3UVEA

Crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
TGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDLAETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMFHTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
total genus 102
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uveA00
4UUPA 4GGOA 3L77A 5ICSA 1ZK3A 3NX4A 2YHIA 2VHVA 4HFRA 3HDQA 1X0XA 5IG2A 4QO7A 1IB6A 4Z9XA 3R6DA 2GN6A 4M86A 2X5OA 4OO3A 3RC7A 3WGOA 3HDJA 3F4BA 4DYDA 1LRJA 2AHRA 1VKNA 2Q99A 1ENYA 3U62A 4B4WA 4CLHA 3PTZA 4I9NA 3ZHXA 1IL0A 5G0UA 1HDXA 3U3XA 3IIEA 4NNJA 4F6LA 2E4AA 1IYZA 3JQBA 4GWKA 3D5TA 2UVDA 4Q3NA 3Q2KA 4IMPA 4CM7A 2RAFA 1TT5A 5L40A 3BMQB 4GQAA 2DKNA 1LRLA 2GO1A 4K6FA 2H9IA 1PL6A 3FTNA 3PQEA 3BIOA 4QECA 1DJQA 1ULUA 4UULA 4L4SA 1IZ0A 4E5MA 1X1TA 4I8XA 2EKLA 1ENZA 2VRCA 1WMBA 4YRDA 3W4IA 4CR8A 3AY6A 5U9CA 1T1SA 1H6CA 1XHLA 1ISJA 1U7TA 3JQFA 2Q50A 3PEFA 2P68A 4WK6A 3E82A 2JHFA 4IM7A 1NR1A 3O8QB 3RWBA 4AJ4A 3EMKA 4YAKA 2FSSA 2HU2A 1WAMA 2Q4EA 1NHGA 2Z95A 1R0KA 4YCAA 3EZYA 4MDHA 3RUDA 1BW9A 3H9JA 3MJSA 3KOUA 3ONDA 4CMAA 4QQRA 1KETA 4LVUA 5JBIA 1NPTO 1MA0A 1E77A 1J6UA 1TXGA 1TA4A 3ZWMA 5JAQA 1E1MA 3TZQA 2O4CA 2DBQA 4BOYA 4CPDA 5G0WA 2PWZA 3EZLA 4E2WA 2OUIA 4DLAA 2O48X 3LU1A 5GZ3A 4NBWA 4GSKA 1I01A 1RM0A 2FR8A 2YV3A 2NVWA 2P2SA 5GZ1A 3IOYA 1I0ZA 2JFHA 3SBOA 1LRKA 3WGHA 5KVCA 4FW8A 1LTHR 4CODB 3JQAA 1FJHA 2H63A 2Y93A 3M6IA 3JYLA 1Q7CA 1O5IA 4J2OA 3KV3O 3A1NA 2NV6A 4WECA 3U49A 4FD3A 4YPOA 4RPKA 1UXGA 3NGXA 3QVWA 1GPDG 1JVBA 2Q4BA 1Z75A 4MO2A 1I2BA 2QX7A 4YJHB 3FHLA 1VJ0A 4I5FA 3WBFA 4GMGA 4EEXA 4OYRA 4RL6A 3GNTA 3ZCXA 5DP2A 2D59A 2DT5A 4HNHA 2EV9A 2VZ8A 3L0DA 2IRWA 2IZ1A 3WQSB 3H5AA 4GVLA 4FS3A 4GVXA 3ADOA 5JDIA 1V9LA 3I4CA 1I10A 3NT5A 3WIDA 3WFIA 2O50A 1GAEO 2PGLA 3JQEA 4ROSA 5A1TA 3OQ1A 1P0CA 2Y68A 3T7CA 2B69A 1LBEA 3PI7A 2SCUA 3DO5A 5I8WA 3E18A 3ZNOA 1CEQA 3ZU2A 4IJVA 4DMMA 1NYTA 1UXJA 2HMTA 4CUJA 4W7HA 1HXHA 3K9QO 4BO8A 2CF5A 3B70A 1JDJA 5F21A 3K96A 1IOLA 3KXDA 5TQVA 5THKA 3ICPA 1DC4A 3JQAD 4A7PA 1P44A 1DLJA 3VPXA 1K6XA 1GTMA 4WASA 5TT1A 4M55A 4NFYA 5DF1A 5IDQA 3C1AA 3I6QA 2B36A 2GUGA 3KVOA 4IIUA 4WLEA 1U3VA 2CMDA 3VHRA 1H0KA 1VI2A 1V3UA 2EGGA 2ZCUA 1OMOA 2QRLA 1P77A 2YV1A 5GZ6A 4Y8VA 4DLLA 2NTVA 2W4QA 1RKXA 2HCTA 2QG4A 1D1SA 3DOCA 3F1LA 3MWEB 2NVUA 4H3VA 3SEFA 3RBXA 3GGPA 4XWYA 2W8ZA 1NQ5A 3NUGA 3U4CA 3MZ0A 4ND4A 1F06A 3ASVA 4O1MA 4B4OA 1E3JA 3ENKA 4YWJA 3E5RA 4YBZA 1OBFO 2YZ7A 1JU9A 4JQCA 3Q1LA 4E2YA 2G1UA 1XQ1A 5C37A 3BTOA 3FNFA 4RPGA 4ALKA 3HDYA 2O7SA 3DXFA 4PLGA 3SXPA 2VNSA 1Q0LA 2DC1A 4Q3BA 4AL4A 4HUJA 3BTUA 1HLDA 1ARZA 2G0TA 1MC4A 3NTQA 3P5SA 4NPCA 4TSKA 3ZNNA 2C0CA 1R4NA 3I9OA 3RJ5A 5A9RA 3R3SA 4D41A 2B5WA 4J16A 4W9NA 3UHAA 3SX2A 2D1YA 2EKPA 4YAGA 2PKQO 3GNQA 1UXKA 1YO6A 5L95A 1ZMOA 2D2IA 5JMPA 2GGSA 2PD3A 3JQBC 5C5IA 1N2SA 4H16A 3VVCA 3QVTA 2VCYA 1C14A 2QYTA 1GCUA 2QZ9A 3PHIA 2X58A 3KYCA 2AQIA 4GX1A 1KVSA 4OKIA 1W73A 4PLYA 4A10A 4Z6KA 3GR6A 4XQGA 3GRKA 3ANNA 3CMCO 1HF3A 3H9GA 4WCFA 1XLTA 4YTEA 4ZGWA 5CDSA 3I1JA 4R54A 4R9RA 4WOKA 3INTA 4E5PA 3L07A 1N7HA 2DUWA 1UAGA 1V0JA 1YJQA 4WLFA 1PEDA 1T26A 3JQFC 4BL5A 3NGLA 4MOWA 1NTOA 3WBBA 2IDZA 1EVZA 3LDHA 2PTGA 3GNSA 2GSDA 3BMOA 3G0OA 1A9YA 3PJEA 4W6ZA 1Y8QA 5EQFA 1KY5A 1VJTA 3OJFA 3NRCA 6LDHA 1OI7A 4HV4A 2GERA 1IZ9A 3W1VA 3FBGA 1DFIA 4URFA 1HDCA 2V6BA 5JS6A 4WLNA 2ZJ1A 4RORA 1CQIA 5H81A 1LDMA 4PZEA 3TN7A 2BGLA 3KEOA 2C29D 3A06A 4NI5A 4RVGA 4J4HA 5ER6A 4UUMA 1DDOA 3GN1A 3W8DA 5G4LA 3KTDA 1P1FA 3DMYA 4CM8A 4N18A 1NXQA 3Q3CA 4MPDA 4I1IA 4OM8A 3LQFA 4MP8A 4AJNA 5FYDA 4BNKA 2OGUA 1MFPA 5B4VA 1L7DA 1OOEA 3NJ8A 4P22A 2I5PO 2O2YA 4D0RA 4D7AA 3CUKA 4PZDA 5DBIA 4LMRA 5L9AA 1SB8A 1ADGA 2AE1A 4CLRB 2VHXA 1LQTA 1EK5A 2X4GA 4JP3A 4MINA 5HM8A 4DIFA 1DHTA 2FPGA 3L4BA 1HRDA 1A4UA 4RVUA 3VVBA 4DVJA 2YHIB 3HDHA 5BSEA 2QZZA 3EYWA 4GX2A 3H4VA 4LRSB 1YQXA 7MDHA 4KTTE 4XR9A 2RHRA 3ENNA 3QWIA 3JQ9A 2VTEA 4XGIA 1YRLA 4GSLA 3JQ8A 3PPIA 3WGTA 4Y6PA 3D3WB 1MV8A 1ID1A 2AQKA 3CEAA 1SOVA 3DBVO 4IDDA 5TNXA 4PLVA 1XQ6A 3G3EA 4HFJA 3I83A 1UDCA 4JXKA 3KEQA 4J7CA 4FOSA 5A3JA 1ZEJA 4DTIA 5JDIC 2YFHA 2DTDA 1W4ZA 2BELA 5A9SA 7ADHA 4XYMA 5TJHA 1BRMA 2ZIZA 3GGOA 1K0UA 2Y05A 4MVJI 3ROMA 1WMAA 1CYDA 1GEGA 3ZWWA 5AXCA 4TKLA 3ZWVA 1GR0A 1MG0A 4IQ8A 3ZWAA 4OHUA 3PZBA 5CFZA 1NQOA 3E48A 1U28A 3TPCA 1PX0A 3PJGA 1E7YA 1K2WA 4KUEA 3KM0A 4FPXA 3H2ZA 4H15A 3MJEA 1TI7A 2Y0DA 3N74A 1NAIA 1ML3A 4D3DA 3H9QA 4A0SA 1PGJA 4ZICA 1HDGO 2Q2WA 1F12A 1BW9B 4PG4A 4NMHA 4YJGA 1BDMA 2WD8A 3GG2A 1DSSG 2J8ZA 2W90A 2IYPA 4U0KA 2O4UX 1DJNA 3PIIA 1E1KA 4O6VA 4CM1A 4KUHA 2XOXA 4EW6A 4PG8A 5CDYA 1MUUA 3QWBA 1Y9EA 3A9WA 3WGIA 5T57A 1LLUA 1UDAA 4BIIA 1Y1PA 4KUGA 3QP9A 2C54A 1ZBQA 4HXYA 3Q0EA 5B37A 1PZHA 1ENOA 1F8GA 2VYNA 3NJ4A 1E92A 1TVEA 4PRKA 1F17A 5CEEA 1NAHA 4UREA 2H5LA 2ILTA 1PJQA 2EGHA 1OC4A 1U1IA 3K6JA 2BMAA 2GLXA 3DR3A 2VQ3A 5A9TA 4MKXA 3AJRA 4FJ2A 4B3JA 4U7WA 3MTJA 2ZTLA 2I66A 4E30A 4W9NC 4RZIA 1A7AA 4ILKA 3PGXA 2X9VA 1HT0A 3NKLA 3HQ4O 3OQ6A 4RF5A 3ADPA 1ISGA 3CXRA 3KYBA 2P4QA 4XA8A 2Y1OA 3OP4A 5TRTA 3C7AA 4Z3DA 