3DTYA 4E5KA 4EUFA 4BNJA 2HAEA 2VNAA 2ZTMA 4HUJA 3ONDA 3ZWWA 2VOEA 2JAHA 3H9GA 3UN1A 1K3TA 2YV2A 2ZK7A 3OETA 1J4AA 4DPMA 1GZ3A 1QXSA 1V3TA 4R1TA 4NG5A 1ADBA 3TQHA 4WOJA 3UVEA 3FCOA 4A2CA 1C1DB 1X1TA 3KSUA 4WLOA 3TWOA 5C5IA 5L51A 2Q50A 3PWKA 4GSKA 1H2HA 4ZN6A 3LSYA 2A4KA 1EFLA 1SNYA 3QVTA 4IMRA 1FDVA 3G79A 3UCEA 4HY3A 1I2BA 2G82A 1PS9A 1YGYA 3PLNA 5DCYA 2YV1A 3VKUA 4MVJD 1DC4A 1Q0LA 2PKQP 3CUKA 3WWYA 2H1SA 1XU7A 5G4KA 2Q2QA 1B3BA 1BDBA 1OOEA 1QV6A 3GVXA 1IPEA 3MEQA 4FGWA 1IHXA 3ADPA 4A27A 4DYVA 1X7GA 6ADHA 1H6DA 4E5NA 3X2FA 4BNLA 3IDSA 4ZRMA 3S8MA 1OMOA 2P5YA 1UUFA 4IJVA 9LDTA 5JDIA 1V8BA 4J6FA 4W99A 1XWFA 3NDRA 3PEFA 3DMTA 4AJ2A 1A7AA 3HADA 2D3TA 2I99A 3QVWA 4KOAA 5A3VA 1X0VA 2EKLA 3A06A 3TFQA 4IDAA 2GN6A 5IJZA 3WICA 2DBQA 2JHGA 2VYNA 3ZU3A 4GH5A 2Q1SA 1HTBA 1WDLA 1OI7A 3C8MA 4FW8A 2HMUA 1NXQA 3F1KA 2V6MA 2PD6A 1H9AA 2CUKA 1AE1A 1LQUA 1TI7A 1UXHA 2JCXA 3U49A 3WDSA 4CUKA 3EZYA 3CIFA 4ZJUA 2DLDA 4OQZA 1B0AA 4TMFA 3AOEA 4B7UA 4JJIA 5DP2A 2Q45A 3NJ8A 4MJLA 3FNHA 4Y8VA 3HQ4O 1VL0A 3FBGA 4J7XA 2ZYDA 4BVAA 4E2YA 5FF9A 4WLNA 1N1EA 2BGLA 4IPTA 1O95A 4QFCA 3NT4A 3B1KA 3ZW8A 3KZVA 1ZMTA 5A06A 2EWMA 2I5PO 4BIIA 5ITWA 3WYEA 2JD1A 4JP3A 4PZDA 2FZWA 1HE4A 3BMOB 3GNSA 3L4SO 3TZHA 2X0RA 2OGUA 4QO7A 4YA6A 1NQOA 4CLRA 4OM8A 3RUEA 1HDZA 4UEOA 2FZEA 4HP8A 3NT5A 2B5WA 1SEPA 4YJFB 3AM3A 1U7TA 2HO5A 4UULA 4Z3DA 5CDYA 1I8TA 5A02A 2IDZA 4WECA 1ENYA 1B16A 2FP4A 3VTZA 4D46A 4E3ZA 4M8SA 1SBYA 1AN9A 5U1PA 4CLDA 1U3TA 4Y6RA 2UAGA 4YAIA 1ISJA 4B8WA 4DLBA 2PGLA 4XCVA 4E5YA 1OBFO 1QYVA 3GF4A 4A73A 1N9GB 2VHVA 2P5UA 3GUYA 3PWSA 5G0UA 4R4JA 4PCVA 3K5PA 3SJ7A 1PWXA 3DBLA 4Z9XA 4B4VA 3HWRA 4RGBA 5KVSA 4OXNA 5A1TA 2OO5A 3KUXA 5L7YA 2VOJA 4MO2A 1H6BA 4CM7A 3TRIA 4YPOA 5KNLA 1JU9A 2J3IA 5KOIA 4J9UE 1E3WB 1HRDA 1ADGA 4Q3BA 3QQPA 1NR1A 3MOGA 1D8AA 4FFMA 4WUVA 3NDJA 2O3QA 3WQRA 2PGJA 2FR1A 2OMEA 2RH4A 1V3UA 4RPJA 1W73A 2FR8A 5B12A 1X15A 5DCWA 1DHRA 1ENZA 2CF6A 3JQ9A 2BI7A 2Q1WA 4HADA 3TFOA 4JROA 5EINA 2JFGA 1ZUD1 4NHEA 2QG4A 2R00A 1V9LA 3FHLA 4H7PA 4UUMA 5I7VA 4RLHA 3C7AA 3A28A 2ZCVA 3AY7A 3MJCA 4WK6A 4BO7A 3QRWA 4EITA 3JQ6A 1ZSVA 3RBVA 3IQDB 2OFPA 2C7GA 1P3DA 5AYVA 3ZHZA 4L9RA 3HSKA 1E6EA 3RSHA 3I52A 3WGGA 2PY6A 3GEMA 3VOSA 3KSZO 4CUZA 1VC2A 2VUSA 2BRUA 4GKVA 3PZBA 4DA9A 1LSOA 3I9NA 1NHWA 4PG4A 4OKIA 3Q0EA 4PRLA 1ADCA 1Y8QA 4JIGA 1MUUA 4E31A 1PJ3A 3DZJA 4BO8A 4RPHA 3W6ZA 3OQ1A 1A7KA 2X7HA 4J2HA 2ZJ1A 4R41A 4AJPA 3F6YA 5ICSA 2Y1OA 4FPXA 4DQXA 3GVPA 3U5TA 2AW5A 1YH3A 2BHLA 2H9IA 3U4DA 2I67A 3AU8A 4J1TA 4DPLA 5G0VA 1EBFA 1YB4A 3KBOA 3FNEA 1PL7A 2IZ1A 1HYGA 3ZWCA 2HJSA 3H5NA 3UGKA 1HLDA 1QR6A 3JV7A 1UP7A 4Z9FA 1M66A 2Y0EA 4BO6A 3D7LA 2VRBA 3EGOA 3I5MA 2ZYGA 4YRBA 4TWRA 2VYVA 5HA5A 3ZHBA 1LC0A 3ZWMA 4YVFA 4AFNA 1U4SA 1DDOA 3TF5A 1C1XA 1X7HA 4D0SA 1EDOA 3WLFA 5JCXA 2UVDA 4XWYA 3AY3A 4G2NA 1OZAA 1RJWA 1R4NA 3FTNA 3STHA 5B37A 1LSJA 1GEGA 2Y93A 1DRVA 2O50A 3ASUA 3HB5X 4H16A 1MLDA 3FWZA 1LNQA 1A4UA 2ZQYA 1ZNQO 4RDHA 1PJSA 2BH9A 3WIEA 1VI2A 1LRJA 3QW2A 5A4DA 2G1UA 1B15A 1ZMOA 3K6JA 5TC4A 1V35A 2F00A 4I8XA 3TL3A 2J3JA 4AVYA 4GGPA 1ZW1A 4NZ9A 5HS6A 3TOZA 5BNFA 3V2GA 4TRMA 1ISIA 1O9BA 4NDNE 1UDCA 3KYDB 2C7VA 3ONEA 3F47A 2EXXA 4N5MA 2CDCA 1E1NA 3DHEA 4LRSB 4B79A 4Y67A 3PJGA 3KB6A 3TN7A 3U0BA 2DPHA 4CM4A 1EK5A 1GL3A 1NQ5A 1ZEJA 1Z7EA 4O0LA 5JDCA 3BXXA 4CR6A 4R3NA 4KQXA 3AW9A 3D4OA 4WGGA 1PJ4A 2X9VA 5CDSA 3DMTC 3H3FA 4HKTA 2X4GA 1P9LA 1CQIA 1MGOA 2Z5LA 4YXFA 5TNXA 2FSSA 3ZWNA 1EMDA 2C0CA 2NACA 2JFFA 4BNHA 4JNKA 3HG7A 1MXHA 2Q4EA 2I3GA 3MJTA 4ALKA 3VPSA 4I9HA 1QYCA 3DDNA 4OXYA 1U5AA 1NASA 3VPFA 3ZV6A 1P44A 4A10A 3FR7A 3GOHA 2FR0A 4XIYA 5FYDA 2BMAA 3H9QA 5L95A 1JLLA 2X8LA 2E49A 3QWBA 4BS9A 3V1TC 1GTMA 5JY6A 3AK4A 7ADHA 1IE3A 4RCVA 1KEUA 4NJOA 4ZU3A 1A27A 4A0SA 2P9CA 5IFLA 3VC7A 3NKLA 3OSUA 1YDEA 4U0JA 5DOZA 4Z9YA 4YRDA 3UAGA 3H9JA 4NJMB 3GZNA 5L4NA 1JTVA 3P5SA 1QLHA 1HETA 3PZRA 5G0TA 1ZK0A 4J4TA 3NTRA 1NTOA 2TMDA 1E3WA 4BKUA 1DAPA 1P1HA 2EGHA 3LZ6A 4FC6A 4XRRA 4B7XA 5JC8A 3PLRA 1LRLA 1DFGA 4LK3A 3MZ0A 5C7OO 3ROMA 2QZZA 1A4IA 1Z73A 1RYEA 3TJRA 1KVTA 3CSDA 3GY0A 4O59O 5IDYA 5F5NA 3OJ0A 2PKQO 4PG8A 4NFSA 2PH3A 4HNGA 3F9IA 3RBZA 1I3MA 1S7CA 2D4AA 4R9SA 1ZSYA 4YJHB 3VDQA 4IJKA 1BXZA 3QHAA 2O4UX 3KYCB 1ONOA 3DFUA 