2IYTA

Shikimate kinase from mycobacterium tuberculosis in unliganded state, open lid (conf. a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
175
structure length
175
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 64
structure length 175
sequence length 175
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iytA00
2OE2A 1ZD1A 1E9AA 2QZ4A 3JVVA 3GJ6A 3OIUA 3QF4A 2OHFA 1P62B 4HZUB 4LC1A 3LO5A 4H1VA 5IK2D 2RGDA 5FTKA 4DBLC 1X3SA 2GWHA 1NMZA 1JQLB 2ORIA 4PPGA 4ZO4A 3QOFA 2DFLA 2XSZD 2ZTSA 4JKIA 3SYNA 1BMFA 2ERYA 2WJHA 2D06A 4TL7A 4US0R 3FKSD 3TIFA 5K8UA 3A1UA 2PZGA 1G7TA 4A4DA 1ONBA 2HXSA 1T6NA 5HE9A 1YZNA 4AG6A 1BS1A 4B3BA 1KNXA 3OEED 1R0WA 2HXYA 4HATA 4TMKA 4TYPA 5K8IA 4UNSA 1KMHB 4B74A 2P3SA 3H1TA 2CLDX 4H1UA 4BLTA 2O8BB 1G7SA 2N1BA 1NVXQ 4YXWA 4I1OA 2RAPA 3NHBA 1OH8A 3MFYA 4O2LA 1WRBA 3AVPA 1FW6A 3A8TA 4I1VA 4EFMA 3OIYA 3Q8XB 1P9RA 2EYUA 2WAXA 1UDWA 3K70B 4NYIQ 1GWNA 1A82A 1TPZA 1HA3A 5DN6A 2X77A 4HYYA 4DEYA 4B3GA 1OF1A 1FZQA 3M4YA 4JLKA 4ASUA 1A4RA 3C41J 4HEJA 4WZBE 3A1TA 4LHZA 3L82B 3T34A 1JXOA 3E5HA 3QVVA 2CL6X 1YZKA 2GVDC 4RJLA 3FYHA 3LFUA 2ZI4A 1IY1A 3HU1A 1EFHA 5B2ZA 5E95A 5TDHA 1F6BA 1NLYA 2VEDA 3VU9A 4C3ZA 1DEKA 3CRMA 3ETLA 2NGRA 4BFUA 1C1YA 2R65A 1E2DA 4B6FA 5EXPA 1OIXA 2CJWA 1NJGA 2J46A 1I4DD 2ZAOA 3CW2A 2WIBA 1Q3TA 4PO1A 2RH5A 3RNLA 2XTMA 1Z28A 3PIRA 3I1FA 1OYYA 2VO1A 3DOFA 1C9KA 3QVUA 1SVMA 2FJUA 2VTKA 4MKFA 2WMOB 5EXTA 5JWHA 4G5SA 3BH0A 2FDCA 5FR1A 3B5JA 3QJYA 1VCNA 3CRVA 1Z63A 1IXSB 3ND9A 2AFIE 3HR8A 5F3WB 4M21A 5FBVB 2CMKA 1IBRA 4DSTA 2KJQA 2D7CA 5JZVA 3GLHB 1CJKC 3GJXC 2N46A 4KFSA 1DADA 4CEHA 1JJVA 3K1JA 4PSAA 4XSGA 1Z47A 4TYQA 4KBGA 4QGHA 3VX4A 2PL3A 5FUYA 1VCMA 5HCIA 1U81A 3KJIA 2V54A 4FI3C 2IS2A 4D26A 1NJFA 3RRMA 5KSYA 5JJKA 5IT5A 3R7WA 1FQKA 5FTMA 1G8HA 1XEXA 3L0PA 4GMXA 4K8OA 2PX3A 2MSDB 3L8YA 1HV8A 1NL3A 1KJZA 3CF6R 1U0JA 4LJ5A 1HH4A 2WSSD 5DI9A 5KPJA 4IFEA 1GL9B 4AYWA 2ODEA 4YDHB 4Q48A 4OJKA 1OHHD 2OFXA 2P67A 5DH9A 3ZZTA 4DCNA 4C0QC 4E07A 3THYB 4KAXA 3LAWA 4LHYA 5D3QA 1EFRA 4LHVA 3HYRA 4B2LA 3GLIB 4BLRA 3BE4A 4IEEA 4TT3A 4P32A 4ZKDA 1D2EA 1NY5A 2OZEA 2BBSA 1LVGA 2GKSA 3LW8A 4P4SA 4Q19A 4R98A 2R6DA 4PHHA 4E22A 3DDCA 3TUZC 3HU3A 1PVOA 4XD7D 1G64A 5LD2C 5J5CA 5JRJA 2D74A 1UM8A 2QNRA 3I61A 1TU4A 4RKFA 1COWA 3QKTA 1XMIA 2HDNB 1E2IA 5KHOC 1DO0A 4CIDA 3VNVA 1E1QD 2NMVA 1OKKA 2YV5A 2HEIA 2H1LA 4Z1MA 3Q72A 5DHFA 4GZMA 1EX6A 1T3HA 2QY9A 1R8SA 1DBSA 1Z6TA 2G77B 4LY6A 3UG6A 1V5WA 3ADDA 3VTKA 2HT1A 2QUZA 1U98A 2B6HA 2ZPTX 4PHGA 1TTTA 4OL0A 4P33A 1N6KA 1YVDA 1E0JA 2F1IA 2OBLA 3BGWA 4DRZA 3TNFA 2OSBA 3U3RA 3IIJA 4RD2A 3ZGXA 1VECA 3C7KA 5CLQA 2ZJYA 5G40A 4A0GA 4BFXA 3CRW1 2BEJA 4B3CA 4GDFA 5P21A 2WBLC 5M04A 3GLFA 3B6EA 3PITA 2GDJA 2ZVPX 1J8YF 1MH1A 5CK4A 4DT1A 1CRQA 4PQRA 1P4SA 1KK3A 1KO7A 5JECA 3QKUA 2WPDD 4Q47A 1IN7A 1ZBDA 3GD7A 3PEVA 2XAUA 5DGXA 4Z8XA 1DPFA 3U3JA 2W2VA 2RMKA 2NO6A 1DG1G 2WJIA 4LV8B 3GLIE 4DKXA 1E4VA 3QPVA 1WDTA 4URZR 3SOPA 2CVHA 2RGCA 1U9IA 2FSGA 4TZ0A 1X8KA 1XTJA 3Q7PA 2DY1A 2XXAA 4KFUA 1DS6A 5EZ6B 3K9GA 4TMVA 3BOSA 5IHPA 3MJHA 3MCAA 5UKDA 4ABYA 2R6AA 1G7RA 1II0A 4DLRA 1MKYA 5GADl 3Q5EA 5ELXA 1GKUB 1UKEA 2VH5R 2WJVA 2IYXA 3EZ6A 4FWIB 1IXZA 1Q1QA 2CLCX 3L0OA 4DXAA 1TUIA 2KBFA 4B6EA 3SE0A 4IOKA 1OJLA 3C15C 5HZKA 1CJMA 5KO2A 2VHJA 5BN5A 2UKDA 3TQCA 3UG7A 4A1FA 5CIWA 5KTYA 4BLOA 1OLOA 1A1VA 1W49A 2V4ZA 4E5UA 4QOSA 2QBYB 5TXGA 2X19A 2ZE8A 4UNNA 3TR0A 1Z6XA 1N2CE 3BBPA 3MGCA 4JBWA 1S4QA 1M74A 1O87A 2FEMA 3C4JA 5HKKD 4O3MA 3OF5A 1XPOA 2W6ID 1KSGA 1G7CA 2D7DA 4JL6A 5H1YA 3OEHD 3CKLA 1TADA 2VSXA 1W47A 4AG5A 3RRYA 3VU9B 3FMFA 1N6NA 3B78A 1UAAA 1J8MF 1TQDA 2JLUA 1G3QA 4P4SB 4OHWA 3PUXA 4PR0A 4HLDA 1X86B 1VMAA 2GEVA 2F43B 3B82A 2JLYA 2VSFA 2B92A 5F2EA 3SQWA 1FQJA 2FU5C 1S1MA 2WJGA 2X2EA 1XCGB 2D2EA 1XFAA 2WWXA 4LV5B 3ZVLA 1FTSA 4O2RA 3MWLA 1DAKA 1F2TA 3BD9A 3UWOA 3ECCA 1LV7A 2OEPA 1GRRA 2MMGA 4KCGA 4BQSA 4AKHA 1CR0A 1G9XA 2KB0A 3OIWA 2OFOA 4CEJA 6Q21A 2J59A 3W8RA 4LI0A 3B1WA 3OFNA 5EP3A 1WP9A 5FI1B 1CIPA 2ZRIA 3IIKA 1J70A 2JLWA 2W00A 4ZI2A 3QNUA 3EIEA 3N2EA 1Z07A 1G6HA 4LHXA 2PX0A 1NVVR 1TNDA 1DO2A 1Z29A 2GK7A 3QG5A 3ZDQA 4FMCB 3UKDA 2PMKA 3V9PA 1QHSA 2Z4RA 3BJIC 2I1QA 2RGNC 3TW4A 2Q6TA 4C0LA 2JLSA 1FMLA 1RZ3A 421PA 2CBZA 1N0WA 2G3YA 4BFYA 2NOAA 4F4IA 3RS7A 4Q4HA 4HAWA 1H8HA 1NBME 2IBMA 1PUJA 1UJ2A 2ZRLA 1VG1A 1HT2E 2QTVB 3QG1A 1E9BA 3TAUA 4B43A 4RD0A 5JFGA 1U0HC 1S9HA 4PQFA 4LC0A 5BW8A 1BYUA 3MWKA 2JIZA 1DVRA 4TSFA 3SJCA 1E9EA 3QKRB 3AUXA 4A6PA 3VQTA 4II7A 4ARZA 2R62A 1AS3A 1COWD 1SHKA 1RPZA 5FTLA 1NN5A 1NY6A 1GRQA 1UBCA 4Q1EA 3FKSA 2RHDA 2J7KA 2CE2X 2OILA 3EC2A 1J7KA 5DYIA 3SYLA 4C0JA 3IGFA 3U6KA 3RVBA 1QHIA 1NSTA 1KSHA 4ZCMA 4YLGA 5AJWA 2ZS8A 5JI3E 1KI1A 2XGJA 2HCBA 5C46F 2FWRA 1UFQA 4PC1A 3MWYW 1OPXA 3K09A 2O8DA 4IXNA 3REFA 3S1AB 4DVGA 3U7HB 4C2UA 3FTQA 4WOPA 1G17A 4NU0A 4WZ6A 4WXRA 1E1RD 3WP0A 3UMSA 1SKYB 2NTYC 4Q1AA 3RRNA 2JDID 3PG5A 4MKGA 1E6CA 4R9UC 3EA5A 3T61A 4FD2A 1HQCA 2YWFA 3A36A 4BRWA 5GVSA 2EFEB 3ADBA 2Q9BA 3IEVA 2C96A 2AKYA 1UPTA 221PA 2Z0MA 2L0XA 3CX8A 