2B37A 1DRVA 5COQA 1V35A 4PFJA 3WMXA 1T2DA 3OSUA 1GQ2A 2RIRA 4GX0A 1ISFA 5JCXA 3CSDA 3DQPA 4BO5A 4D0SA 1NBOA 4WCFC 5CDTA 2RH8A 4PZCA 4IGFA 3V5NA 1C1DB 4E2XA 1HE2A 1JW9B 4RDHA 3CE6A 3RUHA 1EVJA 1KEUA 2VYND 5TC4A 3E9QA 4AJJA 4AJHA 2BLLA 3H65A 3IAHA 3L6DA 3LSYA 3QY9A 1AE1A 4D44A 3QHAA 2ET6A 1N8KA 9LDTA 4WLUA 3OECA 1VLLA 5A3VA 2VWPA 1BXKA 4OOFA 1ZO8A 4PGFA 3OJEA 3GMDA 3H5RA 4YRBA 4E12A 4GI2A 3QQPA 1BG6A 4Q39A 2VOJA 1RM3A 5IJZA 3RJ9A 4NJOA 1ZFNA 2VUTA 1NPYA 3FNGA 2D3TA 1PZGA 1YB5A 2C82A 2JAPA 2X23A 2BD0A 4N7RA 1QKIA 2NVUB 4A2CA 3JD1A 3IJPA 2H6EA 3TZ6A 2CVOA 3RVDA 4GKBA 3I6IA 2GYYA 2PZJA 3AM3A 5JW6A 2OXIA 4FFPA 2YY7A 3TL2A 1O95A 4CJXA 1IY8A 4JCOA 4RV9A 1XEAA 3H9UA 3JCZA 2DLDA 1HSOA 1N7GA 4YACA 2Q49A 2VOEA 2WDZA 1O9BA 3HNPA 4UVHA 1KEPA 4GX5A 4XB2A 4BO1A 4XRRA 1PGOA 2GNAA 3L4BC 3GUYA 1JAYA 3T4EA 1EVYA 2FOIA 4P38A 5F1KA 4EJ6A 3H7AA 3RUEA 1T2EA 4LK3A 3WGZA 3TF5A 3VH2A 4CLDA 5C3MA 2BFMA 5I9MA 4EUFA 1R4NB 3JQ9C 2PKRA 4E4YA 1DC6A 1S7CA 4ZN6A 4TRNA 3VH4A 3UKOA 4M54A 5CP8A 1B8PA 1RYEA 3O26A 1ZJYA 4CLOA 2BRUA 5IF3A 3MJTA 2FPIA 4YVFA 1DBVO 4FJ0A 4LCJA 5EL0A 4IINA 3WTCA 3EVNA 4MIOA 2DVMA 4MVJP 1X0VA 3KYCB 2JD2A 5AXDA 1WP4A 3UAGA 2HRBA 4JP2A 2EJVA 4BNLA 2CVZA 1M76A 5HA5A 2EHDA 1E1LA 4WCFB 4EDFA 3T7EA 1LLDA 4OIMA 1GADO 2JFGA 1EE2A 1EFKA 1KBZA 2DBRA 3LVFO 4B8ZA 4EI2A 1VL0A 2CNBA 3KB6A 1M2WA 5L4SA 3AI3A 3WXBA 1IULA 3FI9A 3TNLA 4MVJA 4RZHA 3BMOB 3ZWBA 1H93A 5CEJA 3PVZA 1LXCA 1Y8QB 4L74A 1BTOA 2HK8A 3RIHA 3CKYA 1JKIA 4BNWA 3RASA 2ZK7A 4D45A 5F3RA 4CUKA 3I9LA 4HX5A 2EW8A 5BSGA 4R68A 5KOIA 1EUCA 4AJ2A 1SB9A 1MFZA 1GUFA 3RC2A 1BGVA 4ALNA 1X14A 5EJ2A 1PJCA 1JA9A 5ILGA 3ZWXA 4NBRA 3D4OA 4RDIA 3WB9A 3Q9NA 1ZIDA 1NWCA 4XEHA 3FCOA 3KZVA 4BNTA 3ZWPA 3VPSA 3O03A 1EBUA 1QRRA 2X6TA 2GZ2A 3ZW9A 3GF4A 3HUDA 3ZGYA 3DTTA 4HNGA 1WZEA 3LLVA 2B4QA 3F47A 2G82A 5BSHA 3X2EA 4NU5A 2NTJA 3JQGA 2FZWA 4R01A 1R15A 2EW2A 1LLCA 2C20A 2B83A 2XXBA 2JHGA 4BV9A 3IQDB 1QMGA 4GKVA 1JKJA 4XB1A 1BMDA 1R0SA 2DM6A 2WMDA 3C3XA 4Y6SA 4W82A 4FFMA 1DFHA 5DP1A 1EE9A 1A5ZA 2CDBA 2WEKA 5IXYA 2X86A 1K6IA 4UAGA 4MVJD 2IE0A 5DOZA 2Y0EA 1E3LA 1H6BA 2JCXA 2YDYA 1R4MA 3FWZA 4JN6B 3Q9UA 4BNGA 3EHEA 1X15A 4QT0A 5CPBA 1GU7A 4DUPA 4MVJM 3JQ8B 4PG6A 3TJRA 2JCYA 4JX8A 3LC7O 5AOVA 2Z5LA 1P9LA 1UP6A 4Y9DA 3FD8A 3ZN2A 2HMUA 1J5PA 1HETA 5A9SB 1E3IA 1GYPA 5H83A 3GMSA 1GDHA 1D8AA 1XYGA 2VTDA 4YQYA 1C0LA 3ZHZA 3EGOA 2P9GA 2ZB4A 1A9ZA 3OMLA 3AFNA 1FDSA 3CH6A 4MVJG 3ZU4A 2A92A 4R16A 3C7DB 1OFGA 2HMSA 3GGGA 1UH5A 1B3BA 1XG5A 5AXBA 4CLEA 2AE2A 1HZZA 3OIDA 3C7CB 4OMUA 4ND1A 5DN9A 2AEJA 4ND3A 1AXEA 4CMIA 1KC3A 1N92A 4B4UA 1E7MA 5JFOA 1B2LA 4DYVA 1JLLA 1QYCA 3IJRA 3ITDA 4R5MA 3KHUA 4XCVA 5AVOA 1D1TA 1DOHA 1CWUA 1H2HA 1EUZA 4J49A 3RFTA 3TWOA 3GEDA 2DU8A 3E5MA 3RFXA 3K30A 1AHIA 1I33A 2UV8A 5KTKA 1F0YA 3H6KA 4QTZA 4DIOA 2VWGA 4OSPA 3K5PA 5K0ZA 2BGMA 5ER9A 3GEMA 1U9JA 5CAEA 3TZCA 3JQ7A 3DHNA 4E5NA 1GFSA 4R4JA 1VJ1A 3PWKA 4KDFA 2X5KO 2B5VA 2O3QA 3DOOA 3S2EA 1ULSA 4IZIA 4XX0A 5C7IO 3NTRA 3R1IA 4X54A 1GZ4A 4J6FA 2E48A 1K5HA 1NVTA 3H3FA 3TSCA 1U2GA 4CV0A 5IN4A 5MDHA 1ADFA 3FPCA 4YJDA 2EEZA 2Q1UA 4P4GA 5HWSA 3TZHA 4D3FA 3K2EA 3O9ZA 3R0IA 2FR1A 1KC1A 2Q2VA 3PP8A 1YVEI 2OORA 2EP7A 2PD6A 4I5DA 2V7PA 1XWFA 3B1FA 1E3SA 2IXAA 4Z9YA 1E6WA 3BMNA 4ALJA 2Q1SA 3VZRA 1U3WA 2JCVA 2PLAA 1ZVMA 1XU7A 2OO5A 4IIVA 3FNEA 1GYQA 4U0JA 4BO7A 3JYOA 3PHGA 4JGBA 2TMGA 3UGKA 4FOOA 4L8VA 2ZB7A 1ZJZA 1DRWA 4DC0A 2ZQYA 2IEDA 1NHWA 3WGYA 4HY3A 4IXWA 5BSFA 2DPHA 3LT4A 1I30A 3QW2A 1O0SA 4I08A 4IDAA 4YJFB 4J0FA 1FXSA 2E37A 3WYBA 4C7KA 2HDHA 3G49A 1P1IA 3GEGA 4Z0PA 3DZKA 3C85A 1ONOA 3FPLA 4RPLA 3D64A 4TMFA 1H2BA 3BAZA 3STHA 2Y1CA 1HL3A 1IHXA 2DBVO 3GAZA 5A5FA 1PJLA 3DOJA 1YQGA 3AOGA 3GPDG 3PHJA 3OIGA 4WEQA 1Q1NA 1Z74A 3AUTA 4R9SA 5CHEA 2RHCA 4IDCA 4EGFA 1P0FA 4Z3KA 3VC7A 2J3HA 1UP4A 4LRTB 3UCFA 1VL8A 1P1HA 3KUXA 4CL8A 3V1TC 4YT5A 1PL8A 2LDXA 2ZTMA 2C7GA 3IKTA 1E3EA 1NWHA 2VUSA 4CR6A 3DBRA 4CMCA 3ZHYA 5L7TA 2PK3A 4GMFA 1HDRA 4KOAA 1B8VA 3GDGA 4RVHA 3COSA 3UH1A 3ZV4A 3LZ6A 4O5OA 1A27A 4PLPA 5DCWA 3RI3A 1GCOA 3DBLA 2Y99A 5DNAA 3G17A 1I2ZA 1P1KA 2W2KB 3FTPA 4Q3EA 3DTYA 3WWYA 4BB6A 3V1YA 4R3NA 5I7SA 4BS9A 3CINA 4TRJA 3W6ZA 3E8XA 4ALMA 4CMJA 4DIBA 2WE7A 1P1RA 2GPTA 3GN2A 2EJWA 1ISHA 2JFFA 3C8MA 1MB4A 3QWHA 3U5TA 4ONEA 5DZSA 1EUDA 1PZEA 1V6AA 3DDNA 4PLFA 3ZNPA 5K6AA 2AA3A 1J4AA 4CQMA 1HE3A 5DDIP 4Q3AA 1OZAA 2E6UX 3N58A 4I5GA 3WR5A 3W4KA 3EK2A 1UUFA 1YH3A 4NJMB 1AGNA 4INAA 2NSDA 3HE3A 1K89A 1DC3A 2QRKA 2HSDA 4M8SA 3NV9A 3OF2A 5JCJD 4JBGA 1PS8A 1FDWA 4BVAA 3ULKA 1QG6A 2O23A 2GD1O 3OM9A 5A06A 1B0AA 5F5NA 3TOXA 1ZMTA 1DC5A 4YR9A 2O7QA 3PWSA 4N54A 2XF8A 3PGJA 4P8RA 3PYMA 3B1JA 4J9UE 8LDHA 5JY6A 2HMWA 2CD9A 2EKQA 3GY0A 4OXYA 4BNYA 4HP8A 4BO4A 4CQLA 1XU9A 4MKZA 2QIOA 3OA0A 3PYXA 3KSZO 5EMHA 3LC1O 4R51A 1T2CA 3JSAA 2E82A 4J91A 5DBGA 4CM5A 4KP7A 1PJ2A 4ZQBA 5G4KB 4WJZA 1AUPA 5TT0A 1YB4A 3UW3A 2D5AA 4UEOA 4BKRA 4BMNA 3BMCA 3MJ4A 1UXIA 4YDRA 3D4NA 2HAEA 3WGGA 3DZFA 1X7GA 3BTVA 4JJIA 1PJTA 4CQMD 3JV7A 1C1XA 1Z73A 4DPLA 2IZZA 3CPSA 4I9HA 2AEFA 1XGKA 1U8FO 