1CR4A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dtdp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
243
Chain Sequence
b'MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRGGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 74
structure length 243
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr4A00
4XD7D 5BN5A 1IJEA 4JT4A 3CX7A 2XXAB 5AJWA 5CITA 5BN4A 3ZLJA 3ZD7A 3QXCA 4LBYA 2GRJA 4G01B 521PA 2QMEA 4CYMA 2CCGA 1MO4A 5CM9C 3WMFA 3KJGA 4EDHA 3W5IA 1U0JA 1ZC3A 3W6OA 2O8FB 3IDQA 1E1QA 1EFCA 1KSHA 3IHLA 4II7A 1Z0DA 1OIXA 1HV8A 4B32A 2FFBA 4UXHA 3TUJC 3CLVA 5CLQA 5LPNA 1ZM7A 4CVNA 3GJ4A 1OFIA 4LGMA 4BLTA 4PC1A 1EFTA 3W3ZB 3AV0B 3NEJA 2VP2A 2XTMA 5F9FA 3W8RA 4D81A 4ITRC 4MH0R 1UBCA 1ZU5A 3L0IB 4QHTA 3ZH9B 2Q0HA 5JRZA 3L8YA 4JJZA 3T1QA 1XPRA 3GLFA 2HEIA 2QM7A 3X2SA 2QEQA 2WAXA 4NHOA 3UMRA 3DMDA 4ZCIA 2IYYA 1GIAA 4TLEA 1IXRC 1XXHB 3M0EA 3QUSA 5LB2A 4F4JA 1XP8A 4C0BA 1UEJA 4B2LA 1D2NA 1RRGA 3ND8A 2ZRHA 4LJ6A 1R0XA 2F9LA 1R8QA 5HE9A 2B92A 5KNCA 1I4LD 1WBDA 3K70C 1N2CE 1G4UR 1SKQA 2B8WA 2W6IA 1EESA 1P72A 3R8FA 2VLIA 2RH5A 2Q3FA 2C9YA 4EKDA 3R9XA 1E9DA 3VQTA 1VKJA 1SXJA 2ZR7A 4MRPA 5B58C 1WCV1 4OI0A 2BMDA 1NG9A 1XMVA 4Q4LA 1CEEA 1LF0A 2C03A 1OH8A 1KDRA 2Q9CA 2DR3A 3WHKA 1F2TA 1WMSA 1KZGB 4JMPA 1QHNA 3L8ZA 4JL6A 3AKYA 3CPHA 1G16A 4DJTA 4KITB 1ZIOA 3FFBA 2FEMA 4TMVA 121PA 2FA9A 2PL3A 4HUQA 2CVHA 2ZSBA 4UJ3A 5JWHA 4AKIA 1K8RA 1W5TA 2IHBA 3OEHD 3MAAC 2KBFA 2R6FA 4H9GA 4IEEA 2O8EB 4BLPA 4A0FA 3VKHA 5JS7A 1NL3A 1XTKA 2V7QA 1MH1A 3LAWA 5KHOC 3CX6A 4TTRA 4WZ6A 1G8YA 5CB6A 3GD7A 1GG2A 2WBLC 3KFVA 3NC0C 2A5GA 3BC1A 2Z6VA 2ZS9A 4LRWA 4P4UA 5FL7D 3UWOA 1BH2A 1G8FA 3PVSA 1EFRD 2PT5A 1NVVQ 3BXZA 5AJXA 1UKVY 4H1UA 3RHFA 3BRWD 1HH4A 3K70D 4N0EA 4CZ2A 5M04A 1G8PA 2WWHA 4ASUD 2YV5A 3LA6A 1KJYA 5FOXA 5FTKA 1NVXQ 2ZRCA 2ZRPA 4X8HA 5FPKA 1AM4D 1SXJB 1EXMA 1TTTA 2J9RA 2IUUA 4GOXA 5C18A 2J87A 4HAZA 4U5XA 5H8WA 4M9SA 1SVSA 1IAQA 1E6CA 1KK0A 3T5DA 4TL6A 5L3QA 2GK7A 1JEDA 2IYVA 4O0MA 1JAHA 3MWLA 1R4AA 4JVLA 3W6NA 2RHMA 3LVQE 4D4LA 2ZETA 3PIRA 2W00A 4HAUA 3PUWA 2G88A 1GL7A 2OBMA 1S3SA 1XZQA 3Q8XB 1J8MF 4Q4AA 5HZHA 1R10A 3QNUA 4PHGA 2Q6TA 1RC8A 1G1MA 3A36A 3RC3A 2VRWA 2CCKA 1UKZA 1X1RA 4UNRA 4M8NE 3IBYA 4KFSA 4Q1AA 2IXGA 2W2VA 3K0FA 1NBMA 4PPFA 4W5JA 2P0EA 4N3NA 4BEJA 2OCBA 3QF4B 3WNCA 1U81A 5HZKA 4OK6A 3AP3A 3K9NA 2IEYA 3HPQA 1VHLA 3LXRA 2VEDA 4B3GA 2GF9A 2YC4C 2HJGA 4JBXA 4NP6A 4V0NA 3RLFA 3U61B 1CJKC 3I62A 4BLSA 1BS1A 3RWOA 2UZ3A 3KZ1E 1VCIA 3AVTA 4NCJA 1YR9A 3LDAA 2ZJOA 1XTSA 3OFND 4V0KA 4WAUA 3T5GA 5FR2A 1XXHE 2KJQA 3TIFA 5G53C 2BM0A 2ZTSA 3AF3A 4PPNA 2CL6X 4V0ME 4IJMA 1XD9A 2WWGA 4QGGA 1KNXA 2KWIA 3T35A 4BFVA 2RGXA 2OLKA 4Q4JA 4NCHA 3FFAA 4GPTA 4UKDA 2OILA 1FW6A 4PSAA 5FPHA 3T12A 3QJYA 5EJEA 4MYHA 4MGKR 4EIWA 1M2OB 3A4MA 3QKSA 2DFTA 1ONBA 4DLRA 4QBFA 1ZM9A 2JCSA 4JLDA 2C77A 3QXXA 4OHXA 2ZRMA 2ZIAA 3Q7QA 5B30A 5BW8A 1IN8A 2GCOB 4YLGA 3CPEA 2VP5A 5K8IA 4O3MA 2BIFA 4JLMA 4HB2A 1ANKA 4LBWA 1E9EA 2BOVA 4RD1A 1JR3A 1XCPA 1KAOA 3EWSA 2VO1A 3ICQB 4D4JA 1S4QA 2H1LA 1E2MA 5TB5A 3CH4B 2YZ2A 4MDEA 2RHDA 2IXFA 2A5DA 4MYTA 4KBGA 4M9XA 1OFUX 2C95A 5JSZA 4RZ2A 4M9QA 2BMFA 5AR1A 3PENA 3C5HA 1JR6A 4DB4A 2A78A 1MT0A 1P2TA 4LHZA 4MGZR 4Z8YA 3RVBA 4D4KA 1CTQA 4JBYA 3RRZA 4HZUB 3SJBA 4B3CA 3AUXA 5EP1A 1GKUB 2AL7A 5H1YA 4FMBB 4PZLA 1FNMA 1NY6A 2NO1A 2ZXUA 3B82A 4TTPA 2XZPA 1W1WA 2B7CA 3NDPA 3VR6A 1M7BA 1BIFA 2XNDA 2H8KA 5JBQA 1QG2A 4V02A 2QMUA 4MUAA 1RRFA 5LBIA 2QNRA 3GJXC 1T91A 3QXHA 4EFMA 3BFXA 1P62B 1Z0AA 2PZEA 3UATA 1P2SA 1Z6YA 2GAOA 3NTUA 1GSIA 4DC9A 5B64A 4GFDA 2LKDA 1GUAA 4RVCA 1R5OA 1AQUA 1P5ZB 4W7SA 4DEYA 3SHWA 2IXEA 4QGAA 2NOAA 1SXJE 2DCUA 3W8NA 2L0XA 3QKSB 3BH7A 4WW0A 821PA 1GKYA 2NGRA 3C7KA 3L0PA 2XJ4A 4AKEA 3NH6A 1BMFD 1A5TA 3EA5A 3FWYA 3KX2A 2ZAMA 4YMSA 3ADDA 5JJLA 3P20A 3CRQA 1XX6A 1ZJ6A 3KKMA 4TL7A 3ZIAD 4AI6A 4F4CA 2WKPA 4MKFA 1XZPA 4MA4A 1XEXB 4GSYA 5DE3A 2ZM5A 4PSKA 3QPVA 2ZVPX 2JLYA 3K0CC 4GL2A 1FPMA 1SVKA 2JJ1A 1OKKA 3C15C 2QQEA 2FSGA 3K70B 3OFNA 2FE4A 5DN6D 2AD5A 2Z0MA 5C2JB 4TYQA 3QKTA 4YMVA 1TQ2A 4DDUA 4V03A 4PO8A 2EFCB 4A6PA 3L43A 4A8JC 4TMKA 3C4JA 2VL7A 1E99A 1NJGA 1TAGA 2FSFA 1XBTA 2AR7A 2ODNA 2EFGA 4P31A 4YMWA 2GEVA 4LV8B 5JEEA 2HT6A 3EZ2A 1LB1B 2GJSA 4Q48A 2I1QA 4C0QC 2XZOA 3CRW1 4L4UA 3AVQA 3UKDA 2R9VA 2I3BA 2JDIA 1KNQA 1LS1A 1Z6TA 4B48A 4FCWA 5C4MA 4Q7KA 4C0SA 5HKKD 2AD1A 2I1VB 3HPRA 2AXPA 2IYSA 3MGCA 2V3CC 1Z5ZA 3S1AA 3KB1A 4QXAA 1GP2A 1ZM3A 1W44A 3U3MA 4G5OA 3VKGA 2V1XA 4OQFA 5AUQA 3RS3A 3FB4A 4DDWA 4KFTA 3ND9A 4CIDA 4M1MA 4PAQA 3K9HA 1O87A 3L2OB 4US2R 2GJAA 2PZGA 3CNLA 1ZD9A 3HP1A 3HR7A 4D6PA 1E0KA 3SQXA 5SZJA 2NZ8A 3A1VA 1W4AA 2HV8A 3BH0A 2HXSA 1IOZA 4KV9A 1OH6A 1T3SA 5FBRB 1E96A 2GZDA 2IYLD 4PC6A 3G5UA 4ILEA 2DFLA 2ZEJA 3LFUA 2PJRA 4DCUA 2GILA 3AVOA 4B35A 1NKTA 4A0HA 3ONWA 2YHSA 4NYJR 3C14C 2ZYVX 4MKHA 4ZPXA 1TADA 2RGEA 2QU8A 2ZRIA 3LQRA 3Q5DA 3BOSA 4UNNA 3X1DA 1NIJA 2W83A 2FU5C 4G5RA 4XSHA 1GRNA 3AKEA 4B2IA 1UDXA 2FNAA 2GEUA 3IIJA 3TR0A 4EPWA 2XX3A 4IDOA 1ZCBA 2XGJA 3KJHA 1Y63A 1ZM4A 2WIAA 3ZVRA 2WHXA 