2MMCA 4JSTA 4JJZA 4MYHA 4ZDKA 3GLFB 4IVQA 1FMJA 4V0MA 3P26A 4GMDA 2V6JA 1IN8A 5DISB 5H8WA 1KO8A 4WW0A 2JASA 5J4KA 4P0TA 3A4NA 3T06B 1Z5ZA 1ZCBA 1Q57A 3EPKA 2IYZA 3RS4A 2JJ8A 4FMBB 3GP8A 1NSFA 3AKDA 1R5OA 4G3XA 4MRPA 4ZDJA 5C1BA 1TQ2A 4JT4A 1U8ZA 2CHVA 4RD6A 2QRNA 3EWAA 1TUEA 3RC3A 3U7GA 3KDSE 2LCFA 2XB4A 3TGPA 4TN1A 1SVSA 3T5DA 3VNUA 1QF9A 4XVRA 3KJEA 3K9LA 1WCV1 4QRHA 4V0KA 5LBIA 3ICQB 1SULA 2YVUA 2ZJ8A 4BFWA 4V02A 1EFCA 2W6JA 4UKDA 3QQ5A 2KBEA 2V7QA 3QXHA 3THXA 3WBKA 1R0YA 4NKRA 4Q4JB 2R8RA 2ZE5A 3KQHA 4AYXA 2PCLA 2ZSAA 3IO5A 5JWRA 4MGIR 4PC7A 1NLZA 2FEOA 2V6IA 5EE1A 1MABB 3JZAA 1FP6A 1R0ZA 4NCKA 1CJUC 3U3KA 1SHZA 1ZNWA 3GLHE 1HQYE 2VYFA 4TMZA 4O0MA 4MYCA 2BWJA 4B3XA 1KIMA 3ZH9B 3R8FA 2DFTA 3IKJA 3UANA 1W7AA 2V3CC 3LWNA 1W5SA 2J0SA 2CDNA 5DHAA 1Q1BA 2NO7A 3P4XA 4KSBA 2ORVA 3B2EA 3CBQA 5G3YA 4ZCIA 4MRRA 1E9RA 1IXRC 4FCVA 5B58C 5JSZA 2GXQA 3GLGB 1N0UA 4EPRA 3WYGA 1VYVA 1ZYUA 4MKHA 3SJBA 5IF9A 3IHLA 3K0FA 3BFKA 2WJYA 2D4HA 3ZQJA 5A4JA 1YJ5A 1K6MA 1Q44A 1RKBA 1NNEA 2IS6A 3IQWA 4XOIA 2X2FA 3QUSA 4G5GA 5L3RA 3GJ0A 5BYKA 1N3BA 1E9CA 1JXMA 3DEFA 3EASA 3CH4B 5TB5A 2C99A 2IF0A 2F43A 2AX4A 2QGNA 2C04A 4M9ZA 3GFTA 5FPHA 4DUGA 2FE4A 4AI6A 1EK0A 2BBWA 3VR6A 2GA8A 2J41A 2WWFA 1TF2A 1GTVA 3Q5DA 4A8JC 3NBXX 1R0XA 1WXQA 3FDIA 2ZJ5A 3HPQA 4TQAA 3EA0A 2WWHA 5IDVA 4CEIB 3LBIA 1QHHB 3SDZA 1XXHE 1E1QA 2QAGA 5J4YA 2GNOA 1GL6A 4PZYA 4M9QA 4B34A 4CEIA 4RVCA 2IS1A 4X8LA 5G53C 4HZIA 2X8AA 4D0NA 3DKPA 4JBXA 3TSWA 1H8HD 1G5RA 3RS0A 1A7JA 1G8YA 3D8BA 3BXZA 1IHUA 2RCNA 2ZRNA 3HPRA 4US1R 4V03A 1G41A 3BORA 3AVTA 1SGWA 3GCGA 1Q21A 4LHWA 1YQTA 1P72A 3BFVA 1YZQA 3RDPA 3EW9A 2HYDA 4N1AA 1KY2A 4Z51A 1AGRA 4CZ2A 5CYPA 1E2JA 4UXIA 4KV9A 4Q03A 3SN6A 4TQ9A 5SZIA 2XTZA 3LQRA 3BB4A 2SHKA 2B7BA 1KKLA 3NBZC 4LV6A 5JMTA 2V1UA 1VHTA 4DCSA 2WHXA 2PJZA 3O8RA 3SHWA 1CP2A 2V9PA 1II8A 3BH7A 2YYZA 1G3MA 2DPXA 1RRGA 3BC1A 3GLIA 1JI0A 3ND8A 2CK3D 4IW3B 2GXUA 1E4YA 1VCIA 4FWTA 4G01B 1RFLA 4EUNA 1KI3A 3CB4A 4OHZA 5EXXA 3WNBA 1GKIA 1JEDA 3TVDA 1KO5A 1TEXA 3DPUA 3EXAA 3K0AA 2WV9A 3KTAA 1JNYA 1S8FA 5HCNA 2HJVA 5FOSA 4YMUA 3A1WA 4UNRA 1FX0A 3CZQA 4OK3A 1QVAA 1JPJA 3SQXA 2AHOA 2CK3A 2EQBA 2HLDA 2ZUDA 3K9HA 2FFHA 2QMUA 4OK6A 3U4QB 3QF7A 4OQNA 4NMMA 4IOLA 4TL6A 3TKLA 3ZVMA 1P5ZB 1IN5A 4TLAA 1TMKA 1ZM9A 2LKDA 3AVOA 4MYTA 2NZJA 3TBKA 1XJ0A 2QL6A 5CK5A 3IEUA 1SVLA 1T0JB 1ZMXA 4NCHA 2Q3MA 1N6HA 3FHTA 2WWGA 2G9NA 1NLFA 2YWEA 4OI1A 3ZJYA 1XRJA 1A2BA 4FW9A 4HAYA 4PPNA 2IF2A 2J9RA 2XNDD 2EFCB 3FPAA 2QAJA 2YINC 1P9NA 1QRAA 1V43A 2EFHB 3OZXA 4LBZA 5JCPA 4LYFA 2NPIA 3CH5A 2DWOA 2ZJAA 4JS0A 4QG7A 4PX9A 3T1TA 3WHKA 3REGA 2JLRA 4QHTA 4G0NA 3Q3JB 1W0JA 2ZEJA 1G8FA 3MG9A 2EVWX 3SJAA 3KJHA 2AL7A 4JVSB 1KI2A 5DN6D 1X1RA 4GL2A 4F93B 1U90A 4RY2A 3ASZA 4YMTA 4HDOB 3SI7A 2F55A 1WBBA 1K5GA 1E2PA 1OYWA 3D7MA 1Z0FA 3KXIA 5GJBA 1PZNA 2FMXA 3U4QA 1YZTA 1KDPA 2OCPA 4BPBA 3PEYA 4URYR 3SNHA 2QTHA 2GAAA 4OK5A 3IUYA 4MA4A 3RS5A 3P20A 4FN5A 3C14C 3W34A 2IW3A 4FMDF 2Q0HA 1PLLA 5G41A 4JLJA 3KTAB 3M0EA 2IEZA 2BMDA 4KVAA 4CW7A 1SXJA 4WA7A 1CRPA 1FOEB 4DCUA 2PLFA 1P9WA 2QP4A 3NBYC 4EPYA 2GCNA 2F1HA 5GJCA 1E2FA 2H7VA 4C0HA 3MAAC 3GLHA 4GFDA 4NZYA 1L8QA 1LY1A 4LJ9A 4NDZA 3SBDA 2CHGA 2QM7A 3DHWC 2HF9A 5L3QB 1ZAKA 4FXPA 3VKHA 2FG5A 5EUQB 1S96A 2DFNA 4KLZA 1G8PA 4M1WA 4TLBA 4GRAA 4ZDWA 4Q7JB 4P4TA 1KI9A 4QKQA 1E96A 2H17A 1M34E 4WAUA 4TTRA 5JJLA 2YOFA 1W4AA 3BK7A 5EE3A 3NHAA 2QT0A 3TSZA 4F38A 1P2SA 1MO6A 1T4GA 1UBEA 2IK8A 1OE0A 4M1MA 2VHTA 1ZD8A 3BERA 3AGQA 1G16A 2QORA 2JGNA 3W6PA 4JLMA 4NPHA 4B2IA 4TYWA 2ODWA 5HTKA 4BECA 3FMOB 2NQ2C 5K8LA 2UZ3A 2ANBA 2G1JA 1EX7A 2AK2A 2OESA 2VPPA 5KOYA 2GJSA 2QE7D 5EE0A 1VPLA 3RSOA 1WBDA 4ZIRB 2QI9C 2YHSA 3C16C 1OXVA 4WBSA 5FPKA 5E4FA 1ZC3A 4HUQB 3SJZA 1CF4A 3PEUA 3DMNA 2FV8A 3AP2A 1FPMA 3AVXA 1FUKA 1Z08A 2NPFA 1KDRA 5DE3A 4ARZB 2B8WA 1H8EA 2MSCB 1RRPA 4W5HA 4ESVA 1VCOA 4Q1BA 1N6IA 3QF4B 4Q21A 5J4VA 2AKAB 2GEDA 5CM9C 3CLVA 4NL4H 4TYNA 3N70A 4D82A 2ZU0C 2AD1A 4OHYA 3P4YA 1W2HA 4RZ2A 1XXHA 1G19A 1P2VA 2Q9CA 4B75A 4L5BA 3DO6A 3GPLA 1TEVA 4HB2A 4B35A 1P2TA 2C9CA 3AVVA 3SR0A 3FVQA 4NH0A 3ZVRA 3K0CA 2VHCA 4EFNA 2NIPA 1Z83A 2XNSA 4RD4A 3ZZUA 3PUZA 1LB1B 2VP2A 3KFXA 4PQYA 2R6FA 3SFZA 3VKGA 1U2RA 2BCGY 4OQXA 1G3RA 2C9OA 3UIEA 1KZ7B 3EZ9A 1UKVY 1ZM3A 5HPYB 1K5DA 4K46A 3KQLA 1OH6A 2WKPA 5D3MB 1G21E 3T35A 2XJ9A 1YR9A 1Z2AA 3U44B 1KSJA 2ZROA 4BLQA 4DT1B 4URWR 2ZSEA 3AH8A 1T5IA 4GPTA 4LYAA 4L8GA 4LJYA 3FOZA 2FF7A 4UNQA 1P73A 1YRAA 4LBYA 3R7WB 2YOHA 3AVYA 4GOXA 1SVIA 4LBVA 3R9IA 5LPNA 1G5PA 1W4CA 5AUPB 1ZUIA 5KYKA 1OT3A 1R6BX 2OO7A 5FBLB 1CLUA 1L7VC 4IVPA 4PSVA 1XTRA 1DAEA 2ZYVX 4TYYA 4L15A 1BO6A 2CXXA 3NXSA 2VBCA 3X1WA 3QI2A 2XITA 1AZSC 4MGKR 1YU9A 1VDZA 2W58A 2XZPA 3SHFA 4LJ4A 4A8JA 2XB2A 3AP1A 4JIMA 3QXSA 2A9KA 1W36C 4QBFA 4Q9KA 1E9DA 4S2EA 2QGZA 5AUOB 3EPHA 1W0KA 1IONA 2VP5A 3IHWA 2GJAA 2WVJA 4BUJA 4G5OA 3T5GA 1GL7A 2IWRA 3QBTA 1D9ZA 3E1SA 1D8TA 4AKIA 3U3OA 4B3DA 1OXUA 1NRJB 2G83A 4MGZR 4KXFB 1Z6AA 5DI3B 1E2QA 4TMXA 4QGAA 5BQ5A 1DAGA 1FX0B 3QPWA 1KK1A 1HY3A 3M6AA 1GVNB 1U99A 4CVNA 4DLVA 