3UVEA

Crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
b'TGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDLAETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMFHTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uveA00
3PFWO 3MOGA 2H63A 4RDIA 4JLWA 4YT8A 1KETA 1I10A 1ZJYA 1Y1PA 5JDIA 1I32A 3G49A 4GX0A 3CSDA 4R1SA 4B3HA 1B2LA 4DQXA 2VT2A 4QUKA 2PH3A 4D41A 1FDTA 3V1YA 4O5OA 1V0JA 3FWZA 3ZW8A 1DRWA 3CXRA 2ZJ0A 1EK5A 4LN1A 3W4JA 5JDCA 1DC5A 1ZIDA 1Y7TA 4WECA 1H5QA 1SOWA 2OHXA 3WBBA 4CM9D 1ADFA 5DF1A 1IYZA 2VYND 3AI2A 3L6EA 4TVBA 1R4NA 5T6BA 2VNAA 4M8SA 5JS6A 5CFZA 3LYLA 2OXIA 3ASVA 1GCOA 4Y6SA 4IPTA 3NTRA 4HFRA 2W90A 3WQQA 4LK3A 5H83A 4B4UA 3ZWVA 1BGVA 2FN7A 4E33A 2HU2A 4CMCA 3HZZA 3GGPA 3VH3A 5JYEA 4W9NA 1WZIA 1XDWA 1WZEA 4J1TA 4PLYA 1U4SA 4R54A 3H5AA 5GMOA 1H6DA 3UICA 4YJGB 3U5TA 2OFPA 4XB2A 3TZHA 5JNLA 3C3XA 1D3AA 4HBGA 5DP2A 4E5MA 5KNLA 4BKPA 1GR0A 2NLOA 2PWZA 2ZTLA 4XRRA 4Q3DA 1QR6A 1NQOA 2ILTA 1PGPA 1VJ1A 2D4AA 5CHEA 3U9LA 1PX0A 1LQUA 3BTOA 5B4VA 1Y5MA 3ZI0A 3ZV3A 2LDBA 2HK8A 3PWKA 3R1IA 4Z9XA 3T7EA 2ZCUA 4AJ2A 3ITDA 3W8DA 4FC7A 3EVNA 2RHCA 4BMSA 2VUUA 2DPHA 3ANMA 3UUWA 1BXGA 3KYDA 5F1PA 1DIBA 3RUHA 1KEUA 1YBMA 2B4TO 4BO0A 3JYQA 3KEOA 4BGVA 3DMTC 3IQDB 3BZUA 2PTGA 2QRLA 2RHRA 4NU6A 4DWVA 5CEFA 1A27A 4O63O 1I3LA 2V7PA 4LSMA 4CLEA 1E1LA 3GZNA 4XDZA 1XIVA 4B3IA 1QYCA 2JAHA 3FF4A 5L4SA 3QP9A 3GOHA 4X54A 4LW8A 4DYVA 4QEDA 1PJ3A 1QYVA 5ES3A 1R4NB 4BKOA 2XF8A 5C7IO 1W6UA 2W8ZA 3DAFA 2DKNA 2X6TA 3VTFA 1IL0A 3JCZA 2C29D 1NVMB 1T4BA 2Q46A 2VCYA 3DOOA 3F46A 2DBZA 2B0JA 5TJ9A 4L4RA 3PQEA 4ZQFA 1VJTA 2QZZA 4HWKA 2NVUA 2PD4A 5TC4A 1P77A 3H65A 3PLRA 5CP8A 5AVOA 5TIIA 4QSMA 3OJ0A 1I5RA 4LRTB 3ENKA 4MIOA 3OETA 2TMGA 4LMPA 2BMAA 4XX0A 4Z9YA 3ZU5A 3A14A 3TDKA 1K6IA 3CE6A 4TRNA 4DVJA 2CFCA 3PHLA 4KZPA 5MGBA 3NV9A 5AOVA 4CLRA 4JP2A 4CPDA 4BNHA 2PKQO 3NX4A 3UF0A 5HS6A 4BNJA 4BNIA 1DHRA 1LXCA 3GAZA 4G5HA 1F8GA 1YL7A 1S6YA 4J2HA 3TOXA 1PS8A 2FOIA 2X8LA 5FEUA 1T1RA 4NI5A 5L7TA 3AY3A 1UDBA 1HLPA 4Z0HO 1LQTA 5T8KA 3GVCA 1LDNA 3LDHA 4BO3A 3ZHBA 3KYDB 2YW9A 3LZ6A 3Q0EA 4FQ8A 4J9UE 4RF2A 1VJ0A 1ID1A 5L40A 4PN3A 3I52A 4E3ZA 5CEJA 5F21A 3TNLA 3DZBA 1N5DA 5B12A 4HFJA 3GMDA 2O48X 2PV7A 1J4AA 5FF9A 3RU7A 4N18A 1V3UA 2AHRA 3E6AA 3GZNB 3O38A 5L45A 3CZMA 3K5PA 1ZKMA 2NU9A 4IM7A 1OOEA 4FBGA 2GD1O 1SPXA 2Q2QA 4INAA 4YTEA 1MFZA 1M6HA 1HEUA 2VZ9A 3QV1A 5TJHA 1MA0A 1R4MA 2QQ5A 4JBIA 2UYYA 1H2BA 2ZCVA 4IDFA 5IXSA 3FHLA 1I3MA 3MJEA 4UVEA 1LSJA 1TT7A 1XA0A 4AJJA 1HTBA 3GNSA 4WJZA 1ISFA 2VYVD 4FPXA 1E3SA 5CDGA 4NBWA 2UAGA 3DBHB 3OHSX 3AM4A 2E49A 3DMYA 1DJNA 2NTVA 4HV4A 1D1SA 5BR7A 2X9GA 3E9QA 3JQCA 2IEBA 5EJ2A 2BFOA 1R15A 3P2YA 3KYCA 3GVPA 1HZJA 4O59O 4QFDA 3PYXA 1ZXBA 1SC6A 1FMCA 3GQVA 4JCOA 4XYMA 3ROQA 4F6LA 2EGHA 3PWSA 3DFUA 1E3LA 1YS4A 5JW6A 3LVFO 1DO8A 1ZFNA 3VZQA 2HUNA 1GAEO 1DOHA 4YAGA 2FR0A 4CMEC 3RSHA 1CERA 2EKQA 4B3JA 1T2FA 3D3WB 4HADA 3ONFA 4BB6A 3FN4A 5JO0A 1F06A 2DVMA 3GZ4A 5GZ1A 3LLSA 1KVTA 1ZK1A 1CF2O 3ROPA 4CUJA 1V9LA 1FDVA 4IDBA 3ZDFA 1PZFA 4BO4A 3QVOA 3WOHA 4B4OA 1U4OA 5AYVA 2B37A 1X13A 4OO3A 2I99A 2QHXA 1EUCA 3E82A 3WLEA 1Z73A 3DHYA 4CQMD 1PGQA 5EMHA 3H4VA 3NT5A 2AG5A 3HG7A 3JD0A 1HDXA 1ADBA 4I5FA 3K92A 4IS2A 4ZA2A 1PJQA 2OORA 2G1UA 3OJEA 3GGGA 3HDQA 5GY7A 3ONEA 3OJFA 3G0OA 3OP4A 5IN4A 1LUAA 2EF1A 4CV0A 1RM5A 1HSZA 4TKMA 1Q0HA 2C82A 3VH4A 4OJNA 4PRKA 4YJHB 3TF5A 2CUKA 4J1NA 1QYDA 3QSGA 3G79A 5U4QA 1EE9A 3LC1O 4ID9A 3I5MA 1L7DA 3DB2A 4M49A 2WTBA 2J3KA 3WFIA 4J0EA 2GLXA 1NQAO 2VTEA 3H3FA 5FWNA 1C0KA 2DTEA 1ADGA 4S3MA 1E3JA 4DLLA 2EWMA 4I8XA 2WD7A 2Y05A 3NGXA 3ZV6A 1LBEA 3RD5A 1XG5A 3D4PA 1ZMTA 3KYCB 1HE2A 3QWHA 3STHA 2B36A 2HMSA 2W2LA 1BWSA 4MDHA 4R3WA 2GDZA 1AUPA 5ADHA 3C1AA 2GERA 1E7YA 5T64A 3JD3A 4AFNA 2A92A 5CG2A 1Y8QA 2JL1A 3AOEC 3DFZA 5IG2A 4WPGA 1E1NA 3GDGA 3H2ZA 1I24A 4MVJF 3I23A 4DPMA 4E5NA 3GC6A 4WLNA 1H0KA 1X1EA 4W82A 1CEQA 1IE3A 5FFFA 3JYNA 4PVCA 3F5SA 3AUSA 3GVXA 1ULSA 2Q1UA 4XRGA 5A05A 3OECA 3KYBA 4GVLA 1XQ6A 3GRPA 1EDZA 2NTJA 5LCXA 1NPTO 2PKQP 5AXAA 1ZK2A 4IDDA 3HUDA 4RF4A 1LDGA 5KVQA 5EERA 2UUOA 5KJCA 3JYOA 2JCVA 1GD1O 4JNKA 5G0VA 1VLLA 1JN0A 4A10A 4P22A 3AOGA 3VOSA 1R0LA 1BHSA 1GTMA 2HJRA 2HQ1A 4K6CA 3WG9A 3L9XA 4NJOA 1E3WA 2EEZA 4Q3BA 1LA2A 4QTZA 5K0ZA 1B16A 2JCXA 5KTKA 2AG8A 3VPSA 1HZZA 3F47A 1X7HA 3WB9A 1C0IA 5JCXA 4U6QA 1EVYA 4PG6A 2ZK7A 2Y1CA 4FN4A 4XGNA 4HNHA 1PTJA 1T24A 3A28A 3ADPA 2IODA 2NU6A 3A4VA 3CEAA 4HUJA 4HY3A 5COAA 3UCEA 3UGKA 4CLXA 1P3DA 1T25A 1E6EA 1QLJA 4AJ1A 3PEFA 2X9NA 3BMOA 2HRZA 1HDCA 4JJIA 2GN4A 2PZLA 5COQA 3LF2A 2WWRA 4AJPA 3B70A 1E1MA 2R2GA 4Q3NA 2GN8A 4B7UA 2Q99A 1Y8QB 1HKUA 4BS9A 4J4BA 1YE3A 3M2PA 3VC7A 4B4WA 1HDZA 1DAOA 2GN9A 3LSYA 4MKRA 5AXDA 3NGLA 1H9AA 1FJHA 2VT3A 5IZ4A 1YL5A 3WGGA 4NMHA 5DOVA 1BSVA 4OSPA 5KVSA 1YGYA 2NUAA 5FYDA 2XOXA 2EKLA 1P1HA 2BF7A 3KXDA 5ENDA 1R16A 4BUCA 1NXQA 3CTMA 5A3VA 4CLDA 4H7PA 1W8DA 3C1TA 3GPDG 1HDOA 2C54A 1KC3A 1RKXA 3VH1A 3K30A 3JQ8B 1MLDA 3ZW9A 2VRCA 4YDRA 1N2SA 1N1GA 3DTTA 2DAPA 4WKGA 1DRVA 2Y66A 3NT2A 4I5DA 3NDJA 