3HADA 2Y67A 4ND2A 4U6SA 5COAA 4F46A 3RUCA 2JD0A 2J3JA 2X1HA 1YXMA 2WE8A 2ZTUA 4CV3A 5KVQA 2BFOA 4ND5A 2QHXA 2NWQA 1QORA 3WWZA 2P5UA 1LSUA 2HQ1A 3F6YA 3X2FA 4PLWA 4E32A 4E5KA 1DEHA 3BA1A 1ZEMA 5IDXA 1HEUA 5JAIA 4RVFA 3KYDA 3UFXA 1SEVA 4GAEA 4J4TA 1DXYA 4IGEA 4LGVA 3NAQA 2W2LD 5KJ6A 1B14A 3VTZA 3MEQA 4U8GA 4B7UA 1ZK1A 3EDMA 3WICA 1GV0A 4XQEA 1ZXLA 1B7GO 4FC7A 4XIJA 5JYEA 4I5EA 4NG5A 1R4MB 3EAGA 2QYSA 4BGIA 4B3HA 4L4RA 1GPJA 2YYYA 4O63O 3TL3A 1NX6A 4BO6A 4B3IA 5CDGA 4HFMA 4E21A 1ISMA 1XKQA 2FHSA 5EPOA 5A4DA 2CDCA 2HUNA 4OGWA 4WGGA 1ORRA 1UZNA 2OHXA 1N9GA 4CMHA 5ADHA 2BH9A 3OFSA 1LDGA 4WCDA 4O59O 1BXGA 2B4TO 2HJSA 2WJPA 2YQ4A 1GV1A 3F46A 4I9UA 1B8UA 3WSWA 1T4DA 2BI7A 2EERA 3S2GA 1XELA 3GZNA 2BKAA 3OBBA 3WDSA 3VOSA 1ZKMA 1TT5B 3P2OA 1PR9A 1VE9A 2JL1A 3QWFA 4AJPA 4CMIB 3K92A 1P33A 2ZKLA 3ZV6A 4II3A 5JY1A 1NASA 1LJ8A 1M6WA 4K28A 1L7EA 3QWAA 5T64A 3GDFA 1PSDA 5A02A 3C1TA 4AJEA 4YT4A 4M89A 4W4TA 1UP7A 2H1SA 4FB5A 1LQUA 3GVHA 4DXHA 4R5HA 4CMEA 4PVDA 4II2A 1CRWG 2ZYDA 3VH1A 4TWRA 4ZRNA 5KNLA 5EERA 5LC1A 1SNYA 1K3TA 1LC3A 2OMEA 3MJVA 4TKMA 4NFHA 3PXXA 4OKNA 3LT1A 3CIFA 1H6AA 3H5NA 3K73O 1DO8A 3HWRA 1CERA 1A72A 4TZKA 4LISA 1RM5A 3F1KA 5F1PA 1QSGA 3DZIA 3H2SA 3DAPA 2R6JA 3M2PA 3E03A 3BMQA 4QO8A 1SMKA 5K6AC 5HRUA 1ADCA 3H3JA 1BVUA 2P91A 1NNUA 5KJCA 1ZXBA 2I65A 4JK3A 2HLPA 5GMOA 4IY1A 2P9CA 3OHSX 5I7EA 1GEEA 1I3MA 3AWDA 1I24A 3AOEA 3RFVA 1U5AA 1LDNA 1PTJA 1LSJA 1HLPA 2VRBA 3LYLA 2AG5A 4Y6RA 3MTGA 4CM6A 3V8BA 2HRZA 3MCVA 4RF3A 5T6BA 1YQDA 3JQAB 1D7OA 1VKOA 2GASA 1A7KA 4TROA 4M49A 1I3KA 1TT7A 4XJSA 5L3ZA 4FFRA 3FSRA 3K31A 1LX6A 4YEDA 2JKVA 2WTBA 4A5OA 1PGPA 1QP8A 4FFOA 3WNVA 4CV2A 2DPGA 4OSOA 3HN2A 4J2HA 5MGBA 3JQ6A 3O38A 4KMSA 4XQCA 4AJIA 5BNTA 4JROA 4LN1A 5JMWA 2CY0A 3IL2A 3M1AA 1P3DA 1YBMA 4MP6A 1CF2O 3DAGA 4WPGA 5JC8A 1Y8RA 3ICCA 2ZB3A 3LF2A 2D5CA 5JSFA 3DWFA 5G0SA 1O6ZA 3WYEA 3GVIA 4E31A 2IZ0A 4IJKA 1U5CA 3PIDA 1AXGA 1PJ3A 1Y81A 4KQXA 2JD1A 3JTMA 5G2OA 3WIEA 3U09A 1NFQA 1YDEA 3B1KA 3WJ7A 5CG2A 5U1PA 4DC1A 5I7FA 2X5JO 3GVPA 1HWYA 3ABIA 1RYDA 3QRWA 4HFNA 4J0EA 5EQDA 5H82A 4WUVA 1N1EA 1JTVA 3SLKA 3UOGA 4P4NA 1VRWA 4F3YA 3FR8A 3DBLB 1SAYA 3EY4A 1MG5A 1YBAA 4ZVVA 2Y1FA 1QYXA 4UVDA 4UUOA 2A9FA 4L75A 4XZ3A 4YJHA 4R3WA 4EYEA 4HADA 4Q9NA 5HTOA 2AXQA 3I3OA 4KDEA 1M67A 5DULA 3WYCA 1V8BA 5COBA 2CUKA 2IEBA 1NM5A 1W0CA 2PZMA 1J0XO 3PDJA 2O3SA 1WZIA 1DPGA 3NDRA 3SVTA 2NTNA 1I3NA 3BHJA 2POQX 3DZHA 3BTSA 4PG7A 4FQ8A 4M1QA 2CVQA 1G1AA 3S55A 4D43A 3KBOA 3NDIA 3RC9A 3PK0A 5C7LO 1Q0QA 3DHYA 3E9NA 1LC0A 1NVGA 4MVJE 5B4TA 1HTBA 3TFQA 2RBEA 1MC5A 3L9XA 3QLJA 3HZZA 3RD5A 4M87A 2HK7A 3GH3A 3PJDA 4W99A 4E3ZA 4E6PA 4B7XA 4QEDA 1VPDA 3ZZNA 3KO8A 1DIAA 2WSBA 4PLCA 4Z9FA 4MIEA 4NIMA 1NVMB 3HSKA 1T1RA 3P19A 1K6JA 1B3RA 1BHSA 1HE5A 1Z82A 2DBZA 4RVDA 5EIOA 1Y5MA 1YB1A 2NADA 3P7MA 3OEYA 2NUAA 3JD4A 3SLGA 2HK9A 1QXSA 4LCEA 2AEMA 1DRUA 2WYUA 4YQZA 4IZHA 4G5HA 4BNXA 1Y5RA 3HFSA 3SC4A 2A4KA 1YS4A 2E49A 2X9GA 3ZWCA 4IPTA 2EWMA 4Q3DA 5KIAA 1NQTA 3EW7A 1ONNA 5JXWA 4KWHA 2BFAA 4WLVA 1C1XB 2FSVA 5DT9A 4EJ0A 5IZCA 4E2ZA 4CMEC 2IODA 3GC6A 4CM4A 1LLQA 1U8XX 3PYLA 3S1LA 3KETA 1HE4A 1S6YA 5I8ZA 4BGEA 1W8DA 2B4RO 1ZNQO 3GG9A 5KCZA 3IP1A 3DZJA 3PFWO 4ZQEA 3U9LA 3IUPA 2BI8A 3LC2O 2BFPA 3HB4X 4OXKA 3WMWA 4F45A 3N7UA 1HKUA 4TRRA 5IAAA 4YRAA 3T4XA 1DAPA 3GUCA 3AI2A 5TLSA 2GCGA 4OQYA 4Y98A 2IYOA 3DC2A 3DEYX 1E6UA 1Q2XA 3LT0A 1O89A 4FIZA 4P4LA 4UVIA 2FY8A 1CJCA 1T2FA 4IUYA 4CM8B 5C7OO 1C3VA 2EIHA 5L4LA 1LNQA 3AOEC 4L73A 3SJUA 4YT2A 3AI1A 4MIYA 1FMCA 1P31A 2X0RA 4B79A 3GPIA 4IDGA 1ONPA 4CMBA 5G0TA 2FZEA 3NT4A 3FWNA 1U4SA 4ZHSA 2VHYA 3JD0A 1VSUA 2X8LA 1D4FA 2D4AA 2UUOA 1DIGA 1IUKA 5EINA 3VPGA 2VWQA 2BGKA 4UVGA 4BNHA 2O3RA 3RUAA 1ZZEA 3CMMA 3S2FA 1EEHA 3WSVA 1AHHA 5T5QA 1A71A 1LEHA 3EC7A 2YJZA 1BWSA 3PZRA 3QSGA 1I32A 3FN4A 3UXYA 3I52A 3RU7A 4BKQA 4BO3A 5T8KA 1ZUD1 2D8AA 4EUEA 1ENPA 3PLRA 4Y67A 3ZI0A 4CR7A 1JQBA 2Q1WA 1MX3A 3UCXA 4MKRA 5F5LA 4BMVA 1ZCJA 1PZFA 1QR6A 3MOIA 1YL7A 2Z1MA 3GFBA 1H9BA 3GZNB 4RLSA 4YYZA 2DQ4A 4MP3A 1Z6ZA 4B8WA 2VT3A 8ADHA 1PU2A 2G17A 3GZ4A 3F5SA 3KLMX 4IXTA 1H5QA 3ROPA 1WVGA 4WLOA 2WD7A 5FI5A 3DFUA 5JYDA 3D0OA 1I5RA 1JWBB 1YBVA 4BMSA 1D3AA 3PLNA 2ZQZA 3W4JA 3D4PA 3ZU5A 2TMDA 2Z1NA 4CLRA 4DQUA 1UZLA 2I3AA 4C4OA 3EVTA 5JAZA 3DAFA 3PFFA 2XPCA 3HN7A 4WE3A 4FGSA 4BNJA 2OP0A 4KTVE 1RWBA 3IC5A 4EITA 4YJGB 3ROQA 3QVOA 3ZDFA 2CZCA 1KEWA 1UR5A 1CETA 3D3WA 3ONEA 1WWKA 3I4FA 3H8VA 2OBNA 1JKFA 3ZWOA 4CUZA 1X7HA 2RCYA 4XYEA 4TRMA 2Q45A 2WYVA 4J1QA 4L9RA 2QQ5A 1YKFA 1PQPA 1HYHA 3VTFA 1GUZA 2PGDA 4AJLA 4OH1A 1C0KA 3JYQA 3H9EO 3BHMA 2PZKA 3HJAA 4ZU3A 3VH3A 4N5LA 3PQFA 9LDBA 2B35A 5IZ4A 3UICA 1EZ4A 3INGA 4S3MA 2JJYA 4XRGA 1DIBA 3RBVA 4U5QA 5T67A 2VHZA 4R1SA 1KOLA 3FNHA 3ST7A 4BNUA 1LSOA 1WPQA 1CDOA 1H94A 3DZBA 3E6AA 1F14A 4RQUA 3L4SO 4DLBA 3NDJA 3VAZA 2I99A 5ITVA 2YW9A 1HDOA 4IJUA 4D79A 3HFGA 5FFFA 1HDYA 3VZPA 1X13A 2DFDA 4A27A 1DB3A 2FWMX 4EEZA 1LDEA 1KY4A 2ZCVA 1BSVA 3AFMA 1RM4A 3NTOA 5L7YA 5ICMA 3QIVA 4IQ0A 4AICA 4K1LA 2EF1A 1Y8RB 5I9NA 2PGJA 1BVRA 3GK3A 4JJFA 