4IWNA

Crystal structure of a putative methyltransferase cmoa in complex with a novel sam derivative
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
229
structure length
229
Chain Sequence
TFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERFVQPGTQVYDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRHHIDAYKAPTPVDVIEGDIRDIAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLHNAGFEHSELWFQCFNFGSLVALKAEDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords tRNA (cmo5U34)-methyltransferase
total genus 88
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iwnA00
2PWPA 2HV9A 4GC5A 2GA9A 3GDHA 1G6Q1 1ZGJA 1KPHA 3C6MA 4HGYA 3HP7A 4BY9E 4EQZA 3CGGA 2G71A 2NP7A 3EVFA 1JQDA 1KIAA 2ZZKA 3BKXA 4RSRA 2OB2A 1NW7A 5CVDA 3KQWA 3P2EA 5DSTA 1JQEA 3EVBA 2O57A 2PXCA 3G8AA 1XXLA 3HA5A 5EMLA 3DTNA 4GOND 3SVZA 4DZRA 3EGEA 4E31A 5HIKA 5GOZA 2R6ZA 4X60A 4ER0A 5IKMA 5LQAA 3KQOA 1JG2A 2OKCA 3SSMA 3VC1A 4YV0A 3V97A 2Q41A 3M4XA 1D2HA 1NW3A 5HIJA 4EMSA 3BUSA 1YF3A 3OZRA 4CWAA 2IBTA 3FTFA 3G2MA 3AXSA 4RTJA 4Y2HA 1FP2A 4KVZA 5ICFA 1XDZA 3DH0A 1XDSA 2FHPA 5K0LA 2JHCA 4PCLA 3KHKA 1PJZA 3UFBA 5FQOA 3KQQA 1NW5A 3MHTA 3NW9A 5B1SA 5GIOE 2GLUA 4E32A 4CKEA 1L3IA 3I64A 2CL5A 2NXEA 4BLWA 2P7HA 5EVJA 5E9JA 2I6GA 3UJ6A 5CUQA 2NXJA 2GPYA 1P1BA 1NT2A 2XVMA 5EZQA 4FP9A 3LKDA 3MCTA 3FUWA 2PBFA 2YXLA 5P8WA 3KR0A 2B78A 1T43A 2ZTHA 4MQ4A 4CXMA 2C7OA 2AOXA 2EX4A 3JWIA 5LQJA 1M6EX 2OPBA 4DM3A 3K0BA 2OZVA 4HTFA 3CCFA 2PY6A 4PYJA 3OE4A 3OZTA 4ZTBA 1RJFA 4IV8A 1EQAA 4MIKA 4QPNA 4R6XA 2AOTB 3IHTA 2FK8A 5EKXA 3BT7A 4C07A 3TM5A 5HZMA 3EGIA 2IFTA 3LCVB 4PYOA 4AX8A 4HRAA 4RTQA 2IGTA 1ZKDA 2PX4A 2C7RA 2A14A 5KVAA 4RTKA 4WXHA 5CVUA 2FPOA 3UA3A 1L3BA 3SM3A 1KYWA 5MHTA 5DRTA 2EJUA 2AOVA 3UZUA 4E30A 2Y1WA 4QPPA 1FJXA 4GEKA 2PVCA 4P7FA 2VS1A 3LSTA 1IY9A 4CKCA 2EFJA 1SUSA 4X41A 5LQKA 2PV0A 3FPFA 2JHPA 3UJ8A 1SQFA 1NW8A 2AVNA 4XUEA 3ORHA 5ICCA 3CBGA 4YUVA 1RI1A 1SVUA 3MB5A 5CCXA 3KQMA 3DMGA 2IBSA 4JXJA 1NE2A 4PYLA 3G2QA 5E9WA 4QVGA 1KR5A 1RI3A 1VP3A 3NTVA 4UOEA 4FSXA 1RJEA 3FRHA 3TOSA 1XTPA 3TRKA 3B5IA 3EEYA 5DM0A 1EG2A 3DUWA 4KIGA 2B9EA 5EOVA 1RJGA 3OU7A 5DRYA 1NW6A 3R9XB 2B3TA 5EIWA 1VQ1A 5HIIA 3EVZA 1JG4A 5DWQA 3NMUF 3PFHA 4LWOA 1YUBA 3ELUA 1WXXA 5E2BA 3GXOA 3LDFA 3T7SA 3LCUA 4PONA 2PLWA 4U7PB 3FPJA 4HC4A 1X19A 3BWYA 2NXNA 4C4AA 3NWEA 5EMKA 3TLJA 3I5UA 3NDIA 3PX3A 5EZSA 3FUTA 3ERCA 1OR8A 2EG5A 2PWYA 1EJ6A 4KIFA 5ERGB 3KQPA 2F8LA 2PSSA 4LWPA 4QTTB 4PYIA 4R05A 4PINA 3ELDA 5ICEA 2G70A 3PFGA 5G02A 2LD4A 4R8RA 5DXJA 2PXXA 3FPHA 4OQEA 4EKIA 2WA2A 3BWCA 5CD1A 3ANXA 2FYTA 5EMJA 2UYCA 3HVJA 4ER3A 2ZZMA 3SMQA 5FADA 5E9QA 5HOQA 4IV0A 4RX1A 3M6XA 3REOA 2OO3A 1YFJA 1FBNA 3DXXA 3L8DA 5GM2A 3CKKA 1WXWA 3ME5A 3LDUA 3SSNA 1P1CA 1TW3A 2I62A 1TPYA 1AV6A 3BGDA 4V0RA 2O06A 7MHTA 1JTEA 3K6RA 4GOOD 2I7CA 1H1DA 3HM2A 4GC9A 1I9GA 1M6YA 3P9CA 4H0NA 3VC2A 2NXCA 4R6WA 4POOA 1AQJA 4PIMA 3KQYA 4OQDA 4RTSA 3PT9A 5DTQA 5K05A 5CIYA 1R74A 2B2CA 5EEHA 4LG1A 4RTPA 2JH8A 1QAQA 2H1RA 1V39A 4OBWA 1RI5A 1F3LA 1SUIA 1ZHFA 2OBFA 4IKPA 4QQKA 5E2AA 5EEGA 4BLUA 5K0JA 5M5BA 3GRVA 1VP9A 5DT2A 3M70A 2ZCJA 1VPTA 5CVEA 3M6WA 3HVIA 3OFJA 1B42A 5HEKA 1O9HA 1O9GA 4HH4A 2OY0A 3BWMA 1UIRA 4PCAA 2PXAA 1BHJA 3CC8A 4BLVA 2YXDA 3A4TA 4HTFB 4AUKA 2Z6QA 4FT2A 3O4FA 3D2LA 1KYZA 3SGLA 5LQRA 3E7PA 5K01A 1TW2A 4A6DA 2IDJA 4X1OA 2IH4A 3KPYA 4QDKA 3O7WA 4V0QA 4YUYA 3EEOA 1NBIA 5K0NA 2BM8A 3UJ9A 4F86A 3BGVA 3LBYA 4YMHA 5DM1A 5BW5A 2UYHA 2ORED 5DX0A 3IV6A 2XBMA 5KQRA 5F2NA 2HR1A 2AOWA 3THSA 3FTEA 1YFLA 3PB3A 5FHRA 3OPNA 1I4WA 5T67A 4DCGA 2G1PA 2BR5A 2WK1A 1O54A 4DQ0A 5U4XA 4MWZA 3AXTA 3GNLA 4QQNA 3TQSA 4PNEA 2QRVA 5EGSA 1M0EA 9MHTA 4GUAA 2YQZA 5DPMA 2V7EA 1G60A 2XYVA 3T0IA 3F4KA 2CMGA 2H00A 3NWBA 1D2CA 1WS6A 5HILA 5CVJA 3B7PA 3GRUA 1L9KA 4M37A 3ER9A 2PT6A 1XCJA 2GB4A 5E8RA 2NP6A 1G38A 2B25A 3OCJA 2V74B 3P9IA 5C1IA 3GWZA 1N7IA 3ER8A 4E33A 4M7RA 1DL5A 5LQNA 5HIMA 3CJQA 3R6TA 3BWBA 5EG5A 2XYRA 4C05A 2P3QA 3UJCA 3VSEA 1WZNA 4L7VA 2CWWA 3RODA 3P97A 2ZFUA 2CKDA 3CVOA 3R24A 2GAFA 1R8XA 3M6VA 1PRYA 1FP1D 3GRRA 5E8JA 3G5LA 4RV9A 3DXZA 2JH9A 5E1DA 5E1OA 3FUUA 2AOTA 3FZGA 3B3JA 3HTXA 2OXTA 1KHHA 1P39A 2QY6A 2VDVE 4KWCA 3G2OA 3AWIA 1SQGA 3KQSA 3H2BA 3LPMA 3RW9A 4XCXA 2AOUB 3KPVA 3DULA 1ZQ9A 4RYLA 3V8VA 1MHTA 2AZTA 4YUXA 4RVFA 4P7KA 2OYRA 4CKBA 1N2XA 3HCCA 3MCZA 1XCLA 2IPXA 3DMFA 2E5WA 1WG8A 2KW5A 2VP3A 1R8YA 4RVDA 4RVHA 5IH3A 1QYRA 4RWZA 4E2ZA 2IIPA 3NJRA 5F2OA 3UJ7A 1XDUA 4E2XA 2Z6AA 3P2KA 3KQVA 3SX0A 2UYOA 2N47A 4FT4A 3UBTA 2ZZNA 3KR9A 1RI4A 2C7QA 1WY7A 3MTIA 3KR2A 4C04A 3HA7A 3MGGA 2PX2A 3GGDA 3T7RA 1L3CA 2YVLA 4YUWA 2PT9A 2R3SA 3PVCA 2OB1A 5FQNA 1QAMA 1UWVA 5T6BA 1NV8A 3TFWA 2IH5A 3GJYA 4Z2YA 1G8SA 2IP2A 5FA5A 5GIPE 3EGVA 2AN3A 2QYOA 5KS2A 3PLAE 2C7PA 3HCBA 4ER7A 1DCTA 1X1DA 3A26A 2AOUA 3MERA 1HMYA 3JWGA 5K0EA 3G89A 4GQBA 3HCFA 3P71T 3A27A 3C6KA 3R0QA 4RVGA 5EMMA 5FWAA 3JWHA 4AZTA 2YTZA 3KKZA 3GIWA 3KQTA 5F2KA 4QTUB 3S68A 1X1BA 5K0BA 1KPIA 2PKWA 4DMGA 1IXKA 4CTKA 5BW4A 4FZVA 1VE3A 5D1HA 5DX1A 5KYGA 3LECA 1BC5A 1KXZA 2ERCA 2QM3A 5EPEA 3QOWA 5E1BA 3HCDA 