2IYTA

Shikimate kinase from mycobacterium tuberculosis in unliganded state, open lid (conf. a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
175
structure length
175
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 64
structure length 175
sequence length 175
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iytA00
3SJAA 4DVGA 3KUDA 4EFMA 1XTJA 4IW3B 1TMKA 3GJ0A 2FPMA 2AN9A 2ODEA 4HUTA 2RGAA 2V4ZA 1Z06A 2ZE6A 3PEWA 1S2MA 3FB4A 5DN6A 4URXR 1E98A 1N3BA 5L3RA 4HDQB 1GNRA 4US1R 1KTVA 2HCJB 5HKKA 5FI0B 3ADCA 3U61B 1OH6A 2YINC 2MSCB 1V43A 2OV2A 2A30A 4ZKEA 4OQNA 3I62A 5LDDC 1D9ZA 2PEYA 4NBSA 3LH5A 3OFNA 3R9XA 4HLUC 2C98A 3OESA 1G4AE 1GWNA 1KNQA 4ESVA 4DEYA 3EWAA 2XXAA 3BB3A 4K46A 4D81A 1OSNA 4C0BA 1T3LA 2VEDA 4MKFA 3W5IA 2WPDA 3RS0A 3SYLA 1XU4A 2VP5A 2RGCA 2ORVA 4LSGA 4XSHA 3VQTA 4R2IA 3B5JA 3QENA 4BASA 1Z8FA 3TQCA 1KDOA 2HLDD 3GJ8A 4KSBA 2UZIR 1Q1EA 2R6DA 3F0TA 1Z2CA 3R9IA 2QE7D 3KFXA 5LB4A 2FSHA 4OI1A 1E0AA 3U3JA 1OKKD 4KFSA 5LBIA 1P73A 4OQMA 5FTNA 4NYJQ 1EGAA 3AB3A 4YXWA 2GWHA 4PZYA 1VYVA 4TMXA 2RGGA 2EW1A 3X1DA 1Z83A 2QM7A 2QPAA 5G3ZA 2AHOA 2ZUBA 3D31A 3OAAA 3NXSA 4MRNA 4CZ2A 5AWFC 4BLSA 1TU3A 4DZZA 4DLTA 1P62B 3EIEA 1KZ7B 3A4MA 3K8YA 5AUOB 2C8VA 3QG1A 4BFVA 3HU2A 4DSUA 4BFXA 1ZBDA 3FFBA 4F4IA 4Q47A 2JLSA 4B2PA 1NBMD 1SGWA 2A5FA 5BN4A 3LXRA 1KMHA 3L2OB 1SVKA 4HB3A 2WZQA 1Z22A 2IYQA 2BV3A 5BQ5A 2BJWA 1YR7A 1RJ9B 2ZRGA 5FL7D 4AYXA 2IYRA 2XXAB 5JEDA 3TR5A 2BEJA 1JPNA 2WKPA 4BFSA 2BWJA 5HE8A 3GFOA 1JB1A 2VO1A 2GF0A 5FPSA 3FDIA 4IHQA 4QL3A 3SBDA 4MYCA 4KI0A 5IDVA 2QSYA 3S1AA 3T61A 5JI3E 5EE0A 1CLUA 4S35A 1R0YA 3H2YA 5KPJA 1I4TD 3UANA 2ZRNA 4P4SA 4URVR 1CRPA 4PC1A 3TSWA 5FI1B 3T06B 2PCJA 5K8TA 2W2XA 5EE5B 1DAKA 4EPVA 1Z6XA 4L8GA 4OQXA 4PQRA 3A1WA 3B1XA 4FIDA 4Z8XA 4BWYA 1E99A 1Q1QA 2CCGA 1U0HC 4ZO4A 4PPFA 4QBFA 1UAAA 4AY2A 2ODBA 1SXJD 2YJTD 4WAUA 2FSFA 3WHKA 1JAHA 1IN6A 4RZUA 4M4SA 4BZXA 3CIOA 1TX4B 4OK3A 2ZRMA 1RE0A 1NIJA 2EU8A 2JDIA 3RABA 4I81A 1HTWA 1KDTA 3WMEA 4IDPA 2BVNA 1E0SA 4BZQA 1YE8A 5KDDA 1IJEA 2F9MA 4L15A 4XD7A 1NVUQ 4DRZA 3L0OA 2QRNA 1Z07A 4CEJB 2FE4A 1G6OA 1XRJA 5C18A 3MAAC 4HSEA 3MD0A 3SI7A 3O8RA 4BZPA 1K8RA 2D2EA 1JJ7A 1ZC3A 2IS6A 1AQUA 1G8GA 1W4AA 4OYHA 4TLAA 1NMYA 2VH5R 4E03A 4V0ME 1IM2A 2JA1A 1Z0IA 1JQLB 5K8IA 2FSGA 3DVLA 2YC4C 4AK9A 3EAQA 1R7RA 3LXXA 2NO9A 3TVDA 5JRZA 2FWRA 4TLDA 2ZRLA 1QDEA 1WXQA 2XJ9A 4Q1DA 2GZDA 4P3YA 5IK2A 4TYYA 3KQHA 3R8FA 1CR0A 1BH2A 3SHWA 1OH7A 3H0KA 1VTKA 3B1VA 2W0MA 3IPYA 2ATVA 2B8WA 4HAXA 4ARZB 2WTUA 4D0GA 3KQNA 1M6NA 4KVGA 1G7SA 1GKUB 4XWOA 3CO5A 2H7VA 4ZIRA 4C7OA 1GNQA 4HLDA 4ZI2A 3C41J 2WJGA 3FKSA 2ZVPX 3SR0A 3G82C 5KOYA 4G1UC 2QPTA 1ZC4A 1OH5A 1G5RA 3CH5A 4TMWA 4EFNA 4AKIA 2XJ4A 1MO4A 4LV5B 4ZCIA 4DT1A 3TGPA 3KJIA 4MYTA 5AJZA 5EJEA 2CJWB 4RFSA 1S3SA 4YDHB 2IYSA 2DFLA 4M2LA 2ZI6A 1UKEA 4J0QA 3ZIAD 2O8BA 2P65A 4JBXA 4HLCA 3TVTA 5F2EA 1JNYA 4FMCB 1V5WA 1DARA 1WP9A 5JBQA 2OE2A 4M9QA 4A0HA 2NIPA 2O5VA 1X1SA 2WOJA 1G7CA 2PX0A 1E3MA 2NMVA 1KOFA 2WBLC 1BOFA 1A4RA 1S1CA 3MCAA 2XZOA 2N1BA 3AF3A 2WJHA 2IT1A 2A2ZA 2IK8A 3LW8A 2CNWD 1PJRA 4WZ6A 4P0TA 3RVBA 4QGFA 3MG9A 2LCFA 5TMPA 2J87A 4NHOA 2DY1A 4M1SA 4HB4A 1R5NA 5DISB 5FPHA 4URUR 1H8ED 4HAUA 3QXCA 4NKRA 4NL4H 2J41A 1XPUA 2W6IA 3N2IA 2IEZA 3CR8A 2GXAA 3P4YA 3V4FA 3ASZA 3FHCB 3HR8A 3P1JA 1OB2A 2FGKA 1EG7A 1S4QA 3I32A 3QIAA 5TB5A 3EW9A 2GBLC 1ESNA 2VF7A 2BOVA 4IXNA 3LW7A 1P2SA 2GA8A 2XSZD 2GDJA 4UNQA 3JVVA 4IDOA 4PZLA 3A6PC 2QP9X 1E94E 1OIVA 2JIZD 1W4CA 2N46A 3H1TA 5HTKA 1R6BX 3QKUA 2Z43A 1OHHD 2VP0A 3DL0A 4FMBB 1HE1C 3OHMA 4DWJA 2H17A 2Q9AA 5TXGA 3NEJA 1IY1A 1IY2A 3CZQA 2BMEA 5DYIA 4ASUD 4EPRA 2HF9A 1SKYE 1KGDA 1E2KA 1NP6A 3LQQA 4MRPA 4NYIR 1G8YA 1OV4A 3NC0C 4PR0A 3RRMA 5E4FA 4JT2A 4LRWA 3LNCA 4M1WA 3Q5DA 3NHBA 4URWR 2MSDB 1XCMA 3BD9A 4EPWA 4ZDJA 3ADBA 3VX3A 5EUQB 5EP4A 3AVOA 4ILEA 1DG1G 1G7TA 1TF5A 1N6LA 1UBGA 4CEHB 3IHLA 1UFQA 1OXVA 3FHOA 3MLEA 2ZRFA 1OT3A 3DMNA 1W0KD 5FTLA 2V55B 2G88A 5A5GA 3THYB 4DHEA 2YZ2A 2AXNA 3LBIA 1KSJA 2Q3HA 1BKDR 4I99A 4NZYA 4O2LA 5KNCA 2ZJ2A 4OHWA 1RIFA 1NSTA 1MABB 4GSYA 2OCPA 1CJUC 4MUBA 3L0PA 4MKIA 1DAEA 1VKJA 1XD2A 3EIHA 3GLIE 1GKYA 3U2QA 4XVQA 2DWOA 2HXSA 4GFDA 1DO0A 4B71A 5K8LA 2GHIA 4YDSA 4MRVA 1N6PA 3I72A 1BS1A 5CM9C 4DSNA 1T9HA 3OEEA 2J59A 1YZGA 2P3SA 3PXGA 3TSZA 4DSTA 1Z47A 2LKCA 1IN8A 3A58B 1S8FA 4IOJA 2CCJA 1SVLA 3EZFA 2AK2A 3CRMA 1G4UR 2QTVB 1H65A 3UMSA 4XVUA 2CHQA 4JKIA 4HB2A 4LPSA 3R7WB 3EX7C 5DHAA 2ZRCA 1GP2A 3MGCA 4JLKA 5CB6A 2YOFA 5LPNA 1CS4C 2HDNB 4LHVA 2WIBA 2RHMA 3HPQA 4NCKA 4MKHA 3B1WA 5P21A 3IIJA 2MMGA 4UXJA 1TU4A 4B48A 3PEUA 2IYZA 4TLCA 1QHHB 1ZNWA 1M74A 3DDCA 4AG6A 4YQFA 3GJ6A 2YKGA 4KYIB 2XB4A 4B2IA 2WM9B 3GLFE 2BHRA 3WHLA 4G5OA 4B73A 1G19A 2J7PA 2NPIA 2ZJ8A 3FTQA 2JGNA 3QXSA 4MDEA 4B76A 5DO9A 2ZRDA 1XD2B 3EPJA 1YZUA 2R6AA 1EX7A 3RS5A 4IDQA 1O87A 3VX4A 1D9XA 2G3YA 1RRFA 4Q48A 2RH5A 3FFAA 1HE8B 3QE0A 1M7GA 1NLFA 4C0QC 3I4LA 4US0R 4JL6A 2CL7X 3WP1B 3CRQA 1NVXQ 1AA9A 1KY3A 2WKQA 3FMOB 3SE0A 5GJWC 1MO6A 1QVRA 2DFTA 5EP2A 3THXB 2CHGA 1NY5A 4PXAA 3X1WA 2ZRBA 