1CR4A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dtdp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
243
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRGGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 74
structure length 243
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr4A00
5AJYA 1G41A 1A82A 4G0NA 1MOZA 1VG8A 4HSEA 5E7MA 1Q44A 1ZU5A 2ZJOA 3UIEA 3R8CA 3I92A 5HE8A 3QG1A 3HWSA 3C7KA 4C0AC 1HH4A 4I81A 4TQ9A 4C0BA 1X8JA 3AGQA 3PUVA 4C30A 1XU4A 3WNCA 1N5KA 1XDBA 4TTRA 4Q4JA 1M1YE 1F3OA 2NO9A 3REFA 4LCBA 4UNSA 4PHFA 3MG9A 1VDZA 4MKIA 4R9UC 3SFZA 4TT3D 3GFOA 1O87A 5FUYA 2VP2A 1NBME 1S8FA 2R6AA 4HI0E 1XTIA 3WYGA 4AIIA 4XJXA 3KKPA 3NH6A 1IN6A 4IOMA 4A15A 4LYAA 5KNCA 3KL4A 1OYWA 1R5NA 1X8KA 4DCTA 4PZZA 2JLVA 2R9VA 4RZ2A 1KI6B 4KFSA 1OKKA 3BAFA 4TQAA 4JLPA 4D4JA 1GTVA 1JEEA 2D62A 4EIWA 1XCPA 4DUGA 3LLUA 4Q1BA 4MGKR 4ZDIA 1JECA 4XH9B 2J59A 2JAQA 3AF2A 2UVQA 3RWMB 3RNLA 1KO8A 3C15C 3GLIB 4ZIRB 2GK7A 1KJZA 1DG3A 2JLSA 1T91A 2Q3HA 3FFAA 2CBZA 1ZD1A 3VR1A 5G41A 4OI0A 3VX4A 4XWOA 3CPHA 4LHWA 1OKKD 2B21A 2OE2A 3GEIA 5EZ5A 4I1OA 5D3MB 5FBQB 2D4HA 2QGNA 2VF7A 2ZE7A 4OQMA 2B8WA 2BCJQ 2ZE5A 2ZS7A 1DELA 1TADA 1QVAA 3GJ5A 4NL4H 4TWZA 1W48A 4YMUA 3VNVA 2VYFA 1UPTA 1E2JA 2QAGC 2QMHA 2WM9B 2QSZA 1XZQA 3PUYA 2A2ZA 3Q7PA 2ZRAA 2OXRA 4M21A 4P3YA 1QVRA 1US8B 3TK1A 2EVWX 4DEYA 1ZC3A 3IPYA 1WB9A 3CR7A 1RRGA 1XEWX 3NEYA 4M1OA 1ZIPA 2FGKA 1Q1ZA 4U5XA 4DLZA 2XB4A 3W3ZB 1IN5A 1Q22A 4LHZA 5TARA 2DFNA 2NIPA 3GEHA 2PJZA 2QMEA 1EFUA 3ECCA 3OIYA 4EPYA 1BYUA 2PLFA 3H84A 5KO2A 4DCUA 5JSZB 2ZRBA 1I4TD 1ZC4A 3VHXA 4UNRA 1YJ5A 1GSIA 3IBGA 3KZ1E 2JASA 3QXXA 4MUBA 4F4IA 5FTMA 3LXRA 4TL6A 1GL6A 3QOFA 4JL6A 2A5GA 4A8JC 3ZVRA 3QKRA 3B1XA 4JT4A 5L3RA 1E9RA 1TTTA 3SDZA 3U3JA 3RSOA 5J4KA 2AD5A 2PZGA 3A1SA 2C2HA 4LPSA 3THYB 1G3UA 1E2NA 4MRVA 2GEDA 1NLYA 1XZPA 3QXJA 2PZFA 1KI2A 2IF0A 3QPVA 4H1VA 4LBYA 2IL1A 1JB1A 3JVUA 5FPKA 2GXSA 2YWFA 4G5OA 4Q4LA 2IHYA 1OXXK 5JWOA 4EUNA 1Z06A 3LA6A 1II0A 3WP0A 4B73A 4DSUA 3UXMA 3GLGB 1N5LA 4V0LA 5CDFE 1HY3A 4B2IA 5HCNA 2O0JA 3B8HA 1P5ZB 3IIMA 2WWXA 4A9AA 1QHHB 3PFIA 1VCMA 3WHKA 4HDQB 1AS3A 2C9YA 4DDVA 1P4SA 2DFLA 1EWQA 4E03A 1LVGA 1Q0UA 1W1WA 2WOOA 3P1JA 1WDTA 4G3XA 3CX6A 3RC8A 2OEPA 5HE9A 3EARA 2O8BB 2NO0A 2LKCA 1QDEA 2ODWA 2VLIA 4B44A 2QBYB 3CH4B 3GJ0A 4PSKA 5KNDA 1KTVA 3THXA 2FX3A 4LDJA 4LZZA 1RRPA 2IC5A 1D6JA 2V6JA 4IEEA 1NJGA 1GIAA 4ZKEA 1FW6A 4MKGA 5B64A 1SULA 3SJBA 3K9GA 3CF2A 3TMKA 2C5LA 1J70A 2WWGA 2J45A 4Q66C 1OH7A 5FTNA 2VHTA 3RS5A 4CF7A 4GZLA 4BRUA 4CZ2A 2GA8A 2P6RA 2MMGA 3RRYA 1ZM2A 4A6XA 1Z0AA 5GADl 5JJLA 1CR2A 2X2EA 4RZUA 5FBWB 2H7VA 3SFVA 5P21A 2B7CA 2NZJA 2WKPA 4LJ7A 1WCV1 2ERYA 4HZUA 3NTUA 1II8B 4DB4A 1KJYA 2QAGB 3HU3A 1E2DA 3D31A 3FHTA 1KSFX 3HP1A 4EDHA 4MDFA 3KB1A 3IHWA 1FX0A 5FPSA 1NLZA 2MSEB 5AUQA 3A1VA 2WKQA 1OB5A 5BWMA 5EP4A 1X1SA 2ZS9A 2GRJA 3CBQA 2ZANA 1IN8A 4F38A 1EFHA 2RGNC 4CEJA 1VIAA 1NMZA 3GLHA 2BJVA 1MR3F 4DEXA 1N0UA 5J4VA 1XTSA 2WJYA 2ZPTX 2NPFA 721PA 2IEYA 1NG1A 1UFQA 1WP9A 4A8JB 3SE0A 4PC7A 3SOPA 1G8PA 2N1BA 2RCNA 1VCNA 5L8VA 1ZINA 1TU3A 2CCGA 2CHQA 2WPDA 4B48A 2CL0X 4M1WA 3DMDA 3KJHA 4AYXA 4ZCIA 4ZDWA 3TW4A 2D7DA 3P26A 4WZBE 4MGYR 4OQXA 3NIBA 4KVGA 4ERNA 4HAVA 3QG5A 5BN3A 5KNBA 1XCGB 4UNQA 3B13B 4PFSA 4EPXA 2PEZA 3QEJA 5ANRB 2DHRA 2GF0A 2GETA 4MRRA 5GJCA 2QQ0A 3Q5EA 3QE0A 4WZ6A 2FDCA 3NDBB 1WQ1R 3SI7A 4C9BA 4NH0A 4D4MA 3NBXX 2YWGA 4NYJR 3KJIA 2JJ8A 1C1YA 5GJBA 4PO1A 4B35A 2NTYC 1UKYA 1N0VC 1RRFA 2F1IA 1S96A 3KXIA 4CW7A 2XJ9A 4Q1DA 4WXPA 1XX6A 5AWFC 1IXSB 1PJRA 3U61B 3SN6A 1OJLA 4S35A 3WMFA 4E09A 4DCNA 3PITA 1VHTA 5H1YA 1Q1QA 2GBLA 2KBEA 4GPTA 5HZKA 2JLUA 1BYIA 4MITA 2EFEB 3ZD6A 1CKEA 3PUZA 5F98A 1DEKA 4Q1EA 3EWAA 2QE7A 3TIFA 4QGHA 4GI7A 1P75A 1RJ9A 3AEZA 4GP6A 2CE2X 1CJUC 1IAQA 1XXHE 1UDXA 2WAXA 1HEIA 1E3MA 4PO9A 3I8SA 4KXFB 3MMPA 4LK2A 4JKYA 1Z0DA 4TN1A 1XCMA 4AWXA 1DAIA 3ASYA 3PXGA 2KE5A 4G5SA 4I1SA 2IUUA 3EWSA 4JLAA 1G1MA 3QIAA 2V8OA 5AJWA 1M34E 1G64A 1NMYA 5DE3A 3TAUA 2W0MA 4KI0A 1DTSA 1KSGA 2QE7D 1UDWA 1N6RA 1E99A 4FMBB 3L0OA 3O8RA 4CRWB 3EAQA 4DDWA 3N5CA 4MKFA 2PJRA 3K9HA 2RGBA 4Q03A 5LB4A 1O3YA 5KHOC 1G9XA 2JATA 5L3VA 1OYYA 1ZUHA 2CLDX 4PSVA 5IHPA 2I3BA 3KXLA 1BH2A 2BMEA 3GD7A 121PA 1EWRA 2HJGA 2B7BA 2OBLA 2RB4A 5JWRA 4XVQA 1TF7A 3AB3A 3VR2A 5J47A 1AIPA 5BW8A 2JLXA 4DCVA 1W5SA 4LJ5A 4B34A 2ZRFA 5J4HA 1HT2E 4QHYA 2BBSA 4KV9A 3B5JA 4DVGA 1II9A 2OFOA 2ZSDA 2PT5A 2V3CC 2ZJYA 3QXCA 1FQJA 1YKSA 1Z6TA 2A30A 4W5JA 2IYZA 4ZCMA 1DADA 2ZE8A 1CJKC 2XSZA 3I4LA 2OCYC 2VO1A 3M1IA 3MWLA 2QORA 3VU9A 1XJCA 1E1QA 1KHTA 4LYJA 4AC9A 3CWZA 3UG6A 2VSXA 3O47A 3V4RA 3IUYA 4EJSA 2A5DA 3EPKA 4KSBA 4DT1B 1XJQA 2FZ4A 2WTUA 2G3YA 2J7PA 4TYNA 