4J3FA 1UDBA 4LSMA 3TZKA 4GLOA 1QLJA 4NBVA 3WLEA 1EBFA 3W8FA 5IZCC 2WM3A 1Z7EA 4AJ1A 3RKUA 1U7HA 3OH8A 3Q2IA 4JJGA 3C24A 4PCVA 4AJKA 5CG1A 3AUSA 2VRCD 3PHLA 3ETEA 1O94A 2ZATA 4XYBA 1U3UA 4NR0A 3ZU3A 4XKJA 1MXHA 4RF4A 4BO9A 2PY6A 4RPHA 2AG8A 5JE8A 1FDTA 4KWIA 3L9WA 4DQVA 5TX7A 3WFJA 2I3GA 3WS7A 3MJCA 2GDZA 2X9NA 3QV1A 4AJOA 2G76A 5JCJA 3TRIA 1FDVA 3R3JA 3RKRA 1PJSA 1E7SA 3QJ5A 4GPD1 5L45A 3GVXA 4YAJA 2P5YA 3JQCA 1C1DA 4NFSA 1KEVA 3V2GA 3ZHBA 4B7CA 4XIYA 4BO0A 2FRDA 2Q3EA 3MOGA 1GL3A 2RH4A 3ZH2A 4IDEA 2EP5A 3V2UA 1V3VA 1OC2A 3DBHA 2OL4A 4QFCA 5DOVA 1E3WA 3NEPX 4ZRMA 2F1KA 1G0NA 3IS3A 5A5EA 4BB5A 4YAIA 3JQDA 3Q6IA 5TIIA 5EN4A 3WTBA 2X0JA 1PJ4A 2J5KA 1LA2A 1WW8A 5CPFA 4XGNA 1E7WA 2PKQP 4HKTA 2NNLD 6ADHA 1VM6A 5T8KC 2NU6A 3VDRA 1MP0A 4EZBA 1EDZA 1PS9A 4BO2A 2FR0A 4XYLA 4CLOB 3OJOA 1E7QA 1GQQA 5FEUA 3DL2A 4RCVA 1JWAB 2P9EA 1H9AA 4GWGA 2C5AA 2OBYA 1PIWA 1DHRA 4FSHA 3UF0A 4J1NA 3SC6A 4FR5A 1UXHA 1KVUA 4J9VA 4OOEA 5THQA 3OJLA 4EJMA 5JAMA 3ONFA 3FF4A 4BQRA 3RU9A 4XDZA 2JAHA 2GN8A 5HBRA 3RC1A 2I76A 3AU8A 5KJEA 2GN4A 3C1OA 4ZQGA 2J3IA 4FGWA 3ITKA 1R0LA 4OQZA 3WX0A 4ALLA 5A04A 1UAYA 2W2LA 1YOVA 1MGOA 4A73A 1ZK0A 2NU7A 3S2IA 1X1EA 2DTEA 1T24A 1JN0A 4CM4B 2I6TA 2AQHA 3PHHA 1SOWA 2V6GA 4IDBA 3DHEA 1SPXA 3IMFA 1QV6A 4ITUA 4NU6A 2AQ8A 1QYWA 3MWDB 4UEKA 4YAEA 3I9KA 3NYWA 1R6DA 2EXXA 3HB5X 3AUAA 1WLYA 4BKPA 5TF4A 4H7PA 2B0JA 5IDWA 5JO0A 4QX6A 2VN8A 5ES3A 5IN5A 4RVSA 2Q46A 4BGUA 4R1TA 4YT8A 5AQ1A 2Y1GA 2V65A 1KIFA 3CTMA 4RPJA 2PD4A 4MVJF 1G0OA 3AM5A 3WG9A 1PQUA 2R00A 1I2CA 1YJ8A 4NK5A 3VZSA 4UUNA 2BHLA 5GY7A 4EBFA 1E6EA 4AG3A 1NFRA 3I9NA 3A4VA 3JQGB 1YWGO 2UUPA 4IS3A 4J43A 3FBTA 3TOZA 1QLHA 1T4BA 3UUWA 3SJ7A 2J3KA 1MXFA 1DLIA 1NP3A 2PNFA 4LSWA 1QV7A 3OJ0A 2YFQA 3FRJA 1T2AA 4CL3A 1DIHA 3RAJA 4J90A 2J5QA 1R12A 2X22A 1YE3A 1PGNA 3ASUA 3IUSA 1FK8A 3KSDO 1GY8A 1P74A 1J49A 1PWZA 4RF2A 4Z0TA 1I36A 1W6UA 3PQDA 4BV8A 1AN9A 3VKVA 4BNZA 4CLXA 3L6OO 4ZQHA 2O2SA 5AXAA 4DWVA 4YXFA 5IDYA 3U0BA 3VKUA 3GAFA 1M6HA 5BNFA 2GZ3A 2VT2A 5LDHA 3A14A 4FFNA 1YL5A 4PG5A 4TVOA 2NU9A 3U4HA 1C0IA 4R69A 4MJLA 4XDYA 4RLHA 2PV7A 3M2TA 4G2NA 1N1GA 3AY7A 3AW9A 4FBGA 3ZWNA 1GZ6A 4TVBA 5BQFA 1WDMA 4J1SA 4NDNE 4AVYA 3I23A 5FF9A 2LDBA 3D7LA 4CMKA 3O4RA 4BQPA 3DMTA 3OIFA 1XIVA 1Z45A 5AYVA 2IXBA 2I67A 3AU9A 1KYQA 2WD7B 1B26A 2C5EA 3IKVA 5KWEA 4XD2A 3ZNQA 1R16A 5IFLA 2C7VA 2VHWA 5KVSA 1HYEA 5JLAA 2NU8A 1E7RA 2ZYGA 3HHPA 3GQVA 4BNFA 5JNLA 3OA2A 1ADBA 2Q2QA 4IDFA 4E0BA 1F8FA 1A4IA 4CV1A 4BNVA 2HKIA 2GRAA 1IE3A 4ZD6A 3BYZA 1WDKA 4ZQFA 4BKOA 4ZA2A 3QVXA 1ZSNA 4PN3A 3EUWA 1LDYA 5JDCA 3OEWA 3ON5A 1UZMA 4UEJA 4GL4A 3I9JA 5KKAA 1PR3A 1G6KA 1GZ3A 1EMDA 2AW5A 4Q3CA 5G0VA 4NK4A 2VNAA 5EESA 5HS6A 1ISIA 1U3TA 5B12A 1WDLA 4ALIA 4G81A 4OL9A 1DIRA 2ZJ0A 4GGPA 1B16A 4ID9A 5A03A 4JNKA 2UYYA 1Q7BA 4MVJH 4BHTA 3JQ7B 2PFGA 4QSMA 1RJWA 1SZJG 1QYDA 1LDBA 3INRA 4XYGA 4EUHA 5I9LA 4J7XA 2GZ1A 5U4QA 1ZSYA 4JIGA 3VZQA 3ZW8A 1R66A 3GRPA 3LLSA 5KJFA 5KVVA 4JBIA 5BT9A 1N5DA 2VZ0A 3VPFA 1V3TA 5BR7A 3VDQA 3DZGA 2AMFA 2DFVA 1KVQA 4WNIA 3IDSA 2WYWA 2ZYAA 2YUTA 4GBJA 4TZTA 1PGQA 2V6MA 3BMNB 3L6EA 3ORFA 4FN4A 3ZWYA 3O8QA 4DPMA 4WNCA 1WXDA 2O3UA 4W7IA 4DPKA 2HO5A 3P2YA 4NH4A 5JC1A 3UVEA 4L76A 5ENVA 3WJAA 4BNMA 1LUAA 1NQAO 1BDBA 1NPDA 2R2GA 3ROKA 1KVTA 1GUYA 1Q0HA 3W6UA 1SO8A 4DQXA 5I7VA 3DB2A 1HYGA 4DBVO 3K2BA 4DBZA 1VL6A 4E5YA 2HJRA 2VZ9A 3ZV3A 3JYPA 3AY3A 1HZJA 1IPFA 3ANMA 4A03A 4N5MA 2C2XA 1EDOA 1BXZA 2YV2A 2ZTVA 3DONA 3G1UA 4K6CA 3LF1A 1NFFA 5L51A 3GLQA 1EQ2A 1YONA 4QXMA 2QRJA 3WOHA 4NHEA 5FWNA 3TFOA 4UVEA 1M66A 4WEOA 2Y1DA 5JPIA 3TQHA 3GHYA 4RO0A 1ZW1A 3GT0A 4NQZA 2NM0A 1LI4A 2I9PA 1HSZA 3KRTA 1PS0A 2R00C 4FFLA 5ITWA 4PLHA 5L7WA 2C2YA 3DBRB 3JYNA 5ENDA 1ZK2A 2A94A 2NVBA 4DA9A 1XSEA 1RPNA 4R1NA 1Y9AA 3F3SA 5KKCA 4K9DA 1KS9A 1XR3A 3CZMA 1H6DA 1YDWA 2PZLA 4PVCA 4CM9A 2G5CA 2QW8A 3WQQA 3DBHB 4NBTA 3QVSA 1E3WB 2D0IA 5KJ1A 4YJFA 3AK4A 1YL6A 4IMRA 2DTXA 3GVCA 4RQTA 3I9MA 5DCYA 1C0PA 3V2HA 1O8CA 3G79A 5TJ9A 1DFGA 2FN7A 2J5RA 4J1TA 1OAAA 3PRJA 4LW8A 2PH5A 3WGQA 2FMUA 3HG7A 4AFNA 4K26A 4ZJUA 2Q1TA 5TSDA 1GD1O 1E5LA 1PL7A 4J4BA 3RCBA 1QYVA 4CQMB 2X0NA 3NT2A 1VSVA 4RJTA 1ZH8A 3U4DA 4R1UA 1U2DA 4LMPA 2ZB8A 4D46A 5HS4A 1I8TA 4XJTA 4PLTA 3S8MA 1LSSA 5LDGA 4FJ1A 2Y0CA 4OJNA 3UCEA 2OP1A 4DMLA 1I3LA 3DMTC 4KZPA 1JVSA 2NLOA 4XGKA 3JD3A 2CFCA 2XAAA 5B1YA 1P1JA 4JLWA 3OQBA 5J23A 4GLLA 3KLPX 4NZ9A 4IBOA 4U6QA 3BHIA 2W2KA 2YDXA 1YOVB 3BXXA 4E33A 4CQLB 4CM9D 1CQJA 1JAXA 3D3EA 4HBGA 5F1OA 5LCXA 2Y1EA 3D1LA 5FI3A 3GDOA 4YB8A 3TDKA 1M75A 1E5QA 3IP3A 1WNTA 3RROA 3WQRA 4C7JA 3LK7A 2DUUA 4R41A 4F6CA 1EQUA 3ETGA 4QUKA 4NBUA 3WNQA 3FR7A 3RQSA 4A26A 4ESOA 3RBZA 2WWRA 4FCCA 2NQTA 4D3SA 3BMCB 1TB4A 4DGSA 3ETDA 5L53A 4OAQA 5JDCC 4FDAA 5TGDA 4NJMA 2GF2A 1SBYA 1R37A 3OICA 3U4IA 1E0DA 4QFDA 2C07A 2O3TA 3LT2A 4XQ9A 1PWXA 4DL9A 3GOHA 3F5QA 2O3JA 2EG9A 5IXSA 3A28A 2P4HX 3GA0A 5DCUA 2CSUA 2PR2A 4WKGA 3RUIA 1Y7TA 1LU9A 3DFZA 2CDAA 5L4NA 4TQGA 2FP4A 2F00A 2J6IA 4OXNA 1CIVA 3I5MA 2YQ5A 3E9MA 3AUUA 1EK6A 4LVCA 5TS3A 5JO9A 5CDUA 3KYDB 