1GTMA

Structure of glutamate dehydrogenase
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
417
structure length
417
Chain Sequence
ADPYEIVIKQLERAAQYMEISEEALEFLKRPQRIVEVTIPVEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGIIVDPKKLSDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISRRKTPAFGIITGKPLSIGGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEVLKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDFLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTAMATE DEHYDROGENASE
publication title The structure of Pyrococcus furiosus glutamate dehydrogenase reveals a key role for ion-pair networks in maintaining enzyme stability at extreme temperatures.
pubmed doi rcsb
total genus 171
structure length 417
sequence length 417
chains with identical sequence B, C
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 1996-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gtmA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1gtmA01
1EK6A 3QWBA 4RVHA 4ZHSA 4YJHA 1VLLA 3JD2A 1WAMA 3PRJA 1N7HA 5EERA 2FSVA 1H6DA 2B37A 4GMGA 3BAZA 4MKRA 4DL9A 3H9EO 1GL3A 3UCEA 1X7HA 1PS0A 7ADHA 1E92A 3EVTA 3LLVA 3ROPA 2WM3A 2XAAA 2O4UX 5EN4A 2IZZA 1U3WA 4CQMA 3BXXA 3DDNA 3KVOA 3ZN2A 4XYMA 1O95A 2VHYA 1HETA 4RVDA 3MWEB 1LU9A 4OSPA 2X0IA 1EK5A 1QYXA 2AQHA 1NAIA 1X15A 2JAPA 1ISMA 4TQGA 3D4PA 1QP8A 2HMUA 3NTQA 1XYGA 3HB5X 3W4KA 4CM4B 1QYVA 5JO9A 2PGDA 2OXIA 1LSOA 5DOZA 4YCAA 2Y1DA 1ZSNA 1LDBA 2VCYA 4LW8A 3OJFA 2I3AA 4AJKA 2FN7A 1GQYA 4WK6A 1BXGA 3VKUA 4NJMB 1LBEA 3CIFA 1ZJYA 1CIVA 3OIFA 4NH4A 4CM5A 3ASUA 1A5ZA 1PQWA 3PJGA 3I9OA 3VPFA 5BR7A 1A7AA 4CQLA 4RDIA 1P1JA 1GY8A 5GZ1A 1IHXA 5JYEA 1NASA 2WYVA 3DHEA 1Y8RA 3TRIA 4Q3NA 4ZU3A 3OA0A 3CH6A 1L7DA 4NBTA 1WZIA 2JD2A 4CMAA 2AE1A 3ZWNA 2NVBA 3AI3A 5JCJD 3L0DA 4J0EA 3DWFA 1QRRA 3FBGA 3GZ4A 1RWBA 2RHRA 2VRCD 3PDUA 4DIBA 2GF2A 5CAEA 4IJKA 4QXMA 4BO1A 1YB4A 4MP6A 4YJDA 3ZWYA 3PLRA 4TRJA 4R54A 1P9LA 4J4TA 4J9UE 3ITKA 4BO3A 4CV2A 3ZWAA 1QYCA 3H9JA 4B7CA 3BMNA 1UZNA 5GZ6A 4CQMB 2EXXA 2X5OA 2J5RA 1FXSA 5L4SA 4I9UA 3NDJA 3RC2A 2ZKLA 1N5DA 3QVWA 2CF5A 4HXYA 5ILGA 1LLDA 5U1PA 4P8RA 1DOHA 1E7RA 1OBFO 1TA4A 4JK3A 5I7SA 2ZB4A 1HYGA 2NTJA 4FDAA 1JW9B 4TRMA 3GEGA 3VC7A 4J4BA 3SX2A 3LYLA 1E1KA 1LRLA 4BNKA 4MVJF 1UZLA 3RU9A 3LZ6A 3UFXA 1BXGB 4RPKA 3ZI0A 2FY8A 1MX3A 3L6EA 3JQGA 2W2LA 3F1KA 1K2WA 4ZQEA 4BB5A 1GUFA 1T1SA 4QFCA 4BMNA 1BXZA 1FDVA 3QY9A 3V2GA 4E5KA 4INAA 3H5NA 3RUIA 4CM6A 4CLOA 1B8VA 3ONFA 4A73A 5U4QA 3QRWA 4BOYA 1AE1A 3C7AA 5F3RA 1FF9A 3JSAA 2A9FA 1C14A 2YV1A 1DB3A 1WDKA 2IZ0A 2VWGA 3HE3A 3VPXA 3AJRA 3INRA 4OHUA 1LUAA 1EUDA 3UN1A 3SLGA 1V0JA 3AFNA 3DXFA 2Z95A 4B3JA 4N18A 1I01A 2X1HA 4IQ0A 3D5QA 4FSHA 2XOXA 1WP4A 1RM4A 4R3WA 3TJRA 2P2SA 4OXNA 1XEAA 3WOHA 3H9QA 4IDAA 3I6QA 1HYHA 1P1HA 3RKRA 5DCYA 1V3TA 2FSSA 1HKUA 3GDOA 3NEPX 4M55A 2I5PO 1ZXBA 3FNGA 1BDBA 1FDUA 4M1QA 1M75A 1WZEA 4XRGA 3PZRA 3JQGB 2Q49A 3U49A 3NT5A 5IDWA 1PWZA 2NSDA 1HSOA 1SZJG 3FTNA 2PZLA 4FFOA 1A4IA 1ENOA 2CDAA 3K30A 2PH3A 3AY3A 4Q39A 3WGQA 4NBUA 1LSSA 1LC3A 1DC3A 3WGYA 6LDHA 2D2IA 2X5KO 3BTVA 3KYCA 4CLOB 1MG0A 1ZMOA 5C7LO 2JKVA 3CXRA 2GR9A 4LISA 3DHNA 4IIUA 3ABIA 1NFRA 3DEYX 3FTPA 1E7WA 3IJRA 5FF9A 3OEYA 3DBLB 3PJFA 2X86A 4FN4A 2DAPA 4H7PA 2CSUA 3RIHA 3WG9A 3O26A 4GX5A 4J1SA 5A9RA 1Z7BA 4Z3DA 4HNGA 4B3IA 3W8FA 1JLLA 3VH1A 4LSWA 2Q4EA 1GTMA 1H5QA 5DCUA 3FR8A 4NG5A 3QA9A 3AWDA 3WNVA 3HSKA 3KTDA 3PK0A 2G17A 4ZQGA 1YONA 1UP6A 3AFMA 3QJ5A 5IZ4A 4CR6A 2ZYAA 3JQFA 3L9WA 3KUXA 5JCXA 3GG9A 1NPTO 2AQ8A 1TB4A 4OM8A 1SO8A 4LK3A 2CDCA 5L4NA 4XQ9A 1I30A 3UH1A 3SC6A 1KERA 4W99A 3T4EA 2YYYA 4L76A 1K0UA 3GVXA 3RUFA 1GU7A 4BGIA 4DPKA 1BXKA 3ROMA 2B83A 5DBFA 4JJFA 2UUPA 2DUWA 1B3BA 3TN7A 3OJOA 1J5PA 3Q9UA 1LI4A 2BGLA 4GI2A 3F9IA 3GHHA 3TZKA 3W6UA 5L9AA 4XYEA 4BKOA 2JL1A 3PFFA 3WR5A 3MJ4A 3LF1A 3KYCB 1PQUA 2HAEA 2ZTVA 5I7VA 2JFFA 5CDGA 3MEQA 3GLQA 2A92A 4EUEA 5IZCC 3GN1A 3KETA 2PTGA 3RUHA 4R5HA 4DUPA 1LDYA 4OJNA 3JD0A 1GUYA 4MVJE 5FEUA 1GZ4A 3N74A 1UP4A 1K5HA 2FPGA 2J8ZA 4LRTB 3LC2O 5G0TA 1U3VA 4ND4A 4XB1A 4Y8VA 3HG7A 2A94A 3ZWBA 3TF5A 2GLXA 3EW7A 1DHRA 1Q7BA 4OYRA 4HP8A 3FI9A 2E48A 4NFHA 1KEPA 5AXBA 3C7CB 3OQ6A 3OM9A 4PLVA 2CVOA 5HTOA 3NTOA 1E0DA 3JYPA 4E0BA 1PL6A 2OFPA 3BTUA 4R16A 4CM8A 3ZWMA 3ADOA 2GN6A 4OOEA 5JE8A 1XCBA 2I3GA 4ALMA 2CF6A 4YT8A 5TS3A 2DM6A 2PD4A 4XD2A 4DBZA 2PH5A 2VTDA 1PJQA 3I4FA 5H81A 4ALKA 1W4ZA 3DZKA 5COBA 2J5QA 1YL5A 3DL2A 2OP1A 3GVIA 4L75A 1P0CA 2GDZA 5LC1A 5G2OA 5JDCA 1P1RA 4J91A 1MUUA 3JQ8B 3R1IA 3KM0A 1YL6A 3DMTC 2VRCA 4WUVA 3TOXA 1T4BA 3DBVO 1Y5MA 3ANMA 1YBAA 1NPDA 5FI5A 3I83A 4KQWA 1VM6A 2P9GA 1J4AA 2B4TO 2PA3A 2EP5A 4EZBA 3OMLA 3RCBA 3S2EA 1JQBA 2CZCA 4BL5A 5EL0A 2BFPA 4YYZA 3R3JA 4R3NA 4CLXA 1Y1PA 4GQAA 4CMEA 3ADPA 1NFQA 1U8FO 2WJPA 4IIVA 4NK5A 4BNVA 4RF5A 4II3A 4DVJA 4UEOA 2B4RO 2IXAA 4MIOA 4FC6A 1HDZA 2VT3A 4YACA 3ZWXA 1E77A 1RJWA 5BNTA 2QZZA 1I3KA 2I65A 4W6ZA 1OC4A 3DQPA 2VT2A 4DA9A 4H16A 3PIIA 3X2EA 4CMHA 2VZ8A 4CM8B 3QV1A 1IHYA 1D3AA 1NXQA 3TOZA 4XWYA 5KKAA 1FDWA 2PD6A 4IGFA 4PLTA 4B4UA 5TLSA 3DAGA 3C1OA 3UHAA 5L40A 5T8KA 1OC2A 1X1TA 4M86A 4DXHA 4MOWA 1EDOA 