1GTMA

Structure of glutamate dehydrogenase
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
417
structure length
417
Chain Sequence
ADPYEIVIKQLERAAQYMEISEEALEFLKRPQRIVEVTIPVEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGIIVDPKKLSDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISRRKTPAFGIITGKPLSIGGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEVLKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDFLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Pyrococcus furiosus glutamate dehydrogenase reveals a key role for ion-pair networks in maintaining enzyme stability at extreme temperatures.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords GLUTAMATE DEHYDROGENASE
total genus 171
structure length 417
sequence length 417
chains with identical sequence B, C
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 1996-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gtmA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1gtmA01
3INRA 2EERA 3K73O 4IBOA 2O3RA 1ZK3A 4FFPA 5AYVA 4ALNA 1ZJYA 4MP3A 3SVTA 3GG9A 4EJMA 2O3TA 4II2A 3V8BA 1J5PA 2BGKA 4J43A 1DB3A 4GWGA 1DRWA 3UGKA 1KOLA 4E33A 3ZWCA 1D1SA 1CQJA 5BQFA 5J23A 1U3UA 1NVTA 2NSDA 1V8BA 2PD4A 3JQBA 3L0DA 3LYLA 3ENNA 3NDIA 4QUKA 1G1AA 3DBHB 2B4RO 2Z1MA 4TSKA 1EE2A 2EV9A 3OJFA 3NJ4A 3QV1A 1ZNQO 5IN5A 3ZV5A 1E3WB 5MGBA 1YDWA 3F3SA 3U09A 2V7PA 3VPGA 1Q1NA 1ZSVA 2XXJA 4XDZA 2WMDA 1TLTA 1DFIA 4RPGA 4RQTA 5EL0A 1BWSA 1UUFA 3QLJA 2B5WA 1ZK0A 1BVUA 2IEDA 4GKVA 1KETA 5A4DA 4E5YA 2G76A 5KVCA 2DC1A 5H82A 3W6ZA 5CAEA 1C0KA 1HE4A 2Y1CA 1I3NA 1LLQA 3D3WA 1A7AA 1T2DA 3GGOA 5L4SA 3WIEA 4QX6A 1R16A 1IYZA 1X1TA 3PGXA 5DULA 1N5DA 3E5RA 3DHYA 4CM9D 4QT0A 2XXBA 4U0KA 1P3DA 2C82A 4FPXA 1U7HA 3GQVA 5CDUA 2ZTLA 3VHRA 3BMNA 2YYYA 1M67A 4GVXA 2XF8A 1TT5B 2ZCVA 3OIFA 2BELA 2FR1A 3GK3A 5CG1A 4GMFA 4YT8A 4CM4B 7MDHA 4WCFA 1UXGA 3M6IA 4W7IA 5F3RA 3QE3A 2B35A 4XYEA 2R00A 1A9YA 2Q4EA 4N5NA 5EERA 5I9NA 3CZRA 2TMGA 3ASUA 4DWVA 5K0ZA 4MVJI 5U4QA 4HXYA 1D4FA 1GV1A 3HJAA 4D79A 1XLTA 1E0DA 3I9NA 1FK8A 4IIUA 5CP8A 4G65A 5IXSA 2NVBA 4BQPA 3OBBA 2BI8A 3UAGA 2YZ7A 4BNGA 3F4LA 2CVQA 4BUCA 2C7VA 1IB6A 5JC8A 2Q45A 4ND4A 2DTDA 3I9OA 4PZDA 3EY4A 3PQEA 1C14A 2B4QA 1NQTA 4OQYA 3S2IA 4CV2A 3P2YA 5T57A 3V2GA 4ZHSA 3ANLA 4AJ4A 1ID1A 1U5CA 1E7QA 3DFZA 3HFGA 3GDFA 3S1LA 1E3WA 2VRCA 1PSDA 4OHUA 3TOZA 1ISMA 3GVHA 5GY7A 1ARZA 1NVGA 3ICCA 4BNMA 3PP8A 5F5NA 4D3SA 1F8FA 3HB4X 4F45A 4CR7A 3OJEA 3OQ6A 1HKUA 1B26A 2ET6A 4E13A 1HXHA 2P91A 2GCGA 3CMMA 5C5IA 3KSUA 4A27A 4IDDA 4MINA 1YJQA 3T7EA 2HAEA 4AJIA 2X1HA 3KLMX 3DZJA 4FFMA 3AI1A 2J5RA 1KVTA 4D7AA 3JQDA 1EFLA 2H9IA 5F1PA 3C1TA 3VH2A 1HYHA 3A9WA 2NNLD 5A5FA 1WW8A 3ROKA 4XYGA 4DPLA 4FC7A 4XYMA 3C7DB 3E03A 2AG8A 5TT0A 4Q9NA 3H65A 4J16A 4B8ZA 4NU6A 2IXAA 4D0SA 2VZ9A 1M75A 3A14A 1HTBA 1AE1A 3K30A 1XKQA 3L07A 4RPJA 5L40A 2GD1O 2PD3A 3GDOA 3VPHA 2W98A 2WE7A 4PLZA 3V5NA 1BVRA 2B36A 3WG9A 2AG5A 1Y9AA 2J5QA 4O1MA 4ND5A 2VUUA 2HU2A 4O5OA 2C7GA 4LCJA 3H6KA 3VZSA 2VHXA 3IJRA 2R6JA 3C7AA 1ONNA 3PXXA 3RIHA 1L7DA 3BMCA 3O38A 4ZGWA 4BO7A 2HK9A 3U0BA 3JCZA 1XA0A 1IOLA 2BGLA 2P9CA 4QSMA 1HDCA 1DFGA 3QVTA 4NFYA 1P45A 5EQFA 3FR7A 4FDAA 2O50A 2PGLA 3INTA 4AL4A 5A9SA 3DMTA 4LMPA 1BXZA 1GEEA 4PLYA 1NR7A 2JFGA 2CUKA 3C1AA 3G49A 4PZCA 4CQLB 4JIGA 3UCFA 4P4GA 1PTJA 3JYPA 4J2OA 5BSFA 3QA9A 1MV8A 2D3TA 4R3NA 1T4DA 1Z82A 4DMLA 3BMQA 3JQBC 4LVCA 3KV3O 2JHFA 1PR9A 4YT5A 4BV9A 4PN3A 3GDGA 2ZTVA 1MA0A 3H5RA 3BMNB 1PS9A 3F1KA 5A06A 1FXSA 1LLCA 5TLSA 4OGWA 5BSEA 4RCVA 5KJCA 3GHHA 1BXGB 2J8ZA 4ND2A 3PJEA 3JSAA 6LDHA 4ZD6A 3LC7O 4OSOA 3EMKA 2PH5A 3IP1A 1SBYA 4KWHA 4QO7A 5BSGA 4GPD1 5L7TA 3TZQA 1AN9A 1N2SA 2H1SA 3QRWA 1A4UA 3ZGYA 5A3VA 9LDBA 1EBFA 2OOSA 2P4QA 1V3TA 4CL8A 3WQQA 4FC6A 5TGDA 2VOJA 2R2GA 3ZHYA 3L77A 4FN4A 1N1EA 2Q1TA 4YAEA 3GF4A 2UVDA 4U6SA 4W99A 4WNIA 1GAEO 2B69A 3NTOA 5ICSA 3G17A 1E5LA 1Z73A 3WGHA 4ZRNA 4CUKA 4N5MA 3L4BC 2QW8A 4W9NA 2JFFA 4XB2A 1TB4A 3G3EA 4QXMA 1EVZA 4E4YA 5BNFA 5TRTA 3W8EA 1R37A 3QVXA 3MJCA 2CMDA 3O8QB 1I0ZA 1I3MA 1VLLA 3HFSA 4ESOA 5GZ3A 4NHEA 3COSA 5CDSA 5ITVA 4XD2A 1EVJA 1XYGA 1SO8A 2VUSA 1XSEA 3IQDB 3QY9A 2JAPA 3AM3A 2Z95A 5L45A 4DMMA 2GO1A 2Y0DA 4CQMB 1LTHR 3FSRA 3JQ6A 2OL4A 3KEOA 4XWYA 2BD0A 1ORRA 1NPTO 5U1PA 3H9GA 3SLGA 1BXGA 4OJNA 4BS9A 4XJTA 1KIFA 4S3MA 1IZ9A 1XDWA 3E82A 2HO5A 1EFKA 1E1MA 4R1TA 5GMOA 4M55A 4OKNA 3NTQA 4DQXA 4C4OA 4WE3A 1UXJA 1Z45A 1JU9A 1VC2A 4UEOA 3GVCA 4R5MA 3ZN2A 4MOWA 4CLOA 1V0JA 1ZBQA 2P5UA 5I7VA 1OZAA 1WNTA 5JAQA 3DDNA 4FJ2A 2GRAA 5B12A 1NQOA 3VDQA 1DOHA 1XGKA 1L1FA 1B0AA 1CERA 4A10A 2X5OA 2GN9A 4LW8A 2JFHA 1Z6ZA 4MIYA 2GNAA 5CPFA 5JFOA 4K6FA 4IDFA 1DRVA 2EW2A 4NZ9A 3PFFA 2GPTA 1I10A 1QLJA 4HNGA 1ZCJA 1MLDA 1RM3A 4X54A 2VYNA 4YVFA 1WMBA 3GOHA 3GEGA 3VKUA 1NQ5A 3DL2A 3LLVA 5KKAA 4J3FA 3P5SA 3QWHA 1ZMTA 4B3IA 5HBRA 2Y1OA 3IL2A 1PGQA 1MP0A 1H6AA 3AJRA 3OIDA 4CM4A 4CMJA 4DBVO 3ICPA 4YJGA 4DQUA 3C85A 4CUJA 5A9TA 4XGNA 1XCBA 4NIMA 3Q0EA 4YDRA 1PGNA 4GAEA 2NV6A 3PWKA 4K1LA 2HMUA 3FN4A 1EK5A 1ISJA 5KJ1A 4HV4A 2BKAA 4WUVA 5BR7A 3ST7A 4R68A 5CEFA 3OEWA 2OO5A 1JWAB 2UV8A 1LDEA 3ZNOA 1BW9A 