1GTMA

Structure of glutamate dehydrogenase
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
417
structure length
417
Chain Sequence
ADPYEIVIKQLERAAQYMEISEEALEFLKRPQRIVEVTIPVEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGIIVDPKKLSDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISRRKTPAFGIITGKPLSIGGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEVLKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDFLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWVKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE DEHYDROGENASE
publication title The structure of Pyrococcus furiosus glutamate dehydrogenase reveals a key role for ion-pair networks in maintaining enzyme stability at extreme temperatures.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 171
structure length 417
sequence length 417
chains with identical sequence B, C
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 1996-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gtmA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1gtmA01
1G0OA 4Z9FA 4A5OA 1IPEA 2I65A 5AXBA 5BR7A 4Y98A 4YJFA 3GZNB 4YTEA 2Q2WA 1YQDA 1IY8A 2B83A 1PZEA 3OJ0A 4WPGA 5TT1A 1RKXA 3H4VA 1ADBA 2ZB4A 3OA2A 5DOVA 1IUKA 1WW8A 4YT5A 1YVEI 4BOYA 1ZK0A 1HZZA 1ZH8A 3CZRA 2BMAA 4G65A 5IDYA 3SC6A 4E13A 1ZJZA 2PFGA 3GNSA 1AHIA 4XRGA 4R4JA 3U0BA 1QYVA 1UXKA 1IZ9A 1LRLA 4HBGA 2JL1A 4DVJA 3KETA 2YYYA 3DTTA 4Q3EA 1DC5A 3UFXA 4DIBA 3GAFA 1U2GA 5LDGA 1VJ0A 3GC6A 3OJOA 3WXBA 5BNIA 5BSEA 2O3UA 1DRUA 2XAAA 3GT0A 4BO7A 5JY6A 4IXTA 1R4NA 4IDDA 4QFCA 4TKMA 1DHTA 3ZWPA 1NAIA 1N8KA 2VTDA 5TC4A 1CIVA 2RAFA 4CLDA 4XKJA 5TSDA 3WQQA 4D45A 3INTA 3GZNA 4FS3A 2HO5A 3PEFA 2CMDA 1KY5A 4OQYA 1XLTA 4W9NA 3EDMA 1T2EA 4YXFA 4J7XA 4NFHA 4OSPA 2J5QA 4YT2A 4PZCA 1JA9A 1L1FA 4CM1A 5IZCC 3PXXA 2GNAA 1WLYA 4EYEA 1BRMA 1RPNA 2VT2A 3CEAA 3RUEA 5IG2A 3KLMX 2IZ1A 4L4RA 4RVUA 4F46A 1ZXLA 2UAGA 3UUWA 1EE2A 1E0DA 2POQX 4C7JA 3PYMA 4I5DA 5B4UA 3M1LA 1E6EA 1DJNA 2DKNA 4FFMA 4IUYA 5T8KC 4LRSB 4CM6A 5KJFA 4TSKA 4CMEC 2C7VA 3ZU3A 5DCWA 3GK3A 3DB2A 2VYND 1W73A 3EZLA 1JLLA 5L45A 5EESA 4YQZA 4HFRA 1LRJA 3RVDA 5ITVA 5JMWA 3ZCXA 2O7SA 2OHXA 4AJEA 3AU8A 5DN9A 1I32A 1I2CA 2GGSA 1PR9A 3UKOA 5AVOA 3RUAA 2I6TA 1O6ZA 2BFMA 4D46A 2WD8A 2X6TA 2NVWA 3SXPA 3IJPA 3OQBA 4XX0A 2P91A 1P33A 3AM3A 3OETA 5A9SB 2C07A 3E8XA 1V0JA 2W8ZA 3ZWCA 5K9ZA 2HMTA 3JD3A 3QW2A 4Z3KA 1FDWA 1PJ2A 4QO7A 3EUWA 3CPSA 1GFSA 2V65A 3VH2A 3CXRA 3RKUA 4BNFA 5L9AA 3K31A 4AJ2A 4IMPA 2CY0A 3V1YA 5KJ6A 2OFPA 3S8MA 4JK3A 3AY7A 5EPOA 3JYQA 4OM8A 1TEHA 4B3HA 4PZDA 3ZWAA 4L0QA 4MVJA 1NPYA 5GZ6A 3FNHA 5U9CA 4A10A 2VZ8A 1VSVA 1NPTO 3Q9NA 1Y7TA 1VL8A 2PD6A 1F17A 2QHXA 3QWHA 4U5QA 3HZZA 4A03A 1V35A 3W4JA 3O26A 1X0VA 3QVTA 4FBGA 1K0UA 1JDJA 5L7WA 3L6DA 3WR5A 3BA1A 1E6WA 3NV9A 4CUKA 4TRMA 4MVJM 5A9SA 3DBHB 4GI2A 1C14A 3ZW9A 4UVDA 1SZJG 2EG9A 1Y5RA 2VN8A 3NUGA 1C0KA 2D3TA 3KRTA 4XWYA 4CV3A 5ITWA 1KVQA 4EEZA 1K6IA 2DT5A 3HADA 3D4NA 2JAPA 3GPIA 4RLSA 5DULA 3D5TA 3IKVA 1DXYA 2DVMA 2OP0A 1FF9A 3B20A 1M75A 1KS9A 1DAOA 3RBZA 3WG9A 3ZU4A 4P38A 3N58A 3KM0A 4RCVA 3WGYA 5C7OO 1EQUA 1ISMA 1T2AA 2PA3A 3MTGA 3RSHA 2PKRA 5JSFA 4MIEA 1DFIA 4BMSA 1QV7A 5IDWA 1YB1A 4FOSA 3ADOA 4PN3A 1NQOA 4N18A 4YAEA 3DHEA 3RC2A 3WNQA 4XD2A 4JNKA 4IGFA 5B4TA 1N2SA 3MWEB 5COAA 5JAMA 2XF8A 3GUYA 4O63O 3GFGA 2VYVA 2VTEA 3WGQA 4A73A 3EMKA 4IS2A 2DTXA 2AG5A 3CE6A 3TZ6A 3DBHA 3MCVA 4G5HA 3GVXA 5EJ2A 3V8BA 4MVJI 5FEUA 2VHXA 4EUHA 3QHAA 4DPLA 2R6JA 4FFLA 1B3BA 1ONNA 1VRWA 4U0JA 2J5RA 5A04A 2HK7A 1NR7A 3BTSA 3PJEA 3H9QA 4B4WA 2XOXA 1M76A 1NXQA 4XGIA 5KWEA 4CQLB 1H93A 1F8FA 1EUCA 5KVVA 3QJ5A 1YGYA 2P5UA 1YB5A 4BNIA 1J0XO 3PFWO 1LSUA 3WOHA 1HDGO 2CNBA 4IIUA 3ULKA 3W4KA 2YDXA 1PGJA 1ZUD1 2OORA 2X0IA 4E6PA 5CDUA 4TRNA 1HF3A 1C3VA 4WLOA 4RJTA 4MVJD 2X23A 5IDXA 5TLSA 3PLRA 3X2EA 2OBYA 4RLHA 4Z9YA 4O59O 1P1FA 1E5QA 4JP2A 1PJQA 4DWVA 1H2BA 1P74A 3F3SA 4E30A 3M2PA 2C5AA 2O3RA 2IYOA 1LSJA 3WS7A 4ILKA 3UGKA 3H5AA 3R6DA 4Q39A 4FFRA 1I2ZA 4YJGB 4CODB 3E9NA 3FF4A 4I1IA 3ENNA 3I9OA 3C7CB 4MVJF 3EK2A 3Q6IA 4JLWA 3E48A 4YCAA 4YBZA 2QRJA 2HRZA 2Q49A 3AWDA 3UF0A 3JQGB 3DEYX 3F46A 3DO5A 4HADA 1N1GA 4CQLA 3PVZA 4GH5A 1QP8A 2H1SA 5JO0A 4B4OA 2YFQA 1JKJA 2Y68A 3JQ6A 1M6WA 2Q3EA 2ZJ1A 4ZQHA 2D59A 2P2SA 2E49A 5TQVA 1NQTA 2JCXA 1A72A 1DIBA 2XXJA 1ZJYA 4PIVA 1CRWG 4J1SA 3KZVA 3WYEA 3AI2A 2V6BA 1SOWA 4CQMB 3NJ4A 5HRUA 2QZ9A 3VAZA 3GNQA 4LSMA 3G49A 1MG5A 3IJRA 4YACA 2BLLA 4NNJA 4BS9A 4IDGA 4YJGA 2VYVD 5TJ9A 3DDNA 3WMXA 3BTVA 3VVCA 2B0JA 4UEJA 1HDCA 1MC4A 3DWFA 3PYXA 3UH1A 1PJSA 2P9GA 1GEEA 4URFA 5L7YA 2ZCVA 4FGWA 3GEMA 2PLAA 3JQEA 1I0ZA 2YHIB 4BKRA 4FFOA 1LDBA 1ZW1A 2PZKA 3IIEA 2RCYA 3DC2A 4NMHA 3RUDA 3LLVA 4E4YA 1HDRA 3AFNA 3HDQA 1VKNA 1A9YA 3PDJA 4XYBA 5A5FA 1UH5A 5IXSA 4W6ZA 1LLQA 1F14A 3CINA 3FPCA 4I08A 1ADFA 4AJLA 5JMPA 3HFGA 1J5PA 5CFZA 3JYOA 1GUZA 5DF1A 2W98A 3BHIA 4QUKA 4Y67A 4YJDA 3HN2A 1N7GA 2J3IA 2GD1O 2QIOA 4ITUA 4Q3BA 2QX7A 1DOHA 1HE5A 3ROPA 4F6CA 1NFQA 1DDOA 3E5RA 3T7CA 3L9WA 1ZFNA 4PG5A 4Q9NA 3C3XA 3SEFA 3TJRA 4CMKA 1GEGA 3FNEA 3DFUA 4S3MA 5CDSA 3QP9A 5F21A 4RL6A 4GX2A 1K5HA 5G4LA 4XEHA 1Q1NA 