1GTMA

Structure of glutamate dehydrogenase
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
417
structure length
417
Chain Sequence
b'ADPYEIVIKQLERAAQYMEISEEALEFLKRPQRIVEVTIPVEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGIIVDPKKLSDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISRRKTPAFGIITGKPLSIGGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEVLKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDFLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWVKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE DEHYDROGENASE
publication title The structure of Pyrococcus furiosus glutamate dehydrogenase reveals a key role for ion-pair networks in maintaining enzyme stability at extreme temperatures.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 171
structure length 417
sequence length 417
chains with identical sequence B, C
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 1996-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gtmA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1gtmA01
1JKJA 1I30A 1A9ZA 3VZRA 1V9LA 5JLAA 3HSKA 1NTOA 2BF7A 4NBRA 1LQUA 5LDHA 2CF6A 1OZAA 4XYEA 2WE7A 1P74A 2FOIA 4IDAA 1E6UA 1O9BA 1LEHA 1EZ4A 3QSGA 2B4QA 4PVCA 5JAMA 5C37A 5MGBA 2A4KA 2ZJ1A 1CDOA 3I9OA 1HZJA 2I67A 2JHGA 1H2HA 1Q0LA 5L95A 1YL7A 5L53A 1Z75A 1EE2A 4BKQA 4DIFA 1E1KA 3MEQA 1JAYA 1KVSA 1I8TA 2BELA 1EVIA 1O94A 4RVDA 1O6ZA 3WJAA 1RWBA 3IIEA 4UEKA 3KYBA 4NBWA 4GWGA 5JDIA 2EP7A 3BMOB 4Y6SA 4D3SA 2PFGA 4J2OA 2BGKA 1ZH8A 2ZKLA 4AJEA 2E6UX 4MINA 4GX0A 1I24A 5EESA 2R00C 1P1JA 4I5GA 2CFCA 1D1TA 1PGJA 1HYEA 3IDSA 1NPDA 1VKOA 3LF2A 3DO5A 1YOVA 3NUGA 4FJ2A 1R16A 2Q1SA 3PHGA 4DC0A 4O63O 2G0TA 3CZMA 3LLSA 4FC7A 3W4KA 1KEPA 2VHWA 2BI7A 3CPSA 3OIGA 2FY8A 3PRJA 1IUKA 2VZ0A 4XIJA 1IB6A 1XU7A 5T6BA 5KJ6A 3BMNB 1I36A 1DC6A 2LDBA 5KOIA 4TRNA 4QSMA 3H8VA 4UREA 3KOUA 2Y66A 2B4TO 1X7HA 4TZTA 3VH3A 3TZHA 3GF4A 3RUDA 5B4VA 1KEVA 3ULKA 5JE8A 4RF2A 3ZV4A 1WLYA 3WNQA 1LRKA 1YB5A 2VHYA 1ADGA 1WDMA 2DTDA 3VC7A 4MO2A 2Y0EA 1I3LA 1F0YA 4IUYA 1NAHA 1E6EA 3NV9A 4BGEA 2DPGA 4HUJA 2ZTUA 5KVCA 1JTVA 1X0XA 2YY7A 1BDMA 5TT0A 3WSWA 5JMPA 3TN7A 3PXXA 1Y81A 3OIDA 4JIGA 5FF9A 1E1LA 1UJMA 8ADHA 2IYPA 2WYWA 4WK6A 3PZBA 4FSHA 3JD0A 3R1IA 1T4BA 4KQWA 1T24A 3ANLA 4YJDA 1F12A 3TFQA 2LDXA 5TRTA 3DAFA 1U8XX 4U5QA 2D4AA 2PH3A 3IAHA 4TWRA 5CG1A 2X0JA 5T64A 3NT5A 4Z3KA 5JMWA 1PR3A 2PZKA 2W98A 2JCVA 1RM5A 5IZCC 3A06A 5H82A 1ZJZA 3X2FA 1H2BA 1DAPA 4J16A 4CM1A 1XGKA 3FI9A 4E31A 3SC4A 4MP8A 1BDBA 3STHA 3EHEA 1GV1A 4ILKA 1SC6A 3VPFA 3GGPA 3ZWMA 4HFRA 4I9UA 4PN3A 3OJLA 2R6JA 4LISA 1HF3A 3KSZO 3VH1A 3ZNPA 3JQEA 3NTRA 3AFMA 1ONNA 1UAYA 1AHIA 2X1HA 1V8BA 1YB4A 4TSKA 3NT4A 4W9NA 3OH8A 4R41A 1P1HA 4DC1A 1NQAO 3KYCA 3JQ7A 4CUZA 1J4AA 2Y1CA 1VJ0A 5JFOA 1SPXA 4JX8A 1E1MA 1E7WA 2VTEA 3L4BC 1PZFA 4D45A 4XR4A 5AXBA 5TSDA 1M6HA 3BTOA 2DKNA 1HLDA 5TX7A 4OO3A 2BFOA 4EEXA 1LDMA 2D59A 1DJNA 1T25A 3JQGA 2XXJA 1DFGA 2DFDA 4NG5A 5A9SB 4WEQA 2B4RO 3E9NA 3O4RA 3UUWA 5KNLA 1NWCA 4C7JA 2QIOA 1ARZA 2PD6A 1R12A 1NQTA 5K6AA 1YQGA 4YWJA 4XGNA 3JQAB 2Q1UA 3B6ZA 2E37A 1K6JA 5I8ZA 3DBVO 4U6QA 1ZEJA 4I5EA 4EJ0A 4J2HA 4PGFA 3NKLA 1HSZA 3LT4A 5ER6A 3I9JA 4Y8VA 4FR5A 5A3JA 4FN4A 2AG8A 1NX6A 1NQ5A 4YJGB 2W4QA 2RCYA 4AJIA 1DPGA 5F1KA 1QLJA 3KBOA 1MA0A 2FHSA 1HKUA 2WEKA 3H9JA 3AM3A 1EVJA 4CQLA 3O8QB 4E2XA 3RI3A 4OQYA 4K1LA 4FGWA 1YONA 1H0KA 2NVWA 3GLQA 2FR8A 2P4QA 1H9AA 2CDBA 4BVAA 3E1KA 3JCZA 3OF2A 4XDZA 1HE2A 3JYLA 4ZRNA 2FRDA 2AXQA 2HK8A 4CM9A 4CV1A 3PVZA 3RU9A 1PX0A 5CHEA 2XPCA 2YV3A 2DM6A 2PH5A 2ZB8A 4GGPA 3WQQA 5FEUA 3H9EO 4TQGA 3FBTA 1GD1O 4Z9XA 1CQJA 4RLHA 4D41A 4DLLA 3TWOA 2EP5A 5THQA 4UEJA 4CJXA 1H6AA 5A5FA 3BMQA 4PLVA 2DBZA 1A7AA 1SMKA 3EVNA 4BO8A 1JKFA 1XSEA 1AXEA 3FWNA 2C2YA 3ZV5A 5CFZA 3FD8A 2O2YA 5B37A 1YVEI 4D43A 4GVXA 4ONEA 3UXYA 3R3JA 5LCXA 3KEQA 2VT2A 3SX2A 4Z0TA 2GN8A 1Q7CA 3UKOA 4DUPA 2CVZA 1CYDA 4N5LA 4BNTA 1ZNQO 3H5RA 3CTMA 4W99A 4GX2A 5F1OA 4RO0A 2X4GA 1XKQA 4YYZA 3DHYA 3BTVA 3FTNA 1L1FA 1B8PA 4FQ8A 3BAZA 3TRIA 3FN4A 1TI7A 4GGOA 4IDEA 1KS9A 2VWGA 4YA6A 4BNFA 2VYVD 1E3EA 1MLDA 4DIOA 3CE6A 2RHRA 1CEQA 3DTYA 2IZZA 2OBYA 3IJRA 2NVUA 1XQ1A 3DL2A 4NU5A 4YBZA 2NU6A 2QYSA 4OSPA 3AUTA 3LT0A 4BGVA 5G0TA 4MVJH 2W2KA 1T26A 2CSUA 4RPGA 1VI2A 3IP1A 5TJ9A 2JHFA 4BMNA 4PG8A 4RPLA 1F14A 1V3UA 3PHLA 1QYDA 3A14A 1HE4A 3WTBA 1UXKA 4XYLA 4II3A 2D3TA 1HSOA 3F4BA 3MTGA 1H94A 4J9UE 1PGOA 1QYXA 3I4CA 4CUKA 2CF5A 5BSGA 4DMLA 1NR1A 5B4UA 2BGMA 2JKVA 3HNPA 1EUZA 2GN4A 4E2YA 1OC4A 1WMBA 3ZWBA 1AN9A 5IDWA 1X1TA 2HMWA 1ZVMA 5IF3A 1GADO 4P4GA 1DBVO 2VQ3A 3UW3A 1FDVA 3R3SA 4GBJA 3ZNOA 1ISGA 1RM4A 4D3DA 3IKVA 1ISMA 1NPTO 2BRUA 1T2FA 4L74A 4PLCA 4BUCA 2UYYA 4WECA 3U4DA 3GEDA 4B7UA 2IXBA 4CMEC 4MKXA 1FJHA 1WW8A 1DRVA 2PZLA 3OIFA 1N7HA 3GNTA 5T67A 4BV9A 3VPGA 3FNGA 3RC7A 1NXQA 2EG9A 4ALNA 4W9NC 3U3XA 1LA2A 4G81A 1JN0A 3KLPX 4FFMA 4UUNA 1E7MA 1I5RA 1RPNA 1YJQA 3RCBA 1ZXBA 2Y0CA 4W4TA 3HN2A 3PPIA 2VHZA 4BNYA 5IN5A 4J0EA 5EQFA 1YQXA 2X22A 4XWYA 1RYDA 4BNJA 5EPOA 4BHTA 3WGOA 3PJFA 1IOLA 2CZCA 1SCUA 3FNEA 4BKRA 4XRRA 2HAEA 3WB9A 1YQDA 4D0RA 3JQ8A 3FHLA 1Y8RA 3LK7A 