3PIRA 4KBFA 2H18A 4M1YA 3RS3A 4LJAA 1QBKC 2G9NA 2IEYA 4D6PA 3Q5EA 2C99A 1ZD8A 3JZAA 4C0SA 2E87A 2Q3MA 3FMFA 4LJ8A 3AVVA 2ZUCA 4RD1A 4B3CA 5L3VA 2O8CA 5FOUA 2GVDC 4LK2A 2RKOA 2J45A 3NG1A 2FU5C 4Q21A 3ADKA 3PCRB 4LYJA 2OSBA 2ZIAA 4GL2A 1SHKA 4E07A 1EK0A 4JL5A 1DEKA 1E9DA 2CE2X 1E9FA 4HUQA 1XTKA 4ZCMA 1ZM4A 3I5XA 4GNKA 2VHJA 3LRPA 2IS4A 3MWYW 3B2EA 4OJKA 1UBFA 2IXFA 3ZDQA 221PA 4YC7A 4Q7JB 5F98A 3IUYA 3C4JA 3KJHA 3Q8XB 5A4JA 1COWD 2DR3A 4LOAA 4CDGA 2NOAA 2PX3A 2ZJZA 4CIDA 1OXUA 4JSYA 2F3TA 3K53A 4GP6A 2XZPA 3RLFA 3BH7A 4KODA 3U4QA 1P6XA 2O8DA 2BM0A 1XFAA 5D3QA 1EWQA 3QEJA 4MQBA 3D6TB 4FMDF 2V3CC 1DAGA 4JLDA 1KI6A 1IHUA 3FWYA 3QF4A 3AUXA 4RD2A 5FUVA 5IRCD 1G9XA 1D6JA 3C5HA 4LCBA 4JLBA 4G01B 1TL7C 3I5YA 4A8JA 1T6NA 2QBYA 1P2TA 2KB0A 1VPLA 1W46A 1NN3A 4IJMA 1R0WA 4A2WA 3IQXA 3GFTA 2Q6TA 3K09C 2HV8A 2ZPTX 2ZRJA 3NIBA 2R65A 3GD7A 1IN4A 5C1BA 4M1TA 3MWKA 5EQTA 2ZYUX 3KDSE 4TMKA 2NO1A 5KDOA 4I1SA 2ZETA 1KI3A 1OFTA 1XD9A 2ATXA 1NG9A 3W3AA 1NVVR 3CF2A 3W3ZB 5L3QB 1U0JA 3VKGA 2OFWA 4HUQB 4UQOA 2VHCA 3RS4A 1NL3A 1UADA 3CNNA 3DKPA 3QBVA 3SJZA 1X8KA 3RRZA 5CITA 3KKNA 1IONA 4W5JA 4I1UA 5KUTA 2ZI7A 4YMVA 1S3GA 3CNLA 1CR1A 2J46A 5A0FA 2CK3D 4PAMA 3CRVA 4NYJR 4TTRA 1L2TA 2O8DB 3U4QB 3FHTA 4KVAA 4LHZA 4BLPA 4GZMA 4BUJA 3ZLJA 4LV8B 2Q3FA 4X8LA 2CEAA 3AVWA 2GJ8A 3WNDA 1KI6B 1HT1E 1ZD9A 2HLDA 4P4TA 2YWEA 5CYOA 1AN0A 1E2JA 3P26A 4A6XA 4EJSA 1G18A 2X2EA 1W49A 1XXHB 1M7HA 1Z2AA 4A8JB 4ZDWA 1GFIA 1KI2A 1OKKA 1W36C 2O8FB 1ZUIA 2FV8A 3GPLA 3UMFA 3X2SA 2D7CA 1NKTA 1E6CA 2ZSAA 4LYFA 4LGMA 1DPFA 3ASYA 3AGQA 5JZVA 4Q1BA 1L4UA 2JASA 1BIFA 2ZI5A 1W5SA 4PO9A 3T34A 3K0SA 1LF5A 2JJ2D 2X1VA 4Q9KA 2AWOA 1FQKA 1KO4A 5JS7A 4PHHA 3C5CA 4GZLA 2PZFA 2GVZC 3U44B 1TQ2A 2FPKA 3DZDA 1U9IA 1Q20A 4FMCF 4V02A 3WP0A 4EIWA 1NJFA 2KI5A 2C96A 1Z0JA 3CW2A 2LWIA 4FCVA 5TY0A 4CYMA 2VP2A 1NBMA 1KO5A 3UKDA 3O8DA 4NCNA 4O0MA 3QOFA 2BMJA 1Z0DA 4G5QA 1G6HA 2ZSDA 1WE2A 1UBEA 2A3RA 1YR6A 4NYMQ 5FL7A 3AF0A 4CRWB 3A4NA 1D2MA 5F3WB 1KKLA 1LV7A 3GLGE 5DHFA 3U3KA 5M04A 4PANA 2FDCA 1WQ1R 3BWDD 3ZZUA 1G291 1G7RA 2JJ1A 3QF7A 1CU1A 3AV0B 5J4KA 2WWHA 1F5NA 3BS4A 1E1QD 4RZXA 1HYQA 3M1IA 4A0RA 2HYDA 2ZE7A 1UEIA 4GT1A 4ZDIA 2ZRHA 2ZI3A 3BB4A 1WA5A 5KTYA 1LVGA 5CDFE 3EIQA 5JECA 3BFVA 2RAPA 4U5XA 1ZIPA 1G3MA 4D80A 3JVUA 2DCUA 1GRNA 1SXJA 4M53A 3EC1A 4BRUA 1E79D 2VRWA 4QGGA 3ADDA 3T15A 5HCNA 1XMSA 4DCVA 2HCBA 4CGZA 4RD6A 3BIFA 3I92A 1G8PA 1XTRA 3E1SA 2F43A 2BCGY 4Q00A 3CRRA 2OCYC 3DM9B 3W90A 1P9RA 2W6JA 1T8TA 2ZR0A 3PFIA 4C0AC 3P20A 3PV0A 1E96A 3C7KA 2CXXA 3BH0A 4IXMA 1FZQA 3QUSA 1HQYE 1VHTA 4UXHA 4OQFA 2VLIA 5D3MA 3NTUA 3E70C 2ASEA 4DB2A 2P5TB 1CR2A 4LJYA 1S96A 2H5EA 2ZRAA 4IEIA 4RJLA 4PC7A 1MH1A 4YMTA 2P6NA 4X8OA 2Z4SA 4L9WA 4A9AA 1ZMXA 3RS2A 1XF9A 4B6EA 2VHTA 3MFYA 3QPUA 4V0OA 1RFLA 1N6KA 2FFBA 2VF8A 1FQJA 1JR3A 5UKDA 3NVAA 4FXPA 4V03A 2QGNA 5SZKB 4XJXA 5DSZA 4LJ6A 4OI0A 5IHPA 3MJHA 3CX6A 5J40A 1AS3A 5BW8A 3LLMA 4FWTA 2QT0A 3BORA 3MUFA 4ABYA 3CONA 1C4OA 3C15C 2R6FA 1SXJB 2H57A 4M9ZA 4W9MC 1CTQA 1FOEB 3HWSA 4RY2A 1RVDA 2IYTA 5EZ6B 3WMFA 1RJ9A 2FF7A 4B3GA 2OBLA 1X86B 2F43B 1OJLA 121PA 2V1UA 3AH8A 5B64A 4Q1AA 3VR3A 5DGXA 4BRWA 4DDWA 3GJ5A 1RRGA 2EYQA 4TMZA 1ZM2A 1LFDB 1KJZA 3I61A 4PAQA 3PUYA 4OQLA 3ZJYA 3ZIAA 1ZW6A 5D3MB 2B6HA 3ND8A 1KI8A 1RYFA 1UM8A 1JAIA 3I73A 3JZMA 4D0LB 3MSXA 3ND9A 4Q18A 2QTHA 3HDTA 5EXSA 4D82A 1Q44A 2BBSA 4F7WA 3TUJC 2ZI9A 3NC1C 5CJ2A 2OILA 1G3IA 4HZUA 3UWKA 1A5TA 1ODFA 4LHWA 3RS7A 1L7VC 3K9GA 3ICEA 2ONJA 1NRJB 1DAHA 1OFHA 3QVVA 2RCNA 1E2LA 1HURA 2CNWA 2GCNA 1A2KC 2C5LA 4RCYA 1X1RA 1E0KA 1ETUA 1H8EA 1G3UA 4FI3C 3VR4A 1WBBA 2OT3B 2J5XA 1EFTA 3EG5A 4IOMA 4EQ6A 4CEJA 4MYUA 3B78A 2XSZA 3LAWA 2BIFA 3KFVA 1CR4A 1YRAA 2ONKA 1W2HA 2JIZA 2PCLA 4B34A 2WJIA 3UIEA 2J9RA 1VCNA 1OHHA 1XPRA 1NIPA 3AM1A 2BMFA 2QMOA 4C0KA 3GLHE 4JZKA 4O2RA 1PUJA 2B21A 3W9YA 2AL7A 4KITB 3ZS8A 4EFLA 2ZJAA 4B32A 4Y0VA 2CHVA 4D25A 5FBVB 4ASUA 1F3OA 4W7SA 3WYAA 4GOXA 4ARZA 5KSOA 2F55A 3VNVA 2ZRIA 2QMEA 4C3ZA 4B3DA 1E32A 2R62A 2X2FA 1JI0A 4B2LA 3K0CA 4QKQA 2JCSA 5C46F 4NDZA 4HZUB 2OFXA 1XD8A 5KNDA 2YV5A 2VYFA 3MMPA 4ZV4A 1YKSA 4MITA 1BYUA 4IVPA 2GF9A 1KSGA 2E9SA 2WWGA 5G41A 1FTSA 4RD0A 5FR1A 4DIEA 4DSOA 4QGAA 3SQXA 1FP7A 3GJ4A 1G5TA 5GVSA 2CJWA 5EXTA 1N0VC 5JEEA 3PEVA 1US8A 1Y3AA 2RGBA 2D06A 3ZD6A 4QNMA 5LD2B 1E2MA 4EQ6B 3W6NA 4NONA 1GSIA 4A4DA 5FTKA 4MGKR 4YMUA 3AVUA 1EFRA 3MWLA 2P6UA 3NKVA 5TV2A 1J7KA 5JLJA 1YZTA 3NWJA 2REXB 4QC2A 2IF0A 1E2EA 1TEXA 1VG9B 1Z29A 2DYKA 3LX8A 5FBRB 3TMKA 3U7GA 2ZM5A 3IIKA 3I8XA 3BB1A 3OIUA 2H16A 1GILA 4CEIB 1JEEA 5AJWA 2QAGA 4TMVA 2JLXA 4U7DA 4BFWA 2GESA 4X8MA 2FZLA 3DZ8A 2ZR9A 3LY5A 3QY0A 4Q7MB 5G53C 3M0EA 4EPTA 4V0MA 4WXPA 4DCTA 2F1RA 3L0IB 2AFIE 1LW7A 2GRJA 4DCSA 2IW3A 3AKYA 4KLNA 4M22A 1N5JA 1KJYA 1N5LA 3QXJA 3BXZA 1GRQA 1MOZA 1Z0FA 4Q19A 4NU0A 4BGDA 4XTRA 3I3SR 3VFDA 1PLKA 2OAP1 3U3RA 5LB2A 2ZSEA 3VKHA 2QG6A 1QHYA 3UMRA 5DN6D 3E2IA 1KDPA 2ORWA 3PUWA 4DCNA 4B3FX 2CLDX 2PZGA 3NEYA 3CPHA 3RC3A 4PPQA 2J3EA 2A78A 5HKKD 3DOFA 1US8B 2J0SA 3ZQJA 1Z0KA 1OYWA 3B13B 4Q4JA 3SC3A 