4IWNA

Crystal structure of a putative methyltransferase cmoa in complex with a novel sam derivative
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
229
structure length
229
Chain Sequence
TFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERFVQPGTQVYDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRHHIDAYKAPTPVDVIEGDIRDIAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLHNAGFEHSELWFQCFNFGSLVALKAEDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cmo5U34)-methyltransferase
publication title S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iwnA00
3FRHA 2G8NA 1RJFA 3UJBA 5KQSA 1JQ3A 4OBXA 2C7PA 4GBED 1IY9A 1Y8CA 5LQUA 2B25A 2ZSUA 3FUTA 3IYLW 2N47A 2OXTA 1RJDA 4MIKA 3PX3A 3MCTA 4RSRA 1UFKA 2P3LA 1QANA 5DM0A 5CVJA 3M6WA 5EMKA 5E1OA 3G7UA 1P1CA 3GO4A 4YUZA 2IH4A 3LCVB 4MTLA 5EKUA 4DF3A 1RI4A 4ER0A 1G60A 5D1HA 3VSEA 3DLIA 3G2OA 5K0GA 5HEKA 2AS0A 1Q0SA 3BGIA 3HEMA 4HRAA 4E31A 2XVAA 5K0BA 5DSTA 3GDHA 3DXZA 3IHTA 2PV0A 2NXJA 2OY0A 1BKYA 5FADA 3SXJA 3PFGA 4QDJA 2HMYB 3GCZA 3LECA 2YTZA 4AZSA 4E2WA 4YUWA 3G5TA 2WA2A 1KPHA 3FYCA 1EJ6A 2XYQA 2YR0A 3PS9A 1M6EX 1R8XA 1YZ3A 5CVVA 5HOQA 2V74B 1WY7A 1TW2A 2E5WA 4IV0A 5DWQA 3BXOA 3LDUA 3KQPA 1ZKDA 1TW3A 2ONYA 2O0LA 3I58A 3KR1A 4HC4A 5FTWA 3NW9A 4F85A 5KS2A 4FSDA 2AOVA 3HCCA 3P97A 3V8VA 3GNLA 4PCLA 2EX4A 3AJDA 5EEHA 4CKBA 2ZTHA 4CKEA 5GIOE 4XUEA 4HSGA 1RI5A 2XYRA 5HIJA 5EG5A 2ZW9A 3KPYA 3CVOA 4GOOD 4DZRA 4HTFA 2H1RA 5CVEA 3NWBA 4RTJA 1MHTA 2EJTA 3LSTA 4YMHA 2JH8A 3FUUA 1R00A 1TPYA 4L7VA 2AN3A 1JG3A 3BT7A 3F4KA 3EVAA 1WG8A 4YUYA 1NBIA 4WVLA 2IBSA 3PFHA 4C07A 3IEIA 2O57A 4IKPA 1XDUA 1KPIA 3I5UA 4OBWA 3C6MA 5BXYA 2PLWA 3KQMA 3I64A 4M38A 3KQQA 1XDZA 3P2EA 4QTTB 5C1IA 3AWIA 5LQNA 2IPXA 1F3LA 5LSAA 2JHAA 3UJ9A 1KYWA 2VP3A 1INLA 3BWYA 3G89A 3Q7EA 1WS6A 4PYQA 5DTMA 1AV6A 3CGGA 5DXAA 3FPFA 3KPVA 2AOWA 5CUQA 1L3CA 1P91A 2ZZKA 5EZQA 2FK7A 9MHTA 4YV0A 4YUVA 1SUIA 4PYJA 3NTVA 1ORIA 4GC5A 4P7JA 4LG1A 5G02A 3TPZA 4PYIA 5LQRA 4AZWA 5EVJA 1BC5A 3NDJA 3EVBA 4R6WA 3OZTA 4BP3A 1OR8A 2P40A 2O06A 1YB2A 1JG2A 2P7IA 1JG1A 3EEYA 4X60A 4PWYA 4RX1A 3TKYA 2NP7A 3LBFA 2A14A 2FYTA 5K05A 3A25A 1ORHA 1P39A 1M0EA 2NP6A 1EIZA 2BM9A 1L9KA 3LCUA 2Z6QA 2R3SA 3OU2A 5DX1A 1JSZA 2PX5A 1AQIA 2ONZA 3UJCA 2OPBA 4BY9E 4OQEA 5FHQA 4EKIA 3KU1A 3KQTA 2PSSA 3DOUA 3HCFA 3FTFA 3P2KA 1YF3A 1XDSA 2PT6A 3PX2A 1VBFA 3R24A 2QYOA 2Q41A 4KDRA 2ZZMA 4C08A 4KW7A 3T7TA 1NV9A 4ATNA 3ER8A 3VYWA 3A4TA 3VC2A 3R6TA 4UOEA 3G5LA 3M6VA 5DX8A 2VS1A 4AX8A 5D1NA 3DLCA 3HCEA 4BLUA 4Y30A 4GEKA 5DRYA 5IKMA 2GAFA 3HM2A 3KHKA 5E9JA 4C05A 1SKMA 3JWGA 2BZGA 3DULA 1AF7A 3KQOA 3LCCA 2PX8A 4DM3A 3A7DA 3E05A 3BWCA 4QVKA 3LL7A 4QQNA 5IH3A 3DUWA 3M4XA 5U4XA 4C03A 5BW4A 5KQRA 3ERCA 3UBTA 2IGTA 5GOZA 1ZHFA 1RI1A 3GWZA 3MQ2A 3TM4A 1XXLA 2PX2A 3THRA 4E32A 4RTSA 2PJDA 5M5BA 1XCLA 5FWAA 3GGDA 3BGDA 4GC9A 3CJQA 4OA8A 4PIPA 2OYRA 5BP7A 2AR0A 3EGVA 5ICGA 3G8BA 4X1OA 4C4AA 2NXNA 3GRRA 1EJ0A 2IP2A 2FK8A 4POOA 5GINE 5K0JA 5CCBA 1I1NA 1VIDA 2XBMA 5E9WA 4YMGA 1JQEA 4P58A 1KXZA 3FRIA 3LDFA 3BKXA 4XUDA 5CVUA 4PYNA 2ZIGA 2PXXA 3B3FA 1DUSA 1X1DA 3X0DA 4FR0A 3OU6A 1G8SA 1XCJA 2AZTA 3TRKA 1RJEA 2ZULA 4RTPA 4PYOA 4R8RA 3PT9A 2YXLA 3S68A 1XJ5A 5EMMA 3FUWA 3LX6A 2H11A 3BKWA 3GIWA 2PXCA 5ICFA 4ER3A 4GF5A 4RWZA 3R9XB 2PXAA 5F2KA 3CJTA 3U81A 2AOTA 4PYKA 4AUKA 4RTRA 4DMGA 4FGZA 4ER6A 3JWIA 3P9KA 2BH2A 4PINA 2NYUA 4P7FA 3DP7A 4E30A 1VE3A 5FQNA 5KVAA 4XUCA 3P9NA 3SM3A 3UJDA 4EQZA 4E33A 2PT9A 2BM8A 1FJXA 1L1EA 5P8WA 3ANXA 3EGEA 4FP9A 1N2XA 1FBNA 1VL5A 3M6UA 4HTFB 1EG2A 2FRXA 4EVIA 2YXEA 2B2CA 4G56A 4R6XA 5T67A 3PTAA 3AXSA 2FHPA 5F2NA 4YUXA 1HMYA 2IDKA 3A7EA 2ZLBA 4Y2HA 4E2YA 1YFJA 3G2MA 3C3YA 3NMUF 3CC8A 5B1SA 4V0RA 2G70A 2HR1A 4EKGA 2B9EA 4GOLD 5CCXA 3GRVA 3H2BA 5K01A 2GH1A 4AZVA 1KIAA 3OE4A 3B7PA 1X19A 1JQDA 4JXJA 1PRYA 4EMSA 2NNWB 4B17A 2JHCA 1NW7A 4KIGA 1O54A 3BUSA 3T7SA 4C04A 4CTJA 4DCMA 3T7RA 4CWAA 4OQDA 5K8VA 5E1DA 2PBFA 1EQAA 5JUWA 3BWMA 1N7IA 5DTQA 2NXCA 2I6GA 2O05A 3GXOA 2EFJA 4BLVA 4E2ZA 5ERGB 1X1BA 5C0OE 2G71A 3DMFA 4Z2YA 2JH9A 2CWWA 3FPJA 3TFWA 1I4WA 2OB1A 2XVMA 3PVCA 4P7GA 3KQVA 2VZ9A 3EVFA 4U7TB 2BR5A 4GOMD 2JHPA 1G8AA 5CVDA 3SSNA 4EK9A 3MCZA 4PGGA 5DXJA 5E9QA 1AQJA 2HTEA 3BZBA 5FWDA 5GIPE 4OX9Y 1L3IA 1B42A 1Q0TA 3TMAA 1QYRA 1RJGA 1T43A 4R8SA 1D2HA 3BGVA 2OKCA 4IV8A 2C7QA 4LWPA 5K0LA 3NVMB 1WZNA 4PIMA 3MHTA 4FSXA 2GA9A 2ZWAA 2QE6A 3DR5A 3QOXA 3R0QA 3G2QA 4RTQA 5EC8A 5FCDA 4NECA 1NW8A 1X1CA 2F8LA 5K03A 1JG4A 1YZHA 3OZRA 2EJUA 2ZIEA 3B5IA 3HVKA 3FUXA 5CIYA 4KRGA 5GM2A 7MHTA 5K09A 5DPMA 3ELDA 1H1DA 5EOVA 5K0NA 3ORHA 5DM4A 1SVUA 5CM2Z 2UYCA 2ZBPA 3EPPA 3PB3A 2P3QA 2Y1WA 2UYOA 1D2CA 3TR6A 1D2GA 4X61A 2CMHA 1NKVA 3OFJA 3T0IA 2CKDA 3LDGA 3HCAA 2IDJA 2VDUE 3DXXA 5FULA 1G38A 2JG3A 1NT2A 2I7CA 2B78A 4KVZA 1JR4A 4X63A 3VC1A 5CD1A 3ELYA 2P3OA 2Y1XA 2ZFUA 1RI2A 4RTKA 3KQSA 3THSA 4E2XA 2KW5A 3KR9A 1R6AA 2R6ZA 3LKZA 5E8JA 2UYQA 2PWPA 3CBGA 3OU7A 4LECA 2PVCA 1QZZA 5DTRA 3UJAA 2B3TA 3LHDA 5LQJA 2FCAA 1EAMA 3BWBA 3GRUA 4E70A 3GJYA 2QY6A 1O9HA 3CCFA 3OFKA 3EVEA 5H02A 3RIEA 3FTDA 1KP9A 2VDWA 