3D6TB 3AGPA 3FMFA 2P3SA 2HYDA 4FCTA 3AVXA 3SYLA 3LVQE 4NKRA 1JR3A 2HCJB 2ZYVX 2O8DB 3EASA 3NKVA 2BJWA 2TMKA 1GFIA 3LH5A 2QM7A 1N6LA 1E1RA 2XNDA 4Z54A 8OHMA 4P4SB 2XSZD 2DY1A 1CULC 1NVXQ 4YONB 2F1HA 2GKSA 3TUJC 3LVRE 4LBVA 2OFWA 2Z0MA 4NYMQ 1CR4A 1XMSA 2QMUA 3M0EA 3N70A 4AKEA 2F9LA 2J7PD 4U02A 2BC9A 2BHRA 4M22A 2QPOA 2YVUA 4HLUC 1AK2A 5G40A 1KGDA 3T12A 3ZH9B 3ZZUA 3CWQA 1JR3D 2IS6A 1Z2AA 4F92B 3QF7A 3WRYC 3L0IB 2R62A 2FMXA 2OZEA 1F2TB 1N6OA 1FPMA 1IXRC 1WA5A 4JKIA 2XNDD 1E1RD 2QZ4A 4X8OA 3SJCA 5ELXA 3EC2A 2AK2A 3KB2A 4Q4AA 2BOVA 4NDZA 2A78A 3QKSA 2FZLA 3W6OA 4B47A 1NRJB 1G4AE 4JT2A 3ZVLA 1T0JB 5AJVB 5FPHA 5LPNA 3B1YA 4FMCF 4A0RA 3VR5A 2ZRHA 1LS1A 2ZJ5A 2ZI5A 1E9BA 1P61B 4DXAA 4B43A 1RYHA 1FP6A 2GXUA 2OCPA 3C5HA 2IX3A 5DYIA 2W58A 2W6IA 3QSYA 2Z5FA 2FE4A 1LFDB 1P6XA 3C8UA 4HB3A 1U0LA 1R0ZA 3WMEA 1U90A 2R8RA 2VP9A 5DO9A 5CITA 4JLNA 3LBHA 4JMPA 1W7AA 1OLOA 4BE7B 1E98A 2QQEA 3NG1A 2CCJA 4TYYA 3LLMA 1YQTA 5FTKA 4MYHA 2VHCA 4QNRA 5FR2A 1UKZA 2XOKA 1HE1C 1P2VA 3BFKA 3BD9A 1ELOA 2V54A 3GQBA 4DLTA 2H92A 2BKEA 3CRW1 1E2KA 2FV8A 2ZUCA 3LWNA 3ZS8A 3U6KA 1FP7A 3C5CA 4GFDA 2IYQA 1S9HA 1JAIA 3RANA 1YHNA 1DS6A 3N2IA 4EFNA 4ZDJA 2KBFA 4IDPA 4W9MC 3EX7C 2W6ID 4RSGA 4PPQA 3QY0A 4HB4A 1DARA 4BPBA 1QHGA 1G3IA 2BEJA 4GP7A 5FOSA 1G8YA 1OT3A 2FGJA 5FPTA 4M2LA 5GVRA 4C4PA 2P5SA 2V4ZA 3C4JA 2P5TB 5KU1A 4GZMA 3MSXA 4IFEA 2N46A 4EQ6A 3A6PC 1GDDA 2XOKD 1DOAA 2HEIA 2P6NA 4HAWA 2OXCA 1E96A 2XJ4A 1H8HA 4DBLC 4DSTA 3A1TA 1DG1G 3K0CC 5JRJA 1HE8B 4US1R 4FI3C 5AUPB 3IEVA 4NCHA 2P0EA 4LV8B 2XXAA 5J5CA 1YVDA 1NN0A 1A2BA 1CR1A 1RRCA 1KI1A 1JXMA 3AV0B 1AS2A 3TKLA 1RIFA 3QEOA 5SZIA 3SHWA 4DC9A 3T61A 2VQSA 4B2LA 2NMVA 3AP2A 1SVKA 3L82B 3K09A 1NMXA 1G8FA 1PZNA 2J3EA 1AKYA 2WICA 2Q3MA 3AVUA 1VG9B 4L9WA 4NPHA 1XPRA 4TTPA 2N42A 2JLRA 2IYSA 4MYTA 1NSFA 3B9PA 2ZM5A 3CX8A 4OQFA 2QPAA 4DLYA 2VHQA 2Y8EA 3UK6A 2VRWA 4ZO4A 4D26A 4OQNA 4QL3A 1W47A 3NVAA 2DWPA 4YMWA 1QHYA 2RMKA 5C4MA 2JDIA 4TMKA 1W4CA 2DBYA 2OESA 3Q9LA 4N0DA 4V0MA 2IYUA 3FWYA 1ZNZA 2WIAA 5JCPA 2LCFA 3AH8A 2GZDA 4NZYA 4P4UA 4Q4JB 4R2IA 4PQRA 3EZ6A 1AJEA 3HYTA 1ODFA 3CPEA 4M0LA 2FF7A 5GJWC 2NO1A 2QA5A 1Z28A 4RZ3A 1Z3IX 3LW8A 5UKDA 3A1UA 4BLPA 5JRZA 1GOTA 3MWKA 4C0HA 3K70D 2JDID 3N2EA 3THWB 2FPMA 1DAKA 1MH1A 1VTKA 4LY6A 1R0XA 1YE8A 4AK9A 2C03A 2OM2A 4LI0A 2J0SA 5KDDA 2YWEA 4Q21A 2UKDA 5L3QA 4HB2A 1GNPA 2BBTA 1MABA 1ESNA 3SNHA 4F93B 3UANA 2ASEA 4A2PA 1KNQA 2IYXA 2VSFA 3RABA 1G5TA 2IW3A 5IF9A 4EPWA 5HPYB 4G5QA 2GILA 5K8TA 3DDCA 1TAGA 2ODEA 3X1ZA 1FOEB 4M9ZA 1K6MA 3GJ8A 1M7GA 1SHZA 4QBGB 2O8CB 3BH6A 4GSYA 2ZYWX 3PEVA 3LX5A 3CF0A 2PMKA 1XB2A 1WXQA 1NNEA 4AG5A 2FFHA 1W2GA 3UMRA 5JI3E 1OV4A 1ZRHA 3QJYA 1ZNXA 4GBMA 3NBZC 5FTLA 1W0JA 4A4DA 1Z47A 1W0KA 1GRNA 5A5GA 4GT1A 3DM5A 4QGGA 3NWJA 1G20E 1P2TA 1WBDA 4TT3A 2GAAA 3UG7A 3DPUA 1P9RA 1GNRA 2C9OA 2QRZA 3FMOB 4XD7A 3RRMA 4LSGA 1R0YA 1KK0A 2JJ2A 1ZU4A 1SGWA 2BEKA 2EWWA 4RCYA 1EK0A 4JSYA 1P62B 2ZU6A 5FI0B 2QUZA 4V0NA 4C0KA 4Y0VA 3F0TA 3D7MA 2AK3A 3EC1A 1G19A 4ON9A 3SZRA 3KKNA 3HPQA 4XVUA 1W0JD 1W0KD 3EZ2A 1XJ0A 2F6RA 2FN4A 3U60B 2CVFA 2VTKA 3QKRB 2YWHA 4FINA 4YC7A 3AM1A 2FPKA 3IPXA 4XD7D 4BLOA 5CIWA 2EYUA 2WWHA 5E4FA 4CIDA 2ORWA 1L7VC 2JJ2D 4LBWA 4M53A 4KHZA 3LX8A 4WAUA 1E0JA 3PEUA 1LB1B 1XTKA 2CHGA 4IFBA 3PENA 3LBIA 3GJXC 3L8ZA 2V9PA 4HATA 5JWHA 2V1UA 1EFTA 3HDTA 5EE5B 4B32A 4ABYA 1QG2A 3GPLA 4D25A 4AI6A 1QRAA 2PLRA 1U2RA 4LGMA 4CEIA 3BH7A 3BFVA 3H2YA 2AKAB 1GM5A 3KUCA 1KI4A 1DE0A 3CZQA 2BV3A 3MRSA 3R20A 5AJXA 4CDGA 1RPZA 1HQYE 1R8QA 2OHFA 3AF0A 4N1AA 2WJHA 1KZGB 2B92A 2BBWA 5FR1A 4GMDA 4R7ZA 5FBRB 2H16A 4QM7A 3ZLJA 1RKBA 2EFGA 3W6NA 3BOSA 4LJYA 1Z2CA 5CK5A 2YINC 1Z08A 2J0VA 1N2CE 2IXFA 4UJ5A 1R0WA 1XEFA 1ZM4A 3K0FA 5LDDC 4D4LA 1GP2A 1NVUQ 5CB6A 4D0GA 1XTRA 4B2PA 1XRJA 4KLZA 2Z83A 1X8LA 1Z29A 4Q4HA 5KOYA 3THXB 2OBNA 4Q7JB 1M7BA 3FYHA 3AVQA 2WOJA 1XBTA 4HEJA 2A9KA 4KYIB 2VP0A 3GLIE 4JLMA 3HPRA 2DFKB 4Q19A 1XF9A 1YZTA 1E4VA 2BMFA 2HUPA 4UNNA 4D6PA 3ADCA 1NI3A 1J90A 1U8ZA 4BFZA 1ZNYA 2YZ2A 1U98A 3CLVA 3U2QA 4IDOA 1Z63A 1X3SA 2WIBA 4N0EA 2R6DA 4QC2A 4RY2A 4B3CA 1M74A 2ANBA 1AQUA 1E0SA 2QTVB 1UAAA 5JCZA 1U9IA 2HT6A 1Z22A 4UXJA 1NBMA 4U00A 4KAXA 2OAP1 2VA8A 3MJHA 2JJ1A 4HZUB 3TSZA 5FPYA 1E2MA 3SS8A 1RFLA 3SHFA 1SQ5A 1F60A 1U94A 4DKXA 4W5HA 4HUTA 4QNMA 2G9NA 1KDPA 2AWNA 2D2EA 3GFTA 4TQUS 5A4JA 4JJZA 2FJUA 1T5IA 4MRPA 5EQTA 2OSBA 2WAYA 3T1VA 3B82A 1E32A 3HYRA 2FEMA 4EFMA 3U4QA 1EG7A 3V00A 3GCGA 2FPLA 3I3SR 5FUWA 1UEIA 2ZRMA 1NVVQ 4NCIA 2IBMA 1M8PA 3U3KA 1E2IA 4CEJB 1LTQA 4KODA 1NBMD 2G83A 4MGZR 4QKQA 1TQ2A 1QBKC 2ZAOA 3GEEA 4OHWA 3L0PA 3LY5A 2JJ1D 3DVLA 4Q7KA 4FN5A 3BC1A 1G7CA 3LXXA 4GRAA 4K81B 4DDTA 3KQLA 3LO5A 4HDCA 4URVR 5B57C 