4YMVA 2W0SA 5CITA 2QBYA 121PA 3NVAA 4LYHA 2A5DA 3PR1A 4RZ3A 2WOOA 3VHXA 1Z0AA 2HUPA 1RYFA 5AWFC 4MDFA 1U0LA 1G291 1E94E 1VKJA 2IA5A 1LW7A 4I99A 3KUCA 2GTPA 1R8QA 2A5JA 2ZS9A 4EQ6B 3TE6A 5B57C 2YWGA 5EP2A 4TL9A 4DSUA 3KXKA 1N6RA 3G82C 4JLDA 3WMGA 4TLDA 3QENA 1MO5A 3DMDA 1MT0A 3NC1C 3LXXA 4MRNA 2LWIA 2KSQA 4WVFA 5KDOA 2WWWA 1E99A 5CB6A 4A15A 2VL7A 1L4UA 3FGNA 4TLEA 4L9SA 2OBNA 2QSZA 3LBHA 1IM2A 1J99A 3KKPA 3RS2A 3U7FB 2QTFA 2AWOA 5FFMA 2Y8EA 1OB5A 1GNQA 3HP1A 3SYKA 5EJEA 5H70A 1G6OA 3D31A 4M53A 4PZZA 4QFMA 1JR3A 2WIAA 1KI8A 1UF9A 2EYQA 3A4LA 1Z0IA 3B13B 4QHYA 4BFZA 1LNZA 2FNAA 2J0VA 2C5LA 2QMEA 2VF8A 1E2HA 2J87A 4HB3A 5DNYB 4IDNA 1W0KD 1D2NA 3T1QA 2VHQA 3VR2A 2Z5FA 4JMPA 5C4GB 2HJGA 4UJ3A 2JJ1A 2JJ2D 5E7MA 4TL8A 1KGDA 1SXJE 3NH6A 3G0HA 4HAUA 1CJVC 1HURA 2GK6A 2CCJA 3O8CA 1N5IA 4DCTA 4Z54A 3EZ7A 4D4LA 3CWQA 3EG5A 2FFQA 3V00A 3IILA 2OT3B 3SU8A 4A0HA 2ZR7A 1OFIA 5L3SB 4JSYA 2H18A 1N5KA 2CE7A 4TTQA 1ZRHA 4DDTA 1TAGA 3AUYA 2QAGB 2WM9B 1KZGB 2DFKB 5ANRB 3MSXA 3ZYCA 5JJIA 2AD5A 1UBFA 3FE2A 2I1VB 3AVQA 4GOKA 2QE7A 4RFVA 4D4JA 5KNDA 2YC2C 3ASYA 2ZJZA 1ZM2A 2PJRA 5FBRB 1FUUA 4LWZA 4JLPA 1VHLA 2J45A 1KJWA 2IUUA 5J4HA 1PLJA 2PEZA 1W46A 2FSIA 3I5YA 1YKSA 1NBMA 4IRUB 1Q1ZA 2O0KA 1T91A 3O8BA 4KU4A 3VR3A 2ZRDA 4DHEA 1OFHA 4N3NA 1HTWA 3PUVA 3KKNA 1E2EA 4Q1DA 3THWB 3TJZA 2BV3A 2IYWA 3T1OA 2A78A 2XOKA 4RSGA 4GP6A 3THYA 4W7SA 3KQUA 4MYUA 4TWZA 3I73A 2BHRA 4BRUA 4DLSA 2BM1A 3LLUA 4QJ5A 2JLQA 1EG7A 2YJTD 1Z0KA 5E7IA 3W9YA 1KK0A 2ZRAA 3P1JA 3TQFA 4US2R 1KHTA 3B85A 4C0SA 4IKEA 1LS1A 4XTRA 4DC9A 2Q9AA 2ZI5A 3U6BA 3FMPB 4IHQA 1E32A 3WNDA 2OV2A 2FSHA 1FL9A 1YZLA 2XJ4A 5JRZA 1E79A 5FOTA 1KMQA 2VP6A 3L2OB 4NYJQ 5FL7A 1M7BA 5L3VA 5FR2A 5AJYA 1WB9A 1Q1EA 1LTQA 1F2TB 3VR4A 1QG4A 3W3AA 4Y0AA 3IO3A 1M1YE 4IEIA 4PAQA 5DI3A 1NIPA 1JB1A 3TAHA 4HAVA 3BRWD 1P3JA 4MITA 4Q7KA 1DAFA 1JAHA 2A2ZA 1IOZA 4PHFA 4JT2A 5JBQA 4BLPA 1JPNA 1C4OA 1L4YA 4Y0VA 2AWNA 4OQLA 3CF0A 5E3HA 1UKYA 3UMFA 1MABA 1BMFD 4DIDA 2J5XA 1W5TA 2H57A 3O8DA 2BEKA 2REOA 4AKGA 2ZRCA 2C98A 5L3SA 1AZTA 1EGAA 821PA 2P2LA 4V0ME 2ZE6A 721PA 2P5SA 1NMXA 2RGGA 2ZRKA 3QXCA 1DE0A 2P0EA 1QVRA 3OAAA 1OSNA 1E0SA 3G5UA 1RJ9B 2QSYA 1QHYA 3RABA 3W90A 1GM5A 1D5CA 3E70C 4QC2A 1OKKD 1XEWX 2VP0A 4D25A 2C95A 2EU8A 3U44A 2G1KA 4I1SA 3NG1A 1YR8A 3BWDD 3LLMA 4RZXA 2EW1A 1DAIA 5A5GA 1R10A 2DB3A 5KDDA 1NMYA 2W2TA 1PV4A 1Q22A 4PC6A 3C5CA 3K0CC 3PV0A 3WMEA 3HJNA 1N6PA 1G18A 1TL7C 1XBTA 4R71A 1Z0DA 4GT1A 4JKYA 4LJ6A 2GVZC 4PTLA 2GF0A 4RD3A 2ZAMA 2I3BA 3EC1A 2W2XA 1A2KC 4X8OA 4Q5IA 4TQUS 1GILA 2EFGA 2HLDD 1TF5A 3IBYA 1LF0A 2X1VA 4ZCLA 3KUDA 4JBYA 4OBEA 1ESNA 3AKCA 1B0UA 4RCYA 3X2SA 3K09C 1DOAA 1JBKA 2QAGC 2ZANA 5BXQC 2CL7X 3FWYA 3TR5A 2JCSA 5C4MA 4NYMR 1ETUA 3MWJA 4F4JA 4PPFA 1G4UR 3LQQA 4ZV4A 3GEEA 4V0LA 4BEJA 2J7PA 2OAQ1 1ELOA 2WOJA 2IYUA 2ZR9A 4P3YA 4JLVA 3X1ZA 5EQTA 2ORWA 4TMTA 1XEWY 4URVR 2GAOA 4OJQA 4BZPA 1CU1A 4NHOA 4DLXA 1CTQA 1F2UA 4G5RA 2CNWA 3QIAA 3PCRB 2ECKA 4QBGB 1QHGA 4EPVA 4D0LB 5BN3A 1JR3D 3QKSA 5GVRA 5FTNA 3KXLA 1T9HA 3K70C 1FNNA 2A3RA 3EPJA 2BVNA 3CM0A 2R44A 3ICEA 4PSKA 1XWIA 3ZIAA 4Q4AA 2RHMA 2FZLA 4Q4AB 1D6JA 2CCKA 3ZQ6A 1ZC4A 1N6LA 4M1OA 4AD8A 2WSMA 4I1UA 2IS4A 4HAZA 2FPMA 1YRBA 2P65A 3EZ2A 3AF0A 2RGNA 2ZXUA 2O0HA 2OBMA 1US8A 4EJSC 2QROA 2ZRJA 1G20E 2W0MA 3LV8A 3NKVA 4IFBA 4RFSB 3GJ4A 2IYVA 4LPSA 1N25A 4ZI3A 3VR5A 1FTNA 1BIFA 1QZXA 2GILA 2F3RA 4A92A 4EFLA 4OI2A 4CF7A 5EUMA 3OAAD 1NP6A 3PUWA 3SFVA 2WTUA 4KSCA 4DUGD 2O8FA 1RIFA 1E2MA 1EFTA 1Z6GA 1ZJ6A 1FP7A 2PLRA 3AV0B 4OQMA 4U5XA 3RAPR 3BS4A 2H5EA 5FPYA 4XWKA 1VIAA 2VSOA 4PPQA 1KI4A 1KMHA 1TQ4A 1AN0A 3NIBA 3IBGA 4NP6A 4JLNA 4XIGS 2O8CB 2EWWA 1KNQA 4OI4A 3PXGA 3X1DA 3CUEF 1G4AE 2QPOA 1U8AA 1VG0B 2FGJA 1GNPA 4QBIA 3VAAA 3I8SA 4G5QA 4NYJR 3B1VA 2QG6A 3K0EA 3MJRA 3O47A 1T0HB 1HYQA 2QP3A 3PQCA 1VYTA 2ZYTX 4PO9A 3I92A 3T15A 5LB4A 5JSZB 4LX0A 4NCIA 3EIHA 3Q9LA 1GOTA 2H92A 4AYTA 2FFAA 1KI6B 1U94A 2GCOA 2BMEA 4XVQA 4HZUA 3DOEA 3GJ3A 5CB8A 2WKRA 3LY5A 2XSZA 3HR7A 4M1KA 1E9SA 2PZEA 4KFRA 3FHCB 2GBLA 1ZM4A 1XTSA 5A0FA 1GITA 1I4TD 3QBVA 4M4SA 3EPLA 2E87A 3RS3A 1E79D 1RW4A 4PAMA 4QGGA 3TH5A 1OXSC 2CEAA 1NKSA 4NYIR 1WMSA 2BBTA 5J47A 3B1YA 4OHXA 4Q1FA 1P2UA 3NDBB 4BZXA 1H65A 2R6GA 4JJKA 1S2MA 5FOUA 1KTVA 1RRCA 1G3IA 2F1JA 2ZRGA 4LUCA 4Q4LA 3R9WA 3RHFA 2RGBA 2Z4SA 4R2HA 4POAA 2V7QD 1Z2CA 4D4MA 2GETA 4Q9JA 1S3GA 3NBFA 4EPTA 4DEXA 2XEXA 4MDEA 1HT1E 1QHHA 2QENA 3AEZA 4YDSA 1P7CA 5KNCA 1J2JA 1NIJA 1P61B 2UZIR 3DM9B 3K53A 4ACAA 1OXTA 5CYOA 4EKDA 2XZOA 4QM6A 5F9FA 5KSZA 4C9BA 2BOVA 4RKEA 1DTSA 1IY0A 4YMSA 4XWOA 5HE8A 4Q7MB 1EFUA 5DYGA 5EP1A 1OV4A 3I62A 2QMOA 1X6VA 2VP4A 4CDGA 4M2LA 1XJCA 1Q3HA 2O8BA 3N5CA 5FUVA 4Q02A 1YHNA 4A9AA 1E9FA 1NVWQ 5G3ZA 5HZHA 1SXJC 3TRFA 1M6NA 4CT5A 2FOLA 5AR1A 3KQKA 1HE1C 3OIVA 1E69A 2XOKD 1EWQA 2GZHA 2C77A 1XP8A 1U8YA 2ZRBA 1VIYA 4QGFA 4EJSB 1NVUQ 1II8B 1O3YA 5AJVB 1XPUA 4Z8YA 1YZGA 1JR3E 2FSFA 1KKMA 2QA5A 5BN4A 4JVMA 2ODBA 4M1TA 2IHYA 1LS6A 4PAOA 4GI7A 2VA8A 4XH9B 4DLWA 5SZKB 1R4AA 1XD2B 2OCBA 4HB0A 4BFTA 5HKKA 1OB2A 4RCZA 1W44A 3T1VA 