5J47A 5CM8B 4LK2A 3QVUA 4IKEA 2GXQA 3AEZA 2ZE5A 5DSZA 1YZQA 3ZIAA 3F5FA 4B74A 2ZSDA 5JCZA 2Q9AA 1SKYB 2J41A 2D74A 1NI3A 1KZ7B 1ODFA 3S1AB 2WSMA 2NPIA 1DAIA 4RD3A 3N5CA 3DOEA 3DL0A 2KBEA 4PX9A 4BUJA 4MYCA 2X2EA 4W9MC 4HZIA 5J4HA 4PQRA 3T1TA 1FNNA 1N5JA 3CO5A 4Q4HB 5BXQC 5KSOA 3V00A 2AN9A 2JEOA 4XWAA 2CXXA 1KSFX 1OHHD 4LHYA 2QMOA 2FFAA 4OQLA 3KKQA 4AD8A 3H0KA 2HCJB 2XSZD 2W0MA 5BYJA 3P26A 4FW9A 5FUWA 2IHYA 4RZ3A 1WRBA 2A30A 3K09C 3NG1A 1Q22A 3KDSE 1SHZA 3PFIA 3WYFA 2Z4SA 2N46A 4LJ9A 4DEXA 1NG1A 2ZI4A 4RD6A 3UIEA 2PEYA 2WSSD 1MRNA 1KI8A 3J81k 1RKBA 2J1LA 3KKNA 4D2IA 1ZIPA 4DBLC 4IRUB 2FWRA 2QROA 5GVRA 2IUSA 4D0LB 4ZDIA 4MQBA 5GADl 3C16C 4WBSA 3RYTC 2VP6A 4BRWA 1R6BX 3JZMA 4IDQA 2VP9A 4KJZA 5G41A 1IXZA 4GP7A 5HKKA 2LWIA 2RGGA 2F43A 1U90A 3ZVNA 1LFDB 2ODEA 2VHTA 3AVUA 2GZHA 4HAWA 1OH5A 3TSWA 2G83A 5P21A 5LD2C 1TEXA 3CUEF 2OBLA 1MABB 2CJWB 2EFHB 1SQ5A 4BZQA 3K0EA 2J5XA 3AM1A 1P61B 4Q5IA 2HJVA 3FOZA 2V9PA 3KUCA 5IRCD 1M6NA 1G3IA 5LB4A 3QENA 2O8DA 1Z63A 1DG3A 2IYUA 4B3BA 3PQCA 2XOKA 5KSZA 1COWD 1NSTA 1CLUA 3CM0A 3K0CA 3EIQA 3LBNA 1J99A 2I4IA 3OZXA 4OQMA 3WYGA 3I5YA 2IS6A 1JB1A 1ZUHA 3SFVA 2PCLA 1ZNWA 3RABA 1FP7A 2MSCB 3FHTA 3QY0A 1ZCAA 1KO7A 2GF0A 1PJRA 3LWNA 3Q5EA 4I81A 5HE8A 3CNNA 1DAHA 2ZUBA 2JLSA 1E2NA 1G7TA 1ESMA 3CB4A 4M4SA 3WNDA 4JVSB 2E1RA 3NC1C 1E1QD 1RJ9B 2FSHA 4HAYA 4IW3B 4A2PA 721PA 2OT3B 1XPOA 1X8LA 4C0AC 4YQFA 4QJ3A 1UBFA 2PMKA 3KQKA 1Q3TA 1P7CA 1I4TD 1T8TA 2WKQA 4S2EA 5L8VA 3CF0A 1F60A 1KO1A 3P27A 2IWRA 1WF3A 4C4PA 1VHTA 4TL9A 2AK2A 1U98A 1HT1E 2WWIA 5DI3A 4NKRA 2UVQA 4HB3A 3QBTA 4G5GA 4NZYA 3RWMB 3EX7C 1CXZA 1H65A 1P2VA 1E9RA 4JLAA 2WJYA 2F1IA 1EX6A 4RCYA 1YR7A 4O25A 4EQ6A 1A4RA 1ZD8A 3WMEA 1ZUIA 3UG6A 1N5KA 1JECA 1Z2CA 2GVZC 3ADKA 4LJ7A 4B3FX 3VR1A 4JSYA 1OFHA 3VNVA 1X3SA 3E70C 2NO0A 4P33A 4TN1A 2X19A 2FZLA 2P6RA 1GTVA 1L2TA 3IIKA 4HDCA 2QAJA 2FH5B 3GLIA 2QRZA 4ZIRB 2WKRA 2O8DB 4DSTA 3B1XA 1XMJA 2W6ID 3LW7A 3LBHA 4JZKA 4BLRA 3H1TA 3AVXA 2XNSA 3H86A 2O52A 4D0NA 2HDNB 2ZJYA 4QOSA 2PH1A 1SKYE 3X1YA 1OSNA 2ERYA 2R6AA 1AN0A 3DEFA 1AS2A 1KI2A 3JVVA 3X1ZA 4DDTA 2OE2A 3U3RA 2VHQA 4J0QA 1MRSA 2ZSAA 1R0WA 4M1YA 4LYFA 4W5HA 4A8JB 4A0RA 1N0WA 2HUPA 421PA 4F93B 4BRUA 2RGBA 1GNRA 1SHKA 2FF7A 3FMFA 3GEIA 4DSUA 4EJSB 3RRMA 1PLJA 1A1VA 2ZJ8A 5EP4A 1EK0A 3FHCB 1X1SA 1SVMA 4OK5A 2GCNA 2AKYA 3EAQA 1CJTC 3GLGB 4C0LA 4M9ZA 1XD2A 2XITA 3T61A 2QUZA 5EXPA 2KB0A 2V7QD 5JHGB 1FFHA 2D2FA 5DI3B 1B23P 1JJ7A 2CL7X 2G0NA 1JPJA 2MSEB 3RNLA 3QSYA 1E98A 1JXMA 1M7HA 1RW4A 4IXNA 3Q3JB 4CRWB 2BC9A 1AGPA 1NVUQ 1JXOA 3EZ6A 2VHCA 1NRJB 2QPOA 5K8LA 1XCGB 1TF7A 2BM1A 4Q18A 4URUR 4CT4B 3T15A 2ZREA 4L15A 1SVOA 3K09A 3A1WA 2BBTA 1XEFA 3WBKA 2D7DA 1FUUA 4KSCA 1US8A 1KMHB 4OI2A 1L7VC 1T5LA 5EXSA 1XNJA 3B1VA 1KDPA 1YRAA 5FPTA 2VSXA 1D2EA 2DFNA 2CNWA 5A4JA 5HCNA 4DSNA 1KSJA 3B1YA 1KYIA 1KSGA 1AS0A 2C04A 4U02A 5BQ5A 3VMFA 4OHYA 5FBVB 3I8XA 1SGWA 3B1WA 3QKRA 4HLCA 4Q1DA 2C78A 4I4LA 1FX0A 4A2QA 4WA7A 5EE0A 2V6IA 3K0AB 5JECA 3IBGA 4LUCA 3REGA 2KI5A 1ZW6A 1AKYA 2CEAA 3D31A 5ELXA 1QHGA 5JJIA 1DBSA 4JLNA 3P4XA 4P32A 1R5NA 1CULC 2DWQA 1WBBA 1XD8A 2D7CA 2G1JA 4QG7A 3CWZA 3GJ5A 3EPJA 1KI7A 5CLLA 4BFYA 3KQHA 3HJNA 1NBMD 2QTVB 1KO4A 1U94A 2YKGA 2O8CA 3AGQA 4Z8XA 1IN4A 2BCGY 3MFYA 4YDHB 2OEPA 4LDJA 1WQ1R 2CLSA 2JIZA 4BPBA 2VP4A 2QGZA 1OXUA 4RJLA 3VX4A 4OI4A 1JI0A 4Y0VA 4AIIA 3UK6A 3HYRA 1G8GA 4KVAA 2IL1A 1XMIA 2YOHA 1W4CA 1Z0KA 3IGFA 3K9LA 5L3RA 5J4YA 2R2AA 3TQFA 4B2PA 2QBYA 2YWEA 2IYWA 3IUYA 3QXJA 4HYYA 2GTPA 1BYIA 2YINC 4CEJA 4LZZA 2DHRA 2FFQA 1E4YA 3SS8A 4NDZA 2GEDA 1FQJA 3F0TA 2R6DA 5KOYA 4TSFA 4RD4A 2IC5A 3PUYA 5F98A 3ZZUA 5JLJA 2CL0X 2QPAA 1EWRA 4DB2A 1BYUA 3AF4A 1E0SA 2G9NA 3GLFB 5LD2B 1E4VA 1IN7A 1JR3D 1SVWA 2IF2A 2V55B 5AJYA 4GMXA 2QPTA 3WHLA 4LBVA 4RCZA 3DMNA 4EPTA 4JVMA 1M34E 3GJ6A 4TQUS 3SNHA 3B13B 3CX8A 4MKGA 1NNEA 3F3YA 3GLGE 2IUTA 3DM5A 3UWKA 5SZHB 2BBOA 4I1OA 3SI7A 1WXQA 1AZSC 2P67A 1KTVA 3G0HA 4AKHA 4A2WA 4HSEA 5JRJA 4KYIB 4EFNA 2BBSA 1II8A 1Z29A 4LJ8A 4PAOA 1IONA 2GETA 4B47A 4A9AA 1XJ0A 1VG8A 4M21A 3A58B 1AGRA 2ZPTX 2GJ9A 4JKYA 4JYCA 4M2LA 1E3MA 1DE0A 1G7RA 2XNDD 4OQXA 3MUFA 1G3MA 1F2TB 4F92B 4LYAA 4BZPA 3EASA 2H92A 2IYXA 4TYNA 1XU4A 3BB1A 1CP2A 3GFTA 4RY2A 4JL8A 3VHLB 3BWDD 4HUQB 5IDVA 3K8YA 5HCIA 1E1RD 1VG1A 3QE0A 2CLCX 4DCTA 1DTSA 1FOEB 5FUXA 3DZ8A 4NYMR 2FN4A 3V9PA 2ODBA 2D06A 2H18A 4WIAA 2ZUCA 2GA8A 5DIFA 3AH8A 2YJTD 1DAMA 3L82B 3R8CA 5GJBA 1HY3A 3EXAA 4URXR 2OAP1 3ASYA 4M1SA 3GEEA 3KKOA 4URZR 1QHSA 2YC2C 1GNQA 2GXUA 5EE1A 1R0YA 1TU4A 1VIYA 3OE7A 2EVWX 1HT2E 4E09A 2NO9A 1D9XA 1JPNA 2O8BA 4B33A 3KTAA 1JJVA 3RDPA 3LD9A 1QHIA 5A5GA 2JLWA 2WVJA 2JJ1D 1OKKD 4F38A 4G3XA 3VU9A 4P0TA 1YZNA 3NHBA 4DZZA 1XWIA 2BBWA 4Q47A 4KCGA 4Q66C 3VAAA 3TE6A 1XRJA 5JI2E 2GZAA 4GZLA 3VFDA 3H4MA 1NLYA 4MUBA 2JLUA 1TF5A 3JZAA 1ZU4A 5BYKA 2GHIA 1YR6A 2V54A 3BORA 3M1IA 4V0OA 2P5TB 3E2IA 4IOLA 1CKEA 1RIFA 1Q12A 2IT1A 3GCGA 5EXXA 1J70A 1ZC4A 5KO2A 1DAGA 4Z51A 2AKAB 2GKSA 2EQBA 4OI1A 1S8FA 1HURA 2OBNA 5GJWC 4L9SA 3U6BA 4IVPA 2QTFA 3FMPB 5L3QB 2OXCA 4KLZA 3IEUA 1LNZA 2QA5A 