4D0RA 1PS0A 4EUFA 5HM8A 3MJCA 1MP0A 1P77A 2Y99A 4PGFA 1YKFA 4IZHA 2A4KA 3OJEA 3PHGA 3FR7A 4CR8A 1PGNA 2YHIA 1YBVA 4CLOB 4BHTA 1Z74A 3F6YA 4GAEA 3ETEA 2PR2A 1O89A 5DCUA 1UZNA 4Q3NA 2AE2A 3GGOA 2Q45A 1AXGA 1E1NA 4BNNA 3A06A 1EQ2A 2DLDA 3K2BA 4TMFA 5H83A 3S2EA 1HSZA 1EK6A 3CKYA 1KVTA 2HK8A 4UULA 2B5WA 3OM9A 1PIWA 4W4TA 1PQWA 4I9HA 4BO5A 4FJ1A 3DAFA 1E3WA 4IXWA 4CV1A 4EBFA 5EN4A 4DBVO 2G0TA 1YS4A 4CPDA 4ZD6A 1DSSG 1T1SA 4GVXA 3HQ4O 5H81A 3VDRA 3EHEA 2NUAA 3BIOA 2I66A 4OOEA 3I6IA 1QYCA 4IPTA 3HHPA 4D3DA 1NQAO 3H3FA 2X7HA 3PRJA 3L9XA 2Q4EA 4IBOA 4YJHB 3QWAA 3TWOA 1EEHA 4CLOA 4C4OA 2Y1GA 4MDHA 4AVYA 4PG4A 4PVDA 1NWHA 1VJ1A 2O3SA 3MZ0A 1HEUA 1IB6A 4L4SA 4D7AA 3AI1A 5ILGA 1Z82A 2OMEA 1YDEA 4J2HA 2BI7A 1XSEA 4IS3A 2XPCA 2ZTUA 2HDHA 2X5KO 1SO8A 4ZQBA 5IJZA 1JKFA 4HY3A 4I5GA 2B36A 4RDIA 3UOGA 4BNYA 1I24A 4LRTB 4YQYA 3M1AA 5ICMA 5JYEA 4L74A 4BO6A 5ICSA 3H8VA 3WBFA 2PZLA 1B26A 1GQ2A 1O94A 2DFDA 2Y1CA 3S55A 1HL3A 2FN7A 1LSSA 3GAZA 4K9DA 1T26A 3S2GA 5A9RA 2VOJA 5F1PA 4W7IA 5IN4A 2EKLA 5GY7A 3C1AA 3I6QA 1NM5A 5KKAA 3UCFA 2B35A 5K6AA 4TKLA 3TZCA 2Y1OA 4WLFA 2DFVA 2UV8A 2HJRA 4IIVA 4YJHA 5I9MA 3OEYA 3E82A 1ENZA 1P1JA 4J3FA 1HDXA 5ADHA 1SOVA 2BH9A 3JD4A 3SJUA 3AUAA 3GLQA 1ZSYA 1ADCA 3DHNA 2GO1A 4CLXA 5COQA 4EITA 3TQHA 2WSBA 1YXMA 3QRWA 1ULSA 3NT4A 1EBUA 1BSVA 3WBBA 3OA0A 4WOJA 3QIVA 3I52A 3STHA 3RJ5A 4W9NC 4O5OA 1D1TA 4CM7A 1O5IA 4XJSA 4WLUA 1RM5A 3PHIA 4DLAA 4HNHA 4RPKA 5AXCA 1YJ8A 4ESOA 4JQCA 1CDOA 4LMRA 2AEFA 2Z5LA 5JC8A 2HRBA 2R2GA 3BXXA 2O23A 1IYZA 3QY9A 4D41A 2NNLD 3GVIA 1TLTA 3JQ9C 1TA4A 5JDIA 1ULUA 4W7HA 3I9LA 3LU1A 1A4IA 1ONOA 1CEQA 3F5SA 4BNVA 2O4CA 3Q3CA 5TNXA 3DHYA 3L4BA 2B4QA 4PG6A 5BSHA 3NTOA 1O95A 4BNKA 1MUUA 5IF3A 1SB8A 2UDPA 2B37A 4GWGA 4AJHA 5BSFA 2NTVA 3NRCA 3TL2A 1B8UA 2EWMA 2VWGA 4DL9A 1UP7A 1U3WA 2CDCA 1GZ6A 4WCFC 2A94A 5JDCC 4KUEA 1LC0A 2WM3A 1U5CA 4WEQA 1U9JA 4J4BA 1GD1O 2HCTA 2CF6A 1XQ6A 9LDBA 5CPFA 1FMCA 1GCUA 3H5RA 3KYBA 4KTVE 3W1VA 4BNHA 1K89A 2V6MA 2PV7A 4HP8A 4PLZA 5COBA 4LK3A 3RI3A 2RH4A 3O03A 1PZGA 4FGSA 4J9UE 4MP8A 2O48X 5THKA 3E1KA 3GVHA 2Q99A 3ITKA 1NFRA 3NX4A 3K96A 3NT2A 4DIOA 1E7SA 2C29D 3WGOA 1LA2A 4FQ8A 5DBFA 2AMFA 2JCVA 3ZWBA 4BNUA 1O8CA 1YONA 3D3EA 4O6VA 5DCYA 5A05A 4DYVA 4XGKA 3WTBA 3DMTA 2WD7B 1ZK2A 3RAJA 4FR5A 1UXJA 2DPGA 1AN9A 3R3JA 4J43A 2WWRA 3PHJA 4PLTA 1B0AA 2Q4BA 2CVOA 2R00C 2GN6A 5HWSA 1TT7A 1EVYA 2DTDA 3R3SA 4FJ0A 5BT9A 3KEOA 1GQYA 5I8WA 3G3EA 5IFLA 5I9NA 1ZK4A 1YB4A 1TT5A 1MGOA 1QMGA 1PQUA 3KEQA 1GYRA 1LLCA 3VTZA 5CHEA 1VJTA 3H6KA 3LC1O 4YPOA 1O9BA 3JQFA 4KWHA 1V3UA 5IDQA 1G1AA 1ISJA 1JVSA 3KBOA 3P5SA 2BI8A 4FFNA 5DP1A 4IDFA 4GL4A 1M2WA 4OXKA 3RWBA 3GG2A 3COSA 4BL5A 2ZYGA 5IZ4A 1MXFA 2BF7A 1UUFA 1G0NA 3ZN2A 2VWPA 2QYTA 4BMNA 6LDHA 1E1LA 2BELA 4GSLA 3ETDA 4L4XA 4Z0HO 1PQPA 1UXHA 5A4DA 1LDEA 3D1LA 2WD7A 1YH3A 3FWZA 3S2FA 1D4FA 3DBVO 4XQCA 5DDIP 4BMVA 1Q7GA 2IRWA 2WDZA 4E5PA 1EDOA 4JROA 4YB8A 5BQFA 3RUHA 4BNMA 1GDHA 3NT5A 1T2FA 4FB5A 1OOEA 3OHSX 1FDVA 3QVXA 2E6UX 2Y93A 3LT4A 4DC1A 5JO9A 2VT3A 2EGGA 3JSAA 3EVTA 2PKQP 2QRKA 4NDNE 1ZBQA 3OJFA 3LZ6A 4CM5A 3KSDO 1DC3A 3AY3A 3ADPA 5EIOA 3AFMA 4RV9A 2AE1A 4TWRA 5GMOA 2G82A 3GVCA 1R16A 3W8FA 3WX0A 4E31A 1H6BA 4BNTA 1NQ5A 3C1OA 1QR6A 1V3TA 1NYTA 4IY1A 3AUUA 3BAZA 4PLVA 2OXIA 2NVUB 3RC1A 2P9CA 3ZDFA 2X0JA 1KERA 1M6HA 3PHHA 3I9NA 1I3LA 1EVJA 2WYVA 1CJCA 1EBFA 5ER6A 3F4LA 4DIFA 2YJZA 1ONPA 5DZSA 3JQBA 2FPPA 2IDZA 1GZ4A 1SNYA 1X1EA 3NEPX 3H9UA 4FIZA 7ADHA 2CSUA 2GZ2A 3LT2A 4XR4A 1KYQA 3AM4A 4M54A 4DGSA 1JW9B 2YV1A 1R0KA 3N7UA 2ZB7A 4NR0A 4AJJA 1XA0A 3UXYA 1M66A 3KVOA 5KNLA 2B4TO 2Y0EA 3IAHA 4NU6A 1IZ0A 2GCGA 4UVEA 2EJVA 2B5VA 1LQTA 4IJKA 4NPCA 3WQSB 1QV6A 1VPDA 3FBTA 4OO3A 1DB3A 4IJWA 5EINA 3JYNA 4CUJA 2EW8A 1DFGA 4WOKA 1BXZA 2E48A 5JLAA 2V7PA 4S1VA 4LW8A 4CMGA 3FNFA 1T2DA 4ND4A 3DXFA 1VL6A 3FWNA 2C2XA 2Y05A 2NVUA 1ARZA 2Z1NA 4IZIA 2PZJA 3GNTA 3WQRA 3ZWMA 3LK7A 3HG7A 1WDLA 3RROA 1U28A 3UVEA 5C7IO 1H9AA 3WWZA 4HFNA 4MVJG 4QXMA 3AK4A 2VWQA 1BG6A 3HB4X 3WB9A 3UHAA 1I3MA 4C7KA 4JJIA 4MVJP 1PU2A 1O0SA 5L4LA 1NTOA 4YA6A 3L6EA 1FDSA 3RC9A 3DOCA 4P4GA 3KB6A 4MOWA 1C1DB 1OMOA 3GHYA 1AXEA 3X2FA 5KIAA 2CZCA 3IUPA 1D3AA 2X5OA 3B1KA 3ZI0A 5JAZA 2CDAA 3V1TC 1UDAA 2YV2A 3KXDA 4HFJA 3OF2A 4EZBA 3OEWA 3B1JA 4XGNA 3VDQA 1K6XA 2DC1A 5I8ZA 4CR7A 4GGOA 2X4GA 3V2GA 1Q0LA 4KDEA 2PD4A 4BO9A 3ZU5A 4R41A 4F6LA 1R12A 2HLPA 3GH3A 2EERA 3PGJA 1ZSVA 3GQVA 4OXNA 2VNAA 4FC6A 4R9RA 1H0KA 4O1MA 4EDFA 3E9MA 1KVRA 1P3DA 2Y67A 5I7SA 3VZQA 1U8XX 1E3EA 3JYPA 2NU6A 4KQWA 3NTRA 5KCZA 1D7OA 1BTOA 1E7WA 1JWAB 1E3LA 4AJNA 1C1DA 5L4NA 2Y1DA 4KMSA 1AHHA 1CF2O 4OAQA 3PIIA 4RZHA 4J16A 4RF4A 5FI3A 1UP6A 2O3QA 1LDNA 4KQXA 1KEWA 1NVGA 1P1KA 4Y9DA 1GY8A 3ZV4A 3I83A 2AEJA 4RF5A 1GZ3A 2X9NA 4YDRA 4CUZA 4CV0A 2ZQZA 2Q2VA 3F1KA 3VH3A 3UCEA 1ID1A 4XYLA 3SX2A 2HMVA 3A9WA 3D3WB 4XA8A 4GPD1 3Q1LA 3RJ9A 4AJPA 4H7PA 1OFGA 2AA3A 3WIEA 1PJ3A 2GZ3A 3ST7A 1WP4A 2C20A 2Y1EA 3FSRA 1UP4A 3IP1A 4Z9XA 4WKGA 1PGQA 3TL3A 1Y9EA 4KDFA 3BYZA 2C0CA 5JNLA 4OH1A 1ML3A 2OZPA 2WEKA 2HUNA 2O4UX 3JQAB 4MKZA 4BV8A 3LYLA 4DYDA 4NK4A 5LC1A 1B7GO 3DOOA 3TDKA 1NHGA 3GGPA 1SEVA 3WDSA 2JKVA 3I4CA 2VUSA 