2NUAA 4LGVA 1TB4A 3EZLA 3D3WA 3E9QA 3IJPA 2JFGA 3LU1A 4I5FA 1H93A 3F3SA 3EAGA 1MFZA 2B35A 3RUFA 3AK4A 3QJ5A 4FGSA 4RLSA 4FJ0A 5F21A 5FYDA 1N1EA 1HDGO 3AOEC 4RVUA 4BL5A 1EEHA 5KVVA 3EMKA 3GVPA 3ZWOA 1FXSA 3D0OA 2BFMA 1A7KA 1LLCA 4TKLA 3JQFA 2BFPA 1IL0A 1E0DA 1SEPA 3I6IA 1P1IA 3QVOA 1PJTA 4RZHA 1DHTA 1DAOA 1N8KA 2VNAA 1HDOA 3ZU5A 3H2ZA 4XD2A 1Y5RA 3RFXA 1D1SA 1GQ2A 1F8GA 3TDKA 3KYDB 1QV6A 3L0DA 3V1TC 1I3NA 3BMNA 1IHXA 4M54A 3ZZNA 2A35A 3L07A 3HHPA 4CUJA 1TT5B 1L7EA 4R5HA 4NBUA 3QHAA 4Q3NA 2FR1A 4B3IA 1I2BA 3RBVA 2IEDA 5JO9A 1Q2XA 2UUOA 4J90A 4YACA 4O59O 2W2LA 3GGGA 5JPIA 3TNLA 1EQ2A 4E6PA 3HZZA 4CLDA 3WX0A 4RF4A 1G1AA 4FD3A 2FZEA 4HXYA 3JD3A 3FR7A 3WQSB 4CM4B 2VWHA 4OM8A 2I3AA 2WD8A 2Q99A 3ETEA 1V3TA 3PWKA 1ULSA 4J1QA 1BVRA 1E1NA 2PA3A 4WOKA 4BO0A 1I33A 1IHYA 1VJ1A 4PZCA 3P7MA 5ILOA 2J5KA 1XLTA 4RVGA 1MV8A 4OYRA 2R00A 5IDQA 5G4KA 4DQVA 3VTZA 1QR6A 5H83A 3MJCA 2VRCD 1AXGA 3FWZA 3OA0A 4O1MA 1GPDG 1OI7A 3K30A 3KTDA 1JVSA 3L6DA 2CVOA 3TL2A 1CIVA 3WTCA 4GLOA 3ROPA 3BMCB 1VE9A 4YJHB 3E82A 4CL3A 3CH6A 4MVJE 4UVGA 3TF5A 3LLVA 4BNVA 2VWPA 1VPDA 3GMDA 4QQRA 1X7GA 2NV6A 1H5QA 3FNHA 1Z73A 3FR8A 3GZ4A 4JBHA 3JD4A 1SO8A 4IM7A 1GZ6A 2X0IA 2QX7A 4EZBA 4YTEA 1HTBA 4EBFA 4YT4A 3JQBA 3E48A 4JJFA 4IINA 3TJRA 4AG3A 5DCWA 3ITKA 4IQ0A 4R1NA 3HG7A 3HDQA 4QT0A 1TEHA 4XQEA 5ICSA 4EUEA 2GRAA 3RSHA 3GC6A 1E3IA 2P68A 3RFTA 4OHUA 2NQTA 4QO7A 3HUDA 3JTMA 2FPGA 1U3VA 2JCXA 5CDYA 1W6UA 3OHSX 5HM8A 1MG0A 2C59A 2OORA 3GUCA 3SBOA 4E32A 1I3MA 5A9SA 3M1AA 4P8RA 4LW8A 1NFRA 1IZ0A 4K6FA 2OFPA 1H6BA 4BO2A 4OIMA 4L76A 2GLXA 3WGZA 2Q2QA 4NJMB 3JYOA 1C0PA 5BSFA 5I7SA 3DHEA 2OO5A 2WWRA 3RQSA 1LRLA 4GLLA 4E4YA 4KQXA 5IAAA 3JSAA 1OOEA 2EJVA 2YDYA 1BTOA 2OP0A 3WMXA 5CEEA 3BHJA 5IZCA 3WG9A 5BNTA 3RD5A 5HTOA 1E5LA 3CIFA 4XCVA 1Y9EA 3AJRA 5KJEA 5FWNA 2XAAA 2Q1TA 3WGHA 3FPLA 5G4LA 4GX1A 1CQIA 2H6EA 5AVOA 4BO6A 2EKLA 3K73O 3GK3A 3M2TA 3OP4A 4XYBA 3ZWWA 3A9WA 1PL8A 1IPFA 4IMRA 2POQX 3GG9A 1P77A 1BXZA 4D42A 5KJ1A 5A4DA 4NNJA 2C82A 3WOHA 4HX5A 5C7IO 1W4ZA 2HRBA 2C20A 1A72A 3L4BA 4UUPA 1QV7A 3DOCA 3C1OA 1U3UA 5G0UA 1CF2O 4A73A 2GZ2A 1KVRA 4AJPA 4YQYA 3QWBA 3U5TA 1J6UA 1YO6A 3OSUA 2IE0A 2C7VA 4JLWA 4TZKA 1LUAA 2WE8A 4ZQHA 1ZK3A 2PD3A 4AJ2A 4MKZA 4AJHA 4BNKA 2EGGA 4PRKA 1QLHA 2GSDA 1QSGA 2EWMA 1U9JA 3RASA 3JD1A 5B1YA 3JYPA 3RBZA 5LC1A 1E77A 3DFUA 3ZH2A 1Q1NA 1LJ8A 3F9IA 2Q49A 5K9ZA 3MJVA 5DCUA 1KOLA 4CM6A 3QWFA 5CPBA 5JO0A 4YCAA 4MVJD 1P45A 5MDHA 1DIGA 3GG2A 3PHHA 5ER9A 2DBQA 4XR9A 3DOOA 4L4RA 4LVUA 1I3KA 2X5JO 3T4EA 3NAQA 1IYZA 3AWDA 3D7LA 2EGHA 5HS4A 1YDWA 1ZXLA 3KEOA 4J1TA 2AE2A 3E18A 3T7CA 3KZVA 1DHRA 2YHIB 3PEFA 4PZEA 2GCGA 1JU9A 3IC5A 4CMGA 4HP8A 4RF5A 3C7CB 1ADFA 1N9GB 3I9LA 4A5OA 5HA5A 1YE3A 2VZ9A 1E3WA 4PRLA 3RJ9A 3VDRA 1NAIA 2Q46A 5C7LO 4LK3A 2PGJA 4ESOA 4YJFA 3COSA 4BKPA 3ABIA 3AM5A 1T1SA 2GNAA 4YRDA 2B37A 4PG5A 2AG5A 3WSVA 1KBZA 4BNIA 3BA1A 3ICPA 1PL7A 1YGYA 2QZ9A 3B70A 1T4DA 2FPPA 2ZQZA 2J8ZA 3ZHBA 1C1DB 2F1KA 2PGLA 3ZV6A 1HL3A 2IODA 4FC6A 1NPYA 2D5CA 1CERA 2AEMA 2HMSA 3WYBA 5JAIA 2ZB7A 4CLRA 5G0WA 2VNSA 3F5SA 4BQRA 3PFWO 3PIIA 3JQ9C 2X58A 3TQHA 5KJFA 4J1NA 1EK6A 4J91A 2CY0A 3DQPA 1VLLA 4ZICA 4GKBA 1D8AA 5ENDA 4DYVA 4GMGA 1Y7TA 1YXMA 3E03A 4KUGA 2NVBA 4QO8A 2YV2A 1GDHA 1IPEA 3GY0A 4HBGA 3H9QA 2DU8A 2NTJA 1BGVA 3KM0A 1KERA 3KXDA 3S8MA 2HSDA 2JD1A 1QORA 1S6YA 2WYUA 2HK7A 1VSUA 3FNFA 4GVLA 4NFSA 1ZK0A 1C0KA 5I7EA 5CDSA 3ROMA 5I7VA 4XKJA 2AE1A 3GPIA 1ZEMA 1GYPA 1IULA 4AJOA 4ZD6A 1E3SA 3GR6A 3FBGA 3PK0A 2G1UA 2X0RA 4JJIA 1MC4A 1DIAA 1YBAA 3DBHB 1SEVA 1XA0A 3QY9A 4I9NA 4IDCA 4Y98A 5A3VA 4YRAA 2SCUA 3JQBC 3DBRA 4ZQGA 2VTDA 4OOFA 3JQDA 1BRMA 2VYVA 3DZHA 1SOVA 1XG5A 5T5QA 1B14A 4I8XA 3JQAD 4I9HA 4IIUA 4BO5A 1ISHA 1RM3A 2FSVA 2IZ0A 1B8UA 2QRKA 1LDNA 2PGDA 3F46A 1HYGA 3WGQA 3H2SA 3VZSA 3BZUA 3ETGA 3VH2A 5T57A 3ROQA 4CM3A 3TZ6A 2DFVA 1U5CA 2RH8A 3H65A 4B79A 3FF4A 3L9XA 4B7XA 1HLPA 5CG2A 3SLKA 1UXGA 3B20A 1E7RA 3GVCA 3PQDA 3NGLA 3P19A 5L51A 1RKXA 4F6LA 3DFZA 1KYQA 3H6KA 1PQUA 4II2A 1JLLA 2X86A 1ENZA 3JYQA 4IXWA 2NLOA 5L7TA 3G79A 1PJ4A 3HWRA 5F3RA 3KO8A 1JDJA 4E5PA 5KKCA 4GMFA 4Q3DA 1ADCA 4CMEA 4MP6A 4ND4A 5TJHA 1UZNA 3OETA 4KZPA 4XJSA 2PV7A 1ML3A 1ZK4A 4IGFA 4E5NA 1NVTA 1NHWA 4DQXA 2FN7A 2V6MA 4J7XA 3K6JA 4ND2A 3NT2A 2IXAA 4E21A 5C5IA 5IJZA 3Q11A 2ZB4A 1W73A 4BMSA 4DBZA 3UOGA 1LNQA 3H3FA 1M75A 2R2GA 4OQZA 2AMFA 1ZK1A 5H81A 2AEFA 3OFSA 4YQZA 3EY4A 2QRLA 3P2YA 4J7UA 3GRPA 3MCVA 2B5VA 5DP1A 1UXIA 1ISFA 4R16A 4U7WA 3QVWA 3ZU4A 3I9KA 5I8WA 3D5QA 2DUWA 2ET6A 3N7UA 2BD0A 3PYMA 3K92A 3GGOA 4JXKA 2B83A 3NJ8A 4YPOA 3AOEA 4M87A 5G0SA 3I23A 4R69A 5I9MA 2FWMX 3DZIA 3IP3A 3D5TA 4P38A 4ND5A 4R1SA 6ADHA 4KP7A 4WPGA 1KC3A 4M1QA 4HFNA 4U8GA 1XQ6A 4MKRA 1GEEA 2ZTMA 2P2SA 4EDFA 2VUSA 3L6OO 4Z6KA 3LT1A 3Q1LA 4KUHA 2XOXA 2O3TA 5L3ZA 1YWGO 4KUEA 4XYMA 5BSHA 3K2BA 4QEDA 3NX4A 4YEDA 3Q9NA 2A94A 2B0JA 2VYND 3DZGA 3DMTC 3GZNB 3C7DB 1IE3A 1ONOA 2I66A 3PYLA 3SJUA 3W4JA 3G0OA 3MWEB 4HFMA 2EW8A 4IGEA 4YB8A 2Q4EA 1DRUA 1X0VA 3OBBA 4TVBA 3IQDB 4TRJA 1I10A 1LSJA 4HNHA 3ZWPA 4S1VA 2BHLA 3AOGA 3H5NA 3ZU2A 3WDSA 5JYEA 4D7AA 3AW9A 1QMGA 4DPKA 4ND1A 4DIBA 1UP6A 3PJDA 1F8FA 1R4NB 1U2GA 