4GQBA 3DMHA 3SX0A 2Z6AA 3E23A 4U7PB 2P8JA 4DKJA 3M33A 4V0QA 2WK1A 2ORED 3G88A 3PLAE 3ER9A 4RTNA 2AOXA 1NE2A 1XTPA 2IH5A 3QOWA 1VLMA 3LGAA 4GUAA 3HA3A 1NV8A 5KYGA 3FUVA 3MTIA 4A6EA 3ID6C 3CKKA 3AXTA 4X41A 3B3GA 3G8AA 3NVKI 1FP1D 3KPUA 4CXMA 2BR3A 2PKWA 3KR2A 3KQWA 2UZ4A 4QTUB 5E2BA 3HVJA 1G6Q1 4HH4A 3EVGA 2AOTB 1P1BA 1VP3A 4HG2A 5DRTA 5FUBA 1ZG3A 1FPQA 4BLWA 3NDIA 5F2OA 4PCAA 4PNEA 2AVNA 4RV9A 2AN5A 2IIPA 1NBHA 2AOUA 1KPGA 3NJRA 4QVGA 3SR4A 3UA3A 5HIIA 1ZGJA 2YX1A 3EVDA 3HA5A 1KYZA 5E1MA 3HA7A 2PGXA 2P7HA 4QDKA 1ZQ9A 5E1BA 4RYLA 2YUIA 3O4FA 1YFLA 5LQAA 3EGIA 3TLJA 2FPOA 3GU3A 4A6DA 3DTNA 1QAOA 1VP9A 3IV6A 3K6RA 4KWCA 2AN4A 4XCXA 5HILA 3UWPA 4F84A 5EHIA 3P9CA 4DCGA 3JWHA 4P7KA 4MHTA 1XVAA 3OPNA 5HFJA 1SG9A 3OZSA 2VDVE 3E7PA 2OZVA 1WXWA 2ZVJA 1G55A 3C3PA 4HGYA 5DLYA 4DQ0A 1NW5A 5DT2A 4DA4A 3SSOA 3K0BA 4PYMA 3L8DA 4RVDA 2UYHA 2ZBQA 2YXDA 2P35A 1KR5A 4MWZA 3HVHA 4R05A 5DM2A 3ELUA 5EHGA 4RVFA 3UA4A 4RTLA 1QAMA 5EMJA 3LKDA 1X1AA 4HGZA 4WXHA 5EZSA 2Z6UA 2HV9A 2CL5A 1JSXA 3DXYA 3LBYA 4M37A 2ZIFA 4RVGA 4H0NA 2I9KA 2CMGA 5HZMA 1HNNA 1R74A 3HNRA 3UZUA 5T6BA 5ICEA 1VPTA 3REOA 2OB2A 5K0FA 4ISCA 10MHA 1N7JA 5FA8A 4AZTA 3DMGA 4RVHA 3M70A 4MQ4A 5LQKA 5GWXA 1L3BA 2EG5A 3RODA 4LWOA 3CJRA 5EMLA 3E8SA 3KPJA 3G2PA 3TQSA 2LD4A 4RTMA 2QRVB 3TOSA 1QAQA 3C6KA 3O7WA 3FYDA 4QPPA 2NXEA 5EIFA 3UJ7A 2ZZNA 1I9GA 2PWYA 3MTEA 1SUSA 2QRVA 3WSTA 3RW9A 1DL5A 2OO3A 5EEGA 2ERCA 5EPEA 5LQCA 1BOOA 2ZBRA 3HVIA 3JWJA 1BHJA 3I9FA 1YUBA 2ESRA 4FZVA 4OA5A 5T64A 3TM5A 1KHHA 5EKXA 5DM1A 5JR3A 3P2IA 4IWNA 4ZTBA 5K0CA 3EMDA 2C7RA 1F38A 4M36A 3OCJA 2GLUA 1Z3CA 3SGLA 2YQZA 3GRZA 3B89A 1V39A 4K6MA 3FPHA 4YV2A 1UWVA 3R3HA 1U2ZA 5EGSA 5HIMA 1JTFA 3HTXA 2H00A 3Q87B 2PX4A 1RI3A 1NW3A 4RTOA 3MAGA 4M7RA 3KPWA 3UFBA 4F86A 4FT4A 5LR6A 5FHRA 2DPMA 2GB4A 4PGHA 3D2LA 1NW6A 2P41A 3A27A 2ZCJA 2QM3A 2IBTA 5EQJB 5GP1A 4KIFA 2GS9A 1R8YA 1WXXA 2YVLA 3EVCA 3FPEA 3OE5A 3GRYA 2G72A 3MERA 2BR4A 2HWKA 3I53A 4QQKA 1IXKA 1UIRA 3B3JA 3KKZA 1IM8A 1SQGA 2K4MA 3KR0A 5K0EA 3MB5A 5DX0A 5BW5A 3FTCA 3V97A 2I62A 3FPGA 3EEOA 3QV2A 1DCTA 3NWEA 1SQFA 1MJFA 4BP1A 1VQ1A 4PYLA 3UJ6A 4PONA 4YV1A 2XYVA 3P71T 5GM1A 4ER5A 5E2AA 3MGGA 2OBFA 2ZWVA 2AVDA 4FT2A 4C06A 1JTEA 2GPYA 3EMBA 3HCDA 3C0KA 3EVZA 3HCBA 3O31A 3ME5A 3P8ZA 2HNKA 4ER7A 2V7EA 3SMQA 5MHTA 2JJQA 4GOND 3TKAA 5EIWA 2WA1A 4FS8A 4CKCA 3KQYA 2IFTA 3M6XA 3SSMA 5FQOA 3A26A 4O29A 4QPNA 5C9ZA 8MHTA 1O9GA 1R18A 5DSXA 4KDCA 3UJ8A 3HP7A 2G1PA 2PY6A 3AY0A 1ZGAA 3FZGA 3LPMA 5FA5A 4CTKA 2P1DA 3ELWA 5HIKA 5E8RA 5ICCA 1FP2A 3P9IA 2DULA 2IH2A 3SVZA 1M6YA 1PJZA 2ADMA 2O07A 3DH0A 2C7OA 3FTEA 2AOUB
chains in the Genus database with same CATH superfamily
1XB2A 2X14A 4BKOA 2WTAA 3H97A 3T1TA 4YCCA 1USKA 4R3WA 3AHFA 1CVIA 5EHXA 5KJCA 2PG3A 2Z8XA 3FUTA 4Z0TA 1BMFD 1AB6A 1TVMA 3F1KA 3TRHA 3NM4A 3G8YA 5HTKA 5JQGB 3UWSA 3RJ5A 1IXYA 3ZGZA 3H9GA 3W5SA 3ZUPA 2HMAA 2GVZC 2B6HA 3U7RA 4O25A 5JS8A 1LUAA 2IH4A 3HZOA 4XDYA 4W5OA 3BMXA 1G5PA 3NHLA 5ALIA 5CBKA 4TQGA 3BGIA 1OIVA 2RHWA 5FR2A 3G0HA 4P84A 2PV0A 1IC6A 1C2YA 2QI9C 1KOJA 4NV3A 2ZJ8A 3VKHA 2ZI4A 5I8WA 1EGMB 2PK3A 3ROFA 3DTVD 3WL3A 2BISA 4QHSA 2X4IA 4WTOA 4EYEA 2ZJ1A 2XYQA 3PS9A 3EQZA 1BSVA 2JLBA 4YRDA 3X2FA 3PIDA 4CIDA 4TSRA 3D6UA 1KYXA 2JGNA 1XD8A 1RJWA 1VYVA 3PP8A 5DWQA 3SICE 3D6VA 4JAVC 5AVRA 2OT3B 4GI3A 4G8CA 3KR1A 1S2NA 3BJIC 2QVBA 3AR7A 1GPKA 2AOVA 4FONA 1HRKA 3UJ3X 2BLNA 1Z6AA 1NMSA 1FX0B 1X8KA 2D2VA 2AW3A 3DDSA 3RIGA 3LTEA 4ZT3A 2Q3MA 3GHHA 4I5DA 1OI7A 2JCVA 3A3KA 4YI5A 2A9QA 3LBNA 3ZYZA 3KXKA 2EP5A 3A1NA 3HRIA 3CF4G 1QE0A 5U1PA 3W2FA 3FNRA 2IW3A 4D2IA 2CXTA 1H4QA 3A9SA 3FF4A 4F9EA 3NT2A 3WGGA 2MR6A 4MUAA 5J1SB 4IIXA 4XDZA 4UQLA 4F3TA 1QOPB 1ENPA 3CONA 3RHZA 1BWPA 1FP7A 3W77A 4TS1A 3E3MA 1BJTA 1E98A 3L05A 4JNCA 4YC7A 1QV6A 3SF0A 4DCOA 3D4PA 2BOVA 4EMUA 2PCJA 2QXTA 3LUCA 3MUOA 3N8HA 3OLVA 1XF9A 3VO2A 2JI6A 5BVHB 1P2BA 4B3TB 1HT1E 4QU8A 5BXYA 4GKAA 2P6UA 4JHXA 5CB4F 3WNBA 4IJQA 5JBNA 5JSQA 5TJHA 2GWRA 4JEMA 3ZZMA 4D6PA 3ZLBA 3FH0A 4DIEA 2NZVG 4WOCA 7AT1A 3P9QA 1KDZA 2JHAA 2DETA 4C3UA 1LI5A 1Q1NA 1F4VA 4QJBA 5LYJA 1AV6A 3DFFA 6NULA 2YWDA 3QSYA 4CETA 4WECA 1PJ4A 2LTAA 4EHJA 4HXFB 6ABPA 4V03A 1W19A 2YWFA 1QMGA 5FO0A 5ITZA 3VNSA 2H7VA 2ZVQX 1S6YA 3VU8A 4GICA 3VZSA 2WSSD 4MW1A 1C80A 2X9GA 2RI0A 4BP3A 1MDBA 1DG3A 2AG6A 3AP2A 1ECFA 2XECA 3H1GA 1VCNA 1WW8A 5CK4A 1MO5A 4JBGA 1SXHA 1WB5A 1NJ2A 1XN4A 5KQGA 3RYCB 4FMBB 5G1OA 1OKKA 1JDPA 1W6RA 1HI9A 1EK6A 2R3SA 1EFDN 1LVGA 1YJXA 2XXBA 2PX5A 3AILA 2JI7A 3IHLA 3O1HB 1P44A 3C4JA 3ZCSA 4Z7OB 2DQZA 2QTCA 5FR1A 1ZD1A 3WA6A 4IXMA 4WBNF 2GZ1A 3JRWA 4RJLA 3CRNA 4BNMA 4YCNA 5BMOA 5AJWA 3KKPA 1F20A 1REQA 2C2WA 4V39A 3VX4A 3RH0A 3HEBA 4PNHA 2WNSA 4KW7A 3QUCA 2UZAA 1W85B 1DEOA 1ZOIA 4P86A 1P2TA 3ZZTA 4C6RA 1SCAA 2IA5A 3ZJYA 1D6SA 3FROA 1S3SA 2XI4A 1YBFA 3DB2A 2GN9A 3CUKA 3MF4A 4CM9A 2EZ8A 5DX8A 2QMUA 2VUHB 5EIBC 1NVVR 5CFPA 1QLWA 3UB4A 5AJUA 1DE0A 2VIIA 1H0RA 1R4MB 3JWGA 4O4IA 4C05A 5IZCA 4LVCA 5KKCA 1RPAA 5CFQA 2O5CA 2IW1A 2O7NA 3GD5A 3IAUA 2PYDA 4F60A 1C7QA 3LGSA 3NUQA 3CWQA 2ZUVA 1A8UA 3L4KA 4QWMA 2BGKA 1FYVA 