3DBLB 1E1LA 3OFSA 1GZ3A 1K2WA 3KYBA 1TVEA 4Z6KA 4OXYA 3EC7A 1M66A 5TSDA 5ER6A 4E2WA 3MEQA 1EMDA 3TRIA 4Z3DA 3PEFA 3P7MA 1PZEA 1CIVA 1GR0A 1ZO8A 4KUEA 1C1DA 3ROMA 3L6DA 4IIVA 3RSHA 4UEJA 3ULKA 5EPOA 3TDKA 4ALLA 4BQRA 1ENYA 1GYRA 4PLTA 4CLHA 5C7IO 1NFFA 4B8WA 5L4NA 5BNTA 3UXYA 3ADPA 1ZK1A 2FPPA 3HUDA 4RZHA 1WVGA 1SCUA 1N9GB 3Q2KA 1GUZA 5C3MA 4CV3A 3KUXA 1HZZA 5JC1A 4OOEA 3VTFA 4PRKA 2BH9A 3PZRA 2W2KA 4GL4A 1Q7BA 1X7GA 4LK3A 4XIYA 3UCEA 3DOOA 4RZIA 5IFLA 3AI3A 1OC2A 4RVDA 4DLAA 3GMSA 4YR9A 3CIFA 4MP6A 3HN2A 3UFXA 6ADHA 1NQAO 3GGPA 3DZFA 4BO1A 3GAZA 1FMCA 1T4BA 4KZPA 3Q9UA 4XB1A 1QYCA 1WZEA 4RGBA 1TXGA 1PJCA 3BTSA 3PI7A 3ZU2A 4BO0A 3CZMA 1SPXA 4B7UA 1WP4A 3PDUA 5DCWA 9LDTA 4PLGA 1KEVA 1N8KA 4F3YA 1PX0A 1ZH8A 3I1JA 4E5MA 1CF2O 2A9FA 3DZKA 4TVOA 3U4DA 4ROSA 3HDHA 3QQPA 2IZ0A 5JAZA 1K3TA 5L9AA 2HMTA 1A5ZA 4RPLA 1AGNA 1ZXLA 2AMFA 4ZQHA 3ZWMA 1RM5A 4FR5A 4HX5A 4ALMA 4YAIA 1A9ZA 3PQFA 3H8VA 5LCXA 4DBZA 2DTEA 4W4TA 1EVYA 5CHEA 3RAJA 2RH8A 3WGQA 3H9QA 1RWBA 1R4NA 1R15A 5K6AA 1YS4A 1ZW1A 1O9BA 1K6JA 1PWZA 3AUUA 1PS8A 3E9NA 3F9IA 3S8MA 2JCVA 1FJHA 3ZWAA 3DAFA 1F14A 2VHWA 2O3JA 2YHUA 1CDOA 2GUGA 4UUOA 1J4AA 3AK4A 1NPDA 3L9XA 4IGFA 3GZ4A 3JV7A 4XJSA 2QRJA 4GH5A 1EUCA 2C2XA 4BO9A 1QV6A 3K8ZA 1R0SA 4AICA 1DAPA 1DRUA 3GNSA 4ZU3A 4N7RA 3W8FA 5DOVA 2E82A 3K96A 3RFXA 4B7CA 3CKYA 3QWAA 1Y1PA 4E5PA 2J3JA 2JL1A 3LC2O 3U4CA 1PEDA 5I8ZA 2FPIA 3DEYX 1XQ6A 5COAA 2IEBA 3K2BA 5L53A 4NBRA 1AXEA 5DBIA 4KWIA 3JD0A 3WGGA 3AU9A 2RCYA 1WDMA 4G81A 1DPGA 5DP1A 2X23A 4FFNA 4ZRMA 5I9LA 3RWBA 4ALKA 2EP5A 1ZVMA 4HNHA 3PYLA 2Q1SA 4D43A 4IUYA 3MWEB 1KYQA 2OGUA 1SB8A 5DCYA 5B4VA 1GQ2A 1GUFA 1PGOA 4PVDA 2VWPA 4RVHA 1R4NB 1KS9A 2Z1NA 1VJ1A 4Q3AA 2C0CA 3WGIA 3NTRA 3KBOA 3OP4A 1HSOA 1O8CA 1SMKA 1B15A 4I9NA 4MVJH 1PJ2A 4R01A 3ABIA 4WCDA 1TA4A 1IPFA 1UXIA 3GMDA 3WLFA 1E3SA 1H2HA 1JKJA 5BSHA 2X9NA 3WYEA 5JSFA 4O0LA 3CUKA 3RBZA 3UH1A 2VNSA 2DBZA 3KSDO 4CMEC 3JQFA 3CINA 2DQ4A 3ZHXA 1IHYA 1DIBA 3BIOA 3U4IA 3TZCA 4BKQA 5FEUA 4ITUA 3JQ9A 2HRZA 1CQIA 3GN2A 3EZLA 3F46A 5TC4A 4L9RA 4TQGA 3WB9A 3HG7A 4JJGA 4P22A 4DC0A 5KNLA 2IE0A 4R9RA 2NACA 1JN0A 2HK8A 4CQMA 3DHEA 5JCJD 2JD0A 4C7KA 4CMEA 3JD3A 3VAZA 4EBFA 2J5KA 4FFLA 1PJ4A 3PJDA 4MVJA 5DDIP 3AUSA 3SJUA 4ALJA 4YTEA 3LF1A 1H5QA 4KMSA 2YV2A 3DMTC 2E6UX 1EQUA 3JQAB 2WJPA 1HYGA 2DLDA 2W8ZA 3FPLA 2WEKA 1TT5A 1U28A 3NDJA 2DPHA 4YAKA 2IODA 2PGJA 3PPIA 4IINA 1ISHA 2VT3A 2EKPA 2R00C 4D42A 1SZJG 3KETA 2DT5A 4U0JA 2AE2A 2FHSA 3I9MA 4YA6A 3RD5A 3FRJA 4YRBA 4HFNA 1WDKA 4J1SA 4K26A 3GRKA 1OOEA 5T67A 3ZWVA 1NHGA 1LRJA 4HFRA 3I23A 1ZIDA 4WPGA 4E31A 2QZZA 3EK2A 4CM9A 4N18A 4YYZA 5AVOA 3OICA 1XU9A 5H81A 3H9EO 3KTDA 1FDWA 2HJRA 1H6CA 4W6ZA 3ONEA 2J6IA 1F06A 2YV1A 4BO2A 3B1JA 4R54A 3S2GA 2CF6A 5BNIA 5A1TA 2W2LD 2IYPA 3EZYA 2DU8A 1ZXBA 5I8WA 1BDMA 4B4OA 4BNXA 3D5QA 4J4BA 5DF1A 4Y8VA 4LCEA 1LU9A 2IDZA 4HWKA 4IXTA 3W6UA 5TJHA 2I9PA 1ISGA 1ZMOA 2IZ1A 4DL9A 4FJ1A 4P8RA 4GSLA 1DC3A 1P1FA 3I83A 4OKIA 3K6JA 3VDRA 1R0KA 4M89A 1W0CA 4CQLA 4JROA 1B3BA 3EAGA 3JQGB 4Z9FA 1CWUA 2VCYA 4L75A 4R1UA 2FOIA 3GRPA 1MGOA 4Y67A 5EIOA 3V2UA 4NNJA 1QYWA 3ZH2A 2C20A 2HMSA 4RQUA 1J6UA 4Q39A 3WWYA 3K5PA 3Q1LA 1Y5RA 1Y6JA 1GCUA 4GX2A 1XQ1A 2EGGA 2IYOA 3BTUA 1LLUA 4HY3A 1OFGA 3C1OA 4PVCA 1GTMA 1U3WA 2EGHA 4NBUA 1Y8QA 4J0EA 2FN7A 1K6IA 4IMPA 3RFTA 4A73A 4AJLA 3OECA 5A04A 1XIVA 2DTXA 1YQDA 2SCUA 1YXMA 1HDGO 3U5TA 3V1YA 3OM9A 3LLSA 2Y99A 4WECA 3VH3A 3NT2A 2WSBA 3IC5A 4WASA 5JLAA 1K5HA 3ZHBA 3C7CB 2YW9A 1W4ZA 1QORA 1GPDG 1HDXA 2PH3A 2RHRA 4PZEA 3W4IA 2AQKA 4PLFA 4H7PA 1ZUD1 5ES3A 4ZN6A 1VI2A 4HKTA 1VRWA 1ONOA 3O26A 1U2GA 3FWZA 2EHDA 3AUTA 4JBHA 4R16A 1MG5A 3Q11A 4YWJA 1RJWA 3IJPA 1F8GA 1JWBB 1YB5A 2AE1A 4JP2A 1B3RA 1NX6A 4MVJE 3WQRA 1HSZA 2P9EA 4NG5A 2QYSA 4INAA 4J6FA 1IHXA 4CUZA 1ADCA 3HDJA 3KYDA 3PHGA 3FNFA 3R0IA 2GDZA 4CLEA 4TRJA 1QRRA 1H2BA 3V1UA 1ZSYA 4NH4A 2OZPA 5CEJA 1P0FA 8ADHA 2PLAA 5C37A 4CLOB 3KYCB 1C0LA 3CTMA 5H83A 3IOYA 3MZ0A 2X0JA 5DBFA 1YOVA 5KIAA 2CNBA 1Q7CA 5IZCC 1GV0A 3ASVA 2PK3A 1UP4A 4J90A 5ADHA 2FSSA 3PLRA 4BKRA 4M1QA 1VJTA 2DVMA 4G5HA 3LT0A 2D8AA 4NK4A 4I5EA 4CM7A 4RV9A 1UH5A 3HN7A 4IQ0A 4RF2A 3O8QA 2DAPA 3CMCO 3EHEA 3GEDA 5C7LO 1HE5A 2EF1A 2WD8A 2JD1A 1A4IA 1OBFO 1H6BA 4E32A 5JO9A 2BHLA 2GZ1A 2OUIA 3SEFA 3WBFA 4CV0A 3G79A 2UDPA 3KRTA 4PG5A 3H2SA 1Z7BA 2ZATA 5T64A 1U1IA 1V3UA 3GPIA 4TZKA 4L73A 1DSSG 4LVUA 4WCFC 3PLNA 3DZGA 4PG8A 4MIOA 3IMFA 2OP1A 2ZIZA 3K31A 2PTGA 2AEJA 3KYCA 2FZEA 3MJSA 4D3DA 1EZ4A 4OXKA 4B3JA 3W4JA 3LK7A 4M54A 4CM3A 3LT1A 1B8PA 1ML3A 4DIBA 1KC3A 1RYDA 2OMEA 2VYVD 2PY6A 1B8VA 2X7HA 3B1FA 3VZQA 3LT2A 3VOSA 3PWSA 2BF7A 1GCOA 4B79A 3TF5A 4KOAA 2C29D 4EJ0A 1NWCA 5TX7A 1O95A 4JJIA 4BL5A 2JCXA 1OC4A 5G4KB 2C59A 3WYCA 2F1KA 4DLBA 4YPOA 5IF3A 4GX0A 3SC6A 1U8XX 2C07A 3UF0A 4MVJP 3WS7A 4OXNA 4CLRB 1N9GA 5CDGA 3GLQA 1F17A 3CH6A 2O2YA 3UOGA 5JAIA 4DIOA 2O2SA 1DIRA 3ZW8A 3OQBA 2J3HA 1T25A 2I3AA 2Y66A 5ITWA 2RAFA 1X13A 2HSDA 4BKPA 1GYQA 3QVWA 3TNLA 1JAXA 4RDIA 2NQTA 1MFPA 1Y8QB 1C0IA 2NU7A 4BNUA 1PJLA 2Y1FA 2CD9A 4H3VA 4IZHA 4R9SA 3ZWOA 2FRDA 1C0PA 2O7SA 3N7UA 3UW3A 1H6DA 2WM3A 5F1OA 2ZK7A 1MFZA 3I52A 2FP4A 2D59A 