2IZ0A 3QW2A 3HN2A 4GGPA 4J91A 2CF5A 1RPNA 3DO5A 4E0BA 4UVIA 2CVZA 2VHWA 5COBA 2D1YA 4D44A 1YL6A 3ENNA 3EAGA 4U0KA 3VVCA 4CMIA 1E3WB 4YT4A 2AEJA 1FK8A 2DFDA 4JGBA 4N7RA 2FWMX 3AUAA 3CIFA 4EEZA 4MVJD 3X2FA 4D0SA 4RZIA 4BNKA 2E48A 1EUDA 2VHVA 4DMLA 4K26A 3RAJA 3QA9A 4DL9A 3FNGA 1IOLA 3D0OA 2YHIB 2BELA 1WPQA 4L9RA 1OC4A 1KIFA 3M1LA 3K8ZA 3IIEA 1BW9B 3QLJA 2NV6A 3IMFA 3S2IA 3JYPA 4PVDA 4CQLA 3S2FA 4RF5A 5C37A 1IZ9A 1NAIA 2A4KA 3BMOB 3SLKA 1CQIA 5A02A 2VWQA 4NFSA 4EITA 1IUKA 4IMPA 4KP7A 5L9AA 3E8XA 1HF3A 1T2AA 4JK3A 2X1HA 4IINA 4TZKA 3VPFA 1VM6A 3INTA 1MXHA 4QX6A 4RVHA 5CEEA 4ZU3A 2BRUA 1ISMA 1GFSA 4NZ9A 1KEVA 1U2GA 2C2YA 4D46A 4P4LA 2D3TA 1FDUA 4Q9NA 1O0SA 3V2HA 3U4IA 1DIAA 3R0IA 4GKVA 4W6ZA 4QFCA 4CM1A 4Z0PA 2X9VA 3E5MA 2W2KA 3AJRA 4G2NA 4DMMA 4K9DA 3QJ5A 5BT9A 3TZCA 1NHGA 3GEDA 5CG1A 3I9KA 3MTGA 3GPIA 3BTSA 1GU7A 3OEYA 1C1XA 3EC7A 4IDGA 4JP3A 3X2EA 3WYEA 3JQBA 1PS9A 3RJ5A 4BNFA 1KVUA 1HYGA 2CDCA 1DAPA 1QP8A 4I9NA 4A26A 5LDHA 2CMDA 1U28A 3IJPA 2X58A 4GAEA 5BNIA 4LGVA 5LC1A 3WGOA 4PLCA 4EZBA 1P44A 2AEMA 1VRWA 2ZKLA 1PS0A 3MTJA 2AEFA 4ND2A 2DFVA 4Z9FA 3DQPA 5A3JA 4DLBA 2ZB8A 5KJ6A 1T26A 4WUVA 4FFPA 1MUUA 3PHIA 1P31A 2AQHA 3BTUA 3KTDA 3KUXA 4YVFA 3RC9A 2EW8A 1DC6A 2A35A 4J2OA 1Q2XA 3IS3A 1Q0LA 4R68A 2JKVA 1WDMA 2WE8A 4IJWA 3GK3A 1SAYA 1LJ8A 3EUWA 2O3RA 4BV9A 1NFQA 4M89A 3NAQA 1DIGA 3LT1A 1NVGA 4HP8A 5J23A 2E82A 2Z5LA 3PI7A 3DONA 4WNIA 4ZRNA 3NTQA 1E6UA 1RWBA 4CMJA 5DCWA 4RPHA 2HAEA 1D1TA 5KJEA 4PLVA 2GF2A 4UEOA 4CR6A 4U6SA 3OM9A 2X86A 2BKAA 2NSDA 4U8GA 4W4TA 2DLDA 2DUUA 1HDYA 3ULKA 4BNVA 2V6MA 5F3RA 3E03A 4BO5A 1BG6A 4UUPA 3O4RA 1OAAA 3FNHA 2VHYA 3NKLA 3RKUA 4NK5A 3TRIA 2O3UA 1A4UA 4DGSA 2DM6A 1Z7BA 4II2A 1SMKA 2HO5A 4E2XA 1ZH8A 3JQGA 4XR9A 5JMPA 3OH8A 1I3KA 4FGWA 1BDBA 2CVOA 3KEQA 4OQZA 5JDIC 1NWHA 1O9BA 2FSSA 2PD3A 2JD1A 3C7DB 1TXGA 1MB4A 1LSOA 2ZTMA 3GVHA 1PJ4A 2Q1WA 5H81A 3NEPX 1TEHA 3B1JA 1A5ZA 3RQSA 3ZV5A 4GI2A 1GV0A 1Y8RB 2VOJA 1GUFA 1GUYA 2EHDA 5JDCC 4U0JA 1ZW1A 1KYQA 2LDXA 3JQAB 2YUTA 4BHTA 1Y81A 4J4TA 1ZNQO 3D3EA 3DBLA 5JXWA 2P9CA 1QV7A 4GSLA 3D5TA 4GQAA 2P2SA 4K28A 4QT0A 3VDQA 5TX7A 1YRLA 3UOGA 3RI3A 1E3EA 4W9NC 1ZO8A 2OP1A 4KDEA 1O89A 1XCBA 3U0BA 2VQ3A 1DC4A 2AE1A 1N7HA 3PVZA 3QWAA 1VKNA 3QIVA 1P0FA 1X0XA 3BHMA 3WXBA 4B79A 2NWQA 2VHXA 4C7JA 3H5RA 3H9UA 5G0TA 8ADHA 1YVEI 3BMQA 3FRJA 3C7AA 3MZ0A 4W99A 1DB3A 4MVJE 1ARZA 1I30A 5JAMA 4DBVO 4UEJA 4WLEA 1IULA 4CODB 1P1JA 4D3DA 3OIFA 5BSFA 5DZSA 1VSUA 5T5QA 1NBOA 3IKVA 1Y6JA 2ZTUA 4FFOA 4BNMA 1WLYA 4BV8A 3JQ7A 3N58A 5G4KA 4W7HA 3JQGB 2IE0A 4HKTA 4H16A 2E4AA 4PGFA 4CR8A 4LCJA 1IY8A 5JYDA 1PZHA 4S1VA 2BFAA 3AFMA 5T67A 3WX0A 4YAIA 1PJBA 3KHUA 5TT0A 1EUZA 4E4YA 4IIUA 4N5LA 1WMAA 4BO9A 1X7GA 3GRKA 1ZVMA 2WYVA 4TRMA 4EJ0A 4MIYA 3INRA 4YAEA 4ALIA 5IFLA 2R6JA 3VKVA 1WVGA 5ILGA 2G5CA 2XXJA 5FI3A 2FP4A 5L3ZA 3DBLB 4MVJM 1RYEA 4Y9DA 3GEMA 4TMFA 2ZYAA 3F6YA 4J43A 3VZSA 1K5HA 3CMMA 3RROA 2X22A 4EDFA 2NU8A 1B8VA 1R37A 5JCJA 3NYWA 2Q3EA 4HFNA 1MGOA 2IRWA 1DFGA 3WLFA 4XYGA 1E5QA 2X0NA 3R3SA 1ZSNA 3ZWBA 1YBVA 3GY0A 1VC2A 4DBZA 1ML3A 1NPDA 1ZBQA 1C1DA 1I2BA 4G65A 3HJAA 2ZIZA 3WFJA 3BMQB 3M1AA 4QO8A 3PP8A 3VAZA 4H3VA 2QIOA 2Y67A 3O03A 3NJ4A 5L95A 4YBZA 3ZU4A 3ZWNA 3C1OA 3ZNQA 2AW5A 2FSVA 2I76A 1KEWA 3DWFA 3F9IA 4QO7A 2XPCA 4BKRA 3AUTA 3I3OA 5T8KC 3RASA 4JXKA 3WWYA 4CV2A 2BI7A 1B3RA 2C20A 3WSWA 3GG9A 1EVIA 2V6GA 2XXBA 3WIDA 1O95A 4DC0A 3OEWA 1J49A 5HWSA 1B8UA 4TWRA 3SBOA 4XYLA 3DHNA 3DEYX 3RIHA 4PLFA 5F1KA 1SEVA 2AQKA 2O2SA 3N74A 3D1LA 2A94A 3I6IA 3KRTA 3AU9A 4NH4A 3OJOA 3AWDA 5HBRA 1JVSA 3PHHA 1VL0A 3PHJA 4IGFA 3BA1A 4JQCA 1JVBA 1U3TA 4D7AA 4AJKA 1PGNA 3ZGYA 2X0JA 2CDBA 3JV7A 3U62A 5TF4A 4Y6RA 1F14A 1HDGO 3O26A 5IXYA 3S2EA 4IJVA 4Z3DA 1HLDA 2V6BA 5CAEA 3KO8A 1SB8A 4BMNA 1GDHA 1UP6A 2ZB3A 3F4BA 3PRJA 4LCEA 3EK2A 5FI5A 5A04A 4ZQGA 1U9JA 1DHTA 2PK3A 3V1UA 4GX2A 4KUEA 4KMSA 2JFHA 4YJDA 3G3EA 3BHJA 1YOVA 1UXIA 5ITWA 1QYWA 5BSHA 4WEQA 1ENOA 5KVCA 1GCUA 4PRLA 1E7WA 1TA4A 5CDTA 3KLPX 1BXGB 1HDRA 4I9UA 2NVBA 1T2DA 2EIHA 2BFMA 1SO8A 3RC7A 5IZCA 1B15A 3WYBA 5JY6A 3EZYA 1HL3A 5AXBA 3WBFA 3ZNNA 1YQDA 2Y1FA 4DLAA 4WOKA 1E7SA 4XD2A 4E30A 2ZYGA 3MJCA 4CM9A 1NAHA 1Z7EA 1AE1A 2HSDA 1I01A 1NFRA 1EDOA 1S7CA 2HLPA 4CM3A 2BGKA 1PIWA 3IAHA 4R9RA 5KVVA 4DTIA 4ZD6A 4BGIA 2D59A 1LLCA 1LC0A 2D5AA 3IDSA 4TQGA 4CM5A 2O3QA 1OFGA 3SXPA 1ZSYA 1GY8A 5IDYA 3ZHZA 1Q7BA 1I2CA 5CDSA 2IXAA 4CMAA 4YQZA 4E2WA 3LU1A 2JJYA 3ZCXA 3U49A 2EERA 3ZH2A 3V1TC 1QSGA 2VNSA 5IDXA 2PR2A 4Q39A 3H6KA 2NVUB 1U3UA 1IZ0A 4IMRA 3WDSA 4AJEA 3Q11A 1JTVA 2H6EA 3VPXA 5KOIA 4MKZA 3I4CA 1TLTA 2HMVA 5THKA 1LX6A 4NBRA 4TSKA 4DUPA 2Y99A 4GL4A 1UH5A 1V35A 4UVHA 5A9TA 1PQWA 3GDOA 3DZHA 3LT0A 3V2GA 4CLRB 3AK4A 1PJSA 2CDAA 1YOVB 5KWEA 1BTOA 4XYBA 3DL2A 3D4OA 4UUNA 4E2YA 2EG9A 3QVXA 5I7VA 1DLIA 2EKPA 4M1QA 3TPCA 1EVJA 4B7CA 1NPYA 4FD3A 4BNWA 2YFHA 3I6QA 4D43A 2DBQA 1YJQA 4GWKA 1NR1A 4BKQA 4IXWA 4XA8A 4K6FA 1YXMA 3GN2A 5KJ1A 3ADOA 2JAPA 3MWDB 3Q2KA 1NVTA 3FPCA 4BMVA 5L51A 1SNYA 1UR5A 1N8KA 1IPFA 4ZN6A 3EDMA 1WP4A 4UVGA 4WLOA 4RVFA 