3UVEA

Crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
TGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDLAETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMFHTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uveA00
2VYNA 5EMHA 2GN4A 1Q7GA 3K6JA 1ZJZA 1PIWA 4KQWA 4CR7A 1VJTA 5A5FA 4J16A 5DBFA 4J1QA 1P1KA 3PRJA 4MP6A 2NLOA 4NU6A 3OQ1A 5KJFA 5ENVA 1GR0A 3JQEA 2Y1OA 4RVHA 4YTEA 1XLTA 3C1TA 1QV6A 4W7HA 4E31A 5G0VA 3QVWA 1FK8A 1XSEA 2W2KB 1MC5A 5ITWA 3I9NA 1V8BA 1MFZA 4FC7A 4E21A 4OJNA 2NACA 3BMQA 5CEJA 1Y8RA 4CLOA 4IS3A 4ND1A 1GQ2A 1Y8QB 2VRBA 4CQMA 3BHMA 3QWBA 2BGKA 4RVFA 1VPDA 5IG2A 2X22A 2QW8A 1YJ8A 3WLEA 1DRVA 2CVZA 1CIVA 4IMPA 3WYEA 5TQVA 4DYDA 4KWIA 4XZ3A 1VKNA 2C82A 5BQFA 4KMSA 4INAA 2DBQA 1ZKMA 3VPHA 1P1HA 5I8WA 1Y8QA 4H16A 4MVJD 4YQZA 3D4OA 2JAPA 1M66A 2B4QA 3ANLA 2PR2A 1O94A 1XQ1A 4NR0A 4D43A 4EGFA 2YQ4A 4PLYA 3AFMA 1GEGA 3D5TA 4XCVA 2PLAA 3RUAA 4DLLA 4CM8B 5TS3A 3HB4X 3G49A 4Y67A 3INTA 5HA5A 3DOOA 2PA3A 1EK5A 1PGOA 3PWZA 5EERA 1E1NA 2J8ZA 4R4JA 2FPGA 3I52A 3ZNOA 1O9BA 5BSHA 1I3MA 2BELA 4L75A 5TT1A 3O38A 4FPXA 3GOHA 3RQSA 4DIOA 1LDBA 4YQYA 3VHRA 4D79A 3DL2A 3FRJA 2HMWA 1WDMA 3TOXA 4AFNA 4FGSA 3TPCA 4RL6A 1FMCA 3NJ8A 3UUWA 2J3KA 3B1FA 4CM3A 1IHYA 3W8FA 3GDGA 1YXMA 2CF6A 2QZZA 4A03A 2J3HA 4YA6A 4AJNA 3OSUA 1DLJA 1I32A 1IUKA 2Z1NA 1I8TA 4XR9A 3KLMX 1P74A 3PIIA 1S7CA 1H6AA 4MVJA 5ITVA 1SPXA 3GZ4A 1SC6A 1TT5B 3QV1A 1NFRA 1PWZA 3C1AA 3T7EA 3KXDA 1AHIA 1UXJA 2EV9A 3WWZA 3OBBA 4JP2A 1ID1A 2VYVA 1JA9A 4MP8A 5KTKA 3JD3A 1G0OA 3ANMA 4CLHA 3I83A 4A26A 3DFUA 2AE1A 1OMOA 1YE3A 4IQ0A 2NTVA 2O4CA 4ZQEA 3EW7A 4C7JA 2PD3A 2VRCD 4GI2A 4BOYA 1HSZA 1KBZA 4MJLA 2PGDA 3ZGYA 3SVTA 4IINA 3PYMA 3VKUA 3JQAD 2PTGA 3F47A 4P22A 4XD2A 4WCFB 3DEYX 4XDZA 2GD1O 3GT0A 4ZD6A 4B3IA 4TKMA 1EDZA 4YT5A 1T2EA 1KC3A 3KM0A 2Q4EA 2CVQA 2GCGA 1U4SA 5B4TA 2POQX 4FOSA 4M86A 1U9JA 4R5HA 3LC7O 3HN2A 3ST7A 4BB6A 2IEBA 4MIYA 4XGKA 3SXPA 4WEOA 3I5MA 5BNFA 5JBIA 1DB3A 3LU1A 4CUKA 3MWDB 1F14A 4JNKA 5L53A 2C5EA 4ZQGA 1YJQA 1DSSG 2PD4A 4QO7A 4K1LA 1BXZA 3IJRA 1IE3A 2DC1A 3G3EA 3LLSA 4WOKA 4CMIA 3E5MA 4XEHA 1NQTA 2W90A 3D7LA 3JQAB 2WTBA 4PFJA 3M1LA 3WQSB 4F46A 3HQ4O 5HTOA 4DQXA 1Q2XA 2GZ1A 2VRCA 4UUPA 1HDXA 1LC0A 1U3WA 3OHSX 3H5NA 3L9XA 5KKAA 3GUYA 4UEOA 5JMPA 4XQCA 4BQRA 1XELA 1IZ0A 1Z7EA 3AY3A 3TZ6A 4FFNA 2JKVA 1LSUA 4XDYA 4YT8A 3CIFA 3JQAA 3OIGA 4MVJF 1P9LA 1E7RA 1E92A 2QRJA 2OGUA 1C0PA 4E33A 5KJ1A 5DDIP 3X2EA 5JAQA 1NAIA 4KP7A 4HX5A 3WWYA 3QQPA 1ZK1A 1BGVA 1ZO8A 1B16A 3A06A 4R51A 4OKNA 3RC1A 3GMDA 4N5MA 4DMLA 3P5SA 4JBIA 3F1LA 3CTMA 1PQPA 4JGBA 5CPBA 5EESA 4XGIA 3VPSA 4HV4A 2WD8A 3KYCB 2YFHA 4B7CA 3N7UA 3QVSA 4CLXA 3GPIA 3OM9A 4RPLA 1EVYA 3QSGA 4R41A 4NBWA 3VPXA 4CV1A 1EQ2A 4YJFB 1RM5A 2D5AA 1NVMB 1N1EA 4WLVA 5JDIA 3DQPA 4IUYA 2OL4A 3GHYA 4B7UA 2GN9A 2GN6A 4HP8A 1R37A 4UVGA 5T8KA 1YDEA 3ZU3A 1F8GA 3KYCA 3G1TA 5BSGA 4IDFA 3QVXA 4NQZA 1Q7CA 2V6BA 1U3UA 4NMHA 2VZ8A 4K6CA 3PFWO 2VOJA 2B36A 3GNSA 3ZV6A 4YJHA 4QO8A 4XRRA 5HBRA 4GQAA 3UXYA 5JAIA 4TZTA 4I5GA 1LJ8A 3H9JA 1GY8A 1P0CA 2V6GA 3E48A 3S2IA 4IQGA 3F3SA 1O0SA 4CM4B 2I99A 3LQFA 4CM7A 3OA0A 2IYOA 3S8MA 2R2GA 2I67A 2CD9A 4FQ8A 4R1TA 5CDSA 5U9CA 4YACA 2O7QA 2UVDA 3DOJA 4GLLA 1GQYA 1T1RA 3FD8A 2ZTMA 1ZH8A 3BHIA 2C29D 4YT4A 3UF0A 1PGJA 3L4BA 3M2TA 3DAGA 4JN6B 4HNGA 3AOEC 2OBYA 3JQ9A 4M87A 1H6CA 4R54A 3U3XA 1Y6JA 1WMBA 4BO1A 4J1NA 1AHHA 1UAYA 3KYDB 1JLLA 4GLOA 3OIFA 3BYZA 3JQGB 2B83A 3H5AA 2Q1SA 1OI7A 1MG0A 5G4KB 4XJSA 3SC6A 5I7VA 3LVFO 1F0YA 5AVOA 3ZZNA 4J4HA 1SOVA 3ZU5A 4A73A 3HZZA 3JQGA 3SLKA 3QLJA 1U8XX 1I10A 1B14A 3QJ5A 2AQIA 2X6TA 3UVEA 5G4KA 1NXQA 1ENYA 3DBHB 3MOIA 1IL0A 3I3OA 1C0KA 4RF4A 1I01A 1AN9A 1ZFNA 1I3KA 4RF3A 4AJ1A 2GO1A 4RPGA 1SBYA 3IL2A 3RC2A 3QHAA 3D5QA 4BNIA 1V0JA 2DQ4A 3GVPA 5G0SA 3MCVA 3C8MA 2NU6A 2CY0A 4CM6A 1UJMA 1QG6A 3CZRA 2IODA 2P9CA 4KUEA 2LDBA 1QKIA 3UW3A 1WW8A 3RUEA 4GPD1 3OJEA 4TWRA 4ZGWA 1T25A 3VKVA 1ZSVA 2WE7A 1U1IA 4OH1A 1HDGO 3WIEA 4BIIA 4BO5A 1NHWA 2BLLA 3V2UA 2JFGA 4GKBA 1C0LA 3B6ZA 2XPCA 3WNQA 3NGXA 1Z75A 4FFRA 3RJ5A 1ISHA 5F5NA 1GUZA 2FRDA 3UAGA 4B4VA 2UUOA 1EBUA 4WLOA 4N5NA 3DMYA 1LU9A 1ISMA 1B15A 3JD0A 3G79A 3F1KA 3NKLA 3RKUA 3H8VA 1EEHA 2NNLD 3A28A 1HETA 3IUSA 1R16A 3GDOA 1GZ3A 3WXBA 3VC7A 4PG5A 5ILGA 2VWPA 3ZWOA 2Q50A 4YAIA 5MDHA 1X13A 3DONA 4AICA 4P4NA 4W82A 1QLHA 5CP8A 3EMKA 4J7UA 4PLWA 1IPFA 2OZPA 3CXRA 3R0IA 4FFMA 3WLFA 1J49A 2PV7A 5CG1A 4O0LA 3AI3A 4JJFA 4BKOA 5AXAA 5I9LA 1KIFA 1I33A 1K5HA 4MIEA 1A4IA 2NU9A 2O23A 2YHIA 5FI5A 4DREA 5L7TA 4YR9A 2EW8A 4J2HA 4N54A 5L4LA 2WSBA 1DJNA 5G0TA 4L73A 2BRUA 3PFFA 3L4SO 1FXSA 1WWKA 4OSOA 4TKLA 3C1OA 1KVSA 1MB4A 4IM7A 1X7DA 4JP3A 1E1MA 4RVUA 3U4HA 3VZRA 2I9PA 3PTZA 1E6WA 1WDKA 1R66A 3RFVA 3IKVA 3O8QB 4I5FA 5KIAA 4S1VA 4XJTA 4WLEA 4O5OA 3PYXA 1I2ZA 1NX6A 1U8FO 2JFHA 2EJVA 3RBVA 2JD0A 3GUCA 1VKOA 1H6BA 3DAPA 3RD5A 3EHEA 3QWHA 2ZJ1A 3LT0A 2OP1A 1OAAA 2BFAA 5JO9A 4DWVA 3LYLA 2W98A 3NT5A 3GFBA 4FN4A 4XQEA 5JLAA 1YBAA 2FPIA 1CQJA 1Y81A 3BMCB 3GEDA 4K28A 5BSEA 3JTMA 3RI3A 3MJTA 5FF9A 4R9RA 