2IYTA

Shikimate kinase from mycobacterium tuberculosis in unliganded state, open lid (conf. a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
175
structure length
175
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 64
structure length 175
sequence length 175
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iytA00
1U99A 1KMHB 2FSFA 1MO3A 2AWOA 4B75A 4KSBA 1U2RA 2ZS8A 1XB2A 4QBGB 1COWA 1OLOA 2F43B 1FL9A 3IKJA 3NIBA 4JKYA 3TMKA 4DCNA 3K9LA 1M74A 2VP6A 3TRFA 2AN9A 3B9PA 4DLYA 2RCNA 1GVNB 2D06A 2EQBA 3BGWA 1YZLA 4PHHA 1LY1A 4TLDA 4WAUA 2IK8A 4EDHA 3K0SA 2C96A 1ZNYA 4B35A 3AF2A 3CUEF 3CKLA 2FH5B 4LV6A 5KPDA 3CLVA 3IBYA 4GL2A 1R0WA 4WOPA 2O8FB 2Q6TA 1M7HA 5CB8A 3FTQA 5F9HA 4KLZA 2ZR7A 2P6NA 2H7VA 3ZIAA 2YOFA 4Q00A 1KI8A 3SOPA 3BD9A 2X1VA 2KE5A 1KY3A 1I4TD 2BOVA 4HATA 1IONA 1JQJC 2EYUA 2AFIE 3HDTA 1KGDA 1R10A 3N5CA 2BDTA 3DO6A 2XSZA 1W49A 4IVQA 1KDRA 2JLZA 1QZXA 2ZVPX 4Q9KA 2ZYUX 4M1SA 3FKSD 4TLBA 4JBWA 4V0LA 3QKRA 3UPUA 3DZDA 2GF9A 3NBYC 3I73A 4EQ6B 4YDSA 1H65A 3VQTA 1IQPA 2WTUA 3AKEA 3L8ZA 4AC9A 2ZETA 3RSLA 2J7PD 4Y0VA 2D74A 2VP0A 3K0CC 3OAAA 3CWZA 4URWR 3WHKA 4B2IA 4B71A 1MRSA 2F3TA 3KJHA 4DZZA 3ZVNA 3JZMA 2HT1A 2FV8A 3REFA 4BEBA 4G5RA 4EAQA 3SJCA 4A6PA 2IYXA 3DOFA 5E4FA 1QG2A 2DCUA 1TF7A 3AP3A 4A92A 2BM1A 5JEDA 5J40A 2H17A 5EUQB 2VEDA 1ZC3A 3GLIB 1DTSA 2ZE7A 3PEVA 3X1DA 5AWFC 2GJ8A 3KL4A 4NYIQ 2PJRA 1ESNA 1AN0A 3QY0A 3KX2A 3L82B 3U4QA 4BFVA 1Z6AA 3GLFA 3A6PC 3BORA 2C9YA 2O8EA 3RSOA 1E2PA 5HPYB 5FFMA 4Q1FA 4V03A 2QAGB 1R0ZA 3ZVMA 2E9SA 1FFHA 2OEPA 1LW7A 1R5BA 2Z5FA 3ND9A 5TARA 4D4MA 1NF3A 4CVNA 3EPKA 4CT5A 1CR4A 4TN1A 4C4PA 4KFUA 1G8YA 3QF7A 1P73A 4PXAA 1LF0A 4NH0A 3LAWA 4MRRA 4F4CA 4PPNA 2WJYA 1KO5A 1UBEA 1E2EA 4TQAA 4DSTA 1NVVQ 2QPTA 3OIWA 1N6IA 3FMPB 1ZVQA 2QG6A 1T3SA 1GDDA 1YR7A 4M1TA 2NZ8A 2J7KA 4JT4A 4PANA 1E69A 2FN4A 4F38A 4TMZA 2ZUBA 1E9DA 2YNMA 3SC3A 4EPTA 4TZ6A 4DLWA 4TSFA 4DBLC 1WB9A 1E79D 5JJIA 2YOGA 4LC0A 4LRWA 4AG5A 2J0SA 3GEHA 1MO6A 421PA 2V7QA 4GT1A 4LHZA 2WMNB 4TTRA 3CNLA 2JJ2D 1OFUX 2DFLA 1JALA 4FMDB 3SR0A 4IVRA 4GBMA 3SYNA 4GOKA 5DSZA 3W6NA 1E9AA 4HLUA 4CYMA 4KCGA 5FBRB 1OH7A 3K09A 4A6XA 5DNYB 2QP4A 1KAGA 3HPRA 1YRAA 4URUR 4JSTA 4Q4HB 2AD1A 2R65A 1N5KA 1HE1C 2ZI4A 3IIJA 4BASA 1EFRD 1Q22A 2DWPA 2CLSA 3KB1A 3C8UA 4JVLA 2R9VA 3KB2A 1ZRHA 4LYAA 3FHTA 2PJZA 4TMWA 1CJMA 2QY9A 4QHSA 2JDID 1FUUA 3AUYA 3I5XA 3U44B 3EASA 3U61B 5FTLA 3QEOA 1YR9A 1JBKA 3UWOA 4ABYA 4P4UA 4R7ZA 2WV9A 3NKVA 3OEHA 4HAXA 5EE5B 4B76A 5C4MA 4M1OA 2WWWA 1U9IC 1FNNA 1KMHA 3H4MA 3KQLA 3DM9B 4TYNA 4RKFA 1VHLA 1T3HA 3L0OA 4XJXA 2O8FA 4C0SA 4NONA 5DE3A 1RKBA 4ASUA 5JS8A 2RB4A 2J0UA 3A58B 3WNCA 1AQUA 1IXZA 4PHGA 4A0RA 2QI9C 1CRPA 1F2TA 1U8YA 1T91A 5FUYA 4DSUA 2XXAA 4UNNA 1ZNXA 2EFEB 3WYAA 4PAQA 3A4MA 1XBTA 4TL9A 1BS1A 3TSWA 4BFUA 4URVR 3U3MA 1G7SA 4RCZA 3NVAA 1Z06A 3ADBA 3QIAA 2OG2A 3HU3A 2NZJA 4G5SA 4KV9A 2NO7A 5BN4A 2O8DA 3P4XA 3B78A 4NTZA 2QUZA 2PMKA 2VO1A 4TQ9A 4P0TA 2ODNA 3B9QA 1VECA 1NJFA 2QT0A 3SYLA 4D82A 2CVFA 1G8FA 1ESMA 4JYCA 1VYTA 5FTMA 2YKGA 3FYHA 3PITA 4GZMA 1HE8B 4LYJA 1KOFA 1G3UA 4FMDF 1M7GA 1KMQA 3KXLA 2IEYA 2VPPA 3W8RA 1W5SA 3MJRA 2D7CA 2NO6A 4B48A 3PUVA 3VR4A 3U2QA 5UKDA 4DVGA 5K8IA 2HJVA 1HV8A 2B8WA 1E2QA 2RH5A 4HDOB 4BRUA 3DEFA 1E2FA 4QNRA 3GLFB 2WJJA 3DZ8A 5FTNA 1JXMA 1TUIA 3PEWA 1DBSA 4BFWA 4TLCA 4TZ0A 3M4YA 1N6OA 3EIQA 3LBNA 1S3GA 1Z29A 2OLJA 5KNDA 4W9MC 2KBFA 1HEIA 4KO8A 3RS7A 1NRJB 3VR6A 4Y0AA 4DDWA 1IN4A 3QBVA 1Z2AA 1G3MA 1OB5A 4XTCS 821PA 1IM2A 4CEHA 5HCNA 2C77A 1I4DD 3K09C 3MWLA 4A8JB 5B57C 1JPNA 4HDQB 4NKRA 3TK1A 2JLXA 1VCOA 1UBFA 2KWIA 1CR1A 3CX8A 4R71A 1ZYUA 4C9BA 5FOWA 4KITB 2QA5A 2ZS9A 3DMNA 1R0YA 1VKJA 4UJ5A 4ERNA 3A1WA 3QI2A 2ZEJA 1R2QA 3RHFA 1XEWY 5JLJA 4IJMA 3THWB 1N0UA 4G5QA 4B44A 4Q21A 3PQCA 2GZAA 3OE7A 1BMFD 4J0QA 1IN5A 3AF4A 2BBSA 2HYDA 2GVZC 1MABB 3LQQA 1N0VC 3CR7A 1CLUA 2PBRA 1J99A 1NKSA 2RKOA 2GNOA 3O8BA 4MITA 1L7VC 1CR0A 4Q1DA 2CBZA 5CM9C 3A37A 1H8HD 4CEJA 1D2MA 3KQHA 3HPQA 1H8EA 2P5SA 4FMBB 1MO4A 4DB4A 1S1CA 1KZGB 4BFTA 4DLXA 2QSZA 3EZ9A 5L3RA 3TW4A 2FPKA 3T5GA 4NCIA 1GRNA 3B7GA 1SVWA 4KFTA 1WXQA 1YRBA 2IXFA 5DN6D 1GNRA 2IS6A 4H1UA 3FMOB 4JLOA 2DHRA 3QQ5A 3QUSA 2TMKA 4P31A 4PSVA 4L9SA 3SZRA 1ZW6A 4A0GA 1KI1A 2QORA 4TTPA 3GLHB 1PUIA 2ZIAA 1L4YA 4PR0A 1D2EA 3QE0A 4UQOA 1KI6A 4FWIB 1VG1A 2OESA 1FUKA 2CLDX 1OIWA 5HKKD 4F92B 3ZZTA 2HLDA 5AUQA 1IXRC 3P26A 4LOAA 1SKQA 3X1XA 1W36D 8OHMA 1SVMA 3AKDA 1EK0A 1KI2A 3KXIA 3PV0A 1P72A 3ZD7A 1GAJA 4TLEA 4TSFD 1GRQA 2EWVA 3L8YA 1T5LA 2EWWA 3VHXA 5J4LA 3GJ7A 2OHFA 2YOHA 3CH5A 3NTUA 5HE8A 2WWHA 1EG7A 2V7QD 5KSOA 2CJWA 2G3YA 5LPNA 1XNJA 2B6HA 5LBIA 4YC7A 4KU4A 4GSYA 1ZCAA 3FFAA 4OI1A 5JHGB 5A5GA 3IQWA 1K6MA 3KUCA 4I1UA 3E1SA 4QGAA 1D9ZA 1RE0A 2ZRPA 1K5GA 3NBXX 4WW0A 4ZI3A 3AEZA 1SKYE 1AK2A 4Q48A 1UJ2A 1ZU4A 3R8CA 3U3OA 4A2PA 2BM0A 1L2TA 5AJYA 4IDQA 3UMRA 2ZR0A 5JMTA 5KU1A 5FBVB 5TXGA 3NH6A 3VKHA 2OUKA 1GIAA 1T0HB 4JZKA 3FFBA 2PL3A 4MGZR 1OH6A 2XZLA 1HQYE 4I1OA 4LBWA 2BEJA 1UKVY 1XTIA 2GDJA 2JAQA 2DR3A 4WZ6A 2XB2A 1WQ1R 2QBYA 1EX6A 1Q3HA 