1ZK4A 1Y6JA 4Y6SA 3WJ7A 2ZCUA 5DN9A 1HTBA 3E9MA 1DIRA 4WLOA 1KVQA 3KEQA 3A28A 5TC4A 5JY1A 2H5LA 4PIVA 3M1AA 4GGPA 5HBRA 5JYDA 3H9UA 4BNIA 4O59O 4OAQA 1LQUA 4BNHA 3OF2A 1C3VA 4D79A 2BFOA 3GGGA 2YDYA 4BIIA 4MJLA 5JAQA 4YAJA 3HHPA 3SEFA 4B79A 1GZ6A 1E7SA 1A9ZA 3WTBA 4PZDA 4BO7A 3E82A 5KWEA 4BNUA 2D59A 1YS4A 4EDFA 3O03A 4F6CA 4DQUA 3VOSA 4ZA2A 4EEZA 3ZCXA 1O5IA 2Q50A 1Y81A 4BO9A 1ZK3A 3N58A 4MINA 1B15A 1X14A 4NNJA 4A0SA 1F0YA 4WLVA 1XLTA 4TVOA 1DJQA 3EMKA 2NVUA 3N7UA 4HX5A 3HNPA 1H9AA 3AI1A 1YOVA 2DUUA 3NX4A 4YA6A 3QWAA 5A05A 3ZW8A 3HFGA 3EZLA 4HWKA 1TVEA 4GSKA 4TZTA 2VTEA 3L77A 2CNBA 1AUPA 3GFGA 2JJYA 2BMAA 3DBRA 1ZZEA 1GDHA 2J6IA 2VWHA 3D4OA 4CMEC 3WFIA 4HUJA 4II2A 3H8VA 1SB8A 3OA2A 3WGTA 5I7EA 4N5MA 2AG5A 4E33A 3Q1LA 1PZHA 4B8WA 4IZHA 4ITUA 4YWJA 1PZGA 1R15A 4IY1A 4RZHA 1R4MA 1I3NA 4IZIA 3C1AA 3L6DA 1HLDA 3PFWO 5B4UA 4D3SA 4IMRA 1GEEA 3ZHXA 2EW8A 1SEPA 1SOWA 3RFVA 4QO8A 3GGOA 1CETA 1XA0A 3LF2A 3Q0EA 5TT0A 3RI3A 3S8MA 2OZPA 3Q2KA 1PGOA 3GFBA 1LRKA 3MTJA 1BRMA 5ICSA 1IULA 3E48A 3UF0A 4U8GA 3V8BA 4KDEA 4NFSA 2HK8A 1X13A 5JNLA 3EDMA 2Y0EA 3FRJA 4HNHA 4RO0A 3S2FA 3GMSA 4D43A 4Z9YA 3RQSA 4BMVA 5JY6A 1YOVB 2PNFA 1H6CA 5A4DA 3MJEA 2AMFA 4EJ6A 3AM3A 3PHJA 1Q7GA 4AL4A 3VH2A 3O4RA 4JLWA 3S1LA 3TDKA 4WCFA 4ZICA 4HV4A 3DBRB 4R9SA 1V9LA 4NQZA 4OXYA 4Q3EA 4IJWA 1P44A 3H3JA 1A71A 2EP7A 2FPPA 4IS3A 1N2SA 3Q11A 4LCJA 4B4OA 4LCEA 1PS9A 4IQGA 1H0KA 2H63A 3DFZA 3WYBA 1JA9A 1C0IA 1JTVA 4M54A 1VE9A 4FOSA 1NVGA 2G1UA 2UAGA 3GVCA 2VNAA 5KIAA 4TKLA 4NPCA 5TGDA 1EUCA 1R4MB 1R0KA 2QQ5A 1VC2A 2HDHA 1T1RA 4MIYA 1R4NA 4K1LA 4L4RA 4R1UA 4J16A 3OHSX 1B26A 3LSYA 3EVNA 2AEJA 4KUGA 4NR0A 1BHSA 1ZNQO 3K5PA 3VAZA 4FOOA 5K6AA 5I9NA 5TX7A 4RLHA 4NJOA 3CZRA 4W9NC 4WJZA 1NQOA 4HKTA 3ZNPA 2JAHA 3OQ1A 4XIYA 1DFHA 4AJLA 4WASA 1DBVO 2G76A 2O4CA 3L4SO 4PG6A 4RL6A 3ZNQA 1QLHA 3JQEA 1XKQA 5JLAA 5JW6A 3PHIA 1XG5A 3ZHBA 2BHLA 2V7PA 3C85A 4I8XA 3E03A 4UVGA 3PGJA 4WLNA 2WYUA 3GPIA 3ULKA 1JWBB 3UW3A 2G0TA 2V6GA 1I2CA 5EPOA 5MGBA 1PSDA 3GF4A 4Q3CA 2D5AA 3DC2A 3SJ7A 1XHLA 4AJPA 2C0CA 2IRWA 4HFRA 5COAA 3TFQA 4BNFA 1KVTA 3RBZA 4ZJUA 5DNAA 2CFCA 3T7CA 1H6AA 4IGEA 4WCFB 1EVZA 1UUFA 2YJZA 3KSDO 3A4VA 2OP0A 1P77A 5BQFA 5ILOA 1P1KA 2C5AA 2VQ3A 1PEDA 5IN4A 1UDAA 5IG2A 4JXKA 5JAZA 4J7CA 4G2NA 1YE3A 3DZJA 4YVFA 3B70A 3SBOA 4TVBA 4DLAA 3ZWVA 1WDMA 3P19A 3QE3A 1HLPA 1ZJZA 3KBOA 4BKRA 5A5FA 1LXCA 2X5JO 2X0JA 4NZ9A 1Z6ZA 5EESA 1AXEA 3E5RA 1X0VA 3OEWA 2VYND 2PZMA 1V6AA 3A9WA 4CM7A 2DBZA 1Z75A 1E6WA 1LEHA 3KYDB 4OO3A 4UVEA 1I8TA 1I32A 4Q3DA 2PZKA 5GY7A 1KEVA 2GCGA 9LDTA 1WDLA 2I99A 1ADGA 2BGMA 1AGNA 3DONA 1OMOA 3EC7A 3AUUA 4YAGA 4XQCA 3WTCA 4NMHA 3AU8A 1I0ZA 3VZSA 4ND1A 2YUTA 5TQVA 2Y68A 4GX1A 2UV8A 1NPYA 1UP7A 1RPNA 4R68A 2H9IA 4DYVA 4BNJA 4KZPA 5F5NA 3IP3A 4PZEA 1NHWA 2X7HA 5JC8A 4BKQA 3K96A 5EINA 4D45A 1KOLA 1E6EA 1ZK2A 4UUMA 1IPEA 1K6XA 1MG5A 2YHUA 3RD5A 1H2HA 3G17A 3FF4A 4E6PA 3JQCA 4UVIA 2V65A 5EQDA 2IXBA 3IIEA 4XDYA 1Q0QA 3L07A 4AJOA 2Y66A 5K6AC 3BMQA 5G0SA 3V2HA 4OL9A 1P33A 1B0AA 1NYTA 1YRLA 4F46A 5FWNA 2C82A 1GADO 3RC9A 5CG1A 5AYVA 4Z0PA 3EAGA 2O3TA 4CJXA 1BSVA 1G1AA 1R0LA 1V3UA 2HJRA 4WOJA 3IKTA 1Z7EA 2PKRA 1U4SA 2ET6A 3HJAA 1MLDA 1W8DA 1KETA 3GEDA 3GAFA 3HZZA 4XX0A 4YRDA 1IYZA 2XXBA 1H9BA 1RKXA 2YQ5A 3CEAA 4AJ1A 1DC6A 3UKOA 5B1YA 4RQUA 2NU8A 4XCVA 1JU9A 2VWQA 4HBGA 5C7IO 3BZUA 4WLEA 4YQZA 5F1PA 4RVUA 1CF2O 5TRTA 3PJDA 5L51A 2NLOA 4YAIA 2CD9A 1UJMA 4DPLA 5JO0A 4IDEA 4DPMA 2JCXA 4J1TA 1HZJA 1GQ2A 2VHZA 4JP3A 2NADA 3FWZA 4FFPA 1J6UA 5TF4A 4E30A 2QRJA 5I9LA 3BMCA 4M87A 4GX0A 4D7AA 3Q9NA 3GK3A 1B8UA 4ZGWA 1BTOA 4UVHA 1E7QA 4NIMA 3AUSA 1JKJA 3GOHA 1U5AA 3HN7A 3VTZA 4YRAA 4QO7A 3I9JA 4DBVO 2FOIA 4CM3A 4RJTA 2DTEA 4IBOA 3VZQA 5L7TA 3BMQB 4U5QA 2P5YA 5I7FA 4CMGA 2R00C 2CMDA 2PWZA 2B69A 2VUUA 4S1VA 1NWCA 1B14A 3U4HA 5GMOA 1TEHA 2QYSA 4UEJA 4RGBA 3GY0A 4E12A 1PGJA 5L45A 4JNKA 4PG5A 1EVIA 4D44A 1ZK1A 2O2YA 4MVJA 4ALIA 3WGHA 2A4KA 3PLNA 4HADA 4MPDA 3COSA 4FJ0A 4Z9FA 2IE0A 3OIGA 3QQPA 3CTMA 1IE3A 4GKVA 2X0NA 4JJIA 2VYVD 4FC7A 1DRUA 4WLUA 1RM0A 4JX8A 1YVEI 3HQ4O 4TRNA 2QZ9A 1S6YA 4YEDA 1XGKA 2BLLA 3FBTA 4YQYA 1EQUA 1U1IA 2DT5A 1HE4A 1MP0A 4GVLA 4GWKA 1N1GA 1GYRA 1VPDA 5EMHA 3VPHA 4BV8A 2NTNA 1YWGO 2PKQO 1F8FA 3ZU5A 3F6YA 2ZJ0A 3PDJA 3MCVA 3I9LA 4BNXA 5CDYA 3CMMA 1BW9B 2Z5LA 4OQYA 1YBVA 3DBLA 5MDHA 4R9RA 2Y99A 3BMCB 1UH5A 4TKMA 1ZVMA 4IM7A 5L4LA 1SPXA 3V1YA 3JQ9C 2HJSA 5FFFA 4UVDA 5DF1A 3BIOA 2OO5A 9LDBA 1Z82A 2AA3A 3PVZA 1PX0A 4PFJA 1DAOA 4J7XA 3RU7A 4RVGA 2DLDA 2W4QA 4GSLA 4RQTA 4CM9D 3ST7A 3I9KA 1KIFA 5IZCA 1BDMA 1KVRA 4IUYA 4RPGA 1B2LA 5FI3A 3S2GA 4K9DA 5L3ZA 2HU2A 3AUAA 3BHIA 1AN9A 4PGFA 1GUZA 1E1NA 1EE9A 4W7IA 3LT4A 4KUEA 4DREA 1R6DA 1SCUA 3I4CA 4XQEA 2Y1EA 2HLPA 3L6OO 5CPBA 2C7GA 1D8AA 1R0SA 3JD1A 4BO6A 1X1EA 4CPDA 3DMYA 1CRWG 2PY6A 2EG9A 3E6AA 1Q7CA 4M8SA 1U9JA 4PG4A 4A10A 5JAIA 3WSWA 4BGVA 1LNQA 2VZ0A 4O63O 2EHDA 1LJ8A 3V2UA 3JQAD 3PWZA 3K31A 2FZEA 4WE3A 2W98A 4Y9DA 2X23A 4MIEA 3JD3A 4EYEA 2RH4A 2P68A 5TNXA 3Q2IA 4Y6PA 2AQIA 3AU9A 4FGSA 1T2AA 1NWHA 4YBZA 2V6FA 4MKZA 1PJTA 3VDQA 1T26A 4RV9A 3DMTA 1QYDA 3MJCA 2NQTA 2GO1A 2QRLA 1VKNA 2NVWA 2RH8A 