2IYTA

Shikimate kinase from mycobacterium tuberculosis in unliganded state, open lid (conf. a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
175
structure length
175
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 64
structure length 175
sequence length 175
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iytA00
4LV5B 4PC6A 5EXTA 1EFTA 3QEJA 4BFYA 4LOAA 3WNDA 4PZZA 3QPUA 2ZRFA 2OHFA 2ODWA 1DO2A 4LUCA 1GZSA 2OILA 1G8YA 2GCOB 2GF0A 3OIUA 4JT4A 1ZD1A 4CW7A 1T9HA 1QDEA 2QE7A 2GCPA 2BC9A 2OBNA 1WB9A 3C16C 5HCNA 1G16A 1D8TA 2FX3A 2GA8A 4LBVA 4D25A 3KX2A 4DCVA 1XEWX 5E3HA 3QE0A 1TTTA 3M1IA 4Z8YA 5DI3B 1KY3A 1G291 1OXXK 1OXTA 1HUQA 2ZS8A 1IN7A 4ASUA 4TMTA 3RHFA 3LV8A 1WBBA 2VBCA 4URWR 2NO9A 4MA4A 3VQTA 1M7HA 4P4TA 4PC1A 2RGNA 3DHWC 4ZI3A 5CDFE 3L43A 4V0OA 2WKQA 1CR0A 4CT4B 2IBMA 4Q47A 2DWPA 1DOAA 4ABYA 3EPHA 4G0NA 1J8MF 2RAPA 2IYZA 2OZEA 2QAJA 3NG1A 4DHEA 4C2UA 2C9OA 1KO5A 1JPJA 1EG7A 4JLMA 4B3FX 1E2QA 5FOSA 2WAXA 2NZ8A 1GUAA 1IY1A 2OE2A 3FYHA 5FBLB 4II7A 3RAPR 5KU1A 3UMRA 5KDOA 1NBMD 1UADA 3HWSA 1AQUA 2QI9C 3FE2A 3AGPA 5DNYB 2XXAA 2VHCA 2H5EA 2CK3D 2J7PD 5CIQA 1DADA 1MT0A 1GWNA 4EUNA 4QFMA 2AWNA 2WWGA 3IPXA 3E2IA 4KFUA 3SJCA 4B48A 2IYXA 2ZRCA 1G21E 1QHYA 2NO6A 1XF9A 1N6OA 1SXJC 2BV3A 3BH7A 3PEUA 3TLXA 1GFIA 3WYAA 3CW2A 4QHTA 1NVUQ 4FMCB 2CHVA 2IF0A 1S0UA 3BH0A 4RZUA 4LGMA 1ZW6A 4JBXA 4AK9A 2ZSEA 4TYNA 1E94E 1A1VA 2CL0X 2ZETA 2GJKA 5D3MA 1EX6A 4V0LA 4EDHA 4QOSA 2PJZA 1AS2A 4N1AA 3T5DA 3RNLA 2B6HA 4PAOA 5LB4A 3VU9B 1W36B 2O8CA 2FSHA 1T3SA 3K70D 2IUSA 4OYHA 3NWJA 1G17A 1NRJB 5IK2A 3HP1A 1FP6A 1U9IA 1DTSA 1MR3F 5K8LA 4MRSA 2X19A 4OK3A 1J70A 2QORA 1DAKA 1DELA 1QVRA 1Z0FA 4CT5A 1E1QA 3SI7A 1OLOA 2J87A 2I3BA 3GLGE 3SJAA 3C8UA 3VX3A 2GZDA 3T1OA 1VG9B 5C4GB 2QY9A 3TSOA 4URYR 1P75A 1XMIA 3ETLA 1W5TA 3TSZA 5AK0A 1KOFA 2P0EA 3SEAA 2HF9A 1P60A 3ZGXA 2FJUA 2RKOA 3KTAB 1HYQA 1Q3HA 3QVUA 1R8SA 2ORIA 1FUKA 4DXAA 3HYRA 4TSFA 1CXZA 4RD6A 3ZIAD 721PA 4QGFA 5FTLA 1ZCBA 2XJ9A 4K8OA 4P33A 3NHAA 4C0JA 3U3OA 2BEJA 2WWYA 5DLQC 2NZJA 4YMTA 1Z63A 1GDDA 1MKYA 1YZGA 3NVAA 3SJBA 2BMDA 3AVQA 3HPRA 3SZRA 2GZAA 4AG5A 3FHOA 2ZRGA 3THYA 3DEFA 3DOEA 4CEIB 1W4RA 1KDPA 1XD2A 5J4LA 3FMIA 1G3MA 1AM4D 2TMKA 2CJWA 2RGXA 3BFVA 1IHUA 3B1ZA 4I81A 3K9HA 5AJZA 4EPTA 2PZFA 4H1VA 1RRPA 4V0KA 1OH6A 1QHGA 1JEEA 2ZR9A 3KKQA 4TLEA 4Q9IA 4X8MA 3OFNA 1CLUA 2JIZA 2ZJOA 2QGZA 5E95A 2CE2X 3CF2A 4A9AA 1DAHA 1OHHA 4OQNA 3PCRB 5JMTA 2VQSA 4B3XA 1FP7A 4YQFA 1AGPA 3FKQA 1YZNA 4OQFA 4Q9KA 2I1QA 3UWKA 1G3IA 2EVWX 3WMEA 2VHTA 3VKHA 4DB2A 1SQ5A 2OXCA 1GVNB 1C4OA 1VPLA 4FW9A 5FUWA 2AK2A 3GEHA 1F2UA 3F0TA 1S9HA 2WKPA 4W5HA 4FINA 4P4UA 4U5XA 3HJNA 2ZANA 4DDWA 1FL9A 2WMNB 4HDCA 5DO9A 5K8TA 4LJ7A 2J3EA 4Q19A 5C46F 1M7BA 5FOVA 1BKDR 3KJEA 1AQYA 4E07A 2XXAB 2QMEA 4C0HA 4MGIR 2BBTA 2IHYA 4DDTA 1VCNA 4CRWB 4E03A 1Z8FA 1NVXQ 1YQTA 3Q72A 3THOA 2CBZA 1KGDA 4Q7MB 4D4KA 3KB1A 1XPRA 4TQUS 2MMCA 821PA 2HXSA 3E5HA 3A8TA 3I8XA 5DHAA 1JR3A 3I61A 4A15A 5AJWA 4WVFA 2FEOA 4DZZA 1SVMA 4HAXA 5JEDA 1XTSA 3VHLB 1HY3A 4BE7B 2OUKA 2B7BA 4LBWA 3LRPA 3QBTA 1XD9A 4JLKA 5J4VA 2JAQA 4R9UC 3SOPA 3CRMA 2B21A 4ZDJA 1M74A 2ZYUX 1U90A 5KSZA 5D3MB 1CEEA 1E9FA 3LBIA 4QKQA 4A0HA 2JLXA 1NKSA 3FMOB 4LC1A 3RS4A 4JBYA 3TQFA 4URXR 1U8AA 3QF4A 5GVRA 1E2HA 4AKGA 3SE0A 1RFLA 3IIMA 2CL6X 4MYHA 2IYSA 4M9QA 4MKGA 1Z5ZA 4B33A 5HTKA 3A36A 5J4KA 3TUIC 3CX7A 2F7SA 2IEZA 1W0JD 5FTKA 1COWA 3NH6A 4NBSA 1N0WA 3PR1A 3LW8A 4WOPA 2Q9CA 3PEVA 3QKSB 4MKHA 3JZMA 5BN3A 4FMCF 1QHSA 2EWWA 4YMUA 4POAA 2VF7A 4A36A 3U3JA 2J1LA 5JRJA 2BBWA 2VSXA 3WYGA 2X2FA 3D8BA 1V43A 2QROA 4JKYA 5F98A 3VR6A 1ZIOA 2YNMA 1NG1A 4M1SA 1Z6YA 3UK6A 3I3SR 1JQJC 4ZIRB 3AVXA 3Q7QA 1S4QA 4C3ZA 2W0MA 3A1WA 2VRWA 2OM2A 1ETUA 4AKIA 4TYYA 1RW4A 1X8JA 3ZVNA 2BIFA 3W3ZB 1TADA 1W47A 4DSUA 4AKHA 3OZXA 3BWDD 3EZ2A 1KSJA 4GMXA 3G5UA 1XEXA 1DE0A 1Q44A 4NONA 4DVGA 1YJ5A 4ZCIA 2VHQA 5TMPA 3C5HA 2XTMA 1G5PA 4MITA 5HKKD 4V03A 4DLTA 1R7RA 4XOIA 3THYB 2WWHA 4N3NA 3TQCA 2FN4A 2EFGA 1E0SA 1XTIA 4JLBA 1SVOA 2JJ2D 1AZSC 3CX8A 1KDOA 1KI7A 1MV5A 2CJWB 1VYVA 2OCBA 2F1HA 1G8FA 4A0GA 1H8HD 3EZFA 5F9FA 2RGDA 1T0HB 3RRZA 2REXB 1BMFA 1E1RD 2W0SA 1IN5A 1W5SA 1G7TA 3SHFA 1UBCA 3HU1A 2QG6A 4QBFA 3EAQA 4HAZA 1JNYA 4PXAA 4ZPXA 4IEIA 2PJRA 3J81k 1KK1A 4Z54A 1G64A 3CF6R 4HDOB 5FTJA 1D2EA 2IYLD 1P7CA 1IXZA 2ZR0A 3I72A 4LPKA 3LAWA 2O0KA 2CLCX 4EJSC 4QG7A 1AIPA 1F2UB 1SZPA 1N6IA 1XMJA 3I1FA 3LH5A 3SDZA 1E69A 2F55A 4XVUA 1ZUIA 4Q21A 2RB4A 4W9MC 2FSIA 1FZQA 4BFZA 1WMSA 3QKRA 4HLUC 3I5XA 3DMDA 1UKYA 4ZCMA 2ZYTX 4U02A 2GRJA 3QBVA 2WOOA 3V00A 4RZXA 2XAUA 1HQCA 1KJZA 1G3UA 1XJQA 1IONA 1HT1E 1SKYB 3LVRE 4MGZR 4IXMA 3K0CA 4RSGA 4M0LA 3U3KA 2B92A 2YJTD 2GEDA 1OB2A 2IT1A 1I2DA 4IJMA 1T4GA 1FNNA 1KO7A 121PA 2Q3MA 1ZC4A 1E96A 2QQEA 4B74A 1KK3A 3HU3A 3LW7A 3ZVRA 3EW9A 3TRFA 3NKVA 2IF2A 1CR2A 3SFZA 2AXNA 5KOYA 1LV7A 1R6BX 2IYVA 4UXHA 3RSOA 3PUYA 1EWRA 2JLQA 1W36C 2R6AA 4BUJA 5DH9A 4NKRA 1UKEA 3KJHA 4FWIB 1G19A 3LQQA 2ZI4A 3ZS8A 1FPMA 1FUUA 2RHMA 3RS0A 3TJZA 1LFDB 5KSPA 1SGWA 5JS8A 3ZH9B 4CGZA 2BEKA 3GJ8A 