3EGOA 4IM7A 4LSWA 1JVSA 1YL5A 1A7KA 1H9AA 3AOEA 5EESA 5B1YA 2X9GA 3HNPA 1MC4A 3OETA 3AM4A 3ITKA 1GD1O 3NAQA 1PR3A 2PZJA 4E0BA 1LXCA 1PGJA 3S55A 1E3IA 4BNTA 3I6QA 2Q49A 1P31A 3DZBA 2VWQA 1E6UA 3I3OA 1E7YA 5I9MA 2Y68A 3GZNB 1X14A 3F4BA 1UZMA 2AQ8A 2W2KB 3JYNA 3AFMA 3DHNA 1UAYA 5A02A 1IY8A 5EN4A 4K9DA 1YL6A 1UAGA 2HK7A 4QQRA 2VRCD 4ZQBA 2TMDA 1DC6A 3WFJA 4D0RA 4RLSA 1KEWA 2HQ1A 2OP0A 4A2CA 4Y98A 4ZQGA 4A5OA 2X4GA 3FPCA 4DREA 1ULSA 2Q4BA 3JQ7B 4BNFA 3KLPX 2RHCA 4DUPA 1GY8A 1E7MA 5IJZA 5THKA 2QG4A 2FR0A 2ZYDA 4YB8A 3INGA 4NJMA 2QRKA 4OYRA 3PWZA 3PHJA 4IJVA 4D44A 2NWQA 2X58A 1O94A 4GX1A 4IGEA 4I5GA 3GVIA 4BO4A 5JS6A 1LJ8A 4U6QA 4FFRA 2BLLA 1DC5A 2VTEA 3B70A 3MTJA 3R6DA 1LQUA 4YRDA 1R12A 4BMVA 2YFHA 4XQCA 1T2AA 3ZHZA 2O3QA 4PFJA 3ZCXA 4F6CA 2B5VA 1J49A 2ZTUA 1EDOA 2Y0CA 5L51A 4CMBA 4WCFB 2JAHA 4BO5A 1V9LA 3JD1A 4YT4A 1BG6A 2EP7A 3DR3A 1LSJA 2QX7A 2DFDA 2YV3A 5KVQA 3KM0A 4CLRA 4UUMA 4MVJD 3KXDA 4DIFA 1YBMA 2A92A 3IIEA 1XU7A 5G4KA 5IDQA 3AY7A 3BHJA 4URFA 3WXBA 3OJ0A 3PHIA 4E12A 1DIHA 4CLDA 5G2OA 5B37A 1E5QA 2NU6A 2W90A 3FNGA 5DBGA 2O4CA 1MX3A 1YWGO 3AUAA 1IPEA 1PIWA 2DM6A 2ZB3A 2J3IA 2CF5A 3L9WA 1IULA 4Z0PA 5JPIA 1HL3A 4TWRA 5KJ6A 1GQQA 1T24A 3LSYA 4Y6SA 1Y81A 3BTVA 3O03A 2YDYA 4CM6A 4XYLA 3BHIA 4CL3A 3QSGA 3TL3A 4FOSA 5CG2A 3UN1A 4P38A 1DJNA 4GWKA 1P77A 1YDEA 3ZZNA 1VL0A 4YAGA 4JNKA 3JTMA 1P1JA 3P2OA 4MKXA 3UKOA 5IDWA 4PLCA 3EVTA 4DQVA 4KTTE 1Y8RA 4HADA 5A3JA 2G0TA 4WOKA 5FWNA 4D41A 4QEDA 2CSUA 3RVDA 1X1EA 3D64A 4YJGB 2NU8A 4AFNA 3RFVA 4BKOA 5JY6A 3QVSA 3GAFA 3TSCA 4LRSB 2Q2QA 5B4UA 2WYUA 4XGIA 2OXIA 3T4EA 1CEQA 1ENZA 1QLHA 3DBLA 4H15A 3GA0A 4YJHA 1KVRA 3NT4A 1ADGA 2ZQYA 3VVBA 3D7LA 4BO3A 3E9MA 1P1KA 2O7QA 3GVXA 4PLHA 4R51A 5COQA 4L4SA 4F46A 1SNYA 3A06A 2H6EA 1DDOA 5KOIA 1LQTA 2RIRA 4P4LA 3D5TA 3RUEA 1TI7A 4XGKA 4PLPA 4OIMA 1E77A 5HA5A 1U3TA 1U5AA 5FFFA 2BFPA 3X2FA 1V35A 4OQZA 4PLVA 5JXWA 1R4MA 2PWZA 4YQZA 4NJMB 3HB5X 3U49A 1P44A 1SAYA 4IDCA 1Z74A 4YJFA 1PJQA 1E6EA 2HMVA 3DO5A 3GFGA 5ENDA 3I5MA 4WLNA 2VNAA 5AXBA 3ZWNA 2AQIA 4WK6A 3WWZA 1PZHA 2ZCUA 2GASA 3H9UA 2G17A 4D46A 3E6AA 3PDJA 1I32A 2IZZA 3H5NA 3P19A 4FIZA 4J2HA 3U3XA 3PTZA 3Q9NA 3WGZA 1DJQA 1IUKA 2Y1EA 4KTVE 1QXSA 4XKJA 5ICMA 3PFWO 5AXDA 4EEXA 1V3VA 4E6PA 1YBVA 4WGGA 3JQAD 2I76A 4PG4A 3HHPA 2GSDA 3KSZO 1YQXA 5HM8A 4BNKA 4BNIA 1T1SA 4RVGA 5F21A 1P74A 4XA8A 4EUEA 3GNTA 3ZWWA 3DB2A 1LEHA 3BYZA 3JQFC 3QVOA 3I4CA 5DNAA 5JBIA 4XCVA 4QECA 4EI2A 3OA2A 2E4AA 4YQYA 4ZICA 1YB4A 2I99A 2CVOA 5AXCA 5KCZA 4OL9A 4Y6PA 3LC1O 4BB5A 1HZJA 4CMKA 1YH3A 3GVPA 2GZ3A 3E18A 4FFOA 1U7TA 4CQMD 1EEHA 3VTZA 4Z0TA 3HWRA 1Y8RB 3F5QA 1KVQA 3JQEA 1S6YA 1NAHA 1HF3A 4OAQA 2X5JO 3NGXA 4EYEA 2H63A 4XRRA 4WKGA 3CSDA 3FHLA 4TKLA 2J3KA 4BNNA 4AJNA 3FNHA 2POQX 4IDGA 5IZ4A 5MDHA 1YL7A 4BO6A 3BMQB 2BFMA 2D4AA 2AHRA 2DUUA 1YO6A 3TQHA 3MWDB 3LF2A 4M87A 5K6AC 1LSSA 3NJ8A 4BNJA 1AUPA 1MC5A 1ZEMA 2ZB4A 4EUHA 1XEAA 1HEUA 4YJHB 2V6FA 3R3JA 4YACA 3RUDA 1CETA 3FWNA 3ZU3A 3EUWA 3JYQA 4DA9A 3KHUA 2OFPA 3ZNNA 3DQPA 4WOJA 4BIIA 4QTZA 4G2NA 1PJ3A 3DFUA 4MDHA 4E2YA 5IDYA 4B4VA 3OF2A 4CM5A 4S1VA 4U7WA 2QRLA 4Z3KA 2D5CA 1Z75A 3DONA 3TZ6A 1PQUA 5LDGA 3ZNQA 5JNLA 3G1UA 3B1KA 1DBVO 5FI3A 2WYVA 4FQ8A 4HUJA 1O6ZA 3A4VA 3DAGA 2Y1DA 2DBVO 1YVEI 5T8KC 1YOVB 2PZMA 2B4TO 1HDYA 1SOWA 2I66A 4IPTA 3FBGA 4FB5A 4QFCA 2VRBA 1LSUA 3BTOA 3DTTA 3LT4A 5IAAA 1DIAA 4R1NA 3RASA 4HBGA 4IY1A 1OMOA 4J4HA 3G0OA 4FCCA 3WYBA 4EW6A 3JD2A 3ETDA 4BNWA 3EYWA 4BNZA 5DCUA 4BV8A 3M1AA 2O3UA 2PD6A 3ANNA 3V1TC 1DFHA 2YQ4A 4R1SA 2O23A 3OEYA 3AOEC 2YHIB 5HS4A 1E3JA 2EKLA 1F0YA 3WTCA 1NBOA 1S7CA 3OH8A 5JYEA 4HFMA 3S2FA 4J9VA 3ITDA 5C7OO 1YONA 4JQCA 4ZQFA 2DBQA 2VHZA 2GN8A 1ZKMA 2G82A 3STHA 3RC1A 4E21A 2BMAA 2FSVA 1B7GO 2PV7A 4FOOA 1NVMB 5ENVA 3D4NA 3VH4A 1HDOA 1RKXA 2PZKA 1V6AA 3KO8A 2D1YA 4O59O 2HRBA 3AWDA 3FBTA 4ILKA 4EJ6A 5COBA 2ZJ1A 4W82A 3S2EA 1GDHA 1EDZA 1GZ6A 1P9LA 4J9UE 5EJ2A 5T5QA 2EXXA 4BNHA 4N5LA 1Q7GA 1G0NA 3IS3A 3JQ9C 2OBNA 3U62A 1UP7A 3OMLA 4CJXA 5EQDA 3R3SA 1GFSA 5JE8A 1EUZA 1KVSA 3IDSA 3RU7A 3WJAA 2X6TA 4AJPA 3F1LA 7ADHA 5TF4A 4AJ2A 4CMAA 1P0CA 2BFAA 4H16A 5TQVA 5K9ZA 2OORA 1O5IA 4UULA 4E3ZA 4KP7A 3IP3A 1PZFA 2FY8A 4RLHA 1ENOA 2CDAA 3JQ8B 2X8LA 2XOXA 3DAPA 2AW5A 4J49A 1LDGA 5DOZA 1AHIA 1QYDA 1JQBA 4IS3A 4FSHA 4YXFA 2YHIA 1I36A 2P9GA 1Q0QA 3VPFA 4JCOA 5IXYA 5A5EA 2WYWA 4MVJM 4PG7A 2Y05A 4I9UA 1M6HA 4IS2A 2CDCA 3RU9A 4FD3A 3FTNA 1AHHA 3JQAA 3SX2A 4RVSA 5KJFA 4O6VA 1NP3A 2GLXA 5EINA 3LVFO 3QW2A 2NU9A 3WTBA 2EIHA 2W2LA 1XELA 4NK5A 2Q46A 1T2CA 5A05A 3PJGA 1GL3A 1X7DA 3AFNA 3SJ7A 5DT9A 3OIGA 3CEAA 4NDNE 4NR0A 2XAAA 2AEFA 4Q3EA 3ZNPA 2FMUA 1T2EA 1Y7TA 1I30A 4J4TA 2W4QA 4MP8A 1JAYA 4AJKA 4QFDA 2DBRA 4XQEA 4GVLA 3WIDA 3IUSA 8LDHA 5A03A 4PGFA 1MB4A 2I3GA 4GLLA 2NLOA 3ZI0A 1SEVA 2YDXA 2QQ5A 1ISFA 4Q3CA 5AOVA 1SB9A 1T26A 2OBYA 4R4JA 1YKFA 2X0NA 4B4WA 2OHXA 2VYVA 3V2HA 4A0SA 4RJTA 3PZBA 1W8DA 1UDCA 4RVFA 4K28A 4MO2A 4XDYA 4JK3A 3VPSA 1I2ZA 1I24A 1RM0A 4OO3A 3ANMA 4EUFA 3A28A 3DZHA 1C1XA 3DOJA 3H7AA 3KVOA 1W73A 2EKQA 2BGMA 3I6IA 4PRLA 2HMWA 1HT0A 1HE3A 2EEZA 4Q3NA 2GERA 4WJZA 3WGYA 4YEDA 3EW7A 1I33A 5I7SA 4BMNA 4GMGA 4MVJG 4JXKA 