3D1LA 1BDMA 3DHYA 4INAA 2WJPA 1N7HA 3IP3A 3HDQA 1HT0A 3VHRA 1E7RA 2WD7A 4DXHA 5KVVA 4E32A 4YACA 3JCZA 2AQHA 3LT2A 2WYVA 4MDHA 1ULSA 1Y1PA 4K26A 2OZPA 1WLYA 4IDCA 4XB2A 3K2BA 1A9ZA 3DZIA 5HBRA 3ZWOA 4DIOA 1NPTO 3V1UA 1T24A 3WX0A 1QP8A 1GPJA 4HWKA 3CMCO 5A04A 3WLEA 1LUAA 2O3TA 4W4TA 1VJ1A 4XGNA 2XF8A 5DNAA 2VZ8A 1HDRA 4D0RA 1LDEA 1N92A 1ULUA 2JAPA 3UH1A 1ONPA 2GDZA 3EVNA 3PYLA 3RC2A 1Z74A 2O7QA 3Q1LA 3HNPA 4K6FA 2VTDA 4ONEA 3OQ6A 1RM5A 3JQ7B 3BMNB 4M87A 4ALLA 1GCOA 2IRWA 4YJDA 4MVJE 1Y9EA 1MA0A 2O2SA 4AJ4A 4KMSA 1P0CA 2BELA 5C7LO 2ZATA 3GEDA 1C3VA 2XAAA 1W6UA 2CNBA 2X9GA 4MVJP 4DVJA 5IZ4A 3RUAA 4Z0TA 3KYBA 3JQCA 1UXJA 3U4CA 1LC3A 3IS3A 3VH2A 1JQBA 1Q2XA 4YB8A 3B1JA 1K89A 3RUDA 2V7PA 3PHIA 4BO9A 1C0LA 5JCJA 1VPDA 5LC1A 4QSMA 4JBIA 2W2KA 3RKUA 1DIBA 4A5OA 1DRWA 4FDAA 3R3SA 2YFHA 4O63O 3TZCA 4CLOA 2JKVA 1TEHA 5H82A 2AE1A 1XEAA 3TSCA 2TMGA 4DIFA 1LQTA 3D0OA 4LSMA 3DTTA 4E5PA 1R4NB 3G49A 1VKNA 1FDWA 3I9KA 4CLHA 2GSDA 5IDXA 1PGPA 1WAMA 1R4MA 3M6IA 3D4NA 2DVMA 3IJRA 4PIVA 4YT8A 1WVGA 1P1RA 2B4TO 3W8FA 3ANLA 4JJFA 3NEPX 4IQ0A 3EYWA 3EMKA 1K6IA 1BVUA 1CYDA 4IIVA 5KKAA 4E12A 3GAZA 1A71A 4PLWA 1NVMB 1MC4A 4RF4A 1QG6A 4OL9A 4U5QA 4PG7A 3OHSX 3I6IA 3RJ5A 4DC1A 3ETDA 4XA8A 4D3FA 1Y9AA 1PGOA 1CQJA 3RASA 3K9QO 1DJQA 1E1MA 4RLSA 3UXYA 2BFPA 2VNSA 4P4LA 1E3EA 1Q7GA 4ZQGA 1DBVO 4XYMA 4EJMA 1WZIA 3G1UA 5BSFA 1JKFA 3K8ZA 4J7CA 1UAYA 1PGJA 4RORA 1NAIA 3GFGA 4Q39A 3BHJA 4Q3CA 3CXRA 3UW3A 3RU7A 4UVDA 5ER6A 1LLDA 1B8PA 4IY1A 4WCDA 4D3SA 4PN3A 1X7DA 5JAMA 4WOKA 5A5FA 1SOVA 2NU9A 3L6OO 3INTA 4LCJA 4RDIA 1XA0A 4RO0A 5FFFA 5GZ1A 4XYEA 1WDKA 1VSVA 4FJ0A 3RFVA 3DZBA 1EE2A 1EUCA 2DQ4A 3L07A 2CVQA 4K6CA 1U8FO 2QQ5A 1PR3A 2C5AA 2CDAA 4CODB 3GN1A 4HFJA 5TQVA 3ZWAA 1YJQA 3FNGA 4AJLA 3G17A 1TVEA 5TIIA 2HLPA 1ZXLA 1NVTA 4IGEA 4TRRA 2FPGA 4IBOA 3WSWA 1YRLA 5CFZA 1V3VA 1NWCA 2FPIA 4XYBA 4LGVA 4N5LA 3WG9A 1JKJA 2X58A 5EN4A 2P4QA 3PHJA 2P2SA 4YBZA 3NX4A 4XIJA 1JDJA 1T1SA 3U4HA 1VRWA 3D3WB 1NFRA 3QWFA 4L76A 4OJNA 2IXAA 2VYVD 1XLTA 1T25A 2GGSA 1Q0QA 4K28A 4MIOA 1YKFA 3MCVA 5IN4A 1L1FA 2OORA 4OMUA 1HYHA 3LF2A 4RVGA 1LSSA 3OA0A 3B70A 3ETEA 3OFSA 3OH8A 4BNKA 1WWKA 4RQUA 2NM0A 2CD9A 2GN8A 2YDXA 1Z75A 3DZHA 4P8RA 2BGMA 3R0IA 3JQEA 3T7EA 3LDHA 5DT9A 2ZIZA 3AWDA 4CLOB 4CMAA 4WASA 5F1KA 3OJOA 1BTOA 3KOUA 2Y1GA 1NPYA 5TX7A 2LDBA 1DC5A 1ADFA 5AXBA 3TDKA 4DGSA 4IDBA 1PGNA 1ENOA 4PGFA 4YJFA 4KWHA 4H15A 4S3MA 4UREA 4BNMA 4CMJA 4HFRA 1HZZA 3AM4A 3U3XA 3UHAA 2QX7A 3DHNA 3I1JA 5JO9A 4CLRB 1PTJA 1JAYA 4LMRA 1PL6A 1KETA 3H65A 4ALMA 3LC7O 1XGKA 4IMPA 5HWSA 2Q4BA 1E7WA 1B8VA 4J3FA 2YY7A 3WGZA 5JFOA 2BGKA 2IEBA 2I3AA 4GBJA 1IHYA 3TNLA 4OH1A 4GGOA 3VPXA 3DONA 3LYLA 3HFGA 1HL3A 2HK8A 4YTEA 4IGFA 3E9QA 4D44A 2VWHA 3PHHA 4EW6A 2W2LD 4Y6PA 1UXKA 2PGDA 3INRA 4PZEA 2Y99A 4NK5A 3FNFA 3Q2KA 4LMPA 4Z6KA 5DBFA 4IDDA 4Q3AA 3WIDA 1C0PA 4HBGA 5EERA 5B4UA 2J5KA 1ZK2A 2P68A 2B37A 3GNQA 4FN4A 5AXCA 4OSPA 2YHIA 3S2FA 2C20A 5I8WA 3OF2A 1GEEA 1RWBA 3RFXA 3WGOA 5BT9A 1F06A 2NVWA 3F3SA 4EDFA 4AJ1A 1XQ1A 1D7OA 2ZQZA 1QMGA 2UUOA 4R54A 5A3JA 4EUHA 4KQWA 1T4DA 4ZVVA 1PWZA 3IMFA 4ITUA 4NR0A 3E6AA 2RIRA 5IDQA 5JPIA 4W9NC 5T67A 4LSWA 4RV9A 2RAFA 1DXYA 3BMQB 4NH4A 3E48A 1HSZA 4QTZA 5TGDA 5IZCA 4MP8A 1IY8A 1M76A 1AUPA 1PIWA 4NBTA 4UVIA 1SCUA 3JSAA 4OXKA 4ZHSA 3T4XA 4I08A 3L0DA 3M2PA 2POQX 2PKRA 3KM0A 4Q3EA 1NX6A 4C7JA 4P38A 4LVUA 2WEKA 3JQFA 2O3JA 3WTCA 3NUGA 2DKNA 3ENKA 1E92A 4QO8A 2NTNA 4B3JA 5LDGA 3E18A 3BTOA 3U9LA 1LDYA 3DZKA 3PIDA 4FJ1A 4TVBA 5K6AC 3CH6A 4UEKA 3VZPA 4DIBA 4ZA2A 4CM8A 3Q9UA 4E33A 3HHPA 2QIOA 5A9RA 4D3DA 3VPHA 5JMWA 4J1SA 1GV1A 1VSUA 1HDGO 3DWFA 3L77A 4FB5A 5GZ6A 1DC6A 4J2OA 3C1TA 4DMMA 3LC2O 3WR5A 1OC2A 3RBXA 1YJ8A 3KEOA 2O4CA 2EF1A 3UICA 2JL1A 3K96A 4J9VA 3S1LA 2O3SA 3NTOA 1A5ZA 3GVCA 2VYND 1XKQA 3D5QA 3JYNA 4UUNA 5I7EA 2PH5A 1M6WA 1X1EA 5JS6A 1GQ2A 1H6CA 1UP4A 1B7GO 1T26A 2BI8A 2E6UX 4NBVA 2AEMA 1PJ2A 3PXXA 4CM9D 1CRWG 1JVBA 4IDEA 4LN1A 5CPBA 2PK3A 4R9RA 2AQIA 2X5OA 3ROQA 4CR8A 2D5CA 4O6VA 4B4UA 4NI5A 3GT0A 1X14A 2YQ4A 4ALNA 3DO5A 4OQYA 1KC3A 1U7HA 2A35A 1Y8RA 3VPGA 3PPIA 2PR2A 4YT5A 3GDOA 4S1VA 4DBZA 4KZPA 4FBGA 4BHTA 4MVJM 2FOIA 3GHHA 2QRJA 3DBHA 1NFQA 1JN0A 2VWQA 2EW2A 1KYQA 1DFHA 4XEHA 4A7PA 4MOWA 4XGKA 2O2YA 3H2ZA 3V8BA 