2W83A 4Q7MB 3K9GA 1E6CA 4JBXA 4C2UA 2GESA 5H70A 3X1WA 1E2NA 3CNOA 5JCPA 1GUAA 4WXPA 3U44A 3KDSE 3D6TB 1JXOA 5EP2A 3GJ6A 5HCIA 1G9XA 1XF9A 5J4HA 2IS2A 4HB3A 4QGGA 3DKPA 4MH0R 3WXMA 1P4SA 2UZIR 2YC2C 4GMXA 3EW9A 1E0KA 3DMDA 1NLZA 4TYQA 2G83A 2QTVB 4OKSA 2BCJQ 1GSIA 4PAMA 2ZJ5A 2ZE6A 4Q7KA 3TE6A 4KBFA 3GFOA 2MSEB 4LPKA 1AS0A 3BB3A 4OQMA 1YU9A 3I92A 1OJLA 1GL7A 1Z0AA 5JSZA 4PZYA 1UBGA 1HH4A 3C41J 4Q9JA 2QP3A 3VR1A 2ZU0C 5A0FA 4E5UA 1NI3A 4B2LA 2Q9CA 1Z0DA 5J4VA 3HP1A 3ZD6A 4OHXA 4LCBA 2V8OA 1DVRA 1E9RA 2LCFA 4NYJQ 5CK4A 2QSYA 1ZD1A 2Z43A 3CBQA 3THWA 1KKMA 4C7OA 4QGFA 5J47A 1NIJA 2HYIC 1UAAA 2VBCA 4F4IA 4B33A 3O8RA 4N0EA 4L16A 5FPKA 1VTKA 3T1QA 1R4AA 4IOLA 2J7PA 3ASZA 4PQFA 1L4UA 1XCMA 3SBEA 1G1MA 1KHTA 2OCYC 5K8LA 1E0AA 4ZCMA 2IYZA 3SE0A 3T06B 1AIPA 1XXHA 2PCJA 5A4JA 4M9SA 1NVVR 5JECA 3AM1A 1U98A 2ZRCA 1VCNA 4JSYA 3AP1A 4IDOA 5G3ZA 3TAHA 3BJIC 2CNWD 3HYTA 1XPOA 2C99A 2GCOA 2DFNA 3T15A 5J4KA 2FDCA 1L8QA 2R6FA 1BO6A 4KJZA 4BLTA 5HR5A 3NWJA 3JZAA 3T1OA 2JLWA 2EFHB 4MKFA 3NBFA 1NMYA 1OIVA 2ANBA 3E2IA 4NBSA 4LJYA 4DUGA 3RRYA 3NC1C 3AVWA 2ZRMA 4CF7A 4ESHA 3QPVA 2KJQA 5LD2B 5GJCA 3RS0A 3EPHA 1LS1A 2OM2A 3RC8A 4LPSA 4LYFA 2FEOA 4XSHA 1A4RA 1ODFA 4DEXA 4LZZA 2ZRIA 4DLTA 3HR7A 4V02A 4IEIA 1E96A 3B1XA 3T12A 1KK2A 1W4AA 1E2DA 3B60A 2CL6X 4PTLA 1E9CA 2JJ8A 1AKEA 2HXYA 2A78A 2ZRFA 4G01B 1X6VA 4OK6A 1QBKC 1HT1E 1X1SA 1Z47A 4OHWA 1KY2A 1WP9A 3EX7C 1E3MA 1XD8A 3IGFA 5AUOB 1Q57A 1CIPA 2QEQA 1ZCBA 3O47A 1OE0A 1US8A 5EXSA 1AKYA 4RKEA 4US2R 1CTQA 3DPUA 4RFSB 1VG0B 2Z4SA 1C4OA 3BBPA 3IQXA 4DEYA 4PZZA 4BZPA 1N5LA 3KKQA 1ZIOA 4FINA 4QRHA 5CLQA 1KDTA 3LD9A 3QNUA 2GCOB 3L0IB 3MWKA 1S1MA 1IY1A 4EFLA 2CHQA 4LJ4A 4ON9A 4DIDA 3FOZA 1GL6A 1X86B 2O5VA 3FB4A 4ARZB 4OQLA 3QJYA 2OFXA 2QNRA 4GFDA 2BBWA 1GTVA 3QPUA 2J0UB 3T1TA 1N2CE 3DM5A 4U02A 4DDUA 3WHLA 1TUEA 4RY2A 4EJSC 1XP8A 1DAGA 4JLNA 4IVPA 1ZM7A 2LKCA 2YWHA 2XGJA 3Q9LA 4TMXA 2QM8A 2VHTA 4TQUS 2IWHA 4ZDJA 2YJTD 1X8JA 2OAP1 1S9DA 2F6RA 3IPXA 4X8MA 4DCUA 4DLSA 4KYUA 5L3QB 4Q4AB 1AQYA 2WPDA 5HKKA 4PPGA 1DAHA 4PHFA 1Y63A 3DL0A 3K9NA 3KXKA 1AS3A 3RRMA 4M21A 3SQXA 4POAA 1CRQA 2CE7A 4ILEA 1Q12A 3ECCA 1SHZA 2OCPA 5K8TA 1P3JA 2VQSA 2PX3A 2R62A 3CO5A 1Z08A 1C1YA 1GKUB 2Q21A 1G3IA 1D5CA 2EFDB 2HV8A 4TYYA 4QC2A 2QT1A 4B47A 2RHDA 5KYKA 3K0FA 2G1JA 3OEHD 4IDPA 4RD0A 4QHTA 3BFXA 3AGPA 4FCTA 4GMDA 4BLPA 4IHQA 1LVGA 3QBTA 2MMGA 2EW1A 5EE0A 3VU9B 4A15A 4KSCA 1WRBA 1XXHE 3MJHA 2GEUA 3EG5A 4DCVA 4DCTA 1UKYA 2XITA 2HDNB 3CIOA 2BMFA 1OXSC 3BFKA 2O8CA 3H86A 4CW7A 2O0HA 1HT2E 3O8CA 1VYUA 3UKDA 4KYIB 3SU8A 1E1QD 1ZNZA 1WBBA 2P6UA 2GZHA 1ELOA 4K46A 2OV2A 4JVNA 2ZSDA 1G5PA 3AGQA 1OF1A 4EFNA 4E07A 2Z83A 4GDFA 3GJ0A 4AG6A 2CHGA 5F2EA 2IYUA 1EXMA 3RS4A 3ZS8A 4AK9A 1GITA 4PPFA 4Q66C 2P6RA 2VH5R 1GM5A 5EJEA 2AXNA 4D80A 3WBKA 4KFSA 2QP9X 3LX5A 4HLQB 4IOJA 2CXXA 2FGKA 2RGNA 1GKYA 4QXAA 4IKEA 2QMUA 1UBCA 5DI3B 4XTRA 4Q03A 1TTTA 3AQ4A 1E4VA 1Z6XA 1E94E 3FKSA 4ARZA 4TMKA 2R8RA 4CEHB 1SGWA 1KNXA 2ZJZA 4TYWA 2O8EB 1F60A 3CX7A 1M7BA 4B3CA 4B3XA 2FZLA 4IW3B 2JLQA 4YDHB 2CHVA 2VHQA 3AVTA 1XPRA 1G19A 1YZUA 5FPTA 4F4JA 2FPMA 3AVPA 1JR3E 3B85A 4NYIR 2R6CA 1QHXA 3HU1A 4Q9LA 2DBYA 3CNNA 5FUXA 2X77A 3BH7A 2KBEA 1J90A 4W5HA 3BH0A 5DGXA 2KSQA 4R2HA 4A2QA 2JLUA 5TMPA 1T6NA 4Z1MD 5FUWA 4NMMA 1T8UA 4UKDA 3X1YA 1RZ3A 1J8YF 3O8DA 2QQEA 2UZ3A 3A36A 2F55A 2CCJA 1Q1ZA 2EYQA 2J5XA 1KO1A 3SJBA 1G18A 1FP6A 1NL3A 1FP7A 1KK1A 3FWYA 1E2IA 3GD7A 1T0JB 4FMCB 1E1RA 4HDCA 4TLAA 5FPYA 5JI3E 3NEJA 4D0LB 1XJQA 4II7A 1VHTA 1KK0A 2WKRA 5TB5A 1IHUA 2FE4A 3ZLJA 5JHHB 2GXQA 2J87A 4NHOA 1EFTA 4NL4H 1XTKA 1A2KC 3Q3JB 2DY1A 4QBFA 1CJVC 1JAHA 1LTQA 1TPZA 4JLVA 1SXJA 2Z6VA 2AWNA 2ODWA 4Q02A 2GEDA 4AKGA 4BRWA 2VA8A 1UDWA 2ZRHA 4R98A 4NPHA 2PEYA 2ZYWX 1VMAA 1OB2A 4KBGA 2QGNA 5FBWB 1QVAA 3VNUA 1NN1A 3KQUA 2VF7A 5DO9A 1RYHA 4QJ4A 4DDVA 2DYKA 4OYHA 3CWQA 4D26A 1ZP6A 2QAJA 4CRWB 4I1SA 1P5ZB 2O52A 1Q21A 4M9ZA 4LHYA 4OQNA 4ZPXA 3GJ8A 4HUQA 1MH1A 1ETUA 3Q7QA 4A36A 3N2EA 1XU4A 4HUTA 2WIBA 1OV4A 4NCKA 4IXMA 5JZVA 5LD2C 1S0UA 5D3MA 4BECA 3GLGE 5FR1A 1P75A 2C5LA 5FOVA 721PA 2IHBA 3ZDQA 3RYTC 1XMSA 3I8SA 4OI0A 1OKKD 4EPXA 2QMHA 1II0A 3TR0A 1OIXA 3F5FA 5CB6A 3THYB 3WY9A 2YHSA 1NMXA 4U00A 3K0FB 1J7KA 2GBLA 1XCGB 3N70A 2D7DA 1KO4A 3IPYA 4D0NA 1DO2A 1NLYA 1A2BA 2GCPA 5IHPA 1ZM9A 5G53C 2AXPA 3K9HA 5JRJA 2XEXA 1TQ6A 1AZSC 3CF6R 4BFSA 2YC4C 1PLLA 1TNDA 3SDZA 3BRWD 1Z3IX 1IAQA 1DADA 3NEYA 4ITRC 4EPVA 4RZ3A 2ZREA 3K0CA 3TNFA 1GKIA 1QHHA 3I1FA 4DC9A 5AUPB 1VCMA 3DDCA 3UANA 4B6FA 1P9NA 1VPLA 2G77B 4FIDA 3IIKA 3X2SA 4IDHA 4Q7LA 3K70C 4RSGA 2IW3A 2BKEA 5CIWA 4DLZA 1W7AA 3U60B 3R7WB 2WICA 2JJ1D 1A5TA 2ZI9A 1RRPA 2GEVA 1BH2A 2XAUA 1HURA 3JVVA 2VP9A 3A8TA 5JWOA 1N6LA 1XX6A 2OSBA 2G0TA 4LJ6A 1AA9A 1KJZA 4TL7A 3OESA 2ATVA 2ZR9A 4URYR 4URZR 2OCBA 3K53A 5EUMA 2XOKD 2QAGA 1Q44A 4IDNA 1XTQA 1II9A 4Q01A 2O8DB 1RJ9B 1J2JA 1O3YA 1PJRA 2O8BB 2JA1A 1NG9A 5AUNB 1E9BA 4PO9A 1YZGA 2ZRDA 1PLJA 3DHWC 4F91B 5KOYA 2A5JA 2B21A 4R2IA 5KDOA 3WMFA 3AP2A 5FPHA 5BN3A 3PIRA 4PFSA 1ONBA 2BIFA 5JS7A 2GRJA 1G291 1RC8A 4LI0A 