2ZITA 2O0HA 3ZS9A 4BEBA 1I4DD 1FQKA 1COWA 4CEHA 2D06A 2V6IA 4EJSC 3NDPA 1JQJC 4BLSA 2IS4A 3HU1A 4MA4A 4Q1AA 2NOAA 3E1SA 2IS1A 1SZPA 1K5DA 2J1LA 3R9XA 1AZTA 1S4QA 3IKJA 1XD2A 2ZJ2A 1KI9A 1T4GA 2ZJ8A 4LYHA 2QT0A 1W2HA 1VYUA 2ATVA 4RD1A 1W4AA 3ZZ0A 3GLGE 1E2GA 4RD6A 3KFVA 1DAFA 3P4YA 1CF4A 1Z0FA 2AR7A 4GNKA 4IVRA 1OF1A 3UMFA 3DHWC 4YXWA 4KITB 3HR7A 4JIMA 4BZXA 4NYIQ 1COWD 2DPXA 2Q3FA 2YV5A 1F48A 1N6HA 3PJRA 1PLKA 5G3YA 1GRRA 2R65A 4HLQB 5EXXA 1UBEA 3RWOA 4OYHA 3PV0A 1HURA 3RSLA 1TF2A 2OUKA 2RAPA 3BB3A 4MRNA 4OK6A 1OFUX 3VTKA 3MWYW 2OV2A 4BEJA 4DZZA 4A92A 1KAGA 3KKOA 4M8NE 2O5VA 1ZIOA 2ZQ5A 2H18A 1TF5A 1KSHA 3CO5A 3G5UA 4YXWD 1RJ9B 5K8UA 3QVUA 3KQNA 4X8HA 4FWTA 3R8FA 3ZIAA 5HZHA 2FSGA 1QF9A 3CIOA 4Q48A 5JFGA 3A4NA 1FTNA 2ZYTX 4TSFD 1CJTC 3SC3A 4RFVA 5JECA 3T35A 1KK3A 3WY9A 5JSZA 3RLFA 2CDNA 3EA0A 3FTQA 2AWOA 4TMZA 1S0UA 1W5TA 1YR6A 5CB8A 1UEJA 1AA9A 2R6CA 2IWHA 1KKLA 3BORA 4BQSA 5DLQC 3X2SA 2IS2A 2ECKA 2X19A 1D5CA 5G3ZA 1N6NA 5CM9C 3K0EA 3IILA 4BFUA 1KIMA 4PX9A 3ZIAD 5CLQA 4RKFA 3THYA 2GCOA 3TAHA 1IM2A 4DRZA 2J41A 1P7CA 1HA3A 1I2DA 2AX4A 4HUQA 4KYUA 4PZYA 3BBPA 5FOWA 1JEDA 2ZI3A 1YZUA 2E9SA 1FTSA 2B8TA 2C8VA 5DI3B 2OBMA 4LYFA 4XWKA 2FG5A 2ZRPA 3OAAA 2HDNB 4NCJA 1Z83A 3WNDA 5DN6A 3OIVA 2A5JA 4Q47A 3L0SA 1AM4D 1F2UA 2GJKA 4ASUA 2I1VB 5DH9A 3KUDA 5FBVB 3MD0A 5CJ2A 1OE0A 2QI9C 5HCIA 1G7TA 1B23P 4I1UA 3PUWA 3DEFA 4Q9KA 4A6PA 4QXAA 1E94E 3PR1A 5CM8B 1E9SA 1V43A 5L3SA 3VU9B 4KFTA 2CCKA 4PC6A 5KUTA 2O8BA 2BKUA 1OIWA 1L2TA 1R5OA 1SXJC 2ZI9A 3FOZA 4EJSB 1ONBA 3OAAD 2QEQA 4BLTA 3AVWA 4AKHA 5DN6D 2DWQA 3BWDD 2XAUA 3O8DA 4Z1MA 1YZGA 4Z51A 4ASUD 2YNMA 1H65A 3GFPA 4C7OA 4JYCA 5JS7A 4DLVA 3GJ6A 2V1XA 4KJZA 4A82A 4F4CA 5IRCD 3K09C 3FHOA 2FWRA 4L5BA 3DKVA 1QG4A 2Q9CA 4TLAA 3BH0A 1MRSA 2HLDD 1A2KC 4TYQA 4BLRA 3KTAA 1T3HA 3KJEA 1E2FA 1GKIA 3MUFA 4PSAA 4OI2A 3R7WA 1NN3A 1R2QA 3REGA 3K70C 4K8OA 1AQYA 3B1ZA 1ZW6A 2FOLA 2YC2C 1WMSA 4M4SA 4Z1MD 1OH5A 1GUAA 1L8QA 4BECA 4BGDA 4ARZB 4EKDA 2ZJZA 1CJVC 1TNDA 4G1UC 3V4FA 3VX3A 1MV5A 1N0WA 2I4IA 4RD3A 2O0KA 1S3SA 1TEVA 2H17A 2NO7A 2ZJAA 1G16A 4RCZA 3NEJA 4YQFA 4Q4AB 1Z6AA 5DNYB 5JI2E 3RRNA 4DSNA 5K8IA 4JVSB 4KSCA 4IDQA 3T34A 1FZQA 1ZUIA 2OCBA 4US0R 2XZLA 1R5BA 2NO6A 2YOHA 4ESHA 3CB4A 2FSHA 4TZ6A 1XP8A 2QU8A 2HYIC 1U81A 2ATXA 1FFHA 2BCGY 1XWIA 2F43A 2DWOA 2GCPA 1HYQA 5C2JB 1Z6YA 3TQCA 3OESA 2QAJA 1ZVQA 4L16A 4AY2A 4TL9A 2QP3A 2CK3D 3K0AB 4RKEA 2JLQA 1ZD9A 2YHSA 4IW3B 4P32A 2YC4C 1LF0A 4Q9JA 3WMGA 4RD2A 3U6BA 3OEHA 1Z6XA 4ACAA 1KO4A 3P4XA 2KB0A 3GJ3A 4JYBA 3RDPA 5E3HA 3RS4A 2IEZA 3A1WA 1YZQA 4QGAA 3K9NA 2L0XA 3AVPA 3IIKA 3OEEA 4LX0A 3E70C 2J7KA 2EQBA 4JVMA 1FMLA 3LRPA 3AUXA 4B71A 3TE6A 1Q1EA 1W36D 2O8FA 4B3XA 2G0TA 1EX6A 1Z0IA 2FEOA 4ACBA 1KDTA 4V02A 1IHUA 1UBCA 1XXHA 221PA 4WW0A 2IT1A 5CYOA 1UF9A 3I5XA 2OO7A 1OH6A 3A4MA 1FNNA 3QVVA 2PH1A 2R6GA 3OEHD 4OL0A 3DZ8A 4JS0A 3G0HA 1MO4A 3ICQB 1Y63A 4NP6A 2EWVA 4OQLA 4JVNA 4B3DA 1LY1A 5EJEA 1VMAA 2B6HA 1P9WA 3CR8A 5FFMA 3OEED 4C0SA 4NBSA 2GESA 3WNBA 1E2EA 1R6BX 3QKUA 3U7EB 3AQ4A 4IEIA 4M9SA 1KMQA 4A2QA 1SXJB 3ADKA 3M4YA 5GJVC 4FW9A 4D4KA 4EFLA 1E0AA 2XXAB 4B76A 1H8ED 3B9QA 2J46A 3CRMA 4B3GA 3JZAA 3B7GA 2UZIR 4XIGS 1Z6GA 2WVJA 5EE1A 2H5EA 1BIFA 4TLDA 3A37A 4JLBA 3EZ7A 1KDOA 5C4GB 1KY3A 4QJ3A 2Q9AA 5FOUA 3PCRB 3FMPB 3IQXA 2GCNA 3L2OB 2XGJA 2C9CA 1CU1A 2ZUBA 3K70B 3LQQA 3EIQA 4EPVA 4LPKA 4J0QA 1SXJE 3GLFA 1FUKA 4QG7A 3DKPA 1YZKA 2WJVA 4ILEA 4IXNA 4CT5A 5DHFA 3S1AA 2RHMA 4Q7LA 3FKQA 2HCBA 1MO6A 2WWWA 4BFXA 1YR9A 1AGRA 2AXPA 5KSYA 4IOJA 4URYR 3QPUA 3DL0A 4PANA 4DSOA 2WMNB 3B6EA 3I1FA 3ONWA 3OHMA 3K0SA 4WOPA 2JLZA 1VG1A 3B1VA 5KPDA 1A4RA 3C16C 2QL6A 1M6NA 4OBEA 5B30A 1KOFA 3QF4A 1KDRA 1FNMA 5B58C 2ZAMA 2VSOA 4WIAA 621PA 1M2OB 2HV8A 3D3QA 4JLDA 3T5GA 2GJSA 4M1KA 4YMVA 3W8NA 2C04A 5AJZA 4MUAA 2P2LA 4I99A 4IVPA 5JHGB 2ZSEA 5DIFA 4PPNA 1YZNA 1MABB 1XNJA 5SZHB 1SKYB 5FOTA 3I5YA 3W34A 4DHEA 3GJ7A 5FH9A 1JPNA 1P2SA 4ZDKA 3RC3A 1KSJA 1YRAA 2W83A 4TLBA 4DT1A 1X6VA 3QKTA 5DYGA 4WXRA 2WJJA 3RS3A 1CRPA 2AHOA 2ZJBA 3VFDA 4V0KA 2QPTA 2BM1A 4YMSA 1PV4A 3JVVA 4JSTA 2QMOA 3ASZA 2ZR7A 4I1VA 5BYKA 1A7JA 4Q01A 2O8DA 3TR0A 1J7KA 1U9IC 4JBXA 4G5GA 4Z8XA 2ZRCA 4JZKA 3C41J 4U7DA 2GK6A 2Q9BA 1E6CA 2J0UA 3HU2A 2XTZA 4KLNA 4P4SA 1OW3B 1KMHA 2ZSFA 2DB3A 1DVRA 4JLVA 1ZYUA 2WBLC 4DLWA 1VYTA 5EP3A 1E2QA 1Q12A 1SKYE 1P72A 4PAQA 1KY2A 4MRSA 1KK2A 4HAZA 1Q3TA 2BDTA 3LW7A 3UPUA 2CNWD 3F8TA 5SZJA 4QOSA 2JIZA 4BZQA 3VHLB 5H68A 1MT0A 4F4JA 1OPXA 2ZRNA 5C18A 1UADA 1G6OA 2ZU0C 3BERA 3OE7D 5JEEA 2R44A 2GHIA 5EXTA 1P73A 4M1SA 2RGGA 4O25A 1KO7A 3X1YA 3EIHA 2G1JA 3CRVA 3D8BA 2QT1A 2BMJA 3FFBA 4MYUA 3VR6A 1KO1A 4NYJQ 1XD8A 2CLCX 3AKCA 2DR3A 1AGPA 3F5FA 1ZD8A 1VCIA 2VHUA 