2YZ7A 1GUFA 1EMDA 2O4UX 2HDHA 1JWBB 1K2WA 1DDOA 3TOZA 3JQ6A 4YDRA 3TPCA 3HJAA 3C85A 2YQ4A 3PWSA 4WCDA 4NJMA 1TLTA 1J49A 1Y8QA 2E82A 2I3GA 3LYLA 3P2OA 2QQ5A 2ZB3A 1NR7A 3IUPA 1YJ8A 1WPQA 5AQ1A 2FR0A 3ANMA 3H5AA 2WYVA 3GNSA 4NJOA 4RQTA 1A27A 1BXGB 5JW6A 5BNFA 4M49A 2JD0A 4Q3EA 5JC1A 3B1JA 1PWZA 3ZW9A 2GZ3A 3CSDA 1EUCA 3AFNA 4LSWA 4E30A 2EIHA 2Y93A 1C1XB 3VPXA 3WGTA 2BGLA 4GX5A 1NVMB 2DTEA 2P9GA 3H4VA 4NK4A 4PLTA 4IDDA 2PTGA 4IQGA 2X9NA 4KMSA 4FBGA 1LC0A 3GDOA 4N18A 1PR9A 2ZCVA 4CLOB 4H15A 3WQRA 2VRCA 2HJSA 5JXWA 2GDZA 1WAMA 4GAEA 1GFSA 4IZIA 2QW8A 4EW6A 1P1RA 5ES3A 4BO1A 2B36A 5AXAA 2BKAA 4WE3A 4B4OA 3CMCO 4ZQBA 4L4XA 1KY5A 4NU6A 1F06A 1KIFA 3L4SO 2J3JA 4IPTA 2E48A 3GH3A 1J5PA 1GY8A 3M2PA 4FDAA 5EN4A 3EK2A 4WNCA 3V8BA 2O3SA 2DBRA 5EIOA 2Q3EA 2GN6A 3DBLB 1CJCA 4NK5A 5COBA 3V1UA 4OMUA 1MG5A 2GPTA 5DNAA 3W8DA 2WD7B 3UFXA 4DPLA 4PG7A 3Q9UA 4KTVE 4XGKA 3U62A 4KDFA 1R4MB 1DC3A 1U3TA 3CEAA 3I1JA 5DCYA 1FF9A 4FIZA 1PJQA 4NDNE 1TXGA 1OAAA 3PJGA 1BMDA 4GSLA 4J1SA 1YRLA 3VVCA 1K0UA 4WJZA 1UZLA 2Y1FA 2YV1A 3DAPA 2D5AA 2Q2VA 3WYCA 2YUTA 4RPJA 2Q2WA 2O7QA 3GVHA 2HQ1A 1R6DA 2QHXA 4MDHA 3S2EA 4C4OA 1EUDA 2PZMA 3DHNA 2I76A 1ZBQA 1WXDA 1ZMOA 1B8VA 3MJ4A 1QYCA 1PEDA 1ULUA 3DR3A 3CMMA 4AJNA 1XEAA 2UUPA 4CV2A 4LMRA 3AY3A 4EJMA 3OJEA 2YFQA 3U09A 1E7QA 1E3LA 2C2XA 2WTBA 4UVDA 1ZKMA 3V5NA 5JY6A 3L9WA 1ZSYA 3GHHA 5IFLA 1ENPA 3C3XA 1Y1PA 1RJWA 3U9LA 1MGOA 4OSOA 1OBFO 3ZHXA 4DGSA 4BNHA 4LCEA 1MXHA 4YAKA 1MUUA 2B5WA 2NQ8A 2DC1A 3DZBA 4WGGA 3Q2KA 4JN6B 1NBOA 1LQTA 5THKA 3OQ6A 1Q0QA 1E7YA 2PNFA 3Q2IA 4XYGA 4BNWA 3PQEA 2GN9A 8LDHA 3INRA 5G2OA 7ADHA 1EVYA 2Y68A 3W6UA 2FZWA 4MPDA 2ZYGA 3CKYA 1LX6A 2IDZA 2OP1A 4H7PA 3IKTA 3D1LA 3BMOA 1P9LA 3UCXA 5TQVA 5EQDA 3Q3CA 3K96A 1VSVA 1K3TA 1UDCA 4NBVA 3AY6A 2X5OA 5I7FA 3KLMX 3C1TA 3T4XA 2E49A 2RH4A 3LQFA 1PZEA 4W82A 5GZ1A 3T7EA 1HDCA 4JP3A 4XDYA 4CR7A 3VOSA 4KWHA 5FFFA 2JFHA 5JDCA 5A03A 4RPHA 2D2IA 3I9NA 2VT3A 1S7CA 1NHGA 4CV3A 2Q45A 2Q50A 3DDNA 2OXIA 2DVMA 3TZQA 4BNNA 5KJCA 4D0SA 3A4VA 1DJQA 5ITVA 3ROKA 3ZWCA 1U7HA 3KB6A 3WWZA 5JBIA 3ADPA 1WMAA 1GTMA 4MVJA 1DIHA 3WJ7A 3QRWA 3C1AA 4XJTA 1TT7A 3DBHA 3ONDA 1M6WA 4LCJA 3WGIA 3WYEA 4DXHA 1DIBA 4B8ZA 5A05A 4R9SA 3A1NA 3S2IA 4UAGA 1DLJA 2Z95A 1Q0HA 1W8DA 4J6FA 3UCFA 5CEFA 5KVSA 3F47A 4HKTA 3U4IA 3WGYA 3RUCA 3GEGA 3MZ0A 3WXBA 2HK9A 4CM7A 2OHXA 5CDUA 1BWSA 4K28A 1JWAB 2CDAA 1Q7GA 1O8CA 2GO1A 3JQ9A 4ALMA 2GR9A 4M8SA 3I83A 3ZGYA 1XR3A 5KCZA 5IN4A 4PFJA 3WR5A 1LBEA 1MX3A 1O89A 1U2DA 2VOEA 3JQ7B 2AA3A 3QIVA 3RC1A 5TT1A 4LN1A 3D4PA 4B8WA 1EBUA 3UCEA 3WMWA 1P31A 2O23A 4M55A 2D1YA 4YT5A 4NFHA 5ENVA 3ADOA 2ZIZA 4J4BA 2DPHA 1B0AA 2HLPA 3PDUA 1EQUA 1H9BA 4MVJP 3ENKA 3SEFA 2NACA 3JQGB 5C7OO 3LT2A 4IMPA 4W7IA 5ICMA 1ZSVA 3SXPA 2NM0A 4P4NA 4WASA 4XQGA 5JNLA 1OMOA 4K26A 1CETA 3ASVA 3KSUA 2PK3A 4HNGA 4AVYA 4JP2A 4WUVA 1RYEA 2FMUA 3IL2A 1AHHA 4Q39A 2J3IA 1UUFA 2CNBA 3H7AA 3NJ4A 4RL6A 4E5KA 2HMUA 3W8FA 3ZWAA 4BV8A 2Y99A 2FPIA 1ISJA 2NADA 4KTTE 4L0QA 1FDSA 4DPMA 4Y9DA 4CM5A 3BHMA 4ZU3A 5JAZA 4YT2A 1QKIA 2NNLD 7MDHA 3PGXA 4UEOA 3HB5X 2I65A 2Y1EA 4WCFB 1PJSA 2X6TA 4D44A 4CQLB 2P4HX 2V6BA 4RVHA 2PLAA 1SB9A 2Z1NA 1ENYA 1KY4A 4MVJI 1A71A 3TZCA 4G65A 2HJRA 1NYTA 1EK5A 4RZIA 3WFJA 4ZQEA 4PVDA 3JQAA 3SJ7A 4I08A 5JC8A 4IS3A 2Z5LA 2AQ8A 1FMCA 2NSDA 2Y1OA 4INAA 1EFKA 4EYEA 1YS4A 4I5DA 1X1EA 1PQWA 4DL9A 3DAGA 1K6XA 3HQ4O 3OEYA 3N74A 2O3RA 3LC7O 1TA4A 1HDRA 3KSDO 3NDRA 4Z0HO 4YJGA 5GMOA 3BMQB 3RWBA 3UGKA 3RU7A 4AJ4A 4IS2A 3AU9A 5L7WA 3RBXA 1PS9A 4IQ8A 4RVFA 5HBRA 5K0ZA 3O9ZA 3O8QA 1SZJG 2ZTLA 1W0CA 3EGOA 3NYWA 1EDOA 4FFRA 4YVFA 2ILTA 5TS3A 3LDHA 4PCVA 3EC7A 1HZZA 2HUNA 4J49A 5I9NA 1R37A 2FP4A 5CDGA 1HDXA 5KTKA 2I5PO 3KUXA 5C3MA 1B3RA 4MVJG 3LZ6A 3LSYA 4UVHA 4QXMA 2OMEA 4DMMA 3O38A 3PHIA 3U0BA 3FRJA 4BNMA 1XWFA 2G5CA 2C0CA 1EBFA 3HB4X 4EUFA 4BB5A 3UF0A 1BVUA 4BNLA 3QW2A 3WBFA 3H9GA 3HFGA 3W6ZA 3GVXA 3IUSA 4URFA 4ALLA 4E13A 3F1KA 1E92A 2GF2A 4CLXA 4UUOA 3B1KA 4EI2A 4A0SA 3A28A 4K6CA 1GYRA 4F3YA 1HWYA 1BXGA 4WOJA 3ZV3A 4NFYA 4YR9A 3RKUA 3W1VA 1BW9B 2O4CA 3RKRA 4Z9FA 1D7OA 2TMGA 3OEWA 4ZA2A 5IXYA 4S3MA 1K5HA 3BTSA 3ETDA 2D0IA 5A9RA 4NH4A 5JDCC 4J43A 1B15A 4J9VA 4R3WA 4XGIA 2G17A 3U49A 3CINA 2UVDA 1ZSNA 3DMTA 3VZPA 5I9LA 4GH5A 1WP4A 4JCOA 1JVBA 1LXCA 3GPDG 4P4LA 2AQIA 4NR0A 3E5RA 1UXJA 1UH5A 4BNGA 1HRDA 2A9FA 5EJ2A 4PLFA 2QRJA 3LC1O 2HMTA 1HT0A 5CAEA 2C54A 1SBYA 1ISIA 1LSUA 2GZ1A 2O7SA 3KHUA 3MJSA 4W7HA 5IDYA 4QECA 2ZQYA 4FCCA 5DBFA 5TGDA 5JY1A 2GD1O 3EUWA 2C29D 4Q3BA 4WLUA 4ZJUA 1D3AA 2VYNA 4WLOA 3UICA 4CMAA 1KVUA 1Z6ZA 2W2LD 2WD7A 3QWIA 5L4SA 1LDGA 3WLFA 2X5KO 3U4HA 4OH1A 1PS0A 1R4MA 1SNYA 4H3VA 2O3UA 1Y5MA 3UH1A 2BMAA 1JQBA 3VPHA 4IIVA 1ZW1A 3U4CA 5IZ4A 3E8XA 4BKOA 1DFIA 3FSRA 2GASA 3ZDFA 2V7PA 4F6CA 3WICA 1FK8A 3S2GA 2VZ8A 1GL3A 3V1YA 3WLEA 2P5YA 1DB3A 1YL5A 1T1RA 3O03A 3PWZA 4Z3DA 3JQCA 4A03A 1SAYA 3RUIA 1T2DA 3V2GA 2WMDA 1B2LA 1GQQA 5DN9A 1XDWA 4LRSB 4XRGA 1YKFA 3NGXA 3ONEA 2CVQA 4CQMD 4E3ZA 1I2CA 2JAPA 3VVBA 4ALKA 1T2AA 3JQ8B 4A27A 1O95A 1T2CA 1Y8RB 1DEHA 4IDGA 1M67A 2DUUA 4PLWA 3D3WB 2Y67A 4DYDA 2OUIA 3L6EA 5KIAA 2Z1MA 3ZI0A 4XQ9A 4YT8A 3OICA 2HO5A 2VOJA 1HDZA 