5BXYA 1QAOA 4MHTA 4M38A 3G7UA 3SXJA 2XYQA 2FCAA 4PYKA 1R18A 4OX9Y 1RI2A 2AVDA 3EVAA 3NDJA 2P8JA 1JSZA 3SR4A 4RTRA 5E1MA 1JR4A 5ICGA 1U2ZA 3B89A 3HVHA 1MJFA 5EC8A 4BP1A 1DUSA 3CJTA 1FPQA 2AS0A 3LHDA 3G5TA 5K03A 3OFKA 4C08A 3C3YA 3HNRA 4KW7A 1R00A 4P7JA 4PYNA 1Y8CA 2P41A 3OE5A 3R3HA 4PWYA 3U81A 4EVIA 5D1NA 3LDGA 3UJAA 5GINE 5KQSA 2ESRA 2P40A 4QVKA 2ZBPA 4P7GA 2I9KA 2O05A 3O31A 3P9KA 4OA8A 2ZIEA 4KDCA 3G2PA 5GP1A 4K6MA 2GS9A 2ZLBA 2G72A 2JHAA 4M36A 1VBFA 2HNKA 1ORHA 3PS9A 4YUZA 3GCZA 4XUCA 5C9ZA 3LL7A 2BM9A 3UWPA 3GRZA 1VLMA 3IEIA 3DMHA 3GO4A 4AZWA 5DM4A 4C06A 3I9FA 3BXOA 4GBED 2QE6A 1QZZA 3A7DA 4FGZA 2YXEA 4B17A 2CMHA 3B3GA 2FK7A 2HTEA 4KDRA 1N7JA 2FRXA 5CM2Z 3DXYA 3GU3A 4FSDA 3DP7A 4CTJA 4E2WA 1I1NA 1G55A 3MAGA 3M33A 3KR1A 2IDKA 3KU1A 3P2IA 3CJRA 3RIEA 2QRVB 1UFKA 2ZBRA 3MQ2A 4WVLA 3HCAA 3BZBA 4DA4A 1P91A 1NBHA 10MHA 3DLIA 5C0OE 2VDUE 5LQCA 3AY0A 5GM1A 4FS8A 4LECA 2NNWB 5DXAA 4E70A 4EK9A 2GH1A 3ELWA 3FTCA 3OU6A 4RTLA 3E23A 2PX5A 2HWKA 2YX1A 3KPUA 5FHQA 1XJ5A 4HSGA 5GWXA 4A6EA 1EAMA 4EKGA 4F84A 1F38A 3FPEA 2BR3A 2NYUA 8MHTA 5EHIA 1HNNA 3NVKI 3HVKA 2DULA 1KP9A 3IYLW 1Q0TA 3EMDA 4KRGA 3C3PA 3PTAA 1X1CA 2K4MA 3UA4A 3GRYA 4OA5A 4GOMD 4PGGA 4PYQA 1IM8A 2O0LA 3ELYA 1INLA 1ZG3A 3B3FA 4R8SA 3EMBA 3LKZA 4DCMA 1EJ0A 2WA1A 1YZHA 4BP3A 2ONZA 3FRIA 3I58A 4O29A 5DX8A 5LQUA 3P8ZA 2ONYA 5FCDA 5LSAA 3LCCA 4QDJA 3VYWA 4ER6A 2Y1XA 1EIZA 4ATNA 4E2YA 4AZVA 2ZWAA 2BH2A 3NVMB 3PX2A 3EVEA 3TMAA 2IH2A 2P7IA 3FTDA 3HEMA 3TPZA 4YMGA 2JJQA 2P35A 2ZVJA 5JR3A 3TKYA 4XUDA 2P1DA 3I53A 5K0FA 3M6UA 2UYQA 5FA8A 4DKJA 5K8VA 1SG9A 3DOUA 1AQIA 2P3LA 4AZSA 5H02A 4P58A 3TR6A 3QOXA 3LX6A 2O07A 1YB2A 2YUIA 4MTLA 5T64A 2XVAA 5FULA 1JTFA 1Q0SA 1JG1A 4IWNA 3EPPA 1VL5A 3THRA 4NECA 3Q87B 2VDWA 3DLCA 5DSXA 3E8SA 5K0GA 4HG2A 3C0KA 4PGHA 2ZULA 2AN5A 3TKAA 5K0CA 4RTMA 2AR0A 1KPGA 2AN4A 4F85A 4RTNA 2EJTA 3P9NA 5DTRA 2PJDA 1BKYA 4GF5A 5EQJB 3G88A 1NKVA 3SSOA 4C03A 3KPJA 4YV2A 5EKUA 2ZSUA 3BKWA 5FTWA 3FUVA 2JG3A 3OU2A 2BZGA 2ZBQA 3FUXA 4X63A 5CCBA 3E05A 1G8AA 1D2GA 3EVGA 3FYCA 3LBFA 3A7EA 3FYDA 1R6AA 2PGXA 5CVVA 5HFJA 5EIFA 1RJDA 2VZ9A 4FR0A 4X61A 4YV1A 1SKMA 3EVCA 3UJBA 3X0DA 1L1EA 3JWJA 3UJDA 2H11A 5LR6A 1Z3CA 2ZIGA 2PX8A 4U7TB 1QANA 4ER5A 1JSXA 3TM4A 3DR5A 4Y30A 2ZW9A 5FWDA 4DF3A 2P3OA 5DM2A 3WSTA 4G56A 1VIDA 2G8NA 3LGAA 1JQ3A 3KPWA 3MTEA 4PIPA 5BP7A 2DPMA 1X1AA 3HA3A 1AF7A 4GOLD 2ADMA 1NV9A 3G8BA 4OBXA 1BOOA 1ZGAA 3FPGA 5DTMA 1JG3A 5FUBA 3BGIA 3T7TA 3ID6C 2Z6UA 4ISCA 2YR0A 4RTOA 3AJDA 5EHGA 1ORIA 2HMYB 5JUWA 5DLYA 3HCEA 1YZ3A 1XVAA 2BR4A 3QV2A 5K09A 2UZ4A 3OZSA 3Q7EA 3A25A 4HGZA 4PYMA 2ZIFA 3EVDA 2ZWVA
chains in the Genus database with same CATH superfamily
2Q62A 4YBZA 1BWQA 2QXUA 1ADFA 1AGYA 2DHQA 3WGNA 2X9NA 4KQIA 4E07A 4P93A 4FOLA 1P4SA 3QE4A 5K3BA 1T5SA 4XLTA 3UAGA 1DB3A 1QIDA 1VSVA 2NP7A 1I4OA 2MSWA 3FMOB 3SQLA 2VR1A 3UGKA 5I9IA 4IQFA 2JF0A 2HF2A 5DK6A 1K4YA 3HA5A 2OHIA 2UVPB 2WIGA 2HD4A 4W7HA 5CH3A 4V2IA 4DCOA 5HGXA 3G2HA 4G07A 2EP8A 1OLXA 1CQZA 2GAOA 1IWOA 3E0XA 4WY8A 2J9YB 4I5IA 5KYYB 1WVIA 2JJ2D 1DX6A 4FN5A 1MB0A 1UPAA 121PA 3ESRA 5C8VA 1WKCA 2AJCA 2JIBA 4MW5A 1FMTA 3D7KA 3H3JA 1AKQA 5DB4A 5EY5B 1JDBC 4X92A 1PG2A 3GEBA 1PVDA 1Y89A 2J3EA 2OBXA 1LBHA 4XCQA 4AURA 5C80A 3X1DA 1IB6A 4JBYA 4RZHA 2ZK7A 3GVXA 2OAGA 2QZZA 3DNFA 4KX3A 1MT3A 1ISHA 1L5GB 3RC3A 3N2GB 1JFFB 4WCVA 1DCKA 4BJ1A 3WIEA 5CDHA 1DARA 2ZU6A 3HJAA 3GDGA 1Y80A 5B1SA 4C14A 1AA9A 4O6VA 4R0MA 1QIEA 2GNAA 4N49A 1H0HA 1L7QA 5AI9A 4U0KA 3WDLA 4AU1A 1W2GA 4BLWA 4IEIA 1GZ7A 2WTNA 1OB5A 4AQYB 1Z73A 3H75A 3LAWA 3IDFA 3SYLA 3VR0A 4A8PA 1DRUA 2PBLA 5LM3A 1W47A 4ROTA 4JL6A 2PZMA 1FS4A 2I4MA 2UKDA 2YMQA 4M9RA 2HK8A 3WXMA 2DFTA 4UD2A 3CONA 3FKQA 4OV6B 4IJVA 2HWWA 4LYJA 3N5KA 3I5XA 4G5FA 4AKHA 2FOLA 1J4AA 2VQDA 1YK1A 4JU9A 1P3JA 1T1GA 3EQZA 1UC5B 4IV8A 4RH0A 4ZV7A 4MUHA 1X8XA 2VJOA 3CMCO 5I9LA 2WE7A 3JALB 4ZEMA 1ECCA 2R11A 3FNIA 1CJVC 1VG0B 4YRGA 4C78A 4DLVA 5BUSA 2XB4A 3AYZB 1EK0A 1SBZA 2A14A 1SCKA 4BMZA 4C5AA 4BP9A 2JCYA 5AKGA 4JI8B 3IKMB 1IIRA 1L5NA 2P77A 2XNCA 4WEOA 1SZCA 4WRRA 4BUZA 2Y9PB 2HGSA 3M49A 3WJ7A 5GPBA 5K45A 2QTTA 3FHOA 3GLUA 3PNKA 2OV6A 3ZV7A 5LQKA 3RYIA 1PFGA 2PV0A 3H18A 2IUUA 4G0MA 3JVDA 1IEVA 4MI6A 4BMSA 1CKEA 1ZI6A 1HE3A 1TUGA 3NANA 1Z8FA 1KEEB 2GSDA 4KFCA 2C59A 4ZT2A 3U7HB 3QENA 4BQEA 2J6IA 1M75A 4I3FA 4WBNF 4PYLA 1MPXA 3K5WA 4B74A 2QRHA 4UOEA 4NPAA 2OBBA 4WCFA 2J87A 4AY3A 3H5LA 1D1SA 1V3UA 1OBCA 4TQ9A 4FHCA 3A0RB 5EIWA 2AJBA 2IDZA 3PQCA 1USVA 5E0OA 2W9XA 3RC9A 2A9VA 4J9VA 3H2YA 4UBNA 1VGVA 1Z6AA 1J97A 2OMKA 2PLWA 4MP8A 4BMCA 1NNLA 3AWDA 5E2IA 1YI8A 2DHEA 3CLUC 3CX8A 3ENZA 3NDIA 4UNPA 3HUFA 3N2LA 1WCWA 3VOSA 4F2DA 1F9EA 3K94A 4JLMA 3GL9A 1EBFA 4ZAXA 2Q1XA 1W5TA 2B7BA 4P3XA 4R05A 4PYIA 4RKYA 1Z2PX 3KUDA 3BQMB 3HB9A 1RQPA 4BB5A 1MO4A 3PFGA 4TRJA 4XIJA 5DASA 2GQ0A 1JF8A 4OAQA 2AX3A 3GGCA 4BNDB 5F4ZA 2M6RA 3TGPA 1ULZA 2YV3A 4FX5A 4JBHA 4Q5IA 2EFCB 1A9OA 3WGLA 3N7AA 1ORRA 3GLIB 5FADA 4NH0A 2X0RA 1NJ8A 1F14A 1RWPA 3IQDB 3KRTA 2HMSA 4B87A 3CRW1 5JCJA 5I6DA 4W6QA 4KB5A 3W2GA 3FDXA 1A2OA 3KVRA 3JQDA 1U1FA 3UUEA 2FZWA 