4P38A 4RZIA 3GUYA 4S3MA 5CEFA 5KVVA 4J49A 4LMPA 1EDZA 5T6BA 4BS9A 4J7UA 4GMFA 1PZFA 3S2IA 3WS7A 5KJFA 1WPQA 2HMTA 3GH3A 1NX6A 1EBFA 3ICPA 5AXDA 5A3VA 2TMGA 4XKJA 1WW8A 3QIVA 1NR1A 2R2GA 3IS3A 2Q3EA 3DR3A 4AFNA 4YT4A 1T24A 1DIBA 2PFGA 1T2DA 1I2BA 4ESOA 2XPCA 3MJVA 3D3WA 2C54A 4WECA 4XYGA 4PLZA 3OICA 3RUDA 1A9YA 4LVCA 2OUIA 3WQQA 3VKVA 4ALLA 3FNHA 3RJ5A 2J3IA 5CG2A 2Z1MA 5IAAA 5HRUA 2UUOA 3NGLA 4B3HA 5KVQA 3I9MA 2WEKA 3TFOA 2VOJA 6ADHA 1LDMA 1BVRA 4OMUA 1YQDA 2YW9A 3PQDA 1HSZA 4M89A 4O6VA 4W82A 3RBXA 5L53A 3JQ8A 3F4LA 2IYOA 4JBHA 1E6UA 2Y05A 4FGWA 1QLJA 4UUOA 3U4CA 3D4NA 1DPGA 4XYBA 3GQVA 4WLFA 3JQDA 3PEFA 3JQBC 3TL3A 3WLFA 2B36A 5HM8A 2VHXA 2QW8A 1ARZA 2ZATA 8ADHA 2IZ1A 3KSZO 4DMMA 4PLYA 4XJTA 1U7HA 3MZ0A 4FS3A 1YB5A 3FPLA 3ZU4A 3SJUA 4CLHA 4WEQA 2AEMA 3EY4A 4DLLA 2PGLA 2WTBA 4NHEA 1MFPA 3LC7O 1NNUA 3U62A 1F14A 3CE6A 1LA2A 1SBYA 4KWIA 4C4OA 4E21A 1B3RA 2C7VA 3PXXA 2EIHA 1U4OA 5CEEA 4CV1A 1PJCA 4NBRA 4OSOA 1BVUA 4L4SA 1DRWA 3FD8A 4A26A 2J3HA 2VZ9A 2JFGA 3U4IA 4KMSA 5FYDA 2PGJA 1SNYA 3WX0A 2Y0DA 4YB8A 4LN1A 1RM5A 3D3WB 3RSHA 4ALNA 1U7TA 1PJ4A 2OORA 4J6FA 3W8EA 5CEJA 1HL3A 3DTTA 4OOFA 5HA5A 2X9GA 4BNNA 3BHJA 3I6IA 4QSMA 5G4KA 3I9NA 4XGKA 5BSHA 3E9QA 1Y7TA 3WMWA 2QIOA 3WXBA 3TNLA 1E1MA 5JCJA 2VWPA 4XR9A 3A14A 1HWYA 4AJJA 2PD3A 3FNEA 2EWMA 3MJSA 3AK4A 4K6FA 4NK4A 2F00A 3OP4A 8LDHA 4GGOA 4BNLA 2V6MA 3B1KA 1ONPA 4NDNE 1DAPA 2P9CA 2GSDA 3D0OA 3WGIA 1GYQA 2O23A 1R66A 1XSEA 2RHCA 2O3RA 4CL8A 2YV3A 1LDNA 1KVSA 4EEXA 2OOSA 3QVSA 3F1LA 3H5RA 4N7RA 1ZEMA 2X9NA 3LU1A 1JVSA 3ZNNA 3AI2A 3IDSA 4BO4A 5DZSA 4RVSA 3K2BA 2WD7B 3LT0A 4I08A 5JBIA 2B5WA 4P22A 3C8MA 2DBVO 1NTOA 3T7EA 4BB6A 3F47A 4MP3A 4CV0A 1IY8A 2YY7A 4IPTA 1PJ3A 3DHYA 1M6HA 1AXGA 3R6DA 3GR6A 1EFLA 1R16A 4OGWA 2LDBA 4TZKA 5CDTA 4R5MA 4JQCA 2EERA 1C1XB 1YXMA 5KTKA 4FW8A 5IDXA 5G4KB 2YFHA 4BO2A 1BGVA 3BA1A 1A27A 2GN9A 4D0SA 1I3MA 1NM5A 4GBJA 2FR8A 2Y0CA 2ZYDA 4NBVA 2OBYA 1C0PA 4CMKA 2ZB8A 5ITVA 1QYWA 1ZBQA 2E37A 2BFAA 3JYOA 1E5LA 1LSUA 3TZ6A 4AJ4A 2YFQA 1NQAO 3RC7A 3C1TA 4MP8A 4ROSA 1T4DA 5DOVA 4CM9A 1ULSA 3ZWWA 1GQQA 3O8QB 4EITA 1DJNA 3V1UA 1P1FA 4J1NA 3LT2A 3B6ZA 2Q2QA 5BSGA 2V6BA 4QFDA 4D42A 4YJFA 2YDXA 3U9LA 1HDXA 4B4VA 1N1EA 2DKNA 3PWSA 3ZV3A 4J43A 4CL3A 3GNQA 1YGYA 2RIRA 5IXSA 1Z45A 3TZCA 3GT0A 2Y93A 1DEHA 3I52A 3OJ0A 1LLCA 1J0XO 1D4FA 3ZGYA 3H4VA 3B20A 1C1DA 1MB4A 4LMRA 4TROA 3JD4A 4L8VA 2HQ1A 4W9NA 4KQXA 2EKLA 3HDHA 3R3SA 1LLUA 4E13A 1HDYA 4BNGA 3PQFA 4FQ8A 1ZXLA 2FZWA 4U0JA 2HKIA 1HE3A 4CLDA 3GC6A 4PG8A 3FN4A 3OSUA 2UVDA 2NACA 1UDCA 5IXYA 3L4BA 3A06A 3UOGA 1MXHA 3KO8A 1QV6A 1E7MA 3PI7A 1T2EA 4KDFA 1EFKA 5KCZA 1K89A 3HFSA 4EBFA 1ADFA 4JROA 5DULA 4U6SA 2G82A 1P0FA 2D0IA 4QTZA 2C2XA 4UAGA 1UZMA 3B1JA 3G3EA 2F1KA 1UDBA 3UICA 2D1YA 3ZNOA 4DIOA 3UVEA 4D0RA 1F17A 1TT5A 2X0RA 3IOYA 5F1OA 1QV7A 3Q3CA 2FPIA 2EEZA 3PP8A 4J3FA 4N54A 5BNFA 3W8DA 2HMWA 2GGSA 2C59A 2AEFA 2J3KA 3ON5A 3PHGA 3HDJA 3GEMA 5BSFA 3WB9A 2E6UX 4JJGA 4Z0TA 1KC3A 2E4AA 4YJFB 1LDGA 5C37A 3CINA 2OBNA 4HFNA 5TSDA 3ZV5A 4XA8A 5J23A 2ZYGA 3PWKA 1KY4A 1DC5A 3KSUA 1JN0A 2FR0A 1R37A 5F5LA 2D5CA 3AOEC 2ZQZA 5L7YA 1OFGA 1U28A 2DFDA 1NHGA 2HSDA 3EK2A 4LSMA 1YL7A 1C1DB 3H2SA 3PPIA 3KZVA 4CV3A 3O38A 4FBGA 2PKQP 4XR4A 4EJMA 2O7QA 1GAEO 2EV9A 3GZNA 3JV7A 3D3EA 4L9RA 1DO8A 1F8GA 5KJCA 3JQAB 4IS2A 3EGOA 3U4DA 4BNWA 1I33A 5BNIA 2EW2A 4I1IA 1HF3A 5IDQA 3K6JA 5ADHA 1FMCA 2D3TA 4TRRA 3FSRA 4J9VA 1H93A 3H6KA 1XQ1A 1JDJA 1T25A 3RFTA 1W6UA 4FFLA 4FR5A 2CY0A 4PRLA 3DZGA 3WLEA 3H5AA 2Y1CA 4C7KA 2UYYA 5KOIA 1JKIA 5G4LA 1Z74A 4O5OA 5LCXA 4EI2A 3NT2A 1TT5B 3ETDA 5AVOA 3QW2A 1O8CA 4PLCA 4E2ZA 4CUKA 5LDHA 3JYQA 3WMXA 2E82A 3ETEA 3GRPA 3KRTA 5TJHA 3ZZNA 4ALJA 1IL0A 5C3MA 3KYDA 3GNSA 2BI8A 1YH3A 1G6KA 2VRBA 3OH8A 4AJIA 2LDXA 2X4GA 3QVOA 5CP8A 3DOJA 3PTZA 1P31A 2B5VA 4XGNA 1RYDA 4BNZA 4RPLA 4B4WA 1BWSA 3UCFA 3LVFO 3L4BC 1ZMTA 3H65A 1VKOA 1DSSG 1MA0A 3WICA 3GZNB 4W4TA 4RVFA 4E2YA 3KV3O 5B12A 4XJSA 4YAKA 1O6ZA 3TPCA 2NTVA 2EJVA 4IXTA 4WOKA 2BD0A 1N92A 1M76A 2C29D 1LRJA 2Q99A 3DOCA 1PJ2A 1KEUA 1EMDA 3ITDA 4CMBA 1KYQA 1D1SA 2SCUA 3TSCA 3NGXA 1CYDA 1IOLA 4CLRB 4JBIA 1TLTA 5BT9A 3KLMX 1ENZA 4YRBA 4YT5A 5DT9A 3EUWA 1ZUD1 4A2CA 1TT7A 4A03A 1JKFA 1GZ3A 5KJ1A 4F6LA 4ILKA 1ZSYA 5ITWA 4MDHA 4A27A 2BKAA 1DIAA 3RVDA 1HDCA 3OJLA 2BFMA 4LGVA 1GFSA 2X6TA 3ZWCA 1H94A 2I9PA 2GASA 2OMEA 4YTEA 1B16A 3KEOA 3TQHA 5THKA 2I6TA 2NUAA 3PIDA 2R00A 4MO2A 4D41A 4DRYA 5A9SB 3QSGA 1YQGA 5HS6A 2NWQA 2O2SA 3I23A 3PHHA 1YDWA 4R01A 3KHUA 4RCVA 1T2CA 2ZCVA 5HS4A 2NNLD 3HDQA 4HFJA 2JCYA 4PRKA 4ZRMA 3QLJA 1Q0LA 1JAYA 1NBOA 1WMAA 3DBHA 3WIDA 1GV1A 2RBEA 4RORA 1O94A 2HCTA 3VDRA 4WPGA 1KVUA 1DRVA 1IZ9A 1FJHA 3IL2A 3H7AA 3H3FA 4FFNA 4M49A 3RASA 3PHLA 5IF3A 1SEVA 5JDIA 4IDCA 1HRDA 4TWRA 4RLSA 2IDZA 5C5IA 4DYDA 1O89A 2H1SA 4D3FA 3STHA 2JHGA 4DC1A 4BKPA 1A7KA 1I2ZA 3P2OA 4PLGA 4XRRA 1ZFNA 1BG6A 3UXYA 1WWKA 5I9MA 3FHLA 1FDSA 1KY5A 4MVJG 1XR3A 4FIZA 1VJTA 3CMCO 2OGUA 5THQA 3ETGA 3JQ9A 5A1TA 3QWHA 4QEDA 4JBGA 1UXJA 3JQ6A 3G1UA 4F3YA 5L95A 3OETA 1HEUA 1Y8QA 1ZO8A 1EUZA 4OKIA 3WNQA 5JMPA 1N9GA 5AOVA 1NP3A 3VH3A 1ZKMA 3GVPA 1I24A 4R4JA 1YBMA 3G79A 