1N5JA 2JLRA 2XNDD 4DSTA 2GXUA 4DCSA 2DHRA 3MAAC 4A2QA 2PEYA 3GJ6A 4Q4AA 2XSZA 5CIWA 4NYJR 2QUZA 1TPZA 2G83A 2Z83A 1W44A 4BEBA 2AD1A 1NVVR 2N46A 3R9WA 4WIAA 4RVCA 3W5IA 4H1UA 1XPOA 4Q1DA 4C9BA 4TZ6A 4ZDIA 3KJIA 1Q1ZA 1XCMA 2G0TA 1W36D 2ZIAA 4MH0R 4OBEA 3W90A 3GJXC 5CB6A 4LY6A 3ND8A 1ANKA 1QHXA 2V9PA 3AVOA 3QEOA 2KI5A 3EC2A 3K09C 4CVNA 4UQOA 3RRYA 1OYYA 1G1MA 4HLQB 4IEEA 1NP6A 3DZ8A 5AJXA 4AC9A 4KCGA 3RC8A 3P32A 1VYTA 4JIMA 1WP9A 3B1YA 3CONA 2NO7A 4OK6A 3D31A 2IW3A 2ZREA 3AUYA 4LV8B 4TMZA 3RYTC 2IYUA 2KSQA 3U7GA 3BJIC 2CNWD 4RCZA 4YMVA 3AB3A 2WWXA 4OQXA 3FTQA 3A4LA 4TMVA 1P2UA 4G5RA 3WXMA 4B73A 1XEXB 5CLQA 5HPYB 3QF7A 5FH9A 4S2EA 2VP0A 3THXA 2JATA 1PLLA 4F92B 3B5JA 2BBSA 1OJLA 4PAQA 4TMWA 5G40A 1FTSA 3ZDQA 2QL6A 1E9DA 2J46A 3W34A 4U7DA 3HR8A 2D4HA 4LYHA 5JHHB 2ZRAA 1NN0A 1LVGA 1NLZA 3MLEA 2BM0A 4HYYA 2VL7A 2IYWA 3IBGA 1SKQA 1GTVA 5JJIA 4FCWA 2GBLC 5CM8B 2Z6VA 2AR7A 2XZPA 3BRWD 2NTYC 1W46A 2V55B 1F5NA 1G4AE 1PLKA 4HZIA 1N0UA 1W49A 4MRNA 3MWKA 5BYJA 3P4XA 2QA5A 2BCJQ 1D9ZA 1VMAA 2IXEA 2QE7D 3U6KA 4GL2A 5GJBA 3NEYA 1WXQA 1E2DA 4BFXA 3KQKA 1ZM3A 5FR1A 5GJCA 1OF1A 5JLJA 4KBGA 5KDDA 3FVQA 1RPZA 1JJ7A 1XMVA 5CLLA 1JEDA 1G4UR 1T3LA 2W6ID 1YR9A 1KNXA 1ZNWA 2WIBA 5B64A 4MKIA 2A9KA 4D4LA 5K8IA 5JWRA 2W83A 5KHOC 3AVPA 1KI1A 3L0IB 3QJYA 4A8JA 1E2LA 2HF8A 4ASUD 1KMQA 4BRWA 2RGEA 4M1MA 4KFTA 1I4LD 4V02A 1GNRA 2WJGA 4JL6A 4RCYA 1DEKA 1Z22A 3AVYA 3AVTA 3QKRB 3SBDA 1F60A 1YR7A 4OK5A 2J0UB 2NQ2C 4GP6A 5SZIA 4LJ5A 4DRZA 3GFPA 4OI0A 1X6VA 3AKDA 3U3MA 1ZD9A 1US8A 2ZSDA 3NH9A 4X8LA 3CPHA 3AQ4A 4OJQA 4HAVA 5L3QA 1CS4C 4KHZA 2YWFA 4RD0A 1E2KA 4DCNA 4PO9A 1XPUA 2PT7A 1GITA 4EPWA 4LBYA 4C0AC 5TDHA 1HE1C 1NG9A 1Z2CA 4PHHA 2ZYWX 1Q3TA 1NMYA 1GNQA 5J40A 2ZJBA 3HR7A 1NN1A 5C4MA 2ATVA 2G77B 1R5BA 1JAHA 1GOTA 2GXAA 1NJFA 2O8EB 2WMOB 2IYRA 4I99A 4AWXA 1W0KD 2R9VA 4B2IA 1N25A 5H1YA 1ZD8A 2AHOA 3X1YA 3BXZA 1XXHA 4P4SA 2GZHA 5BW8A 4IDPA 3R20A 4BZXA 3B6EA 4TL9A 3VFDA 4TTQA 4G3XA 4IOLA 4TMKA 1XZQA 1NKTA 2MSDB 1EWQA 1U9IC 3GLHA 1S96A 4QBGB 3ADCA 3GJ0A 1ZNXA 1EFHA 1IJEA 3IIKA 4LYAA 5LD2B 4GRAA 2VTKA 1U8YA 3ONWA 4UNSA 5FOWA 3SQWA 4F4CA 1DPFA 5JBQA 2ZTSA 2J9RA 3KKOA 4G01B 1II9A 2BMJA 3MRSA 4HAUA 1JXMA 4DLUA 4KLNA 3SBEA 3WRYC 4C0LA 3VHXA 3WMFA 1KMHA 1VDZA 2BMFA 2YWEA 4K46A 1XB2A 3EZ7A 4Q01A 3ZQJA 5IK2D 1E3MA 2XJ4A 2GK6A 5DN6A 2F1RA 4DKXA 3U7FB 5AJYA 3RS5A 5LDDC 2DWQA 2QBYA 3IHWA 3SYLA 1Q1BA 1E1QD 1DVRA 1KI2A 3KKPA 2ANCA 4Q18A 3NC1C 4PSAA 3NXSA 1WCV1 1Q1EA 1X8KA 1RKBA 1OIVA 2QAGB 3VNUA 3VTKA 3LNCA 2R6GA 3TGPA 1GRNA 1RJ9A 3CUEF 4A4DA 2RGBA 3P27A 4AURA 3THXB 1AZTA 3FPAA 4B6FA 4RY2A 3GJ7A 2GVZC 3S1AA 2QP3A 1D2NA 4TSFD 3JVVA 3CX6A 5TVKA 1NIJA 2QNRA 2Z0MA 4Y0VA 3A1TA 3MG9A 4QC2A 3U2QA 5EXXA 2HCJB 4RKEA 2ONKA 2RHDA 3TSWA 5L3VA 1N5IA 1KZ7B 2REBA 2O5VA 4QHYA 5IDVA 4D26A 4B43A 4FMDB 4B2LA 1OSNA 4QGHA 2ZRIA 1VECA 1KHTA 4M8NE 1R0ZA 1Z6TA 3FFAA 1E2PA 3IQXA 1WF3A 4HB4A 1CU1A 4Q4JA 4XD7A 3P1JA 1N6HA 1OKKA 2F6RA 1B0UA 1LS6A 1E79A 5AJVB 4KODA 3A37A 1MO5A 2GVDC 2R62A 5FOTA 2D7CA 4A92A 2OLJA 1HEIA 3C7KA 3PIRA 1U99A 4QJ5A 3BB4A 4XVRA 3LO5A 4DBLC 3OFND 2JIZD 1R5NA 4A2WA 1NF3A 1TAGA 3KKMA 4IVPA 2AN9A 1C9KA 3H4MA 1TNDA 1OHHD 2WJYA 3UATA 1TQ4A 2EFDB 4A8JB 1KKMA 1OYWA 4PO1A 3TIFA 1LW7A 1NY5A 3SYKA 2BJWA 4WBSA 1P9NA 2R6FA 1CR4A 4LHXA 3TW4A 2YYZA 2H16A 5JCPA 4V0MA 2N42A 1UJ2A 1VHTA 5BN5A 2GEVA 1GL9B 2CXXA 3L0PA 4NCHA 1XJ0A 2JCSA 3IBYA 1HH4A 1AA9A 5SZKB 5L3QB 2JDIA 3K70C 1IY0A 4ZCLA 5JWHA 1XTKA 2R65A 1Z6XA 2ZUDA 1AK2A 1MO3A 3I92A 2FU5C 4IKEA 5DYIA 5FUYA 3RS3A 3SR0A 1Y63A 4LYFA 2H1LA 3EPKA 3UG6A 3IQWA 1W1WA 5B30A 5H68A 2CLDX 3IGFA 4C0KA 1LTQA 3DZDA 3LY5A 3EX7C 3C15C 4IVQA 4Q9LA 3CPJB 3X2SA 5G3ZA 1BO6A 2V8OA 3X1WA 3GMTA 4Q03A 1G7SA 1GIAA 1XXHB 2QRZA 4M9ZA 1CULC 4P4SB 3TW8B 3WP0A 5KSOA 2PH1A 1JR3D 2J7KA 2K5UA 3BS4A 2IA5A 4UJ5A 5HR5A 3HPQA 2XX3A 2WSSA 1VYUA 5G3YA 1K8RA 3TE6A 3GLHB 1MH1A 4YLGA 1Q0UA 1VCIA 3K0AA 4URZR 4WXRA 3WY9A 4BZQA 3GJ4A 1N3BA 4B75A 2QU8A 2IS4A 3BERA 3B60A 2IYQA 4CEHA 4MDEA 4XTRA 3O8CA 5FBVB 3ADDA 3KKNA 4R71A 4XTCS 3EIEA 4URVR 2D2FA 4PQRA 1S8FA 2WKRA 3QPWA 3FFBA 5LPNA 1NMZA 2HT6A 3KQHA 2C96A 2ZI5A 5EE3A 2PMKA 3KL4A 1H8EA 1S2MA 1TQDA 2ZU6A 2YINC 3B13B 3EZ6A 2OCAA 5FL7A 2QSYA 4URUR 5K8UA 4JLOA 3O47A 1KMHB 1VG8A 3QUSA 3OF5A 2X1VA 5KYKA 1E99A 5JI3E 3AVVA 1ZU5A 3ICEA 1COWD 2FNAA 2ZR7A 1IY2A 1UEIA 1PLJA 1G41A 2HDNB 1HV8A 1EGAA 4Z51A 2Q3FA 1ZBDA 4ZKDA 2FZ4A 2KBEA 1CJUC 4PC7A 4AD8A 1Z29A 5FPYA 2QBYB 4M9XA 2IEYA 1XJCA 2LWIA 4LJ9A 2NG1A 1ZYUA 2FOLA 2WJIA 3PVSA 4AKEA 1E9RA 2GHIA 3O8RA 3PEYA 4JYBA 1TUEA 1R2QA 1F3OA 4BGDA 1ZUNB 3CRRA 4R2IA 1L4YA 4NCIA 3RABA 4GT1A 1O87A 4B76A 4QBHA 1OXUA 4M1WA 1DBSA 4DSNA 3B8HA 1KI3A 4C30A 3ZVMA 5IF9A 1J7KA 3S1AB 2IK8A 2ZI6A 2ZRMA 2H17A 4DLWA 4G5OA 4PQFA 1M6NA 3W3AA 3DKVA 1YE8A 2BMEA 3ZJYA 2QGNA 4QGAA 5TB5A 1SVKA 1G8GA 2JEOA 2V4ZA 5FI0B 5A4JA 2WJHA 2WPDA 1T91A 2F1IA 3CNOA 2UKDA 3BH6A 2DY1A 3NHBA 5G53C 4B47A 2ECKA 1YZUA 1K5DA 1SULA 4Q4JB 1TF5A 3U60B 2H7VA 4M9SA 5JI2E 3L0OA 2AFIE 2CVHA 1Z0DA 3NBFA 4WAUA 2OG2A 3QOFA 4BEJA 1XD8A 2FG5A 4CEJA 4LRWA 