3ZHYA 2I5PO 1R4MB 1XHLA 3GMSA 1MG0A 2PGJA 2Q2VA 4YJFA 4YYZA 1QV6A 3G1UA 4R51A 3VZPA 2CD9A 1DDOA 1RJWA 2O2YA 4OKIA 1GEGA 1XU9A 4D45A 3KETA 3KM0A 2YHUA 4LRSB 4GVXA 4YXFA 1W4ZA 3CINA 3BYZA 1F0YA 2RH4A 1KY4A 4CM6A 1B7GO 4CUKA 1V3VA 1V8BA 3ZNPA 2PKRA 2RBEA 2OUIA 5ILOA 1LDMA 2BLLA 2YDYA 2O3JA 4LMRA 3WGTA 1K0UA 3S55A 3AM3A 1IHXA 5TS3A 4CMGA 4GSKA 2Y1OA 4NG5A 3PFFA 4ND4A 4LSWA 3PIIA 4OQYA 3S1LA 1QG6A 2EXXA 3BMCA 1DIHA 4FR5A 4R5MA 4XKJA 3G1TA 4IJKA 3UN1A 3UXYA 4BNLA 4A73A 3UVEA 4XYEA 3DC2A 4OM8A 5GZ3A 2I3GA 1G0OA 1AN9A 1WNTA 4DPKA 2BHLA 3AM5A 5JO9A 3UFXA 5HRUA 4NQZA 3IC5A 3RBZA 1AXGA 2Y0DA 2B83A 4MIEA 1A7AA 4XIYA 4A03A 5K6AC 2I65A 4PLTA 1YJ8A 3PJGA 4OIMA 4OXKA 1SOVA 4WCDA 5I7FA 3RU9A 4L0QA 1KS9A 3KSZO 2GYYA 3TL2A 2VWGA 2O3SA 2Q1SA 4DIOA 1XWFA 2Z95A 2NADA 4BVAA 3SC4A 4J49A 4FS3A 1G0NA 1B8PA 1DRUA 1P1FA 4I5GA 2C0CA 4F3YA 1YB4A 3AI1A 8LDHA 4FOSA 1PWZA 3TFOA 2FPGA 1ZCJA 1WDLA 5JAIA 2IEDA 4OSOA 1HE5A 3MJSA 3ETDA 3NJ8A 2Y1GA 4GMFA 4YJFB 3UCFA 1A72A 1I3NA 2YV3A 7ADHA 1U2DA 2JD2A 1GADO 1ONOA 3CMCO 2FPIA 4ALLA 4YRBA 4GLLA 2DTDA 2VYVA 1R0KA 3HFSA 5IDQA 1I0ZA 3ST7A 3C24A 4MJLA 5I7EA 5JSFA 2WD7B 2P9GA 3ZZNA 2P4QA 1E6WA 1O94A 4J1SA 5A06A 4BO8A 3ZWMA 2ZTVA 2WSBA 4Y98A 5K6AA 3BIOA 3KLMX 1PZGA 1YKFA 3PDJA 4R01A 1NYTA 3DZJA 4ALMA 5F5NA 4N5NA 5B4TA 3BMCB 3JQAD 1LLUA 2B4RO 5EPOA 1DIRA 3ETGA 4PZEA 3ANLA 1X14A 5A5EA 4DQVA 4PLZA 3RFXA 2Y1EA 2G82A 4YCAA 4EEXA 4ZQHA 3WWZA 1E5LA 1SB9A 3COSA 3EYWA 2W98A 4DA9A 5DOZA 5C3MA 1XU7A 2X7HA 4R9SA 2GRAA 3R6DA 4FFLA 3RC2A 2QYTA 1LEHA 1PQPA 3S2GA 3DR3A 2WEKA 1Z74A 3ZWOA 4CQMA 3C8MA 3DDNA 4J3FA 1K6JA 1YWGO 3F1LA 5EIOA 1N9GA 2X4GA 3HDJA 3WYCA 4FFNA 1XSEA 1YDEA 4NBVA 2GZ3A 2GUGA 1DBVO 1VL6A 3K9QO 3OA2A 4GPD1 4MP8A 1ZK4A 1J6UA 3KSUA 4RVSA 3BMNA 4RJTA 1JA9A 3QWIA 4IGEA 4B8WA 4XQEA 4RORA 4UUOA 4R3NA 3VZRA 4E5PA 4Y67A 3VHRA 4E31A 2BI8A 1HXHA 3MWEB 3V8BA 2I3AA 2V65A 3VKUA 3FWNA 1JU9A 3AW9A 1KVSA 2Q50A 4WK6A 4YWJA 3T4EA 1LSSA 3BTVA 3OQ6A 4HNGA 4WLUA 3JQBC 1EVZA 5A9SA 3DAPA 4ONEA 3K6JA 4AJNA 1YH3A 4WCFA 4ZHSA 2VWPA 2YY7A 4UVDA 2P91A 3PXXA 5EL0A 1P74A 2X23A 1TB4A 1PU2A 1RM4A 1E7RA 1P45A 3DZGA 3L6DA 2EJVA 3Q6IA 4FFMA 4JJGA 1XGKA 4CMBA 3PZRA 3ZN2A 5L4NA 3K96A 3HN7A 4NDNE 4KTTE 2Q1TA 4CM8A 3SJUA 2NACA 1D7OA 2ET6A 3D64A 2Q45A 5K9ZA 4UREA 4ALJA 2CF6A 3EVTA 4RLHA 5G0WA 2NU7A 5CPFA 1JAYA 1OC2A 5CDYA 5TGDA 4E13A 2GCGA 3K31A 2FR8A 5A4DA 1ZXLA 4FDAA 4LISA 4ZRMA 2FZEA 4O6VA 5I9NA 3ASUA 4BO2A 4ZJUA 3QY9A 4KQWA 3B1FA 3RCBA 3U09A 4CV1A 2Y0CA 3NDRA 1XQ1A 3CKYA 3CUKA 5EN4A 4ILKA 1JWBB 4UUMA 4Z6KA 4CQMB 1LTHR 3ICPA 4R41A 2QYSA 2C5EA 3PTZA 2X5OA 3F4LA 3H8VA 3MJTA 4IZIA 4OGWA 3C85A 3PJDA 4J16A 1FDWA 1Q0QA 5IAAA 1J0XO 3PPIA 2DTXA 3HDYA 1UAYA 4E5KA 2RH8A 4WGGA 1BXZA 1HSOA 1NX6A 3RJ9A 4C4OA 1DJQA 4J7CA 2Z1NA 1SEPA 4OOEA 2OOSA 4CMIB 2HKIA 3D5QA 3TJRA 1T2EA 2J3IA 1YQGA 3FPLA 4GMGA 4Y6PA 1QRRA 4RVGA 1CQJA 4EUFA 1KVRA 2QX7A 1Y9EA 1X15A 5CDUA 4JROA 3ANNA 4BGUA 2WYUA 1R66A 9LDBA 2J3JA 3DZFA 1U7HA 3EGOA 3E1KA 1GZ6A 4ITUA 4L75A 4DREA 2AQ8A 4CQLB 4LVCA 3LQFA 5JC8A 5TQVA 2OGUA 4WLFA 4P8RA 3L77A 1QMGA 2JCYA 1E7QA 3UKOA 3TWOA 4RQUA 1LC3A 4RPLA 3VPHA 4PLHA 1AHIA 2AE2A 4CM8B 2B5VA 3ZHXA 2VN8A 1PJTA 3ROKA 4C7KA 2I67A 1VI2A 3H9EO 1MP0A 1ORRA 3GA0A 2C59A 1SCUA 2ZB7A 3W4IA 3PDUA 5CPBA 1ZK3A 3OQ1A 1P1IA 2WM3A 4PG8A 2W2KB 2WYWA 3AI3A 4MP6A 1H93A 3E9MA 5C5IA 3LLVA 4BNUA 3BHIA 4IS3A 3TZ6A 3EMKA 3I9MA 2XAAA 3UAGA 5MDHA 1C1XB 3W1VA 2E6UX 1K89A 3L6OO 3GH3A 1R0SA 1ADCA 2GZ1A 5C7OO 1IB6A 2HMWA 3I9JA 3NDIA 3KZVA 1LDEA 3OQBA 3VVBA 4TKLA 4NK4A 1NNUA 4AVYA 4DIBA 2A9FA 4L73A 2PA3A 5T57A 5I9MA 1NFFA 2GGSA 1DEHA 3P7MA 4XWYA 4BIIA 2UV8A 3DAGA 1PQUA 3G17A 4IXTA 1IHYA 4R1TA 3UH1A 4OYRA 5KKAA 1BMDA 3ZWCA 3L0DA 5HTOA 4BOYA 1X0VA 4BO1A 1V6AA 2WDZA 1JKJA 1O8CA 4PLGA 1RYDA 1F17A 2ZATA 1BVUA 1FDSA 4NHEA 4ZQEA 2GR9A 1ZJZA 4G81A 3GEGA 2POQX 4R4JA 3DOJA 2DBRA 2HK7A 4GX1A 2HMUA 2JHGA 4JX8A 4PG7A 4BQPA 4BNGA 2TMDA 4RVUA 1JKFA 5TT1A 3D7LA 1P9LA 1ZUD1 1XR3A 4YJGA 4EJ6A 2F00A 4E12A 3PIDA 4PG4A 1P0CA 2B35A 2IZZA 2VHZA 2B69A 2G0TA 3DOCA 4ROSA 2O23A 2D2IA 2IZ1A 3JQ9A 3E48A 1B26A 3F1KA 3JD1A 3RUAA 1UUFA 2HDHA 3PQFA 5JPIA 4ND5A 1AGNA 3PZBA 3ZWWA 2YQ5A 5L7YA 5ITVA 2QW8A 3MCVA 4KOAA 4ND3A 4IQGA 5TNXA 3VPGA 4BNTA 4E2ZA 1EQUA 4NBUA 3ETEA 1PZEA 3ZU2A 1UP7A 1LRJA 3HSKA 2VTDA 3OF2A 6LDHA 1PGJA 1CYDA 4I5EA 5C7LO 1NASA 2YDXA 1ENZA 1MV8A 2BH9A 1UXKA 3GGOA 3JTMA 3SC6A 9LDTA 1ISJA 4MINA 5TSDA 4E5YA 1OZAA 4TZTA 3BXXA 3QVTA 2J8ZA 4YRDA 3TQHA 1JWAB 2C7GA 5JLAA 1KEPA 3HHPA 3HQ4O 4EYEA 3RVDA 3OBBA 3RUIA 4PLPA 3EHEA 1JKIA 1UDAA 1M2WA 2YFQA 4DYDA 3F3SA 1ONNA 3FNEA 5I9LA 4GX5A 1UZNA 3WICA 2W4QA 4EJMA 1LI4A 4GLOA 4YAKA 4CM4A 4AICA 3VDRA 1M75A 1L7EA 4IY1A 2B5WA 4URFA 4A7PA 4F46A 4HXYA 1K3TA 5IF3A 3JQEA 1Z6ZA 3L9WA 1VE9A 5L53A 3L4BA 5B37A 3JSAA 1U5CA 1EFKA 4IDCA 4AL4A 1L1FA 1DPGA 3IUSA 3T4XA 3GT0A 5I7SA 4KDFA 3D4NA 3WNVA 2GN6A 1OMOA 1ZMOA 2OZPA 4M87A 2B4QA 2HRBA 4EBFA 4FOOA 3WGYA 5IZCC 3I83A 1UXJA 5JAQA 4Q3EA 4D3SA 2VOEA 4BNZA 3AUUA 4P4NA 4XJTA 2H1SA 1LRKA 2PGDA 3JQ7B 2P5YA 3QE3A 5G4KB 3M2TA 4NFHA 