4PHTA 1S0UA 1AA9A 1F48A 3LA6A 3RRZA 2JLVA 4QM7A 1XZPA 4ACBA 1F60A 2WMNB 4RD1A 4O25A 2FPKA 4DJTA 1S9DA 1Z6YA 3WYAA 2K5UA 5TVKA 3U2QA 1T5LA 4DWJA 5HR5A 3L0SA 5AK0A 1XU4A 2J0QA 3SEAA 2AR7A 1BOFA 4DCVA 1YR7A 3CNLA 3L43A 3NEYA 2JJ1D 1QHXA 4Q66C 3D3QA 4P31A 2OM2A 2OXRA 2BCJQ 4W5JA 3QEJA 3GJ7A 3ZS8A 4WZAE 1AGPA 1KI6A 4AWXA 5LDDC 3TSOA 4I81A 4MRSA 1IJFA 2ZI6A 2IC5A 5KSPA 1XEXB 3B1ZA 2IWHA 1XNJA 4IDOA 2IT1A 2JATA 4AC9A 3CIOA 1ZU5A 4L4UA 1HE8B 2DBYA 3LD9A 1KAGA 3C8UA 1W2GA 1XCMA 4HLUC 1XB2A 3X1XA 4EDHA 1NN3A 4JYCA 2GZDA 4HLCA 3K70D 3V4RA 2GESA 4X8MA 2ZJOA 1WA5A 2ZUBA 4AURA 3U61B 2BDTA 5JEDA 2WWYA 4D2IA 4PO8A 3J81k 2GBLC 2A5YB 4IOJA 3FB4A 3KB2A 5TARA 1XCPA 1DG3A 1J90A 1XXHB 2A5FA 1IJEA 2JLZA 2E9SA 3I32A 1ZP6A 3DKVA 5EE9A 1XD8A 3Q7QA 4EAQA 2PZFA 2WZQA 2NZ8A 4B2PA 1QG2A 3GFPA 2ZYWX 3DM5A 2JLXA 3ONWA 3ZD7A 3BAFA 2ONKA 4PC3A 4NONA 4RFSA 1QHNA 2YZ2A 2YKGA 2OXCA 2BJVA 3B9QA 2D2FA 4M22A 1PJRA 2ZREA 1EXMA 4ILEA 1GFIA 2O8FB 2VP9A 2CL0X 1EWRA 4IDPA 2ZE7A 2IYYA 4LGMA 1KYIA 2KE5A 2ZU6A 2IXGA 2Z83A 3UPUA 3F8TA 1S1CA 2ATXA 1ZUNB 1T3SA 5FI0B 3W5JA 1MR3F 2F9LA 2HV8A 3M1IA 3QE0A 5JWOA 3FMIA 2AFHE 1T3LA 4JLAA 5FOWA 4QJ3A 2QEQA 3K8YA 4BZQA 2W6IA 5KDLA 4C30A 4LZZA 3AF1A 3SZRA 4DDUA 4U02A 1KK2A 2GXSA 3AB3A 1GUAA 3CF2A 4V0NA 3TW8B 1XMVA 3KJGA 1E2GA 1GP2A 1M7GA 4DDWA 2EWVA 1JEEA 1EFRD 4B47A 3BB1A 3CPJB 5FTJA 4EJSA 3H4MA 3H84A 2JEOA 5KUTA 1XD2A 2J0UB 3B7GA 5KPDA 1ZNYA 4PFSA 4HSEA 3A1VA 2G6BA 1S3SA 1E2LA 1SXJB 2QPTA 3A4MA 2A7QA 4D6PA 3L8ZA 3VFDA 3I5XA 4HI0E 2CNWD 2ASEA 2C03A 2KI5A 1W1WA 3OHMA 3P27A 4ITRC 2HCJB 4M1SA 4LSGA 4EIWA 1OH5A 3I3SR 3K0AB 3F3YA 4C0AC 1ZM7A 2C2HA 2C78A 4C4PA 4QXAA 3B8HA 1LF5A 1UEIA 1TU3A 4LJ7A 4F7WA 2O0JA 3WRYC 4CEJB 3GJ5A 4CT4B 1ZINA 2ATVA 4B3FX 3AF3A 5CLLA 4M0LA 4G1UC 1KSFX 2PCJA 3FHOA 3MRSA 4KFTA 1AQYA 1MO3A 1CR2A 1XDBA 1IY2A 1TQ6A 3NEJA 5TMPA 1GAJA 2GJ9A 4NTZA 2MSEB 1TX4B 1GG2A 2D62A 2ZIAA 2BIFA 1W48A 4IDHA 1ZIPA 4D81A 1ZNZA 4MUBA 4E03A 3WY9A 1RJ9A 1WF3A 1N6OA 3B9PA 4ZPXA 1UADA 4KLNA 4KYIB 4Q01A 2D3WA 4YONB 4CGZA 2NO1A 3HU2A 4QBHA 3CNNA 4BFSA 3TUJC 5FH9A 4C2TA 2DCUA 1E0AA 2AN9A 5B30A 4GOJA 1ZUHA 2LKCA 2ZI3A 4C0BA 1F2UB 5SZHB 2WKQA 2Z6VA 4HDQB 1PLKA 3LRPA 3IIMA 4QJ4A 3OESA 3GEIA 1WQ1R 1IN6A 1Z3IX 2JA1A 1UBGA 1NVVQ 521PA 4B76A 3UMRA 1K8RA 5TV2A 4UJ5A 3QKRA 3H0KA 1KDTA 1AKYA 3D6TB 4B44A 3TK1A 1XMSA 2JJ2A 4DB4A 2F3TA 1NKTA 1XTIA 5AUNB 3OFND 1WE2A 1OFUX 2UVQA 1R5NA 2C8VA 1W0JD 5FUXA 2B7CA 3CNOA 4QNMA 3CR8A 2QRZA 1IN4A 2W83A 5FL7D 5FOXA 3I8XA 3I4LA 5SZJA 2RGXA 4CRWB 2Q3HA 3FKQA 4EPXA 3AQ4A 4XWAA 3LXRA 4XTCS 2C9YA 4D4KA 2O52A 1OFTA 2WJJA 1DARA 4GZLA 5DSZA 2GJKA 4QNRA 1IAQA 5KSOA 2O8EA 3QXXA 5F9HA 3K0SA 1G1MA 4TZ6A 1I2DA 2DHRA 3CPEA 3QPUA 4XJXA 3GMTA 4TTPA 1NI3A 3MLEA 1FFHA 1QDEA 4CYMA 5GJVC 3DL0A 621PA 1E1RA 2YC4C 4BEBA 2KWIA 4U00A 1CJTC 3GJ8A 4CEHB 2ZJBA 3EWSA 2DR3A 1KO1A 2HF8A 3SS8A 1CKEA 5FUWA 1OXXK 4ZDIA 3CWZA 4U7DA 5D3MA 1SKYE 2RGAA 2IUSA 5JS7A 1W36B 1TF7A 1AIPA 2TMKA 3FFAA 3LW7A 1VYUA 2ZSDA 4KYUA 1GSIA 1UDXA 3T12A 2QPAA 4MKIA 1PUIA 4OQFA 1GIAA 3GLFE 5B64A 4F92B 2QQ0A 1FNMA 2RB4A 4KITB 2GXAA 3ZZ0A 5LD2B 3EZFA 4YMWA 3X1YA 4A0FA 5IK2A 3WRXC 5IRCD 4KHZA 2VF7A 3QY0A 1AS0A 1F3OA 2BKUA 4B33A 1F5NA 3A58B 5CDFA 5JS8A 1XX6A 2R9VA 1US8B 1Z22A 2OCAA 4NBSA 4ZIRA 5J4LA 4DLTA 4YQFA 4LOAA 2QU8A 2XTNA 3CRQA 3TUIC 4WIAA 4OHVA 2QMHA 3GEHA 4HDCA 3HYTA 3WMFA 4AK9A 1Y63A 1R2QA 2H16A 1P60A 3CX7A 4Q4JA 3W3ZB 3A1SA 4ERNA 1SVKA 4UNPA 4MGYR 1GDDA 2R2AA 2ZSBA 4NCNA 3ADCA 1NG9A 2FPLA 4BGDA 1XEFA 1MOZA 1T8UA 5DLQC 2ONJA 1OH7A 1I2MA 4BWYA 1AK2A 2CJWB 4DLUA 2H8KA 4FMDB 5CM8B 2QM8A 3KKQA 2WICA 4C7OB 3KX2A 4KBFA 2ERXA 2IYLD 1P75A 2GF9A 3H86A 2JDIA 4BE7B 2Q3FA 1OHHA 3MMPA 4B48A 2IEYA 1U9IC 4XSHA 1ZCAA 3CX6A 2F1RA 3B1XA 3CZPA 3S1AA 5FBWB 4IXMA 4Q4HB 1XTKA 1KY3A 3K9NA 2DWQA 5FBQB 1BKDR 2RGEA 1CR4A 2FA9A 2ZITA 4Q9HA 4Q7LA 4J0QA 1W36D 3KKMA 1YE8A 2G0NA 3CRRA 3K0FB 4KJZA 4UXHA 2ZI7A 4LDJA 1VG9B 2REBA 3KB1A 1IQPA 1Q0UA 4HLQB 5FPTA 3UATA 1XJQA 1ZW6A 4L9WA 4A2QA 1XMJA 1KDOA 4BFVA 3THWA 3V4FA 3U60B 2J1LA 3H2YA 1VTKA 2WAYA 4EQ6A 2O5VA 2J0UA 2ZUCA 2BMFA 2FH5B 3KL4A 4QL3A 4E09A 1D2MA 5FL3A 3BFXA 3CONA 3VX3A 4BASA 3PJRA 4AIIA 1OW3B 2WPDA 4X8HA 4FINA 4GSYA 4KVGA 2GCPA 1SXJD 1P6XA 3OE7A 1JJ7A 1KI7A 1ODFA 4RZUA 4OYHA 4TMWA 2FX3A 1AJEA 4HUQA 1I4LD 2XNDA 3WXMA 2REXB 3GFOA 3SBEA 2CHQA 3WP1B 1SZPA 5L8VA 3VR1A 4B73A 3RWOA 3AF2A 3ZS9A 2OUKA 2V55B 5H68A 1JECA 2PT7A 4WXPA 3RSLA 3NDPA 4M9SA 3PVSA 3AP3A 4N0EA 3OE7D 2OG2A 1HUQA 2V8OA 3DZ8A 1ANKA 2CCGA 3E2IA 3DVLA 1MRSA 4LCBA 1ZNXA 2FGKA 5JI2E 1D9XA 1CEEA 4YC7A 1E98A 3VHLB 4EPWA 1XZQA 4AY2A 3LDAA 2V1XA 4IDQA 4LJ8A 4DLYA 5EE5B 4A6XA 4MH0R 4ESHA 3W5IA 2VIIA 3BB3A 3UWKA 4F4CA 2ZM5A 3HWSA 2FZ4A 3C5HA 2QN6A 5KNBA 4DSOA 4OKSA 4M8NE 2BMJA 3TMKA 2IYTA 2ZRFA 3LX5A 4NCJA 5DIFA 4R2IA 1AM4D 1CULC 2ZI9A 2J7PD 1CS4C 1GZSA 3NTUA 2P6NA 1GKYA 2R6CA 1KAOA 3TLXA 2IXEA 1JAIA 3VKWA 4HLUA 4W9MC 3GLGA 4GP7A 4HAXA 4V0OA 1W4RA 3R20A 1E3MA 1SVOA 1NBMD 1QBKC 3CPHA 2A5GA 3MUFA 4P4UA 3EARA 4GBMA 4FCTA 3NWJA 3IQXA 1RRFA 3KZ1E 1JALA 2IXFA 4LBWA 2IX3A 