2IYTA

Shikimate kinase from mycobacterium tuberculosis in unliganded state, open lid (conf. a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
175
structure length
175
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 64
structure length 175
sequence length 175
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iytA00
2J1LA 5IDVA 4M22A 1YRAA 3BH7A 1HA3A 3IO3A 2OBLA 4M4SA 3RWOA 5DLQC 2GJ9A 4KXFB 4B2PA 1GRRA 1MRNA 1T5LA 3WBJA 2IS6A 1YR9A 1XZPA 4C30A 4DB2A 2G1KA 4ZCMA 3SJAA 1U0LA 4JSYA 1CIPA 3GLGE 4GZMA 2BMFA 4U00A 1WRBA 2C9CA 1T5IA 5J4KA 1Z0DA 1H8HA 5CB6A 5EXXA 1I2DA 3CX8A 4W7SA 3EIQA 1XEFA 4Q4AB 3TW8B 4W9MC 4YDSA 2P5TB 3C16C 2CHQA 3KXLA 3RC8A 2EYQA 1YZNA 3UKDA 3ZIAA 4TMZA 1XD2B 1IJEA 3CW2A 3K0CC 4EQ6A 4L9WA 4GMXA 1WCV1 4B2IA 4TYYA 2WJHA 3EWAA 2CXXA 1G3IA 4HDCA 1V5WA 3RYTC 3BFXA 4OK6A 1J99A 2F6RA 2Z43A 4A2QA 2F55A 1GNPA 2PT7A 1MV5A 4ZV4A 2REXB 5EP2A 3O8RA 2XJ4A 3L2OB 2ZRFA 1NY5A 2ZJAA 2QROA 4UJ5A 3KTAA 4OHXA 2EFGA 3HJNA 1VHTA 3K53A 2NO7A 4Z54A 2IBMA 1BMFD 4OI0A 2WJGA 4LI0A 3K9NA 2IWRA 5FBRB 1CJUC 4ZCIA 1EWRA 2F9LA 2QT1A 2VHJA 2IX3A 3UPUA 5SZIA 4YXWA 5H68A 1KY2A 4TLBA 5HR5A 1D9ZA 221PA 3IO5A 2ZYTX 4LV6A 2GXAA 1OHHD 1VYTA 2GVZC 2ZYWX 1TU4A 2D2FA 2WKQA 1NJFA 1RJ9A 1E0JA 2I3BA 1OIXA 4G1UC 1WF3A 4A8JB 4Z1MA 1R8SA 4CVNA 5FTMA 5SZHB 5JSZA 2JJ1D 2GNOA 1TQ2A 5JI3E 4TLEA 4D6PA 2FFQA 3CH4B 3TSOA 1S9DA 2HT6A 2V7QD 4ZDIA 3ND8A 2O8DA 1J70A 2OAP1 4O0MA 1M1YE 1TMKA 2BHRA 2CLDX 4JJZA 3WYGA 3HR8A 4IDOA 1QHXA 4WOPA 5KU1A 1KTVA 5EE3A 5BN3A 4NONA 3SQWA 4AWXA 2HCJB 5JCPA 1SVWA 3QI2A 2IYVA 4AIIA 4NPHA 4BFUA 3G82C 5LPNA 3I8XA 4EPRA 1CR4A 4KAXA 1NVVQ 2ATVA 2QAGA 4GRAA 4L4UA 1NF3A 5CLQA 1COWA 3W5JA 1T0JB 3BFKA 3U3JA 4EAQA 5FBVB 2QPTA 3D8BA 1YHNA 4LJ8A 4NCIA 4BPBA 3D6TB 2ZRKA 5EE5B 3SJBA 3TLXA 2F1IA 3IDQA 1KK1A 4XVQA 4WZBE 3ECCA 3OEHD 1NIJA 4LHVA 1F3OA 1E2MA 1P75A 3CRVA 2H16A 3TK1A 4P4SB 4JLKA 4KHZA 3P4YA 1KI6A 3TUIC 1UADA 4KFSA 3FDIA 2WSMA 3W90A 5FOWA 3NEJA 1YZTA 1LV7A 2GTPA 2I4IA 3ADBA 2J87A 1IOZA 2PCLA 3A4MA 4OQNA 4V0ME 2EFHB 1SXJE 5FL7A 2AXNA 4PHHA 2FDCA 1R5NA 4NHOA 1XEWX 4Q47A 4A6PA 3B1ZA 4MQBA 4DLSA 5F9HA 4C2TA 1T91A 3TAUA 3VX3A 1B23P 3BS4A 2QSZA 1KAGA 1VPLA 1ODFA 1NN0A 4IOMA 1KSHA 3WBKA 3EARA 1QRAA 1T8TA 5B30A 1BKDR 2CE7A 2WOOA 4X8MA 3WMGA 1GRQA 1G6OA 5K8IA 3H0KA 2E87A 2W6JD 1QHNA 2ZYVX 4CEHB 1FFHA 3VHLB 1AIPA 3L8ZA 1F5NA 1Z83A 5J40A 2F1JA 2OT3B 3GFTA 1KDOA 3GJ8A 2Q9AA 1EFRA 1FQJA 1FP7A 2GA8A 2PJZA 2QT0A 1W36B 2MSEB 1PJRA 2NIPA 3BFVA 2R2AA 3WP0A 4RD3A 4AK9A 4B3GA 4QBHA 3F0TA 2BKEA 4URWR 4JYCA 3RNLA 1VYUA 2AWOA 5L3QA 1ZP6A 3QKUA 3SJZA 1P73A 3S1AB 1D8TA 2CLCX 1GNRA 4UQOA 2EFCB 1UKYA 2FV8A 4CEIA 3A1TA 4Q4HB 3T12A 1S4QA 5CYPA 2QMEA 1DPFA 1G18A 3HU2A 1JAHA 4PPFA 4U5XA 2AKYA 4LOAA 2IL1A 3KQUA 1VCIA 4LPSA 3UANA 2QGNA 2OSBA 5JWRA 2ZRDA 1J90A 3FTQA 4ZI2A 421PA 1OF1A 1PV4A 4TL7A 1E1RA 1J8YF 4LBZA 4JLDA 4NCKA 3NG1A 5TXGA 2ZS8A 3QSYA 3CRW1 1S3SA 3QPWA 2OBNA 3AKEA 2ZTSA 4HZUA 3B13B 4JJKA 5JJIA 4HB3A 3OEED 4PAQA 2ZAMA 2V1XA 4TL6A 1W0KD 3EIEA 1U9IC 4GOKA 4LBVA 2GESA 4FWIB 1OB5A 4MDFA 2D3WA 1BH2A 2OG2A 3CZPA 1N0WA 2CE2X 2VRWA 2DY1A 4HAWA 1FMJA 1KO7A 4P0TA 2WMNB 2UZ3A 3EPLA 5CDFA 2QY9A 1CRPA 2MMCA 2ZEJA 3ZD7A 2ZI6A 4NCJA 3AGPA 4F4JA 4RCYA 5IRCD 5EQTA 4CEJB 1YR7A 4A2WA 4E07A 1G16A 2JATA 2Q9CA 4HDQB 2CL7X 3CB4A 5DI3A 3P20A 1N5LA 2BBOA 1ZM3A 5FPSA 4ZDKA 4V03A 3DOFA 2OFWA 1XCGB 4NCHA 1G7SA 4QHTA 1CF4A 2FFAA 2GHIA 5L3SB 2IEYA 3PEVA 3ADDA 2GBLA 4LHYA 2IYTA 5GJVC 4A0RA 2NO1A 4Z8YA 2ZI5A 1OH7A 3OIYA 2VA8A 4BEBA 3OIUA 2WAYA 4JT2A 4QNRA 3QXSA 4Q66C 3ND9A 3BORA 3E1SA 2D74A 2ZSEA 3MD0A 2VO1A 3B1YA 3U7EB 1G8FA 3BD9A 4EPWA 4DB4A 1PUJA 3KFVA 4EDHA 2KI5A 1UEIA 2B8TA 3THYA 2ZVQX 3BH6A 1E32A 2YHSA 2FGKA 1D5CA 3AP1A 4A0FA 4BZXA 1FX0A 5L3RA 4B74A 3U7HB 5JS7A 4JBXA 2R6DA 3FGNA 2ZRJA 3LD9A 1U98A 3ASYA 3V9PA 4C4PA 3T15A 1W48A 1W0JD 2W00A 4NYJQ 4KJZA 2RGNC 5D3QA 4CZ2A 1UDXA 1GSIA 3ZD6A 3H4MA 2ZR7A 1NVUQ 1YZUA 2RMKA 1KHTA 3F8TA 4EJSB 3EPKA 2VHQA 3LW8A 5EUQB 3SN6A 2W2TA 3WMEA 2E9SA 2F3TA 2WWXA 4NKRA 3GLIA 1WA5A 3OIVA 4Z51A 3U61B 3KFXA 2C95A 4PFSA 3VR1A 1GFIA 5DE3A 3FKQA 5AUOB 4M53A 2FE4A 1RFLA 1J2JA 1DVRA 3TKLA 3KQKA 2NOAA 3SC3A 1E9BA 1N5KA 5DN6D 4UNSA 3GJXC 3DHWC 4BFXA 5FR2A 4G3XA 2QQEA 3QNUA 5CIWA 4XWOA 1DARA 2XNDA 5B64A 4ASUD 5KPJA 3MJHA 4LRWA 4AYWA 3ADKA 2CEAA 3MJRA 2XEXA 4MYCA 1M8PA 3B1VA 3PEWA 2RGCA 2O8BB 2V55B 2RB4A 2AFHE 2MSDB 2C9YA 2J45A 5E3HA 1K8RA 1P3JA 2O8CB 2Z0MA 3QXJA 3J81k 2ZUDA 4OBEA 4XD7A 1E79D 1IN5A 1P6XA 3U44B 1E2IA 4RZXA 1HUQA 1MABB 2WOJA 3CH5A 1Z6YA 1N5IA 3UWKA 1BS1A 4JLAA 3R7WB 4DEXA 2QE7A 4URVR 1F2TA 3PV0A 3QBTA 1P7CA 1W4CA 4FINA 4Q5IA 2HF9A 1IXZA 5JHHB 3NBYC 2EW1A 2FFHA 1ZBDA 4NL4H 5EP4A 3EZ7A 2PEYA 5TVKA 2P65A 3SYNA 1EX7A 3EZ2A 1U90A 2W2XA 1ZU4A 3B9PA 4LBWA 4TMTA 4Q4JB 3BK7A 1N25A 3FMPB 721PA 5FOTA 1AJEA 3LAWA 1PLKA 1N2CE 1Z6AA 3BB3A 3ETLA 4HSEA 3HPQA 1P9WA 2BIFA 3K0FB 3VHXA 5FR1A 3QF4B 1II8A 2GVDC 4OJQA 3ADCA 4URUR 3ZS9A 2R9VA 1KJWA 3LA6A 4UXJA 1YZQA 1OKKD 3TQFA 1W4RA 4ARZA 4PAOA 3I62A 1KKLA 3C4JA 3CUEF 4KFRA 4IVQA 5FL3A 2CNWA 