2Q2NA 3EWSA 2DM6A 4PRZA 4WSOA 3ZHUA 3AVVA 5ELXA 5K6AA 1MH9A 4WXPA 4PQYA 1YACA 2LBPA 2ZTMA 4GLFA 3TUIC 3U3RA 4FZ5A 2I7CA 4O2BA 4NK4A 4PSDA 2Y1FA 16PKA 1CR0A 3C98A 3H1TA 2CFCA 1MB2A 3LQ4A 4PBSA 5DGHA 5EEHA 5INTA 1XPOA 5A0VA 3RVPA 1E6CA 3LP6A 1ZHFA 3KJXA 3EDOA 3MF4A 4P98A 4XJXA 1NONA 4IPTA 5DBIA 1SKYE 2ZAIA 3BWVA 3GRVA 4FOOA 5KYKA 1REQB 4YQFA 4XM1A 3ZGXA 2WWGA 1KSHA 4PXYA 3INNA 5CCDA 3PPYA 3UH0A 1YK0A 4B76A 4DV0B 2Q6OA 3JQ9A 4UULA 3HNPA 1ZC3A 2WJ4A 3HDGA 5DN6A 1FXWA 5JBQA 3O0DA 5KX5F 1HKUA 3A2NA 5DU2A 2ZANA 1XV5A 2O5VA 3G02A 4QDKA 3TTUA 1CQJB 3DCIA 3C85A 3EARA 2NUAA 1I5RA 3M82A 5JWRA 2ZVQX 1Z83A 1DBVO 1ISGA 3SYKA 4DNPA 2JFQA 5EJ9A 1OWNA 1T1EA 2XBMA 3GP8A 2SBTA 4UEQA 1E18A 4YH1A 4A0QA 1YFLA 2D5LA 3JYPA 5DULA 4UASA 3U3JA 4B5LA 2VF2A 1FYWA 3QG1A 4OQMA 5T67A 2O2DA 1Y7HA 2XMCA 2QJTA 1VHLA 4WGGA 3W8EA 2DTEA 4O8CA 3REQB 5EGSA 5CB4B 2MIIA 1Z6YA 4M9XA 4CHGA 4CRWB 2VAWA 2XYVA 1PWXA 4DLXA 2CMGA 4KVGA 4BBJA 4QOEA 4R01A 2QIOA 3E0QA 5LZ9A 2OV4A 1PF7E 4QTZA 5A1TA 2VT3A 1NXPA 1P29A 5A5VA 4RD3A 2I3BA 2NP6A 2XUOA 3B48A 3P9IA 3R77A 4RLFA 3GWZA 4KQHA 5C1IA 1DJOA 2C57A 2AI2A 4P82A 3RVQA 2BMAA 2R86A 2VHUA 3TPCA 1HSOA 2F3RA 5B4VA 2A3NA 5LQMA 3KXDA 1NQWA 2I6SA 1YC2A 2AX4A 1F3OA 2R8RA 3HKEA 3UJCA 4PC2A 4DQVA 1UXIA 4DR4B 1U4OA 4QUJA 2JFZA 4GD3Q 2C8VA 4NU6A 4EKNB 3IBFA 2C5SA 1ID1A 5F7XA 1TTPB 5B4TA 1QP8A 1RDFA 4LTNA 3T06B 2XLBA 4V3CA 4B0PA 5KTYA 3K7EA 5ALIA 3EIWA 2W8ZA 2R8ZA 3QKWA 4NOLA 3PYXA 4PZYA 5CGQB 4YPOA 3GLIA 2Q2VA 2WP0A 2QY6A 4Q3LA 5M04A 1LQ2A 2GUWA 2Q1UA 3AEUA 3R6GA 4QNNA 3WLHA 5CD9A 1WMEA 4GR5A 2FEMA 3CA8A 3G9TA 3Q9NA 5SZJA 2ES4A 2IIBA 3GMTA 4UZFA 3FCUB 3R7AA 1GN9A 4MUFA 3NALA 2DLDA 3LNCA 1YZFA 2W98A 4JEMA 4RVFA 3DOCA 4X64B 4OFBA 1KMIY 2IPXA 1J39A 5JAZA 1MO2A 3UFXA 4BB9A 1K97A 1KIMA 2Y1CA 4DRXB 5CXXA 4AS3A 1A9ZA 1ECJA 1LSSA 1XDUA 3LCMA 3HWWA 3P2KA 3V34A 4JLAA 1OVMA 4E2XA 1M1NB 4JI3B 1PJRA 3BSWA 1MQ8B 3X2EA 1GAWA 1MO6A 1E7SA 2LWIA 2VPZA 4UEKA 5T3UA 4IF4A 3VMFA 2PH5A 1E0SA 3O03A 1S1CA 4PC3A 5ALUA 3T7RA 4UTPA 2V54A 4WCFC 5BMVA 1OUMA 4K9QA 3UG6A 4ETNA 2HMVA 3G68A 3GQBA 3GPLA 2D2XA 1OXTA 3JASA 3KJQA 4NBSA 1RZRD 3M81A 1G21E 4JNCA 3N6RA 4C20A 4TLDA 3AKCA 4FCVA 3ADPA 4LWQA 1MENA 1NYRA 1ILWA 1OKKD 3NCTA 4C6RA 2G76A 3D4PA 4UBLA 3PNPA 4WN3A 4OLHA 1S96A 3EN0A 4IQ0A 1KFBB 1DT5A 1PK7A 4MUXA 4ZT5A 1B0ZA 3R0QA 3HYNA 3IXLA 3Q1KA 4HVLA 2B4KA 3GIWA 1S5PA 4NY1A 2CLOB 1GVNB 4UBKA 2O8EA 1L4BA 3GAAA 4Y9SA 1E6EA 2ZRLA 4EHIA 1YOVA 1M33A 4QX6A 1CZKA 4Q7JB 4WBNB 3RRJA 2CZCA 4WERA 1QGUB 1OU0A 3IMFA 1SM4A 5HE8A 4XVCA 3VOBA 2QUIA 1YR9A 3AEXA 2B5OA 3O26A 4LGCA 3RYCB 3NGXA 4J91A 1SCUB 3ZNQA 5ICGA 4YRBA 2OVBA 1QX3A 3HVHA 3V4PB 3KSDO 4PQEA 3QEAZ 4J0CA 3OZCA 2XNHA 3WLAA 1IBSA 1E1DA 1DAPA 3HP4A 3O47A 2IYEA 3U81A 1RHJA 4PWYA 2YFQA 5IXJA 2YHUA 4JHXA 3SF0A 5D1NA 2X4IA 1RT9A 2EZ8A 4AN0A 4BL5A 4Q93A 4MP3A 1T2NA 4K1LA 2ZATA 2XUDA 3ZWXA 1MX3A 3NIDB 1SIUA 2CNDA 1E5VA 3ZWQA 1C5KA 1X3LA 2JZNA 3PTLA 1QGDA 5A6SB 3ZGVA 1SCJA 4OB8A 2ZSKA 3GO4A 3AHJA 2UU9B 1V6SA 1C80A 1QZZA 4BC0A 3INYA 1RWNA 2X7HA 4HWGA 1M2JA 2R5WA 3INGA 5G0SA 4B2PA 3T8YA 4F4JA 3IE0A 3O4HA 5DM70 2B8TA 4O3MA 3WLOA 3G8YA 3REQA 3OC6A 3LQ1A 1VLVA 4HXEB 2FFQA 4JP5A 1SUDA 1XWIA 3HSYA 4XDGA 3TQRA 3K0AA 1D0VA 3NC1C 4FYVA 5H70A 4KI0A 1F4LA 1NN3A 2GILA 1TVMA 3D6JA 3A11A 3OICA 1Q77A 3BBLA 2D1TA 4ETWA 1Y6GA 1PR5A 4HAOA 5LQCA 3KT6A 3AY0A 5E3HA 4MKZA 5GM1A 4A82A 4C1BA 1KO8A 4E70A 2CEKA 1VCIA 1Q21A 3PUJA 4BO0A 4JC4A 1W2WB 3LNTA 1E4OA 1DX9A 2Q5QA 1JR3E 4UJ5A 5AK5A 2B5WA 5GWXA 1YR8A 4K46A 5ETJA 4LPKA 2GKGA 4DMHA 4EHAA 5H9WA 2OCLA 3GR6A 5ALXA 5D84A 2GEJA 2GCIA 2JAOA 3I9KA 2YDYA 4M9CA 5CLQA 2CF5A 2X19A 1NIJA 4KQEA 4D9MA 3O8QB 1B6GA 3ETDA 4DIDA 1QVVA 1ONOA 2XMRA 4Z99A 3A6JA 2VNJA 3GRYA 2C1EA 4HUJA 5AUPB 3N0RA 1RPNA 3DAPA 4IVRA 3BL6A 4BB6A 1UJ2A 1YAHA 4TXJA 4W5WA 1B0UA 1R8QA 5AM1A 3R7WB 4DDKA 4Q4JB 6ADHA 2J31A 2Q4DA 2Z4SA 4OHMA 5D6NA 1KVUA 1V1JA 3PPXA 4S0ZA 3QXHA 5HF9A 1NQUA 4DLWA 1ZOPA 3JRXA 3KELA 4IZHA 5A0FA 5FORA 3RVSA 3MRXA 2GO7A 2ID9A 1Y4DE 4XPZA 4NYIR 1QFZA 4U6NA 5KZMB 1CUFA 1XZCA 2F00A 2RSLA 1Y5IA 3HCRA 5JJKA 3TMAA 4I1PA 4Q3KA 3FTDA 3TTSA 2POQX 3VYVA 4ZJUA 1KMHB 4Q4AB 2MCFA 3VO8A 3F5DA 1IUKA 1K06A 3G2NA 4BNXA 2VPPA 5I3ZA 5BR8B 4Q3CA 3UPTA 1K8YB 4JUIA 2Y4OA 4JR2A 1YIDA 4FFBA 4KPYA 1MORA 4Z9FA 5F35A 1PYOA 3VZRA 2BGKA 2HK6A 3B52X 3OE7A 4GO1A 4O5AA 4Q7EA 1CB0A 1Y9DA 4RSGA 3MRSA 3AJ9A 3E7FA 4FGUA 4MWCA 5T64A 1YAJA 4HWTA 1JTFA 4B48A 4ND2A 4A0FA 1O6GA 5B7GA 3AESA 3RKRA 2CYAA 1JPNA 4GZMA 3C39A 4HVAA 4K86A 1DQPA 4RCVA 1WPXA 5EAIA 1HQDA 3WYCA 1CIJA 1BMFA 2HA3A 3RC2A 2R8YA 3RRMA 4N0DA 1R0WA 2WIAA 5LMUB 4H1WA 2QX7A 3N8NA 4R1SA 2QUJA 3GYBA 4GF5A 1R12A 2HL6A 2VKTA 3CN9A 1JX6A 4HOYA 3OU2A 1MH1A 1FLNA 4PLHA 4X63A 4YB8A 3D6MA 3S55A 1XZIA 2V9PA 1CR1A 1P5FA 4FGLA 5E7JA 3JTMA 4TTJA 4CL0A 3UXYA 4HEJA 4DEVA 1V8BA 4GL2A 1GPH1 1FSZA 2YWGA 3M4JA 4GAEA 5CITA 3HPQA 5DWDA 4Y6OA 2CXTA 1YB5A 2B6HA 2GYWA 1UKAA 5SY6A 2F1IA 4ZK6A 5HUHA 2FZLA 3ZWKA 5IHPA 4C7OB 2CNWA 4C7MA 1JIVA 5JALA 4YLYA 3RS2A 1Z3CA 1X7ZA 3U4DA 2RGCA 2QRMA 2QRGA 2ZP1A 3OA2A 1FUKA 2NX2A 2NPIA 1MJ5A 2FJPA 2JKVA 1OI3A 