3EA0A 2IA5A 4WZBE 2F1RA 3OEEA 3V4FA 1TF2A 1KOFA 1W48A 4AKGA 1E2DA 2JDID 4Q1CA 1P3JA 4ZDKA 4Q7JB 6Q21A 1GL6A 2ZRDA 5AJVB 4B73A 1S1MA 1T8UA 4Q4AB 3SYNA 1Q3HA 2CMKA 3QIAA 2CCJA 3QPUA 1F2UA 4U7DA 4URVR 1P9WA 2EYQA 2VSFA 3ZVMA 3SJAA 4PHTA 1GILA 3LX5A 3K0FB 1EG7A 3Q85A 3A8TA 4YXWA 1Q57A 4RKEA 1WB9A 2ZRGA 2ODWA 1Q0UA 1G20E 2ORIA 2J0UA 2OCPA 4OYHA 3LV8A 3HU3A 4QM6A 1XDBA 3GP8A 1T0HB 3SU8A 1QG4A 4K81B 5UKDA 4B6EA 3KTAB 2AWOA 4D26A 1NVWQ 2D3WA 2QL6A 3O8BA 3GLFE 2IW3A 2XTNA 1E2HA 4B75A 1DAFA 4ON9A 3ZS8A 4AURA 2XTZA 2CK3A 1Z0JA 2QORA 3NDBB 2HLDA 2JLQA 4C7OA 3BFVA 3RS2A 1II0A 2AX4A 4DUGD 2G77B 4PZZA 5EP2A 1GDDA 1QHHA 4BZXA 3IO5A 3W3AA 4KI0A 3FE2A 1NIPA 2F7SA 1E1RA 2QAGA 2IX3A 2QP9X 1TMKA 4Q4JB 4XOIA 3RS7A 4EAQA 2QT1A 4N1AA 4XVQA 1T3HA 3IILA 5DO9A 5B57C 4RFSA 3U7EB 2G0TA 2J3EA 2Q9BA 1KI6A 1XB2A 3ADBA 1IHUA 3I61A 4DDVA 1G5TA 3A1UA 1U9IA 1U0LA 1SVIA 2ZRBA 5DH9A 1PUIA 4Y0AA 3CNOA 4OK3A 5EQTA 1RYFA 1Z06A 1JBKA 4HAVA 2GCPA 2JASA 1W0JA 3Q72A 4LBZA 1Z47A 4MITA 5E7IA 2C9CA 3KFXA 5KSPA 4LHVA 3L0OA 3KJEA 1J7KA 2ZS8A 5D3MA 3K1JA 1G3QA 1IN6A 4HAXA 1KAGA 1VDZA 4LC1A 3I3SR 5JI3E 1KY2A 2R44A 4PFSA 4KVGA 4LCBA 4YMUA 3BAFA 3MJHA 1E2KA 3A37A 3SBEA 1QVAA 5JSZB 2BMEA 4HI0E 2ATXA 1DEKA 3LNCA 1DO0A 5EUMA 4QHYA 2ZAOA 3AKDA 1Z0IA 1GVNB 3GLHA 3BE4A 3MLEA 4X8LA 1IQPA 2BWJA 1AZTA 2WWFA 2ONKA 2J7KA 3ZS9A 2BVNA 3MMPA 2CVFA 3CKLA 5J4KA 4PHHA 4K8OA 1E2GA 3LBIA 4S35A 2J0SA 4NYJQ 3PEWA 4LSGA 4LC0A 1Z6AA 4QNRA 4JS0A 2CHVA 3TNFA 3WP1B 1XJQA 3ZZ0A 2XJ9A 3AP2A 3HWSA 1T4GA 3I4LA 2NPFA 4PTLA 2KE5A 3NHAA 4L9WA 4PC3A 4X8OA 4Q9LA 5HR5A 5KSYA 1N6KA 1M8PA 3U2QA 2NZJA 4DLUA 3QEOA 5DGXA 2OSBA 4FWTA 4GP6A 2ZJ2A 1W4BA 1TUEA 4CGZA 2GESA 2OLJA 2HCBA 4DKXA 5KPDA 1E9FA 3QG5A 4G0NA 2ZYWX 1ZYUA 5HPYB 4TWZA 1KIMA 3RSLA 4XTRA 4HB4A 5AWFC 3UXMA 1E9SA 5CJPA 1QZXA 4JLJA 1Z83A 4OHZA 1RFLA 3KXIA 2XOKD 5CIQA 4R7ZA 4CT5A 4TL8A 5DLQC 1UBGA 2Z83A 3LH5A 2W58A 4TMTA 2ZJZA 5D3MB 3EW9A 3EPHA 2F9MA 2VF8A 2P3SA 3CWQA 3NBXX 4A4DA 1Q20A 5CYOA 4DUGA 1OLOA 4K46A 4XVRA 1NBME 5GJCA 5E3HA 3VR2A 1T9HA 3PG5A 3E1SA 3AGPA 5TVKA 4NTZA 2JJ8A 2F3TA 1ZNZA 3FKSD 4TMWA 5AK0A 4QL3A 2EFDB 3QI2A 1G18A 3CBQA 3GJ3A 2J59A 3N70A 1R7RA 3FTQA 2R62A 1K5DA 3LRPA 5FTNA 5E7JA 5JS8A 3NEYA 5FI1B 2BJWA 1AK2A 2H17A 2OUKA 3W90A 1RE0A 2GXSA 4A15A 4Q1EA 2VIIA 2H57A 4B34A 3EPLA 1CR2A 1G9XA 4M1KA 1YHNA 4CDGA 3EC2A 4CEHA 3CIOA 4B6FA 2AHOA 3SZRA 4ZI3A 1GOTA 1UADA 1DADA 1EGAA 1EX7A 3EG5A 4TT3A 1E9BA 5FUYA 3AVVA 2DWOA 3DM9B 1W0KA 4D25A 2F3RA 4IXMA 4LHWA 1E2QA 1FP6A 4QRHA 1E2FA 5IF9A 3FPAA 4JJKA 3B9QA 3LW8A 1G4AE 1U99A 4C0JA 4DLVA 5BWMA 5L3SA 4WXPA 4MKIA 3ZZTA 4A82A 1RRCA 2EW1A 3RRNA 5AUOB 4QBIA 1EFHA 1JR3E 1LW7A 3KKPA 3LY5A 1QVRA 4HB0A 3IPYA 2K5UA 1CR1A 1YZKA 5JWRA 5A0FA 3B8HA 2D4HA 1E94E 3NXSA 5TXGA 1Z08A 2Y8EA 1RZ3A 4DLYA 4HUTA 4JLOA 2IYTA 1FL9A 3W9YA 2DB3A 1E0JA 3L0SA 4M1OA 5JMTA 4DWJA 1HYQA 1T5IA 5FOSA 1FZQA 2FEOA 1DG1G 1E2LA 4NCIA 2WTUA 1X8KA 1CF4A 2KSQA 1XEWY 1Q1QA 2E87A 4AG5A 2OM2A 4KXFB 2YWGA 1F48A 1D9ZA 1AS3A 1E2PA 4KBFA 1Q1BA 2GVDC 1T3LA 1G21E 1E69A 1UKYA 2WIBA 3FMOB 5SZIA 3T06B 1QBKC 1RRPA 1HA3A 1OV4A 4URYR 2A9KA 4M22A 1XTQA 2GBLA 1P75A 2ZE8A 3SOPA 5DYIA 1NKSA 1RYHA 2RGCA 4O2RA 2ZVQX 1ZNYA 2FDCA 3TAUA 1S9HA 2RCNA 3U4QA 1NN5A 2DPXA 3MJRA 5FFMA 1UF9A 4FCVA 5FOUA 2CE2X 1UAAA 2OCYC 3RSOA 3QF7A 3BERA 3KQNA 3U44A 2GAAA 1C1YA 3NIBA 3OIYA 4KHZA 4KFUA 3TKLA 4N0DA 3T1OA 2OO7A 2BEJA 2YOFA 2NO6A 5G3ZA 3SDZA 5L3SB 4UNPA 3KL4A 1PLKA 3FKSA 5J40A 3ADCA 2C98A 4FMDF 4ZDWA 4AYXA 4MRRA 4XWKA 3THWA 2CNWD 3LXXA 3PCRB 2O5VA 2P2LA 5FR1A 2VSOA 2ANCA 4P3YA 2HYDA 1OB5A 1P9NA 1OT3A 4CEIA 3IHWA 4OKSA 5IK2A 1F5NA 1ZMXA 4JSTA 5JFGA 4IOJA 1HQYE 1PV4A 2F43B 2CBZA 1ZVQA 5K8UA 3HDTA 3U7GA 3T34A 1UFQA 4C3ZA 3KB2A 3GLHE 3RAPR 1QF9A 5KDLA 2FMXA 2JAQA 3SFZA 1G5RA 4FCTA 4QGFA 1VCNA 3N2EA 4D80A 3AVPA 3NWJA 2ZANA 2IS2A 1E79D 1LVGA 2GWHA 3P1JA 5FOTA 4PAMA 4GT1A 1V43A 1KK2A 1M74A 4LJAA 3REFA 3UMSA 5EP3A 1F6BA 2WJGA 3R7WA 5F9HA 3VNUA 1X8JA 3U3KA 1MOZA 2FJUA 1A2KC 2WJVA 3EZFA 2JIZD 3IIMA 3TR5A 2PX0A 1S96A 4JYBA 2PJZA 2VYFA 2ONJA 1HE8B 4KLNA 3SJZA 2HYIC 5KNBA 4QM7A 5FOWA 5FBLB 3ETLA 3HR8A 3TK1A 4BGDA 1JQJC 1GM5A 1Z8FA 3BK7A 1S0UA 4EPRA 4DLZA 2A5FA 2OCAA 1NLZA 1JAIA 5CB8A 4KYUA 3SEAA 4NU0A 4D82A 2ZSFA 4IDNA 4KSBA 3PEYA 5E7MA 2O8FA 1IXSB 4PZYA 4TYPA 3BH6A 2X1VA 3I8SA 5L3VA 2N42A 4B3DA 2F55A 1KDOA 4A1FA 3GPLA 2FZ4A 1ZINA 3THWB 4TQ9A 3M6AA 4TSFD 1OE0A 3VTKA 1IM2A 1YR8A 1G64A 1KO5A 1O3YA 4QNMA 1YKSA 1Z0FA 4OJKA 4DSOA 2AFHE 1CJMA 1CBUA 1KY3A 3RS4A 3IQWA 4Q03A 1J8YF 4U00A 5F3WB 1MO5A 3OIUA 4ZKDA 2ORVA 1PZNA 4EQ6B 3WBJA 4R2HA 1W2HA 3N2IA 4UXJA 3BFKA 4E5UA 5G40A 1B0UA 1Y3AA 1JALA 4NYIR 3NBZC 4BWYA 4GBMA 3TUIC 1E32A 2IS1A 1HUQA 4Q7LA 4ZO4A 4V0MA 2ZU6A 4BASA 4GMDA 2P6UA 4BECA 3ASZA 3TGPA 1MO3A 2CDNA 3GLIB 3FGNA 4LYHA 2F1JA 3AF1A 4RD2A 1L4UA 3R7WB 1JNYA 1XEWX 5CYPA 4R71A 4OQNA 4FXPA 2REXB 1SZPA 2FFHA 3DO6A 4MYUA 1UJ2A 4Q01A 1QHYA 3QPWA 3ICEA 5CIWA 4QJ5A 1H8HA 4NE2A 5F2EA 2JLXA 2Z5FA 1TUIA 3B5JA 1FMLA 3PUXA 1N25A 1NLFA 4L5BA 2QG6A 3ZDQA 2PCJA 2C8VA 3I32A 1X6VA 3U7FB 1G19A 1CU1A 1XFAA 2QY9A 