1ZD8A 2I71A 1T2EA 5I9NA 2LKDA 4KQ2A 1X1EA 1ZHFA 3L7DA 3W1EA 5JCJD 1L7XA 3VO1A 5LPNA 1V8PA 2XCQA 4B80A 1GAWA 1Z15A 3JARB 3KOMA 4DVGA 1SIWA 5EWJB 5B3KA 4KGVA 2C8KA 2K7ZA 3AOEC 3RGWS 2CMFA 2YS6A 4Q4HA 3BWEA 4L4XA 4KVAA 4W1PA 2YASA 3D6TB 4RDXA 1JU9A 1QH1B 1LDBA 5JJLA 1PFWA 3AW9A 4JBYA 3GUUA 4BDTA 4JB2A 1L1FA 4N0DA 4RLHA 3QVJA 1UPAA 2CL6X 1JSCA 3JQ9C 1AXEA 2Q4RA 1XZQA 2JFOA 1D07A 4FR0A 3IR7A 2DOKA 2RD2A 5EJMA 4NF2A 3OKPA 4TVOA 3WY9A 4KAFA 4DG9A 5IZ4A 3PT9A 3B3QA 3F73A 2H1HA 1G5IA 1HFJA 2PXCA 2I2CA 3K2BA 3TPCA 1Z2AA 3N2YA 1VBMA 4HDRA 2QBYA 4MZDA 1OWLA 4B4UA 4CMIA 2DBZA 1EQ2A 1Q84A 4IOJA 2AHOA 1XQYA 2C0PA 5AKYA 3ZXUB 5CMLA 4K0KB 4PS0A 3BQNB 4PSDA 5EJ8A 3BMOB 3MLAA 3BORA 2OBYA 2AXQA 2X2PA 4GW3A 1PKEA 3AZPA 3DW3X 4LDJA 3TZCA 3QU9A 1ZU5A 3KZOA 1HMYA 3QQ5A 3AR6A 5DHSA 3KEMA 1AS2A 2Z56A 3OBBA 5DB4A 4E2YA 1NQXA 1B8OA 4EHIA 1QU3A 4TT3D 2XBUA 4OPMA 4IS3A 5TS2A 3FWYA 1VKNA 1P45A 1PU2A 5EQDA 3RFXA 4BC0A 2B4KA 2WSIA 4Q9LA 4E1AA 4ZDIA 3N9IA 2DECA 5K01A 3G1UA 4EG1A 3OE4A 2B7LA 2PMBA 1E20A 3F9IA 5C81A 3QMMA 4EMSA 2C82A 1JPJA 4UBIA 3SXUA 4HYQA 5E6UA 5BN5A 1J07A 4DUGA 2PYZA 4IDQA 3PJRA 1SQ6A 2PGIA 3DDOA 4AB1A 2XOXA 4JJ6A 4Q37A 1JHYA 2EGHA 3GLHE 1HDZA 4WN3A 5KVCA 3HMKA 2IV2X 4XFJA 3AVQA 2I6GA 3DNMA 2CC2A 1H2RS 4MJ7A 3ZV6A 4DCTA 2QGFA 2IYQA 2W2OA 1XTUA 2IU4A 4XOUA 2GJSA 3K9HA 4DIFA 1CY0A 1CF9A 3TZQA 3GVHA 2QMQA 3KD3A 4GSLA 3TZLA 1L5QA 2DQYA 1CJMA 2WUVA 4OXIA 4DADA 2JIRA 1YE8A 1ORWA 1WEHA 2WMNB 2Y8EA 2WNIA 1RTKA 1VG8A 2FZKA 2P75A 2YN2A 4RVCA 3ZWPA 4DYHA 4US0R 3NVDA 5KNCD 1TJNA 4G8JA 3ZHSA 3IBCA 3UEOA 5GIPE 1FFGA 2WJIA 4BUJA 1DG1G 2VRCA 3W3AH 1Q0TA 5TV2A 3CLTC 2QR5A 3PI6A 1M1NB 5GJBA 1N1EA 1CEQA 1I2DA 4HLCA 4I4TB 1LB1B 4ZFNA 5KTPA 3HXQA 2ZRDA 3A4LA 1K89A 1VL0A 1JIVA 1ZC3A 3C98A 3FOCA 3OHSX 4TMXA 5AKLA 4BFUA 1WZ2A 1U4OA 2GARA 2MSEB 1NOJA 2H2WA 4NZZA 3U4DA 4IL5A 3HACA 3O83A 3FVTA 4JP3A 2N9UA 2FZ4A 4XSHA 4BTEA 3I2IA 4O2AA 3IA7A 6GPBA 3FUXA 3ISJA 1O89A 3BXXA 1Z12A 1NN1A 4MVCA 4RHCA 5JNVA 3MBKA 5EE9A 1YIOA 5COQA 1NRWA 1E60A 2WR8A 1SVUA 1NONA 5DM4A 5AW1A 1Y7TA 3E58A 1XEXA 3X1XA 2QLFA 4JP8A 1PJRA 1SWWA 2W2VA 3L79A 1E99A 4H31A 1OH7A 1K4MA 4HX5A 4BVJA 4TTTS 3IEUA 2BMFA 2DR0A 3CZ9A 5FOUA 3I42A 3ZDDA 4OQMA 4GZLA 4JLSA 1CETA 3THYA 3CNEA 3WMXA 1AIPA 4N5MA 2A9RA 3EN0A 5JS1A 2Y1XA 1YRWA 1RI2A 2O48X 5LMUB 3KQSA 2D06A 1QH0A 2R48A 3B1WA 1GM5A 1FMTA 2WHPB 4P82A 5KHAA 3KX2A 5JD6A 1A9OA 3NWJA 4JSRA 4B8ZA 3LC1O 2NYVA 1T10A 1LY1A 2RC6A 3OM9A 4F6RA 4DV0B 1S7CA 4D9NA 3FTDA 2R8EA 2VDWA 4PV7A 1SBQA 2IHBA 1T1SA 2NU9A 5ED0A 5J2UB 5LZ5A 4CQLA 2RGNA 2P9FA 1YQGA 3GFSA 3T3OA 2G4LA 3INGA 1HLFA 1XYGA 3CB4A 3HGQA 4C0LA 4Y9UA 1Z22A 4EUSA 1VLMA 3B13B 3WIVA 4IHQA 5HZHA 1EQUA 2FW8A 1EYZA 3R3YA 2BFBA 3LTNC 3T9BA 3WKEA 4FI3F 1CUUA 1EB9A 3N2KA 3WNZA 5IWCA 5K1ZA 4LNAA 2DMRA 1IULA 4NV1A 1VRCA 4D41A 2JAQA 1UP6A 4PE5B 4HI0E 4YRKA 3KT8A 3KBBA 3ZU3A 2I65A 5DO9A 4F11A 1ZI8A 3DE6X 4TXNA 1N5DA 4UU7A 3T5MA 2VHVA 1NNUA 4JC4A 4PZAA 4X8OA 3STHA 2YDYA 1ZG3A 3ABOB 3RJ9A 1Q0PA 1SD2A 5ALSA 2HLHA 4QVGA 4CF6A 1ODIA 1XMJA 2YX1A 5A0TA 4KQMA 1WMDA 1E77A 2LP4Y 4BGEA 3WLMA 4B3HA 4IX1A 1FSSA 3AINA 2IHUA 5HILA 3RB8A 4AM8A 4E09A 3CZMA 3NV9A 1PKXA 3PFIA 4P7KA 4LNHA 1XVAA 3NHKA 1UZAA 3KXPA 2VBIA 1SB8A 4DLXA 4HGYA 5G0WA 2V7QA 3PI7A 2YY5A 1SO8A 4XGNA 1T1JA 2FPUA 2YW2A 3G2IA 5LLSA 3G9UA 4G0OA 4U2GA 4BBZA 4Q12A 1VXRA 3D4BA 4UCFA 3VA7A 3DCJA 1ZIXA 1XC7A 3DNPA 4G4JA 3VBEA 4DCPA 1DINA 2DUNA 2QZJA 4J0JA 5CJ2A 1XXHE 4WXHA 3HU3A 2W2KB 2A0FA 3JVEA 2QTWB 4Q1CA 4V0SA 5ECDA 3IDAA 4EYSA 5A5GA 2OK7A 4LSZA 4TLEA 2CYBA 5CVTA 2RB5A 4HLNA 1CQJB 1TT7A 2AJTA 3WNDA 4QARA 3HJBA 621PA 4UBNA 3ZE0B 5HYVA 3O3NB 2FSUA 2OVBA 4ZRDA 4Z0PA 3J7TA 5FA8A 2FN3A 4HDNA 2IPOA 2OHHA 1KZ7B 3U3MA 2XTJA 1U1GA 1SUFA 4MINA 4CMKA 1URPA 3CJRA 1V25A 3BEDA 1C41A 1SXJC 2VJMA 4NPAA 3DE1X 5IYZB 4XB6B 4IIJA 3C8UA 3FNQA 2TMYA 3VFDA 5KMGB 1WQ1R 2ATVA 1ZD4A 2Q7XA 5LA6A 2D7DA 5CFLA 1UBGA 4YBRA 5EUCA 4EABA 3IKLA 1I9GA 3ACDA 4D4IA 1IB0A 5BQ5A 1E1CA 3ADCA 4L5JA 5EPEA 5LQCA 3K70D 4KUHA 1N36B 1TQ4A 2FV8A 4HQLA 5JTUA 1ZGBA 1P6QA 1G5TA 3IVMA 3WSWA 2JLWA 2OO5C 2ZUSA 3KFVA 2Z09A 3AONB 3UQZA 4D3DA 1E1KA 2VL7A 2R60A 4M0CA 5CDFA 3TIGA 4W5QA 2GLUA 3O1LA 4RNDB 1DQPA 4MQ6A 3QXHA 2VJDA 1ZH6A 2NYAA 3SIWA 3B89A 2YVQA 1UZLA 3DYIA 4H7EA 3W9BA 1B4DA 1FMCA 3EGOA 3MXOA 4B6QA 5JSHA 3HTXA 1XA4A 1RT9A 4D3FA 1XU4A 1R9JA 3C3JA 3D31A 4N3GA 2O2IA 2XNDD 2BVNA 3L1JA 3WK7A 4POAA 4C0QC 2HA7A 4EUFA 4S1TA 2YC4C 4MIEA 1TGVA 2HJ9A 3JALB 1N2OA 4D46A 3ORSA 4JJZA 2B3DA 3FPEA 1CQXA 1CY4A 2WF9A 3OCCA 4QUIA 4YCDA 2QM0A 4IP0A 5DXFA 1N34B 2XODA 3KZKA 2Z1NA 1EVYA 1KFCB 4BVHA 1NW4A 3NR2A 5EZ5A 3UCFA 2F17A 3W2IA 4AS3A 3SY8A 5F7OA 4I55B 1U8UA 5B1HA 2VNJA 2Y9MB 3BXPA 4HRXA 2OQ2A 4J49A 1G8JA 4XEHA 1C1YA 1SQFA 4GPIB 2EP8A 4UMDA 2QYHA 1GL7A 3LYLA 4I1YA 4F8YA 3WLPA 1YD7A 1J09A 3JD1A 4ZDKA 2YZNA 1KJJA 4YQZA 4A7PA 3O31A 2WF6A 5FH9A 5LMCA 1YS6A 1ZM4A 1KTIA 2CXPA 3AR5A 2ZUWA 3QU5A 4GOND 2R1VB 4XX0A 5J4YA 2CXXA 3ULKA 1UZNA 5EIWA 4JOSA 2Q1WA 4QOSA 3V8QA 2FMUA 3ANTA 2IHTA 5HS6A 2PNJA 1SD1A 3I9V1 2CLKB 1R0ZA 2Z98A 4CTKA 4IHJF 1LVHA 4PLCA 2QRNA 1G6OA 