2C20A 2D8AA 1VL6A 1F12A 1L7EA 5A5EA 3GVHA 3RUEA 1VI2A 4HY3A 3NUGA 5BSEA 1CQIA 3W6ZA 2FHSA 3NT4A 4WNCA 1QG6A 2B35A 4L74A 2W90A 5IDYA 4I5DA 4AG3A 1G0NA 1QORA 3AM5A 1NR7A 1UAYA 4N5LA 1EQ2A 3UUWA 1DFGA 3GA0A 3GDGA 1NQ5A 3DBHB 1MXFA 4BKUA 5KVCA 3EHEA 3ZDFA 4BNTA 3MWDB 2FR1A 1Y9AA 4B7UA 4W7HA 2DU8A 3HDYA 3WYCA 1BW9A 1DFIA 1DIHA 3VZRA 4BO8A 4GX2A 1OAAA 4J0FA 5JMWA 4ZQHA 1NVMB 1DIGA 1PJBA 4DGSA 5I8ZA 2XF8A 5L7WA 5JFOA 2P4QA 2EGHA 4L0QA 4ZQBA 5DCWA 4JCOA 5H82A 2WD8A 2BI7A 4JGBA 1GEGA 2GD1O 2FMUA 1A4UA 1LLQA 4KTTE 4YJHB 1B7GO 1OZAA 2DVMA 3NDIA 4IMPA 4IDFA 2JFHA 2POQX 3PYMA 4B7XA 2OL4A 3GPDG 4YJGA 1SAYA 2YV2A 4E31A 2A35A 3NV9A 1Y8QB 1GPDG 3VVCA 1I10A 3W1VA 4EW6A 3WWYA 4XDZA 1UXKA 1N9GB 3GNTA 4J1QA 2Q1UA 2HK9A 3VZPA 3GRKA 1SMKA 4J2HA 3ROKA 4IDGA 2WDZA 5B4TA 1DHTA 4Z9XA 4TMFA 1ISHA 1K6IA 2ZIZA 5CPFA 3M1LA 5JDIC 1XU9A 4ND5A 1ADCA 1ZCJA 2C2YA 2P9EA 1AHHA 3ANLA 4EGFA 4NU5A 4PZCA 3INTA 1Q1NA 2EF1A 4DQXA 1P3DA 3WYEA 3DFUA 2PLAA 1MC5A 3JQ7A 1TI7A 1I3LA 1SOVA 5B37A 1U5CA 2O3UA 2QYTA 1CJCA 1CERA 4PN3A 1HZZA 1M66A 3PZBA 1PGNA 2R6JA 1ONOA 1U2DA 1FK8A 4CQLB 4FFMA 3GMDA 3JQBA 2W8ZA 1AHIA 1PS8A 1Y8RB 1HDRA 4FJ2A 3RWBA 4WNIA 3ZHZA 1I5RA 1LTHR 5K9ZA 1PGQA 4Z0HO 1E3WA 3NYWA 1LSJA 2GPTA 3OFSA 1KS9A 4YJGB 2O48X 1V35A 2VUTA 4BNMA 4P4LA 5G0WA 3AM4A 5AXAA 3OJEA 4YAEA 1EVYA 3WSVA 4RPJA 5ENDA 4JP2A 3FNFA 1DLIA 1JWAB 2DPHA 2X8LA 1U3UA 4PLHA 3CZMA 3EYWA 3FWNA 5DBGA 3BMNB 3PJEA 1MV8A 3P2YA 4XGIA 2BH9A 5AQ1A 1MC4A 2HK7A 3CPSA 1C0KA 3ICCA 3RUCA 2FWMX 2DBQA 4I5FA 5F21A 1CEQA 1GCUA 3V1TC 5COQA 4GLOA 3AW9A 3VHRA 1X7GA 4GL4A 1OI7A 4RF2A 3KYBA 1VL0A 1WLYA 4E32A 1ENPA 3BTOA 4ND3A 5DBIA 4Z6KA 1A72A 4AJHA 3JQ7B 4KUHA 1YO6A 3TL2A 4PG7A 1XWFA 3FPCA 3IMFA 2EJWA 4QT0A 3VH4A 1H2BA 5U9CA 4YDRA 1CDOA 4R1TA 3ZU3A 3DZBA 1ORRA 4DWVA 1EE2A 3WIEA 4IXWA 3DZFA 2JD0A 4WKGA 3B1FA 3LK7A 3NKLA 3PQEA 4QX6A 4ZD6A 1E3WB 2VYNA 1KEWA 5TT1A 1VSUA 2ILTA 4U6QA 1UAGA 2ZB7A 1VJ1A 2O3SA 2YHIA 5DP1A 2B4QA 4I5EA 2OHXA 2ZTUA 4MVJH 2IYPA 4PLWA 1R12A 3C3XA 5A3JA 3DO5A 1K6JA 2GYYA 3BHMA 3NDRA 5JXWA 4R41A 2ZTMA 4I9NA 4OKNA 4QUKA 2O7SA 1P45A 4AJ2A 1P1IA 2E49A 2Q1WA 4E4YA 5A02A 3LQFA 2IODA 3C7DB 3KOUA 1EVJA 4U7WA 1WVGA 5G0VA 3LDHA 3WFJA 3BMOA 2ZB3A 4Y6RA 1EBUA 1D7OA 3U0BA 2HO5A 1PWXA 4PVCA 4R51A 3ZV4A 4CM1A 2WE7A 1XELA 1HDOA 4GKBA 2EKQA 2J5KA 3ROQA 5IN5A 3HB4X 4J90A 1W73A 4AJEA 4YXFA 3W4IA 4BUCA 2HRZA 3BTSA 2NQ8A 4KP7A 2DPGA 1SC6A 1RM3A 5CDUA 2BGKA 1YDEA 3IKVA 2DTXA 5CHEA 4K28A 2D4AA 3AOGA 4X54A 4IDDA 2QG4A 3NTRA 1L1FA 1K3TA 3WDSA 1ML3A 4G5HA 3ZU2A 4LVUA 2Y1OA 2H6EA 5DDIP 3WJAA 2O3QA 2PZJA 1M2WA 5G0UA 3QWIA 3V5NA 2WD7A 4R1NA 2RAFA 4GVXA 5B4VA 4OH1A 1OOEA 3RAJA 4EJ0A 4B8ZA 2HMVA 3G0OA 2PV7A 5HWSA 1DC4A 4U0KA 1ISIA 2YHIB 4DC0A 3ZH2A 2TMDA 4LRSB 5F1KA 4O1MA 5A9TA 2AG8A 4CODB 1KC1A 4GAEA 3F5QA 4Q3AA 1U2GA 1C1XA 1IUKA 1UXHA 1X7DA 5DP2A 4YR9A 1IB6A 4UUNA 4PLFA 1YJ8A 1VRWA 3M6IA 3QWFA 4GLLA 1Z73A 4ZRNA 2X58A 3BMOB 1MGOA 2Q2VA 4H15A 5T67A 4Z3KA 1J49A 2BRUA 3ORFA 2Q2WA 4NI5A 4CMIA 1WMBA 2WWRA 1SB9A 2W2KA 1U3TA 1E3SA 2YZ7A 2I76A 2FP4A 3RKUA 2O50A 3F3SA 3ENNA 3P5SA 3IUPA 4DQVA 3INGA 3IJPA 2DQ4A 1GR0A 1YB1A 3O8QA 1UXGA 4FFRA 4I5GA 4R1SA 3IP1A 1VSVA 1LC0A 4BMSA 3Q6IA 4FPXA 5TJ9A 4BO5A 3WGGA 2FRDA 3LC1O 4P4GA 2VHVA 1RYEA 2NM0A 3WBFA 3M2PA 4BQPA 1PL8A 5KNLA 1IZ0A 3D64A 5EJ2A 5KVSA 3MJTA 1QR6A 3E9NA 4MVJP 3HADA 4YPOA 5ER9A 3JCZA 4BVAA 2P91A 4ZVVA 5EQFA 4A7PA 2J3JA 1YJQA 4RDHA 2VYVA 3HN2A 4DMLA 3H9GA 1UR5A 3F46A 3JQFC 1HE5A 3UGKA 4TSKA 2Y1GA 3PGXA 1N7GA 3FCOA 3U5TA 1GYPA 5ICMA 3G49A 4E3ZA 4BHTA 3GUCA 4CUZA 2ZK7A 1PR9A 1HT0A 3AOEA 3E18A 1NFFA 1ZK0A 1YQXA 2RCYA 2GZ3A 4JN6B 3U3XA 7MDHA 4QQRA 3WWZA 1FDTA 4CMIB 4RPHA 4XEHA 2DC1A 3DAFA 3RROA 1HE2A 2W2KB 4UUPA 1PIWA 2G5CA 2GZ2A 4WCDA 5C7OO 3OIDA 3JTMA 4FB5A 3GHYA 5JC1A 1S7CA 2NU9A 1E3JA 1ULUA 4CMJA 4P4NA 5ES3A 2VNSA 3E8XA 5T64A 4H3VA 1XU7A 2I67A 3D5TA 3ZW9A 1ONNA 1TXGA 1DLJA 1E3EA 2B0JA 2WE8A 3ANNA 4K26A 5H83A 3TZQA 3AY7A 2AHRA 2GUGA 4KTVE 4BNYA 5T5QA 3IAHA 1VL8A 4IINA 3R0IA 1XIVA 2CDBA 4WEOA 1CQJA 1GD1O 1PJSA 5TIIA 2UDPA 4GWGA 4CQMD 3LLSA 2BELA 1E1LA 2P5UA 4XYLA 2Q45A 4AICA 1QXSA 3G1TA 3UCXA 2PK3A 2Q4BA 4DTIA 3JQAA 1GV0A 3F5SA 4UREA 1NAHA 5JPIA 1U8XX 3QVXA 4CR7A 1PGPA 2AE2A 5ENVA 3VTFA 3TWOA 2GNAA 3DTYA 3WQSB 1M67A 1V3VA 3ENKA 3OBBA 3E1KA 4I9HA 2GRAA 2CVZA 3ZV6A 1H6BA 3GGPA 4FCCA 2C07A 3WQRA 4L4XA 2YQ4A 5JDCC 1PL7A 5IFLA 4CMCA 3NAQA 3RFXA 1ZSVA 4KOAA 1GPJA 4Q9NA 2Q1SA 3IUSA 1KBZA 2Z1NA 1I36A 3CKYA 5EIOA 4E5NA 3I5MA 5CFZA 2GERA 1HXHA 4N5NA 4AVYA 5K0ZA 1BMDA 3P7MA 3S55A 2DFVA 4Y98A 1C0LA 1YKFA 3DZIA 3GAZA 3HWRA 5KKCA 1MFZA 5A03A 1XDWA 2VUSA 3SC4A 3TZHA 2AQKA 3PYXA 4AJNA 3H2ZA 5A04A 1G0OA 4BGEA 1XQ6A 4ND2A 3D7LA 1E3IA 4L73A 3GDFA 3D1LA 4YT2A 3FR7A 2ZQYA 4IQ8A 3RBVA 3VPGA 4J2OA 2BF7A 3EZYA 2X22A 4BO0A 1ZIDA 2IEBA 3C24A 1ZH8A 2I66A 1PTJA 4DLBA 3DB2A 5A06A 2QX7A 3WBBA 2WYWA 3U09A 2PR2A 3KB6A 2DTDA 1QSGA 1O0SA 2QHXA 3DOOA 2GN4A 3MTGA 2ZJ1A 3NRCA 1IPFA 4C7JA 4ZN6A 4DIFA 4MVJD 4CLEA 1F06A 2JCVA 3LT1A 4E5PA 1ISJA 1E7YA 2CVQA 2GN8A 5GZ3A 5T8KC 1EZ4A 1PU2A 4CLRA 1DXYA 4OXKA 2GZ1A 2W2LD 4G81A 1ZEJA 4QECA 2NVUB 3QP9A 1UXIA 1Q0HA 4EUFA 3ZHYA 1NQTA 