1QYWA 3HG7A 4JQCA 3FI9A 1T4DA 2G1UA 4YBZA 1X1TA 5H81A 1LBEA 1D7OA 1JDJA 2XXBA 4IJWA 3NYWA 1QRRA 5T5QA 2GNAA 3BMCA 4BQPA 3V2HA 4L0QA 4DIBA 5KCZA 5T64A 3ZNQA 3DZHA 2VN8A 5DCYA 2DBRA 3MZ0A 5T6BA 2B35A 4GX2A 3E5RA 1PEDA 1DBVO 1LLDA 1KETA 2C2XA 2HU2A 1CDOA 3GFGA 4W9NA 3RFTA 4WCDA 2Q99A 4TVBA 1K2WA 1A9ZA 4N18A 5TNXA 1Y9EA 3EDMA 3SC4A 4AJLA 3INRA 4MDHA 4II3A 1KVQA 1SCUA 3WGZA 3Q11A 2O3RA 2GGSA 3PDJA 4NBVA 3I9KA 1BDMA 2EKQA 3GNQA 5F1PA 1YB1A 1UZMA 1Q0LA 2BKAA 1HKUA 2JD2A 5JYEA 2P91A 2ZTVA 3O03A 5C3MA 2EERA 1PZHA 1GTMA 4GGPA 4MINA 4CV3A 1LSJA 2P5YA 2VZ9A 1GU7A 4Y9DA 2Y66A 4ND4A 1BW9B 1XQ6A 5CDGA 2OO5A 1HEUA 2G5CA 3PVZA 4BO3A 1GZ6A 4FJ2A 5JPIA 4MVJI 4FS3A 5IZ4A 4BHTA 3JQBA 4RPHA 1QYXA 3BTOA 1I24A 1PL6A 1NM5A 8LDHA 1A7AA 4IZHA 1DAPA 1ZW1A 1E7SA 1LUAA 2Z95A 4ZRMA 1DIHA 1IOLA 1NAHA 1B26A 1E3WA 4ZRNA 3GG9A 1T24A 4E3ZA 1BW9A 1DO8A 3E18A 1JWAB 3OJOA 4HADA 5BNIA 4QECA 1UP4A 1P1JA 3WJAA 3EC7A 3MJVA 4JJIA 1P31A 2HJRA 2VOEA 4WLFA 3TRIA 3RUIA 1TB4A 5KVCA 2FPPA 2EXXA 1H94A 1GPDG 3K2BA 3RBZA 4PLCA 4L9RA 3RKRA 5JE8A 3ONFA 3HNPA 2RBEA 3MJ4A 1LNQA 1U5AA 4ROSA 4HY3A 2J5RA 4D44A 3H9QA 2IDZA 3V2GA 3KUXA 4Y6PA 4OXYA 2Q46A 7ADHA 2NTNA 3W8DA 2VHYA 4OIMA 5TC4A 4B3JA 1P1FA 4JIGA 3DHYA 3AUTA 3KEQA 4K6FA 2OBNA 5EQFA 1AUPA 1QR6A 3IOYA 4MVJE 1I5RA 4IDEA 4IIVA 3QW2A 3HB5X 4UUMA 2C7VA 1PQWA 4OXKA 4ALJA 2DPHA 4BKQA 4PN3A 1JKIA 3O9ZA 1E7MA 3BHJA 3PHJA 4B4WA 2NQTA 1QXSA 4IJUA 2WE8A 4KTTE 2VHXA 3EVTA 2P4HX 4UEKA 1QMGA 5THKA 3ASVA 4XIJA 4R9SA 5JNLA 1HYEA 2VWHA 1R12A 4I9UA 3F5SA 4TSKA 4GSLA 4CMEA 2HCTA 2Q1TA 1PS9A 3EAGA 5COBA 3DAFA 3JQ7A 3UCEA 4GX5A 3BTUA 3FR7A 2QX7A 2H6EA 1ZSYA 3GZNB 3W4KA 1KVUA 1QLJA 2J3IA 4A2CA 2CMDA 2GF2A 1KERA 5L7WA 2GUGA 1D1SA 4ND2A 3TOZA 1JTVA 5I7SA 1R0KA 3LT2A 2F00A 4RV9A 3KLPX 4BNHA 4EZBA 4CQLB 1OFGA 3PP8A 2PH3A 3GZNA 2C0CA 4EUEA 2DTEA 4MO2A 4XX0A 2ZTUA 3ORFA 2B37A 3GVHA 5BSFA 5F3RA 3RUCA 1B8UA 1LDMA 1KY4A 4HFJA 4XB1A 5DP1A 1VL6A 3ZH2A 4BGVA 3NGLA 4F45A 4RQUA 1H9BA 4CQLA 1UAGA 5ER9A 3CH6A 3Q2IA 5ER6A 4Q3NA 3ON5A 1A9YA 4CLEA 4DLBA 3D1LA 1ULSA 4JK3A 3BXXA 4BGUA 4EITA 5A02A 1NPDA 2DTDA 1MXHA 4D3DA 3GDFA 3MJSA 2ZTLA 3OEWA 4W4TA 1E7YA 4GWGA 3NDJA 1PR9A 3FSRA 2WJPA 2IYPA 3ZWXA 1HDOA 1Q7BA 3OECA 2P68A 4LMRA 1HSOA 1YB4A 1CRWG 5L4SA 4UUOA 4UVDA 4B8ZA 4ITUA 3PWKA 2Q2WA 3H5RA 1LXCA 1U7TA 1UXKA 1XG5A 2JCYA 2VWQA 3DZKA 2FOIA 2W2KA 1NWCA 5G0UA 3PIDA 3ZW8A 4CM1A 4DC0A 2W4QA 1DFGA 1Z82A 2BGMA 3DZIA 4M8SA 3QY9A 4FC6A 2NVBA 5BR7A 3K30A 2FMUA 2O2SA 1RWBA 1EVIA 1P44A 1UP6A 1J5PA 3VTFA 5TT0A 4BKRA 4ZHSA 4E2ZA 3VAZA 2TMGA 4H7PA 2I3GA 4JJGA 1OZAA 4EDFA 5IZCA 5HRUA 3VH4A 3OJLA 1JU9A 1M75A 2O3QA 2VHWA 1JKJA 3WTBA 3ZNPA 2GR9A 2HMSA 3UKOA 3JQFA 1MGOA 2QRKA 1HZZA 4BMSA 4E0BA 5B4VA 4ALLA 4G65A 2CVOA 1P77A 3U4DA 4FW8A 4A10A 4OAQA 3IAHA 2B4RO 1HE3A 4CM8A 3U9LA 4ZVVA 1HDCA 3DHNA 1T2FA 4CMKA 1U3VA 2PNFA 3KO8A 1U2GA 3ZHZA 3O4RA 3VZQA 2EP7A 2IZZA 4QEDA 2NV6A 1EE2A 3JD2A 2DVMA 3LF1A 4J7XA 3ZWWA 2UAGA 1N8KA 2D1YA 2ZIZA 3ITDA 4CJXA 2UYYA 1PS0A 3R3JA 1PGNA 1H5QA 1XYGA 5ILOA 4GWKA 3H65A 1NASA 4URFA 4Z9XA 1BDBA 2V65A 4YB8A 5JDIC 4Q3CA 1PSDA 1K89A 5GZ6A 1H93A 5T8KC 3GVCA 1CERA 5ICMA 3GVIA 4XYBA 3EK2A 2WD7B 3O26A 1DIBA 1LDNA 4N7RA 4LN1A 2JHGA 5H83A 1SNYA 4R1NA 4Q3EA 4D45A 5JS6A 3KETA 1BTOA 1EK6A 1NFFA 1TT5A 1ZZEA 3F4BA 2BI7A 3FF4A 4U5QA 3WFIA 4CMJA 5TLSA 2EP5A 4E2WA 3FWNA 4CMBA 2VUUA 1I2CA 1VI2A 4LW8A 3ONEA 1RYEA 4AL4A 4WUVA 2WD7A 3ZU2A 4AJHA 1GQQA 9LDTA 3I1JA 4BKPA 1K6IA 5IAAA 1PZGA 3ENNA 5IJZA 3SBOA 1XDWA 4BNGA 3GEGA 1WZIA 1OBFO 1V6AA 3MJCA 1YGYA 2Y99A 4HWKA 5IN4A 5ICSA 4KTVE 5CDTA 4FFPA 1PS8A 3RJ9A 1LRKA 1T2AA 3QVTA 4JBGA 4WCFA 3H9UA 3R3SA 4HBGA 1PJQA 2PZKA 4I5EA 5A9TA 4UVHA 4YEDA 1VL8A 4ZU3A 3SX2A 4DLAA 4D46A 4J4BA 3H2SA 4OYRA 5DCWA 4BNUA 1Q1NA 2OORA 3L4BC 1T2CA 2R00C 3GHHA 2FSSA 1Z73A 5B1YA 4IY1A 2Q1WA 4M55A 4MOWA 3FBTA 1YQDA 4WJZA 3DBLB 1HDZA 3ABIA 4D0SA 5IDXA 1KYQA 4LISA 4LRTB 4BGEA 1YQGA 2DFVA 3NT2A 3D64A 2BI8A 2B0JA 3B1KA 3NEPX 1U7HA 4D42A 3PDUA 4ESOA 1DIGA 1L7EA 4BUCA 4CPDA 5F1OA 3PQFA 1A71A 3K92A 3FTPA 3W6UA 3OA2A 3RC7A 1UXIA 1UXGA 1E7QA 1KVTA 4J1TA 1SMKA 3EYWA 3WBBA 2YYYA 3V8BA 3PHIA 2HDHA 5CDUA 2O50A 3GQVA 5L7YA 1ZXBA 5AYVA 3OQ6A 4OGWA 2C59A 3ZDFA 3LZ6A 4Q3AA 1GUFA 4AJIA 4YT2A 1UDBA 3RASA 3ROPA 3GA0A 4B79A 4OM8A 4OOFA 3KHUA 1YDWA 2DU8A 4U7WA 2OMEA 5L45A 5L51A 2NADA 2X9VA 3IUPA 1B8PA 1H9AA 1R0SA 1ISFA 1SEVA 3ADPA 8ADHA 2PZMA 4UREA 2G0TA 1O95A 1VC2A 1A72A 4WLNA 3M6IA 3U0BA 5KVVA 3KSZO 1UZNA 2JL1A 3SEFA 3UN1A 3I9JA 1XGKA 3WGIA 1E3IA 5JCJD 1BSVA 2HQ1A 1Y5MA 4M89A 1NPTO 4RPKA 1DHTA 5EIOA 1BRMA 7MDHA 1V3VA 4YJFA 4RORA 5CEEA 4EI2A 2J3JA 3C7CB 1JVBA 3WDSA 2GASA 3KSUA 4IDDA 4ALIA 1E7WA 1RJWA 1NR7A 2NU7A 3F46A 3JV7A 1X14A 4WNIA 4J1SA 4XWYA 4MVJP 2HMTA 3HE3A 4NJOA 1J0XO 1PX0A 2VHZA 4PG4A 4MVJH 2B4TO 3LC2O 3OJ0A 4PLGA 5EINA 3DC2A 3V5NA 4BNXA 4DVJA 5IXYA 1HL3A 1DEHA 4WK6A 5FWNA 2C5AA 2HUNA 2X9GA 4RDHA 5C37A 1EE9A 4LRSB 4YRBA 3P7MA 1Y9AA 3ZWBA 4CM4A 2FWMX 2R6JA 3EY4A 3U62A 1CEQA 3JD1A 4GVXA 4YDRA 3MWEB 2PFGA 1QYCA 1UR5A 3ZWYA 2Y1CA 2V7PA 3NV9A 5JCJA 3K5PA 