1Y5RA 3D4PA 4F6LA 5JW6A 4A03A 1DRUA 3JQAB 1CWUA 4E2ZA 1F17A 2C54A 3K2EA 1NQAO 1LJ8A 4DREA 2GYYA 4ROSA 1HE2A 2YQ5A 3FN4A 1O6ZA 3ICCA 4I1IA 1GAEO 3OEYA 1E6UA 3JQ8B 2D5AA 5TS3A 5K6AA 2QZ9A 3R3JA 3WOHA 5JAIA 2WE7A 3EDMA 4NIMA 3KV3O 1X13A 3VVBA 2J3HA 1VM6A 2SCUA 4OSOA 3G1TA 4IS2A 2ZB7A 2Y68A 3ZHYA 3UFXA 4ZGWA 1KEWA 3VAZA 1SZJG 3A1NA 3DAFA 1XU9A 4NNJA 2YV3A 5U9CA 2IZZA 1QV7A 4FIZA 5DBIA 4TZTA 1LX6A 1T2FA 2JD0A 1QYDA 5L4SA 1PU2A 1YE3A 4J0EA 4N5NA 4KUGA 1P1KA 3JQGA 3TZQA 4XR9A 3GK3A 2OXIA 1VE9A 3BYZA 2HK9A 2NTVA 3EVTA 2YYYA 1DIRA 4AJOA 1FDSA 7MDHA 4Z3KA 4FFRA 1TA4A 3RVDA 4BNFA 3JQBA 3O8QA 5T6BA 4BO0A 3GVHA 3DR3A 4UEJA 1V0JA 4GLLA 4XJSA 1KVQA 1DIHA 1Y81A 5K9ZA 1PR9A 1N2SA 1QYXA 4J4HA 2EW8A 1A9YA 4G65A 4IZIA 4XKJA 4ZICA 1SOWA 4K1LA 1U5CA 1MV8A 4TQGA 4MP3A 3E1KA 3DAPA 5IXYA 2OBNA 1DB3A 4CV1A 1KEVA 1TB4A 5A9SA 1DLIA 4XZ3A 5JDCC 3V5NA 5JE8A 1NVGA 3WMXA 3DBRB 4M86A 1I3KA 4ND5A 4MKXA 2A92A 1B3RA 3P7MA 4EZBA 2JCVA 4LVCA 3D5TA 1O89A 2D2IA 1K0UA 3HJAA 3H9EO 1PJBA 5DDIP 5ILOA 3CZRA 1XG5A 2AE2A 3OMLA 2VCYA 4NK4A 4PLYA 3U4IA 5TJHA 3ASVA 4XQ9A 5CG2A 4M55A 3JYLA 1L7DA 3ZWVA 1RPNA 3BAZA 1BMDA 5CEJA 4EBFA 1Y6JA 2GF2A 2I76A 5JXWA 1SB9A 4AG3A 2NU6A 1SC6A 3HUDA 5I9LA 3QSGA 5L3ZA 1E5LA 2VRCD 3P2OA 3U62A 5BSHA 3OICA 4CPDA 4MKRA 5L4LA 1QSGA 4DLAA 1G6KA 3FPLA 3GR6A 3GG2A 5I9MA 1ML3A 1T2AA 1CF2O 1UDBA 4FS3A 1WXDA 2CSUA 3PHGA 3DBRA 5GMOA 5EL0A 2I9PA 4BO5A 1DJNA 3R6DA 3VH3A 4WCFB 1NM5A 3ITDA 1S6YA 2NTJA 3NGLA 1YL6A 4TZKA 4CMIA 3F4LA 4G5HA 3ZWYA 4UAGA 4BMVA 3KO8A 3K30A 3ZNNA 2IXBA 3FF4A 2PZLA 3VDRA 2V65A 1Q7CA 2JD2A 1I30A 1BW9B 2BD0A 2G5CA 3BHIA 1JA9A 2RBEA 2WYUA 1P1IA 3F5SA 3ZDFA 2FN7A 4WCFA 4XRGA 2W8ZA 4GVXA 3IC5A 3S2IA 2HUNA 4QX6A 2PZKA 4LW8A 3PJDA 1FK8A 2B0JA 4BO4A 1ZKMA 2FRDA 3MJVA 4RZIA 2XOXA 3Q6IA 5T5QA 1ISGA 1FXSA 3Q3CA 3ZWPA 4WNCA 3KRTA 4YCAA 3VVCA 2EGGA 5H83A 2HK7A 3KETA 3ST7A 3GG9A 1I24A 1B14A 1GADO 4URFA 4XX0A 5HTOA 3FWNA 4RVFA 2HQ1A 1YS4A 2O23A 4AICA 3SXPA 5B1YA 4R1SA 4IUYA 4ZRNA 4OOFA 4E2XA 2P4HX 4R1UA 5ENDA 2QHXA 2VUTA 1Z82A 5LDHA 1HDXA 4YJHA 4GWGA 5JMPA 1ZIDA 4WE3A 4RVDA 1HKUA 4CMGA 5AQ1A 1Y5MA 4BNZA 2O3RA 3SEFA 1G0NA 5L53A 1R15A 4WNIA 1CEQA 4YYZA 1ZCJA 1GY8A 2VTEA 1LXCA 2CZCA 5DF1A 5TSDA 5B4TA 3QE3A 1LEHA 1ZK4A 3AJRA 3CTMA 1BSVA 1E1KA 3WGTA 4BOYA 1P74A 4Q9NA 1EVIA 3DZGA 1ENPA 1H6AA 4CM3A 2GN9A 4NU6A 3OIGA 3WTBA 3ICPA 1LDBA 4I5DA 1NAHA 4WCFC 3I9JA 5JAQA 4BKQA 2DU8A 4UVEA 5EQFA 3TZKA 1PX0A 3ANMA 3QP9A 2AG5A 2BKAA 4O5OA 2H63A 1YOVB 4CMEC 1U4OA 3QLJA 2FMUA 1FJHA 4PLVA 4CV2A 1GQQA 2NSDA 1LRKA 3JTMA 1PS0A 2NNLD 3PWZA 1ZVMA 4I5EA 2IE0A 2VQ3A 5ER9A 5CDGA 1YQXA 4NBUA 4ND2A 2Y0CA 5DN9A 1P77A 4IJUA 4PVDA 4HXYA 4WPGA 1IZ0A 4PLFA 4EEZA 1E6WA 1WDMA 3RJ9A 1LDGA 2AQ8A 4BV8A 3A9WA 4CLXA 3E9MA 4GI2A 4KP7A 1YDWA 3EHEA 3I9MA 3S55A 3WYBA 2GO1A 2P9EA 4L74A 4GX2A 2GZ2A 3TZ6A 1O94A 4AL4A 1ZO8A 4B8ZA 3PVZA 5COQA 3UKOA 1OAAA 4XYGA 4BO1A 2V6GA 3KSDO 4R3WA 4XJTA 4U0KA 2HMVA 3IUPA 1GCUA 3AUUA 2X22A 3JQGB 3OEWA 2GPTA 2X86A 3KTDA 2WDZA 2OL4A 2Y0DA 1XYGA 1NBOA 1ZJZA 3T4EA 1NP3A 1QLJA 3WGQA 4IQ8A 3N74A 5KWEA 2VZ0A 5GZ3A 4ZQEA 4U7WA 2BFOA 2X0JA 4RF5A 2GN4A 1EUDA 3NTQA 1N7GA 2J5QA 3NRCA 3JQAA 1EVYA 3CMMA 4YAEA 4PLGA 4TSKA 3ZV3A 5I7SA 2BF7A 1QKIA 4IS3A 3BIOA 4IZHA 4M54A 1E7QA 3DOJA 4AJIA 3GUCA 1BWSA 1YWGO 5F5LA 2EJWA 3CINA 3IOYA 2VZ9A 3W4KA 4YR9A 4F46A 1YB5A 3S2EA 3QWHA 4KUHA 3C3XA 4J16A 1PQWA 4BGIA 1RKXA 3W4JA 3WSVA 3EAGA 3ZWXA 1R12A 2GCGA 4KTTE 2C82A 4HNHA 3SJUA 4L4XA 4L75A 2NWQA 2O48X 1EE9A 4BGEA 4WLFA 1UZMA 2AA3A 5T57A 2HRBA 3KVOA 1DHTA 1TT7A 5L7WA 5JC1A 3U09A 4BNIA 3ON5A 2E37A 1YQGA 3BMQA 2RH8A 3GQVA 3PRJA 1YBAA 2QYTA 3H8VA 4WLUA 1UJMA 1YO6A 5DCUA 1YXMA 4JGBA 4IJWA 5JBIA 1YONA 1EK6A 3WGHA 2BFAA 4HFMA 4BKPA 3T7CA 2EJVA 3MWDB 3I4FA 1C14A 1ISHA 4L73A 3QVXA 2VHWA 1PZGA 4D43A 2QYSA 2EP5A 1M67A 3ZHXA 4D42A 3MJSA 3JD0A 2Q2WA 3GPIA 3CKYA 5IN5A 5G4KB 3DBVO 5IAAA 3DOCA 3H5AA 4F45A 4L4RA 5JSFA 1M2WA 4LISA 3GZ4A 1HF3A 2DPGA 1GV0A 1U2GA 2YW9A 3GMDA 3OM9A 2H6EA 3IIEA 2UUPA 2H5LA 1I3NA 4ND4A 3EUWA 3OQBA 3KEQA 2B36A 3OECA 4HFNA 1BGVA 2J5RA 3GEGA 5KKCA 2B4QA 3I3OA 4IDFA 2I66A 4NQZA 4LCEA 3G0OA 5T8KC 4EJ0A 3ANNA 2FHSA 2NV6A 2VHZA 3P2YA 2GR9A 3TPCA 4Y98A 5I7FA 1N1GA 3EC7A 2NADA 1U2DA 5HM8A 3FPCA 1NPDA 1KC1A 2OBYA 