2X19A 4XWAA 2E1RA 4IKEA 1RKBA 5EUMA 1H8EA 2EU8A 1KNQA 1XXHA 3NTUA 3IGFA 4PSKA 2QSYA 2A3RA 3V4RA 4CW7A 1OXTA 1G291 1HV8A 1ZAKA 1XTKA 4LUCA 4US0R 1SHZA 1KNXA 1FTSA 1JEDA 1P9RA 4C0BA 2OLKA 5EZ5A 2FN4A 1MKYA 1R4AA 3GEEA 5FTNA 3CRQA 3FMIA 4LBYA 3CX6A 3KQHA 2QMUA 4MYUA 1OB2A 1T8UA 4P4UA 2A5FA 4V0KA 1CR1A 4AKHA 4A8JC 3GMTA 1Z07A 2ZITA 4NYMR 4BLQA 4E5UA 4GOXA 2PCJA 3C14C 4C0SA 4LJ5A 4BRUA 3T5DA 3PUXA 4ACBA 1VECA 4V0LA 4GSYA 3Q9LA 1OIWA 3IIKA 2HJVA 4IRUB 3T34A 4DLWA 2ZRLA 1T9HA 3QE0A 2UZIR 3GJ5A 3MAAC 3QKTA 1F2UB 2RH5A 3NWJA 3JZAA 4OJKA 3Q5EA 3LBNA 4RSGA 5FPKA 2QMOA 2XITA 2RHDA 4LCBA 5EE0A 3SZRA 3MUFA 1ZM4A 4QM7A 3EIHA 2I1QA 2B21A 3PVSA 4O2LA 4ZDWA 4KYUA 1U0JA 5FTJA 2VP4A 2WJVA 2R6FA 2DPXA 2RGBA 3QG1A 2F1RA 4B75A 2IYWA 1R6BX 1ZD8A 4PO9A 2P5SA 3KQNA 5F3WB 1XEXA 1XNJA 3KB2A 3MRSA 4GMDA 4DDVA 4B3BA 2BBSA 4RD6A 5EZ6B 3DM5A 4JVNA 4M1SA 3RAPR 3GJ6A 1Y3AA 3B1WA 1C9KA 3BB1A 4KI0A 1KIMA 3AF2A 1TQDA 4ABYA 2CVHA 2QP4A 4Z1MD 1QDEA 1P60A 2R65A 4CIDA 1D2NA 1KY3A 5FI0B 4YMVA 2OBMA 2FPMA 4MUBA 1MO5A 2AX4A 3RWMB 4TYNA 4DSUA 2RGGA 4HLUA 3SOPA 4UNNA 1G8GA 2QQ0A 1A2BA 1PVOA 3QXHA 2VH5R 3CM0A 3A36A 1JI0A 2DFLA 4KVGA 5J4LA 3EZ6A 2OLJA 4EQ6B 4W5WA 3VNVA 2OUKA 5HE8A 1EWQA 2JJ2A 3LX8A 1J8MF 2ZJ5A 5AR1A 2YYZA 4PC7A 3IKJA 4DJTA 2D2EA 3ZVRA 4M9XA 4B6FA 2XJ9A 1A7JA 1W36C 2VHCA 4FXPA 3OAAD 4F92B 4BFZA 1IXRC 2J0UA 4Q18A 3QEOA 4MGZR 1IN8A 4QBGB 3K9GA 3LX5A 5F9FA 4YLGA 5DNYB 1I4TD 1SHKA 3KTAB 4DIDA 4DXAA 4DDWA 1IJFA 1Z28A 4UNRA 1P9NA 3KJIA 1L2TA 2AK3A 1ZCAA 4MKFA 1R8QA 1RIFA 2FX3A 2YKGA 4HAUA 1JR3E 4BECA 5HKKD 1Z0KA 2DB3A 4G5SA 3K09C 4DLZA 4G5OA 1E2LA 1E2NA 5FUWA 2NQ2C 3WRXC 3K70D 3W6PA 2QMHA 3R20A 4RY2A 3ZQ6A 1RJ9B 3CBQA 4GDFA 1JR6A 5FL7D 3EZFA 5EXSA 4DUGA 4DCUA 4MKIA 1ANKA 2H92A 3LFUA 4QKQA 3CWZA 1JAIA 1P5ZB 6Q21A 5JSZB 4R9UC 4HUQA 2L0XA 3SDZA 4QFMA 1XFAA 2OCAA 3LW7A 3QXXA 4TTRA 4AG5A 2O8DB 1L8QA 1TL7C 3W5IA 5BXQC 1UBFA 2D4HA 3O8BA 5KSPA 5AJVB 2ZRAA 4IVPA 1NSFA 1TAGA 4XTCS 5DISB 1LW7A 2OESA 1OH5A 2GAAA 3BXZA 2VP5A 4XSHA 2BVNA 2ERXA 2WWFA 4PQRA 3W3ZB 2NO0A 5AUQA 2BJWA 3CLVA 4A92A 4HYYA 1HTWA 4NE2A 1EFRD 2Q3FA 2QM8A 4GZLA 3E2IA 3U3OA 4I99A 1W2HA 4CRWB 1NJGA 1E1QA 2LKDA 1U8YA 2W0SA 3SE0A 4B34A 1W4BA 2PBRA 1GIAA 3Q7QA 1QHIA 3C8UA 4MGIR 3AVVA 4PZYA 1Z47A 4MITA 4Q1FA 2CCJA 3DEFA 2QRNA 2FH5B 3LV8A 2HEIA 3GJ7A 1KI6B 3PUYA 5FI1B 2ZJBA 4GPTA 4IW3B 4IOJA 1U2RA 2P6UA 2FA9A 4Q03A 1CLUA 1CBUA 3K70B 1NY6A 1KJZA 1NKTA 5HE9A 2RKOA 1W47A 1FMLA 3GLHA 1N6OA 1Z0JA 1Q57A 2GJAA 1I2MA 2FFBA 3A6PC 1X1RA 2OCYC 4I1VA 4D0GA 3MWJA 3LNCA 1D6JA 4JLJA 2H5EA 3D3QA 4US2R 3G0HA 2BBWA 2GKSA 2C9OA 1VDZA 3BWDD 5G53C 1XX6A 3B1XA 2OXCA 2JDIA 3TH5A 2IXEA 2BJVA 2Q0HA 1KI2A 4OHYA 2LKCA 3V4FA 2YWGA 5FOVA 3H86A 1GITA 4EJSC 1G8HA 1SVMA 1Z0AA 2GEDA 2CBZA 2ZE6A 1X8LA 2ZI4A 1RYFA 3EASA 4LK2A 4FW9A 4GP6A 3EW9A 4TT3A 2R8RA 1ZM7A 5CK4A 4PPQA 3OFNA 2BOVA 2QP9X 1TQ6A 1MO6A 2JLVA 1GOTA 5TV2A 1XMIA 5L3QB 1FL9A 4DEYA 5DI9A 1Z0IA 2QI9C 1CJVC 1B0UA 1ONBA 1RRFA 4M1KA 4M1OA 4CEIB 3THWA 1RZ3A 3OESA 4IOLA 3KJGA 3DVLA 3WNDA 2X1VA 2F1HA 4OQMA 2DYKA 1YVDA 3B82A 1JBKA 1OT3A 2DFKB 3HYTA 4UXHA 5JI2E 3GFPA 4OL0A 2ONKA 2XOKA 1UDWA 4G5GA 3VAAA 2EQBA 4JL5A 2G88A 1TF5A 3M0EA 2ZYUX 3NH6A 4PHFA 4HAVA 2QBYA 1OXUA 1DAHA 3FMFA 3FE2A 3P32A 2FPKA 1ETUA 2IA5A 2KWIA 4LV5B 4A2PA 5J4YA 3I5YA 2JLYA 3CPHA 2XTMA 3KJEA 2DFTA 1W2GA 1E0KA 3PUZA 4Q7LA 1OLOA 3BJIC 3C7KA 4LJYA 3ZZTA 4IEIA 4BLSA 3THXA 3B5JA 2W58A 1YE8A 3HU1A 5JZVA 4GOJA 2ZE5A 5KO2A 1GVNB 5CLLA 1MOZA 3FYHA 1A2KC 5CIQA 3ASZA 3FKSA 3QQ5A 3QOFA 3UATA 1AZSC 2A9KA 4LWZA 3B78A 1RRGA 4HAZA 3RRMA 5DI3B 4JSTA 5E4FA 2G9NA 3L43A 2WWIA 3VU9A 1DADA 4E22A 4YDHB 4K8OA 5KNBA 1KK2A 4LGMA 1NIPA 3QPUA 3CF2A 1XCPA 2YOHA 1CRQA 3I3SR 4RKEA 3WP1B 4NP6A 1KKMA 2ZS9A 4W5JA 1GP2A 1LTQA 3K0AA 3AVOA 4XD7D 4M9QA 1U0HC 1U9IA 3TAHA 3GCGA 1W44A 1QHGA 1CJMA 4BLTA 2H8KA 2RGXA 3QKRA 3ICEA 2GEUA 2QE7D 1OFIA 3THYB 4TSFD 2ZQ5A 4EFNA 3CRRA 1TX4B 4OHWA 1FX0B 4MRSA 3T35A 5C2JB 2IYSA 4UNQA 1W36D 2ZRGA 1N3BA 1GL9B 1VIYA 1GM5A 1LFDB 3P1JA 1ZNWA 3UG6A 3X1YA 5KDDA 3TNFA 3P4XA 4A36A 4JVMA 4DLYA 1XU4A 1NVXQ 1X6VA 2J7KA 1D2MA 3CF0A 1Z2CA 2GF0A 1I4LD 5JRZA 3EPHA 1JPJA 2JGNA 2WIAA 1KO5A 2QTVB 4G5QA 2AXPA 3GLIB 2R6GA 4XWKA 1R5BA 3QVUA 4GNKA 4YMUA 1QVAA 4OQFA 2CHVA 1N6LA 2FSFA 5KNCA 4H1UA 5FTKA 4QGHA 5C1BA 2J7PD 3SHFA 4AI6A 2HCBA 2CNWD 3WNBA 5E7JA 3EA0A 2WWYA 1D2EA 1ZC4A 4YC7A 1H8ED 4DDUA 5LB2A 1KI7A 121PA 4TMKA 1Z29A 3SJCA 1Q3TA 1YJ5A 1E9DA 2N46A 4DSTA 4PSAA 3GLFA 2CDNA 2WHXA 1US8A 5KHOC 1BIFA 2PT5A 3L0SA 1C1YA 3P27A 4IXMA 3WY9A 2DR3A 2GF9A 4BZQA 1EFTA 1E0AA 821PA 4P32A 1XTRA 3KKQA 4D2IA 3KXKA 1F2TB 1G5TA 5IK2A 3T1TA 1W1WA 3ZVMA 3D7MA 4QJ5A 2HYDA 3IBYA 4JBYA 1SQ5A 4ACAA 2GXQA 2YJTD 5CK5A 3X1ZA 2C96A 3W8NA 5E95A 4H1VA 2WJYA 5KPDA 4G01B 5H8WA 3GJ0A 5FBQB 4DDTA 5F98A 4N0DA 2FMXA 2HYIC 1BYIA 4YMTA 1SKQA 4URXR 3TW4A 1OYWA 1HQCA 1NLZA 3K1JA 4PQYA 2XXAA 2G6BA 1II8B 3IEVA 3EXAA 3L0IB 5EP3A 3W34A 2H1LA 3RS7A 3DOEA 8OHMA 2PMKA 3IEUA 4XJXA 3VFDA 1TPZA 4ARZB 3HR7A 4HB2A 3SR0A 3ZVLA 2RAPA 2KBFA 5FH9A 2XTNA 3GD7A 2OZEA 5JJLA 1FOEB 1ZCBA 