2ZYAA 3D4PA 5T67A 2DLDA 1Z6ZA 1I3LA 3WR5A 5BNTA 1EVZA 3H3JA 3U5TA 4NI5A 5CFZA 3VVBA 3KOUA 4QTZA 3KTDA 4CODB 3UCXA 4R5MA 5JFOA 3PK0A 1ZXLA 1OOEA 4N5LA 4RVDA 4Z3DA 4AJ2A 4NFSA 2AQHA 1WPQA 5IDQA 5KVSA 2EEZA 3NT4A 1YL6A 2V6FA 4BNNA 2GN8A 3NTRA 1AXGA 1DDOA 2X0JA 3KYDA 3ONDA 5CHEA 3WBFA 5KJCA 4IZIA 5C7LO 2BH9A 5B12A 4CL8A 2X23A 3CMMA 2QYSA 2Z5LA 4R69A 4IPTA 3EVNA 1C1XB 1KEPA 3DB2A 2ZYDA 1H0KA 4U6QA 4B8WA 3LF2A 3HFGA 4ND3A 3RU9A 2X5OA 3TL3A 1K0UA 3VH2A 5IXSA 4O63O 1DC3A 4MKXA 3JQDA 4HKTA 1LRJA 1HXHA 4OOEA 2D59A 3WYBA 3CUKA 1HDRA 2EWMA 3DBHA 1C1XA 4YXFA 3V1TC 1ENZA 2D2IA 3TQHA 2ZCVA 4JXKA 4ZA2A 1Y1PA 5I7FA 2CDAA 3L6DA 4CL3A 1BVRA 1DPGA 1PZFA 1YH3A 3A4VA 3P2YA 4BO6A 2CNBA 3RIHA 2ZB3A 1LLUA 3W4IA 4YAJA 1YO6A 4OO3A 4W9NC 2WEKA 3PLRA 1E3JA 1HLDA 3B70A 5JY1A 3L0DA 4RPJA 3L6OO 4J4TA 4Q3BA 3Q2KA 1RPNA 4KUHA 4RJTA 1QYDA 3DBRB 3I23A 1LRLA 2EKLA 4ILKA 2VTDA 1ENOA 1EDOA 2P5UA 3DMTC 5KWEA 5KKCA 3Q9NA 1AXEA 3RVDA 3AUSA 1YS4A 4KDEA 4L74A 3E8XA 1ISGA 4FSHA 5C7OO 3KYBA 3Q0EA 4GVLA 4NFHA 1FF9A 2WMDA 4TRMA 4IQ8A 1PWXA 2P9EA 2WYUA 3DBRA 5I8ZA 3GH3A 2G76A 3IMFA 2DM6A 3AI2A 3FPLA 1BWSA 4IDBA 3TDKA 3VVCA 3PJGA 2FHSA 2NUAA 4YPOA 3R1IA 4KOAA 4II2A 2X5JO 4ND5A 2NU8A 1EFLA 4PZEA 4C4OA 5L4NA 4EEXA 1N7GA 4EUHA 3FTNA 4QSMA 3ZI0A 4YYZA 1XKQA 4JROA 1I36A 2O3TA 2Y05A 1WLYA 5U1PA 2OHXA 3W6ZA 2AA3A 1IHXA 1GFSA 1RYDA 1HF3A 4U8GA 1YOVB 3E1KA 4WPGA 1Y5RA 1B3BA 3GNTA 2D3TA 2RH4A 3PPIA 1H2HA 1S6YA 2YV1A 4P4GA 3IIEA 2Q49A 2PGJA 4NH4A 1GYPA 1AGNA 1V3TA 4UEJA 2FY8A 4KDFA 2AG5A 1YOVA 4W6ZA 4BKUA 1N1GA 1QV7A 1NQAO 2AHRA 2CDBA 2JFFA 2PZLA 4GX1A 4P4LA 1GCOA 3PLNA 3S2EA 3CKYA 2A9FA 3TWOA 2FR0A 2BD0A 4CLRB 3FWZA 1XR3A 2P2SA 3B20A 1MC4A 1WNTA 4IDAA 4YCAA 1HT0A 3NRCA 3AFNA 4U6SA 5JO0A 1C0IA 5JY6A 3F9IA 3NJ4A 4NJMB 2B5WA 3JQ8B 3IP1A 3KBOA 3O8QA 3VH3A 5K6AC 3KSDO 3C85A 4NPCA 2J5KA 1VM6A 3ROKA 3WSVA 5HWSA 3BTSA 4WASA 4CLRA 4I08A 4E12A 5DOVA 2V6MA 3K8ZA 1PJBA 1YBVA 2IZ0A 3MOGA 3PJFA 3WS7A 4XRGA 1XCBA 1EUCA 5EJ2A 4IMRA 1NBOA 4X54A 5G0WA 4BO7A 2RAFA 1E3LA 3VDRA 4NJMA 2OP0A 1N5DA 3PI7A 5A5EA 4BO4A 1X7GA 1CJCA 3GR6A 3LT1A 3LSYA 1VJ1A 3PHLA 5AOVA 2X0IA 3DZFA 4D3FA 4L4SA 4MKRA 3MTGA 1A27A 1MG5A 3T4EA 1D8AA 1VSVA 2VHVA 1G0NA 5DOZA 5KJEA 1SO8A 4CMEC 1LLQA 3FNGA 1JVSA 4I1IA 3D3WB 3DZGA 4BL5A 1C1DB 1DRUA 4FJ1A 1DOHA 1U3TA 4XYGA 2IE0A 1G6KA 2QYTA 5F1KA 3DO5A 3HSKA 2PKQO 4H3VA 2RH8A 3OJFA 3ICPA 4YAKA 4RLHA 3ITKA 4RQTA 4BNKA 2P9GA 1UP7A 2GYYA 3U4IA 3AU8A 3AM3A 3A9WA 2VUSA 2CF5A 1PGQA 1QP8A 4WE3A 5FYDA 4RO0A 3WFJA 2Q4BA 3IC5A 4RVGA 1WZEA 3E9MA 4G81A 5C5IA 2HMUA 1HTBA 3QWAA 1SB8A 1MLDA 1U2DA 2DUUA 3ETDA 2WWRA 4Q3DA 3ZWPA 2YJZA 1P3DA 2GDZA 4OQZA 1KOLA 4A0SA 3NX4A 2Y93A 2LDXA 1ZUD1 4K26A 1EUZA 2YDYA 1K6XA 1YVEI 5AXCA 3WGTA 4ZJUA 4I5DA 4HFNA 1E3EA 2X86A 1JAXA 3NDIA 1LSSA 4DPLA 2VT2A 5TJ9A 4CUZA 4FB5A 3ZCXA 3TZCA 1MA0A 5JDCA 3UH1A 4OHUA 4E5KA 4FBGA 2VNSA 4FFLA 3WIDA 1GV0A 2WYVA 4BO0A 1KS9A 2PKRA 5GMOA 5DCUA 1JWBB 1JKFA 1LSOA 1PJ4A 4DIFA 2YZ7A 1E6EA 2VCYA 3LDHA 3MTJA 1KEVA 1VLLA 2IRWA 4AG3A 4J9VA 4NIMA 1EZ4A 2X9NA 4MKZA 3WMWA 4HNHA 4L4RA 4M54A 4DRYA 2I66A 1P1RA 1XIVA 2I3AA 2YQ5A 1Z45A 3W8EA 3QVOA 4NDNE 3EZYA 2HSDA 5EL0A 3WYCA 4DQUA 4IXWA 5L40A 1HRDA 2NWQA 5LCXA 2PWZA 4LGVA 3PQDA 4NBTA 4CR6A 1K3TA 3PQEA 2EKPA 2O4UX 3Q9UA 3IQDB 4Y8VA 4BV8A 2OOSA 1T1SA 2IZ1A 1GCUA 3IKTA 1FJHA 2H1SA 3JQ6A 3G0OA 3HN7A 1WDLA 3VZPA 1BVUA 4GAEA 5HM8A 2PH5A 2DBZA 1SZJG 3GEMA 1X15A 1N9GB 2A35A 2VYND 1X1EA 4I9HA 2NQ8A 1B3RA 3G1UA 3GRPA 1PZEA 4ONEA 4S3MA 4LK3A 5U4QA 3TZHA 5COQA 4GL4A 1M76A 3T7CA 4R1UA 1A4UA 2RHCA 1UUFA 1LQTA 1R4NB 3P19A 4EBFA 2C2YA 2YY7A 1TLTA 4YJGB 3AI1A 4Z0TA 4FFOA 4XGNA 1SOWA 3VTZA 1YBMA 3B1JA 3KRTA 4A27A 4TMFA 3A1NA 1PU2A 1ZCJA 2Y1DA 2NVUB 4M1QA 3HDHA 4F6LA 4DPKA 1PL8A 1BMDA 1X0VA 4B3HA 4RCVA 1YRLA 1R4NA 2VQ3A 4LCJA 3WMXA 4UULA 1DFHA 1ADFA 2EW2A 3E6AA 4YJGA 4MP3A 4BNMA 4QUKA 4DBZA 4AJPA 4XYMA 5KJ6A 1X0XA 1K6JA 1ZK0A 2I5PO 2D8AA 2BFOA 2NVUA 4CQMD 1FDSA 3E03A 3Q3CA 2FZEA 3GY0A 2XXJA 2RIRA 2J6IA 2GSDA 1CYDA 4OL9A 4PZDA 3ZNNA 1JQBA 4KUGA 1RM4A 5DZSA 3OF2A 1EVJA 4IS2A 3K2EA 4YJDA 4OXNA 4XR4A 5KVQA 5TX7A 4NNJA 5A06A 3JYPA 4Y98A 4WEQA 2ZK7A 2HJSA 4IJKA 5TF4A 4RDIA 3RWBA 4IBOA 1E6UA 3GF4A 1BXGB 1L1FA 3BMQB 5F5LA 2FSVA 1Y8RB 4CLOB 4WCFC 3QE3A 1D4FA 3DDNA 2X8LA 4CQMB 2C20A 2UDPA 2ZYGA 5BT9A 1N7HA 3TNLA 5JCXA 1BXGA 3JCZA 3LC1O 1DIRA 4A7PA 1W6UA 4UAGA 3RC9A 3DTTA 2BHLA 4BMVA 4Y6RA 3WNVA 2ZATA 1IPEA 4EJ0A 3F4LA 2H5LA 3HDJA 4Q39A 1NTOA 1KEUA 3JQCA 4JBHA 1CETA 2G82A 1HYGA 1TEHA 1XA0A 2HAEA 4J6FA 1IB6A 2YV3A 1P1IA 3FNEA 2B69A 3ULKA 3UICA 1ZJYA 1ISIA 2Y68A 1X7HA 1NR1A 2BMAA 4PLPA 4TVOA 2GZ2A 3RFXA 4WOJA 1FDVA 4BNFA 2Y0DA 5TGDA 4CV2A 1Y7TA 3GVXA 4EJMA 1N92A 1NWHA 2XOXA 5JSFA 2C07A 3ZV3A 1MP0A 3QIVA 1PJ2A 2GRAA 3CZMA 3IJPA 5ADHA 3GPDG 5A04A 2VYVD 1E1KA 4BMNA 3ZWCA 2I6TA 3FNFA 3PHGA 4FD3A 1VJ0A 2JJYA 3NUGA 4LVUA 4E2YA 3DBVO 4TRRA 1A7KA 1GDHA 3E9NA 2AQKA 4MIOA 3RCBA 2Q1UA 1U28A 5THQA 1UXHA 3JYOA 1ZK2A 2AQ8A 3GGOA 4QFDA 1HE5A 1HE4A 3NTQA 2FP4A 1W8DA 4FR5A 3RROA 2A92A 4L4XA 4K9DA 3BIOA 2BFMA 2Y67A 