1JJIA 3LLMA 4YS6A 3LQRA 4ZCMA 1NXOA 5KQMA 3M5DA 4QTZA 3ZCUA 2WB2A 1P19A 2O5EA 1CUJA 2EHDA 3TVYA 2DFLA 4QYMA 2FFAA 5JAPA 4CBVA 4FFBB 3NJ4A 1F8YA 1BDIA 2C8VA 1UJ5A 3KUDA 4IY1A 1M1ZA 4MW0A 2C7PA 1JW9B 5L4SA 1I7DA 2CLDX 4L8GA 1N6LA 1MENA 5EJEA 4BVBA 1EK5A 3D4NA 3NTOA 2EGGA 2OXTA 2ZM5A 1CZOA 1EESA 2E4VA 1ZXXA 3HE3A 1VIYA 3M6WA 1TVKA 4M9ZA 1XGKA 1GP2A 4IQGA 5EMKA 3KK0A 1K6XA 4TSKA 1UBJS 2R25B 4XM0A 3PIIA 4MTLA 1SUBA 1XZPA 4RL4A 2XCRB 1DFGA 2FMTA 2F3TA 2X5KO 2A3NA 2DCUA 3IAEA 4B3DA 4EFLA 1RZRA 4DMCA 2EQAA 5FADA 4ZEMA 1C9EA 4CKYA 1IY2A 1XNQB 2IPMA 5IM4F 3QUSA 1NXWA 2GD1O 3OBIA 4WL0A 3WDMA 2G63A 3IIIA 2E18A 3MRSA 5A5DA 5LMNB 1ZWLA 2PQMA 4YROA 3VBCA 1NJGA 2QLNA 4JT2A 3PA8A 4FDAA 1T1RA 5HGXA 5FX2A 5FOVA 4W1SA 4O2BB 3KQLA 1G8MA 5JO0A 3RU9A 3IS3A 2R86A 3KL4A 4CEJA 3ODGA 1ZAYA 2AXNA 4W5HA 3RTGA 5AUOB 1Z0ZA 4GOOD 1SVNA 1HORA 1GKLA 5D84A 3CH7A 1H42A 4TQAA 1YKGA 3FUUA 3TOCA 2W42A 2WDZA 1GNLA 4P4UA 4GVXA 4ARSA 1RYMA 1G59A 4E4TA 4LOJA 1QBKC 3KV1A 3RWMB 3RU2A 3PEYA 4XFDA 2ZUBA 4B84A 4W8GA 4LYEA 3E81A 4MW5A 3IEIA 3EIFA 3MK31 4BATA 2Q4BA 3WDLA 1GXSB 4P80A 2IYTA 2RB4A 3L7YA 3RTBA 2CJXA 3I5UA 4P0QB 4QU0A 3GAFA 4NAVA 2JIOA 1QCYA 2XA9A 2WKPA 3K30A 3GFOA 1R27A 4UOZA 1QXSA 4CEHB 2B99A 1ZCAA 5BVHA 2UZIR 1YXMA 3BWYA 3RSZA 1A2QA 3V4OA 1FUYB 2YHSA 2D4AA 2IYUA 2GZ3A 1CLUA 1ADJA 3DBVO 4DJTA 3K8YA 5BQFA 1NM5C 2PZEA 2GM5A 4CM4B 2PZKA 1F2VA 2Q8QA 1YS7A 2ZIXA 4QM6A 1KC3A 4F4FA 9MHTA 2FHSA 3GWGA 2C4VA 2WLTA 3KYCB 5SYNA 3RF7A 3H2JA 2ZRFA 1NLZA 2N3ZA 1TF2A 2QV7A 3ESCA 2Z0MA 1V48A 2EF1A 3A3PA 3ANLA 1KO5A 2Q3LA 4YNBA 4TLLB 1O95D 3U40A 4MARA 3HFJA 2VP6A 5I7RA 1CUXA 2ZJ0A 1N32B 5CDYA 1T5LA 1V5EA 2H17A 5CB8A 1BHSA 2IHVA 1U7TA 1MAUA 1X0VA 2V7GA 3L7KA 2OUKA 4GX1A 2H6EA 3LQQA 2NP6A 2DKFA 1KI4A 1G8YA 1TA4A 3ZDBA 1EFAA 1LLDA 3UJCA 3RVSA 1K68A 1QFXA 3AV0B 3ZWVA 3A2LA 5FHQA 1KDVA 2NSYA 3T3PB 3RYCA 2ODEA 4FOOA 1PZXA 4A5OA 2QJWA 2WMDA 3C45A 4ONEA 5H9VA 1G9TA 2GETA 1ZGGA 3IEPA 1ZN2A 3R3VA 2C20A 2ERYA 3JQ8A 4JX9A 4UAJA 5J4HA 4Q9AA 4Y6OA 5KSZA 2WJGA 3B51X 3ET4A 5EESA 3T7TA 4ATNA 3CBQA 2HJRA 3VYWA 3NIWA 1E8MA 2KPOA 4BNNA 2WWTA 2W71A 4LV6A 4MPPA 5TS3A 1JHAA 1CX9B 3MJVA 3OH8A 3TX2A 4EA8A 5BURA 5LLDA 1TAUA 2ZB8A 2JB9A 4AXBA 1SN7A 4D0NA 1W85A 2X22A 5A4IS 3HJTA 1QQ7A 3BREA 3IVGA 1Q3KA 2E21A 5DRYA 5FUXA 4EL5A 2C04A 1L5FA 4BTVA 5JHGB 1MJGA 1SOMA 4JQCA 1FP4A 1V45E 2PX8A 1A5ZA 2IE8A 3DE2X 4J4TA 4QD3A 5ALLA 1USWA 3IEVA 2XCSB 3DUWA 1Q15A 1ZRSA 2H59A 1L6IA 1ABEA 3QNUA 4YRFA 4D8VA 4GD3Q 1EBBA 1P7CA 1R0BA 2PMCA 1OBFO 3C15C 1ZBQA 4YJFA 2ZRGA 2V6MA 3JVIA 3LUPA 2ZXFA 3WFIA 5GGYA 1UKCA 4Q24A 1HETA 3ROEA 3PQCA 3K9NA 4FZRA 2NU8B 5D3KA 4LGYA 2AR0A 5DGCA 1C1DB 1YMVA 1XTQA 4BQRA 1RZ3A 4NBLA 2HSGA 3ZTTA 2P5UA 2PWZA 3JZDA 4J2OA 3RVNA 4CV3A 4FWTA 3DT6A 2HIGA 1KXZA 1T0IA 1VLLA 1DAPA 2L0XA 2QRLA 1QH1A 3D1VA 4BMYA 4LDRA 2VYFA 3OIFA 4YAGA 2PE5A 1LDYA 2YHAA 4QQFA 1J2EA 3GFVA 5DGHA 1QHXA 4XPZA 5E4YA 4ZVOA 2GCGA 4R8RA 5JHHB 1GDDA 4OJQA 3FUWA 3VVLA 3B1JA 3GIWA 4ER3A 4DLYA 1ZVJA 1P4GA 2C31A 5C8YA 4XRGA 3U5TA 4RZQA 3AHCA 1NVVQ 1OGJA 4HGRA 1BXGB 4RLQA 2JGJA 5ALHA 1T9KA 3R3XA 4RF2A 3SM3A 3V42A 1BX0A 1SUWA 3OZUA 5EJ6A 3A6PC 1T4BA 2VNSA 1OX6A 1N4DA 1WMFA 3RUIA 3SPXA 4CCWA 3ENZA 2I6TA 3PNMA 4PLWA 3K15A 2MSNA 4BWFB 4YUXA 3U09A 3C3WA 5FI1B 2X9LA 1OF1A 2RKOA 3BMOA 3UMGA 3CINA 3IB3A 3N0VA 3ZHZA 1AUPA 4ZQBA 1KVUA 1D0VA 3L7BA 4D99A 1PJSA 2WFLB 4NNPA 1EHIA 3A6DA 3RAJA 1CUDA 4H1HA 4NAHA 5HBRA 4XXHA 1MH9A 1PRYA 3FOWA 3CVUA 3OUZA 1QHIA 1XLTC 3C4VA 5HBGA 4C04A 1KMMA 4DCMA 5CLJA 4QGFA 3GMSA 1PG0A 1SVSA 2FPRA 4X97A 4DS3A 2J0UA 4X90A 4NULA 4EW1A 1GNQA 2ZJ5A 1QLJA 5HRAA 1PQYA 3BJEA 2BMDA 1QJ4A 1M2JA 1PFVA 3EPRA 1VRVA 3MYYA 3NRJA 4J0DA 4N0EA 4BFLA 4PZEA 5BNZA 4RELA 1FVHA 4YXFA 4Q6BA 3AR8A 2JH9A 4C0HA 2A59A 2C94A 4OK3A 3VNAA 2D5BA 4EVQA 5JD5A 1U8XX 1H2YA 2H2DA 2V7VA 3K4PA 4DIDA 3MTAA 3HR8A 4NU0A 1V6SA 2BEVA 3TIFA 2CSXA 4M1WA 2OFWA 1JDSA 1V8DA 1U5AA 2OHJA 4INOA 4D4LA 1KMIY 5JSZA 5JZSA 1HR0B 4Z9BA 3TS1A 1MZVA 2G1AA 3TMAA 5JYEA 3MOGA 4MPRA 1DWQA 2PUDA 3QQPA 1TVEA 2C7QA 4LWPA 2CEAA 1NA5A 4J2HA 1VE9A 2WUFA 1RXYA 2X5OA 1RWNA 3BWDD 2EX1A 3JYLA 4RHTA 1UMKA 2V8OA 2ZIWB 1XPUA 4C0AC 1WX1A 2H4YA 3G9ZA 4RCVA 1X1CA 4B09A 5DP2A 1T0JB 1U2EA 4IDHA 1SUPA 1YZHA 4X93A 4FOPA 521PA 2ZRQA 1BU8A 3V46A 1XMSA 2Z08A 4KRGA 1FZTA 1QE5A 4A0FA 4L51A 2OLJA 5E0KB 3X1DA 3HB4X 3K8ZA 2PFKA 1P75A 2CXOA 2L19A 4LTDA 4EI2A 1NRIA 5HKKA 5IT4A 3DNFA 1D2CA 5BWNA 5JH7A 3TW6A 5JAQA 1T4MA 3SEFA 1YZVA 2IYVA 3UOGA 3LXRA 3ZV4A 3D8HA 3IP7A 4JI3B 3VZDA 5CA1B 4I2NA 1Q16A 3VU9B 2A5YB 1JR4A 3RTAA 2R8XA 1P29A 3BH7A 1X7DA 2FDXA 5KHOC 4G0ZA 1XTJA 4BBAA 3EW7A 1G8KA 1HYGA 5HOEA 4ZVLA 2G9VA 2PWPA 2UYQA 3C7DB 3P9ZA 2PJRA 3DLHA 3Q0TA 4QULA 2RSLA 3U3XA 2G1KA 1I36A 2OC4A 5FI5A 3NRCA 1TLTA 3D6MA 4RSHA 3ZS9A 3GJYA 2Q9BA 2PRJA 3MMPA 3RIEA 3AUXA 4XASA 5DYYA 3TLBA 4BNVA 2VXYA 3U0BA 3UFXB 5JOQA 2NZ8A 4EFMA 1LBQA 1XZJA 2BPOA 4FXOA 1JIJA 3MYRA 2Y27A 4AKIA 4LPSA 5G0SA 1GEEA 2XZOA 3EHDA 1KMHB 3D5QA 3MWYW 3JATB 2P79A 5FNVF 2B1GA 3UW3A 3O73A 3X2SA 3PEWA 3GXBA 5IUNC 3DB1A 1LC0A 4FB4A 2FWIA 1E3IA 2PQ0A 3GJ3A 3N2GB 5C34B 