1ADYA 1U3GA 3Q98A 4IQ4A 3K32A 3LVFO 4M1QA 3T3PB 1XN1A 2PRYA 5CK5A 2QL5A 4RJTA 3UQZA 4RUKA 4BQRA 3G8BA 1ISPA 5K0SA 1B1CA 3SHTA 1G2QA 1Z37A 3CMMA 4HDNB 2QW8A 4BJ3A 1MJHA 1S3IA 4RTOA 3L7MA 1QJ4A 3KHSA 3O7MA 4UTZA 1WXIA 1HEYA 3HCEA 2UZ4A 3ZU6A 1RHMA 2QVBA 1GZ3A 4IQ8A 4K03A 1PQPA 1V1MA 4QYWA 3T5BA 4BEWA 5EJMA 5KCMA 4LF9B 4NBVA 5KPJA 3ABIA 3S28A 2H7VA 3DYBA 4B82A 1R0BA 1G6Q1 2NU7A 3SU8A 1EI9A 1D1TA 4L0DA 3UW3A 2ANBA 5I7WA 3ZD7A 3PC8C 1CSEE 1KDPA 4GM0A 1DAFA 4J2TA 3CZPA 3ZGNA 4EBBA 4YRSA 5DBFA 5A4DA 5JTUA 3L0CA 2ZXEA 5LZ4A 2ZZKA 3MK31 4MVJI 5K6TA 1HX7A 1RAAA 2GZ2A 2PXCA 1JKMA 1XXLA 2P4EA 1N7GA 4E3WA 2LKCA 3RQIA 5GOZA 5LQAA 1UDRA 4G4GA 2WUWE 2DBRA 2PLRA 1J56A 1ZZEA 5GJWC 2RH8A 3EMKA 4BV3A 4B3MB 3B8HA 3TCKA 1U0FA 4N54A 2P2DA 1R15A 4MUJA 4QAQA 5HIJA 3H9GA 3COYA 1K27A 2FUG6 4X54A 1NPYA 2OORC 3V00A 1U9JA 4FYJA 3BMOB 4DQLA 5DLQC 4TV8F 1K9SA 4HJRA 4ZVVA 3HDQA 3GP3A 4OSEA 4RTJA 4OQNA 3PCTA 2DQKA 4YHBA 3H5WA 4ZCTA 2NUBA 4F9FA 3ZE7A 1ZCFA 4C7XA 2I99A 1BE0A 4EHLA 3DDNA 4QQFA 2ORWA 3NHKA 3Q8MA 1OC4A 4GQIA 2XUJA 4E32A 3O95A 5GZ3A 3IQEA 2FF7A 1T2CA 3VDMA 1YCDA 5IC6A 4AJOA 3CG4A 2AI3A 3ZXXA 4PTZA 3PKZA 2UUPA 3M1IA 2BE9A 2B83A 1SG0A 5BWNA 3UCEA 1E3MA 3QEOA 4RLQA 2BFMA 1TQ6A 1JLRA 3LYAA 3R5KA 4Y2GA 3W04A 2AWNA 2Z4RA 3A06A 1G8KA 3DZHA 2Q3LA 4AWAA 1QH8A 1E3TA 1RYDA 4H1VA 3AF6A 4MRAA 3DOIA 2EBFX 5T7BA 3QLVA 5FI0B 3EUFA 4I5EA 1UPXA 5AHOA 1JIKA 1BJTA 2VRNA 3OZBA 4UHBA 3H17A 2W93A 2H7CA 1R9JA 5DM60 3JR3A 3B6KA 4LBWA 3V8EA 3IT0A 3SJCA 2HBRA 3VNQA 4DCTA 1L4FA 2KX7A 1ODJA 1EZ4A 1XD2A 3GYGA 4MWOA 3BOSA 3DDOA 3BHIA 4L4SA 4M2LA 1GNLA 3UAXA 4E30A 5KEIA 5G4KB 3WAKA 1FJXA 1YQDA 1N2GA 2PZAA 4GP6A 2TMYA 3THOA 4Q66C 4D92A 4D02A 1ZVQA 3WGQA 3GOQA 1FYXA 1PR1A 2RHLA 4NOMA 4OHRA 5EIXA 1KYIA 4OYRA 3K8OE 5FPQA 7ABPA 2H54A 3EX7C 2HT1A 1GCOA 3CSSA 3AC0A 2NGRA 1WZ2A 4WKCA 3C5CA 5LMNB 5H4GA 1CS0B 1LBQA 2C1XA 3TOSA 1V71A 4N40A 5KSZA 3F78A 1G3UA 2APJA 5JAPA 1KJWA 3AOGA 4LMAA 2Z2ZA 4GWGA 2R1UA 4I9NA 4ND8B 4UHEA 5CURA 1RJGA 3SEQA 3IUBA 4AG3A 4E4TA 3PSHA 2WWHA 4H7HA 3H2SA 3SHOA 4Z4GA 2O8FB 2ZJ3A 1J25A 5IP5A 5MN6A 1JJ7A 1HLDA 1T8YA 3DPIA 4FHGA 1YZVA 4UMVA 3RVBA 3WGMA 4BVHA 4BNFA 3OETA 2CY0A 1EA7A 2EZTA 3HGMA 4A2QA 1EVEA 2D4HA 3IEPA 4BNNA 1YR3A 3JQEA 4G89A 1L6IA 3CXRA 3WMEA 2VK2A 5BVGB 3HN2A 3PUWA 1V4VA 2YNMC 1E69A 3IQIX 3W2EA 4DPMA 4RZUA 1H2WA 3LIIA 4H0FA 4QFBA 1ECBA 5LQSA 1DFIA 2HWUA 2X7JA 1E7QA 4OFXA 4U0JA 2H0QA 3DHNA 4WADA 1EE9A 2E21A 5GJVC 3R75A 5LXTA 3EPJA 2BSXA 2J3KA 2O8NA 5IT4A 5MF6A 3IIKA 3P0JA 4LRYA 1NY6A 4C0JA 2QSUA 5I48A 1VMIA 3K53A 3GLGB 3GT4A 3IVCA 1PZEA 4IV0A 4LC0A 1JDTA 1ORDA 4QU5A 4QEDA 1AVTA 2E55A 3FH0A 1QCCA 2OCXA 1RBYA 3DFFA 3RFUA 3HR8A 4A2CA 4DLTA 2IYYA 1LNSA 4PXSA 3ANLA 3FG9A 3BWDD 1KO7A 4EJ0A 1FDRA 3DEZA 4CEIA 1UOEA 3TOZA 2IYPA 4F60A 1C7ZA 3W7BA 1PR3A 1H1TA 4ONEA 3PDUA 2VXYA 2OCAA 2Z2IA 4GPBA 3VDRA 2W71A 3OLCX 1DMRA 1Q17A 2I4TA 2PLFA 4ZCPA 3RFCA 4M3NA 3FB4A 4RTPA 2W0SA 2OR3A 1KIFA 1L4YA 2GPNA 4FFDA 5K0JA 4MYSA 2R0QC 3UB3A 2PVPA 4TLCA 2GM9A 2GI4A 2A30A 2VUUA 1FL9A 1LC0A 1A72A 4LZAA 3EZ6A 4RW0A 3TLKA 3LTNC 3D4BA 4P0TA 3FROA 5CEEA 2G9QA 1BHJA 4Z7JA 3A4TA 1TVEA 2HH9A 3HK2A 3QTLA 3ZHOA 3QY0A 4MUMA 3H2JA 1KH3A 1HDRA 4Z8XA 5HIAA 2V1XA 5DNYB 2W4IA 3OZWA 1ES9A 3OTHA 1YASA 1EVLA 2AMVA 2J30A 5TB5A 2H07A 4G0ZA 1MN6A 1XXHB 2MMCA 3LHKA 4R3NA 2OO7A 1M9NA 3IX7A 4WKGA 4NDZA 1VRCA 3IV6A 2EGUA 3RFTA 5F2NA 5KQRA 3VGJA 1CE8B 3DP9A 3R7LA 3RS3A 4BQPA 1G6OA 2XITA 1C1DA 1NZFA 4BQNA 4E5DA 3D6FA 4FR5A 3MJSA 4RDCA 3VR2A 2RE8A 4J1NA 3IURA 4S1NA 2IW3A 2QNRA 1DC4A 3HXKA 1M7GA 5JXWA 4GRDA 5FWYB 4Q9NA 2H00A 1PZXA 3FYUA 4UC0A 5FBLB 3OJOA 2YJ6A 1TPZA 4Q1CA 1T2AA 4LHZA 4JP8A 4LF8B 2EAUA 4EF5A 3W4IA 1UCFA 1XEWY 1Z34A 2W6NA 3ITNA 2X86A 5FL7D 3IA7A 1GFIA 1GVHA 1I5EA 2E48A 4JLDA 5BPFA 3A3OA 5C8YF 2K5UA 2RARA 3HKCA 1YTLA 2CMFA 3L1HA 4P92A 4H27A 4QDOA 5F3RA 1U3WA 1XP5A 3MOGA 4RVUA 2CWWA 3WLEA 1P0IA 1AD2A 1JDUA 1XRJA 1ZMTA 4FC7A 4P31A 1EVQA 5HDBB 3M6VA 1DJNA 1QQ6A 1ZUNA 3GRRA 1PV2A 4P80A 4KOAA 2C8JA 3WQBA 2OWDA 4RV9A 2ZJAA 4HDRA 2J1LA 4RK5A 4ZOAA 1Q44A 1B8OA 5D3KA 3B3JA 4WWHA 1BAPA 2I4LA 1JU4A 4D98A 4HUQA 3K0EA 1YVDA 2H51A 4Q4AA 4IDNA 2D13A 1A4UA 4U2KA 2WT9A 5H3LA 3EXHB 3KPVA 3SBXA 3MAJA 3GJXC 3GEGA 1WQ4A 3UIEA 4BHTA 5DYWA 3OT5A 1E7WA 3VPAA 4F06A 1BE8A 1XVVA 5F1KA 1OVGA 1P9OA 2QVLA 4IXMA 1DOZA 2J7PD 1WG8A 5DW3A 1NG9A 1R8YA 4NEQA 4EEXA 3QXJA 2DG2A 5KOIA 3R3ZA 2ZZNA 4HD8A 3UMYA 5AHXA 1AMOA 3SLRA 3R7WA 3OP4A 3D8TA 1W75A 5A3JA 1WPRA 4MKFA 1W8DA 3LLVA 3UAOA 3H6HA 5JNLA 3MUEA 4RZ2A 5DHPA 4HFMA 2IPNA 4BKMA 2WTUA 3NIFB 2FWJA 1U0BB 4ZO9A 3I9V1 2C2YA 2PNJA 4KKVA 3EGVA 4CKZA 2H5LA 4RY0A 3ANYB 2V97A 3IXQA 3NT5A 3AM3A 4KIJA 4D9FA 3HVRA 2X8WA 2FW0A 1P75A 3MERA 2WSMA 1HMYA 3F67A 2HU2A 5JC8A 4OUDA 1MQ9A 1QTNA 1VG9B 4KXVA 2Y6VA 3RM3A 1HDIA 2HU8A 821PA 1TAHA 2HCFA 4QGHA 1K6JA 1NX6A 3KT3A 2QMUA 3LI2A 3L7BA 2JJYA 3QYPA 3REFA 3AETB 1N34B 5JDIA 4WKNA 4I2NA 3F4LA 4REQA 1RIFA 1SAYA 2FR1A 4I8IA 4PYKA 5AVTA 5EI5A 3TE7A 1TF5A 1N75A 4CL3A 2PV7A 1JSZA 2QZJA 2P0EA 3GN2A 3DWFA 4PG4A 4YRKA 2ZIXB 1P0PA 1RQ2A 1TM2A 4UUMA 3V46A 1NBMD 2AS0A 