1SKYE 3UANA 2P6NA 4LHZA 2VP6A 1GP2A 1N6PA 3N2EA 4ON9A 1BMFD 1JQLB 2J5XA 3LXRA 4K81B 4LJYA 1KAGA 1N0VC 3OESA 1NBMA 1R10A 1X1SA 3L8YA 4LCBA 2B8WA 4Q9JA 3EG5A 2W2XA 2QN6A 1RVDA 1XX6A 6Q21A 1JR6A 3PFIA 1JR3E 4G1UC 2XTNA 2OXRA 3GEEA 3OAAA 2WBLC 4YC7A 1Z6GA 4LV6A 4FMDF 5FBWB 2XB2A 3WRXC 2WZQA 4X8HA 1P2VA 3CRQA 1DAGA 1KI6A 2IUTA 4JZKA 1PVOA 2PEZA 4IOMA 5DE3A 2JA1A 2ZAOA 4NYIR 4BFWA 4AIIA 2Z4RA 1ZAKA 1ELOA 1PZNA 4I1OA 4PZLA 2VLIA 4WZBE 3IILA 4NTZA 2QT1A 4F4JA 3LQRA 5EE9A 3CBQA 5ANRB 2ZRJA 1T3HA 4RKFA 3RRNA 1X8LA 1R0YA 1RE0A 2P65A 4KLZA 2HXYA 4PC2A 4CDGA 4DIDA 3K53A 3QKTA 3H1TA 4TT3A 4YMSA 4DIEA 1FW6A 4Z8XA 3SQXA 1TQ6A 5LD2C 1G8PA 2O8CB 1SXJA 5JHGB 1A2KC 3U4QA 3NBYC 1NLYA 5C2JB 1ZM2A 1VKJA 1ZM4A 2ZRBA 3QSYA 2UVQA 2YOHA 2QM8A 4KFRA 2IXGA 3I8SA 3PUWA 5GADl 1OFIA 4TWZA 4LHWA 4BECA 2ORVA 2ZAMA 3K0AB 3WNCA 2PLFA 5D3QA 1YU9A 2C77A 3TK1A 3VNVA 2X77A 4CEHB 5C18A 1XDBA 4PQYA 2QEQA 3AM1A 1XBTA 2ZSFA 1KI8A 4FCTA 4EFLA 4LI0A 1GAJA 5BQ5A 3CO5A 2FDCA 3F5FA 4JVLA 1UBEA 2KJQA 3QPVA 3DVLA 3SHWA 4HAWA 1FMLA 2XSZD 1IOZA 1BH2A 3GQBA 1E0KA 3TMKA 4AI6A 4TZ0A 4L4UA 2P67A 2A5FA 4KYUA 3PITA 4WZ6A 3C14C 1G20E 2C03A 4MKFA 2QAGC 5HZHA 4HB2A 4NHOA 4JVNA 1GSIA 1Z28A 1E0JA 2AK3A 4TLCA 4F93B 2HEIA 2Z4SA 3Q5EA 4JMPA 4B3CA 1KDTA 4KXFB 3R8CA 1K6MA 1G9XA 1AGRA 2XEXA 2NPFA 4Z1MA 2HJGA 4P3YA 3IUYA 3U7EB 5FPTA 3QVVA 3WHKA 1ZNYA 1KAOA 3QXHA 2YV5A 4I1VA 1XD2B 3NDPA 3RWOA 1NN5A 4MQBA 3PUZA 3KXLA 4BLSA 3KQLA 1RRCA 4Q48A 4O3MA 5ELXA 2H57A 2VF8A 3VR2A 1WDTA 1Z47A 1VG0B 2WICA 1F2TA 1ZU4A 3BD9A 4KV9A 4P32A 3K9NA 3GP8A 1KSFX 1Z0KA 2WHXA 1UEJA 3LLMA 4HUTA 3AKCA 2V3CC 2Q21A 2O8DA 3KFVA 3LDAA 2ZJZA 3GLFA 5HZKA 1GKIA 4MUBA 5KPJA 2EFCB 4MGYR 5HE8A 4DUGD 2F3TA 1IN6A 2WV9A 2CEAA 2GCNA 1E32A 2W6JA 5L3SA 2ZRDA 3EIHA 3QXXA 2A5YB 2IWRA 3CRW1 1DAIA 3CB4A 2A5DA 5EXPA 3LX5A 2ZRHA 3OIYA 4QXAA 4BFSA 2ZRPA 5AUNB 4CEJB 1TU4A 2ZUCA 4XJXA 3F8TA 2FWRA 5JFGA 4X8OA 1JPNA 2P5TB 1XCPA 1N6LA 4Q7JB 5KUTA 1GILA 4KAXA 1LNZA 2A2ZA 2F1JA 3MMPA 2J41A 4EPXA 4O25A 3GD7A 3X1DA 4HZUA 1AN0A 1LS1A 4FMBB 2CL7X 5FPKA 3N2IA 3RVBA 1KNQA 2BVNA 5JWOA 4U00A 2VP5A 4JVSB 2DFNA 1YVDA 1GKYA 3CPEA 3T06B 1G7RA 4OHXA 4FXPA 1GL7A 4D82A 3CWQA 1KI6B 1OH5A 1UBFA 1P2TA 4R98A 1UAAA 4DDUA 4GP7A 1IAQA 5DGXA 4MYUA 4A1FA 5JZVA 1Q1QA 5B2ZA 2CDNA 2VYFA 4L16A 3PJRA 3V4FA 5FPSA 2BOVA 4WZAE 5JJLA 3C41J 4BFVA 1W4BA 2JLZA 1UF9A 4DT1A 5KTYA 4Q1BA 5EE0A 2BKUA 1T6NA 2CE7A 4KITB 1KIMA 1N5KA 1ZVQA 3TAHA 1KZGB 2DFTA 3WBKA 4FWTA 3TUZC 3AH8A 3AF3A 1TQ2A 2NO1A 1H65A 4PFSA 3K0FA 2C9CA 4DLSA 4JLNA 2QM7A 1OPXA 1GRRA 1ZM9A 2A78A 3QF4B 1X1RA 3NIBA 4QRHA 4UNRA 2GDJA 1W0JA 1SXJB 3L0SA 3U4QB 3QI2A 4M53A 5DSZA 4LDJA 2YWHA 1KK2A 4M4SA 4PHGA 4D6PA 3GJ5A 3T1QA 1BS1A 3AP2A 4YONB 1I2MA 2AFHE 2ZJYA 1ZCAA 1EK0A 4IDOA 4ESHA 1W48A 1WQ1R 1ZUHA 2G1JA 3FKSA 3LLUA 4F38A 3D6TB 3KB2A 4PZYA 2ZRLA 3B82A 1VIAA 2QP4A 2C9YA 1ZNZA 3AF2A 3T1VA 5M04A 1G5RA 3AP3A 3OEEA 5EQTA 4AYXA 2MSCB 1TL7C 3UPUA 3MFYA 5AUOB 1W4CA 2FV8A 2V1XA 3G82C 4MYTA 3QXJA 4JT2A 2ZRNA 1MOZA 2OFWA 4UNPA 2WVJA 3H86A 5H8WA 3WHLA 4KSBA 1RRFA 4QJ3A 3W5JA 2E9SA 3ZYCA 2GETA 4B3BA 4BLTA 3MWYW 2EYUA 4US0R 4EKDA 5HCIA 3AKYA 2GJAA 1M7GA 1KJWA 4W5WA 2DR3A 3IKJA 2IUUA 2ZXUA 1RRGA 3FHCB 4D4JA 2QPOA 2Q9BA 4NL4H 2O52A 1CJKC 4JL5A 1BIFA 4Q1CA 4QL3A 5EUMA 4C0BA 4EPRA 1E0AA 4IW3B 2GXQA 5EP2A 4KU4A 4OQMA 1A5TA 2JJ2A 3DM5A 4OL0A 3B1VA 4FI3C 5DN6D 5KNCA 2L0XA 2VHJA 2ZE6A 4JBWA 3CF0A 2FPMA 2OFXA 1CP2A 1GM5A 2HJVA 3DOFA 4JLJA 3OHMA 4M1OA 3EARA 4HLDA 2ZVQX 2EWVA 1F2TB 4PPQA 5EZ5A 4N0DA 2NMVA 3EWSA 2AKAB 3OEHA 1E6CA 2RGNC 2MSEB 2FH5B 4JLAA 2O8DB 4Q7KA 3AF0A 2ZVPX 5EZ6B 2ZQ5A 2GTPA 2ERXA 1L7VC 5F2EA 3GLFB 4B44A 2ZSAA 1U81A 1ZM7A 4M1TA 4NMMA 3CR7A 5DYGA 1TX4B 3K8YA 4HSEA 1OFHA 4R2HA 5L3SB 2V54A 1P5ZB 1A82A 2FGKA 1OW3B 1P72A 3GLIA 5JS7A 2JLUA 2REOA 1K5GA 2ODEA 1D5CA 2PCJA 2OESA 3UG7A 2PZGA 3CRVA 4MYCA 1E4YA 4HB3A 1XMSA 2R6CA 1AKEA 3AVUA 3I4LA 3WBJA 4C0QC 1M2OB 5UKDA 3DL0A 4XD7D 3VX4A 2OV2A 3E1SA 3BB1A 3ZS9A 1OKKD 1VG1A 1E79D 4GZMA 2DFLA 2GXSA 1YR6A 4HI0E 4HZUB 4IOKA 4TL6A 521PA 1XP8A 2QPAA 2R8RA 4G5QA 3B85A 1EFRA 2C99A 1CJTC 4RFVA 2CHGA 2N1BA 2IS2A 1OFUX 4ARZA 4JSYA 5FOXA 3ZZ0A 4EJSA 3W6PA 1Z83A 5FFMA 1RC8A 1XXHE 2WAYA 1ZC3A 4C0SA 3B78A 2FFHA 1AS0A 4HLUA 3T61A 1LF0A 3NC0C 4NH0A 2BBOA 2QMHA 4E5UA 2HT1A 1PJRA 3GLHE 2E1RA 4UXJA 1P9RA 4DT1B 4RD2A 2V7QA 2XITA 5FTNA 2QTFA 3F3YA 1JXOA 2Q0HA 3QENA 5FL3A 3R9XA 1ODFA 2EU8A 1E2JA 2CCGA 3DKPA 5E4FA 4TL8A 4M22A 4Q4HA 4N0EA 3TVDA 2JDID 2F9LA 2JLYA 3KXIA 2ANBA 3K0FB 5TV2A 5AUPB 1VHLA 1II8A 2P3SA 1L2TA 2I4IA 4P0TA 1GRQA 5EP3A 5BN4A 2PLRA 2XOKA 2X8AA 1E9AA 4OHWA 4Q4AB 4BLPA 1XEWY 4JL8A 4MRVA 3ND9A 2VA8A 4R7ZA 3PG5A 3U7HB 3KZ1E 2OO7A 4LC0A 1ZJ6A 3A6PC 3VU9A 4QM7A 3RDPA 2QMOA 4QM6A 4I4LA 5CK4A 2ZITA 3IEVA 3NBZC 2GJ8A 1FOEB 621PA 1TUIA 3FHTA 3VAAA 3Q3JB 3X1ZA 2WSSD 1OH8A 2OBMA 1R5OA 4B32A 3T35A 3ZZTA 1IN8A 1BOFA 2PZEA 1UKZA 3H84A 2QZ4A 2X2EA 3SC3A 3UIEA 1P3JA 1U2RA 1PUIA 2IX3A 1W4AA 2IL1A 3P20A 4EPYA 1OXVA 3OIWA 3T12A 1CBUA 3IO5A 1CJMA 5CYOA 2J0VA 3OE7A 4O0MA 2XZLA 2DWOA 3R9IA 1H8ED 1O3YA 1IBRA 