3PFFA 4RDHA 1ZK3A 1Q0HA 2V6GA 4RVGA 2D5CA 1Z6ZA 3PZBA 1XDWA 2NQ8A 2OBNA 5DT9A 3ZWYA 3U49A 1WVGA 4AJKA 1WPQA 1UDBA 2O3TA 3SC4A 4DXHA 1FDUA 2VNSA 4A2CA 4B4VA 2DBVO 1D8AA 1TVEA 4R9SA 4FFPA 2IYPA 4I9NA 1PS9A 2EP7A 4INAA 3D3WA 3WGHA 1ZEJA 2JCYA 4BO1A 1UZMA 4J2OA 4M87A 3EZYA 1OC4A 4J4TA 2BGKA 4P22A 4ZGWA 2IXBA 5JCXA 3FN4A 1PX0A 3DZJA 3JV7A 4BIIA 1PEDA 3C85A 2H9IA 2WJPA 3O8QB 3JQAA 1DAPA 3OSUA 3CUKA 1J4AA 3C8MA 4ND5A 3TSCA 3HFSA 3BZUA 1MV8A 1UDCA 1NP3A 4FN4A 4ALJA 3ZZNA 4FW8A 5IZCA 2NM0A 5JBIA 3PPIA 4B3IA 1VC2A 1NHWA 2UUPA 4JJFA 5DNAA 1YL5A 4NQZA 3PK0A 1Y6JA 1YQGA 4E3ZA 2O2YA 5FYDA 3IC5A 5A06A 2YQ4A 1WAMA 3Q11A 3GEGA 2DQ4A 4YRBA 5T8KA 1A5ZA 1VL0A 4CMEA 4N54A 2PGDA 3KYDB 3PJGA 4NBTA 4Q3DA 4U7WA 2ZYAA 3MWDB 4WEOA 4CM8B 4KWIA 2B4RO 2AQHA 1QKIA 1ADGA 1VLLA 1U7HA 1X7GA 4GQAA 2DUUA 4GX0A 4J90A 4BVAA 3O8QA 3AOEC 5TS3A 4J6FA 3H9GA 3E9QA 3GDFA 4JGBA 3UAGA 1B2LA 2BD0A 4IQGA 5H82A 3RU9A 5KOIA 1LLDA 3D7LA 1B15A 5FFFA 1XIVA 3RU7A 1BMDA 3TPCA 2GERA 5JC1A 2RHCA 3A4VA 3VZSA 5FF9A 1Y8QB 1DIGA 4UUOA 1U8FO 4XB1A 3JQGA 1N9GB 3RC7A 3U9LA 4E32A 2CF5A 3H2ZA 3QVSA 3MJVA 2VRCA 2CD9A 4OKNA 5AYVA 4O0LA 4PRLA 4J91A 1X14A 5CPBA 4CLEA 1PWZA 3PQFA 4J7UA 3KYDA 3DZHA 4QTZA 3S2IA 3MOIA 1ZXBA 4K26A 4CM8A 1Z75A 1U4SA 4MPDA 3PP8A 1E7RA 1UAGA 4OGWA 4CQMA 2GUGA 1HRDA 2OP1A 1ENPA 2Y1FA 3WFIA 4X54A 4E0BA 1A71A 1MLDA 2FOIA 3NGLA 1PJTA 2Y0CA 1ORRA 1CETA 2WTBA 4WNIA 1IOLA 3WGTA 1PZFA 4MIYA 5IXYA 3ZH2A 5JYDA 3GVPA 3JQAD 1Y9AA 4OJNA 2D2IA 3W6UA 4M1QA 4RVFA 1R0SA 1DC4A 2VQ3A 3V2UA 1ZVMA 4LCJA 2UVDA 3LT1A 3VHRA 1Y8QA 4DLLA 4II3A 5T6BA 4TQGA 1N9GA 3D5QA 3W6ZA 3U09A 3GZ4A 2J6IA 5K0ZA 2X8LA 3JTMA 4GBJA 2GN9A 3GF4A 4YRAA 1NPDA 3G0OA 5B1YA 4LCEA 5CEFA 4PLCA 3NDRA 3ETGA 4CR6A 3TZKA 1EUZA 2PD3A 2I9PA 3GR6A 2DU8A 5JFOA 4Z0TA 4GWKA 1BXGB 3INGA 5CG1A 4AICA 5JCJA 2GPTA 4ALLA 2I5PO 1ISIA 2H63A 4LVCA 2FSSA 3K73O 1E3SA 2C59A 2C82A 5JE8A 3ZHXA 1XWFA 1ZO8A 3I9KA 4R1NA 4PCVA 1HE4A 3SJ7A 4M55A 1PJLA 2JAHA 1T4DA 4CLRB 3OICA 4L9RA 4OIMA 3Q2IA 3JQFC 1T24A 3ASVA 2EF1A 1GR0A 1W8DA 4ALMA 1CQJA 4NI5A 3NDIA 4FD3A 5LCXA 4TRRA 4UREA 4I8XA 3VPSA 3JQCA 3TFOA 4ALKA 5TIIA 4TRJA 3PDUA 1GV0A 4LGVA 2VRCD 5KTKA 5L40A 5U4QA 1TB4A 3I9JA 2YHUA 4Y8VA 3DONA 4DPKA 2ET6A 2AEMA 1PL8A 2JHGA 5THQA 4BNWA 1YO6A 3DZKA 3INRA 3ASUA 4EW6A 3VH1A 5BNFA 1GU7A 1GQQA 4CLHA 3T4EA 1BXGA 2YUTA 2AXQA 3L4SO 1JAXA 4MJLA 1GV1A 4R1TA 1E5LA 4TROA 4L8VA 3CMCO 4I5FA 2I76A 2EP5A 1DC6A 3KV3O 4WUVA 1BVRA 2ZYDA 1QYXA 4TVBA 2YY7A 4RPHA 4BV9A 4CQMD 2GN4A 3NAQA 4BO0A 5J23A 1P1HA 3VKVA 3LVFO 3QVWA 1XG5A 1WMAA 4WCDA 3G79A 3TFQA 5G4KB 3WSWA 4CLRA 1NR1A 4EGFA 2VUUA 4GKBA 4R68A 3GGGA 4J9VA 4UUMA 1U3TA 5F5NA 3T7EA 3KOUA 1MFZA 4PLPA 1Y8RB 2GSDA 1SEPA 1E7QA 2EGHA 3A1NA 5A03A 3L77A 3V5NA 1Y81A 5CDGA 1WMBA 2P4HX 4WGGA 5TT0A 5AXDA 1P1IA 4CM3A 1LXCA 1C0PA 2HJSA 5KJEA 4ND1A 3DL2A 2ZCUA 4RF3A 1BW9B 3WMWA 3IL2A 1PZHA 1ZK1A 1OBFO 4Y6RA 5A9TA 2FWMX 2PKQO 1DLJA 1T25A 3OQ1A 4IINA 4HV4A 5CDTA 2JD0A 5I7EA 2PWZA 1E7MA 3ZWNA 1P9LA 5EERA 3HDYA 3PQEA 2FRDA 4YR9A 2FSVA 2BFPA 2A92A 2NTNA 1LDMA 1PGPA 2Q1WA 1EDZA 1Q7BA 3JQ8B 3B1FA 3LF1A 4KUHA 5DBIA 3WYCA 1DRWA 3QWBA 3WJAA 4A27A 5CAEA 3KUXA 5T64A 3UCXA 1C0IA 3W8DA 1GADO 4R16A 5G4KA 3WGGA 3QSGA 3DZIA 3ENKA 2ZTMA 3ROKA 1HSOA 1NFFA 1Y8RA 3I9MA 1U3VA 4J1QA 1XU9A 1E7YA 1PL7A 1B3RA 1XEAA 4DQVA 1QLHA 3DFZA 4BNGA 1ZMOA 2OO5A 2HSDA 1I01A 3HJAA 1ENOA 1Y1PA 1Q2XA 2X22A 2CFCA 2HKIA 3QWIA 4AJIA 1LX6A 3BHMA 2NSDA 4R54A 4ZQGA 1BW9A 2FPGA 2E4AA 5FI5A 3U62A 3RUFA 1R4MB 3ZHYA 3HSKA 3NJ8A 4D79A 5CG2A 5JW6A 3OMLA 4N5NA 3ABIA 5G2OA 2UUOA 5HS4A 3K5PA 3N74A 3AUSA 1PS8A 4PVCA 3FBGA 3R1IA 2W90A 4NJMB 3L07A 5G0VA 1KETA 1UXGA 4HXYA 1P0FA 3Q2KA 4WASA 4ZJUA 1RM3A 1SCUA 4AFNA 1OAAA 3SLKA 1YBAA 4NBWA 1AE1A 2GR9A 3H5NA 4IGEA 1MFPA 4DBZA 4XYEA 4U6SA 2EEZA 2XXBA 4PLGA 2ZKLA 1YRLA 1RYEA 1HKUA 3PZRA 1LEHA 4NBVA 4A7PA 3WGZA 4ZU3A 4NFYA 3H3JA 1IHYA 3ZNQA 1WXDA 2WE8A 1U7TA 4MP6A 4PZEA 1H6CA 2I67A 3QWFA 2VWHA 1E92A 4YT4A 3G17A 3M2TA 2A9FA 5TJHA 2TMDA 1R4MA 3AM5A 5AQ1A 2LDXA 1H6DA 4CV2A 4MIOA 4WLVA 4W99A 4TZKA 4I5EA 1F8GA 3JQ7B 4OMUA 2FP4A 3TN7A 1E6UA 2D1YA 4K28A 1KBZA 3NTQA 3W4IA 3WIDA 4E21A 1DRVA 4JBHA 1KEUA 4R5HA 2X9GA 2VRBA 1VKOA 2X5JO 4LVUA 1HYEA 1H9BA 4B8ZA 1CERA 1HE2A 3RD5A 4D3FA 4L75A 1K6JA 3FR8A 1MA0A 1VM6A 1NVTA 3DZBA 5L4SA 4QSMA 1VE9A 4E5KA 3D4OA 3FTNA 3P2OA 4DUPA 1XR3A 2P9EA 5HS6A 3F1LA 4PLFA 4GVLA 3C24A 1YBMA 3KYCB 3ANMA 3ZV5A 1VSUA 2JD1A 2W2KB 1BHSA 1N1EA 5G0UA 5TX7A 2EKQA 4RO0A 4JBGA 4XQEA 4K1LA 2NACA 4XCVA 3IMFA 4WLEA 2AG8A 4QO8A 1U4OA 5FWNA 3PTZA 4WNCA 2B69A 1E1KA 2NQTA 3L6OO 1EMDA 1MG0A 3WSVA 1GPJA 3JQ7A 1JTVA 3CH6A 3PJDA 3Q0EA 1C1XB 4BGIA 4PG8A 1Z45A 3RFXA 3RASA 2RBEA 4OKIA 5ENDA 3HUDA 1D1SA 3IDSA 1V6AA 2J3JA 3ITDA 4UVIA 4YYZA 2BGLA 2D5AA 4YT8A 3GPDG 4BKOA 5HBRA 3IS3A 1U5AA 3H2SA 1J49A 4Y6SA 3DR3A 4RVSA 3U5TA 2J3HA 2Q50A 1P1RA 4RPLA 4M89A 4WECA 3LC2O 5DP2A 1RM0A 3DBLB 2AW5A 4NH4A 3UICA 3KYCA 1HXHA 1YDWA 2W2KA 2RHRA 2HQ1A 4IM7A 4WLNA 2HMUA 2YDYA 1K3TA 4ZN6A 1GAEO 3P7MA 1NBOA 2EIHA 3QLJA 4FC7A 4RQUA 1JVBA 3ON5A 3F47A 1QLJA 2DBQA 4WCFB 3U4DA 4ZRMA 5BSGA 1BDBA 3BTUA 3L0DA 3PQDA 4CMHA 4MVJH 2SCUA 3KTDA 1ZKMA 1A7AA 5IAAA 