1ZU4A 1QHNA 3K0AA 4LC0A 4AKHA 4A0GA 3B7GA 4Q1FA 1KJWA 2Q21A 4C4PA 2BM1A 3B9QA 1DOAA 1E69A 1YQTA 2OO7A 4Y0AA 1FW6A 2XGJA 2ZS8A 2ZSFA 3Q7PA 4LI0A 4JVMA 1SQ5A 2B8TA 4Q9HA 4ZDKA 3VR6A 3SNHA 2FEMA 1FNMA 4N0DA 5JMTA 4LBYA 1JPJA 2QORA 2ZYWX 1Z5ZA 2QAGB 1VCIA 3B6EA 2IWHA 3DM5A 2OLJA 4NTZA 4K81B 2JAQA 4DUGA 3BBPA 3Q72A 5KDLA 3OEHA 4ACAA 1QHSA 3UG7A 1Z63A 1GL6A 2PJRA 1LY1A 3PJRA 3KL4A 3QBTA 4CEHA 3SBEA 3SEAA 2C9CA 1CJVC 2R6CA 2ZEJA 3KB1A 1XWIA 1Z28A 3LD9A 3QXHA 2ZXUA 2IXGA 2VHUA 4DLVA 3THYA 1AKYA 4WA7A 1CJMA 1VMAA 2G0TA 1QHIA 2QNRA 4NP6A 1KSHA 1W0JD 4NH0A 5CK4A 3DMDA 4RKFA 1MABA 5GJCA 4YXWD 3CPEA 3OZXA 3RHFA 4JVNA 5FOSA 5GJBA 1OFIA 3T1QA 2QI9C 2ODWA 2GXUA 3QG5A 5FPYA 2O0JA 4EPXA 1ELOA 5DI3B 1NI3A 1IBRA 4BEBA 4Q4JB 1F60A 1HH4A 3PENA 3PG5A 1T0HB 2W2VA 2E1RA 3K0AB 3TQFA 2BC9A 1RW4A 4JL8A 1MT0A 1F6BA 2ZAOA 1NVWQ 5FH9A 2ZRPA 2R44A 3MWJA 4HAWA 1GRRA 4TZ0A 2EWWA 4JJKA 4XOIA 3R7WA 4KFTA 2WWWA 4CF7A 1P2UA 3T1OA 1H8HD 2ZE8A 2D2FA 5E7MA 4IRUB 2QMHA 3AQ4A 1D8TA 3GFPA 2IYLD 3C8UA 1K5GA 2ZYTX 5HE9A 3KTAB 2OXRA 1FFHA 4JLPA 3DO6A 2RGNA 5HZHA 1ZCBA 4QJ4A 1P75A 1QHHA 1YRBA 3CF0A 4P32A 1I4DD 2VIIA 2KBEA 2PLRA 2WWYA 5FOVA 1CJKC 3TAHA 4MGZR 2PL3A 1NLZA 1TADA 3OE7D 5HCIA 4G0NA 4OK5A 3U7HB 3CH4B 3A36A 2WIAA 1GUAA 4TYWA 3W34A 4EPYA 3V00A 5FUYA 1AJEA 1NLYA 3AUYA 3IPXA 2PLFA 3NH9A 1E0JA 1T5LA 2WWXA 2CMKA 4PC3A 1U81A 1ZINA 1XZPA 4XD7D 2NO0A 5FOTA 3DHWC 1DADA 1SVMA 3THXA 1VG1A 1DELA 2XOKD 1JXOA 4A2QA 1RRCA 4PQYA 4PSAA 1XP8A 4TWZA 3BFKA 3UWOA 1SULA 3KJGA 3EC2A 2F1IA 3THWB 1OXSC 2QM8A 1E4VA 4TYPA 2IYVA 2CK3A 3EASA 1AQYA 4US2R 4XWAA 2QP3A 1HY3A 2EQBA 2OBMA 4LUCA 2IYUA 3EPLA 1HT2E 2JLVA 4MKGA 4AIIA 1F2TB 3BC1A 4B44A 4B75A 3U6KA 5F9HA 1SKYB 3QKRA 2FSIA 4I4LA 1RZ3A 4EAQA 3LA6A 4WBSA 4BFYA 4A8JC 2PBRA 1BMFA 3CRW1 5FTJA 1IOZA 1E2DA 3KQKA 3SZRA 1F2UB 4F4CA 3ZS9A 2RGDA 5H70A 1AZSC 3IBGA 4WIAA 1R2QA 1WMSA 4D26A 1OXTA 4M9XA 4E22A 4MGYR 2OESA 1RYHA 3AF4A 1P72A 3KJEA 5CIWA 4DCUA 4DLRA 4FW9A 1JJVA 3X1XA 3PR1A 2QQEA 2XEXA 3GQBA 4TLEA 1IXRC 1CF4A 2VPPA 3VU9B 1AZTA 3HP1A 5FOXA 3NBYC 4OKSA 4C2TA 3NBZC 2ZROA 4TYQA 1TQ4A 1II8B 1N5IA 4AYWA 3GLFA 4GDFA 2QENA 3L8YA 1ZIOA 2KJQA 4WXRA 3TAUA 3KXLA 4ESHA 2UKDA 4PZZA 2JLZA 1NF3A 1TF7A 4OHXA 2BMDA 1KI4A 3GLIB 3FMIA 2ZREA 4TL9A 4A1FA 2D7DA 2DPXA 1OIXA 3QKSB 4LYAA 4S2EA 4CT4B 1OIWA 1U99A 4Q9LA 3AVTA 1OYYA 3FMPB 3Q7QA 3UG6A 5K8UA 1C9KA 1LTQA 4TTPA 2GEVA 1PZNA 5J47A 2KWIA 1B23P 2J0VA 1U98A 4EJSC 2CDNA 3QKRB 2G77B 1DG3A 1E1QA 2C77A 4MUAA 4M1OA 2IA5A 1L8QA 2J7KA 5DLQC 3CB4A 4TSFD 5AJVB 5SZHB 4RZ2A 1OFUX 3IDQA 4A6PA 3FVQA 5L3QA 2WICA 3HR7A 3AP1A 3UATA 3P27A 2HEIA 3A8TA 2BBTA 2HXYA 5KYKA 4B35A 3RANA 1E79A 2YWGA 1AIPA 2IS2A 4KAXA 4TYNA 2C9YA 3K70C 1GDDA 1U9IC 4XSGA 4EKDA 3IEVA 2A5JA 3CF6R 2IF2A 3GLFB 5FR2A 2PT7A 4QG7A 5EP1A 3ZYCA 3ZVLA 1PV4A 1GG2A 3SDZA 1OH8A 2XNSA 2AXPA 4LJ7A 4R9UC 5KPDA 1RC8A 4G3XA 4HYYA 2QA5A 4Q7LA 1A7JA 4DLYA 1N0UA 5KU1A 3ZVRA 1A2BA 4TT3D 5E7JA 1FTNA 1CP2A 1ZUHA 3QVUA 4FCTA 1I4LD 1O3YA 1XXHA 3K9LA 1T5IA 4QHSA 3LX5A 3QNUA 3IIMA 4Z54A 2O8FA 4IFBA 1OPXA 2EVWX 3IO3A 4IFEA 2EFCB 3U7FB 2GKSA 1P9NA 2NPFA 1XEWX 1SVSA 1W44A 2FOLA 1E1RD 2BEKA 2ANBA 2OAQ1 3ZZ0A 2ZTSA 2WKRA 5IF9A 2FFQA 1ZNZA 1B0UA 2GCPA 4LDJA 1S9DA 4JYCA 3U44A 1SXJC 3PUZA 2IC5A 3EZ6A 4W5WA 3V9PA 3EPKA 2FA9A 4IVRA 3WYFA 3NBFA 4NYIQ 4ITRC 2UZ3A 3TRFA 4JVLA 4L9SA 2H1LA 4XWKA 4H1UA 3SS8A 1IQPA 4XTCS 2FMXA 1Z08A 4LBWA 1XX6A 1F48A 1XJCA 3GEEA 2VA8A 4LC1A 4URZR 3D3QA 3NDPA 1U8AA 2QMUA 3CWQA 5J4YA 1R0XA 2L0XA 5G3YA 3QJYA 2HYIC 4TN1A 3WNBA 5JJIA 5CLLA 1EFUA 1XEXB 1QHXA 2X19A 5E7IA 4O3MA 1II9A 2ANCA 4LYHA 2B92A 4DXAA 4EDHA 1XTQA 1TQ6A 3VAAA 1EX6A 2QE7A 3CWZA 5GVRA 1E2HA 3W6OA 1CEEA 3KUCA 2V54A 4N0EA 2J1LA 1R8QA 4F92B 4PO1A 4DJTA 2X8AA 1SVOA 4AC9A 4OI4A 1LF0A 1NY6A 3MJRA 2ZANA 1W47A 1Z3IX 2IYYA 2Z83A 4M1MA 1VG0B 1NMXA 2ZJBA 1FPMA 3CKLA 4II7A 4P31A 4QRHA 1TQDA 1FL9A 1P3JA 3AKDA 2FGJA 5EE9A 3WYGA 1FUKA 4XIGS 4Q4AB 1G17A 3W5JA 3BE4A 3RRNA 1QVAA 4RFVA 2Z4RA 2MSEB 4UNRA 4IEEA 5JHHB 4Q9JA 1JEDA 3ZQ6A 4GMDA 1VHLA 3B85A 2FJUA 3QI2A 4E5UA 4Z1MD 4LX0A 1Z6AA 5JS8A 1UBCA 1UKYA 3TK1A 2P5SA 3FGNA 5L8VA 3BAFA 3WMGA 4KXFB 4WVFA 2O0HA 4GRAA 4MA4A 1E2PA 4KU4A 1QZXA 2R8RA 3I8SA 3REFA 1MKYA 3SFVA 2HJVA 4N3NA 1R10A 4UKDA 3RDPA 4PAOA 1G3QA 3GMTA 2Z6VA 1Q57A 2ZQ5A 1KO1A 1M34E 2C9OA 4WZAE 1ZNYA 4A2PA 4HATA 2IUTA 2WJJA 1Q3TA 3ETLA 4RKEA 4JBYA 1J8YF 521PA 2J0UB 2QQ0A 3RYTC 4YONB 5J4VA 2ZS7A 2NQ2C 1E9EA 1I2MA 3FE2A 3E5HA 4B6FA 8OHMA 1WB9A 3QPVA 2WSSD 2Y8EA 3LVQE 4TQAA 3RRYA 1G8FA 1PLLA 1SXJE 3BERA 2VHQA 4F93B 3T5DA 4B43A 1Z6TA 4M21A 3SOPA 1KK3A 1TTTA 5LD2C 1UF9A 3N2EA 2WV9A 1UDWA 5B58C 1DE0A 2GZHA 5EUMA 3TUIC 1VCOA 2K5UA 3RWMB 2QPOA 1N6OA 2PEZA 1S9HA 2OCBA 3CX8A 3QXXA 1KO8A 1S0UA 3UK6A 2AD1A 3FOZA 3KKOA 5JJLA 3VHLB 1HA3A 1T0JB 4IOLA 3EARA 4ZPXA 3Q3JB 2CLCX 2ZAMA 3FKQA 2AD5A 5J4HA 5AJXA 2W00A 1YVDA 4UJ3A 5SZIA 1IN7A 4V0NA 4OHVA 4C9BA 3KKMA 1J99A 2PZEA 4JBWA 2FEOA 2G83A 4KFRA 1U2RA 1JQJC 2PMDA 1U0LA 4V0LA 721PA 2ZU6A 1T8UA 3OF5A 1JR3E 4IVQA 5FFMA 3GCGA 3GLGB 1KHTA 3K0CC 4PPNA 1X8JA 1VIAA 2DFKB 