5FL7D 2DFKB 4M1KA 1P73A 2PBRA 1QHNA 3IDQA 5FTMA 3RC3A 3CNNA 2G0NA 1Z0AA 1TF7A 1GKUB 2A3RA 4YMWA 4NU0A 1E2EA 4F4IA 1Z3IX 4GZLA 2LCFA 3SS8A 3BK7A 4JJKA 5TXGA 3DPUA 4KJZA 1JALA 1XU4A 3PEWA 1ZMXA 2B8TA 3DDCA 3VR4A 2FA9A 2ZJ8A 1WRBA 4NYMR 4CEIA 1M8PA 4ESVA 2NO0A 3ZD6A 5DIFA 3DO6A 3BIFA 5IT5A 1NLFA 4E09A 4KVGA 4TYPA 3I32A 2GJSA 1G18A 4W7SA 2P6UA 1YRAA 3EZ9A 1U98A 3IHLA 2W6IA 1Z08A 3BGWA 3K0EA 3VKWA 1N5LA 4XSGA 2WWFA 4NZYA 3U6BA 3B9PA 1D9XA 1U0LA 3RANA 2ZS9A 2RMKA 4ZO4A 1T5IA 1TU3A 4PPGA 4B34A 4V0ME 3GLIB 4OJKA 2WPDD 3EASA 4D0NA 3Q9LA 3QY0A 2GBLA 4L15A 4DJTA 2HLDA 4IDQA 2QTVB 5CB8A 3SNHA 1Z6AA 3A1SA 3Q8XB 4YXWA 5EUQB 1QVAA 2GESA 4B3GA 2Z5FA 1CF4A 2EQBA 2RGGA 3ZZUA 2BCGY 4Q1FA 1Z2AA 4UNNA 3H0KA 5E7MA 3BFXA 2G1KA 2EFEB 3N5CA 4PHTA 1A7JA 1IXRC 4Q02A 2F43A 1US8B 2H18A 2PMDA 4DEYA 2ZS7A 4XH9B 1I4DD 2VSFA 4ARZB 4JS0A 5CDFA 1DARA 3NTUA 4EJSB 1JAIA 5FBRB 4XWKA 1EESA 2ZROA 3B1WA 3A1UA 3QG1A 4TQAA 2JJ1A 2YC4C 4BASA 4QBIA 3OAAD 2V1UA 4DSOA 4BWYA 5KO2A 1VTKA 3PENA 4BPBA 1DS6A 1S3SA 1M1YE 2HYDA 3EPLA 1W0KA 2MMGA 4L5BA 2P6RA 3AGQA 3WNBA 3K0SA 1KDRA 3A4MA 4KI0A 3AKEA 3BB3A 2YHSA 3AVWA 4C7OA 2C5LA 2DBYA 3U44A 4G5GA 4A0FA 4V0NA 1E2IA 2JJ8A 3BORA 4Q4HB 1T8TA 4MUAA 4OI1A 3B7GA 3VR1A 5FR2A 3CZPA 3PQCA 5J4HA 3AEZA 4LYJA 4CF7A 1P4SA 1II8B 3MD0A 221PA 4JSTA 2ZJAA 4TYQA 2ZPTX 2IYYA 4TL7A 1P9WA 1E9EA 3QXSA 2D2EA 4OI2A 4QNRA 4OHZA 3U3RA 3T15A 2UZIR 1D2MA 1XTQA 4TT3D 1QHIA 4EIWA 3R7WA 4LX0A 2H8KA 4TQ9A 1OH7A 2QP9X 2CVFA 3IIJA 4NCJA 1W2HA 1SXJD 2ONJA 3LVQE 1KSHA 3CNLA 5AR1A 4Q4LA 1QHHA 2CCKA 2NOAA 4LZZA 3QKSA 2CLSA 1QG2A 1P6XA 1SVIA 4JVMA 3U5ZB 2DCUA 1FX0A 4GI7A 2ZI9A 3FGNA 4D2IA 3R8FA 4Q1AA 2F3RA 5C1BA 2KWIA 4ZIRA 5FOUA 4XIGS 3QIAA 4NYJQ 2ZM5A 3W6NA 2YZ2A 1G3QA 1RJ9B 4JLPA 1JI0A 4B35A 4HAYA 3W6OA 4D81A 1NVVQ 3TKLA 4IDHA 1QF9A 3GLGA 1UDXA 4IFEA 1KK0A 1J99A 2FE4A 2QTHA 2GAAA 5KPDA 1NY6A 3JVUA 3CKLA 5FUVA 1YZTA 3M0EA 4O2RA 4HLCA 3ICQB 1E2MA 1MABA 2A7QA 3PV0A 4A6PA 3KXKA 1HT2E 3LBNA 4EQ6A 3THWA 1UPTA 3RLFA 4Z1MD 5L3RA 1GG2A 3WMGA 4DDVA 1NBME 3QKUA 4L9WA 2FEMA 3LBHA 4NDZA 4L8GA 3TNFA 3KJGA 2W2VA 3ZVLA 4FIDA 5HKKA 1OB5A 2OAP1 2VP2A 2ZI7A 2EFHB 4YDSA 1U0HC 3M6AA 1KY2A 4XVQA 5GVSA 2QMUA 2D74A 2IC5A 1QRAA 2P2LA 3ADKA 4RZ3A 3QNUA 1VIYA 4KSCA 4Y0AA 1U8ZA 4KVAA 4LJ4A 4D4MA 3FWYA 3D3QA 1KJYA 4C2TA 5E7IA 4MGKR 4PPFA 3LFUA 2O8FA 2HCBA 2C78A 2EYQA 4RFSA 2CK3A 2NIPA 2GF9A 2RH5A 2J7PA 3CZQA 2W6JD 3MJHA 2BDTA 2E87A 3K0CC 2JLSA 1LF5A 3PXGA 4ERNA 1TF2A 3AUXA 4TLDA 1CKEA 1NN3A 1S9DA 4BFUA 2OAQ1 2ZU0C 2EW1A 1E2FA 5IHPA 1NJGA 2FFBA 2F43B 4PO8A 1RIFA 1WE2A 3BBPA 4PSKA 1Z0IA 2WIAA 5GJVC 1DG1G 3UXMA 2SHKA 1XRJA 4HB0A 3RWMB 4D0GA 1RYFA 2RCNA 3IO3A 1RZ3A 1IM2A 4KFSA 1ESNA 3DMNA 4DLZA 2ZJ2A 3EA0A 1SXJE 3GJ3A 1PUJA 2OLKA 4LJ8A 1SVLA 2C2HA 2BJVA 3X1XA 1LB1B 1G6HA 2GK7A 4LSGA 3LXXA 4JKIA 4LJAA 4F7WA 2AL7A 4C7OB 4RJLA 4RZ2A 1EXMA 3IPYA 3ASZA 3U44B 1NNEA 4KYIB 2JLWA 1L4UA 1B23P 1TMKA 3CH5A 3KDSE 1ZRHA 1CRQA 3K9GA 3WP1B 4GBMA 2IHBA 4MRPA 2JLVA 1G7CA 2PL3A 3K1JA 4BLQA 2WJVA 2RGCA 1KKLA 4C4PA 5HE9A 3KQNA 1LY1A 1A4RA 4BZPA 1JBKA 5J47A 2OFOA 3D7MA 3JZAA 5EJEA 4OKSA 4B71A 1UKVY 5EXSA 4A0RA 2G9NA 1FNMA 2B7CA 1XWIA 4M21A 2QQ0A 4F91B 5KNBA 4KBFA 2GAOA 3A58B 1UM8A 1L8QA 1UBGA 3R7WB 4ZDKA 4AYTA 4RD1A 3VR3A 3T5GA 4S35A 4A6XA 2PX3A 3SJZA 1E4VA 5J4YA 1HURA 3PUXA 1II0A 1G5TA 4PTLA 1QHHB 2FPKA 3ZIAA 2KE5A 4B3DA 2WWWA 4JLDA 5A0FA 3FDIA 1KYIA 3HDTA 4GFDA 4WW0A 5CITA 2D06A 5AUQA 1FX0B 1Q57A 3FKSD 4B2PA 4ZKEA 4HEJA 2A30A 1N2CE 2J45A 2IWHA 4XWOA 1IXSB 2FGJA 3O8DA 1KO4A 1U0JA 3OEED 4AYWA 5F3WB 1R4AA 5H70A 3W9YA 4LJ6A 3REGA 1E9BA 3ZQ6A 1FQJA 4DC9A 3ASYA 4AG6A 5CYPA 1QG4A 1S1MA 2ZUBA 1YZQA 3GLFE 2KB0A 4TTRA 4A2PA 1DAMA 3TVTA 3TR0A 4Q1EA 3VKGA 3GLGB 1Q12A 3EC1A 4AY2A 2IYTA 4GOJA 1Y3AA 4J0QA 1G3RA 4QNMA 2VH5R 3RS7A 4PR0A 5G41A 3A1VA 4HATA 4GOKA 4NPHA 5CJPA 5A5GA 4CYMA 3U61B 1MABB 2V6JA 2OEPA 4M1YA 1CRPA 1JB1A 4FN5A 3BAFA 4H9GA 5BXQC 1TEXA 3TAUA 2R6DA 4EQ6B 3THWB 2ODNA 4OHVA 1X3SA 4RD3A 1WBDA 1DAFA 4ZI2A 3ADBA 4US1R 2VP4A 4G5SA 1SHZA 4ZDWA 4DCTA 4HDQB 4ZV4A 4D0LB 4NP6A 2YKGA 1YKSA 1OT3A 1W7AA 4LPSA 2C98A 2WTUA 2CMKA 2ZEJA 2ZJ5A 3EIQA 4A8JC 4IFBA 4FD2A 1MO4A 1UDWA 1XFAA 1KO8A 3OEHD 2BHRA 2KBFA 1ONBA 2D62A 5AWFC 4BQSA 4ACBA 2GKSA 2A5GA 3LA6A 4PANA 5E7JA 4IVRA 1Q22A 2QENA 5JSZA 2NGRA 1BYIA 4XWAA 4DCUA 5BYKA 2R44A 2O8FB 4RFSB 2D7DA 4PC3A 1AKYA 2QT0A 1E2NA 4KO8A 1Z06A 3EPJA 1ZP6A 2J0QA 1RYHA 5B58C 2FFQA 4NYMQ 3GFTA 2V6IA 2XZOA 1OE0A 1YR8A 4A82A 3I5YA 1FFHA 2NPIA 2AKYA 3KFXA 1DAEA 4CZ2A 2ATXA 2P5SA 3BE4A 2FSGA 3LWNA 2OCPA 2XNSA 3NDBB 3MWLA 2J0UA 2LKDA 3T1TA 2HV8A 5DISB 3W8RA 1ESMA 4LHVA 3L2OB 5FI1B 3TBKA 3V9PA 1V5WA 1BYUA 1F6BA 2W00A 3BOSA 4TMXA 2VSOA 1NVWQ 1Z07A 1E9CA 2ZI3A 3MSXA 1HE8B 4OI4A 1EFRD 3SN6A 3ZLJA 3L8ZA 1J2JA 3REFA 1C1YA 3CH4B 1ZINA 5L8VA 1OIWA 1XZPA 2I1VB 2HUPA 2GWHA 4WXPA 2RGAA 3I73A 2Q9AA 1R0WA 2BM1A 5SZHB 2O8BA 3EXAA 1NSTA 1N6NA 4DB4A 2BKEA 4PX9A 2ASEA 4JJZA 4TLBA 4LWZA 3FOZA 2O8EA 2HYIC 3SYNA 2YWGA 4IOJA 3K70B 1KI9A 1KO1A 3FB4A 3RSLA 2GNOA 2F9MA 2G6BA 2ZE5A 1AJEA 3A4NA 4NCNA 4UKDA 