3VR3A 3UANA 1OB2A 1N6HA 2QQ0A 4TYWA 1G6HA 4ABYA 4UQOA 2H16A 1S9DA 5EE3A 1U8ZA 5TARA 4LJ4A 5FH9A 2O0KA 2ZRNA 2YVUA 1CIPA 1ELOA 2HF8A 2G1KA 1GWNA 1XMSA 2O8EA 1UEIA 2GJKA 4POAA 1XD2B 3X1WA 3DKPA 1E79A 4M53A 2Q3MA 4JVNA 3R9WA 221PA 4R2IA 2ASEA 4F7WA 1ZNXA 2W2TA 1FTSA 3OE7D 3TH5A 5AJZA 3RANA 1LS6A 1GRRA 3CZPA 4WZAE 2NIPA 4AWXA 5GJVC 4BQSA 4LPKA 4CF7A 2WOOA 3BIFA 3X1XA 4XTCS 1I4DD 1R2QA 2ZJBA 3GJ8A 3MWKA 2ZYUX 1U8YA 2J7PA 1W49A 3NH9A 2YYZA 2UZIR 3A4NA 4BLQA 1S2MA 3RS5A 4G1UC 5CDFA 1IY2A 2RGAA 4HDQB 1US8B 5FOVA 1H8EA 1HE1C 1KK3A 2QT0A 4OHWA 3U5ZB 1HTWA 3Q9LA 1UDWA 3SHFA 1RPZA 4Z54A 1NY5A 3SR0A 2VPPA 3OAAA 2QAGC 2ZRJA 2V4ZA 2RGDA 2A5YB 1IJFA 3IQXA 1U0HC 2C2HA 4Q9JA 4FMCF 5C46F 3E5HA 2N1BA 4QC2A 3CPJB 1DS6A 3OEED 3QKRB 3SYKA 1FX0B 1GRQA 4LI0A 1DAEA 2EFEB 2GNOA 1OYWA 2ATVA 1U9IC 2RKOA 4Q7MB 1T0JB 3TVDA 5KU1A 1WDTA 4NYMQ 1ZD1A 3DVLA 1VG0B 2IYZA 3TAHA 2QE7A 4B43A 3PV0A 2B8TA 1N6RA 4B71A 4E07A 3AVWA 1LF5A 4G5QA 4XWOA 4NONA 1KO8A 1TQ6A 1VIAA 2LKCA 4YXWD 4MGIR 3GJ7A 2O8CB 1NN3A 5EE5B 1UKEA 1BOFA 1KI1A 1Z07A 3QF4A 1NMXA 2EWWA 2WV9A 3DDCA 4F4IA 1OXTA 2JATA 5JCPA 2PLRA 2R8RA 2RGNA 1D8TA 4IOMA 1SVLA 3IPXA 4CW7A 1PUJA 3LQQA 4A92A 4PPQA 1II9A 5K8TA 1MKYA 1YZTA 1VYTA 1YZLA 2ZE7A 3BBPA 2CHGA 3FYHA 3VHXA 3GMTA 3ZJYA 3PXGA 1ETUA 2IEZA 2ZJAA 1M1YE 4XD7A 4JIMA 3WY9A 4ESHA 5FL3A 2OFOA 3UPUA 3NKVA 5JJKA 5CJ2A 3DZDA 2CK3D 2OXRA 1KHTA 3PUZA 4X8MA 2HLDD 1XCMA 1Z3IX 2QBYB 1Z22A 1GFIA 4PC7A 3W34A 4CEJB 2D2EA 4QKQA 1TPZA 2LCFA 3GLIE 5EUQB 2ZI3A 4KO8A 1YZGA 4Q9IA 4BFWA 2DY1A 2QI9C 3LLMA 4RZXA 2QM8A 3FKQA 4L16A 4QJ4A 2AWNA 4FD2A 2GK6A 2ZS7A 2DYKA 3EWAA 4LYJA 1N6LA 4HEJA 5KYKA 1WA5A 2BDTA 2X77A 3WYAA 2XZLA 3OESA 4YMTA 2IYQA 3A4LA 1Z28A 1NMYA 2BKEA 1IBRA 2BHRA 4PQFA 4DLSA 3AF0A 2J0VA 2GCOA 2VH5R 2VP0A 1E0AA 4NCKA 3AUYA 5FBWB 3G82C 1J90A 1LV7A 1N5IA 1S1CA 2C5LA 3IKJA 1W0JD 4TLBA 2B7BA 621PA 1I2DA 4JBWA 1NP6A 2QTHA 3NBYC 3DOFA 3TSZA 1NVVR 4TZ6A 3R9IA 1OW3B 3C41J 1DO2A 3QVVA 5EXTA 5LDDC 3FDIA 2ZROA 4DCVA 3KJIA 1G17A 3O47A 2VA8A 2ZI7A 3B7GA 5E95A 2JJ2D 1W5SA 3AB3A 2H5EA 5AUPB 4QFMA 3F8TA 4M1TA 4TZ0A 2REOA 1N6IA 3TVTA 3B2EA 1GL9B 4HZUA 3OHMA 2CE7A 2FSIA 1II8B 4IDHA 4XJXA 3DKVA 5EZ6B 1OYYA 1R8SA 2PX3A 4PC2A 4WOPA 3NBFA 2TMKA 3SQWA 4DIEA 1OF1A 3O8RA 4AC9A 1W46A 1W4RA 4ACAA 3PEUA 3NVAA 1VECA 2WJIA 1ESNA 1VG9B 2NTYC 3BJIC 3GFPA 3HYTA 1QHXA 1N0VC 4FMDB 1NJFA 2BKUA 4IFBA 1TQ4A 2FGJA 1W36C 2QMHA 1AKEA 1OXXK 3OEHA 3AKCA 3A1SA 2WZQA 3TMKA 4E03A 5KUTA 1CRPA 1G6OA 4DVGA 2ZITA 5JEDA 2C96A 5E4FA 4PSVA 3LX8A 4JLBA 4A0GA 4QGHA 2PLFA 5BN3A 3CRVA 3CH5A 1A82A 2QP3A 4US1R 1OIWA 3TW8B 3ZGXA 1VCOA 4RKFA 1XEXA 5CK5A 2O8BB 5FL7A 4IFEA 4MRSA 1PVOA 2VTKA 1EFRA 3W5JA 5FI0B 3CZQA 3VU9B 1Z2AA 2IBMA 1Q21A 3M4YA 4BE7B 3ZD6A 1KMQA 4ARZA 4YONB 4B44A 5J4VA 4P4SA 2QN6A 4ASUA 4AY2A 3QOFA 1R5BA 1CJVC 4DLTA 1W2GA 3VR4A 4ZI2A 5B2ZA 5GVSA 5CK4A 2VQSA 1OPXA 1X86B 1D2MA 2IWHA 3T1VA 4C0KA 2MSDB 3OIVA 4QHSA 1E2JA 4AK9A 2DBYA 4PO1A 2YWFA 3WMGA 1NSFA 1C4OA 1NF3A 2OAQ1 3O8DA 2QP4A 3AF2A 3EIEA 4UNQA 1MV5A 1UBEA 2IK8A 1GKIA 1SULA 2ZU0C 4Q00A 3SJCA 3GJ0A 3Q7PA 4DT1A 3VX3A 3LVRE 4M0LA 4GOKA 1W36D 1KJWA 1G7SA 1YRBA 2ECKA 2P65A 3SN6A 3H2YA 1J2JA 4MDFA 2P5SA 5CDFE 4TYYA 2ZUDA 2GBLC 4HLUC 3P4YA 1F2UB 3O8CA 2A5JA 1G8HA 3I5XA 1FQKA 3LLUA 4BLOA 4TT3D 1HQCA 2ZQ5A 3EARA 2HT1A 5TDHA 4RFVA 1W0KD 3V4RA 2NG1A 4BFUA 1XF9A 4EFLA 4A36A 3QG1A 4OHVA 3W6PA 1TEVA 2JJ2A 1KKMA 1N6PA 1N6OA 1OIVA 2J0UB 2OHFA 3OIWA 2GDJA 3B78A 1GNPA 4PR0A 1N6NA 2PMDA 4ZCLA 1OXSC 3MWYW 4BFZA 5FTLA 3QQ5A 3WRXC 3DHWC 3ZVLA 1AQYA 4LV6A 1S3GA 3SBDA 3U7HB 4BFXA 3B1ZA 4JKIA 1E9CA 3U3OA 5H70A 4ARZB 4RZUA 4MGYR 2FV8A 2FPLA 3HU1A 4P4SB 1G3RA 1VYUA 4TLAA 1UPTA 1ZBDA 4G5SA 3WRYC 4C7OB 2O0JA 1F3OA 1XJCA 3IO3A 2HF9A 2ZYTX 1QHHB 1OXVA 4IOKA 1AIPA 4FI3C 2XB2A 2BEKA 3B85A 2PT7A 2QAGB 4GDFA 5D3QA 1WE2A 4JLKA 2REBA 1KKLA 1YVDA 1C9KA 4F91B 3PJRA 2ZRFA 3MRSA 4EJSC 3RRYA 5TMPA 2GJ8A 2WOJA 5FPSA 2IS4A 4RFSB 1IN5A 1VPLA 2ZR9A 2MMCA 2YOGA 2ZE6A 4JL5A 2JA1A 1KI6B 1A7JA 4DCNA 3HU2A 1G291 1K5GA 3MD0A 3KUDA 4A6XA 4Q02A 5IHPA 2ZI6A 5FPYA 4DT1B 4TMZA 3BB4A 2Q3HA 3AP1A 1L4YA 1VTKA 4UXIA 4EPXA 8OHMA 1N5LA 2X2FA 2FGKA 3KXKA 5DISB 5C4GB 1N3BA 2F6RA 2WAYA 2JLVA 4C9BA 4KFRA 2NO7A 4DLXA 3ZQ6A 2A2ZA 5TV2A 3PUVA 4ZV4A 4TLDA 2W6JD 1ZM2A 4Q4HA 3THYA 2FPKA 4JLPA 4XVUA 4EPYA 3MWJA 3ZYCA 3THOA 4C2UA 2WJJA 5KTYA 1GZSA 4IEIA 2C9OA 3BS4A 3GLHB 3EIHA 3C5CA 4DRZA 1DAKA 1JEEA 4Q1BA 3LO5A 4UJ5A 2B6HA 3D8BA 5DHAA 3IEVA 3CR7A 4IDPA 1MR3F 1P73A 1YZUA 2RMKA 3CF2A 3TQCA 1QDEA 4ZCMA 3I1FA 4ACBA 4QBHA 5AUNB 4MRVA 5IT5A 2OFXA 2UKDA 2ZI5A 4L8GA 5JWOA 4RSGA 4LX0A 5HTKA 4GI7A 2V1UA 4QBGB 4DCSA 2QSZA 4R98A 5IK2D 1XTJA 1TL7C 2WWYA 1KK1A 1P9RA 3CW2A 4NCNA 4HLQB 4KAXA 4ESVA 1QRAA 1BO6A 2DFKB 2XEXA 1U8AA 1CRQA 3CONA 2JLZA 3C8UA 1DPFA 2WPDD 2EYUA 1L8QA 1YJ5A 4JT2A 5H68A 1MABA 2CJWA 2J0QA 3UMFA 1YE8A 4FMCB 3D3QA 1BMFA 4DHEA 5TY0A 1Q44A 3MSXA 3CRMA 2RB4A 4JLVA 4KU4A 3K53A 4NBSA 2XB4A 4AG6A 3DPUA 5DHFA 3ECCA 4HDOB 1N0UA 4PXAA 1EWQA 2QRNA 3SE0A 1U2RA 4MRNA 4LPSA 5DI9A 1AA9A 3TBKA 4EUNA 3K9GA 4FINA 2WWXA 3BB3A 4URWR 