2A9FA 2Y67A 3GGOA 4QT0A 3QVSA 2ZTVA 3PI7A 4YT2A 1AGNA 1BVRA 4AJJA 4RJTA 5KJ6A 4AJEA 3QIVA 3H2SA 4KDEA 3SLGA 4KUEA 2ZB8A 1R37A 1CIVA 1UDAA 2X0NA 1MG5A 3FSRA 1HDCA 5AVOA 1A72A 5C3MA 3HB4X 1JVSA 5A9TA 1NR7A 1PJQA 1R6DA 4DQVA 3RD5A 3MTJA 1IB6A 2NQTA 3JQFC 4DWVA 5ICMA 1E3JA 5CPFA 3LLVA 4YWJA 2G17A 1GDHA 3DEYX 5KCZA 2R6JA 5EJ2A 3GGGA 1NNUA 2DTDA 1ZZEA 4BO3A 1OFGA 5ADHA 3E5RA 1DPGA 4WLEA 2Y1DA 1ARZA 3SX2A 4W6ZA 1U9JA 2JHFA 3QVOA 1TXGA 1ZK1A 2J3KA 3I83A 3WFJA 1T1RA 3B20A 3OJLA 1V6AA 1BXGA 4BQPA 5BNTA 2Q1TA 2VRCA 4BNTA 4AJHA 4MIYA 3K73O 4CMIB 3DFZA 1C1DA 2NUAA 3PDJA 2YFQA 2E4AA 1Z7BA 1BHSA 4J7UA 4ND1A 4ND3A 4GL4A 2NVUB 2C29D 3I4CA 3KYCA 1GUZA 1WP4A 3O8QB 4FQ8A 4DYDA 3Q9NA 3ZWBA 5DBGA 1K2WA 2YDYA 1JW9B 1R0SA 2CFCA 3PP8A 4PRKA 1WNTA 2W90A 1I10A 1B26A 1HZJA 1F14A 4JJGA 1NYTA 5KVCA 1E3IA 2PLAA 1R16A 4CMKA 1PL8A 2ZB3A 1GU7A 1DEHA 5CP8A 2PFGA 5BR7A 3PK0A 1WZEA 3RWBA 5TRTA 3H4VA 2X5JO 4DPKA 1Q0HA 4NBRA 2R00C 1XELA 4OIMA 4NJMA 4BNVA 3E82A 3RIHA 1LLQA 5TLSA 5KTKA 3ZV5A 4YQZA 1PZEA 1MX3A 3WGIA 4DQUA 3JQ9C 1H9BA 4FFLA 4YJGA 3HN7A 4JP2A 4RF2A 1BG6A 4PLZA 1I3LA 3ZW9A 4YEDA 1YBMA 2AEJA 1GPDG 1XR3A 2DBRA 2P91A 4GVLA 1GR0A 3IJPA 1E7MA 3F1LA 9LDBA 4BNXA 2V6BA 4FOSA 5THKA 4FOOA 4II3A 1I0ZA 1CDOA 3VH4A 1E0DA 1Y8QB 3BTVA 4BQRA 1G1AA 1H93A 3D3WA 4XQEA 1PEDA 1EUZA 4GSLA 4GPD1 1SEVA 3PQDA 1O0SA 1PGQA 3IKVA 3OJEA 5TF4A 3WWZA 3IAHA 4R69A 4FSHA 5H81A 2ZYAA 3QY9A 2NU8A 1D3AA 1J49A 1L7EA 3AOGA 2DTEA 3W1VA 3INGA 1LA2A 3ZI0A 2HMWA 3BA1A 3WMWA 2GNAA 2CVZA 1LI4A 2XXBA 1I2CA 1XIVA 1BRMA 2X23A 4ID9A 4MVJA 3QWAA 1C0KA 1R0LA 3L4BC 1MP0A 4L4SA 3GHYA 2FWMX 3LT0A 2C2YA 5THQA 4J0FA 4NU5A 3RU9A 1I36A 4U8GA 2YHIB 5IXSA 3WBFA 2HMTA 5A03A 1NWHA 3NAQA 5CEEA 1DO8A 1WMAA 1KEPA 1GUFA 4Z0HO 3GN2A 2Q49A 2BLLA 2CY0A 2AMFA 2Y1CA 3QWIA 2EKPA 2R2GA 3JQBC 4FR5A 2HKIA 1PS8A 4E4YA 3L9WA 1MG0A 1ZSNA 1J5PA 2G0TA 2X6TA 3C1AA 3RCBA 2YHUA 1W8DA 2C07A 5COBA 3Q11A 3OJFA 2D8AA
chains in the Genus database with same CATH superfamily
5K5EA 3JD3A 3PYXA 2HW8A 3WYFA 1P5ZB 3PFHA 1VRCA 4FK8A 4RQTA 1A2OA 2CXTA 2PUEA 6CHYA 1DFIA 1D07A 4UHHA 5F33A 4H1TA 3T0IA 2MSEB 3HB0A 5D51S 1FFSA 3PQ2A 4BO2A 1UH5A 2OVBA 1A76A 4F5ZA 4ENVA 5IRCD 1KKLA 2VYQA 2OV8A 3G2HA 5EXSA 3T1YB 2RGWA 3QFHA 1EZ1A 1RBYA 1XVAA 1O8CA 4W5QA 2D54A 1ODJA 4OQNA 1MRSA 3EG5A 4ZANA 4OYYA 3RPEA 2Y2UA 2CNWA 3GRVA 1DLJA 3L6EA 4UBLA 3G8CA 4D6XA 2BH2A 4MTLA 4C7OB 1CSEE 3GEBA 3QPVA 1USVA 5AW1A 2WKQA 1T0BA 1G6HA 3NC4A 4C6TA 1JR2A 2W2NA 4N5DA 1WXHA 2JLZA 1DC7A 1WTCA 1N5MA 1L1RA 1WKBA 3PXBA 1CUUA 1XMXA 3NJ4A 2CCJA 1X8JA 4NOJA 2JJMA 5IWCA 1O1YA 2QRVB 5IVPA 3B5EA 2IS2A 5AW6A 1T9ZA 3P9RA 3DMYA 3URKA 3IRUA 1XHLA 3DT9A 3QA3E 3NM5A 2DR2A 2QZ4A 3PGJA 1V26A 3SBOA 2EHDA 1PQYA 3PJFA 4QGGA 1LLUA 1TM3E 4E0BA 3EEFA 1VJGA 3TGPA 1W0CA 1JH9A 2C4HA 4ILKA 3KEMA 4OL0A 2GKOA 3LP8A 1NF9A 1QYWA 2GAAA 2ILTA 4KXNA 1NUPA 3R9XA 4F2PA 4LECA 3O90A 4DCGA 1PQUA 3YASA 1NRXA 4POAA 4X6XA 1MU0A 3FBTA 4FYPA 3GJ8A 2G3YA 1UXGA 2RC5A 1VJTA 2GRAA 1CP3A 2P1RA 3EF3A 1RMQA 1P31A 3GJ5A 2VBFA 3K5WA 5BSEA 3UV6A 3U7FB 3FRHA 4R51A 2Y05A 3ZEAA 1STOA 5AMXA 2IXGA 1RPZA 4W9RA 2A8YA 5AXAA 4ZHQA 4EYGA 3SKXA 4NCBA 5JJBA 3ZBTA 4JK3A 1OFHA 1QH1A 2QA5A 2GPBA 4IZOA 1E1CB 3IMGA 3RADC 3LX5A 1OV6A 4W7HA 721PA 5LCXA 3TCXB 1JWBB 3ZNOA 1ML4A 5EOVA 3S70A 4CCWA 1LDMA 4CQLB 5BPFA 2O6HA 3O83A 1E7YA 2GUGA 4XARA 4I9NA 1T9CA 4ZQIA 3V4LA 3ZGXA 3G23A 4EKEA 5ERYA 2C9ZA 4RZHA 4MYUA 3ORFA 3DFFA 3Q1KA 2FZ5A 4OFXA 5FQNA 3ENNA 1I32A 4G6ZA 4ZVMA 5DXFA 2X0DA 2C2OA 1N2JA 3JQAD 4CR7A 4BNNA 3QI7A 1W88A 3BWBA 1Y5IA 4QM7A 3F5QA 3EISA 3RU3A 3NKVA 4JUIA 3EXHC 2Q62A 2H92A 5JV5A 3UHOA 3ISTA 4BEBA 1CUAA 1H2FA 3O38A 3H3JA 4KWIA 2YY5A 4J0HA 4HQKA 4A9AA 1IIRA 3OQIB 3WA6A 4LZAA 2HCTA 2IYLD 3RJMA 4OI0A 5BUZA 2Y0BA 4RX1A 4K3UA 2EL7A 5ALRA 2CB9A 3FB1A 2FXIA 4C4ZA 2BN4A 3I0NA 2DAPA 2NX2A 4FEGA 1N2EA 3VYVA 2IUTA 4EG4A 5EIOA 4GOOD 4KQ2A 4DY6A 5K0ZA 1C4XA 2F8MA 3IUSA 3IR6A 5KS2A 3LX4A 3PXCX 1PJ8A 3E05A 3TQQA 2R6GA 2WD7B 1NZDA 3BTSA 1OWNA 1Z47A 2E1PA 2HLDA 3K3PA 4M0EA 4QUKA 5KJCA 2ZB4A 2NU8B 3I62A 1C3OA 4LYHA 2MOKA 1N34B 3J7AC 1T3GA 2YXDA 3KFXA 4FDVA 3HJHA 5K0EA 5L45A 1EQUA 1ZL2A 2AG6A 1L4UA 2YZKA 3OOHA 3GB9A 3P8ZA 4ZI7B 4EA6A 1I80A 1XNJA 1FMLA 2BCGY 1LTHR 3V9PA 2OAEA 3GYGA 5JY1A 