2GF2A 4CMHA 1P1HA 3ZW9A 4CV1A 2EJWA 5JDCC 2NM0A 1ZK2A 4W9NC 1UZNA 1LSOA 1KC1A 4NFSA 3WLEA 4L4XA 5T6BA 5B4TA 1HLDA 2UYYA 1AXGA 4Q3BA 5TT1A 2Y93A 1VM6A 2ILTA 4RPHA 5U9CA 4CMCA 1TEHA 5AQ1A 3F6YA 2NVWA 3NUGA 4J1NA 4ZJUA 3RUIA 4KUGA 4NU5A 3PVZA 1MG0A 3HADA 3OHSX 1BHSA 2E49A 4JBIA 1EVIA 3M2PA 1XR3A 5G0UA 1RM4A 1T1RA 2PKQO 3DTYA 1FF9A 3IKVA 1JKIA 3ONDA 1E3LA 4TRMA 3HQ4O 3GH3A 2GZ2A 3FNEA 1KBZA 1LUAA 3PIDA 2P2SA 3MJ4A 3PHHA 4AG3A 5IG2A 3DBRB 5TS3A 1H93A 3LZ6A 1PQWA 1M76A 3CPSA 4BOYA 1ZZEA 4WNCA 4E30A 3GT0A 4KUHA 1LC0A 1ONPA 1WDLA 5ILGA 2PZLA 3ZU4A 1B14A 1G6KA 2JJYA 1G0OA 1H94A 2A35A 4BB6A 1NPYA 1O89A 1UXKA 3NT5A 2A4KA 3AW9A 5F5LA 4CMIB 3NYWA 4Y6RA 3GHYA 2C2YA 2HJSA 2VZ8A 1ENPA 1NNUA 1VE9A 4LGVA 2V6BA 4LMRA 5JW6A 5JDIA 3FR8A 4UVHA 3K9QO 3QWBA 4IJUA 1K0UA 4UVEA 3SC4A 4E2XA 4DGSA 4WLFA 4DPMA 2X9VA 1ULUA 3FD8A 4J7XA 2YY7A 3E1KA 3RUAA 3CE6A 4RL6A 1UJMA 3WICA 4OOFA 2DKNA 4KQXA 3C3XA 3UVEA 4XQGA 4EGFA 3DBHA 4J1TA 4MPDA 4Y9DA 1SOVA 2BI7A 4PIVA 3NDRA 2NVUA 4M8SA 3BMOA 2NTJA 3HZZA 3PQDA 5JMPA 1DAOA 2Q2VA 4XRGA 5EMHA 3WJ7A 1DLIA 3RBVA 3ZWPA 3KB6A 3H3FA 2VQ3A 5FF9A 4GLOA 1E7SA 3DXFA 3GN1A 4UVDA 1ZFNA 1C1DB 1QV7A 1YBAA 1O0SA 4K6CA 1JDJA 2WWRA 3K92A 3HDYA 4M49A 2GN4A 1YRLA 4GGPA 2EJVA 4O63O 4BHTA 1PU2A 3WR5A 1KVUA 4NBVA 3JQGA 5KTKA 2I67A 2ZB8A 4FGSA 4GX5A 4MKRA 1KEPA 4RF4A 2E37A 2X0RA 1BW9B 3JYLA 2DUWA 4FBGA 2Z5LA 3TPCA 4BVAA 4DTIA 2H5LA 1X0VA 4R5HA 3VH1A 1Y9EA 1YQGA 1H9BA 4YCAA 1EBUA 5G0VA 3EDMA 3WSWA 2Q50A 1R0LA 4ID9A 1PGPA 5L3ZA 3UICA 1GPJA 1NR1A 1KEUA 3GNQA 2FPGA 2G5CA 3B6ZA 4II3A 4BNVA 3A1NA 5L7WA 1CJCA 3VPXA 4I5FA 4BGVA 1GUYA 3H5AA 4WLUA 2ZYAA 5G0TA 1ZSNA 3ZU5A 4CR6A 3ONFA 4EITA 3WNQA 4LRTB 3PRJA 3VKVA 1Q0HA 3BMOB 2UAGA 4FW8A 4NMHA 2D0IA 3ZWYA 4NFHA 4PCVA 1LDNA 3PYXA 2QYTA 3CXRA 3GPDG 1E3EA 1FDSA 4UEKA 2HKIA 2FZWA 3AM5A 4OH1A 3I9KA 2B37A 4R41A 3E9QA 4BGUA 4J1QA 1QG6A 4I8XA 1UP6A 4FS3A 3W4KA 2VOEA 1LLDA 3ZV4A 2A94A 3I4FA 1J0XO 1HRDA 1VSVA 4DYVA 1E92A 1R66A 1D8AA 2P68A 2O48X 4YAJA 5FI5A 2VN8A 3ZWBA 2VHVA 3DWFA 3WBBA 4Z0HO 1UXHA 4IMRA 1KY4A 3IKTA 1A72A 3RCBA 1DXYA 3L4BA 4GI2A 4AJJA 5HS6A 1MXHA 1SC6A 1U8FO 1E7RA 1HWYA 1P1RA 3GC6A 1GEGA 2AA3A 3I9LA 4BNYA 2WE8A 3ROQA 5CFZA 5TNXA 4JX8A 1JTVA 2P4HX 1U4SA 1ZJZA 4U5QA 3L6OO 4OMUA 4ZQEA 4ONEA 4BNLA 3UCXA 4N54A 5FYDA 5I7FA 3QWFA 2B0JA 3TOXA 4ZA2A 5JCJA 2NVUB 3UHAA 2CY0A 1NFQA 2WDZA 1LX6A 1GZ4A 1CYDA 4AJ1A 4DVJA 4JJFA 3VVCA 3D1LA 4MIEA 5CEEA 2JHGA 3X2EA 4ALIA 1NFRA 1EUDA 2IRWA 3EVNA 1UR5A 2PKQP 3TFQA 2QZ9A 3KYDB 4B3HA 2PNFA 5L7YA 1I2CA 1FDVA 3MOIA 2FR8A 2I5PO 2PA3A 4TVBA 2VZ0A 3GFBA 3TZHA 2EG9A 4KDEA 3NEPX 4RDHA 5JMWA 1PL7A 3ON5A 3UUWA 3BAZA 4JN6B 1NM5A 3RUHA 5KVVA 4IJWA 3ETGA 1Y5MA 2BRUA 4R3WA 2RBEA 3T7CA 1YGYA 1MXFA 3E48A 4J0FA 3RQSA 2C5EA 2VUTA 4PG6A 4YT2A 3BMCB 3U9LA 4NQZA 1NASA 4A26A 4AJOA 4AVYA 1U9JA 4UUNA 4TROA 3RBXA 4TRRA 4Z9XA 1ZK4A 4OSPA 3RUCA 1LNQA 1YJ8A 1BRMA 3MJEA 3MOGA 3RKUA 1N7GA 1BTOA 2JCYA 2ZKLA 2CFCA 1ZEJA 1PJTA 2NQ8A 2QHXA 3OSUA 1PJSA 3QWIA 4UAGA 4UVIA 5ILOA 1HETA 1X7HA 5JYDA 1FDUA 1ADBA 1NXQA 3GUYA 5GZ1A 1Q0LA 4D3FA 1WWKA 2JD2A 3N58A 1EE9A 1E6WA 3JD4A 2ZTMA 2G1UA 3QIVA 3IUPA 5LDHA 4RPKA 2Y67A 2VWGA 4XQ9A 1BSVA 1DHRA 1HDZA 5CPBA 1WAMA 2UUOA 2PR2A 1NTOA 1HDRA 2Q1UA 3L6EA 1A27A 4CLXA 3HSKA 1IZ0A 1LDYA 1QR6A 5A9SB 1B16A 1X15A 1PWXA 1M2WA 1UZLA 2D2IA 3OQ1A 3KZVA 2ZYGA 3JYOA 1I3LA 2CZCA 1WZIA 2V65A 1KY5A 2QIOA 3PGJA 1U2DA 2WTBA 2X5KO 4RORA 4QO8A 2X22A 4KQWA 3ZDFA 1PS0A 2NUAA 3WDSA 1I8TA 1PQPA 4WLEA 1BDBA 3D0OA 4BO8A 1C1XB 4J7UA 2C5AA 2YQ5A 3GEMA 3GY0A 3TL2A 5HWSA 5G0WA 3AU8A 4PLWA 3L4SO 1U4OA 4I1IA 1JKFA 3ETEA 3T4XA 3Q2IA 3TN7A 1DEHA 3IAHA 1N7HA 1JW9B 1HE2A 2V6MA 2CVZA 4GSKA 4B7XA 3WFIA 5KWEA 4CM1A 3RC9A 3RI3A 3K2EA 2NTNA 2Q99A 1QKIA 4EDFA 1LA2A 3BA1A 3H2ZA 4XX0A 1VJ0A 4CR8A 2HLPA 3D3EA 3AI2A 1A71A 4Z9YA 4LSMA 1E1NA 1Q2XA 2LDBA 4AJEA 1BMDA 4BGEA 3H3JA 1L7EA 1LI4A 2VT2A 2UUPA 3NGLA 1C3VA 2C54A 4IXWA 5TJ9A 3D3WB 3SLKA 4CODB 3RJ5A 3ZV6A 1X0XA 4FGWA 3D4PA 3F5SA 2XPCA 1QYXA 3DC2A 4CM8A 3C24A 4RO0A 3DMYA 2VWHA 2O3SA 3ORFA 1N1GA 1UDAA 2I6TA 3KEQA 1NHWA 3N74A 4WEQA 3WMWA 3SBOA 2V6GA 4R69A 1QP8A 3RUFA 3C8MA 1VPDA 4LISA 3WMXA 4B4UA 5JCXA 4GKBA 4EEZA 3OJOA 2IXBA 1KERA 4ZVVA 4EZBA 1WXDA 3BXXA 1JVBA 1F12A 3F47A 1D1TA 4W7HA 4M86A 4YJFB 5IN4A 4P4NA 3JQCA 5THQA 4E5NA 2JKVA 4TKMA 3WX0A 5G4LA 5CDTA 1I01A 1NAIA 3PYMA 2YJZA 4L4RA 1NWHA 1M6WA 1BGVA 1IE3A 3VZPA 5CDYA 4XIJA 1QMGA 1GADO 3M1LA 1PZGA 1EK6A 3GGGA 1CRWG 3VC7A 3FCOA 2O4UX 3PK0A 3AY3A 4D45A 4TZTA 2FWMX 2NTVA 3GG2A 4GGOA 4JLWA 5JAMA 1B8UA 4CM8B 4IDBA 4RVUA 5ER9A 1XWFA 1QYVA 1K6XA 3GUCA 2F00A 3RJ9A 4YRAA 4JGBA 4KDFA 4MKZA 4XZ3A 3W8DA 2X0IA 2Q1WA 3TZKA 2Y1GA 4DPKA 4F6LA 3TFOA 1MUUA 5HTOA 4DLLA 1D3AA 3NRCA 1TT7A 5IDXA 1DC4A 5GZ6A 1HYEA 3ZWXA 2PFGA 1E7WA 4JBGA 3NX4A 2Q2WA 4DXHA 3B20A 4LN1A 5DN9A 4XYBA 4I5DA 1VSUA 4U8GA 4IDEA 2AXQA 3WGOA 3QP9A 2NADA 3ADOA 4MJLA 5BT9A 1XG5A 3JQ8A 3U4HA 5KKCA 1B2LA 2PGDA 4YBZA 1WMAA 5LC1A 3DBVO 2DFVA 5JDIC 3OJLA 1P1IA 1H0KA 2WD7B 3RC7A 4MVJF 3WGTA 5G0SA 3OA0A 4JP3A 3ENKA 3Q6IA 1P33A 4RF3A 1YE3A 1QSGA 3LU1A 1U3VA 2I65A 4DRYA 1DHTA 3PHLA 3WOHA 2Y0EA 4IJKA 2EW8A 4GBJA 1HLPA 4TRNA 