1PQWA 1Y6JA 2DAPA 3V1UA 5ILOA 3B6ZA 1UJMA 1Q7GA 1ZSVA 3BZUA 4KQWA 4E13A 2VYVA 1EVIA 2X0IA 4L4XA 5G4KA 2GR9A 3RSHA 1E1NA 1KVRA 4N5NA 1EFLA 1DAOA 4IJWA 2HMVA 3ZV5A 2Y66A 2GN9A 1GYRA 2PH3A 2XXJA 4RGBA 3AM4A 3QA9A 4HWKA 4O0LA 4PRLA 3RUFA 1KERA 2OOSA 3ANLA 3W8EA 3PWZA 4BGVA 2X7HA 4G65A 4Z0HO 4PIVA 1T25A 4S1VA 4CM3A 3JD2A 1P45A 3PJFA 2FPPA 2W98A 3OETA 3M1LA 1N9GB 4B4VA 1NR7A 2NQ8A 2UAGA 3KSUA 3VPHA 4D42A 4WOJA 3Q11A 4CMGA 4BKUA 1X7DA 1FDUA 4IS2A 1BXGB 4BNNA 2V6FA 5CEFA 2OFPA 4DREA 1IHYA 2A35A 2OZPA 1TEHA 5A05A 3QE3A 1ZK4A 3GHHA 1VC2A 1U4OA 4BNIA 3D5QA 2VWHA 1SC6A 1XCBA 1MLDA 1B15A 1XA0A 3K8ZA 3UN1A 2NACA 4JBHA 4XR4A 3GFGA 3B20A 1YGYA 1IPEA 1FF9A 1XDWA 5DBFA 2VYVD 1GQYA 1SEPA 1Z7BA 1TLTA 3PDUA 2PA3A 4IQGA 3E1KA 5K9ZA 3G1TA 2C59A 4DRYA 5BNIA 4BUCA 5B4UA 1SCUA 1PJBA 1HDZA 4L0QA 3F4LA 2UDPA 1L1FA 3WLFA 4YA6A 2YHUA 3CZRA 4GH5A 2CF6A 4J7UA 4PLZA 2BF7A 3F9IA 2VUUA 4FC6A
chains in the Genus database with same CATH superfamily
2JJQA 1V5IA 1JTEA 3KE8A 3JALB 4M38A 3NBFA 1P1CA 1ZK3A 2JLQA 1ISSA 1GRCA 2VNKA 2QXYA 2WPDD 4Y2GA 4RY8A 2SKCA 1NI3A 1IB6A 4Z9XA 1P5RA 2I6FA 3G2NA 2BP7B 2HA2A 4XQ0A 4NNPA 1G3RA 4BQQA 3K05A 1TDJA 4HLDA 1BE8A 1XKXA 2AHRA 4BRZA 1ENYA 2YZKA 2R3SA 1WSAA 4I3HA 4LBZA 3U62A 4B4WA 3LGXA 3VR5D 2YJ4A 3RIEA 1IL0A 5G0UA 3UAXA 2XAUA 3IIEA 4F6LA 1X7ZB 2GEUA 1YUMA 2UVDA 3AYXB 3Q2KA 3F7MA 4ZWNA 4TXLA 5A2GA 1TT5A 5THXA 2GXQA 5L40A 4C7MA 4EKEA 4Z7OB 1HKHA 2ESRA 1MO2A 1RAHA 1E64A 3OCVA 4K6FA 4M36A 1XQXA 1LZLA 2AOUB 4V24A 3NIGB 3FTNA 3VC2A 4YUZA 1ZI9A 3QFTA 5JWHA 1FNMA 1W36C 4W5QA 1XWIA 2NXWA 1GTG1 1X1TA 2X4LA 5EFOA 3LH5A 1MNAA 2VRCA 3K0SA 2ZCJA 1WMBA 4YRDA 1QGUA 1Y33E 4CR8A 1IVNA 1MRSA 4EO7A 3KB8A 4F9FA 2JJMA 1U7TA 3FYTA 4WK6A 3BZWA 4WADA 3QE2A 3DW3X 4ZCMA 1NR1A 1OIWA 3DCJA 3O8QB 4EKDA 3UH0A 2HQRA 2FSSA 1GPH1 2HU2A 5DRTA 4FUQA 4CL0A 3C41J 4BX0A 1TFRA 3HYTA 3RUDA 3EZYA 1XVAA 5HSGA 2VTKA 4TLLB 4GT1A 3ZIAA 1BEUB 2DR0A 3IRUA 5TARA 3VR6D 4BFYA 2JG3A 2HB6A 4RY0A 4RJLA 1KETA 3HB0A 3B3AA 4LVUA 1H8HA 4P4SA 3EG9B 2WG0A 1FZTA 1NPTO 1XE3A 2Y0PA 3ZWDA 1T2VA 5FLXA 3KX2A 1C0EA 1AGYA 1TA4A 2CLKB 4EG6A 2XDYA 1WHSA 2VHEA 1Z9BA 4HEQA 2J1LA 1RWOA 3TZQA 3ZDQA 3E7WA 3OHPA 4ZYLA 4CPDA 1FXWF 4ZEXA 3T7KA 3QF4A 3E22B 3EZLA 3P9IA 4DAOA 2W2VA 4KXUA 1C3OB 2CV0A 4LV5B 2H4WA 3ND6A 4ZVPA 4NBWA 4ARBA 5AVSA 1JJVA 2HRRA 1ZGCA 2RKBA 1RM0A 3B78A 2GTIA 1LKZA 3KKLA 2NZWA 3OU7A 2QPTA 4TV9A 4HVCA 4LFAB 2J9RA 1JPNA 1JWLA 5FWYB 4R3UC 2QTGA 3ZDYB 1VLVA 2P2SA 2ODNA 1SKYE 3SZRA 4HGOA 3ZBTA 2JFHA 2QORA 1FEZA 1LCIA 4FW8A 1FUKA 1BE6A 1LTHR 2BFFA 3HCRA 3MJFA 3S44A 1HH4A 2ALJA 1FJHA 2H63A 2QD2A 5EHGA 3K9HA 3V1MA 4C07A 1DEXA 1XP8A 1MAUA 3LPCA 3A1NA 3WZ2A 4ZP1A 1Z5WA 2CJFA 1BMFD 3R3HA 2YWFA 4R81A 2HBYA 4G0ZA 4FSDA 4S2UA 4H27A 4MUXA 1T5DX 3R5KA 2XD4A 4LEIA 2IC5A 4R0NA 5HF9A 3UAOA 1XVVA 2CNWA 1FXUA 4MO2A 3RNLA 3ZDDA 3AXTA 1JHMA 2W2OA 2QX7A 4G4SP 4KO2S 1IAQA 4G26A 1U99A 1WEHA 4I5FA 4OQMA 4F2GA 3WBFA 4OYRA 1TKAA 2HDNB 4PHGA 4RL6A 4UW9A 1OPRA 3SZ3A 4PYKA 1V43A 2PKYX 4DS3A 1DZ3A 3PTAA 2I54A 2EV9A 1BWRA 5K8VA 1QZTA 2IZ1A 1XLWA 3F6BX 5AQEA 5GM1A 3GP3A 2SNIE 2I55A 5IYZA 3DV9A 1I10A 1IH8A 2AI1A 1NMXA 2O50A 3LHFA 3LUAA 4GIBA 2CXNA 2ZREA 1IY0A 1QH8B 3G9TA 2OBLA 1YC2A 1T8PA 2CHQA 2Y6UA 3BGSA 5FOSA 5B6IA 2Y68A 3CEHA 1LBEA 2SCUA 4OMFG 3PD0A 2JGNA 3E18A 5I8WA 1YR2A 4DMMA 1W36B 121PA 3VA7A 3VUEA 4W7HA 3K9QO 4KXYA 4XLZA 4BO8A 1NN1A 2AMLA 4JUBA 1JDJA 1QS0A 4KPUB 5F21A 1SBIA 4BVKA 1NIJA 3KXDA 3PDCA 5E4TA 3RARA 5P21A 1HEYA 1P3Y1 3QLVA 4XOIA 1DC4A 2FFJA 1YGPA 1FS5A 1TK3A 4QQFA 4A7PA 4GRDA 4LXTA 3S1SA 1T1IA 2M6LA 3T5BA 2OA0A 4PSUA 3UW1A 4IFEA 4CFZA 1EFVA 4WASA 4HTFA 5IDQA 3OLYA 3KUUA 2JIDA 2ODAA 4PZPA 4IIUA 5ECGC 4LHSA 3ROEA 3VHRA 3S1AA 1H0KA 3UUEA 4GPEA 4XDHA 1GAJA 4RVNA 5BY2A 5I7OA 4U6NA 1VP3A 2PS1A 2H65A 3CJRA 4EKYA 1WKCA 4Y18A 4FI3C 4CQNA 5JHGB 1DQYA 3DOCA 1ZCZA 4M9XA 5LB2A 3KB2A 2NUAB 3GGPA 1LWNA 1RI3A 2O8EA 1Q17A 3U4CA 1T5OA 3KJIA 1YCFA 2O9JA 1GFWA 4OHKA 3TIGA 3QFRA 4CF7A 1RPTA 1X1RA 4JJ8A 3FSJX 3FYHA 3OM0A 4G0NA 1V1RA 4X84A 4HNAB 1ZJWA 5JSUA 2HF2A 3C39A 2YZ7A 5IKMA 3WGIA 4C88A 3Q1LA 4V3BA 2G1UA 3O3NB 2B4YA 1Z4LA 1V48A 3OPVA 5F35A 3T34A 4RE5A 1ISPA 1JIJA 4RPGA 4XSVA 1VE5A 1T8YA 2IK8A 2Y1KA 4INJA 5EWJB 5FNZA 5HCIA 1AMUA 2D7CA 2DC1A 2AXNA 3I73A 1Q14A 3C8HA 1UXOA 2DE0X 4Q3BA 3UEOA 6GPBA 1JLKA 1OI4A 3BTUA 1UPXA 2IEAA 1ARZA 4RADA 4RV5A 5H7XA 3V4LA 2H1WA 3P5SA 1UIRA 2R60A 1CB0A 3FMGA 4JNCA 3ZNNA 3M5DA 2IV2X 4BX9A 3G8CA 4OK6A 1RI2A 3HXPA 4M1WA 4XOUA 2EKPA 2WSYB 2H9YA 2Z6VA 1G63A 3U4GA 4YAGA 2X7JA 3A1FA 3M34A 2FMFA 3FHJA 2VBFA 5JMPA 1F4VA 3BUSA 2WHPB 1FPMA 4JENA 4Q24A 4A0RA 2C5HA 3VVCA 2ZIVB 4QTXA 4NNOA 2QYTA 4PBTA 1I7DA 5FUXA 5AI6A 1S02A 1YV9A 2I6QA 1IATA 3KYCA 3G85A 2XB6A 4C4SA 4M1MA 1KVSA 1DV1A 3MILA 4F3NA 2HJGA 3GR6A 3AUYA 3W5JA 5EJ8A 3BWYA 2R1UA 4GNRA 3TW8A 1YIOA 3UMMA 2QUZA 5FI1B 5BV7A 3CMCO 3MF4A 3H87A 2G4CA 1EA7A 1GQFA 3EGDB 5EHZA 3AM1A 4RK1A 3PE3A 2ZYRA 4MRPA 4P2GA 4R9RA 5AUOB 4E5PA 1G59A 3B13B 1UAGA 2O2XA 1YJQA 2VNIA 1PEDA 1GKLA 1XD2B 3C3YA 4YRCA 3SEQA 2WV9A 3ED5A 3EXAA 2IDZA 3VSCA 