3N70A 4TLAA 5TMPA 4FIDA 4XH9B 1XXHB 3GQBA 5EP1A 3LY5A 1ZNXA 4K46A 4Q7KA 1ZU5A 4Q9LA 1G64A 4TN1A 1NBME 2J9RA 2JLRA 2J41A 4KFTA 5ELXA 2W6ID 3C15C 2R6CA 3ZGXA 1EG7A 4PTLA 3TJZA 1VCMA 2PJRA 5E7MA 4A0HA 2WWHA 5CYOA 5GADl 1N6HA 3L0OA 1TADA 1RRPA 2NZ8A 2FSHA 4NH0A 4DLXA 2KSQA 3BOSA 3RABA 1N5JA 2VHTA 1G21E 3IUYA 5BN4A 1U8AA 3QVVA 4KCGA 2IXGA 3OE7D 1GAJA 3VTKA 1MR3F 1E9SA 1FNMA 4MRNA 4OK3A 4EPYA 3N2IA 4WIAA 1FUUA 4ITRC 3HPRA 4WZ6A 3TR5A 4XVRA 3U7FB 1CEEA 4PX9A 3HWSA 3JVUA 3VR6A 1Q20A 3MSXA 1TF7A 3ZJYA 2PZGA 2QEQA 4C0LA 1IY0A 1Q1EA 1JXOA 3ZH9B 1XP8A 1AS2A 2DWOA 1FQKA 4N0EA 3PUWA 1VG1A 1GNQA 1X86B 3IQWA 2O52A 4PZZA 4Q7JB 5KNDA 1II0A 2AL7A 3AVQA 1OIVA 2PZEA 3I8SA 1FP6A 4URYR 4M9ZA 4C0QC 2O5VA 4JT4A 4PC1A 3KKNA 3GLHE 3CF6R 5TARA 5DYIA 3T5GA 1N6RA 3ONWA 3AVWA 4A1FA 3I4LA 4BFWA 1ZYUA 1Z08A 3DO6A 4WW0A 2WAXA 1RC8A 5JLJA 5HZKA 2ZVPX 2RGAA 5DH9A 3DM9B 1LS1A 1WMSA 1NRJB 3RRZA 5C46F 1XEXB 4NCNA 3MWLA 3FVQA 1UBEA 5KDLA 3U3MA 4AURA 2FJUA 3K70C 1KI1A 1T3LA 3HYRA 1JNYA 1P2SA 1ZIOA 2A5JA 1XB2A 1Z22A 3AB3A 3QEJA 4KITB 3DDCA 4DUGD 2XSZA 2QORA 2ERYA 4RCZA 4B44A 3PEYA 5JFGA 3QBVA 1PLLA 1G9XA 2ZSAA 1GUAA 4BLOA 3N2EA 5L3VA 4DSOA 1NBMD 1S8FA 1FZQA 1Z2AA 2VP2A 2A7QA 4DHEA 2W83A 1TTTA 4EPXA 2ZETA 3B8HA 1XTQA 3WMFA 5HTKA 2NMVA 4D4JA 5IF9A 2EWWA 1G20E 2V3CC 4HEJA 1RRCA 1KDRA 5UKDA 4JLBA 1ESNA 4YONB 2PH1A 2FSGA 2ORIA 3JZMA 3Q85A 3W6NA 1F48A 2YC2C 5TDHA 2AR7A 2WKRA 3SEAA 2ZIAA 3X1WA 3SFVA 4Q9JA 1E4YA 3IHLA 2FU5C 2IYYA 2WPDD 4KLNA 2J0UB 2IS4A 1Q1BA 4LYJA 2XB4A 1RPZA 1QBKC 3KKMA 4B6EA 2TMKA 1GWNA 2BMDA 2ZRCA 5CJPA 4HLDA 3NVAA 4DWJA 1E9AA 5JEDA 1VG8A 1M7GA 3RS2A 4FMDF 3LXRA 3CPJB 1YZLA 4NYMQ 4F4IA 1G5PA 1QG2A 1UPTA 2BBTA 3FWYA 1E69A 4Q00A 1SGWA 4KSCA 3VR2A 3R9XA 4OHVA 2GJ8A 2PLFA 2ODBA 1KOFA 2FEOA 3A4LA 2QZ4A 3I32A 1NVWQ 4L15A 2RHMA 3GLGA 3U60B 1N6KA 2VIIA 2AHOA 2GZAA 1DG3A 4AG6A 1SVKA 2GETA 1EGAA 5BW8A 4BFYA 3QXCA 2BCGY 2OILA 4DLRA 2WKPA 2FGJA 4BLPA 4V0NA 3AVYA 4JVSB 4CF7A 3RS4A 5FPTA 1R0YA 1QHSA 4TWZA 2JIZD 4PPGA 4JLMA 1SVLA 3WYAA 2DWQA 3BAFA 3F3YA 4URZR 4Y0VA 4PSVA 4TQUS 1F6BA 1UJ2A 1XDBA 4XIGS 2EYUA 4DLTA 1H65A 4E03A 3I61A 2WIBA 4PHGA 1LF0A 1L4YA 2WSSA 1E2GA 5JHGB 1UKZA 5FPYA 4TT3D 3ZVNA 3HDTA 5DHFA 2PX0A 4Q1CA 4F4CA 3OFND 1O3YA 3BBPA 2ZUBA 3B2EA 4GT1A 1HEIA 1WBDA 3AV0B 2OFOA 5DYGA 1ZUIA 4I1OA 3LVQE 5JCZA 3PJRA 1AGRA 2I1VB 4O25A 3THOA 3SI7A 4CT5A 1IM2A 2AKAB 4TTPA 5HPYB 2HJGA 1H8HD 1E2KA 1OYYA 2GBLC 1GG2A 3AP2A 1XRJA 3LLMA 3REGA 1Z6XA 3GJ3A 5AJXA 1Q1QA 1V43A 1NL3A 4L9SA 2XX3A 1QG4A 1NMYA 3OF5A 3ZIAD 1VHLA 3KX2A 2W6JA 1T3HA 2C2HA 1EFUA 3GLHB 4BLRA 1XPOA 4PXAA 3TBKA 1M34E 4B47A 2WMOB 5EXPA 1XJ0A 4Q19A 4MA4A 2ASEA 5KUTA 3TGPA 1TNDA 3AKCA 4R71A 4QJ4A 5LB4A 1C4OA 4QHSA 3EPJA 1SKYB 1ZNZA 1KZGB 3AVPA 3VMFA 4GP7A 3MCAA 1IAQA 2H18A 2NPIA 3R9WA 1N0VC 1S0UA 3AEZA 3EZ9A 3OHMA 4HAYA 3DL0A 2JA1A 3LLUA 4B3XA 3JVVA 2ZI7A 3TUJC 4RFVA 4C3ZA 3CONA 3R9IA 5FUVA 4EFMA 1VIAA 4YXWD 4M0LA 2OCPA 2ZSBA 1EXMA 2K5UA 2ZROA 1OXXK 1HY3A 4LY6A 1LVGA 2ZE8A 5IHPA 4U7DA 5TB5A 2V8OA 3RS5A 3PUVA 5A4JA 3H1TA 4IFEA 5EJEA 4PC3A 4EUNA 4TMVA 1DAMA 2VEDA 4WBSA 3C5CA 1WQ1R 2YWEA 4IDHA 1AZTA 2BM1A 2CK3A 2EWVA 3CX7A 1E98A 4RD4A 5AJZA 4ZCLA 2VSOA 4JZKA 4BFTA 1G7CA 3Q3JB 1CULC 3OEEA 2GCNA 4QOSA 5JBQA 2IYLD 2H7VA 5J4HA 1DAEA 1KO8A 4II7A 1YRBA 1JEEA 2HV8A 1Z0FA 3U3RA 1JALA 1PZNA 2FPLA 2VTKA 3TSZA 4DBLC 2VP9A 4V0MA 3DZDA 1SXJA 2ONJA 4PPNA 1NMXA 2OXRA 4TYPA 4ZDJA 2QBYB 4FMDB 2VLIA 5L8VA 2CL0X 3LVRE 4AYXA 4NDZA 1KJYA 5A5GA 4HB4A 1JB1A 2CCGA 2VBCA 1CJTC 4LYFA 4DT1A 1COWD 1Z5ZA 2H17A 4TYQA 1IN4A 2R62A 4X8HA 4KBFA 3B7GA 1G17A 521PA 3V00A 3MGCA 1HURA 1Q44A 2QUZA 1AN0A 3B60A 3LRPA 4TLCA 1OXVA 4UNPA 2Q21A 1WDTA 3T1QA 1IN7A 1UKEA 3RC3A 2P67A 4TLDA 2C78A 4LC1A 1IN6A 2NO6A 4LYHA 1KI3A 1Q22A 1S2MA 2NTYC 2ZRBA 4M1TA 1CU1A 4KVAA 2GCOA 2N42A 4R2IA 3UG7A 5CJ2A 3BB4A 3K0CA 3RLFA 3AGQA 2WTUA 4OI2A 3VU9B 1QHYA 1W46A 5CDFE 1EK0A 4RZ3A 2ODNA 3U4QA 1GKIA 1KO1A 1VTKA 1TQ4A 4DKXA 2XTZA 3BE4A 5G40A 2IUSA 3FHTA 4LDJA 1KSFX 2ZU0C 2BEJA 3K0AB 1CXZA 1GL6A 1E9FA 1F60A 1ZMXA 2WVJA 1LS6A 1CKEA 3KUCA 4V0OA 2IUUA 2ZSDA 3QKRB 3IIMA 4JKIA 3EX7C 4DCSA 4UJ3A 3NHBA 2IT1A 3TRFA 5GJBA 2BV3A 2QAGB 4LJ6A 2WJIA 4DLVA 2W0MA 1SVOA 3C41J 1DAIA 2BKUA 4RKFA 1PLJA 5DN6A 3U2QA 2YZ2A 3K0EA 4ASUA 4IXNA 1ZM2A 2ANCA 1W7AA 5DSZA 4KU4A 2GILA 3RHFA 3X2SA 3EC2A 1N6PA 4QXAA 2X2FA 3GFOA 4ILEA 4Q1AA 2CL6X 3A1VA 2DBYA 3IPXA 4Q48A 2V9PA 3LDAA 2YINC 1U8ZA 1KI4A 1U99A 4FCVA 4Y0AA 1E79A 2VSFA 1JJVA 4ZKEA 4WVFA 2J5XA 2GJSA 2O8EA 4LYAA 3TR0A 3GLIE 3U5ZB 2JLUA 5EE9A 3Q7PA 2KJQA 4OQLA 4QGAA 2QP3A 5AJWA 5K8TA 2ZRNA 1E1RD 3MWYW 3TIFA 4BE7B 4AY2A 3RRNA 1II9A 3ZZ0A 1KI8A 3DMNA 1HYQA 1S9HA 1ESMA 2KE5A 1GKYA 1VCOA 2ZJYA 2R6AA 1G3QA 1T6NA 2X8AA 3A4NA 2DHRA 2QPOA 1E2PA 4AYTA 2CMKA 3GLFB 1KDPA 4RJLA 4A15A 1US8B 2F43A 4QG7A 1KAOA 1AA9A 1KZ7B 5CITA 1DO2A 4XVUA 1OW3B 4DIEA 3NC0C 1E99A 2BMJA 1KDTA 4LJ4A 2YC4C 1MRSA 1E9CA 3UXMA 1E9EA 2YWHA 3AUXA 1CJKC 1ZIPA 1G4UR 3L8YA 1ZINA 4GL2A 3FPAA 2DFNA 1FTNA 2C5LA 1LB1B 2ZJZA 3EAQA 1ZW6A 1OKKA 2C03A 4OI4A 3KQLA 4DCVA 3GP8A 1DAKA 4O3MA 