3L6CA 4AZ0A 3P0RA 2DY1A 2HBYA 3OFKA 3UXEA 3HNRA 4EJFA 4PO1A 1KJIA 2XGJA 2P41A 5FO0A 3WYEA 5J4KA 3UT5A 3QEBZ 4KX5A 4QBGB 5KQSA 1Y98A 2P9BA 3LY9A 4ZZ2A 2IOFK 2NZYA 5EGNA 5IVDA 1JXQA 2JFPA 2JGFA 3OPYI 3EULA 4ZCSA 4OTZA 4OUKX 3DZIA 4JQYA 2XB6A 3CT6A 3R3XA 1QQBA 4N01A 2XSZD 4QJ5A 4XYGA 5CT9A 4DSNA 3R5HA 4F4IA 4PIVA 5AM2A 4KSBA 4X24A 4WPGA 2O19A 4RKQA 1WRBA 2EW8A 3JARB 4EEZA 2FI1A 4JI4B 1GN8A 1Y6ZA 3B3GA 4D8YA 2WKQA 1K68A 3GU3A 4YPVA 5HVNA 3DP7A 4ZZIA 3THYA 2ZUSA 1V7ZA 4P2GA 3U9TA 1Q1AA 4ZMSA 1MAWA 2Q5FA 3KOYA 1GGEA 1UR5A 4NSNA 4PLGA 3GMIA 1PE0A 4DVJA 3I39X 2DAPA 1UFKA 2EDAA 5KJ1A 4URHA 4JJ6A 1JLMA 1NYTA 3RR2A 4MROA 4EYQA 3WTBA 1NUUA 5JCZA 4LECA 1P31A 1CY8A 2WTMA 1XLTC 3SIRA 2OCKA 3ROQA 3OLZA 3PJRA 3KPUA 1ZD2P 4K05A 3K9QO 3M1YA 3HWX1 3FE2A 2AFRA 5I8PA 1HNNA 1Z0AA 1E6UA 3HVKA 2YRFA 3C4VA 1Q0TA 4ZO8A 2DFVA 4KQWA 4JC8A 4CMHA 4H0CA 2FZKA 4FB5A 4KRGA 4EZEA 3INRA 3N0VA 5CA1A 4PGGA 1XQ6A 2CDRA 4K6GA 2Y6UA 2RGXA 2WMYA 3CB2A 4JB0A 4HYEA 2XDQB 4JK3A 3H9CA 4I36A 5DEOA 1C3LA 2C5BA 3V3KA 2WTAA 1P7PA 3AB7A 4CLDA 4KBGA 1BROA 2FSSA 4UVIA 5DBEX 3ZUPA 1O7JA 2JCVA 3UICA 3I58A 4BLRA 1RAFA 1RHUA 1T3ZA 3GXBA 3AHGA 5LSAA 3WZMA 4FSHA 2DWUA 2R1TB 4JEUA 5JY1A 1JAXA 4UTVA 3ADCA 1DG1G 1E3DA 2BGIA 2R25B 3RSSA 4EMBA 4F8JA 3NR2A 3KLBA 2F64A 1DUVG 4LAFA 4DKXA 1JEQA 4WJLA 5DNCA 4P4LA 4C0HA 1NKSA 2FLKA 3RLIA 2P1DA 2EKBA 2R1TA 1RLJA 3I53A 5HTOA 2HEIA 3DDZX 1D4OA 1E2KA 1W581 2W5UA 4KJZA 1P9WA 4TT3A 5EWMA 4AZSA 4FFBB 3O74A 3HABA 4ZARA 3EA5A 4EHKA 1RZVA 2VTKA 3QIAA 4BQQA 5ED4A 3TRHA 3S8YA 3K9FC 3PNLA 3E9RA 5TV2A 3CZQA 3OZXA 5BV2P 4UHFA 2G4LA 1VL5A 3ZE9A 3LX4A 4FIZA 2BEUA 1C0PA 5DSXA 2A0KA 4A1FA 1EVZA 3LXUX 3E8SA 5CB8A 1YDMA 4BC1A 1JAZA 4M54A 1CUJA 2QN7A 1DU4A 2Z9DA 3BYZA 1R10A 2AN4A 1JYFA 1ZNYA 2RGWA 3HACA 4HCJA 2YYYA 1FW8A 1T36B 3ESCA 2FEWB 1ZI8A 1JJVA 2QXYA 4FEYA 5ECGC 3SX2A 4C03A 2JG3A 1ND5A 3A0UA 5JATA 4CMKA 2J48A 2ONKA 2R8OA 3AIIA 3F2IA 4AY4A 2H5IA 4MQLA 4OBBA 3HI4A 1CIPA 1HE4A 4MVJH 4EMTA 2W11A 4X61A 2OTCA 5DIZA 3MTAA 1WIWA 4ND4A 1K5DA 2H4HA 3ON5A 4MDFA 1N2CE 4J3JA 1L8QA 3ADKA 3KDSE 3CZAA 4YCJA 4CN9A 3D8SA 3S81A 4A91A 2GD1O 3DV0B 5EE0A 2C8LA 3T12A 3G0DA 3H5RA 1S1MA 1JE0A 3THYB 1BO6A 1H2BA 4GYKA 1NUQA 5HFAA 4JI1B 2WUVA 4QKQA 2OAEA 2EW2A 1I33A 2WV9A 3CUUA 4UUNA 5A6VA 3LGAA 2Q29A 2V7BA 4J90A 3EPHA 3KSBC 1UC9A 1GA1A 1Z5ZA 3R74A 1FQKA 5L6LB 2BHRA 1OYYA 5GY7A 5FUBA 3RPEA 1JG3A 1NWCA 4D57A 1O97C 1X7HA 3GFVA 1V35A 4CIDA 2QP4A 4RK6A 1LLFA 1JEOA 1WULS 1VJ0A 3L43A 3GFOA 3BHJA 2YYSA 2KLHA 4UM8B 3H11A 2OHJA 3OZSA 1HT2E 3I28A 5DCUA 2DWOA 3HRKA 4ZEOA 1Z36A 3D6VA 3UV7A 4AKTA 2DRIA 1PDOA 2IZ6A 4CMEA 4ZCIA 5JSQA 2RBKA 1KZHA 1KPHA 3IQGX 3BN3A 3RIXA 1E0DA 2WAXA 4PAWA 4F5WA 1FF9A 2QLTA 3KEFA 2A1TR 2A1IA 3IUQA 1J70A 1JQDA 3EVFA 3L49A 3DAGA 4GE3A 6NULA 2PFGA 3FLBA 4X0EA 5C9ZA 5ALRA 1WLYA 2VRWA 3EGEA 2BJVA 3JSXA 3P2MA 4TX1A 4QBFA 4E31A 3HEBA 3O4JA 3RDPA 3KQOA 3VXKA 4C0QC 2I2WA 4GI3A 4EHNA 4MRRA 3V97A 4ZGGA 3RGGA 3M4XA 2CVHA 2H18A 1BCSB 1T6BY 5HJ5A 3AIOA 1AB5A 1B6TA 2VDJA 1SIOA 2EKZA 1XDZA 4ZEVA 1V8FA 2VK4A 1VZ3A 2VJDA 2EATA 1K4MA 5K0LA 1SXQA 1A1VA 3K0SA 3NBKA 1FJHA 5REQB 1JWBB 2Y1EA 3MHTA 4MV5A 3QUAA 2Q4OA 1P3Y1 1W5EA 3BA6A 3H9QA 4NP6A 2RH9B 1DADA 2I55A 4YAKA 2NUTA 3P26A 3TFOA 4BUCA 5JD3A 1W59A 2FGJA 2C9BA 2IYFA 1OX6A 4P4SA 4R0VA 4RJJA 1F5NA 5C37A 3G9ZA 3IQXA 2PD3A 5A06A 5IU6A 3VR5A 2XCTB 1HGXA 4ACBA 1E9EA 2QPAA 3D2CA 1EEXB 3HXMA 4D8TA 3P9YA 1GL7A 1HMPA 3PE6A 1QVAA 2VWQA 4OGGA 5AVKA 1D03A 5GONA 4BWGA 1JJIA 1E1QA 4NZOA 3TW8A 1O5IA 3QXSA 2DSTA 5AOCA 4N3GA 4P33A 7REQA 2BTQB 2AH5A 1CS4C 4MS1B 5EJ7A 5D5HA 4MKHA 2JLSA 4TRRA 2DQ4A 2JGMA 3IOEA 9LDTA 1FY2A 3RKUA 2HNAA 4E09A 2XMBA 2D2EA 4UVEA 1C3OA 5HZMA 3A3YA 4EX6A 4B31A 3JALA 2PA0A 5KPDA 5EYPB 4HRAA 1DBRA 2XQKA 2A57A 3RS5A 4FCWA 4NC9A 3H87A 2WI8A 3CUYA 1L3BA 2H59A 1ZKMA 2NT4A 3HZOA 2OV8A 3K2IA 4EUNA 1CY4A 5E4JA 4R1MA 4RZXA 4EA9A 1ODKA 3W05A 3I83A 4LN1A 1T5LA 1UQRA 2YIJA 4ITVA 4QWWA 5KVVA 4W9NA 4H7FA 3FB1A 4DUZB 3JTEA 1VI2A 4M98A 3GJ3A 4JQCA 4TL8A 4ADSG 1KJJA 5FWYA 4ABTA 2QNBA 1SVKA 4Q48A 1SXJC 2ERYA 1HPLA 2VAPA 3BTUA 3D8HA 3DBHB 3DKIA 4ZQFA 1X8JA 1MRNA 1W29A 2P6PA 4QVGA 1VJ5A 4URFA 4ZU6X 2BVNA 3EAGA 4LTMA 3IVAA 1L5KA 3C3BA 4X20B 3WP1B 2OK7A 3ZHCA 4EP1A 1EG2A 2RK3A 1BMFD 5AJTA 5D85A 3TDNA 4GKAA 3OU7A 2W6ZA 3LW8A 4MLZA 5HMMA 4UU7A 1CEEA 3E9YA 5AH0A 2HU7A 1JEDA 4ZO4A 4L16A 3F7OA 5JSHA 1RBMA 2OV2A 4Z0PA 3O8NA 1WXXA 3F49S 2ASVA 4AJ4A 3OY2A 1O5OA 1W4LA 3AG5A 1YBMA 2A2ZA 1A9QA 1XN4A 2QTVB 2VHWA 3IO3A 4UUOA 1TZJA 1E2GA 1QGYA 3ZTWA 1FSSA 3QY9A 2CFRA 3JVUA 4P84A 3ZXUB 2PSSA 3KJGA 1XZEA 3WWEA 4B3IA 4B3JA 4RF5A 2X8JA 4B9EA 3GLKA 5BPHA 1C3EA 3QFSA 5D6OA 4F4UA 1ZUHA 3ZDQA 5IULC 1QQ5A 2Q50A 3GPDG 4UDNA 3V2HA 3DGFC 2V7PA 1OY1A 1EUYA 2WZQA 5JVDB 5DVZA 1Y5LA 5JROA 2Z2YA 1DEKA 4BDTA 1Z4NA 4QG3A 4UM9D 1TXGA 5CFNA 5LZ2A 2IKSA 3IAM1 1QIHA 4M21A 3BGOS 3EG5A 4MVJF 2GPTA 3ZX5A 2ZVDA 4LS3A 3VR4H 4COKA 4NMXB 1GTZA 1M6HA 4N5NA 2D1YA 4UUQA 2HI0A 3BGDA 1NU6A 2IUYA 2ZB2A 4Y2TA 3K6SA 3ADBA 2BGRA 2WKRA 1VRVA 5HKAA 3GJ7A 1CF4A 4PC1A 3V4ZA 3NOOA 2HR1A 2C84A 1KEUA 1XTQA 4EG6A 1LUAA 4V3BA 