4JL8A 5HE9A 4YQFA 4US0R 1W2HA 4BPBA 1FNMA 5G40A 1OYYA 1XTSA 2F1JA 3PENA 4ZCLA 1E1QA 5F9FA 1GL9B 3B2EA 2FX3A 1ZC4A 3AVOA 5E7IA 4QNMA 2VP4A 5H8WA 3BXZA 2WVJA 1V5WA 2I4IA 1R8QA 4P32A 1DARA 2J0QA 2IYRA 2XNDA 5KTYA 1F5NA 3QENA 4NCHA 3U6BA 3K0EA 2QRNA 4RD4A 2IT1A 2AL7A 2IHYA 1RJ9A 4FCWA 1EWRA 2YWGA 1KSGA 3PUWA 4YMWA 3G0HA 4DLVA 5FH9A 2ZAOA 3S1AB 3ZYCA 4V0OA 5E95A 5JWHA 4WA7A 2FFHA 4BWYA 4RD2A 1RIFA 1UDXA 1R0XA 4BUJA 3LW8A 1P7CA 4HB4A 2VHCA 1IY2A 1ZBDA 3AF1A 4NYJR 3RAPR 2DWOA 1HYQA 4DDTA 2VIIA 4CZ2A 5EXPA 1E2JA 2QROA 2NOAA 4OI4A 1QF9A 1XD2B 2IF0A 4GRAA 3BWDD 5HTKA 2IL1A 4WIAA 1DO0A 1VIAA 1AZTA 1Q1EA 1UKEA 1T5IA 1KSFX 1KIMA 2CNWA 2VSOA 4G0NA 5JSZB 2XZPA 1SVSA 4Z1MA 3UG6A 1E32A 1W0JA 4EJSB 4O2RA 1K8RA 3RWOA 1A7JA 3AB3A 4BZQA 1LFDB 1N6HA 3NH9A 1M34E 4LBVA 3U3RA 1N3BA 621PA 3THXA 1VG9B 3CM0A 2QRZA 4OHYA 4D0GA 4DSNA 1NJGA 1U81A 1CULC 1FX0B 3MG9A 5CLLA 1H8HA 5DHFA 2A7QA 1G41A 1JEEA 2GETA 2JGNA 4BLSA 3AVVA 5DIFA 4AD8A 2NG1A 3P4YA 3QKSB 4ZDIA 2GHIA 5GVRA 3QKUA 1W47A 1X8LA 1AS2A 4I81A 4HUQB 2BMEA 4C0QC 3QG5A 1NP6A 2YZ2A 1HA3A 3KFXA 2GA8A 3RABA 4QM6A 3MD0A 4TT3A 3KZ1E 4Q47A 2CMKA 4DLUA 2CL0X 4I99A 1Y3AA 2Q0HA 2GK7A 1D8TA 2ZAMA 3FPAA 4WZAE 2B7CA 4Q7JB 2Q3MA 1EFUA 2FNAA 5LB4A 2GVDC 2O0JA 4C30A 5IRCD 2P65A 2WJHA 2OCAA 3UMSA 1XRJA 4ZIRA 4B2PA 4LSGA 1U8AA 3BC1A 2GXSA 2BBTA 2IBMA 4QBIA 3TQCA 3QXHA 3I62A 4QG7A 4JLAA 4A0HA 2A2ZA 2UVQA 4JYBA 4TYPA 5EXXA 2ZANA 3FDIA 5CIQA 3TW8B 4PHTA 1E9SA 2FG5A 3C14C 4TWZA 4EQ6A 4NCJA 2WJVA 1Z5ZA 4XVRA 3U3KA 3MFYA 4JKIA 2YWFA 4MKIA 3V4RA 4M9QA 2W2VA 2J3EA 3UIEA 3SN6A 1W4CA 4C0KA 2WPDD 4G5GA 5FTKA 3KKPA 3SQWA 2A5YB 2HXSA 1A82A 4XIGS 1NVUQ 1ZM2A 2IXGA 3QOFA 4I4LA 4LWZA 4M2LA 3V00A 2AD5A 4MGKR 3D3QA 1EESA 2IYWA 2H1LA 1P2TA 1KI6B 1Q0UA 2QN6A 4C7OB 2OBNA 1KJYA 4L15A 2E87A 3EPLA 4Q18A 4Q9HA 2ZU6A 1VIYA 2PMDA 3EIHA 4LK2A 2I3BA 4NDZA 4ACAA 3QEJA 1SZPA 2CLCX 1RPZA 2J9RA 3VR5A 1AM4D 1WE2A 3ICQB 1CJKC 3TUZC 2FPLA 4HSEA 3V9PA 3G5UA 1XJCA 2IS1A 3VFDA 2JASA 2E1RA 3EIEA 5CDFE 1YQTA 4K81B 5HZHA 4KAXA 1U90A 5D3MB 3CPJB 3E5HA 3CONA 2ANCA 3F3YA 3IEVA 1W2GA 1FTSA 1MRNA 2A5FA 2ZUCA 2ZJYA 5SZKB 1YHNA 5H1YA 1ZUIA 3BERA 4IOMA 3VR2A 2OO7A 4M22A 1XEXB 5KNCA 3R9XA 1OYWA 2CCGA 1G20E 4L9WA 2C9CA 2EU8A 2QENA 3FHOA 2GJ9A 1TX4B 2HUPA 2J0VA 2ZJAA 2W0SA 1P6XA 3RANA 3RRZA 2WIAA 3BS4A 1RW4A 2NO9A 1S8FA 3CF2A 4RZXA 4KVAA 1OH5A 4HAYA 4X8OA 2ONKA 2AX4A 5FOSA 4RD3A 1IY0A 2BCGY 4FW9A 1G3RA 3MAAC 4MA4A 1XEWX 4DT1A 5KNBA 4Q19A 3T5DA 2D3WA 3RDPA 1Z0IA 1WMSA 5KHOC 1QG4A 4KODA 1DAMA 3LX8A 4HEJA 2Q9BA 1AGRA 1DE0A 3SJZA 1N25A 2BEKA 5C18A 5GJWC 4Q4LA 1YZQA 4UXJA 3G82C 5CYPA 2FFQA 4MKGA 5EP4A 3SFVA 1CU1A 3DKVA 1OFHA 5B64A 3LV8A 3GJ4A 1F2UA 3UMFA 1PUJA 2FU5C 3A1SA 3E70C 4FWTA 3I72A 3AVQA 1KTVA 3LO5A 1OFIA 3PCRB 3PUZA 1BMFA 2CL7X 1E0SA 2H18A 5FUVA 4DUGD 1WA5A 2RGGA 1X1RA 3W6PA 4JLDA 5DISB 1XZPA 4YMVA 1ZIPA 5JEEA 1Z07A 3WNBA 2ZJ2A 1ZM4A 3CB4A 1JJ7A 2WSSA 2ZVQX 5DLQC 2GCNA 1FPMA 4LDJA 4V0ME 4URXR 1EFCA 5AK0A 2QMOA 1II8A 1HY3A 2V6IA 3CRQA 4LGMA 4RCYA 4IFBA 4LC1A 4NYMR 4O2LA 1UPTA 1W0JD 5CK5A 3SFZA 5DYGA 3BOSA 3IHWA 3QKTA 4OHVA 4JLPA 4BFZA 2V9PA 4IFEA 2G88A 3EZ7A 2R6GA 4RFVA 3THXB 4M1MA 4QJ5A 1UKZA 1MO5A 2JATA 4JJZA 3WMEA 3PJRA 4PSAA 3T34A 2BC9A 2OAQ1 2W6JA 4L8GA 5JJKA 2ZSAA 1GOTA 1Q1QA 5FPSA 4EJSA 4CDGA 3NHAA 3D31A 2FFBA 1NIPA 1P61B 1T4GA 2P2LA 3EWSA 4UNRA 4JVMA 3LDAA 5JFGA 3THOA 4C2TA 2CK3D 2V6JA 4EIWA 3U4QB 2ERYA 4MYTA 5CITA 2CVHA 2VHJA 3OIVA 1G17A 1E2GA 3TR5A 5BW8A 1NLFA 3UG7A 2XJ9A 3NXSA 3OF5A 3B8HA 2R2AA 2JIZA 5C2JB 2PZEA 3BAFA 5FL7D 1ZD8A 4XVUA 1KI3A 5KSZA 2HJGA 1FMJA 1SVKA 2P0EA 3EC1A 3KFVA 4N1AA 1WBDA 3TSOA 2O0KA 4BLOA 3MGCA 2FEMA 4CEJB 2O8CB 1NY5A 1G4AE 2FSGA 2HT6A 4IXNA 1KDPA 3OEEA 2F1RA 2REBA 4PQRA 3AVUA 1IN8A 5AJZA 4AWXA 1CXZA 2RGCA 4P4SA 4TMVA 1JI0A 2EVWX 4P4SB 5C4GB 3BIFA 1IBRA 3W34A 4QM7A 2ZRKA 2WWFA 3PEUA 1XPUA 4M1YA 1V43A 3GMTA 2F43A 4JLJA 2W6IA 2DFKB 5DH9A 2VSXA 2FWRA 2XTMA 4MUBA 4MGIR 3PG5A 1NNEA 2BVNA 3U7EB 4G3XA 1JR3D 3M6AA 4C3ZA 2P3SA 3FGNA 1DG1G 4HYYA 4EPYA 4MRPA 5JRZA 5H68A 2LWIA 3NBZC 2XOKA 5L3QA 3QXSA 3VKWA 2QQ0A 1HQCA 1T3LA 2P67A 4LBYA 1TEVA 4LYHA 1EWQA 3PUYA 4DLRA 4BE7B 3I4LA 3TUJC 4KI0A 4QHYA 1XTJA 4RFSA 1U0HC 1E9EA 4ZDWA 4EPWA 2OE2A 1CEEA 1UEJA 2R6DA 3ZH9B 3NG1A 1NMZA 4V0MA 5KO2A 2GJKA 2H92A 3QVVA 3L0SA 3KUDA 1E0JA 5P21A 3B6EA 2Q3FA 2BV3A 4ZDKA 3FHCB 4MRVA 5JJLA 3RLFA 4M8NE 3TIFA 3OFND 5EP1A 1TL7C 3W3ZB 1U9IA 3EA0A 1US8B 5EXTA 4PPQA 2FZ4A 2I1QA 1Q3TA 1UADA 2N1BA 1BYUA 2ATXA 4HB0A 4MRNA 5L8VA 1KI9A 4YMUA 4TL8A 1FZQA 2ZRGA 3SI7A 3VNVA 4PC2A 5FOXA 1M1YE 4ZKEA 4LBZA 2JCSA 3H0KA 4D81A 4H9GA 5EP3A 5FI1B 2A9KA 1Z0FA 1YJ5A 1G64A 2F9MA 5CYOA 4Z8XA 4K8OA 3U3JA 4C0BA 4EFMA 1Q1BA 1EGAA 1FQJA 1NBME 3TUIC 2NMVA 3V4FA 4HAZA 4TMTA 2RGAA 2XSZD 4C0JA 1KSHA 1VG8A 3QXCA 3QF4A 4OK3A 3RS5A 3EPJA 2ZSBA 5IK2D 1GNPA 3ZJYA 2BMJA 2VRWA 4QKQA 3CR8A 1KO8A 1P60A 1I4LD 2OFOA 5EQTA 1UEIA 1RVDA 2C2HA 1E1RD 1S96A 2VLIA 3D8BA 2WBLC 1HTWA 1TAGA 3BB1A 4OHZA 3R9WA 4KFRA 1W44A 3KJIA 4D4JA 5CJPA 1FOEB 2XJ4A 5SZHB 1OT3A 1G4UR 3BK7A 2ZSFA 2GAAA 2J1LA 4L4UA 4BZXA 