4P31A 4HLUC 2V1UA 3BRWD 4PO8A 2G0TA 3QG5A 4DCNA 1KSJA 4MRRA 1DO0A 1PUIA 1TU3A 4US1R 3AF3A 2Z4SA 3I92A 3RANA 4B43A 4ZI3A 2ORVA 1NI3A 1VG0B 1IHUA 4NYIR 621PA 3D31A 4D80A 4IVRA 5KDOA 1XF9A 2XXAB 1XJQA 4OI1A 3PR1A 1K5GA 3IHWA 4C7OA 3QENA 4UKDA 3ZLJA 1JJ7A 4I1UA 2EVWX 5CM9C 4LV8B 4LX0A 4BZPA 3AF4A 3Q72A 4Z8XA 1ZNYA 5FFMA 4LJ7A 5CB8A 1NLYA 3RSLA 3T06B 2XB2A 5DHAA 2QA5A 2Q3MA 2JEOA 2JASA 1IY1A 2HDNB 4F93B 2GWHA 1E94E 2ZPTX 1QF9A 2PEZA 2QU8A 4LJAA 3R8FA 1X3SA 4M21A 4D26A 4HATA 4CDGA 4P3YA 4IDNA 4MUAA 4HZUB 4IEEA 1DELA 4PC2A 5C4GB 5KTYA 5FUXA 3B6EA 4PZLA 2P3SA 4HI0E 2NZJA 4FI3C 2BM0A 4DC9A 1LY1A 1X8KA 3TVTA 1XXHE 4WXRA 2O8FA 1UAAA 1DS6A 4BWYA 2OHFA 1TUIA 1AKYA 2A5YB 3CZQA 3NKVA 5DO9A 2XSZD 2ZS7A 3FOZA 1E4VA 4MRPA 1NN1A 4JMPA 1OH8A 1EFHA 4TL9A 4DCTA 2XZOA 4MH0R 4H9GA 4MDEA 2CJWA 4PO1A 2UVQA 5FOSA 2B92A 1UF9A 2VYFA 2OAQ1 2JLSA 3QIAA 1E2DA 1Z8FA 3NEYA 2XNDD 4LHZA 4R2HA 2VPPA 3PIRA 2ODEA 2GDJA 2NGRA 2ZSFA 1R0XA 2WV9A 2ZRPA 4HB0A 4F38A 4TL8A 1R7RA 2HT1A 3SFZA 1W49A 2D06A 1FNNA 3UWOA 2F9MA 2P6NA 4KBGA 3DKVA 2HLDA 2LWIA 3LQRA 1A82A 1KMHA 1DEKA 2ZRMA 3SYLA 4B3DA 3UIEA 1G8YA 4A9AA 3RSOA 3P26A 3EC1A 4C0JA 3CNOA 1WXQA 3GPLA 1E2QA 4BASA 3E70C 2G83A 1Q3HA 3N5CA 4RFSA 3RDPA 5FBLB 1AM4D 4S2EA 1G3MA 5JWOA 2XZLA 5FTLA 2ZRHA 2FWRA 4ERNA 1BO6A 1N6IA 1Z6GA 1M2OB 3DPUA 4B73A 5B57C 5B2ZA 3O8CA 1I4DD 2ZE7A 1OE0A 2BDTA 3A1UA 3GJ4A 5LD2B 1G5RA 5FUYA 4F7WA 2P0EA 2ZXUA 1P2UA 4B32A 3VQTA 2JCSA 1VKJA 3PEUA 1IBRA 3NIBA 1UKVY 2RCNA 4B35A 3VKGA 3NBFA 4JLOA 2G77B 3C5HA 3OAAA 3QF7A 2ANBA 3KL4A 4C0HA 4ZIRA 2WJJA 2QGZA 4S35A 3MFYA 2OE2A 2AWNA 3KKPA 5GJCA 3KZ1E 1IQPA 4KYIB 1Z3IX 4TQ9A 1HE8B 5HKKA 1CTQA 3DMDA 1GKUB 1YZKA 2Q9BA 4MRVA 1YKSA 5HCIA 2C04A 2VP0A 1R2QA 2WSSD 4J0QA 1KK3A 1QHHA 2RGNA 1A5TA 3VKWA 4D81A 3PG5A 3SS8A 3MWKA 3KJHA 3GEHA 2ZJ2A 2IWHA 5HZHA 1DOAA 4LHWA 1G41A 4JLNA 4HZIA 5FOXA 5D3MA 2IS1A 4UXIA 4FD2A 4LSGA 4W5HA 3LQQA 2QRZA 3E5HA 2FZLA 4HLCA 2A78A 4JKYA 1HE1C 3Q5DA 3NH9A 4ZO4A 5C4MA 3FFAA 3K8YA 3QKSA 1RE0A 3A58B 4IFBA 4NTZA 1E3MA 1NVVR 3VR4A 4KODA 4OQXA 4OYHA 1GILA 3MMPA 2HUPA 3ZS8A 3GLGB 3KKOA 4P33A 3VR5A 3FFBA 3B85A 5HCNA 2Z5FA 3WXMA 3TVDA 3X1XA 4A82A 2D7DA 1P62B 2IYZA 2A30A 3PCRB 1XZQA 1ZRHA 3SNHA 1E96A 1G8PA 3W9YA 1AS0A 1ZD9A 4PR0A 3RRYA 4BEJA 3LBHA 4A4DA 4OK5A 5SZKB 2IYQA 3BH0A 2RGDA 4Q4AA 1E2FA 1N0UA 1OH6A 4A0GA 4QJ3A 1EX6A 1JQJC 4TMWA 3PXGA 1ZUHA 4JIMA 5SZJA 1DAFA 1KK0A 1XTSA 1XD2A 2F3RA 2XNSA 2YVUA 3H84A 1NN5A 1ZM9A 3LBIA 4JL8A 4MGYR 5JECA 3AVTA 1IY2A 1RVDA 1SULA 2B8WA 5BQ5A 3QY0A 1G7TA 3NDPA 2R44A 5KSYA 1Z63A 2J0VA 3VNUA 2A5DA 1OFTA 2CK3D 1JR3A 2B6HA 5KSZA 4DVGA 2J0SA 4U02A 4IDPA 3BGWA 1FUKA 4JLPA 2C77A 3CR8A 3VX4A 3EA5A 5JWHA 3A1WA 2C99A 3A1SA 3PFIA 5JS8A 3NDBB 2A5GA 3PQCA 1SXJD 1NNEA 1G6HA 2JJ2D 3M1IA 3T61A 1E2JA 4C9BA 2ZUCA 5B58C 1S96A 2OO7A 2QAGC 3GEIA 3TUZC 4B2LA 1QZXA 1YZGA 2VP6A 2HXSA 2ZM5A 3FHCB 1Y63A 3AF1A 2ZR9A 4HUTA 5E7IA 4A8JA 2AN9A 4IDQA 4X8OA 1HT1E 1W5TA 3MLEA 5H1YA 1G19A 3TSWA 3AF0A 5BWMA 3ZZUA 4I81A 3SQXA 5M04A 1SKYE 4JBWA 1N6NA 2VL7A 4WAUA 3A8TA 3WHLA 1JPNA 3ZQJA 3NBXX 4KSBA 5DIFA 1SVIA 1J7KA 3M6AA 4PANA 4D0NA 1UBGA 4YMSA 3QUSA 4TQAA 2ZJOA 1NLFA 1WB9A 4B76A 1NN3A 1MT0A 3UMFA 3I73A 3T1VA 3CWQA 4JS0A 4KV9A 3RS3A 2V4ZA 3VR3A 2IYRA 4LPKA 4YMWA 4EPTA 4K81B 3AP3A 1XD9A 3LH5A 1P4SA 2B7BA 1GDDA 3UK6A 3CKLA 3ZYCA 1Q12A 1FPMA 1RYHA 2H57A 3Q8XB 4MGKR 4PHTA 4D25A 2AD5A 2O0JA 4AKGA 4BRWA 1G7RA 2GZHA 3WHKA 1IXSB 2IF0A 4LHXA 2G0NA 2YOFA 3AM1A 1BMFA 2V6IA 1SXJB 4P4TA 2W2VA 4P4SA 1OSNA 1D9XA 1UM8A 1O87A 3KUDA 2WZQA 4RD1A 4FCWA 1E9RA 3R8CA 4CYMA 3SYKA 3KXIA 4Q01A 2QPAA 4QBIA 4DT1B 1GTVA 4IJMA 4CGZA 2FOLA 1OHHA 1E1QD 1XMJA 4EFLA 1GRNA 1NG9A 4DLUA 1GZSA 1YR8A 1YQTA 4NZYA 4AD8A 1G3RA 4WXPA 2AFIE 4C2UA 1XPRA 1OXSC 1S1MA 2JJ1A 2OEPA 2P6RA 2IHBA 2JJ8A 1XTIA 2N1BA 3NBZC 1XBTA 3CNLA 2JLZA 1LNZA 5LDDC 1MH1A 3U7GA 3IQXA 2IF2A 2V7QA 4QHYA 3AVUA 4HLQB 2WWGA 2GEVA 4QGGA 2IS2A 2GCOB 1G3UA 5FBWB 1ZC3A 5FOUA 1GL7A 1P2VA 2VQSA 2A2ZA 2ZI9A 2OV2A 5AUNB 2Q6TA 4Q1BA 4Q9HA 4XTRA 1OPXA 4CEHA 1VYVA 1TEVA 4TSFA 4HUQB 3CRMA 4NYJR 3U4QB 2IHYA 1R5OA 3IPYA 3T1OA 1ZD1A 4GBMA 2ZJ8A 4Q02A 2JLWA 2ZU6A 3OIWA 2MMGA 1P2TA 1ZUNB 1JQLB 3HU3A 4XSGA 2GJKA 2JDID 4N3NA 1SVSA 1M7HA 5G3YA 5JMTA 2ZI3A 5J5CA 4KLZA 4EIWA 4DSNA 4M1MA 1EESA 3OEHA 2WBLC 3LO5A 2V6JA 3S1AA 1T3SA 5F2EA 2Z83A 4Q4HA 4LC0A 2X77A 3EG5A 4B71A 4PC6A 3AKYA 2QAJA 2Q3HA 3K09A 4PQFA 5JEEA 1OV4A 4I4LA 1UFQA 2Z4RA 4QC2A 3IBGA 4M8NE 3TE6A 2GXUA 3NHAA 2QNRA 2WM9B 2J7PA 2DWPA 2FSIA 1NG1A 1T4GA 4MYHA 2FF7A 3AUYA 4M9SA 1XMVA 3O8DA 3I5XA 4R7ZA 2F7SA 2BEKA 2FEMA 1M7BA 1KYIA 4TZ0A 1UEJA 4FMCF 2CLSA 3ZDQA 3FMOB 3CPEA 1NKSA 3DZ8A 4QNMA 1L7VC 2YOGA 2G1JA 4FN5A 2REBA 4Q1DA 4R98A 2UKDA 3I1FA 1WBBA 3H2YA 1ZJ6A 4B3CA 1MO3A 3I72A 4MKHA 2ATXA 5C18A 2QM7A 2CVFA 4C0KA 4BFVA 2EFEB 2PX3A 2XOKD 2OM2A 2OCBA 1T0HB 1JECA 2XZPA 4L5BA 4YQFA 2O8EB 4L8GA 3FHOA 5ANRB 1XCMA 1BOFA 5FPHA 2HF8A 1NMZA 4IOKA 2BC9A 4BGDA 2CCKA 3L82B 2D62A 1KO4A 2FZ4A 4JLVA 4Q1EA 4CEJA 3HP1A 5BYJA 2F43B 3UMSA 1OFUX 1OJLA 5DGXA 2D7CA 3LXXA 2PMDA 1R0WA 2QN6A 