1MB4A 1C1XA 1SAYA 2X9VA 1B16A 4ND2A 4E5MA 5T57A 4F3YA 1B8PA 5ILOA 1CQIA 4B79A 2AHRA 3OECA 4RVHA 2F1KA 1I10A 2ZIZA 4OSOA 1LU9A 2P5YA 1EK5A 2C2YA 3F5QA 4BKUA 1SMKA 4JBIA 4NBRA 1HLDA 3ROQA 2D4AA 1BWSA 4E5NA 4TVOA 4KP7A 3ICCA 3JQ9A 1KVSA 3OFSA 5A5EA 1QXSA 4MINA 4UUPA 4NFSA 1FK8A 3CSDA 2PGLA 3DBLA 3NYWA 2JFGA 4GLOA 1EUDA 2ZQYA 3RUIA 4IQ8A 2E82A 2Y66A 1UR5A 1HYHA 2YW9A 3JCZA 4ZRNA 3WGIA 1YE3A 1HT0A 3ZNOA 2O2SA 4KZPA 4MVJE 4LSWA 5JAQA 5C7LO 2DBRA 2QQ5A 3AJRA 1S7CA 4YAJA 5L53A 5A3VA 4XQGA 3GFBA 2W2LA 4WCFA 5ES3A 4BB5A 5JDCA 2CVZA 2ZK7A 5AOVA 3RFVA 1R15A 4K6FA 4BNLA 2RIRA 1DLIA 3EY4A 2C7GA 2PH3A 3DMYA 4JX8A 3UW3A 3O4RA 2IEDA 3GY0A 1YL7A 2CUKA 2DUWA 3GG9A 4AJOA 1IULA 3R0IA 4G2NA 3RIHA 1HDYA 5T5QA 2E37A 3HN7A 1IPFA 1U3UA 1P44A 4R51A 2NTJA 1B14A 2G76A 2FZWA 4AJ4A 5F1OA 1Y5MA 3C1TA 4YAIA 1V9LA 1X13A 4L76A 1DJQA 3HNPA 2FHSA 2GLXA 2H5LA 2HU2A 3AUTA 5CEEA 1LUAA 2Q2QA 3FD8A 4E2XA 1R6DA 3GN1A 4N7RA 3VH4A 2P68A 1W0CA 2Q1TA 2R00A 4N5LA 5JXWA 4QQRA 4GSKA 4ZICA 5KVSA 4QFDA 4GKVA 1V8BA 2Q46A 1U1IA 4I9UA 3TNLA 3BMCB 2X1HA 4OL9A 1I30A 3ZHBA 5B12A 1ZIDA 4BNXA 3GRPA 4D44A 3C7AA 4B4UA 4R1UA 5F3RA 2G1UA 3S1LA 4A26A 3LLSA 2I3AA 1I2BA 3AOGA 1A27A 1AGNA 3SVTA 2ZTVA 1G6KA 2ZJ0A 1LSOA 1T4BA 1EFKA 1NWCA 4AG3A 3E6AA 3OIFA 1GL3A 4R01A 1R0LA 1EFLA 3OH8A 1Z73A 5JS6A 2PZMA 4BKQA 3CIFA 2VHVA 4MKXA 1HE3A 2IZZA 4CMBA 2AQ8A 4J0EA 1CWUA 3VOSA 1MX3A 1EVIA 1MXHA 4JXKA 4BNJA 2EXXA 2WE7A 1N92A 4CM4B 4JN6B 2O50A 4DQXA 3KSZO 2X58A 4BB6A 1E1MA 3JD0A 1QRRA 4NU5A 1HDZA 1KC1A 1R37A 3FTPA 2VZ9A 4XYMA 3RCBA 1PGOA 3F9IA 3GRKA 1BDMA 1FXSA 4HNGA 4AJ1A 4E12A 1JAYA 1I36A 4ZQFA 4XB2A 1QG6A 1TI7A 3LF2A 2JJYA 2W2LD 4KTTE 3BMCA 2NVBA 4UVGA 1WDMA 2PH5A 5MDHA 4HX5A 1J6UA 1VI2A 1W6UA 3MJ4A 4G81A 4JCOA 1P31A 4Q3CA 4XDZA 4B8WA 2D0IA 1DHRA 3I3OA 5TF4A 5I7FA 4FSHA 2VCYA 3ZHZA 3PLNA 2I99A 3TZHA 5L7TA 2AQIA 1HTBA 2VHZA 5ER9A 1I3KA 4Z0PA 5KJCA 1LBEA 2IEBA 1X7HA 3GHHA 3RUCA 2QYSA 2ZB8A 4NHEA 3IUSA 4P4NA 4RGBA 5CDYA 1F0YA 2WYUA 1SC6A 3FHLA 3MEQA 1JN0A 4XQ9A 3JYLA 4FOOA 4KUGA 3IP3A 1YL6A 1NAHA 2VOEA 3OQ6A 3V2HA 1PR3A 4CM4A 1L7EA 3D0OA 1OI7A 1XGKA 1I33A 3NDJA 2J3KA 3BMQB 4EEXA 4OOFA 2Q1UA 3PWSA 1ZZEA 1HWYA 3FNGA 1ENYA 3IOYA 4IQ0A 4R1SA 3W8EA 2FMUA 4H16A 2QZZA 2BHLA 4UAGA 2Y0DA 4DA9A 3ZV6A 4BGEA 2W4QA 4RORA 4QX6A 4J1NA 7MDHA 1BGVA 1RJWA 3EW7A 4IJVA 4ALIA 1ZMTA 3U4CA 4E2ZA 4P8RA 5K6AC 1DIHA 1FDTA 4MP3A 4NG5A 3QV1A 3CMMA 4OQZA 5EQDA 3HDHA 1GUYA 2BFAA 4BKPA 3NGXA 4D42A 1WZIA 2IXAA 1QSGA 3B6ZA 4ONEA 4D43A 3A28A 2NU7A 2YQ5A 1JWBB 2OOSA 4FJ2A 1SB9A 1ZSNA 3DAPA 4BGVA 3OIGA 2DAPA 1KEVA 1C0LA 2J8ZA 4OXYA 3ZGYA 4Z3DA 3VPFA 4HFMA 4BO4A 3BMOB 4Y6PA 5L51A 2ZB3A 3HWRA 4PLWA 1Z7BA 1PJBA 4NBUA 4YVFA 3BMQA 4IDAA 1H2HA 5AXAA 4ID9A 3EYWA 3ICPA 1GUFA 3AI3A 3IKTA 3VPGA 2EKPA 3ZWOA 3T4XA 1WNTA 4QT0A 4BO8A 1HZJA 5CP8A 3MJEA 1X7DA 5JDIC 2O3JA 2D8AA 4P4LA 3WYBA 2EJWA 4NJOA 3WLFA 3DZGA 3L4BC 5A3JA 3HB5X 4CL3A 5C5IA 4F45A 2O7QA 3H9EO 3RKRA 1N5DA 5B4VA 4DLBA 1E3IA 1Q7CA 4B7XA 1TXGA 1KOLA 3RBXA 4D0SA 1K2WA 4H3VA 3BMNB 3BTOA 3RQSA 3PJFA 1PL6A 3WWYA 3ZWVA 4OYRA 2QG4A 3QE3A 4MO2A 2JFHA 2C54A 5HTOA 3BMOA 2HMSA 5JAIA 1XQ1A 5ENVA 1YWGO 3B70A 4IMRA 5F5LA 4E5YA 2I3GA 1F12A 1KIFA 3PI7A 3PWKA 4GX1A 5A1TA 2GASA 3ONFA 3FI9A 4R69A 1IL0A 1V3VA 2IZ0A 1HDOA 3PHLA 4RZIA 3VZPA 5B37A 1YQXA 2VHYA 3TOXA 4UEKA 1T2CA 3VPXA 4R3WA 1E3WB 2VZ0A 3I5MA 2VHWA 3D64A 4ALNA 2Q1SA 3DZFA 3ZU2A 4D3SA 2LDBA 2DBZA 1WDKA 2VUTA 1ISFA 3ANNA 1OC2A 4XIYA 1GPDG 3WNVA 3G1TA 1LC3A 4CL8A 3K92A 4XJTA 3DMTC 3K6JA 4H15A 4JJGA 3LT0A 1LQUA 3GDOA 1LNQA 2A35A 9LDTA 3LSYA 3QQPA 3BMNA 5G0TA 4UEOA 4BQPA 3ANLA 2NU9A 3GOHA 4LISA 4TZTA 4DMMA 4ZVVA 1I3NA 4CMCA 1BXKA 1XCBA 3D4PA 1P0CA 3DOJA 2AQKA 1DIAA 5EMHA 4BO3A 1KEPA 1LJ8A 3EAGA 4EI2A 1F06A 3UN1A 5L3ZA 4B7CA 2FY8A 2X86A 3VKUA 3DBRB 1PJCA 5DBGA 3U4IA 1UZLA 4CJXA 1I5RA 1E77A 1UAYA 2ZTLA 4IDBA 5C3MA 4PG7A 2QRLA 5BNTA 3WICA 1RWBA 5U1PA 5HA5A 3TZQA 4DQUA 3FRJA 2JD2A 1YOVB 1N7HA 1PJ4A 3GA0A 4CM9A 2OGUA 3V1UA 1DFHA 2BFOA 3DAGA 2G5CA 2V6FA 4LMPA 1ISGA 3DQPA 1LDYA 4B3JA 3FPLA 2DPHA 3JQDA 3I1JA 3ZW8A 1NASA 1T1RA 2BGMA 4PFJA 4R3NA 2OL4A 4XDYA 5A02A 2BRUA 1EVZA 1QORA 3H65A 1FJHA 3ORFA 2TMGA 4PRKA 1PWXA 3MTJA 4MKRA 4W82A 4BNZA 4EJ0A 4B7UA 4CMAA 3OIDA 3ONEA 3LDHA 8LDHA 3M6IA 2NV6A 3E18A 3JD2A 3DBRA 3HE3A 4J0FA 3WTCA 2CDBA 4IDEA 3EGOA 2NADA 3VZRA 4WK6A 1KC3A 3K8ZA 2RH8A 3ZWXA 1Z7EA 1IHXA 4KOAA 4RF2A 1HLPA 4PLYA 4E2WA 1SBYA 2C5EA 1ZEMA 2OUIA 3KO8A 4II2A 4WE3A 4XIJA 1GYPA 3ROMA 5KKCA 2PNFA 1YOVA 3F4BA 4GLLA 2GZ1A 3H7AA 3WFJA 2JFFA 1H94A 1DO8A 1XU7A 3CTMA 4DMLA 1JU9A 3O9ZA 5CEJA 4Z6KA 3JQBC 2G17A 2GDZA 2GN8A 1CYDA 3PIDA 4HKTA 4M8SA 8ADHA 1EE9A 2GYYA 2FZEA 5JCJD 5G0SA 3AY6A 3JD1A 1X15A 1HYGA 1GYQA 4BO2A 2EHDA 2HMWA 4XZ3A 5I9LA 4CMJA 3WJ7A 4XYGA 4DRYA 4IDCA 5G0WA 4ZA2A 3AOEA 1JKIA 3DTYA 4EJMA 1ZNQO 2BKAA 5I7VA 1DBVO 1YJQA 5EQFA 3GUCA 2P4QA 1I8TA 1AUPA 1RYDA 4M86A 3K30A 4GMFA 4J4HA 3Q9UA 4M49A 1ZCJA 3HDJA 1PTJA 1UXIA 5IN5A 4EJ6A 1DEHA 1L7DA 1UJMA 4U0KA 4U8GA 5DOZA 1KVUA 3KLPX 3VC7A 4XRRA 1H6AA 2J5KA 4RPGA 2GRAA 4HWKA 4J49A 3KSUA 4E33A 5L95A 2PK3A 2PTGA 4U6QA 2DTEA 1DIRA 4LN1A 3H9JA 5C37A 3FCOA 5T67A 5JPIA 4CM9D 2FR0A 