2V7QD 4U02A 2Q9CA 1J90A 4FWIB 1SVWA 4LJ4A 3GEHA 3K9HA 3KXKA 1DS6A 1N2CE 1XCGB 2EYUA 1N6RA 2F3RA 5IT5A 2PT5A 3AF2A 4Z8YA 1W1WA 5JWOA 1Y63A 2C04A 3RSOA 1LB1B 5DI9A 5FL3A 2AX4A 3VR2A 1ZAKA 5FBQB 4IDHA 1P7CA 1MO5A 2VBCA 2YVUA 2P67A 3G5UA 2Z0MA 4BQSA 1Q12A 2IUUA 4GI7A 4Q7KA 3B1ZA 1UDXA 3CX7A 2EFGA 4MRRA 3Q85A 1P60A 4JLOA 4DLZA 4OHYA 1WDTA 3CPJB 4Q4HB 4AURA 5EXPA 2XITA 2D74A 2NO6A 2QAGC 2DWQA 1WBDA 3LVRE 1M2OB 1NVVQ 3HYTA 4PQFA 4DDUA 2V1XA 4MYHA 3RWOA 1OE0A 3O8CA 1OB5A 2R9VA 1XJ0A 3TNFA 3K0FB 1YZQA 1UKZA 3SN6A 3TR0A 2X77A 3DOEA 4HLQB 1UEJA 4JJZA 2QL6A 2GCOB 4JKYA 2DBYA 3PUXA 1JALA 3F5FA 1N25A 1VDZA 1AK2A 1CRQA 4DB4A 3SQWA 2ZRKA 3IBYA 3AVQA 3X1ZA 2O52A 3SHFA 1IJFA 2A7QA 4OI2A 5GJVC 1W0JA 2XX3A 5EE3A 4LZZA 2VSXA 3SJBA 3VMFA 2YC2C 1E9RA 2G6BA 1YR9A 2H8KA 3KX2A 4HB0A 3W6PA 1W36B 3AVYA 1R5BA 1Z0AA 3HU3A 4EUNA 1SKQA 4C0JA 5AR1A 4Q1CA 5EZ5A 4Z51A 3QSYA 4QXAA 3K70D 2EWVA 2QRZA 1QRAA 3U3OA 4CEIA 3TW8B 3LFUA 4PSVA 4KFUA 2F6RA 1R5OA 4B74A 2VP9A 1XJQA 1OW3B 5BN3A 4MDFA 3CM0A 3IO5A 2IUSA 5KHOC 1VCMA 2Z5FA 2CLSA 5GADl 3U5ZB 1OLOA 3GLHA 2BBWA 4BLOA 1ZU5A 1XTSA 1H8HA 1N6HA 3LWNA 4F4JA 4RVCA 1AGRA 2C78A 4YMWA 1GNPA 4QGHA 1E2FA 3M4YA 1QG2A 2JJ1D 2ZJOA 3O47A 1AS0A 4TZ6A 4FCWA 4PHGA 1KI1A 4ACBA 3UXMA 1S1MA 2GXQA 4CVNA 2JLYA 2C2HA 4URYR 1R4AA 5AK0A 1W0KA 2I3BA 3H84A 3TIFA 5F9FA 3SJCA 4FMDB 4Q66C 4L4UA 4R2HA 1NJGA 1ZM3A 1G20E 4D4JA 5DNYB 1XTIA 4HDOB 1M7BA 1UKVY 3NHAA 3U7EB 3OE7A 1KYIA 2IWRA 1YU9A 1XZQA 4G5GA 3N70A 2GZAA 5BYJA 1ANKA 3ZVMA 1I2DA 4DLWA 3VNUA 2NZ8A 2YOHA 4HLUA 3R9WA 2XNDD 4BEJA 1YZKA 3VTKA 2G0NA 4WW0A 1EFHA 2A5YB 1OF1A 2W6JD 4PFSA 1FP6A 621PA 2XOKA 2ZYVX 5HZKA 1XMIA 1KMHB 1U90A 4MGIR 2QTFA 2WMOB 2G1JA 2ZUDA 5CLQA 1Q3HA 1KO7A 3GLHB 4XVRA 4C30A 4BLRA 2P6RA 3AF1A 1N5KA 2GK7A 3M6AA 4H9GA 4PPGA 3DPUA 4LJ5A 3B82A 3S1AB 1ONBA 3BH6A 3F8TA 4JLJA 2YNMA 4NCIA 2XB2A 3EZ9A 1W36D 4JIMA 4BLQA 1VG8A 2RGXA 1JR3D 2P2LA 4P4SB 2RGNC 4GMXA 2F7SA 2AKYA 2UVQA 1GZSA 3QQ5A 3R20A 4N1AA 4GOKA 2HUPA 1KIMA 3BRWD 2FZ4A 4NMMA 4TMTA 1Q1BA 1EESA 5DI3A 1J2JA 4OJQA 1AM4D 2NTYC 1UJ2A 3D7MA 3ICQB 5TVKA 2OG2A 2ZITA 2R2AA 2HT6A 3HU1A 1JECA 1MRSA 2QU8A 3IKJA 4FINA 2A9KA 3J81k 1MV5A 3N5CA 4QM6A 3OFND 1XBTA 4JYBA 3I1FA 3RAPR 1P61B 1IAQA 2H92A 2GEUA 1RKBA 4GBMA 1X3SA 4ZCLA 1ZUNB 3ZD7A 1G21E 1QF9A 3PITA 4M0LA 4MH0R 2QT1A 2IL1A 5B2ZA 2Q9BA 2WPDD 2RHDA 4JT4A 5H8WA 4LHXA 3TKLA 2FG5A 3BOSA 4IDNA 5AJYA 3B9PA 1SVIA 2XZLA 1EWRA 5FUXA 4IOKA 2ODNA 3O8BA 5FPKA 3KXIA 2TMKA 4LY6A 2GJKA 5AUPB 4QM7A 4Q02A 1VYUA 3KTAA 2QZ4A 4F38A 2OXCA 3K1JA 1TPZA 4QHTA 4ZKDA 1JBKA 1T3SA 2XTZA 5FUWA 2WAYA 4KV9A 2HF8A 2V9PA 5JWHA 1G16A 4JVSB 2BBOA 2GJSA 1G3RA 4ERNA 4PHFA 2QEQA 2B7CA 2ZJ5A 1WRBA 5CK5A 3RNLA 3PVSA 3EPHA 2QROA 4PC2A 4DEXA 4LPKA 1A82A 1W48A 4JLVA 4CW7A 1IXZA 3OAAD 2C03A 3ZZTA 5KO2A 4TSFA 4G5SA 1W4RA 2B7BA 2GEDA 3IGFA 1XPOA 5HR5A 3AKCA 2IYWA 1VYTA 2JLRA 4ZIRB 4C7OB 6Q21A 2IHYA 1AKEA 4PHTA 1KI9A 5CYPA 4QJ5A 1XCPA 1IN5A 5JHGB 3AEZA 2IX3A 1FNNA 3EXAA 1KMQA 3K0EA 5FTMA 4BFZA 3THWA 1KK0A 4HZIA 4Q4LA 2O8EA 1Q0UA 2YOGA 1P4SA 1COWA 1KY2A 1DO2A 3CR7A 5EP3A 4DT1B 421PA 5J4LA 4I1OA 3TJZA 1E2QA 1QG4A 3V4RA 2C95A 4RFSB 3ECCA 5JRJA 2ERXA 1F2TA 2W0SA 3A1SA 1DTSA 3P4XA 2CE7A 3T35A 2WWFA 2O8BB 5ELXA 2JLWA 2AWNA 4TT3A 1E2GA 4POAA 2P0EA 2ZR7A 1MRNA 1YZLA 1F2UA 2ERYA 2W2TA 3P32A 4XH9B 3TE6A 5BWMA 1X6VA 2F9LA 5H68A 3G0HA 5DYGA 2FH5B 1Z6YA 3CLVA 4LBVA 2D4HA 1PUIA 4KSCA 5H1YA 1IY0A 2GAAA 2JLQA 3VR5A 1T4GA 2G1KA 3B1YA 2N42A 2JJ8A 1E1RA 1ZCAA 4MRSA 5JJKA 1QHGA 1BO6A 1TF2A 3LLUA 5TARA 4FN5A 2VTKA 3VU9A 1FX0A 2JDID 3QEOA 1SHZA 3PUVA 4RCZA 1Q1ZA 2BKEA 1II8A 1E9BA 1J70A 4AWXA 2ZS9A 5KSZA 1G8HA 3BK7A 4TQUS 2KE5A 1YHNA 2VL7A 3C16C 4HAYA 1XMVA 3SU8A 3GLIA 3W8RA 1A1VA 3BGWA 1EFRD 2DFNA 1GL7A 1U8ZA 3QKSA 1AGPA 2BKUA 2IYXA 4KJZA 4QOSA 2O8EB 5B57C 2AK3A 1HV8A 2CL0X 1KSFX 3AGPA 1G1MA 4HAVA 1MO3A 3FPAA 4D2IA 1CIPA 2VP4A 4DBLC 1C1YA 5IK2D 1GVNB 1GTVA 2OLKA 3A1VA 3U3MA 1HQCA 5E95A 1KAOA 1W5TA 3IILA 1DVRA 821PA 1II0A 2QY9A 1SZPA 2NZJA 3AP2A 4UXIA 5E3HA 4BE7B 2OHFA 5CJPA 2PJZA 3L82B 1GITA 3IEUA 3HPRA 3UPUA 1G5PA 5CM8B 1NKSA 4RD3A 3FKSD 2GJAA 2XTMA 1ESMA 4YLGA 3WBKA 4HI0E 1E9AA 1RRPA 1MR3F 1DAIA 4NYMR 2FFAA 1KNXA 1P9WA 1RPZA 2FN4A 2JJ2A 1FX0B 4R98A 1KKMA 1P2VA 3B60A 4G5RA 5C4GB 2ECKA 2GBLA 3TSOA 5TDHA 1ZD1A 2QUZA 5EE1A 2J0QA 4AD8A 4PTLA 1XEWY 2VQSA 3U6BA 1E9CA 1X8LA 2W58A 1AS2A 4D4LA 4TTQA 4QBIA 3ONWA 3GP8A 2CBZA 1ZVQA 2PMKA 1E2IA 3A1TA 4YMSA 2AFHE 3IHWA 2OEPA 3TH5A 4BFUA 4Z1MA 2GAOA 1FMJA 4PO8A 4UNNA 5CB8A 1KI7A 2WJVA 2BCJQ 5ANRB 2KSQA 3NDBB 1M1YE 4P33A 4UNPA 4Q01A 2IS1A 1DAMA 4QJ3A 3WNCA 4DUGD 4JMPA 4AYTA 4KLZA 3BJIC 3OEHD 2YHSA 3MRSA 4PX9A 4QNRA 2NO7A 1WF3A 2F1JA 4C0HA 5C4MA 5C2JB 4B33A 1XDBA 4OBEA 5FBWB 1KAGA 1Z6GA 1ZYUA 1Q22A 2W6ID 1JXMA 3C14C 4OK6A 1R8SA 1VIYA 1U8YA 5AUNB 3WXMA 1FUUA 1KZGB 4KYUA 1T3HA 3L8ZA 2GJ9A 2WOOA 3ZGXA 2ZVQX 1NN1A 5JFGA 4W5HA 2I4IA 2WSSA 4FD2A 4LV6A 5JCPA 2HT1A 4TL6A 4BLTA 3A37A 4QFMA 2Q0HA 3W8NA 2SHKA 2XTNA 1JR6A 4TL7A 3KKPA 4M9SA 2NG1A 3LBHA 1GKIA 4TLBA 3L43A 2EFEB 1GL9B 3PQCA 1XEFA 1XEXA 