1TU3A 3QEJA 1DOAA 2IF0A 2R6CA 5FUVA 4R9UC 4FN5A 3RC8A 3AQ4A 2GXAA 3K0SA 2QSYA 2AXNA 3PR1A 1FMJA 3BD9A 2QGNA 2WMOB 4LOAA 5DN6A 3THYB 4GOJA 1KI9A 1DARA 2MMGA 4I1SA 4TTQA 1EFUA 4Z1MD 5FTMA 1RVDA 1A2BA 2A7QA 4FIDA 4YC7A 1IY0A 1LY1A 3BGWA 4TMXA 1BKDR 2FG5A 2J46A 4HLDA 4M1WA 1JQLB 2WMNB 4D4MA 2PBRA 1RJ9A 1KI4A 2P6NA 4LY6A 3EPKA 1UM8A 1ZAKA 1D6JA 3H84A 4GZMA 4TQAA 2BMJA 1OH7A 2ZRKA 1GITA 1DVRA 4US0R 2YNMA 4NH0A 2PEZA 5KDDA 1NMZA 2PZFA 4RD0A 3GEHA 3A1TA 3D6TB 1GAJA 1ZUNB 3EZ9A 2FOLA 5FTJA 3FHOA 4HLUA 2FX3A 1W36B 1G3UA 4EPVA 1K6MA 4I1UA 4Q21A 2WJHA 2QZ4A 4NMMA 3B60A 4IHQA 4CEHB 1Z6XA 4C0HA 4PQYA 4LWZA 2ZJ5A 2ANBA 3U60B 3CF6R 3SYLA 4UNSA 4C30A 1V5WA 4H1VA 2W6JA 4I1VA 3I73A 3FMIA 4LV5B 3WXMA 1NN1A 1TNDA 1T6NA 4BFSA 1TX4B 4ZKEA 2JLRA 5EE9A 4XH9B 3ZQJA 3KXLA 4ZIRA 5C1BA 1NN0A 1WP9A 1CS4C 2VHUA 2RAPA 1VMAA 4AYTA 3RS0A 4Q9KA 2E9SA 2Q21A 4B76A 4W5WA 2SHKA 3R20A 2Z4RA 3U6KA 3THXA 2Z43A 5KDOA 2QENA 2ZRAA 3QKUA 1KJZA 3SC3A 1H8HD 1P2UA 1SXJC 4GNKA 2IYRA 1LTQA 1FUKA 1KDTA 4O2LA 4A8JA 2G6BA 2OESA 2OG2A 1VCMA 2H7VA 2NQ2C 2YWHA 4E22A 1E2EA 1CR0A 4Q9HA 4LJ5A 1E9AA 1XTIA 2HXYA 3OF5A 2AFIE 2XAUA 4OBEA 1ZP6A 4EJSA 5FBQB 4ZDJA 1PLLA 4WVFA 4YDSA 3JVUA 3TLXA 5G3YA 2WPDA 1YQTA 3KQUA 2WM9B 2C99A 3GLGA 3CR8A 2DWPA 1G5PA 1P4SA 1HEIA 3MCAA 4IVQA 2VBCA 1ZRHA 2R65A 2V8OA 4I99A 1W47A 2AK3A 3VR5A 2NMVA 3CRRA 4BEBA 3D7MA 1R0ZA 4OJQA 5DNYB 3QBVA 4XIGS 4PHFA 3EC1A 2BCJQ 2CLDX 2EWVA 1P6XA 4OL0A 4V0LA 5ANRB 3WNBA 4GRAA 3TSOA 2BV3A 2V6JA 2RGNC 3MG9A 3AVYA 4PANA 4NYIQ 2ZR0A 4P4TA 3GFOA 4KODA 1FTNA 4DIDA 2OV2A 3U4QB 1AJEA 1XPUA 1CR4A 2OZEA 4C2TA 3TJZA 2XXAA 2J7PD 4Z1MA 2VF7A 3WP0A 5J4LA 1VYVA 1OHHA 2G3YA 2ORWA 4IVRA 4ERNA 1G7CA 3U44B 2CHQA 5DYGA 5SZKB 1DELA 2XSZA 4HATA 3I72A 2X8AA 3TRFA 1H8ED 4Q19A 1E2IA 1KMHA 4B3XA 2BJVA 2ERXA 2R6GA 4D0GA 1IY1A 1SXJD 5JZVA 1MO6A 4FWIB 3I92A 3GQBA 3THXB 2WSSA 3OAAD 4NL4H 3TW4A 4XSGA 2ZI9A 1XTRA 3EZ7A 2J45A 2WICA 1D5CA 2B21A 1G41A 2O0HA 1TQDA 1Z6GA 4CEIB 3P32A 3UG7A 2OFWA 4DLWA 2W2XA 4LJYA 4Q1FA 2W0SA 3U3JA 4PO9A 1Q1ZA 2VHJA 4WXRA 2EU8A 3K0AA 4TLCA 2FPMA 3VKWA 1I2MA 3B6EA 1KGDA 1XXHA 1Q1EA 3KQLA 5KNDA 2ZSEA 2QE7D 2WWWA 1M7GA 1OJLA 1YU9A 1OFTA 2JGNA 3QXSA 5J5CA 3PITA 4NPHA 4DXAA 3FVQA 4BFTA 3B9PA 3A6PC 1KI3A 2A3RA 2D62A 4LHXA 2F1HA 2ZRLA 4AYWA 3PEVA 1COWA 5KPJA 5JHHB 5EZ5A 1CJUC 1W7AA 3TUZC 4PPGA 1P60A
chains in the Genus database with same CATH superfamily
5FA5A 5BN5A 1IJEA 4RU1A 4ADSG 5JNUA 4J2TA 3UJ8A 2NO5A 3CX7A 4LCEA 5BN4A 3ZLJA 1NFRA 4MYDA 1Q7BA 4DEVA 3ZD7A 1Y8RA 4BO3A 5A5FA 2ZXEA 3D6FA 4ZEOA 4NF2A 1UPFA 5LYJF 1QO7A 3EGIA 3W6OA 4WKCA 5CA1B 2O5EA 3FUCA 3IDQA 1KARA 3JWIA 4II7A 2E6UX 1OIXA 2LCQA 3BJZA 3UOAB 4B32A 3ZZ1A 1PS9A 3FYUC 2VJNA 1IBLB 1V0JA 1DINA 5KQLA 3GJ4A 1FRVA 2J4CA 1KH2A 4PC1A 1UXOA 4AF7A 5JQGB 4MGEA 3Q9NA 1Q2XA 1CQWA 1WXDA 4F04A 5F9FA 3L4BA 3W8RA 4D81A 3EXEA 3VR5H 3DT9A 2E4YA 1UBCA 3SJ7A 4BU1A 3L0IB 4QHTA 3GC6A 4DA0A 5JRZA 1V9CA 3I9NA 2VP3A 3PI7A 2C59A 4KX5A 1RAEA 1YK0A 3PJDA 1MC4A 1LX6A 3DNPA 4MWSA 3PLAE 2QM7A 4WKPA 1VA4A 3ET5A 3L5KA 1H5QA 3DMDA 4K7JA 1N2EA 2IYYA 3KZVA 4I8IA 1C0PA 1O94D 3WWYA 1IXRC 5HP4A 1RXIA 3BWCA 1RPAA 1YV9A 3QUSA 3FM9A 4FZRA 4G8JA 5LB2A 4R0NA 3ZY6A 1D2NA 1CQXA 3HB7A 3LGSA 5K7SA 3OD1A 1DJOA 3WKAA 1R8QA 1JR4A 3A1NA 4IMJB 3MJCA 2IXDA 4Q3DA 1I4LD 1QLJA 2XBLA 5I7RA 4K9PA 1XLWA 1WG8A 4KN8A 3FPFA 1L5KA 2CZQA 3DDNA 1N2CE 4PFKA 5HJ7A 1IXKA 2RHJA 4FDTA 2RH5A 4BBPA 2NVUB 4TRNA 3R9XA 3DPIA 3G89A 1VKJA 1SXJA 4M9CA 2ABWA 2PV0A 2P8SA 4PONA 5C1PA 1AKVA 1V35A 1XVTA 2BMDA 3EGEA 5J2UF 3TX6A 3M1YA 5BN5B 1QTRA 3MUEA 5AESA 1RQXA 5AIAA 1DP4A 2YQ4A 3DTYA 5TS2A 5AVVA 2Y1GA 4JI1B 4NZ9A 5IKPA 2W43A 2GH1A 4QPCA 3DE7X 2RGUA 3K6KA 4MPPA 5EKSA 1Y8RB 5DCLA 3UYKA 2G1AA 1F2TA 3WHKA 2PSEA 1QIIA 1IEVA 2PSSA 1PGPA 1L6RA 5LIPA 3GMIA 4JL6A 3TRJA 1G16A 4XYLA 3G17A 4DTIA 1IM5A 1ZIOA 3LRTA 4Z4HA 2PL3A 2POQX 3EOZA 4N48A 1Z9BA 4E2XA 2BH2A 1PGJA 3N58A 5KNDH 3OEHD 2G04A 1MXHA 3MAJA 2KBFA 2R6FA 3FSRA 4P54A 1QKKA 2HI0A 1YCGA 3W7BA 3DCNA 3DBHA 4H60A 4EHBA 5JS7A 4LQDA 2FKAA 5CGZA 1MH1A 3CINA 3EXEB 3LAWA 3CX6A 4MV1A 3EOBI 3V34A 3QW2A 4V2UA 1GXSA 2C3PA 5F7ZA 5CA0F 1FNSA 4M98A 1X70A 1RYNA 3GD7A 5J9FA 5JAIA 2OHJA 1SBCA 1VFNA 3OTGA 3O31A 4KN6A 3RFCA 1M66A 3O8OA 4OAPA 2D5BA 2JF0A 2YH2A 4Y2PA 3K6SB 4RK0A 5DM0A 3UQZA 3ED1A 5D6OA 1UKVY 1T1IA 2JGRA 4KLAA 4O02B 1ADBA 2GLXA 1A98A 2V58A 2XVMA 4PLFA 1G8PA 1X7GA 2WWHA 3I5UA 4H08A 4E08A 4F6CA 5BNWA 2YV5A 2D8MA 1MIOB 4FFLA 1RHUA 1J25A 1PW5A 3LQFA 1SOWA 5FTKA 2ZRPA 5EKXA 5HDBB 2X6RA 2OAGA 1JGTA 2R00A 1FUEA 2WMYA 2OBXA 2EG9A 3TLGA 3R9XB 2GR9A 3UHPA 5A05A 1QC5A 1SXJB 1HDRA 2AF3C 3Q2KA 5K1ZA 1KFCB 1Z8NA 4FJ2A 4CTKA 3Q8LA 2BSAA 3AHJA 5C18A 3HO8A 4LI3X 2A6PA 3LX4A 2P62A 3WGIA 3AEYA 1DDIA 1E3QA 1IAQA 4EB0A 4PYNA 4UAUA 1KC3A 1AMOA 1J8QA 1VIVA 3MYRA 4X66B 1LD3A 4KQXA 16PKA 3M4NA 4PXSA 1OV6A 4TKZA 3H1GA 2GK7A 4OY3A 4O0MA 2NTJA 2Y1OA 3F5MA 4HYQA 2VF4X 2OD9A 3PC2A 4LAFA 2JGLA 4R8RA 4W82A 2GN1A 2W00A 2P7HA 5K45A 3H3XA 3ZWVA 4FZJA 3WJAA 1LQ2A 1XR3A 1BCRA 2UZAA 4HRAA 1XZQA 3Q8XB 1J8MF 1Z0UA 3CLTC 1I13A 2XCOA 5BOSA 1XZKA 