4GPD1 3K2EA 3ASVA 2P4HX 3VPSA 1LX6A 3GN2A 3MOIA 3M2TA 1HYEA 3AUTA 2NU7A 4MVJI 3WGZA 3JYNA 4Y67A 3JYLA 4XZ3A 5T57A 3F4BA 2DBRA 1VJ0A 5JAMA 4E2WA 1QMGA 1B8PA 1PJLA 2NV6A 3OECA 2O3JA 4D46A 2EGGA 1HDGO 3CSDA 3SLKA 5A9SA 4ID9A 5LDGA 3KLPX 4Q3BA 4BQRA 2NU6A 4KWHA 5JSFA 1JVBA 3K8ZA 3SXPA 4A5OA 1ENYA 4K6CA 3W4JA 4EUHA 3MOGA 1LDEA 2HUNA 4IJUA 5KJ6A 2VOEA 3K73O 3A1NA 3RC1A 1WXDA 4JIGA 1Y5RA 4CUJA 4IDBA 4R69A 3CUKA 2QRKA 1T2FA 3AY6A 4PVDA 2Q1TA 3QHAA 2WMDA 3DZHA 3HUDA 4FD3A 3L9XA 4ZQFA 2C5EA 1NVTA 4G65A 3ONEA 3E5MA 3QVTA 4XIJA 3ZWPA 3IQDB 4WCFC 4MVJM 3O9ZA 1QKIA 4O0LA 3RJ9A 3K92A 5IJZA 5KJEA 1ADBA 2IEDA 4PCVA 1DDOA 4GH5A 1PZEA 2Y1FA 2JD1A 3I1JA 3PYLA 1PQPA 3ONDA 4J4HA 4URFA 4E5YA 1ISFA 3SVTA 3BYZA 3NJ4A 1ZW1A 4NFYA 4UULA 4CR8A 3KXDA 2X9VA 4RF4A 4D3DA 2XXJA 3NJ8A 4XQGA 1D1TA 1E3LA 4NBWA 3DAPA 1V8BA 2HRBA 1O9BA 4F45A 3RUAA 2CUKA 1N8KA 4IJVA 2HMSA 2VN8A 4ONEA 4MKXA 4BV9A 1ISGA 5I8WA 1PR3A 3IC5A 2AXQA 1LQTA 4XB2A 4OIMA 4CM4A 5JS6A 1Q2XA 2EKPA 4RF3A 5ER6A 3UAGA 1GCOA 3K9QO 3GG2A 5AXCA 2Q46A 2WSBA 3I3OA 3WGOA 2ZTLA 2AW5A 4WGGA 1R4NB 1P74A 1EEHA 1M6WA 4NJMA 1WNTA 1Y9EA 1X0XA 3OQBA 3ZWOA 4E2XA 5CDSA 4FJ1A 1CWUA 2JHFA 3VVBA 4BGUA 1E5QA 4PLPA 2Y67A 1JAXA 4UEKA 3X2FA 2VHWA 4OQZA 4E5MA 1ID1A 3T4XA 1W0CA 4HFMA 4NU6A
chains in the Genus database with same CATH superfamily
4P33A 1EK6A 1LTKA 4L9AA 2BHRA 2VSFA 3ZZMA 2C9ZA 3CLTC 2FSVA 4JD5A 4JWTA 2ODWA 1H6DA 5ALDA 3TQQA 1GGNA 1NN0A 4Y2YA 1UKYA 3O8BA 3B3AA 4MVWA 2WB2A 1OCEA 4Q9DA 1M1YE 3Q7TA 2IPLA 3V4PB 5BMVA 4DA6A 1DGQA 2ACWA 1FXWF 3S4YA 3MGBA 3NEJA 3G8DA 5JALA 1X9IA 4R2HA 3LLVA 1YC2A 4X7BA 4TKUB 4OGGA 2XAAA 5HHTA 3NM6B 4G56A 3BXXA 3WRYC 4B47A 3DDNA 3KJXA 4XYMA 4CEJA 4NS4A 1AKEA 5ADVA 3SSAA 1LU9A 3T5DA 1EK5A 1QYXA 2WM9B 1SRQA 5B1SA 1NDUA 5I48A 4V24A 1WU8A 3B3FA 1QP8A 1VPTA 1T9GS 3NTQA 3PPYA 4HMOA 3W4KA 4WZBE 1QYVA 5JO9A 4C07A 2PGDA 4PAWA 2OXIA 4MUIA 1LSOA 3E3MA 2Y1DA 3K8OE 5ALYA 4H0FA 5BV1A 1LDBA 5KHAA 2IPXA 4Y2TA 2AIRA 4AP9A 1T0IA 2DFLA 2FN7A 5TQ2B 1Q74A 2WAXA 4C7OA 5J5VA 4LMBA 3AVUA 3LAWA 5DFAA 1SR8A 3AJAA 4ZYLA 3SSOA 4Z5XA 2ISSD 4AAYA 3C1UA 4UM5A 5H1YA 3AT1A 4NH4A 4YRLA 2JJQA 1A5ZA 3HR7A 1X7ZA 3I9OA 5TMDA 2VP6A 1BVHA 1SM4A 2BCJQ 3ZX4A 2X13A 1N6HA 1GY8A 1P1JA 2AFVA 3N8NA 1NASA 4M1SA 2GESA 4N5IX 1JMKC 3DO6A 4ZU3A 3ELBA 3FNBA 1QOQB 2GBLA 2ZDQA 3N0WA 1WZIA 1Z8DA 3A4TA 3CZPA 3ZWNA 1XRLA 5J2UF 4UDOA 5IBPA 1WQ1R 1O6FA 5HE9A 4UC0A 2ZAOA 5JCJD 4O0MA 3RV4A 3L0DA 1RLUA 3PD1A 1WR8A 3DWFA 1MJNA 4PSKA 2GF2A 4HWOA 1JG4A 2UVPA 5CAEA 1M2NA 4BO1A 2W6JA 1YB4A 4MP6A 1A9XA 5KX5F 2ZM6B 4DFDA 1C4OA 4MV9A 1CXZA 4J4TA 1BHQ1 1DBPA 4GRDA 3WA6A 4BO3A 5K03A 5FNVF 1QYCA 4B7CA 4C6SA 1UZNA 3EIUA 3S8EA 4CQMB 2EXXA 1P4RA 2GHQA 1SK9A 3B82A 3BGDA 4GMKA 3L0YA 4GBGA 2J5RA 4IKPA 2B1RA 2WG2A 3L06A 4JA0A 1N2BA 1Z5GA 4L8YA 5IH3A 3R44A 1N3BA 3VR3D 4HXYA 2BGIA 3L7MA 4X1KA 4P8RA 4UUQA 2CFTA 3NWJA 4A1OA 2ZU0C 3E5NA 4C4AA 2QX9A 4ZYTA 4GDFA 2YN0A 3TGPA 4FDAA 2WSIA 1FYFA 4TRMA 1AKTA 3UHJA 3CF0A 3N8HA 1UC4B 4NQRA 4BAUA 4MQUA 3LYLA 4BNKA 4D9NA 2VSNA 4MVJF 3RU9A 1BXGB 2B9VA 4RPKA 4Z0NA 5IUKC 4LZWA 2I9KA 1R8JA 3L6EA 5HFJA 7YASA 3V8QA 1KDZA 2W2LA 2B4KA 1TW2A 1L4MA 2I29A 2AUNA 1T1SA 3UGJA 1XPUA 2J08A 4DB4A 4YUWA 4E5KA 3H19A 2JGDA 4J0CA 1PTKA 2OHFA 2OV2A 3FMOB 5HF6A 3RRFA 5CT9A 1IOZA 2P2CA 1QHNA 1TMKA 2AD5A 2RHOA 5J5AA 4YXWA 1XRNA 5DK4A 4E08A 1W9MA 4IEIA 1D2RA 4N0MA 4ENVA 1Y3IA 4A73A 1KKUA 1X80B 4MA5A 3V7UA 4MR9B 2O8VA 4PWYA 2VBFA 3C6KA 4BOYA 1AE1A 3WMEA 4IRXA 4Q4JB 3R7WB 3LMKA 4WN9A 1Q3KA 3JSAA 4RXUA 1K8XB 1N3LA 1OBHA 1S1MA 1WDKA 2GNOA 2IZ0A 3T1HB 1JILA 1FOEB 3AIOA 4OHUA 1J56A 1EUDA 2I80A 3EWNA 4I1RA 3SLGA 1YB6A 4B3JA 3OCJA 1E5TA 3P4UA 4OREX 4YI5A 4DLYA 4KR9A 1Y8CA 3LQ2A 2VI5A 3E7PA 1K8RA 1A04A 3D5QA 3OCXA 5DB4A 5JQGF 2Y2VA 2XX3A 3JQRA 4LJ7A 5ALOA 1R0CA 1RM4A 4FKMA 4IICA 4R3WA 3L4EA 2PRIA 4RLQA 4D82A 2BKUA 3GZTB 4R8VA 1I5EA 1JYSA 2WUDA 3H9QA 4M9UA 4B85A 1CJMA 2OHGA 3IMCA 5KYWA 1T4MA 1M6YA 1P1HA 1UBMS 3NYRA 3WNDA 5DCYA 4NYIR 2BM8A 3VSDA 4U6NA 1TCVA 4GOXA 3GDOA 4LXQA 3NEPX 2QM3A 3WKCA 4R2WA 5AR1A 2JLUA 2WUEA 1N2CA 2GBLC 4HDSB 5EA2A 4CIBA 2BBTA 4BZXA 2NVOA 3RIGA 3DQZA 1QUFA 4HLNA 3KJHA 3RS7A 4OBWA 2W58A 3U49A 3NT5A 1FS4A 3QOYA 1FW6A 3AEUB 4W8GA 4GPEA 5KNDD 3MS4A 4NCAA 1A50B 1WB6A 1UL1X 4TT3A 4S1OA 2R9VA 2G9QA 2F43A 3C39A 3AY3A 4BAZA 2P5SA 3PSHA 4Q39A 4AP6A 5HOEA 1G7TA 1PKXA 1VSQA 3WGYA 2WIJA 3KYCA 2DECA 1HPLA 2I7CA 3MPUA 3HL4A 1F4PA 4JR1A 4DXDA 2JKVA 1N2GA 5C7LO 2NP7A 1IEQA 2GR9A 3L7JA 1UWVA 3ABIA 3CLKA 3D8TA 3FTPA 1ABFA 1FUYB 1NP6A 3DBLB 3FUUA 3OEYA 3PXDA 3WYFA 4PEVA 1RMTA 1L1QA 2WA2A 3PB3A 2DAPA 1TIBA 3U81A 5AW0A 5CFNA 3IVRA 4AZ3B 1SUFA 5D7NA 5LOVB 4DMFA 2IYNA 4PGGA 1DKMA 1DL5A 3NHLA 4GYJA 1Q5PA 4JA2A 4HNGA 2FW7A 1KJNA 1NVKA 2WZBA 4ESEA 4K3VA 1XHFA 1L4KA 1WBBA 4IFTA 2ZJ7A 1BH2A 3UB3A 4Y6QA 3FR8A 1JHYA 1VIVA 4JBWA 2IEIA 4UBNA 1CUEA 2H9AA 1LFAA 3PK0A 1KZ6A 4OYLA 4RH1A 1COWA 4ZQGA 1UP6A 3AFMA 3DMGA 4OA5A 1LQ2A 5CFLA 4N39A 3DEZA 4AY5A 4BQQA 3EC1A 3MYRA 4LYFA 4DLNA 1GT91 2QI9F 1W5BA 4OM8A 4FYHA 3G0CA 2NUTA 3MWGA 2AW3A 2WHPA 3SC6A 3UH1A 1KERA 3W5DA 3BB4A 1JL3A 2AJLI 2YYYA 3I12A 4H4EA 5KYUA 2YHBA 5FCDA 1L1RA 4KU4A 