1TUIA 3X1YA 3LDAA 3AVXA 3EZ7A 3CZPA 4U00A 3BFXA 2A5DA 4OL0A 1N0WA 4HAZA 4JS0A 4L5BA 2FFHA 1W2GA 4V0KA 1E2NA 1G41A 2WSMA 1NN5A 3NH6A 4NE2A 2GETA 2CVFA 3EA0A 1K5DA 2GTPA 4P4UA 4B3BA 3REGA 2V6IA 3GJ3A 2A5GA 4NCHA 1XXHE 1KK1A 3T5GA 5JI2E 1P5ZB 4DC9A 2F1HA 2ORIA 2I1VB 4GOJA 2WMNB 1YR8A 5CIQA 4A92A 5KNBA 2W83A 2VSFA 3QKTA 3K9NA 4PC6A 4AKEA 1HEIA 3IQWA 3KKQA 4Q4AA 1GAJA 5JCZA 3LQRA 5FOWA 2QP4A 5G40A 2KBFA 2V7QA 4TQ9A 5JSZA 1XNJA 3VHXA 1CJTC 3Q9LA 4KCGA 3A4LA 2WJYA 2I1QA 2O0KA 3T12A 4JLMA 5FPTA 4DDTA 4H1VA 3L0SA 3TLXA 3T1TA 4O25A 2O8CB 5DH9A 4KBGA 4X8HA 4DKXA 1KK2A 3ZVNA 1K6MA 1TEVA 4HDCA 1DBSA 3WRYC 3OIWA 3RC8A 1CKEA 1PVOA 4PSKA 1TAGA 4R71A 3DKVA 1N6IA 3EZ2A 4Q5IA 4DLXA 5BN5A 1NMZA 3OEED 3VKWA 1IXSB 2V8OA 2EFHB 4JLNA 3GJ7A 4B3XA 4AI6A 2QSZA 3EA5A 4ZI3A 1GOTA 3D8BA 3KB2A 1NG1A 2OZEA 4GP7A 4I1VA 4LJ9A 1PLJA 1ZM7A 3OIYA 3WBJA 2GNOA 3TUZC 4M8NE 4D4KA 3LBNA 1LNZA 2DWPA 3SFZA 5BYKA 2J0UA 1FMLA 4F91B 3WY9A 1G64A 2HJGA 2IXEA 1ZP6A 3KQLA 3T1VA 1DAFA 4D4MA 2OBNA 2R6GA 3A1UA 4Q03A 2GILA 4QBHA 2ZU0C 4AKGA 3FYHA 2ZSBA 4DDVA 5KSPA 1XB2A 4KO8A 3QF4B 1BYIA 3DEFA 4BECA 2DHRA 1BMFD 2QN6A 2YWFA 4DLSA 4B47A 2OM2A 1LS6A 2RMKA 2JEOA 5DIFA 5JSZB 2QBYB 2ZI4A 1M8PA 4C2UA 1E4YA 4RZ3A 2OCAA 2VP6A 3CUEF 1L4YA 1TNDA 2WAXA 2J7PD 3OIVA 4QHYA 4CT5A 1VECA 1W7AA 2REOA 2YWHA 1NBME 4GPTA 1D5CA 3H86A 1J8MF 1EXMA 1HUQA 1NN0A 3GJXC 2VSOA 2RGEA 2YYZA 1E9SA 4LWZA 4RD4A 5DE3A 4K8OA 1CBUA 1XMJA 3RSLA 2QGZA 1U94A 3HYRA 5L3SA 4Q1EA 3AKEA 3VR1A 2FPLA 1Q21A 2ZE5A 4BFTA 2DB3A 4HEJA 1ZJ6A 4A15A 1LS1A 1D2NA 1CULC 4D0NA 2LKDA 3LO5A 2D3WA 4M1KA 1GM5A 4L16A 4R7ZA 2AR7A 3GLGA 3CNOA 1ZNXA 1CXZA 1EFCA 4NPHA 4JSTA 4QBGB 3LV8A 2D62A 2BJVA 3NBXX 4TL8A 4WOPA 2WHXA 2QAJA 1KDRA 5AUQA 5HPYB 4A0FA 3GEIA 2FNAA 2JATA 2V6JA 1GIAA 3H4MA 4C0LA 2EFDB 3AP3A 3SYKA 2IHBA 5CDFA 3K09A 5FBLB 3THOA 3AVPA 5EXXA 4EJSB 4UNSA 2REBA 2ZJYA 5JWRA 4LHYA 1ZM9A 4AG5A 5J5CA 4RSGA 2XAUA 2PH1A 4OHZA 2FX3A 4UJ5A 3QPWA 3SYNA 4DIDA 3B8HA 2CCKA 4JLAA 4KHZA 4BPBA 3ZH9B 3HJNA 4A82A 5BXQC 2CL6X 1YZNA 4DLUA 4A36A 4Q4HA 1D2EA 2WWIA 1YJ5A 2NGRA 3R8CA 3TW4A 1ZRHA 5SZJA 4IKEA 2XNDA 3K70B 1WCV1 4Q9IA 2WVJA 1W4BA 2RB4A 5L3SB 3U60B 2OFOA 5KSYA 3KZ1E 2BDTA 1N6NA 3TBKA 2OUKA 1TUEA 1NSFA 1T91A 4NCJA 4WZBE 3F3YA 2GXSA 2JLUA 1OXXK 1R0ZA 2GK6A 3WRXC 3K0FA 2CVHA 3EWSA 4E09A 1NNEA 2IBMA 2GCOA 4LBZA 4ON9A 3PEYA 3KQUA 5B30A 1UPTA 2MMCA 3CBQA 2AKAB
chains in the Genus database with same CATH superfamily
1UDAA 3B53X 3SJAA 4DVGA 3PYLA 1XTJA 3S8MA 3Q0EA 4UBMA 4F3TA 3H7AA 2XRFA 4JBGA 4P7BA 2FPMA 3E1GA 2P7HA 4LYDA 2PANA 1M34B 4AKSA 2ODEA 4WZAB 2ZE6A 2ZTLA 1MNAA 3ICPA 3O4JA 1P33A 4WBNF 5DN6A 1NFRA 4URXR 1OC4A 3QW2A 1HDZA 2XXJA 4POOA 2XF8A 1D03A 1G5IA 4WFIA 4HDQB 5F21A 4CV0A 4ND6A 5BQ3A 1RQNA 1Q7CA 1HDGO 1CRWG 3X2EA 4TSRA 5LA6F 2XMBA 3ADCA 3U61B 3SSOA 3UAWA 1OH6A 4ATNA 1N2CA 2YINC 1N2JA 4ALKA 2MSCB 2P4HX 3SKXA 5KVVA 4ZTUB 2I2FA 1HFKA 2CB0A 4OQNA 4V2UA 1Y98A 3OFNA 3R9XA 3G6WA 3B36A 1Z35A 1CK4A 2BT4A 4QTTB 1KS2A 3DG9A 4DJJA 4ESVA 1ZJJA 5BQOA 4K46A 2XXAA 2P9YA 1OSNA 4C0BA 3O8OB 5EQDA 3Q41A 1PNVA 3R5JA 1XU4A 5J59A 4JZYA 4OJMX 2WG0A 4YECA 3WGZA 3LBFA 3VQTA 4R2IA 1YDFA 4KWEA 4UCQA 4ZO7A 3QENA 4BASA 1O89A 4BL5A 2HA2A 3GJ8A 2UZIR 2R6DA 3R9IA 1F4LA 5LMUB 3ZI7A 3ZLVA 2R1UA 3KFXA 4IVNA 2HIAA 3WLPA 1TIPA 4BBAA 4KWIA 5JQGB 2FSHA 5KTOA 2HFJA 1U80A 1E0AA 1OKKD 5HA5A 1YQUA 4OQMA 1O9BA 1PL7A 2CY0A 3LZ6A 4O2AA 4L0MA 5IVKA 3FWZA 1EGAA 4EG8A 2OQIA 4RMNA 3VVLA 2XW6A 4YAUA 3UOWA 1PYGA 5IJWA 3O82A 3WAJA 4M0PA 2CVZA 2QM7A 3OP1A 1FRQA 2AHOA 1DJPA 3O2NA 4HNQA 5G3ZA 1I13A 4AY5A 3KAQA 3CTMA 3M89A 3OU7A 4NJMB 4HPJB 1L5FA 5AWFC 4DV1B 3T9DA 1HXHA 3CB2A 3QLEA 1P62B 1ZDMA 4B0PA 3K8YA 4KMRA 3IAM6 2VJLA 2BP7A 3EDYA 3HU2A 1ULZA 1BA2A 1ZBDA 1AUPA 4F4IA 3U16A 3ZN2A 1GN9A 1AKVA 3UBTA 2GHRA 5KHLB 3ORFA 2QZJA 2YW2A 3D1VA 3HXPA 1KXJA 1KMHA 3AUSA 1T26A 1SVKA 4HB3A 4GOLD 4JNKA 5AKYA 5CBPA 1NP3A 4F11A 2Q49A 1YR7A 1RJ9B 1CUUA 5FL7D 3RRXA 2VHWA 1V16A 5JEDA 3DVAB 4BFSA 2WKPA 1CEXA 2ZWOA 1DEOA 2C5GA 3PEEA 3UB3A 2XUOA 1JFTA 4IQ8A 1UOPA 4Z0TA 1T1JA 1UXKA 4IHQA 4K2HA 3ZDXB 3S1AA 4QGSA 5LM3A 1E89A 1Z34A 3C3WA 4CKZA 1YAHA 3DXFA 1R0YA 4Z4CA 4A27A 2ZUEA 3ESXA 2ZRNA 5IVPA 1I6KA 4HS9A 2YJ6A 4KDRA 3COJA 1CRPA 4BNFA 2PRZA 3T06B 5K8TA 4TGLA 2W2XA 3P2IA 2FOXA 3OZEA 4YGXB 4L8GA 3QUTA 1LZKA 4DJEC 4QZVA 3RRFA 3DCJA 5J9FA 5K0LA 4BWYA 4Z8XA 3LMKA 1E99A 3TZKA 4JJ6A 2UUOA 3ILHA 2P4EA 3RS8A 4ZO4A 3TZCA 1KQPA 3N3AC 2WYVA 4L22A 4AY2A 3F71A 2ODBA 4BLUA 1T6BY 3C1OA 3MCZA 4JP1A 4WDQA 4WAUA 3SKYA 3WHKA 2EV9A 4OK3A 3LCMA 1GR0A 4FHDA 2ZRMA 5SY6A 1DC4A 1RE0A 4G0XA 4GQIA 3K1YA 3A9VA 1ZUNA 2DT8A 3VZBA 4UAJA 3FCEA 4LXXA 1YA8A 4RIFA 4IDPA 1EQ2A 1P2DA 4TLMB 3VDQA 3OFVA 3W3AH 1SJ9A 4BZQA 1YE8A 4R1NA 3KZNA 2VPZA 4CM4B 1IJEA 1SEPA 1VFNA 1WD5A 2F9MA 3ABOB 4GX0A 4XD7A 5BN4B 4CEJB 2CVOA 2PH5A 3FW1A 3KJNA 2FE4A 3JQAD 4G8CA 5B3KA 2GPBA 4FP9A 3RR2A 1C30B 2R7LA 1H2WA 5FWYA 3O8RA 4JXXA 2JI8A 2HHLA 4ENWA 1J1UA 2W7TA 1E4EB 1X7XB 2D2EA 4BZPA 4DXDA 1NI4A 2G63A 3ICVA 4LCJA 1U1EA 4FOPA 3NTRA 2D1RA 1G8GA 2JD0A 3RQIA 1CV2A 2IS6A 3DO8A 