2C92A 3NAMA 2QUHA 3GGDA 3TMAA 3RS9A 2JCGA 1X1RA 3L41A 4JBHA 2WE8A 4INJA 3DBHB 4QQFA 4QSMA 3K0FA 1A9QA 3QE9Y 1X1TA 1ZJ5A 3KPUA 3FBTA 2D0DA 1E1CA 1G5HA 2OCBA 3QF4B 4BEJA 2CB9A 1CUCA 2B61A 4PRZA 1ULUA 3ZWCA 2IEYA 1A5ZA 1M1NB 2JL1A 3EVZA 3LXRA 1Z5UA 3VNQA 3PPIA 2GF9A 3UJNA 2P6OA 3BQNB 3H8SA 4FGKA 3ZCQA 3U61B 3L1IA 1TMYA 3OKCA 4NZZA 2JS7A 4MS4B 3WYBA 1BS1A 1Q0ZA 2C8LA 4NPAA 3RJMA 4ZJYA 3PDHA 3KJFA 4DV6B 2PY6A 1VCIA 1CETA 2Y1DA 3DVSX 1CJBA 3A26A 2K2WA 1HYGA 3HFSA 4GP9A 4NMLA 1K8ZB 4Y6QA 1HQKA 2ZJOA 5EZYF 1O4VA 1PE0A 4D56A 1XXHE 3N0TA 1XCJA 2Y0CA 5KX5A 2IZOA 1W59A 4IGEA 4PPNA 2CNKA 2FW8A 2MSLA 4S3MA 1YR1A 2B20A 3KU4A 1WS6A 1TAHA 3LUAA 1FDWA 3QFFA 3QRWA 2WWGA 4GWKA 3T35A 3TLGB 3C3DA 1OA1A 4GZ5A 1DBVO 3HYNA 2KYRA 4XIJA 5L95A 1PAUA 3QFSA 3DE3X 3Q0TA 4FGJA 3G59A 4GMKA 4H0FA 1I3CA 1XC7A 3GARA 4KLRA 4LRYA 4NCHA 1FW6A 4AXXA 2BFCB 3KCNA 4KQWA 1FFXA 3MB5A 4TOIA 2XE4A 3QKSA 1AX9A 2DFTA 4QBFA 4HWOA 2C77A 3X1MA 1QO9A 2HHHB 5B30A 3DEIA 1U0OC 1IN8A 3HJGA 3ZLTA 3CPEA 4O3MA 2E55A 2KHZA 4MRAA 5TMBA 4MX8A 4NQZA 1SD5A 2A86A 4HB2A 5CLHA 3CLTD 4W5NA 5CW1A 1C7IA 1KEPA 2BOVA 1I2AA 4PIMA 4RD1A 1JR3A 1DAPA 4DA6A 1BCRB 4O33A 2X1MA 3ICQB 1PZHA 4D4JA 4II2A 2POCA 4LDPA 1VJ1A 4Q6WA 3IQEA 2ODPA 2BGGA 3CGGA 3UJ6A 4TWRA 2C4UA 2OBBA 2R8PA 2YZ2A 2RHDA 3EBLA 2FAXA 3HSKA 4BP3A 2A5DA 3MJVA 3G0BA 4NMWA 1DRJA 3GA0A 1QUEA 4IGKA 2C95A 5CEFA 3PFWO 4A91A 4EAAA 5AR1A 3GRCA 1AKTA 4FWBA 1RACA 1IBKB 3GT7A 4BBAA 4B8ZA 5DHPA 4OX9B 4COKA 1BFDA 1Z4KA 1MT0A 1P2TA 2PRIA 3BSSA 3K7EA 4LHZA 4Y6OA 1CTQA 1KOLA 3Q12A 5A9SA 4UTOA 2I7DA 5EP1A 1L4BA 3N5KA 5H1YA 5EKUA 1AURA 4PZLA 4Y7DA 3O2JA 3RFUA 1YASA 1T1SA 4CHGA 4L8WB 1T5DX 2BGRA 3LC0A 3T3OA 1KMCA 2VTBB 2IX9A 4E1BA 4JI0B 1BIFA 1AKNA 3ETEA 4V02A 4JP3A 2ZWVA 5FFFA 3VTZA 4OFXA 1U7PA 2J3LA 2QNRA 3GJXC 3EVCA 4YCAA 5HF6A 2M6LA 4DCOA 3H5OA 1HDOA 1JSZA 1VRWA 1P2SA 1WMEA 2GAOA 4MVJI 2JRCA 3ZWPA 4AN1A 4DC9A 3H2JA 5EKDA 1TXGA 3PU6A 1IG3A 1YI1A 2Y99A 1M2GA 4RVCA 2VAXA 1AQUA 4PSDA 5AXCA 3QELB 4DEYA 2R5NA 2IXEA 4NDAA 1XZCA 4QQNA 1OWNA 2IKQA 2ZB8A 4V2IA 3VISA 3WWDA 1NPTO 3QKSB 3HSSA 4RMGA 3BH7A 3F3SA 3OZTA 1MA3A 2MSKA 3R40A 4DDKA 2EBFX 3C7KA 1FLNA 5DU2A 2XJ4A 1ECPA 3V7UA 1HYEA 1N8NA 3L4SO 1A5TA 3OZVA 3EA5A 5FI3A 4UDXX 5HUQA 1PN3A 3P20A 1XX6A 4M83A 5HJEA 1V9LA 3ILSA 1D2CA 1NX9A 1XZPA 2WHYA 4MA4A 1LA2A 4GSYA 4X97A 4OGLA 2HF7A 1YONA 3X1KA 5DE3A 4CG1A 2R8EA 2WUEA 1KE2A 3DSRA 4A0SA 2XDQB 1T2FA 2JLYA 1SHJA 1XELA 2VHYA 2ZP1A 3EFHA 4P35A 4KXWA 5E2IA 4A7PA 1NW3A 3OFNA 1KP3A 3AUUA 4MW4A 4R1MA 5HKLA 2Z0MA 4EF4A 8ABPA 1CEYA 1K9SA 3PR3A 7REQA 1OWMA 3AEQA 3DYVA 1V4BA 3AQIA 2X0FA 4C88A 3ED5A 3HXOA 3DDSA 2V9ZA 5CCBA 3ZCVA 1RQLA 1E99A 1GV1A 1NJGA 1TAGA 2B4KA 2QRKA 3IV7A 4YRQA 1XBTA 2D3TA 4Z9FA 2AVDA 1NW5A 3RTDA 3U3XA 2ODNA 1NXQA 1RCTE 2P9QA 1QV9A 2D2VA 1KERA 3CLHA 2MYTA 5EMNA 2R87A 4MOWA 1CZRA 2NUBA 2JLCA 2HM7A 4U7PB 4ER7A 1V6SA 4FQ8A 4D3ZA 2AEEA 1RXCA 4BZWA 1DZ3A 2OV8A 3LUBA 4F60A 2FVYA 4HYTA 1JHDA 1KNQA 2H4ZA 2J32A 4C0SA 3N7AA 4LVNA 1AN9A 4PIVA 3PQ6A 4YRJA 4EITA 4F8JA 1MC5A 2IYSA 4ZVNA 3KB1A 5ALFA 4WJZA 4YJ3B 4G5OA 3U3MA 4DCMA 2PKEA 2V1XA 5F5XA 2WT9A 3CSSA 5AW9A 1U0SY 1X2BA 4KFTA 4MR9A 1BCSA 4LWQA 1YF3A 1Z75A 4S1PA 1MIHA 1HNZB 1JF8A 2JARA 3L2OB 2XF2A 1N75A 3CNLA 5FNZA 3T0FA 4R1NA 1C2YA 4D6PA 1Q92A 1SU8A 3L5OA 1VPTA 4FDAA 2YMLA 3NM5A 1F9AA 4HF7A 1VB3A 2W4IA 3QXGA 3A1VA 1W4AA 2HV8A 3BH0A 3H6GA 3FFTA 4V1CA 3AIMA 1T3SA 1LJLA 1M6EX 1Q5PA 1E96A 2GZDA 4NJMA 2C00A 2HA0A 4BMYA 3ETHA 4BX0A 5I5GA 1QLWA 1YBVA 2ZEJA 3KB8A 3LFUA 4B3IA 2PJRA 1RSZA 1NW8A 3AJDA 1LLQA 4B35A 1GTSA 1W1UA 1DIHA 1L6IA 5CNJA 2A9JA 2AFHA 2PYZA 1QZ3A 3BL5A 1Z5WA 3DP9A 5IVKA 4BIIA 3WMWA 5JH7A 5AKEA 3IUJA 1JQAA 4ZPXA 3U7QB 2C0PA 7REQB 2WTAA 1R9MA 3Q5DA 2AYYA 4W9RA 3X1DA 4RKYA 4EHJA 2W83A 5EXEA 3TJRA 4OFWA 2G28A 2PA3A 1OASA 4OXRA 3TR0A 5G0WA 3HVJA 2R8XA 2J3IA 3PBKA 3S3TA 3UT0A 2HMSA 2XGJA 1XWFA 4XUDA 3S2FA 2WQ7A 1UIRA 5AOAA 1KYYA 2WIAA 3I1JA 4UUBA 1NLMA 1N2BA 2XCRB 2PZBA 2ZIWB 4ROTA 5LYYA 4F84A 1R6UA 3ANMA 3CKMA 2BFFB 3PX3A 2X7JA 2C4VA 4GX0A 5CT8A 5HKAA 1KP9A 2ZSDA 4LYYA 4R1PA 2J4DA 1O6ZA 1SKYB 2W8BB 3OFSA 4UTZA 4L2IA 4WGGA 5ILGA 3V4VB 1NI3A 2Q0QA 3KSDO 1QE3A 1N8SA 3TM5A 4BVHA 3IV9A 2C3MA 1ACJA 2HMUA 2VSNA 3IQHX 1H9BA 5JD3A 4M0KA 4KE7A 1L7AA 1PV1A 3DL0A 4MYCA 2X2EA 4JNKA 4W9MC 3KOYA 1YJBA 4DGSA 3LC1O 4LXQA 4MR9B 1BCSB 4DJFC 2X1HA 4PQRA 2RH8A 1R50A 3DO5A 1N5JA 2OORA 3NEAA 3O90A 3VZBA 5A0TA 4J1QA 2JEOA 5KINB 3IEXA 5DULA 5JNLA 2QMOA 2FFAA 1ZI8A 2WG0A 2UZ1A 2XKAA 4WFQA 1NM5A 4DQLA 4MVWA 4MW7A 4RESA 3ZV6A 5HM6A 3RAFC 5HGJA 1KJJA 4FW9A 4ZTBA 4Z3DA 2IHYA 2ZWOA 1UFKA 1Q22A 1WDKA 3AONB 3R3SA 4BB5A 1M2JA 4FXOA 1FQWA 3DO8A 1YJCA 3OZDA 1CQZA 5THKA 1NG1A 1LTHR 2ZI4A 3RQSA 4DEXA 1UXKA 1D2RA 1GZ7A 2PEYA 1KI8A 2PH7A 2J1LA 3KKNA 5ESXA 1FFSA 2QROA 3O73A 3KE9A 5LOVA 1YI8A 4ZRMA 4ZDIA 4MQBA 3K72B 1CX9B 3RYTC 5GADl 1H22A 4L4RA 1IY9A 1OFUA 2V3VA 1R6BX 1TUGA 2HNKA 3NKFA 2A1UA 4DLKA 1WOMA 4JI5B 5BWNA 4J0FA 4MR8A 3R7NA 4Q15A 1U90A 3UN1A 1LFDB 1YHYA 2A9OA 2VHTA 4JYMA 3I83A 2GZHA 2JFPA 5HJ5A 4DGQA 1CY6A 2G83A 5P21A 2R66A 3G8DA 