4F91B 3IPYA 1ZIOA 3UXMA 2HT6A 1M2OB 2XZLA 2PT5A 3BH6A 2RKOA 2A30A 3IPXA 2OLJA 5KU1A 3WNCA 2WSSA 1NN0A 2JAQA 5CIQA 3F5FA 2J3EA 3PENA 4Q00A 1YR6A 2EFDB 5J40A 3WYFA 3A6PC 2VHUA 4A8JB 2AK3A 4I4LA 4XVUA 1UKZA 1XPRA 2GRJA 2NO9A 5TY0A 2FN4A 5JEEA 3ZIAD 3PFIA 4A2WA 2QT1A 1AS2A 2CVFA 4D0GA 3N2IA 4JZKA 2PEYA 4A82A 4LYJA 4DDVA 4Q9LA 3LVQE 4GNKA 3ZLJA 3RYTC 2ZRPA 2P5TB 4NE2A 4JVLA 3JVUA 5K8TA 3OEHA 4JLBA 1JQJC 2N42A 2YNMA 5JLJA 4Q18A 4LK2A 1JR6A 2ZR0A 2GCOB 1H8ED 2IYSA 2DYKA 3AVWA 2YOGA 2GZAA 4N0DA 4PANA 3F0TA 3RANA 4TLCA 3AVUA 3BIFA 1RE0A 1OIWA 1R5BA 4KO8A 5CJPA 1N0VC 1HEIA 1G5TA 5FPSA 2OFWA 1AQUA 4FIDA 5GJWC 2ZYUX 4MRVA 3DZDA 1CXZA 1BYIA 2ZRHA 2ZSFA 4UQOA 1A5TA 2G0TA 2VRWA 2GHIA 5CDFE 2Q21A 1BH2A 3EAQA 3ZD6A 5EXSA 4A0RA 2F7SA 4A2PA 3HDTA 5JHHB 1Q20A 4DB2A 3W6NA 5AUQA 4DSNA 4OI0A 2XXAB 1SVWA 5EP4A 4PZLA 4ASUD 4B71A 3AKYA 2NO0A 2JIZD 4UXJA 4BLSA 3SC3A 5EZ5A 3ADKA 2O8EB 5F98A 4JVNA 4NYMQ 1RC8A 1G8GA 4K81B 1LFDB 4C7OA 3LH5A 4KODA 1UEJA 1ZU4A 5AJXA 2GJ8A 1T8TA 2ZVQX 1AKEA 4DLZA 2O8DB 2WWIA 4YXWD 4AKEA 2G88A 2NG1A 5L3QA 2GEUA 1DELA 4IJMA 4Z1MD 4KI0A 2VLIA 3OEEA 2ZS7A 3QSYA 1G3UA 1KO4A 3AKEA 5C2JB 4M9XA 5AJZA 2E1RA 1M7HA 1N5LA 3GQBA 2PMDA 2ZETA 1SKQA 1Q12A 2PH1A 4Q1CA 3JZMA 4MUAA 3EIQA 3NC0C 4W5WA 5JHGB 3RC8A 2AXNA 3A37A 5JCZA 4H9GA 4D80A 2OAP1 1KOFA 2BJWA 2Z43A 2IHBA 1MV5A 4HUTA 1RVDA 4PC2A 3KQNA 1E2KA 2F9MA 2VQSA 1OIVA 1GRNA 3RLFA 4JYBA 2IYRA 1Z0JA 4FCWA 2HYIC 1CR1A 3LX8A 3U5ZB 5LB2A 2P6UA 1XTQA 2CLSA 1CBUA 1M8PA 2ANCA 2IL1A 1KJYA 4DIEA 4TSFD 1W4BA 5FOVA 1R7RA 4L16A 3RWMB 1II9A 4ZKEA 3ZVNA 1X1SA 1DAHA 3Q85A 2ZJ2A 4MQBA 3QXJA 5C18A 3THXB 4IOMA 8OHMA 1X8JA 1B23P 2QP9X 3FFBA 3IDQA 1NG1A 2B21A 5E7JA 4JL5A 1DAMA 2XX3A 2ZRMA 4R7ZA 4XD7A 1MRNA 1VG8A 2QQEA 5CJ2A 2I4IA 4S35A 2FFBA 1ESMA 1N5JA 1SQ5A 3TVTA 3B60A 3LBNA 1GNRA 1MO4A 1X8LA 1YZUA 2ZQ5A 3L0IB 1E0KA 3MD0A 3THOA 2YWHA 4DZZA 3WHLA 2O8CA 4IVRA 3U3MA 4TT3D 4URUR 5BWMA 1Z06A 3QEOA 1Z8FA 3AGPA 1EESA 1XF9A 2OLKA 1L2TA 3W8NA 3W6OA 3EX7C 2AXPA 4LJAA 3I72A 3PUYA 4A36A 2ODNA 2IYQA 2OCYC 4ON9A 4URXR 2BBOA 3U7EB 3P32A 2IUTA 2W6JD 1Y3AA 3KFVA 4JL8A 2B8TA 4M1YA 3AM1A 3LVRE 3VMFA 1NF3A 1ZD9A 2BKEA 3KKOA 2BM0A 2PBRA 4QHSA 4B32A 1ZVQA 3CO5A 2DWPA 3LNCA 4LPKA 3UK6A 4PXAA 4C0KA 1XD9A 4Q9IA 3GLGE 4LRWA 3WBJA 5BYJA 1RYHA 3CR7A 3QKSB 5DO9A 4HB4A 3R8CA 4JLOA 2P6RA 3AF4A 3PEWA 2F6RA 2BC9A 3R9XA 1E2NA 4FMCF 1NN1A 3NH9A
chains in the Genus database with same CATH superfamily
3B3QA 2OE2A 2QD4A 1E9AA 1P0QA 2QZ4A 4N47A 1F8UA 2B4KA 3GJ6A 3OIUA 3RS9A 5CXQA 1HE3A 2Y0BA 3IUBA 1ZMRA 1H0RA 2ZPUA 4KTTE 5FBHA 3KCQA 4FYIA 3BJRA 3A3PA 5FNZA 1M6HA 2VPWA 4BFLA 5KYVA 1ECLA 3K0BA 1P29A 1T9ZA 1WABA 4JT9A 2ORIA 4Q3NA 4J7UA 4PPGA 1JGTA 2Q5CA 4DUPA 4Z6KA 2XWQA 1XO1A 2IGTA 1MTOA 5GM2A 5MFPA 2O7SA 5JE8A 3KM0A 5B6PA 4QSHA 3SYNA 2ERYA 3IYLW 1PJBA 1XVAA 5CA0A 4TV9F 2VXOA 4N8DA 5CH3A 3O8OB 3ZI4A 4US0R 2XCIA 2XBUA 2OXEA 4EY8A 4FNOA 4BN4A 1KAMA 2YV3A 3A1UA 1G2QA 4QXQA 2JGDB 1EE9A 4BFXA 2QR2A 4CPDA 1G7TA 1ONBA 3MAJA 4OL9A 2JAWA 5JMPA 3WIUA 1ULBA 4AG6A 1BS1A 2SBTA 3OEED 1KRHA 2HXYA 3EZXA 2VUSA 4F1KA 2P3SA 4LYEA 4MW0A 1XEAA 3DUFA 4P92A 2FB9A 1R6VA 1J0XO 2H54A 2RAPA 3MFYA 3ONVA 2WDPA 4PX2A 5LJIA 3UJNA 4X71A 2XGMA 1N1DA 2WD7A 3A8TA 1J0BA 3CUSA 3VXKA 4ZYXA 2GM4A 3OZGA 2IUYA 3Q8XB 3WDMA 5A6SA 1KJIA 3UUEA 4JEUA 1K1EA 2VBIA 2E49A 1EP2B 1BWSA 1GWNA 1A82A 1SVUA 1TPZA 1WUYA 2OCLA 2NZWA 3KTDA 1FBTA 3B2NA 5DN6A 4AS2A 1IHYA 4B3GA 2W6ZA 3FFWA 4A3SA 1OF1A 2P78A 4OFZA 3I53A 2H2GA 3W05A 4TS4A 4JLKA 1MZVA 1XA4A 1N5OX 4AB1A 3QHPA 3RIHA 4ARBA 1ABBA 1FFAA 3HA2A 1QU2A 3BJMA 3L82B 5CLJA 3SS9X 1MJ5A 4FGLA 3CCCA 1H42A 3ZGOA 1C1XB 4HADA 3QVVA 2FLKA 1QLWA 5EIEA 1Y82A 3NTXA 4J07A 4OMUA 1V0JA 3LFUA 3HU1A 5FEUA 2R87A 1ZO8A 1F6BA 1JIJA 1NLYA 2VEDA 2ZUFA 1DEKA 2OHIA 2NGRA 1BWRA 3GDHA 5DK4A 2BGIA 5EJ6A 2KMLA 1T3GA 3A1CA 3EY9A 3HL4A 3NBQA 1NJGA 2J46A 3W9BA 5I8PA 4BU1A 4BZZA 2GEKA 2RHHA 3RIMA 3TJMA 3LQFA 5ARBA 5K4HA 3UMYA 2OD9A 2XTMA 4X84A 1CHNA 4O4JA 1PT6A 3HP4A 4ZEVA 4ZC8A 3DOFA 1C9KA 5JY6A 3RCBA 1SVMA 1YZHA 4LNHA 5EKTA 1D1QA 2VTVA 2WUWE 1G8KA 5HK9A 1SK8A 5KC8A 1O8CA 2XDYA 3G1WA 4B0OA 4ND8B 5FR1A 3QJYA 2WNSA 1DSSG 3AETB 3Q8KA 4M21A 2PLAA 2DUWA 5D8DA 4DSTA 5KTOA 3WXBA 5D7NA 3OE5A 4PFKA 1Y42X 4MV0A 4FBLA 4RWZA 1M6VA 2IZ7A 2X8WA 3LCUA 3Q2OA 5SV2A 3SR4A 4PSAA 3HTXA 4QGHA 5FO0A 2PL3A 5CNIA 1O5TA 2FG6C 3ZZNA 4I1IA 4W7IA 2NZ2A 5LQRA 1MRZA 2XQIA 3JASB 1Q17A 2WG0A 4FGUA 1FQKA 1PSWA 1MF7A 2BGRA 3R7WA 4X6XA 3WRWA 1KEPA 5BNFA 1FSPA 1G8HA 1RC0A 3NTVA 5BSEA 1XLUA 4FMPA 4RFLA 3ZHBA 4G65A 4DV4B 2R4UA 1XU9A 3EG9A 4YRIA 4ZPJA 1U0JA 5KOJA 4E6EA 2C3OA 1ZXXA 3ODGA 3EWIA 2CKMA 1T4CB 2A9VA 1GL9B 1UL1X 4RXTA 4AYWA 2ODEA 4CQJA 3OPVA 4Q48A 3H4VA 3K94A 1E7YA 2II6A 2AXEA 3GGJA 5DH9A 3ZZTA 1T5HX 4AX4A 3M5PA 3F1KA 1AU9A 4YUWA 3MTGA 2YV4A 4KAXA 3UHFA 2I6QA 1NU8A 3L49A 3L46A 4LHVA 2JANA 4DSZA 1I0LA 4B2LA 5KNCD 1CB0A 1JPUA 5B7QA 1RAGA 4IZ6A 5DWQA 3V4OA 4XYLA 1Y5IA 4TT3A 1QGUB 1F4LA 1D2EA 3I64A 2BBSA 2GKSA 1CUHA 3EVBA 3EWNA 2RHJA 4JQYA 4Y2TA 4K9LA 3KYDB 2PNFA 3I76A 3KT6A 3DT8A 3R3ZA 1CUAA 4X1KB 