3VAAA 2PEZA 4DKXA 1S2MA 2G1KA 4GZLA 1NG1A 3IO3A 1MV5A 3A1UA 3ICEA 2V3CC 2IYSA 2V55B 3C15C 4NYMQ 4X8LA 1GILA 4EKDA 1TQ4A 5J5CA 1CF4A 1Z8FA 3BB4A 1OH8A 4AY2A 1SXJB 2ZI5A 4XD7A 1R7RA 2RGEA 1JNYA 4I1VA 2XB4A 2OXCA 3LW7A 4TTQA 1PLKA 4XSGA 3WBJA 2QTFA 2BBOA 2ZRJA 2PLFA 2D2EA 2GXUA 2RMKA 3KTAB 3WP0A 4TT3D 1G16A 3BE4A 2BJWA 3P1JA 1G7TA 1N0WA 1P2VA 1SHKA 4DWJA 1TMKA 2IF2A 4A0FA 3AKCA 2OLKA 4MDFA 2C98A 4B43A 1RYFA 1E4YA 2Y8EA 1D2NA 2QE7D 2W00A 1N6NA 5EE3A 2GK6A 1PVOA 1G7CA 3W5JA 4D6PA 1PV4A 3VHLB 3WNDA 4JLMA 3GP8A 2IYTA 2A5GA 4BFYA 3RWMB 4C0LA 2FGJA 4OJKA 4UNSA 3GLGB 4A2WA 1KYIA 2ASEA 2QPAA 5FTJA 4DJTA 3OZXA 3MUFA 2O8BA 5KPJA 3FKQA 5CM8B 4NCNA 3F0TA 4D4LA 3BFVA 1BKDR 3QG1A 3SEAA 3RRNA 3U7HB 1X3SA 2C95A 2JIZD 4JBYA 3N2IA 3SHWA 2J59A 3QXJA 1CJTC 3GJ5A 1U0LA 3LH5A 3QF4B 3U6KA 1SXJC 3AV0B 2ZI6A 1BIFA 3VX3A 3OEED 3ADCA 1NBMA 4Q9IA 3PVSA 2ZRAA 4HB2A 3AH8A 4F93B 4CIDA 4NU0A 4G1UC 2LKDA 3ZQJA 3A4NA 1D6JA 1O87A 3DOEA 2JDIA 3ZVRA 2DB3A 2P5TB 1DOAA 1BOFA 5JBQA 1TQ2A 4ZIRB 4YMSA 1IJFA 5F3WB 2L0XA 3LXRA 4HZIA 4NE2A 2VYFA 2W6ID 4QBHA 3U7FB 1XWIA 5TDHA 4D2IA 2ZE8A 3T35A 2QTHA 1YZNA 3MRSA 3RC3A 1MOZA 2WJIA 1GFIA 4H1VA 2AFHE 5G3YA 4IEEA 1U8ZA 4MQBA 2WAYA 5G41A 1NN5A 1W48A 2GZDA 2J45A 2ZS7A 2VL7A 4GI7A 4PC1A 5FL3A 3B82A 1KK3A 1XCPA 2FF7A 1YZKA 3WYFA 1DEKA 4O3MA 1ZJ6A 4JVSB 1KAOA 1XFAA 1YR6A 2G9NA 4EPRA 3ONWA 5ANRB 3KJGA 2H5EA 3NHBA 2PH1A 3THYA 3AVYA 3PXGA 1W0KA 5EE1A 2ZJOA 4V0NA 3QKRB 3LVRE 2FMXA 5FR2A 1NSTA 2B7BA 5EZ5A 1GG2A 2A3RA 1QHYA 1JEDA 3GCGA 1ZU5A 3LBIA 4LJ8A 3ND8A 2IYLD 4DT1B 2AKAB 1W36C 1M6NA 3QSYA 1MR3F 4WBSA 3IHLA 5KSYA 2ZJ8A 4B32A 4E09A 4NP6A 5HZKA 1G8GA 1XMVA 2ZYVX 3U7GA 2D4HA 2IYYA 4YLGA 1NSFA 2F7SA 2X19A 4XWAA 3S1AA 3GLFE 4Z8YA 3OAAD 2J46A 2PZFA 3B1YA 2JLRA 1QHIA 3W3AA 4FN5A 2REXB 1ZUHA 2R6AA 4R9UC 4RZUA 4EUNA 5BN5A 4AKIA 1W4BA 5JCZA 2X2FA 3QPWA 1ZMXA 2BJVA 3B13B 2HEIA 2HF9A 4KHZA 2R44A 1CBUA 3LLUA 4PO1A 1SXJD 1CKEA 2GBLC 3Q72A 4OJQA 2ZJBA 5F98A 4KLNA 2AR7A 3BH6A 3VKGA 3ETLA 4O0MA 5AJVB 3TVTA 1DAKA 3W8NA 1OHHA 1ZM3A 2VTKA 2ZQ5A 4IRUB 4YMTA 3W90A 3ADKA 5KDLA 4ESVA 1TU4A 2WWIA 1FW6A 1OW3B 3CW2A 4AURA 2GILA 2PZGA 1JR6A 3MMPA 3W9YA 4G5OA 3TSZA 6Q21A 1KZ7B 3I32A 1I2MA 2WOOA 3TGPA 2B92A 2QBYB 4UXHA 1DAFA 4Q5IA 1W36B 3ZZUA 1YKSA 2KB0A 4LV8B 1UF9A 3RVBA 1UFQA 1F2UB 2NGRA 3KKNA 5AJXA 1OKKA 1R5NA 4HAUA 4HLUC 5DI3A 3FMIA 3NDPA 4AIIA 4Q4JB 2QGZA 3IBGA 4S2EA 2H16A 4XD7D 2FFAA 2QAGC 3UXMA 4LJ9A 2ZROA 4RD1A 3K0AB 3RS3A 3K0AA 2SHKA 1P9WA 3GPLA 4QFMA 2CK3A 2PCLA 3EZ6A 2CEAA 4ACBA 3KQNA 5DN6A 4MRSA 2GF0A 3LVQE 1GP2A 2REOA 4HAVA 3MWJA 4Q1EA 5ELXA 3CZPA 2B8TA 4ZKDA 3B5JA 3NDBB 4GOXA 3K70D 2XZOA 3HYRA 2NTYC 4XH9B 2JJ1A 2PT5A 4JMPA 1E2LA 2QE7A 2W2XA 3K1JA 2QZ4A 4MKHA 2QL6A 2X8AA 3B1VA 3LQRA 3UATA 2WKPA 1LF5A 1T8TA 4FMCF 4OL0A 2D2FA 5B30A 1OSNA 1MKYA 4M4SA 4MGYR 3LY5A 2IUSA 2JLYA 1SVLA 2ORWA 3R20A 4A1FA 1TU3A 3IEUA 1TF2A 1S4QA 3CRW1 4RZ2A 4UNPA 1TEXA 1AGPA 1R6BX 5DI9A 3SNHA 2JEOA 3ZVLA 1U0JA 5E7JA 4XWOA 1KI7A 3A1TA 3KKOA 4QJ3A 4ZV4A 4OI2A 3EZFA 2Q9AA 3I5YA 1SVOA 2ODEA 1FX0A 3Q5EA 4HI0E 4DCSA 1A1VA 1J8MF 4JLBA 1Z22A 2N42A 1G6OA 3JVUA 5CJ2A 2ZM5A 3ASYA 1KI4A 4ASUD 1WCV1 2DFTA 2VSFA 2ZRLA 1NVWQ 2HF8A 3OIUA 2GJAA 2CE2X 5AJWA 2NO0A 3GEIA 2IUTA 4GP7A 5FOUA 1OXVA 2MSCB 1YE8A 1HUQA 3K70B 2F3RA 2BMDA 1N6RA 2N46A 4JIMA 1TQDA 3EZ2A 5BYJA 1IXSB 1CP2A 2RGDA 2UKDA 1X8KA 2XNDD 4DXAA 4OQXA 2KI5A 3HWSA 1NVXQ 221PA 4US1R 4M9XA 2AKYA 3L2OB 3VMFA 4A9AA 1P2UA 5CDFA 1E9FA 3D7MA 3VU9A 3ZIAD 2FA9A 4BQSA 4UXIA 2AK2A 3I3SR 2AHOA 1M2OB 2F1HA 3C16C 3GFPA 3IILA 4Q1BA 3KQKA 3ADDA 3QVUA 3FE2A 2ZRNA 1OFTA 3LRPA 3W5IA 3X1ZA 5LDDC 1II8B 4L5BA 5E3HA 4C0HA 2ORIA 4WVFA 2VHUA 4LX0A 3WRXC 3DVLA 2BWJA 1GNQA 5IDVA 3CH4B 1GRRA 1WF3A 2RGBA 1QVRA 1M8PA 4B34A 4UJ3A 4D25A 1G6HA 1C9KA 4CGZA 3A4LA 3C5CA 1DS6A 2ZI7A 3CRVA 5LB2A 4Q4JA 5IF9A 1QRAA 2NQ2C 1JAIA 4MYHA 4ZI2A 1CJUC 1W46A 1J70A 4JL5A 1N6KA 5DYIA 5JI2E 4M0LA 2NIPA 1TADA 2IXEA 1U94A 1DELA 1SVIA 4LHWA 3R8FA 1XZQA 1QHGA 3C4JA 4U5XA 2VF8A 1UM8A 3TH5A 4B3GA 4BGDA 2G6BA 3LNCA 2NPIA 2IC5A 1G3QA 2YV5A 1SKYB 4B3BA 4B6EA 1KJWA 5KUTA 3LBHA 3MLEA 4LHVA 4DRZA 1YVDA 4LV5B 5K8UA 3PEYA 4ZCIA 2V54A 5TVKA 1GWNA 3LLMA 4HLCA 2IA5A 2PLRA 3LXXA 2XXAB 4AI6A 4GPTA 1XXHB 3R9IA 2WWXA 2WOJA 5BYKA 5BXQC 3OE7D 2F1IA 4XWKA 3KJEA 5BQ5A 5L3SB 2YINC 4QL3A 2IX3A 4DB2A 4UNQA 4YXWD 4FCVA 3WMGA 2RGXA 3TBKA 1G21E 1OHHD 2W0MA 5AR1A 3EA5A 3GLIE 1Z0KA 3Q85A 2W6JD 4FD2A 2C8VA 3R7WA 1R5OA 4N0DA 3B1WA 1XTRA 5GJBA 121PA 1JJVA 2WMOB 2EFCB 3LWNA 4IOKA 4AYWA 2IS4A 1QHHB 1OXTA 1XEFA 2OBLA 1N5JA 3T1VA 4U7DA 4M1WA 1F6BA 2YYZA 1P9RA 1E79A 2JLSA 2RHMA 1CR2A 2WM9B 5TV2A 2I1VB 4WXRA 4GP6A 4MYUA 2V1UA 3EARA 1TF5A 3MCAA 5L3SA 4E22A 3K8YA 4RD6A 4Q4HA 2FJUA 4X8HA 4FI3C 1LB1B 4PAOA 1WDTA 4W5WA 1KKLA 2D62A 1FTNA 2IYQA 1EFHA 1XDBA 3MWYW 2JLVA 4P3YA 1YR8A 5GVSA 1Z63A 4RVCA 2C78A 5FL7A 3CPHA 2HLDD 5SZJA 4KXFB 3VX4A 1FMLA 1G5RA 5IT5A 4JT2A 4V0KA 4PSKA 1EFRA 1Z6GA 1Z6TA 4Q4AA 5J4YA 2WWYA 3EXAA 4ZO4A 1NN0A 1VCIA 3GJ3A 3C7KA 2PT7A 3U5ZB 2GWHA 2V1XA 1E2KA 2CDNA 2ZITA 3IO5A 4W7SA 1AJEA 3HR8A 