3VMFA 2V7QD 3AV0B 3RS2A 4Q7LA 421PA 2QSZA 4OQLA 5CJ2A 4HUQA 2ZE8A 2VEDA 2PT5A 1YHNA 1NIPA 1IN4A 4US2R 1TEVA 1YZLA 2IXFA 5DI9A 2PCLA 4DLRA 4EFMA 4MDFA 2UZ3A 3GEIA 3C4JA 3QQ5A 2G3YA 3MWJA 1NMXA 3GCGA 2XOKD 3TR5A 4QGGA 3T34A 2C95A 5KDLA 4WA7A 1G6OA 5FPHA 1G8HA 1UFQA 2AWOA 3L82B 3UWOA 4GDFA 4Q9HA 3RRMA 5EP1A 3TH5A 5P21A 5TY0A 3MJRA 2WWIA 1J90A 1WA5A 1CIPA 2J59A 2W58A 1VCMA 1S1CA 1XCGB 1T0JB 1XTJA 3N70A 4Q00A 5BWMA 2DYKA 4O2LA 2IS6A 1E9SA 4BFTA 2A5JA 3VR5A 4IXNA 4TN1A 2YC2C 3KUCA 1EFUA 3B9QA 2LKCA 5SZJA 2BWJA 2W2TA 2WM9B 3KUDA 1H8HA 3CIOA 1IQPA 2WJJA 1T5LA 3B1XA 2QAGA 1E1RA 3FMFA 1EX7A 2QPTA 2Q3HA 3OE7D 2GCOA 1N6KA 2DPXA 3O8BA 3P4YA 3BFKA 4DLYA 3KQUA 5F9HA 4LBZA 3H2YA 3MGCA 1CJVC 3GLIE 1MRSA 3DM9B 2XGJA 3GFOA 1P2SA 4DLVA 2YVUA 4GNKA 4DUGA 2QRNA 2VO1A 1HQYE 4CIDA 2FFAA 4GPTA 2G88A 3HYTA 1JECA 3AP1A 4PPNA 2ZYVX 4ACAA 1R0XA 2O0HA 5DI3A 4NE2A 1FTNA 1YRBA 2FZLA 1QZXA 2FPLA 5JRZA 5EP4A 4IHQA 2FMXA 2JGNA 1NSFA 5JEEA 1JJVA 4LHYA 2VP9A 4GOXA 5CK5A 5EE5B 2AD5A 3Q7PA 4E22A 1KTVA 5JECA 1EFCA 1P61B 1OXSC 1GL6A 2AX4A 5JJKA 4GMDA 5TARA 3FMPB 5GJWC 1SVSA 1YZKA 5LBIA 2YOGA 5JSZB 1W2GA 2FF7A 3K9LA 1P62B 3NBXX 3GPLA 1AS3A 1CR1A 1GNPA 3I62A 3B2EA 3CR8A 2J0SA 4L9SA 2OCYC 3NEJA 2WSMA 3QG5A 1NL3A 3QXCA 4NCKA 3CLVA 4P31A 3UMFA 4B6EA 5KNDA 1E98A 2GJ9A 2ERYA 4DEXA 1J8YF 4FCVA 3SFVA 1NI3A 4EPVA 1OV4A 1R8QA 2VIIA 2HLDD 2OBLA 3TUJC 4JLVA 3V4RA 4YXWD 3MCAA 4BLRA 4M2LA 3OIVA 4TLAA 1Q20A 3E70C 4JYCA 4UJ3A 8OHMA 3LX8A 2ORWA 4QJ4A 1KSGA 3WYFA 1FQKA 1OIXA 2GILA 5EE1A 2XB4A 1Z0JA 2Q6TA 3IEUA 4MRRA 1PV4A 3BC1A 4BRUA 2Y8EA 2C04A 3SU8A 4PSVA 5IRCD 4TYWA 1I4TD 3Q5DA 2JASA 2XNDA 4TTPA 4GSYA 1IJFA 1XNJA 1FMJA 2O8BB 3HU2A 4I1UA 1DG3A 2O0JA 4I1SA 4DWJA 3M4YA 1F48A 2JJ1D 1X86B 3P26A 5JCZA 1KI4A 2IS1A 4ILEA 4QHSA 2Z43A 2H92A 1U94A 2OSBA 4IRUB 1S3GA 2CCJA 1VCOA 4UXIA 1SVWA 2D3WA 5J5CA 3LD9A 5KSYA 1A2BA 2PX0A 2ZSBA 2OT3B 4RD4A 3PUVA 1XTRA 4NYIQ 1QBKC 5LB2A 4HUQB 2DB3A 4OHYA 5DHFA 2R2AA 1MRNA 2VPPA 1XEFA 1OFTA 4UNQA 1Q21A 4XSHA 3G0HA 2GEUA 1CTQA 4W5JA 4DLXA 2ZE7A 1E2GA 3ECCA 3EWAA 5CM9C 3ZD7A 2WOJA 3W8NA 1T8UA 1N6RA 1D6JA 1SHKA 4Q5IA 4BLOA 3Q85A 1DO0A 2FSFA 1HA3A 2VHUA 3C5CA 2CNWA 2ODBA 1ZIPA 4IDNA 4ITRC 4Q66C 4D80A 4YDHB 3AF1A 3CWZA 4EAQA 5FBQB 3UMSA 2AXPA 1M34E 2C8VA 2YOFA 3MUFA 5B57C 3KTAA 3EA5A 4EFNA 3UKDA 2CHQA 2ZRKA 4LK2A 1MO6A 4PHFA 3K09A 1HTWA 2XTZA 3AF4A 5FUXA 4PAMA 3CM0A
chains in the Genus database with same CATH superfamily
4LV5B 4PC6A 1CYDA 1DDOA 4BFYA 3E03A 2QAIA 1CJSA 3FPSA 3QOYA 4Z2YA 3WNDA 4PZZA 3QPUA 2OHFA 2OOKA 3RF7A 5DMHA 4JCCA 4YLYA 4DR2B 1YRHA 1X7GA 2W6CX 3GEBA 3FNGA 4TS4A 5JXIA 3OKAA 2GF0A 3H5LA 4CV3A 1P4RA 2ZUVA 1R6DA 4YJGB 4JT4A 1T26A 4G0UA 3MWEA 4Y2JA 3ZCQA 1WB9A 1KOGA 1D8TA 3C8DA 2NWQA 5GONB 4ND3A 1IPEA 5K0ZA 1TCBA 3GGDA 4DCVA 1MXFA 4BRZA 4QRDA 3LUHA 4UBIA 5E3HA 4PRZA 4F5EA 1YRYE 4OLAA 1TMGE 2MYNA 1TTTA 3D8UA 3EGCA 3IVXA 4KR2A 1G291 2J5QA 2JIDA 1ZR2A 1O89A 1OXTA 4BO8A 1KDYA 3JAWA 3NTOA 4BLUA 2Y93A 4J0EA 8ABPA 4ASUA 3AUTA 2Y1XA 4TMTA 3JV7A 3TDMA 2NQTA 4URWR 3U7JA 1I33A 3VQTA 1DG9A 3WADA 2XWBF 1JA1A 3ABQB 3AR2A 2WG1A 1KVSA 4JBGA 4O29A 1CR0A 4V0OA 1JQKA 4KXUA 3PTLA 1OTHA 3SYMA 3EPHA 4F71A 5HM6A 1GKKA 4IY1A 3PPXA 3O21A 1J8MF 4BQQA 3HUDA 3LRTA 5A62A 1ZR4A 3N8KA 3ETNA 4AJ4A 4LYGA 1KYZA 3GWZA 5A05A 4G86A 5LU8A 4C6SA 1Z9BA 4OYRA 1E2QA 4HT3B 2WAXA 3FYTA 4RZSA 1IY1A 3FYHA 5EJ4A 5IASA 5KNLA 1JDUA 3U56A 2OLEA 4RACA 4CDNA 3HWSA 1AQUA 1SM4A 4CM9A 3QPBA 4DG9A 2H2GA 4WESA 5DNYB 1RJFA 3CNQS 5H3HA 3UQZA 2X0FA 2CK3D 2HA7A 4GBED 5DNUA 4RHXA 1KZ1A 2BR4A 1CRZA 4AKTA 3N0WA 3NTVA 2XIJA 1DTWB 1DAOA 1PRYA 4AZ0B 2AWNA 2IZ6A 3IPXA 3KLOA 4KFUA 1GJRA 1VRVA 3L1VA 3MVEA 1CUCA 3UJBA 3W7AA 1LBEA 1R0SA 2J67A 4QYIB 3PS9A 1SXJC 3TLXA 2B1QA 1KVUA 1OLUA 4XWWA 4BWGA 2XVMA 3I05A 5JY1A 1OFGA 2VPQA 1NVUQ 1WPQA 1HDZA 1S2IA 3MAJA 2CHVA 4UHJA 1K6XA 2YASA 3BH0A 2VZ9A 4LDQA 1QIMA 4U39A 2OGWA 5A1TA 1WD5A 4B31A 3I58A 1T0UA 3R3HA 2WYUA 4EKYA 3RHTA 5BSWA 2Q5JA 4EO7A 3SF8B 4JP8A 2O48X 3QLUA 4NECA 4BATA 4CJXA 3F6SA 1UP7A 4EDHA 3LLVA 1ORIA 1T3ZA 3SK0A 4AXXA 4XQEA 1FS5A 1AS2A 1X80A 3AM4A 3E9MA 3LPCA 5LB4A 3T5DA 1JI3A 2JFQA 5CX4A 3TLCA 4EVRA 1W36B 3GT7A 3WWOA 2P0AA 2V0NA 1T3SA 1DWQA 4CQMA 4ZALA 4AF7A 1Z12A 1G17A 1NRJB 5IK2A 2DT8A 5GQSA 2ODAA 3T7CA 3HP1A 3M6IA 5ALTA 4JGIA 1QQBA 1C9YA 4N39A 2G5GX 2X19A 4C7BA 1J70A 5EA2A 2QORA 1DAKA 4X95A 3ZK8A 5LLTA 1Z0FA 3T1HB 2I1WA 1EXWA 1ZJ4A 2HHAA 2QTGA 3KELA 3F4LA 4TTIA 5ALRA 3OWXA 4U1RA 5JPIA 2GZDA 3RIMA 5C4GB 3UJ9A 4RQBA 1Z4NA 1YCFA 3AIMA 1QG6A 2XQJA 4NJMB 1JVSA 1QLHA 3LSTA 2P2GA 3ETLA 1W5TA 2ES4A 2CLMB 5AK0A 3S5JA 4HQKA 3J7AC 1ZGAA 3B3GA 3IR6A 2RE8A 1IULA 1ZIYA 5EKTA 3K5PA 1P60A 2WA1A 1J1IA 3PTZA 4D4HA 4NQZA 3G68A 2RKOA 3KTAB 3W77A 1HYQA 1NNUA 3IVRA 1CXZA 5ALSA 1LI7A 1V95A 3BMCA 3L8FA 4QGFA 4C2TA 5FTLA 1PWXA 1RC0A 1ZCBA 2XJ9A 3NHAA 1OILA 2BEJA 4YMTA 2NZJA 3EXIA 1Z63A 4HN4B 1HSOA 3OO1A 4E7OA 3ROTA 1HNZB 2NZ2A 3SJBA 4JCOA 1KYYA 3DR5A 2TMYA 3SZRA 3NHLA 1J0AA 2GZAA 3HC7A 3FHOA 2JAOA 5FWYA 1XCJA 4HNGA 2XW6A 4OV6B 4S2UA 4GWKA 4CEIB 2AMYA 5J23A 2SNIE 1K8YB 