2DPGA 1VKNA 4E5KA 4BMSA 3GR6A 4GQAA 2GGSA 3D4OA 4AJHA 2P5YA 4NBWA 3AOGA 1ISIA 1VKOA 5DP2A 4HP8A 1GQYA 1PJBA 3BZUA 4NBTA 3DOCA 1JLLA 5JY1A 4L8VA 1LDMA 4UVGA 4XR4A 5TIIA 2E48A 1OAAA 4CMGA 3RROA 4CMIA 1WPQA 3MJTA 4TMFA 5IZCA 2BFOA 3PIIA 2X86A 2B83A 3BHMA 2D5AA 4E2ZA 1DO8A 3TWOA 1R6DA 2Q3EA 2VYND 1RYEA 3PJFA 2AEMA 4WLVA 1NYTA 3FTPA 4UREA 3O9ZA 4L76A 1LRLA 1RPNA 1YB1A 2LDXA 2ZJ0A 4A7PA 4NI5A 2HDHA 3DBRA 3TJRA 4IQGA 5KVSA 2VHYA 5I7EA 4L0QA 4ND1A 1PL6A 5KJEA 4IDAA 4FJ0A 1K89A 1LBEA 2EWMA 3VZRA 4OM8A 3QHAA 3DZIA 4I9HA 1VL8A 3WQSB 2YFQA 1FDTA 5AXAA 1DIGA 1W6UA 2HUNA 3KOUA 3O4RA 3W1VA 3WNVA 1I2BA 3M2TA 1OI7A 3MTGA 3WSVA 4IQ8A 3NKLA 1UDBA 5JDCA 3MCVA 5DZSA 4NJOA 2CDBA 3FI9A 1I3KA 2GN6A 4CPDA 4XEHA 4C7JA 4WLOA 2HCTA 1D7OA 5T8KA 2VTDA 4J91A 4A03A 3QJ5A 3MJVA 4BGIA 1IL0A 1I5RA 4YJDA 2ZQZA 5L4LA 4J7CA 2PKRA 5HRUA 5JO0A 1EQ2A 5F1KA 3Q3CA 1T2FA 3E5MA 1N92A 3LQFA 1GU7A 1E1KA 3HDQA 4I08A 1BXKA 3FF4A 3G1TA 4RF5A 3RC2A 2YUTA 3GZNA 4L74A 4DC1A 1GYPA 3SXPA 3E8XA 1PL8A 2ZB7A 3ZV3A 1R4MB 3HE3A 4Q3DA 2GYYA 3R1IA 3AY6A 1DLJA 1XHLA 1VL6A 1JA9A 1LC3A 1SEPA 2WD7A 3I9JA 5A9RA 1WLYA 4XR9A 4IZIA 2RH4A 1Z7EA 4HFJA 4UUPA 4ND3A 3ROPA 3NV9A 4DYDA 2GR9A 5L95A 1LRKA 2AQHA 3JQ7A 3H9JA 1LDBA 1ADFA 3RKRA 4NPCA 3LDHA 3H4VA 4WEOA 4BKUA
chains in the Genus database with same CATH superfamily
4HQ6A 3LY9A 5SY6A 2ZSDA 1JR3D 2TMKA 3MQ2A 1ZK3A 1BGXT 4L27A 4RKEA 3EWNA 3HKBA 4E1VA 5CYOA 3UWMA 3GG9A 1KAEA 3BH7A 4TPKA 3V8BA 2W2TA 5A5VA 4J43A 1DB3A 4GWGA 3AILA 4IIJF 5IC6A 5J23A 3ZWCA 5BQFA 1S2LA 1FRQA 3ZX4A 1U3UA 2PD4A 2JZOA 3JQBA 1OFUA 3NDIA 2QUKA 2IYTA 2GCEA 4L5IA 3WDMA 3I64A 1EK2A 1YVUA 2W22A 3GARA 2QPAA 1QIJA 2E4UA 1RWPA 1WKBA 5DEOA 3WKBA 4DY6A 4OQQA 2DE0X 1L4YA 4AU1A 1IU9A 3WNCA 1MO5A 2Q9CA 3U09A 1P2VA 2UZAA 1W4LA 5DHAA 3A31A 5I9SA 1ZSVA 2VAWA 2XXJA 5HK8A 4W5WA 3STXA 4A2QA 4DCCA 4E5DA 4B3MB 4YNBA 5FTLA 2LIVA 2QN7A 1SOUA 1UUFA 4UFPA 1UBNA 1FSZA 2J9ZB 5AW6A 4ZOCA 3Q5GA 5A4DA 2G76A 4IUBS 1FU8A 3W6ZA 4URZR 1HE4A 2Y1CA 2ZJZA 2XZPA 4MWSA 1LLQA 1N7IA 3TUJC 1WW3A 2B8JA 4Z9BA 4QX6A 1IYZA 1X1TA 2PMEA 4MVYA 4B40A 4JLPA 4F2HA 1WABA 1UBJS 3PNMA 2WPNA 5E0KB 3L7LA 4IGIA 1QH0A 2PMBA 4RAOA 1SHLA 3C4VA 4RL4A 1XLWA 4U0KA 1P3DA 1TZ2A 3BJIC 3FFBA 5JSUA 1IWPB 2C2ZA 4Q15A 1RI1A 1UBMS 1Z18A 4REOA 1Z7YA 3BRQA 3VHRA 2H1LA 3PBKA 1SGWA 2YYYA 5G1NA 4ENSA 4YUWA 5IHXA 5JWOA 1ZVJA 2KLHA 4JELA 3EAQA 4MRSA 1G3RA 3VR3D 5A5GA 1K4MA 4PRZA 4AIIA 5TVKA 1JIUA 1BWQA 3L06A 3MFQA 1BX1A 4NLLA 4YT8A 2ZUBA 1W76A 4O1HA 5KYKA 4NZYA 2QKYA 3QPCA 4JKIA 4PSDA 4WCFA 4W7IA 1XCLA 2JH3A 2B35A 4BBPA 4XYEA 5AJUA 2YWGA 2CWWA 3V8MA 1U9IA 3ZCUA 3AUYA 1NQUA 2TMGA 2W93A 2GD2A 4OMCA 4HXYA 3ENQA 3DE7X 5E2BA 2WAAA 1R00A 1XTIA 1QUFA 4IEEA 4RHCA 3QJYA 3U17A 2HREA 3T8YA 4BNGA 3HLKA 1R8SA 3JQRA 2C5BA 3KAQA 2WZCA 1YIDA 2CVQA 4F3NA 4RE6A 2C7VA 1IB6A 4FE3A 1IC6A 1T8TA 4ETMA 3L01A 5JFTA 1IQUA 4PZDA 3T1QA 1U11A 3A1WA 2C4NA 1E5VA 2B4QA 1H2RS 3ENZA 3GPBA 4IX1A 1Z8NA 3CBGA 4UNPA 5FJIA 4LFCB 3SYKA 3QYFA 5T57A 2EWWA 4ECAA 1U5CA 4KXMA 2IBSA 1E7QA 3O8DA 2E2WA 3C3EA 1Q3KA 3S1LA 3WYDA 2G9UA 5FUWA 4OHUA 4S24A 1O95C 1I2MA 3JAKA 1ARZA 4HB0A 3ICCA 4BNMA 1VPVA 2HLNA 3PP8A 5I9BA 4D3SA 3EC1A 3ESXA 4BN0A 3ZZ0A 5IM4A 2FW0A 1PEAA 4F45A 1GA6A 4B76A 4CR7A 2ZSUA 3OJEA 1DKOA 2D7JA 3GP5A 5LMNB 1B26A 1R8XA 4E13A 4LVNA 1JKMA 2JVJA 1HXHA 1PFUA 3FM9A 3QYPA 1WCIB 2AX4A 2GYWA 2J1LA 3CMMA 4KE7A 4UBJA 2E5LB 3GFQA 4IDDA 4MINA 3WLLA 2HAEA 3FETA 2X1HA 1VJGA 1MO6A 4D9CA 3IA2A 2BFDB 4BVEA 5JALA 1CY8A 3AI1A 2J5RA 4D7AA 3PTAA 3PCRB 2LD4A 5CFMA 1WXIA 2OBXA 2SKCA 2WWIA 3S99A 3SZUA 4ENVA 1MJ5A 5H3HA 1WW8A 1HRKA 3UFXB 1GAWA 2PMDA 4YASA 3U13A 4XYGA 2VSFA 3C7DB 3CCCA 2W2XA 2H2IA 3K70B 1FNMA 4Z2AA 1AF4A 4O1IA 3H65A 4Q9NA 4M4SA 1GKUB 3VU9A 2HPHA 4PX5A 2OXRA 2IXAA 3LHFA 3IT2A 4O2BA 3UUFA 1HTBA 2GZHA 2C8KA 3D0KA 3TVTA 4AX8A 3GDOA 5TMEA 1SUAA 2F1RA 5DYIA 3CVVA 3ECCA 1R4ZA 5JCJD 3H5OA 4KLCA 4ZI7B 4XVUA 4MR8A 5FRDA 1VI6A 1YFKA 1FTSA 1TK3A 3DLCA 3VTAA 1GG2A 1J99A 3KUDA 1Y9AA 1ZMRA 2IZ5A 2PYZA 4B48A 4CFYA 2VUUA 1XTBA 5IK2D 5IXJA 4YAOA 3KKPA 3F8WA 3I2KA 3NMUF 3GRFA 1HX7A 1O6GA 1NL3A 1ONNA 4QYIB 3AIKA 3EYAA 4HGQA 1M1NB 1TLLA 3MK31 4BLVA 4BO7A 3CWQA 4PWZA 4ZEMA 1Q21A 1ZGZA 2IUYA 3DZCA 2A5JA 2H2GA 1HDCA 1M2FA 5AO9A 4GECA 3PFNA 1EP3B 2J09A 1P45A 3EH2A 3DF7A 4HVTA 2FPGB 1VGQA 2JH9A 2FEOA 4AN1A 2YHAA 4EJSB 4ZTUB 4LMPA 5NULA 1BXZA 3FWPA 4X66B 2PM8A 1MD9A 1ZN8A 4PLYA 3ZXXA 1K7XB 4F4HA 1JFTA 4QPNA 1OLOA 2D1RA 3EIOA 2GQ0A 4R8RA 4MQUA 1W47A 3LPAA 4WXEA 1XWWA 2WMOB 3DVRX 2XWSA 4KQCA 5KTRA 4P4GA 5BSFA 4GOND 2IYXA 4LWQA 2BYTA 1MRSA 2D3TA 3QA9A 4PPQA 4R3NA 4WKNA 4FR2A 4LX0A 5LZ7A 3AP2A 4GXRA 4CTOA 1M7GA 4V0QA 5BV8A 4GI5A 4KR6A 1JL3A 5TQ2A 4MGHA 2ZTVA 4WA8A 1QBGA 1W1IA 4Y2HA 1N6OA 1Z8FA 2GEFA 2I7DA 3FYUC 3NHFA 4FKMA 4AURA 5JNRA 4UAJA 5EXEA 4EY4A 4BZWA 2HCBA 2JJ1D 1BXGB 1K7EB 1SQGA 3BGDA 2XA2A 4JDPA 3PXAA 1R50A 2GTPA 4LDJA 4XSHA 3D8NA 3LC7O 3V4LA 5JZSA 4KBFA 2ODTX 3MYYA 3PFBA 4KWHA 2W2OA 5BSGA 5EZQA 4LF6B 2NXCA 1FP4B 4GPD1 5L7TA 1N2SA 3G0GA 5I47A 4TTVA 1VLVA 4GFDA 1XNQB 3E0QA 4MUBA 4W1QA 3D0RA 3DEIA 5D6NA 3F73A 3WQQA 2JARA 1XDDA 5TGDA 3B2EA 2ZYHA 1NMQA 3BQ9A 4ESVA 