4YRZA 5KB3A 3ZE2B 1I5EA 1KZHA 1OX4B 1O94D 2PR7A 2G6BA 5G0UA 4R4JA 2UZ4A 5PGMA 4DDVA 1D9ZA 1HA3A 1ZD5A 3B2EA 4NICA 3L1UA 3MFQA 4BO5A 4L72A 1O5TA 3DZHA 2B1RA 3A4IA 2OCXA 1IQPA 1BFDA 3KT0A 4WPGA 5FUBA 3EG5A 4A2WA 4QRIA 2BCEA 4BQQA 4EF5A 4BLWA 4JUFA 3KXIA 3QIVA 2OD9A 2HFKA 4D74A 3O75A 1BE0A 3G17A 1MTZA 1NI4B 4FE4A 3DLAA 3T1QA 5IHXA 4IIVA 2HREA 4EHKA 1MO2A 3IRUA 1ADFA 1J42A 2BELA 2CLHB 3PXAA 3F47A 5E3JA 2BGLA 4A5SA 4M0FA 3DEFA 5LQAA 1GRCA 2HPHA 2I55A 1TAHA 2GHIA 4H4EA 3UB3A 3UIEA 4UVGA 4EI7A 5KTOA 2W2PA 2O54A 3E03A 3A2KA 3CLRD 2WJJA 3QG1A 1T9CA 4YY3B 3BFVA 3OI7A 4BQEA 1CYEA 2VDVE 1ZUHA 2C83A 1BEZA 1JA0A 4RPHA 1NW5A 5DT2A 4M1YA 2DLNA 2IOFA 3F46A 4XWGA 3T9EA 1Z0FA 3K5IA 4JKIA 2I34A 1FIUA 1EXMA 2YN4A 2C8LA 2JDID 3IQEA 4GLFA 4NMLA 3NX4A 3S2SA 5JNTA 1UDAA 4ZN6A 1NVUQ 3O94A 4Z7JA 1DRKA 5JRJA 5KQPA 4XWTA 3GY0A 4AYXA 3N5CA 5MN6A 2FI1A 3I39X 1E9RA 1BXZA 1AKRA 2WT9A 4D9CA 4J7UA 3WWCA 5EINA 4UM7A 2QTFA 3QVMA 1X7HA 3RARA 5B64A 1GIAA 1T1EA 1DAEA 5K0FA 3OWHA 4UHDA 4HAIA 4M88A 3DMGA 3H17A 2ZJOA 4FGSA 2GJKA 2C29D 4IMIB 2YNMA 5KOJA 4EPVA 1WP4A 3AU9A 3LXXA 3Q7RA 1XRRA 3TQSA 4G5OA 4RTMA 3KWJA 4P0PB 5EPOA 3K16A 2CYCA 1CHDA 3AF5A 3EZ2A 3PQ6A 3ND7A 4QQ8A 4W6QA 5JXGA 2R6CA 4N5DA 4MLZA 5JQGF 1DL5A 1W25A 2FWPA 4HD8A 4EJMA 3BTOA 5FORA 5KMGA 1G66A 1N8NA 3VR0A 4JI8B 4RGYA 2DP4E 2ESRA 1FMJA 1IHUA 3H4MA 2C3PA 3ZCQA 5FJIA 4NK4A 4PLGA 2RHCA 3THXA 2FFBA 2FW6A 2HRZA 2P9QA 4LIPD 1ATZA 4QAJA 4XQEA 1WB6A 2VP9A 2H29A 3JQ7B 1NU6A 4O4HA 7ABPA 2FG6C 2K2QB 4WY2A 3FFWA 2HMWA 3PXXA 1JYSA 2IZZA 3R40A 5EGSA 1HF3A 1XVUA 3V8BA 2IXFA 2HB6A 3WLJA 1SOAA 5DM70 1R0LA 3Q3VA 3PE3A 4INAA 4M9XA 1TMKA 2PBRA 3GUVA 4PLYA 2JLZA 5J1TB 3DF7A 1EK2A 1RKXA 3AUUA 1EHCA 2RG1A 2CMDA 3QBJA 1G21B 2JGKA 3EUWA 3H2KA 3H05A 5KNDA 4A0HA 1APBA 3K6SA 3HNOA 5JJ5A 1NY6A 2PH5A 3MERA 5CIWA 1PWXA 1ZJ6A 2BR4A 3B1VA 3EEQA 4QXRA 4ZT5A 3TGWA 1K2WA 1WOMA 3WGMA 3IJRA 3FHCB 3FTCA 1OH6A 3I8XA 2I62A 4OCZA 4RKYA 1XL1A 4WW0A 2EWWA 4IJUA 5DE3A 4LI3X 3O2JA 1H2BA 4N3BA 1RMTA 1MJFA 1GUBA 2I3BA 2XNHA 3ER6A 3NOVA 4QG7A 2F2TA 4B7ZA 4DG5A 5JJCA 4OGLA 5IJWA 2BSXA 4I55A 5CD9A 2ZWVA 1HLGA 1J5XA 2VPZA 4ZMSA 4FT2A 4S2UA 1N7HA 5JAOA 3EVZA 5HG0A 3IXMA 4ZKEA 1JXAA 1BW9B 4A82A 4CF4A 5DYIA 4Z7NB 1TEVA 3CVXA 3SMQA 2PM8A 2WUWE 2AI3A 1RXIA 4QUJA 1WL8A 2VUUA 4R5HA 1V0JA 1M5RA 4IRUB 4CQMD 3JR7A 4N01A 4UARA 2R751 3RVRA 4TKLA 3SJBA 421PA 4EL0A 1DRVA 2IVZA 1OFVA 4PG4A 1YB7A 5DSXA 1RLIA 5ALXA 3AY0A 2CXHA 3Q40A 1AHHA 3P19A 4NYMR 4EITA 4KFUA 2MJLA 1QKIA 2RBEA 4EW6A 3WR5A 1NUSA 4J0KA 3DGFC 1NVWQ 4RK1A 5E8RA 5HMMA 5A1TA 3G49A 2O23A 2CCKA 1H4TA 4PHFA 3ZQ4A 2X5XA 2C2ZA 4GMFA 2ZSFA 2ADMA 3RUCA 4DMUB 4F1JA 4KRFA 5EFOA 4OSEA 4Q1DA 5CA0B 4TKUB 3S2GA 1BJRE 3NGMA 3EZLA 4GBED 3R7FA 4KE7A 3RFUA 4FFBA 1NJ5A 4BMXA 1UC4B 1ZM7A 1ZCJA 2VLIA 1Q50A 2Z8YA 1XLWA 3MCTA 4LF5B 1W2GA 2YIMA 2GYYA 4E08A 4B85A 3QFCA 1I1QB 1JX6A 2GNPA 1KAHA 1SKAA 2DFDA 2PVSA 3ZVRA 3MWKA 1RI4A 4KX5A 4RA9B 4UNQA 3DLIA 2ALJA 3E22B 1W87A 2QSZA 1TUEA 1XAHA 1Q0SA 3VKVA 1DKUA 1NF2A 4HNAA 4L9AA 2NU6B 2P9BA 4GOKA 3JVDA 1WU7A 3E7FA 3ETDA 4WZBB 3ZWXA 2YFHA 3GEIA 2UZ1B 3L4JA 5LIRA 5AUPB 1CDEA 1PQPA 3UPDA 2D5CA 3DOCA 2FPIB 3K2EA 2FE1A 3TSOA 3FYCA 4LJKA 4YR9A 3T95A 1L7QA 3Q1LA 4IV0A 2QIOA 3V6LA 3RV3A 2ZTUA 3DHNA 1PL8A 5GV8A 4B3RB 2Q1SA 4KZKA 3DVRX 5JDIC 1UBHS 3P1JA 1YZFA 4S3MA 1GR0A 4AMYA 4G0MA 2W2NA 4XUEA 3DSRA 3UAZA 3WX0A 1KARA 2AI2A 4DA9A 2H1RA 5SY6A 4O2BA 1Q2UA 3BRCA 3IBFA 5F73A 3BXZA 2CMKA 1Z2PX 4Z9FA 1CUVA 2B83A 3GGJA 4NBUA 3T7IA 2O7QA 2AN3A 3V2HA 3AP3A 3E8XA 4E14A 1EJ2A 3H3XA 2PGDA 1WG8A 1YA4A 1MDFA 1PLKA 2EZ4A 4GOXA 3VGPA 1OXUA 4BEVA 5BV2P 5CXSA 3NWOA 4HAYA 1YMUA 1ZUNA 3R9KA 3TD9A 5C18A 4C4SA 4CMEA 2PNFA 2PSJA 2O57A 1AOXA 3CX6A 3ZJUA 1JR3D 4DSZA 3VV2A 1A4IA 1E1DA 1PNOA 3P2EA 1Z26A 4PO8A 1VKRA 2ADFA 4EGAA 2I78A 2GFIA 4REQA 1I4TD 3OT1B 1O03A 1XZFA 2UUOA 1SFRA 3LL4A 1WS6A 2VDPB 1CDZA 3W4JA 4YRRA 2Z30A 1X7WB 2C61A 1HQKA 2HKIA 1GQSA 4L6IA 4YWJA 5IFLA 1PZGA 1P91A 1T4DA 4TYMA 3OG9A 5AW2A 3NPAA 3ENQA 4OHRA 2VN8A 5GVRA 4YUVA 3CLKA 4WGGA 1R6BX 5KNBH 2C7VA 4F3NA 5ENVA 4B4OA 1UFOA 1GG9A 4TM7A 1O8CA 4MW2A 4CM4A 2ERXA 2C57A 3BDAA 3M9WA 3KXDA 2COUA 5AOVA 3TL2A 1IG3A 1ONPA 4DR7B 5DYTA 1B76A 3KYCA 2OLEA 5A0VA 3IPXA 4TV8A 2BHRA 2BKAA 1G3UA 1TU0A 4MB6A 2FYTA 5C7YA 2M6SA 4GBMA 3WGTA 2NO7A 1T8WA 4IMPA 3BL6A 2BM9A 3LCUA 2JKZA 2O8NA 2ZJBA 1X2EA 3PG5A 2XUJA 1J7KA 1K88A 4X1IB 4Y6RA 1PUXA 3SQXA 2OV3A 4WFKA 1M6HA 2YICA 1B8PA 1P3JA 4LJ7A 3ZY2A 1XDSA 4BO0A 2PT6A 4GM4A 3PX2A 4NENB 5CB0A 2GQ0A 4FJ0A 4L9RA 2BE9A 2ZZMA 1ZK2A 4KXVA 4JCOA 1IOWA 1U3GA 3WLSA 4CR6A 2OAGA 1WBJB 3R0VA 5AW8A 1V35A 3DE5X 1VB5A 2XY4A 3UGJA 1CY2A 2PKYX 3BQMB 4IEEA 3HCEA 4HDMB 3IVXA 4MGZR 1E5QA 1NWCA 5AKIA 1UADA 2GCIA 1YDHA 1NQ5A 4QJ4A 4HYYA 3CX3A 2PUAA 4GX5A 3E82A 3LCCA 4QYWA 1ESZA 3N76A 1WTCA 2VPTA 4TLAA 1LTQA 1T9BA 2Z83A 3L5KA 5BOVA 2IS6A 4MMYB 5U4XA 3RAFC 1G2PA 5BOSB 5I9IA 3DMTA 3VKWA 4IQ4A 3SZLA 3S2IA 3LUKA 1JBKA 2VK2A 3VMFA 2PX6A 3GAMA 4MV8A 4NBNA 3WQHA 4N6GA 4V1CI 4IO0A 2FZEA 3EOBI 2E4WA 3V4SA 5ELLA 2OOKA 4D42A 3DEAA 1QRSA 4ZJYA 1FK8A 2GBCA 4WZZA 3IP3A 3IPAA 