2PZ8A 1G5RA 4NPCA 3V2HA 5CG1A 4YJKA 1D5CA 4BQIA 3WFIA 4S1TA 5LKRA 5J4VA 5B3AA 2UYYA 1UXIA 1TU0A 1TZJA 2V4MA 2Y1FA 4ZRDA 3AEKB 8LDHA 3GD7A 4DV4B 5BSGA 3LC1O 3FB4A 1HSOA 1PV2A 4Q0MA 4NENA 5IG2A 3EF1A 3GAFA 4CJXA 4D9NA 4DOMA 1X7ZA 3L0BA 2HPZA 1ZX1A 4NS4A 5ALJA 3QFSA 5CJJA 5T6MA 1GM5A 4M49A 4GMXA 3N86A 4C3VA 4G5OA 4YRGA 1FDUA 1U7DA 2HU2A 4UASA 3K9NA 4MUGA 5B6IA 2CJFA 3SVZA 3IOCA 1RC8A 1K97A 2E85A 3EMDA 1U1DA 4P22A 4QVKA 4EB0A 5AW3A 1UMDA 1O77A 3U80A 1SAYA 1XDWA 3M7IA 4IAOA 2VXCA 1GUYA 4ARBA 3HCDA 5C52B 2Q0XA 1UIRA 2NXEA 1JFSA 5FI5A 1KVRA 3O1JC 4E21A 1OXXK 3MIIA 3NHBA 3F96A 4B43A 1CS4C 1MC5A 2H4YA 2HRDA 3TG2A 3G0GA 5CT9A 2AUMA 5A9SB 4JVSB 4LXUA 5CB4A 1YL5A 2IIQA 3FPJA 3FSGD 4I4TA 3L9XA 5I7OA 4ZDJA 5KB3A 2P6MA 2DUJA 4UUBA 1F48A 4IIBA 3RHTA 4XVHA 3TLGB 3QPCA 1E96A 3NU1A 1R6BX 1FYWA 1W48A 2Q5OA 4GE3A 5JYEA 1F8FA 1QORA 3ESCA 1C0IA 4IH9A 3TLEA 3PA6A 2AF4C 4I9UA 3FYCA 4P4UA 4EDHA 3BXGA 2JDIA 2C84A 2J6IA 3ICQB 2JAQA 2AMVA 2ZRIA 4N47A 1UC5B 1U0FA 1CJMA 1WRBA 3CZMA 5MF6A 3GRPA 1SUWA 2VDVE 4OU4A 5IUJC 3RE1A 1OU0A 3S6JA 1VI5A 4BVGA 2O19A 2GLXA 1B42A 1A95A 4NAHA 1XA4A 2JFUA 3GDFA 4BE9A 2ZJ5A 5BYAA 1TRKA 4DL9A 4YT4A 2X4IA 4JP1A 2P79A 3T12A 4MPDA 4HGYA 1Y8RB 4XQGA 3KZXA 4ZC8A 3R1IA 1FXWA 2HQOA 2Z1MA 4TTAA 2Q7OE 2P9BA 3L8MA 3ETGA 3PFFA 3I09A 3HBNA 1BCRB 2QRKA 1L7BA 1J24A 2XGGA 4FYMA 4J7AA 4MITA 4U2BA 4FQ5A 5HFAA 5JJCA 2QY6A 1XHFA 4B3HA 4DDHA 4NBSA 4D4HA 5ADWA 2H06A 2IHYA 2ZSHA 3M1AA 1BO6A 1FC0A 2HDHA 2EVWX 4HMQA 3KHUA 2ZRGA 1YCGA 4Y6SA 2DR3A 3OEHD 3QG1A 3LOQA 1YI1A 2C9OA 5DLQC 3DQZA 4CM5A 2DYKA 2CNWD 3FUVA 4HX5A 1M1YE 3GH1A 4UCXA 4WXYB 2AKYA 2VTKA 3TR6A 1OLOA 4HNRA 2O20A 3Q7PA 1C30A 2YCLA 3NHMA 4FDLA 3WVNA 3CLSC 5K0JA 2LNDA 4H1VA 1EFRA 2GYWA 1WXGA 1E8DA 4N18A 1J21A 2W6IA 3MPUA 3O8DA 2YQZA 1K27A 1H5QA 3FPHA 5CXSA 2W71A 1ZK3A 4MGKR 3G8BA 5B37A 3UOWA 3UUWA 3WIVA 4MKGA 3W2HA 2A3RA 4MQ5A 3STUA 2J9FA 3I9LA 4FGJA 4KN9S 2IYQA 2HPVA 4R16A 3TK1A 3PFWO 3UAYA 3UH0A 4AKSA 1FFXB 1FMCA 3NAGA 2ZVDA 4WFIA 3ZN2A 4DLRA 4EGFA 4YUAA 2FVYA 3FLEA 4YJGB 5FI3A 5JEDA 1R5OA 1APBA 3D2CA 1E64A 2RDMA 2PBLA 4RIGA 3VAAA 1H0SA 3VTKA 3B6IA 4JA2A 2YTZA 4PLPA 1FRZA 2QTZA 3EARA 3JD1A 1XXHA 1JH8A 4IUCS 5TT1A 3NS7A 1Q0ZA 4GF5A 1N8KA 2GM5A 5H7XA 2D7DA 1KZGB 1O3YA 4N03A 5BUQA 1E4EB 1TMGE 4F06A 1HZZC 9MHTA 3PE6A 1L4HA 3P94A 1BEEA 4MMYB 4C7VA 4UQPA 1S8FA 2R65A 4HEA1 1AT1A 3GD5A 4MUBA 1ZUHA 2M6SA 4ZKDA 1EWRA 4DUPA 5CYGA 4FGKA 4KN8A 4II2A 5CDUA 4JP5A 2ZYHA 3E2MA 1JJFA 4PBTA 3EOZA 3NTLA 5F3DA 1Y7LA 1NP7A 3BXFA 3EXEA 3WWDA 5HGXA 1XKLA 3N7UA 4EI7A 2O7RA 3OCJA 3DSRA 4C21A 3VHXB 2CVFA 3KPUA 1XU4A 2G4LA 3QFRA 4QOJA 1T2DA 2YZMA 4S1NA 1GD1O 3T99A 1I4LD 1C9YA 2B78A 3AINA 5DZSA 4J3NA 4YP6A 2Y66A 3P45A 3DZFA 3K20A 4M0PA 3IAS1 1L4YA 3H7AA 1EWVA 2Q3EA 4G1MB 4O4JA 5FEUA 1OX4A 1B1CA 1FY2A 4ZYTA 5E38A 4ALJA 1YCDA 3AI2A 4P83A 1DCKA 1WE2A 3LBYA 4NPHA 2J7PD 1B93A 2IODA 1Y1RA 4QOFA 3S4YA 4C4RA 3GW8A 4LDZA 1Z0IA 4ZPJA 5F98A 3HVUA 4B4OA 4RKQA 1NY6A 3O21A 2BHNA 2D0IA 4N39A 1G3UA 2ONZA 1QTIA 3C8HA 4PZ0A 1M75A 3D6MA 4NJEB 5CJPA 1R0CA 2I7TA 4TS3A 4G9EA 1UBGA 3AV3A 3JD4A 1ACJA 4CV0A 1SXGA 4BMSA 5FA6A 1SD5A 1GQOA 2Z95A 4W82A 5ITZA 2MSLA 1GLVA 4QPCA 3DCYA 1Y8CA 2PWBA 4J4BA 3EXEB 4KB5A 3ONFA 3WQSB 3ABIA 3BFJA 3A04A 1QC5B 1REQA 4XQCA 1EDDA 4R5HA 1E9BA 1GTZA 3MGAA 1VBNA 4DMFA 1I7SB 2HGZA 2H2FA 2PVSA 3H75A 4RIFA 2CMDA 2Y92A 5K6TA 4B6PA 4RZSA 1DOAA 4NCNA 5B4VA 1ULTA 4CI9A 2YH2A 2H1OA 3DE2X 2HWYA 4Q7KA 1LSUA 3OPYA 2AEFA 3Q3GE 1K6JA 3G82C 1QGUB 3EWSA 4G0QA 4LYAA 4N7RA 4RHCA 5BR8B 1QHEA 2VWPA 3RYIB 4LF4B 1H2WA 1XB2A 3H86A 4G4GA 1DT5A 3ZGLA 1UR5A 3MINA 1EA5A 1CBUA 3BB4A 1HYQA 4YIKA 1RWOA 1QF6A 1U1IA 2Q6LA 3AI1A 4PF1A 4QYSA 1ONNA 1VSBA 2DBVO 2AOTB 3C3MA 3LCMA 1UZLA 3IT2A 1E61A 3LFHA 3C6YA 1DDGA 2C83A 3LKZA 3AUYA 4IIUA 4Z9AA 1J6UA 3A3YA 3O9VA 4NYMR 2IJGX 4OFWA 1UL1X 2YYZA 1GKIA 3AI3A 1YMVA 3DEZA 2QSUA 1ZD5A 3DDSA 2I0FA 3KZOA 3NATA 4O3FA 5CCBA 2V1UA 2NQ8A 3F4KA 2FRDC 3M1YA 3EMBA 4L8VA 1WMBA 2Z83A 5BQ5A 2IU0A 1BJRE 3KLMX 1N5LA 3L01A 3W9UA 1O8BA 3UB4A 2HWWA 3OE7A 5J47A 4TUYB 4IDOA 3IXMA 2CXSA 1HFWA 4KPEC 3L0YA 1TMOA 2KB0A 5FTWA 1GZ4A 3BGVA 1KQNA 4YUZA 5ESXA 5B55A 3FLMA 3PEEA 3OZEA 4BNUA 3FHOA 3G7UA 4OAQA 2PRSA 4DJDC 1DCMA 2D1YA 2UDPA 3CGGA 3L7NA 1YVRA 5JCJD 