3AWDA 1Q0QA 3WGOA 4KWHA 3TN7A 4GSKA 2EHDA 2YDXA 2ZKLA 3GAFA 5K0ZA 4BGIA 1FDWA 4P38A 4PCVA 4GBJA 3BAZA 3P2OA 2Y1GA 3HDQA 4IXTA 3EZLA 1ZBQA 1TVEA 3DZBA 1EBFA 3ZHYA 2I76A 4CM5A 3ZWAA 2AMFA 3D3EA 3H2ZA 3PGXA 1WAMA 2OXIA 2A94A 3M1AA 1PJSA 4FOOA 1D3AA 5A9RA 3V1UA 1NQOA 1P45A 3I4CA 3FCOA 2ZQYA 1O6ZA 3KV3O 4Z9YA 3F5QA 3PJDA 3KVOA 3GMSA 1O5IA 1ORRA 2ET6A 4NBUA 2GERA 4AJJA 3AM4A 3BMNB 2EGGA 5A3VA 5DF1A 4BNVA 3HJAA 5I9NA 3K9QO 2HK8A 1TXGA 4CR8A 1MV8A 2DPGA 2G17A 4E5YA 2VNAA 1PL7A 3JQ9C 3QWFA 5MGBA 1FDUA 2EF1A 1M2WA 3IP3A 4WLUA 3UCFA 4D0RA 4OKIA 2SCUA 1I0ZA 3BMNA 4R16A 4CMIB 1ZK4A 3M2PA 5GY7A 2EJWA 3PWSA 2JAHA 4Z0HO 3JYNA 3WGQA 4AVYA 2DTXA 4GH5A 1E5LA 2UV8A 4QQRA 5A03A 5IDWA 1DXYA 1UDCA 1JAYA 4WECA 3DBLA 3RSHA 2CUKA 4NU5A 4BNLA 3CEAA 1YKFA 2QIOA 4FDAA 1KC1A 1DC5A 4R1SA 2VTEA 1A5ZA 1R15A 5CDYA 1IY8A 4Z3KA 2Q45A 3W1VA 5JMWA 3VOSA 4NBRA 3ZU4A 3C24A 2E6UX 3OIDA 1HWYA 2ZJ0A 2AG8A 3N74A 5DULA 4BVAA 2X4GA 4I8XA 3ETEA 4R3WA 1B0AA 1ZSNA 4JCOA 3ROQA 5B4UA 1TT7A 1H6DA 4PG8A 4J9UE 4BNTA 3LLVA 4G5HA 5B37A 2JD1A 2DKNA 1W0CA 3WTCA 2DBVO 1Z74A 3DXFA 1P0FA 1GD1O 4ZQBA 3ETGA 2Y1EA 2VZ0A 1HZJA 4HFRA 4OQYA 1T2DA 2PZJA 4WGGA 1BHSA 3W4JA 1XEAA 1PJ3A 3OEYA 4DMMA 3LT4A 1Q0HA 1CQIA 4D41A 4BNJA 3RUHA 2NVWA 3STHA 3WGHA 4OMUA 4E4YA 1LLCA 1DC4A 3DWFA 3AU9A 1GYQA 2QG4A 4E32A 2D0IA 3HWRA 5KOIA 5L3ZA 3CSDA 1V9LA 3DHEA 4BNZA 2PD6A 1GL3A 3ZV5A 2NTJA 3GLQA 4TZKA 1J6UA 3DTYA 3U09A 1OC2A 3H6KA 3GAZA 1B2LA 4ZN6A 4P8RA 3HHPA 1DJQA 4YJHB 4JLWA 5TJHA 3VDQA 5JYDA 3KZVA 3C3XA 1M6HA 5AQ1A 3FN4A 3OQBA 1R6DA 3GK3A 2E49A 4ID9A 1U4OA 1WP4A 4XQ9A 1LX6A 1I2BA 5A9SB 4XIYA 5CPFA 1IYZA 1EFKA 5JW6A 3MJEA 3NDRA 3INGA 4J0FA 4YRAA 1PJLA 4H15A 3ZWNA 2AEMA 1ZIDA 4FIZA 4XB2A 4F6CA 3AK4A 4RZHA 4UUNA 3WJ7A 1ZMTA 3ANNA 4Z6KA 3X2FA 4BNWA 3DFZA 3GN2A 3CPSA 3GGPA 4YAGA 4YVFA 4J2OA 5A9SA 1ISJA 1IZ9A 1RKXA 4JX8A 3ZWVA 1W4ZA 1WXDA 2EGHA 2FZWA 2CFCA 3CE6A 1MUUA 4RF5A 3RU7A 1DAOA 4EJ6A 3WGGA 4CUJA 1GYRA 2E4AA 1ML3A 4L8VA 5TSDA 5COAA 1WMAA 5GZ1A 5FEUA 4GX0A 1U5CA 1AE1A 4GMFA 2EIHA 3AOGA 1EUDA 1DLIA 5J23A 2I65A 5ENDA 1KY5A 1V35A 1TI7A 1VL0A 4CMAA 2DUWA 2JCXA 3PJEA 4MVJG 1Z7BA 2W8ZA 3K96A 2R00A 5DNAA 1PJCA 2Q2QA 1JW9B 1O89A 1ZNQO 3GRKA 4BV9A 1UDAA 1ZVMA 3L77A 4F3YA 1ARZA 3FBGA 1YL7A 2HO5A 3WICA 3ZN2A 3RBXA 5LDGA 4PLVA 4CV0A 3TFQA 1VSUA 3HDYA 1ADGA 2E48A 4R3NA 1E5QA 2IXAA 4Z0PA 4XYLA 2WYWA 3COSA 3D0OA 5IFLA 5LC1A 4PGFA 4Z9FA 3HUDA 4B4UA 5DBIA 1G1AA 5LDHA 3WGYA 1N2SA 1KVRA 2FR1A 1E1LA 4PIVA 1F12A 3RAJA 4XYEA 3ADOA 1YWGO 1PTJA 4EYEA 3UOGA 1XHLA 4O1MA 3AUUA 2ZB7A 2HMVA 1F17A 1YONA 5JAMA 2O3SA 4EEZA 2O7SA 3GG2A 3NTOA 4YAEA 5JC8A 3WOHA 3N58A 1GV1A 4HXYA 1DIAA 1PJTA 1GPJA 3H9GA 3ZW9A 2YV2A 4FJ0A 3Q1LA 2UUPA 2HK9A 3DR3A 4AJOA 3ICCA 3GGGA 3T4XA 2CSUA 1HLPA 3HADA 4ALKA 4U0KA 1NPYA 5DP2A 1JN0A 3QP9A 4J90A 2NSDA 3Q6IA 4G2NA 3ZHBA 3EUWA 5JXWA 1KEWA 1MXFA 3SJ7A 3WQRA 5DN9A 1F06A 2DT5A 3EGOA 3OFSA 2X5KO 4IDGA 4GGOA 1DC6A 2PK3A 5G4LA 1NYTA 1ZMOA 2AE2A 4AJKA 1C3VA 1L7DA 3A14A 3WQQA 4IDCA 3PHHA 4PLZA 4Y6SA 4J3FA 3OH8A 5FFFA 4DGSA 3TL2A 4NK4A 3CINA 3AY7A 5IDYA 5I9MA 2YFQA 2DAPA 3TF5A 1M67A 4J43A 2TMDA 3JQBC 2B5VA 1NVGA 4LCEA 1GZ4A 4TQGA 5G2OA 3TZQA 1WVGA 3KEOA 4BB5A 4DC1A 3AY6A 3VZSA 2YHIB 4RLSA 4NHEA 2RHRA 3ROMA 1ZK3A 3I4FA 4PZCA 4IGEA 1FDTA 4IIUA 1C14A 4QFCA 2P4QA 2X1HA 5EN4A 1NP3A 2OUIA 2Z1MA 5JDCC 4PG7A 4HFMA 3AOEA 3BMOB 3OETA 2GZ3A 2Y0EA 3PXXA 4BO8A 4E30A 3OICA 4RGBA 3E9QA 4NK5A 2Q2VA 1GEEA 2PGLA 3H4VA 4AJ4A 3OMLA 2CZCA 2O3JA 1LA2A 5EPOA 2AEJA 3SJUA 1LC3A 1UZLA 2YW9A 1DRWA 3QRWA 2ZB8A 1E3SA 3CMCO 3GN1A 4KZPA 3FHLA 2H9IA 4GKVA 3BMOA 4NFYA 3JD4A 4D3SA 4CM9D 3UGKA 1HYHA 4E5NA 1P33A 1ULUA 5A3JA 2D5CA 2W2LD 3VPGA 1F8FA 2IEDA 3K73O 1ZEMA 4QXMA 4PRKA 3JQ8A 1SB9A 4CLDA 4CMHA 4LMPA 1LDGA 1ONPA 1ADCA 2X7HA 1XWFA 3WB9A 3I9MA 4J0EA 1LDEA 2FR8A 3F6YA 1CWUA 3LK7A 3L9WA 4A5OA 2QRLA 3ZHXA 2H63A 3TJRA 3SLGA 2GPTA 4LVCA 4DTIA 2ILTA 2GLXA 2Y0CA 3UHAA 1R0LA 1RM3A 4DBVO 4E5PA 1UH5A 3I9OA 3S2FA 6LDHA 1YQXA 2AXQA 4ZQHA 1BG6A 2JCVA 4DPMA 5KNLA 1NNUA 1OC4A 4IJVA 3S55A 2X0NA 3WSWA 2C7GA 1T26A 2ZQZA 3IDSA 4CMGA 4J7CA 3OP4A 1ONOA 2OFPA 1BXKA 2ZCUA 2J5QA 1EMDA 1D1TA 1O8CA 2O3UA 2PKQP 1QORA 3AJRA 4O6VA 4E6PA 5FI3A 3D3WA 2HKIA 4I9NA 1XU7A 1C1DA 2X0RA 1LQUA 4CM9A 3H7AA 4KQXA 4UVEA 4XQGA 5HS6A 1ADBA 3WG9A 3V1YA 3RUDA 4RVSA 3L07A 2RCYA 2NM0A 1B7GO 3ZV4A 1LEHA 1E77A 5T57A 4LSWA 4NG5A 2W2LA 4AJEA 3PZRA 4EW6A 1PGPA 4RZIA 3QA9A 3DMTA 4E13A 2HRZA 4J91A 4J49A 4DQVA 3UFXA 4OSPA 2VWGA 5CAEA 1I30A 4PRLA 1V3UA 2O2YA 3AM5A 4YWJA 3FNHA 4DL9A 1E0DA 1GADO 3GC6A 3G17A 2VUTA 5JC1A 1PR3A 2HK7A 4D7AA 1SEPA 4L76A 1NHGA 2WM3A 2HLPA 3D4NA 4ZQFA 3S1LA 5CEFA 5HS4A 2YUTA 2PY6A 5L9AA 1E3WB 3I9LA 5TRTA 2Q3EA 1LI4A 5DBGA 4TROA 1XU9A 1GUYA 3PEFA 2XF8A 2Y1FA 3ZWMA 4B4OA 1QSGA 3BZUA 4MVJM 1R4MB 3NAQA 3K31A 1M6WA 4YRDA 1H2BA 5AXDA 3VPFA 4W7IA 1MFPA 2E82A 1J4AA 3U4CA 4BO2A 3QWIA 1VE9A 2IXBA 3BA1A 2A4KA 3E82A 1VRWA 3PGJA 4CMCA 4EUFA 2DFDA 2WDZA 2E37A 3AUAA 1R4MA 4BNYA 2XAAA 4C7KA 5H82A 3IS3A 3HFSA 4E5MA 1RM0A 4PLTA 2C54A 3TSCA 4PLHA 2EG9A 3DZJA 4IGFA 