1CIPA 2WZQA 2EFCB 4Q9HA 2O8EA 1NLFA 3R9IA 5TB5A 3ADBA 1AN0A 2ONKA 4TMVA 1SKQA 2JIZD 1CXZA 1OSNA 1ZAKA 1XEXA 2GZAA 4B3FX 4IRUB 5AUOB 2WHXA 1ZCBA 5JEDA 2IF2A 4AURA 1QHXA 3VAAA 3TVTA 4JL5A 5K8LA 1KYIA 3TRFA 2GF9A 1I2MA 4CEIB 1UJ2A 4B3BA 3HJNA 3QUSA 4LC1A 2GEUA 2VF8A 1Z0KA 3TUZC 2CEAA 4BFVA 1KI3A 2X1VA 4M9XA 4OHXA 3I32A 2XZPA 1D2MA 5TY0A 2A7QA 3H1TA 1ANKA 1ESMA 1DAHA 1EGAA 3IIJA 1J99A 2AL7A 4XWAA 4MYCA 1RYFA 2ZI6A 3SYKA 2X8AA 2C78A 4AG6A 3RYTC 3CKLA 4E22A 5H8WA 4QJ4A 4DLXA 2C96A 3PEYA 2BIFA 3MFYA 3K0FB 3W6PA 4ZPXA 5AUNB 1N5JA 4TL8A 2WKRA 1LS6A 2QTHA 2PEYA 3CONA 2RHDA 4Q9LA 1JPJA 4NONA 4PZLA 1OXSC 3H0KA 4OHZA 1U8AA 4IJMA 2A3RA 4Q4HB 5TDHA 3EPJA 4PPGA 4DLSA 1E2HA 4P31A 2ZUDA 1TQ4A 2PT7A 2LWIA 3U44A 2CL7X 4PHGA 4HAUA 2PL3A 4P33A 1OFHA 1Q20A 2V7QA 2W0SA 2ZIAA 2P65A 3MWJA 1IY0A 2MMCA 4S2EA 5JLJA 3ZQ6A 4BRWA 3X1WA 4CVNA 1KJWA 3PG5A 1AKEA 2QRNA 4LHXA 4JJKA 1DPFA 4AKIA 3PIRA 2G0NA 1GRQA 3SU8A 1NIPA 3DOEA 5C46F 1QHSA 5J40A 2JEOA 4NCKA 2RGAA 2WWIA 3VQTA 1XEWY 4UQOA 1RC8A 4JBWA 5B2ZA 2GJ9A 2Z4SA 5CJPA 1Z5ZA 2ZRIA 1N5IA 3Q72A 4B75A 3GMTA 1TEXA 4RFSA 1G5RA 2XTMA 3TNFA 1D9ZA 1GWNA 5KSZA 1HQCA 2V7QD 2MSDB 4PPFA 4Q1FA 1GAJA 4TMTA 2ZREA 1OB2A 1R8SA 4PC3A 4OHYA 1G6HA 5CIQA 4HLDA 1Q21A 1KI7A 2IHBA 4HLUA 3U4QB 4LJ8A 3KX2A 3VR4A 4WA7A 5EXPA 2J0QA 3SJAA 4KBFA 1SVLA 3OIUA 3QBTA 3AUYA 1T8UA 4BUJA 3OF5A 3A58B 3IO3A 3EZFA 3T15A 1XPUA 2CMKA 3NHBA 1TUIA 1Y3AA 3NH9A 5BXQC 1NP6A 1NL3A 3E5HA 4N3NA 3PVSA 1K8RA 4Q18A 3X1XA 4A1FA 3BFXA 3QBVA 4QBFA 2ZSBA 4AKGA 3MGCA 3CUEF 3AP3A 3T1QA 4AYTA 2V55B 1Q1BA 4BFYA 2G88A 2FH5B 4NCNA 3U5ZB 4CEHB 4KU4A 3THWA 4EPRA 2Z43A 2IA5A 1UKVY 2QROA 3NBYC 2VL7A 4I4LA 1M7HA 2REBA 4LWZA 4D80A 1ZM3A 4F91B 3CH5A 4OHVA 2QY9A 2GBLC 2QGZA 1OXTA 2F1RA 4M1TA 4O2LA 1SVWA 5FOVA 1R4AA 1XD2B 3ZJYA 2O52A 3VKGA 1YRBA 3IQWA 1KO5A 4TYPA 1Q3HA 2J87A 4CYMA 2I1QA 2ZR0A 3NXSA 4XTCS 1HUQA 4R98A 2NQ2C 4OI4A 4WZAE 1Q57A 3ZYCA 4V03A 2O8CA 1ZCAA 3QXSA 2PBRA 3KJGA 3TJZA 1I4LD 1LF5A 2CJWA 4DUGD 4JLOA 4ZKDA 2IYRA 3MJRA 2AFIE 3HR8A 4BFTA 1VG0B 2C77A 2ZRJA 1XMJA 2RGDA 1CLUA 3MLEA 4NHOA 3TUIC 4DJTA 4TLEA 4YMTA 3SJZA 3BJIC 4IXMA 1A1VA 1N3BA 1IJFA 4TTQA 4O0MA 1N6KA 4KBGA 2LKDA 4MH0R 4QBIA 3KXKA 1E69A 3AF3A 1G21E 2NGRA 3WHLA 1E2PA 3LBNA 5J4YA 5TXGA 2VP4A 4F7WA 2EFHB 1TU4A 2ZRLA 2UZ3A 4FIDA 2JLYA 3BB1A 4KCGA 1TQ6A 4RVCA 3G82C 1TX4B 1WE2A 1DBSA 1FX0B 2XEXA 2EU8A 2PX3A 2GVDC 3K0CA 4R71A 2AD1A 1JXOA 2AN9A 1QZXA 3VR3A 1W36C 2YOGA 1WRBA 5FBLB 2IYVA 1ZUNB 2CL6X 1E2LA 3GLHB 4FMDF 4LC0A 4ZI2A 1E4YA 3DMNA 1GKYA 3ZD7A 2YOFA 1BOFA 4IDNA 5FTJA 2GAOA 3CNOA 5AR1A 4URUR 4CGZA 2ZRGA 521PA 5JJIA 3IHLA 1BO6A 4FWIB 2P6UA 2QNRA 1S3GA 2GCOB 2OLKA 4NYMR 821PA 1X1RA 1G7SA 2ORVA 1KI6A 1A5TA 1KAOA 2R2AA 3BGWA 4HUQB 4QFMA 3KKMA 4TZ0A 4JBYA 1XMVA 2BBOA 3NBFA 2DYKA 2J5XA 1E79A 1VPLA 1JJVA 5LB2A 4IDHA 4PHHA 4LOAA 4TYWA 2AXNA 2ZVPX 3DM9B 1U99A 1YR8A 4OI1A 1V5WA 3LNCA 3Q85A 3TW8B 1G8HA 5KPJA 3W9YA 1F2UB 1U0HC 3FMIA 4Q02A 3GLHE 4US2R 3GLIA 2RKOA 3VMFA 4ZIRA 1TL7C 1PVOA 5EE3A 1IQPA 2GVZC 2G77B 1G3MA 4XOIA 4B6EA 3SYNA 1QHNA 1LW7A 3CM0A 4URZR 2G1KA 2RH5A 4QHTA 1F6BA 5JJKA 2ZS8A 4IKEA 5D3MA 2ZEJA 5L3SB 2QP4A 1JQLB 1W4RA 2WMOB 2KI5A 1NKSA 4KFUA 4TSFA 4WBSA 1E79D 1TQDA 3TBKA 1FL9A 1FMJA 4C0QC 4PR0A 4BZPA 5GVSA 1T6NA 4MGIR 2XTNA 3VKHA 1BMFA 2OAQ1 1EESA 3KFXA 2X77A 2W2XA 3I73A 4XVRA 5E7JA 4C7OB 4GL2A 4FMCB 3W90A 3O8CA 1US8A 4M1YA 3NC1C 1OHHA 1UBGA 3Q7QA 3X1DA 3AKDA 5HKKA 1T5LA 1ZM7A 4M1MA 5EE0A 3RHFA 3DO6A 2FA9A 3W8RA 3KTAB 4UNPA 2YJTD 4GOKA 3JZMA 2K5UA 3FPAA 4HAXA 4A0GA 3U7HB 2PX0A 2F7SA 4OJQA 3A8TA 3R7WB 5LD2C 1UKEA 3ZDQA 4QBHA 3EZ9A 5JBQA 3WXMA 2D74A 4V0OA 1D2NA 1NIJA 5CDFA 1BMFD 5F3WB 1MKYA 1P60A 3CNNA 1E9EA 5TMPA 3U7FB 4PQFA 3R9WA 2REXB 2MSCB 4RJLA 2JLWA 1T0HB 1ZNWA 1OHHD 5G53C 1MO3A 2WWYA 5HKKD 3U3MA 4O3MA 5BQ5A 5EUQB 1ZBDA 3CNLA 4O2RA 4E5UA 5CLLA 2W2VA 1T3LA 3TVDA 1RVDA 5IDVA 2HF9A 4FCWA 3U3OA 2WSMA 3V9PA 3EPLA 3U7GA 2ZTSA 5AK0A 3FE2A 3AF1A 4UXIA 3I61A 4NMMA 4Q9IA 1CP2A 4BWYA 2D2FA 2FFAA 2D7CA 4YDSA 1W36B 3GLGA 3WYAA 4G01B 3LAWA 2F43B 2A5YB 2ZR9A 2VEDA 3BE4A 3OFNA 4PC2A 2GXAA 1QHHA 3OZXA 4QRHA 2QSYA 1S1MA 1VCOA 2WWFA 3K53A 3KKQA 4E07A 3TGPA 4YDHB 2KJQA 3C14C 3ZGXA 2VIIA 2HLDA 3RS2A 3AVYA 5FL3A 5CK4A 3I72A 1E0KA 4H1UA 2ZXUA 4BFWA 2DFTA 5FUVA 2Q0HA 5DISB 4QHSA 2GXQA 1D9XA 2Z4RA 3ZVMA 5KDLA 2ZYUX 2R6FA 4HDOB 2QBYA 2O8FB 4W7SA 2VHJA 4NTZA 3TLXA 4IVQA 4A0FA 3FHCB 3RAPR 1OFTA 4Y0AA 5C1BA 5IK2A 5JHHB 3OFND 2NZ8A 5DI9A 1XPOA 1XXHB 2YYZA 2SHKA 2C95A 3RS7A 2WPDD 3ND9A 2CE7A 5KSOA 2Z6VA 3ICEA 5DGXA 4LV5B 5DHAA 3AVVA 3CW2A 6Q21A 5EE9A 1T8TA 1NJFA 1EFRA 1IN7A 1LV7A 1DAEA 2JGNA 3MAAC 3WRXC 2GNOA 5IK2D 2X2FA 2QN6A 1II8A 1VKJA 4DIDA 2QAGA 4PHTA 1ZMXA 1ZM9A 2EYQA 