1EUQA 4PSCA 4Q9KA 3ZDCA 1OU4A 5AVVA 4TZ0A 1X7XB 1NRJB 3I6MA 2OECA 4BP8A 1NJFA 2QAGB 2PUVA 5BN4B 5THXA 2ZRMA 3VR4A 3SXJA 1XDGA 5D5HA 3ZU2A 4JL5A 1WD5A 2I2AA 4WGFA 3OHMA 4EYSA 3KELA 4HV4A 2HCFA 2CE2X 1TM7E 1TTPB 2GNPA 4P3XA 3LH5A 2BTQA 2UUAB 2FW9A 1UODA 4DLWA 1EFKA 2IGBA 4GX1A 4I19A 1XXHB 1RRFA 1ZAKA 2PXCA 1Y9JA 4D99A 1CVIA 3FJ1A 2CEAA 4JB8A 1RKVA 4J1QA 3HU1A 5DIFA 1RLOA 1IMJA 2RGGA 3WB9A 3IJ5A 4QRIA 5IASA 3QJ5A 2W2KB 3REQA 1X6VA 1G4UR 4Q02A 3Q12A 2GCEA 4D79A 3ZLUA 5CB6A 3VO1A 5JXJA 5KPDA 1DBWA 4KITB 1LJUA 2I78A 5JZ9A 2ODBA 1U0OC 2A9QA 4F4DA 1LX7A 3W34A 3OX3A 3UJ8A 1GRQA 4RL6A 1N5OX 4QREA 3RI3A 3ORHA 3OIFA 3V8MA 2A33A 1FSPA 2JF0A 1U9YA 1JTFA 3OX2A 2JRCA 1KAQA 4Q48A 2NO6A 2P35A 2QROA 1R0YA 4D2IA 3LT1A 1ZVVA 4Q7EA 2GB4A 3ESXA 3I9OA 3PIIA 4PSAA 4RF3A 1LBEA 2QG9A 3KR9A 5KYVA 4CQJA 2GPNA 4JJAA 3TNYA 2BOVA 4J0DA 2PUGA 1TLFA 3I37X 4UATA 2XBMA 4KNYA 1SVMA 1EDBA 2Q5JA 3IVAA 3UMJA 5B6JA 1TTTA 1X1QA 1Z8HA 2Q6VA 4P53A 3RKRA 6AT1A 2P7IA 2RGYA 4Z86A 5EESA 1VJ0A 2PRKA 1YFLA 2NU7A 3AVYA 3ZH2A 3PYMA 1DAKA 3LG2A 1ODTC 2RGUA 2Z5GA 5EXPA 3W6UA 5DP1A 4YV1A 4O4HB 2BFMA 5D2CA 3HN2A 1UFOA 4EO4A 3CZ9A 4YROA 1XCJA 2P8SA 1O97D 5E0KB 5I8ZA 4YDRA 2B20A 4GDMA 2JH9A 1YL7A 3NJRA 4OHKA 4RQBA 1BXKA 1XQ6A 2FH5B 1QIJA 1U8YA 4RA9B 1E1RD 1EXMA 4R2XA 3E3MA 4QTTB 4ZO4A 4H6VA 4CM6A 2WSBA 1NDUA 2VJKA 3GU3A 2ZBUA 3FYUB 4Y1EA 4JGGA 3VU3A 4BKRA 2XUHA 2Z30A 3CPSA 3HB1A 1PN3A 2FEPA 2N42A 1U6IA 1FX0A 1Q84A 4LWQA 4Q1DA 4MW7A 2J9ZB 1OFUA 3K9HA 4WINA 5JFTA 5G0WA 4X44A 4X8MA 3V97A 2W6OA 1NXPA 2RIPA 1UKZA 2QVXX 1J7JA 2OD2A 4TS1A 1RJDA 2OFFA 2Q46A 3V6MA 1I2AA 1JR3E 4PICA 4V1CA 4DR5B 4EAQA 2DFNA 5IUKC 2VK2A 1XFDA 5GOZA 1JDPA 1OAOC 1VMEA 1Z35A 4UD2A 1J0XO 5G2OA 4EB8A 4ZYYA 4YS6A 1LI5A 2H07A 1M6VB 3KEGA 1GDDA 2XY4A 3LFUA 4GUDA 4L3WA 2NVBA 1UBUS 2D5BA 2XRYA 2GPAA 1VG1A 1WNFA 3GJTA 2FWPA 4MRNA 4QBTA 3PU6A 4MUEA 3KYDA 1KK2A 1XCBA 3T0GA 4LYEA 5A5EA 2G76A 1XNHA 1T2CA 2DC1A 3AL3A 1QHXA 4C0XA 2IA5A 3V32A 3ERCA 3J7TA 2WHPA 1PJLA 4HLUC 2XYPA 4BKOA 1FTYA 1MV5A 2OOSA 1E6KA 4M0FA 1GXSB 4LY9A 4C87A 1I51A 1ZG3A 3BJRA 1S01A 4G8CA 3DDHA 4OBEA 4QU8A 4RPLA 4JZYA 1QIIA 5TT0A 4BB9A 2BEWA 2ZIWB 3QMVA 1JUDA 5J5CA 4IILA 4J90A 3JZFA 1HDYA 1AU9A 2W00A 4J43A 3QKSB 1Z4LA 3PD7A 1SK8A 4P34A 1BXRB 1RJGA 4IQ4A 3IOBA 2VP5A 2YRXA 3NASA 3TEJA 3ZGYA 2GK7A 1B2LA 4Z7JA 4IXTA 5T64A 3JQQA 4JYMA 3C14C 1IK4A 1FXWF 4C2TA 2ZDHA 3NGMA 2FPLA 2V97A 1JKXA 2W6ID 3TAUA 4FW9A 3KVNA 3C43A 5JD3A 4FHCA 1R6VA 3LHKA 4FYXA 2J3LA 1XVUA 1V3TA 3CRW1 4HAYA 1WIWA 2VJNA 3ZHRA 4YUWA 3NEAA 3U56A 4G07A 2FPRA 1Q3KA 5FUXA 4BLVA 3TWOA 3SIXA 5L51A 5ITZB 1IOZA 4JSRA 2B7CA 1DKMA 3PWKA 4GSKA 5T4EA 4QBIA 5KYTA 1YCHA 3ASYA 4Q16A 2A4KA 3OEEA 5C1PA 3ZJVA 2FDRA 3DDCA 3QVTA 5K05A 1FDVA 3UCEA 13PKA 4A92A 1V8PA 4P5EA 4QYMA 2A9VA 5YASA 1CJKC 4GYKA 3VKUA 3MC1A 1SCUB 3WL7A 1LFAA 2HMAA 4ENQA 5LU8A 3HXTA 2Q2QA 4MWSA 4Q9IA 1BDBA 1OOEA 3C8UA 1RPAA 4IHQA 1IHXA 1ORDA 5IUNC 1PUXA 4E5NA 1MEJA 3QX8A 3S8MA 1A5SB 3H5TA 5KBYA 3FCAA 1DJPA 3V4VB 3AL2A 1VLVA 2ZJYA 4W99A 2QVCA 3NDRA 3MTAA 3DMTA 4UAUA 4AJ2A 4U2GA 2JA1A 1CJSA 3CVJA 2AT1A 2NO4A 3QVWA 2EKLA 5CB4F 5HQ3B 4P33A 1ZLXA 2A0UA 5FOSA 4K7JA 2GN6A 3TFQA 1P5JA 3VV2A 4MARA 2OORC 1HTBA 2P67A 3AEZA 3C8MA 5CAEA 4FW8A 2IYYA 4YCLA 3B2EA 3JQRA 2D1QA 3B51X 4P0TA 4JI8B 3PQ5A 2HTFA 2XUGA 1W0KD 2V6MA 2CKMA 2D2EA 3T1HB 4NMLA 4PQFA 2ACWA 2EDAA 3HI4A 1EXVA 4CDRA 1L4BA 2CUKA 1TI7A 3H0EA 3WDSA 5B1DA 1VP3A 4B9AA 1VPVA 4O25A 1XP8A 3F7MA 1QHIA 1PHRA 2PWYA 2QRUA 2XQJA 3EZYA 3NHUA 3CIFA 3M33A 1JR6A 3A6ZA 3VXKA 4TMFA 1JDBB 2Z8ZA 1ETUA 4A6DA 3AKZA 4UC0A 1ID8A 2JFQA 3ECAA 5J3JA 5M3BA 4JJIA 2HBZA 4MJLA 2KBFA 3RNOA 3SE7A 3ANXA 3T9CA 1DDIA 1VL0A 4FM9A 3O82A 3FBGA 2WMYA 4J7XA 1X3SA 4M9XA 2FUKA 4TT8A 1QHHB 2WILA 1DKNA 1GRNA 4IPTA 4QFCA 2X77A 3NT4A 4KPYA 1ZMTA 2QPAA 3FBWA 2EWMA 1IFXA 2I5PO 4LBYA 3U7RA 4BIIA 4WN3A 1M5TA 2JD1A 3WYEA 4JYBA 5J59A 2LR0A 1E79A 1EIZA 3VHQA 2FN8A 4OHCA 2RBKA 1CUDA 2EQAA 4E94A 3BMOB 3GNSA 1W2WB 2X0RA 4MRRA 5EI5A 1ZI6A 2HLHA 4D74A 4CLRA 4JYPA 4Q3LA 1U3FA 2G6BA 2CNLA 3TAHA 121PA 2RFLA 3MQ4A 3IP5A 1IY9A 1XZGA 2CLMB 1IZ7A 1TZBA 1U7OA 3NT5A 3Q9LA 1SEPA 2C95A 4YJFB 1VE5A 3AM3A 1U7TA 2P5SA 3FAKA 2NZWA 4UULA 4XASA 5J2TF 5DLDA 4N6NA 4ACAA 2IDZA 1HBJA 3DV0B 4JLMA 