4E2XA 5K9ZA 1B8VA 5IZCC 3ASUA 1ENPA 2BFPA 3L6EA 3H3FA 3C7DB 4PVCA 3I6QA 3MEQA 4ALMA 3JYQA 4ZICA 5I7EA 5AXBA 5K6AA 1GAEO 1LTHR 1ONNA 2QZ9A 4WKGA 1QYVA 4FGWA 6ADHA 3PYLA 3JQFC 2BGLA 2D4AA 1ZEJA 2JHFA 5CG2A 3C7AA 2AW5A 4PLFA 4R68A 4WNCA 5TIIA 5IF3A 4GMGA 4FCCA 4O59O 2CDCA 2VT3A 4PVDA 3AW9A 4RF2A 4DA9A 5A4DA 4XA8A 5EQDA 4U0JA 3FPCA 4HUJA 4Q9NA 3JQ7B 2HRBA 4DXHA 3R6DA 4ALNA 2BF7A 5DT9A 1W73A 1DFIA 1IULA 4UVIA 1MX3A 1EQUA 1NFQA 2F1KA 2AEFA 1N9GA 2ZB4A 3TZKA 1T4BA 5ES3A 4DYVA 1I3NA 3JSAA 5A05A 5L95A 3KB6A 5GZ3A 3BTVA 4LSMA 1HE2A 2QQ5A 4TRJA 5C7IO 2QHXA 3FR8A 4M49A 3S2GA 2YHUA 1LDYA 3WX0A 1NVTA 3U49A 4BO9A 4PG6A 1DHRA 4B7XA 1SAYA 5A1TA 1PQUA 3DOCA 4QT0A 3JYLA 4R01A 1YL5A 4QX6A 5F21A 4BS9A 4NZ9A 4TRNA 3ENKA 3VH1A 4W99A 5JAZA 1CF2O 5IN5A 9LDBA 3PZBA 1YB5A 3H9EO 4DUPA 2X58A 1HDYA 3RUFA 4XKJA 1NQ5A 2O48X 1TA4A 3I6IA 2FN7A 3TFOA 4MPDA
chains in the Genus database with same CATH superfamily
3GJ5A 1JLRA 4LHSA 2ZIWB 3GRUA 4IXDA 5EKSA 3PGLA 5F33A 4UDYX 2XUDA 3BM5A 2PMDA 3V1LA 3K1ZA 4EG5A 1Q7GA 4F1JA 4KN8A 3K6JA 4JS0A 1VRCA 1X77A 4GECA 2BIFA 2ZR7A 3WGMA 5DYTA 1MNQA 3AHEA 2J5BA 4D9GA 3RS9A 5CD9A 2ON6A 4J1QA 1AS0A 5DBEX 4INPA 3L04A 2Z9BA 4NENA 4EB6B 2J9XB 3PRJA 5EMLA 5KJFA 3LW7A 5B53A 2G28A 3TRJA 1GR0A 3JQEA 2Y1OA 4FWTA 5DRYA 1HEIA 3RBAA 1QCYA 2HY7A 2QMUA 1UT8A 2ZANA 4FFSA 4D4LA 4JU8A 4OAOA 2YN4A 4W7HA 1GQRA 2DUJA 2X42A 2EZUA 1YB6A 5AW3A 2GHQA 4EB6A 1AKRA 2QT9A 2AN3A 1MFZA 2OORC 2QKYA 5FWXA 2O8DA 5JAPA 4YS6A 3AO0B 3RSFA 4PZYA 3WQHA 3C74A 3UT6A 3LHFA 4OJNA 4E21A 4CGYA 2AYYA 2X2EA 4E5DA 4RYLA 2H17A 2Q4OA 1V8PA 3R4VA 4ND1A 4G0UA 1NVEA 1IM8A 2GYVA 2XBUA 1I2MA 1GNLA 3IO5A 1VPDA 2DCMA 3MW8A 3OI7A 5IG2A 5CNIA 4DIMA 3ZGZA 1UIRA 2W6CX 3WLEA 4F2PA 1CIVA 2ZZKA 2RHJA 1YUMA 3UMFA 1JQ5A 1C9JA 3JYHA 4IGIA 5BQFA 2FAXA 1W85B 4IF6A 3R09A 1YV9A 1O5TA 4IW3B 5FPQA 4J1TC 4KRYA 1LPOA 3I32A 4OA5A 4ZCSA 1X7XA 1D5WA 2HYDA 5I8WA 2NT3A 5ES4B 3TNYA 1RSZA 4MUYA 3DULA 2WUEA 3VHQA 2ZBFA 2DWPA 2W6IA 3NNSA 2PR2A 1XQ1A 2WM9B 2SNIE 4R7TA 4D43A 2YQ4A 5K0EA 3L4KA 1S9HA 1IB0A 4FR2A 1T3HA 3G8DA 3QNUA 3ROFA 4CM8B 2PBLA 3P9XA 5TS3A 2IS1A 3HB4X 2R66A 4P4UA 5CLLA 2H92A 1ML4A 3VNVA 2ODWA 4XUEA 1H8HD 3FYUB 5LM3A 4XAQA 3RDPA 4FSXA 2QQFA 3PNPA 2PVSA 1Q0ZA 2HPZA 4YFVA 3U44A 1JPUA 3ZQ4A 2KWIA 3O38A 3IPYA 2RGGA 4FPXA 1KI3A 1P4SA 2ZXUA 2PZ8A 3DLIA 1NYQA 4KR2A 1VA5A 3GOHA 3KK0A 4FN5A 1LDBA 4HGYA 3I9V6 4TT3D 4UMFA 5CIWA 2HMWA 4YQYA 3T5BA 3VHRA 1QHHB 4D6PA 3HKDA 2ODBA 2GVDC 2RJOA 3FTDA 1NKSA 3PXUA 4JKIA 3RFCA 3ZTTA 2J3KA 3GLRA 4KE7A 3WE7A 2QZPA 4GQBA 5C8YA 4ZPXA 4KGZA 3P0HA 4V1CB 3PNKA 5ELMA 1RHKA 4P08A 2C2HA 4YCBA 1IUKA 1X9HA 4U4AA 4I2NA 1M7HA 1EFHA 3GAMA 4XR9A 4YRSA 4Z4CA 1Z08A 3IMEA 3KLMX 2IYEA 2P2ZA 1S7CA 2R6CA 4MKGA 4MVJA 1QHHA 5J4HA 2ODNA 1SC6A 1ADJA 3GZ4A 4TXHA 1SU4A 4ER6A 1NFRA 1PWZA 1U7OA 1JIUA 4TWAA 1SKYB 2EV9A 3NZEA 3Q3GE 4OQNA 2AMYA 4ENTA 3WWZA 2CCJA 3E7XA 3OBBA 5GOTA 2VLIA 4RK1A 3GFFA 4JP2A 4UE6A 4V1CA 1OH8A 3MHPA 4HQRA 4OBWA 1ISRA 4TWZA 3C3KA 1F2TB 2OXCA 2Y9MB 1L5QA 4CLHA 3U48A 3DFUA 4A26A 3WYNA 2QM3A 4AKGA 4MULA 2O4CA 1DX9A 5DTIA 5EE3A 3QE4A 2PD3A 4C7JA 1NR5A 3AXSA 1W87A 4DUGA 3FOEC 4C0WA 1E2UA 4MJLA 2PGDA 3ORYA 3UGTA 1WF6A 3ZI4A 1NVKA 2FZKA 1E4YA 2IIQA 3PYMA 2PTGA 2YS7A 3F49S 3F47A 4P22A 1F2TA 1X7ZA 1PYDA 1SU8A 1NN5A 2GD1O 2Z2YA 1JPJA 2ISSD 3EG9B 3WLSA 1KSJA 1U0FA 4C7MA 4M6WA 4TKMA 4B3IA 3BN3A 3ESYA 4MHOA 2WJJA 1DMRA 2CVQA 3LQRA 5M3BA 2UUCB 3ZU6A 4E22A 4J0JA 1CUJA 4Y9TA 2P41A 1M33A 3ST7A 4JUDX 4B2LA 3P4XA 2JZNA 4XGKA 2CFTA 2DEUA 2GO7A 1WCIB 2PMWB 1KZ9A 2WU4A 3F6PA 4UHJA 3ZZ0A 4DJJA 1DB3A 1OBOA 4MQEA 1JL3A 2GXQA 1DSSG 1XZFA 4HUTA 1A4RA 1BEEA 4R1QA 2FN4A 3UO8B 2WINI 4K1LA 1LJLA 3IPRA 2Z4SA 4H17A 3HB1A 4UNQA 4KLRA 3HB0A 1P5HA 4KAXA 1OFUA 3CT4A 1WCIA 2WTBA 2WTEA 3GIDA 3IQFA 5EUBA 1QFJA 1L7MA 1CE8B 1X1SA 1CRQA 4PQYA 3SEQA 5HTOA 2J3EA 3DGEC 2P3LA 4P3XA 1D0SA 2V0CA 1WV0A 1U3WA 2FXIA 4K9LA 2IV3A 3OHSX 3H5NA 2JJ1D 1DL5A 3EBOA 2VT6A 2QPOA 4Q19A 3VMMA 5JMPA 4B9AA 2EG5A 3VNQA 2GARA 3COJA 2EKZA 2HA3A 1LSUA 2W4IA 1HURA 1W6RA 1P3JA 3A6ZA 3AGPA 4YT8A 3O8OB 2XUGA 2J9FB 1OHHD 1U6JA 4O25A 4HLUA 2RAVA 3UANA 1CY8A 2GESA 4BQFA 1M0WA 5FQOA 3B1YA 4KI0A 5E6RA 4Q66C 3G2JA 3QFCA 4HX5A 4ARVA 4P36A 1PG2A 2ATCA 2WSSD 5CW2A 5A2QA 5JFGA 3AVTA 1JG1A 3GBSA 4GYJA 4GUAA 1IM5A 3RU3A 1XZHA 4D9CA 4HRVA 4M9CA 1JE0A 2J9FA 4JEIA 4ARBA 3E2MA 3U6BA 4JBIA 1PWEA 1TUIA 4WV3A 1RWXA 2A3RA 5KYXA 4QASA 1N6IA 1TJNA 3NP9A 3EXG2 1PT7A 3C6ZA 3QPBA 2O2GA 5FA5A 3TB6A 5HJEA 4DMHA 2WD8A 4HV4A 2R86A 3THRA 2YFHA 4HOYA 3LQ4A 3QVSA 3ADBA 2O5EA 4CLXA 5GONB 1VLZA 3OM9A 3AVOA 4KYUA 2IHYA 2W2OA 4CV1A 3L7YA 2C5LA 3R4CA 1A97A 2C5BA 5LQNA 3SYKA 1RM5A 1WL8A 1NVMB 4JLJA 5AVJA 4WLVA 4XSHA 4XARA 1L4GA 2PMKA 3RTBA 5JDIA 2WWXA 1V5GA 1BJRE 4XWWA 2REBA 5ALOA 4K5QA 2DFKB 3EPRA 1WUIS 1F8GA 3LQKA 4K86A 4JENA 1A2KC 5DK4A 1QP4A 1VJGA 4XX1A 5BSGA 5LP1A 1OKKD 3KG2A 5TGZA 4NQZA 3L84A 4PS0A 4DR3B 2FKAA 5FHRA 2I80A 1H2RS 2ZZNA 4WHMA 4XGQA 4UU0A 1FFWA 5KQPA 4J8PA 2I91A 3BK7A 3CGWA 1H2YA 2B36A 3GNSA 1QTIA 3VV2A 5JSZA 2QRPA 1L5ZA 3AF4A 