3EHEA 3FPBA 1KMMA 1JIUA 4IS3A 2JH8A 3FGNA 4KGZA 4LG1A 1KE2A 3U19A 3GLGA 1TFUA 4OBWA 1QDEA 1NXVA 3FNFA 4RK7A 4KZPA 1IHUA 3I6YA 3NYRA 4ZD6A 1XB2A 1RM3A 5AUOB 5F73A 4EY6A 1EP9A 5HEKA 1SXPA 2FZ4A 1V8DA 1M5RA 4AM8A 1EXNA 2F17A 2PT5A 2ZYVX 1PT6A 4NMLA 4WLFA 4EHDA 1SZJG 1VFPA 3OT4A 3O4FA 4MV9A 4ZT7A 3QUBA 1OSNA 2D5IA 1C8VB 3T5GA 1KBZA 1XPJA 1YS7A 3GFSA 3DL0A 1L4NA 1D4AA 3QX3A 4LHWA 4OXXA 3E03A 2F3PA 1FFXA 1PN3A 2JLCA 1FMCA 2OBMA 2VYVA 3PPVA 3RJ5A 3HADA 3H5AA 3WL7A 4YMHA 2UYHA 4L3WA 4NBRA 2F59A 1ONSA 5AW0A 2DH6A 2VF4X 5IN4A 3OM9A 4UEWA 4OSOA 2W6MA 4CMIB 2F3TA 1T25A 1S8AA 2KQUA 4MWZA 4FHDA 2FR8A 1CS0A 4JLBA 2EJWA 1DOAA 3TQSA 3ZJYA 4ZVKA 3USZA 4AUMA 1A4RA 4G0OA 2NYRA 1MEOA 4MJLA 4D44A 2JVIA 3D3QA 1G8MA 4TTIA 1YIOA 3CEPB 2YOHA 1WPQA 1DAKA 5KYWA 2AQ8A 2AXEA 2WJYA 5AMXA 2P5TB 3BRCA 5DW0A 4TYWA 3IPXA 3WYAA 3MCAA 2G1KA 3KWLA 2EIHA 3GEDA 2ID8A 4BO8A 2EEPA 3O2NA 3U61B 5E38A 1A95A 4JYCA 2G28A 3CJQA 2YNMA 4KSCA 4TTAA 1P7YA 3R6TA 4YCMA 4PVCA 4B85A 4KN6A 4C1NA 1Q74A 3CH6A 5B53A 8ABPA 2P2SA 2W6QA 4XX1A 1E1QD 1E9DA 1THZA 4MJXA 1U7DA 2GJ4A 2JDIA 1KEEA 2Z08A 3R3SA 4E15A 4GYYA 1Z3IX 2G5PA 3X2FA 3PUIA 3O8OA 4HEHA 1QRRA 2E18A 1EK5A 2FCRA 3VR5D 1JMVA 3ZD8A 1KK0A 1U9CA 2PSHA 3AF3A 4G5HA 1L5FA 1KHHA 1P39A 1QHHB 4IZOA 4NICA 3L41A 2DR0A 1I36A 3RQSA 2OILA 3TW0A 2I2CA 1V8PA 1C8KA 2AOUB 1ZQ9A 4JVNA 5A7FA 2P75A 1DAMA 2R65A 4YUXA 2WOOA 2XQFA 3B7GA 4CEIB 4YT2A 5B2FA 1ZJJA 2RKBA 3OE1A 4MRMA 5JJLA 1H2EA 2ZR0A 1VHWA 2CB0A 1QYRA 3PG5A 1HM5A 1VSBA 2N47A 4YAUA 3TLXA 1W85B 3ZI0A 3RSZA 5FLXA 3MD9A 3L06A 3QWBA 4C0WA 3OJWA 1M54A 2PX2A 3O3OB 1L7RA 3GGDA 3ZHXA 1E8NA 4HV4A 4BNYA 1JLLB 1PGPA 1JKJB 1J8MF 1UMDB 2FPUA 2PT9A 2RKWA 3BCUA 3CPSA 1BGWA 1T3SA 3A9CA 2OFXA 3HC7A 5DLEA 5CPFA 2XYHA 1JPVA 1AUXA 3HKBA 4ML3A 4MRSA 2G82A 2Q1WA 1W4RA 4O4HB 1UMDA 4RV4A 4G3XA 5GIPE 3RUCA 3JAWA 1N5RA 4LQLA 1Z35A 2BCEA 2B35A 2FPKA 4RH1A 1OJLA 2WU4A 5BVGA 2BFCA 5C51B 1XZMA 2BDEA 3G89A 2X0FA 3PQ4A 5LOVA 3EIFA 3LUAA 2O23A 1Q16A 3GD5A 3S68A 2IEIA 2FA9A 1OXSC 2ODNA 2YJ5A 1IXKA 1QO9A 1IJKA 1B2RA 4YDSA 5LYJB 2O2IA 3QOWA 4PRLA 1LZKA 2O3QA 3GEIA 5FFFA 4KZKA 2CVZA 3UWKA 3DPSA 4C2TA 1MHPA 3G7UA 5LDDC 2XYQA 3V1UA 1FXWF 3QLVC 2HFJA 5DBHX 4YCDA 4M0PA 3IPYA 2ISSD 1P33A 3PFBA 4N5MA 3ROZA 4DEYA 4QBKA 2OZKA 3ZGZA 3O8OB 3DKVA 2Y0BA 3D0OA 4KQMA 4Y1FA 5K4HA 4ZJYA 13PKA 4M55A 4WA7A 3VBEA 5KYYA 1KWGA 2LNDA 3JQ8B 1F0NA 4QM6A 2N1MA 2P40A 1CQXA 4I08A 2ZYRA 4QVKA 1NZJA 5K3DA 5KX5B 3COJA 2BTQA 2YV4A 1GITA 2H4WA 2OO5C 3O31A 2BRUA 2NQ8A 4HWRA 4ZQCB 4KQ1A 3EJ6A 5I9TA 3U0BA 3VYUB 1RTTA 5IHXA 2M98A 9ATCA 3PS9A 4YA6A 2V8BA 4QEKA 2LR0A 2OBLA 1YL5A 1CD5A 1TDJA 3IEIA 1MA3A 2MOKA 3C41J 4MUIA 4M99A 3CM0A 4YC7A 4C06A 2AI1A 2HHLA 5FAXA 3GLFA 2MYUA 3OZAA 4OK5A 1JDJA 4P4SB 5EL0A 4M60A 1P4HA 4FSDA 1VBMA 1QYWA 1QF6A 1TZCA 3TECE 1KTIA 1EP2B 5LA6F 1J2UA 1DINA 3FBGA 4TSFA 3FHLA 3Q2KA 5CU7A 3CJRA 5KAPA 4CMIA 3HCAA 3MC1A 4IEEA 3KQNA 1I3NA 3DOFA 4IHJA 2QRPA 10MHA 1WZUA 1PS8A 1O95D 5FLEX 4CU2A 1SRQA 5EKDA 5B37A 3FSGD 3QWFA 2C61A 3FTCA 3CGWA 4MYUA 1P62B 3CPJB 1GCAA 3DMNA 1L7XA 3E23A 3LPCA 3UYLA 2IF2A 5CA1F 3BRWD 1R64A 3INTA 3VPBA 1PGNA 2WTXA 3PHCA 5EKTA 4D9JA 1FDTA 5B4UA 2VTVA 3TSZA 1IUPA 1FU7A 1YWGO 5ES3A 2L2QA 3U26A 4QDTA 3GG2A 3U56A 2H08A 1WV0A 1ZH4A 1PDWA 3WIOA 4BNZA 5KSOA 2OK8A 5ESXA 5DGCA 1KU0A 1JIXA 3COPA 5AHRA 2X77A 4LA4A 4R1PA 4E5VA 4HAVA 4YDQA 1GZHB 5IFLA 2FW1A 3AR8A 3IP5A 2B4AA 1YVRA 4LYEA 4MS3B 3SI7A 2X23A 2FLWA 1UPFA 4RK4A 5HTKA 3DYIA 2HSZA 3VPXA 2ONYA 3TB6A 3LCCA 4LYHA 4FVTA 3RHFA 3U3ZA 1GU1A 2NMVA 4G5RA 4MHSA 1IXSB 4FE7A 3WYNA 1RRGA 3G2JA 1GQFA 3CHYA 2Q6KA 4QYMA 2ATEA 3I30X 3OF5A 4WX2B 4AF8A 1I4TD 1S3FA 2JAXA 4UBIA 2EJCA 1C0LA 2BBSA 1EUZA 1KAMA 2MSNA 3LVRE 3FNBA 2I66A 3MVEA 4QGSA 4CKWA 1NR7A 3BIOA 2ADFA 4NDNE 4QECA 3IERA 2W2OA 1EIWA 3T3MB 3Q15C 3TTYA 4MMYB 3VH2A 2XWQA 3DOUA 2IIVA 3EAFA 3ZQ4A 1WSDA 3HFSA 3WRXC 1JPUA 4XYEA 1Y3CE 2IEAA 4I55B 1H42A 2O07A 3QTBA 1C4WA 1T2DA 4QUDA 5JS6A 3IOYA 1H8HD 3BK2A 2A1UA 1AT1A 3SYRA 1XZKA 1Z6GA 2P62A 1Z17A 2J0EA 3OO1A 4IGEA 4YMIA 3MG9A 5IT0A 3K1ZA 1PGOA 4LRQA 5AICA 4YALA 1G21A 4X91A 2ONJA 3KOUA 3IKLA 4H1UA 5J59A 2R87A 2R62A 4I4TB 4JT4A 2C2MA 3ROFA 4E5MA 1U8UA 2FWNA 1WHSA 3KPJA 4XASA 4QSMA 3FETA 2ODQA 3C7AA 5HMLA 2BUCA 2B4RO 3DBVO 2LP4Y 5IW8A 1F0PA 4AIRA 4ARBA 1M2KA 2R751 4A73A 4MI3A 3GCDA 2WSIA 4C0KA 3K70B 2C54A 1N8TA 4GVPA 1SKMA 1RM5A 2PSJA 3DVAA 2GZRA 3M4ZA 3HUUA 1GPYA 3JWJA 4E1VA 3FWPA 2GXUA 2NVOA 2YDXA 4X20A 1P0FA 1FDWA 1ZM4A 1WZEA 1YOBA 1NBAA 4LC9A 4U6SA 521PA 1NM5A 2YZKA 3BIWA 4BMVA 4CUJA 2CXXA 3NHMA 1SG6A 2G0AA 3LH5A 2Y68A 3TBKA 5E7QA 4II2A 5KTKA 2DPMA 2MT9A 1J09A 3G0BA 1J22A 1E9CA 1NBMA 3AERA 2W2VA 1YZYA 2X14A 3HUEA 1V11B 4UNSA 2ID7A 3SQWA 4Q34A 3UHJA 3PK0A 2KBFA 1RWXA 1N92A 2HFKA 3QVOA 4W63A 4G97A 4B9AA 3PXUA 5JBNA 2I2XB 4CHTA 2FSVA 2D2FA 3MJEA 1YE8A 4IDDA 4DNXA 4PSAA 2Y0PA 3RSOA 2J0UA 1A50B 1GQYA 1PSZA 1U7WA 2QTWB 4MOWA 2X8BA 4Q1VA 2FFHA 4LGYA 3V42A 4DV4B 2UZ0A 4JYMA 2ONCA 1ZGJA 3CNQS 1BQ4A 2R6CA 4OHFA 4Y18A 1S8OA 3HP7A 2BT4A 1FZQA 3FAZA 4XYBA 1ODFA 3TW4A 1W94A 1FRVA 4EQZA 1PKEA 1WSAA 3TBHA 3CRRA 8OHMA 