1B8OA 1SZDA 2AR7A 3QKIA 4M8SA 2O5CA 1N1MA 4Y0NA 4XTCS 3ZIAA 4EVRA 1OTHA 1U0JA 3EEIA 5CB8A 4B3RB 2P3OA 4CLDA 4GXQA 4G5RA 2XB2A 3OZIA 1I0LA 2ADFA 4YAIA 1RAIA 5KYXA 3IEKA 5EGSA 1DRKA 2FWJA 2B5OA 2ZRLA 4LGCA 2L19A 4XCVA 2HV8A 1N9GB 2OFXA 3UMGA 2P5UA 3PWSA 1U31A 5G0UA 3S68A 4CEJA 4ZARA 3SJ7A 1PWXA 4HWRA 4LE1A 1KJJA 4B4VA 4DNOA 5CVTA 4MYDA 4YCCA 1TUIA 4CF5A 2G70A 2ODQA 1R0BA 5EUBA 3MJHA 1VKZA 1SUBA 2V3VA 2OO5A 4OXNA 2NUTB 1Z83A 2PL9A 4H17A 4TL8A 3TRKA 1P19A 1A4RA 1VB3A 1Z2DA 5CLFA 2J3IA 2VHQA 5AVWA 2R8PA 3VR6D 1ZM9A 4U00A 4G01B 5FBWB 3R7WA 2O05A 4HZUB 4B6QA 2A5FA 4KX3A 4WUVA 4KIFA 4PONA 3NC0C 3WQRA 4RGYA 2FR1A 3BXPA 2RH4A 3WKAA 1W73A 2GAJA 4NZMA 1WHTA 4KYUA 1KPIA 2HYIC 5C53B 1ENZA 3PVSA 3MYRA 3W1WA 1T5DX 2BI7A 2QD5A 5P21A 1TIKA 2QT1A 3D0QA 3TLGA 1KMMA 3DGEC 3EWIA 1X9HA 1CDZA 4X1KA 2Y8EA 1DWPA 3TDMA 2BGUA 1P39A 2R1VA 3T6KA 5I7VA 1AMUA 2NZ2A 3HACA 3IE2A 4R1PA 2ZCVA 2ZS8A 5A0FA 4J0IA 2Q4RA 3QRWA 2I8CA 3BE8A 1RCFA 3QYJA 1ZSVA 4ARVA 1QO0D 4E07A 1PRYA 3W2GA 2J09A 2OFPA 5DM4A 5AYVA 5B7QA 2REOA 5TQ2B 3ZHZA 1MF7A 3H1EA 3OE7D 2XRFA 3I52A 3WGGA 2ZRFA 3IOMA 5GJCA 4JFAA 5CRIA 1IQUA 1OWMA 1VC2A 2VUSA 2ZT7A 3C6XA 1M2HA 2BRUA 3HDVA 3MTQA 3QM1A 2VHTA 4LXXA 4LGMA 1AKUA 4HRAA 1L7VC 3AERA 5CLGA 1VKRA 3PZBA 2XMZA 3UWKA 3SZRA 3EVDA 2HLNA 4KI0A 2Y6UA 1MUUA 1XOIA 3GUHA 1IJBA 1NI4A 2I8AA 4K9LA 2Z2ZA 1A7KA 4V24A 5D3KA 2VSYA 5BWBA 1TA9A 3K8YA 2DH6A 1YDGA 1YB6A 4LHXA 2II6A 1WY7A 4XLTA 2COEA 4RPIA 3F6YA 1J2TA 3W90A 3FKJA 3K0AA 4C06A 4LNHA 4GEGA 4UZFA 2ZBRA 4B3BA 1MAVA 3FPBA 1HT2E 1ZN2A 2FMIA 2JBAA 3U4DA 1T2VA 2H7XA 1HTTA 1TF7A 4W5HA 4J1TA 4DPLA 3OQHA 2QAJA 1T91A 3B6MA 1F4PA 3KBOA 3FNEA 2K6GA 2XWBF 2Z1DA 3ZWCA 1TVCA 1RKBA 2HJSA 3H5NA 1HLDA 3LQYA 3B7GA 2BEKA 4HPXB 3WO0A 4DJAA 2BP7A 4ZOAA 1M66A 2ZT8A 5MFZA 3D7LA 2FKNA 2PH1A 2GCOA 2ZYGA 3T7AA 3CU5A 3N76A 5E9AA 1XQVA 3W05A 1MZPA 1LW7A 4YVFA 3ZWMA 1SKUA 1G3QA 4AFNA 3V33A 4F3NA 2Q4TA 4LDNA 3CW8X 2PU5A 4NYIQ 3RTDA 5HTKA 4AQ7A 1NVUQ 4DYHA 3E2PA 3KEFA 3E3NA 5EEHA 4YMVA 1N4DA 4G2NA 2PUJA 3SGLA 3E53A 1L2TA 3IELA 3WRXA 1R4NA 1F7VA 4B81A 3STHA 1M1NA 1D0VA 3QITA 4LMAA 3PUXA 4HZIA 1RU3A 1GEGA 2Y93A 1TK9A 1OGYA 3KKKA 1IPHA 4H16A 1RRGA 1I1NA 1LVGA 1RPTA 4PXYA 1A4UA 5KYNA 2VQEB 1LRJA 2H2HA 3A1VA 3DFKA 2G1UA 3QW2A 4ND6A 5TC4A 1R9JA 4CCSA 3H99A 3KU1A 1BGWA 1NNSA 3BWMA 4HZGA 3QXJA 3DS8A 2RHMA 3OTGA 5BNFA 2P11A 1ISIA 2VDMB 1KBQA 2CKDA 2TYSB 2VXOA 1JALA 4DM7A 1E1NA 4RXUA 1MT0A 4X0EA 4M1EA 3JZMA 2H0RA 3LUBA 2RHJA 1FFEA 1WJGA 3LV8A 2DPHA 5LP6F 4KVFA 4YV2A 5C81A 1NQ5A 2ECFA 4EKGA 4OX9B 4PHCA 5FX2A 1RXEA 2F1OA 4ARIA 2WJIA 3BXXA 3EVEA 4RY2A 1SIOA 2YUIA 4OI1A 4KQXA 4O4IA 3AW9A 1XJWA 4KNWA 3H3FA 4QNRA 1V5FA 1P9LA 4G09A 4HKTA 1TQ6A 2HSZA 4YXFA 2VQFB 1SUAA 4FLMA 5TNXA 4YECA 1EMDA 1VCHA 1R64A 2JFFA 3G13A 4HDQB 3HG7A 4ALKA 2Q4EA 4O08A 3O1LA 4BX2A 3HSYA 3O7MA 5AKJA 3D6HA 4B0OA 2P78A 1L4KA 1VSQA 3TLAA 2Q3LA 2ZAYA 2VJMA 3A25A 3TOSA 3VPFA 3ZV6A 2A1UA 1L5QA 1UJ5A 3DV0A 5K3EA 2XD9A 5FYDA 3KIPA 3VKFA 2RSLA 3TINA 4TUYA 4P36A 4DCSA 5FUBA 1G3IA 1OI3A 4KQ6A 2FK8A 2WFZA 2E49A 4LJAA 3LK6A 4PFSA 1F5NA 5AVRA 4W5NA 2AZTA 1Y4DE 1FMTA 1AVTA 4D8TA 1OGIA 4LYGA 4KO2S 4ZU3A 2WJ4A 2W4IA 3DNPA 2WHYA 4R2KA 5DASA 5LMCA 4BXOA 3HN6A 3NRJA 5DE3A 1YDEA 4U0JA 5ALEA 1CUYA 1SOMA 5DOZA 5EZYF 4C3OB 1BYUA 3KOZA 3GZNA 3LVRE 3BJIC 4NJMB 5AUOB 5DTQA 1QLHA 1SULA 3GJ0A 4PFKA 1LPPA 1LPNA 1RC0A 1KH3A 1KJ8A 1QIMA 3AV0B 1G20B 1SM4A 3EXAA 5SY4A 1W5TA 4MCIA 4BKUA 4XUEA 4ZZ3A 1ZUNB 3RS3A 2M32A 4B7XA 2UZ4A 3ILSA 4DV0B 2VK1A 3QVGB 3SBXA 2V7UA 3X3HA 1FVOA 4UNRA 5EMLA 1DFGA 3F67A 3TUIC 3L84A 3MZ0A 1YMUA 4IDPA 3ROMA 4HVCA 1CKEA 3LWDA 1Z73A 1RYEA 1RQXA 1KVTA 4ZJYA 3CSDA 3GY0A 2B4KA 4O59O 5IDYA 3OZDA 4PZAA 2ECKA 1D6MA 4ODIA 1JEAA 5CDFE 2Y6VA 1QQ5A 1XEWX 3FOBA 2Y1WA 2FW1A 2PH3A 2XVZA 3F9IA 5DWVA 2G83A 2QY9A 3T5BA 1I3MA 1CUXA 2W2QA 2CFRA 4UTXA 4YJHB 3VDQA 1NSTA 5ELLA 2X13A 1ONOA 1L4MA 1BDMA 4BX0A 2XMRA 2JLXA 3IP3A 1TAGA 4HDSB 3RRZA 1CFZA 3GAAA 3HDQA 1U1FA 1YQ9A 3IV6A 2BUCA 3A6GA 3I4LA 2OQ2A 4Q4JB 5KVVA 5IC4A 5BXQC 3JCZA 5L8VA 1JSXA 3T1QA 4YMWA 2IXTA 5KHOC 3RAFC 3FW1A 1NXOA 2GCOB 4K26A 2W7TA 5AM2A 1WLYA 5AM4A 2PGNA 1DG1G 3K2BA 1D2HA 5IAOA 4FNOA 4F11A 4J0JA 2PS0A 1D4ZA 1S8OA 3DZIA 2H18A 1C7JA 2R48A 2GK3A 1BMQA 3ZWOA 4MEBA 