3VNRA 3HWX1 1SXIA 1G3MA 4WE3A 1GQQA 4ZT7A 4EI8A 4JXKA 4RC9A 4HK4A 2C42A 4RANA 1IHUA 1IZ7A 1NR1A 1RZVA 2QM0A 3KSRA 5F5NA 1C1HA 3EOZA 2GN9A 3TSYA 5B2EA 1MHTA 2ZR9A 1JEEA 4MPJA 4Q9IA 2RC6A 3P0IA 1VIMA 2I3DA 3RVPA 1O6GA 1CLUA 1VE3A 2JIZA 3L7BA 4PU0A 4IJUA 3RSQA 1ISPA 4NARA 1QCYA 3FZGA 4AROA 3F7MA 1I4EB 1YJCA 5FV7A 2NP7A 1PNTA 2FZ5A 1WWKA 3SLKA 2EKPA 1W0CA 2EL7A 1FK8A 2JBWA 1WUTA 1NI5A 1YUMA 4Q9KA 5JAUA 1YZNA 4OQFA 2I1QA 1WBJB 3SDBA 3GGPA 3WMEA 4UUQA 1LSUA 3VVBA 3ZY3A 2YHAA 3DLTA 3C3CA 2OXCA 1TYEB 3MM4A 3N87A 4L0MA 3ELUA 2UVPB 4OLBA 1QU3A 5I9LA 5LZ7A 4MW4A 4UTZA 1X42A 2XCIA 1F2UA 1T5TA 4EYQA 2X7HA 4H18A 3ZDBA 3B52X 3ZU5A 2QUJA 4W5HA 3DBLA 4NMWA 1Y3BE 4TX1A 1WUJS 3OU6A 3GARA 3O2SB 3HJNA 1LDYA 1OC2A 2R11A 4M0PA 1R0LA 3OKPA 2WMNB 4DDWA 3TPFA 3C7DB 4QYSA 1QK3A 3FG9A 4IIJF 3W5HA 2Q7XA 1WXGA 1NW8A 1NP3A 1PDOA 4LMRA 4YRIA 3FNBA 1N2XA 1BKDR 3LLSA 3MUNA 4G65A 1BDJA 4WESB 5HK9A 2V6GA 2QMEA 1YB4A 3SFTA 2CFIA 3ZCPA 1L7OA 1KQGA 4LYYA 1L4MA 1SKMA 4EABA 3ORYA 1SCBA 3EVFA 2JK0A 4XSVA 1NVXQ 1VLJA 3PICA 3PX7A 3ZCVA 2CBZA 2C5HA 5BUQA 2BFDA 4UMVA 2MMCA 3O1HB 3WLQA 1T2DA 2VSYA 3B38A 1Z3CA 1QWSA 4UVHA 4EG1A 2VHWA 1JR3A 5TGZA 4GPBA 5E1MA 2B8NA 3U4AA 4A15A 4RCVA 1NBIA 2Q6IA 3VGPA 2EEZA 4E5SA 1OLUB 1SAYA 1XTSA 1H6DA 1QIEA 1HY3A 2WLSA 3F1LA 2O7SA 3IOBA 4WQMA 4BE7B 4LBWA 1QORA 2E82A 5IVPA 3EXEA 2I7TA 5I9SA 3BBLA 4CFSA 1JZSA 4NFSA 1MEEA 1U4OA 2GD1O 1HE4A 1UFOA 1U1GA 3CRMA 3PFWO 5HA5A 4B3HA 1AKQA 4ZDJA 5AHRA 2Q4BA 2ZYUX 3BWCA 5KSZA 1AMUA 3BICA 4XUEA 3PC8A 3H1PA 2QV0A 2PYIA 1J5PA 3B53X 1GNLA 5ICSA 2QDKA 1U8AA 3GA7A 4ZHSA 1X9GA 5GVRA 1E2HA 1X80B 1C9DB 2F3QA 1RFLA 4MYHA 3VR0A 1DWUA 2ZB2A 1VGVA 4GQIA 4B33A 5HTKA 3GBPA 4CQMB 5DEOA 4K88A 1R37A 1Z37A 3ZWOA 1E62A 3KHKA 2X8WA 3NH6A 4FNGA 4KBYA 4NBSA 4OYLA 4XWTA 5E6SA 4XIFA 4E32A 3AHEA 1THGA 3TLBA 4ZT4A 3WC4A 4OP2A 9GPBA 2Z3ZA 3V33A 3H8JA 5BN3A 5DHRA 4HD8A 1QHSA 2Q4EA 3HXQA 1R0KA 3CLKA 2J1LA 4KQHA 3UKOA 2EC5A 4MWCA 2BBWA 2VSXA 3WYGA 3COJA 3D5TA 2AW3A 2I2DA 1WTAA 4J0CA 4BMYA 5CDUA 2YVKA 3KAQA 4XDHA 2YNMA 2Z58A 1Z6YA 3ZI7A 4UFPA 3UK6A 2NZYA 3I3SR 3ZY5A 2QX8A 4DYVA 3FCUB 3Q7QA 1I5EA 3PNBA 3GPIA 4KMMA 2G7ZA 4LKRA 4QXRA 1ZJZA 2FPGA 5LOVB 1ETUA 2GPTA 3L49A 1QNLA 1LD3A 1VL2A 4CR7A 3AEUB 2BIFA 4XB1A 1QLWA 3BMCB 1TADA 3PBKA 1XK7A 3G9TA 1PZEA 5AW6A 5A2QA 3LDGA 1QIKA 3KWMA 3U80A 5DIZA 3EXIB 1WXHA 5L6MB 2DXIA 4JH0A 3F98A 3VH2A 1YJ5A 4JUIA 2M9MA 5E0KB 5ESRA 1U0FA 2VHQA 2HO4A 5TMPA 1UJBA 2VQDA 2Q3DA 2XTMA 3C5HA 4MITA 4R8KA 1NBEA 3G2KA 3V55A 3MMNA 3U7IA 1I9CA 1N2EA 1DJOA 4ZCRA 4N3NA 5BR8B 2VTBA 1O6FA 1UBHS 2FN4A 1DU4A 1GL3A 2I6TA 2RDMA 4P8RA 1E0SA 3DEHA 2JJ2D 1U6JA 3MGAA 2PX2A 3W06A 4ARVA 1KDOA 1KI7A 1MV5A 3CBGA 1BFKA 3NHYA 4GD3Q 1LZKA 1G8FA 2Q5EA 1KAMA 1VPVA 4X62B 1ZH8A 4DBZA 1FBTA 1FUIA 5JR3A 4QGBA 1T0HB 3JQDA 2GTIA 1G2QA 3RRZA 2W0SA 4C20A 2QV7A 1ZRMA 3SQDA 1NW5A 2VJKA 3SHFA 5EZYA 1YDWA 1TZJA 1ADBA 3TLJA 4CLEA 3FF1A 2BGNA 4OHOA 4QBFA 2ECFA 2X9NA 4XFDA 1IZ9A 4HAZA 2YVLA 1JNYA 1PFGA 3K2QA 2PS9A 3BCRA 4M8KA 3RVQA 4Y1GA 4BB9A 4C0XA 3CZMA 3VJRA 2GLTA 4NRDA 4XYMA 1C8BA 1NYQA 1YR1A 1TJ3A 3GCXA 3GNLA 1Y8QA 3KZOA 1G64A 1S89A 4CV0A 3I72A 2ZR0A 6GPBA 3VI3B 4C5CA 2OD7A 2ST1A 1SC4A 1LC3A 1AIPA 3QE3A 1F2UB 1SZPA 2A9OA 4DPKA 1Z5UA 4UTPA 1N32B 3IL2A 5C81A 3G2MA 3LH5A 4XVUA 1ZUIA 3DBLB 3UK1A 1NVFA 2QE6A 2JGIA 2RB4A 3HP4A 3OPYI 5YASA 5TS2A 1TJNA 1FZQA 3OHPA 1M0EA 3QKRA 1P19A 4HQ0A 1OWMA 1NNLA 1P2BA 1RAEA 4L78A 1TI7A 2WOOA 2ZBEA 4H7PA 4CETA 3N2YA 2I55A 2W98A 1KJZA 1G3UA 5JDIC 1XJQA 1SKYB 3CLTC 4IXMA 1GPMA 1WCXA 5HUJA 4L2IA 2Z1DA 1VHWA 4RSGA 4UPEA 1GKLA 1UODA 2YIDA 3UFBA 3H65A 1N75A 1XQXA 2IT1A 3H4VA 2BFDB 1I2DA 4IJMA 4M7PA 1KO7A 121PA 2Q3MA 1AUPA 5C7LO 5JNTA 2VYND 1I0ZA 1FS6A 5CXUA 5CT5A 2QQEA 4ZN6A 1N34B 1CSEE 3HU3A 3ZVRA 3EW9A 2ZBQA 3MWDA 2IQIA 3SFZA 3WIDA 4OHUA 1UPUA 1KQ3A 1LV7A 4H7DA 5KOYA 2DX7A 3JQAD 2IYVA 1B00A 3KT6A 3PRJA 2HMUA 3PUYA 4NV0A 3C3BA 4FDMA 3LPLA 3EXEB 4W8HA 3LOQA 3U9TA 1W36C 1VB3A 4KW7A 2X9GA 1ZQ1A 3KJHA 1DJNA 3G1TA 4NOMA 1FUUA 1PJLA 2PD6A 1BHSA 1JT9A 4O02B 2VATA 3MLAA 4X1YA 3TJZA 4DR3B 1GCOA 5BWCA 3QVXA 2K7FA 2I22A 4HTFA 3ZH9B 1XQ9A 4CGZA 4HXEB 3ZG6A 2XNDD 4DSTA 3FMVA 1OCEA 2GXUA 3I2JA 4MLDA 1A3CA 2HMWA 3GJ6A 3LZDA 5FAXA 2JRCA 3SEFA 2F2TA 3FM9A 1K08A 1MH9A 1QYVA 3N39C 2FWBA 1JLKA 3UO8B 1W44A 3UGTA 3M8KA 5A1JA 2AD1A 1NVVR 4RYDA 3P45A 5E6SB 4DRXA 4Q0MA 4FE4A 1P80A 1TM2A 3IERA 1EWYA 1XPOA 4Q1DA 1HE5A 4FPXA 5BN3B 1U31A 4TZ6A 3DMPA 1HDEA 1Q1ZA 1YJQA 2G0TA 3A9WA 3R5KA 1KC1A 4MH0R 5F35A 5BRJA 4TT8A 3GJXC 5A7FA 1WETA 1O95C 3U5TA 3L41A 1QHXA 2V9PA 1HDIA 1GR1A 2CNOA 2NM0A 1O94C 2BRUA 1OYYA 2Q62A 3VTFA 1OZHA 2PMWB 5AJXA 1YT5A 2PPVA 4KCGA 3RC8A 3ONNA 4LRTB 1VYTA 1A88A 4JIMA 5KYNA 3G8CA 3PKJA 3L6OO 4FFOA 2NO7A 4JQCA 3KSMA 1BWSA 2DUNA 1XAIA 3D31A 3AUYA 3PXCX 3BT7A 3WDKA 4TMZA 3RYTC 2KSQA 2X5NA 3I28A 3BJIC 4FIZA 1HLDA 2XCLA 1OUMA 3AB3A 4OQXA 3UQYS 1A98A 1ZGBA 4GEKA 3KOOA 4B73A 2FW0A 1C7FA 3ELBA 3FLBA 3QF7A 1GLNA 1SRQA 3G9ZA 3PHLA 1KYQA 3R5XA 4KQWA 3V97A 5FH9A 3B5JA 3UUEA 3B6JA 3E9ZA 3L7LA 4WRRA 3ZWAA 1OJLA 5G40A 2PHZA 