2FRVA 4H1UA 3UXYA 1DAEA 1QMPA 4MDYA 1SK8A 1KI8A 1ZD5A 3DLTA 4I5GA 5B1EA 2ONKA 2Z83A 1SC9A 2CYBA 2ZJAA 3E9YA 2PX5A 1BKSB 2AUNA 1XT6A 3FW1A 3O1HB 4I46A 1O0SA 3AEYA 3AF2A 2WTMA 3P1JA 2PL5A 4NSNA 4CM7A 1VLJA 3OC6A 3OA0A 5KSWB 5DJ5A 1N5JA 3VVMA 1LTQA 1X94A 2Y3IA 2R2GA 2ZJYA 4GMKA 3CZAA 1WPGA 5CDSA 5E3HA 3VDXA 5ADWA 4AF6A 3OEHD 2C77A 3FD8A 1N25A 1XZMA 2KS6A 2PLFA 3M3HA 5ALGA 1Z4QA 1E64A 2BEVB 2GCNA 2QLNA 1DELA 1FFXA 2QWXA 3BICA 4H3HB 4LJ5A 4ND7A 4Q7JB 3L7AA 3UF0A 3L4BA 5ARDA 1SD1A 1HT3A 4DMCA 1OAOA 2OBYA 2C2BA 1H6CA 3BRSA 1CUUA 2YMPA 2AKEA 2ANCA 1WMBA 4NMMA 4J1NA 4G26A 1GGMA 2HBQA 1RT9A 1JLLA 3FRHA 3KYDB 1Y42X 3PVCA 3OIFA 3VYSB 1EGHA 5J2TB 5IBRA 3BYZA 2B83A 4ER0A 3H5AA 1ZCBA 4DCPA 5G1OA 1MG0A 3P9PA 2I03A 4FNOA 3ESXA 5CYOA 1KO5A 3PB3A 3CF4G 1CUGA 1NGSA 1P2SA 1R18A 3ZCSA 2ZSBA 1SUPA 4GZ3A 4O2BB 2I8AA 3PCXA 1G7SA 3EJWA 4IEEA 3ZJ5A 1YTLA 2FEWB 3UB3A 1ODKA 3EXEB 3GYGA 4A73A 2AOUB 2X0KA 2YZMA 3HUEA 3QJ5A 1I10A 3A1FA 5AUQA 2X0DA 2X6TA 1CUZA 1EM6A 1NXQA 1U0SY 4A36A 1K68A 1RPTA 1N77A 3I3OA 2YASA 4EKEA 3L7JA 4TX1A 5B64A 2VTBB 1AN9A 2WQZA 4N40A 1W1UA 1RKQA 3MTIA 1SBYA 1WKVA 1Q1BA 3KLNA 3UA3A 1GIAA 4BVEA 2OECA 1TADA 5KTSA 3GVPA 3EXEA 2FX3A 2BW0A 5G0SA 5GOZA 2ZT6A 4XDHA 1Y1SA 2R1TA 4K9QA 1W93A 3O74A 4OJKA 3SFTA 2ZJ5A 3PQ6A 5DO9A 2AS0A 3WK7A 1G9SA 2ZI6A 4F3NA 3COWA 1J39A 2LDBA 1XMIA 1QKIA 2EBWA 3UW3A 4OSEA 3RUEA 1XYVA 1CCWA 2YKGA 4TWRA 2B1GA 2GEVA 1U1IA 1IWBB 1OWOA 4PANA 3FHOA 4GPIB 4B3RB 4D3ZA 1QO9A 4QDJA 1BX3A 2EFCB 1TK9A 4C2UA 2A9PA 5I01A 5FWDA 2WYIA 1L5YA 3FUVA 5LZ8A 3CVXA 5DB4A 3A3NA 4GKBA 3KT6A 1C0LA 3FB4A 2JG3A 1EFCA 3C6MA 1Z75A 4P3NA 3I73A 1ISHA 4MR7B 5D3MB 3KALA 3I58A 5AO9A 1X8LA 3M9WA 3UAGA 1U94A 1ZPDA 2YW2A 2IVZA 3EUFA 3QI2A 1EBUA 1XZGA 4WLOA 1BQ3A 1BH6A 1ZMXA 3DMYA 4QYMA 4KK4A 3G8BA 1ISMA 1PD1A 1PUIA 1Q2UA 1DWUA 5AJVB 5HKBA 4B3MB 3G79A 5FBHA 3HA2A 3FCXA 3F1KA 1G16A 2O1WA 3AV0B 3SKXA 3PS9A 4YQFA 2NU8B 2VHTA 3IUSA 4HYTA 4ND8A 4P83A 3C8HA 2F1JA 3KDAA 3GRYA 4OQDA 3P9IA 2V55B 4RNDB 4BMVA 2FGJA 4KAAA 3T7SA 1XMQB 3FIJA 2FUG1 3UMSA 1I3OA 1KP3A 3SGLA 2PKXA 3REOA 1SY7A 3LY9A 1E1CB 3ZK9A 3EYAA 3H5TA 1L6IA 3SXJA 4Z5XA 2PX3A 1U1GA 1L5MA 1J49A 1U3FA 1SCKA 2G8NA 1YDFA 2V8BA 3D2BA 3OE5A 4RX1A 1CUVA 2PRJA 3AF5A 4X85A 3O94A 3ZOZA 2C0PA 3AB7A 4BKOA 4B5KA 5I9LA 3D4BA 5JJ5A 3BIWA 3AIIA 2Q1XA 2OSVA 2PFKA 3WL3A 2AN5A 2A1IA 1K5HA 4EJFA 4DARA 3OWXA 2YV4A 4KLCA 3KCQA 5A0FA 4DREA 4ENVA 1D2MA 1RJDA 3T5CA 5BYBA 3IPLA 1ZA2A 5BSRA 2BRUA 5KYWA 4S1WA 3PFFA 1NT2A 3L4SO 1F9AA 3H0EA 4AXXA 5JXIA 1IJKA 4H9GA 4TKLA 1HFKA 2WF6A 2QGZA 1OFUX 4IM7A 2I29A 4MVYA 2Q4RA 5E8RA 1QHGA 3DT6A 3C3PA 1SRRA 2JATA 3CNHA 4FQ5A 1JIXA 1E6WA 1XD2A 1NV9A 1QR2A 1WDKA 1R66A 2BFWA 1MAWA 2YX1A 3IKVA 4K2AA 3TX2A 4BBPA 4EW1A 4RXUA 2BFEB 1CR2A 1U90A 1X1CA 1Y1TA 3CRMA 3QFFA 3G1WA 1CLUA 5KIAA 4O33A 5I4KA 4F4JA 3ROGA 2EJVA 5FWYA 4S1NA 3CZ5A 3DAPA 2IY9A 2M6LA 2ADFA 4BCCA 5MHTA 4JI6B 1GT6A 2HEIA 5CVEA 1LKZA 3I1YA 1EUCB 3KIPA 3PSAA 3U7EB 3M0EA 1QF9A 5JO9A 3TRDA 4DWVA 1I9CA 2WIBA 3H1FA 3NT5A 4Z53A 5F98A 4TTIA 2FPIA 1N33B 1CQJA 4MRMA 2AK2A 2BFEA 2QRQA 2YWBA 3GEDA 5BQ5A 4AAYA 5BORA 5DTQA 1CVIA 5FF9A 4R9RA 2C95A 4A8TA 2LW7A 3U7FB 3P52A 4DLRA 3D3NA 1DO2A 4D5GA 3D6FA 2X2FA 3PFNA 1JDJA 3AF3A 3LUPA 2GYWA 3NYWA 4IJWA 4JR0A 4TV8B 1NBEA 5T5QA 1KI9A 3SXUB 4PIPA 4QU5A 2OFFA 2GNAA 3ANSA 5EHZA 3E58A 5KKNB 1G8YA 1REQA 1PJRA 4WK4B 1AKMA 3HFJA 5KU1A 3V2HA 2VAPA 3KQWA 2ZM5A 4FDLA 3DZHA 1Y5IA 1NOIA 4RZXA 4BZZA 1B73A 4YP0A 2QP3A 3AHJA 3IUJA 4J94A 2DBRA 3ZE0B 1JMYA 1G3QA 2QN6A 1PEDA 4GX2A 2QI9C 2EFEB 2HU2A 4W9NA 3RFTA 2BN4A 3HCBA 1GSHA 1NQUA 1EP2B 2PU5A 2KM1A 4NEQA 1L9KA 2W11A 3QJYA 2FEAA 1SBZA 4ZALA 1G8KA 3T5AA 2D6FA 5TNXA 1OTHA 2R25B 5HMLA 3OX2A 4LHYA 2ZWAA 4ZO6A 5AVKA 3QEBZ 4MDHA 4II3A 1KVQA 2J0UB 3QKSB 3SSMA 5IT0A 5BUQA 1CBUA 3GD5A 3HACA 4G0QA 1H2ZA 2DG2A 2JJ2D 2QM7A 3I9KA 4NBVA 5BW6B 3CUSA 4C20A 2H2HA 3EVZA 2XVMA 2GEUA 3GNQA 2AEEA 1T9AA 3EXHB 3MCTA 5F1PA 3VO2A 2YFYA 4EMUA 3MC1A 1L7RA 2BUBA 2BKAA 4MPJA 4UQLA 1HKUA 2ZTVA 3O03A 3T3HA 4KLZA 3L7BA 2YVUA 5ULLA 2AOWA 4K3UA 3B3QA 4Q4LA 3THSA 4XWKA 1PR2A 3QKSA 3VJKA 3H2KA 4G0WA 2WUFA 3DAOA 1GU7A 4BE4A 4D8YA 3UC9A 1SG6A 4Q00A 4QJIA 2Y27A 4Y9DA 4JQYA 3V7NA 4ND4A 1RQXA 1NVUQ 3M1IA 5D00A 1HEUA 2GK6A 4BO3A 1W5EA 3K70B 5JPIA 2WHPB 4C05A 4EY7A 4BHTA 3Q9LA 4P7FA 1SA0B 1QYXA 2NO9A 3BTOA 4RPHA 3EX7C 1OE0A 4GKJB 2XA2A 4GM4A 4D9MA 1A7AA 3M89A 1DINA 2BFCA 1ZW1A 2Z95A 2Q07A 4LWQA 4NBSA 4YASA 4ZRMA 4EZEA 2BAGA 1B26A 1F3OA 4E03A 4E3ZA 4P0QB 3R5XA 4XD7A 3STXA 3WK8A 5JUWA 1TUEA 5JYBA 1JWAB 3G2KA 4C04A 3CU5A 2CYAA 2ZULA 4A8JC 1UK6A 2DLCX 5BV7A 1UP4A 2RK6A 3PEYA 2WVGA 3WJAA 3PEUA 4Q4DA 3EC7A 3F7TA 1JHQA 2QSYA 3ZE2B 4AYXA 3DEHA 1BE1A 2Q6VA 4QRDA 3KEFA 5F73A 2ONJA 3ZDDA 3P0EA 1V11B 5JIBA 3IT0A 3ZE7A 3ANYB 4QDZA 4F91B 5IHPA 4EUKA 1K88A 4TM8A 1VG0B 1S3SA 3IEUA 1VI5A 2VLBA 3UG6A 1BA3A 2R62A 5HNKA 1YBFA 1AS3A 4G9BA 3VXKA 4F1WA 1GLVA 2J5RA 1XQXA 2IDZA 4NMLA 2VJKA 3SLRA 3V2GA 2DY1A 3VPDA 2VQFB 3H4TA 3SFVA 1JLKA 2VHYA 3LBHA 3V34A 3ZHOA 3CUWA 1S2LA 3K9HA 1RXYA 3SJCA 1J2TA 