4NIMA 3WLEA 2IE0A 1NX6A 3TOZA 1QYWA 4DREA 1IE3A 5GZ3A 3JQ8A 3GMSA 4E2YA 4GX5A 2H6EA 1EZ4A 4NZ9A 5GZ1A 6ADHA 3C7DB 4FDAA 4Q3AA 4WJZA 4IJUA 4NK5A 3TRIA 1ISHA 1X1TA 4K6CA 2CVQA 2JHFA 5F1KA 3GN2A 2ZATA 3LC7O 4FCCA 4BQRA 1TT5B 3QA9A 3ZWWA 1M67A 4UUNA 4XR9A 2UYYA 2YZ7A 4ZQEA 3ZNNA 2YV3A 4ND3A 5MGBA 2PGJA 2IODA 2HK9A 1LLUA 3LQFA 2WMDA 3RFTA 2ILTA 3ZV3A 3PGXA 1QYDA 3K9QO 4QEDA 4GMGA 4FPXA 3IQDB 4DC0A 4CMIB 4JIGA 2X0RA 4J1TA 3P2YA 2FPIA 4YRDA 3VTFA 2YFHA 3E03A 5JY1A 1WWKA 1XELA 3I4FA 3RBVA 3P19A 4HUJA 3GMDA 4YAGA 3QVOA 5KJ1A 4AL4A 5KVQA 1A7KA 3I23A 1HETA 4GGPA 2EW2A 3E5MA 1PSDA 3NKLA 3MJSA 3OBBA 4L73A 3O38A 4NJMA 2NLOA 4ROSA 1A9ZA 3A14A 1LRKA 4UVHA 2PY6A 4RQTA 4YJFB 5TGDA 1WZEA 5EL0A 4ZHSA 1DPGA 4YWJA 5KVCA 3K2EA 3GEDA 3PWZA 4JP3A 3U3XA 4OHUA 3ZNPA 1SPXA 3OJLA 1GCOA 2HAEA 4RVDA 5LDHA 1Q0QA 3CZMA 2NWQA 4YAKA 1H5QA 1S6YA 3ONDA 2WYWA 2X0NA 1LTHR 3AW9A 4QECA 4YEDA 3SBOA 3SLGA 3MJTA 3KHUA 1BVUA 2EV9A 3U4HA 3TF5A 1LI4A 5TRTA 1NVMB 4J7CA 3G1UA 4R5MA 1GTMA 1B8VA 1RM4A 1U2DA 1JQBA 1XKQA 2NU8A 3VVBA 2FR1A 3EVNA 1A4UA 3OP4A 3PYLA 4PLHA 4BUCA 2VYNA 1MC5A 4N5MA 4DPMA 4CMIA 1XHLA 2DM6A 4DTIA 1XYGA 2Z1MA 4A0SA 3AU9A 1R66A 1R4NB 3EC7A 3MOGA 1X0XA 4BGUA 1LDGA 2FR8A 2Z95A 1W4ZA 1NNUA 2QW8A 3VPHA 3BHJA 1P45A 2GF2A 2F00A 3GDGA 1E3JA 4EUEA 1OZAA 4RPJA 1KY4A
chains in the Genus database with same CATH superfamily
1VHLA 4POOA 4QOSA 3DLBA 1Z2EA 3IPLA 3TIVA 3TQRA 4DKJA 1E79D 2GBPA 5FJJA 3T7DA 2B83A 2FPPB 5K3AA 1NF8A 2JGEA 4DUZB 2GXUA 4HQFA 1V95A 3OA2A 2QQGA 3UHPA 4C7MA 1YVEI 4TXLA 4GIBA 1KJWA 3LVBA 4I8IA 5FPSA 1YVUA 3UTCA 1G6Q1 1YBFA 2GK7A 3QYAA 2BMAA 3SC6A 1GR1A 5IDYA 4E13A 5LA6B 2CFOA 2PFGA 3AZQA 1N2ZA 3GNSA 4IW3B 4QGFA 4O02B 4R4JA 3U4QA 1XUOA 1Z4PX 1KHTA 4HBGA 4UUBA 3CW9A 2XCLA 1BVYF 2FW9A 2YCBA 2HRCA 2WHEA 3MBIA 3OLYA 3KE9A 4C7VA 3GAFA 3WYNA 3LUCA 4O2LA 4YQEA 1VJ0A 5LDGA 4ABYA 1Q19A 3IXLA 3G2MA 3PC8C 4AK9A 4C07A 4DRZA 1E9DA 2V9CA 1JR2A 1N8TA 4QT4A 2GEFA 4IDDA 1KEEB 7YASA 3M70A 3X1KA 3PFCA 1N8KA 4Y2PA 2VTDA 2FETA 4IIJB 4ZOEA 1ESNA 5TC4A 1G20E 4FS8A 1SOMA 1U5BB 3VJKA 1FX1A 2DX7A 4I14A 4WKNA 1N2OA 5C35A 3AX6A 4D45A 1D6NA 5DXAA 5KZMB 3PUXA 3QNMA 4OQYA 2JIBA 3DE4X 1T2EA 3C3KA 5J4YA 2J5QA 2ZAGA 4YT2A 1W6RA 3DULA 1SVOA 2GA9A 4BRUA 1YVPA 4JUDX 4B3RB 4CM1A 5IZCC 4KVZA 2ISCA 1Z62A 2IUEA 2WTNA 1YU6A 5T41A 3KB2A 3RUEA 3ZE8A 5LA6A 1HE8B 1MGPA 3OEEA 4D6YA 3OOHA 1K6MA 2V03A 5BYKA 2IZ1A 2JLRA 2WTEA 1LZKA 1TAQA 4L4RA 5K3OA 1BQEA 4F56A 1N0HA 2HPZA 4BZQA 3DJYA 1SBQA 1M54A 2ZVDA 1PHRA 3OF5A 4I5DA 1I7QB 2CLDX 1THMA 3GRCA 2DKNA 4MPPA 4KIGA 2HGZA 4IUYA 4K8OA 4LRSB 4CM6A 1Z0SA 5CJPA 5EXXA 3CYFA 4A1FA 5KJFA 1SBIA 1HG1A 1XZGA 2NPIA 2XYHA 4IVQA 5CFOA 3DO8A 5DNUA 1PG2A 3DB2A 2Q2OA 2K2QB 4RESA 2W00A 4DA0A 4GM4A 1JECA 3EZLA 1ZOSA 1JPUA 4PYIA 1F7UA 1SZCA 3K0FB 4H7KA 4LJ8A 3EFEA 4EKEA 4HG2A 5CGQB 4LC1A 1ZLYA 5L45A 3QKRB 4HFRA 4IIJA 5ITVA 1DMRA 4NNPA 4RIGA 1U5BA 4PO1A 2ZUSA 1C9NA 1I32A 2GGSA 2CJPA 1E1DA 2VDMB 1FP4B 2MINB 2HV9A 3HVUA 3T7SA 3C45A 5F9HA 5ALEA 4DLSA 2QE7A 6CHYA 1CK4A 5L8VA 1T10A 3UJ3X 2HHCA 1NJSA 3SOPA 3SQWA 3AM3A 2R7NA 3BSWA 4EFLA 1I2DA 4ASUD 3HLKA 3E8XA 4UOZA 1V0JA 2AOXA 1CZNA 3LOUA 3ZWCA 2CFSA 1SM4A 4B34A 4DW8A 5K09A 4C0LA 2OYCA 4DCJA 5K0EA 1E66A 1U7DA 3EUWA 1DQRA 5ALFA 2XNCA 3BGSA 2V65A 5DPMA 4KFRA 4CG2A 4RADA 3M5CA 3T7IA 4LZZA 2XTAA 3ZLVA 4YMTA 2CY0A 1G2IA 3I73A 1DZIA 1FDOA 3T7RA 1WQ4A 2OFPA 3H2IA 4QOEA 3FLBA 1Y33E 5EPOA 2JGIA 1FXWF 3BQMB 3QG1A 1KF0A 1TEHA 3ROFA 4DEXA 4L0QA 4MVJA 1EVQA 5EJ9A 5LR6A 1U0BB 2VATA 1DP4A 2VS1A 3FY4A 2FPRA 3KX2A 4M1SA 5AM1A 5U9CA 2NUPB 3TG8A 3ZXIA 1VSVA 1EDEA 3K0FA 1DRKA 3QJGA 4D80A 1HL7A 1X1AA 3L43A 2FSHA 4ZCQA 2PPVA 2Z58A 3QKRA 4U5QA 4KREA 3HZZA 1JJBA 4EGAA 4A03A 5BYAA 2EQ5A 4G07A 2CLOB 3O26A 2B1QA 1XWIA 2MINA 1UL1X 5AK4A 1SUCA 1SK8A 3QVTA 5EZ5A 3TLAA 2PX2A 1I1OA 1W75A 5L7WA 3BA1A 1RXIA 3TLZA 4DARA 2HNAA 4G0XA 4TRMA 5SZJA 3DBHB 4GI2A 4LHZA 1MAUA 1G2PA 1N6KA 3B2QA 1SZJG 2XI4A 1C0KA 1F20A 1H4SA 5BSKA 4CV3A 4NE2A 3BRSA 3IT0A 3F96A 2FGKA 4QFMA 1K6IA 1J06A 1R6UA 4I6EA 1MZPA 1RC8A 4YP7A 3WY9A 3SSNA 1AXRA 4IGIA 4B3DA 2QXTA 5LN1A 4OEHA 3OZ7A 3OVMA 2C4VA 1Y4ZA 1P6XA 3B20A 2JAOA 4JIMA 1DAOA 1YR2A 3WG9A 1QTNA 1U9CA 4LDJA 3Q3HA 3DZ8A 5FR1A 1FA9A 4JP8A 2HHHB 4F97A 1ISMA 1T2AA 3RSHA 4X62B 4YCSA 1YU9A 2NUPA 2H8KA 5IC5A 2ZE8A 3GNLA 2XQGA 3GLVA 1RVV1 2J4FA 1M1UA 4G5RA 3RRMA 3WNQA 4JNKA 3IB3A 3B7WA 1JI3A 4IGFA 1JDZA 2V7EA 5COAA 5J59A 5JAMA 2R3SA 4OFBA 5EGNA 5CCDA 2ROQA 2QX8A 2FZ5A 4ZXFA 3VYRB 4LHYA 2DTXA 2AG5A 3AIOA 2OZVA 1V47A 3TZ6A 1TTTA 2WF8A 3DBHA 3KT0A 3MCVA 1L7AA 2RCNA 1WXIA 4EY3A 3VSDA 3PUHA 2O59A 2R6JA 5LQSA 3ELWA 2YRWA 4FFLA 3AYXB 4B3GA 4UKDA 4N9WA 4U0JA 2R65A 1DUIA 2JI4A 4Q1EA 3X1YA 4MAFA 3PE6A 2I2WA 4HWGA 3ZOZA 4DA6A 4C0JA 2YY6A 3B3AA 5FXMA 3C3DA 3TKAA 1F8FA 1U0SY 1AIPA 1YGYA 2JKYA 3I1YA 4BNIA 4JYAB 5AK3A 3SLRA 2NAPA 4Y6LA 5A3QA 1LSUA 1HDGO 3CF4A 3ZDFA 2HA6A 4RELA 3ULKA 3GD7A 2BPOA 4QJ5A 1YD7A 3WLKX 2X4LA 1ZUD1 4E6PA 4WLOA 1C3VA 2CB9A 2WHRA 5K01A 3UC9A 3L6RA 3AXSA 5D3KA 1P2BA 1R9GA 4RLHA 3FMVA 4O59O 4QASA 3IYLW 4Z9YA 2A0FA 5LZ8A 3RAGA 3RHTA 3SKVA 2GN1A 4W8OA 2CEAA 4OMFG 4YH1A 4E30A 1O3YA 3F9CA 3M2PA 2OQRA 