4CU2A 2CV1A 2QL6A 4MVJG 5IBQA 3WIEA 1IAVA 2PKEA 1QNFA 3D4OA 5CFRA 1N5DA 4LZPA 5JU6A 1SO8A 2VRCD 3A4YA 2R48A 1YZ3A 4NZPA 2D4HA 4X94A 1JEOA 1NN0A 1R88A 2O2SA 2POCA 2YMQA 3BXGA 3WAGA 2H5JA 4W9RA 3FUUA 2VL7A 5DFAA 3KYIB 4PLPA 3WDLA 3F7NA 1NWCA 4RHYA 3LQYA 4XAQA 2Q5LA 1SKQA 4GNRA 5CM8B 1ZESA 3BRWD 1VRWA 2AF4C 3WFZA 4KIJA 3NAQA 4HZIA 1N0UA 4KZKA 4JNCA 2X8JB 2DAPA 3P4XA 1YKGA 2GARA 3SBXA 2VHXA 3OE5A 1GLVA 1E2DA 2XHZA 1L8AA 1NHGA 1ZM3A 1DXYA 3GWGA 3KAKA 2Z8YM 4H3HB 4CNBA 4WBNF 1NPYA 5ALUA 5JLJA 2VZ8A 3LDFA 5KDDA 1JJ7A 3N76A 1B1AA 1L4BA 1Y8QB 1FU4A 4CEHA 4CLXA 1KNXA 2CV2A 2AR9A 3KZCA 3E35A 3GLQA 1Y9AA 4LTDA 4Y18A 5KQSA 2HV9A 1N2ZA 2Q99A 4B7XA 2PBFA 2W6QA 1CP3A 4MZDA 2XKAA 1LTHR 3OY2A 3L0IB 3QJYA 1THMA 2HF8A 2R7KA 4M0EA 4M1MA 4CUZA 4V02A 5E6RB 3SGLA 2WJGA 3J7TA 4MW7A 1XZNA 3WAJA 1DEKA 1Z22A 2GTHA 3QKRB 5C7IO 2CEKA 1YR7A 2SKDA 1XTPA 1SH7A 4GP6A 3SP1A 3O93A 4IUCS 1UBUS 1V4NA 3RE1A 2OG1A 5BWOA 1NQTA 1XTTA 5EHIA 2AI3A 1WMAA 1JYFA 2ZSDA 1F2DA 5C5EA 2O7QA 1QQTA 5CT8A 3OPYA 2J0EA 2NTVA 2LXNA 4FDLA 2F9FA 3AQ4A 3EEIA 1Z4JA 4HAVA 4L2IB 4N3CA 4O1IA 1E3LA 1E2KA 5FIUA 4DCNA 4OQZA 1RJGA 5JAHA 1XPUA 3N59A 4ZEWA 4HRAA 1O5OA 4UZFA 1P4GA 4C0AC 3A4TA 1Z2CA 1MU0A 1U1DA 4LMPA 3OFSA 2ZYWX 5ALEA 3L8DA 5B7NA 2ZJBA 4JB8A 1H66A 2WG0A 1ZNQO 2C2GA 1H2RS 1R5BA 2WZBA 3KC2A 2GXAA 1GGNA 1SCDA 2G6TA 3MWDB 4OX9Y 3HCDA 2IOQA 4QLBA 2IYRA 4AWXA 1N78A 2E5FA 3SE7A 2CN1A 2C2MA 2R9VA 3VR5H 4A0QA 2ZIVB 4EMUA 2AHOA 2CJPA 2GNAA 4H0NA 3O7MA 5JD6A 4BV8A 1EM8A 4WLUA 4IDPA 1UMBB 2VPXA 5IAAA 4X1YB 4DLBA 5H4HA 5EHXA 1PI3A 4IJKA 4Z4QA 4HTFB 3CTPA 3P8ZA 4RYLA 3RC9A 2A9QA 3C8MA 3GLHA 3RH0A 1IL0A 3BE5A 3ADCA 3GJ0A 4GZ6A 4CM3A 3DMTC 3PC3A 3O4JA 4LYAA 2ONZA 1PNOA 5KOJA 1U8YA 4RK5A 4GM0A 4UNSA 2HMAA 3IXMA 1C80A 4DRXB 2D2VA 2BKXA 3K2IA 2ZTSA 5CHYA 2J9RA 3A11A 5BQXA 2BMJA 4HAUA 3IIIA 1QJ4A 4J4HA 3URKA 2BFCA 1JHVA 1QVWA 1T9ZA 4JI5B 4IKPA 3SBEA 3U4DA 4C0LA 1FBNA 1VDZA 2BMFA 3F8WA 1ITZA 2IY7A 1WABA 5T8KA 5A6VA 3OJFA 4Q01A 1S3IA 5BSTA 1B2RA 2X5XA 3IOEA 3I9MA 5HS6A 5F12A 5T4EA 3SY8A 1VZ2A 1O9HA 3IR7A 2AMJA 4GE3A 4A8HA 3IHWA 1Q1BA 1Y89A 4HQNA 1E1QD 1MVLA 1KI2A 4E51A 2RCYA 1QIDA 3RUFA 3NXSA 1PYDA 1D1QA 1WCV1 1WNFA 1X8KA 3HI4A 2IGTA 4L7QA 4PBSA 3W8FA 2GDZA 1KQNA 3WNQA 3ZCTA 1DJQA 5K8JB 3GEDA 3RS9A 4C4XA 5KNDH 3VNUA 1GQSA 1GRNA 3WSVA 1KJJA 4OVKA 3QWFA 5JAOA 4LSMA 4WFIA 3GOQA 4IQGA 2Q2OA 4TWBA 1HDRA 3BEOA 3UTDA 5A3QA 3V32A 3HV2A 2QP3A 4DDKA 2RFLA 2VF4X 3OLWA 4TSFD 3TMAA 1EVIA 3JVVA 4O2AA 3ZV5A 4BO9A 4ALLA 3ER8A 2ADMA 2JHPA 5C8YA 4WOKA 1B0AA 3D4BA 1NIJA 2JAPA 4Y9RA 4AQDA 3A1TA 1PK8A 2XUFA 3OH8A 2QKYA 4RH3A 3HDJA 4QODA 2JFOA 4RKEA 3GC6A 1MDFA 2RHDA 4KOEC 1QCZA 4D8XA 1FTGA 2REBA 2XADA 5AK4A 3KOYA 1VL0A 4QHYA 1L9XA 2UZ0A 4ENVA 4FMDB 3A9RA 4M8NE 3IQXA 4BJ3A 2ZULA 3IBTA 5I9BA 1EBBA 1I3CA 1KEUA 2GOYA 2O2IA 5DX0A 2D6FA 2B4RO 5JYDA 3GFFA 2JFPA 4FYYA 1E79A 4OXNA 5AJVB 4Y6OA 4YLEA 4FUTA 3UMMA 1CQJA 3R7BA 3Q9NA 1MO5A 2PKYX 4FWBA 4IXWA 4ZA2A 5FOTA 1XQ6A 1HEIA 2GFQA 2O3QA 4PVDA 3TL3A 8AT1A 5EFZA 3OFND 1P4JA 1TAGA 4I8IA 3OA2A 1YRWA 3FNRA 1KZ6A 2AN9A 3N7AA 4Q9DA 3KJZA 2GCGA 4V3BA 3WLPA 3AL0C 1HEYA 2PX4A 4PTYA 2WJYA 3UATA 4EELA 1U80A 2EFDB 4YBZA 4D97A 1SHUX 4I8XA 4CTOA 3CLHA 4GICA 3ZN2A 1WU7A 4R54A 2WU8A 4WLOA 3SYKA 2BJWA 1L5FA 4S1VA 3TG2A 3TW4A 2H16A 4YWJA 1YI0A 2Q28A 2Q0SA 3OCUA 3USCS 1UJ2A 1MD9A 4BTLA 4ND8A 5IDXA 3QVWA 2GEVA 1C0EA 1EVKA 2AOVA 2CXXA 2VJCA 3CT6A 2FWNA 2MYPA 3C3MA 3FVWA 4X93A 4Q7EA 3OU7A 4B8YA 3BDIA 1A9XA 3IBYA 1H1DA 2WIKA 1N9GA 3I01M 4F3YA 2X9QA 2ZKIA 3A3KA 4Z9YA 4ZCLA 4OF4A 3S6JA 5I9NA 2R65A 1DCMA 2A59A 1AK2A 2XTAA 3I92A 2FU5C 3KYJB 3PGKA 1LPPA 4AFNA 3RM3A 1K0UA 4KE7A 3L06A 1ICIA 4YQZA 3QJ5A 4LN1A 3EPKA 5KPDA 1AV7A 2IQ5A 1OGYA 2JVJA 3HRKA 2CLDX 5CFPA 1TGYA 2GYWA 3DZDA 3LY5A 3EX7C 4GPZA 4C1NA 3HP7A 4GEGA 4F56A 3MS7A 3OUTA 5G3ZA 1DO8A 2DULA 1VHJA 4AZVA 2XNHA 3X1WA 4NNJA 1GIAA 1UWCA 3UB3A 1I7DA 1CULC 1EM8B 1KQPA 3AJRA 5KSOA 3BPSA 1FQOA 1TM5E 1GGEA 3BS4A 2IA5A 3ESCA 4UJ5A 9LDBA 5HR5A 2I4TA 4P7BA 2JH3A 5AICA 1VOTA 5KQGA 3WL6A 4MVJF 2EAUA 4F6RA 3KLNA 5AKGA 3GLHB 1H2HA 1NJSA 4MJXA 3IP5A 4DTCA 1N3BA 1S2GA 5COAA 3CGWA 3H11A 1T6XA 1Y8ZA 4UDOA 3B60A 4XX0B 2Q8PA 2WIFA 4XTRA 4RTNA 2ZDGA 3A2LA 5BR7A 3OZWA 5KOJB 3Q6NA 2D2FA 5I9TA 5AVWA 2QRVA 9ATCA 2WKRA 1THZA 2W2OA 3RFUA 4TVOA 1V1MA 3KQHA 1VGQA 1K4YA 3TJRA 3KL4A 1H8EA 1S2MA 2GO7A 1LQUA 2ZU6A 1E4EA 2OCAA 1RKVA 2W6NA 4Y1FA 2BFCB 2ZJ7A 4DJFC 1Y7PA 3HSSA 3PVCA 5I9IA 3OZSA 1DKPA 1D04A 3DE7X 3HZHA 2DG2A 5TEWA 5JIBA 5KQPA 2C8JA 5DWVA 4PFJA 1T4CA 1COWD 1EH5A 2HJWA 1DQSA 2ZR7A 1JH8A 2FKAA 2O0LA 3NAZA 4HLNA 4U8GA 5AKJA 5CFLA 5KJCA 2HDNB 1HV8A 1EGAA 2Y1OA 1EUQA 2Q3FA 4MI3A 1KPIA 4C7VA 1BW9A 2KBEA 4ZVNA 4B80A 4CMHA 1TVCA 4KJXA 4BGEA 3I04A 5FPYA 2QLNA 4MA0A 3T4PA 2NTEA 3FPEA 4N47A 1BVUA 1SVNA 4I8DA 4LJ9A 5AOCA 4AKEA 2GHIA 4BU0A 1M10A 1UKCA 4JYBA 1Y82A 2RG7A 3CRRA 4R2IA 2O2XA 4GT1A 1O87A 1FP4A 4QBHA 1JHUA 2XDWA 5HIMA 4CTMA 1KZYC 3B8HA 1EB9A 2DZDA 4MUYA 4OP1A 4C30A 1WUHS 4ARBA 5IF9A 4CQNA 3MCUA 2ZRMA 4E08A 1KEKA 4W6ZA 2P9JA 4E2YA 4O2AB 5COBA 2ZT8A 3DKVA 1YE8A 