2W2XA 3DF9A 5E7QA 1TM7E 1UQRA 3K71B 1AUPA 1SQ0A 2C9YA 3IOYA 1I5RA 3VNSA 4MUEA 5KQRA 4IDEA 1E9DA 3TLCA 4RTRA 3O4GA 4EEKA 4LZNA 4ALJA 1GWNA 3VJMA 6PFKA 1ZN8A 4NZMA 4KO4S 2XJ9A 1JKIA 1O94C 3BHJA 3O9ZA 4O8CA 2AMJA 3P27A 4QNNA 3H16A 4WXPA 3EQZA 2HDOA 1PR5A 4EB3A 2WE8A 4KTTE 3LOUA 3ZGLA 2XWPA 4OI0A 1A2QA 3KQTA 3CLSC 2AI3A 3FPBA 1KEZA 4WN9B 2CMFA 2VWHA 2PRIA 4I9UA 5EEGA 5T3UA 4O02B 1Z4OA 1YQUA 3F5SA 4ZXFA 4GSLA 5HFAA 4ENPA 2P5SA 5L3QA 1TCVA 3WQBA 2QYOA 1G2OA 5GJCA 4EL0A 3TM5A 1AQNA 3BTUA 2YIDA 1ZINA 2H6EA 3FJ1A 2EHJA 3GZNB 2IYZA 3DZDA 5FB3A 2WIFA 4XTCS 1BXRA 4QBKA 4A2CA 2D5BA 3QX8A 4R8VA 1RLOA 1Z2AA 1WW2A 4YRKA 5L7WA 3MGAA 1GDTA 4CF5A 4B2IA 3TIXB 3LT2A 2R7KA 1J8QA 4RV9A 1RMQA 5EWMA 3X1JA 4EZBA 4IOKA 5IHXA 3UMBA 1OFGA 3PP8A 5A6SA 3LS2A 3GZNA 4PZUA 3GLGA 4LCBA 2XHZA 1ZUNA 3FFXA 4M0FA 4MO2A 4DA6A 1TYBE 4UDOA 4ZYYA 3G8CA 1JG2A 1G7TA 3DT9A 3EWIA 4JT4A 4YJ2B 4QEZA 3RUCA 2ZAYA 2QTCA 3IAM1 1KY4A 4HFJA 4XB1A 3A6JA 4BGVA 2OZKA 2ZQ5A 3LTEA 2O1EA 1J0BA 5DM1A 1Z5WA 2GA8A 1Y3HA 2OO7A 3ZY3A 1QLWA 2JIOA 2VEDA 3MSCA 5B2ZA 5ER9A 3RYTC 3TN7A 3FY4A 4JU9A 5JNSA 1HQCA 1QE3A 2DKFA 2R8RA 2O2ZA 5K3CA 3DZ8A 4QC2A 1OIVA 2OG2A 4HN9A 5I3ZA 2D7DA 3FHJA 4JK3A 4UNNA 3K4PA 4UASA 4U2DA 5FPPA 1RWOA 1P9WA 2WPNA 3VYUB 1F7VA 1G2QA 1C7IA 1ODTC 3BXFA 1IVYA 2PXXA 3PGVA 4W4TA 1L4MA 3UV6A 1ULAA 3COZA 4GWGA 1WP9A 4AZSA 1T8YA 1NMSA 1LTKA 4JI0B 1PVOA 4HZUB 1HDOA 3KTOA 4YGYA 1W25A 4EJSC 1RLUA 3O90A 1J99A 2P68A 4NCIA 5F3DA 4Z9BA 1HSOA 3Q7QA 3ZIUA 4BBZA 2Q5EA 4UUOA 2UKDA 4AZ3A 4Z54A 1NJ8A 1P6XA 1SHJA 1Q1ZA 2PSDA 1OJLA 1QRSA 5DRTA 2YJTD 3CLUD 3U4AA 4RUKA 1F5SA 1W76A 1FW6A 1NWCA 4BTEA 3NBKA 4WGFA 4G1UC 1G19A 2W4QA 1DFGA 4DC0A 5JS1A 4HZUA 2BGMA 3C3AA 3DZIA 4M8SA 4UEWA 3A6PC 3LCJA 3K72B 1HL7A 1P7CA 2R44A 2FMUA 2WFLA 4LXQA 2O2SA 5CT4A 5FOVA 4AN1A 4L78A 2G77B 4UJ3A 3RRFA 4ZI5A 1POWA 4XIGS 5E4YA 3VTFA 4E2ZA 1ECBA 2GCOB 2BMFA 3ZBTA 3L4JA 3U40A 4ENQA 2I3GA 2B8NA 3FHCB 3GCGA 2FQWA 1G8SA 1L8AA 2O06A 4DLKA 2LPMA 4BLWA 1C50A 2ZWIA 3IAM6 4LJYA 4PZAA 1Y80A 3LRPA 1SUEA 3OOWA 1F1JA 4C06A 4XIIA 1J5EB 2ZSHA 3Q5EA 2FLWA 2GR9A 1VE7A 2AJBA 1I4EB 4R2XA 5EIHA 3VI4B 3UKOA 3JQFA 1AMUA 1HZZA 3EC1A 4BMSA 4C6SA 3S44A 3IB6A 1QG4A 4LFAB 1D2GA 5K20A 1TIKA 5E2BA 2IBTA 3U7IA 1GAXA 3COYA 3MJFA 1GU1A 1X42A 3JRWA 1HE3A 4TLLB 4HSGA 4DB2A 1NJ1A 3U9LA 2PGXA 3M4XA 4HVAA 2ATEA 3KZNA 3S2UA 2FW6A 4UBKA 4KG7A 3D6AA 3BD6A 3NBXX 4JB3A 3BXGA 4YJ3F 3ZHZA 1U2GA 2PL3A 1OA0A 3EVBA 3O4RA 2BBSA 3KSAC 2RMKA 1VIYA 4GBED 4PYMA 4ZAZA 3O3OB 2H8KA 1EE2A 3JD2A 5FBZA 1QPBA 3B7GA 3NM4A 5AKKA 3ZK7A 4AQDA 4P86A 4ID3A 3ITDA 2IHTA 4QUGA 5TS2A 1PS0A 3QTTA 1JHAA 1H5QA 1XYGA 3R3XA 4F2WA 1M5TA 2M6KA 1CG6A 3JSXA 3H65A 4PZLA 1NASA 5BSMA 4EKYA 4URFA 3R76A 2PUBA 2V4ZA 4Q1DA 4HNRA 5BWOA 4YB8A 3IP6A 3DMGA 4Q3CA 3FWPA 1C1HA 1NUSA 5BVGB 4PPYA 5ICMA 1GTVA 3GVIA 3HMQA 1R5NA 3OFVA 1DIBA 5HOQA 3UWKA 1NE7A 3TLGA 3LX8A 5H83A 5LB4A 4B40A 1QOZA 3WK9A 5LN1A 3KB2A 3QXGA 2QRUA 4Q3EA 2XBMA 4D45A 1DWQA 5JS6A 1ZZEA 1NFFA 3DPUA 3FF4A 5CH8A 2X14A 4CMJA 5B3LA 1NVVR 3K0KA 2EP5A 4GPAA 3FWNA 2P2NA 5DXAA 5BVGA 1VI2A 4ZWNA 4AM8A 4LW8A 3O21A 1ZUIA 2FN8A 2ZYSA 3H42B 5LJIA 3PXEA 4AL4A 3ZU2A 2I2BA 3O3NB 5IAAA 1U0GA 4UHDA 1HTWA 4LQ4A 4OQ4A 5SZIA 1F4PA 3B2NA 3CNLA 5IJZA 2ILVA 1WZIA 2ORIA 4HWOA 3VSBA 3DF7A 4WDQA 2Y99A 4Y3UA 2FWIA 4B45A 1E1QA 4OL0A 2QA5A 5JBNA 1XP8A 4FFPA 1IC6A 3KJEA 3QVTA 5EIXA 1QAQA 1VKZA 3H9UA 4HBGA 3UOWA 5I48A 6ADHA 1CVRA 1VL8A 4ZU3A 4AKSA 4DLAA 4D46A 4KREA 3RSCA 4I6EA 4OYRA 4EPTA 4FX5A 1JEEA 2OORA 4ZPJA 3ZY5A 1Z73A 1Y7HA 4AWAA 3MWKA 1YQDA 2NYVA 2VQ6A 4KXLA 5F4BA 3ABIA 1N2ZA 3AR7A 2GH1A 2QRVB 2CMKA 2F1OA 4LISA 3QZUA 3WAKA 2J09A 1YQGA 3NT2A 4MVCA 4AUMA 5EJEA 3WLNA 3B1KA 3P9SA 3L40A 3EQ7A 3U60B 1HYBA 1Z12A 3PDUA 4KMMA 4EF6A 4FMCF 2ZBVA 4G36A 5DW0A 3SQLA 3WMEA 1M2JA 1MO2A 1V8ZA 2OB2A 3FTPA 4G24A 3GB9A 3PR2B 1E18A 4LE1A 3PT9A 5FO1A 1Z33A 2C03A 4J1TA 1SMKA 3EYWA 3ILVA 3QVVA 1M1XB 3V8BA 4ETIA 5CDUA 2CLSA 1J56A 1H22A 2O50A 2VJCA 2XX3A 4JT2A 1SFRA 3PBKA 2ZXEA 2YH2A 3N70A 4FVTA 3LFHA 3SIRA 1LD3A 5M34A 4XH9B 2A9KA 3LDUA 1N7IA 5CTAA 4G0PA 1FVFA 2I1QA 1Q1EA 4I1OA 1H4SA 2W9XA 2YVQA 1CW2B 1IRXA 3OE4A 4B79A 4OM8A 3CRRA 3KHUA 4OOFA 1M6VA 4MARA 3I6MA 421PA 3AF6A 4ZVKA 3OQOA 3BJZA 3WZ2A 2OMEA 5L51A 2JPDA 4MUNA 3IUPA 1ATZA 4N3GA 3CWQA 5EWJA 3V48A 1N36B 4O4LF 1QQTA 4ZYLA 1F4LA 3EFOA 4LC9A 4ZMRA 3ZWDA 2PM8A 4BC0A 3U0BA 3ZHCA 1IQRA 4DLNA 4YLEA 2AG0A 3R5SA 4P35A 1O6BA 2JBHA 1ODJA 3UN1A 1EXDA 4DSOA 1MT3A 2H57A 1IHPA 3WGIA 1ZD9A 3II6X 3HWSA 2OV6A 3GROA 5JCJD 1Y5MA 3KWMA 1NPTO 4I4TA 4ZI7B 3R8FA 2IP4A 3IEXA 3R44A 1U9ZA 3L7KA 4F71A 4C78A 4R2LA 5K4AA 3H2HA 3T5GA 3I5XA 4O2LA 4ZTUB 1OHHA 1S01A 2N9UA 4PE5B 1KAMA 5K01A 4N76A 4PGHA 1RQ7A 3JVIA 3BE4A 5FUQA 4X71A 1XTPA 1DP4A 4Y18A 4F4DA 1E7WA 1RJWA 2B9VA 3AESB 3H2IA 3PGA1 3ED5A 4KNVA 4Z51A 4WNIA 4OY3A 3ZHTA 2G04A 2H00A 3KCNA 1YS9A 3L1JA 4XWYA 1TEXA 1PX0A 1VJ5A 4ENSA 3L6RA 4NCBA 3LOPA 3MIIA 4QHYA 4O08A 3BJIC 4ZT4A 2B4TO 2D1FA 1BROA 2X8AA 3LC2O 4ZQCB 4C4PA 3TBKA 2FSPA 2VSOA 3DC2A 1C81A 4YMVA 4IHKA 5J5CA 4BNXA 4YMGA 1HL3A 