3BTSA 2A86A 3BD9A 2WFLB 5JRZA 3KQWA 3II6X 1OHHD 3NB0A 1S8FA 5FTMA 3P9PA 4R51A 4FI3F 4Y1RB 3DUFA 4JY7A 2NV6A 2CZQA 2KI5A 3K2QA 3TW8B 4EUHA 4AG5A 4GSYA 1YRLA 2AC7A 1HFJA 3KTAB 1JEYB 3VO2A 3PHGA 4X85A 4YJGB 3SSMA 4TKUA 4JX8A 5C3UA 4DCVA 3KJEA 1VJCA 3PQDA 1MB4A 2YWDA 5BSGA 1TO2E 3UMCA 2FOIA 4HXGA 3JAKA 3W9BA 3K30A 1ZHHA 4C3OB 3NGMA 3FDZA 5DBOA 5EUMA 2WT4A 2WDZA 3N8DA 4CCWA 4EKDA 1X0XA 3CR7A 1FP2A 4ALNA 1E60A 2ZQYA 1FFEA 2CLKB 3EEBA 5D3MB 5CA0F 1DAHA 4MDYA 1I2DA 2V5UA 5REQA 2VWGA 4YJFB 4Z1MA 4KPUB 2EC5A 5KU7A 2XWPA 2D2IA 3F8TA 2GLUA 4FPXA 3SZRA 1MC8A 1XF1A 3I64A 4E2ZA 4ENPA 4GPTA 3EZFA 4QO7A 5C1PA 5FPPA 5JSUA 4AL4A 3D3WA 3NBUA 1OXUA 4F93B 5FXMA 5JAQA 1FS5A 3P45A 3QLTA 2YJGA 5FUXA 4ZT4A 2WYVA 1GLNA 2I6FA 5H1YA 4KPFC 3AV0B 1BRTA 4EW1A 4GI7A 3FCYA 1RYBA 2OZVA 3OCWA 3PLNA 4H4EA 4UCXA 5ENVA 2PRJA 3VOAA 1PX0A 2BBWA 2CNOA 4QD3A 5A3VA 4EENA 4OL9A 3DVSX 3U2QA 1DC3A 1UKCA 4UVDA 6Q21A 4HPWA 3BXHA 3DZJA 4GPZA 1JH9A 1JVSA 4NBNA 4K6KA 1XTTA 2QAIA 3O91A 1W5AA 3V2IA 2VYVD 1KERA 1SU7A 3P9SA 1MR3F 4H7KA 5E6RA 1PGJA 4UKDA 1IN5A 3DD1A 4D4KA 1E32A 2N75A 1NGSA 2XTNA 3U37A 4B6RA 2DCUA 5EJ2A 3V6LA 3BDAA 5MHTA 5DRTA 2OPHA 1R50A 1R9NA 2HB6A 4FKBA 4IFTA 2WHYA 3H3XA 3HJHA 4G0WA 3LQYA 2PYDA 3FWZA 3IUJA 4MQ6A 1G3IA 1LSJA 5JPDA 2R4UA 1B3BA 2C96A 4Y8VA 2DR3A 4LI0A 3CKYA 1QG2A 1YC5A 2Q2OA 2G4VA 4YAEA 3RKSA 3RUDA 4EO4A 4BPBA 1G1AA 3PQ6A 4RDIA 3U4AA 1C30A 5CVTA 5GVRA 4F3RA 2HCTA 2JFGA 4MW2A 3DDWA 5KNBA 1Y4AE 4HS9A 4JXJA 2BHNA 1DFHA 1H69A 1RI3A 3KS9A 2RBGA 1QGUA 3KKKA 1KVRA 4EDHA 1E92A 4EL0A 2KB0A 5JFOA 3OQMA 2H65A 3RSCA 5TQVA 4HLCA 5ALHA 4ASUA 3QX9A 4CF5A 1U2TA 1SZDA 4R8VA 4KIWA 5FV7A 3PUZA 4IOLA 4C4XA 3OLVA 2BTEA 2O8EB 2FSFA 2F6RA 1H5UA 1QNFA 1VFNA 4WFJA 3UGQA 4M1WA 1QB8A 3L1IA 3WLPA 4A0HA 4W82A 3RVJA 1KVSA 5JU6A 1IH8A 1MLDA 3FPJA 1M0SA 4IEFB 4XB6B 4COOA 1C3VA 4C4AA 3AEYA 4PLYA 1KYYA 1T2UA 3C5WP 3E58A 4FJ2A 3TNFA 4BB0A 5L3QB 1L1RA 1T5IA 3DNPA 4H7JA 2XUIA 5K8IA 4HP8A 3KQPA 2DERA 1NNEA 1KEVA 3KJFA 3O9VA 4HB2A 4ICIA 2L69A 3RNLA 4PINA 3Q3IA 3VHRA 3G8DA 4EARA 2LW7A 4P3OA 3GB9A 1P0QA 3IJPA 4BNIA 4NCBA 2I1QA 3DUFB 4LK2A 4A36A 1CQWA 2YW2A 3KFVA 5C35A 4UMDA 3ZHRA 5AESA 4R8RA 5DXJA 1PJQA 4OQEA 4P9NA 1H9AA 3RUHA 3MINA 4EOGA 1EWQA 1EUCB 3AZOA 2QJWA 1PLJA 5C5DA 2D0PB 5JARA 1IVNA 3QOFA 1EWKA 3QVJA 3A2LA 3M6XA 4W7SA 1U31A 5EWMB 2D54A 4F96A 4PY2A 3SZUA 1XDWA 3A9VA 3ICWA 3OMWA 1XZQA 3A4MA 4PX5A 2QTRA 4H77A 4X71A 5C4IA 1R66A 1E7MA 1V1RB 3WHKA 4MWBA 4RU1A 1VIVA 3JZDA 3L84A 1EWRA 5CHYA 1X87A 3E9QA 3HU5A 4RKRA 1QFYA 1AV6A 2AFHB 3WSVA 2W2PA 2O06A 1GA4A 2QN2A 4GOOD 4ODIA 4DANA 1N78A 1U5BA 5CYPA 3TLGA 3RIYA 3EOAI 1ENPA 3AF1A 4PIMA 4Z5XA 2ZI5A 4IXTA 1U65A 3KJIA 2ZM5A 3RUEA 3NOQA 2ZUFA 3ZU3A 1CT9A 3AFIA 4QFCA 3KUXA 5CXQA 2F3SA 2C78A 4KE7A 5DXFA 3EA4A 3LCRA 3A05A 3CG0A 1WCYA 4LNHA 5HJ7A 4OATA 1P2TA 1YHYA 3OFJA 4KHPB 2JGEA 1CZRA 1Z13A 3W6NA 4EMUA 3CZMA 3NDRA 1V7QA 1QNLA 1NTRA 2CBZA 1IONA 1D0SA 2GO1A 5EUBA 4DNOA 1WPGA 2JCGA 3I04M 4B43A 3F47A 4I6GA 1U80A 2PX6A 4EBFA 2I3DA 3RBXA 5K01A 1RIIA 4W9NC 3PWKA 5LPNA 4AKIA 3PHLA 4AMYA 3UJ9A 1FMJA 5FOXA 3BGVA 2X9GA 1QF7A 2EXXA 1BH6A 1C9KA 1Z06A 4NCKA 5BW5A 1DKNA 3V5NA 1AGXA 3THSA 1KS9A 2VXCA 5CB4A 1KMQA 5SY9A 3MMZA 2VJBA 4JASB 4MUNA 1YBHA 1VE1A 1G21B 1Q57A 2AMFA 3JRWA 4HDKB 3L93A 5DNEA 5U4XA 1KH1A 3WV4A 1T1SA 4CW7A 1X94A 4A5SA 4R3WA 2VT7A 5LLSA 2GFQA 4J16C 4YI3A 2I6UA 3RSHA 2ZYTX 3T1HB 1WX1A 1P4AA 5DPMA 4HZIA 4DREA 3RAJA 3GAZA 4PU0A 1P4RA 3OQIA 2YFYA 3HBLA 4M37A 4W4TA 3W8NA 5DYIA 1YGYA 5IAKA 1OWMA 2BZSA 1POXA 2R00C 3PICA 5IM4F 3DV9A 1J00A 4JUDX 3FCCA 4ZO6A 4ABYA 5L9AA 1ZJZA 4XW2A 1K7EB 1PG5A 2GBCA 4QNRA 4F71A 2Q9BA 4RA6A 4K87A 3HM9A 4OL0A 2P3QA 2WJHA 3QPDA 3O8RA 2AG8A 4J2OA 1UT5A 2XMSA 4DV1B 4K9KA 2CKDA 2ZCVA 2PWAA 3O1IC 4DPKA 3FNEA 1RU3A 5C7LO 1PRYA 4I8DA 1XK6A 4ZGBA 1Y4ZA 3HSSA 4FUTA 1PIWA 2ZKLA 3OOYA 1Q19A 3DKKA 4KMSA 4CEJA 4TTTS 1VCNA 3STUA 1YA4A 2Z1NA 4Q9AA 4Y2RA 3O4RA 4F46A 1SQGA 4M8LA 3U40A 2F8MA 3DWGA 3HMKA 3THWB 2I2FA 2VXOA 4E46A 3HE3A 3D9QX 5CBKA 1G1MA 4LXGA 4YRPA 1FTYA 5A9SB 2GZHA 4KGVA 1U0OC 2IYUA 3HYLA 4HWSA 3AY7A 4OYYA 4QOGA 1DV1A 2F1OA 4OH1A 3GLTA 4WNYA 4JIGA 1TYDE 4C76A 3UBTA 2FFBA 3N2KB 1X7DA 2XQJA 1E2DA 2VK8A 1OU4A 1E1NA 5J47A 3KJNA 3OLWA 3JD0A 1CUCA 4M88A 1G5HA 3LBHA 4MH0R 2IJGX 4MV4A 3NGLA 4BNDA 1PVOA 1G8FA 3LXRA 3PVCA 1CQIB 2VJCA 4J3FA 1NF8A 4PC6A 4QREA 5COBA 1NMEA 3PA6A 1DEHA 3R09A 4FZ3A 4IGFA 1PL7A 3UBMA 4XSGA 4JT2A 3JWGA 4EPTA 4DZTA 1D2NA 1F8UA 1RSZA 2KE5A 2BKVA 2Z58A 1JQAA 4IOMA 2E37A 3WMRA 4GSKA 3K5IA 4D0NA 4DW8A 4KEAA 1UPBA 3LHIA 4JI6B 1TADA 1US8A 1U8TA 4ZYWA 1M1YB 1O8CA 4JGBA 2YWFA 3T52A 1QAOA 1OLUB 1TM3E 2ZR7A 4M38A 4B75A 3GA5A 3CB4A 4JOQA 2KM1A 4NYJR 4NK5A 4CETA 3KV3O 4KTVE 4LDZA 1ZH0A 3AMVA 3I04A 5AM5A 2RHRA 3ZWNA 4FFVA 4X6XA 1AZWA 4RMNA 4UW9A 1ZK2A 4D3XA 1NJ1A 3EK2A 5JNWA 2E4YA 3ETGA 3TTWA 5K5EA 1R00A 1FRFS 1XNGA 2B4YA 3QJYA 1DXYA 3R3HA 2CLSA 4P7JA 4RVCA 4ZVMA 3TEMA 4CTOA 3KXPA 3IC5A 3JYNA 2ST1A 2A0UA 1ECLA 1PD0A 2O05A 1WUTA 2ZITA 2VZ0A 3P0EA 3BMNA 1W0KD 4EJSA 3AF5A 3S2GA 5CB0A 1PX2A 5AXCA 3ZYZA 2ZGVA 2HNKA 3JPWA 3U0VA 1VDZA 