2OLJA 1SVSA 3UKDA 4TL7A 1JR3E 1G3RA 2ERXA 1NKTA 3BIFA 1JNYA 1G7RA 5EZ6B 1J8YF 2CK3A 1DAGA 5FI1B 1MO5A 4PXAA 5LBIA 2H1LA 5EUMA 2IWRA 4GOJA 5DSZA 3TSOA 4D0LB 3K8YA 1D2EA 3AVOA 3VKWA 1DAMA 3QKSB 4POAA 1W46A 2VPPA 1EFRD 1PUJA 4LHVA 4GDFA 4R2HA 4L8GA 4NE2A 4TLCA 5J4LA 3I62A 5LD2B 1G5PA 2WJGA 3GLFB 4ZV4A 2FSFA 1SVOA 1E9DA 4C3ZA 5BN4A 1GKUB 3LV8A 4A36A 3S1AB 1SVIA 2H57A 3QENA 1SVMA 4A8JA 4L4UA 2ZROA 4CT4B 1BKDR 2GWHA 3CRQA 4C0LA 3SQXA 3UMSA 2IYLD 5EP1A 3A4LA 3UWOA 4XSGA 1IN4A 4ESVA 2AFHE 1PLJA 4HZIA 2DCUA 2F3TA 2CLSA 3T5DA 2IYYA 2WJIA 1OXUA 5F9HA 1GL7A 1NN1A 5DI3A 3OIWA 1NN5A 3DZDA 5TVKA 2BWJA 3CX7A 3QF4B 3ZVNA 2ZI7A 1WBBA 4MKHA 5FL7A 1T9HA 5F9FA 2JA1A 1PLLA 4LRWA 1IXZA 1R7RA 2QTFA 4FCVA 5D3QA 2IK8A 2BMDA 4WVFA 3LQRA 5HTKA 3GLFE 1IY1A 2F55A 2EFDB 1H8EA 2CXXA 4UKDA 1VIYA 4LV6A 2IUTA 2RGXA 3P27A 3AKEA 1OH8A 1CTQA 4HAYA 4C2UA 4LJ6A 1P9NA 5F2EA 4YLGA 5EXSA 1Z8FA 3BK7A 2OCAA 2IYTA 2OG2A 3I8XA 4AD8A 4EQ6B 4LJAA 2F1JA 3B2EA 5HR5A 3GJ4A 1NG9A 2GDJA 5FL7D 3WYFA 3IBYA 3WBJA 4JLJA 4HLCA 4Q1CA 4UXHA 3FGNA 5KYKA 3B85A 1XFAA 3EG5A 1FUUA 4DLUA 1GITA 1E9AA 2ORIA 1IY2A 2EW1A 4BASA 4D0NA 3T1OA 1C9KA 1DO0A 2H8KA 2J0UB 4EAQA 2GZHA 2VH5R 3IO5A 4MQBA 4Z8YA 1KMHB 2RGEA 2XZOA 2OILA 2FFQA 2QM8A 1C4OA 1E1QD 2J9RA 4JLKA 4KFRA 4TMXA 4HB0A 3F3YA 3SBEA 2ODBA 3AVTA 1KI8A 2ANCA 1GZSA 3AKYA 1KZ7B 1JR6A 1OIXA 5CYPA 1NVWQ 1G18A 1E9CA 1SHKA 1PUIA 4ZCLA 1LNZA 1JJ7A 5BYJA 4PQYA 1K5GA 1EXMA 4Q7MB 1EFCA 4ARZA 3NHAA 4C0JA 3KQKA 2JCSA 4IOLA 1W4BA 3EW9A 3CPJB 4KVAA 3VNUA 1NY6A 3Q3JB 4PC1A 3W5JA 1RZ3A 3RS0A 2VBCA 2FSIA 2XB2A 1S1CA 3L43A 4JL8A 3SQWA 4B6FA 3KQHA 3W3AA 4L9SA 4NU0A 4JVLA 1W49A 4XTRA 2O8EB 2GEVA 1P2UA 4QM6A 2HT1A 1CR0A 2REOA 1N6PA 3RRZA 4OK3A 2Q21A 4DB2A 1UBFA 1TMKA 1XEXB 2RGNA 2D3WA 421PA 3FVQA 3UWKA 1NY5A 5BN5A 3PEWA 4DCSA 2OT3B 3W5IA 4B74A 1CBUA 3K0AA 4D2IA 1JALA 1UM8A 1GVNB 1E9FA 1G8GA 2QENA 3FKSA 4GOXA 3KQUA 4V0ME 3BRWD 1NF3A 5FOXA 5L3QB 4LHYA 3EIEA 1RE0A 3O8BA 3K1JA 5JZVA 1CJMA 1XMIA 2IUSA 4EPTA 3E2IA 3H4MA 5JS8A 4RD4A 1MRNA 2VP6A 5A0FA 3P32A 2F3RA 3T1TA 2C98A 1TUEA 2CNWA 1NVVR 3QI2A 4DIEA 3TR5A 4H9GA 1G3QA 3J81k 3K9LA 1S2MA 4LJ9A 2CVHA 1JAHA 3FKSD 2BVNA 3KDSE 3OE7A 4DWJA 2F9MA 2RGCA 4ZI3A 2ODNA 3ZZTA 3B78A 1U0JA 1G4UR 2GTPA 3SBDA 5FUXA 3CRRA 1Z0JA 4DDUA 2XITA 2C99A 4XSHA 4P4TA 3U44B 1L4UA 1S9DA 2ZRKA 1L4YA 2XNSA 3CZPA 5E95A 2ONJA 5E7IA 4FMDB 1SXJA 3FB4A 3M6AA 1VHLA 1OXVA 4X8LA 3U3RA 4C2TA 4A2WA 2VP5A 4PAMA 4IHQA 4RZXA 2P67A 5KDOA 4LJ4A 1F2TA 4QJ5A 4ITRC 3BXZA 3GP8A 1IONA 1J2JA 1GILA 2QP9X 3EPHA 1X86B 4AYWA 1JBKA 2FU5C 1CEEA 2WSSA 4URWR 4RFSB 2BM0A 4RD0A 2ZETA 3T06B 1F5NA 4NYIR 1KKMA 1H8HD 4K46A 4FD2A 5SZKB 1BS1A 3ETLA 4Q00A 1XD9A 3CF6R 4LUCA 4HYYA 1SXJD 3WBKA 2PZEA 5IT5A 1XTQA 2WV9A 3RVBA 2G6BA 4GMXA 3QQ5A 3Q5DA 1GNQA 1HTWA 4P0TA 4L15A 2HXYA 1VYVA 4KO8A 5TV2A 1WF3A 2ZRDA 1CRQA 3NC0C 3PQCA 3PUXA 1GL9B 1G17A 2IXEA 3LDAA 2IYWA 1J8MF 1HT1E 3MCAA 1GG2A 2NG1A 1QHIA 2A5FA 1ETUA 4TMWA 1KNXA 5M04A 1OIVA 1IBRA 4URXR 1ZP6A 3IGFA 2WSSD 3QNUA 4UJ3A 4W5WA 1YR7A 4OK5A 4IOKA 3A36A 1CS4C 5KSPA 5KTYA 2W2TA 3TSWA 2HF8A 1W44A 3ZQJA 1U8YA 2FFBA 2HJVA 3H86A 2W6JA 2ZE6A 3B60A 2ZVQX 1D8TA 3BB4A 2E87A 4D81A 3Q8XB 2XX3A 4OJKA 3EA5A 1IJEA 3IDQA 2NPIA 4Q5IA 4BLQA 3SEAA 3ADDA 1VECA 1YU9A 1P3JA 1AS0A 3AF4A 3UATA 3AP1A 3FDIA 2PMDA 4B33A 4II7A 3EXAA 2ZI4A 2KWIA 5H70A 1RW4A 3P20A 2W6JD 1KK1A 2Q6TA 3BS4A 4QGFA 2PCJA 3ND8A 4PTLA 2ZSAA 1XTJA 2CJWB 1YZLA 2PCLA 1N25A 2FNAA 2YKGA 2GJAA 2IXGA 2E1RA 1G291 2CHVA 3LFUA 1AZSC 1IOZA 1HV8A 3TH5A 1JI0A 4BFSA 2OFXA 4M9QA 3DOFA 3QPWA 1Z07A 1TPZA 4D82A 3WP1B 3B1WA 1ZJ6A 2GJ8A 5JMTA 3LD9A 4PO8A 1EX7A 2KSQA 4LBZA 4DLRA 4FXPA 1NSTA 2HXSA 4G5RA 3TQFA 3L8YA 3QXHA 4OKSA 2W00A 4PAOA 4A0HA 1B0UA 3SR0A 1N6IA 2AKYA 3THOA 4X8MA 1R10A 1DO2A 2QG6A 4MDEA 5EP2A 1T3SA 3IEUA 1OFIA
chains in the Genus database with same CATH superfamily
4UUMA 3R7SA 5E7MA 5G4LA 1Q44A 1ZU5A 3V32A 3JAWB 3ZU5A 4ZC8A 2VYND 5HE8A 4GX0A 3C7KA 1W94A 1CRLA 2FQWA 4V0SA 1Q5PA 2C9ZA 2NO5A 1JLLA 1ZD5A 4M6WB 3LPDA 2BD0A 4E5MA 3SXJA 4ABTA 4W63A 4JYAB 5LZ7A 1XDBA 2QN7A 3MWFA 4H08A 4N5DA 4Q4JA 3RROA 3I6YA 5IKOA 1K7SN 4UNSA 3FW1A 3MG9A 3MLBA 4WESA 4R9UC 5BSHA 2GPSA 2MR5A 3GFOA 4IF4A 4WK0B 5FUYA 3E8MA 3GVPA 3L1HA 4BO5A 4YUWA 1KVQA 1MXFA 4HI0E 4AN4A 3HHEA 3OJCA 4P81A 1CS0A 1QGDA 1KOGA 4DR6B 4YJ3A 4LYAA 3WKCA 2H07A 4ND5A 5KYXA 4EW2A 3OO1A 1UPFA 2P4HX 3KS9A 3IP5A 1KI6B 3M3DA 2Q50A 4KFSA 1OKKA 4HR7A 4ZYZA 3C5EA 2RK4A 2D62A 3PD1A 1YONA 4ZDIA 4JV5B 1N8SA 1PFVA 4XH9B 3QHAA 2VTDA 3B7WA 6GPBA 2JAQA 3AF2A 5F52A 1EK5A 1QGYA 3DDSA 1GGMA 4Q3LA 4F4HA 1M2WA 2NYVA 1FSGA 5K0SA 5E1OA 3UCFA 4YIHA 1T15A 3H11B 3I01A 4GUDA 3F6PA 2AW5A 2DJIA 4F4UA 1RHUA 2P30A 4L07A 2Q3HA 2QTRA 