3LDHA 1SCKA 1LWOA 2PTGA 1CS0A 3MG9A 4QBKA 3BMOA 4WOBA 3FUTA 5CYPA 3TW4A 1QZXA 3IKLA 4ND8B 5C51B 2QUHA 2B5OA 4FYHA 5IP5A 5KNCA 1Z47A 3BL5A 4WJLA 1QU3A 4F04A 2VJBA 4AULA 5F51A 2X0EA 4B0OA 1G66A 3OJFA 3L8EA 4LJKA 3U5ZB 1CJTC 4JYCA 1PW5A 4LFCB 4RJ2A 4YUVA 2BMDA 4HV4A 3AW8A 5L3RA 5KJCA 2PL1A 1DKLA 4NBSA 1J70A 1NV8A 3L8CA 5JS6A 5FQOA 1YHYA 1C9NA 1EP2B 1I7LA 1NYQA 4OLHA 1LDMA 4PZEA 5H81A 3TN7A 3ZCRA 5K2OA 4NPAA 3HVRA 3BD6A 3A06A 3D8UA 4J4HA 3DDZX 4HNTA 2FX2A 3LOPA 1FYVA 3K9LA 4UUMA 2UYOA 3GLIA 3ABRB 2Q27A 1WPXA 5DMHA 2BE7A 3B38A 3DMYA 1TQ6A 4MUGA 4CM8A 5HX7A 4KIWA 4LGYA 4MYUA 3V8EA 4R2XA 1WBJB 2NPIA 3U3MA 3UA4A 2YMMA 3LQFA 4NYMR 1K8RA 3BB4A 2OR3A 4MP8A 3MBOA 3GJZA 4BNKA 2OGUA 5LP6F 2P62A 5EXEA 3WGLA 1MFPA 4V1CB 2HX1A 4MITA 1L7DA 4Y2VA 2COEA 1W5FA 2I5PO 3NWOA 2DEUA 3PFIA 4O3FA 3WIOA 4CIAA 2WZCA 5L9AA 2P2NA 3JXEA 5AJYA 3QOYA 2CLCX 2B7LA 2VHXA 3OPNA 3R8XA 4OK5A 4JP3A 2GXAA 4H59A 1NKSA 1Y3DE 3V6MA 3ANYB 1SBNE 1BHJA 4JOCA 4DIFA 3L4BA 1HRDA 5HM8A 4L95C 2QZZA 3EYWA 2YQZA 3HVHA 4LRSB 4K2AA 3HYSA 1YQXA 2DZDA 4KTTE 4M0FA 4MUNA 4W1QA 3TVDA 7MDHA 4W8GA 3VSAA 3WJ2A 1AN0A 3ENNA 1QJCA 5HE8A 1R6TA 2VTEA 3M6AA 3MWYW 4ME6A 1YRLA 1A2OA 3N5KA 4XGIA 4CGYA 1PT7A 3PPIA 4LOLA 5EE9A 1NJSA 1VXRA 3CEAA 2AQKA 3MHTA 3WV5A 1BS1A 4ZMSA 1GL6A 1TUEA 4HFJA 1XL1A 5LPNA 1UKEA 3KOZA 3BXEA 2Q3JA 3KEQA 4J7CA 2Q6VA 3SSMA 4ZIRA 2XUGA 2YFHA 1W581 1T6NA 1W4ZA 1UKVY 2GETA 4M21A 1GP2A 1OWLA 3CONA 1NVAA 3JU3A 5TJHA 2IPAB 1B1CA 3R77A 4IG9A 3MPUA 1WUIS 3I42A 1MKYA 2YHBA 4HYQA 3EBLA 5JALA 3FIJA 1Z88A 2J7KA 3S68A 2G07A 2PRIA 1KFKB 4IHKA 1DCKA 4JQOA 3JY6A 9GPBA 1DPFA 5JAUA 3ZVNA 4MV6A 1G8MA 4WVFA 4HB4A 2I3BA 4IUBS 4EGJA 9ABPA 3E48A 5BO5A 4MCAA 1SU7A 3GRAA 4LY0A 1XTTA 2OZVA 4KUEA 3KM0A 5DHFA 5DRYA 3ESDA 3MJEA 3N74A 5T3UA 1G1MA 5IHPA 3H9QA 2OB1A 1G98A 2J9YB 4YRSA 2KHZA 3ZGVA 4ZICA 3HU5A 1V47A 2ZAOA 4EYQA 4HK4A 3H6GA 4ARAA 4F4FA 1Z2DA 2ENWA 5KQPA 5LU9A 1GL7A 4X65B 1IPHA 5K03A 5C32A 4LXQA 1BDMA 4UMDA 3TAUA 3GG2A 1PRYA 2J8ZA 2W90A 5EE5B 4IH1A 1AUQA 5IK2A 2IYPA 5AVRA 3U81A 2BFDA 4XIGS 2UVQA 1DJNA 1OGYA 1AJEA 3IQZA 3PIIA 3ZCUA 1VLJA 4PFQA 1MAVA 4EW6A 4OU5A 1JDSA 1L8QA 1Y3HA 4OA5A 3JARA 2GEJA 3QF4B 4JT4A 1X1BA 5T57A 4RTKA 1K08A 4BIIA 4KUGA 2W6CX 2OCAA 3Q0EA 1SK8A 5B37A 5CVTA 1F8GA 3NJ4A 5FWXA 3V46A 4PRKA 4Y6GB 1G2QA 3ENQA 3IHWA 3WWOA 4R71A 4Q9LA 5CEEA 5JZ9A 1NJ5A 3UGTA 3QNMA 2HA3A 4F8YA 1IXYA 2ZSBA 4IXMA 4AMGA 3C3KA 3GRFA 3KQKA 5CFOA 1ULHA 4I36A 1U1IA 2W4IA 3D6HA 1R8YA 3BF8A 3GT7A 3LBHA 4US0R 4DEYA 1PT5A 2BFFB 3AEZA 4AF8A 4YPVA 4RVOA 2ADOA 2XDQB 2C96A 2IHKA 3WK9A 1I4LD 1ZUWA 1A7AA 1Y3CE 2QRMA 4KVGA 1EM6A 2VF2A 4U9UA 4ZVSA 3CX7A 3C7KA 3NKLA 3ER8A 4BJ1A 3WDLA 3OQ6A 4RF5A 3N6VA 3E3AA 3MTIA 5AVWA 5CMLA 1R50A 3KU4A 3P9PA 4JMLA 5F2KA 3OTGA 5FPYA 5T4EA 3OP4A 2W4MA 4ZTZB 3C7AA 2HIMA 4L3VA 2B37A 1DRVA 1YFLA 1RPZA 3QKTA 4A6PA 1XZDA 5H4GA 4FYPA 2IEGA 3WMXA 1L7NA 2G08A 2HU8A 2XTAA 4LWPA 2WF7A 1GNLA 4GX0A 4HQRA 5H1YA 1ISFA 1ODJA 1FS4A 3C3AA 4AF6A 3ZQUA 3L7LA 2LIPA 3EFBA 4B7AA 1NBOA 2ZDGA 3JVDA 4M3NA 5DNDA 2BONA 1WR8A 2QN2A 2VK2A 4PZCA 5IYZB 3NFYA 4PHTA 1NZFA 2NG1A 5C5EA 4I1VA 1ZIOA 4WESA 1JW9B 5C4MA 1JR3E 4DLVA 3CE6A 4C4TA 2IBSA 1B42A 1V39A 2VYND 3MS2A 1CR2A 3KFXA 4G1FA 4N03A 5BW6B 4XSHA 5F76A 3SKYA 4YAUA 1G4AE 4KACA 3WLJA 3AI7A 1N8KA 1QS0B 2F90A 4WCVA 2GPBA 3CGGA 4WLUA 3M8KA 1VLLA 2PYIA 1RHRA 2Z6AA 1BXKA 1BZYA 5ECDA 1M2HA 2XVMA 4RTOA 2I2CA 1EFVB 3GMDA 3KSBC 3H5RA 4YRBA 2EBFX 3B89A 1JSZA 4GI2A 3QQPA 1BG6A 3CO0S 4Q39A 5IJZA 1RAFA 3RJ9A 2JPDA 5DYWA 5K5EA 4HDSA 3R7AA 1JU3A 2M98A 4AY6A 1GITA 2FSPA 3BBPA 3CS3A 3OD5A 3P2KA 3FLEA 5JXGA 3U44A 2D3TA 1YB5A 2ADMA 4N7RA 3TO5A 3LQYA 3ZTWA 4LXGA 4P6VF 1Q0ZA 5AHXA 3JD1A 3IJPA 4KR7A 3P9QA 4GKBA 4ER0A 4MWZA 2HA4A 1V2HE 3I6IA 5DHPA 5FL7A 5KTPA 2D62A 5IWAB 5IDVA 1NF2A 1KTVA 1VHLA 4CG2A 3EPRA 4H1HA 1S9HA 1RWMA 1V1RB 5B3AA 2VQEB 2YY7A 3HRIA 3PTLA 4L7VA 4GKJB 1EWYA 2HSWA 1XMXA 3NP7A 4PTYA 5KTTA 5I3CA 1UJCA 2DLDA 3WYNA 3AR7A 2VOEA 2WDZA 3B3FA 4KG7A 3HNPA 4KYTA 5LQKA 1KEPA 4EHKA 1CZRA 4EUNA 1PGOA 3L4BC 3GUYA 4D8UA 1T0PA 1EVYA 5JZOA 4EJ6A 2I87A 3WGZA 3VH2A 4CLDA 5KWIA 1CJUC 4UNRA 2BFMA 2GT1A 5BW8A 2BSQA 1JYFA 1P7CA 1CSEE 2VR1A 3L7NA 4BLUA 1S7CA 2X2FA 5EIAA 2J5XA 3NALA 5H70A 1K6MA 2OZKA 5DK4A 2IYRA 4M54A 4DN6A 1B8PA 3O26A 1C30B 2QX4A 3ZH9B 3MJTA 3FTDA 2FZCA 4YO8A 2CVHA 3C48A 4I1RA 4EVRA 1WV1A 4UAJA 5CT4A 3R7BA 4F9GA 3WTCA 3DNMA 3TQTA 3FYSA 4HF7A 1X0VA 4RKWA 4NMWA 1RSZA 3KYCB 4QOSA 2GHQA 4X62B 2HMAA 4Y9RA 2WK1A 2I3DA 2JD2A 5AK6A 2ZZKA 1N5JA 2QW0X 1FVOA 3NH6A 4Y2JA 4PO1A 4MUMA 4YALA 2RARA 2H11A 5HA5A 2ZJBA 4DUGD 2EHDA 4EDFA 1XI2A 4QARA 3T7EA 4OIMA 1D4ZA 2JFGA 3LVFO 4KGXA 1G2OA 1JEEA 2Q6IA 4HD8A 4HGQA 4B46A 3NVAA 4V0QA 1QRUA 2VCEA 1W9MA 2QYHA 3GT4A 3FI9A 4MVJA 4E15A 1NG1A 3BMOB 1WY7A 2VSOA 3N3BC 1VIVA 1GSOA 3PUXA 1LXCA 1ODTC 1GN9A 4L74A 4WFIA 5D87A 3WLHA 1FW6A 4JLMA 3GLGA 3MWDA 1VG9B 2DH6A 1KFBB 5AK5A 3I9LA 1PR5A 2EW8A 3P0HA 2QD4A 4EPWA 1EUCA 3K6RA 3QU2A 3V9AA 4JLNA 3AYZB 3U3ZA 3LX8A 4Q1FA 4IWNA 1BGVA 3PS9A 4I4LA 2VPIA 5ILGA 1T0IA 2AFHE 3GGDA 5FUMA 