1JDBB 3W7AA 1R4NA 4C4AA 3AEQB 2NXNA 4JASB 4LHSA 3PTZA 4PXSA 1KIFA 4HWTA 2CF5A 2J1LA 3FPCA 1ADYA 3IIKA 4PX3A 2NU8A 2XBMA 4OP3A 1NX6A 3TD2A 2CZGA 3GDGA 2OGUA 5AJXA 3CNBA 3I6MA 2QP9X 3DKPA 3LPNA 4PZ9A 3DV2A 1XJ5A 4XB2A 1E6MA 4URVR 3U7IA 2H11A 2IXBA 4CIBA 1YIAA 1UZUA 2CLMB 4GXQA 3W2GA 4NXNB 3GT4A 2Z4RA 2PANA 3VU3A 1DC7A 3QKIA 2VOEA 1CR2A 1SUAA 3ZNNA 2CJWA 4ROTA 4BB0A 1R5OA 3P9NA 1U02A 1W0KA 1XRQA 1AT1A 4II3A 1POXA 2H06A 1PWHA 5DZSA 3BWVA 2G04A 5P8WA 5DBFA 1QGYA 2WT8A 2GDJA 1VE5A 1BXGA 3HJNA 2YXEA 3I6IA 4N5IX 3CHYA 5JXHA 1ST3A 4NYIQ 2ZKLA 4IH1A 5TLSA 4BKQA 2VC2B 1BWRA 3HJAA 3KSRA 5ED4A 1TI7A 2G70A 2CGEA 4G41A 2A1IA 4ZYLA 1JF8A 2WIFA 4LRQA 3ZV3A 2YXNA 5IT5A 2J7PA 2WUDA 2YCLA 4TTJA 3HKDA 4CMGA 3LY9A 2G1UA 3CSUA 3HG7A 2WFLA 2QOEA 3AMVA 3RVQA 2R8ZA 5ER9A 4MUJA 2PX3A 4RD4A 5F5LA 3U9TA 4C3ZA 3Q7PA 1PEYA 1M0TA 3KJFA 1N8KA 2AG8A 1C2TA 1ZA1A 2GSWA 3B53X 3MEQA 3R3SA 1WZIA 4IWYA 4K9PA 2NXCA 3GXOA 3H2GA 3MLEA 4JQSA 4MV9A 5DEOA 1N3LA 1L5MA 3ACCA 2DKOA 4YT4A 2HK9A 5AJHA 4QPCA 3RIYA 3S4YA 3AY6A 3R0ZA 1T3ZA 2HSJA 4FHFA 4EFNA 2X6RA 2PUBA 3CZAA 3AVXA 3KKMA 2JHPA 3VR4A 4NE9A 1XZAA 2WMOB 4KAJA 1M0SA 5FLKA 3L0IB 5KAPA 4U2EA 1QF6A 1M72A 3RYTC 2V6FA 1Z17A 1J9ZA 3IKMB 4MV4A 2OWDA 4N76A 5IBRA 1RJGA 2Z9CA 4X6XA 3D6JA 4OJYA 1D2HA 3USZA 3SKXA 5J4LA 1BVRA 1MRZA 2W98A 4HB3A 3MHTA 1FRVA 4JEUA 2WEKA 5JASA 2HYIC 4Y2XA 1KKUA 3QOXA 3R0QA 2HJWA 2IYXA 4JOBA 3DVSX 5GZ6A 3MUNA 1BVHA 3SBOA 4NECA 2GT1A 1QGED 4KYTA 3T12A 1WV1A 4PPGA 4UREA 3ANMA 1SNYA 2BFDB 3IUBA 4HEJA 3V80A 3QEAZ 3CVWA 4G4GA 1W30A 4N48A 2WLSA 1J6UA 1L7OA 4LF7B 1VHWA 2IKQA 2OC9A 1Y3CE 2JJ1A 3VOSA 4G36A 4YP0A 1GKYA 1KF0A 2YV3A 3KYDA 2ZOSA 5KBYA 3L1VA 5EWMB 3S6JA 2DY0A 3IAHA 3G68A 1A2BA 4LQDA 2MSKA 4H4CA 3S28A 4MRMA 1YI8A 4HT3B 2IODA 3EX7C 4OAOA 3BDVA 4UHEA 5ALWA 5IX8A 1PBTA 4NOJA 1G38A 1TAQA 1A72A 3OX3A 4PAOA 1C4KA 3F3KA 3KKLA 4UEJA 2ANCA 3OAAD 4HEHA 1E3WB 2LIVA 4DSTA 2F1RA 2GCNA 2KW5A 1Z6QA 3VU9A 2H8GA 2H63A 1AGPA 2KYRA 3NT5A 2B3TA 4X64B 2RI6A 2XQJA 4RIGA 1ZN9A 3WIOA 4MDFA 3H75A 2ZT8A 3GRUA 2XADA 1GDHA 4GSKA 3DDUA 4U7GA 3KOUA 1ZGHA 4GQBA 4XCQA 1J2TA 2VCEA 4Q02A 3C7AA 1ZRMA 2BCGY 2PSEA 3CX7A 3QEOA 4HS4A 2ORED 1RCUA 2ZVDA 2UXCB 4A8JA 2W8BB 1IPEA 4CHTA 1XTPA 3WXMA 3AZQA 3FCXA 1E9FA 2J33A 5KYGA 1J8QA 2QVLA 2R6AA 1ESDA 3BCSA 3B3GA 3DPSA 2QMOA 4CM1A 2VA8A 1MCZA 1KMHA 3JASA 3AJ8A 3JATA 1PD1A 4H3SA 3L7OA 4RADA 2BR3A 1VLVA 3V48A 4UNSA 1P3DA 5G4KA 5ULLA 3RSCA 1UC9A 3WB0A 4AU1A 4DN6A 3HSSA 2B4AA 3KYJB 1AU9A 3EXFB 2Q9UA 3RQSA 4C7XA 3PJFA 5EE3A 1OX4A 1XU7A 1YCGA 4HFMA 4QFBA 3EVNA 1BMDA 5CG1A 5ANRB 4US2R 4XD7A 5EE0A 1XCGB 2NM0A 1L4BA 2XOKD 2EV9A 5G4LA 4O8ZA 3BJMA 4CG1A 2OGWA 1MIHA 1C7RA 3G3EA 3RYFA 1N5JA 1CFZA 1QHNA 2JD0A 1KYZA 3JWEA 4MUKA 4MRPA 1XK6A 2AYXA 1K8QA 2P7HA 3W2TA 4BNTA 5AVZA 2VJOA 3GNSA 2KQUA 5E1BA 4DMHA 5F23A 3PPWA 4IX9A 4KE6A 4LJ5A 4X3OA 1NI4A 1U8AA 2I3AA 3FKSD 1RADA 3E4CA 4FYXA 1JYEA 2F6RA 2W6MA 4IEIA 3GYBA 4MUMA 1E69A 4E5PA 4HN2A 5JMWA 1FLDA 1VDZA 4HBZA 4CIYA 4CZ2A 1EZ4A 4DPLA 1AD2A 1QVWA 5CYGA 2CVFA 2I1LA 3OWXA 3C3PA 1F9AA 4G97A 4JA0A 3BCRA 4NHOA 5HXAA 5CPFA 2RFLA 3HGTA 1K3TA 1XVIA 1YB1A 2CWDA 2I22A 2VF2A 4P4NA 1KO4A 1XDBA 3RS0A 3EDQA 1EFCA 3CZ4A 3BHMA 4FGWA 4UU0A 5DBGA 4GT1A 2JIZA 3BFPA 1XCMA 3CVVA 3JQBA 5DM2A 1HNWB 3D3JA 1XTRA 2PS0A 4AG6A 3CLSD 5AKJA 3T94A 1JXQA 2B1IA 2Q07A 2JCSA 2O52A 2Q5FA 3A6LA 3C7CB 3PWSA 2I4NA 3OEYA 4TWJA 5CX1B 2YVAA 3X44A 1CZKA 4D44A 4DCJA 1E1QA 1I3NA 4GPBA 3ROGA 3HKCB 3HGMA 3ZXIA 5A9SB 5L7WA 2ZS8A 3MT0A 4B34A 1THGA 3OURA 4C0JA 4M54A 5HF9A 2X2EA 2N46A 4L3VA 2OXIA 4ZI7B 3AI7A 2ZT5A 3EBOA 1UPUA 4UHBA 5FOTA 4J7CA 2EG5A 4BRUA 3QBDA 5JC8A 5JSUA 1DDGA 1I4DD 2DCMA 2FUCA 4YT5A 3PDUA 4AAYA 3LUHA 3P0JA 1RRCA 4K7JA 1T8RA 2VHXA 4Q7QA 2GBGA 2Q3BA 5EIFA 5TIIA 4GSYA 4IF6A 1S8NA 2ZZNA 4R1TA 2J3KA 1OT5A 2ANBA 3MTEA 5ALDA 1KP3A 4KLZA 4IZ6A 2OO3A 1UOPA 2O2YA 1LPOA 2AD5A 3O4HA 3DMRA 2ZBRA 2YWXA 5TB5A 4Y67A 3VR6A 4TMVA 3SP1A 1PYGA 1YUBA 3D64A 2AQ8A 4KWEA 3ROMA 2HMUA 1NPTO 2UKDA 4ZTBA 1LPMA 3EMDA 1VLZA 1DKPA 4AD8A 4ZTUB 3WJ1A 1BZYA 3CRRA 2ZYDA 3CO5A 5I7EA 1ZW6A 4YJ2F 1YT5A 4LYFA 4NOKA 4D02A 4KV7A 2YV5A 4XJXA 1MH1A 3JQ7A 4WOPA 3KOZA 2JK1A 2P2LA 1YFZA 1GQQA 2HOQA 1ZNYA 1K4YA 2VYVA 3CRZA 3IA2A 1LBTA 2FJUA 1YR1A 2GN8A 4RVUA 3VDXA 4LY3A 4D45A 2AFRA 2BEKA 4ZHQF 5EIXA 1AGXA 1ZL2A 4WINA 1JR3E 1PCXA 4G86A 4Y1RB 1J8DA 1M1YE 3CUSA 5JO9A 4P5PA 5ISMA 3HVRA 3GEEA 2K4MA 4D0LB 2DFVA 3QX7A 3TLEA 1G21A 1B1AA 2GJ4A 1S1MA 3MB5A 5T6MA 1MQSA 3SK0A 4CM9D 2KHZA 1FYWA 4QNMA 2ATXA 4Y6QA 2FXIA 3OPYB 3EEOA 2J5KA 5KCZA 3WB9A 1Y4UA 2XTAA 1S0UA 1ZMRA 4IMJB 4HGQA 4LTNA 4M9SA 3T3GA 2A5JA 4B6GA 4QGHA 2IS2A 1G18A 3F78A 2WAAA 3DZCA 5DYWA 1ZONA 4JJIA 4YMWA 1TZJA 2EKBA 1NOKA 1V1MA 3VDQA 1MA3A 3B82A 5JTTA 2VQEB 1DMSA 4Q4AB 2P0AA 2B20A 1PR2A 2ATIA 3NWPA 1OIXA 5K4AA 3TKAA 5B2EA 2QAGB 3Q3EA 1BW9A 2FU5C 3MW8A 1J0CA 2BUCA 5C9ZA 2HDOA 4ERNA 3AKYA 1KJ8A 5HKBA 2PIAA 3DS8A 3G02A 1ZH4A 4BRSA 1QTNA 3FCOA 4R2KA 5IUKC 1ZGAA 4UUBA 3CH5A 3H8WA 3SYNA 1ODTC 1H05A 4LDQA 3QVLA 3D7MA 3RLFA 3QF4B 4WEQA 4AQ7A 4UM5A 1DXQA 3PEFA 2VNHA 3IH5A 1D2AA 3BIFA 2G0NA 1EMDA 3LBIA 