3S4YA 2WIFA 3OQ1A 1WQ4A 1ZD1A 3RU9A 4HNAA 2ZB3A 5AK3A 4ER7A 4XWOA 3JD0A 1U8TA 2G9RA 2P68A 1BJTA 1OKKD 2B21A 1TO6A 2HA2A 5EZ5A 3VVCA 4KMSA 3LUBA 1M2VA 1U5BB 1LU9A 4XDHA 2CFIA 2A14A 3RJ9A 4B0OA 1IBCA 2ZS7A 1KH2A 1DELA 3BEDA 1QVAA 3PDWA 4HRVA 4TWZA 5EJ4A 2BAGA 3BM5A 4PYMA 2IYNA 4Y2SA 2JH9A 4LZAA 2VYFA 2B1QA 4ZTZB 1NW5A 5KTPA 4EUKA 1YQ9A 1N0HA 3E6AA 1A2QA 2NX2A 1CQIA 1H1DA 4K05A 3ZLUA 5CD1A 4XW2A 2JL1A 4WOKA 5EIHA 2QWXA 2XBLA 2ZRAA 1M6VA 1UOOA 4M21A 5GOTA 2EVWX 4BP1A 1GGVA 4BS9A 2W42A 3DZIA 2GN2A 1RRGA 3H1PA 3I28A 3R23A 3QZUA 3NEYA 4PY2A 4M1OA 3WIDA 2FGKA 5CG2A 4MV5A 3BXXA 4PZDA 2XB4A 2OK8A 3W3ZB 4FB5A 4YRZA 1B6RA 3CLUD 3GX1A 1M1ZA 4L27A 2PJZA 2JIOA 1BYUA 2YN4A 4BVAA 2A88A 5KO2A 3HWX1 3FAZA 2ZRBA 4L7VA 2WWRA 1E18A 5DHRA 4DCUA 3KZ1E 3QXXA 4I1IA 5K3EA 1QIGA 1XELA 5HBRA 1XVTA 3M89A 4TL6A 3UT0A 2A5GA 4C2AA 2B5OA 3QKRA 3OLYA 4JT4A 1HYHA 3R6LA 2C7GA 4G9GA 5L3RA 1CUIA 1TTTA 4TXHA 3RSOA 1JEOA 3FZEA 4RS3A 3DZGA 4DAEA 4XCXA 3IDFA 1Z5VA 2D1TA 4CL3A 2XEDA 3G2JA 2C2HA 1RLUA 3C3AA 1NLYA 3G6WA 3H13A 1OFUA 1T0UA 4C22A 3HLTA 3G9QA 1X1CA 4YDQA 5CFOA 3QPVA 4H1VA 3ZOZA 5ALKA 4G5OA 4H0NA 1OXXK 5JWOA 4BVKA 3F7NA 4IIEA 1V5GA 4DSUA 3VSEA 3GLGB 1QR2A 4GGMX 4CIWA 5CDFE 1JHVA 3MTAA 1R3DA 2L82A 4B2IA 2PVPA 3UPDA 4XJTA 2XVAA 1AT1A 4MQEB 3PFIA 4W7HA 4XIJA 4J9UE 3W3AH 1QGAA 3GT3A 2C2KA 3WG9A 3WHKA 4DTCA 3HKBB 1P4SA 1D2AA 2CXHA 1TEHA 4DMFA 3PZRA 1LVGA 1W1WA 2PGIA 2WOOA 1EEHA 5LIRA 4KWTA 4HVTA 2ZIGA 2WIDA 3CX6A 2FWPA 2OEPA 2GPAA 3LL7A 3NNNA 2EBWA 1X13A 5E3IA 4ARSA 3RC8A 4WCFB 3EMDA 1M6HA 1G0NA 1YC5A 4INJA 4K3UA 2NO0A 2LKCA 2NXNA 2ODWA 2Y1EA 3CJTA 2P35A 2W2MA 3FHLA 4K6FA 5E6UA 5SY9A 3V8PA 4ES6A 2C1XA 1WMFA 3W79A 3PE6A 4PSKA 4DL9A 3SZOA 1HNNA 2OBXA 3H9GA 3LO8A 1YK0A 4LDJA 3THXA 1RRPA 4HP8A 5HBGA 1W5EA 4IEEA 4KXMA 2ABWA 1GIAA 1CQZA 4H1HA 4ZKEA 1QIFA 1T8SA 1HLPA 1RMYA 1ETHA 2HU7A 1LDYA 3WNCA 5C5EA 5ITVA 3R5SA 4XJSA 3U4MA 4GLOA 4X71A 3S29A 5FTNA 4BCDA 4FHGA 3IXLA 4CZ2A 2COUA 1J00A 1POWA 2CL5A 1JAZA 2OHVA 2VAWA 4UOQA 2E4XA 4YEDA 3DEIA 1FU7A 1Z0AA 2X4GA 3GVXA 4TT8A 4B5LA 5GADl 1YA6A 5IVKA 2X8JB 3PQ5A 4QUBA 1X7YA 3GPBA 2B7CA 5P21A 3R7LA 3MFQA 3OZCA 1KQPA 4LYEA 4HZUA 3AY7A 4NC9A 4DB4A 2QAGB 3GT4A 4QFDA 2CGEA 3OF3A 2I76A 1JLRA 2P78A 2VAMA 1KSFX 4EDHA 2G5PA 4S1PA 1JV2B 5FPSA 1NJ8A 3FOWA 1M2JA 1TCVA 3AI7A 1JPVA 3COZA 2HJHA 3DZKA 3CVUA 3HI6A 1QIKA 4F38A 5H3LA 4ZVRA 4Z7NB 1CT9A 1OLXA 2RGNC 1YNOA 3HDJA 2FMKA 2J48A 4FOSA 4H2DA 4I9UA 5CVJA 5H16A 4I3HA 1QP0A 4N3AA 5C37A 2E55A 5LMZA 1ZN9A 3WJ1A 1U0GA 2Y99A 5K0TA 1APBA 1G2QA 1GZ7A 1XTSA 1XL0A 4W8GA 3FR8A 721PA 5EGNA 2WK1A 5BN4B 4C29A 4DM3A 1T13A 1TFUA 1WUIS 1JJAA 1U31A 1J0DA 3SOPA 1ZONA 4R16A 3JQFC 4B6QA 5JNTA 3PYMA 1E62A 2EF0A 1TU3A 2CHQA 6NULA 2WPDA 4B48A 3IMEA 4ZDWA 1OILA 3EZGA 5EIEA 2HWXA 4J4HA 4LRSB 1IEWA 3CUVA 3HCNA 3TW4A 4MGYR 3S2ZA 3SMVA 3TSYA 1SB9A 1IM8A 1LRJA 1RLTA 1OWLA 1XU9A 3Q1KA 4HAVA 2I2FA 2YIJA 1REQA 4UASA 4PFSA 4HNHA 4W6ZA 3K8ZA 3O82A 3QEJA 1PT7A 2GF0A 1TMGE 3ZGLA 3P97A 3I04M 2BPOA 1T1JA 4JB8A 2WP0A 5EKXA 5GJCA 2ZT8A 3T9BA 1QRUA 3DLHA 1JSCA 2DUWA 3Q5EA 3ZBTA 2FDCA 3A1CA 2XBMA 3D6FA 1C30A 1C9JA 4ZAZA 2Z6AA 1CFZA 1QPGA 3CS3A 2PY6A 5LNK6 3G8CA 2XRZA 4R84A 5GJBA 4PO1A 4B35A 1HT3A 4RVFA 4WINA 1PV2A 3S44A 3FJOA 3J7AC 3SZLA 4XPIA 3IAEA 4YWJA 3T3MB 2I7XA 5I7VA 2VUSA 5IJ0A 1UBRS 1LBQA 2R96A 2ZXFA 1EHIA 4OGKA 6AT1A 1NUSA 3S5UA 1C1DB 1JS1X 2ZR8A 1JHRA 1K08A 2YV3A 3W8FA 2IPOA 2W5UA 3KE9A 1OFGA 3WMFA 4E09A 3TI9A 1QAMA 1VHTA 3AO0B 3PITA 5H1YA 4IIXA 1RFGE 1F4VA 2GBLA 4FGSA 4U7PB 1VE7A 5I5EA 2JC3A 2GPYA 4JB0A 1PFQA 2EFEB 4MHSA 2C42A 1CKEA 1L5FA 2HPHA 1V39A 3NCTA 3BGIA 3A06A 3PUZA 4Y2UA 5KTRA 1J39A 4WE3A 4I5DA 2EG5A 3SF0A 3ENKA 3PCTA 2AOVA 3PQ4A 2CE2X 2I4LA 2PSHA 4GP6A 4ESOA 4J03A 1GGEA 1UDXA 3AUFA 3OOHA 4KZPA 4ZREA 1VRWA 5CW1A 1QOPB 2NYUA 3I8SA 3CX4A 1XRPA 1HKUA 4J4TA 4RZIA 4AWXA 1E6UA 1EVKA 3WGHA 5I51A 1FDTA 1EJBA 1EP2B 2UUOA 4FZ3A 4BV8A 4EABA 5DHQA 3HO1A 2D13A 1B6TA 4FSXA 4EG3A 4G5SA 5BSUA 4D46A 3EWSA 4TV9B 1XJWA 4JLAA 3LWBA 4DUZB 3CTMA 3UB4A 3D4PA 4LVUA 1M34E 1G64A 1X7XA 4CIVA 5DE3A 3TAUA 1DTSA 4B4OA 1XGKA 3IMGA 1CDEA 1RLJA 4RXUA 1UJ5A 4K9NA 4GEGA 1A8IA 4UDOA 2CLKB 2KQUA 1XLTC 3KWLA 3EAQA 1K7EB 1I3CA 2PJRA 1FSSA 2JANA 2RGBA 3AZOA 1KEEB 4JP3A 1IIBA 4IIVA 4Q03A 5CFQA 1V8OA 3KJNA 1PR5A 4G1VA 2NU9B 5HZGA 4L73A 2JATA 3KZVA 5KHOC 2VEOA 3FPBA 3WMRA 2UV8A 3PLRA 4M8SA 1SBYA 4OLHA 4BN0A 5JAQA 2RE8A 3KLOA 4PSVA 2I3BA 3KXLA 4ER3A 2BMEA 4MCHA 2O7NA 1EWRA 2HJGA 2RB4A 2B7BA 3GEPA 4IGKA 1R9MA 1TJ4A 3AB3A 2PFSA 3D2AA 3HI4A 5EN4A 3T3IA 2P27A 5CDGA 5J47A 1VKRA 2L17A 2YJ6A 4QFBA 4Q9DA 3K1YA 4B34A 4WH0A 3TIIA 1V3VA 1IBLB 1NAIA 1HT2E 4KQ6A 3NAMA 4EJ6A 1AV7A 2YFHA 3B53X 1LI7A 4KV9A 3NHYA 3O2QB 