4CM8B 3VTFA 4FOOA 1E3JA 1PGNA 4IZHA 5BR7A 2G82A 1K89A 4HWKA 3M1LA 3RUAA 4AJJA 4B3JA 3V2HA 3RJ5A 3EVTA 3DB2A 3ZWVA 3RVDA 4Z9YA 5KVQA 4B3HA 3DMYA 4CMIB 1ZIDA 5IG2A 5DZSA 4AJ1A 1UP4A 4RGBA 3WIDA 4EUHA 3GOHA 5B12A 4FOSA 1LSSA 4R68A 1GUYA 3RUEA 2Q1WA 2Q4BA 4R51A 4FJ1A 4XZ3A 3MOIA 3EW7A 3KRTA 1I0ZA 3OQBA 4DRYA 4YAGA 1KETA 1ADBA 4M89A 3ON5A 3FPCA 4P22A 4QFDA 3HFSA 1GPJA 2H1SA 4R1UA 4EGFA 4BO7A 2X0NA 3AUAA 1R15A 1DFHA 3QA9A 4OKNA 5IXSA 4Y6RA 3JV7A 4CMHA 3BYZA 3INTA 4JROA 3DC2A 2X9VA 4JBGA 2PZJA 2X23A 3UN1A 4N5MA 3QQPA 5AXCA 2HRZA 3JYNA 5HWSA 2J3KA 4E2WA 5JCJD 3KYDA 3RFVA 1NASA 3PHJA 2ZYAA 4Z0PA 2ZATA 3LC2O 4J3FA 2YDXA 1TT5A 1QP8A 1XCBA 3OJ0A 1KEWA 1DO8A 4L9RA 5G4KB 3ZWNA 5L4LA 4NIMA 2BFAA 3GDFA 5L7YA 1A4UA 2YFHA 4DA9A 2ZJ0A 3Q0EA 4IDBA 1UP7A 1XELA 3IOYA 4CQMB 2ZTVA 3GNQA 2PY6A 4ZN6A 4A26A 1XYGA 4GL4A 1P1KA 3K8ZA 1EFLA 3W8EA 4AJLA 3D4OA 3ZW8A 1G0NA 3L77A 2VWQA 1VM6A 4NI5A 4M86A 1LSOA 2J5RA 2J3HA 2HU2A 2NWQA 1YBVA 1H6CA 1ZZEA 3GFBA 5EMHA 4CM4A 1C0IA 3DOJA 1X14A 4MOWA 4OJNA 1PJCA 1WVGA 2YQ5A 2I6TA 3GDGA 3ZHZA 5KKAA 4CPDA 2DQ4A 2Y0DA 1M66A 4WNIA 5U1PA 2JD2A 5DF1A 2PKRA 3SLGA 3VH4A 2V6FA 2QZZA 3S1LA 4CLHA 1NVGA 3PGJA 4R1TA 3PQFA 5F5NA 3HDHA 1LLUA 3LF1A 3UAGA 4XA8A 4OGWA 3BMCA 4YJHA 1NWHA 1GR0A 3I5MA 2PKQO 1GCOA 2O48X 3PLRA 1FDWA 1ID1A 3NEPX 4JGBA 3S2FA 2P9EA 4RF3A 3E5MA 4ROSA 4R54A 3QVXA 1LC3A 2BH9A 3NTOA 1UR5A 4A10A 4ZGWA 1NFQA 4Q3AA 9LDTA 3IMFA 4R5MA 1M2WA 3OJFA 1N92A 4DREA 1XIVA 3OM9A 3ANNA 4AFNA 1VL6A 4F46A 4FPXA 1ZMTA 4XQCA 1Z74A 4N7RA 1XHLA 3I52A 3QP9A 1R0SA 4E5MA 2X7HA 1N5DA 3VAZA 3ONFA 3X2EA 3GA0A 2PWZA 3MOGA 4B4WA 1A9YA 2GGSA 1DC5A 1HEUA 1I2ZA 2UAGA 4IXTA 4BOYA 3GFGA 5AYVA 4BMVA 1WDLA 4PG6A 4R9RA 4WCFA 3WS7A 4CMBA 4OOEA 4HV4A 3ENNA 3UHAA 1JAXA 3DWFA 5JYDA 3OMLA 3F4LA 4UULA 4Q9NA 1U4SA 5JSFA 2I99A 3R0IA 2NU8A 2CDCA 1F17A 1U4OA 4MIEA 4IBOA 2OL4A 4ZHSA 1AE1A 2B69A 1X15A 3BTUA 3PYXA 1PGQA 4A7PA 2EXXA 4ID9A 2QYTA 4I1IA 4BGIA 5BSEA 5EL0A 5TIIA 4BO4A 4A2CA 1KEUA 2EW2A 1N1GA 3E9MA 4CR6A 1CRWG 4DTIA 3GN2A 5F1PA 5HRUA 5CDTA 5U9CA 3RC2A 1MXFA 4CLEA 2IYOA 4JJGA 1GCUA 4BNZA 4UVIA 2PD4A 5DBGA 2XF8A 2X9GA 1P0FA 1UAGA 2RIRA 3OQ1A 3GRKA 3QVSA 1CWUA 3C24A 3ORFA 5JDIC 4QFCA 1A4IA 1B7GO 3RC9A 1VL0A 1Z45A 3ICCA 3AUSA 4R01A 4EITA 2CMDA 4U0KA 2JAHA 1A5ZA 4J4TA 1PIWA 2AW5A 2OBNA 4RQUA 2DBVO 3VPSA 1Z82A 3QWHA 2AQHA 2FSSA 1U1IA 3PLNA 3W4IA 1UDBA 4WEOA 4D79A 3PIDA 4ITUA 1M76A 5BQFA 4U0JA 3B1FA 4IJUA 4LRTB 3MJTA 2ZCUA 4OXKA 3R6DA 4HADA 3ZNQA 2YHUA 4MVJM 1QYWA 5U4QA 4YXFA 3S55A 3K31A 4GPD1 5J23A 2JFFA 4MIOA 5DOVA 1E3WB 1P3DA 3NTQA 4XX0A 2UV8A 4MP3A 1P1FA 1YDEA 2O50A 3F6YA 4YJFB 5GY7A 4TROA 1BW9A 2O3QA 2IZ1A 4OKIA 5A02A 4B7CA 3H3JA 4BGUA 2UDPA 3WIEA 5AOVA 4OXYA 1Q7BA 1P0CA 1Z7BA 1U5AA 4FS3A 1YB1A 1E6WA 1YH3A 1DOHA 3DONA 3DZFA 2EKQA 5HS6A 4E0BA 4G2NA 4AJKA 2PR2A 3M6IA 1PJBA 4CLRB 1X13A 2OZPA 2V65A 4PLYA 3Q6IA 4RVSA 1IZ9A 2AHRA 2VUTA 4NPCA 2WSBA 2YHIA 4B4VA 2IEBA 4RORA 2WDZA 4DVJA 5B4TA 4LMPA 3RAJA 4RDIA 4E2ZA 3H9UA 2VHVA 1N9GA 2Y1GA 4UVEA 5FI3A 5TNXA 3VKUA 4UUMA 4AL4A 2IRWA 3NDJA 1O5IA 2YJZA 3FTPA 3ZU3A 1U8FO 4KDEA 3OA2A 3F5QA 2ZK7A 1VL8A 3WBBA 1MC5A 3KETA 1OC2A 2AEJA 2H9IA 3K5PA 1VJTA 2RHCA 4YRBA 1C0LA 4GSKA 4XB2A 4ZRMA 4FFOA 4RPKA 3WFIA 1DRWA 1DSSG 1N2SA 1YOVB 1R66A 5G0VA 4HFJA 1BHSA 3G49A 1C1DA 1LDBA 4Y6PA 5DULA 6LDHA 5L40A 4IDFA 3PI7A 1PQPA 4FW8A 2EKPA 4RV9A 4E12A 5JCXA 3AI1A 2F00A 2O3JA 5ILGA 4FB5A 4H16A 3TSCA 2YW9A 1GZ4A 3G17A 1EDZA 4W6ZA 2RAFA 2HCTA 1LLDA 4K9DA 3I4FA 3BXXA 2AQKA 2Y05A 5T8KA 4NHEA 1PZGA 3DBRB 1LTHR 3EYWA 3INGA 2P91A 1TVEA 1UDAA 3K9QO 1FDTA 2E4AA 3TFOA 3CUKA 4TMFA 3N58A 2DLDA 3GQVA 1MP0A 1JA9A 4FFNA 3F1LA 5ADHA 3GT0A 2EV9A 4IJWA 2RBEA 3GHYA 3LVFO 4FFLA 2GYYA 1HETA 4J7CA 1Y9AA 5EERA 2JCYA 1C3VA 4BNXA 1FDUA 3PTZA 1B16A 2QG4A 3PFFA 1VC2A 3QLJA 4LVCA 1B3BA 1BSVA 4J4HA 1HYHA 1WWKA 3G1TA 4PLGA 1ENOA 4OXNA 1P33A 5COQA 3ST7A 3PJEA 3V2UA 5K6AC 2H5LA 2GUGA 3NDIA 3TL3A 3VZQA 1PU2A 5F5LA 4CM8A 1P44A 3D3EA 1HXHA 1PTJA 1ZUD1 4AICA 1U3WA 1GAEO 4TKMA 2W8ZA 1DLIA 1WZIA 1Z7EA 4L4SA 1GUZA 3DTTA 2WM3A 4PZDA 4MVJF 4CM9D 3PDJA 1I01A 2NTNA 2V6GA 2XXBA 1E5QA 5EINA 3QVTA 4X54A 4CMIA 4WCFC 1RM0A 1GEGA 4JK3A 3HDYA 4OAQA 4CODB 1LDEA 4HY3A 3JD2A 1UZMA 3IS3A 2YYYA 4GKVA 4WLFA 4F45A 3GEMA 4BB6A 1V3VA 3NRCA 3ZWXA 3HDJA 4BO9A 4E5YA 2I9PA 3KYCB 4BKUA 3MWDB 4YAIA 1LU9A 3PZRA 1OFGA 4PLPA 1LLQA 5DP2A 4CR8A 1NQOA 3D64A 1R0LA 1QRRA 1PJLA 4JNKA 2EF1A 4IJKA 5CEJA 1BXKA 2JL1A 3CXRA 1N7GA 1PL6A 4PLHA 1X7DA 4MJLA 3QE3A 9LDBA 1NNUA 5DT9A 1AUPA 1ONPA 2P5UA 4PG4A 3AUUA 3KV3O 3C8MA 2VHXA 4N54A 4NBTA 2CUKA 1LI4A 2Y1DA 1G6KA 5CP8A 3AM4A 2J5QA 2GERA 2TMDA 1WZEA 2CD9A 1V6AA 3VKVA 3EZYA 1PJ3A 4Q3CA 4CQMA 4ZVVA 1JW9B 1YBMA 3G1UA 3I9MA 4O6VA 4WLNA 4N5NA 2EHDA 4L73A 1QYVA 2A92A 1NFFA 2C7GA 1SB8A 4BQPA 1DIRA 4ALIA 4CL8A 5IDXA 2O2SA 2D8AA 3E6AA 2H63A 1L7DA 3O26A 4C7KA 4XEHA 5COAA 4OL9A 4FFPA 4R4JA 4D46A 1V35A 4GWKA 2NTVA 1VRWA 1U28A 3UVEA 5L4NA 3ZN2A 2C07A 4R3NA 3QWAA 3C7AA 3P5SA 3ASUA 4WLEA 5L9AA 4CMKA 4MIYA 4B4UA 1YL6A 3PP8A 3DEYX 5DBIA 5TF4A 4ALJA 5A5EA 3BIOA 5A06A 3GVIA 3CZRA 2HMVA 2VRBA 1WDKA 4YAJA 3ZWYA 3SVTA 1PWXA 4LSMA 4BIIA 2DTXA 3WNVA 4L75A 4RDHA 