4MKFA 2R7LA 1PEYA 4CCSA 1I9CA 1BQ3A 2WIFA 5AJZA 4JJFA 2BM1A 3IUQA 4DHWA 5CFRA 1B3BA 3LOPA 3OJOA 5LZ7A 2HFKA 5C8YB 3F9IA 4D97A 1Q12A 3S2ZA 3GHHA 2G8NA 3DXZA 1DG3A 3W6UA 4CGYA 3KQWA 2ZBEA 2IHKA 4BKOA 5HKBA 4DNFA 4EYQA 3PFFA 3MJ4A 4FK8A 3VC3A 2QTGA 1NVFA 2ZPUA 4UHCA 3QA3E 1CY1A 1C8KA 4OLFA 5J4KA 5CDGA 4NU0A 2MT9A 2NO5A 2J6CA 2A92A 1D5CA 1TTPB 3USCS 3URKA 2X0EA 1U31A 2ZI9A 4DUPA 1RYHA 5FEUA 5P8WA 4QG3A 1U0NA 4UQLA 2PWBA 1AQNA 2I3DA 1GZ4A 2R8XA 2FPGA 4LRTB 5G0TA 5K4HA 2VO1A 2C5LA 1YJAA 3ZWBA 3R40A 2GLXA 1HTWA 3EW7A 1KH3A 5IYZA 1HDIA 3CRW1 1AO0A 4BWYA 1ZI8A 3RF7A 2CUNA 3PE3A 3FX2A 1YE8A 3EGXB 1XCGB 5AXBA 4G0ZA 4QE3A 3OM9A 5K6TA 3ZE1B 3JYPA 4E0BA 1PL6A 3BTUA 1TVMA 2BZ0A 2LW7A 1KXZA 3ENZA 4OOEA 5DTIA 4TYQA 4GLBA 1IPHA 2QV7A 4ALMA 4YT8A 2AD1A 3EXHC 3MAGA 3GMTA 1E66A 1E9SA 1Y48E 5TS3A 3LS2A 4XD2A 4BFLA 4H7KA 2VTDA 4OBEA 4F7DA 5IC4A 1QG2A 1O03A 1VE5A 3DZKA 3HVIA 2RB4A 4M6WA 5DGCA 3O8CA 1SKMA 1QRTA 3LUAA 4QBTA 2C5HA 3DL2A 1F60A 4I19A 2W2XA 1JH8A 1SA0B 2H7CA 3TD6A 4DV0B 3IBCA 5DYYA 5G2OA 3RRXA 1VB3A 2M1XA 1SC1A 1YR2A 1XXHA 3KM0A 2XGSA 4OQNA 4X0EA 1W46A 1YS2X 2BDTA 3OPMA 3TOXA 3NAMA 1T4BA 3TRHA 2OEPA 2WQ6A 4JVMA 2P11A 2ZDHA 4MUGA 1WXEA 4R2KA 3RTAA 5FI5A 4Z7QB 1VM6A 4OFWA 1J4AA 1L7NA 1W35A 2B4TO 1NTRA 1SCAA 2PA3A 4G09A 4GSYA 3OMLA 3S2EA 1GPWB 1RP7A 4NXMB 5EP1A 2CZCA 2ZJZA 1TMOA 3VR5A 3MCZA 2YWDA 2BF4A 2BFPA 2X40A 3KALA 3R23A 1ZUWA 5IK2A 3IP6A 3QPCA 5BURA 4GQAA 4JGGA 4WK4B 3BWXA 1D7AA 3ADPA 3ICVA 5EZ6B 2YVLA 3DE5X 1SJ9A 2C9MA 3B48A 4HDMB 4NK5A 1KRWA 4RF5A 1OLXB 4RK4A 2ZRBA 4QDKA 5K2OA 4F4HA 4ZJPA 4JYBA 4UEOA 3TR0A 3QSYA 2B4RO 2NO7A 3R7NA 4U2DA 4MIOA 4N12A 5JSYA 4QBHA 3LDAA 4B2YA 1O08A 5FHQA 3PNPA 4FC6A 1XPOA 1HDZA 4YACA 3ZWXA 5BNTA 1E77A 1Z6YA 3N2NA 4W5OA 2QZZA 2IDMA 4W6ZA 3DVQX 1XKTA 2QD4A 3ZLVA 4X6UA 3MT8A 4G24A 3IV9A 4H16A 4OPMA 5ALSA 4QASA 3IVAA 4C6HA 4HH4A 1NXQA 3ND7A 3RT7A 4DV7B 2C9OA 2QK4A 1PFWA 5TLSA 1EA5A 3QH4A 3AQIA 3RK0A 3ZLBA 1Y1KE 3BQMB 3OZCA 4YO8A 2C4WA 4PPNA 3SQLA 4GWLA 1RWQA 4M86A 4DXHA 5CXUA 1EDOA 1M1ZA 3FYUC 1Y6JA 4Y6SA 3WJ7A 1KFCB 2YJ3A 3QF4B 2JNWA 5BWLA 4OH7A 4K2AA 4MB6A 5CR9A 1KK3A 3QU7A 2FQQA 1AMUA 2EFYA 5B1DA 3RVJA 5HBRA 5I7HA 3UMCA 3H9UA 1KS2A 5IP5A 2N1MA 4OAQA 2DJ5A 2PL1A 4EG1A 1H1LA 3KYJB 3OF2A 4EH1A 3TXXA 1Z29A 4D79A 5IASA 1JE1A 3GGGA 3KFXA 1W0KA 2GEBA 3LOQA 3O4VA 3QEBZ 1FXUA 2A57A 4YAJA 1INLA 1VMAA 3DLCA 5JWHA 5EPUA 2XTNA 1GT6A 4RTMA 4B79A 3F6RA 2CSXA 1D1PA 1C7RA 4UTRA 2I2BA 4PF1A 3FZNA 3G8AA 4BNUA 4H0CA 2DKOA 1I2DA 4IIXA 4MEAA 3WIVA 3L7BA 2CBGA 3ACDA 3TH5A 1SXGA 3R6TA 4F6CA 5LQJA 3VV3A 1A76A 4L5JA 3AVOA 1RS0A 3VOSA 4FHDA 5DEOA 4ZA2A 4GG1A 1HORA 2JS7A 4LOIA 3C4VA 1Y81A 4JXZA 3THXA 2W37A 4L5CA 5AW9A 4TSFD 1CW2B 1D07A 1VBNA 2JI6A 3EVZA 4D96A 2W6NA 3HBFA 4YQFA 5KQPA 5TS2A 1I6MA 1J1UA 3TI7A 1XD8A 5TR9A 1DJQA 3ZS9A 3OIYA 2ZM5A 2LRHA 1YS6A 5DO9A 3V1LA 4AIIA 3HNPA 3N75A 3AI1A 1JP7A 3AJ9A 2DUUA 4GEKA 4UD2A 1I2AA 4HOYA 1M2KA 2Q1YA 4E7PA 3QKUA 2ZROA 2R8BA 3AIKA 3T9BA 2L2QA 1VFPA 2VTEA 5BSWA 2OQIA 1KI4A 1AUPA 1XD2A 2VF5X 1OTXA 3RYIA 3DVSX 4RE6A 5MN4A 1BMQA 2ONKA 7MHTA 1VI6A 1T9GR 3J81A 4HMPA 4QU9A 5TY0A 2H48A 5C5DA 2YC4C 1K5PA 3PFGA 3H1AA 3R6GA 5LYYA 2FPSA 4M0PA 1YVUA 3OFKA 4GYKA 3WVNA 4AC9A 2ZWPA 2BY4A 2G40A 1VP9A 4QPNA 3UMYA 2AK3A 2JGNA 1VMIA 1SB8A 2HA4A 1RKQA 3D8BA 2WMOB 3OA2A 5FTNA 3TQHA 3WGTA 4YCNA 1P61B 1Z83A 4A8JB 4GKKB 3Q1LA 1UM9A 3E53A 1PZHA 3PENA 4V2IA 4LGCA 1Z6TA 4WXEA 1RTTA 5CLQA 4YWJA 2A4MA 5J4VA 1QGAA 1GPH1 1RHQA 2H65A 5DBOA 1CQWA 2P4UA 1FW8A 1HLDA 4S2UA 5F76A 3ZKAA 4AKGA 2PSDA 2L42A 3NGMA 5DASA 5AM4A 4NYJQ 3TNJA 3L43A 1FIUA 1FMFA 1XI2A 5E6RB 4QO8A 3IQXA 1OTHA 4TMYA 5ALRA 5AVYA 1XA0A 1OLSA 2J7PD 4MMZB 4N03A 3V80A 2K4MA 2C58A 4EQZA 4KITB 5TT0A 1BMTA 2QQFA 2XD4A 4BB0A 3RU2A 4H1VA 4ZU6X 1XK6A 2ZRAA 2OZPA 3SYMA 3UAOA 2CGEA 4B6OA 2VSYA 3VO2A 1LRKA 1XJCA 3TSAA 1BRMA 1CZUA 2NSYA 3E48A 4EHHA 5HPYB 2HK8A 5JNLA 2CXSA 5JJKA 1K7SN 3S2FA 3N8KA 1RHMA 1KYWA 3G0HA 3PE6A 2GILA 2GI4A 4UNIA 2E21A 5CA0B 1NM5C 4D43A 4PQEA 3RQSA 1YOVB 2WRZA 3EOAI 2ZWAA 2DWCA 3O83A 4IH4A 1QF7A 3MJEA 4YRFA 1JHVA 3ZDCA 4M1OA 2GKOA 5FOUA 3NP7A 3IAM6 3OSZA 3PHJA 4NLLA 4R1LA 3S0JA 3V4FA 4Y2VA 4ENQA 3CLHA 1XEXB 2E89A 3O4RA 3TDKA 1NBAA 1DAGA 1JQLB 1QLWA 2VP5A 3DBRB 3IAM1 4R9SA 5I7WA 5CRIA 2BZGA 5A6SA 2XCIA 2J4DA 4Q3EA 5CLIA 4Z2AA 1RWWA 4LK2A 3ZJ5A 2TRSB 3PQ3A 3DYBA 1FU8A 2WAMA 3Q11A 2WY2D 3T7TA 4Q6WA 4YWHA 3T34A 2QTVA 3LRTA 4LCEA 2JVJA 2AJTA 3HFJA 3GP5A 4LHSA 3WYBA 1R3UA 3CJQA 1LF5A 2H31A 1ORHA 2H8GA 4M54A 2ZDGA 2FPUA 4UBMA 5AKEA 2BE7A 3V8RA 1E3MA 5JOQA 4FZ3A 4BCDA 4EG4A 2VNAA 1MC8A 4I1YA 4X64B 4NPCA 4WVFA 1R4MB 2C2HA 3KNZA 4HK4A 4L28A 3HYCA 1VC2A 2IYSA 2HDHA 1F7UA 1QH0A 1CJTC 1R4NA 2QN7A 4J16A 1CJVC 5CYPA 3L93A 2PRJA 1GGKA 1QPGA 2V9PA 3OVMA 5BYJA 5B30A 2AEJA 5K6AA 3VAZA 1EWYA 4WJLA 5TX7A 4RLHA 1DCFA 4NJOA 1BJRE 4BN4A 1M7HA 1UBOS 3HUEA 1J22A 3JAKB 3OQ1A 3O0TA 3FOWA 1BD3A 3OX4A 4TM7A 4XIYA 5F52A 3U3DA 4RL6A 3L4SO 4PG6A 1GPKA 4P54A 1ZL0A 1HYBA 3X2SA 5JW6A 3PHIA 3B1VA 2BHLA 1IDOA 4I8XA 2ORIA 2H2FA 3DUFB 3PGJA 4WLNA 3FJYA 3IHWA 1WULS 3R7BA 3ADDA 4JSTA 4I1SA 4C6RA 3F6EX 3PFBA 2KX7A 3KEFA 2QYOA 1NLZA 4KODA 3FVQA 