4P5DA 4DIOA 4GIBA 5CA0A 1DXQA 1X1RA 1QP8A 3DOHA 4HWKA 4GWLA 2VF2A 1EFRD 3KJHA 1V43A 1MRNA 4B3SB 2LTAA 1LUAA 3F74A 4N8DA 4I3FA 2UZ1A 4KE7A 3IDAA 2L17A 3JSXA 1WUYA 4NH0A 3MTBA 1PX2A 4BQQA 3E5HA 1AA9A 1A9SA 2CJWA 1J8DA 1NJ5A 2CXHA 4V3BA 1HR0B 1DAGA 3FFTA 1OWPA 4OP1A 4D8VA 3AVTA 4U4AA 4G5FA 1QCZA 1N3IA 3HEMA 3PIRA 4QASA 2QPLA 4X62B 1IN4A 1RM5A 4S1OA 2O8BB 3FWHA 4PGMA 1G5FA 1A8HA 4L3VA 4MLPA 1N2GA 1Y9EA 2D0OB 2SCUB 2WU0A 3BC1A 3P4XA 3QXSA 3FAZA 4GR5A 2BELA 2ORWA 1H3FA 4KMSA 4AJ4A 1XEXB 3W3AH 5C7LO 2CNBA 2X9GA 3ITNA 5IZ4A 2CEKA 3RUAA 5TQ2A 2B7LA 2IKSA 1LQ2A 3KYBA 3JQCA 2DWPA 1LC3A 4QSHA 4TM7A 2CNDA 3U3RA 4LF6B 1JQBA 1Q2XA 4UM9B 5FWXB 3THXB 5DYGA 4BNDA 3RUDA 5EC8A 4IIHA 4BO9A 4IL5A 3UJHA 3H04A 1Q22A 2E7ZA 3K4PA 1EGVB 3UK2A 3U7GA 3WL3A 2Q8PA 3ESBA 2B98A 3V8RA 2HA7A 2X42A 1G8JA 1VBFA 2ZJFA 3DE7X 3IMKA 4IUDS 4I6EA 4XJVA 2FZ4A 3R6LA 1Z7WA 3D6JA 2NAPA 4JODA 1G5TA 4MV6A 2WHPB 4YCDA 3AHGA 1TMKA 4J29A 3H1FA 3TZCA 2JKVA 4Z2YA 2EFHB 4W1QA 3SZOA 2AE1A 4XVRA 1B6GA 1CP2A 1FNSA 4FSXA 1TAQA 1E4OA 4D8XA 2TMGA 4Y2SA 3WLKX 4AQDA 1RYMA 5A6VA 2V0GA 1NYRA 2GSDA 1Z17A 1PGPA 3VPDA 1QTNA 4BFYA 1KMQA 3PGVA 4WVFA 1R4MA 4ZAFA 3M6IA 1Z4OA 1HNNA 3OURA 2GF0A 5FPSA 5HNKA 2JAXA 3W8FA 4CTKA 4JEHA 2Z3VA 3NTVA 4JJFA 3FG9A 4MWBA 4Y18A 2UXBB 1CNEA 2DUMA 1CQZA 1BVUA 4U02A 1CYDA 1XMPA 2KHZA 4QDTA 3TXAA 4E12A 1IONA 2X2EA 1ONSA 1RT9A 1WDTA 1ZH0A 3C6MA 1J39A 3CLRC 4DW8A 4OL9A 5AH0A 1I3OA 1FNCA 5BT8A 4DC1A 4E09A 5JI2E 3ETDA 3CUYA 3KUCA 4AIIA 1Y9AA 5A4JA 4RHFA 4K86A 5D6NA 3UT6A 5J43A 4RA6A 3RASA 3D7KA 5C4IA 1L7PA 2AFHE 1E1MA 4Q9HA 4IJQA 4ER3A 1B00A 4AYXA 3HXPA 6GPBA 4PX9A 3NWBA 1TRHA 3SZLA 3K15A 4D6PA 1NKTA 1XX6A 2ADMA 2RAPA 3C3YA 4BVEA 4RORA 1IM2A 1PGJA 4U2FA 2ID7A 5HF8A 2XOKD 4DJFC 2R8XA 2P2YA 3BHJA 2RB5A 3PUIA 3UW3A 1BYIA 2C4WA 1RCUA 2ZT6A 4PC6A 3BH0A 1B8PA 4WCDA 3ZY2A 1X7XA 4LQ4A 1WDWB 2EOAA 2GTIA 3AR4A 4PN3A 4YV0A 2G71A 1SOVA 3FDZB 3L6OO 4LCJA 5FFFA 3NB0A 1XA0A 3T3DA 2Z2XA 1AQIA 1IXRC 4FJ0A 3ZVRA 5B3JC 1SCKA 1NW5A 5JROA 1QQBA 2DQ4A 5KX5B 2R6CA 4PWYA 1YE8A 2QQ5A 1PR3A 2RHTA 1FBNA 3FCYA 2CDAA 1CUCA 3GN1A 1K92A 2W2OA 4DLZA 1Q57A 1NE2A 2H7CA 4ADSG 1MIHA 2HYDA 3D8UA 3FNGA 3G17A 3HL0A 1TVEA 4AJLA 4EFDA 1CZNA 5B3JA 5TIIA 1ZXLA 3ZJTA 5F51A 1NE7A 5FL7A 2PSDA 1I2MA 3OU2A 3AFGA 1NVTA 3MTDA 5AI4A 4IGEA 4MJXA 5D84A 4XGRA 1O6BA 1NWCA 3IQZA 1LTQA 3PDIB 3CEHA 1UJBA 3D59A 3JXEA 4IWYA 3OZRA 3PHJA 2P2SA 2QUJA 4XIJA 4IV8A 4KWCA 1T1SA 2I87A 4FEYA 4HDCA 2BPOA 3FGNA 3Q88A 3B8EA 4EJSC 3HO1A 4HTFB 2WAOA 3QWFA 4OFZA 4BFZA 2R79A 5J4LA 4OJNA 1G21A 2IXAA 2FN3A 3OEHA 5BVHA 4K28A 1QQTA 3G59A 5AK6A 1YKFA 3MCVA 5IN4A 1L1FA 4DKJA 2GNOA 1J8VA 2Z09A 3I9FA 3LZCA 4I2NA 5BN3A 1NLUA 5KYGA 2O07A 3VJKA 1H22A 2CFTA 3KT0A 1VPWA 3B70A 2Z9DA 5B58T 4JU9A 3EFOB 1YRQA 4PYMA 2IHZA 4RQUA 1UPUA 3GRFA 4R2MA 5A7HA 1Z75A 2YVQA 3DZHA 1KZHA 1T6ZA 4H59A 4LZLA 4EJ2A 1H2ZA 1OBCA 3LUGA 3QLTA 3R0IA 3SHFA 3QEKA 2AD1A 3A6DA 5FIUA 2GA9A 4R8LA 1JJAA 1VCMA 3FTDA 3MLBA 4MHTA 1SKMA 1VXRA 1FFCA 4GLJA 3FMPB 4Q37A 3GLSA 5E6SA 4CMAA 2JJ2A 3GP8A 3GQBA 1BTOA 3OJOA 2F1HA 4OCZA 4ZI7F 2Q28A 1JHQA 1ZGJA 1NPYA 3SYTA 2LDBA 1DC5A 3LVBA 1Y37A 3TDKA 4PPYA 1PGNA 2OAQ1 1ENOA 1KYZA 4EY5A 4UTZA 3U3OA 4D82A 4KSCA 3SICE 4BNMA 1I1OA 5IMSA 2J9XB 3U3XA 2IW3A 1ZMBA 3HVHA 2Q7DA 3DHNA 4H4EA 2Q21A 3Q3EA 4KXLA 3VU8A 1JAYA 4EG8A 2QTCA 4RTQA 3CR8A 4F3CA 1PL6A 3H65A 3KOWA 4HDSA 3LC7O 4XWKA 2F43A 1B8NA 1JU3A 3TW8B 1KR5A 2Q9UA 3TR5A 1B8VA 3LCUA 1UWLA 3EN0A 3RYFB 3PXUA 5JFOA 2BHRA 2WUDA 3ZW7A 4RJ2A 3KSRA 3TNLA 4V0OA 4E1BA 5I4IA 1HL3A 2QTGA 4RD3A 2FYTA 1NVWQ 1D7AA 1COWD 1DQZA 1UWKA 2YV4A 3B5IA 3MOSA 3LM8A 3U81A 3E9QA 5HX7A 1KJQA 1JSZA 1QJ4A 2NIPA 5FL3A 4ARUA 1ZONA 2W2LD 3FROA 1RSZA 3HA5A 3KHSA 3INRA 5IW8A 1QCCA 4A8JA 3NZEA 3V7UA 1V5EA 4GI7A 1OA0A 5CFMA 1ORTA 3CZCA 4NK5A 2J3MA 3FNFA 2XVAA 4KQIA 4PRYA 3HB9A 4U2DA 1P1BA 5DBFA 2CWDA 3EBPA 4FD2A 2UKDA 3GT3A 4Q3AA 2G1PA 5EP4A 1GGFA 2VRNA 4H4DA 2R7AA 2JIOA 2PEZA 4GE0A 2J5KA 3H84A 1V2GA 4IWNA 2B37A 4RD2A 1UKEA 5CX1A 3ZD9A 4F4CA 1W93A 1TAUA 1F1JA 2FEAA 4ML3A 1GEEA 1RWBA 4X1OA 5BT9A 1ABBA 3D0KA 1E66A 2J9FB 2OZVA 1VKHA 2J0QA 1XQ1A 2H5IA 1QIKA 3LHFA 2ZQZA 3K1YA 4UCQA 5B1EA 1NLYA 1TL7C 5BN3B 1PDVA 4C6TB 4KQWA 1U8EA 2EATA 4DABA 4EUHA 1O9HA 3KSBC 2DWUA 1C7FA 1PWZA