4KUHA 1J5PA 5DNAA 4U7WA 2NNLD 2ZB4A 3S8MA 3V2UA 2P5UA 3GNQA 2GZ2A 4YEDA 1KC1A 4I9HA 2BD0A 4MPDA 3RUFA 4UULA 4Q3CA 5JFOA 4IIVA 4KUGA 5U1PA 2DT5A 4AG3A 4GGOA 4CR7A 3LC2O 3ZWYA 7MDHA 3O9ZA 1U3WA 1K6XA 4D79A 4YPOA 4A2CA 4R5HA 3HB5X 1GV1A 5I8ZA 4OXNA 3WTBA 3TZQA 4XGIA 4CL8A 1XLTA 3FD8A 2VWHA 2CSUA 4OH1A 4XQ9A 3WJ7A 1YBAA 5BNTA 2YJZA 4Q3AA 4B4VA 3B1KA 3SX2A 2I6TA 3RBXA 3QWFA 4RL6A 5L7WA 4U5QA 4CM4B 1LU9A 1CJCA 4TRRA 3W8FA 1GQ2A 4YT2A 3HNPA 4B8ZA 1GYPA 4L4XA 4BQRA 2NQTA 4J7XA 2F1KA 2WD8A 4NU5A 1I2ZA 1EQ2A 4WOJA 1PL6A 2Z1MA 4BGEA 3DBHA 2OP0A 4J0FA 1R6DA 3DHEA 1C1DB 1YQXA 4PLWA 3FR8A 3TN7A 3WGIA 1ISHA 4TVOA 1AXEA 4UAGA 4O1MA 3PWZA 3DMTA 2IYOA 2W2LD 3C7CB 1PJ2A 2DUWA 4L8VA 2PGLA 4TRJA 4XEHA 3U3XA 3WTCA 3H5NA 2JFFA 3GR6A 3IL2A 4RPGA 1PL8A 1UXHA 3KVOA 3W4KA 3D3WA 4R69A 2VYNA 2G17A 3AY6A 3ZWAA 4CUZA 1X1TA 4Z3KA 4ALNA 3GUCA 5DT9A 3WNQA 4ZICA 1GPJA 1HWYA 2OO5A 3JD4A 2FRDA 2H5LA 3H2SA 2FMUA 1U8XX 3FR7A 3GHHA 4CM7A 3UW3A 5KIAA 5G0SA 1JW9B 1ZEMA 2D0IA 4J7UA 3WS7A 1HE4A 4AJ4A 1O6ZA 2NTNA 1GZ4A 3HWRA 3OMLA 1V3TA 1EE2A 3B6ZA 4YR9A 4YAJA 1BXKA 1HYHA 4GKBA 4RPJA 3WSVA 4OAQA 3R3JA 1YB5A 4YT5A 3VH2A 1DC3A 4YJHA 1CETA 1WXDA 1EEHA 2DQ4A 2SCUA 3GNTA 1NM5A 3CZRA 4FGSA 3O8QA 4P38A 2ZQZA 1UZLA 3RWBA 1LDYA 3ZWPA 3W6ZA 1C0PA 2AQIA 5ICSA 3TL3A 1ISGA 2QRKA 2HCTA 4Z0TA 3QHAA 4AJHA 1XKQA 1ZK0A 1UXGA 4TROA 1WW8A 3KSDO 2VZ0A 2HMTA 3Q9UA 4B7XA 5DCYA 3ONDA 4OXYA 1QYXA 3MOIA 1TI7A 1KVQA 3QRWA 1ENPA 1BVRA 4RGBA 3M6IA 3RC1A 5B1YA 4XJSA 4XZ3A 3ZWXA 3RKRA 3ORFA 1P1RA 4CJXA 5EINA 3ZU3A 3AY7A 2EP7A 4WASA 4IUYA 3JQDA 3ON5A 1HE3A 1MXFA 2CZCA 5HA5A 4ZGWA 2C07A 5A1TA 1D8AA 2FR1A 2ZJ1A 4FFRA 3V5NA 3Q2IA 1H2HA 3FTNA 2YZ7A 5DDIP 4IBOA 2YV2A 2DPGA 5BSGA 1H6CA 4WEOA 4IDAA 2JHFA 5H82A 1GEEA 4IDEA 2EV9A 5DCUA 3L4SO 4ALKA 2J3HA 3KBOA 1NWCA 2VRCD 5EQFA 3TFQA 3RFVA 5DBFA 1HYEA 4ND1A 5ER6A 2AA3A 4DIFA 4BKUA 3OA0A 2IXBA 1I33A 3WJAA 4OHUA 4N5MA 5EESA 1UJMA 2Y1DA 4E21A 4MVJP 3WIEA 4NFYA 3H3JA 3QWBA 3AFNA 4JN6B 1M67A 3H9JA 1DLJA 4YA6A 3O8QB 4J4HA 2O7SA 4CMKA 1GQQA 4MO2A 1A9YA 3P5SA 3GG2A 4YRAA 3Q1LA 4RVDA 4GH5A 1Z45A 5KCZA 1G1AA 1X7DA 2WMDA 2H9IA 4CMEA 2FPPA 4EUEA 1DFIA 2P4HX 2P68A 3KV3O 1C14A 1GYRA 3DBRA 2OL4A 1DSSG 1B3BA 4NBTA 3EY4A 2X0RA 1UZMA 1ONPA 1GYQA 4L74A 1QLHA 3A9WA 3PJEA 2Y93A 4RLSA 3E9NA 4QECA 4XIJA 1M6WA 5KJFA 5F5LA 5BSEA 1E77A 2FHSA 2J5QA 4BL5A 4DPLA 1Z75A 5JC1A 3IKTA 2WE7A 3RUEA 5IN5A 3HB4X 3MJVA 1TT5A 2VUSA 2RCYA 3N7UA 4WE3A 1LLDA 5TRTA 3GN1A 3U4CA 4BNNA 4IZHA 4J90A 1D4FA 2VZ8A 1U3VA 4D42A 3INGA 4BNYA 1Q1NA 1UP4A 3WGHA 2DC1A 4D0RA 4DXHA 1R12A 4PCVA 3H9QA 2HJSA 4FJ0A 2YYYA 1A7KA 2NVWA 3JQ8A 4R1NA 1WDKA 2PD6A 1HETA 3WQRA 1PJCA 3IUPA 2O4UX 1EBUA 3FSRA 4JBGA 4MP3A 1GL3A 2DBVO 2X0IA 1NTOA 3GUYA 4MVJG 3PGXA 3U4HA 5KKCA 3E5RA 3W6UA 4ZQBA 1P1KA 1TVEA 1CIVA 4FIZA 1DXYA 4J9VA 5DBIA 4HFMA 4IQ0A 4I08A 2Q4BA 5HS4A 3SLGA 1EFLA 3FCOA 4PFJA 2O3TA 3JQFC 4JBHA 3A1NA 2AXQA 1Y5RA 2I9PA 4NJMA 4RZHA 5ENVA 1K2WA 1BRMA 1B0AA 1A71A 1M76A 4QQRA 3W8EA 3AOEA 1LLQA 2VRBA 1E7MA 4LVUA 4WCFC 4R1UA 1H94A 3LC7O 4RO0A 5HM8A 1E92A 3KB6A 5IDWA 2YHIA 6ADHA 2EW2A 3HADA 2PFGA 1BW9A 5ICMA 5GZ6A 4M86A 2OMEA 3RUCA 4GBJA 3UCXA 2BGLA 1QXSA 3DBRB 2UUPA 1EMDA 1VKOA 1XELA 3WMWA 2EGGA 1JAXA 4MVJH 3SJ7A 1Q7GA 4II3A 4JJFA 2O50A 1YONA 1W0CA 4RV9A 1F8FA 1SZJG 3GHYA 2GASA 3ICCA 1KBZA 1LSUA 4FC6A 1H9BA 3FBTA 1DFHA 1Y9AA 2X5KO 5I8WA 3E18A 5A03A 2UDPA 2Y68A 1VPDA 3BAZA 3IJRA 1TT5B 5JE8A 1IPEA 4PZCA 4KWIA 4XQGA 1I8TA 3FI9A 1MX3A 3F5QA 1ZSVA 4XCVA 4PG5A 3QQPA 2PZMA 4KQXA 2PY6A 4DQUA 4XGKA 4UEKA 1B14A 2NQ8A 3A06A 3JQFA 3JD2A 1EK6A 1F12A 1CDOA 1W73A 3FTPA 2I66A 2RIRA 4MKXA 3B20A 4GWGA 2VUTA 4NR0A 3FBGA 2J5KA 1PGOA 1GZ3A 1U7TA 1G6KA 1RM3A 1MG5A 3I9LA 4NNJA 4YB8A 3GDFA 4M55A 3GFGA 3TZKA 1EBFA 1Q7CA 3PJFA 2C5AA 3OICA 3GAFA 3GF4A 5EQDA 1VSVA 3SVTA 4YQYA 4L4SA 4NJMB 4WLVA 3MJ4A 1CRWG 4FJ2A 1Z82A 3OIGA 4ZVVA 1I36A 1KERA 5THQA 3I9OA 4CMHA 5A5FA 4XQCA 4L76A 4OOFA 1C0LA 2EJWA 1GQYA 2UVDA 4RF3A 1FXSA 2ZQYA 3DZIA 1KOLA 2IYPA 5DP1A 2DU8A 3EZLA 3QVSA 3ROMA 2J6IA 4MVJI 5JY1A 1BDMA 1O5IA 1P33A 3JQ6A 1JLLA 2C2XA 1QKIA 3LF1A 2CVQA 3RBVA 3EW7A 4FW8A 4K1LA 1T1SA 1ISIA 5LDGA 3VTZA 1N9GB 3OIDA 5G4LA 1U8FO 1NP3A 5F1OA 3UHAA 3GVIA 4J1QA 2R00C 2GPTA 3ITKA 5BQFA 1XYGA 3LT2A 1HRDA 1JDJA 3BMNB 1LRLA 3NRCA 1PWXA 5B4UA 2AMFA 2GSDA 3WQSB 2P9EA 4J6FA 3WMXA 1A4IA 1T2CA 2GNAA 2X5JO 3AU8A 1EZ4A 3MEQA 1U5AA 4KTVE 2G76A 2Q2WA 4P4GA 4A0SA 5JAZA 1YB1A 1ZZEA 4E32A 1CWUA 3PHGA 3DZKA 4PIVA 4DRYA 4FB5A 4DC1A 5A9SB 3Q9NA 4AJLA 3WR5A 1VL8A 2PNFA 1WAMA 4WCFB 4CLHA 1UAGA 5TLSA 2C7VA 2O7QA 3RFTA 3K73O 1PEDA 4PZDA 2ZYDA 2YV1A 2BFPA 3HE3A 3T7CA 2D5CA 4M54A 1Y8RA 4HX5A 4CLOA 1ENYA 1WMBA 2IDZA 5JMWA 1LNQA 3JYLA 3NTOA 2E37A 1UDCA 1PJLA 2OBNA 3JQAA 4CV3A 2Q49A 2Y0EA 4JIGA 4W7IA 4XR4A 3PYLA 2V6FA 3U4DA 5AXCA 4IQ8A 3PK0A 5DBGA 1H6AA 1AHHA 3PLNA 2R00A 2BGMA 2CNBA 4AJOA 4BNXA 4N54A 4OMUA 2PZJA 4CL3A 1OI7A 3TOZA 5L4LA 3HDHA 1HT0A 2PH5A 4I1IA 3NUGA 4EI2A 1XEAA 4RPKA 1E1KA 1NQ5A 3FNFA 4H15A 5JCJD 5JBIA 4QXMA 1NR7A 3GLQA 4RQTA 1LDBA 1C3VA 2PLAA 1GPDG 4NIMA 