5HIAA 2BM9A 2QGFA 1S2LA 4JASB 1ZIDA 1P2UA 2CLSA 5A7FA 3FCOA 1SXQA 3IUQA 4P33A 3PPYA 2RGWA 4A92A 4FILA 3GLIB 3U4QA 1EBUA 3D7MA 1FRQA 1X80A 3ZW9A 2YZGA 3HUDA 3TSWA 3MT0A 4L8GA 4Y2HA 3ZGYA 3MOSA 3QU9A 3WP1B 2QR3A 3TQQA 3F73A 1IUPA 2REQA 4OXQA 4AIRA 1LLCA 2B83A 3A58B 3EZNA 2JHGA 4BV9A 5B7GA 1Z6PA 3W9SA 3MXOA 3LUCA 1BMDA 4TMVA 1R0SA 1ATZA 2AYZA 3LL7A 1MW8X 3C3XA 3LGSA 2EZ8A 2MOKA 3QLTA 4JH0A 4W82A 2F1HA 1DFHA 1P19A 3A6DA 5DP1A 1FC0A 1MBZA 2BJVA 2X86A 3C7TA 4KQIA 1ZQ9A 3U1VA 2IE0A 3LX6A 2Q4OA 1E3LA 1INLA 3PU6A 2GNOA 3CVYA 3X1JA 1K9VF 3NR2A 2Z9DA 1OZFA 3FWZA 4FONA 3TRJA 4MUAA 2G28A 2ZRQA 3TLZA 2CNKA 3FOEC 1H1TA 2WQ7A 4ZTUB 5LUBA 3HJFA 1UMBA 4DUPA 4M8KA 1QZZA 4MVJM 2P6OA 5BSRA 3TJRA 2NQ2C 3GLUA 2D54A 4EA9A 3SFTA 1A0OA 1JYEA 3IMEA 4FYXA 1GKYA 3FD8A 4NBNA 4ZIRB 1HETA 2GQ0A 5FAXA 1RD4A 3NDPA 2J0EA 1E3IA 4GM0A 3CNNA 4MWOA 4K9KA 1GDHA 3U4AA 5JNUA 2OCIA 3UMRA 2IHZA 3EGOA 4QUEA 5EE0A 1TZMA 4WA8A 2VH2A 5CITA 1GTVA 2GVDC 4MDEA 4RTQA 7REQA 3U7RA 2ECQA 2CDNA 1I14A 2C4VA 4LX8A 4R16A 1U0NA 5EIXA 1M73E 1TK2A 1W59A 1VPTA 2XITA 1PLLA 1UANA 3K9GA 3COPA 1GG5A 3EDCA 4CT0A 4OK3A 4MCHA 1TAGA 1UH5A 5EG5A 1IN8A 1AKWA 2F3PA 2PX5A 3A2NA 3F3YA 3OE1A 5TY0A 1OI3A 3OIDA 4XJVA 4ND1A 1QMPA 1X8XA 3EWAA 5JXIA 4O4LF 3K20A 4REOA 4Q3OA 4B47A 1EK1A 1T5TA 4HLUA 5AJHA 1N3BA 1I4TD 4ND3A 3T9BA 2C31A 4RWZA 1L8AA 1UKYA 4LRUA 2QLNA 4OP2A 4X3PA 4QLBA 1KPGA 2CXSA 1SQ0A 4Q4AA 4ZHQA 5D86A 2EF0A 4KR0A 2RHMA 4R5MA 3P8ZA 1P91A 4J0HA 3E53A 2E4XA 3CRZA 4H0FA 4MRVA 4UD6A 2HGZA 3C3WA 2DRIA 4JXJA 2RK3A 1CWUA 1XTRA 4X85A 1YE5A 4UUBA 3WL5A 3RFTA 2UXDB 2HQOA 4I55F 2H31A 3IVMA 2BFDB 2PT9A 2Q4RA 3NOXA 4RK0A 1T8UA 3RFXA 1XWWA 1TCCA 2EBUA 16PKA 3EMBA 1K27A 3IERA 4K5QA 4QTZA 3JARB 4DIOA 4BDTA 4F96A 4XD7A 2Y1LA 4KB5A 1UFQA 3JAMA 1BFKA 5K0ZA 1G42A 2MR6A 5LQJA 1YRAA 3T3HA 2Q5QA 3IELA 3PC7A 3O90A 4EUFA 1UEXC 5FWXB 1OBVA 1U9JA 4MV4A 1ZM3A 4PCAA 5CAEA 5BYJA 3AP3A 4RYLA 1GFSA 4MTCA 1CVIA 1CT9A 2P0YA 2G9NA 3CQ9A 4B43A 3HM9A 4KDFA 2PNJA 2O8BA 4EOGA 3A6KA 4D99A 1ULSA 1E2MA 3NTRA 1BD4A 1DC8A 2OCYC 1JDPA 3GOQA 3KWFA 2A57A 7GPBA 3E81A 1I7QB 1ACJA 2VRWA 1K5HA 4S1PA 4M1YA 3ZS9A 1US8A 2MJLA 3SJBA 1U2GA 3P94A 4FDTA 1ADFA 3FPCA 1T0HB 1QK4A 3NVMB 5B1HA 3S2YA 2G77B 3O9ZA 3R0IA 1QIGA 1RS0A 2A0KA 2ZJAA 3PGVA 1PW7A 3DGFC 1CE8A 2H4JA 3I0ZA 3A31A 4BMPB 4DUYB 1GFZA 1A98A 1OR8A 4OQQA 4X71A 3RG8A 2FK7A 3WNDA 4CCYA 2GYUA 2Q7OE 1NLMA 2Q1SA 2WFAA 4HN9A 1BWQA 1XU7A 2OO5A 5KOHA 4NAVA 4DV7B 1WF3A 1GYQA 4RKRA 4YV7A 2XYPA 2W6JD 2DQSA 4FOOA 5TF0A 4TXMA 1ZJZA 3HZHA 2IEDA 1MIOB 5CHYA 5ED4A 2A1UA 4EDHA 3M4JA 4ON9A 2JAQA 1REQA 1W4LA 2PX4A 3FLAA 1K7FB 1FVXA 2BC9A 1O0SA 1HLFA 2QVGA 2WRZA 4M83A 4YJFB 4YMWA 4UZEA 5FJJA 4C5BA 1WOMA 1RVDA 1W75A 3BWDD 3G49A 2I7CA 4AUNA 2OYRA 3UV6A 2C1EA 1U9CA 4TMFA 1P17A 2C04A 2HTEA 4N0EA 4ZT6A 3RUPA 2PBZA 4JC0A 3F2VA 2Y1CA 1HL3A 4JZYA 3PF8A 5CDFA 3FRHA 2F4NA 2IF0A 1XBTA 2MYNA 3GPDG 1Z18A 3FMVA 2K5UA 4EGFA 3DL4A 5FBWB 4Z3KA 1RPJA 3ICVA 4KXNA 2J3HA 4OHBA 3UMGA 1A8PA 1NRXA 4LRTB 1Q3HA 2FEMA 4P92A 2OCXA 4E1VA 1K75A 4EW1A 4JY7A 4Y1GA 1JVNA 2FZVA 4HDSB 4GZ6A 1BMQA 5EP3A 2WIJA 5JRZA 3Q7SA 4WN9B 3U44B 3DBRA 4GXNA 4CMCA 5HIMA 2PLNA 2R1TA 4L3OA 3RYFA 1SA0A 3T9CA 4FXOA 4RGVA 4OHCA 4RVHA 5BSMA 1E66A 1FTSA 4F5ZA 3COSA 1L7AA 4FCWA 3UH1A 3OQHA 3ZV4A 3KJGA 2BBSA 3M6VA 4HWGA 2IVFA 5I48A 1GCOA 3KZ1E 1U9YA 3OCCA 5CH8A 1L5FA 2XQIA 1F6BA 4WZZA 1TLFA 1QR2A 4FT4A 5DNAA 5DVZA 3UENA 5EHXA 2FW7A 3FTPA 3CVWA 3M4YA 3TLKA 3SXJA 1YRYE 1WPGA 1ZDMA 3WWYA 1NXOA 3ABZA 1V5FA 3M4NA 2ACKA 2D13A 2GN0A 2PQ6A 4G4SO 2PUAA 1VBNA 4KR9A 4LRWA 4M0MA 4RVSA 5H16A 4DIBA 5LQMA 1OH6A 2GPTA 3PRKE 3BXOA 5IM4F 3GN2A 3ZCQA 4PNPA 2JFFA 3IVXA 4W1SA 5E4JA 3JATA 3QWHA 1KA9H 1QK5A 1X42A 4ONEA 1OFHA 1V6AA 1OAOA 2ZZNA 4PLFA 3H5VA 2J45A 2AA3A 2OZLA 4KODA 3T99A 5CA1A 4Y2TA 1PVDA 1MPXA 4B1FA 3BQ9A 2LNDA 3O0DA 3N58A 3RGGA 1OFVA 2IP4A 2E6KA 3EDYA 1XQWA 2HWYA 1WVIA 5DSZA 2YBDA 5C8ZA 1LBTA 1L6RA 4FN5A 2WM8A 1UPTA 4I1PA 2HSDA 2X6RA 1NQUA 4AZVA 5HKKA 2BMEA 2COUA 5NLLA 5JCJD 4X7RA 1X38A 5JZVA 4JBGA 3P9RA 3LP5A 3PSHA 2YC4C 3ULKA 1C9JA 1BA2A 2GD1O 1YZ3A 3BGVA 3EIHA 4EGCB 1A4RA 3JZAA 1SCBA 2EFYA 4BLPA 2FV8A 1L5RA 3PWSA 2EDCA 4RZ3A 2C2GA 3TEFA 4BFTA 3AGQA 3AHFA 3SBEA 3M6WA 3WB0A 4NCIA 4XDGA 3SSNA 2I6SA 2XMGA 2FG5A 2GH1A 3IPRA 5SZHB 2EKQA 5JY6A 5M04A 3W5DA 4RV4A 4BNYA 3S8YA 1V8ZA 2V7QD 3ACDA 4PZYA 3TRFA 5BMVB 2FP3A 3BWEA 5ALSA 1IONA 1J09A 1OKKD 1XU9A 4BO4A 3IAM1 3T3NA 3BFPA 4HLUC 1C81A 2QJTA 1T35A 3IODA 2Z4RA 3AB8A 3UIEA 5EMHA 4CTNA 1IIBA 4LNAA 1T2CA 2IF2A 3JSAA 2E82A 4QOGA 4QVIA 2RIPA 2GAIA 5DV9A 3G9QA 5G4KB 5J43A 2WT9A 1FFSA 4YCNA 4M8NE 2IHBA 4FWIB 5TT0A 2PAAA 1NGSA 1CP2A 2VK8A 2WIGA 4G5RA 1YZKA 2IDKA 4L02A 3D02A 4RXMA 2M9MA 3MJ4A 4TLAA 1JXMA 5EMJA 1TM2A 3D4NA 1C2YA 3WGGA 1RZ3A 2GBLA 1X7GA 2PXCA 1P4RA 1PJTA 5J9FA 6AT1A 4JQYA 1HNZB 2O2GA 2HLNA 5A4AA 2B98A 1B76A 3L1KA 4RYDA 4P80A 1OB2A 3OVMA 1U8FO 3HADA 4ND2A 2O2CA 2OSVA 4HDCA 1F0NA 1SUSA 4F46A 1YXMA 3IAS1 4ZI7A 1BD3A 2FLVA 2BFOA 4CV3A 3U4QB 4WHMA 3H6HA 3O91A 1WMDA 2C03A 2FPPB 2QHXA 2BUAA 3KXLA 1GWNA 4G8JA 