4F72A 3CUEF 1W581 3PUKA 2LUOA 3T3NA 5JCOC 1Z74A 1PYGA 1OY1A 1SQ5A 4Z0TA 1DIRA 3ZHZA 4H18A 4BNYA 2WLSA 1SG9A 3FOZA 1CVIA 1HRKA 3KUCA 4D0RA 5LB4A 4KIGA 3N1UA 1O77A 3PQCA 2F64A 1PO7A 1COWD 1NJ8A 3LBNA 3OZXA 4UDOA 3EIQA 1J99A 1UK8A 3P0JA 4OQMA 3WYGA 4A1OA 4RF5A 5KU7A 5LU8A 1FFAA 5AOVA 1EUDB 1ZUHA 4B4OA 2PCLA 1O6GA 1IC6A 4WLNA 1BD3A 3SVTA 1BJKA 2MSCB 3ZCXA 5ITZB 1ZA2A 2MU1A 2ZKLA 4TVBA 3GG9A 2AG1A 3HV0A 4GVPA 2G8NA 3KZXA 2GPJA 2JD2A 2JLSA 1E2NA 2ZTLA 1QRSA 1G7TA 1WUTA 1I1QB 2TMYA 1GQQA 2MSNA 1AGNA 3FAKA 3SY8A 2ZCJA 3NPMA 4GGOA 4HAYA 3FF1A 4IW3B 2GO1A 1GA1A 3HWX1 3HBMA 4QJ3A 3AR9A 2PMKA 2QX6A 3G8CA 3KQKA 4N4AA 5FTWA 2TYSB 4FOSA 5IAOA 1T8TA 1NF2A 4DNFA 5JXWA 1J0AA 2WIDA 1J00A 3OE4A 1SEPA 3P27A 2P41A 2IWRA 1RHMA 3VPFA 4DIUA 5C51B 2LXNA 7MDHA 1J2UA 2IZ0A 3GEDA 1E6LA 2AK2A 1Y4SA 4NKRA 3RJZA 2UVQA 1J20A 1YQDA 1CXZA 1H65A 3RVNA 2C7GA 4JLAA 2JIRA 3N2NA 3EWNA 3M82A 2J3JA 1D0VA 1VL6A 1YU6A 4MR8B 2WJYA 1GCOA 3EHDA 2F1IA 2EJWA 1DBWA 1B1CA 1EP9A 4ZZ0A 4BVLA 1ZD8A 1ESEA 4O63O 4QELA 4PCUA 1Z2CA 3EZLA 4XRRA 2X8WA 4JSYA 3PT9A 3V2HA 5HFAA 1Z12A 3O4VA 5BXYA 4KQGA 4N41A 4Q4DA 4N6GA 2NO0A 5KX5F 2X19A 2HMVA 4IJVA 4I8XA 3KWJA 5AKKA 3IJ5A 2C4HA 3MWGA 1FDIA 1M2KA 3D4NA 3O6VA 2F1OA 3GLIA 3G1WA 1ENOA 2UYQA 2VNAA 3LW7A 4JZKA 4BLRA 5E6SB 3H1TA 2HU5A 2CC2A 2PQ2A 3DXYA 3MB8A 4ZQGA 3FRJA 4M7WA 2O52A 4BLUA 3MUOA 3ETNA 1I6LA 4QU0A 1MQSA 1H94A 4NV0A 3PL5A 2QX4A 1NLUA 4CTNA 4E5PA 3X1YA 4QVKA 1JDSA 1LRLA 1AN0A 1AS2A 1KI2A 2AEFA 3MIZA 1OROA 4P38A 1IQUA 3E58A 2OE2A 5CGQB 3U3RA 5AW7A 2BHTA 3TNLA 1OQAA 2ZSAA 3HP4A 4IQ0A 3Q8KA 3DAPA 3ESDA 3FPCA 1G60A 4A0RA 2DHEA 4F93B 1TVCA 4QXQA 4DREA 1QO0D 3VKFA 1KJQA 2FF7A 3FMFA 2GYWA 3NO4A 2PANA 2W11A 1R3UA 4N54A 1A72A 3VZRA 1T5BA 1KEEA 3FTDA 4I5FA 1H2FA 2X4IA 4IDCA 3AFOA 2I8CA 3HXLA 1M34B 2Q3EA 3EAGA 3OPYA 3ZE7A 5EP4A 4E6EA 2AJCA 1SVMA 4N7JA 2AC4A 4WK4B 3CW9A 3WWZA 2VZ9A 5K6AC 5I9NA 5TF4A 5ENVA 3MMSA 2HU8A 3CX3A 1FRFS 3CISA 1XD2A 5J1TB 2DJ5A 1DG9A 3T61A 5DYWA 2B94A 5DX1A 4EG4A 2E0IA 1TCVA 3G8BA 4U2KA 2CL7X 1Z45A 1R18A 2OBYA 3EZGA 1RW4A 3DOIA 3JCZA 2EC5A 1KQGA 2P3OA 1DNPA 2NM0A 1PNVA 2B1QA 1PT9A 3L8MA 2OOKA 4LRQA 1CZNA 2GO7A 3IOYA 2VDLB 3HWWA 3EZ6A 4XI9A 1M2VA 1NRJB 2WEKA 1VRCA 3T52A 5HOEA 1WXXA 5IC4A 3DGFC 1AUPA 4FFBA 4OHFA 1GRCA 1XCGB 3L7CA 3SX0A 4MP3A 4D99A 5IT0A 1IH8A 5I6DA 2BM1A 1Y37A 3H9JA 4H27A 2J3QA 1HNXB 2ZREA 4P1ZA 1RLIA 1TZ2A 2DUMA 4ETWA 2ZB3A 2NWQA 2ZDQA 3A1WA 3IAHA 2HK7A 3PFCA 5FORA 3T7EA 3WDMA 1FUUA 2EIHA 2JANA 2RI0A 4ND1A 1RR6A 4EDFA 3PXDA 1XNJA 1EVKA 3GFRA 4WLUA 1BN6A 1BEUB 1KDPA 2VOJA 2VSXA 2CNWA 5K0GA 3LUDA 3KKKA 5A4JA 2O1EA 4GAEA 2NQ8A 2XCTB 1KSGA 1XCOA 2C04A 4U02A 4LWOA 4NU5A 2ZIXA 3O92A 1GA6A 1OGYA 2OGSA 2XZTA 3I8XA 1SGWA 4HLCA 4Q1DA 4A2QA 3S44A 4WA7A 4KXMA 3H2SA 3N07A 5JECA 4U7TB 2KI5A 2W2LD 4M37A 4MB0A 1EIWA 2CEAA 1BFKA 3D4OA 2B0CA 3PC3A 5ELXA 3P4XA 4P32A 2YY6A 1QH1B 1ICEA 3D6UA 3DKKA 4URHA 3CWZA 3EPJA 1KI7A 1L4NA 4OXXA 3MYYA 1BQEA 1KO4A 1U94A 2G72A 2XYQA 3CZAA 5B6IA 2YKGA 1ACLA 3OM8A 4ZQEA 3OCJA 4G0YA 2BCGY 4KQIA 4OH7A 5HMMA 1NC1A 3ZJ5A 4Y1GA 3Q7SA 4E6PA 1KL7A 1WSDA 4BPBA 2VP4A 4ZT3A 2CJYA 1PR4A 4L8YA 1LBHA 1GDTA 1X1DA 1JBEA 3CC8A 4OI4A 5D01A 3UAYA 4AKSA 2AMYA 3HYRA 4I5IA 1WX1A 1LH0A 1XLTC 2ISSD 3KHSA 1Y8QA 4M8IA 5K0JA 2FPWA 4ZAXA 1BXGA 1S2DA 5EMJA 1JU3A 4FZVA 4F6LA 4IV5A 4CODB 1BGVA 2R2AA 4B2PA 2WP8J 4R2LA 3PC4A 5LUBA 1T9DA 2YWEA 2QBYA 3ER8A 1GPAA 4HYYA 3PTZA 1Y7HA 1F8GA 1RAAA 3DVRX 4J0CA 4CEJA 2DHRA 4RLSA 2DFVA 2H8GA 5AXAA 3O7MA 3QVMA 3G2MA 4MI3A 5CYFA 4RTSA 3NT2A 3K6RA 1EWVA 1Y89A 3F0TA 3L8HA 4RMHA 3UJDA 4CE6A 3D3JA 3M2TA 5AW1A 2PDAA 1EXWA 4BQFA 3G49A 2HSDA 3OZUA 2GF2A 5GVSA 1A9TA 3V4ZA 1G20B 2PG3A 2PGAA 2PZKA 2CL0X 1K7EB 2WSBA 4HWPA 1LVUA 2VTVA 3C98A 1U8FO 1NVTA 2ZYRA 3CGWA 1XVUA 5EQFA 3BIJA 3RFFA 1NRIA 2PX8A 4JJ8A 2RHGB 3RTAA 2IPNA 2ODTX 3K9QO 3U37A 2G9NA 3KT8A 4Y2XA 4L5YA 2B25A 4WLEA 4IO0A 5E6UA 5I4CA 5KYXB 2V55B 2X9LA 2X3UA 4P5PA 4EL5A 2IHNA 4LBVA 1P18A 3DE6X 2OXTA 4RCZA 2I4LA 5IJXA 3BGSA 2IFTA 3DMNA 3IMKA 1TAUA 1TRHA 3PXBA 3VVMA 3T3HA 5JH7F 1SH7A 2AI3A 4IR7A 4IYRA 3F3YA 4AL4A 1LCIA 2IUTA 1AT1A 3DFIA 3KBOA 3GLGE 3KTDA 3LC2O 4RGYA 3SQOA 3L8EA 1UAYA 2OB1A 1GAWA 1W88B 2P67A 1KTVA 3DOCA 2ECFA 1D6SA 3P9RA 4HSEA 4EA7A 1BMTA 4O2AB 2IV7A 1QDLB 3TQRA 4RKRA 1YZ3A 4B85A 1WPGA 1M5RA 3WB1A 2I3ZA 2P7IA 5D1NA 3LBAA 1Z29A 1YE5A 1IONA 1W34A 3OM0A 2MT9A 3GLRA 4GKBA 2PJUA 3D4PA 4PAOA 4A9AA 1XJ0A 1PL0A 3NM6B 4RHTA 3A58B 3WIBA 2NQTA 3RVMA 1UJ6A 4PGHA 2FRVA 1DE0A 3JWGA 4OYYA 1W93A 3K16A 3MUFA 1G3MA 4F92B 3VH3A 2DBZA 3QVJA 3C6QA 3F8WA 2C2KA 1R16A 1CFJA 2A0WA 3UA3A 1MENA 4ZRDA 2EP7A 3G7UA 2I4RA 3CZCA 3K8YA 2WF5A 1MGPA 1DB3A 1VG1A 5HCIA 3F9IA 2GGSA 4HNTA 4HS4A 1DTSA 5KTSA 4G4SO 3DZ8A 2FN4A 2FJ0A 2H18A 1ZIXA 3IELA 3F96A 2YJTD 3PPXA 1YOBA 1LPAB 3SZMA 1SK9A 2QYTA 3R8CA 5GJBA 2HMTA 5EIAA 1YJAA 3KSRA 4HDNA 4PLGA 3ASYA 2O50A 5DM2A 3AIOA 4O4HA 3GEBA 3GEEA 3KKOA 1H1DA 2YC2C 1PK7A 4URZR 3UBMA 1VIYA 4PRYA 4R1LA 4E09A 2PWYA 2NO9A 1WVIA 3HDQA 3KNZA 3PFFA 4YRGA 1PQUA 3EGDB 2XMDA 3EVFA 3I1YA 3KTAA 3RDPA 1TEHA 2RHOA 2EL9A 3IUPA 3LD9A 