5LD2C 2IK8A 4ZPXA 1WE2A 5L3SA 3A37A 2IEZA 2KB0A 4NU0A 1IONA 4QRHA 4DRZA 3FKSD 1G4AE 3TQCA 2SHKA 5JRJA 1S1CA 4RD0A 5IT5A 3WRYC 3GLFE 5LBIA 1Z6TA 2VHUA 5CM8B 2J3EA 2IC5A 1BYUA 1CR2A 1KGDA 2CHGA 2ORWA 4RZ2A 2VF7A 1X8JA 1VG9B 4QM6A 4NBSA 2GZDA 2NO9A 2JAQA 2HXYA 2EFDB 5EXTA 3THWB 5BYKA 1KI9A 3WYFA 2AK2A 2O0HA 1AKEA 4ESHA 4B3FX 2BWJA 4QGFA 5AK0A 5GVRA 4C7OB 2W6IA 2GRJA 2J46A 4RVCA 5K8LA 2HLDD 1TUEA 3SU8A 3CO5A 4AC9A 1R10A 2C8VA 1P72A 1W0KA 1XMSA 4N1AA 2G3YA 3KDSE 1XPUA 5J47A 4EJSA 2C98A 4OHZA 1AQUA 2GXSA 4XOIA 1VCNA 3RVBA 1DAGA 4JYBA 3OE7A 3KB1A 1L4UA 5BN5A 2KBEA 1XJCA 3MG9A 3VKHA 1OFHA 2DCUA 3SBEA 1DBSA 1U94A 1S3GA 5AJYA 4RD2A 2WICA 4D4MA 5AUPB 5GVSA 1XTJA 3DKPA 4Q21A 1XD8A 1XWIA 2O8FB 3THXB 1X1SA 5KYKA 3M4YA 4BQSA 1NSTA 1E2EA 2XGJA 2O8BA 3L0PA 4A6XA 2GAOA 3U3KA 4HAXA 1NP6A 3AVXA 3O47A 4LZZA 3WNCA 3W8RA 2QG6A 2O8CA 1RW4A 2FNAA 5TY0A 5KSOA 3REFA 2CJWB 4JVLA 2IYXA 1Q1ZA 1K5DA 1R0ZA 2OFXA 4POAA 3U44A 4DZZA 1MABA 4KFUA 3AH8A 4PAMA 3SBDA 2J0QA 4Q9IA 5GJWC 3R7WA 4TYWA 2P2LA 3RS0A 3CNNA 4OKSA 3BERA 3B9QA 4Q4LA 3NC1C 4AKEA 5K8UA 5G41A 1ELOA 2QTFA 5A0FA 4ESVA 2RGEA 1JXMA 1MO4A 1KMHB 1Q21A 1W0JA 2QL6A 2FG5A 2NPFA 4FWTA 2GCPA 3PITA 1W4AA 4BUJA 4BFSA 3G5UA 4JL6A 4Q7MB 4Q4JA 4RZUA 4WZAE 4B48A 2V54A 4FMBB 5P21A 4AKIA 1U81A 4D0LB 2J59A 4FMCB 4Q9KA 1HQYE 3TMKA 5EE1A 4LJ9A 3OZXA 4RFSB 3K0FA 3X1DA 5IK2D 3QF4A 4O2RA 2PLRA 2YNMA 2QTHA 4B33A 1AK2A 1A4RA 1NBMA 1QVRA 3UMRA 3BIFA 1UBCA 2Z6VA 2REOA 2JLQA 4V02A 2GK7A 4I1SA 2O0KA 4KO8A 2YWFA 1LF5A 1AS3A 4D82A 2NG1A 1CR0A 3LWNA 4M1YA 1AGPA 4GI7A 4CT4B 1G1MA 2IXFA 3FB4A 2VSXA 2IYUA 1YU9A 2Y8EA 3SHWA 3CIOA 4M1WA 2B7CA 2LCFA 2ZRIA 2X2EA 1P61B 4NMMA 3F5FA 4TMXA 3K9LA 4G0NA 1XEWY 1KSGA 2BMEA 4NYIQ 1E2HA 5H70A 3PENA 2WPDA 4IHQA 4ZIRB 2IW3A 1A1VA 4EKDA 1FW6A 5JJKA 2ZR0A 2AD1A 5AWFC 3EWSA 2ECKA 2VF8A 2MSCB 2ZAOA 4M2LA 4ZKDA 4GFDA 1DG1G 3AKDA 4EPVA 1HH4A 1M6NA 1QHHB 3NXSA 3BC1A 4QL3A 4MKGA 5G3ZA 1HT2E 1CP2A 3ICQB 1AQYA 1F2UA 1M74A 4TTQA 1VMAA 1Q0UA 1WP9A 2QENA 1DE0A 1W5SA 5D3MB 3K0SA 1SZPA 3K9HA 4ON9A 3QJYA 1TEXA 3U6BA 4L16A 1E0SA 2ZANA 3AQ4A 4E09A 2BCJQ 2WWWA 1JR3D 1KMQA 3CR7A 4X8LA 3W6OA 4D4LA 1K6MA 4FCTA 1E6CA 3QKSB 4TZ6A 1ZVQA 1YR6A 4MYTA 3W3AA 5KOYA 5J4VA 2PL3A 4C0AC 1CS4C 1DTSA 2JIZA 1Z06A 1EFCA 2YV5A 1TF2A 3IILA 2GK6A 2XAUA 2ODWA 4G5RA 3IIJA 4D4KA 2JLXA 2ZREA 2PZFA 1SXJC 2IUTA 3QPVA 4HDOB 4QBFA 4F91B 3U6KA 4WA7A
chains in the Genus database with same CATH superfamily
2J1LA 4N49A 1J24A 1E59A 2QRJA 4UZSA 2OZVA 5IDVA 3QBEA 2OBYA 4A27A 3IO3A 5DLQC 3R7AA 4GM1A 3FVTA 1FSSA 1TI7A 3H9QA 3ZW9A 2D0DA 4Z1OA 4HGRA 4OP2A 2E82A 1XYYA 3GX1A 1D2RA 1RQ7A 3HA2A 4H0NA 1G20A 3GQBB 4NBNA 1BE0A 1PI3A 4U00A 4YBRA 3WIDA 1C30A 3ZXYA 3NHJA 4BFLA 5C7YA 2BPOA 2VNIA 2AJCA 1I2DA 1ZJZA 4W7SA 4Q4AB 2P5TB 3EG9A 4RKYA 2GYYA 3D8TA 3ZXIA 3D59A 3KXLA 4FU0A 3RC8A 2PGLA 2P8JA 3VHQA 3UKDA 4OA8A 4TMZA 5CVDA 3IJRA 1VRCA 4UEWA 2IKQA 1USUA 2BGLA 2JBWA 2PUVA 2VJDA 3MW8A 5AM1A 2X4DA 2GLUA 1Q14A 3HB1A 4XQCA 3VR3D 4B2IA 2C4UA 1D1SA 2BR5A 2F48A 3EWAA 5L45A 2HGSA 2HLNA 1G3IA 2OTCA 3I39X 4HDCA 4Q7EA 1T4CB 5IASA 5CVUA 2H06A 2YFHA 4PGFA 2YHUA 3IPAA 4EPWA 3RYTC 4C87A 5FI3A 4U2EA 1H0HA 3QYFA 3ZJVA 1RU3A 1MV5A 1XTZA 3O8RA 5LQCA 1YQEA 1Y3IA 3D2AA 4XDZA 3CGWA 3EK2A 1VPVA 1U8CB 2QROA 2ZJAA 5BOSB 4XFDA 2R7NA 3NHZA 4ILKA 3JVDA 4J07A 1VPTA 3EFOB 1WR8A 2XY4A 4IXWA 2YVQA 1KJNA 3FTEA 1CUIA 1T36B 5LU8A 1NW8A 4L73A 2WJGA 4LI0A 5FBRB 1CJUC 1XTPA 1EWRA 1VIVA 1IPHA 2R48A 4RNDB 2IX3A 3UPUA 1MB2A 1W85A 2BTOA 2WWRA 2I4MA 5H68A 3ZXSA 5M2QA 1LJUA 3GLSA 1D9ZA 4RSRA 1DLIA 3OPQA 1L5RA 3GJSA 4TKLA 2FJPA 1OCEA 1PZGA 2GVZC 5H4GA 2Q49A 2ZYWX 3LVFO 2D2FA 1W96A 1Z12A 2JJMA 1Y1TA 2N9UA 2D5AA 4JV5B 4B82A 4RA9B 1V8FA 2RHTA 4CVNA 3DE5X 3KAPA 5SZHB 4E32A 4CBVA 2AG0A 3KZVA 3WL5A 4LMBA 3LSYA 4J16C 1N4DA 4GDMA 4TLEA 1VLZA 4U7PB 2FFQA 1SC3A 2RG7A 3U9LA 1JIKA 4R81A 3TSOA 4RVSA 4WK2B 2XDQB 4OMUA 1J0DA 2BHRA 2CLDX 1ZJ4A 1VJ1A 1F12A 3F8SA 4IDOA 4WOPA 5KU1A 2PSSA 5TF0A 4ZCTA 3CIFA 4IJUA 4RH0A 3F46A 4YRTA 1U2QA 1P81A 5EPUA 3V4SA 1VJGA 2OB2A 4JGGA 4F6RA 4B6PA 1HMYA 3IT1A 3MILA 4GMFA 3V1UA 3ICVA 2RIRA 4KDRA 1NRIA 3F73A 2JCBA 4PLYA 1CY7A 2FPUA 5CLQA 3D1JA 1R3UA 5F33A 2I2FA 3LG2A 2M6SA 1QYIA 4HWGA 1T0JB 3W5JA 4NQRA 1PJTA 4EAQA 4BPBA 1XELA 4NCIA 1WUJS 1YE3A 1C1XA 1XKXA 3D6TB 3MAGA 5EE5B 3OJEA 3G8CA 3SJBA 3TLXA 3O3OB 4XASA 4S04A 4WZBE 1C0LA 3N2NA 1EP9A 1Z25A 2ADOA 1NIJA 4LHVA 2NNLD 3IVRA 2HR1A 1E2MA 1SKBA 1U2PA 4YIKA 4LXGA 5CH5A 4II3A 1AKRA 1NVMB 3TUIC 1M2NA 1ULAA 2LRHA 3AJ9A 3FDIA 4UUMA 4RSMA 4JT9A 2B7LA 3LBFA 3KALA 4LDNA 4RIEA 3Q9NA 4PYKA 5T4EA 2J87A 3DG9A 4ZOEA 4L7VA 3SSNA 5A5FA 4WEOA 1VB5A 3PLAE 4V0ME 5IW8A 2YYAA 1S4MA 5DP2A 2X9LA 5BW4A 3DTNA 1U5BA 1ODSA 1WXFA 3QRWA 1XYVA 4MQBA 3ZBUA 4DLSA 4C2TA 4KWHA 3VX3A 1XFDA 4OB7A 1GT6A 3BS4A 3GZNB 4BEVA 1V3UA 3EH2A 5DGDA 3T3EA 4I3FA 1KSHA 3IMFA 4K9RA 4C4TA 2JGDB 3CE6A 1EUCB 3OZIA 1YVEI 2VSQA 1T8TA 3JQ8B 4TZTA 3UXHA 1BKDR 3MT8A 1F3LA 3MGKA 4FXOA 4X8MA 1G6OA 2VAXA 1GTRA 2C2BA 2E87A 2W6JD 2GFQA 1O8CA 3A32A 4UUAA 5HIKA 4RF3A 1FFHA 3ENQA 5A4IS 1LDEA 1AIPA 