2FG5A 4M9QA 3I2GA 4XWGA 1E4EB 3HBMA 4YUVA 4DSAA 3MS7A 4WK6A 3PXGA 2AFHA 2E7ZA 1C1YA 1M9NA 4EH1A 1T6XA 1PR0A 4MH0R 5GQSA 3V42A 4DAOA 2N1BA 5TVKA 2APJA 1KDPA 3PT5A 1XVIA 1EE9A 2WK1A 4F11A 2VBFA 5IC6A 4D1YA 3ZWBA 2WMNB 3ONVA 4MYDA 2Y1XA 4Q15A 5EWLB 13PKA 1P2BA 1EUDB 1MQ8B 2H1IA 3MWEB 4MI6A 3ZWYA 2X6RA 4F3TA 1E3QA 3NV9A 1L6RA 2FFHA 3K5PA 3NIWA 3GLIA 1XQ9A 2BUCA 1Z6ZA 1P4JA 1V26A 3BD8A 1EVZA 1T2NA 3GBVA 3U7QA 3AVYA 2SKEA 4XW2A 4KE9A 3LNCA 5AT1A 3KOUA 3A10A 3UPUA 3WMFA 3AB8A 4ZYWA 3K8OE 3FDXA 5BMVB 3PK0A 1OOEA 2GZRA 2WWWA 3O9VA 3LO8A 4CTOA 5JSYA 5JPCA 1TQ6A 3EGIA 1NDHA 1U31A 2QVLA 2QD4A 5KVSA 1IZZA 4FHGA 1EX1A 4U2FA 4X7MA 4BNNA 1JXMA 4RHXA 2X0JA 3L06A 2JLQA 4FLEA 4PO9A 1J06A 1CY1A 5CT5A 2X23A 3CMMA 5FR1A 2GZAA 2JGDB 4IPTA 1EB8A 1C1XB 1EX6A 4YUZA 1H5UA 4Z0PA 4NYJR 4V39A 1AG9A 1JVNA 5BOSA 3V55A 4JQZA 4J0QA 3TL3A 1E9EA 3IHLA 1R8XA 3OEHA 4RANA 4MKXA 4F4CA 2BFDB 1KFJB 2FWRA 3BDVA 4JNCA 5DBOA 2OYSA 4QSHA 4DG9A 1EIZA 3CUKA 1ELOA 1HDRA 3RVBA 1C1XA 1H1LB 1ENZA 4XCQA 3PDHA 4ASUA 4G85A 4RY9A 4QGFA 3QPUA 1Y1PA 3DEFA 1W34A 2RJNA 1KI1A 2CDAA 1UWLA 1L5LA 1HKHA 3DM5A 4FEAA 2R5WA 4BFTA 1I6MA 4I36A 2F8LA 4MI3A 1PZFA 1YH3A 2XDQB 2BFDA 5BT8A 3OLYA 3P2YA 4BO6A 4JUCA 1H8ED 4Q4JB 1JAZA 1P81A 1G66A 3RYIA 1JALA 3U9SA 3GLKA 4DMRA 1E5XA 4RADA 1A8UA 4W7SA 1PX2A 3GP8A 1K08A 1WOMA 2H1WA 5ALSA 2WB2A 2XB4A 1TM4E 3W2IA 4Z3OA 3JQPA 2UXCB 3R7WA 2ONCA 4RETA 2R6ZA 1D1QA 3CEHA 3U9TA 2HA7A 3L6OO 1G6HA 1VA4A 4J4TA 4BFXA 4PN7A 1OFHA 1OTXA 2FDCA 3HKEA 2XDQA 2VO1A 1QYDA 1LRLA 1OV4A 1QANA 1VSQA 1JHXA 2EKLA 2OGTA 4Q4JA 2WG2A 5FR2A 4TN5A 3TRKA 4W9MC 2P5UA 2TSYB 3DMTC 1N5IA 4B76A 3V2IA 4UHCA 5KWEA 3P71T 1LWOA 1XMJA 2QNRA 1YHYA 3AUJB 5KKCA 1AXEA 1TJ4A 1AUQA 3SZGA 3ZJVA 1NW8A 1XHEA 4Z4GA 4NFHA 1FF9A 2WMDA 1ZI9A 4BVFA 2YCBA 1YF3A 1PTKA 3G2PA 3DDWA 3CV3A 3O47A 3TUJC 4Z1MD 5K4GA 3IMFA 3ZY6A 5D3ZA 1FXWA 1CHNA 3FPLA 2G4LA 5D1NA 2CEAA 2FHSA 2NUAA 4X8LA 1XVAA 3R1IA 2ZR8A 2O05A 1M0SA 1ZWLA 1PV4A 4PZEA 2PT6A 4KYIB 1FQWA 2G80A 3PU6A 4HBZA 2E55A 5DX1A 4EUHA 2RC6A 4HAYA 4O4HB 2C96A 5JVDF 4YYZA 1XKQA 4X20B 1IJEA 2FYTA 1WLYA 2AA3A 4MWDA 3IV6A 1C9YA 1JMKC 1GFSA 2IHVA 1RYDA 2PS9A 2R87A 1IIRA 2B2XA 3O1LA 2HEGA 1Y5RA 1B3BA 2IZOA 1JT2A 1MBZA 2GJKA 4XDGA 5EXXA 1H2HA 4JWKA 5EE9A 3UUEA 3AMVA 4FZ5A 4P4GA 4ARAA 2W0SA 2BZGA 3SVLA 3KC2A 3IIEA 4O4HA 1ZDMA 2Q49A 1P3Y1 2PGJA 1JEQA 2J0EA 5KOJB 1MDBA 2OV3A 1AGNA 1CUBA 4MITA 3DJYA 3IIMA 2TMYA 3L7CA 5IARA 4H3KB 4JC8A 2FY8A 5KOHB 3PUWA 3K1AB 3G2MA 1WZNA 2ZREA 2IBSA 3MVEA 4RIGA 1U9IC 1FQJA 2R1VB 4B0OA 3ELWA 3A9CA 2PZLA 4ZEVA 1JAIA 2AYXA 4PPFA 3CKYA 3KOOA 1WVIA 4XLLA 1O9GA 1UPTA 3FWZA 4ARZB 1SVWA 3ZZMA 1DBPA 3B20A 4DR2B 3RIXA 1WNTA 2CYCA 1GTSA 3KP1A 5KOHA 5JY6A 1DARA 3F9IA 3NJ4A 4DAEA 2DFLA 3K1AA 1D7AA 5E7JA 3WAGA 4IKOA 3GJSA 1X1DA 4E07A 2NZYA 2CUTA 4NPCA 1OXVA 1MTZA 3WSVA 3UJ3X 4I08A 5DOVA 4BFYA 3K8ZA 3MOGA 3ZHUA 3DL7A 1B6RA 3A6GA 4PEVA 2AG1A 5B1HA 1K86A 1NBOA 2CZQA 5G0WA 5JSHA 2JJQA 4IH9A 2RARA 1LPBB 2LKDA 2GLTA 1TLFA 2QTFA 3PI7A 2VJDA 3QXJA 3B6KA 1E32A 1X7GA 2B21A 3U4GA 4HNQA 3WMGA 3LSYA 3P9NA 1JS1X 2PGNA 1NRJB 2CDNA 3UHFA 3UTDA 2PRKA 3PEEA 4OX9B 4PC6A 3KE8A 2XUOA 3Q7RA 4L4SA 1JDUA 3A2MA 1A27A 3AB3A 3MTGA 2Y92A 1QIIA 4BFVA 3P0JA 2YIVX 1PHRA 4UD6A 3AIOA 2CBZA 2YJ3A 4JYMA 2BTQA 2PMFA 3RVKA 5IXJA 4R8RA 4QU9A 1N4DA 5KJEA 2F64A 4R6WA 5EKXA 3V80A 4I1IA 4EY5A 5BXYA 3D3WB 2GKSA 3DZGA 3UMMA 1XTZA 2PVPA 2EX4A 1WRBA 2CN1A 1XXLA 1DOHA 1DX4A 4D92A 1U8YA 1U8AA 2HHLA 4QAJA 3NORA 5B57C 5TQ2A 5F1KA 3DO5A 1MU0A 1JIIA 1PFQA 5BR4A 5F23A 4N9WA 4FP9A 4I6GA 3QE0A 5JAUA 5CFOA 5BR1A 2IYQA 1FSSA 2ZVPX 4MYRA 4EG8A 1L5NA 2PUDA 1TVCA 4CIDA 2XQJA 4M38A 4RQTA 1NBIA 4EY8A 4MUFA 2P9GA 1E2KA 2X9LA 3CLTC 1DXOA 3AM3A 3HI4A 3A9WA 3CR8A 4ICIA 3VR6D 4JLPA 2PRZA 1PGQA 5CH3A 1QP8A 1VL2A 4PZ0A 1IOWA 2HJ9A 4JP8A 4MW0A 1O0BA 4FBMA 5B2FA 1RPJA 1YVPA 2B5OA 5FYDA 3WK5A 2WU1A 1OB5A 5JPDA 3Q10A 1JDPA 1STOA 3PD7A 3IC5A 4LZWA 3VU9B 3BQNB 4IOJA 4YALA 1WZEA 1ORHA 1K97A 2K87A 2V9CA 4G81A 3WADA 5AOBA 1P4GA 1RRPA 2W48A 1ZUHA 1LBIA 1MNAA 1MLDA 3DV0A 3QWAA 2DUUA 1NU8A 3RHTA 3TQIA 4EG0A 3FZYA 4V1CI 2BFNA 4HQOA 4A0SA 1RRVA 1EWQA 2ZYVX 5DMHA 3HA7A 4E6EA 3RW9A 3TTXA 2J59A 1Q74A 1QUFA 2HMAA 1UKAA 3QKRB 4W5WA 1GRNA 1Q3TA 4HFNA 1E3EA 2WPDD 2Z9DA 3K4QA 5ISMA 3IEMA 2O8FA 2C1ZA 4REOA 2G83A 1GGJA 4PX3A 3TZCA 5JDCA 1QJ4A 1RXEA 4EY6A 3MBIA 2WSYB 2RHBA 3SR3A 3UQYS 5KBYA 4LJLA 1GNTA 2EW1A 3OKFA 5ALKA 4UBMA 2VJAA 4UTOA 1JFFA 3UC5A 4D98A 2EX1A 5H9WA 5JWRA 3NJRA 5LOVA 2V8OA 5DFAA 1B6TA 1ULZA 4BZQA 3P96A 2VHUA 4A2WA 4AY2A 1PHPA 4GI7A 4DGQA 4AG3A 3ZJ4A 4C0JA 2ODAA 2Q3CA 4LOIA 4M54A 3NW9A 2I3AA 2P1ZA 3LCVB 5EL0A 2OCLA 3WYCA 1MRNA 3K0CA 4DQUA 2RFLA 4DR4B 1NJFA 4CU2A 4HWRA 1ISPA 3GQBB 2OCKA 3OU6A 5CFNA 3GP3A 1A7JA 4U2EA 1AKQA 4URYR 3PNSA 1R64A 4FWIB 3QHPA 3C1UA 3FWYA 1V16B 4JZKA 4Y8VA 3S99A 1KGDA 4NYIQ 4WZAE 1MOZA 2IZ1A 2O5RA 1DKOA 3R6GA 3B9QA 1FU4A 2GPBA 2UVQA 3HH8A 3K6KA 3D8TA 3K53A 1D6NA 1QVZA 3HN7A 3KJQA 4YO8A 3C7KA 4TM7A 2Y77A 1BVUA 3K9BA 4GAEA 4LDJA 2WA2A 3VO1A 3ZCQA 3A1EA 5HM8A 4PINA 1LW7A 2DBZA