2G40A 5LD2C 5J5CA 3L0CA 2OXTA 4CUKA 2D74A 3W2IA 4BYMA 1JE0A 5DLPA 5E38A 3MXTA 2QNRA 4BMVA 5IZCA 4C4AA 1WZ2A 1QQAA 2WNIA 4N5HX 4Y6OA 1XQ1A 5AW0A 3VO1A 1KFJB 3K2BA 1A7KA 4V0RA 2YV5A 3EFHA 5AKZA 1RR6A 1THZA 5K0TA 3IP5A 2ZTHA 3GQBB 3Q72A 4JAVC 3RIYA 2YASA 1D4ZA 1CHDA 4XR4A 1EX6A 3L6CA 1H9BA 4DYHA 2R5NA 4YEDA 1RWXA 4KPUB 1DBSA 1TKCA 4LY6A 2XCRB 1V5WA 3BYZA 4I5FA 2ACEA 3AHGA 1LNQA 1U98A 2ZPTX 5BVHA 4OL0A 1CDOA 4ETIA 3AJ8A 4DRZA 1E0JA 2F1IA 1WZEA 1TXGA 4JUIA 4EKIA 1OQAA 1XU7A 2OSBA 1M1ZA 3HUFA 3IIJA 1VSUA 1H69A 1RAHA 1DIAA 1W88B 1GQ2A 2VN8A 3C7KA 4GPZA 2BEJA 2IZ0A 4M6WA 3FIJA 1MAWA 2G28A 3U4DA 2WBLC 3A7EA 4H17A 1NUAA 2C5AA 4UVDA 3RC9A 3GLFA 3NM5A 4F5ZA 5CK4A 4M36A 1CRQA 1B6RA 2B2NA 3N2ZB 1T2UA 4WCVA 1V4NA 4ID9A 4QDOA 2WPDD 4FFNA 3GD7A 4RKYA 2P9TA 3NIFB 3OUTA 2FPPA 2ZSUA 1DPFA 5GWXA 5AOAA 3LHKA 1IUKA 3BTSA 3WGYA 2RMKA 4CQMB 5JYCA 4IIBA 1KDZA 3VR4D 4Y9RA 1DG1G 2WJIA 3EEOA 1MOQA 3RVMA 3WQSB 4LDRA 3SOPA 1W93A 2WJZB 1JT9A 3RI3A 2RGCA 4HNAA 3GYBA 2IBTA 2D0IA 1LDMA 3M1LA 3AHJA 5CDGA 1J2TA 3HZRA 1PYDA 3CUKA 3Q7PA 1AD2A 1DS6A 1PT7A 4WLNA 3SSMA 4AP5A 2X4IA 3SDSA 3AR6A 5COBA 1YASA 2Z08A 2R6AA 4YVFA 3W5SA 2O2CA 2XVYA 4FEAA 5IVDA 2V7WA 4MVXA 4DLRA 1YQDA 4MAAA 1IQUA 2BFBB 1MKYA 3OA2A 5GADl 2Q1XA 1GKUB 1NBWB 1UKEA 3EZ6A 2DUUA 3SZMA 1G98A 4P3KA 4WY5A 4CL8A 3FOBA 3VV3A 1TUIA 2KBFA 3M5CA 3VH4A 4B6EA 1FFCA 4BB9A 4IOKA 4XYBA 5F4BA 1EDZA 3FVVA 3F74A 5KTMA 3FYUB 3HA5A 1JL3A 1UPAA 2PVCA 3BM5A 3LX4A 3LZDA 3BTVA 5EWMA 1V95A 3JZIA 1FSZA 1NVFA 3UUWA 1O7JA 3ELDA 3NUGA 4O33A 3GCDA 2OGTA 3MCTA 1C8KA 1W49A 5EKDA 5AW4A 2I7TA 1BGXT 4JWTA 1QFYA 2I8LA 2ZE8A 1IBMB 3QNMA 1VE6A 3E81A 4JBWA 1KARA 1S4QA 4R5HA 1M74A 1C0EA 1QH9A 2FEMA 3H6HA 1GZ5A 2CNNA 3B53X 3HCBA 3ISJA 3M1YA 2PUWA 4GVXA 5EERA 5HKKD 1XPOA 4GR4A 2GUGA 2H59A 2D7DA 3BTOA 5H1YA 5KNDH 2AI2A 3OEHD 3CKLA 4R2WA 5DEOA 1R64A 2YS7A 2R3SA 2H5JA 2UYOA 1W47A 3ZHQA 2RE8A 2PX5A 2Y99A 2C5HA 4EYGA 3K8ZA 3VZCA 3RRYA 1ZH6A 2GCGA 3BHNA 3VU9B 3HRKA 5KHLB 3AU8A 4BKMA 1GLVA 2Q50A 4IIJF 4ZCRA 1J8MF 5MFZA 2JLUA 3TOZA 2QJWA 4P4SB 5K4GA 3GXOA 1EGQA 3PUXA 1R3DA 5HQ3B 5SYAA 5DZSA 1X86B 3MOSA 5TGDA 2GEVA 5BY2A 3OUZA 3K31A 2JFFA 2OQ2A 2X2EA 3CIFA 4FFRA 3TCKA 4DLBA 2C4WA 4KQFA 1XCGB 1XFAA 3PC2A 1G9TA 2CWDA 3UOAB 2VNKA 3MGAA 3V8VA 1WUJS 2JIQA 3ERCA 2GGSA 3BD9A 4U2BA 3FPSA 4GWLA 1U9ZA 4CM9A 5EHIA 5C8VA 3RNOA 4R2XA 1X9HA 1YIAA 3BMCB 4KXVA 2BFPA 4BQSA 4AKHA 1QV6A 1GPKA 3LHFA 3W8RA 4DV7B 3TS1A 2VJAA 5AO9A 2HA4A 2XYVA 1WP9A 1RBYA 1RKVA 1TK3A 1KIAA 1DX9A 3MLAA 2ERCA 4R2MA 3QNUA 4QOHA 1EPUA 1P4GA 4OMFG 3D6FA 1LLDA 4LHXA 5GV8A 1GZ4A 1XXLA 2ZIXB 2ZTMA 1NVVR 4UE2A 2GK7A 1O95D 4BUZA 3H2BA 1EX1A 5A6SB 3UKDA 2W98A 2WAMA 2Z4RA 5EJ9A 3GVHA 1RYDA 2PJDA 1C1HA 2DBQA 2JLSA 5JYBA 4H4CA 1EDEA 1Y6ZA 1MC4A 2TMDA 1RZ3A 4YGYA 2X7HA 5D6OA 2CBZA 2G3YA 4IIJB 5EGSA 2NOAA 3EVNA 3IOEA 4CMGA 3Q8MA 1UMDA 4E15A 1DMSA 3ETCA 3QMPA 4RXMA 3NAGA 3I37X 4I1RA 3SF8B 1U63A 3N05A 4OHOA 3GVCA 2ZRLA 3M6FA 3E3AA 2ONCA 2XE7A 1U7DA 4E70A 3QG1A 2EJVA 1WW8A 2ASVA 2O3RA 4MV5A 5TT1A 3H2JA 2ZSJA 4A0HA 4B43A 4BBPA 5ILGA 5TJHA 2A86A 3DH0A 1PGPA 3RU7A 4B6OA 4BGEA 3VU0A 2WMYA 4PQFA 3KVNA 4DV6B 3L1IA 1BYUA 4I5IA 2NUTA 2EX1A 2GHQA 2RI0A 3SJCA 3ET5A 2O0MA 1E9EA 4XGQA 3BMNB 3VDQA 2PV7A 4A6PA 3PJDA 1TO2E 2I8AA 4HF7A 3DMTC 4MWDA 5HRCA 3ETJA 1EJBA 3TAXA 4BC0A 1COWD 1RPZA 4QLAA 2R00A 1FXWA 1HWYA 1PR9A 4DN6A 2XUDA 3FKSA 2D1FA 4DQDA 4JQZA 1GPDG 2YX1A 4C0JA 3K6JA 4CUJA 1NSTA 1EX9A 1ORDA 2DP4E 2X5XA 3BGSA 2BR5A 4YLGA 2MYTA 2WJ6A 5ER6A 4ZCMA 2QN9A 2J3DA 2Y1WA 2HCBA 2YWJA 2ECPA 1OTXA 3ZY2A 5IDQA 3AW9A 2FWRA 4QREA 2PSHA 4PC1A 4RGBA 3WADA 1NURA 4ZMRA 3MWYW 1KRXA 2HU7A 3FTQA 3ZY5A 5JT1A 4JU8A 5B36A 3UMSA 1W5AA 3UA4A 1FW8A 1FXSA 2JDID 3PG5A 4MKGA 3MUNA 5ALNA 4KG7A 5EQDA 3T61A 2Q41A 3TNDA 2UUOA 3OCZA 3D2BA 1SUFA 4BRWA 1RKUA 3MWEA 3ADBA 2VTBA 3IEVA 1UK7A 4KQGA 4I36A 4ADSG 1PR5A 4K40A 2Z0MA 5LCXA 5CDSA 4WLEA 3QWIA 5EPUA 1YDFA 4CU2A 3F8WA 1FMJA 3MBKA 3OBBA 2X76A 3P26A 5JSUA 1IN8A 4G84A 1PTJC 2LVBA 5DISB 1KO8A 5CD9A 2VDJA 3DBLA 4Y2GA 4DC1A 1G21B 1TTPB 2V7UA 1QDLB 3IQIX 2IYEA 2NXJA 1YT5A 2JASA 2XUHA 3FGOA 1E5TA 5CA1B 1DX6A 4UM9D 1VGVA 2ROQA 3C3MA 4P0TA 3ZK9A 3U80A 2YZKA 1ZZEA 3AUTA 3N9IA 5EHGA 1UZMA 5IABA 4RA9A 5KYWB 1U0BB 1O6CA 4E4RA 3HCFA 3ORSA 5I9BA 4F9FA 1NJSA 4CUZA 3NHPA 4WD3A 3NVKI 1VHDA 2NVWA 4MVJM 1R5OA 3VU8A 3LBAA 4CEIB 1D2GA 1HDOA 4FONA 1TQ2A 4I6EA 2CHVA 3GRUA 4JT4A 5C1BA 3KD2A 3COSA 1U8TA 3KDSE 3WIBA 3L6BA 3ZG6A 4E7PA 3TGPA 1MVOA 4RGYA 3KJEA 1QXSA 2E4YA 2I1LA 1Q0SA 2BL4A 5LBIA 4C29A 4XUEA 4HVLA 2PPLA 4BFWA 3KNZA 1I30A 5KYTA 2WZCA 3LNTA 4YUZA 3RK4A 1WETA 2PRYA 3BXEA 4P5EA 3Q3HA 4OFWA 4Q4JB 2R8RA 2ZE5A 3PHBE 4QODA 1A77A 3PIIA 3P9SA 1CY0A 1D1SA 1ODSA 2X0IA 2RDMA 4MVYA 1NLZA 1GUDA 4LF9B 2FEOA 2V6IA 1T3ZA 4TS9A 2R60A 1MABB 4HGQA 2I67A 2P4QA 3JZAA 4JB3A 3EB9A 3QW4B 1LBTA 4MB0A 1C4WA 3DDOA 1PEDA 3I4FA 3P9ZA 1CJUC 4IY1A 4BVBA 1C9EA 2SCUA 5GP1A 1HQYE 2UVPA 2W9XA 3OX3A 4O0MA 3AY3A 4RAQA 3B38A 1W1UA 3JX9A 3INGA 3UANA 2WFMA 3NDRA 2I87A 4I50A 1K06A 2F67A 4CIYA 2J0SA 1YULA 4L72A 5A03A 5LQCA 5IDWA 