1WQ4A 3W04A 3GJ0A 1U9IA 1QUFA 4IQ0A 2JZCA 1VZ2A 3IC5A 4HAXA 1Y8CA 3UMBA 5IBCA 1QO0D 1DJOA 4TZTA 3OTQA 3EXIA 1VLJA 1HC7A 3FCAA 2VPYA 5CA0A 4TKUA 1E96A 3T6KA 4BLOA 2JARA 2ZSAA 4J1QA 5CLQA 4ALIA 1UJBA 4DYDA 4OKSA 4Z4FA 1GFZA 2FB9A 1E2GA 2VSFA 3K0KA 1TM2A 4GKVA 4N0MA 1E9BA 1Q0LA 2EJCA 1WHTB 3ZH2A 3TBFA 4D4GA 3AM3A 3G2OA 2DHRA 4V0KA 2RG7A 4OH1A 4KQCA 4QVIA 1Z37A 1EVZA 1R6TA 2CLOB 3OCUA 4KN6A 2AJ8A 2WKRA 4LHVA 5DSTA 2ZRLA 3GLKA 3RT7A 4RA9A 2NXJA 1K66A 1BKYA 4DT1B 3EPLA 3W8FA 3E22A 4B82A 4MQFB 4NCIA 3SYMA 1NJ1A 4AG5A 2W5UA 3D6NB 1Y37A 3G5TA 4EP1A 5CVVA 1SC6A 2XMRA 3R6LA 1JE0A 1P0QA 4K5QA 4GVPA 4LJ6A 4K9RA 3KQPA 4RZ2A 4CKEB 3T5GA 1O97D 4F85A 1P0PA 4FBLA 1GUDA 4FSDA 5H9WA 3SE0A 5KEIA 4RVSA 1IM2A 1KJNA 2H5LA 4HAOA 4NYMQ 5U9CA 1P5ZB 3Q7SA 1XP5A 3USCS 4BO4A 3S2YA 4D4MA 4E5MA 2QLJA 2XYRA 3ISTA 1DJMA 1UF9A 5L3SB 3RVOA 1KQ3A 1FVOA 1FLAA 3HWSA 2QQEA 2JFBA 5FOQA 1XBTA 4U0KA 1U2GA 2PCLA 4XAQA 1LK0A 1QHHA 3AETA 1O77A 3L7JA 1XUOA 1Y8ZA 2BH2A 4X7BA 1U1FA 2VZLA 1RQGA 4D82A 4ZT2A 1UXOA 2FZCA 1IN5A 2BGRA 4HJXA 1EFVB 5J2TB 1O1YA 1U9CA 3F74A 3CMMA 1PT7A 4AQDA 1LPBB 1SAYA 3W7BA 3U80A 3B5JA 4O4LB 1Q91A 4HDAA 3C6MA 4C76A 3O5AA 4MVWA 4FDUA 4TKVA 1H5UA 1P5FA 2H5IA 3ZBQA 3PUVA 3TH5A 4ZVMA 1F60A 2P4EA 5LSAA 1Z25A 1TQ2A 3T99A 5BWOA 1JFFB 3C5VA 4ZWNA 3PNVA 2FETA 2FW7A 4NU5A 3FYUA 3DV0A 1V5WA 5KWEA 1Q44A 1YL5A 2EAUA 3OZCA 3WRWA 5C5EA 1V4VA 3M82A 3OT1A 1DUIA 1G16A 4IXNA 2COKA 3TUIC 3EDOA 3ZJ4A 2A0YA 4ZOCA 3NNDA 1RYBA 1SXQA 2ZITA 3TR0A 3RVDA 3NHSA 4ZT7A 4QBKA 5J23A 4II2A 4PQYA 1BC5A 3C1UA 3BVPA 3NDJA 2A3RA 3ZIDA 1AH2A 3IIJA 2JJ2D 1BS1A 4FGJA 4XJVA 1NVTA 3EWAA 1J2UA 3LBFA 2GD0A 2NP7A 3I09A 1XR3A 4N9QA 4NFYA 3GRCA 4DZZA 4WUVA 3SZGA 2IZOA 1DV2A 2XB4A 3ZWKA 4EHLA 2P0YA 1LRLA 1SOVA 3OU2A 1PGNA 3MT7A 5DX1A 1W94A 4M4SA 3TW8B 3ZC3A 3RSFA 4K9NA 1WUYA 1H8ED 3QENA 1ECGA 3VVMA 4ENPA 3V1KA 2YJTD 4WHMA 2ACKA 4QUDA 1GLNA 2CL0X 3OZVA 3U17A 4DJDC 4HZGA 5LP6F 3THOA 5HM8A 4FFNA 3G7NA 3WKDA 1GT6A 1X14A 1A96A 4MWSA 2JGIA 4WLFA 4NH0A 1E3DA 4X1IA 1W8IA 4CG2A 3E5NA 4X94A 2CCJA 3HKBB 1H66A 4NYJQ 1N6NA 3VC2A 3M2TA 3LT2A 5LP1A 1FNBA 2C42A 4JQOA 2EWVA 3UMFA 2NTYC 1CY1A 1E6WA 3O8BA 1SVKA 5AW9A 2HHJA 1A69A 4U9UA 4HSEA 1B1CA 1NAHA 1E2FA 3EMKA 3LD9A 1N2CA 5DGTA 1JHQA 1QCCA 1PLJA 1SBHA 2RI1A 5E9JA 5LUBA 4GRDA 2G76A 4AN4A 3O6VA 2Z2YA 5D6NA 3OP1A 4DM3A 1G8FA 1B6RA 3NZEA 4LJ8A 1MOQA 1QRAA 3BK1A 4HDMA 4QDTA 5IDVA 2HYDA 3SJUA 3VDMA 1ML3A 1NXQA 1QHGA 3OLQA 5BVGB 4JYZA 4RK4A 3CG0A 4LDNA 3V3KA 3ERCA 2RKBA 4UCXA 1SCNE 4MS1B 1KJZA 5D3QA 2JVKA 3ILHA 3WICA 3SG0A 1JSRA 2CJYA 3NXSA 2BE7A 2QVYX 3SAJA 3D2BA 1OJ7A 4ODIA 2X4DA 1L4GA 2ZXEA 3E9CA 4L0MA 4UXHA 4F5ZA 1CDOA 3GEGA 2HUNA 1V5FA 1C3JA 3EGXA 4QEKA 4PIPA 4NARA 5CFOA 1BDBA 3DFIA 5BP7A 1O58A 3U31A 2HDNB 1DEXA 1RPTA 4BEJA 5CCBA 3BTUA 4BJ5A 2M1XA 1R5JA 2XDQA 1WMAA 5AW7A 3H7IA 2UZ0A 4F2GA 3KZMA 3WMWA 1T6NA 4BMOB 2F55A 3AVYA 2I6XA 5T4BA 2IU6A 1DUSA 1MX1A 2DFKB 4FINA 1T9DA 4ZOLA 1W34A 3VKFA 1LRKA 2VDNB 1UT6A 2YRWA 2HLNA 1O4VA 4Q9NA 3WIDA 4PYOA 4DQVA 2J3QA 4UATA 4XARA 2P67A 1XEAA 1F6WA 4QOIA 1GNPA 4JDPA 1TLFA 1SMKA 4GF5A 4MEJA 2PXAA 1F6BA 1ID1A 3C3XA 5LM3A 2OFFA 4L9WA 1SKUA 1XF1A 4FKMA 5EP4A 5F12A 1GAXA 1T0BA 2QTGA 3LO5A 3JWIA 3B1KA 2NYUA 4R1NA 3KT3A 3M1AA 4LF6B 5CA1F 2XGJA 1G5QA 1YRQA 3N8KA 1F0KA 4BV2A 5IU6A 2ILTA 2ZTMA 2WILA 4TTSA 3EGEA 4QWWA 1FBNA 3JQFA 2YJ4A 4RIEA 2XDWA 3W8RA 3WYFA 2NT3A 4J94A 5DMHA 2GF9A 4DPMA 5BMVA 3OJWA 4F04A 1A82A 2ASVA 1VMIA 3FFTA 1SG0A 2VKTA 4Z9AA 5GONF 1YFJA 2QHXA 3FNEA 3RC1A 1E32A 4R1PA 2HR1A 3MHPA 4N39A 2GK6A 2WM3A 1GQ2A 2ZR8A 2PSDA 1HE3A 3D4OA 3FPAA 2AA3A 2R7NA 4GOLD 1COZA 1ONSA 4LF9B 2O0HA 2EP7A 5ES3A 2VK4A 3FGPA 3PD7A 4JFRA 5HQJA 5A7FA 5I4CA 1Q0RA 4WT7A 3REQB 3VHLB 2NUBA 3D8BA 1JQDA 2BUAA 3GELA 3IT3A 1GSOA 3FCSB 3GEPA 3NKVA 3T06B 4ERXA 4Q6WA 1W73A 3C87A 4CWAA 1SXJB 4P98A 1XSEA 2IHYA 3BWMA 1YB4A 3I30X 4TLCA 1W8DA 1N7IA 3A06A 3DBOB 3I92A 4UBLA 4HYEA 4B87A 2GD2A 3R7NA 4YMLA 5AVUA 1C1XB 5KNCH 4X24A 1E6KA 5IBPA 4L5YA 4N7JA 4QJ5A 4BXOB 3OZEA 1GNTA 4F4CA 3HO8A 4L3WA 4FCCA 3BMQB 3RYIB 3TFWA 4YR7A 5MN4A 2GK4A 3R2JA 1OBOA 4K6CA 4JITA 1FDUA 1ADCA 3ND9A 2XSZD 4LFBB 4K2HA 4PGGA 2BT4A 1T8UA 3FVVA 3RRNA 1DKRA 4IIGA 3OTIA 3P9PA 1C5KA 4TUYF 5F98A 1L3IA 5B58C 4KMRA 4LJAA 4A2CA 2BWJA 1M2FA 4G2NA 1NQTA 2FN4A 1KMNA 1V9CA 1F2TB 4RQTA 1RAAA 3BB4A 2P5YA 1W1UA 4B81A 1FQWA 1JIQA 4EUKA 5KINB 4JXKA 4TS9A 3LHSA 2QE6A 2E55A 4OQ4A 3FHLA 5G53C 2DSTA 2C9YA 4E3ZA 2ISCA 3B2NA 4DLAA 4QA9A 2I3GA 1PJ2A 2Q6LA 5AHRA 1JHPA 2PUCA 1L4FA 1JR6A 3E27A 3HVKA 5GM2A 2P6OA 3NP7A 1NF3A 1GG2A 3GLTA 1DAIA 1NSYA 3BMNA 1RCFA 1B2RA 1ODCA 4FD3A 2J6CA 1Q7CA 3GD7A 3DE4X 3IQGX 4J1NA 4JN6B 3QG5A 3AR9A 3DZIA 2Z95A 4PSCA 2W6JA 4FDVA 4GEGA 3ZV5A 1J39A 3OZGA 3O47A 3A1UA 1RAFA 2C2HA 3K7EA 1A8IA 2JG3A 4J0EA 2F4NA 3JQQA 3CNLA 3AQ4A 5TXGA 5BR1A 1KEEB 1SR8A 2F1OA 2P3OA 3JVUA 3GEBA 4IKEA 3LQFA 3RRXA 3SI7A 1E2QA 4AJPA 2P9YA 4U00A 4ZIRB 1R6AA 1K63A 3V4PB 5KVVA 2XCLA 2R00C 1E3WA 3WL4A 5JZBA 3LF2A 1STOA 2JVJA 2ID4A 5LDGA 4B75A 1RVV1 1ACMA 2BEWA 1N3IA 1JKIA 4WDQA 2BY4A 3E9MA 2C00A 3Q5EA 3E0QA 5LUAA 4RTNA 4RQBA 