2Z0MA 3B1ZA 3CRRA 4S35A 1JB1A 1JPJA 2ONJA 1Z6YA 3SHFA 1QHSA 4DSOA 1W5TA 3ZQ6A 2H8KA 3T61A 4F7WA 5B58C 4PC7A 1IJEA 2OXRA 1I2DA 521PA 1S9HA 2MSDB 3TVDA 1COWD 2XTNA 1ZUNB 4PX9A 4DIEA 1JR3A 4M53A 2YWEA 2ZUDA 1NBMD 1E98A 1YZTA 1RFLA 3TJZA 2QU8A 2WSMA 3TQFA 2PX0A 1DAEA 4XVQA 3EWAA 4OK5A 1EX7A 2F9LA 1P62B 3Q7PA 3SS8A 4LUCA 4D4KA 2ZI3A 5DHAA 3P20A 3I61A 1E99A 4QGHA 4JS0A 4E03A 5JWRA 3HJNA 3P32A 2DPXA 3AUXA 3QXXA 3A1VA 4PC3A 3MSXA 3H2YA 4P33A 3M1IA 2C9OA 2X2EA 1SXJE 1KNQA 2ZE5A 2XX3A 1G8HA 3OFNA 2ZYTX 3GLHA 1Q20A 1SULA 2Z4RA 5SZIA 1CS4C 2ZSEA 2BHRA 1VYVA 2H57A 3GQBA 4AYTA 3GLIA 1RRGA 2V4ZA 1G7RA 3TAUA 1G5TA 1NY6A 5E7MA 2IYVA 3L0PA 4HZUA 4LJ7A 3P27A 1R8SA 1W0KD 2HCBA 1VDZA 4PQYA 4Z54A 1KO7A 2GTPA 2BKUA 5M04A 2WAXA 1W4RA 3WP1B 1ZD9A 2ZTSA 3M0EA 4DHEA 3ZGXA 2VP5A 4MUAA 4B74A 1F3OA 2OBMA 3OIYA 5FBLB 2NPFA 2WKQA 1Z0JA 2CJWB 2OFWA 2CCKA 4LJAA 3GLGA 4AKEA 4AKHA 4HAWA 1XMIA 1GZSA 3CF0A 5IK2A 3AKYA 2C03A 1LNZA 1MT0A 1MABA 2QM7A 3WRYC 2MMCA 2OZEA 2QMEA 1ZNWA 1SQ5A 3EC2A 1E2MA 3ZS9A 2DWQA 2WSSD 1G8PA 4KVGA 1DG3A 1XEXA 3FVQA 4Q1CA 4B73A 1KDOA 3REGA 2IWRA 3LFUA 2K5UA 4P4TA 1B0UA 1JQLB 3NC0C 1N5IA 4JLKA 1QDEA 1F48A 4HLDA 1XD9A 1B23P 2WWGA 1OXUA 3F8TA 5KDDA 1JECA 3TKLA 4Z51A 1XD2A 1Z2CA 1ANKA 2FSHA 3PFIA 5EE9A 2VP2A 4MYCA 4A8JA 2C04A 3SBDA 2IEZA 4M1KA 1ZAKA 1PZNA 3GEEA 2WJGA 4HZUB 2WHXA 4LJ5A 4GOJA 3L43A 4PC6A 5BWMA 2FOLA 4BLRA 1H8ED 1BYIA 2HCJB 4TL6A 1OXXK 5D3QA 3SYKA 4Q1AA 3CZQA 4W5JA 4BLQA 2ZRBA 1NN3A 5EZ6B 4A4DA 1IOZA 1KSJA 1DAIA 4A82A 1RRCA 1XJ0A 3PUXA 2ERXA 4LHXA 3CX6A 1S3SA 4FXPA 4BEJA 2GXAA 1Z28A 3EAQA 1LS6A 1P2SA 1IN6A 4WZBE 5C1BA 3AF0A 3VTKA 2JJ2A 2ZPTX 4YXWA 2WZQA 2XTZA 1XMJA 5KSPA 2GKSA 2G0NA 3Q5DA 2EFGA 4B3DA 4PO8A 3RNLA 4LY6A 1D9XA 2OT3B 4A8JC 4B3FX 4CEIB 5FBQB 3IUYA 1E2HA 4O25A 4RJLA 1OPXA 4GNKA 1RRFA 4OBEA 3CRMA 1FQKA 4OQFA 1T9HA 5GADl 2Q3HA 3CPEA 5B2ZA 2RGNC 4JJKA 5FI0B 4AYXA 2XNSA 2IUUA 1ZINA 4BFXA 2YVUA 1W1WA 4YONB 3TLXA 4C0AC 4MDEA 2GAOA 2ECKA 1IN7A 4XOIA 3KKMA 4QOSA 3W6OA 5C46F 3AVXA 3IIMA 3GLHE 3SJAA 3GJXC 2ORVA 2W2TA 2A30A 4N3NA 3OHMA 3PR1A 4PZLA 4CEIA 3J81k 3H1TA 3WYGA 5L3VA 1NKTA 2RAPA 3UWKA 1LV7A 2ODBA 5GJVC 3LA6A 3I8XA 3H84A 4JL6A 2QPOA 2J41A 3UK6A 2AK3A 5TY0A 1K5DA 2ZXUA 3VR3A 2A5DA 3QKSA 3GFTA 1F2TB 3RS2A 2W58A 5FOTA 2OILA 2GJSA 4CT4B 1QHNA 3IDQA 3AF3A 1N6PA 3ZZ0A 3KTAA 3C5HA 3Q8XB 4NZYA 3HU2A 3FMFA 2NO1A 1Z83A 2FSIA 1DPFA
chains in the Genus database with same CATH superfamily
1CJSA 3BTUA 4IPTA 1MO3A 2AWOA 4LCJA 5B6IA 3P45A 5IW8A 4B75A 4GVXA 2PGOA 3DXYA 1BWPA 1OC2A 1VSUA 2BGKA 2FYTA 3EPPA 1OLOA 1G66A 4LNUA 2G17A 2Q4BA 4YQEA 4MVJA 3UUEA 1N5DA 1YI8A 1M74A 4CKZA 1Y4DE 1XYYA 3G0OA 4UDYX 1YCDA 2X8JB 4HSGA 2MINA 3JXEA 3SYRA 3ESAA 3B9PA 3NHLA 2RCNA 1HRKA 3DZJA 1SUWA 3NV9A 2EQBA 3Q11A 1N2ZA 4BO0A 4MMYB 4TLDA 4R2LA 3GR6A 3KBOA 5KQRA 3QE4A 4L07A 1MT3A 5M5BA 2VXOA 1NYRA 2P9YA 1TCBA 4YMLA 2WYWA 3R0JA 4PGFA 1XMXA 3ACDA 3A0RB 4L3OA 3PCXA 2O3SA 4B7XA 4UM8B 5ERXA 5GMOA 4RJTA 1REQA 4DKJA 3F6BX 5IKPA 1ZQ9A 3QMPA 3R3UA 2P4UA 3DO8A 4WOPA 1JG4A 2PH3A 3HVJA 3W7VA 3WRXA 5CB8A 2I6GA 4JIGA 2W8BB 4KLZA 3WGYA 7ABPA 4MW5A 1ORDA 4KQCA 5AW1A 5LXTF 2H7VA 5HF6A 2YOFA 1UPCA 3N2GB 5JT1A 1MMFB 3H6GA 5FA5A 5FFFA 3OTOB 1Y4ZA 4H59A 1JPUA 2VBFA 5DWQA 1YZHA 1J42A 2BOVA 5F3RA 3T3IA 3VDRA 5I3CA 3N5CA 2EYUA 3CC8A 4AG3A 1KGDA 1L9KA 1R10A 2BDTA 5FNVA 3VU0A 1FW8A 1W49A 1Y5RA 2FUG6 2VTVA 3MMZA 3JYPA 3GFFA 3NBUA 2CB9A 5LWHA 4M1SA 5IAKA 4K6CA 4RTPA 4JBWA 2OMEA 3N75A 1H65A 2VDKB 2WYUA 3HDYA 3VQTA 3AKEA 1GAXA 4DA8A 3DKIA 5CW1A 4WZAA 4Y0VA 3UJ3X 2RJNA 3K0CC 4GYKA 3D5TA 4XOUA 1QQ7A 4URWR 3WHKA 2F3TA 4Z0HO 4DZZA 4MHTA 3JZMA 5K3EA 1CJCA 3F5MA 2HT1A 3ECAA 1C29B 4QBTA 1HL3A 3GVCA 3FYTA 4X00A 1EUZA 2V65A 3DOFA 3DQZA 3HCNA 1UT5A 4MUJA 1UODA 1UBSB 2DCUA 2AVNA 2G70A 2Z1DA 5EKDA 4MROA 2GPAA 3RQSA 3WMRA 3FPCA 2WM2A 1EP1B 4M54A 4NPAA 1H22A 1DX4A 4G5YA 1XQVA 1ZC3A 3I5MA 4YIHA 3GLIB 3Q7SA 2ZE7A 4GNRA 1GG9A 4GX1A 5TQ2B 2GASA 4ZMSA 4M9UA 1GT6A 1S3IA 3JQBC 4NYIQ 3VTAA 3QY0A 3WLLA 2FPGA 4AZSA 4ENTA 2MR5A 1RVV1 2JD0A 1I3LA 4LECA 3GLFA 4YV1A 2C9YA 4GG1A 4ZVSA 4AQ7A 2Y67A 3EFOA 4DVJA 4PGAA 3VNAA 2WTMA 3N2YA 2HMTA 3MXTA 4K88A 1UP4A 5FFMA 3FX2A 4G1CA 2A4KA 3LBFA 4I46A 4KH1A 3GVXA 1EQAA 1FCJA 1HZZC 2C2XA 1W93A 2EP8A 2OEPA 1LW7A 2WM3A 4M7RA 3U7RA 3ND9A 1SQSA 2NVWA 5TARA 3SBOA 1GLVA 1E5XA 1NF3A 4TUYB 3T7KA 1SR8A 3PDIA 3E61A 3UAGA 3VZSA 1TAHA 4HADA 4YCLA 1EGVB 2Z5LA 4R7TA 4BNJA 1P73A 4OSOA 1XTUA 2YJ6A 4MRRA 4PPNA 2VNIA 3L7CA 2GUGA 4IJ5A 1UBEA 2F48A 4CM4B 4YAIA 2QPTA 5CCEA 3EVGA 4PIVA 4Z0PA 4F1WA 1N6IA 4MKZA 2PS9A 1XLUA 3GJQA 1YR7A 1GDDA 3MTBA 3JAWA 5AI6A 2QVBA 2J7KA 4PANA 3L6EA 4F38A 4TMZA 3DE4X 5LMNB 1E9DA 2YNMA 4JDPA 4HNQA 2V5VA 4DLWA 1B93A 4TSFA 4QPNA 3GRZA 3U4GA 1L4BA 1G9TA 5K4HA 4IJKA 2TYSB 2HBQA 2HF7A 1CWUA 2AOVA 3DYVA 4LC0A 3IUMA 1E5DA 1SUEA 3PNQA 4RENA 5IZCC 3DFFA 1P91A 1ZSVA 3BJMA 421PA 4GT1A 4OTZA 1SD1A 4TTRA 2JJ2D 1OFUX 3EVAA 2DFLA 2PGDA 1XVIA 3SR0A 4ILKA 2V7VA 1G20A 5K0BA 4A5SA 4HLUA 1XE3A 2VJLA 2VK8A 1QZTA 2ETXA 5C5CA 5FBRB 4GWGA 3PX7A 2YMQA 1T1JA 4WOBA 5G2OA 3REOA 