2J30A 1Q1BA 1SWVA 4MP8A 4G4GA 2HBZA 2JRCA 2NO7A 3P4XA 4KSBA 4YAJA 2IZZA 3WFJA 3RAFC 3CBQA 3QTBA 4EBFA 3UAOA 1T0UA 1IXRC 4IYJA 1FP2A 4MR8A 1OA0A 5B58C 3HUDA 4LDNA 4EPRA 1IWPB 1K92A 1NVBA 1VYVA 2Y4OA 3NYQA 1FMFA 4JBIA 1WPXA 3ZGNA 1UMCB 3OJLA 4HH1A 4D4IA 3IHLA 3RUHA 2GCIA 2OV6A 2OWDA 1U2TA 2D4HA 3FOCA 1X74A 3THSA 3NASA 3ESZA 3ZQJA 2ZVJA 4JXXA 3KYIB 3EQ7A 4QQRA 5CT4A 2F3PA 4Z3KA 3LLCA 4MW6A 4I4TF 3QUSA 2CB9A 1N75A 3WSVA 4Z4IA 2K2QB 2HQBA 4G5GA 2I0FA 2HA7A 2Z2YA 3E15A 3GJ0A 1MPTA 3DE7X 4G26A 4Y2VA 5C34B 4BP1A 1JXMA 3UK1A 1K75A 1ODKA 3RSQA 4N41A 1VE5A 4IS2A 3SGLA 2EBWA 4BCBA 4EKNB 1OX4B 2AX4A 2QTZA 1Z73A 3W5HA 1I2AA 1IL0A 4V0SA 5FNVA 7MHTA 4DUGA 3PHGA 1DRWA 3ZHCA 4AI6A 3VR6A 2HA3A 2I99A 1XN4A 2WWFA 1EXVA 1KFCB 1MHPA 1SQSA 3IMCA 4EMBA 3UGQA 5LOVA 1R0XA 4JUCA 3JWHA 1WXQA 2TMGA 2H1IA 2ZR8A 2ZJ5A 3HPQA 4P35A 2QLMA 2W6NA 4GNRA 3EA0A 4L02A 1VLJA 3LBIA 1DKQA 1QHHB 1SH7A 1XXHE 2AQKA 1IWBB 3AEKB 1P39A 4Q3EA 2W48A 2NT4A 4D9IA 4RVCA 2PKXA 1YS7A 3DEHA 2IS1A 2ZTVA 2WAAA 5G53C 4HZIA 4JWKA 4D0NA 1HOTA 5JCXA 4JBXA 1I7LA 5K3FB 1WHSA 3VC3A 1G5RA 5KEIA 5GTDA 2G82A 5IM5A 4KIFA 1IHUA 2BZ0A 1U6IA 4V03A 5CHYA 1U3WA 2VYVA 4NH4A 4DY4A 3OCYA 4LE1A 1OX6A 1X7WA 3OMWA 3QV2A 4UVHA 3GL9A 4I4TB 2H3HA 4AN4A 4EL5A 3E7WA 3KDAA 3QU2A 1YQTA 4NF2A 2C2OA 4WZAA 1GU1A 4EVQA 2B1QA 2ZATA 3QFCA 1M33A 4RNDB 3WWOA 3D6HA 3CMCO 3JQ8A 2NYAA 3DONA 1ZOIA 2V7XA 3LQRA 4K9QA 2SHKA 1CYDA 3D02A 1AQIA 4KDRA 4QTXA 2V1UA 3ZY3A 1UR5A 3AFOA 1C2YA 4J16A 4J75A 4YYEA 2V9PA 1OJ7A 1JHZA 2VYNA 2DPXA 3IEKA 3EGIA 3ZHOA 4YT8A 2UXCB 3ND8A 2CK3D 2I4NA 4PCUA 3SF0A 1E4YA 4G01B 1RFLA 1UXGA 2I66A 4JOSA 4ITUA 4M0DA 1GKIA 4AZ3B 5TEVA 2Z2ZA 3PNPA 4MLCA 3TVDA 3UA3A 1AH2A 1MDFA 1TEXA 2FRDA 3DPUA 2DBRA 2IBSA 2J3KA 3K0AA 1L7RA 1BGWA 5B3LA 1M2OA 1S8FA 5D01A 2DX7A 1VFPA 4Z9YA 3CZQA 3DXXA 4MR9A 4OK3A 1ZNQO 3ZWKA 1UXOA 2CK3A 2EQBA 1GCIA 2G4CA 4J2HA 4RO0A 4TXLA 1R8JA 4MS4B 4D8UA 2QMUA 3DKKA 1TCAA 1QIEA 3KHTA 3ND6A 2N9UA 3TLBA 5CG2A 3U4QB 1GXSA 3L05A 1JB9A 3OU7A 4L74A 2VATA 3TKLA 3ZVMA 1ABEA 1TM1E 5A5EA 2X0EA 4QJBA 3ELUA 1RMQA 1QIDA 5LR6A 2NZJA 2O1SA 3V55A 1H1LB 3TBKA 1KVRA 3I05A 5EXDA 4AZVA 2I8CA 2VDWA 5I7WA 2QL7A 2QL6A 1KE2A 3B5EA 1DC5A 1SVLA 4LGVA 3AUSA 3GPCA 3RKRA 1AHPA 4RVGA 2UYHA 5EQFA 1K0FA 1M1NA 2VTEA 2BFCA 2WWGA 1QAQA 3V8EA 1G66A 4OI1A 1BC5A 1I4WA 4KRYA 3R5JA 5F78A 1A2BA 3NOQA 1GO2A 4DDHA 4YXFA 3UGJA 1CNEA 1N32B 4CM7A 1SG9A 2J9RA 2TECE 3HY6A 4QHTA 1AKQA 2G9VA 1TIPA 2XUJA 3FPAA 1P9NA 3IUSA 4H6VA 1ZD5A 1K6XA 4UDYX 3DAPA 5JCPA 4LYFA 4TWRA 3CZAA 1A04A 3PXAA 2OYCA 5LZ9A 3I9V1 4JS0A 5HIJA 3VKVA 3N87A 5E0OA 3Q7IA 1C29B 1BROA 1S3IA 1T9CA 1KMMA 1SIOA 2JLRA 3JQ6A 2C7VA 2PX2A 2QYTA 2RHCA 2VJQA 3IR7A 3U09A 3Q3JB 4O2BA 3TDMA 5FQNA 1G8FA 3FRIA 1Z4IA 3KJFA 3HEBA 3KPVA 3RADC 4X0EA 4P0QB 2QVBA 3E61A 4RY2A 4ZU3A 2DEUA 1DRVA 3ASZA 3SMQA 3SI7A 3D8RA 3E0QA 1ZJ4A 1J20A 2AE2A 1H94A 3U1TA 1Z0FA 4B9EA 3P9NA 2XNHA 4C4SA 1VDMA 1BKYA 3JY6A 4BNHA 1YZTA 3PA8A 5K3DA 4G1VA 2OCPA 3WICA 4BVEA 4D99A 2B6NA 1R50A 1DXYA 1ZN8A 3IUYA 3GGPA 2WC1A 4FN5A 4ZAYA 4TUYF 4ZTUB 3V2GA 3NX4A 2QY6A 4L95C 5GV7A 2Q0HA 3OQMA 1PLLA 3HBLA 4I3FA 4JLJA 3T7DA 3D1JA 2IEZA 3FTPA 5LNK1 1Z56C 4IGFA 4BAGA 1FOEB 1E1YA 4H1TA 2QP4A 3NBYC 4QYWA 5DRYA 2IOFK 1H2FA 2EKDA 4EPYA 1W1IA 1DFHA 4V39A 4Y18A 5I4BA 4C0HA 5JJCA 4GFDA 3ILXA 4NZYA 2FRVA 5HDBB 4CKWA 3L0DA 3U4GA 3DR3A 4FZVA 4R5MA 1U3TA 2CHGA 3CH7A 2G1UA 3P0IA 2HF9A 5L3ZA 1ZAKA 4H0FA 4ZCPA 1PU2A 4FSXA 1K0UA 1OI2A 1REQB 4KLZA 3DCJA 5LP6B 3T3NA 4RK1A 1XA3A 4MS1A 4OXIA 1KI9A 5K8JB 3F46A 1ZCZA 2FLVA 4BMCA 3A10A 2BR4A 4CR6A 2HSJA 2QT0A 3KQOA 3TSZA 2B3DA 3ILHA 2NU8A 5EMJA 2OLEA 3PB3A 5B2FA 4C7KA 3NIWA 5HJ7A 1I8TA 2RHLA 2QMZA 2VHTA 4J1QA 4M1MA 3ETGA 4QUDA 3SAJA 1ULHA 3HHEA 2GT1A 4R0NA 4B2IA 5FUBA 5HTKA 4BECA 2ILVA 3OOWA 4QU0A 2ANBA 5BSTA 4L8FA 2H2IA 1QH1A 3WSWA 2VPPA 4ZODA 4C6RA 1QAMA 2GJSA 5DSTA 1VPLA 1B3BA 3DTVA 1EUDB 1JSZA 4JNKA 1EFKA 1WBDA 3REQA 1OUMA 2QI9C 2YHSA 4RIGA 2AEEA 3TTYA 3FOEC 3UBTA 5EFOA 1ZPDA 4GIBA 5G0WA 1NX9A 5FRDA 1GSHA 4YRMA 2GB4A 4GS5A 3WO0A 1VPDA 1OFUA 2QWXA 2QYSA 3INTA 4Z4HA 1R00A 3PPWA 4X45A 3VPGA 3PJEA 1DKOA 3IPAA 5F1KA 5I51A 1NPDA 4MVJF 4ZAVA 5ULLA 4NBKA 1RI4A 3W6ZA 3ZBPA 4KLCA 5DE3A 1OAAA 4YAOA 3OH8A 3ITEA 2MSCB 4ARZB 3U3XA 4Y2HA 4W5HA 5ENDA 4PZAA 3WJAA 1P2GA 2YBDA 3R74A 4Q21A 3W7BA 5CM9C 1UKBA 3AY7A 2XYHA 1XAIA 5B53A 4D82A 2ZU0C 2AD1A 2FW6A 2A9OA 3VU1A 3G8BA 3WX0A 5LZ5A 3WGVA 1XXHA 5DRTA 4E0BA 1T2FA 2Q9CA 3DT6A 3IRVA 1X15A 1YVRA 3GPLA 4B35A 4F9TA 1P2TA 1TC2A 3SR0A 5F23A 1Z45A 3FVQA 5KIAA 3SC2B 2XNSA 1E64A 3N7TA 3GNQA 5C7YA 3PUZA 5A7GA 3KFXA 4NR0A 2R6FA 4PQYA 3LYUA 1U2RA 2PUHA 1OI7A 2XYGA 3OKFA 4QT4A 3C1AA 1TM7E 1OLXA 2Z58A 3WDLA 1ZM3A 4CMEA 4XFDA 1XMPA 2CF6A 4QDUA 2IV3A 3KQLA 5D3MB 1G21E 1N1GA 4YPFA 1G38A 4BCCA 2HU8A 4QG3A 3LSTA 1Z2AA 1PDWA 1KSJA 2DTDA 4INZA 4DT1B 3U44B 1QX3A 4OGFA 1GD1O 2BCEA 3FMGA 3M82A 4HEA6 4URWR 5KJ1A 4GPTA 4LYAA 4I4TA 4UNQA 2C82A 5CM2Z 1UOEA 4W5OA 1TZBA 1YRAA 4OLBA 4F71A 3CTMA 3ZU4A 2FXVA 1XVIA 4X7RA 3MPUA 2B35A 3TD2A 4CQLA 1SVIA 2WG2A 4P5PA 1G5PA 1YONA 3VAZA 2BW0A 