3O94A 4I50B 2IYOA 4BWGA 3NM4A 4U6NA 1KS2A 3FKQA 2MTBA 3IV6A 1XQWA 4Z4QA 1MQSA 2IYVA 4RK7A 3D6AA 1VRVA 4Q93A 2PN1A 3WLRA 1KFJB 2PX5A 4LDAA 4DM4A 1PLJA 3F8WA 4DMKA 3AETB 4I1IA 3ENNA 4MRVA 4ND6A 5B2EA 1IBMB 4NYJQ 4IKEA 5CHYA 1JEAA 3AMVA 3Q6IA 2OXTA 3E48A 1ZI8A 4ICIA 1GVHA 2BR3A 4RMIA 2ZIWB 3UF0A 2ZE6A 4L8FA 2WA2A 3A4TA 1JG6A 1NZDA 3CJRA 4HD8A 4QUEA 1N1GA 1QANA 1VE5A 5K6RA 3JAMA 5J2TA 2CZGA 2I4TA 1QP8A 2H1SA 2J3QA 4GH5A 3DMFA 5JEDA 1T0UA 4YJ2B 4QVIA 1LBQA 2VUHB 1HM5A 1VHDA 4AROA 3JWHA 1UBHS 3GJ0A 2OAGA 5CVEA 3WGUA 1B23P 3F98A 1KE1A 4MS1B 2R1UA 2KW5A 5FL7D 4QATA 4FOPA 5FI1B 3K5HA 2Q5EA 5TQVA 5IH7A 4TL7A 1FW6A 4IV0A 3B6EA 2H16A 2X77A 4OQFA 4LHXA 1CRWG 2AN9A 2VHJA 4KQCA 3RK4A 3Q98A 1KAGA 1Z12A 2GKSA 1PKEA 4CQMB 2QMZA 3ELYA 3GLIB 5LM3A 3NHJA 4PCAA 4I50A 2XNSA 1XF1A 2O2IA 2W4IA 3GNQA 4LSMA 5GGYA 3K70C 2Z6QA 1E0KA 4EYQA 3QVJA 4B6QA 2BISA 4X8OA 3WB0A 1A9XB 4FOLA 2VSNA 1TQ4A 2VYVD 3Q7QA 3NPAA 1KDOA 4YRRA 5C1OA 3AETA 3T9BA 3OTQA 3O4FA 2Q7XA 3TSAA 1FRQA 3PGA1 1HDCA 3DWFA 3PYXA 3IMEA 3OPYB 4KDRA 3IA7A 3V3TA 2OO5C 1OYYA 3DZDA 3L5OA 4YV1A 2D1QA 1ICIA 4JMLA 4EHAA 3IVCA 1BD4A 2I6UA 3B5IA 1LDBA 4RH1A 4MGHA 4AUNA 4YJ2A 3DC2A 4NMHA 3RUDA 4EKGA 3HDQA 3AFNA 3LDFA 4FHDA 4HNTA 3PDJA 2COKA 5A5FA 4MW1A 4W6ZA 3G8YA 2GX6A 1F14A 3CINA 2YJNA 1S8AA 2LKCA 2VBIA 4MS1A 3FPCA 4Y9UA 3RC3A 4AJLA 5AW0A 2A1UB 1X86B 4E1VA 4BX0A 4YUXA 1J5PA 2ZRKA 1GUZA 2BT4A 3AHEA 4FMDB 5DF1A 4DM3A 2WVJA 3A1WA 1BMFD 4ITUA 3SK0A 1CVRA 2M6RA 2FZVA 3ABQB 3ZHVA 2YWDA 2NAFA 3F97A 1NFQA 4IR7A 5CM2Z 1SUFA 2Q7DA 3I5XA 4K3VA 3PNOA 5DBOA 5E0OA 4Q9NA 3C3XA 3OZVA 2ECFA 4V0RA 4MEAA 1P7ZA 4L2IB 1ZW6A 4AUKA 1CULC 4CMKA 5EKUA 3CG0A 3L49A 3FCSB 5AVYA 1A9XA 3I58A 5CDSA 4RNCA 2YXDA 4RL6A 2CEKA 2EW1A 4X1YB 1K5HA 5F21A 3WJ1A 1UBTS 2FPLA 4XEHA 2BEVB 1PZMA 3LY8A 4AC9A 4D0RA 4DE5A 3MJCA 2XGGA 1AB6A 4K9NA 1SVLA 3VVMA 5LKRA 2ZUCA 4IV5A 2WJHA 1OI4A 3GI1A 1WB6A 1DBPA 4EUSA 1OWLA 4CR8A 2ABWA 1CUJA 3C41J 1HV8A 3MS4A 5GGXA 4KWCA 1UJCA 1Z47A 1FFHA 2QJRA 4NATA 4GAEA 3ETEA 3MTDA 4IIEA 4A0FA 1O89A 5AM3A 5FUQA 2PUAA 5DCUA 3HXPA 4L3WA 2BMFA 1GFZA 5JBQA 1DQYA 1QG0A 2GEJA 2A1UA 2JBHA 3S99A 1AXGA 2O5RA 3ZE2B 1WDWB 5B30A 3S2EA 2GARA 4TT3A 4NP6A 5CVDA 3M6XA 3VR5A 5IJAA 1ZNWA 2G63A 2XWQA 4X84A 1KBQA 1PIWA 2JFVA 1OVMA 1W0KA 3IEUA 1OREA 3M6MD 1X77A 2ZKIA 4KXWA 3VRHA 1J33A 2IEYA 3KU4A 1G7SA 3KJEA 2JARA 1U7OA 5A6SB 1S8FA 1OZHA 1V26A 3H2BA 4L2IA 4IYRA 4KJXA 4CV1A 4EBFA 3R9IA 4DBVO 4DOMA 2YINC 5KYYA 2C97A 3LIIA 4CPDA 4EATA 1NXVA 2W2VA 3JR7A 2BEVA 2E9SA 5H81A 4BV3A 3HR7A 1KJZA 7REQB 1XE3A 3F6PA 2G36A 3DFIA 3ZH9B 5JFTA 3FW1A 3DL4A 1V1RB 2GCPA 4TM7A 3I6IA 4D8XA 2MSWA 3HHEA 1NQAO 1NBAA 1XV5A 4JHLA 3ZE7A 4R2KA 3L9XA 3R0XA 3N3AC 3S2UA 3HGTA 1WY5A 4HWTA 4QUAA 5H70A 4C89A 4C4OA 2QORA 1T0PA 4NH0A 1XXHB 3G02A 3R8FA 1QH0A 2NXNA 4QYXA 4AVYA 4PVDA 3K1YA 3V97A 2B1RA 2G9UA 2QVCA 5ICGA 2MIIA 4FM9A 1T3ZA 2R60A 3EXEB 4JL8A 4D7AA 1ZJ4A 2HCFA 3VPAA 3EAQA 5ILGA 4RIEA 4Y2RA 4C0WA 1KI9A 1IRXA 1YKGA 3LWZA 4J2HA 2BI7A 1XSEA 1AKUA 4K6HA 4OBXA 3W5UA 5I51A 1PW5A 4ZQBA 3REFA 1JKFA 1O5TA 4HY3A 3UGJA 2WRZA 2ZSBA 3ONVA 1Q74A 1X42A 3RK1A 4UBNA 1WX1A 2V3CC 3H8VA 1N5MA 2C2WA 3EHDA 3EQ7A 4KBYA 2ZBRA 1KI3A 4YO7A 3WBFA 3T7KA 2Y1CA 3BAFA 4ZREA 1LSSA 3T9FA 4K9DA 1T26A 5A9RA 1YRAA 1RAFA 1K9SA 2XJ9A 2GBFA 4KNWA 3VNBA 1F60A 1Q3KA 2J46A 1Z4QA 2K6GA 1X7XB 5IN4A 4Z4GA 1GGEA 1FXUA 1S96A 1NM5A 1OQAA 1SC4A 1SD5A 3H18A 3I6QA 5GY7A 3ER6A 3NCHA 4IXDA 5IARA 5K6AA 2F3PA 4TKLA 5G3ZA 3TZCA 3HPRA 4QGGA 2BF4A 3MJHA 5FAKA 2ZITA 3V1LA 5HQTA 3E3LA 1NVVR 1KAEA 1SQ0A 3LNCA 2AK3A 3OEYA 3QEKA 521PA 1Z88A 2I87A 3MCTA 1PJ8A 2C9BA 2HWKA 1XXHA 1HFEL 2D7JA 3I2KA 5ADHA 2EJCA 5I3ZA 1NMYA 1RP1A 1WUHS 3JD4A 4HNUA 2QMYA 3GLQA 1ZSYA 3PJRA 1PT7A 1VJCA 3GJQA 1RC1A 1WTAA 3TQHA 5B3LA 3EXEA 3AUFA 2WSBA 5AJYA 2L69A 2YTZA 2LCIA 3QRWA 1WU8A 2XCRB 1WUKS 3G5AA 4P0TA 3C2QA 1AMNA 4QWWA 4WOJA 1D4AA 3QIVA 2FP3A 2PH7A 3RJ5A 1H5UA 2JJ2D 4O5OA 4CM7A 1EJBA 1TA9A 1O5IA 1ZIXA 3A6ZA 1VGVA 4FLEA 4BBZA 1DX9A 1H3FA 2XVXA 2ZAMA 3NTLA 4PEVA 4W5TA 1LNZA 5EZYB 4MRAA 4ESOA 2RMKA 2BDTA 5AJZA 3MAGA 2Z5LA 4PX2A 1W49A 1JSRA 1MAHA 2BONA 4Z4HA 2W6JD 1W93A 1IYZA 1XD9A 1L7QA 2QG6A 3QEOA 2QPAA 4NU8X 1TA4A 2I1QA 1ULUA 4JT8A 3LU1A 1X7XA 3WKCA 3O8CA 2SNIE 4EH1A 5LP6B 3F5SA 3IUQA 2O4CA 4UATA 5G53C 3B6IA 4BNVA 1R5BA 4X8LA 2IBSA 1OGYA 1YUNA 2PT7A 3KAJA 5K8UA 1I4OA 3TAHA 3D7KA 5F33A 4M38A 1QONA 5EE1A 1Y4DE 3K0EA 4AJHA 1ODTC 1I4LD 4S1OA 3TCNA 4G0YA 3VZDA 2IPOA 4Y0VA 2EWMA 1KZ7B 1XAJA 3SHVA 2QRUA 1U3WA 2DB3A 3O4JA 5IAEA 3MB8A 4KUEA 1XOIA 1LC0A 3CX4A 4XSVA 1TO1E 4QVGA 1U9JA 3UYLA 5IM4A 4J29A 5L3RA 1UBJS 2J6BA 3CWZA 4INJA 4LVOA 3KYJB 2E21A 4UAVA 4HNAB 2O52A 2D8MA 2HV8A 2NOAA 3W1VA 1IJFA 1GL9B 4HB2A 1K89A 2V6MA 1FB5A 1H69A 4PLZA 5COBA 3U9TA 2AYZA 3O03A 2IY7A 5EZYA 4Z54A 1WSDA 1R8QA 1GA4A 2P0AA 1IEVA 5FLEX 2IS4A 1OFHA 2L2QA 1OX5A 3AHGA 5L3SB 1R6XA 2G72A 2XUIA 3ITKA 1XTSA 1UMCB 1ZHFA 3AEKB 1E7SA 1NJ6A 3WGOA 3KUCA 3P20A 3ZUPA 4B3SB 5CLIA 2R7MA 4FQ8A 1CQZA 4JI1B 4P2GA 3ZWBA 2G25A 2LKDA 4EYSA 1VZ2A 3DUWA 1L1QA 1XZNA 1CUVA 3D3EA 4Q18A 4WRRA 4B2PA 3DMTA 1ZK2A 3IQXA 4KLZA 3EPLA 1DX4A 3A10A 5J4KA 3R3JA 4J43A 1UF9A 2QTMA 3G82C 