4RJJA 3WZ2A 4RS3A 3NEAA 3A14A 1Z83A 4KE7A 1POXA 2F1JA 3GJ8A 1KDOA 3D4OA 3MSCA 1Y7LA 3ZE8A 1OREA 4UOEA 1FP7A 4G81A 1W36B 3KTOA 5DXFA 2WZBA 1LW6E 4OLJA 3ZV4A 4CQMB 2TSYB 1QR2A 4MICA 4AK9A 2RIPA 3U4IA 4ZOLF 4MX8A 4BP8A 4BMDA 5J59A 1AQLA 5B6PA 2IVFA 3LKBA 1EQAA 2HAEA 1P1CA 2Z56A 1JTEA 3L9WA 3QKUA 2IZOA 4I19A 2PNFA 5CDUA 1UM9A 4QGSA 2EFCB 1UKYA 1Y89A 4ZOLA 4BOYA 3SMQA 3ESZA 5CYPA 2QMEA 4GE0A 2AMYA 1TJ4A 3BMNA 4PXSA 3W5UA 2XB9A 3GIWA 1QUEA 3HG7A 2AKYA 3PCTA 2OOSA 2VPIA 2BFDA 2PS3A 2Y1XA 2IL1A 3E3AA 1SA0B 3B12A 3TFWA 2NU7A 1KXZA 2OFPA 1C8KA 5JWRA 1J90A 2VSYA 1JS1X 3VXKA 4BGEA 1PV4A 1WNTA 1IYZA 4TL7A 3W05A 1J8YF 5KB3A 2CNNA 3ZLUA 1XDZA 4HLNA 5ED0A 2A0YA 3QSYA 4R1TA 1CCWA 3L18A 1MH9A 3MLAA 3OX4A 1S3SA 5KMGA 3PRHA 2OBNA 2ZTSA 3HEAA 4W1RA 4WFQA 5K2MA 4HB3A 3EDOA 4PAQA 2IDJA 3C1OA 3HCPA 3DDWA 4TL6A 5KC8A 1KH2A 3TG2A 4LXYA 5DRYA 3RU9A 3B53X 5BWOA 4N82A 5KTOA 4FJ2A 2D3WA 1BH2A 2IQIA 1ORIA 2OG2A 4U6QA 2CE2X 5A06A 1CZLA 4B7AA 1WMFA 4HAWA 4D46A 5AVJA 3FIJA 4YDRA 2UZ3A 3PGXA 4QGBA 2DH6A 3C0KA 1CRPA 2MMCA 3GXOA 4IX1A 1K75A 3AGPA 4NCJA 5FA6A 4F4JA 1YJAA 5HUHA 1CX9B 1HTTA 4J1QA 3K5WA 5DV9A 4ZVNA 2JATA 4A2WA 4DARA 1CV2A 2CL7X 1H69A 1HFEL 1ZOPA 2BBOA 1ZM3A 2WR8A 4WBNB 3UHOA 4UE2A 1MJNA 3D4BA 1ZOSA 2FFAA 2ZBVA 5JARA 4B09A 3D6JA 1ULTA 2XR1A 3UGTA 3Q8MA 3QVXA 3QUCA 3ADDA 3MRVA 2GBLA 3MCZA 2IYTA 1XRMA 1XZAA 4Y98A 5AI6A 5E9QA 2JGIA 1JYSA 1DIHA 3VI4B 4DHWA 4G5HA 5HP4A 3OKFA 2ZUWA 5T64A 1E20A 4BZZA 2WAYA 5IUJC 1PT5A 3FTDA 3ND9A 4WCFA 1L7EA 2P3QA 3E1SA 5A04A 2ZSEA 3B1YA 2POCA 1G8FA 2F90A 4QU0A 5K6RA 2BZ1A 1J21A 3P45A 1O96B 4KDCA 3X43A 2ORED 4HVTA 4EZIA 2P4HX 2IUFA 2ZVQX 3BH6A 3NJ4A 5DBOA 2CUZA 2Y1OA 2YHSA 2ZJ4A 3AP1A 4A0FA 5CCEA 5H5JA 1FX0A 4B74A 3U7HB 5JS7A 3FGNA 3OLZA 4RNCA 6PFKA 2PE5A 1EGHA 5FWYB 1EE9A 1YKFA 3E0QA 4IKPA 1LV8A 2W00A 2EV9A 4NYJQ 4KJZA 2RGNC 2YXLA 3IBCA 5J63A 4JMLA 1W6UA 3KAKA 1GSIA 2F8TA 1YZUA 2RMKA 3WTCA 5F5NA 3T9FA 2A33A 2JRLA 2IQ5A 2QN3A 4JOBA 1L7RA 1K3TA 5TT1A 4O3FA 2W2TA 4PRYA 2F3TA 2WWXA 4J90A 5T4FA 5IJXA 4E94A 3GLIA 2AR0A 3M6MD 4JOCA 2XWBF 2C95A 5AUOB 2DUMA 4M53A 3CO0S 3TKLA 3AR3A 5JZ9A 2FUEA 2VPQA 3GCWA 1QMPA 1RI4A 1E9BA 5LA6A 1YQWA 1QYXA 3T7CA 4BQFA 4KR3A 1AGYA 1HTBA 3H4TA 3C6ZA 4BFXA 5B64A 2QQEA 2WZCA 3FPGA 3REQB 2XNDA 4F6LA 5K0NA 2YASA 3GFQA 3V8NA 1RM0A 3MJHA 4LRWA 4LHEA 2WA2A 2XA2A 2LUOA 3ADKA 3HADA 4C4OA 5IKPA 1R4MA 4YP9A 2HDWA 3GG2A 4LEIA 1M8PA 4MYCA 3PEWA 4M1QA 2RB4A 3VU0A 5DJ5A 2C9YA 2HI0A 4Z9YA 2OC9A 5AKKA 4YJ2F 4B7CA 5KC9A 2GBPA 2PN1A 3AY7A 2O8CB 3WR5A 2Z0MA 2AJDA 5DHTA 2ZUDA 3U44B 1E79D 5KBYA 2X3UA 4BNHA 3KXDA 4XX0B 5BY2A 1B0AA 4BV8A 1HUQA 2VQ3A 3UWKA 5I9IA 3PC6A 1TGYA 2P9HA 1ZGJA 1D07A 3E4CA 3L8FA 4U7JA 4BNGA 1A9XB 1YRQA 2GAFA 2NSYA 1E6LA 1UJBA 1P2DA 4B40A 3QBTA 1Q0PA 1W4CA 3VTAA 2JFPA 5HKAA 2HF9A 1IXZA 5JHHB 2B37A 2EP5A 3DE2X 1C5KA 1ENYA 1Q50A 5TVKA 4Z9AA 3UUGA 4PRKA 5KYVA 2P9QA 4P3KA 2ID9A 3B9PA 3NHPA 4TMTA 4UNIA 2GM3A 2OZLB 4UHJA 3FMPB 4ZICA 1AKNA 1C14A 2YDYA 1KOGA 1PWEA 3NUGA 4BVLA 4TYWA 3K0FB 3PVCA 1II8A 1JR4A 2Q2VA 2QRKA 5B1EA 4F2GA 3ANNA 5FJIA 5J1SB 3TD6A 1VJRA 2BEVB 1P17A 2FB9A 2AE2A 2O1WA 3R0XA 1L5LA 2YICA 1YZQA 3GRKA 1DKNA 2OGTA 4YHHB 4JJEA 1ZR4A 2WU8A 2XUFA 3GY0A 4M0PA 4P0PB 2HPVA 3PS9A 3F9IA 1WULS 5EUMA 2WHYA 1T8PA 4HNGA 4AF7A 3JQCA 5LZ7A 5ITWA 2EU8A 2NVWA 4MI3A 4ZP1A 1FU7A 3V4RA 3VNBA 3B5IA 3E7DA 2PYDA 4HTAA 1QH1B 2Q1TA 2ZB3A 1T1EA 2KW5A 3G13A 3I30X 3UY4A 4B4DA 4CG0A 4F85A 1I7DA 4LOKA 2Q4EA 1JEDA 4C0BA 4BRZA 2VSNA 3MRXA 3H7IA 4L0QA 1MKYA 3IQDB 5KYXB 3IMKA 3QLJA 4H1WA 5DX0A 1OB2A 5G4KA 5A3QA 1T8UA 3E48A 2P62A 1R6VA 5CNKA 1B8OA 2OR3A 4U7GA 3WHIA 4AKHA 5LQKA 3GMTA 2SBTA 2ZITA 5JNUA 4NYMR 5DBHX 2PH7A 4BLQA 4XEUA 1VI5A 3PQ6A 4O6VA 4GYYA 4LJ5A 4BRUA 1MU0A 3GUVA 3NI2A 4DNPA 2QY6A 3PUXA 4R9RA 4Q3KA 4ACBA 3RG8A 4CKYA 1VECA 4J7UA 4GSYA 4JJFA 4YRKA 3IIKA 4UW9A 4RVDA 3AUSA 5H16A 2PAFA 3DMYA 3EAFA 1T9KA 3EHDA 4LOIA 3RYCB 4O2BF 3BZBA 2UZIR 3QKTA 4L8LA 2RH5A 3K4HA 4FR5A 2C7VA 1Q92A 4IDDA 1B42A 3N5KA 3Q5EA 1CUAA 5BT9A 4LJLA 3LBNA 3HNRA 5F1KA 4NPAA 1DXYA 3LPLA 4NMWA 2HQSA 3V42A 3C3AA 4GWGA 2L17A 5ALVA 1ZM4A 2XE8A 1KR2A 3VZSA 3FA2A 1OFGA 1DV2A 2X9VA 3JAKA 3N0XA 1FYVA 3CUSA 3PVSA 4DQKA 1GXSA 4BO0A 4DV2B 1UBMS 4C5AA 3QPBA 4G8BA 1G8KA 1O6FA 2WU0A 3SZMA 4BNTA 4BVHA 1NOIA 1D2AA 1RWBA 1TM3E 1Z75A 2RGBA 2QN8A 3QG1A 2GD2A 4Q9NA 1KETA 1HGXA 1HX7A 4MLPA 1XEXA 2QX8A 4FNOA 4JWKA 3RGGA 4AO6A 1GTZA 2BBSA 5EZ6B 1U2ZA 2QLTA 3EXG2 1XALA 3HACA 2CVQA 3UUFA 2B2CA 3I23A 3B1WA 3P2IA 1C9KA 2X1MA 2VDWA 3AUJB 3IFSA 4ABYA 3F5MA 4ARAA 1W5BA 2BDEA 4AKSA 3SDSA 4ND8B 4Z1MD 4HH0A 4RHXA 1G20B 3JWJA 2YHAA 1IOWA 3D6UA 5FHRA 2Y2VA 4L5CA 1E1DA 1ZQ9A 2Q5LA 2B0CA 4JB0A 2OBMA 1JYEA 4MUBA 4WKBA 1N2ZA 3ASVA 1U7OA 3EG9B 1YVRA 3EB9A 4QT0A 1ZK0A 4UNNA 1G8GA 2QQ0A 5IUNC 1G1AA 4XLLA 3CM0A 2AUTA 4O08A 3CC8A 1TPYA 3WS7A 5BNZA 2DFLA 3PX7A 1UKCA 5J4LA 1UJ6A 1PJZA 1Q77A 1XO1A 1V5GA 4QUKA 4R1SA 2V4MA 1JHYA 1VL5A 1J20A 2RAVA 1KP2A 4YJ3B 3C98A 3INNA 3KOOA 5HE8A 3CN7A 2V5VA 5LXTF 3ZY3A 4BNJA 4RTRA 4DJTA 1PR1A 1GTG1 2D2EA 1VLJA 4B6GA 2V6GA 1A7JA 3HDQA 