1V0JA 1HE5A 1ORRA 2HKIA 5JAQA 4JBIA 3RUHA 1Y8QB 4DBVO 3RIHA 2C5AA 1H6DA 1GV0A 3EDMA 3GZNA 5GZ6A 1MFPA 4CV0A 3GMSA 1QG6A 4QTZA 2X8LA 1ZFNA 5GZ3A 2NU7A 2P9CA 4KOAA 4ZQFA 3WWYA 4O5OA 3AI3A 1GU7A 4EJ6A 4BS9A 2EERA 2EJWA 2VUUA 3DXFA 1WNTA 1R0KA 5JCJA 2BI8A 4JQCA 1R4NA 1E7SA 1AGNA 4PLZA 4O0LA 1DXYA 5TC4A 1PGPA 1LDYA 1PJ2A 1JKIA 5FI5A 1ZK2A 4ND3A 2C5EA 3HN7A 1Y6JA 1O0SA 4RJTA 1PZHA 4WKGA 1UXHA 1KC1A 3TZKA 1KVQA 5BNIA 3I3OA 1IY8A 1GYQA 2NVUB 1EE9A 3GN1A 3SC6A 4WLVA 3AY7A 4PIVA 3ZNNA 4G5HA 2NU9A 2W2KB 1T2EA 4QX6A 4TVOA 1GQYA 1K6IA 1MB4A 5A9TA 4CMJA 3GAFA 4RCVA 5T8KC 4YAEA 1DC4A 1KVTA 1ZO8A 5AXDA 1I32A 4KWIA 5ITWA 1C1XA 1HDYA 1ZJYA 1PS8A 1VKNA 4Y67A 3BHIA 2EEZA 3GUYA 3WGGA 3AI2A 5LDGA 4IJVA 4D3FA 3K2EA 1BG6A 1ZCJA 3MJEA 2W90A 3QV1A 3MTJA 4GI2A 2OGUA 4U6SA 1XU9A 5CPFA 2DAPA 5DOZA 3VHRA 4E33A 5L45A 1SOWA 1QXSA 4NMHA 5BT9A 3DZKA 4L8VA 4EEZA 4TRMA 4DQUA 4CLOA 4QUKA 5TLSA 3AU8A 1PSDA 2PKQP 2VCYA 2JJYA 4NQZA 5DDIP 4TRRA 3HADA 5A1TA 2WJPA 3VDQA 3G3EA 3OECA 3GAZA 2OOSA 3ZCXA 1U7TA 2J6IA 3KVOA 3RROA 4CMCA 3ZHYA 1NP3A 2BLLA 2DT5A 3FCOA 4IY1A 2VN8A 1EVZA 3TOXA 1LRJA 3D4NA 3OJOA 2ZYDA 4DWVA 1C14A 1J0XO 4DLAA 3DZJA 5A04A 3HE3A 5KWEA 3I6QA 3JQFC 4BNUA 1GZ3A 4BO3A 1D4FA 4J0FA 1G0OA 1HE3A 4DLBA 4XB1A 3DBLA 4NZ9A 4GQAA 4XIYA 2G76A 1NM5A 5JS6A 3ITDA 1B26A
chains in the Genus database with same CATH superfamily
3PB3A 1I30A 2QPTA 4KH0A 5JU6A 2Q3FA 3HSKA 4DCCA 4HAWA 4NBRA 3S6JA 1SBZA 5HZHA 2CF6A 1OZAA 1L7MA 3PT5A 4HLUC 2OFFA 1G8HA 4OA5A 2K2QB 4IDAA 2JVIA 3EVEA 4ZVMA 4BQNA 4YQFA 2W71A 4NNOA 3D0KA 2B4QA 2X6QA 4O1HA 4BLVA 1OJLA 4NONA 4BWFB 5C37A 1R27A 2ZJ1A 2ZSKA 3T1OA 4HS9A 4ETIA 1HZJA 2JHGA 1Q0LA 5L95A 3FPBA 1Z6PA 4Q12A 4CYMA 3UZUA 4DIFA 1E1KA 4O4IF 2Q6LA 3LUGA 4LJRA 3LZCA 1QS0B 2QJFA 1SCUB 3WJAA 5GQSA 1TVKA 4I0WB 4NBWA 1V39A 3FWKA 4KI0A 2FW1A 2G5TA 3FLMA 4CTJA 3L7LA 4D3SA 3NM4A 1CR0A 2V4UA 3ZDCA 3BGDA 1W85B 3WL8A 2OLJA 2VDWA 3O84A 1E6MA 4AC9A 1ZH8A 2ZKLA 2VPYA 1LZLA 1PK8A 3SF0A 3KJIA 4MINA 1XLTC 5EP4A 4AJEA 2PFKA 4GX0A 2R00C 1VIYA 4H4EA 1A9PA 3SXUA 1V8FA 3N0XA 5J3JA 4G0MA 3G2HA 1KE1A 1NPDA 1VKOA 1SULA 2JLAA 3LF2A 5C1OA 3EZFA 4GOKA 1YOVA 2HU8A 4ZCMA 4WINA 1R16A 4CHGA 3W5IA 1T34A 3RIXA 2Q1SA 4DC0A 3PDCA 2M6SA 5IHXA 2W6IA 5H3CA 4FC7A 4AWBA 2QU8A 4B5KA 5HSGA 3PXAA 3WP0A 5BWOA 5AT1A 3IULA 4DUGA 1DARA 4FGZA 1YASA 3CPSA 3OIGA 4KYUA 2WILA 3GRYA 1UPUA 1QQBA 1SXJD 2FVXA 3VOAA 3ECAA 3G2MA 3QEMA 3UY4A 1ZJ6A 2PMDA 4HGZA 2WFZA 4U63A 1JAHA 4L7QA 2GFIA 2PS9A 1OYVA 2COUA 4JASB 3GFRA 3IDAA 3VNVA 1H3EA 5BR8B 1DBSA 1B4DA 1E0JA 3MPUA 4RMGA 1K8XB 4KFUA 4X24A 521PA 1U11A 1X7HA 4TZTA 2GKOA 1N6LA 5IDVA 1U0TA 4I2NA 4RLQA 3E27A 2M1XA 3P5BA 2AVDA 2IJGX 2G1JA 4RF2A 5JE8A 4EA6A 4WFKA 4C03A 4L8WB 4L22A 1R10A 1NDHA 3IPRA 2DTDA 3OLWA 3QXHA 4NY1A 2Y0EA 3K32A 4QSHA 3VC7A 1EKXA 1BVHA 3FFTA 1SXJC 3HUTA 3I2KA 1PFVA 1NLZA 3IQXA 3EDQA 3PC8C 4NOKA 621PA 1NN0A 2JVKA 5KVCA 5AI9A 5D3MB 3KJFA 1N4AA 1KKUA 3I6YA 3PXXA 3MINB 4JXJA 4H7DA 1XPUA 1RQ2A 3ZLVA 3W5JA 4AMZA 1E1LA 4HI0E 5T4HA 2F3RA 8ADHA 4B3GA 2WYWA 3D3QA 5D86A 3CLRD 3SHWA 3JD0A 4QE3A 1MB9A 3QFTA 1CNMA 2CXNA 2X15A 1VKHA 2P6NA 1X7ZA 2PL9A 3EXIB 4PQEA 2D2XA 3GELA 4U5QA 2OXTA 4YRLA 3TR6A 3AC0A 1QX3A 2PH3A 1R0WA 1VE6A 3CEPB 3NT5A 4FFBA 4Z3KA 2PZKA 2W98A 2H54A 2JCVA 1ZG3A 4IMJB 1HRKA 5H82A 5IZCC 5FWAA 1G9XA 5HW0A 2XNDA 3ROGA 3MA0A 1DAPA 4J16A 2FN9A 2HCBA 3FI9A 4NYJR 4WZZA 4OI1A 3HY4A 4E31A 1BDBA 5JR3A 3STHA 4B45A 1QQ6A 1H69A 5K6RA 4RMJA 4DG5A 3ZWMA 2XDAA 4FFDA 3WISA 2FLVA 4I9UA 4LQDA 1E1CA 2AIRA 3OJLA 3QKWA 3CLRC 3X43A 3KSZO 4GP9A 3DEAA 5KTRA 1R5NA 3ZNPA 3JQEA 3AERB 4C6RA 2PL1A 3AFMA 3PFNA 5KOHA 2VQ6A 2OE2A 2WSYB 2QGZA 4JBYA 1TM4E 4WRRA 1JSLA 1P1HA 4DC1A 1E1RD 2V5AA 3MWDA 1OR8A 2WT9A 1J4AA 1LBHA 1UBNA 1SPXA 1VJ0A 3A37A 3CTPA 4U6NA 4BX8A 1OFUX 1E7WA 1UJ6A 4MUJA 1WB6A 4UNIA 5TMBA 4D45A 5AXBA 3L8GA 4P54A 3CVWA 3BTOA 3N59A 3Q8WA 3PSAA 3N8DA 3QPCA 5TX7A 1FFAA 4EEXA 4ERXA 1VMDA 5AJXA 2I2XB 3JQGA 4JUIA 2XXJA 4OHRA 5E95A 1RJFA 4EGSA 2HYDA 2WP0A 2PWBA 3BSFA 4QJIA 1NF8A 2PPVA 2YFKA 1Z4QA 1Z8HA 5EHGA 3BBLA 3MB5A 4U2FA 4WEQA 3CRQA 3LTNC 3NWOA 4WDRA 1NWCA 3WQBA 3D7SA 2PSDA 1CEXA 1ARZA 1KDVA 2ST1A 4DNXA 4ENTA 1NQTA 3C5HA 3WMEA 5JHHB 3K1JA 2HJVA 3FX2A 2Q1UA 4D9KA 2E89A 4HRXA 3C39A 4U6QA 4I5EA 4N9WA 2X4DA 1OX4B 3U1TA 3EARA 4X8LA 1G20A 4PGFA 3TIIA 3UOAB 3LIIA 2D1FA 4QYIB 3FUVA 2XUAA 4DCUA 3LT4A 2QL9A 2IA5A 3DDUA 4Y8VA 4YY3B 4M9RA 5A3JA 3GLGE 4FN4A 3FCSB 1BWRA 1DJOA 4YJGB 5C8YA 3SC2B 2QG9A 1DQZA 2GKGA 2RCYA 5A71A 3PVCA 1OFIA 5D6NA 2PYZA 2REQB 2RKBA 3B51X 3V46A 1KBOA 1M2KA 2WEKA 3K5HA 3O8QB 4LZZA 4P4SB 4B44A 3LXXA 3TVYA 1H0KA 3GLQA 2FR8A 2PPLA 5ALEA 1H9AA 2FP4B 2JJQA 3DS8A 3FPEA 4L8LA 5SICE 3WKAA 3ZCQA 4BVAA 3I2IA 1CIJA 3OF2A 4MV5A 3O4IA 1WKVA 4WDQA 1MRNA 2YINC 2FRDA 4KIFA 1F0PA 5KO2A 2HK8A 3KV1A 1JT2A 5D5PA 1N2GA 4ZDJA 4WKBA 1H0RA 2YV3A 3BMXA 4H2DA 3QUTA 4GYKA 2C8JA 4NMXB 4TQGA 4G1MB 3NKVA 4FYMA 4K9NA 3N9IA 4EW1A 4M7RA 1BHQ1 1UC8A 4EHDA 4EQ6B 4ZIRA 1H6AA 4C20A 2SECE 5J4YA 2HX1A 1O08A 4MS3B 1A7AA 1G21A 2XUJA 4Z9AA 4GPEA 2NSLA 1QK4A 3VDNB 1NUSA 5C2JB 2C2YA 5CFZA 1N6NA 1ZPDA 1NDUA 2JH3A 3H1BA 2XUDA 4G6ZA 1RQRA 2Y76A 2H5EA 3TMKA 