2G1KA 4KGZA 5JZOA 3FG9A 2OCKA 4FP9A 1YASA 4W5JA 4D0NA 2R00C 1RE0A 4HWOA 5KSZA 2IYZA 3F8SA 5E8RA 2BTQB 2FPMA 3GBPA 3UUGA 5I8WA 2DTDA 5EE0A 3E0XA 4RKRA 5KSPA 1FP1D 1GQYA 1ORVA 3KTAA 3OTHA 1ZD8A 1S4MA 3IEVA 1UPUA 5HJ7A 1Q0ZA 1C30B 1MRNA 4QUIA 1TMYA 4L28A 2XGMA 4QKQA 1GYRA 2X2FA 1D2HA 3RYTC 5CHEA 1G17A 5AW6A 1SKBA 3K20A 3CZ5A 3TZLA 5IDQA 3EEYA 2FXVA 4F9TA 1G1AA 3HRKA 5CFNA 3V1NA 4M37A 3HP7A 1N57A 3OHMA 1KYVA 2R79A 4IDFA 4KV7A 4OXKA 5CUQA 5IVKA 2ZYGA 1SD2A 3MRXA 2VLIA 3OPNA 3I8SA 1QHFA 2BF7A 4BNUA 2JLYA 1UUFA 4LY3A 4PX3A 1U3FA 5EP2A 1WXXA 2D4HA 1SCAA 2VWPA 4ZEVA 5L3SA 1RLIA 1E61A 2QYTA 4WFQA 4ZAGA 4BMNA 1GCGA 1L7BA 1UMCA 2C9MA 3AEKA 3DVLA 4HDKB 4O33A 2ECKA 3ORSA 4K8RB 4C3VA 2O1SA 3NRBA 4YJKA 3OTOB 5EHZA 1TO6A 1Y48E 4CEJB 2ZE5A 4XVQA 2A58A 4BVEA 1NMQA 1YH3A 1ZDMA 3DTVB 3FWZA 4C4RA 3DBVO 1O95D 3F6RA 1Q7GA 2IRWA 2PMDA 2O2EA 1JPNA 5B2FA 1EDOA 3RUHA 3KVVA 3PD1A 5AICA 2WUDA 4Q01A 3TS1A 4C0XA 1GDDA 4PYNA 4YGYA 4DANA 2BTQA 3RFUA 2V58A 3K2QA 1PW7A 1W94A 1FDVA 2OCYC 2P1ZA 4ND7A 2V4ZA 3LT4A 3V8VA 4DC1A 5HKBA 1C30A 1CFJA 5JO9A 3AXTA 2GKOA 1M3SA 3JSAA 1FTGA 3EVTA 1T9KA 3NZEA 1G8KA 4QU5A 5FULA 2V0GA 2QJTA 4LXIA 2LWIA 3TW8B 1ZBQA 3SBDA 3LUFA 3LZ6A 3BQ9A 1TM1E 3KSDO 2P2NA 5DWDA 3FOBA 1VG0B 3ZGZA 1WKCA 1Z5ZA 2E55A 2FGJA 1YRQA 1TDJA 1IG0A 4ITVA 4OPMA 3LAWA 2X0KA 2YL2A 3TUZC 3C3AA 3DDOA 1GRRA 2CXPA 2D1RA 3SHTA 3C1OA 2FUEA 1QR6A 1RMQA 1F5SA 2O05A 4HDKA 2M6LA 3SEZA 4ZO9A 3Q85A 3RC1A 1ADYA 2BMVA 3BWDD 1Y1RA 1H8HA 2X0JA 3JZAA 3U16A 3GLTA 4F4DA 2JEOA 2ISQA 2WYVA 1CUUA 2HXYA 3DTVA 3L8HA 5ER6A 4JDUA 1S8NA 1JFTA 2EC5A 4C04A 1EUDB 4LZLA 2YJZA 1PX2A 5DZSA 4EA7A 3JQBA 2IDZA 3EE6A 4QOJA 3WDMA 4YRSA 7ADHA 4FIZA 4LHWA 2AKEA 5IX8A 1VKZA 1WL8A 2YBDA 1KYQA 2VKTA 2QRQA 2JAWA 4XR4A 5IHXA 1XNGA 2ZRBA 4ZV7A 2YUIA 3WHKA 4EHLA 4HWPA 5LYJF 1VLZA 2ANBA 2QL6A 2V74B 3F7NA 3IP7A 5D3ZA 4QYMA 1RSZA 1M66A 4LWPA 3IAHA 3NHAA 2M98A 1AZSC 1KYWA 1NVBA 2FFAA 4XDGA 4DIEA 4HZUB 1W0JA 4JWTA 3RSOA 1JSXA 1LQTA 2YASA 3TW8A 3WQSB 1QV6A 1ZRSA 3OIWA 3GP3A 3ETLA 3HZHA 4BIMA 4Q00A 3GJ7A 1YVDA 2YJ6A 3GFPA 4MV6A 1P9RA 2FOXA 4OO3A 1VCMA 3JYNA 4MMXB 2BL4A 2XUGA 4X1IB 3FYHA 2IEGA 4Q4JB 3VZCA 1T2DA 3M81A 4RV4A 2KLBA 4M7RA 3FWNA 4AO7A 2Y05A 2B2CA 5THXA 3WQRA 2ZPTX 1XTBA 2SHKA 3ZWMA 4K6MA 4E70A 1JI0A 3G5MA 3MS2A 3LK7A 5KWVA 1WDLA 4F4CA 3Q6NA 2FPUA 2PUHA 2LW7A 2GO7A 1BEUB 4Y1GA 3UEOA 1BDIA 3UT0A 3HY4A 1AGRA 3G88A 1JG1A 3OY7A 5CLQA 2WIKA 1M0TA 3HB4X 2NO7A 3SQLA 1NXXA 4GKKB 1G7RA 5DSZA 4NZYA 3KXLA 5C18A 5L6MB 4JT9A 2O1WA 1DG9A 1N2CB 4HN2A 3FZNA 3C3EA 8ABPA 3I0ZA 3UMBA 1PLKA 3LG2A 3NC0C 2R7LA 3RC9A 3GP8A 4P4GA 2UZAA 2RKWA 1N6LA 4DCCA 2DJ5A 3OUTA 1YZLA 5K51A 2N3ZA 3GHYA 3HB7A 1BS9A 3IDZA 4F60A 4HZUA 4PHCA 1QRAA 2R8PA 4J0DA 5H02A 1XEWY 3FPKA 3P4XA 1D3AA 1R10A 2Y1WA 1ZLXA 3CX6A 3E3NA 3ZI0A 3RR2A 3V1TC 4YRZA 2YV2A 3I45A 4EZBA 2HY7A 3OEWA 5FHRA 1J9GA 4MB2A 4OI0A 4UBMA 2DC1A 5I8ZA 5BV1A 2W7TA 5CYFA 2J3EA 2P2ZA 3UWOA 1KZGB 5SYAA 4Q4JA 2X4GA 3OZDA 1S8OA 3V2GA 4G0OA 2FNAA 4ZVKA 3HY3A 2Y6VA 2VPZA 1ZU5A 3O4IA 2X4IA 3LIPA 3ZU5A 1ES9A 3QSYA 2OQVA 3GWZA 1R12A 3A04A 4HH0A 2DT8A 3LLCA 3RQIA 2B1IA 5A62A 3L46A 3D9QX 5LJLA 2VNAA 1U7ZA 1DJOA 5IJ0B 4TXJA 1CZKA 1XNRB 1AUQA 1DPFA 1W4AA 4AP5A 1INLA 5SICE 4LXHA 1TKRA 2OFOA 5ALWA 1N2CA 1U8XX 4MPTA 3JYPA 1CUWA 3MERA 2HJVA 4M8LA 3N8NA 4IDQA 1JRLA 4O4HF 3HDVA 1JWAB 4RCZA 1E3LA 4AJNA 1ZM3A 3NBAA 4IJQA 2Y1DA 5G40A 5L4NA 3D6NB 4KMSA 5LMNB 2UYHA 2B99A 1AHHA 2HX1A 4LFAB 1E0AA 4RF4A 3N1UA 1LDNA 3R5FA 4IDNA 2ZIXB 1DUVG 3BE5A 2LZ0A 1KEWA 1RHMA 3ZV4A 1R4ZA 2QAJA 3FSEA 1SIWA 2FPSA 3SIRA 4YDRA 5LMUB 5JSYA 1G2OA 2EZTA 4WH0A 5F1YA 4F4JA 3KLNA 4O0MA 2PBZA 3SIWA 3VH3A 4XYLA 1NG9A 3CEPB 4N48A 3LCJA 5ALPA 3KWFA 4L22A 1IZZA 3MD0A 3P27A 2HMVA 3A9WA 2QNIA 3D3WB 3OJWA 3T1HB 1EP3B 3W0LB 3Q1LA 4S2EA 5HFNA 2BCEA 5DGXA 2C78A 3E9EA 1WP4A 2BR4A 2ZR7A 1DBQA 1NVAA 3WZMA 3PNLA 4WKGA 1Y9EA 3PU6A 1BVHA 5AR1A 5CCBA 3ND6A 5IJ0A 3OX4A 2HUNA 2SICE 2DWOA 5F7ZA 4BV8A 2IIPA 3HYRA 5LIRA 2F62A 5LC1A 1X74A 1B7GO 2JEZA 2JLBA 3TDKA 4XLZA 4DWWA 4M1WA 4DJEC 2HF8A 4R9NA 4ARAA 4WDQA 2JLUA 1SEVA 4BJ6A 4QU0A 4X5OA 4UM7A 4DLWA 4C4SA 5IDVA 4AIIA 1XCLA 3KFXA 5I01A 2D5CA 1X39A 4M1OA 4OQPA 3EC1A 3WKAA 1KTIA 2NQ8A 2OBNA 4RD1A 3U49A 4YAWA 5EI5A 5CH8A 3B9BA 1X6VA 1LZLA 2MOKA 4X8HA 2VQDA 4WI1A 2CCGA 3OZRA 3SC4A 4A6EA 4BJHB 4KE8A 1FDUA 5E2AA 2FJUA 2G70A 5T7BA 2VNSA 1P4AA 2QTVB 4IHJF 4A2CA 2P7HA 1H2WA 1D8AA 1TVEA 3FUWA 2GEVA 1QVWA 1PT6A 4FFPA 1W1WA 3T5TA 1Y7HA 2IYPA 3PC8A 4GLBA 4XVCA 5C7YA 1EWRA 3ABSB 5HSGA 3D3WA 3WGHA 3C8HA 1UZMA 1UXOA 4M87A 2EZ4A 4MNTA 2BGKA 2BRUC 2F17A 3L02A 1HE1C 1K75A 1R2QA 2IXBA 4ZGWA 4FFDA 5JCXA 2OK7A 3STVA 1PNRA 2C5GA 3D7SA 3JV7A 1PDOA 2IV2X 1PEDA 2YMMA 2A84A 2WK1A 1NLUA 1UBCA 4I4TF 3LX8A 2IYXA 3MW8A 1BHJA 4ACBA 1DAPA 3OSUA 4NC9A 4MX8A 4IAOA 2YOHA 2MMGA 3BZUA 1QIEA 2JGAA 3MTIA 1TAGA 3RVQA 3GZJA 1MV8A 3TW4A 5BOSB 4P3YA 4O4JF 3U26A 5IZCA 3KP1A 2XMGA 2WY2D 5JBIA 5HG0A 1NXSA 1JR4A 1NHWA 1YS1X 4DADA 4F12A 3CY6A 4OI2A 1A98A 4H0CA 5JSQA 3PK0A 1Y6JA 5K0SA 5HJEA 4HQLA 2X8JA 2O2YA 4IOMA 4E3WA 4E2ZA 2YZKA 2L17A 3L7BA 4EMBA 4MCHA 5PNTA 2QTVA 1ZUHA 1C0EA 1GLNA 1RMYA 2DQ4A 2MYTA 2RHGB 2IU0A 