4V0ME 1IM2A 4D1YA 1ZY2A 2JA1A 1RP1A 4HVCA 1E92A 1UQUA 3SQDA 2YC4C 1LVUA 3EAQA 4IIFA 4AK9A 5I7FA 1GO2A 3EFOA 4JITA 2X0NA 2L19A 2ZRLA 3K0KA 2XJ9A 2V03A 4O4LF 4P3YA 3LECA 5M7EA 1AUOA 3I42A 5CH8A 1CR0A 4RDCA 4MA5A 2OO3A 2KM1A 4B8WA 3T1HB 4R0NA 2W0MA 3DZFA 3DZJA 2P9JA 4ARZB 4B6PA 3S55A 2PS9A 1TDJA 3KQNA 2WTUA 2JHCA 4F2WA 1VJGA 3LUDA 5KVCA 1Z2OX 2XCIA 3CO5A 5CH5A 4ZIRA 5JAMA 2VATA 2LE0A 2V45A 2VP3A 3T7KA 2P30A 4KIJA 3K6KA 5IJXA 3FLMA 5C8XA 1ZC4A 1NVMB 2NZWA 2M98A 3WRWA 2FF5A 2OKCA 1WP4A 4MKRA 5K8VA 4HRVA 4K9PA 1MO4A 3FCAA 3T95A 4KI7A 3V7WA 4DCJA 3B6JA 5EJ8A 2EX0A 2HQ1A 4RFSA 1S3SA 3VR3D 2HWYA 1DCMA 2IYFA 3E8SA 3NUZA 2JI4A 4JIGA 3EOAI 3F6CA 3CV3A 4QOHA 3WJAA 2IYSA 2XRZA 5IWCA 4M2LA 2QD3A 2ZI6A 3HSYA 4RA6A 4R9VA 4E32A 5KYNA 1ML4A 3OQIB 3HBLA 3IE1A 1OA1A 3PQ3A 2O2ZA 3GRCA 4JR2A 5HQ3B 1LVHA 4HLCA 3TVTA 4N12A 5F2EA 3CVWA 3MBKA 4WI1A 1MJGA 2AKEA 3I4FA 3RE1A 3L93A 2RBEA 4GL4A 1GD1O 4JB0A 1UZLA 1NJ8A 2H2IA 2NIPA 2B37A 2X13A 3RAFC 3I5MA 2M6RA 1X1SA 4IDGA 5B6JA 4UEQA 1KOFA 2YH2A 3ER6A 2B25A 3OTQA 2MYPA 3HO6A 3VDMA 1S1CA 1WSDA 1T1IA 2XZOA 4QOIA 1I1OA 1W4LA 4UAUA 4D3DA 2EWMA 2A2ZA 2IK8A 3ITKA 1Y5MA 4BNDA 4FS8A 1BHSA 1EUCA 2X4DA 3KUUA 3QV2A 1QU2A 5TSDA 2LCFA 4Z9XA 1Z4QA 2C4HA 5FPHA 3SP1A 3AJAA 3ZV4A 5LJLA 1LW6E 3WL8A 1IPHA 3CEMA 2WHPA 3E0XA 1YCDA 4MHSA 3AR7A 4UOQA 3T5CA 3ASZA 3FHCB 3B7WA 1UAYA 5DB4A 3KOMA 3QIAA 2R8BA 3G0IA 1ESNA 2GBLC 2VF7A 3PQ6A 1EXNA 3D4LA 3HBNA 4K6HA 4FONA 5L4NA 3HVHA 4I9HA 4PYJA 5ALGA 2GDJA 3R3HA 3ZOZA 2BFNA 2JCVA 2QYHA 1BKSB 4QUHA 1W4CA 1YRYE 2OENG 5HTKA 5TJHA 1R6BX 3GCZA 5I9BA 4F3NA 4ENUA 2BKLA 2Z43A 5DGHA 1SUDA 1L4KA 2QTAA 3J7AC 4WMLA 1G66A 4RA9B 1X87A 3Q8KA 3OZFA 4OEHA 3U4DA 1UXOA 2H17A 5TXGA 1VHQA 2WIKA 4RVNA 3DW3X 3OWHA 4YP0A 5TS3A 2GPWA 1I3CA 2PSSA 3A6EA 2IUEA 5B1HA 4BV2A 3ON5A 4ZC8A 3T7JA 3NS7A 4MEBA 1Z3CA 1EVIA 3EVZA 4MQ5A 3DGEC 1KGDA 2QTVA 1NP6A 4MX8A 4IV5A 5EVCA 1G8YA 1OV4A 4BTVA 1S2GA 4ZAFA 1FNSA 2VC2B 3VU1A 1H1TA 3QELB 3AERA 4U0KA 3GROA 3LNCA 4OUDA 1FUEA 2E4VA 4URWR 4E5PA 1NNI1 4E2YA 1J1IA 2BGRA 4O59O 5DW3A 1P0PA 3BD9A 3OJFA 4RDHA 2IHUA 2VJMA 4JJGA 3VX3A 3ADBA 5EP4A 4ILEA 2Q5QA 3HBJA 1TF5A 5KU7A 4DA4A 4QJBA 3O95A 5D85A 3EGXB 5EAIA 3IHLA 4QG3A 1W2WB 3MLEA 1OXVA 3D43A 5ADHA 2ZRFA 4YQEA 2QMYA 3DMNA 3T5TA 3ZWPA 3DKRA 4OYRA 1RXUA 3N2ZB 1DAPA 4H77A 3LBIA 4O2LA 1V41E 1RM4A 4GZ6A 4GPEA 4U6QA 4IUBS 3QVGA 1DIBA 1IEXA 3WE7A 4JI0B 1FSPA 1ZQ9A 5GV7A 1QMPA 4RLQA 2F4VB 1T9CA 2E5WA 2XLBA 2XDYA 2CHEA 3QE4A 2VTVA 4MVJA 3M83A 4PZDA 2DECA 3WKEA 1MC1A 4C88A 5C1OA 4KRFA 1T3ZA 2L18A 2YFYA 5B1IA 4Z4FA 3P9SA 1EEXB 4D9EA 5K8LA 4YDSA 4MRVA 4DV2B 1N6PA 2QRUA 3VKUA 4ESEA 4GZ5A 1QVVA 2W2QA 4QWWA 4DSNA 1OGJA 1H5NA 3OEEA 2ZVDA 2HA4A 2P2NA 3TSZA 2P3SA 3UAYA 1EWYA 3PUHA 1IN8A 1E1NA 1SD2A 2Q3DA 3ADOA 4KUEA 4EAAA 2FR0A 3Q9UA 4MYRA 3FCOA 1JHVA 3EZFA 3WLSA 2AK2A 1E77A 3EXFB 3NBKA 1LK7A 3UMSA 4MAFA 3TTXA 1O96A 2VJYA 5DBOA 4XVUA 4ND7A 1VMKA 4JKIA 5EWJB 3GHYA 4I50B 5TC4A 4HH3C 2ZRCA 3I23A 2YOFA 1R5JA 3C3XA 3F90A 1CS4C 2QT9A 3JWEA 4NBNA 2WIBA 2WUWE 1CUHA 3EHEA 5H02A 1SC6A 1LXCA 4DLKA 4Y0NA 1YZFA 1TUBA 3G2LA 3IIJA 5D1HA 2JK1A 1WUJS 4KUGA 2IZ1A 1C8KA 1Q1AA 1QLWA 1ZGCA 3PFHA 2XOEA 2CNNA 3AI2A 3PDCA 3C3EA 1QHHB 4AG6A 4TTTS 4RY9A 1JWLA 4KYIB 2XB4A 2WM9B 1ZVKA 2ZDQA 3ZBUA 1B6RA 3FPBA 1FA9A 4DUZB 3QXSA 2JGNA 4LZNA 1XD2B 2C4UA 4C7BA 5FDFA 2C3PA 3EF0A 3H19A 5FWXB 1Z2PX 1JFSA 1QU3A 3LKDA 2PKRA 5ES3A 1T1GA 4GGMX 3UUWA 2PT9A 3RJMA 1UMDB 1D9XA 2QNIA 2MWMA 3KCQA 2WSLA 1JQ5A 2RH5A 2PG3A 3QE0A 4TWJA 4US0R 4HNUA 2HGSA 4S1TA 2WNIA 3WP1B 4FUQA 5JQGF 4AXXA 2EERA 3CRQA 3PNSA 1AA9A 1MDFA 2CSUA 2WKQA 3SE0A 2OXEA 4AJ4A 4MWGA 5EP2A 1KR2A 2ZRBA 4UNIA 4LRXA 3ZU6A 1BOOA 4HGYA 4M1YA 4HEQA 2PUFA 1QJ4A 1QBKC 3GHHA 5I7RA 3PGMA 1WZIA 2ZW9A 2Y99A 3GW8A 2IEYA 1F12A 1RRMA 5AXBA 1GDTA 1U6KA 2H1CA 1NW7A 4K6FA 2C99A 1ZD8A 3N6RA 4Y9RA 1U7DA 1ZNQO 5TEVA 3Q3VA 1Q7RA 5CLJA 1QRTA 4RD1A 5DGIA 3RF6A 2I6XA 5FOUA 2O8CA 2Y0DA 4RPHA 4XAQA 3CEPB 4NESA 2VHZA 2O3RA 2P2DA 2RKOA 3EH2A 5GAJA 1INLA 2V3WA 4RKWA 1C7FA 4X0EA 1NUHA 1RBZA 5DBGA 3RD5A 2PKQP 3PCRB 4KIGA 2MJLA 4JDUA 4M98A 5BSRA 4UFOA 2IJGX 2XUGA 1THZA 4E07A 4GPBA 3EGDA 4GHWA 5AD1A 3IQFA 1XTKA 2IOQA 3GVIA 5EWMB 3LPDA 3N75A 4NMWA 2LXNA 2AI3A 4XGKA 4Y2VA 5AESA 4QREA 5BO5A 4EVSA 1N5RA 4L8LA 2IXFA 1GCOA 1LKZA 2VRCD 1RWXA 1ZK1A 4IF6A 5ARDA 3VA7A 2ZUFA 5F98A 4RV4A 2IPXA 2GPTA 4IIJB 4TRJA 3UUFA 1COWD 3AXSA 3OCXA 2ACKA 4CIDA 3M2TA 1QHFA 4AN4A 3I2JA 2PWYA 3K53A 3P7MA 4ZOAA 1DO8A 1RI4A 3EIFA 5IC6A 3RLFA 1AO3A 3WSWA 2Y27A 1R6UA 3GNTA 4IV8A 5D3QA 4CR6A 2O8DA 1EWQA 3I6IA 4MQBA 1IHXA 3D6TB 3NPMA 3QTBA 1J9GA 3O90A 2GTHA 4W7IA 3O7MA 5EIAA 2C29D 2FUG6 3AUXA 4C3VA 1DLJA 4ZOLB 2ISCA 3MTQA 2BISA 5IRCD 1GPLA 1I80A 3FFTA 3C5HA 1HKHA 3OEWA 3PD7A 4NEHB 13PKA 1TL7C 2HEGA 2YV2A 3ANLA 3FPFA 1RLOA 4HX9A 4FEGA 1T6NA 2O2CA 3DAOA 2QBYA 4DIFA 2DP4E 4HD8A 3T8YA 1W46A 3NJ8A 3UH0A 2DXIA 1JHXA 3IQXA 2QF7A 1TC1A 2ETXA 2NVOA 3GFTA 1VXRA 1NGSA 1YVUA 2ZRJA 3FR7A 3TLEA 3JQBC 1BW9A 3WJ7A 4CCYB 1CD5A 2ORED 2WB2A 5C1BA 1IATA 2OO5C 1PDWA 4I4TB 3HCEA 3VPGA 5EA2A 4KQMA 