3ABIA 1H6BA 1JQBA 1M66A 4EUHA 3OSUA 4ESOA 3WGZA 1QORA 3JQ9C 4EGFA 1A9ZA 3IP3A 2EP5A 5G2OA 3WGQA 4FJ1A 3DBVO 2HK9A 3TSCA 4AJIA 3K2EA 4O0LA 4MOWA 4F45A 3NT4A 3IOYA 4RDHA 1U1IA 2JFGA 1N92A 4YACA 2D8AA 5IJZA 1PL7A 4A27A 3DTYA 3I4FA 5G0UA 1KY5A 1NHWA 4BB5A 4D3FA 4FCCA 3ZV4A 1OBFO 3PYMA 4OKNA 3CPSA 3QVWA 2QZ9A 4MVJA 5U9CA 4RCVA 2FY8A 2FZWA 4F6CA 3CH6A 1NQTA 2GO1A 1MC5A 2RAFA 3I9NA 4E6PA 1MFPA 2PZKA 1FF9A 3L07A 3H7AA 1E0DA 1YDWA 2Q4EA 3OFSA 1N7GA 4Y8VA 5BNFA 4XB1A 1PR3A 1ULUA 3HFGA 4FSHA 3ZNOA 4BO6A 2OBYA 5A9RA 3IP1A 4CLOB 3KOUA 2YQ4A 3I1JA 1RM0A 2O4CA 4BO7A 3LT4A 4WNCA 2J5RA 2QG4A 1ZEJA 5DULA 1MC4A 3GFBA 3P2OA 1YO6A 1N1EA 3SEFA 2NM0A 1SBYA 3Q3CA 4OL9A 3K2BA 3PQDA 3RUDA 2JD0A 4NPCA 5DN9A 1PR9A 1E3IA 3DXFA 4A5OA 2QRJA 3L4BC 3LK7A 1WWKA 4R16A 3PGJA 3H9GA 5AQ1A 2CY0A 1T4DA 4KWHA 4IJUA 4EW6A 1GUZA 3OJLA 4XDYA 2WJPA 1PSDA 5ER9A 3P19A
chains in the Genus database with same CATH superfamily
3PFWO 4QBHA 2H63A 4FZ3A 2OWDA 2QYHA 3BQ9A 2JJ1A 1I10A 2OB2A 3LCCA 4IJ6A 5EMKA 2H4ZA 1E64A 2PSEA 2Q0QA 4JLDA 4GX0A 3ZDDA 4ZEXA 4B3HA 1FJXA 3RW9A 3LPMA 2VT2A 3U4AA 2QP3A 2CV1A 1V2HE 2PH3A 4GNKA 4D41A 1UBRS 1T2NA 2NUPA 1FDTA 3PNOA 5U4XA 3F78A 3VHXA 1P1CA 4RJJA 4DA8A 1J2UA 1JDBC 1QP0A 1U94A 3NYIA 3C5WP 3ZHVA 5JDCA 1K66A 2MYNA 4WECA 1IM2A 3BXEA 4FI3C 1QG0A 1H5QA 3NAZA 1NRIA 1MQAA 4IHJF 4TL9A 3OG9A 4UMDA 2FN9A 4NF2A 5DF1A 4IJ5A 3AI2A 3LDAA 4IKPA 2JFOA 1UM9B 3I8OA 1GU0A 1GZSA 1R4NA 1DEKA 4ZQIA 3ILHA 4JS0A 5AESA 2B3TA 4LF9B 1P39A 1T43A 2XUQA 2OXIA 1UKZA 3FMPB 4MA5A 2ZRFA 2CEAA 3NASA 3NTRA 3D8TA 2YNMD 2E4YA 2WJGA 3IQXA 4HFRA 4LK3A 4PGAA 4PS0A 1RYFA 3WQQA 4B4UA 1E1RA 3M4ZA 3OIUA 4OXIA 3GGPA 3LYHA 4YP1A 1WZIA 1Z0KA 4HK4A 3AETB 3O7WA 1U4SA 4C0QC 1H6DA 2GOYA 4B87A 4YJGB 3W5SA 1J1IA 6REQB 3U5TA 1VPWA 2OFPA 4MGIR 3OTGA 2R6CA 4UBJA 2QVXX 1W5AA 3WB1A 3OE4A 2RB4A 3KOWA 4ZYLA 4JP8A 3HXOA 2ZTLA 3AVOA 5FA5A 2I2XB 3W8RA 2J9GA 4D6YA 2XWPA 2CMHA 4ZCMA 2MDTA 2OOKA 4Q4AA 4ZREA 3CGGA 3ET5A 1QR6A 4PZ0A 5EHQA 1U7ZA 1KSJA 2DPXA 1U3CA 3TR0A 5ALWA 3TW6A 1KKUA 1PGPA 3U9LA 1QF9A 4X3OA 4EHHA 3VJLA 1EP3B 5JZ9A 1PX0A 3TINA 3BTOA 2EYUA 4Z99A 3FYDA 2Z6UA 1WPRA 1EK2A 3R3YA 4TXNA 3OUUA 3ZXYA 1ODIA 1TNDA 1ZUHA 2BGIA 3DV9A 1YZQA 3I2KA 4Z9XA 3T7EA 4AJ2A 5A0VA 1A5BB 1AD2A 3ITDA 3EXIB 3KKNA 5M3BA 4TV9B 1TM5E 3SHVA 4P3OA 1N2OA 1YZLA 4X1KB 3LY9A 4ZU1X 1XDSA 4KWEA 4TLEA 1W581 4K9OA 5F1PA 3CVVA 3JYQA 3OMXA 1OYOA 4A6EA 1X1BA 3ZUPA 2PTGA 3KHTA 3WGJA 4HDQB 4MGKR 3S1SA 1PR5A 1EM8A 1CLUA 2OESA 5EXXA 4BUJA 1DAEA 5JHHB 4KPFC 3GFVA 3OCZA 4G0NA 2ZUEA 2NZ2A 1YZTA 1ZNZA 4MQUA 3ZKWB 1E1LA 1I0IA 3QV2A 3WIOA 3F7NA 1EP1B 3IMKA 5AVTA 1P2FA 2BLNA 2X14A 3FF4A 3LBAA 5K4HA 1T0IA 4NPHA 1JIVA 1SQ0A 3GOHA 4X54A 4LW8A 4MV5A 2A88A 1GARA 3PVCA 3W1EA 4EG8A 4DYVA 3G0BA 4B48A 1QAOA 1STOA 5AT1A 2GPAA 4BP9A 1KQ3A 3HV0A 4LSZA 4DCSA 4F8JA 4BKOA 1D7AA 1LPAB 1YJCA 3LJKA 4BFYA 4TMZA 5C7IO 4D2IA 4MV1A 1MU0A 3GH1A 1WUHS 5KYNA 5EA2A 4ZMRA 5FD8A 1S2LA 3JCZA 4M0UA 1QAQA 1G8MA 2FG5A 3ABZA 3WRYC 1NVMB 1E9FA 4Q9JA 3VHQA 3OO1A 1BROA 2JK0A 1G9SA 2G1PA 3DOOA 1E61A 4PPQA 1NZDA 3X2SA 2X8JB 3UYLA 3CQ9A 3M83A 5TC4A 5J47A 1QRUA 3I45A 2IYAA 4XGQA 3OJ0A 1FXUA 4RABA 1TZ2A 3NRJA 5KQPA 2I54A 2TMGA 4CF3A 4FILA 3K5IA 3ZU5A 3P0HA 3KOZA 4CCWA 4CGYA 4IVNA 3WNCA 1K6IA 2FW8A 1CVLA 3CE6A 4REMA 4DVJA 1G20A 1NL3A 2Z5FA 3PHLA 3N0RA 5MGBA 2O07A 4GWLA 4CFYA 2JFWA 5AOVA 4CLRA 4JP2A 4CPDA 5M2QA 3R7DA 1Y8ZA 5ENZA 1SBIA 2BFNA 4HWSA 2GBFA 3GAZA 4G5HA 4ERXA 2FN4A 3P52A 1LV8A 1RJDA 1QOZA 1RAHA 3RPEA 4E70A 4QYIB 5ALEA 5CW1A 1Y42X 4NI5A 5L7TA 5EC8A 2Y0PA 3MSCA 4A9AA 5AVYA 4A8PA 5T8KA 3F98A 5KX5A 3OZ7A 1V11B 2ZANA 4ADSG 3HZOA 3KYDB 3EQ2A 3QXXA 1MH9A 3N2IA 3Q0EA 5AHRA 1AA9A 1VJ0A 3P2EA 4MCJA 3PC7A 4FYKA 2W70A 2GM4A 4PN3A 1E2KA 1G38A 3I52A 4DCUA 4E3ZA 1ZOPA 2JBHA 3DB1A 5B12A 4HFJA 5IUJC 4X6XA 5JD5A 1US8A 2HHLA 2PV7A 1L2TA 3WRYA 1NI5A 2JAUA 3N2GA 3K9LA 2F6RA 5ALXA 1V3UA 2AHRA 2PFKA 4DLXA 2I22A 4RTLA 5L45A 4DSUA 3A26A 4D82A 2AF4C 1WUYA 2QRMA 3C16C 2I6XA 4F6RB 4ZYTA 3S68A 1X77A 3BE6A 4TYQA 1SPXA 4YCLA 3TZLA 2C4WA 1MFZA 5K3OA 2PMCA 2RHDA 1PT9A 1MA0A 2IOFA 1BN7A 4LX8A 1DQZA 2QW0X 3KCNA 2UYYA 1QZ3A 1R5JA 4W5NA 4D3XA 3MJDA 1H2BA 3BJZA 3BRQA 2H31A 4MQFA 5GWXA 3TUZC 4UDNA 4IDFA 3THYB 5EQTA 3HY6A 4EQ6A 4UVEA 4QE3A 1GFWA 1ZX1A 1DXHA 3IIMA 4PSDA 4ND8A 3ZCQA 1TT7A 3JWPA 3AR5A 3CW9A 2J30A 5E6UA 1L4LA 3K5HA 5IT0A 5K0GA 4C3OB 3DBHB 3P1JA 4KXQA 5E2BA 3DMYA 1VXOA 4HV4A 5CIQA 5H68A 1IWPB 3C14C 1UJBA 5ECYA 5CFMA 3JYHA 1JP7A 1TQ8A 5IULC 1R15A 1XAHA 3WMEA 4CL0A 3DC7A 3NHMA 1HUQA 3PNMA 4YMIA 1HZJA 2V74B 2JDID 1TUBA 4O59O 1QLWA 1FMCA 3A70A 4JCOA 3RLFA 4F6LA 3INNA 1X7XA 3DVAB 2P6UA 1RP7A 2DJIA 2O8FB 5JH7B 1ZGGA 3STXA 4NBWA 4EB8A 1OV6A 3L8CA 2R7KA 4MS4A 1UWVA 3FM9A 5K5EA 2HUNA 2BCGY 2AWOA 4YAGA 5KYUB 1IM8A 3VO9A 2QTTA 2YBDA 1RVDA 4CMEC 3B5JA 4GC9A 2EKQA 4IEFB 1T2FA 4QYWA 3ONFA 2MTBA 1B73A 1F06A 2DVMA 3ABRB 3ZX4A 3DPIA 4LZWA 1HORA 1CF2O 3BXOA 3ROPA 2X8BA 3PHBE 4G89A 1A97A 1G8PA 1U8YA 4GPEA 4IDBA 2GO7A 2ONYA 3U2QA 4TKUB 1KK0A 1LS1A 4D9HA 2G67A 5AYVA 1OZHA 1E1QD 3HEBA 3KD2A 