1U5BA 2D1QA 2FX5A 3Q3VA 3SZUA 4Z9BA 4Y2HA 1A5AB 3W9BA 1OHHD 4TUYF 2GN8A 2XQIA 2FQYA 4JHXA 3UKOA 1WXFA 3K0BA 5BMVF 3ZXYA 4N5LA 4IG9A 1ZNQO 4O02B 5FBZA 2O7VA 4B73A 5A7FA 4Y6GB 3PRHA 4U3JA 2KYRA 3C3WA 4GX2A 2CHVA 5DEOA 2B82A 1XHFA 3MQ4A 2A9JA 2P1ZA 4WACA 3BT7A 1B8PA 3BAZA 3FN4A 3R75A 3VSCA 4G3XA 1QK3A 2ZYUX 2FMHA 2J4CA 1KFKB 4A0HA 4GDMA 4BVFA 1V25A 3OZFA 1FNDA 1YCFA 3CE6A 4NFLA 4ZOQI 2OC4A 2F1HA 2J3EA 2PMCA 2G06A 5C8DA 2GEDA 2VHCA 4MCIA 3DE4X 1XQ1A 2W6JD 2ZSUA 3BRWA 3DL2A 3NHKA 3OI7A 4FONA 5E2BA 2M6LA 2P6MA 1U0JA 2P77A 3COZA 3WRWA 4BGVA 2W6NA 3I9V6 2IW3A 1T26A 2FCAA 2Q0HA 3H9BA 3V33A 4XWKA 2WQ6A 4RPGA 1VI2A 1ODKA 4L3WA 1N5RA 1IRXA 5TJ9A 4C6HA 4CKEB 2JHFA 3OZ7A 3EIEA 4RPLA 4BMNA 4PG8A 5BPHA 3THXA 2O8NA 2CEAA 2Z1DA 2C1ZA 3QG5A 2II6A 1MRSA 5ELLA 1LS1A 4TL8A 5J2UF 1OA0A 4XYLA 4JWKA 2D3TA 3WGVA 1HSOA 3KBBA 4D3XA 2FSVC 2WKSA 5EE1A 4PWYA 3FAKA 1TC1A 3WLRA 3MJRA 3U4QA 2Z57A 2EQAA 3DVLA 1PGOA 2YW2A 3I4CA 4HDNB 4AY3A 2KS6A 4F96A 2YNMD 5BSGA 9MHTA 1ZGHA 3NI2A 4BRZA 5BUSA 4DMLA 5CA1A 5B4UA 1TAGA 3ABRB 2Q28A 1WUJS 1A9OA 2QJRA 2YN4A 3AUFA 2NXNA 1D1QA 3LCCA 2FETA 2GN4A 5EMMA 4E2YA 3DNFA 1AN9A 1U81A 2R62A 4U2GA 5EYPB 2C9BA 5J63A 3SHFA 2XYVA 1ZVMA 5IF3A 4AULA 4ETNA 2A0UA 2PMBA 1GADO 2QORA 2WSSA 5LDDC 1DBVO 1XJ0A 2GCOB 2W37A 5IUNC 1WO8A 2FXIA 1RADA 4GO1A 5LUBA 2HQSA 1FDVA 4PU0A 4GBJA 2DHEA 3E1GA 4FT4A 1H2XA 1W2WB 1RM4A 4NV1A 2V7QA 1XXLA 4F3TA 3GGSA 1O9HA 1FRQA 3IKVA 2YNMC 2C4UA 3SQDA 4GRDA 1GSIA 3FYHA 5C51B 1C4KA 1D9ZA 4B7UA 4CMEC 3AZPA 1VHTA 1J9ZA 1TTQB 1A77A 3EEFA 1EGQA 6REQB 2JCSA 1WW8A 5LNK1 3I61A 3T5DA 4HQRA 2PZLA 1DZIA 1PJZA 5IYZB 4O4HB 2AN4A 3E81A 1L8AA 2YHAA 2V8BA 3A27A 3L8FA 4FZJA 1GN9A 3INYA 3H2IA 3WLAA 5GPBA 4C6SA 1JEAA 4PHHA 2OZEA 2A5YB 4ALNA 2JDID 2PBLA 1JHQA 4YRGA 1JN0A 4FFMA 4XWWA 1RPNA 3GQBA 1S89A 1B8NA 3RS8A 1A2KC 2DKOA 4W4TA 4B6FA 3GZJA 1NVUQ 1HQCA 3PPIA 4BNYA 4ZJPA 2CL6X 3L49A 5DI9A 1TTPB 1UBLS 1GRRA 2B8EA 2HA3A 2WIGA 3G5LA 1QYIA 4J0EA 5EQFA 4BNJA 3OFJA 4O2LA 1QS0A 1F0KA 3E5NA 1IFXA 4PCAA 3T7IA 2QUIA 3OIVA 1SCUA 3AHJA 1X9IA 4XRRA 2HAEA 1QAOA 1J7JA 4Y2PA 3WB9A 3D6FA 2XRFA 2HF7A 2FGKA 3FHLA 2XOKD 1I14A 3DEIA 2PHZA 4LGVA 3NO4A 2B6NA 4D8UA 4PX2A 5JS8A 4RY8A 1TB4A 1W85A 3FGZA 1CNEA 2R87A 2VKTA 3BDIA 3IJPA 3PX3A 2FVYA 1CDEA 3LU1A 3PE6A 1H93A 2CYCA 3WAGA 1JPVA 1YAHA 1MFZA 1XZAA 2B35A 2GAIA 1QF7A 1GRCA 3THWB 3QJ5A 4RLSA 4AYXA 1V1MB 3AOEC 2GXAA 5KC8A 3MQ2A 1W4LA 1N5JA 2DWOA 2MSDB 3DB1A 3L0SA 3O73A 4FOLA 2Y27A 3EMKA 2HNAA 4G63A 1FXSA 1XPJA 3LDFA 3UJ8A 3U61B 2O5EA 1DAIA 1UOPA 3OOWA 1KYXA 1U7PA 1ND6A 2GEVA 2P40A 1SEPA 3ZGXA 2IIVA 1P1IA 3KOWA 4MW6A 4CKWB 1YE8A 3IAEA 2VIIA 1SBTA 1E1QA 1RWKA 2VNAA 1HDOA 2VQEB 3NIDB 4QRDA 5CDFA 3UT0A 3ZK7A 1F8GA 3VPDA 3ELDA 4KN8A 3IQFA 4E3WA 1A8IA 4LOKA 1ACLA 1T8SA 3G8BA 3HJUA 5JPCA 5LLTA 1KU6A 1IHXA 1N9ZA 2V7GA 4ZT5A 4OLHA 1TD9A 5IC4A 5K5EA 2A3NA 3ZLUA 1QZXA 3PF9A 4IHJF 1L7EA 4I4NA 4R5HA 2VQSA 4ARCA 4N3AA 3IV6A 4KMMA 3QHAA 4RGYA 3MTAA 2JGKA 4PSDA 5FDFA 4B3IA 3RBVA 3AYXB 4WV3A 1OCEA 5AM1A 5JO9A 1Q2XA 1GP2A 5EXSA 4J90A 4CFYA 4O59O 4FDUA 4E11A 3DCJA 2FRDC 2VDUE 3VXKA 3TNLA 4E6PA 3C6MA 1UZAA 4N7MA 1AQJA 2I0FA 1Y34E 3C5WP 1FP7A 3D2CA 5FUBA 2XUKA 4G0NA 1G3MA 4BZZA 4ZI7B 3JD3A 1A2QA 1ZWLA 4ZO4A 3TSAA 2YVAA 4MQLA 1KFJB 2VWHA 4CM4B 1HL7A 4PHTA 1GNSA 3MINA 1U0EA 2RHOA 3ETEA 3UEOA 4H7HA 4DLTA 2CXQA 4A6DA 2GWRA 1BGXT 1TAQA 1RXEA 5BUQA 4WOKA 4MAMA 3E53A 1I33A 1IHYA 2QROA 3KSRA 4JIMA 4MVWA 3KAQA 5DX1A 3AHFA 3DHVA 3EY9A 4TT8A 1GKKA 2IY8A 2J5KA 4YRTA 4NXMB 4BC0A 4M98A 4OYRA 4V0SA 3U13A 3EXIA 1UBMS 2OFXA 5B6IA 3RO7A 4HEQA 5AK5A 3SFZA 4DQVA 1V8PA 1DAGA 1KAHA 3FDXA 4B83A 5H83A 4CQJA 1UKAA 3FWZA 3OA0A 4JYCA 3K30A 3RVQA 4N0QA 5CB4A 4PC7A 3L6DA 1XKLA 1DP4A 1ZISA 1CIVA 2WM2A 3IALA 2KWIA 3B1XA 2VRWA 2YRWA 1CX9B 3CFYA 2XEXA 3BMCB 3IEUA 4OQEA 3ROPA 1O6GA 4CL3A 3MTQA 3FBWA 3QGMA 4IEFB 3TTXA 2VWPA 3EJWA 1GU1A 3R8CA 3RT7A 3GMDA 1X7GA 3JX9A 1H5QA 3FNHA 3GZ4A 4JBHA 4YIKA 1O5OA 1GZ6A 1IEQA 4DLUA 4BFYA 4I81A 3K0KA 4OLJA 3UMGA 4EZBA 4K9KA 4YTEA 3CNEA 2FTKE 4KO8A 1RFGE 1IQ0A 1MJ5A 1SXHA 3O0DA 3OJWA 4LX8A 4JJFA 1E2QA 1OAOC 4IINA 4DCJA 2I2AA 1K9VF 4R1NA 3HDQA 3SOPA 3PUZA 1D5WA 3RSHA 1XN4A 1X9GA 3WY9A 1JH9A 1TEVA 2HNBA 2MR6A 3EAFA 3ICOA 2IUTA 4V0QA 1IZZA 4MKGA 5B55A 1Z2DA 2XD4A 3OCYA 4QO7A 3GEEA 3UANA 1Z38A 1PNVA 5B1SA 3JTMA 3OX4A 5HM8A 1GCGA 1AZLA 1SGWA 1W6UA 1L4KA 1L4YA 2PT6A 1MG0A 1ZH4A 2QVBA 2VH2A 3GUCA 3U7QA 5BR4A 1GT91 4BFVA 1H6BA 4BO2A 2DFTA 4L76A 2NU8B 4JVSB 2QQGA 4RA6B 4GL2A 4GSYA 4HJXA 5FUMA 2QD4A 1KEZA 1KOGA 1NBEA 3C15C 3O8RA 3G2PA 3CT4A 2HWWA 1R1DA 2ZI5A 3OJCA 3L01A 4RD2A 3F4KA 5ALRA 2UXDB 4KQXA 3BFKA 4UNSA 2VTKA 4FNMA 5K0SA 1OX4A 3R8FA 1MIHA 4JEUA 2EZTA 4EKNB 1H2FA 4GEKA 3WMXA 2W58A 1BYIA 1ZD5A 4QYIA 3S2SA 3CRVA 4QOJA 4IGAA 2HA7A 3WG9A 3GRFA 1RXCA 4EL5A 3V3KA 1KP9A 1PR4A 1M1ZA 3CIFA 3TLGA 2IGBA 3AJRA 2CXOA 3SC2A 4C4XA 2FA9A 1TPYA 3HDTA 3FPLA 4RPIA 1YVRA 1KXZA 5G4LA 3WGHA 2CMHA 3QKSA 4QZVA 3N7TA 1C9DB 4X95A 1CUHA 5GM1A 1AZTA 3GK3A 4D6YA 1BQ4A 3EVZA 1NKVA 3A9WA 1RAAA 3ZWWA 1YB6A 1PL8A 1CVLA 3D8HA 3EQ7A 1Q1GA 3ORYA 3VZCA 5AW8A 1GM5A 3FOBA 1FFSA 2J31A 3ILSA 2NZUG 3RJMA 3T94A 4P5EA 1B00A 1P77A 4BN0A 