5BW5A 4TMKA 3VO2A 3G13A 4I1SA 2ZETA 4EYGA 5KDOA 1XD9A 2VBGA 2JGLA 3IB3A 2GZ2A 3IDSA 3CF2A 3N8GA 3ZY3A 4XQGA 3GX1A 1DKUA 1FNBA 2BE9A 3FHLA 3QU7A 1KYVA 2VHCA 4HUQB 4UQOA 2DPLA 3UMCA 3PHGA 4INOA 4OFZA 3H9CA 2ID9A 1D6MA 2YXBA 3OJEA 1UADA 3CNNA 3DKPA 4NPAA 5CPFA 1HDOA 4G4JA 5CITA 2Q7OE 4S1PA 3LRTA 2LRHA 1XZFA 2H1HA 2Q8QA 1J42A 2IGBA 3GZTB 4AP9A 5KUTA 3CVYA 3KBBA 5LWQA 1N2XA 4ZCQA 5KAPA 2WD7B 1HLGA 4CM3A 4A3SA 4YCNA 2J46A 3USES 2ZIFA 5HYVA 3F9RA 2CK3D 3ORHA 4PAMA 3CRVA 1PDVA 4FT4A 3VR6H 3C43A 3I0ZA 1L1QA 1L5WA 1EBFA 3H3FA 1QRRA 1SO8A 3L5KA 4MDYA 1M75A 2RI1A 4BLPA 3ZLJA 2W6MA 4X8LA 4MMYB 4ZU3A 2GJ8A 1KI6B 3KZOA 3NC4A 3ED1A 4BO2A 2YWEA 3RU2A 1VMEA 1G18A 3TD6A 3NONA 3UC5A 3UCFA 1M7HA 3I58A 3C6QA 3AR9A 1VJTA 3ZJTA 5I01A 1KQ3A 1FS4A 1ZUIA 2HRQA 1NMQA 3UMFA 1NYQA 2XUDA 3KV3O 1YR1A 4HRYA 4LYFA 4LOIA 1DPFA 3VNBA 5JAZA 1RIIA 3AGQA 5IAOA 1O6FA 4ZQHA 1L4UA 2JASA 3UJBA 2XVZA 4PN7A 1R16A 3GOHA 4D8TA 3K0SA 3O38A 2X1VA 3OP4A 3JD4A 3P9CA 3PGKA 3QYFA 1H5QA 3IA2A 3BWBA 1KO4A 2PNJA 2PH3A 2CUNA 2W2MA 4PHHA 4QGBA 4D4IA 5IXSA 2NP7A 5T6BA 3U44B 5JASA 3JWPA 3JAKB 4B3JA 1F06A 3R0IA 2C96A 1V3QE 3BMCA 4YV2A 3K15A 4DYVA 1GUBA 3BRCA 4Y9SA 1LH0A 5ECYA 5A03A 5C80A 1DEXA 4O4JA 4NCNA 1KVQA 3ZR4B 4G5QA 2ZSDA 4S2UA 1WE2A 1PEAA 4NYMQ 3MWDA 2WF7A 5IAJA 3ZD8A 3M1LA 1KEZA 3GRZA 4CPDA 5IXYA 3PUKA 1C50A 2HAEA 4C4OA 2G5GX 3U17A 2ZSUA 4TS4A 1LV7A 2P11A 3THWA 4JI4B 2FDCA 4JB8A 1Q0LA 2A33A 5SYAA 1JGTA 2R1ZA 3S2IA 1EVEA 1PL0A 2WWHA 2ZATA 1BE8A 3WYDA 3ZE2B 1Z15A 1RHUA 2F9FA 3BS4A 3KQTA 2H1FA 1UMCA 4AY4A 1C2YA 4GT1A 1OVGA 3DLAA 2X7HA 4ZDIA 1I5OA 1C1DA 3PVCA 4IDAA 4RE6A 2ZI3A 1QK4A 1WA5A 4Q4CA 1SM4A 2XGOA 1LVGA 1KL7A 1L5KA 4OV6B 4K6KA 4N03A 1AUXA 3RSZA 4BNMA 4NENA 2AOTA 2GNAA 3MJFA 1G3MA 3NJ4A 3TI9A 4Z2AA 1LSJA 2DCUA 4G8BA 2VUSA 1U7PA 2IHKA 3EC1A 2IE8A 3ELYA 3RCBA 4BRUA 5CA0B 2VDRB 4JUIA 3ADDA 1M0SA 2YYSA 1BCSB 2PMCA 1Z5OA 3HA3A 5JFTA 3R6WA 5FX2A 1ICEA 2XKBA 3GFVA 2B1RA 1DRVA 3E1SA 1BGXT 1R66A 2WMYA 4O1MA 5LSAA 4P0PB 1QP8A 4DGSA 2DPGA 5DHUA 1PD1A 3HKEB 4WD3A 4U2BA 1ABEA 4ZVRA 3DM9B 3W90A 1Y3CE 1RBMA 2FP3A 3PFIA 5LYJB 2IU3A 1JWAB 1LNQA 1WQ4A 1ZJ5A 1HQYE 1W88B 4UBJA 3NV7A 1I7SB 4J03A 3ZHYA 3OA0A 3DZKA 4DB2A 2WSIA 1Z6PA 2WF9A 3ZXXA 4LJYA 1S96A 2D1FA 3BD6A 4IEIA 4E4TA 3VSDA 2QD4A 3D8RA 5F1OA 2B78A 4B9EA 4YMTA 4X8OA 2AOWA 2VZEA 1DC7A 1EAMA 4L9WA 1ZMXA 2WFAA 3OZBA 1XF9A 1DTWA 2VHTA 4RF5A 5EINA 1HDRA 1X1TA 4JP8A 3DBLB 3ENZA 3IBSA 1XAJA 1F8YA 4FFSA 2WT8A 2B5VA 3GJSA 3JZIA 4GYKA 1CQIB 1N6KA 3WB1A 1R3DA 3AR3A 1B6TA 4EVQA 3OT5A 2ETVA 3EIUA 4X1KA 3BL5A 1MCZA 1O9GA 2CD9A 3G7SA 5F64A 3RUHA 4IZ6A 5DSZA 4QPZA 2GYWA 3MBIA 2E6UX 5IHPA 4ND1A 5J40A 1AS3A 4L72A 3PPWA 2QT0A 1D4AA 2FAXA 3W2GA 2VUUA 1L8LA 1T1SA 3BKWA 3CGWA 3VTAA 2KMLA 1Y9EA 3KCNA 2X0IA 3GEPA 3KB8A 2R6FA 3UH1A 4EO4A 4EBFA 1ODJA 2POQX 3R8XA 1FOEB 3GCXA 3Q2KA 2HKIA 4RY2A 4G9BA 4GVPA 2D5LA 1MUUA 3QE3A 3BXGA 2OBLA 2F43B 1XDGA 4EMUA 2NADA 1KZ1A 5ALOA 3ZV6A 4OMFG 3AH8A 1JF8A 4Q1AA 1VL6A 5LOVA 4CUKA 2DLNA 2NLOA 3AFNA 5BNFA 5FFFA 2OCXA 5T64A 4UTXA 3UV7A 1EVJA 3EEOA 3I61A 5JQWA 1AUQA 4I50F 2HDWA 1JT9A 4OQLA 5D3MB 1CUWA 1EDDA 1MF7A 2B6HA 2AMLA 2G07A 3GGSA 3ND8A 4L4SA 5JMPA 3UUGA 5L6MB 3PL5A 5E6SA 1RYFA 3TX6A 4EARA 1UM8A 4OHFA 1JAIA 1JDNA 1JUDA 1WY5A 1JDVA 1SH7A 1YHYA 1VZ3A 3ELDA 1G5HA 3JZMA 3KD2A 5HQJA 1F4PA 2WT9A 3MSXA 1HMYA 1Z6QA 4XUEA 3K1AA 4WQMA 1MHPA 3ZW7A 4OYLA 4RGYA 1JU9A 2AJLI 3L8CA 3HDTA 4F7WA 3UEOA 1GQYA 1SHJA 4WZBB 2VZ8A 3TUJC 4ZRDA 4JI7B 3VAZA 3WQBA 2R87A 2ADMA 1X74A 2OILA 3LUAA 3QUBA 1ODFA 3NKLA 4YP1A 3R0XA 4J4TA 3RS7A 5C5EA 1SA0A 2ONJA 4M37A 1QP7A 3ICEA 1ZGBA 3D02A 3IT1A 3KP1A 3NAMA 4EZIA 3WWDA 1CX9B 1J49A 1E2LA 1F0YA 1HURA 1T0IA 1YS7A 5ILQA 1OAOA 3Q4GA 1XQVA 4DREA 1E3EA 2ZUVA 3B70A 3FDJA 4JOBA 4RCYA 3WO1A 3V4ZA 1ODTC 2WU4A 3VOSA 3VR4A 3W1EA 5KYUA 3B5EA 4HFRA 1WBBA 1Z2EA 1SCNE 4U7FA 4U63A 4YRSA 4HNSA 3WAKA 5EFZA 5KTNA 4NS1A 4YAEA 2YWJA 3DLIA 4G4SO 4AJEA 1EUQA 6LDHA 1JSZA 2IOYA 2J33A 5ITZA 4YRTA 1F7UA 4HDMA 2QTBA 3NAQA 1A1SA 1J00A 1TCBA 2FG6C 1GTJ1 1NF2A 3EISA 5BSHA 2PRSA 4TV9B 1D1PA 1PJQA 3AT1A 4QXPA 3SYMA 2ONKA 3M34A 3RYHB 1IOWA 1I3NA 1FMCA 3RJZA 1XPRA 1OHHA 3TTTA 3BGVA 3AM1A 3QLUA 1TYAE 2FPPA 4HPWA 2Y77A 1XQXA 2MINB 3ASUA 3O94A 4K8RB 4O2RA 5BSTA 3W9YA 5B1SA 3FDFA 1KRXA 3FGZA 1XPJA 4IYJA 4RQAA 2ASVA 4Y0VA 4M54A 4PIVA 4D25A 2WU8A 2GHTA 3WYAA 2F55A 4GOXA 3EZGA 4MJXA 4FWBA 1UJ6A 2QMEA 3PNBA 4OB6A 5IMBA 1C7RA 2ZJ3A 1E32A 1EVYA 2F8SA 2POCA 3K5IA 2ZBDA 3VH2A 4UZFA 2XAAA 2AIRA 4RSMA 3DF7A 9ATCA 1PS0A 1TT5A 1XD8A 2C5EA 2QI9F 3A2NA 4QU8A 1GCIA 5KNDA 2YV5A 3O5AA 2GDZA 4ZV4A 3H8JA 4B0OA 4XZ3A 1M0EA 2X6QA 2R8EA 2VSQA 4IVPA 1THGA 2B2NA 1KSGA 4DMHA 1FTSA 1JEQB 3IT0A 3PB3A 4YQZA 2EX4A 2NAFA 5FR1A 1STOA 5BV2P 1HT0A 1K0UA 1O77A 1WXEA 4QGAA 2GD0A 3HP4A 2XKJE 1BN6A 2CJWA 1ECJA 3QE2A 4GQBA 4XFJA 1T13A 5GVSA 2PUAA 3RHZA 1HEUA 1US8A 1L1FA 3UMBA 1X9IA 4R8LA 3WV5A 1E2MA 4IJQA 2VDLB 4IIJF 3W6NA 1VLVA 1KF0A 1RRKA 3LLSA 3AVUA 1QVZA 3MWLA 4TT8A 3B1JA 1J7KA 3DDHA 3SXPA 1JN0A 3NWJA 5GV8A 2REXB 3CJTA 2IF0A 1A8UA 1ACLA 1E2EA 1VG9B 2DYKA 3C1AA 