2F59A 3UMFA 3NALA 3L82B 1X70A 1NOIA 1OUMA 3K0BA 3AP3A 2Q4TA 4CQMD 5JJBA 3AKZA 5C8YA 5SY6A 5FHQA 1S1CA 4C4RA 4LXHA 2QI9F 2AG5A 3HG7A 5F51A 3JD0A 3NIBA 3M6FA 4YAFA 1XE3A 2B61A 4I5FA 4ZA2A 1BN6A 4XXHA 4LPSA 2GJ9A 3E2MA 4O2RA 1D2NA 2Q41A 3OJFA 1JR3D 1N5IA 4TPKA 5IN4A 3CZAA 4CV0A 1L5SA 3LHFA 1Y4UA 2FV8A 1E2EA 5IUKC 2O52A 3PHCA 1SVLA 4QU8A 4YLEA 4AF6A 2B1QA 2H06A 1QYDA 2SCUB 3G79A 4BB0A 4WZBB 2JFNA 4FEAA 1X2EA 4JYZA 1UKBA 4DA4A 1A8PA 1C0EA 5HK8A 3BX1A 3GEHA 4M49A 1EJBA 4W63A 3K8QA 2WTBA 2HADA 4R8LA 3AKCA 5C1IA 3KPWA 3QTBA 4N47A 4EG0A 3DW1X 2GLXA 1NDUA 1ZP6A 3W5JA 1C0KA 4DMGA 2PMEA 4S3MA 1YF3A 1XJWA 2NP6A 5D3ZA 2OV3A 3LGXA 5DPMA 2HA0A 2HXYA 1CJUC 1W9HA 3AZOA 1P29A 3N2KB 3NGXA 4RU1A 4X1YB 3H42B 4YONB 4QM6A 4QNMA 4P9NA 3RM3A 2WWYA 1ZMTA 4N6OA 2NPIA 1BEZA 1CB0A 3MCAA 2Y6UA 5ADHA 4UUQA 1M2OA 3ZZMA 3I4LA 3QBEA 2ORED 4L8GA 2A92A 3KJHA 4KPEC 1T0HB 3DT8A 3GDGA 1K7YA 1JKMA 1N6PA 4KVGA 3VOBA 4MVJF 3C5HA 3L4EA 1YOBA 3GC6A 4TV8A 3M6MD 2YJ3A 2Z6VA 3M7IA 1P2TA 2I62A 4W82A 5E9WA 3P9YA 1IE3A 4CKXA 1HDEA 3NH9A 4XRGA 2ZE6A 1USIA 2BR5A 3IJEB 3LS2A 1JFSA 4GVLA 2H52A 3RYFB 3RQIA 3VSEA 2NTJA 3WMFA 1ZR2A 3KC2A 1Q3KA 1UJ6A 4FW9A 5AM4A 1U9CA 1I7SB 2P9JA 3IAM1 3MERA 1ACLA 4IDDA 3U7EB 4YPVA 2N46A 4IMJB 4KXNA 4OD0A 1MQ8B 5ES4B 1P7VA 1R7RA 2AYYA 2UUOA 1M8GA 2PH7A 1KEEB 5KCMA 3WLRA 3OQVA 1GD1O 1U2SA 1FTNA 3OWHA 4KBGA 2NO7A 5G0VA 5KWJA 3DQZA 3HY4A 4HYTA 3U81A 1VLLA 4FK8A 1JN0A 5DVZA 4A10A 4AKEA 3DCYA 3RSOA 3VOSA 4WD3A 4EVSA 4QM7A 3LDFA 2ZZNA 3A6EA 1GPAA 3GJ6A 3ZI4A 1KWGA 3WG9A 2NAPA 2R0QC 1E3WA 4GRAA 3GAAA 4IL5A 5EJ4A 3OZBA 2CHFA 4JSRA 4QT4A 4HB3A 3QYJA 5K0ZA 1FSFA 2ZR7A 2C1XA 1L4MA 1QP7A 3OY7A 3L7DA 4R7ZA 4HDAA 2ZRCA 3FKJA 3OY2A 1J8VA 3H8SA 2HK6A 1X7HA 5HKBA 4BPRA 4QYSA 4L51A 3TQOA 3MGBA 4QRHA 3W2GA 3O8RA 2ZK7A 2Y1CA 2DBYA 4TV9F 2XSZD 4XGNA 5CW2A 5CB0A 2VQEB 4QJIA 2NU6A 3A4VA 4EG7A 4D74A 4NE7A 4CLXA 1P3DA 1T25A 3HBJA 3NNDA 3SQLA 3IIIA 2Q6KA 3LKBA 4RIHA 4U7PB 3VYSB 1M1YB 3KFVA 4JUAA 1U99A 4G01B 3BIWA 2PZLA 2BGUA 3LF2A 3O8NA 4HGQA 4HNAB 3U3JA 3RYCA 1TJ3A 2FWBA 2R2GA 5AWFC 5B36A 5KOJA 1KDOA 2GZMA 1Y1LA 4BS9A 1YE3A 4PFSA 4MS3A 3ISTA 1BJTA 3OKFA 4MKRA 3H83A 3KZMA 4J03A 3NGLA 5TPWA 4F4DA 1H9AA 1FJHA 1JLKA 4D6XA 3HEMA 4IXDA 3WRXA 2XCOA 2BHTA 2QL7A 4TLMB 2PQ2A 3BWVA 2YH2A 4ARAA 4BLWA 3ZG6A 5DOVA 3W9BA 1H8HD 2P1ZA 3RK1A 2B78A 2QX6A 2P0EA 2XOXA 3OMWA 1P1HA 4KK4A 5ECWA 3VX4A 2VDPB 1XA3A 4L5IA 3LHDA 3I0NA 5CNIA 1VSBA 2XNDD 5A3VA 4H60A 1W8DA 5TMDA 3GPDG 4L7VA 1KC3A 3EAQA 2CE2X 3A9VA 4C0SA 1RKXA 3K30A 1PCXA 1ZJ6A 5FPPA 5DV9A 2UKDA 1EHYA 2N9UA 2VRCA 3KU4A 4YDRA 2IUFA 5TE9A 2DAPA 3G2JA 5IT4A 4ZZ3A 4Q3LA 4WDRA 3FTQA 4JODA 2CJXA 3NT2A 1BKDR 3HGQA 3QX9A 5DHRA 3NDJA 2IZ0A 4L08A 3QW2A 1T5OA 3PPWA 1U7UA 1II8B 5HZMA 2CF5A 2YFYA 1TUIA 3T9FA 3QYAA 2CVZA 3D6HA 3P4XA 3RIEA 3QFFA 4F91B 1JG7A 1K4YA 2WHPA 2BFCB 5IAKA 2JC3A 3VVCA 4Q7KA 1KFJB 3RF7A 3ROGA 3ZU6A 4YT4A 1XN4A 1A2KC 2ATXA 2XMDA 3UMGA 2OHHA 3KWJA 5HUJA 4JGBA 5I4CA 3BSFA 4EEZA 4BJ6A 1G3MA 1JEOA 2X3FA 4RWZA 2PXXA 4L9WA 1QQBA 3KT3A 2IHYA 2ZREA 2VHVA 3AERA 4MWSA 5HIAA 3ZBPA 4K26A 1PKXA 721PA 1YFJA 2YHIB 3QKRB 4B2LA 5C1BA 3KK0A 4L9RA 5AK0A 4HZIA 1L4FA 1BW9B 1H9CA 4MUNA 1UMBB 1DS6A 1H1TA 1Z4LA 3GRUA 3IMFA 4ZEOA 1H2WA 1RTTA 2IYUA 3S2FA 4YDSA 2GMWA 5E2IA 1IZ9A 2IOYA 2XQJA 5AW9A 4MS1B 3AEXA 3BMOB 1DTSA 2ZRHA 3ONWA 4JYBA 4EITA 4KP7A 5IAJA 3G0DA 4DBVO 5L9AA 2F17A 1FTWA 3E8XA 1X3LA 4MKFA 4WXHA 2NUTA 4RX1A 3DD1A 4EL0A 1T2AA 1QU3A 5BT8A 3M9WA 2VP9A 1ZOLA 2A9KA 3EDOA 1RQ2A 2WSIA 3D6VA 4N9WA 3INTA 3M4JA 4EPVA 1USWA 1ZCZA 1ISMA 2V98A 1GFSA 2RK4A 2X9QA 1XL0A 4MUIA 4RD6A 4V3CA 4D97A 1Z06A 4P4LA 3PA8A 1S3SA 3S5UA 3U13A 3G5UA 1VYVA 4BPBA 1VHLA 4P3NA 1VZ2A 5IJ9A 3A6KA 2PU7A 1G17A 3R0IA 3U4IA 5DGIA 5AM5A 5LJLA 3OESA 3Q7TA 4JCCA 3G8CA 4Z0PA 2X9VA 1PN3A 2W2KA 2XWSA 3OPVA 4DMMA 4PO3X 5HRAA 4K9DA 2R4QA 1C7QA 2RHWA 2UZ0A 4BY9E 3MTGA 4G9EA 1E1YA 4UBNA 2ZBGA 1REQB 3BTSA 4OJTA 1GLGA 2VPWA 3EC7A 4EGCB 4JC4A 2HQBA 3X2EA 3JQPA 1KVUA 1QRDA 5ABPA 2EL7A 4Q4HA 1JZTA 2XMSA 3UV3A 4AM8A 2YTZA 3K1AA 5CFOA 4RSGA 3V4RA 2HV9A 1MO2A 3ZWQA 4EGAA 4YCCA 2X58A 3U60B 2WHRA 4ZAZA 2P78A 4PAQA 4JIMA 3WGOA 1ZBDA 1Q7TA 1SBZA 3GDHA 4K3UA 5HG0A 2WIFA 3GP3A 2AOWA 4NKRA 1AKUA 4BQOA 1PWHA 1VRWA 2I0FA 2ZKLA 3MTJA 4KJZA 4ND2A 4AIRA 3SYNA 1KWKA 3Q3GE 1QGZA 5BOSA 2O05A 5KNCH 3T06B 5D5PA 4I3HA 1CCWA 1EFPA 1QWOA 2D2EA 4HDKA 5JEEA 4N4AA 2WWHA 1AB5A 1M2FA 3AF3A 1WX1A 2F3SA 4GBED 1PR2A 2Q2NA 4X5OA 2WB2A 4U3JA 1LV7A 1W94A 3TR6A 2Q3LA 1ST3A 3KUXA 4FE7A 1FZQA 2EW8A 1XX6A 4DG8A 1ZVKA 1E62A 2G9UA 4FMCF 3SSAA 3W6NA 4PSVA 4J76A 1IXZA 5D7BA 1Q2XA 4UATA 5C1PA 2ONJA 4AUMA 2EBWA 1SAYA 3ZY4A 3BF7A 1GVNB 4C1NA 5F64A 4BV9A 1T91A 5LKRA 1NFQA 3RT7A 3V1KA 2BH2A 1RWMA 1R6TA 4IDOA 3V1NA 6YASA 1CC1S 4OMFG 4N03A 3LOPA 3DONA 1RWBA 3O8OA 4PINA 4CMJA 4F92B 2Q1YA 1D1TA 2H00A 3O75A 5KJEA 2I4IA 1EESA 2Z2XA 1PT5A 5AW6A 5EXEA 2D1TA 3GLHB 3OLWA 5L3QB 1SN7A 1YUNA 5LQSA 2X86A 4OMCA 4G1FA 1CR2A 3FPAA 3TD6A 4ZOEA 4LTDA 1Z18A 3B1VA 3JSXA 1HDYA 1IN4A 2PEZA 1QX4A 4RPCA 5F3RA 3E03A 1DAHA 1BG6A 2L42A 