3U31A 2CUZA 4YRNA 3D3QA 4INZA 4Z7QB 2PGDA 3PJGA 2VBGA 1ABBA 1L7OA 4JYCA 5I7AA 2WOJA 4CM8B 4WEOA 1AHNA 3L0ZA 2X8AA 1GGHA 1U7HA 4Q3KA 3CVUA 2WFLB 4NOJA 1IRIA 1PZXA 1IVNA 2X15A 1H23A 3UJPA 5LSAA 5DB4A 2CLKB 4CFZA 4EKNB 4US1R 3E9QA 4AF6A 2OC4A 1NC3A 4JGBA 4L5CA 2BD0A 2XW6A 1YCGA 1LLDA 3D7LA 1VE1A 3THWB 2W6NA 1NOKA 1Z7YA 1K92A 3DMNA 5FFFA 5BOSA 1BMDA 4HUQB 1Z37A 3TPCA 3WMGA 4UTPA 2RHCA 1CY8A 3EVBA 5LB2A 3IPCA 3AHIA 3VZSA 4AMUA 1Y8QB 1KPGA 3FPGA 5GJBA 3U9LA 1KE2A 4Z7JA 1CU1A 3MJVA 3QLVC 1CY7A 1GNVA 3H87A 4QXAA 4I66A 4OKNA 5J2UF 4O0LA 2PZGA 1ZINA 3O2NA 2VQSA 4JZKA 1JDTA 3E8SA 3U44A 5CFRA 1P29A 3L4KA 5LP6A 2IOYA 1QHIA 1ZD3A 2ZT6A 2QUKA 1KKLA 2CFIA 3DZHA 2R5NA 3UV7A 1J7JA 4PAOA 1V4NA 1ZOPA 1G21E 1KJYA 5JMOA 5KX5B 1U99A 3QZUA 1K7CA 4CM8A 2J7PA 3TQSA 5I7WA 1JLKA 1E7RA 3GBSA 5TEVA 4DCGA 1DXQA 2OP1A 3WFIA 3ECCA 4BVGA 2WFLA 4CQJA 3VX3A 3D3JA 5CCXA 1CNMA 4LYYA 1TPZA 5ECDA 5J47A 2ONKA 421PA 1IOLA 3WGTA 5JYDA 1G4AE 3I0MA 3WL7A 3GVPA 3T0FA 2AFIE 4DB2A 1N5LA 1JFVA 2G77B 3GFFA 4HUQA 1LV7A 2IOFK 3PKIA 4OP3A 1DC4A 5JNSA 5JQWA 1GGKA 1IDN1 1VBFA 4BXOB 5LYYA 2UVDA 2WWYA 3CPHA 1Y8QA 4II3A 3JZIA 3QI7A 1L6IA 1S01A 3FFAA 3GZ4A 2J6IA 5F2EA 5K0ZA 1U11A 3FNRA 3HVRA 2RKOA 5CFPA 4X6XA 2X8LA 1LBSA 2IL1A 4W8GA 4US2R 4JI5B 1JIUA 2WJ4A 3LYAA 3GF4A 4RWZA 1CJBA 1E6LA 2CJXA 2XEXA 3EFHA 2QTBA 4KJZA 5B1YA 2XYGA 2IK8A 4PLCA 5FUYA 5JU6A 3SM3A 4XE5A 2J59A 5B7PA 1DQNA 1MIHA 2HIMA 1EUZA 3EBPA 1YF3A 2AGVA 1FQKA 1S02A 2I9PA 2VK4A 4QDUA 4NYJR 5BV2P 5AO9A 2I3ZA 4Z0TA 5JCOC 3OUUA 1NUPA 1ZN9A 5KX5A 5CG1A 2DHRA 3FMPB 2EGUA 2GPTA 3TI7A 4ALLA 3N2LA 3PE3A 3L8GA 3P4UA 4XTRA 1L4MA 3HCOA 1SKAA 2FSSA 3K73O 4QODA 3RIMA 3QENA 3GLHE 2XVMA 3AG5A 3RIEA 5C4MA 3I9KA 3S8YA 1MN6A 5E4JA 1GG8A 4LUCA 4EPRA 1HE4A 1MEJA 3SJ7A 2C5HA 4CWAA 5DU2A 1PJLA 4CLRB 1T4DA 3G2HA 5B53A 2Z04A 3SX4A 4M99A 1IWOA 1WTCA 4L9RA 5E1OA 4XM1A 2DQYA 3IO5A 3WISA 4RANA 4BXOA 1H2AS 1W29A 2GZDA 3EGVA 3N8GA 1QH9A 1EHYA 2C3UA 5ALTA 2XYQA 3FFBA 4X63A 4MRNA 4D4IA 3B85A 5HBGA 1IQUA 4I8XA 2RH9B 3JQCA 3TNJA 4ALKA 1IOZA 3V4LA 5TIIA 4MDEA 1GDTA 1L8XA 1VP9A 4LGVA 4KQHA 1KMMA 5L40A 5U4QA 2YWCA 1CY6A 2W8BB 3DONA 1ZVVA 2AEMA 1PL8A 5F2OA 3UMJA 1YO6A 3D2BA 4LDZA 2WD9A 3DH0A 1W36D 4ZCTA 5BNFA 1GU7A 3DKPA 3N6RA 4CLHA 5HF5A 2X9LA 3GEEA 3V8PA 4MJLA 1RXYA 4TYYA 1E5LA 2YMPA 7MHTA 2QMEA 1C8BA 2P77A 3K8YA 4FI3F 4WACA 5BV8A 3ZY6A 5HRCA 5BUSA 2H0AA 1IJBA 1CUHA 4N1AA 2XTMA 1QYXA 2ZYDA 4TVBA 3DE5X 4AWBA 4C05A 4KNYA 1K4MA 4JL6A 5CIYA 3HCFA 4X3CA 3VNRA 1DAKA 2RBGA 2XLBA 2GRJA 3EOZA 5EMKA 5JNWA 2HSJA 1RIFA 2IQIA 1TIBA 2ZRLA 3K70B 5H3CA 2WTMA 4FHFA 3OJXA 2YRFA 4KIFA 1Y7PA 2W6CX 3WSWA 4CLRA 4EHNA 1NR1A 3QE4A 4QQNA 3BFKA 1LQ2A 3T7EA 2B1JA 5JXHA 1XMPA 3X2SA 4WN9B 2CMFA 1Y8RB 2GSDA 1SEPA 3AT1A 3BGDA 3IODA 3KZOA 2BC9A 4KLCA 2Z5GA 4Z8XA 4ZVRA 1W5FA 1Y81A 4NU0A 3EMDA 1VYVA 2X41A 3J81A 2BCGY 4RMNA 1FNBA 3ROTA 4BZZA 5T4BA 4DR1B 3NR2A 2YWBA 3B6KA 3B1XA 4AXXA 4EMTA 4N6NA 2UZ4A 1LXCA 3H83A 3ZY5A 4BQSA 4M9ZA 2VC2B 2ZCUA 4RF3A 3U3JA 3WMWA 1PZHA 1X8XA 2FPGB 3IQHX 1PP4A 3WRXC 2W8BA 3AUKA 3QOXA 3VPDA 1OWMA 4CIDA 4NCAA 4CGZA 1Z4NA 1DLJA 2O9JA 4P54A 4NX2A 4JL5A 1AJEA 2JH3A 1KJQA 2H11A 1K7YA 3GJ5A 1XLUA 2ACVA 3NASA 2D0PB 4YAFA 2PWZA 2QRGA 4ZANA 3EVGA 1D07A 1P9LA 4EKIA 5AW2A 1G5FA 5CLGA 2KBFA 3HCAA 1T3SA 2IPMA 2A92A 2NTNA 3MAAC 1LDMA 2J0SA 1EDZA 2CDRA 1QLWA 3B1FA 2C58A 3WYCA 3IIKA 3QWBA 5FTMA 4RIHA 2ZDGA 4A27A 2F8SA 2GF0A 3NHMA 3UA4A 4K87A 4W1PA 2H59A 3CR8A 3FYSA 1C0IA 2NYVA 5T64A 3EEIA 1DG1G 1GADO 3IIIA 4R16A 2Q6LA 3KJGA 1V7CA 2H1FA 3QMWA 3QSGA 3QXXA 5FOSA 1CTQA 2OGWA 3EULA 1TL7C 4WN9A 3CNBA 1Y8RA 1BEEA 3I9MA 3N2KB 1XU9A 1E7YA 1CJVC 1XZIA 2HBYA 3TAXA 1RKUA 2YW2A 3LC0A 1SPBS 1Y3IA 4EYOA 3SVZA 4BNGA 1ZMOA 2OO5A 3K0CC 4UJ5A 4Z2AA 5C31A 3T7AA 1C7QA 2RK4A 1I01A 2EZ8A 3NP9A 1J8YF 2HLDA 4RXMA 1ENOA 1I51A 1Q2XA 1KQPA 1Y1PA 3N28A 4C2UA 1LX6A 4U8HA 3M83A 1VLMA 2DFNA 2NSDA 3MYYA 4ZZ1A 5JHHB 1MKYA 5JAHA 1N6OA 5AW8A 2FPGA 1VMAA 4R05A 5FI5A 3RAEC 3HSKA 4KDCA 3L0YA 3RF7A 5CG2A 1DKQA 1DQZA 3ABIA 4JNCA 1YR1A 3ZLTA 3L7LA 2CYAA 4KE7A 1A7JA 3RGWS 1P5HA 4F84A 1PS8A 3FBGA 3R1IA 2VAMA 2QD4A 2Y1KA 3CLTD 5AHWA 1KETA 2Z3WA 1UXGA 1ZCZA 3GJXC 2TECE 2XKKA 4G56A 1P0FA 1U1DA 4MYTA 3SZGA 2HF7A 4J7AA 3UMVA 4BJ5A 4C0SA 1JR6A 4PS0A 4NBWA 5CK4A 3PL1A 4C5AA 1P6UA 4KCGA 2ASEA 1J9EA 4YQFA 1MFPA 3V4VB 3NNDA 1E9VA 4ZHQB 4X7PA 4DLXA 4N41A 2EEZA 3AF2A 2ZKLA 1KP9A 1A9QA 2PGIA 1NVFA 3HR8A 3PZRA 1CEYA 4AD8A 4TXMA 3VDMA 1Q84A 4ZCSA 3DFKA 3N2KA 3NYRA 4ZU3A 2CV0A 1L4HA 2VUIB 3H3JA 1Z5NA 3L93A 1N3YA 1IHYA 1XI2A 5F7OA 2CUTA 3DCIA 5KC8A 2GM4A 3BSYA 2WE8A 2D6FA 3DS8A 1T43A 4JJ4A 2RGAA 3KNZA 2AMJA 4YI5A 3VTAA 3MLEA 4FGLA 4YT4A 4AYTA 5CNJA 5DEOA 2A9FA 5IUNC 1GTL1 5AP9A 1XQ9A 3PT5A 1YUMA 3ND8A 4HAIA 5AQ1A 2BJVA 4MIOA 1XZHA 4H0NA 4WLVA 1RRKA 1I7PA 5GONB 4CFYA 9ABPA 1NXOA 3GJRA 1ZN7A 2BUCA 4G0ZA 4K28A 3A1VA 3W4IA 4B84A 4RAOA 3HN6A 5GAJA 1W30A 1R9JA 3F6CA 3ABZA 3GO4A 2IYFA 3IT2A 2GAJA 5IVHA 1KEUA 1E2GA 1YDGA 1MQ9A 1OBCA 1E2HA 3E84A 3KQWA 4QC2A 2W2NA 5EEGA 3UAXA 1T35A 3LHKA 1VYTA 2OSBA 4B8ZA 4ZHQA 1CERA 1NSTA 4EYKA 3FDFA 4DV7B 3HBFA 4OHOA 4H3SA 4N0EA 2Y3IA 3UOAB 1R6AA 1NU6A 3D4OA 3FTNA 3GFTA 2C2HA