3WI7A 1VMDA 4DLKA 2ZSDA 3KSAC 1J0AA 2QS9A 3EGXA 3PDCA 3PKJA 2V3CC 2VBIA 4C6TB 1YKSA 4W5JA 1V8BA 3K20A 5WRFA 4CF6A 3BTUA 3TTYA 1O7JA 2X6RA 3M1IA 3OOSA 3MWLA 4RZSA 1TGVA 3IKLA 4IZ6A 4LYJA 4BNUA 1BMDA 2FZCA 3D8NA 4GI2A 3O21A 4BO7A 4C07A 1TB4A 4BP9A 4DBZA 3EPKA 5DBEX 4KSBA 5EKSA 4DT1B 3OOJA 2LR0A 2G3YA 4WI1A 1LWNA 5KU7A 3A9SA 2H1VA 2J7PA 4TYNA 5IASA 2I3AA 4TWIA 4FCTA 2D2XA 4MW9A 3W2HA 3LVQE 2CFOA 1JFFA 3R3SA 4AO7A 1KVSA 3PCXA 5KYWB 2ZYVX 5HUQA 2O8DB 1D2RA 3WZ2A 4FEAA 2BFBA 4OQ4A 3IHKA 3LH5A 3E23A 4P5EA 1E1RA 2WWTA 4Z54A 8OHMA 1H6BA 1HC7A 1HDGO 4P4SB 4S05A 1XOIA 3H18A 1T29A 4NXMB 2DY1A 3LK6A 3T7KA 3TDMA 2VJCA 1Z3CA 2Z0MA 1MC4A 3CN9A 3EISA 4Q7EA 2XUAA 4ZXPA 3FOFC 5BWLA 3ROKA 5BR8B 1XMSA 1X1TA 3AHJA 4NFSA 2Z6QA 2F9LA 2J7PD 2PKQO 2ZXEA 3FRIA 3KEOA 1SOVA 3LQ4A 2BC9A 3QE2A 5AW9A 3U4GA 2YVUA 4HLUC 3V1NA 1ZK3A 1USVA 2VRBA 4URFA 3NIWA 3ZZUA 3CLSD 5AK4A 3TBHA 2IS6A 4F92B 3AWIA 1BH6A 3DCYA 2ZM5A 4OUDB 2R62A 1NI4B 2OZEA 3OTIA 1AE1A 3FPCA 3T1YB 5DXAA 5CFNA 3ECSA 5GZ3A 3CT4A 1WA5A 3O8OB 1DQNA 5IP5A 1E1RD 1DBPA 4X8OA 4YBRA 3UKOA 3N3AC 1N33B 3AYZB 3EC2A 3KB2A 3DE3X 4RIFA 2BOVA 1A77A 1UFKA 2VXBA 3QKSA 2RAUA 2FZLA 1YZYA 4BO2A 1NRJB 1PDOA 5GV7A 1G4AE 1PI3A 1KZHA 3TD2A 4DVJA 2C5FA 5FPHA 4XFKA 5LPNA 4FMCF 3T95A 2ZWAA 4A0RA 2ZRHA 1L4BA 1LS1A 1VCHA 3PDIB 1H4SA 1E9BA 4E21A 4B43A 1SBIA 1VPTA 2DM6A 2I65A 3AG5A 1A4UA 3PXEA 2FSPA 4NFLA 5C53B 4NEGA 1GLGA 3KUUA 1ZW1A 3ADPA 1LFDB 4F60A 1P6XA 1U0LA 3WMEA 4HDNB 5DO9A 3ZV5A 5EGSA 1OLOA 3FKJA 3WLQA 2QQEA 3D2CA 3NG1A 4GI5A 4DRXB 5B6JA 1XK6A 2RHBA 3NORA 1YQTA 7REQB 4X65B 4FOOA 4NZNA 1UIMA 2VHCA 3GJTA 3UMBA 2Z3ZA 3NM5A 3OX2A 3QTTA 1UKZA 2XOKA 4HS4A 1FDOA 2XYQA 3HEBA 3BFKA 5K0FA 1ELOA 4QDZA 3J81A 4FGWA 1Y3IA 1B8NA 4YAFA 2ZUCA 3U6KA 1ZAYA 4HMOA 3PC8A 2ILTA 5AM0A 1S9HA 1YHNA 3ZW9A 4FFPA 3N2IA 3X43A 1YL5A 4W9MC 3ZIUA 4M83A 4HB4A 1UPXA 3BSYA 3RNOA 3FA2A 1QHGA 1G3IA 3LIPA 3E7XA 4DYDA 1OT3A 5FPTA 1N1GA 2HQRA 1U9YA 5GVRA 1BVUA 2Q5CA 5AH0A 1DIRA 1OR8A 3VVMA 4E3ZA 5KWVA 3EUWA 4DRYA 3L6UA 4Y2GA 3H1BA 3P0IA 3WGVA 3JZFA 3U1TA 3IAFA 2R3SA 1TUBA 4IFEA 4CF5A 1TM1E 1GDDA 2XOKD 1DOAA 3GWZA 4J7CA 3UMCA 2P6NA 4YMLA 3BCUA 4QJIA 5DULA 4HAWA 2A9FA 1E96A 2ZFUA 4Y67A 1OBHA 5B1DA 1OD6A 4M38A 1GQFA 4M3NA 2KYRA 3FVWA 3EGIA 4DBLC 4DSTA 1HFEL 4E13A 1SG6A 4ISCA 1DG1G 4UVIA 2C7QA 1HYBA 5IFLA 1HE8B 3GQVA 4FI3C 1NQ5A 4D74A 3ZVKA 3PIIA 1EGMB 3HL0A 3NIDB 3IEVA 2PQ6A 1NN0A 1BDHA 4KMOA 3NBAA 4D0RA 3AV0B 3GNSA 3FXAA 1MBZA 2GFIA 1AS2A 2VPIA 2XDQB 4K6OA 4JEMA 4LXTA 4MVJP 3TKLA 3T61A 4WVLA 4DC9A 2X4LA 3AP2A 1SVKA 3DZCA 3L82B 1BXZA 1J0CA 1RPTA 2QTNA 3M1YA 3O31A 4RF5A 5SICE 5KZMB 5CCBA 5KX5F 5FFNA 2A1TS 4MMXB 3R9KA 1RM5A 3DLPX 1DLJA 2Q3MA 2WICA 3M49A 4R6XA 5DNVA 3AVUA 4X41A 4X1KA 1ZSNA 1VG9B 1QYCA 1TQ8A 4JSRA 4NPHA 2N42A 3K4QA 2JLRA 4MYTA 1JYEA 9ATCA 3KV3O 1SG9A 4B7UA 4O8CA 4Y2QA 1JG6A 3MOGA 3SHOA 5BRNA 2DT5A 4OQNA 3H9EO 2YICA 4QL3A 1W47A 4C4AA 4XYMA 1Q0SA 3EE6A 3ZCPA 3PXBA 4ZAGA 1VGRA 4ZXFA 1W4CA 1ACLA 4N0DA 1C1XA 1JLLB 1D04A 1QONA 2IYEA 2IDKA 5ARDA 2G1UA 1GZ4A 1Y5IA 2WIAA 2LCFA 2YWJA 1UWKA 3AH8A 2YMQA 4L95C 4HWOA 3UGKA 3OOYA 2P69A 3GJRA 1QP8A 4NZYA 4Q4JB 4DAOA 1DDIA 2GYUA 4WESB 4U7TB 3HYTA 3KC2A 1HLGA 1K3TA 1T5BA 4LXUA 1ODFA 3CPEA 4M0LA 1UC8A 3UFXA 4X92A 3NAGA 1QDLB 2QA5A 1Z28A 2HCFA 3DGEC 5TR9A 4RZ3A 3F8WA 4RPCA 1SBCA 1T2CA 2B1RA 5EIFA 1KWGA 2Q2NA 3DV0A 1YRLA 3A1UA 4JJ4A 4UDNA 3AR9A 3CXUA 1L8OA 4YJ3B 1UP6A 3M6IA 4BLPA 4F3NA 4ZICA 1HX7A 1UBTS 4OPMA 5DEIA 3Q5GA 5JZ9A 5KYXB 1QTIA 4HOYA 5BSMA 4IAOA 4R0VA 2UAGA 2R6JA 1I51A 3PFCA 1J2EA 2EL9A 2JFPA 4TTIA 1JAYA 4GR4A 4LY6A 3D8SA 4AK9A 2C03A 2OM2A 3ABRB 3KVVA 1BNCA 2YWEA 4AT1A 3W4IA 2P9TA 2WEKA 3IV9A 3LIIA 3DV9A 4YA6A 1LUAA 4GSLA 4FYWA 1ESNA 3MSCA 1ND6A 2VZLA 3SSOA 4E1BA 2BGLA 4A2PA 3ZTTA 3RABA 1V0JA 2G8NA 2IW3A 4IIJA 4INPA 1I9GA 2EF1A 1YRQA 2PUJA 3GRRA 1B93A 2XQKA 3V3KA 4CMBA 5HPYB 4G5QA 2VOEA 3DDCA 4HNAB 2WPNA 4TXMA 4P54A 1FOEB 5HRAA 5HRCA 3DDNA 1K6MA 2C7OA 1YBHA 5DN9A 2ZYWX 3LX5A 4EB6B 4GVXA 1M2VB 1NNEA 1U3UA 1VB5A 1W2GA 3HVKA 5ELMA 4GU5A 1K88A 3A9WA 4DG5A 4DSAA 4ZT5A 1X7WB 5AXAA 5A02A 4F6RA 1D09A 1OI7A 3NBZC 3C87A 2FE1A 1GLVA 3D8RA 1DC8A 1Z47A 1CQIB 1E6MA 4YMIA 4XUGB 5I8PA 3AR3A 3ZV3A 1M6VB 3DPUA 3UG7A 1P9RA 13PKA 3H87A 4F3RA 4MUJA 1Z62A 4HQOA 2L19A 4LSGA 1B1CA 3TLAA 1KK0A 4HO1X 4U6NA 1RYBA 4N5LA 2WE7A 1RXWA 1TA4A 1WXDA 2VQDA 1N2HA 1SGWA 4LTDA 5CLFA 1E58A 5K1ZA 4EY8A 1EK0A 4JSYA 1WMAA 4EHLA 2ZYGA 2ZU6A 4V0NA 4EI9A 3SJ7A 4V0RA 2HZ7A 5I7EA 2JS7A 2GAIA 3D7MA 3MBKA 1P4JA 3DFKA 1G19A 2ORED 5FULA 5HDBB 4YX9A 1ZH2A 2Q1UA 3MOIA 1ZHHA 4PRYA 3ECAA 4RU1A 3RF7A 4RPIA 4MVJG 4AJ1A 2A58A 5T5QA 1FRZA 1XJ0A 3ZXUB 2FN4A 1X7ZA 3OD1A 2EIXA 5IARA 2MYTA 3QKRB 3VUEA 2BGNA 3U60B 