3PICA 3TRHA 4BO5A 6GPBA 3U19A 5T4FA 3ZDQA 2ZCJA 1Z4OA 2FPLA 3FNHA 1M1UA 3NKLA 3R2JA 1P6QA 2CC2A 4GGMX 3TRIA 4CCSA 2HU5A 4FR0A 5AW5A 1SMKA 3FLAA 5H9VA 3HJGA 3TXXA 1NUHA 2YWXA 4M7RA 2WTMA 1Z56C 4XR9A 1E0JA 1H65A 1MDFA 1GUAA 3HC7A 4FGWA 2CVOA 4HRXA 4BX3A 4OQZA 1XEWX 2F3QA 1QS0A 1NKSA 2FX5A 1ZRSA 2JD1A 2PD3A 4KXUA 4OF4A 3W04A 5BR1A 2WUWE 2C4VA 1Z63A 5H81A 2Q21A 1AKWA 4HNQA 1NLFA 1SA0A 2ZEJA 1T3LA 2HFKA 4ER3A 3AHIA 2QP4A 1Y8CA 4OI1A 5GOZA 1GUYA 3E0XA 4XTRA 4E1VA 4B3DA 1JDNA 4PO9A 4FLFA 3E70C 5EUQB 3E4CA 1KYQA 4CN8A 2YUTA 5FLYA 1Y81A 4J4TA 1BCSA 1ZNQO 3DBLA 4QDUA 1V95A 1RIIA 1MPXA 3ED5A 1QV7A 4GUDA 2QAJA 1J20A 4LJ9A 2B8EA 5FL7A 3LIPA 5G1NA 3PFCA 3U7JA 1Y9JA 3KXLA 4BTVA 2Y71A 1FLDA 3VDQA 4AKGA 1X8JA 4DFDA 3KKMA 2XCSB 4D26A 2H5IA 4Y2TA 2GEKA 4W9NC 5KTPA 4JLSA 4AT1A 5JBNA 4KDEA 1O89A 2XYVA 1B41A 2HXGA 3HBNA 1ATZA 3TMAA 1B23P 1Y7LA 2GTIA 1Z33A 3ESCA 4NNPA 3QIVA 2JIZD 4O4JB 4R8SA 5DHTA 1P0FA 2J46A 2P2DA 5CRIA 1C5KA 1M5TA 3GZJA 4I55A 4JDPA 3HYSA 4J0QA 1SQGA 4RIFA 1OWOA 1BX0A 3H5RA 5G0TA 1UBLS 1SG9A 3MZ0A 1YHZA 1QFMA 3B7GA 4PHFA 5JSZA 1ARZA 3HM2A 4WLEA 1Q0ZA 3TQFA 5D51S 3UIEA 5JI3E 2NP7A 2C3PA 4CNBA 4CODB 1RHRA 4B4WA 5BSFA 5B2ZA 3TRFA 3EBPA 3WI7A 1AZWA 4K6MA 5C5EA 1FL9A 4TQAA 1I13A 2WA2A 2WJWA 1W35A 3NRBA 1A5AB 3P9QA 4FFOA 1K8RA 1P75A 4BV8A 3JQ7A 2I34A 3OPNA 2RJ3A 4I2NA 4TMWA 4W7HA 5G4KA 1PG2A 4RULA 3T3OA 4UNIA 3U39A 1BWRA 4X44A 1P0PA 1MJNA 3PC2A 5FPYA 5B3AA 3CLTC 4H16A 5H9WA 3GLVA 2FFQA 3HKEA 2BFAA 1WRBA 3VFDA 2XQVA 5J4LA 5T67A 1GQOA 4DQ0A 1Q77A 2BGRA 1U7OA 4HLUC 3R5HA 3V7FA 5DGDA 4DCOA 3VAAA 3H05A 3I9V6 3Q15C 3ZJTA 3E84A 1RWXA 3HKCB 4TXJA 4MIYA 2FSGA 2A9VA 4YMSA 4DNPA 3NR2A 5FUMA 1U0OC 2FSVC 4WKPA 1YQ9A 4QC2A 5IFLA 2IEZA 5HFJA 5ILGA 3VKVA 1TCBA 4I9GA 4G5GA 4EHDA 3M5CA 3Q0IA 5L3ZA 2GD6A 2NG1A 1DMRA 2ERCA 2VEOA 5F78A 3ZGNA 3TGWA 4EVQA 4EKDA 2E1RA 4J43A 2G08A 5HIKA 1K5HA 2P0AA 3G8YA 3RTEA 4B2PA 4DLVA 2BCJQ 2Q07A 2HRRA 2X22A 3ZHUA 3DF9A 4NABA 4C7VA 2C2BA 1MDBA 4KODA 4X3CA 1R37A 3C6QA 1IAQA 1ZCFA 3TLXA 1CP3A 4WY5A 3V4LA 4C14A 1MGOA 5JU6A 1C41A 1G8AA 2IRWA 1DFGA 4EYOA 3FOZA 4K2HA 2D2XA 2FK8A 4XYGA 3OPYB 4IGKA 3IO3A 4C07A 3R3SA 4QKQA 4J0CA 1I7LA 3ZWBA 4MPPA 3SF8A 5BVHA 2XUZA 1CJTC 1NPDA 2IFTA 1I2BA 1DRJA 3OUZA 2OSBA 1T3SA 1V26A 5EJFA 3WFJA 2CDRA 3BMQB 4TWZA 1U9IC 4QO8A 1BGWA 5K0TA 1HFKA 3EJWA 3MUFA 4PQGA 4X8HA 5FBRB 4H3VA 4M83A 2GNPA 3MYYA 3NOOA 2C5FA 2Q3BA 5TPZD 4YR7A 5L95A 4YBZA 1LI5A 3PNKA 1OI2A 3ONNA 3N2YA 4FGKA 4XM2A 3R3UA 2AW5A 5EIFA 3ZNQA 1VIAA 2FSVA 2QMZA 3HRIA 4H1UA 2R751 4QO7A 4E6EA 5FT9A 2FZGA 1G7CA 2PNJA 3VR6H 5DK6A 3MM4A 1PJRA 5IEJA 1KTIA 1AQUA 1IOVA 1L4UA 4CV2A 2ODWA 3WWYA 2BI7A 4XH9B 1QF7A 2C20A 3F3KA 4RZ2A 3L02A 2E2WA 3DOHA 1NMXA 2QUBA 1FQJA 3QEMB 1J49A 1U2QA 2WKPA 4EFNA 3D6JA 1B8UA 2ZRIA 2DQSA 2R6ZA 3ESDA 4OLBA 4LFBB 4MITA 3ELBA 1SIBE 4LI3X 3OOWA 3GXBA 5JBQA 1SEVA 2AQKA 1NUTA 2O2SA 3EOZA 4LHXA 2XUKA 2PTHA 4V38A 2OYRA 3JVIA 5HBRA 3B5IA 2QNIA 5EZ5A 4Z86A 1U1FA 2VXOA 3PHJA 4QBFA 2PGIA 2FP4B 4ZIRB 1KO1A 1LPBB 1Q6YA 4MIKA 1Y1SA 3ZGYA 3AJAA 4O2AB 4X95A 3PXGA 5FFMA 4Y6RA 1F14A 1CZNA 1HDGO 2EZ8A 2PX0A 3PR2B 4PYKA 4KZKA 1NUUA 4ZKDA 2HSZA 3VOTA 2V6BA 3AVTA 1C7JA 4M1MA 4BMNA 1EK1A 2FSIA 5FI5A 1JIKA 4GR4A 5IZCA 1J7KA 4ZQGA 3V1UA 1AKEA 3N76A 4GX2A 5LNK6 3BHNA 4PC6A 2AC7A 2E1PA 2ZT8A 3HCBA 3G3EA 3F0TA 3LNTA 3ML1A 3NBQA 2OZKA 3VDNB 4AF7A 3GJRA 4M46A 2BEWB 5JJLA 3NVMB 5AHXA 3IKMB 3FYSA 1BMTA 1OT5A 5DYYA 2VAMA 1CY7A 4BC0A 4EW1A 1AKRA 1W8IA 3WLTA 1TA4A 1P9WA 3N39C 4ZXFA 1TQDA 5FLKA 4LQ4A 4EPTA 2DH6A 5CDTA 1HL7A 3SJZA 1IN1A 2GAAA 5FLXA 4RKFA 1TFUA 4ZCQA 4HQFA 1X3SA 5IYZB 5GONB 5LMCA 2VBFA 3ACDA 4UAVA 4ZO4A 2C2KA 3D8UA 3MELA 4KL8S 4V0SA 5JY6A 1IXSB 2P6RA 3EZYA 1HL3A 1UIMA 5I7WA 4D25A 5MHTA 3A9RA 4F4IA 2GZDA 1D4AA 1LBSA 4E7PA 3IDQA 1P7ZA 4O8ZA 1UPBA 3TKLA 3CRZA 2VG8A 5G1PA 1Z7EA 4OYLA 2XHEA 1I01A 3NFYA 1T2UA 2JJMA 5TMBA 4X61A 3IAHA 4E09A 5A5DA 2P35A 3RYIA 4KSBA 4BGIA 3RU3A 2D59A 1Z4NA 5IPFA 1LC0A 4YUWA 2EKDA 3OQHA 3L1KA 3L7NA 2BZ1A 3LG2A 4PYJA 2O3QA 5JARA 1IN8A 2A0YA 2BM0A 3PSHA 3SXPA 3GP8A 1K7XB 1ACMA 2WFAA 3SZLA 5HOEA 2IXAA 2JLZA 2VP0A 3FETA 4CWAA 4P83A 4FVTA 3T9DA 2AOUB 2ZGVA 3A6HA 4WESB 1MO5A 4E2WA 4LY6A 4UNNA 3LU1A 2JJYA 3N5KA 3EZFA 4IDPA 3TCKA 3U49A 3V1TC 2AI3A 1QSGA 2V4UA 2VQ6A 3DUWA 4Q1DA 4F3NA 4Q39A 2NVUB 2Q8QA 3HB7A 5B1HA 4Q82A 1IB0A 2JPDA 2WTXA 3PNVA 5IJAA 3FZGA 1L5WA 3CVOA 4Q6WA 4AJEA 1BDJA 2VK4A 2W42A 2H6EA 2XRZA 1F1JA 1X9HA 2C2MA 4LQCA 1TLTA 1VB3A 4Y2VA 2JH8A 3D4BA 5THKA 5JSQA 1JG4A 4TSKA 4U9HS 3N7AA 1CJMA 1XU4A 1TKRA 3NWBA 2Y99A 2C2OA 4H4CA 1ZRNA 3SYMA 1PQWA 3MJHA 3RNOA 1RBQA 3DZHA 5AKZA 4ZOCA 3EASA 3VYWA 1PJSA 1P3Y1 2P67A 3EC1A 4R31A 3SFZA 3KALA 5DLPA 4GI7A 2CUNA 4C7BA 1GNPA 3AF1A 4JI4B 1BTOA 1E0AA 2VLBA 4XYBA 4MKGA 1KP9A 4LZJA 1Z3IX 4I4TB 1I1QB 2FEMA 3SDSA 3TXYA 2EG9A 3QVXA 3HPRA 1DLIA 4RXUA 4F9GA 2EKPA 4M1QA 1P3JA 3EISA 5BUCA 7REQB 5L8VA 3THXB 5FR1A 5GM1A 5M04A 1NPYA 4GOLD 1N5OX 1RYZA 3J7TA 2BDTA 5IF9A 2NV0A 1ZHFA 2RI0A 4LV8B 2ENUA 3MTIA 2ARKA 2PX8A 3EOBI 4OREX 4BMOB 2WTEA 4XA8A 3UA3A 2WZDA 1ZNXA 