4NAVA 1XRLA 4U9UA 3K6KA 2MU1A 4DA9A 3UXHA 5EPOA 5AJWA 4D4HA 2BP7A 3I9FA 4EB0A 3DEJA 3IP3A 3ZS8A 3QXCA 1PO7A 1VOTA 4Y2SA 2CMHA 3H2KA 2ZJ2A 4TS3A 1Y1KE 4KDRA 1NIPA 3SEAA 3T5MA 3W8RA 4D45A 1CNFA 4OI4A 1XTVA 3RG2A 2DBZA 1QZUA 5IJ0A 3M33A 4Q16A 4LRUA 1ADBA 1IJFA 3GJ0A 1KAQA 5K8JB 2A9QA 1HDYA 3I9NA 2R48A 3GJ5A 1VE5A 1BRMA 1E62A 1SGWA 3HG7A 5ITSA 1P91A 1YO6A 4EYGA 2GBFA 2CE2X 4LQCA 1HYGA 2ZTUA 5LP6A 3HKDA 5HR5A 1VL8A 3DL4A 2YZ2A 3BWXA 4E4RA 4HSGA 3TZHA 1WDWB 3WWPA 1JXMA 2VKQA 2BR3A 3C5EA 4Q1EA 1DJMA 1Q1QA 4BVEA 4UNQA 4R54A 3IEMA 4K6FA 3EWAA 3N2ZB 4G0QA 3X43A 4ND1A 1XZGA 5IJAA 4MQUA 3CNNA 1S7CA 2ZRNA 3MJVA 5E6SB 3VGPA 4MZXA 1YDGA 1K7SN 2DBQA 3B3FA 3C8HA 5ADVA 4EG1A 1G4HA 3IIMA 5LP6C 4DBLE 5IAOA 5TEVA 1APBA 4YO7A 1EFKA 3F97A 4Y2JA 1I30A 5U1PA 1M6VB 1JJBA 3KYDA 4IL5A 2VCEA 3G79A 4OHKA 3DO6A 4Z49A 3MJTA 1XQYA 1YH3A 2N46A 3MIZA 4G9GA 4ARAA 1X1EA 2B61A 3PCXA 1F0YA 1BDBA 4FMCF 4ZHQF 5CG1A 1YUNA 4XTCS 4AICA 2H2FA 2ZWAA 2Q5IA 1J2EA 2CUNA 2RGEA 3MCUA 3PC2A 1OA1A 4RJIA 3S27A 3EVEA 4BBZA 4ASUD 2P7IA 4FEEA 4IMIB 1GEEA 2HA4A 1C0IA 1C4KA 1V7PC 3IUNA 4JLJA 1LDMA 3REGA 2VF7A 1DDIA 3I1IA 1Z0FA 2DPLA 2DX7A 1B1AA 3W77A 5KNBD 1AQIA 2QN1A 1GAXA 4UMEA 2OXFA 5DNVA 1BU5A 1R0KA 3KAJA 1EFPB 2RC5A 3L3BA 4W7IA 2CJWA 4IGAA 5ALMA 1JG1A 4MICA 1JFRA 2B7LA 2HF8A 3WB1A 1NJ6A 5A5GA 4KFRA 5DHFA 4DT1B 3S29A 1J2YA 1DSSG 1ZPDA 2Q8NA 2VUIB 4PZEA 5DV9A 5JWOA 2PJUA 2PUJA 1PSWA 2FP4A 1IEQA 3C0KA 4PGHA 3ZGYA 2BLNA 4WJKB 3K4PA 1HDZA 2Q4BA 4MR7B 1FFCA 1NPTO 3EBOA 1GKIA 1NOIA 4WJZA 5FWXA 4ZFNA 5KIAA 2BFFB 3ZK7A 2ZBUA 1NBEA 4FOTA 4MZDA 4W5RA 4Y9UA 3WC4A 1SD1A 2F4VB 2WKPA 1CUGA 1SU6A 3HUDA 2WIJA 5L3RA 5E4YA 3P32A 4RA9A 2TMGA 5AKIA 2O8FA 3GZNA 4JMPA 4RPKA 4IDGA 2PEYA 3DLPX 1AK9A 2Y9MB 4M1ZA 1E89A 4UMFA 3GRKA 1B41A 3K6JA 1LEHA 2VP9A 1BG6A 3T15A 4CL2A 1QB7A 4NCHA 2AGVA 1QOPB 3ZXSA 3LU1A 4O4LB 4OIMA 2PQ6A 3TAXA 2EP7A 1KMCA 1N5OX 5BWCA 1ZU5A 4G56A 1KDRA 3OQBA 3RC1A 3ZQJA 1KS2A 2FNAA 4HEA1 1T6ZA 4MCJA 4EG4A 1LDEA 4AO8A 1N9GB 1W96A 1YQ9A 3OCUA 1NT4A 1W4ZA 3QBVA 4YP9A 5CDFE 3AVYA 3FPGA 2HJHA 3OEED 3Q9SA 4ISCA 2B1IA 2VPXA 5CM8B 4C4PA 2XNSA 4D8WA 2G0NA 3RK4A 1AQUA 3QV2A 1E6KA 5F76A 6AT1A 3A4LA 2WDPA 3R8XA 3RANA 4I1IA 5EHZA 3TQQA 1RQNA 1WJGA 1E3SA 2XWBF 1OA0A 3EEFA 3K31A 4P8RA 5ELLA 4YR7A 4GC5A 1CDEA 3SK0A 5I3CA 1ZRNA 5DJ5A 1ZLYA 1AMUA 4CZ2A 1V0JA 1AN9A 3HCPA 3SJZA 1KDVA 2WSBA 3A6EA 2Y66A 1D5WA 2HCRA 1WXEA 4QJBA 4PSKA 4W5OA 3I2IA 5TLSA 1E4VA 2REBA 2ODWA 2EU8A 3FCOA 2X0IA 2XA2A 2YHIB 5I7OA 2EKDA 3L0BA 4RHYA 1F17A 2HBZA 4WKOA 1LBSA 4MVCA 2CXRA 3WO0A 4B3SB 4X8LA 3GH1A 4AUNA 4I50A 4Y7CA 1RLOA 4E6PA 1JG2A 3IP7A 2HAEA 3KKPA 4EA6A 1ANKA 3CRMA 1E4EA 3AJAA 1O6BA 2ZBGA 3IDQA 4XLZA 1ODCA 4J6EA 5B55A 5BWBA 4FFNA 1CRWG 1G6HA 2QZPA 3RTEA 3UAVA 4AK9A 5B30A 2BMFA 2HDHA 1HRKA 2OHFA 4BAGA 3P52A 4OMDA 5MFZA 1E3WA 1M1ZA 4AS2A 1JHQA 1X1TA 3EBLA 4RD2A 4R9VA 3K71B 3GW8A 1N6IA 3MWJA 3NCHA 3PD1A 1F2UB 3JCZA 2G83A 3B20A 3I5MA 4RQAA 1U2GA 4PCLA 4UPDA 1A1SA 3KHKA 2L42A 5BSTA 4YN3A 3KQQA 2QAGC 1T29A 2XUGA 2QN6A 4K6CA 4OHXA 2QAJA 4EJMA 1ZN2A 4P4UA 2XCQA 2VSNA 2YVKA 3WGJA 1YCHA 5JCPA 5L7TA 4CKEA 4ZAZA 1LF0A 2CL5A 4I0WB 3ZW9A 4BRZA 3V2GA 1E7RA 4QUIA 3EDYA 2PGNA 2OGSA 3SPXA 5C3MA 3TF5A 3AFHA 4R41A 2BI7A 2O8DB 3LT0A 4OXQA 2XVMA 3FSRA 1AKWA 4R7GA 2PBFA 3L0IB 4LJKA 1E64A 1XL1A 3DHVA 2OV3A 1PNTA 3QUTA 4CR8A 4DUGD 5IJ9A 2P2NA 3ROGA 1UBUS 4LVNA 2NQTA 4XVRA 2OKGA 2JA1A 2RGGA 3VU9B 4JLKA 2OEPA 5ALPA 4WZAA 4PYJA 1V16A 1SXIA 2M9MA 2QJRA 1UF9A 1JIJA 1SCAA 2Z2KA 4R6XA 2FK8A 2FLVA 4KU4A 2AE2A 3DE0X 4OHPA 2PNFA 4BKRA 1A0OA 3EGIA 4AT1A 1PT7A 3U9LA 1PJAA 1X3SA 1XTBA 1FSPA 1Y3FE 3B3QA 4JJZA 5ENDA 4M83A 5J2UB 4P3YA 1A7UA 1JGTA 2F43A 1V5FA 3BBPA 5HQ3B 2JAQA 1LZLA 2D3TA 3OEWA 3N58A 1GZ5A 1GCIA 2PQ2A 2PBZA 2Z6VA 1KAHA 1NQ5A 2FWAA 3MIIA 2D62A 1MIOB 3STTA 4HNUA 1UKVY 2AYXA 1VJTA 3EZLA 1RTKA 4ME6A 4BQSA 1AH2A 4PM4A 1J7JA 1X7YA 3KAKA 3QG5A 3DW1X 4P3NA 4CKCA 3J81k 3PI7A 2WNIA 3DTYA 4KH0A 4LV8B 5K51A 3JYOA 2FUEA 3QEJA 1ZU4A 1MDBA 5UKDA 3B60A 1B76A 4YREA 3PEYA 3G17A 3GCXA 1EBUA 4V0KA 1CU1A 1VIMA 1OROA 3I01A 4OHOA 2AFIB 4CBVA 1NJGA 1ZVJA 5IYZA 1VJRA 5JH7B 4DNFA 1I8TA 1BS2A 5FUQA 3PQFA 4URUR 1UBFA 3E9DA 4B8ZA 5DN6D 3AL0C 3OUUA 1W6UA 4GLOA 4PLFA 4C7OA 1OAKA 1CRZA 1ESZA 1Z6PA 1KZYC 1NW6A 3FHTA 2B3TA 2ANCA 3LGSA 3RS9A 1XFDA 1JG4A 2ETVA 3BB3A 3EVZA 3BSSA 3PFHA 1OTXA 5AKZA 4AECA 3GXOA 1GUAA 1RACA 3F6RA 1AQLA 3LCUA 4MWSA 3WQRA 4K8RB 3A1VA 1TECE 1HDOA 4HC4A 1GO2A 1OXXK 4UE6A 3V7UA 2VHTA 9GPBA 3RAFC 1IHOA 2CXOA 4G65A 5BR4A 2YC4C 4IUBS 4JI0B 3KCQA 3ZZNA 2YVQA 2F8LA 4JJFA 1GUYA 3IQZA 3EE6A 4LXYA 1XCMA 3NHAA 1FNNA 2VZLA 2XKJE 1QQAA 3GOHA 1VL1A 2Q1TA 3PLRA 2LD4A 3FPHA 4B6EA 1B8PA 4CM3A 5EMJA 4QPCA 4LY0A 5LL6P 1UINA 2QUAA 3QFTA 1T3HA 1JI0A 3HBMA 3HJRA 4KV9A 1QFMA 4XPIB 5FYQA 2L0XA 2V55B 3A1DA 5BXQC 5A7HA 3DXXA 5LXTF 4WLVA 4WK4B 7GPBA 2QZSA 3NHLA 5CLHA 1P1CA 1QK5A 2RBEA 4NBWA 4J7AA 3QKSA 4N65A 3WL3A 4G0YA 4F4CA 1GFSA 1ZDMA 2JRLA 3O8DA 4ZOEA 1JTEA 2R85A 3W9SA 1P9LA 1U0TA 3OF2A 2TMDA 3KUCA 4TSKA 1I9GA 2REOA 1HETA 4X97A 2CV0A 4EY7A 5EJEA 4CR7A 4FYIA 4BMPB 5IAGA 4AYTA 1PK8A 1UWCA