1UZUA 4MZDA 1ONPA 5KYKA 5FBLB 4JSRA 4HP8A 4GKJB 4R7TA 4OP3A 2EG9A 4P2BA 1ABFA 1MN6A 2OM6A 4L15A 4BV9A 2CXXA 4GPEA 1NQWA 2VBCA 4JUAA 4RETA 2A3NA 2WILA 3MVEA 1YU9A 1FYDA 1JLRA 1VDZA 2MYPA 3F4LA 2Q2WA 2B7LA 3L7AA 3MT0A 3OJOA 4W99A 5LA6F 4AUMA 2FQWA 2CGEA 1E1MA 2XCLA 3DLHA 3G13A 1SPBS 3WGJA 1YK1A 1A8SA 5AUOB 1W0KA 5FT9A 5FDFA 2O14A 3V8BA 1IONA 4G0UA 3U5TA 3PQ6A 1FNSA 2B4TO 1RYNA 4G5OA 3T5GA 3W4JA 3G9ZA 4C20A 5FX2A 3DDHA 3QBTA 4CTOA 3E1SA 3ABIA 3SC4A 3VOAA 5BV2P 3H65A 1OXUA 4K87A 5I4KA 4PLVA 1E2QA 4TMXA 4KVFA 4QGAA 1WUTA 1FX0B 2A35A 2DQKA 2D1RA 3AJEA 3BRSA 3GRKA 3IHTA 3DZFA 4O2AF 4WLOA 5F21A 4CVNA 4YMVA 1R15A 2DQSA 2O5RA 1ITZA 1U4SA 1P1CA 1DG9A 1S8AA 2QLBA 4XOUA 2D7JA 4RZ3A 3DQQA 2WOOA 3E1GA 3HEMA 2R79A 3VHXA 1KZ1A 2HUPA 5JYDA 4D42A 1RYFA 1GSAA 3E9QA 5T6BA 1B43A 3U7IA 4PG7A 3A14A 1G291 1E94E 4QBKA 5AI8A 4LWQA 5LP6A 4I99A 1LW7A 1ST3A 4CG0A 3JCZA 3UJBA 2R7MA 2JS7A 1S01A 1KAQA 3AUAA 1KEWA 4QDKA 2GJ4A 1UBNA 2PL9A 5SICE 1YGPA 3JR3A 3KE8A 4AJ9A 1BHSA 1A95A 4JEHA 4YACA 5EP2A 5EMKA 3GR6A 1N6RA 2MU1A 3HB7A 5F3DA 4E14A 4EHFA 5LLTA 2YUTA 3FCAA 4MB6A 3ETNA 3ICWA 4TLDA 4EG0A 2NSYA 1IULA 2JHPA 4F97A 3TQSA 2C84A 4TKUB 3LXXA 1BW9B 4RK7A 2CNDA 3VNBA 2ADFA 1C7JA 5IAAA 1AUOA 5EZQA 1Z88A 4CI9A 3MMZA 4MPPA 1O54A 2VDKB 5JLAA 4NZ9A 2WD9A 2WYVA 2P1RA 4Q3LA 4XGNA 1FMCA 3RBAA 2OBNA 4XWYA 3DB1A 1IM2A 1MLDA 2BY4A 4J94A 3U7FB 5LQSA 3ZJ5A 4ZVQA 3QE3A 3ONEA 5BR1A 4NMXB 2G9UA 2O2JA 1JR3A 2B0CA 2JI6A 2WIAA 4LVOA 2Y77A 1KI8A 5FJJA 3B13B 3G7NA 3H18A 3RRXA 1GFWA 2FNAA 1M2FA 1ZHFA 4KE6A 4IDDA 2C5LA 3WYEA 1UZAA 2AYXA 2VF8A 3DV9A 2J87A 1TJPB 4HB3A 3LQKA 3QOWA 4KMSA 1U8EA 5A3RA 2QU7A 1K2WA 4ZQIA 5JW6A 2AYYA 1XRQA 2IQIA 3ECSA 3QKWA 4P3PA 1GU0A 3RVKA 3T9AA 2PQ6A 1GAWA 2Z5FA 5DW3A 3TLGB 3VR2A 1QE0A 5C4GB 2C7QA 3MINA 1SG0A 4I55F 1KGDA 1SXJE 1T5TA 3WL5A 2BSAA 3G0HA 3W5CA 4HAUA 1JFTA 2GK6A 2EL9A 3O8CA 1JHQA 1G5HA 1UDCA 5LYYA 3OFSA 2ZAGA 3NGLA 5TVGA 4Z54A 1BS2A 2PKQP 1CUWA 2BFEB 1JH9A 4IO0A 3C3EA 5E2AA 4JSYA 4ER7A 1E5XA 2CE7A 4FE3A 4TTQA 1QPGA 3WFIA 1TAGA 3AUYA 3PA6A 4DDTA 2O3UA 5JJIA 2FZCA 2AD5A 1UBFA 2CUNA 4EO9A 5CFLA 1TI7A 3FE2A 5IJAA 2SECE 2Q99A 5FA5A 4B4VA 5KREA 4BE4A 1IZ0A 3IUQA 1H9CA 4ZOLA 1MB4A 1PDVA 1M34A 5BYBA 5M3BA 4FYKA 4ND7A 4D4JA 2ZJZA 1T0IA 3A28A 4Z9BA 1NKVA 5JDIA 1VKRA 2P8SA 4HDSB 3OZCA 4X95A 4LWZA 4JLPA 1VHLA 3T1HB 1KJWA 2VUUA 2IUUA 3RYHB 3WZLA 1PLJA 5IPFA 3I5YA 1YKSA 4IRUB 4PCAA 1Q1ZA 2O0KA 2P9EA 2VWQA 2A0KA 2LV8A 3VR3A 1WR8A 3UAVA 1W2WB 4R1OA 4RVDA 3DDUA 1JIUA 1B8PA 4X9XA 4FR5A 4E5NA 3PUVA 3KKNA 1E2EA 3THWB 2WD8A 4EECA 3DE4X 1N2SA 4I9FA 3T1OA 4RSGA 2J33A 2A9QA 1L7OA 4BKRA 4HGOA 3EDCA 3I73A 5KNLA 1YNSA 3JWIA 5K0ZA 1EG7A 5JISA 4NLLA 1K86A 4OAQA 4US2R 4C0SA 4XSVA 2CYCA 2O3QA 2Q9AA 2R8BA 4QLBA 1E32A 1FRFS 2X3FA 1EA5A 2OV2A 3E8XA 3KPWA 4RDCA 3CUVA 1UDAA 1FLAA 4BQQA 1FS4A 2QF7A 1E79A 1WP4A 5JRZA 3VUFA 2JGAA 5KX5B 4S1WA 2H8GA 2K87A 3L2OB 3QX7A 4G6ZA 3H16A 1M7BA 5FL7A 5JCJA 4R1SA 3VR5D 5AVVA 3O8LA 5ECWA 3U1BA 4QWWA 1HK7A 3GBPA 3PIDA 4JNCA 1T5OA 1TKRA 1QG4A 1W85A 2XW6A 3KWMA 1XZKA 1M1YE 2XUOA 3IO3A 3MN1A 1QVZA 3W3AA 4OY3A 4PAQA 4WSOA 3BRWD 4MITA 3MHTA 2Q27A 2R8PA 4Q7KA 1JEYB 1JAHA 4W4TA 1IOZA 2HZBA 4PHFA 5KYXB 1X1QA 3CF4G 1MX3A 1TEHA 3DL7A 4L6AA 1L4YA 3IBTA 4DGSA 5J43A 1GY8A 1KOLA 1X87A 3MS4A 1ECBA 4E5YA 5IVPA 4MVCA 1GARA 2VHEA 1H3EA 2DPLA 1BMFD 3HMKA 1OXBB 1TFRA 1LQTA 1M2NA 4GRDA 1R4MB 2ZIUB 4JODA 5FLYA 1JWBB 1YQWA 2PKWA 3D5QA 5L3SA 2FMTA 2IY9A 1EGAA 4IHJA 5AM4A 4YAKA 3ZE6A 721PA 5A5FA 4UE3S 5A4MS 3KT0A 4QSMA 3AEUB 4JI5B 4IKPA 1QVRA 4LZPA 1V7ZA 3PNQA 1LU9A 4IZHA 4DZRA 3G5UA 1RJ9B 4JFAA 3DAYA 1U7XA 4IIJA 4U8GA 1OVMA 3P2EA 2P2GA 1FP4A 1PJ3A 1YL5A 2C31A 2FWPA 2VP0A 1EWTA 3PC8C 2V3VA 1XQYA 4D25A 2OCIA 5FEMA 3U44A 3BK1A 3E18A 3JQFA 4I1SA 4RABA 3ZD8A 5JALA 2DM6A 2QJRA 3BWDD 2QR3A 3FUUA 1U0GA 3HBNA 4MV3A 1E58A 3RPEA 5A5GA 2X0KA 1R10A 4C4XA 2LRHA 1R27A 2PMBA 5AM1A 5KDDA 1AT1A 1N8TA 2W2TA 2Y6VA 2FPGA 4CM3A 2AR9A 2GASA 4RQTA 3K0CC 3RG2A 3NPMA 1DGQA 3HJNA 2VDNB 2Y0CA 4CIBA 1XBTA 3X44A 3N0TA 4PTLA 1X7YA 2GF0A 4PYIA 4KWEA 1HFEL 2C9BA 5EIHA 4AO6A 1A2KC 4K9NA 4RCVA 4G5HA 4AROA 2H4WA 1BE6A 2HMVA 4Y6SA 5CW1A 4TQUS 2NU7A 1TF5A 3VJLA 5SYNA 3O31A 3H1FA 3KUDA 1VIVA 3SG0A 3X2SA 4RCYA 3C74A 3OZFA 2YV1A 1MAHA 4N3AA 1JBKA 4QUIA 5BXQC 2QVYX 5F1OA 1VRCA 3D1LA 3PZBA 4MEBA 1Q6ZA 3JQCA 3TR5A 4NYMR 3FWHA 2DTXA 1RCTE 1ZSYA 2B98A 4E2ZA 4OQQA 4V0LA 4YAUA 1Q91A 2VJDA 4BEJA 1X19A 1FTYA 2OAQ1 1ELOA 5DF1A 3DE0X 2W4MA 3N3AC 1NFFA 1HF3A 1MCZA 2JGDA 1I0IA 3GNSA 4P3YA 3FFTA 3WKBA 4TMTA 4X61A 1RI5A 1DDGA 1CU1A 1EZ4A 4NBRA 4WQMA 5IULC 1IUOA 4G5RA 1SHJA 2H06A 3D7LA 3H6GA 3PCRB 2A9JA 2GK3A 3FRJA 4ZAXA 5ALDA 2C0QA 2O2EA 4J3FA 2WJAA 2IEBA 5BN3A 3GLRA 3HBMA 1RPAA 4J4TA 2O6HA 1T9HA 3K70C 5BOSB 2ZCUA 4U2DA 1JKXA 3KFLA 1V8OA 3CM0A 2X2PA 5D1NA 3ZW9A 3F96A 4PLCA 3IE1A 1XWIA 4L5IA 4KX5A 1IE3A 2HJWA 2F90A 2N47A 3GDWA 3COJA 5DFAA 2DLCX 2F8TA 1L4LA 1FUYB 2CCKA 2P3QA 2Q6LA 2JA2A 1N6LA 1FP4B 3O83A 3NQ41 6PFKA 2A1UB 1BW9A 1KWGA 4B33A 2BGGA 1ZCFA 4HAZA 1A4IA 3INRA 2GDZA 2ZBGA 3VO9A 5K8VA 3G5LA 1GFSA 1EP9A