4FN4A 4J0GA 1XNRB 3SR0A 2QVCA 1SURA 1FP6A 4JI5B 3AYXB 1UPUA 3NZEA 3O3MB 2B69A 2Y1WA 4O2BB 4Q3KA 3UY4A 4X64B 2N3ZA 3G17A 1Z73A 4X6XA 1ETHA 5HPYB 3AUXA 1J5EB 1Q22A 2E55A 1JQ5A 3DNMA 2JFFA 1KK2A 5LYYA 3P0FA 2PUJA 2OB1A 5AMXA 3QEKA 4YWHA 1EVZA 1THGA 1VA5A 3TQIA 5BNFA 1WX1A 2XMCA 3QF4A 4PYLA 5TRTA 3QVXA 4CCAA 4JITA 3E7FA 1PAUA 3UJDA 2HXGA 5GZ3A 2FZKA 4NE2A 4BFVA 3BRWD 2I6FA 2ZIXA 3AJDA 5C5CA 1S2DA 3UMFA 1QZXA 2DY1A 4LYJA 1JFVA 3VJKA 5LFAA 5EIXA 3MCAA 4ZWNA 2M9MA 3PNOA 1A8UA 4IXMA 1VIYA 4XWYA 1T3ZA 1ORRA 3S1AB 2JH8A 3CW9A 5U1PA 2HU8A 3H9GA 1YC2A 3CR8A 2HCJB 1H85A 1ODCA 2PHZA 2QNBA 2X8JB 4OJNA 3LCMA 4TV8A 2WT4A 1ZD4A 2YWRA 1XZCA 2QTLA 3P97A 4KGVA 2C9ZA 1MRNA 3GLHA 2R1ZA 1XZIA 4XJTA 1I7DA 3E82A 2RH5A 3K9HA 4A2PA 1EFKA 1KQFA 4Z4HA 1E1MA 4NEQA 5GMOA 4M55A 3KVNA 1A04A 1SOAA 4BWFB 2P3OA 1II8B 4WE3A 4C4OA 1UXJA 5KOHB 5EJ5A 4PY2A 4UNNA 5CT8A 3ZN2A 2ETXA 4EHNA 1NN0A 2PX8A 4NCHA 4LJ4A 1L1QA 4M7WA 2ECPA 2P5UA 2CUNA 3NBAA 2XCSB 3O1IC 3UMYA 5JAQA 1TAUA 3KJFA 2D7DA 2FF5A 4MA0A 4ICIA 1RC0A 1XGKA 3GFOA 3O4FA 1L1FA 4BGDA 1NVXQ 4H3KB 1HNXB 5A0TA 2GN9A 4FDTA 4GG1A 2JFHA 4MIYA 5JFOA 1R0ZA 2PSJA 1Z12A 2FV8A 4FMCB 4K6FA 4QPZA 1RI2A 2PL9A 1TTTA 3DNFA 4W5HA 5K99A 4DIUA 1UC5B 4F1KA 4HNGA 1B23P 4X54A 4RTPA 3EE6A 3STVA 2VYNA 3L8DA 4GMDA 1T0PA 1YQ9A 4O4IB 4AECA 3GOHA 4ZT2A 2DF8A 5KC9A 4OA8A 1MOZA 3T38A 1LK7A 4J3FA 3GJXC 3QVVA 3QWHA 2F9FA 2R8BA 2C9MA 1NJ2A 3OIDA 4DBVO 4TL9A 1NX9A 4YJGA 4A8JA 2PV0A 3DW1X 4ON9A 4FCVA 2ZANA 2SHKA 1AGYA 2ON6A 5JSHA 4UM7A 3TX6A 1B6TA 1RWQA 1XCBA 5EHZA 3K70D 2A5YB 3EGWA 4YAFA 1INLA 3UC5A 3OY7A 1VPTA 4Z3OA 4L22A 2R6ZA 1A8SA 2HFJA 1G6Q1 1Z34A 2NV6A 2RK3A 5FLKA 4D9KA 3PUKA 2HMUA 4Z8YA 3FN4A 1EK5A 4MS1A 3MRXA 4GYKA 3CISA 4RD1A 3PXEA 4V03A 4S2UA 4LJ9A 1H8HD 4HNSA 3ST7A 1I4EB 3RPEA 1T35A 2EWVA 1C4XA 2OM6A 3DBLB 1BAPA 4AS3A 3G2IA 1ZIPA 2VH1A 5IBPA 1W36C 1NR5A 3N6XA 2C7QA 4HR7A 10MHA 4P5PA 3N0TA 3N7AA 4LRQA 4O3MA 5LZ5A 4UM9D 1S0UA 1PR5A 3SHVA 4F5DA 5B55A 2WIGA 3V6LA 4H59A 3X0DA 1JWLA 1IY0A 3M9WA 1XN1A 1QG4A 2NO6A 1V7ZA 5FO0A 4KOEC 3P7MA 3EVCA 1PTJC 1CIVA 1C1DA 1AKNA 4UTNA 3WGNA 3L6DA 3IOMA 1LB1B 3ULKA 2Q3HA 3PC7A 4Q82A 4R8MA 4NPAA 2G5TA 1OVMA 2ZRKA 1Z0IA 4CLHA 1A1SA 2RHTA 5B64A 5BNTA 3IAAA 4OB7A 1NRXA 4O4LA 3QXGA 4YDHB 1VDZA 4RZHA 4MV6A 1II0A 1ZD2P 3DXYA 5ALUA 5J4VA 5C3MA 1VKZA 3UAYA 4IIJA 1W4AA 4OCZA 4PRKA 2BH9A 1DBQA 3PZRA 4C87A 3VH3A 1FIUA 2AXNA 1AOXA 4ZOAA 3C2QA 2ERCA 3OEEA 2QV7A 3JAWB 4ZT7A 2FFAA 1UC8A 1H23A 1EWQA 1OC2A 4I55B 2C5GA 3VNVA 4HNRA 4FIDA 2VUIB 4KYUA 4DLUA 1ZDMA 4YALA 4S05A 4OHOA 3CIFA 2WQZA 2R4QA 1BMQA 3A4TA 4K6KA 3I6BA 3RTEA 2BBTA 2VPTA 1G5IA 3DZFA 5PNTA 6ADHA 3GAZA 1T4BA 3IAM6 3Q9UA 4G4SP 1O2DA 4XB1A 1QYCA 1YR1A 3HYLA 2ZBDA 4CG3A 3ZU2A 4KV9A 3C3AA 4BO0A 3LDAA 5IJWA 3RVSA 3UW1A 4B7UA 2LCQA 4RK0A 2JDID 1KEVA 1E1QA 4O08A 2WYHA 4F3YA 1GFIA 3FPKA 1PTKA 5LQAA 1PD1A 3HCCA 1G20E 1W35A 3DZKA 3KFXA 4CDRA 4E5MA 1OH8A 1Z4JA 1QVRA 2Q62A 2D2VA 2VS1A 1A5ZA 2B30A 3AKYA 3N76A 1J1UA 1PV4A 1GHTA 4H7EA 3QM1A 1KJWA 1JEYB 4OQPA 3PL5A 4A9AA 4N0PA 1N2GA 5IRCD 1CD5A 4CKZA 1ZCAA 3FJOA 4HX5A 3CLUD 2O0HA 1TCBA 4QULA 4ZKDA 4PS1A 4TWIA 2V45A 1XEWY 4TLDA 3H8VA 3TLYA 3UT5A 3T9EA 5KMGB 2DTEA 4Z4IA 2CWDA 4W4TA 4YRJA 4C0HA 2WV7A 1J2YA 1X19A 2RH8A 3BFPA 4HYQA 1ZA1A 3TMYA 5JTUA 4WGFA 1EGAA 2P2DA 3IOEA 1R15A 4DRZA 1NVEA 5EKDA 2XOKD 3WYFA 1PWZA 3AUUA 2KM1A 3WP1B 3OOSA 3E9NA 3F9IA 2OLJA 2JCVA 3HCWA 1IG3A 3EH1A 5E4YA 4TS3A 3WGLA 1F14A 2VHWA 2YHUA 4MRPA 2QVXX 3CO0S 1D2CA 1CDOA 3UK0A 3OZRA 3ORQA 2JKZA 3AK4A 6ABPA 1NPDA 2FOLA 2H7YA 3A7EA 3KQNA 3OX1A 3Q7PA 1KJ9A 1UT8A 5DSZA 1QIKA 2IP2A 1RI3A 4M76B 4RZ3A 1E9BA 4TN5A 5TR9A 3OEED 4QBIA 1RWWA 4ZU3A 4Q4CA 3R24A 4INZA 3RFXA 2FZ4A 1AKWA 4MI9A 1AS2A 5FPQA 1W7AA 2XXAB 3HRKA 1RP7A 4XOIA 3U4CA 2HYIC 3WL8A 2GZSA 1EFRD 2R751 4PQFA 3J81A 4OQLA 1AS3A 3K2BA 5FB3A 1YQUA 4NBRA 5DBIA 1SC9A 1M1YA 4NABA 2BCEA 4YQEA 2WZBA 3PXUA 3IR7A 5IJ9B 3AU9A 5IP5A 3OJWA 4KITB 4H1UA 3TZLA 1K8RA 3K9NA 1ZYUA 1V4BA 1YZYA 3USES 4PHGA 4H27A 3OF5A 3LW8A 3H7IA 5ERYA 2ZT8A 2ZRIA 2EL7A 3E23A 5TVGA 5B57C 3HCRA 3QLEA 3RVNA 3PYLA 2QYHA 4TQUS 5JXJA 4G8BA 5K0LA 1B8NA 2OGUA 1FFDA 3MWEB 4BVKA 4CPDA 4EMTA 3BBLA 1FJGB 1GUFA 4D99A 3HB9A 4TL7A 2VSYA 5E7QA 1XHEA 3I2HA 3KBOA 3G5TA 4E1BA 1O8CA 1O54A 1YDFA 1B15A 2Y76A 3FAZA 4MV3A 4TQ9A 3RVLA 4C6SA 4RU1A 1P2GA 4CKYA 2QU7A 4OQXA 4W6QA 4YV2A 3GMDA 3GZJA 3AG5A 1H4QA 4A4DA 5DXFA 1H2HA 3EXFB 3ROTA 3OTOB 4IG9A 4K3VA 5BSHA 1D8TA 3G7UA 3KPVA 1E60A 5AD1A 1NV8A 5JSFA 4KGXA 1CR6A 4OUKX 5CR9A 5IT9A 3GEHA 2VNSA 1M2OA 2DBZA 2P1DA 4QNNA 3ZEIA 1T1JA 4MZXA 3ZXUB 4WVFA 5DSTA 3WLKX 5IT5A 3DT8A 1DIBA 3TUIC 1SXJC 4V0ME 1M6NA 2YJTD 3GJTA 4ITUA 4R7ZA 4PPNA 3A9UA 1UDRA 2PIAA 3G8AA 3IQXA 1F2UA 2HRZA 3GN2A 4W8GA 3E9ZA 4X1IB 1QTIA 4RC9A 1RYFA 3HG7A 3WKAA 4G1MB 4DC0A 1ISSA 1XCPA 4EYGA 5AVTA 2IE0A 3PNSA 4H3HB 1FPMA 4CQMA 4QARA 5B1EA 1GAQA 3WIOA 3VAZA 1QFMA 1K06A 3MWKA 3IYLW 2J5KA 3L1KA 1PJ4A 2JBHA 2QV0A 1QJ4A 2OHHA 4RPCA 1Z2NX 4EHBA 3SJUA 4X1KA 1UEJA 3LF1A 4FYJA 5HQTA 4IIDA 1H5QA 1Z2DA 4K6MA 2W0MA 1ZINA 3DMTC 3O1JC 4PXYA 2OCPA 3ZWKA 4BTLA 1ND6A 1SVMA 3LDFA 3CIOA 1KH3A 3JQAB 2DLNA 1H2FA 2WJPA 1EU1A 3ZGVA 1HYGA 