1HFJA 5A5GA 3KJNA 1R66A 1IZYA 2ZBPA 5KOHB 4JB8A 4YT5A 4F38A 1FB5A 5E9WA 3WGZA 5KTMA 4RVFA 4NZOA 5LOVF 2EQAA 2BE9A 2X0JA 3PUIA 3FJOA 3HN7A 3QTTA 2BBWA 4Q47A 2DPHA 4AF8A 2AA3A 1NUAA 5K0LA 1XRJA 5DW3A 3SYMA 4MW9A 3BHMA 3H4MA 1MP0A 1NLYA 2RHLA 4MUBA 2W8ZA 4B4KA 4RNDB 1CUFA 2Q46A 4B83A 3MJDA 5BYKA 2YS7A 5JANA 3CZ4A 4V0OA 1GN9A 1P5HA 3E2IA 3NWEA 4M1EA 4AMGA 2GHTA 5ALGA 3DG9A 5EXXA 1J70A 1CRZA 4Y6LA 2ODQA 4HO1X 2EQBA 5T6BA 4R0VA 1C3EA 1R37A 2CXRA 4X61A 4L51A 5GJWC 1FMFA 3E7FA 1LJUA 3IKMB 3TDMA 3WJ2A 4RH3A 5CBPA 4LKOA 1LNZA 3EA0A 4DJAA 2BFBB 4GPD1 3RUHA 1H9AA 4DCPA 5DGIA 1TF2A 3T7DA 4H1WA 1W48A 5KQRA 4F4HA 4UVHA 1BROA 1PUXA 1P3JA 1T4DA 4G85A 1LPPA 1PJTA 1F06A 1GL6A 1QYXA 2AN4A 2BFNA 3BCUA 2VI5A 1KZHA 2G6TA 3UV7A 8AT1A 3WLEA 4DPLA 5FWNA 2JEYA 2JGDA 2V7PA 1T8UA 3DT8A 3HXTA 2D6FA 3PRJA 2R48A 1AB5A 3QIAA 3QPBA 1XHLA 1F2UA 4R8VA 4FP9A 4URVR 1XL1A 2RSLA 2VSFA 4I9GA 1GILA 3AEKA 1FYVA 2W2PA 4HMPA 3EQ8A 3F7TA 1JHQA 3ABOB 4E2FA 4HDNB 1HX7A 4FZ5A 3CEPB 2ZRGA 3TPCA 1Q0UA 3KJXA 2ORIA 4UULA 4OYHA 4WBXC 4ZVUA 3LV8A 3HU3A 4QM6A 2BI7A 3DD1A 6PFKA 3G2LA 5AMXA 3UOGA 3P2IA 1EI9A 4YASA 5IKOA 4L3OA 1DKLA 4ZTUB 4UM8B 3KTAB 3R41A 4MKRA 4DUPA 2DR2A 4UHHA 2EFJA 4NRDA 2WTBA 1NVWQ 2QL6A 3COPA 1IQRA 1NHWA 3EEFA 3SZGA 5K4GA 5LQKA 4XJSA 3IVGA 3G5LA 4FOTA 4J07A 1FMCA 5EIBC 4LIPD 3I01A 3ZY3A 2H1CA 1YRLA 4ON9A 2FZCA 3KSMA 1OYOA 2HLDA 4WVLA 3BFVA 3RS2A 1QIGA 1YB1A 3C5VA 5L7TA 4KGZA 4G4JA 3V1KA 2GAIA 3BMOA 1BS2A 1QHHA 4BZXA 2WIKA 3IO5A 4OVKA 3W3AA 2APJA 3FE2A 4BVJA 3KKZA 2QAGA 4PNZA 1CQPA 1HPLA 1TMKA 3KC2A 3CLKA 4Q4JB 4X1YB 1DJPA 2B4QA 2QT1A 4XOIA 5JNWA 3IILA 4KR0A 1FDTA 1TCCA 4I1RA 1SB9A 1JG6A 3ECAA 5DO9A 3CNBA 4EHIA 4G0VA 1OAKA 1E18A 1E62A 3MERA 4NSNA 3IJPA 1KI6A 1XB2A 2R8YA 5CNMA 2W4MA 2AIRA 3EXHA 4JH0A 5L7WA 1G5TA 4CQMA 1JDTA 4LEIA 4ID3A 4HKTA 4Y0AA 2VDVE 4CKXA 3D9QX 2PUWA 1L3BA 4YUWA 3KJQA 1WW3A 5EQTA 1H6AA 1Z06A 4JCOA 5CG2A 4Z54A 4DNPA 1B42A 3AZPA 1HTBA 3SX4A 3L0OA 4LRSB 4XQ9A 4QSHA 1J7KA 2ZS8A 5D3MA 4LY9A 1IN6A 1I7PA 4EYSA 1VDZA 3ZPXA 1KY2A 3KUXA 1ZHOA 4BB0A 2OVBA 4A0QA 5EHXA 2FHSA 3B3FA 3MJHA 5AOCA 4ZAYA 3DMRA 4GRDA 1QR6A 1ZSYA 5LIRA 5TRTA 2P75A 1DEKA 1EZ1A 2VWPA 2MINA 2IV3A 1XJ5A 5EUMA 1N2XA 1NC3A 3D1JA 2BKAA 1G0OA 1REQB 1IB0A 3GLQA 4J6EA 1Z0IA 1L5LA 5IH7A 2XLBA 4JZYA 2F62A 5EWLB 1V6CA 1AZTA 2MIIA 2ONKA 2WWFA 2CY0A 3E9DA 3OKPA 5EIBD 3WOVA 2CVFA 3ZS9A 4BL5A 1Y3CE 4YK7A 2JC3A 4RJTA 2H07A 4NYJQ 3JYQA 4U9UA 3WP1B 2CHVA 1UWLA 4BNVA 5IJ0B 4FLFA 4QTTB 4HQLA 1P4GA 4U2BA 1OZHA 3QV2A 3I4LA 5I7AA 2Z04A 2FSSA 2KE5A 3NHAA 4L9WA 1T9ZA 4UM7A 4DG9A 1E8MA 4CLOA 3CR3C 4PC3A 5IW8A 4ZALA 4CR6A 4QDJA 1M8PA 5KWJA 3U2QA 3WX0A 1V1JA 3N8DA 1XRNA 3N8GA 1JSCA 2CYCA 4DLUA 4R2WA 3FNQA 4CMIB 4G1CA 3V5NA 3J80A 3W9BA 1QZTA 4GP6A 3CVVA 1W4BA 1Z2PX 4CGZA 2B98A 1A96A 3QG5A 5KCMA 3QOYA 4EY5A 2FZVA 2RKWA 3ORSA 1ZYUA 5HPYB 2WI8A 2AMJA 2I4MA 4TWZA 1S3IA 3W8DA 4L74A 3BG5A 1E9SA 1GSOA 2QRUA 3FCSB 4B4WA 1Z83A 1VZ2A 3GUZA 3OCCA 5H5JA 4TRJA 4YAIA 4OH1A 2VJQA 5ER6A 4XDZA 3VGPA 2IITA 1MDBA 4L6CA 3EFOB 1EWKA 4HBZA 2X5NA 4YJHA 3QGMA 4N39A 4QPNA 4TMTA 5AHRA 5D3MB 4J9VA 4BKRA 1AU9A 1F4VA 2JFXA 3FHLA 1O96A 1PG2A 2I4NA 3CUVA 3NIDB 3EPHA 4L75A 2NU9B 3V1UA 2P3SA 2ZYIA 5KIAA 4NZNA 4LVOA 2WSLA 3IMGA 4CTOA 1W85A 3LRXA 1BA2A 4YJ2B 3N2LA 3HWRA 4DUGA 4GBGA 3UFXB 4CU2A 5GJCA 1FC0A 1P8AA 4KK4A 3CRNA 1GT91 1T9HA 3W3AH 2GN9A 1ZR4A 4AQ7A 3WDKA 4CU5A 3TQHA 4LKRA 4NTZA 2JJ8A 2NN3C 3MAGA 2XMGA 3OPNA 5L45A 5AK0A 1JIIA 1CDZA 2EFDB 3O83A 3PE6A 3LQ4A 4WY2A 4CUKA 5CVCA 3D7LA 2G0AA 3CBQA 4DMHA 2J5KA 3CBGA 1FU4A 3PHJA 1K6EA 2R6R1 2ZYSA 4JA0A 1YFZA 3MNFA 3PYMA 4LWPA 5IYZF 3VKVA 4JT8A 4AP6A 4ZWNA 3QA9A 1VE7A 2Q3DA 2VUTA 4P9NA 4HDKB 4D3FA 1Q0LA 4N82A 5LKRA 2B8EA 4IRMA 1D0SA 1RE0A 4WBNF 4CLOB 1EZZA 2P9HA 4DNXA 1QF7A 1T5HX 1U3FA 3M9WA 1YHNA 4CDGA 3EC2A 4B09A 2DM6A 1VXOA 3QTBA 1JYFA 1H2ZA 1OLSA 2IP4A 2QUBA 3DW1X 3EG5A 4DJEC 2JKVA 2RH9B 4D57A 3EF3A 3W2HA 3ZDFA 3ZU2A 4W6ZA 2LCIA 3QHPA 3P8ZA 1B6TA 1NXPA 4Y0NA 4MW0A 1GQOA 5JS6A 1CYEA 4IS2A 1G4HA 4K28A 2EKPA 4CG0A 2H08A 4MB2A 2MOKA 4QVGA 3ASVA 3R0QA 5IF9A 4IM7A 4JJKA 2IKSA 5DLPA 4YJHB 1G4AE 3CWCA 2F3SA 1WW8A 4WXPA 1X1QA 4XFJA 4MKIA 5CFMA 1LBIA 3ID6C 1RLJA 2EW1A 4RTNA 1EFHA 2NUAB 3KKPA 1QVRA 3L6EA 3WMRA 4K3UA 5JWRA 5HRCA 5A0FA 3UMMA 2D4HA 1MJHA 1LU9A 1Z08A 1T13A 3A9RA 2Y8EA 1YA6A 2PSFA 2R6HA 3OJEA 4JLOA 1ZSNA 2XBUA 3W9YA 1N3YA 2BD0A 3Q87B 4DWJA 2OAEA 1FDVA 3OPMA 4EHAA 3NATA 1FZQA 2BF7A 2BT4A 1E2LA 3B70A 3C8DA 2XT0A 5MGBA 3BMQA 3PP8A 4XWWA 1QIDA 1XEWY 4KKVA 1Q1QA 4PBSA 2NV6A 1CK4A 4JDUA 2BTEA 1WMDA 3CO0S 2GCEA 1HG1A 1X38A 3Q3VA 5DYYA 1FYWA 1F48A 1T9KA 4LHSA 3R6WA 4OF4A 3SR3A 4EG7A 1E2PA 4NAHA 5EWMB 1YB6A 4BQEA 1NQAO 2Y2UA 3TLMA 1Q1BA 1QYRA 3AETA 1XNHA 3SIRA 1FJ2A 1NR7A 1G21E 2ZSJA 3MIIA 2VDNB 1P9OA 3GA7A 3T06B 3N8NA 4DR3B 2JJMA 4ZMRA 2A9KA 2QTNA 4GYKA 4M22A 4OIFA 2QSUA 3HYLA 5I9MA 4R51A 2ZE8A 1NKSA 2J85A 4MVJA 1R8XA 1F20A 1SZJG 3KR2A 4G1FA 1QIJA 3R7SA 2ACVA 1OLSB 2RHHA 3HY4A 3Q1LA 3H2IA 1U0FA 2FDCA 1NZDA 3EF1A 3JSXA 1VLJA 3U4QA 1NN5A 1P77A 3CLUC 3UHFA 1UF9A 4OATA 3RUPA 4KPGA 1QX3A