5TEWA 3I8OA 3DAPA 4G67A 1YRAA 3C48A 4H3KB 1J2YA 4LHEA 4DQDA 4Q4HB 2JFVA 1MQSA 3R0VA 2BFDA 1N5KA 1HE1C 2ZI4A 3EFEA 4B5LA 2F8SA 3UB4A 1QQ6A 5ALGA 2QTMA 3ES9A 3MTQA 3ZOZA 2DWPA 2CLSA 2E55A 3T5TA 5REQB 4LXGA 3GCZA 4LYAA 2I3ZA 4KNWA 4TMWA 1CJMA 4DG9A 2COUA 4EHLA 4HQNA 1HOTA 4IFTA 2QTRA 3IBTA 5G0SA 3KLOA 5LDHA 2JDID 1FUUA 3I5XA 3DLCA 3ZWQA 5BUSA 3EASA 2R6HA 3O0TA 5EYPB 2QW0X 3IKMB 4N47A 2C5EA 4B8ZA 2GM4A 2IPLA 2WV9A 3I58A 2ENWA 3NKVA 4B76A 2BZGA 2I3DA 2FN8A 4YJFA 2I34A 3H65A 1VHLA 1MNQA 1QMGA 3COSA 3CW8X 3AI1A 4ASUA 4YAFA 2RB4A 2FW7A 4DC0A 3D8SA 4FT4A 1IQ0A 4IYJA 3TGWA 1ZGJA 1AQUA 3JTEA 2HPVA 3WNCA 3WLKX 3K9BA 2CY0A 1W1IA 2QI9C 2VF2A 1UZUA 4RHXA 4L2IB 1KAEA 3TXXA 3FHJA 4PAQA 2IDMA 1ISMA 4KMRA 4CCYB 2XW6A 1P1CA 1JQKA 3U3MA 3BXXA 1G7SA 4OHCA 1ZAYA 3NVAA 3BMQB 1FDRA 1L4EA 1W9MA 3V2IA 4ALMA 1QKIA 2NZJA 4KV9A 2W71A 4RWEA 4C07A 4NTZA 1UDRA 4FWBA 1B7GO 2QUZA 4YP1A 3ZLTA 4UM9B 2IZ7A 4OB7A 1H05A 1W5BA 5TX7A 2QT0A 2QN8A 3K6JA 4D82A 1C4WA 4JYCA 1VYTA 3WJ2A 4MVJD 4PBRA 4PYOA 5TQ0A 3UOWA 1KOFA 4LGYA 4D5EA 1NMSA 1QOPB 2OO3A 2VT2A 1KMQA 3KXLA 1C30A 5I7UA 5KOJB 3HV2A 2W2LA 3W5HA 3OX4A 3PGA1 4BATA 2VPPA 4EK9A 4X1YB 2W4MA 3D1LA 2DY0A 4YRLA 3FXAA 3W8RA 4JK3A 5J43A 4B48A 3OJ0A 3S4YA 1Y98A 1BDIA 2PGXA 1JMYA 3RJTA 1FDUA 4C6HA 4HH3C 3HP7A 2H3HA 1E2QA 1WS6A 2RH5A 4YB8A 1UFRA 3DEFA 3PUKA 1E2FA 1ZSYA 4E3ZA 1Y6RA 4EHIA 4QNRA 4Q3CA 3BIWA 4UUBA 2XMSA 1AHIA 1DBSA 3VSAA 1DIHA 1NUQA 4HMOA 4RMIA 4Z9AA 1IDN1 4TZ0A 1XGKA 1R8JA 3BIXA 3EIQA 4X41A 3LBNA 1S3GA 1Z29A 2OLJA 4YCNA 4X63A 4ADSG 4W9MC 4J7UA 2KBFA 1HEIA 2R1VA 3RT9A 4Y0AA 4DDWA 1GU1A 3FYSA 2VNJA 1QGZA 1Z2AA 1G3MA 1FTWA 1MTZA 2ATCA 2IZ0A 4KAFA 1M34A 2NV2B 2PWZA 4UUMA 1GZVA 1J20A 2C2WA 4PAWA 4UE6A 4IMPA 4BMNA 2QNBA 1NT2A 4NKRA 3TK1A 3ZWDA 4AJ9A 3G79A 1M6VA 1T3GA 3ML1A 1GGNA 3HJCA 3O4VA 1ZYUA 3OZFA 4QARA 4WLFA 3VKVA 2CLFB 4YYEA 3AF6A 1IBKB 2GBIA 2QA5A 1FRZA 4QUHA 4KGXA 3ZE6A 3ZV6A 5L51A 1U0GA 4GW3A 1R2QA 1JMVA 1OA1A 2HWWA 3O26A 4ARUA 1IK4A 1ICIA 5I9BA 5BPFA 4D8XA 3C1TA 1L5KA 2PAFA 3JARA 2CZGA 1OTXA 5LL6P 1BMFD 1IN5A 2BR5A 2BBSA 3TSCA 1TYEB 1N2XA 4G9EA 2Z3VA 1CLUA 5HRAA 2BYTA 3GFQA 4G25A 4BKOA 3T5AA 1NKSA 2RKOA 3VSBA 3O8BA 4EABA 1L7VC 3OG9A 3UEOA 2M6KA 4ZT6A 2YWRA 2CBZA 5CM9C 1OBHA 1HI9A 4NNPA 1BS9A 4RMHA 1JA9A 3HPQA 2P1DA 2B4KA 2BF4A 2QSZA 3ET4A 1A9TA 1O77A 4BNUA 4ZOLF 2OFPA 4NCIA 1GRNA 1NGSA 3B7GA 3OBIA 3WICA 2X5XA 4M6WA 2IXFA 3R0XA 2ZJ6A 3VO2A 1A88A 1BWSA 3G8YA 2IS6A 4QASA 4MEAA 2LTAA 4QELA 1W88A 4B4WA 1VGVA 2RKWA 3H3FA 3QUSA 1CHNA 3I37X 1O94C 4YH1A 5FRDA 3FPBA 1JSXA 2GBGA 4IJWA 4L9SA 5C3MA 1ZW6A 4ND5A 1IQRA 3R7DA 4KAAA 3U9LA 2C2YA 4O4HB 1TTQB 4A0GA 4LF4B 1LXCA 1VCHA 1L4YA 2ZK7A 4Z0TA 2WJAA 3REQB 4ER6A 2QSJA 3QE0A 1EXDA 4UQOA 1KI6A 4FWIB 1TCUA 3FIJA 3GL9A 4LZNA 1VQ1A 4QEDA 2NU7A 4J0HA 4OQQA 1ZD2P 1FUKA 1C8VB 1DZ3A 3DEKA 3LYHA 4NFHA 4KACA 3UOGA 2HLDA 3CWCA 3PQ7A 4TKUA 3P26A 3RU7A 4BRZA 4F5ZA 3KSBC 1EK2A 4R4JA 3X1XA 1W36D 4KTTE 2VG8A 5JXIA 3ZD7A 3PV0A 5ALJA 2WFAA 1QV6A 1GAJA 1X8XA 2VHZA 3DVQX 4TSFD 2PJDA 4D45A 1N1MA 1IUPA 4AF8A 4H4CA 2OHFA 2YOHA 3UT6A 5PGMA 3UB2A 3RIEA 1QTIA 2CJWA 2G3YA 1KDVA 3ZHZA 5LPNA 1BEUB 1X7ZB 4JHLA 4YC7A 4KU4A 2Q5CA 3PHBE 3JQ7B 4PS0A 3TB6A 4AX4A 5EXDA 2C2OA 1DFHA 3P9XA 5A5GA 5DB4A 1FDTA 1PL7A 1J1UA 3WKCA 2ZSJA 1D9ZA 2PU5A 2HQRA 2WNSA 2ZRPA 3JZIA 1K5GA 3GNLA 3LC0A 2JI8A 3NBXX 3FD8A 4IKPA 4TSKA 3V32A 1E7QA 3U3OA 3R40A 4W6QA 4A2PA 1JDNA 4LJRA 5IPFA 3EZXA 1I6KA 5IUJC 4IDQA 5KX5B 1EX1A 2MSLA 4KPGA 3VKHA 3C3PA 4JZKA 3FFBA 2G8LA 2KYRA 3KR9A 1ADGA 3OD1A 5K8VA 4H15A 4MGZR 5ES4B 4B9EA 1SJ9A 1HWYA 1Z5GA 3KCQA 5CLIA 3UQYS 1PR3A 4WZ6A 3GCDA 3TTWA 3COJA 1WQ1R 4S24A 3F67A 4YRDA 4NAHA 2W6PA 2J33A 3DE2X 3NAZA 1N8SA 3QYFA 2Q3CA 4FNOA 5BOSB 2G80A 5JAZA 2FW9A 4U6SA 1V7CA 3VSDA 1E6CA 2ETVA 2BFFB 4P7BA 2GESA 2BGUA 4YJ2A 4C2UA 2DSTA 4WXPA 1JXOA 3LCUA 3GJ6A 1R0SA 1VL6A 1FJ2A 3N8IA 2QR3A 5EJFA 1YIOA 2XUOA 4MH0R 1H0HA 1P4SA 2AUMA 1E1DA 5JXJA 1S2IA 1L1QA 2YC2C 4GMXA 4E5NA 5IFKA 3UGJA 3O9ZA 4J1TA 1BJTA 2C7BA 4P7KA 4DGQA 4NHEA 3G2JA 4MJ3A 4QO7A 3CLSC 4TYQA 1OI2A 4ZVPA 2DQKA 3FOAA 2ZE6A 1WUHS 3GNQA 5BUQA 3GJZA 3KPWA 5H82A 4LPKA 1M3SA 2OR3A 1AS0A 4G1BA 5AKXA 5FNVF 2B3TA 5C0OE 4YRNA 4PZYA 1EXWA 1UBGA 4HFJA 4KVZA 3VR1A 2EF0A 4ZRNA 4IO1A 5D7BA 4OXRA 1AC5A 1WIWA 3H5TA 4JITA 3CEJA 2Q9CA 4XYEA 4AJKA 1QAOA 2I91A 1SOAA 2W7TA 4Y8VA 1ZUD1 2DT5A 2CNOA 4OHXA 1TO1E 5AKJA 2R8OA 2PUAA 4J91A 2DUNA 2Q1WA 4BBZA 3QBDA 5CK4A 3U26A 4N39A 2VT7A 2Z43A 1V3TA 3THWA 1KKMA 1Z0UA 4B3TB 4C7OA 1NUPA 1FK8A 3DHNA 4ND8A 4Y6PA 3W5DA 1GKLA 3LPLA 4N0EA 4L16A 4K9MA 4M46A 4QDZA 5FPKA 1MFZA 4U8HA 2RE8A 2XVMA 4ZYLA 3E9ZA 2C2MA 4ZTUB 2FPIA 4LZAA 4PQFA 5JLAA 2OCYC 3ROQA 2EBHX 3CW9A 1OJ7A 4KW7A 3SE0A 4J90A 1G0OA 1NVVR 5KBYA 4JSYA 4TWRA 3BJIC 4ENWA 5IAEA 3WB9A 4B81A 3DG9A 3SEQA 3DL7A 2WU8A 5ALOA 2DFNA 4GHWA 3WKBA 5J4KA 1AMNA 1UFOA 3BJEA 1QS0A 3QFHA 1IMOA 4KJZA 1L9XA 4ZYVA 5HR5A 3IVXA 1ULSA 1ZJZA 3ICCA 4ZI5A 3T1OA 2EFHB 2MTBA 3TLCA 2JLWA 4I55B 1QFSA 2Q5FA 3SGLA 4EO9A 1WG8A 4U7WA 3NC1C 2FMTA 3AVWA 1YGPA 4C4ZA 2B35A 5C7YA 4MA0A 4KE9A 5KQPA 