1Y1PA 5DM0A 3OAAD 4BFZA 4AXBA 4RTPA 3G59A 3QFSA 2G06A 4QBGB 3H5WA 2C82A 2B4TO 3DBOB 3K9GA 4IH4A 4WGFA 4I4TF 1FFEA 3VV2A 5DNYB 1SHKA 3R9KA 3RFVA 3T3DA 4DPLA 4OJNA 4GRIA 1Z28A 3QGMA 3I9MA 1P9NA 3EEBA 1L2TA 3KJIA 3NC4A 4HN2A 2JRCA 4R1MA 5A7HA 2O2XA 3LDUA 2PJUA 1RIFA 2FX3A 3EYAA 3QJ5A 1HLFA 1I5EA 2EJCA 3ZN2A 3CZMA 2O07A 3G68A 2H3HA 1JQKA 3K0BA 1B2LA 1GHTA 5JXGA 2IIVA 1Z2NX 2HFKA 1THZA 4DLZA 3PPWA 3BG5A 1O2DA 2QMHA 1KXJA 4DF3A 2VDMB 3BF8A 2BISA 3K9FC 4GDFA 1JR6A 1IQRA 3EZFA 1B8NA 2FSPA 2OCKA 3PE6A 4DCUA 3LFUA 2WWVD 3GGPA 4HUQA 2L0XA 5BR7A 13PKA 3SDZA 4PLVA 1BEUB 2L69A 2O48X 3DXZA 3MXTA 4HEA1 1IUNA 4XYLA 1FBNA 1UT8A 3LW7A 3UT6A 1WAMA 3QXXA 4PFKA 3U0BA 4ZCQA 2XUIA 4DLLA 4EJMA 1D7OA 5ICGA 3U4MA 4WCDA 1EHYA 3U1TA 3W5IA 3EQ7A 3DEHA 3TZQA 2G6TA 2GLXA 3U3ZA 4AJEA 2B1JA 4LZWA 1NSFA 1TAGA 1WDMA 5CT9A 1LK0A 3A3YA 4OGGA 3C43A 3P9CA 3BXZA 2C58A 5DDIP 3WNZA 3NTVA 3P2MA 3F6SA 2YH2A 1A9RA 4BNIA 4YO7A 4RMNA 2BVNA 4Y6OA 4WKCA 3T95A 4F6RB 1TECE 4H08A 4UM8B 5GIOE 2NO0A 4NU6A 5AUQA 1TIPA 3OT5A 4EY3A 1HTWA 3Q1LA 2C94A 3L46A 3URMA 4F1JA 2OM6A 3U3OA 4YRQA 4XEHA 2O9JA 3JV7A 3EFBA 4G24A 1Q3KA 3FWHA 4JXKA 3M81A 4Z9XA 2I7VA 3SE0A 4AN0A 4D7AA 2CD7A 4RVNA 2CBXA 1C1XB 1QHIA 2EW2A 4P2GA 3SVLA 1AKWA 3AVVA 4LOHA 3KVNA 3HR4A 4B9AA 3GZJA 4B3IA 1Z47A 3EUAA 2ZIEA 3OZWA 2OQVA 4HXEB 3JYNA 4K05A 3DEFA 2X4GA 1U2DC 5L9AA 2QZ9A 2QRNA 3CF4A 4XGIA 4Y2HA 4N7JA 2FH5B 1J1IA 1IHYA 3LV8A 3BUSA 3GJ7A 4YHBA 5ALXA 5FI1B 1VE1A 5C8VA 4GPTA 3U37A 1YS1X 1U2RA 2P6UA 3EEIA 5ESRA 5HDQA 4Q03A 4EX7A 3IB3A 1UOEA 1ZUWA 4BVFA 3GUCA 4LF9B 2O6LA 3ZK7A 3EVGA 3S7ZA 3BF7A 1E3WA 1XZ8A 3CH7A 1FMLA 3OQ6A 5HILA 4IDAA 3HUFA 4A23A 3L7YA 3NB0A 4KWCA 1QWSA 2OCYC 3AG6A 1U5BB 3MWJA 2BBWA 2L42A 2ZVJA 4LZNA 4DLAA 1VDZA 1ZL0A 3BWDD 4INZA 1UZLA 2BSQA 1SVUA 1TYDE 3HYNA 3FOAA 4OFBA 1V45E 2OXCA 2WP0A 4BB9A 3QJGA 2BJVA 5AP9A 3FLAA 3PT9A 4MW6A 5GAJA 1GAEO 4B4WA 1OXBB 1KI2A 4RK1A 4ZHQF 4XR4A 2HFJA 5FOVA 3IAXA 4ZMBA 5IH7A 1UQTA 4EJSC 4MUKA 4U6SA 4FOSA 1JE0A 1J4AA 3EDCA 4F56A 4ZQCB 1BXRA 1T34A 4FGWA 3WGGA 5GM1A 2IDMA 4FHDA 1H4VB 2VYVD 1M2VA 1DCFA 1T3GA 3EW9A 4TT3A 1ZM7A 2VJCA 4ND4A 3WL7A 1PT7A 4BQOA 1YWGO 4JBHA 2F9FA 1GCUA 3G79A 4DE5A 2IBTA 2QP9X 1PS0A 4GICA 3ZWYA 2W6MA 4DCJA 1Z2OX 3PQFA 3H17A 5ER9A 3M6XA 4CQNA 1U9ZA 2CDAA 3F96A 3KM0A 1HRDA 3GDGA 5TV2A 1FL9A 4CFSA 4IZHA 4DEYA 1Z0IA 1ZKDA 1L8LA 1PTJC 2X3FA 4RJIA 5H3CA 3V1NA 1ONBA 4RHEA 1H0KA 3IDFA 5IZCA 4MKXA 2YS6A 1UM9B 3SMVA 4ZOLB 5ARCA 4IOLA 3BCHA 1XKLA 3HBMA 1O54A 2CNKA 3FX2A 3OZVA 4H35A 5ALHA 3BMNB 1J1ZA 1YVDA 1Q0QA 3IV9A 5SV2A 2Q3JA 3CURA 4RGBA 4UXHA 1DCKA 5AHKA 3PGKA 3TXXA 4BE4A 5JI2E 3GFPA 3IT0A 3UJCA 4BS9A 2XOKA 3IHTA 3GLTA 2BFDB 3HA3A 4JROA 2C31A 2V7WA 1ABFA 2NU7B 2PX2A 2BFWA 1UK8A 4FGZA 1OT5A 2ZYUX 3VPAA 2HSGA 2DR0A 5B3JC 4HAVA 2HK8A 5JNSA 1G0NA 3I12A 4ZALA 4E5SA 3P32A 2FPKA 4GL4A 1A69A 2IA5A 3RSCA 1KHHA 2JLYA 1AK9A 3O2QB 4Y1GA 1AQ6A 2VBFA 3KJEA 3R7DA 5KU7A 4IIJF 2RBKA 3WO0A 1NNSA 1QAOA 2JAPA 3EGIA 2G9VA 3PLRA 4IEIA 3THXA 1FFYA 5EWJA 1DBRA 5ECYA 3HU1A 4PGAA 5JZVA 2CMHA 2ZE5A 2YY6A 3H6HA 3MYRA 4RJTA 1GVNB 4GKBA 1H4QA 3FYHA 3I2JA 2XRZA 1WD7A 3SXJA 5CIQA 4EEZA 3ASZA 1M8FA 1JVSA 3QOFA 1WB4A 2VNSA 1AZSC 2CN1A 4LWZA 3KUUA 4WSOA 4KXUA 3B78A 2XTAA 3QE4A 1J2TA 2PR2A 4S0XA 3L6RA 4H18A 4D9CA 1ZCZA 5JYDA 3S2IA 5K0BA 3IUJA 4AQYB 1LC3A 1YMUA 4CTNA 3H1BA 2QOEA 3VBCA 2ACEA 2VPTA 2BRUC 3WB0A 1DADA 5JO9A 4X65B 5H7XA 4D74A 2NACA 4IMRA 1H2YA 4D3SA 4RPIA 2W71A 2C7PA 1BWQA 2YOHA 1T0IA 1ZPDA 2C4VA 2WF8A 4HDNB 2JJYA 3QVTA 2W8ZA 1W93A 1FSGA 1LTQA 5KQRA 1TQHA 3K0AA 4MQMA 3AVOA 4XD7D 2R25B 3VPFA 3TBHA 8ATCA 5ESXA 4R2JA 4NX2A 5ICMA 3QKRA 3OTIA 4EB3A 1BA3A 2ZYGA 5I9MA 3DPSA 3ICEA 4M7RA 2A9VA 3GQVA 3RUCA 3OZEA 4RCVA 4NY1A 2ZQ5A 3ZHYA 5EG5A 2B83A 3AYXB 3CRRA 5D7NA 1AUVA 4RY8A 3JZFA 1DC4A 4B6JA 5GWXA 3EEOA 1FX0B 5F9MA 3T35A 3VC1A 2PAAA 3K3PA 4PLCA 1YA8A 4UNQA 1R4NA 5C2JB 1W36D 2ZRGA 2AMJA 2BKLA 1DWOA 1VIYA 3TRHA 4BV9A 2JGJA 2X5XA 4UM9D 1NP7A 3K1AA 2YTZA 3X1YA 4NHEA 4JVMA 3UAGA 1XU4A 4C3VA 3ZBQA 5I01A 4B6RA 1D2MA 3AINA 1Z2CA 1ZS9A 2MSNA 4FYPA 4EKEA 4MRMA 1JA1A 1UXGA 3CZCA 3GLIB 1C2TA 5HBRA 2DRIA 1AD2A 1R5BA 3DZFA 3AR6A 4GNKA 3UB4A 4EF5A 5JCXA 1DAOA 4OQFA 2B1IA 3UJ3X 3Q7IA 4MV5A 3PD1A 4Y7CA 2Q9UA 4EG4A 5JZOA 5LA6B 5C1BA 1GPUA 4DQ0A 2J7PD 3VUEA 2JHGA 4AJIA 4FZVA 1KYZA 2QV7A 1JSRA 2WWYA 1R4MB 3CSUA 1DOHA 1H8ED 1GJRA 2I22A 2R66A 3GOHA 4Q3CA 3DZKA 3WKBA 4NXNB 1KI7A 2NXCA 2E4XA 3G88A 1Z29A 1O94A 2QLBA 5E2AA 4JU8A 3V6LA 4D8XA 1YJ5A 3E9CA 5C5IA 1BU5A 1E9DA 2N46A 4KWEA 2JL1A 4DC1A 1XNRB 1P4AA 3GLFA 2ZOSA 2CMGA 2WHXA 4ZO7A 2D5BA 2ZIXA 5DWQA 2JI9A 1J49A 2O5RA 1E0AA 1C1YA 3A04A 3P27A 2IUYA 3O2JA 4FZ5A 1B8VA 1EFTA 1VLHA 4RZSA 4WN9A 1XTRA 3D5EA 1V8PA 3FXAA 1MGPA 3KKQA 3V4OA 4D2IA 3NEPX 1VHQA 3EF1A 3LVBA 1HETA 1OC4A 1LX6A 1W1WA 4OY3A 3ZVMA 4L0CA 2IU3A 2XADA 3IBYA 2HUNA 4JBYA 3TI9A 1LRLA 1C3XA 1BQ4A 4BKOA 1JQBA 1CG6A 1F8XA 1WWKA 1ZX1A 3NVMB 4G4SO 2RAFA 4X61A 1G2IA 1ZBQA 1WPGA 2H1FA 5JCOC 2Q5QA 4F97A 3QPCA 1DUVG 5AM5A 5LQNA 4D96A 1NZFA 2D2VA 3FPKA 4G01B 5KPDA 1R0RE 4MCHA 2BF7A 1YRYE 4N0DA 