4C0HA 1KK0A 2HY7A 4NNJA 5CM9C 2JFZA 3GD7A 4WA7A 1UANA 1YZFA 1EXMA 3AP3A 2HRBA 1OTXA 4BX0A 2G77B 5D3ZA 3ZHCA 2B3DA 4YK7A 1E4EA 1TKCA 3X1XA 4IEEA 1NI3A 4EQ6A 2G9RA 5CFNA 1EXVA 1I1NA 2VHQA 2CJYA 4HAXA 4ZQCB 5IEBA 3QWBA 2ZSJA 4JLWA 4MA5A 1MABB 2C7VA 4NTZA 2WE8A 3LFHA 1DC7A 1KSJA 3K0CC 2D06A 2PT7A 3IHTA 3UK2A 3SDZA 4BNKA 4YI5A 2EGGA 4JA2A 1K66A 4J0DA 1QLHA 3IDQA 3ZIUA 1QSGA 4HK4A 4FNOA 5EXDA 4NV0A 4O3FA 4WOBA 4XX0B 5FBLB 3UK1A 3DFUA 1FLAA 1YB2A 3T0GA 1GAJA 1Q1NA 1UJNA 1VBFA 1RC1A 1WHTB 4CM6A 2I6QA 4GWLA 4PW0A 3ZYZA 3N0TA 2IEGA 5CPBA 4YCAA 5JO0A 3NTVA 1P45A 1DIGA 3JVDA 3WK8A 3FUXA 5FWYB 2DBQA 4RHFA 1JDZA 1EK1A 3PUVA 1N2ZA 2BDUA 3R20A 5DSXA 3ET5A 1P2VA 1I3KA 4WNAB 3PEUA 5EJAA 1Y0BA 3T4EA 3OPQA 3VA7A 1CLEA 1XXHE 3KQUA 2G6BA 3ZD8A 3D7LA 3VX4A 1BE6A 4J1TA 4JDPA 1FJGB 1G17A 3E18A 2W6CX 3SM9A 3T7CA 3KZVA 4AO6A 3ZTYA 1DHRA 2CLOB 1AG9A 2YHIB 3E3OA 3PEFA 2XVMA 3IC5A 2PGIA 4L27A 4RM3A 1CUFA 4CMGA 2C7OA 3Q87B 1L8LA 4RF5A 3DBOB 3C7CB 3MT9A 1ADFA 4CF5A 1N9GB 3TIVA 1HV8A 3P71T 2ADMA 1EM6A 1E3WA 3AVQA 3C5CA 4ZYLA 1NNLA 4N5HX 5KU7A 1L3CA 2H0AA 2AJBA 1E60A 2QJOA 3H9CA 3TRFA 2DQKA 5CNKA 2FJ0A 3MJFA 4Q05A 4C4RA 4CKEA 1H22A 4U7FA 5KWSA 1S4MA 2OEPA 2MCFA 4JC5A 3WSVA 1M74A 3PD7A 4ZRDA 3ICPA 1Z4LA 3W9UA 4ZMRA 1BNCA 2C4VA 3LECA 1RC8A 1AQ6A 5F77A 1Y6GA 4EAQA 1C1DB 1W5EA 2O07A 3E23A 3T3GA 4ED9A 1KFCB 2FN3A 3IP8A 4FC6A 1NPYA 4IH4A 1O6BA 2AEMA 3QKTA 4HXFB 1L5OA 4Q47A 1PK7A 2ZB7A 5G0WA 3T3OA 3PQ2A 3UENA 2NT4A 2H9AA 3F5SA 4WBNB 2GK4A 1LLFA 3TRHA 4XH9B 5BORA 3C8UA 4YNBA 3L06A 4YN3A 5JFTA 1WRBA 3OMWA 1CUCA 4MEAA 1RYYA 1ECLA 2Z56A 3LYHA 3P0RA 4Q01A 3TQHA 4BRWA 1NKTA 4EFDA 1EK6A 4YCJA 5KYXB 1VLLA 3DWEX 4ZICA 4I6EA 1U9CA 2DERA 3IPAA 4IEIA 1IQUA 1N9KA 2BJVA 4GMGA 4JI2B 1YXMA 1RU3A 2GCOA 1YS6A 2AFIE 5AW9A 2PT5A 3JQRA 2EFCB 1GDHA 4TVSA 2HTFA 1KI6B 1PBNA 3JVVA 3WAJA 1N7JA 3MGGA 5A3SA 1PEAA 1RKUA 3KXDA 1ZESA 3WB0A 4Q1CA 2HSDA 2NO1A 4OEHA 1QORA 1IC6A 1PG0A 4GVLA 3ZI7A 4M60A 1V96A 2O5CA 4XTRA 1XZHA 3WZ2A 5A4FS 3COPA 4A4DA 4KK4A 2AXEA 3ROMA 2C9DA 1OV4A 2PWPA 1Q91A 3A1WA 4XKJA 4HVLA 1NSYA 2CGEA 2B94A 3EVDA 1A7JA 4EF6A 1GYPA 2JIQA 4AJOA 5H5JA 4YBRA 4QOHA 1V5IA 3KZMA 2XJ4A 1VDMA 4XM2A 4ZD6A 4MW9A 4F4HA 6CHYA 1SXQA 1ZRHA 3IT3A 3FBGA 3PK0A 4QLAA 1JZSA 3ANSA 3EZXA 3IHLA 3OCUA 4K7JA 5KBYA 1KZ6A 3DBHB 3QY9A 4I9NA 1I7QB 2CUNA 2JFWA 3TOCA 1Q1ZA 4KN6A 3B9BA 1PW5A 4YDSA 2VRNA 3Q85A 4DADA 1FTGA 2Z2ZA 3JQDA 3T5GA 2A5DA 2ONJA 3LP5A 3RH0A 3IR7A 1B14A 2IYRA 4IIUA 3K70D 3ZJYA 3OLCX 2ZSHA 1ISHA 4QDJA 5SZHB 1QUEA 1DQPA 3WLJA 1LDNA 1TVMA 3F46A 3WA6A 1WSBA 4FZVA 1HYGA 3F98A 2J9FA 3VZSA 3STTA 5T57A 5U4XA 1ZONA 3A25A 5EMNA 1U5CA 2PV0A 3EOBI 3FF4A 5FBQB 3L9XA 5DNDA 4BZPA 4L8GA 1L8OA 2VKQA 3I32A 3MOSA 1UXGA 4ISCA 4B7XA 1M6YA 3Q88A 2QTFA 3THWA 2BBSA 1RKXA 1IJEA 1V1MA 3WKDA 3K70C 5CU7A 4II2A 3V4SA 5C8XA 3B9QA 3BZWA 3JYQA 1E32A 2J45A 4IXWA 3HYSA 3V3TA 2NUPB 1JIJA 4Q19A 1QHHB 3V1MA 3GX1A 2A7XA 3ORSA 3DYVA 2P79A 3KKMA 2IPXA 2EFJA 2QD3A 3PA8A 5KKCA 2V3CC 4GMFA 3M6AA 4Q3DA 3M6VA 4NXNB 3H97A 2PTHA 3C3DA 1MJFA 3O1LA 1R9JA 1OPRA 2PN1A 4ICIA 1UZNA 2YJTD 1QHNA 4QARA 3F71A 1EBBA 1ZIXA 2OV4A 4G67A 3ESYA 2BEVA 2BF4A 2PV7A 1ML3A 4BXOA 3G5UA 4DHWA 1I3OA 2LIPA 2Z3WA 2M6RA 3DL0A 1ICEA 1L4GA 3KQNA 5EOVA 5DK4A 3GLIE 4DQXA 2FN7A 2V6MA 2VPPA 1GOTA 3K6JA 3L3BA 4ND2A 4Q3LA 1R6VA 1XFAA 2IXAA 4WZ6A 4H17A 4E21A 2C7PA 1UK8A 2J59A 4NV3A 5BV2P 5IJZA 4UCQA 4AO7A 2V7TA 1O96B 4V1CB 5EHZA 3HRKA 2ZB4A 3M4NA 2IYYA 2GRUA 1KDRA 1W73A 3IAAA 3BCHA 3N6XA 1QTRA 3FIUA 3UOGA 1LNQA 3H3FA 1M75A 4OQZA 3QPDA 3DVRX 1FFHA 3A36A 6ABPA 5KTNA 3T9DA 1NJ2A 2EARA 2X1VA 4W7SA 3A05A 2BMWA 2GN2A 1BEEA 4ASUA 1ZY2A 1DRKA 2PUVA 5IHPA 5CFPA 3K8OE 1Z37A 2WICA 1J25A 3MCVA 5A5GA 4B2YA 2B5VA 3ER6A 3T35A 1M3SA 3VISA 2GF0A 1IEXA 1MAVA 1NN1A 2CVHA 3I9KA 5I8WA 2E4WA 2ID7A 4V2IA 4AYWA 2YMQA 2XZTA 2BD0A 1E5DA 1SC3A 1BE8A 4I1PA 1QQ5A 3NJ8A 3D6NB 5G0SA 2W70A 2WHEA 1ZLXA 1S1MA 1QNFA 3I23A 2FWMX 4FUQA 4PYRA 4YP1A 1KDYA 5L8VA 5FYQA 3DZIA 1T10A 3T3DA 3D5TA 1UPBA 2QZJA 4ND5A 4R1SA 3NOXA 4E14A 4D4MA 4KP7A 5KNCH 1W88B 4M1QA 5K0NA 1H4VB 3P4XA 1P0QA 3LY7A 1RQLA 1MOSA 1IIBA 1HFKA 4RETA 5K3FA 3ZDBA 2PYIA 2NOAA 2VUSA 4RD4A 3K0AB 3O4HA 3UB4A 2QTTA 2VJOA 4EHBA 2WG0A 4KUHA 5JH7A 5F33A 5C7YA 1A96A 5FTLA 4BV3A 2WU3A 4IGKA 4HUQB 5BN3B 4M8IA 1VE5A 1MEEA 4YRSA 1UFQA 4BX9A 4YWHA 4J1TC 4MICA 4CU5A 4POAA 1B73A 2PRJA 4UHFA 3D02A 3SJUA 4B0PA 2P9JA 4Z4QA 2GUWA 4B3DA 3M1IA 1GN8A 1ATZA 2QLMA 4ZJZA 4ND7A 1IQRA 2WF7A 3DLIA 3OCJA 5C8YF 4KXLA 3ZWPA 3PGA1 5I4BA 4S1VA 1L5LA 2WWTA 4ZJYA 2BHLA 2IPNA 3AOGA 1R88A 3E8SA 3LT5A 4ZVQA 5H80A 4EG4A 5JRZA 4MCJA 3PXBA 1QIIA 3S3TA 5KSPA 1F8FA 4YUYA 1MV5A 1CKEA 1REQB 3RF6A 3BM5A 2O4UX 2HDHA 1XD9A 4KE6A 2NZWA 4DV4B 1JWBB 3DMNA 3JQ6A 2BUCA 3GNLA 1CUDA 4H9GA 2IE8A 2F2TA 4S24A 2YQ4A 5FPHA 4C78A 2PS0A 2Z3VA 2ZSDA 3PWSA 1L5FA 2GILA 4RA6A 4WCDA 3V4FA 1C80A 1XD2B 3B5EA 2QQ5A 3IUPA 3TG8A 3V1NA 3H5AA 2N1BA 5J1TB 5KVAA 2E18A 5JW6A 1BXGB 1IATA 2NU9B 2WJZB 3QFHA 4R71A 5JQGA 4ZTUB 1UFKA 3OWHA 5C34B 2CMFA 5AKEA 3B1JA 4UDOA 4X71A 5BWBA 5ESDA 1YE5A 1XLUA 5A5VA 4LSWA 1V4VA 4E30A 2F9LA 4ERNA 4PGAA 1QRDA 4ME6A 1KHTA 2Y93A 1ZUWA 3NHBA 3WGTA 4D25A 