2WILA 1DV1A 1RZUA 5FBRB 2ZQYA 4RLHA 2ZWPA 3IIKA 3I8XA 4IY1A 4Q6WA 5TLSA 4OP3A 2HRCA 4WKOA 1QP4A 2OHIA 5K05A 4MQFB 1FRNA 1W59A 1FSZA 5DKFA 4K87A 1IEVA 1ZR2A 3G5TA 1QKJA 2IHNA 4FSXA 2PGIA 3RLIA 1PHRA 4Q7MB 2QTRA 5TEWA 3M0EA 2OYSA 1GT91 1P17A 4FX5A 1QRSA 4HNVA 4Y9TA 3L0IB 2MSLA 1WKCA 2O5CA 4I6EA 2FYTA 3W6ZA 1KU0A 5GY7A 1LW7A 1QGZA 1NDHA 2GYYA 2WQZA 3AKYA 3P5BA 4FR2A 4I4TF 4A5OA 3CCFA 5B7PA 1XHLA 2C92A 2PXAA 2WHEA 1EH5A 3PQ2A 1KJYA 3OCZA 1GRQA 1Z0FA 4PSUA 1V11A 1XTVA 5TPZD 3C3AA 4TWBA 1RS0A 2UYYA 1D2RA 2X0KA 3I3SR 3GBVA 3VFDA 1O7JA 4D9BA 1Y8RB 2E6KA 4DA8A 3VKHA 3OHPA 1PT7A 1IN1A 1EQAA 4UTNA 3E2IA 3H6GA 1UOEA 1NYTA 1WZUA 4BAZA 1B00A 2JBHA 3VUFA 3NEYA 2V8BA 1E3WA 4NHEA 4X71A 5AH0A 1BX1A 3NX4A 3H5AA 4Z0HO 3RC3A 2A78A 3RSGA 4CN8A 4P2GA 3KUXA 1A96A 3CE6A 1P91A 2V65A 1VP3A 4DMKA 4KIWA 4PONA 1QCYA 4AKHA 4LC0A 3L7MA 4DR5B 3D7LA 2Q21A 2XYQA 3V7YA 1GUFA 4R2WA 5JISA 4H15A 2BM1A 3H4VA 1E69A 1B0AA 3MMXA 4UEOA 2VZLA 2GM3A 3D3WB 4BJ3A 1K7YA 4CV2A 1J07A 1SQ5A 3BMXA 4JVMA 2P1RA 1MJGM 3SNHA 4P6VF 2A0FA 4N0DA 4DJDC 1O95C 2O4CA 3K32A 5JMTA 4BMNA 2QPLA 3HZHA 1QPZA 2QAGB 4G0QA 3DM5A 3D8TA 5C5DA 4IF4A 3UK1A 3K72B 3KEFA 1UWKA 1DRWA 4LJLA 2WD8A 3Q72A 5KDLA 4G6ZA 3TTYA 4C89A 4G37A 3UG7A 2AHRA 1E1CB 3BXEA 3DKKA 3A4YA 3F6YA 3O8LA 4FR5A 4XGRA 1XRSB 5GOZA 4RHTA 2OYCA 1V8FA 3KSUA 1NX9A 3I52A 3SBEA 3SEAA 3H9JA 2EBUA 3DMTC 1PR2A 3TI7A 3DFIA 3LD9A 1E5XA 3HXLA 3QXHA 5H9VA 3WLFA 1Y81A 3QSGA 1CJMA 3G9QA 4KPYA 1R0SA 1V48A 3N74A 5DCUA 5E1MA 2E5FA 3MWFA 1A9TA 1TLTA 1LPBB 4F97A 1MABA 4YXWD 3IQHX 4ZQCB 2UYHA 5DEOA 2QVGA 5LZ5A 1C8LA 3RHFA 3I9NA 1P4JA 4JVNA 5FOSA 5GJBA 2Q4RA 1OFIA 3T1QA 4G25A 3DWFA 3QG5A 3I1IA 3UMVA 3GT3A 4P7JA 5KYTA 2IPOA 5DI3B 4CG2A 2F8TA 1EBBA 4BEBA 3L7KA 1F60A 1HH4A 1ML3A 3D5EA 3PENA 4AVYA 2A92A 2W2VA 3EW7A 3ZZNA 4YY3B 2A9JA 4R68A 3B51X 4BCBA 3HGQA 4JL8A 4RK1A 3OCUA 1F6DA 2ZAOA 3UT6A 1NVWQ 3DAYA 2W6NA 3K9CA 4FJ1A 4EJ6A 1GGHA 3SF8B 5DGTA 4QNNA 4GO1A 3OURA 5K0BA 2QUHA 2EWWA 4JJKA 3HCPA 4UBKA 2X5NA 4LVNA 4MI9A 5D7BA 4MB2A 3T3OA 3DYVA 2X1MA 5T4FA 4D46A 4CF7A 4AF7A 2HB6A 1GA6A 1VLJA 3OJLA 4DAEA 2EZ4A 2J5KA 3AQ4A 4D6YA 1URPA 1UAGA 4FDVA 1KJ9A 3GFPA 3JVDA 5BSWA 1YQXA 2IU6A 3L7NA 2XYHA 3FI0A 3HEBA 2IYLD 5IUKC 4BP1A 4YTEA 2Z95A 3LX4A 2C8KA 1FFHA 2D4AA 4NBRA 3TAXA 4LECA 3VGJA 5CA0F 5HKAA 5HUQA 5IJ9A 2EZ8A 2Q5EA 1Y9JA 1ZCBA 1EA5A 2YBEA 3CF0A 1CY0A 3V4OA 4BY9E 4KR7A 5CNJA 3R7LA 2BM8A 5EXDA 3HVRA 2KBEA 4C78A 3SSMA 2GLTA 5BQFA 2HSGA 2VJCA 1AQ6A 4LF7B 3HI4A 3TAHA 4MGZR 2PL3A 3K9QO 1JS1X 2J0EA 3AU8A 4NFYA 4ZTBA 5HCIA 3UJDA 4U2EA 1TQHA 4G0NA 3V1NA 4GRDA 4OK5A 3VH4A 4UU0A 3WGJA 3CH4B 5LYJF 3HCWA 3SWWA 3WDMA 2WIAA 4PTZA 4BYMA 3W34A 1J2UA 1J0AA 5IMSA 4UBOA 1C4XA 4R7GA 4NZPA 4RTRA 4IJVA 3QEBZ 2D3TA 2OK7A 1T5LA 3AWDA 4L5CA 2KYRA 2HK6A 5ESRA 3MJSA 5HRAA 5JALA 2H7XA 3M4XA 2G8NA 1ZIXA 3HKDA 4D8VA 2AOXA 3E23A 4FBGA 3S8YA 4HGNA 3JCZA 1Q83A 4ZZ0A 1L5MA 1Z9BA 2QRMA 3MJCA 3UWOA 5HIKA 1NXSA 2ZP1A 3EC2A 1X1QA 3F3KA 2O5RA 5IH7A 5EL0A 1SQ0A 2I1WA 1QIFA 3K8ZA 3JQ9C 3BE8A 3Q7RA 3TD9A 2EXXA 3VC7A 1G5FA 2AVNA 2IYAA 3D2CA 4XWAA 4BNYA 1WABA 1HY3A 1U1IA 4ISCA 4AZWA 4MP6A 1XAIA 3DGFC 2RSLA 4RELA 3HCBA 4GLBA 4XA8A 4B75A 5F9HA 4W1RA 2M6SA 3BN3A 4WA8A 2GM4A 3T3PB 4YT5A 1R8XA 3LA6A 3NI2A 5DSTA 4EAQA 5EUBA 4BFYA 4EJ0A 4YP5A 4A8JC 3E8MA 1BMFA 1Q1NA 3CRW1 5DK4A 2ONCA 3EK2A 1EP9A 3PUIA 4GVLA 3ZS9A 4D74A 1SUPA 3E7FA 1REQB 4R01A 3V8QA 3KPUA 4E22A 4DCUA 3KJEA 1WO8A 3UXYA 4ZAZA 5A3JA 5BYBA 2QQEA 2XEXA 3AY6A 3OUZA 1J97A 3STVA 3IP7A 2CL5A 3OSUA 4LEIA 2VKTA 3FX2A 4IGEA 1ZJ4A 1ZI8A 3T7CA 4REQB 4CIYA 2VPPA 3WYCA 5E4YA 4BFLA 3NBYC 2W2KA 4OKSA 4C2TA 3VC1A 3NBZC 3BIJA 1PWEA 3H4IA 3T5AA 3EWNA 2DUNA 3FFWA 3JQ7B 3KYDB 3GLFA 3FSGD 2XUZA 4IUYA 1YL5A 2KJQA 1XI2A 3DR3A 4QEDA 1CHNA 2WTMA 3TDMA 2JLZA 4HHEA 1C9EA 1H23A 1NF3A 4M88A 4TWIA 2VTDA 1F7VA 5J3JA 2R7KA 3FMIA 2ZREA 1WJGA 4A1FA 2H63A 2DGDA 3IKMB 1JG4A 1Z4JA 2D7DA 4G09A 3N05A 3BJEA 4C08A 1N1EA 1OIWA 1U99A 2PO7A 2BMAA 2DE0X 2Q3CA 2YV3A 4RTKA 3FMPB 1RAIA 1JHMA 1GTL1 4GLFA 4XM1A 3UG6A 5K8UA 4UMDA 2XGMA 2GEVA 4TTPA 4EG5A 1EM8A 1IMJA 4OQEA 5J47A 1ZLYA 2X4LA 1SUBA 2HRDA 4EITA 1FDOA 1TAUA 3NDIA 2J0VA 1U98A 2MSWA 2C7QA 3QKRB 2G77B 1XN1A 1KHHA 1E1QA 1Z5VA 2B1QA 2C77A 1CY2A 2HJSA 1CE8B 5KJEA 1L8QA 2R84A 2IGTA 4FDMA 5JXHA 3LDFA 5CLHA 5DXAA 4ZPJA 1YJBA 3HJFA 1WY7A 4UD2A 4FDTA 2ZTMA 4DILA 3IDQA 3QYAA 1V6AA 4QYIA 1RWPA 3OMXA 4A6PA 4AULA 3FVQA 4CLEA 4E0BA 5FAKA 5E1DA 4YQYA 3MCVA 5KYKA 1JKJB 3RAEC 3UHPA 4DMRA 2NNLD 3E9MA 2YWGA 2IS2A 3JQCA 4KAXA 3TZLA 2IP4A 4BE9A 5IP5A 4TYNA 2ZDGA 2Q4TA 2WWRA 5D3KA 4YBRA 5TMEA 3K70C 3GH1A 4F85A 3MTIA 4MW1A 2CDCA 2BFBB 2UXCB 3KKEA 2XYRA 3F3SA 1U28A 1RM0A 2BEUB 3N7AA 1MX3A 2UUCB 1OH8A 2XNSA 1P4AA 3GP3A 3SCZA 3V8EA 2AOUA 3DH0A 4GAEA 3MMSA 2MYTA 3N28A 2JFWA 4EZEA 2WIDA 2DR0A 3EULA 2E4YA 1KVSA 3OH8A 1V26A 2FZEA 4UVIA 4Q9NA 2IV7A 1XLTC 5FQNA 2HO5A 4E12A 5JCOA 3QVJA 4RVFA 1ZUHA 1FTNA 3SBXA 1T0BA 1T5IA 1W5BA 1MIOB 4MV9A 3UTDA 4Z54A 3BJMA 5P8WA 4MS4B 3M1YA 3M6VA 2I5PO 2O8FA 1OPXA 5K45A 1EJ0A 3KZCA 2EVWX 3N8KA 3HGTA 2VJOA 1JEJA 4IFEA 3DVSX