1TD1A 5SZIA 4JLSA 1XHLA 1XZBA 4AJPA 2IRWA 2O2HA 4HFRA 1RACA 5DXFA 2R48A 3R41A 3RSFA 5BUZA 1FBTA 1FE8A 1GUAA 1Y63A 2CFCA 3AJEA 4M1YA 1C9KA 5DNAA 5HF5A 3T7CA 4D3XA 1UUFA 3OZXA 4QEKA 3I28A 4NY1A 1P77A 3ZYZA 2PEZA 3F5FA 5BQFA 2C5AA 2R5FA 2OFFA 4UBKA 2EL7A 4XWTA 4CIWA 5IG2A 3MSXA 1U3DA 4JXKA 1OWMA 1N9ZA 4J7CA 4DMGA 3LDFA 1ZN8A 3ZHQA 5GWXA 1Q6YA 3K0CA 2FP3A 4KLZA 4RHFA 4WFIA 1JI3A 4KLNA 5FH9A 1CDDA 1PR2A 2NIPA 3ZWVA 4F1WA 2ZRQA 4PX3A 4RQAA 1ID8A 4KGVA 4NC9A 1I1OA 1P2VA 2GLTA 2B6HA 3O4JA 4CYMA 2BGTA 1JDBC 2X5JO 3IP9A 1X7YB 1KIMA 4XGQA 3ZXSA 5J2TA 5IT4A 1J24A 3IYLW 3AF6A 2BHTA 1X0VA 1U28C 2R1VB 5C9ZA 5KU1A 2PZMA 5AK4A 1LI7A 1RXYA 1V6AA 1OFUA 3HEAA 1KPHA 3MBIA 1E6WA 4JS0A 4UVEA 5FYQA 1UFRA 4G5GA 3WKBA 1OFUX 2Z9DA 1MIHA 2PZKA 1TJNA 1NVUQ 2WHXA 5KDDA 4YMVA 3JQQA 3SQWA 5E4YA 4N7MA 3BCRA 1FRVA 1KJQA 4FNAA 3SEQA 1C4WA 2H1FA 1VXRA 1VMDA 4PICA 1YCFA 4YAGA 2M6KA 4BLRA 5MHTA 1JTEA 5BRNA 4GR4A 2FMXA 2YUTA 5TQVA 2BEVA 4RM2A 2Y68A 4GX1A 2UV8A 4DYVA 4TWZA 1U3CA 5F5NA 1I4DD 3G7NA 3K6KA 5A5DA 2RK6A 2GPSA 1BMFA 1JHXA 4RQBA 1Y8ZA 2Z04A 1MQ9A 2HQBA 4OD0A 5AKKA 3ZWQA 3CLRC 3FFXA 4C3OB 5IHPA 4KQ1A 1IPEA 3H0KA 3NHMA 3RVMA 4F11A 2FG6C 3ZTTA 1CLEA 3TAUA 3PXBA 4EY5A 2FXIA 3JQCA 4EECA 5JS2A 2V65A 4KXUA 3WLSA 3ZLUA 1ZMXA 2IXBA 1U0SY 2BBOA 4AJOA 1MJGM 3U31A 5K6AC 1J0DA 4FEAA 4KNYA 4YJ2F 1P33A 2A9RA 1V8OA 2X3YA 1QG0A 3ZOZA 1NYTA 1YRLA 4K86A 5GADl 4M0EA 2BJWA 2QJRA 1P4SA 4PHCA 2DX7A 5LXTB 1Z28A 2RAVA 3O4IA 2O3TA 2E3JA 3VR1A 2B8EA 1V3UA 2RIPA 2HJRA 4ZZ0A 4WOJA 1R10A 1TTHA 1VCIA 2Q3DA 3HJAA 4TTVA 1BEUB 3U9SA 1MLDA 3QNWA 4IV5A 3D0KA 1W8DA 4L8LA 3GAFA 3ANTA 4YP6A 5CCEA 1YTUA 2O1EA 1AG9A 4YRDA 4A2PA 1IYZA 2Z2ZA 4BU1A 3HSYA 1QPZA 1W1WA 3KUCA 3CEAA 2NG1A 1BOFA 2KI5A 3UKOA 5I45A 1I6LA 3OPYI 3R76A 4K8OA 5ARDA 1WPXA 2BKEA 2YWCA 3P0FA 4R3UC 2ICAA 5IM5A 4HBGA 1YBFA 4G5QA 4GP9A 3RS4A 2C9BA 1E9EA 3CA8A 1NXSA 4HDRB 1CF2O 4E5DA 2ZIXA 5L51A 4NCBA 2BTQA 4YAIA 4HQFA 1UJMA 3NOQA 3W8NA 1MTZA 4MR9A 2FW9A 3EH1A 4POAA 2NADA 4WOBA 5IRCD 1J6UA 5TF4A 3GWGA 2I6XA 4RIIA 5I9LA 1TA9A 4ITRC 3P9IA 2ONYA 4GX0A 1XZFA 2CWDA 5L3QA 2Z09A 4U2FA 4DSOA 5AI0A 4WZAA 1BTOA 1VLMA 4TXNA 1YDFA 4C0HA 4ZGWA 3AUSA 3M6FA 3GOHA 4XLTA 4NNPA 5BN4B 1WO8A 2M98A 2CB9A 4Q3LA 3Q87B 4QO7A 4J3NA 1DWPA 3I2IA 3JPWA 2G5PA 2HX1A 4CM3A 5L7TA 3KEGA 3UJDA 1C3LA 3BMQB 1SZDA 3KKQA 4Q4LA 2CMDA 2B69A 4B0PA 1Z5OA 1ZGJA 2A33A 2VUUA 3DE1X 4HDKA 4S1VA 2ACVA 2ZB2A 1CPYA 3ESZA 3UPDA 1P0QA 3SC2B 1UKBA 2QYSA 4C89A 5ALHA 3TX2A 5TGZA 2XTAA 4KHPB 4IO1A 2CXPA 4ZHQF 4EJ2A 4XUEA 3GJXC 4HS9A 1ZVQA 1IHDA 3ZVKA 1ZK1A 2O2YA 1TC1A 4OHVA 3SS9X 4OHMA 4RJIA 3TLBA 3WGHA 4A0RA 5E1OA 4QKQA 4ZMBA 1TZMA 3CTMA 2ZAYA 4BEWA 4XX0B 1BVYF 1TECE 4UCXA 5LQMA 1SVSA 1GNPA 3IUBA 4WY5A 2OCDA 3ZDQA 2R0QC 1CV2A 4NCKA 5KYTA 1EUQA 3L0CA 2NU8B 2CL0X 4TRNA 2DHCA 1YVEI 4JX8A 3NORA 4WESB 3ZBPA 1QIJA 4YQYA 3QVUA 1U1IA 4BFUA 1HQCA 2KE5A 1SVOA 1N1GA 2IOHA 2C77A 3JASB 4LZAA 2RHDA 3VPHA 4BMDA 2NTNA 4JT4A 3DH0A 4RXMA 2PKQO 2ZSEA 1BC5A 3ZU5A 2O0LA 3Q4GA 3PDJA 3SHFA 4BNXA 3CMMA 4LV8B 1BW9B 4M0KA 1EK1A 2Z5LA 2ORWA 3T9FA 1E6LA 1RJGA 2HZ7A 1CRZA 3DBLA 4FMDB 1JH9A 1CP2A 3IVCA 4M0CA 2NYUA 4FTWA 4TKMA 4JEMA 5L4LA 1SPXA 3V1YA 4P31A 2QZJA 5D87A 4P81A 3TKAA 3V6LA 4AZ3A 5FFFA 3THYA 3P4XA 5DF1A 4ARZB 4BTVA 3BIOA 2OO5A 4RSRA 5EKDA 3P9NA 3AEKA 1V48A 4N0PA 1XTSA 4TZ0A 3V8NA 1PX0A 1XAIA 2D7JA 2O2ZA 2G6TA 2CC2A 3H2GA 3C8DA 2DLDA 3QGMA 4KWCA 5DNWA 3R7LA 3GRVA 4EJSA 2YYZA 2VSOA 3V4RA 3L0BA 5IZCA 2QR2A 2OCIA 1B2LA 2INGX 2J3LA 5FI3A 1F2VA 4JU8A 2WJYA 3H5IA 3IBGA 4K6OA 4K9DA 3K1JA 2Z4TA 5L3ZA 4BFYA 2J0QA 1WCV1 3AHGA 3CY6A 2HU8A 4PGFA 3W6NA 2AI3A 2OV3A 3WL3A 2NP6A 4F5WA 1UJCA 1UOPA 5EZYF 1J0CA 4FYMA 1G6OA 2R3SA 1YZ3A 1JLHA 1R6DA 5BQPA 2J87A 2PKYX 1M2JA 2B1QA 4XQEA 3QY0A 2HLPA 3L6OO 3CRVA 3E2IA 4IVRA 3W5JA 3JD1A 4LHXA 2BYTA 2F1IA 1AC5A 4O4LF 2YZNA 5HQ3A 1IAQA 1N32B 3DMYA 3VNUA 4GF5A 3HB1A 1PP4A 4RJLA 4A10A 3C3AA 3LQKA 3TOVA 1HKHA 1LNQA 4ZODA 2EHDA 2ZXUA 2V8BA 1DAFA 1LJ8A 2ECKA 1USWA 3O3MB 1P2BA 5KTNA 4PR3A 1I13A 2FZEA 4Z4EA 5FLXA 1M2OB 2X23A 4IIYA 3MTIA 2H1VA 2Q5JA 4MIEA 1GTVA 1Z3CA 1S89A 1Z4MA 3N2LA 5TNXA 1RLMA 1EGAA 2OLKA 5FOVA 2GPJA 2PMEA 1JBQA 1YULA 4FGSA 3HCBA 3CEMA 4P3PA 3OHMA 5L3SB 4OJTA 1MJGA 4CHGA 1EG7A 1YF3A 3HXPA 4H18A 2ZBFA 4RV9A 4Q4DA 1T1EA 3W04A 4DRZA 1VKNA 2HCFA 4LOHA 4CTMA 4P38A 1I14A 1IY9A 2NZXA 1EDZA 4LMPA 4TS1A 2JEZA 4KXVA 3VUFA 3JRWA 1NG9A 4U63A 4V0QA 1PZFA 1G1MA 3PU6A 2EQBA 5KJFA 3AR5A 1NX6A 5EJ9A 4ZT7A 1JA0A 3QYJA 1SIWA 1BN7A 3GFRA 4ZO4A 5IAGA 4GZ3A 2TMYA 2Q3EA 3EGXA 4AFNA 3KWLA 3GQBB 1FFWA 3W78A 3QEJA 3SICE 1I2BA 1NURA 1RRMA 4R31A 1EZZA 3K0HA 4XYGA 1JHPA 4WECA 4O2BB 4PLZA 1NN3A 1B1AA 1RQNA 3BIFA 3OICA 5CYFA 1A9YA 4LVCA 3HCWA 4FCTA 1AS2A 2PXHA 1OW3B 4XE5A 1JR6A 2VJLA 1SCUB 2B0CA 2POCA 1ZX1A 3ICOA 2Z1MA 5KSOA 3NGLA 2EZUA 4RAQA 2BL4A 3PUWA 3I72A 4D9GA 3I9MA 3QLTA 2VOJA 2WABA 4GM4A 1EYZA 5TVGA 1LDMA 1BVRA 3L8FA 3S44A 5K8JB 4F5ZA 4DDTA 1NV8A 3DE0X 1M6EX 1FUKA 4O6VA 1ECBA 1KFBB 2FNAA 2W0MA 2WZQA 1G3IA 3D2AA 4DSUA 2IYOA 4CKBB 1E6UA 2XYVA 1Q11A 2VK1A 3O2NA 5BY2A 5L6MB 4IDOA 1X7XB 4KR2A 1E98A 3G9QA 1EINA 3GQVA 2XOKD 1FYDA 4WLFA 5SZKB 2WJWA 3JQDA 