4JEUA 1RLOA 2WEKA 4BMDA 2HC9A 1SQ5A 3E2PA 2YWDA 4G9EA 4X6UA 5E9JA 3QF7A 4RIGA 5EKXA 4BVGA 1OH7A 3WB1A 3BXEA 2FPSA 2YXBA 1ISHA 5FOUA 3G2NA 2GLTA 2ZAGA 5D1HA 4BE7B 5AUPB 1C3XA 1QF7A 3OTGA 3SVZA 3HKEB 3A9CA 3FUWA 2JBWA 2FHSA 3ZHBA 16PKA 3D8TA 1ZNZA 4YA6A 2VO1A 3EFOB 4J2TA 1CC1S 1UXOA 4HFNA 1I7QB 1W6RA 3RHFA 3LA8A 2M1ZA 3ZWVA 3KC2A 1LRJA 1ZIDA 4MKFA 3SSOA 1SK9A 1ECCA 3EK2A 2KQUA 3A6ZA 3OICA 4RADA 1U8YA 1CUDA 5H81A 1XA3A 2H4ZA 1ZU5A 3H9EO 4TL8A 4G37A 2HJRA 4NE9A 3TBFA 3IMGA 5D00A 4C9BA 2PPLA 4JOQA 5CFPA 1JNYA 2BL4A 3LE8A 5ESRA 2J6IA 3BIXA 3M9XA 4BO2A 1C8VB 1L1EA 4R54A 2XUAA 3TW8A 3W5DA 4QDTA 3KWLA 4H7JA 1R6VA 3EZYA 3L18A 5I8WA 2HOQA 1BDMA 4L16A 3MINB 4OP2A 4X7BA 4DQDA 4BNXA 1DKMA 3D5QA 3KDSE 3AB8A 3E9EA 4X1YA 2EZ8A 1AKMA 4EGQA 4LCEA 4PO1A 4QXAA 3QUSA 2QS9A 2GZDA 2FZLA 4IXTA 3W6UA 4K9OA 4Q1VA 3SYNA 4WXHA 5TJHA 4PGMA 1ZMOA 3PI6A 4IHAA 1KFJB 2LE0A 4JC8A 4OI2A 4FJ1A 1C2TA 1YTLA 3T9FA 3ILSA 4V2UA 3ZBUA 1DJLA 3M7IA 1P1FA 1ZGCA 4HH4A 5FULA 4IQFA 3BIJA 3A1UA 2QA5A 3GLRA 3ZQKA 4DTCA 1B3BA 4I6JA 1C9JA 1PUXA 1FYFA 3BFVA 3KLBA 4IKEA 5LR6A 3D8RA 1RQ7A 3IAUA 4PW0A 3T3NA 1E1QD 3T5PA 4OXIA 5EP1A 2VCYA 4L75A 3LCUA 1V1MA 5JD3A 3TOVA 1F1BA 3LYUA 4Y67A 5EKTA 3V2UA 5SY9A 1JHUA 2GN2A 4YCSA 3A3OA 3ZH2A 1OLSA 1Q83A 5LQKA 2ZZNA 1TOAA 1J6UA 4ZT6A 5IT4A 3WWYA 1U3CA 1YK0A 2BLNA 1WMDA 2OV4A 4GX2A 5JU6A 3PVSA 2QM8A 1LLUA 2FZCA 3NWJA 4HY3A 4Z9AA 2XYHA 1HQKA 3QXCA 3VNBA 3B3JA 3LRTA 4NKRA 1NNLA 2G28A 1RAHA 4C21A 5G40A 3PHBE 1GTMA 2BGGA 2XT6A 1Y8QA 5EYPA 1JJIA 2G9VA 2WFLA 4KQ9A 2FFHA 4LXTA 2VJQA 1M33A 3A9VA 4NDZA 2A1TS 4KR9A 4PYKA 5BSMA 1HYBA 3Q3HA 2QTVA 4LV6A 3U5TA 4C7OA 1B6GA 2O8CB 3OM9A 2VAMA 1IEWA 4UUQA 2WSBA 3NIBA 2QOEA 3L8EA 1XROA 1SBHA 1X7YA 3MAJA 4UXIA 1G17A 4HOYA 5JLAA 3C7CB 3SR3A 3V48A 1R5OA 3RTDA 3T4PA 2PH3A 5MN5A 2RHRA 4FZRA 4RKFA 1OXMA 2HL6A 1NJ1A 3H18A 4WY8A 3FBWA 1Y8AA 3R9IA 4AS1A 3IDZA 2PJRA 1SCJA 4UAVA 4UM5A 1XYVA 2WFAA 3NBZC 2CLSA 4FX5A 4TT8A 2JA2A 1Z47A 4HKTA 2RGCA 2VP2A 1URPA 3AUTA 4ZCTA 4RFLA 4JB3A 3LZDA 1QDEA 2E21A 1CG6A 2ZAYA 3IJPA 3K16A 1BOOA 3NONA 4JT4A 1JLRA 1JWBB 1YB5A 3FMIA 3PU6A 4PYOA 2B8WA 2H1CA 5EIWA 4B6SA 2MT9A 3N2YA 4O4HA 4BP3A 1EG2A 2P9EA 4FLEA 4HTAA 2H1RA 2VA8A 3A2MA 3E3LA 1WXWA 3EZNA 3NEYA 4MWTA 4WACA 4CUZA 1Y5NA 3PHGA 3FNFA 1P2BA 1RYHA 2A5LA 2XHEA 3M9LA 3R0IA 5DNEA 3PC6A 3QE0A 4CLEA 1PFGA 1YHZA 1QRRA 1Q1BA 2PT7A 3LUJA 5D3QA 4AC9A 5KOHA 4BMOB 3FUVA 3QG1A 2QDXA 3F8TA 2O7NA 2CN1A 5AUQA 2XD9A 1FYEA 1EAMA 1GKLA 4LE0A 3H16A 1OXSC 5DI3B 3PPXA 3MZ0A 1D6MA 2Y9PB 4C4XA 1I6MA 1TZKA 1Q7CA 2CNBA 4MHOA 1GV0A 1PT9A 3AHHA 3CJQA 1JF8A 4RKYA 1QFZA 4XQ0A 3SS7X 3U7FB 5ADHA 2FSSA 3A11A 1K9SA 2I1QA 3D02A 3T12A 4D4MA 1KI7A 4OLFA 4XSGA 2VG8A 4QDUA 2DVMA 1ILWA 3JYHA 2J48A 2RB4A 3JZDA 5DWQA 3BRCA 4B17A 2D8AA 1GL6A 5F2OA 3FZEA 4CM7A 1ZI6A 4YBRA 3HN7A 4BFWA 3AR4A 4JEMA 1USUA 2O0JA 3A27A 1KHHA 4MHSA 1OKKD 1NOIA 1EXWA 2EF1A 4HAOA 1WLSA 2JD1A 4GPIB 4AZ3B 4YAUA 1OBFO 1OSNA 3W9BA 1KI3A 1GOTA 2OHOA 3IBGA 1M5RA 1WPXA 5JO9A 5JIBA 2JFQA 1UZAA 2GZ1A 4MV9A 4M83A 4URHA 1UANA 4BFSA 4RHUA 3T1YB 4G4JA 1Z7BA 1VYVA 2ZATA 5T64A 2I22A 3O47A 4C20A 1HZZC 4TZKA 5K9ZA 1ZITA 1UBCA 2W43A 4L73A 4WCFC 1SVWA 2NQ2C 2WKPA 3PLNA 3I72A 4MIOA 5EJ7A 5H5JA 2ZIZA 1EHYA 1JIJA 2BHSA 2HNKA 1HTTA 2FZEA 3KYCA 4INPA 5SYMA 4AJ9A 5A6VA 4QG3A 4CIWA 4LX8A 4DR4B 1OB2A 2FQXA 2VHJA 1P17A 1OT3A 3LT1A 4J75A 2OMEA 4Q3LA 1XMQB 1WUHS 3R3YA 1KRXA 2AEEA 3NOOA 3AXTA 3CJRA 3HBMA 4TKVB 3D7MA 4Z53A 2OESA 4KPYA 3HY4A 3G9UA 2YZ2A 1GCOA 2HIMA 1HY3A 3TF5A 1QK3A 1T9ZA 3CLRD 5AUNB 5LKRA 2P9FA 2DYKA 4GOXA 2HZBA 2OFWA 5CCXA 2HF9A 4JJIA 4NBSA 3JALA 1OC4A 1YQWA 3AGPA 2BM9A 2F1KA 3TINA 3UXEA 3WYCA 3ZD8A 5JCPA 3SC6A 2JAOA 1ZGBA 2YX1A 3OT4A 3Q3VA 4OXNA 3WS7A 3ZHOA 2Q5LA 1M34B 1FRFS 3BK7A 3GLQA 4F4JA 1F17A 1MCZA 4JP8A 3MQ4A 5LL6P 1TD9A 4DIOA 1DIRA 4INOA 1P75A 1XRJA 1T25A 1NATA 5ITWA 2CK3D 4I7EA 4C29A 3SHTA 1GYQA 3QVWA 3NIDB 5CA1A 2AUNA 1P4RA 3RM3A 3L7IA 1MFPA 1WHTA 3K4QA 2I4IA 3U37A 1C0IA 1KRHA 1GRQA 2GUWA 1PJLA 2Y1FA 4EUSA 3U6BA 4H3VA 4QLOA 4R9SA 1QU2A 1E3MA 1P9NA 1BH2A 1F9AA 2ZU6A 3N7UA 1H6DA 5EWJA 2PNJA 3TQOA 5JZ9A 2HHHB 2D59A 4IM7A 4MQBA 2WWFA 4HDMB 5D5PA 3TD6A 3MLBA 3AOEA 2X9GA 1BDJA 2VQDA 3PD1A 1QRTA 1N34B 1GD1O 5K51A 1UKYA 1PR3A 2BV3A 1S3GA 2WU0A 5D5HA 1QH8A 1FQWA 3COWA 1UWVA 2Y92A 3EISA 1PGJA 4DZTA 3WLMA 5F23A 2ABWA 3C48A 2CUZA 5FD8A 3EQ2A 3EBPA 1Z37A 3R9KA 3GLVA 2Q49A 3DZBA 4EL0A 1E6UA 3IEIA 1E7YA 1EHCA 2FEAA 2JI9A 2IITA 2Y68A 2ECKA 3D4BA 4PV7A 1B2RA 1OIXA 3QPDA 4ZZ2A 3L79A 4DUYB 4JSYA 4NMXB 5AI5A 5KHAA 3B6KA 3F3KA 2WUFA 1J8QA 1TAGA 4UHEA 1R0YA 5A2GA 1UAYA 2Q1XA 4AMBA 5A02A 3UG6A 4GICA 2YC2C 4MAFA 2V8OA 3P2KA 2VTBB 2P78A 3CKMA 3EZ9A 1T9BA 3AFOA 1XB2A 2IXFA 3OLZA 1ESNA 4QQRA 2CXQA 1ZXXA 4L5CA 2MR6A 4ZQBA 3JWIA 2D13A 1TA0A 1GJRA 4C3OB 2J0VA 2BGNA 1DC6A 3WFJA 4D0RA 2HQ1A 1E2LA 1T6YA 3OOYA 3GT7A 4G9BA 4L8YA 4A2CA 2GM4A 1AH2A 1BE8A 1NUQA 4EEKA 3CCFA 2FW8A 5BOSB 1PV2A 1K6EA 1D4AA 2PBLA 3QX8A 3IP7A 3HHEA 3RRZA 4DREA 1AMUA 2JLWA 1UEXC 1NJGA 3KLPX 3WYNA 3ZI4A 5AQEA 3R40A 5EZYF 3TXAA 1P72A 1JR4A 2WDPA 4OYRA 2F9MA 1XXHA 3PWZA 4X20B 2QR2A 1Z5VA 1W4RA 4D44A 5KINB 4GX1A 4Q4DA 1IATA 