3HCCA 4KOAA 4C06A 5C8YB 5IG2A 1KBQA 3LY7A 1JG2A 1YHZA 3K0HA 5TB5A 3WYNA 1G8GA 1YJXA 3O95A 3V7UA 2Q3EA 1NXTA 2WPDA 4DMMA 5FT9A 5IUNC 2AF3C 2ERCA 2UKDA 1XKTA 3II6X 3NHBA 3PRKE 3OX4A 1ULZA 1BQ4A 2PM8A 1NBWB 4GWLA 2OP1A 4OJTA 3VAZA 2L19A 4HAOA 1QRRA 3K8ZA 3L0OA 4EHJA 1IRIA 5DKFA 2NXNA 3NBFA 4NZNA 4WAUA 2OG2A 1PCXA 1CQJB 4Z0TA 4LRWA 3FUWA 3TECE 1FS4A 2WTMA 4QYMA 4LHZA 4FQ7A 3VO2A 2BH9A 1N6PA 3N2EA 5I47A 1P0IA 4K81B 2D0IA 1KAGA 1ORVA 3GPBA 1NBMA 3OF2A 1ZMTA 4DIOA 3IODA 2NU9A 4QDOA 2VDWB 4K0KB 3H3FA 1RVDA 4UU8A 1L5OA 3S2UA 4BAGA 5A4AA 2EJCA 3EY9A 3HCFA 3S2SA 3L1IA 3STXA 3NT5A 4G1UC 3FXAA 4JP3A 5HGXA 4ZQBA 3OAAA 3KTDA 4KR0A 4P3KA 1WUKS 1H6AA 3U1BA 2WZQA 1RI2A 1C9EA 1Q0HA 1ADFA 4XUCA 4YFVA 2XZTA 3CRQA 1XOIA 4ZK6A 1NQUA 2WAAA 3HHEA 3PX2A 3M2PA 2IUEA 2NVBA 4Y9UA 1PVOA 4BP9A 2PEZA 4C76A 3FA2A 3G2NA 3PQFA 4IOMA 4K9QA 5DE3A 1TO2E 1NFFA 4EBFA 1RS0A 1A9XB 4MR9A 4C78A 1RWWA 5JCOA 1N9GB 4H6XA 1GSAA 3V8QA 4C04A 1R64A 1ZAKA 4H6PA 5IEJA 1N2JA 2JL1A 1FFBA 1JLMA 2VLIA 9ABPA 1D6MA 4WZBE 1JDBB 3IILA 2CUZA 4X61A 4AJEA 1HT3A 2JGRA 2UUOA 1CDDA 1LFAA 1JB9A 3CBQA 5AI0A 2OUIA 4JB0A 4CI9A 4EB0A 4IZOA 4A2CA 4CDGA 3N8DA 2UZ4A 3QYAA 3FIUA 2JCGA 4DNPA 2HSEA 3K53A 4UAJA 4DIDA 5IDWA 2I3ZA 4FT2A 2YY5A 3IIEA 3H9UA 5LWHA 2VKQA 3D6VA 3VAYA 1ID8A 2VN8A 3K73O 4QPNA 4MI6A 5TPZA 5JHGB 1A2KC 4Z2AA 3NBYC 3ZWCA 2H1IA 3H5AA 1KFKB 1AHNA 1W75A 1F6WA 3QSYA 2QM8A 3GJRA 4F6RB 4MHSA 3PUWA 1CEEA 1OFIA 4BECA 1B93A 1ZUD1 3RLIA 5F23A 2QJRA 3JQ6A 3H11B 1OREA 2WSIA 5JARA 4J1TC 3VBCA 3BDVA 2QRVB 1XBTA 1VBFA 5LDGA 1KI8A 2Q50A 1YL7A 1ICEA 1GAJA 2J31A 3F5FA 3DV2A 3V34A 4RWEA 3X3HA 2KJQA 1FFAA 1AN9A 1E4EB 1RI4A 3SHWA 4DW8A 4HAWA 1FMLA 1IOZA 2VJNA 3TCKA 1E0KA 5TR9A 2J3IA 4Q3LA 4NFYA 1Q0ZA 1T4CB 2A5FA 4KYUA 4Q05A 2P5YA 3C14C 1G20E 1DT5A 1KYWA 4MKFA 2Q3JA 4A73A 1WULS 1XLWA 1GQOA 3AG6A 3K8OE 2CLKB 3MJVA 3TTVA 4MV1A 1GSIA 2RHHA 5DW0A 1BW9B 3EYAA 5TF0A 1Z28A 4PWZA 4F93B 5EWLB 3R2JA 3FUTA 2Z4SA 3TGLA 2WUVA 4RK0A 2AB0A 3E8MA 3MHPA 1K6MA 2H4FA 1G9XA 2VNHA 1CUAA 1DWPA 1QTRA 2OVBA 4Z1MA 4P3YA 2OKCA 3IUYA 2B78A 2BMVA 4TVKA 3ANYB 1H4QA 3QXHA 3QKWA 2UUAB 3L4JA 3U40A 1UT5A 1FP4B 8MHTA 1XRMA 4R1SA 1IHYA 2HMTA 1UBJS 4FOTA 4WADA 2ONCA 4BLSA 3B6ZA 4L51A 4Q48A 1IQRA 2RG1A 2H1RA 2Q46A 3DW3X 1AVTA 1SG0A 3O2JA 2JPDA 4MIOA 5BV2P 1IPFA 1Q1NA 2DBRA 3BD9A 1L5LA 4OSEA 4P32A 1DTEA 1IM8A 1KSFX 4YMHA 1EHCA 2VP3A 4PSCA 4D3SA 1GPAA 5KWIA 2WR8A 4RDIA 2EXXA 3CVYA 1DQZA 1G2PA 3TTWA 3QPDA 3LDAA 5AI5A 2ZJZA 2F62A 4ZHQF 1DRWA 3D4IA 3LUDA 5HZKA 4B3TB 1GKIA 4MUBA 4MGYR 4DUGD 3LBYA 2I80A 5DU2A 1AGXA 1BCSB 2WV9A 2CEAA 3FOBA 5HFNA 2W6JA 3HL4A 5K3CA 3MNFA 2PH5A 3BZWA 2A5YB 2P7HA 2A5LA 3ENKA 4BNMA 1TCAA 3ZV4A 2MSNA 3HS3A 1V3TA 3CRW1 2FZCA 5EXPA 3CB4A 2A5DA 5KYYA 1FNBA 3V2GA 3LX5A 2YDYA 4BNYA 3P5BA 4F6LA 4LJSA 4AN4A 2XTJA 5A6SB 2WP0A 3M4NA 3ZKAA 3RAEC 3I39X 4Y2TA 4XJXA 1PNVA 2FWRA 4RDHA 3I0ZA 3AR8A 1YU6A 1FSGA 2AYYA 4Q7JB 4EJ0A 1A4UA 4XFKA 1DT3A 3GJZA 1REQA 2F1JA 5LJIA 2PNFA 4NAHA 4O25A 5E1BA 3WKCA 2PIAA 4PCLA 4HMQA 1AN0A 2C9BA 3F6EX 3ITDA 4FFLA 1V5EA 4U0KA 1CK4A 2VEOA 4JY7A 2UYCA 4HGRA 3P9YA 4DJAA 1QO0D 5EIEA 4UATA 5FA8A 2VP5A 3WLRA 4RMIA 3CPEA 3V7WA 3Q12A 4FXPA 4Q37A 3VC7A 3CWQA 1WQ3A 3N6VA 1OH5A 4R98A 2Z3VA 3EF3A 3N3BC 1SEPA 2PMEA 4L08A 1R6TA 5FLKA 1IAQA 4KXMA 4RF2A 1Q1QA 4Y1RB 2VF5X 3WWZA 3VR6H 2BOVA 2Z57A 5LN1A 1W4BA 2BPOA 1UF9A 4FDTA 3P2MA 2V6MA 4H1HA 2WWVD 2C54A 4DT1A 4WZZA 3T5AA 4I1PA 5EE0A 1CY4A 1D2AA 3VSDA 2O54A 1ECLA 3QTBA 4KITB 1KIMA 4GBJA 2WWTA 1V8FA 5JQGF 2WWRA 4L4YA 1V41E 2W90A 3AOEC 4Q12A 3TIXB 1B3RA 3AH8A 1U8EA 1XIVA 4ZVKA 3RYIA 2EX0A 4PFSA 4X6XA 3IAS6 1BDMA 3R75A 1JKJB 1GYPA 2Y68A 1RNLA 3L18A 4OAOA 2A78A 2GERA 3CUTA 4WZBB 1SBQA 4UNRA 2FZGA 2WUGA 3QUQA 3L0SA 3Q98A 3LG2A 1PL6A 3QI2A 4JQSA 5IMBA 5LKRA 3FJYA 2Z6AA 1G4HA 1VPTA 1EB8A 1TB4A 1HG1A 4KIUA 4M4SA 4CF5A 2B30A 4D57A 5AESA 3T3OA 5TLSA 3HN2A 4JYAB 4KK4A 3Q1LA 4ITVA 1I6LA 2O3UA 4HRVA 4IDOA 3G3EA 1UJ4A 1W48A 1WQ1R 1ZUHA 2JGKA 4QDTA 5G0WA 3UV7A 3WLNA 3MTDA 1UAYA 3LWZA 3KB2A 3IVAA 5G0TA 3THSA 4A6DA 3VH4A 2QP4A 2C9YA 1ECBA 3AF2A 4BQOA 4KKVA 5E4YA 5M04A 1NI4A 4ND6A 3UUGA 3MTIA 2MSCB 1V3UA 1V8OA 3LUBA 4G41A 4LRSB 4G0XA 4RNDB 4EA6A 3G82C 4FONA 3EVGA 2GN2A 4CDMA 3AM5A 5DGHA 4MYTA 1NNI1 3QHQA 2VPWA 4FNOA 5EMJA 1HLGA 2ZRNA 3C5EA 1HZJA 2CZCA 3BGIA 1R6AA 3HUUA 4I66A 4KACA 4Y0NA 2E9SA 2QD4A 4G8DA 1JG1A 4F97A 3R7LA 2OO5A 4OA8A 2IITA 2RJOA 3L7JA 4US0R 2P3QA 2BFEA 3I2FA 3I4CA 4EKDA 2ZIUB 3E81A 2ZYAA 5DOVA 5HCIA 1LDGA 2C29D 2GJAA 1GNTA 3NB0A 4TXLA 4BEWA 3QE4A 2DR3A 3IKJA 4XYEA 2IUUA 1T6YA 2ZXUA 3FHCB 1IN1A 2IYEA 4D7AA 1CDEA 5AKYA 1M6EX 1QHEA 3QWAA 4K40A 4NL4H 4QE3A 2BI8A 4UREA 4BTEA 3SVZA 4C0BA 5ISMA 3KETA 1L5SA 1P8AA 2FMKA 3FNIA 4HWOA 2GXQA 3FOCA 4YRRA 3H16A 2JZCA 2W2QA 3DM5A 1A9RA 1D0VA 2J3HA 3N7TA 2NUBA 4FI3C 5KNCA 1P5JA 4JX8A 5IJ9A 1ZD5A 5FD8A 5TT1A 1QTQA 1V9CA 2OFXA 2BGUA 2DMRA 3GLTA 1UMKA 4X66B 1NC1A 3RK0A 4MAAA 5D84A 3I09A 4HLDA 3VA7A 1H23A 3IJRA 1OWNA 1DNPA 4N0DA 4HXFB 3EWSA 3NHPA 4QBTA 5E1DA 3ESXA 3WL7A 5EIBD 1LSJA 2ZDHA 1U7DA 4KE6A 3T6KA 4RMNA 3RFCA 2AI2A