1E3WA 3I2JA 1T5TA 2KJQA 2D5AA 4S3MA 5GJCA 3DT8A 3COVA 3HU5A 1HBJA 1RM5A 3I28A 4KIUA 1C9NA 2IPNA 2OM2A 3M5WA 1G20B 2QLNA 3OTGA 4LYFA 4PCVA 4BV2A 3U16A 1ODFA 5K0CA 1BS2A 3NVKI 3OETA 2FUKA 3UAWA 4DLTA 4V02A 4ARZA 1E96A 3B1XA 4KE6A 4L4XA 3R6LA 5BSEA 4EVRA 1KK2A 3PRJA 2AZ4A 1XV5A 2PS1A 1PFKA 1R9MA 2HXYA 2ZRFA 4G01B 3ZHBA 1FPQA 3WWDA 1X1SA 1LC0A 4OHWA 3IBCA 3CH7A 2Q4EA 4EHNA 3HK2A 1BEZA 4JHXA 3IGFA 5AUOB 1Q57A 1ZJ4A 3ZDBA 5I4KA 2B36A 3EUEA 1XZKA 1CTQA 4PVDA 1OXBB 3KE9A 2NAFA 2WFMA 4DW8A 1RMQA 2YBDA 3BMOA 2OV6A 3D02A 4PZZA 4MWCA 4E32A 4UTRA 1N5LA 1ZIOA 3V4SA 1WXIA 1ZXXA 1PV2A 3IJEB 1JLRA 3IJ5A 1XQ6A 3FMGA 3BL8A 1TIPA 3L0IB 1P18A 2G09A 4KWIA 3IOMA 5AW7A 2CHQA 5NLLA 1L1EA 1ODIA 2B0JA 4CM5A 1JTFA 4DIDA 2ZZKA 3FOZA 1ZI8A 5MGBA 1GL6A 3FB4A 2PUWA 4HDSA 4R1OA 1KTIA 1D4OA 4CLEA 1ILEA 1QYRA 4GFDA 2OFXA 2QNRA 3ABZA 4GVPA 2HMSA 4H60A 4O2BF 3WJ1A 1GTVA 1PSDA 2EARA 2X0KA 5F5NA 2O59A 1DKNA 1I7PA 2WR8A 2XB9A 1TUEA 1V4VA 4LDRA 4NFYA 3T9BA 2ZTUA 2YWHA 1Z7EA 2JH3A 1A9OA 3PI7A 2QM8A 2VHTA 4ZDJA 2YJTD 2CXPA 1ZOPA 1JQBA 3OEWA 2OAP1 4KO4S 1PL0A 3IPXA 4L7QA 4DLSA 2H5IA 3OOJA 5L3QB 1E66A 4I9HA 4PLYA 2Q7XA 3HM2A 1B6SA 1PNOA 3GW8A 1DAHA 1NXVA 1ZN2A 4B7UA 2SECE 3P52A 2JRCA 2GZ2A 3RRMA 1YJBA 2ZYRA 3S2GA 4RE6A 2C7QA 4OG2A 4GI5A 1NMEA 1Q12A 2NXEA 3FG9A 4GM0A 3EEYA 2G40A 3WV4A 1NC1A 1QZ3A 2R62A 3V1NA 3RHSA 3B52X 1M1UA 1Z08A 1JUDA 1IWBB 3J81A 1MJNA 2HW8A 4MR8A 2Q1SA 1NW6A 2Q21A 1D5CA 1PBNA 1SN7A 2EFDB 3KRTA 4TYYA 2FK7A 3BRCA 2ZXFA 2M1ZA 2GN8A 1AO3A 1TGVA 2X4GA 2WF7A 2RHDA 4ID9A 5BYBA 2HMYB 4ZQFA 2Y2UA 3K0FA 2G1JA 2CLHB 2XEDA 4P81A 1FNCA 4QHTA 3AOEA 3ODPA 4RD0A 4GMDA 1GSAA 3ESXA 3VU9B 2Z2ZA 1PWHA 2ADMA 3O8QB 1WRBA 4U2DA 4KMOA 3WGLA 2BM9A 3CN9A 4MEBA 2FLVA 1Z33A 2BMFA 4OHRA 4PTZA 4ZAVA 3ZOKA 4D9EA 1DCTA 4ZHQF 3ZYZA 1YR1A 2YHAA 4J0CA 5TLSA 2VZ9A 1FDOA 4ZVMA 2O0HA 4G89A 2XCQA 5B3AA 3NM6B 4OGFA 4BVFA 1HT2E 3PE4A 5AOBA 8ATCA 5AVZA 3T3OA 4KYIB 3SU8A 4YMGA 5JDCC 4QECA 4Y9RA 2OOKA 4E30A 1ZNZA 2CZCA 2WKSA 1ELOA 1PVVA 3INGA 3RRXA 4MARA 4JVNA 3UYKA 2BKXA 4ETMA 3V4PB 5F4BA 1G5PA 1EKXA 1M72A 4YIKA 3SAJA 4E07A 1QR2A 5G4KA 2Z83A 1DCKA 1CF9A 2R8XA 4AY4A 1DRUA 2XIQA 5F2EA 4F6RA 1EXMA 4ZODA 3ZY6A 3NUGA 4FN4A 2M1XA 2FUNB 5J5VA 4PNHA 2JBWA 2NM0A 1M2VA 3DT9A 1IUOA 3ZV7A 5LQKA 1X1EA 1PD1A 1Y5IA 4D80A 1PZFA 4WKOA 4QUJA 5KJ6A 2QP9X 5JW6A 2D13A 1VGQA 1RU3A 1YS1X 5LZ9A 4GLLA 2QMUA 5TEVA 2CDCA 1NRXA 4J2OA 2ZSKA 1TVMA 1Z6XA 1AKRA 1E94E 1U6KA 1WLYA 2A35A 2HWUA 2RJOA 3FKSA 4H0CA 3BHNA 3QNMA 3ID6C 2FK8A 3HCFA 4YJ2F 1SEPA 4JENA 5B36A 4H7FA 5LLDA 3OHSX 2O8EB 4LCEA 1P1FA 1QRTA 1M0SA 2FZLA 3ZCXA 2EW2A 3MT7A 3O9MA 3U13A 2IU6A 3PRYA 5KYWB 2QTBA 4II3A 1XPRA 5KJCA 3CXUA 3JWHA 1AD2A 2Y1OA 5FPTA 1ZIDA 4HWSA 1QHXA 3HU1A 4M0EA 5EIWA 4URXR 4RJIA 2KBEA 1J90A 4S04A 4TRJA 2JLUA 3Q8LA 4NECA 1NJ5A 5TMPA 4PYMA 1BRMA 2JHFA 1NF8A 3V34A 2Z3ZA 4Z1MD 2BPOA 2R48A 1NKVA 3O8DA 2ZOSA 1RTKA 1O9GA 1RD4A 5TIIA 3ELYA 3RVKA 5DP1A 4MQLA 3A9RA 3GUUA 1E3EA 5BOVA 4AAYA 4EJMA 1VJGA 1E2IA 4BQPA 3GN1A 3C4QA 5E0OA 4OM8A 3PFHA 3B53X 4UFOA 1VHTA 4O4IA 3TBHA 1TJYA 3P2IA 1SG6A 4Q93A 2DPLA 3M33A 2GXQA 4NHOA 4C4YA 5JHHB 1EFTA 5EMLA 5IXJA 3N8HA 3Q3JB 4QBFA 1SB9A 2FWBA 4WFIA 4L0QA 1BJKA 2WSBA 3TCXB 1T8SA 3O92A 1N5OX 4JGIA 4JLVA 6ADHA 1EVLA 1ENOA 4E15A 1WY5A 3ZKWB 1T0UA 1FUYB 4YGXB 3WFIA 4RS3A 3HXQA 4PFQA 3WYDA 1UJBA 1QSGA 1O6BA 2BKLA 2NT4A 2Y66A 3DMFA 3PA6A 3PGVA 3UA3A 4D9FA 3DFZA 2VF7A 3BFPA 2HTEA 3AHFA 3KYBA 2IKQA 2VDPB 3CWQA 4CQNA 4Q3OA 1C80A 1YSCA 2P6OA 3FPGA 2DTEA 1RMTA 2QAJA 4OLAA 1T9GR 2PUTA 1P5ZB 1VJ1A 2A86A 2DH5A 2O52A 2YH2A 3ETNA 3I2YX 1JI3A 1V7ZA 1XHLA 2Q50A 2UZ0A 3G5LA 3QK7A 4UHJA 4CF4A 1TZ2A 5CT9A 2XWSA 1MZPA 4REQA 1U0OC 4YCJA 1QX4A 2FWIA 3BXHA 3WLRA 1RLUA 4LX8A 4XX1A 2QGFA 3OQMA 4A36A 4YV2A 2WIBA 1E77A 4LRQA 4WLUA 2MJLA 1S0UA 3HUEA 5D3MA 1Y89A 3KP1A 4HGOA 4AY3A 1LD3A 4TMYA 4ZO8A 1RQNA 3RG2A 4ZMBA 4BB0A 4HGQA 4IGFA 4WJKB 4ND6A 4ZO9A 5DBHX 3QEAZ 1NW9B 1RXEA 5DMXA 3D7NA 2OHVA 3F5FA 4MS4B 3TR0A 2R66A 1CUUA 1VYHA 5DM0A 5EJ2A 4NMHA 4DOMA 4I5GA 3PL1A 4FJ1A 1DKQA 1SMKA 3A3YA 2I03A 3CUWA 2AN3A 3I9FA 5DX0A 3GH3A 4IRMA 4EFDA 2IHUA 1RAHA 1FNDA 1NLYA 2GSDA 3AHCA 3PR2B 4NVRA 4A1OA 1ZM9A 3DMRA 2AXPA 2AXEA 3SM9A 1U1EA 1YZFA 1V1RB 1Z75A 4OQYA 4BFSA 2EBUA 1TNDA 3NHYA 4AY5A 1DCFA 1HL7A 1Z3IX 1IAQA 3MINB 4NBNA 1H9CA 1DADA 3WQBA 4M99A 4EPVA 1M1NA 4DBVO 2ZREA 1H94A 2XBUA 1U0TA 4PHCA 1HRDA 4DC9A 2EX0A 4M7OA 3SZOA 3DDCA 4B6FA 3UANA 5JCJD 3D81A 1P9NA 1VPLA 4G1EB 3IIKA 3RF7A 1CG6A 2JIQA 3N07A 4Q7LA 1G55A 2IW3A 1BAPA 2BFFA 4ZQGA 1Z17A 2H11A 1CQWA 2VRCA 4P7FA 4W7HA 2G9QA 2DT8A 1RRPA 3QLUA 1BH2A 3DUFA 3HUFA 3QELA 1HURA 2NU6A 3RBAA 2VP9A 4B3SB 5ALPA 5LQMA 5E2BA 1WMFA 3CVWA 1XZJA 2G0TA 3G0IA 4LJ6A 4DR7B 3F6EX 3ILYA 5EZYA 1F06A 4WCFC 4G4SO 4KRXA 1R3DA 2EKQA 5JRDS 3OJXA 2ZR9A 1TUGA 4URYR 5I9TA 4WWHA 2O5EA 5AVKA 1Z16A 4IDNA 1XTQA 1II9A 3II6X 4MQEB 4BMZA 1RJ9B 3KSDO 2RK6A 4ZI7B 1CUGA 1O3YA 3PIDA 2JA1A 2FRVA 1NG9A 5AUNB 2BGIA 4NEGA 1UMCA 2YVKA 5HS4A 5JH7B 4KRFA 1ZGBA 3WMWA 4N3AA 3S2FA 4Y18A 4J9UE 2A5JA 3ZWBA 5KDOA 3WMFA 3IP5A 3KZKA 4L6IA 5BN3A 