4CQNA 2OBMA 2CB9A 1NVMB 2DTEA 1JR3E 1CK4A 2FMKA 1H23A 2QNRA 2RIPA 3FYUB 4B43A 3W5BA 4DQDA 3OZEA 2H8GA 3FYSA 2FPMA 2D0DA 2F1IA 1T1IA 2I2BA 4IQGA 4N18A 1PR9A 3KTFA 4CLOB 1T8RA 1VE3A 3FVVA 3JAKB 2HCJB 4KXVA 1O95C 5FLYA 2VRCA 1UZUA 2P2LA 2GBLA 4MAAA 4U2CA 2GDZA 4GAEA 4IZIA 4G01B 1S2LA 2QW8A 3BFJA 4A2PA 4ZAXA 3PQ7A 4JQYA 5ESRA 3UMYA 4WE3A 1EA5A 1M7BA 4YJ2A 3KHKA 2DHCA 3BUSA 4JKOA 2PKXA 5T6MA 2MT9A 2BFDA 4JYZA 5MFZA 2HREA 2AYYA 4IPTA 4RZ3A 3AIIA 2J4FA 3UHFA 4LF4B 1J5PA 1F5NA 2VL7A 2ALJA 4FDAA 4QKQA 4GOND 3L18A 2HWUA 3LWDA 3DE7X 3R5FA 4G9BA 3IVAA 4YP5A 4BE9A 1MABA 5HGJA 3V8BA 5IFKA 2XECA 5GJWC 3DTVD 2JLZA 1V5GA 3V1UA 3H18A 4OMUA 3DFKA 4M9CA 3W8DA 1PV2A 5E1OA 1GLNA 1CRQA 1JKJB 1RLIA 2FPOA 3P2KA 2YBDA 4KTVE 4XGKA 1BROA 3U62A 3AVXA 1TYCA 5ALQA 2VH5R 4AU1A 3W7VA 1DC3A 4NHOA 2F4NA 1BDIA 2HL6A 1FF9A 1PJQA 4QTUB 1TXGA 3BKXA 4GSLA 3VVCA 2MJLA 3DNPA 4D92A 1AB6A 2V9CA 1D03A 2Y1FA 3DAPA 1AA9A 2FEAA 2QY9A 4KGDA 1N8TA 3VSBA 2P75A 1L7OA 4RPJA 4I1UA 1S9DA 2O7QA 3GVHA 2ILVA 2WMNB 2WF6A 4M99A 3ZCTA 3ISJA 1R6DA 5AI8A 3WAKA 5JMTA 3VO9A 3ABQB 3KQTA 2BHRA 2H51A 5CA1F 1P91A 2BKLA 2I76A 3DHNA 2PGAA 2X8WA 5FEUA 4KN5A 3E7WA 3DR3A 1WDWB 5CLIA 1Z0FA 4AJNA 1XEAA 2PGOA 2UUPA 3P20A 3PDIB 3MT7A 4KXNA 3CS3A 4LMRA 4KFCA 2WYOA 5ERYA 4L02A 5F7JA 3U09A 1M8JA 1FU7A 5JY6A 2ZI6A 4H31A 2WWIA 1ZSYA 1NATA 3GHHA 1ZM2A 5IWAB 1A95A 1A9RA 3P0EA 1Y1PA 4KFTA 3GXBA 1ODTC 4XX1A 3MXTA 4KQGA 3U9LA 1ZQ1A 4EI9A 1CUZA 1J56A 4YRJA 4DGSA 1NLUA 4FXOA 1A8QA 2J67A 4KNVA 4UASA 1TDJA 5BN4B 1MXHA 3P4YA 3WBJA 2L2QA 2AD1A 3SIXA 2NQ8A 2JGJA 2WVAA 2DC1A 5G1NA 1DKRA 2WM8A 3CEMA 3ZDYB 4BRSA 4D8WA 2ZUEA 1M2VB 1LH0A 2QSYA 3Q2KA 3MTIA 2VXOA 1ESZA 4DV2B 3ZGZA 2NP6A 4MKHA 4XYGA 2WJWA 3LOPA 1JX6A 3PQEA 3INRA 5DLQC 4UCWA 1MOPA 1V5FA 3P94A 3ZCUA 4WBNA 2ZI4A 1K5GA 2Y68A 4HQNA 3W6UA 5KQLA 5JS1A 2ZVJA 5EJEA 4DDTA 4FEAA 1QDEA 4OXXA 3GJTA 4A8JA 3AR9A 2B6HA 2ZYGA 3CKYA 3EJ6A 3U44B 3NUZA 4EG6A 1FP2A 2FSFA 3PV0A 4V24A 3D1LA 3BMOA 4IUDS 4B84A 4EPRA 5KYXA 4IOKA 4MWDA 1QIFA 1MORA 2GZDA 1D0SA 4NBVA 5LVAA 2I7DA 1XWWA 3O6VA 3KLMX 3N05A 4MI1A 5DFAA 3HKEB 1DWOA 1H8EA 3TQIA 3L4JA 3BIJA 3QOXA 1JR3D 4MUKA 3C3BA 2YZ2A 4XDYA 7GPBA 4CR7A 1MENA 1V1RA 2Q3CA 3H2YA 4KWHA 5JDCA 2QRZA 2V74B 3G02A 5KHLB 5B53A 5JPDA 1L4LA 1Q57A 4DMKA 3VI4B 2WWWA 2VT3A 2QYHA 4CV3A 2EKZA 2GTIA 2J32A 2RAUA 3DDNA 3CR3C 4HMOA 4EOGA 3UAZA 3CX3A 1L5YA 1R0ZA 3FUTA 5KJCA 3A4VA 3LUPA 1DJQA 4EBBA 4L4UA 5EFOA 1U7WA 1HFEL 3F8TA 3IV9A 3ELYA 2A67A 5EKUA 4ZEXA 3WWZA 4F97A 4FCTA 4UJ5A 3QRWA 2AV6A 4E46A 4XJTA 3DBHA 2QI9C 2XB8A 4EVIA 2I9KA 1GPKA 4TN5A 4UM9B 1IAQA 2ZBPA 4HATA 4C0LA 2ZZMA 4TSFD 4US0R 3WYEA 1W6RA 4ZVKA 1GPMA 3H4IA 4YUZA 3DP9A 4GI1A 1CUWA 1CY8A 2J46A 2ZWOA 1EIZA 2BKVA 4R9SA 1DLJA 3S2IA 2Z95A 4F86A 1ZOLA 5CEFA 4J6FA 3CWQA 3ZYCA 1WXXA 2G71A 3OZWA 4G8CA 3VOBA 3F47A 4HKTA 1NVVQ 5IW8A 5FBVB 1V8ZA 4NE9A 3A6FA 2E87A 1GNRA 2SHKA 3RUCA 3NNNA 4EPTA 3MZ0A 3WXBA 3L7BA 4CM7A 3DAYA 2DFNA 4Q1VA 2VAWA 1JB9A 2ZVDA 1BWSA 1H2EA 1X2EA 3JTEA 2CHEA 3KU4A 3MAAC 4ZOLA 4ALMA 3USZA 3ISTA 4PPNA 2GR9A 4ZKEA 3I83A 3G7NA 4TKVB 2FWBA 4NAVA 2JGEA 4TS4A 3GFQA 2ECKA 1P7WA 4FD2A 4C22A 3WR5A 3QVJA 3FHJA 4CDMA 1LBEA 2VOEA 3QIVA 3SBXA 1T9GR 4A0RA 1HT1E 1MC8A 1LF0A 5EXXA 2FEOA 1OQAA 1PWHA 3D4PA 4LN1A 1GPWB 5DLPA 4D1YA 2I3BA 1P31A 2I54A 4WZAA 5HJ7A 1CDDA 2D1YA 4YT5A 1U4NA 3L6CA 4FN5A 1TU3A 3W5SA 1O57A 5ENVA 2OKGA 3BF7A 3NVKI 4CEJB 4PPGA 3EN0A 3MIIA 1EQUA 1SU7A 2YBEA 1H9BA 1R6AA 3F73A 4J07A 2NACA 4RTLA 3UJ7A 3AEQA 3ABOB 5CJ2A 1YR6A 4W7IA 3WVNA 2F3PA 3QX9A 3KZOA 3SXPA 4Y9RA 3HKBB 3T1QA 1G5TA 1OKKD 1GZDA 1R50A 1U0LA 3G0BA 3HZOA 4XQGA 2XXAB 4K26A 2H7YA 1CETA 2IWRA 3W0LB 2PK3A 3K0SA 1RBMA 1Y7PA 5CB4F 1MX5A 3LPLA 3REFA 1SHZA 3QU4A 2OCIA 4WUVA 2UZ1B 1RYEA 2FMUA 4WXEA 3SZ3A 3RV3A 2A0FA 5YASA 3UGJA 1N36B 1UUFA 4TLMB 2CNBA 4BDTA 1FYWA 1UFVA 2GBLC 3DEZA 2HMUA 1E79A 3U9SA 1QZZA 1X42A 2Y99A 2CDNA 1C9YA 2XAUA 5EAIA 3BRQA 4B0OA 4EG0A 2O7RA 4RENA 4EJFA 3OPYB 5CK5A 1E2IA 2NZXA 2Z6VA 4YT2A 1QKIA 1EWKA 4J7AA 7MDHA 2HT6A 5KNCD 1XVLA 2LKDA 3TTSA 4EJSB 3CZPA 4LOIA 1YK0A 1ZN8A 1XJ5A 3KPJA 3T9FA 3A1FA 3JQPA 3MB8A 4FU0A 5EI5A 3TGWA 5FBWB 2OECA 1I7LA 5FTNA 2HFJA 4C9BA 1GGVA 5IJ0B 2V6BA 1L3BA 4L50A 2ZE8A 4EF4A 4MVJI 3CN7A 1AQYA 3TZCA 3G2QA 1POWA 3TEFA 2HJRA 1NYTA 1EK5A 3QFFA 1XMOB 4NH0A 3LRTA 3WFJA 2RGAA 3T3EA 3HA7A 4KAAA 3BE4A 1Q12A 3IXQA 2GD2A 2AQ8A 2KW5A 2Z58A 3IBGA 4HZGA 2XI4A 1VMIA 4G85A 2Y1OA 4Z0NA 1SCAA 1EFKA 1KJ9A 2E0IA 4I5DA 1JQDA 2YVUA 1HOTA 3SHOA 5CB8A 1RPJA 2Q5IA 5DHUA 3E2MA 3O7MA 2ZBRA 3X1WA 3K0AA 2Z4RA 4D9BA 4ETWA 3PJRA 1T5SA 4Z0HO 1M8GA 5GMOA 1BO6A 3FOEC 4EG1A 1GA6A 3RU7A 5BN3A 4AJ4A 3HFRA 1W4CA 3BIXA 4F8EA 3G9ZA 4EA8A 4IQ8A 4RVFA 5DNWA 5TB5A 2ZYVX 4PAQA 3ADBA 4M9XA 3EGOA 3ELUA 2BFCA 2FUNB 1Z5UA 2ILTA 1FQWA 5TS3A 1BX1A 4PCVA 5I4IA 2E4VA 3EC7A 4BFUA 1HZZA 1LPAB 1WQ3A 4J49A 3R0XA 2IXGA 5I9NA 1R37A 4G23A 1C3EA 4WK0B 1WXHA 4OHXA 3JZAA 4NSNA 5CDGA 4JI0B 1TAUA 3G82C 4JU9A 3C3KA 4M6WB 2IV7A 5A2GA 5T4EA 2IYEA 2X4IA 3I6BA 5AM5A 3LZ6A 3LSYA 3HFJA 4DMMA 3SKYA 3O38A 3U0BA 1ZOIA 2GHQA 3PHCA 3WHKA 4H77A 4D9NA 5FCDA 1REQA 3VSAA 4U2EA 3HB4X 3KXKA 3VHQA 4BB5A 2H4JA 3A9VA 1OXBB 4TMTA 5HIIA