2Y92A 2AV6A 1RLUA 2AHOA 2WIKA 1Z4JA 2QE7A 4HYEA 5CGQB 3X2FA 4D97A 4NCHA 4E32A 1X92A 2REQB 3QTBA 5DIFA 3SOPA 3FPFA 3EPPA 3B1VA 4LTNA 3UXEA 4E21A 1YJ5A 1I4OA 4GAEA 4J4TA 1VI5A 1RXIA 4GBED 3AF0A 4GFDA 4IGEA 2QUIA 4I5IA 3E9EA 1B14A 4NBKA 3WA6A 1A50B 3MEQA 4U8GA 4K05A 3K9NA 3EDMA 4EVSA 1IXZA 2PYDA 1XRPA 2BGIA 3AZOA 1SC3A 4B6QA 1OB5A 4FWBA 4JL5A 3IR5A 1AKTA 1VB3A 2JFUA 4C0LA 2IXEA 1P62B 2VEDA 3C3CA 5BN4B 2V7EA 4BGIA 4OHZA 1O08A 2B21A 3OEHA 4L4RA 1W85A 1UMBB 3RV4A 4O63O 5MGNA 2IXDA 2P9TA 3L1IA 4X1YA 4B3IA 7MHTA 3DTVD 4B84A 1NUPA 3GBPA 4UAUA 2AJBA 2OO5C 3CZ4A 4PQYA 1SULA 1U90A 4KFCA 3ZGZA 3QMVA 1J2YA 1K7YA 3P2JA 4FI3F 1ORRA 1EXVA 4CMHA 1OA0A 2BH9A 1LVGA 2FNAA 4D25A 1QGYA 4XGRA 2B1IA 4IEFB 5F4BA 5LZ5A 2C8LA 3O8CA 5EWMA 2B4TO 2B0CA 3W5AA 1D2RA 2WJPA 2QTNA 1GV1A 3EFOA 4HNSA 5DW3A 3GDWA 3L02A 3WSWA 4F3CA 3HWSA 2AC4A 2O52A 3EIFA 1GJRA 3EF0A 4B5KA 2CLLB 1Q0TA 4TX1A 2XCSB 1DZIA 2WP0A 3GZNA 1ZYUA 1GDDA 3UC5A 4DDMA 1M9NA 1TGYA 1MVOA 2C00A 2FFRA 3OBBA 4G0QA 5DTEA 1ZKMA 4HVTA 2QM7A 3HA3A 3UG7A 1J5XA 3FPGA 1YBFA 4BEWA 2V3CC 2F1OA 3G9ZA 3QPCA 4RH0A 1P33A 1Z7WA 1W0JA 1R0YA 1DTSA 4L5AA 5IFKA 4Q4AB 5SZIA 2VYCA 4II3A 4Q15A 4DB2A 1ZVVA 2X15A 3S7ZA 1M34E 4KHPB 1RTKA 1M6WA 5JI2E 2CFRA 3BG5A 2I4RA 1L7EA 2AKEA 1KY2A 1CFZA 2R87A 3C6XA 4AJEA 1BYUA 2V03A 2FG7C 4L6IA 4H6VA 3P5BA 4JQSA 4Y2SA 2H1SA 3BFKA 3MTAA 4O29A 2LCQA 3RW9A 2YRXA 1M1UA 3CVOA 4HDAA 1PDWA 4DXHA 5KTOA 2BFCB 4IDPA 3F9CA 3JZIA 4II2A 4CMEA 1MF7A 2GVNA 2ATCA 3B48A 5FHRA 1OT5A 2NAFA 5EERA 3COJA 4MIKA 1QGZA 1TPYA 2OMEA 4MULA 3STTA 4B7ZA 4QYIA 2G1KA 1P2BA 5J2TA 5CAEB 3FDXA 1LTKA 2HLHA 3CIOA 3LT1A 1OWOA 3CIFA 3H5NA 4DKJA 1X3LA 4FX5A 1YI8A 5AHOA 1FX0B 2JDIA 4PYOA 1CERA 4I4IA 3V7FA 1A72A 1RP1A 3FOCA 4LISA 4EK9A 3RS5A 5ALPA 4DV4B 1QSGA 5E3JA 3DZIA 3N2GA 3N2KB 4N9QA 3M2PA 4H7IA 1OAOC 3E03A 3KQPA 4QO8A 1SMKA 3JWJA 2WFLB 4XWGA 5K6AC 1ODCA 4FX2A 3AL2A 1BVUA 1QB7A 4B3CA 1JIKA 2CLEB 1ZJJA 4NPHA 1XZIA 2A0YA 2I65A 4DCGA 2DKFA 2LR0A 1SXPA 1U31A 2QMQA 1I3MA 2EFHB 4G8BA 3AOEA 3QMMA 3HB7A 3OIVA 3ABSB 4GS5A 3ZVRA 4EIWA 1ELOA 1HLPA 2AG5A 2VZEA 1CE8B 4LYEA 3A11A 3D7RA 1G3UA 4O25A 2QY6A 3M82A 4RY9A 4W8HA 4MWBA 3RFCA 4Q7MB 4HHEA 2GASA 2ZWOA 3FYCA 4P3PA 3CJQA 5HTKA 3UNXA 2ZUSA 5L3ZA 4N82A 5JH7B 2X0FA 4YI5A 1MMFB 1ZICA 4GU5A 5ES3A 4KJXA 4IMIB 4TV9F 2WTBA 4KFUA 4YEDA 5HZMA 1PGPA 2DKOA 2C95A 3AV3A 3WNVA 2ID4A 1N6PA 4J2HA 1N77A 2C78A 2A1UB 4J0JA 1SXJA 3SNHA 4EATA 2Q5HA 1REQB 5BR4A 2ZYWX 1UWCA 2YRWA 2VP4A 4LN1A 4OGKA 2H7CA 1P39A 2CY0A 4E08A 5AIAA 5K3EA 5J2UF 1P3DA 3IEUA 5AJVB 4E51A 5HRAA 3PXEA 3LCCA 3R3ZA 3DAGA 4URYR 1Y8RA 2QLJA 3T7IA 2A58A 2ZB3A 2XOKD 3IDOA 2GBLC 2HEGA 3DWFA 3LF2A 4PINA 3ZCSA 1Y42X 3NYIA 5HF5A 3ADBA 3MW8A 4E31A 3TAHA 4TTRA 3WKAA 4Y7CA 4HAOA 1YU9A 4IJKA 1U5CA 3PIDA 1AXGA 1TRKA 4OF4A 4UHJA 1DX6A 4B2PA 3CLRD 3DA8A 3OP1A 1ML4A 4N5IX 4LI3X 4HR7A 3U09A 3KSAC 3NXKA 1NF9A 1NFQA 1YDEA 5HRUA 3QPDA 3EIQA 2ERCA 3NONA 1OHHD 4OUKX 1W8IA 5AOAA 2AOVA 2R1TB 3R76A 2VZLA 3I34X 721PA 4NG4A 4NXNB 4Z4GA 4J0EA 5LM3A 4W5OA 1Q11A 3T9EA 4WUVA 1NNEA 1N1EA 1VPEA 1JTVA 1FVFA 1FTQA 2ZUVA 4P4NA 3SLKA 3TMAA 1DBRA 3LCUA 2JLCA 3WLSA 4MV8A 1SAYA 1YBAA 2NUBA 4UVDA 4E11A 4R3WA 4QQ8A 2YJ5A 4HADA 4DWWA 5HTOA 4QPJC 5A1JA 2IHUA 4KDEA 5DULA 4IHQA 2CK3D 5B2EA 1C9YA 2W0MA 4XM0A 1CQPA 1JF8A 1V8BA 5COBA 2JJ2D 2XUAA 3R5FA 1AX9A 1NM5A 3E3MA 3PDJA 1ZD5A 2AT1A 3ANTA 5FI0B 5HKAA 4Z4HA 1SVMA 2IEZA 3JATB 3KBBA 4GMXA 5BVGB 1NNI1 4DEVA 3ZK7A 3BHJA 3LUHA 2ST1A 3BTSA 5IARA 2OZLB 3KALA 2JLVA 1AQUA 1G1AA 3ELDA 5J1SB 4CKWA 2YOGA 1NI4B 2WTEA 1DINA 1ZD9A 4H1WA 2OQ2A 3RC9A 1R8QA 3B2QA 4RS4A 3WLTA 1KAHA 2WF8A 4EUSA 1E0KA 1GCIA 5BMOA 2Q5IA 2QTTA 1WCXA 3L9XA 2IYVA 1WW3A 1K5GA 4NATA 3S81A 4DMRA 4M87A 1DWQA 3O4GA 3H5WA 1QZ3A 2ZI6A 2CMFA 2Q3FA 3EFHA 3KO8A 1Z4MA 2HXYA 4PLCA 3NEYA 4QEDA 5KPDA 1UZUA 4ZCLA 4MIEA 3RQIA 3NGMA 3HSKA 4CYMA 4RVDA 3P19A 1HGXA 1K6JA 2WZBA 5AD1A 4BXOA 5B1IA 1R1DA 2IUEA 4UARA 1T9DA 3DEJA 4BMOB 4U7JA 5AW0A 1JXOA 2VNJA 1EAYA 1J8DA 5KS2A 3QVGA 4G23A 4Q1AA 5AK0A 1RCUA 2AEMA 4UXJA 4L9AA 3TJZA 1H8ED 3WRWA 5LMNB 2PUEA 4XWAA 2FW6A 4U9IS 2XHEA 3BQNB 2JBAB 4O1HA 5E1DA 5ADWA 1M6VB 4RSRA 1YKSA 4YRPA 1UJ5A 4BEBA 2EWMA 4Q3DA 4P7GA 1NQTA 3E05A 1ONNA 5JXWA 3SFZA 2J3MA 4X8OA 2O1XA 3AJDA 3CYFA 2GLUA 4DDTA 2E87A 3K5IA 3OAAA 2XB9A 4MRNA 5BWLA 1ZPDA 1P80A 2VQFB 4CMEC 2IODA 2RSLA 1GZ7A 3DZ8A 3S1LA 4B3GA 3E1SA 3KETA 1HE4A 1NATA 3PT9A 5BWCA 1E1QA 4X45A 1X9GA 1ZM9A 2B4RO 3HA5A 4I81A 4GMHA 5BVHA 3IP1A 3TE7A 1QQ6A 5JJ5A 1E2GA 3U9LA 2BFPA 5AR1A 3T9DA 4F92B 2R66A 1H85A 2CCJA 3N7UA 3NBYC 1NA5A 4TRRA 4IHJB 6CHYA 3BRWD 5LN1A 4Q1EA 3HXMA 1TAQA 1V8OA 4TGLA 1I1NA 3B5EA 3FBWA 2IYOA 1ZUNA 4EMBA 4ARSA 4F9TA 5HW0A 1AQJA 2YBEA 5DHSA 4PO8A 3KZMA 1Q2XA 1VYUA 2RHBA 3LT0A 3O9VA 3OX1A 3RVBA 3ZUPA 4UVIA 1EI9A 4U3JA 1CJCA 4FMPA 3VKFA 4QOHA 4D9IA 3O6VA 4PEVA 2ECOA 3AOEC 4Y1RA 4LF5B 4YP9A 4CI9A 3OO1A 1U9IA 3ZGXA 5C5DA 5FJIA 4URVR 1QVWA 4K9LA 3U7GA 1TOAA 2QNRA 1XAGA 2G9UA 2CXXA 4JEHA 1FTWA 2FZEA 4NEGA 1SIUA 4O8ZA 2EJUA 2OAGA 1RWVA 1QM5A 4X1YB 1KSJA 3JD0A 1VSUA 1X8KA 3PHCA 2D4AA