3I05A 4QGGA 4BWFB 2FFJA 3EXHB 1CQZA 2BMVA 2QA5A 3GT3A 3HP7A 4B3BA 3WLFA 5AVQA 1LPOA 5HM8A 2DHDA 3PUYA 1ARZA 2XMSA 4EVRA 2ZATA 1J9GA 4EJSC 1VRCA 1VFNA 4PLYA 4KVFA 2D54A 3MZ0A 1YB5A 3VDXA 4M21A 4KSBA 3FPLA 3ZGZA 2J85A 4WOCA 2ZZMA 5CJ2A 3AR3A 2PM8A 2WTBA 3P97A 3S27A 1UFVA 1NNUA 2A7QA 4MRSA 4YECA 4HDMA 3T0GA 1Q0UA 4I5IA 2BT4A 2X2FA 3A05A 1OLXA 1ODTC 1XE3A 4QEZA 5J40A 2C8VA 3HBAA 4RA9B 3EGDA 1NBME 1H2AS 3PSAA 1TQDA 2EIHA 3MM4A 2BEWB 5SY9A 1U4OA 1O6GA 4H59A 3BWCA 3VFDA 1MHTA 1XK7A 2OE2A 1BVUA 1QKJA 4L4SA 3I6BA 4K05A 2JFGA 1FP1D 2I4LA 3N07A 3U4IA 3UAWA 2IHUA 3IB3A 5HEKA 5JSQA 4W1RA 5FYDA 1SNYA 1GQRA 4UNSA 3MC1A 2IWHA 2HIAA 4UBIA 3M5DA 3D3WB 1W88A 2H00A 3UK6A 2YV5A 3D54D 1EM8A 3FMPB 1R4ZA 1SHKA 2PX3A 4JSRA 4IIHA 2WMYA 4RV5A 2WNIA 3W8EA 1P9RA 4L8FA 4OOFA 3ESRA 5CYGA 2HEGA 3I6IA 4QSMA 1QR2A 3QEMB 5B6JA 4LYEA 2BEUA 3O9VA 4FNGA 4G3XA 3F9RA 1O4VA 2ZT5A 4MAAA 2VTBB 1EGQA 5IKXA 1EXMA 4KWTA 2C92A 5B1HA 5JCJA 1T35A 1KXJA 1AU9A 3GLHB 4KMMA 2EFDB 1XZMA 2Q6LA 1CNEA 2O20A 3NWPA 3PUKA 4K6FA 4CF5A 1YK1A 4GGOA 1Q44A 4JB8A 4EG0A 1E1YA 3FPJA 2FZVA 4G9GA 2DR0A 4HGRA 2JDIA 2ZJ2A 5CX1B 1BNCA 4QT4A 1N8NA 2CV1A 1BS9A 1Y98A 2PRZA 4QYSA 1BZYA 1FFSA 3D0OA 3VSCA 3IOBA 3SAJA 2CKMA 3WY9A 1OIWA 1LDNA 1O96B 1Z6PA 3HGMA 1MAUA 3QVSA 4N9WA 4WQMA 3CR8A 4NV1A 3GIDA 4Y9TA 4R98A 2CLLB 4N7RA 3UAXA 3HWX1 3VR3A 2C5GA 5JIBA 3HCPA 5CD1A 4DCCA 2F3SA 3B12A 2VPWA 3GLSA 3N2GB 2O8CA 1DBSA 2EFEB 1U9CA 2W2QA 3A58B 1UPUA 4UMFA 4ZDIA 1PDWA 4B6FA 5K3EA 3G6WA 1JR2A 1QP4A 3V48A 2DBVO 4ZOAA 1OBOA 4TYMA 4ZTBA 5GONA 5JS8A 1DAIA 3EZ6A 3BIWA 4BB6A 1ZD8A 4F9EA 2V5UA 3F47A 3NBYC 4UU7A 4EWLA 1PF7E 3IDZA 1FX1A 2VH5R 2GN2A 3PQ7A 3ODGA 3DCNA 3VVMA 1M6HA 2HCJB 3R6DA 3OEHD 1VGQA 5CXSA 1OBVA 1NW9B 1QIKA 2GXSA 3AKDA 3UHPA 1EFLA 4LOJA 4LF5B 4OLHA 2LDBA 4TZKA 4Z49A 4R5MA 1OREA 4AO8A 2DR2A 2XCUA 2EERA 1C1XB 5FUQA 4FW8A 4JB0A 4F4FA 3CNQS 2ID8A 1LBTA 3AIMA 3MGGA 1JEAA 3QU9A 1ZRSA 4YONB 5G41A 2PUGA 5DX8A 1JIJA 3HB0A 3UC5A 1J20A 1C50A 2COEA 3QMMA 4FYXA 1NQVA 2B9EA 3U40A 3FE2A 1XDBA 1HNWB 1M6NA 3D3KA 2A3NA 1RQXA 1L5MA 3I37X 2CT8A 1QE5A 1X9GA 2CE2X 2FR8A 2GPBA 3G13A 4CN8A 1U8TA 3DMFA 3U60B 4HX2A 1V9SA 5JD5A 2QAGC 2ZAMA 1XVTA 4C7XA 2ZB8A 1XTTA 3HM2A 4A8JA 5EI5A 1N1MA 4W5WA 3R5XA 2HTEA 2BFAA 2HY7A 1E5LA 3JYOA 3O95A 3U44A 1E8NA 2WKSA 1Q84A 3HPQA 4N1AA 3THSA 3ZK8A 3IERA 4M3NA 5DOVA 5T4FA 1CR4A 4KR0A 3WDKA 5AKZA 3NHFA 3O8QB 1J07A 2CHGA 1P1FA 1ZD1A 3IQWA 4OCZA 5E4FA 5E6RA 1ZUHA 2OZVA 3AY0A 3L7YA 4XW2A 3K0SA 1NSYA 1ZWKA 5JNSA 1ZU5A 1OAOA 1X8LA 2HSWA 3B38A 3EHDA 4NZYA 5H3LA 2ZUSA 3BDIA 5KWIA 4LBVA 2C2OA 1ECCA 3PWSA 2RMKA 4V0OA 4Q9IA 1T8TA 1KU6A 3ROGA 4AZTA 4JQOA 3AESA 1ZGCA 4CDRA 5FIUA 3GT0A 3I52A 1DEHA 3L1KA 3O91A 4FLFA 4XDGA 1E96A 1NMXA 3PNYA 1LLCA 1ML4A 2VAXA 3HLKA 4O4HF 2H4XA 4D9JA 3ESQA 1A95A 2HHHB 1FBNA 5CA0A 2BDEA 4O33A 1C1DA 1YU6A 3A4YA 2G5GX 2BH2A 1FSPA 4QOHA 1UBLS 4X92A 4L8VA 5TVKA 5KNDA 2ZIWB 2MSKA 4FONA 2Q2NA 2EKLA 1T5OA 3HU2A 3R3SA 4W9NA 3UATA 2ILVA 1LLUA 3ZVLA 4URVR 4XI9A 2FUEA 1PRYA 2FX5A 3OI7A 1JQDA 2WJ3A 2X6QA 1EFPB 4IF6A 3HGTA 1U0LA 2QTFA 1SULA 2AX4A 1R3DA 2I87A 3PD0A 4WTOA 4C01A 1KMCA 5ECWA 2OYCA 3FN4A 1LJLA 1A9PA 4QSHA 2E55A 2PIDA 5HKKD 5IXYA 5C1OA 2Q0QA 1MXHA 3PBKA 4YO7A 2QRNA 1CUAA 2OCKA 3DVLA 1K89A 1Z22A 2ZXFA 3H1EA 4JC5A 1ADFA 4NJEB 2ZITA 4EBFA 4U6SA 1WA5A 2E0IA 3T3OA 2G82A 1P0FA 1LKZA 4Q93A 2C2XA 4UAGA 1ZG3A 1TYZA 4BLQA 3G3EA 4DA4A 3U4GA 2ABWA 1UDBA 1AT1A 2D1YA 3ZNOA 4DIOA 1F17A 2P2YA 4OHKA 1ZWLA 3IOYA 3Q3CA 4J3FA 4P92A 1T1IA 3TTYA 1RQGA 3DMPA 3P9YA 4XH9B 4D56A 4FFSA 2GGSA 2C59A 2AEFA 1I80A 2J3KA 2O0HA 4KAXA 1NBWB 3RVBA 3OT4A 4D6YA 3HDJA 3GEMA 3I1IA 3WB9A 1LVHA 5CH8A 5SYAA 3R8XA 4Q4AB 3AKZA 3L2OB 2E4AA 2H51A 3QTLA 4G01B 4F3TA 3FIJA 3ZK7A 3JAKA 2AI1A 3MAAC 3QVGA 1C0EA 5TSDA 3ZV5A 4FWTA 5FR1A 5C4MA 3V55A 2ZYGA 3PWKA 5DYWA 8ATCA 3SS7X 1KY4A 1DC5A 3KSUA 3ZPXA 4EY7A 1YSCA 1X8JA 2W6MA 1POXA 2QLBA 5F5LA 3TQCA 3AOEC 1Q22A 2ZQZA 4IOMA 3ITEA 2EIXA 2HSDA 3EK2A 2GUWA 3PNMA 4LSMA 5CM2Z 3TSZA 5BWOA 1YL7A 3K2QA 2RGBA 1OB2A 2ZUDA 1IU9A 2IYQA 3H2SA 2CXTA 4I8DA 4CV3A 3O38A 4FBGA 3C87A 4EJMA 3V7FA 4YS6A 4AROA 1GAEO 2EV9A 2P8JA 4TV9B 1M1UA 5K01A 4V0LA 4L9RA 4MGHA 5EIBD 4INPA 4L8WB 1R4AA 5AJWA 1NNLA 2G70A 2H3HA 2VJPA 4DJJA 2JLWA 2AI2A 4FFDA 3U0VA 3K32A 1SQ5A 4EKIA 1HF3A 2R6AA 3U7JA 1IBLB 1W75A 1J2RA 1R8XA 4J3JA 1H93A 2ZI5A 5IWAB 4GOOD 1KYZA 1Z5PA 1UADA 1NA5A 4R84A 4FFLA 4H7JA 2CY0A 1I4EB 4LGMA 3FUCA 3Q3GE 4NCIA 2GBIA 5HIMA 1OXVA 1OAOC 4EDHA 3EVCA 4RYLA 3WP0A 2DPXA 1AF4A 4NONA 3IR6A 3H5AA 5DIZA 4ETWA 2CLCX 2DCUA 1G8YA 5G4LA 4NWIA 3SSNA 1WQ4A 1X7YA 1L5NA 2AZ4A 1TT5B 5EC8A 4DN6A 3U7HB 5DJ5A 3HRHA 4O25A 5HZMA 2WOOA 1EPUA 3OZ7A 4PC3A 2I03A 4G8DA 4UCQA 4KQFA 4G4JA 1VCNA 3ETEA 1E9BA 3GRPA 3FYSA 3ZZNA 4QTUB 2I7VA 2EC5A 3KTFA 3V8PA 1MQ8B 3HP4A 1G6KA 1KI6B 1WSWA 4P1ZA 1U80A 3JPYA 1JDPA 2XNHA 5EJMA 3GJSA 4WWHA 3QVOA 5CP8A 2OD7A 1GDTA 2QZSA 1VRVA 2KHZA 3B2QA 3HACA 5GJWC 4GXQA 1P31A 1AZWA 5ALVA 2XNDA 2B5VA 2IXGA 3TTWA 2HF9A 2WILA 3H5VA 5DX1A 1DP4A 4B6GA 3JALA 1QOZA 1E2GA 3CIOA 3UCFA 3V1MA 5FPYA 5B7PA 2WJ4A 1J8QA 1FNBA 1TOAA 5DYIA 1DSSG 1MA0A 1PNOA 4JLMA 1KR5A 1ULBA 5TPZA 1TRKA