3KEGA 4QOHA 3NWPA 4BO5A 3WQSB 2HYIC 1I7LA 4IQ8A 1F1BA 1OYWA 2B30A 1BJKA 2QZSA 2XXAA 1V8OA 4X6LA 1II8B 1FSFA 4MR8A 5EP3A 2G4CA 2J48A 2V7BA 4HS4A 2AQHA 3ND5A 2CKDA 3T61A 3RS7A 4BO6A 1RHMA 1FYEA 2Y1KA 1PV2A 3GEPA 2RAPA 4Y67A 2KBFA 4A1OA 1XSEA 2XTNA 3ROXA 1YS7A 4ZO8A 3V4LA 3VOAA 3HB9A 3GD7A 1MEEA 2CB0A 2HK6A 3KOMA 2ZPUA 1WV1A 4D0SA 5TMPA 3P2JA 4FIDA 4U7WA 4KSYA 4Q37A 3CCFA 3GVIA 4UVDA 3LF1A 2DQKA 4TN1A 3IS3A 3R5KA 2O3SA 4F2PA 4H4DA 2BFCA 5F73A 2CYBA 3LC2O 2VT7A 4KFTA 3IAM1 4PLGA 4QPZA 2A0UA 1ZOLA 3KYCB 3NT5A 1HNWB 1XG5A 5G0UA 2WIFA 4PTLA 3ZWCA 3TJZA 2PJRA 3FWKA 4ZARA 4R51A 4I1IA 3L0OA 5G4KB 1T3ZA 1P3Y1 1RRPA 1TADA 1XDGA 2OP1A 1KP9A 5DK4A 1UXKA 4DIOA 5K0TA 2UZ4A 2DEUA 1U28A 4OHMA 1R6AA 3BOSA 3GAMA 3PFHA 5FQNA 2WM8A 5TEVA 1DXOA 4GWLA 1U8AA 3B6ZA 3KBBA 4GS5A 4U2CA 4XRRA 4E0BA 3VTKA 2DR2A 1E9SA 2OORC 3F9CA 4RAOA 1FUUA 3TR5A 3HPRA 3FBGA 1K7XB 1MX3A 3BFPA 4GR9A 2HA2A 4DV7B 1WU7A 3VR6A 3MSXA 2E37A 2ZYIA 3H42B 5EMMA 3TZCA 2GYUA 3KE9A 4HV4A 1JXOA 3K5HA 1V47A 5CYGA 3L4BC 2YUTA 4UBJA 1V71A 5IKOA 2VNHA 1LPPA 2ONZA 1LLFA 2D1YA 1AS2A 1NUHA 2DQYA 2DWOA 3OU6A 1QGYA 4Q3OA 4KXLA 4N0EA 2QZPA 4DA8A 1RPJA 3E84A 2QKYA 4OHCA 4N5DA 4NAHA 3KVVA 4Q7JB 2NYRA 4QUBA 4XQ0A 4EL5A 5I7WA 5IF3A 4CMBA 3KRTA 1L5HA 4AN4A 3EOAI 2D5IA 2XOEA 3V8BA 1IFXA 3KLBA 1SHTX 1U2TA 3BHIA 4PC1A 4Q6WA 3KKNA 3GJRA 3GLHE 3JAKB 4AS2A 5JASA 4QREA 5KSWB 5DYIA 2ZIGA 1N6RA 1N5OX 1Y33E 2H31A 1UBTS 4ZQBA 1I0ZA 1ECBA 3OZUA 4A1FA 1D4OA 4BFWA 4F6CA 3Q98A 3DXXA 4IJWA 3NDRA 1Z08A 3EISA 4W9NA 1QAQA 3K2EA 4WW0A 3OOWA 5E9JA 3WSWA 4M0UA 1RC8A 1FE8A 5U9CA 1ACJA 1XOIA 4F72A 1NRJB 1BU8A 1XEXB 2PWYA 1UBEA 4IBOA 3PKJA 3H9BA 3U3MA 4JJ7A 1NVGA 2YJ6A 1IDOA 5DB4A 1RLOA 3ILSA 4GX2A 4P7KA 1IMOA 1T3LA 3HDYA 5EHQA 5L7WA 2QVYX 3H2ZA 2VDWB 3UCEA 1ZWKA 3AM5A 5CNJA 1KL7A 3DDCA 3LOPA 3UOWA 3WDLA 1R4ZA 2JIQA 4DUGD 2EKLA 5IKXA 3KWMA 2E4YA 2WT4A 1CUFA 1E8NA 2LIPA 1U0NA 1G9XA 4RA6B 2LD4A 3N2EA 2BZGA 1FUYB 2CJFA 4A2CA 4DSOA 5L4NA 3P0JA 2W83A 3MB8A 4MQ5A 2ZULA 3BSYA 4Z9BA 2ZETA 5COAA 3KOWA 2DXIA 2C8KA 3JD0A 1PWYE 1YZHA 2WM2A 1DNPA 4D4JA 2EWWA 4C03A 4P1ZA 1G20E 4J6FA 2GUWA 3SWWA 3CHYA 1KDRA 5UKDA 3D0KA 4AG3A 3W5HA 4YPFA 5T3YA 2PZAA 1S2NA 3NYIA 1E1NA 1SHJA 1F48A 2OHJA 2IP2A 4RGVA 1BDIA 2CJPA 1TZMA 3AESA 2PPVA 2ZIAA 4BMXA 3X1WA 2FEAA 2Q6KA 1JDTA 2V7TA 5B1SA 4Q9JA 2FU5C 4KLNA 5B3AA 4IDFA 1K5PA 1A8HA 2NZVG 1RRVA 1RTKA 4F7DA 2XB4A 4CM9D 1RPZA 4MSUA 3W06A 3KV1A 3BILA 1N1DA 1WZCA 3BD8A 3G2HA 3MRTA 1VKHA 2J5BA 1GWNA 1LI5A 5F51A 4HLDA 4C0WA 5I9LA 1E9AA 1QP0A 4CR7A 4UARA 1VG8A 2ZCUA 1NVTA 4RZIA 4Z5XA 4NEGA 5IKMA 1DIBA 4H7KA 4BHTA 4I1RA 4M6WA 1QG2A 1UPTA 3B7WA 3ANSA 1SGWA 3KPVA 4M46A 3I9KA 4OHVA 5K4GA 1GPMA 4DC0A 5HVNA 3A26A 5CPBA 2FEOA 1DKQA 1EDZA 1XDWA 1OWNA 2LR0A 4JR2A 2QZ4A 2HRZA 2WF6A 5LCXA 5JNRA 4M89A 4L15A 4R3NA 3HBFA 4UTZA 1HDGO 3ORQA 3VVLA 4MZDA 3GNLA 2AHOA 2H54A 2QMZA 5LFAA 4CEIB 3GLUA 1ZR2A 1FMTA 1G0OA 5G0SA 1XLWA 1LLUA 5CG1A 3G9UA 5JRDS 5KJ6A 3BCUA 2BR3A 4KGXA 4N03A 3HYSA 2FGJA 1H23A 1TRHA 3QWHA 5BNIA 1E60A 4CF7A 5D5PA 3M9XA 4TWZA 2EJWA 1RMTA 2I2DA 4PPGA 4X66B 2FEKA 3NNSA 3WYAA 2DWQA 3BAFA 3QWIA 4RPCA 2ZBPA 4PSVA 4Y0VA 3AKZA 1XDBA 4DJFC 3SR4A 4KPGA 1G21B 5BO5A 2WIBA 3IP7A 3SEZA 4PHGA 4QIHA 3WGHA 1L4YA 1ZONA 5JG7A 1C0EA 1SELA 5JHGB 3SE7A 1WCYA 2EKBA 2VAMA 5KX5A 3HDTA 1EXWA 2XCUA 2LDBA 2PX0A 4Q1CA 4YRCA 5G0TA 1BDMA 3BBPA 4GT1A 3IYLW 4IVNA 1HEIA 1YGPA 1O5OA 5JCZA 4I1OA 1CB7A 2F67A 1O57A 3UHPA 3VO8A 4TV9A 4LSWA 4B8YA 4RELA 5KTKA 4TQGA 1F8UA 3UXYA 2HLHA 4OMCA 4YJGA 1D4FA 4NSNA 3NDIA 1T6YA 3OLYA 2TRSB 2ZBUA 5AVRA 4JI4B 1ZICA 5C53B 3M5PA 2HU8A 3FFTA 4ZQFA 3T8YA 3HCFA 4N6OA 5AJXA 3WO1A 1V43A 4AZ3B 3IIIA 3STUA 1U02A 3OF5A 3MYYA 1E3WB 2BD0A 1IWBB 1E5QA 2APJA 2PZ8A 1EFUA 1K08A 2XMCA 3E3NA 4TXLA 4BTLA 2C42A 4GR5A 1AOXA 4Q19A 3IUSA 1TNDA 2M32A 3C3BA 2ACVA 4KPUA 2QX9A 4GZ6A 1QYRA 2BP7A 4ND7A 3TDNA 4DSAA 3RO7A 3D8HA 3PF8A 4FW8A 4QJ4A 3OWHA 3EPJA 2JLBA 3MIIA 3ORRA 1IVYA 4DLKA 2I1LA 1KZGB 3KS9A 3VMFA 3OQOA 3I34X 4GP7A 4ONEA 2C5SA 2Y0PA 2J9YB 4PYIA 1IAQA 1JTFA 3RQIA 1M1YA 2O20A 1YFLA 4G09A 2PFKA 1J33A 3DMTA 3ED5A 2B35A 3LXMA 4KK3A 3AM3A 4EHBA 4HAYA 3DL0A 3KVOA 3QBDA 1V8ZA 3IQGX 3JVVA 4WVLA 4E4RA 1CVLA 3KTDA 5D8DA 1KEKA 3DDUA 4D9MA 4BBZA 1R6DA 3IEIA 4RFVA 4RULA 3CONA 3R9IA 5FUVA 2ZSBA 1M2VB 2Y05A 3LPCA 1YUBA 3HVIA 1EXMA 2K5UA 3N6RA 1HY3A 2WIJA 4MWZA 2IHJA 2VT2A 1YVPA 1RAAA 4M1EA 2Z5VA 5JXHA 3KT6A 4IIFA 1S5PA 3BA6A 4LVCA 1A88A 3OUUA 2PRKA 1RXCA 2V8OA 3CW9A 5TB5A 3V9AA 3RS5A 1I2CA 3EGWA 4IFEA 5EJEA 2IPLA 4TMVA 3E8SA 4EEKA 1ZVJA 5FNZA 4YCLA 3AUTA 1EXVA 3C5CA 3F1LA 4WPGA 2YWEA 3I4FA 1AZTA 7ADHA 2EWVA 3K6SA 1N8KA 1J0AA 1E4OA 4UULA 2G9UA 2Z1NA 1OBHA 3PGMA 4GH5A 1JSXA 3SSAA 1CULC 2XEDA 3HV2A 3DEZA 2C4NA 1V6CA 1E92A 1RRMA 1P9LA 2PBFA 3B1JA 3JYOA 4NAVA 4C14A 2QD3A 1NVEA 4MQEA 1Z0FA 1DZIA 2JI6A 2VP9A 3DZDA 3ENNA 4RORA 3ZHUA 4TYPA 3H8WA 3SSMA 3BWVA 2VAPA 4K28A 2VNJA 4PSDA 4J0JA 2HQBA 5F35A 3KTFA 3ZWNA 4HB4A 1EAYA 3NM6B 2VBCA 4DT1A 1A2QA 2HEGA 4M7OA 4N12A 1N2EA 1A8SA 1U8XX 1Z5ZA 2H17A 2WP8J 4TYQA 4ND3A 3U4CA 3UJ8A 1CRLA 3AUAA 4BO3A