2QRUA 5BUZA 2PX0A 3N2LA 2CD7A 2JASA 4QODA 4HP8A 1L1QA 1CUZA 1XPOA 3W4KA 2XPCA 3TI9A 1T9ZA 5A0FA 3UAVA 3LIIA 3KD2A 1RYFA 1IJFA 4DBLE 2W8BA 1RHJA 3RSLA 2FPXA 2AQIA 1M2VB 1QPZA 1EB8A 4NMMA 2GXQA 1KO7A 1IAQA 1JS1X 2AZ4A 3FF1A 3WNQA 1A95A 4RF3A 1D8TA 3UHJA 5K99A 2ECKA 1D2RA 4LV8B 3FVRA 3ILXA 3DLBA 2ZDQA 3UMCA 1DV1A 2AOTB 1W9MA 1DTEA 1JHRA 1FQOA 1Z7EA 2P4SA 1X86B 1HE8B 1IK4A 1S9DA 1AKEA 1CC1S 1O6GA 3JD2A 3UG6A 1UZMA 2XQVA 3EXFA 5E7IA 5B3JC 1RZRD 1C30B 4HPWA 5HM6A 3UM9A 4I08A 5FTKA 1PN3A 1U28C 1ZGJA 3ZUGA 1COWD 4LXYA 4TTRA 1TF5A 4J1TC 2ECFA 5DWVA 2XUHA 1B8NA 2O8DA 1G9SA 4CF5A 1QB8A 2NV6A 2P9GA 3AEUA 3BDIA 3KKQA 4YACA 2OZLA 3OIYA 1OXVA 4X7RA 3QYAA 4DCGA 3EH1A 1NLFA 4DILA 4GMKA 4RXTA 3OZSA 3BCHA 1BDMA 1QYIA 2FSVC 4PG6A 2BI7A 2RH8A 1TUIA 4WBSA 1UDRA 4BB9A 5IXYA 3SSOA 4OD0A 4PYMA 4M0LA 4N9WA 5JMOA 1GL3A 1DLIA 2QAJA 5EZYB 4HDKB 5T3UA 4QUBA 3K1AB 4R16A 4PR3A 1XEWX 5IJZA 2C98A 3G8CA 4IKOA 2Z6UA 2W4QA 2V7XA 3GN1A 1QV9A 4DDUA 3QJGA 2R11A 1FUIA 4OMCA 3UHFA 3GFPA 1GQOA 4GLOA 4BZPA 4Q1AA 1WHSB 4LN1A 4QX6A 5ICEA 5L4NA 3HXTA 10MHA 3KVYA 4QYIB 4BFCA 5KTMA 4TYNA 1HX7A 3RASA 4BZWA 5A9SA 5JATA 2GZRA 3VR1A 2QUZA 1MVOA 2Z04A 2BKUA 2ZYSA 1VSVA 3NC4A 5HE8A 2ZR0A 4LHEA 4MIYA 4MZXA 1Y3AA 1UMBB 4PC1A 3V8MA 4F4IA 1SWVA 3U3RA 4Q4DA 3TOSA 3DBRB 4G24A 3WGHA 4ZI7A 2D2EA 2QG9A 4EG4A 3OQMA 3C74A 2GJ8A 3D7KA 4QPPA 4NE7A 1U90A 4OATA 5LZ9A 2C99A 4TXLA 1WF3A 3O3CA 4P3YA 4ZVUA 4M9RA 1NOIA 2I67A 1NNSA 2YUTA 1UKEA 2WU4A 3EIOA 5EEGA 3FWNA 2HTFA 4F96A 1PZMA 2PRSA 4LDAA 4WZBE 1BGWA 4ZEOA 4AJLA 4RJTA 2QENA 3HBNA 8ABPA 4YRCA 4J3FA 2IS1A 4BPRA 1JZSA 3GRZA 4X65B 5TX7A 2D7JA 3CEMA 1V39A 1RYNA 1NGSA 2F1HA 4M53A 4RU1A 1C9DB 1UWVA 1U2ZA 2FG5A 2XX3A 2ODPA 4KWHA 4DUPA 4E15A 4MJ3A 2BSAA 3DR3A 1IVNA 1Q1GA 5TC4A 3DMDA 2O3QA 4LZOA 3O8LA 2P41A 1WKCA 2GPWA 4EB3A 1XZKA 2Q1UA 3X3HA 4IZOA 5K8JB 5J5AA 2P62A 4IZIA 5HKOA 1FRZA 1WW3A 1S3FA 1TAGA 3U0VA 2OPHA 3H18A 3QSGA 3ZOKA 5I8PA 1PDOA 2NVOA 5THXA 4E5NA 1PGOA 2M32A 3BF8A 4YRGA 4Y1RA 1AKVA 1RDFA 4HKTA 3KJZA 4LC0A 4FILA 4CLXA 5AHXA 4B6OA 3PXEA 2C7GA 4JJAA 2XUDA 3PL5A 5IEBA 3ONWA 3L5OA 4BX9A 1G20B 5GJWC 3HCDA 4RULA 4ALKA 3NUZA 1IYZA 2Q99A 4UE2A 2Q2OA 4HNVA 3O8QB 3KAPA 5A5VA 1RWQA 1YULA 2ISQA 4RACA 4OHZA 5C53B 4XB1A 3BE8A 1R0YA 1M8PA 1W5AA 2BEUB 5EIBD 5B5SA 3JQPA 3P0HA 5FBHA 3M6XA 1IXZA 1U7DA 3VMMA 1PJ8A 4GE3A 3NHBA 4U2BA 4LE1A 2JHGA 3ZNQA 5AJVB 1J24A 1W88A 4KDCA 1PFKA 1TC1A 2QAGA 3LPMA 3FPLA 1M2OA 3FZGA 1Y5IA 3O38A 3GUYA 3K8QA 4GFDA 1L2TA 5CM9C 3TCXB 3VNQA 4CN8A 2GAJA 4J2TA 1MBZA 3FVWA 4YP5A 1H69A 1P1RA 5FUQA 3UXHA 5I7SA 1E5XA 4DCUA 1VB3A 1WBBA 1YOBA 2BKXA 3HCNA 1U2QA 3DC7A 1M6YA 2AG0A 4NBKA 4Q7KA 3WK4A 5B3LA 3B8EA 2WHYA 3AYZB 3JAWA 3DE7X 4OYRA 4TWAA 1VHDA 1B0UA 1DIRA 4Q9JA 1M8JA 2B30A 1P8JA 1IY9A 3L92A 2DZDA 1KJIA 3A6JA 3OJEA 2HEIA 3KQUA 1UXHA 2HBYA 2ZSUA 3ONNA 5C1PA 2OQRA 4MIKA 2FPKA 3V7UA 1UFKA 2X0IA 1QANA 1EFKA 2B4RO 3ORFA 1TTHA 1NI3A 2ZRKA 5F3RA 3TINA 4D56A 4TYQA 1UKVY 2H54A 2Q28A 2F64A 3FNFA 4LQCA 4YAUA 1WCXA 4O3MA 1G60A 2E6KA 1X9IA 1HT0A 4LGVA 2PSFA 3AU8A 2AS0A 2XVAA 4O6VA 5FL7D 1MJ5A 3MCWA 2OY0A 2X77A 4H3HB 3SXJA 3DHEA 4QDJA 2FUKA 3QW2A 2W6ID 2GCPA 3N3AC 5FBWB 5T5QA 1L7AA 5B12A 3MSCA 1NQUA 3R1IA 1M6EX 1YZ3A 4HXEB 4DT1A 5IDXA 2I8LA 3L77A 2GAIA 4MQFA 1DAFA 1RLTA 5K0GA 1Q1QA 3NW9A 5ALOA 1CBUA 2A58A 3PGLA 4II7A 4YRAA 5SYMA 3SFZA 1RKBA 1U7PA 1GUYA 5AVOA 3N59A 3EPKA 4CKBA 4CKEA 3F6RA 4YPFA 1SCBA 5IKOA 2BW0A 4RJ2A 3KPYA 3RAPR 2Z4SA 5CBPB 2MDTA 5F7XA 1KK3A 4PVDA 4YJ3B 1RNLA 1UP4A 1ECLA 4LZLA 2XEDA 4HEA1 4BQFA 5EE5B 2XGMA 3FB4A 1LDNA 2QL5A 2W43A 3FLMA 2D1RA 3L0PA 4FEGA 4JL5A 5IJ0B 2A84A 2GRJA 1T3TA 3D7SA 1IB6A 3CF0A 4L0DA 1GO2A 1JLMA 2FEOA 1JVNA 3TZBA 5LN1A 5FTLA 1U4SA 4E5SA 3FHJA 1XRSB 3GJZA 3V4ZA 3WLQA 3I64A 3NEAA 5J2TA 1EFVA 1XDZA 3EIUA 1H85A 1T8TA 4IGAA 1I51A 1Z47A 3NTRA 1OLXA 5ESDA 3USES 7YASA 3D02A 4O4LA 3P0EA 1DCFA 1K8YB 3HDTA 4L28A 4RE5A 3UJ9A 1M33A 1SK9A 1U8FO 1TPZA 3NFRA 3T5AA 3OFVA 1PTJC 1A8SA 1YGPA 3ZIUA 1MAWA 2PN1A 3FPFA 4JMLA 1PR0A 3U6KA 1E1YA 2ZZKA 1V47A 3IJEB 2C9CA 4EBBA 3DZKA 2ROQA 1TZBA 4PYIA 4AO8A 3EAFA 4JT8A 4L78A 2VTKA 3ETEA 3CLTD 3HWWA 1YR9A 1S89A 2BKLA 2GM4A 2O06A 2WFAA 4BUCA 3W3AA 3TSYA 3TF5A 1FFEA 4FDMA 2VHQA 2WD7B 2Y4NA 2DFTA 1M34E 3AR3A 5JI2E 1V7ZA 13PKA 2NQ2C 2Y2VA 3KUKA 4W6ZA 1VM6A 3HWX1 1RQRA 4NP6A 4FJ1A 2BGUA 4KJZA 3SC3A 4CM8B 1WF6A 1Q1AA 1EKXA 3GFQA 3KU1A 1ZCBA 2Q50A 3ZWDA 5IAGA 4DJAA 1CEEA 1JECA 1XLVA 4MGKR 4WV3A 3KJGA 1DEHA 5GPBA 3EGDA 2ZAYA 2AKEA 3IDFA 3KAKA 4GMDA 4Y0NA 5JY6A 4RHFA 2QTVB 1F4PA 1Q7TA 5LA6F 4DLKA 3ZHYA 4ARBA 2ZAOA 3S1LA 3KVRA 4CKCB 1YK1A 3F0TA 3M6VA 3Q2OA 1NN0A 2XR1A 4JGGA 1NY5A 3CEHA 1KVQA 5GY7A 1XI2A 4BP9A 1GZVA 1ZGZA 2C03A 1GPUA 4N8DA 1GRQA 4QXPA 4E07A 4X91A 4HUQB 3QUAA 4KITB 4YWHA 4QOHA 3WWDA 3S2EA 5AM0A 1W49A 2E49A 3VHRA 4C03A 3O8CA 2UUBB 5TQ0B 4UTPA 2R66A 2X6QA 4M0DA 3TLZA 1RLOA 1HDIA 1ID8A 3CR3C 3CZ5A 1V5GA 3GWZA 3KJNA 4NR0A 5KDLA 3UF0A 3WRYA 4DGSA 5B58T 5BVGA 1SHUX 2IUYA 2Q0SA 2IV7A 2QDXA 2ADOA 4MS1A 5MGNA 3G82C 4MVJI 3CJQA 2I99A 4TV9A 3ZDEA 1ZR4A 1Q11A 4P9NA 1Z34A 1ZOLA 1UODA 2FSIA 4OV6B 3FSEA 3ECAA