4FQ5A 4FYPA 1C8KA 3TJMA 1U90A 3OX1A 2V7UA 1R0BA 1NVTA 4HYQA 4PQYA 2VP3A 4GYYA 1GG9A 1SNYA 3OHMA 4KE8A 4AO7A 3CU5A 5CT4A 3STUA 3EDMA 3WL5A 1A8QA 2FN3A 1LTQA 2QLLA 4WLOA 1U63A 4RVFA 3ZHYA 4MTLA 1FIUA 1NR5A 3GLTA 4YALA 1XHLA 3C3YA 3GMSA 1MG0A 1C1YA 3CF6R 3BGWA 5AI5A 3ZVMA 3GBVA 1KBQA 4ZYUA 4YYZA 3VZPA 1M2JA 1AQIA 2O2YA 2VQSA 2XYQA 3MG9A 1GEGA 1XU9A 4LOHA 4OKIA 4NENA 3KM0A 2YHUA 1UQUA 1VXRA 3L6CA 4IG9A 4U39A 3CCCA 2N0SA 3K8OE 2XIJA 4YXFA 2ORWA 4IZ6A 2C7PA 1N2XA 4FMDF 1F0YA 1I4TD 1KY4A 3L0SA 4CUKA 1ZNYA 1BC5A 2KLHA 2Q6LA 3BILA 2RGNA 5KYXA 1RW4A 2PLNA 4NOKA 3CRW1 1NULA 3I12A 4CCYA 3G8DA 4OVKA 2IL1A 2RI6A 4L5YA 4DMKA 5AVUA 4M98A 2AKYA 4ZCIA 3A10A 3QNUA 1XZFA 3S40A 1OX4A 5TS3A 3MJFA 2BEVA 3D4LA 1KMMA 2H4XA 3OJXA 2OV6A 4GSKA 3A3KA 3PIIA 1POWA 1U2DC 3L7MA 4QGHA 1C4XA 3OTWA 4WNAA 2GUWA 1MVLA 5BVGA 1SCDA 5CXQA 3CF2A 2H7YA 2Q4OA 4YMWA 4FLEA 4N1AA 3N6RA 4N3CA 4A73A 3AIKA 1TUGA 5ALFA 3DC2A 3UMBA 4OM8A 5H0IA 5CB4A 2E89A 2MT9A 3P94A 2C78A 2I3GA 1G0OA 2W2QA 4P35A 1CZHA 3JWIA 4L72A 2FHPA 2O9JA 4GM4A 3EA5A 4CT0A 2FFBA 2R79A 1F9EA 2G9QA 5LPNA 3IVAA 1AXGA 4PZZA 1P7PA 1XUOA 1P2VA 2I65A 1G64A 1YJ8A 4OXKA 2YIMA 4PHHA 2XE7A 2PGNA 2XH8A 4WCDA 3BD7A 3QNWA 1O6GA 3L0CA 2ZR8A 5TQ0A 3WGLA 5JZBA 4JMPA 5JS1A 4RA9B 4WXMA 2VWGA 1XRPA 4WCVA 1W0JD 3WYDA 2Q1SA 3GA7A 4UMEA 4ZO7A 1OKKD 4Y2QA 4AZ3A 1HNWB 4U2FA 3L7BA 3IDZA 2Q0SA 1NBEA 3OT4A 2FZLA 3BE8A 3JVVA 5EYPA 5ELLA 4FS3A 4B76A 1ETUA 1SXGA 4Y0VA 2A59A 1QX3A 4EFLA 4F3YA 4HSGA 3STVA 3TFOA 1VCOA 4NEQA 2CB0A 3IP9A 2VJYA 3TSAA 1ZCJA 1WDLA 3AGQA 5KYYA 3BGIA 2G4CA 3JPWA 3MJSA 3IUYA 3MWEA 3D6AA 4GMFA 4YJFB 2CYBA 1NC3A 5DASA 2Z58A 4DANA 1U2DA 1FCJA 1J7JA 5DGXA 1V4VA 5I7OA 1EG7A 2MSKA 2FPIA 4G0PA 4LPKA 1Y98A 3C4VA 3BXFA 1KR5A 4XSVA 1V41E 1Z34A 3CG4A 1RQXA 4B34A 1NY6A 2W8BB 5G3YA 3M89A 5T4BA 2CMFA 1AURA 1I0ZA 3W78A 3NZEA 1SUPA 1ORHA 1SBQA 1UANA 3C24A 3FPKA 4MRRA 2WD7B 3PX3A 1O94A 4GD3Q 3ZWMA 1YSCA 2ZSEA 4MWEA 2ZTVA 1P5ZB 1XFDA 2ICAA 4I8DA 3ZDZB 4C4AA 2R9VA 2JCGA 4MVCA 5JJ5A 3U6BA 3AEKB 1Y89A 4IFIA 5HIJA 3DVSX 4YRQA 4Z53A 1EI9A 4EO4A 4HLQB 2FWRA 1WTAA 1VG1A 3REQB 2OHVA 3FPGA 4RK7A 5DGCA 3DZJA 2GK7A 2X4IA 5F5NA 4QBTA 1DKOA 2DHEA 1O0CA 1A7JA 1VA5A 3F6PA 1A5SB 3JQAD 4KE9A 2AGVA 5EPOA 2ZUFA 3NXSA 2WQZA 3ETGA 4PZEA 2AW3A 1E1CB 1J2RA 1YE8A 3ANLA 1X14A 2E3JA 1IQPA 3RWOA 5KI6A 4DQVA 1Z0AA 3IA2A 1P2GA 2G82A 2Y1EA 4R40A 4ZHQA 2PUCA 3WWZA 3O4FA 5EZYB 4AX4A 1E5LA 1SB9A 3CJTA 1XAJA 2BWJA 1JEJA 2W98A 3QU7A 2PT6A 3EA0A 1BE6A 1TTHA 4XGRA 1Z5WA 4EKYA 2DZDA 2G5PA 4R9SA 3KR1A 2VKTA 5C3MA 4ITVA 3RC2A 3C15C 3S0JA 1LEHA 1QOQB 2IQ5A 1YS7A 2B8JA 5CK5A 5AI0A 3TTUA 4NEGA 3MK31 3S2GA 2CT8A 1OJ7A 3HI4A 1L5VA 1GZVA 1HEIA 1A82A 5DGTA 1JFVA 3EPRA 1Z08A 1Z7WA 3AJEA 4ZOLA 3C8MA 2GJKA 2MCFA 3VNRA 3I73A 9GPBA 1GAXA 5HQTA 3GWZA 2JH9A 3GCDA 4Z1MA 4FFNA 1WZUA 5K0CA 2GZ3A 1CUJA 2I1VB 2Y2UA 1N1MA 2EFJA 3K9QO 4OFWA 3N0WA 4TWAA 4AKTA 2CLMB 5LXTF 1RIFA 4MP8A 3PE3A 3QVKA 1E89A 3G1WA 3BMNA 4JDUA 4Q1BA 3NIWA 4RVSA 3FVQA 2Z2JA 4XQEA 2QR2A 4BZWA 4RORA 1SCAA 5K3CA 1DCTA 2W7TA 5A2GA 3ZI7A 2QMEA 4DJ5X 2JI4A 4BE4A 4G8CA 1C3XA 4Y67A 3VHRA 2BI8A 5FH9A 5EXDA 3P0EA 4H1HA 1PO7A 1WB4A 1XTUA 1TM4E 2V65A 4IV8A 4Y2UA 1JU9A 4ZCLA 1KVSA 2Q50A 4WK6A 3T1QA 4CF6A 5LQDA 5ADWA 5A9SA 1AO3A 3DAPA 4ONEA 4AJNA 2VK2A 1SUAA 1YH3A 4RS4A 1SHTX 5FTJA 4W5WA 1JEAA 2VWPA 1ILEA 4HQNA 1CEXA 1E6MA 1GAQA 5KYWA 1NQVA 2RGWA 3VYVA 1WXEA 4TTQA 4P7JA 1E7RA 3D2AA 3DZGA 2EJVA 2PJDA 1B0ZA 3Q6IA 2A5LA 1XGKA 1RFGE 5GONF 5IYZF 5C8DA 1M1NB 3M6WA 4A8JC 3PZRA 2NZ8A 3J81k 3DLCA 5L4NA 1OFUX 2P4UA 3K96A 2W6ID 3WL7A 4B6PA 2GBLC 3I28A 2ZRKA 4G5FA 4AU1A 4YRJA 1D7OA 1P4SA 2WHQA 1ZA2A 2C1ZA 3H9CA 3PFBA 1JDVA 2BFDA 1G3IA 1SUBA 2W6QA 4ALJA 1DKLA 4RLHA 5G0WA 1FP1D 3LECA 5CPFA 3MQFA 5DTJA 1JAYA 2MSDB 1J1ZA 2EOAA 2KS6A 3E9RA 4GXNA 5CDYA 2V4MA 2GCGA 4E13A 2FR8A 1JB9A 4NJEB 1JVNA 1OWPA 4FDAA 1QZTA 5FL7D 4RUKA 4KXLA 5C34B 5JCPA 2BUCA 2YIJA 2DF8A 2FZEA 4O6VA 4ZRMA 2AL7A 4BO2A 1X2BA 4PICA 5CCXA 2I6GA 3UAOA 1K4MA 3EPJA 3RCBA 5KB3A 3MS2A 3OC0A 4CV1A 3U09A 1F38A 3WK5A 4WZAA 5IARA 3S7TA 4ILKA 2FKNA 1OZ0A 1L9XA 3AT1A 2ADOA 4CQMB 1R10A 1ML4A 4P53A 4JUDX 1XZPA 1TMKA 4W8OA 3SQDA 2JG3A 1EA7A 3F4LA 3DT9A 4BGDA 4BXOB 2N42A 2ZRLA 1CEEA 4MZXA 3TD9A 1FDWA 1EGMB 2XNCA 1SZDA 3WB2A 3K0FB 1J0XO 1II0A 3G9XA 3IXMA 1JYEA 5HE8A 2EX4A 2MSLA 1ECFA 1HSOA 2RH8A 3K4HA 4FDTA 3T5DA 4F5ZA 4H17A 5AP9A 3UMYA 3LCVB 1FTSA 3EQ7A 3T7KA 1DQPA 3SFTA 5AW3A 1B6SA 4V3BA 4A8JA 3G13A 1V1RA 4NMXB 2A6PA 4WFQA 2O7VA 4P0PB 2GBLA 5AJUA 5LM3A 5F12A 4L5AA 1KVRA 1DV2A 4G1UC 2QQFA 4QXAA 3RRZA 5CDUA 4JROA 3TVYA 3ANNA 5CK4A 3ZTTA 3D9QX 4O8CA 1Z0SA 2WWWA 2G7MC 3IERA 3KTFA 3DL7A 4ITUA 4I4TF 4HXGA 4L75A 4DREA 1QZZA 2AQ8A 3O2NA 1J5XA 4CQLB 5JC8A 5CVVA 1OW3B 1ELOA 4QUDA 3WP1B 2WTNA 4IQFA 5KO2A 3KKQA 3QA3E 4X90A 1SQFA 1SU4A 1QIHA 5BUQA 2PKXA 3R4VA 2HRCA 1AHIA 4PLHA 1VE6A 2HWKA 3DCIA 3GLIE 2VPIA 4WFJA 3ZHXA 3QOYA 1KU0A 4NHOA 3UUEA 2D1RA 2CD7A 3N3AC 2UYQA 4DCVA 2GYUA 1VI2A 3LDGA 4Q34A 3GA0A 3DT6A 3IESA 3ICOA 3PEEA 3WHPA 1A3CA 2L0XA 4UCXA 4FYIA 2ZB7A 1KJYA 3KL2A