4IGEA 3S0JA 4EUKA 3D6NB 1DC8A 1TQ6A 3LQYA 1LJ8A 3G5MA 3MXOA 1DC5A 4Q9HA 4A91A 4PGGA 3ZD6A 2OKCA 4Y0VA 1L5GB 3KPUA 1VL1A 4DA0A 1Z9BA 5KMGA 3ZHZA 1QG0A 2OZKA 3EG9A 4W7SA 1BHJA 4L28A 4RJJA 3ZCXA 1VMIA 2XB6A 2RHBA 3RVQA 5IYZB 3UBTA 4M7RA 5AOAA 2WLTA 3QEMB 3CNOA 4OB6A 2QT9A 2HUPA 3CY6A 4EG0A 2JI4A 2J3MA 2LGJA 1XZAA 2BR4A 5B5SA 2JAHA 3JD1A 5HFNA 2ZIVB 3SM3A 2OHJA 3N2GA 3VU0A 1YHNA 2QX7A 2QTCA 4J0CA 1ZIYA 4RMJA 5AFSA 1EYZA 3MGKA 1JDZA 4AXBA 4WKBA 2A92A 1XU7A 1VB3A 2ZRBA 1IEXA 2ZVPX 4URFA 3OJ0A 3PHIA 4IMIB 3UC9A 3DEAA 4JBXA 4PBTA 3ORSA 4HL6A 1JXQA 4P33A 1MX3A 4FDVA 1L5NA 2DM6A 3EXAA 1G3UA 2ZB3A 3QOFA 2CF5A 3RS8A 4UAUA 4KQFA 4Z0PA 3V7FA 3HK2A 4TWRA 1BX0A 3LGSA 1GQQA 1VIVA 2WF5A 2WWTA 4Y6SA 3SC3A 4ISBA 5FWDA 1X9IA 1L8QA 1Y81A 1RW4A 3BFXA 4C01A 2QZPA 3DTNA 1IZZA 2FKAA 4F56A 1O0BA 1GZVA 2OZVA 3QBEA 3QSGA 3AEQB 2Z3ZA 2CMHA 4IDEA 2DULA 3OO0A 1KWGA 5CG2A 3UN1A 2P3SA 5L3QB 4L15A 3FMVA 1DJNA 4H3SA 4D6PA 4FINA 3FLAA 1H8ED 1P77A 1PVVA 4MGZR 3VV3A 3VYVA 1V11B 4JNKA 3JTMA 4W5RA 1BYUA 1E2UA 1H69A 1PWEA 2IBMA 2OO7A 3DKRA 3EVTA 4UTOA 1PCXA 3WBKA 2FAXA 1JHAA 3K0HA 3GRYA 1XD9A 2H00A 3JVUA 1QH8B 4M9UA 1Z0JA 4H1HA 3C87A 3RF7A 1KMHA 4WOKA 2G71A 3CEHA 3A6EA 4EPVA 4F2DA 3ZDAA 4QEDA 1D9ZA 1X1EA 4FUTA 4YJGB 4U7HA 1AY0A 2NU8A 3LGAA 2XNJA 5GGYA 1T5OA 3OE4A 4N5HX 1RRKA 3B60A 3GAFA 5JY6A 2Q2QA 2JFUA 3V4FA 1DGQA 1VZ2A 1XTUA 2R1TB 2CUTA 1G2PA 2D5LA 1X7ZB 4UXHA 4K46A 4HEJA 1ENZA 1ATZA 4R84A 1G59A 3ZDCA 1QLHA 4C4ZA 2AWNA 4LZOA 1P7CA 4H15A 1Q84A 1ZICA 2DHCA 4P3XA 3UK6A 3OZGA 5FDFA 5JJLA 3VVBA 2AR9A 3E9MA 1P1KA 3DGEC 2QL9A 4GXQA 4BXOA 4L4SA 4C43A 1JG1A 1KARA 1ZGAA 5T4BA 4MJ7A 3D7SA 4F9GA 5KOIA 1LQTA 2RIRA 4ZV9A 3RUEA 4TV8F 1BDHA 4EMUA 1C50A 4XGKA 1R6UA 3HA5A 5HMMA 1U2ZA 4G0MA 4YO7A 2PJUA 3TXYA 3D0QA 4YR7A 2QP4A 5HA5A 4I2NA 5JPCA 3IEXA 2Q07A 2WR8A 2O2ZA 2BFPA 3GFSA 1V35A 3KUKA 1FMLA 2JJQA 1A8IA 1YFJA 4WBNB 1R4MA 3AR7A 3SIRA 3T7DA 1N5IA 1BIFA 2JRLA 3TO5A 3HB5X 4CFSA 4NYMQ 4B3FX 3SQWA 1S9HA 1P44A 1O3YA 2YFYA 3HCBA 3U49A 2VJOA 1Z74A 4FYXA 3R8XA 1M0WA 1FTNA 1PJQA 1X6VA 2HMVA 3DO5A 1FJXA 5ENDA 1P62B 3CSUA 3K0BA 3A7DA 5KZMB 3E4CA 1G9XA 2VNAA 4L6CA 4A0RA 2KBEA 4BJ6A 3ZWNA 4B85A 2XGSA 4MS3A 4U9UA 4UDYX 5T3UA 2XYRA 5EY5B 4HVAA 3L41A 2X0EA 3WWPA 4X7RA 3WWZA 2BUCA 1H22A 4J94A 4Z8XA 1O57A 5FNVF 4D46A 3NM5A 3OM1A 3E6AA 3E0XA 4JL8A 4YC7A 2IZZA 3ZDEA 5EIHA 3WGZA 1NC3A 4PX9A 1DJQA 2Y1EA 3CSSA 1QXSA 4TZ6A 3AB3A 4LJ5A 3MPUA 4XKJA 3PFWO 1V3VA 3O9MA 1AGRA 4BFZA 1MDBA 4PG4A 4NF2A 1J9GA 1DAHA 1JLMA 2GSDA 1Z5WA 3KSZO 1YQXA 1MB2A 3FPEA 5IAKA 1TJ5A 3RRNA 3E70C 4X3CA 5HM8A 2C96A 2R6R1 3QTTA 3TLMA 4AKHA 3FPSA 2OG1A 2JAUA 2UKDA 3VAAA 3OCCA 5D3KA 5F21A 3UMJA 5BUSA 1X9HA 2HPAA 2PX3A 1L5HB 3DB2A 1JR3A 4B0PA 4PRYA 5K8IA 1RP1A 1REQB 3C74A 2HT6A 3N8GA 3BM5A 1N2ZA 1Y6ZA 3QEOA 4XCVA 1NIPA 2GK7A 4QECA 4C1NA 3TSAA 2JC3A 3FCYA 3SQMA 2Q6TA 3PFCA 4ZICA 4M1SA 3O92A 4F2WA 4BY9E 5AXCA 4OL9A 3LX5A 4QFMA 5F9HA 2AZTA 2BN4A 1E2PA 3BSSA 4O4JB 4UHFA 4HZGA 4EYOA 3P2EA 3VBEA 2R6CA 2NU8B 4NCAA 1T8YA 1YJBA 2DHDA 3EXG1 3URKA 5CFNA 2XCLA 1EFPA 2NZVG 4Z0TA 2XEXA 1CU1A 3HWRA 3UT5B 2F59A 4DNPA 1KVQA 3T94A 4OUDA 1GGNA 2X5JO 2YWJA 4OAQA 4AM8A 4EYEA 2JLSA 4QOSA 5CFOA 4MWOA 2ZQ5A 3HVKA 4WKGA 5ALSA 8OHMA 5HJ5A 4B3TB 1JEDA 3H0CA 3HJBA 2XE8A 3EQ7A 1UCFA 4TKLA 2XR1A 2VP6A 4F12A 5JAUA 2FG5A 5EXXA 3DT6A 1EP9A 2NO1A 4OQEA 4JUBA 3O1HB 4TXNA 4XPZA 2DCMA 4D0LB 5IZ4A 2FWAA 1SCNE 1M1YE 4NPHA 2ZPTX 2IFTA 3BMQB 5F52A 5FA5A 2WKWA 2C8VA 4TLBA 1GTJ1 4COKA 5CB0A 2G0NA 3LBIA 1TMGE 1U2SA 4GR5A 4HUQB 5K6AC 1A5AB 3D7KA 3WLSA 1Z0ZA 2LBPA 1FXWA 1NDQA 2AC7A 4BNJA 4DSTA 3M6VA 2P5SA 4D74A 1SVKA 3IVGA 4XPIB 4EUHA 2VF2A 1XEAA 4MDEA 3O8OB 5EIBD 3OIYA 2PCLA 4JI0B 3V2IA 5K2MA 4MAAA 1E9FA 3EUWA 4DA9A 4Z7JA 3RLFA 1AQIA 2OFPA 3LVBA 4MWBA 2R62A 3ZNNA 3CNBA 4WOJA 3UWOA 4B09A 2MDTA 3AKEA 2AMLA 4EQZA 1PJ3A 1N33B 1ND5A 4E2YA 1WCIA 5IDYA 3S5JA 1T4CB 3OF2A 3TIIA 1E1DA 4HMOA 4AG5A 2D5CA 1Z75A 2NYVA 3DONA 1NMXA 3KT6A 1MTOA 1V16B 3V42A 4H4DA 4DCJA 5JNLA 3I5AA 2BKUA 4BZQA 5KQRA 4LG1A 4ARIA 3JAKB 3VR4A 4TTAA 1YASA 3FKSA 5CRIA 1TD1A 3VYSB 4UOZA 3HCDA 1TO6A 1YK1A 4ZANA 2ZAIA 1F8YA 1ZONA 1VSQA 2ZAOA 3FBGA 4IPTA 5AM2A 4QFCA 1G3QA 1V41E 2CJFA 1X7XA 1CZRA 1XQWA 1LSUA 2QMQA 3DTTA 3LT4A 4UBMA 1B43A 3RG2A 5IAAA 1UBFA 5JT1A 1ZN2A 2A9OA 1OMOA 4IY1A 3UANA 4ZK2A 4WNAB 3PDCA 4EW6A 1BC5A 4H4EA 4PAQA 2Z6UA 1QF6A 5ALFA 1I94B 5DGCA 2B0CA 4DARA 2PD6A 3NBQA 1RKBA 2YQ4A 1O6CA 2Q0SA 2JIQA 4NAUA 2P2YA 3FMGA 1ZM9A 1E3JA 2EKLA 3DVQX 2XUFA 4D4HA 3WNBA 1UKCA 1W93A 2FVYA 3NHMA 4QHYA 3RE1A 3RFCA 1ZD5A 1S7CA 3LP5A 4DCUA 3OHPA 1T0BA 3ITDA 4V1CB 3K35A 1EDBA 1EI9A 4D4KA 1OHHD 3OWXA 4KR0A 2JJ2A 4IJ5A 4LE2A 4P0TA 3RC1A 3U7GA 2BMAA 3BFKA 4D9EA 2VIIA 4JBLA 3BBPA 4K3UA 5GM2A 2PUBA 1V6AA 3KO8A 4CT0A 4KQIA 3ELYA 3NXKA 4MKGA 3AWDA 4CCYA 1GWNA 3CVJA 3O4JA 4MMXB 4X3OA 4RTSA 2ZJ1A 2HYDA 3S2EA 2UZ1A 1VE1A 3MF4A 1GDHA 3MYRA 1D9XA 1AXRA 1EDZA 1GZ6A 4BNHA 4D97A 5CM9C 2OZLB 2E5FA 2GOYA 4XW2A 1NVVQ 4UDXX 3IS3A 1PR4A 2C5HA 3RVJA 2E5WA 4FI3F 1ZD9A 1UP7A 3OMLA 4OVKA 3WFZA 4FVTA 3EJ6A 3IPXA 1A69A 1KVSA 3IDSA 4TKZA 1PK7A 4WSOA 3WJAA 1Y37A 2DWQA 5SZKB 1D2AA 3LA6A 3NR2A 1RQPA 1P0CA