1I14A 5FPHA 4Z4GA 4RF5A 2GFQA 3RSFA 3LQFA 2FX2A 1G291 4I7EA 1HYEA 1KYQA 5SICE 3HYNA 3KQSA 3B6KA 4OQ4A 2XRZA 5HE9A 4MRAA 5D87A 4YQFA 1G2PA 4WNAB 1PT5A 3ZLBA 3GFRA 2AH5A 1DQPA 3PD0A 4P84A 5AK4A 3HL4A 4BJ3A 4CF5A 3SDBA 2F1JA 3C6MA 3MXOA 4L28A 3PENA 4YJFB 5I48A 1CUAA 3ZKAA 5LKAA 3TXAA 4LRXA 3H2ZA 4B6SA 1G42A 1Y9DA 2AOXA 3B2EA 3K2BA 2DE0X 3GRYA 1ZY2A 5B37A 2VP4A 5H8WA 3EGWA 1VGRA 1ZEJA 4ED9A 1MA0A 1F4LA 3KWLA 1R8QA 3IH5A 2FMUA 2G6TA 4YP7A 4COOA 2J0QA 1TAUA 1U3GA 3H5IA 4E5PA 5KTYA 3NT4A 3QENA 4NCHA 2IHZA 1TYBE 5AKLA 2AOTA 4QFDA 2F4VB 3GJRA 1EWRA 4YHBA 5FNVB 4MV9A 1ID1A 1ZK4A 3BWMA 3JATB 3JQDA 3G0HA 2ZAOA 4YRMA 3DWEX 2MYPA 3AHDA 5EJMA 1RYZA 1E63A 1IYZA 1SEVA 1XR3A 2P3LA 2RAVA 4V0OA 4WOJA 3B9RA 5ILGA 2XZDA 1RIFA 2VJQA 3LW8A 4I19A 1JQDA 4R69A 2VHCA 4FFDA 1E6WA 3N7AA 4IIJB 1IY2A 5I8WA 2FR0A 2F3QA 5AW4A 3LDUA 4D9JA 3EBPA 5EXPA 1E2JA 1PK7A 2PMWB 2PN1A 2ZJ1A 1OFGA 3ITEA 1TTPB 2IF0A 3W3AH 4LC9A 2BFEB 2XUFA 4OSPA 1C3LA 1G2OA 2GHQA 4J9VA 4G0QA 4WIAA 1AZTA 4Q16A 3BGDA 3P9KA 1T5IA 4CNQA 4EENA 4DDMA 2CNWA 4Z7JA 2RG1A 1AHHA 4LY0A 4AJJA 4XUEA 4XEUA 1YB2A 4I4TA 4Z1MA 4O4JB 3O03A 5DRTA 1K8RA 3EVTA 1A7JA 3HV0A 3AB3A 3M6LA 4MWDA 1BW9B 3GP5A 3RWOA 3STYA 4BKMA 4BN5A 1LFDB 2OD2A 4CCSA 4YAKA 5L6MB 2P0AA 5D6NA 5THQA 3PGLA 3SIWA 2P35A 1N3BA 4XRRA 3U3RA 5BSHA 1BX3A 5KYNA 4EY7A 2PHZA 3THXA 4GKBA 3JX9A 1DHTA 3TTTA 3M6FA 3UY4A 1WSAA 2I7TA 1FJGB 1UINA 3PUHA 4F97A 1Y6JA 3ORQA 1RWVA 1PHRA 1CLEA 3N2LA 1TECE 5ARDA 4URFA 4WKNA 3WGOA 3ROZA 3U17A 3EDOA 3P71T 5JALA 4DMCA 3AVVA 3F46A 1KOLA 2FZKA 3NTQA 2FR1A 5JQGB 5KEIA 4BQNA 3QKUA 1X8LA 3EN0A 4JOBA 4U7PB 4H6VA 4HUQB 3HB9A 4Y2VA 2YZ2A 5A06A 3KFXA 4NENA 5HK8A 4YP5A 4Q3BA 3CVYA 1POWA 4PIPA 1QH8B 3LUPA 2QUAA 1SCUA 2CL0X 3U4CA 1Y3AA 2C5AA 2PRSA 1JT2A 5K0EA 2WPNA 1B16A 2Y6UA 3OPNA 3VPSA 3EG9A 2JFUA 3E8SA 3FPAA 3ROMA 1MG5A 2JGLA 1NLMA 1EFUA 2J9ZB 2X8WA 4D0RA 2LR0A 2P65A 2WJHA 1NLUA 2OCAA 4KO1S 1Y7LA 4UOQA 4UDXX 2J67A 4N76A 1O4WA 2AJCA 3IEXA 3M4JA 2PKRA 2CKDA 1QPGA 2YXDA 4R0VA 1Z2PX 4DARA 1F9AA 3TM4A 4QBIA 3I62A 5JZ9A 2GXSA 1XRNA 2EKDA 1NOIA 3I34X 3QXHA 4K3VA 3TQCA 3QZUA 4JJ7A 5B7PA 3N1UA 2UVQA 2JJYA 3CNHA 4GKKB 2VPXA 5EXXA 2ZANA 3TW8B 4XR4A 2FPXA 2CXNA 5IJ9B 2VHWA 1VIDA 4FOTA 2C82A 4P34A 2OV4A 2MCFA 3TQRA 5FV4A 2YWFA 3MERA 3ZIDA 3LE8A 1I7DA 1KZYC 4M9QA 3PWZA 4GLOA 5EFZA 3RODA 3UIEA 2D5BA 4B9AA 2WPDD 3M6MD 4G5GA 4DCCA 4GX5A 1Z7YA 3KKPA 3CCBA 1EAMA 4I5EA 4JJFA 4QTZA 4BZZA 5FJJA 4ZD6A 3GWGA 2IXGA 3QOFA 4GPAA 3BYZA 2AD5A 4MGKR 4N18A 2RGWA 1Q0UA 1U5BA 3DTVD 3GGOA 4AO6A 4C7OB 4EGCB 2AHRA 1FJHA 1RWNA 3EPLA 2ZU6A 4N0PA 4WVLA 1EK6A 3EDMA 4LK2A 3UK1A 5AO9A 5BMVB 2X5OA 3RUPA 4QXRA 1W30A 4QD3A 1K4YA 1SZPA 2H59A 4LKOA 5TQVA 5LYJA 2RHGB 2ES4A 1WNFA 2PZKA 2PGIA 2GDZA 5HDBB 4XX0A 1ZGHA 4QLAA 2BFMA 1RYYA 2IS1A 2X8JA 4QEKA 4IQGA 3HMQA 5H4GA 3TDMA 3LLSA 1YQTA 2O2DA 3UFBA 3MUOA 4GI3A 2JCBA 3CURA 3CONA 4F1JA 2ANCA 4K9KA 3DOIA 1PN3A 1NHWA 3SF8B 3DULA 3IEVA 1IOLA 1MRNA 2A5FA 2ZUCA 2PVPA 3FLEA 5AM2A 3LT4A 4IOMA 3TI9A 1ACJA 1VXOA 3VR2A 4KX3A 3C6KA 1GZ7A 2OO7A 4EW3A 5KNCA 3PX2A 4DCPA 4AQYB 1OYWA 3HO8A 1YZVA 4HD8A 1GXSB 3EA4A 2H2GA 4CM9A 2EDAA 3L4SO 3HY3A 2QENA 2VDWB 1ZEMA 2XZTA 4MVJP 3PNVA 4UQPA 3RUHA 2QZZA 2H85A 4FHGA 5AW5A 3UHJA 5BV2P 2HUPA 2EG9A 2J0VA 5KC9A 2HCRA 2W0SA 1M73E 4GQAA 3GYBA 5E9QA 1AUOA 4DMRA 4RU1A 3E3OA 1RW4A 4KC0A 5I7VA 3CF2A 2QTLA 3KEMA 4KVAA 2VJDA 5AHKA 4HAYA 3DNMA 2AX4A 1NQXA 5FOSA 3OZAA 2PWYA 2ZCUA 2OZVA 1IY0A 5DYWA 2BCGY 6GPBA 2PMBA 1G3RA 3MAAC 3ND5A 3FUVA 1RWQA 1XEWX 4MA4A 4DT1A 4OGLA 1I51A 3GVIA 1GTJ1 4MQUA 4AJ2A 1Z0IA 1KFKB 1WMSA 1YCFA 1ZMTA 1N7HA 2CVQA 3GJTA 3O8QA 1Q0ZA 3P0HA 4IIUA 2E4XA 3SJZA 2Q9BA 3IOCA 3MGBA 4JC0A 1T34A 2IDKA 1IIBA 6REQA 1YK0A 5GJWC 3CIFA 4Q4LA 3C1OA 7REQB 3G7SA 4LTNA 3RRBA 1FP4B 3R5SA 4RADA 4P5PA 1KIAA 5JJ5A 2IEAA 4LGCA 3UUWA 2IIQA 3SFVA 2HA0A 1OFHA 4XPIA 1NV8A 2XUZA 1RRMA 4C78A 1NULA 3F1KA 4FPXA 2WMYA 2C4WA 3RJMA 1ZS9A 1HTTA 4FS3A 4FWTA 4HTAA 2O48X 3I72A 3UJPA 2C4VA 1DXQA 3ASUA 1EWYA 2EERA 1PF7E 1L5OA 4NJEB 3ZTYA 1E0SA 2QUBA 5E6RB 3S7ZA 3VXKA 5E6RA 1X1RA 1YJ8A 1SK9A 2CSXA 1XZPA 5AI4A 4YMVA 4TKZA 7AT1A 5IU6A 4RDIA 5B2FA 1Z07A 2ZWAA 2ZJ2A 3FZEA 1XDGA 1ZM4A 2BY4A 3CB4A 3GMDA 4KX5A 3TX6A 1XTZA 4V0QA 3FJ1A 1UJ4A 4NAVA 4RAQA 1FPMA 4MZDA 4R2WA 3AU9A 4LDJA 2QVLA 1M2HA 1SKUA 4IQFA 5AKKA 2PUVA 2C4NA 5I7AA 1KQ3A 4X1IA 4E33A 1YDHA 1II8A 2V6IA 4RCYA 1CDOA 1FDVA 5CFRA 2OXTA 1QWOA 2IGBA 3AONB 5DYGA 2JIMA 3BOSA 9LDTA 5FUQA 4OHVA 2YN4A 1SCJA 1V9LA 2YJZA 1BVUA 1MVLA 2CF5A 1RPJA 3KSAC 1Q1GA 2UAGA 3THXB 3ZDEA 3WYNA 1UKZA 1MO5A 2VAXA 5LN1A 2W2QA 1KE1A 4DR4B 3D2AA 3PHGA 5BN5B 9ABPA 4F60A 3OT1B 3I9NA 1BQ4A 3NHAA 1Y3CE 1LI5A 1T4GA 2HNBA 4OMCA 1EPUA 3EWSA 3FWHA 4RV4A 4UNRA 1EK1A 4C2TA 3DV9A 4F2DA 3JALB 1ADJA 4E6EA 2ERYA 3AEUA 2BZ0A 1FLDA 5AJUA 5ICGA 4WEOA 3Q3CA 5ADWA 1L4FA 3I2FA 4HDRA 3OIVA 2JIRA 4YJ3F 5BSWA 1IBMB 4LXYA 1FSFA 4H3VA 1N4DA 2D1QA 1E92A 1JDJA 1WHSA 1NU6A 1BVYF 3PKZA 3NASA 2XJ9A 4UUNA 3C7CB 3C97A 3B8HA 3TQHA 2R2AA 3OZTA 1JEYA 1OGJA 1E9VA 1I5RA 5JYEA 2CFSA 4YRAA 4GX0A 1LQ2A 1XL1A 5FL7D 1KI3A 1XPJA