2IUEA 2YWHA 1K2WA 4X6XA 4AQ7A 3AM1A 1FZTA 1YK1A 2A1UB 3EYWA 1GGHA 5L4LA 3S2IA 4BO4A 1L7VC 1QK3A 4M53A 3HA2A 4N0MA 1XTKA 3E9RA 2BGWA 2B4RO 3JPYA 3NHPA 3AZQA 4RMHA 2O48X 3SYRA 3TSAA 1NJSA 1M2EA 4B9AA 3KV1A 3RREA 1G66A 1UJNA 3V2GA 5CVDA 4RKYA 3GPLA 4FC6A 3BWEA 1QRAA 4D25A 1XV5A 2NXWA 1YR2A 4JASB 4NS4A 4JROA 1L5VA 4LGMA 3BH7A 3NTQA 1G8JA 5EHNA 5I9BA 3CKYA 3H2YA 3QFTA 4RVDA 3S2EA 2CHFA 4DIOA 1P1HA 4E0BA 2E37A 5HJ2A 3KUCA 3TLKA 4X0EA 4GNRA 4PBSA 1KI4A 1NBWB 3H5LA 1LTKA 3CZQA 2VJDA 4JR0A 2BV3A 3A0RB 5DCUA 3N6XA 5F2KA 1Z34A 1R8QA 2JAOA 2OHFA 2P3QA 4N0QA 1M0EA 5BSFA 2J85A 3HY4A 2QRLA 3GEDA 3OVMA 4RIGA 1F8FA 2B92A 4I50A 2BBWA 4QPCA 1W93A 3Q0EA 3ETHA 4GMDA 2GHRA 2C59A 3EVTA 2JFQA 2WE8A 2XLCA 2ZBUA 2FWNA 3M5PA 3W6NA 3BOSA 3OPQA 1Z2CA 3FPSA 1A27A 4RSHA 5CK5A 2J0VA 1N2CE 3UTCA 2O06A 3KCQA 4FXOA 1R0WA 3KR1A 4HGQA 5EMJA 1P33A 3OU2A 5G02A 1MJGA 4D0GA 1MC5A 5CB6A 5E6UB 1LDEA 1FSZA 3AHEA 4AKTA 1Z15A 4KLZA 1X8LA 1WXHA 5LLSA 1F0YA 4LGYA 1NNUA 1LI5A 4Q4HA 4RJ2A 5KOYA 3THXB 1JEJA 2OBNA 3EB9A 5BQOA 1NW8A 4QTXA 2C29D 4QXMA 1V1MA 1P6UA 3EN0A 1YUBA 2I4TA 2RHJA 3T0FA 3Q9SA 3WXBA 1FS6A 1NFQA 4L78A 2NP6A 1SWWA 2A9KA 1AKQA 3GLIE 4IJKA 4JLMA 4D8YA 2DFKB 1YZTA 3V4SA 4HDSA 2BMFA 4ARIA 1NI3A 2VN8A 1SKAA 1VJRA 1U9ZA 2IUFA 2QTMA 4PYOA 3CLVA 2YZ2A 3GF4A 3LUPA 5F3DA 3SZUA 4EM6A 5CEJA 2RJNA 1SC9A 2F62A 3X3HA 4RY2A 4LYDA 1M1YA 5M5BA 5KWSA 3OEYA 1GA4A 4XVCA 1RBMA 4QQ8A 4O4IB 4DWVA 5LQMA 1Z22A 1OA0A 1Z18A 4EJ0A 1X7YB 4NBWA 4KAXA 2AYZA 2JVIA 2OAP1 2VA8A 4NEHB 3SEZA 2ZWVA 4GKJB 4HZUB 4IH9A 3M8KA 3P9QA 1E2MA 3QWAA 3SS8A 1RFLA 4AZ3B 1SQ5A 4BFCA 4HN4B 5L4NA 1LSUA 1S8OA 3OPNA 3D5TA 5LDGA 3ET4A 1EDEA 5FO1A 4HMPA 3ZKAA 3ICCA 1KDPA 2V3WA 2D2EA 2VAVA 2Y4NA 1LC3A 4G5XA 2PRJA 4JJZA 4X6UA 3PFFA 3CUKA 1T5IA 3GFRA 3UQZA 3M5CA 1PHPA 1RTKA 3T1VA 3B82A 1JT2A 2FXVA 3A32A 4ZVNA 4ZU3A 2QX7A 3S3TA 3LLSA 2YR0A 2FUG6 4R8SA 1K8YB 5EAIA 1J5PA 3H65A 2QTGA 2CSUA 4R9RA 4NCIA 1ISHA 5LU9A 2IBMA 1M8PA 1OLXB 3P9ZA 4UM8B 4KODA 3GMIA 2C2OA 3IOCA 2BTEA 1OAAA 4KNVA 4ND2A 4YUAA 3IBFA 4OHWA 1L7MA 2RHOA 4YDRA 1F4LA 1Z7WA 4FM9A 3DVLA 2AUTA 5J43A 2TSYB 3AONB 3BC1A 2WNIA 5K3SA 3N2LA 3C4QA 4K81B 4MW0A 1YQWA 4HDCA 5D5QA 2V7VA 3SHQA 5DNWA 3GAAA 4JN6B 4BEBA 4GKKB 1XCLA 2V6IA 2AFIA 3DFMA 3OX3A 4N39A 4TLLB 3Q3EA 3L4KA 3FZGA 4GYJA 2NOAA 1OWOA 3E1SA 1DC3A 3NNDA 4EX7A 2BYTA 1REQB 2GBGA 1AZTA 1S4QA 2H08A 4S3MA 4O1HA 1PQ4A 1JPUA 1XD2A 3QNWA 2FVXA 4LYHA 1T4GA 1CQXA 3IAM6 4PM4A 4BXOB 3OZAA 3L4JA 2GN0A 1P9LA 1C30B 2ATVA 3KQOA 3ZV6A 4TROA 4ZRNA 3ZZ0A 1G0OA 5L6LB 1GPMA 3P4YA 3FDFA 1JDSA 1DDOA 5AOCA 3UMFA 3ZCRA 4IO0A 5A05A 5IVIA 2HDHA 3B36A 3LWZA 4KITB 3HR7A 1F0KA 4JIMA 4XPIB 1CDDA 3D4NA 1MIOA 3FBWA 4KWEA 4NYIQ 1N6HA 5AXDA 5JYBA 1PLKA 2IU3A 4KUGA 1I4EB 3O4GA 4R0NA 4YPVA 4OGFA 1JLHA 4KE8A 1GRRA 4J3NA 2A7XA 4C7JA 3VGPA 1JKFA 5EXXA 4HWTA 4MB2A 1DQZA 1OCEA 5JDIA 4B8YA 1UFRA 4I50F 1S5PA 4OQQA 3SGLA 4DV1B 4B7XA 4ZVLA 1YQQA 5BV1A 4Z2YA 2B4YA 3QFHA 4Z9FA 3AUSA 2H18A 3C7CB 4YUXA 3GR6A 2HBRA 2VUUA 4D3SA 2WYHA 3G5UA 1SCNE 2LNDA 4NHEA 3BGOS 4HEQA 4ZEXA 1RHJA 4KDEA 1MXHA 2H4ZA 2FSGA 4JC0A 4XR9A 1MO2A 1WCWA 4ILKA 2I6TA 2Q46A 3ENNA 4Q48A 3BDIA 1XXLA 3A4NA 3N59A 4MWCA 1CJTC 4AKSA 9GPBA 3C3JA 1N75A 3NV9A 3OFJA 3IKTA 2Q28A 2GERA 5EWJA 3T35A 5JSZA 1FFAA 3RLFA 2CDNA 3EA0A 3OM1A 1R8XA 2AWOA 4TMZA 1W5TA 4MVJI 4HVLA 4E51A 4ZFNA 2YCBA 1IBSA 1AA9A 1L4FA 3D2LA 4O0LA 5TQ2A 2JD0A 4NXNB 1R5JA 5DLQC 1LSSA 3C3EA 1EFAA 2GX6A 2ECKA 5ALXA 1CNMA 5G3ZA 1N6NA 2ASVA 4C5BA 2CB9A 3K0EA 4ZPJA 1J2TA 3ISJA 5CUQA 5AW1A 3DR3A 5MF6A 4FKZA 1U7HA 4N8EA 2J6BA 2ZZMA 4M1EA 4Y6LA 3A6HA 4KUHA 3U13A 3VC7A 3P9IA 1I2DA 1U0SY 4L8FA 5AICA 3BBPA 1JEDA 2ZI3A 1YZUA 2OECA 1FTSA 2QX9A 2ZJ3A 4F3CA 3OZVA 2O2XA 3LGAA 3H8SA 4IUYA 2OBMA 5DI3B 5A7GA 3RTGA 1N2OA 2ZRPA 5IVPA 1U0RA 1A9QA 3OAAA 3R5KA 5BR4A 2ADMA 4DIMA 5ISMA 4FYMA 3WNDA 3EOBI 1OI3A 3O8QB 4Q34A 2A5JA 5E8RA 4Q47A 5K0BA 4S1TA 2QR2A 1B14A 3IRVA 2VTEA 2WM3A 4FOPA 1PYOA 5DWQA 3VSBA 4BQRA 1M2NA 2WD8A 3MD0A 5HGXA 2ARKA 2O3JA 1KQ3A 2GN9A 4GGPA 3EGXB 5CBKA 2B2XA 2NZYA 3PUWA 5LKRA 3DEFA 3H8JA 3Q2IA 1ECBA 2WD9A 4A6PA 4QXAA 1F8YA 1E94E 2V0NA 3PR1A 1RQRA 4C6RA 4M49A 3BGDA 3NDIA 4D97A 2P2GA 2WF9A 5I01A 1RQ2A 2BGMA 4E88A 1B7GO 5K20A 5BV7A 1OIWA 3FOZA 5GWXA 4TYMA 2DC1A 3O73A 4MTLA 1IAVA 1ONBA 3A4YA 3OAAD 4MCAA 4BCBA 3RAFC 3AVWA 5LDHA 2BFOA 1RAGA 1WETA 3P9YA 3CN7A 4QDOA 3KWMA 4KE7A 2XAUA 1YZGA 2IEBA 4MQFB 1WCYA 5H4GA 1JFFB 1VE5A 1Z74A 2WTAA 3FPKA 3GFPA 4JYCA 4MW7A 4RA9B 2MOKA 3H99A 2XB8A 1D6NA 3IEIA 2F64A 3FHOA 3WADA 2BFBB 1EM6A 3HXPA 1WM1A 1IM5A 3DKVA 3NTXA 3ZGNA 1T8YA 4TLAA 2QL5A 4UVEA 2BRUC 4QQRA 2OBFA 1D7AA 5T4HA 2HLDD 2R11A 1GD1O 1ZSVA 4RGBA 4TYQA 1TW2A 3K32A 5F7JA 3KJEA 4MKZA 2HA4A 1A9TA 1Z4NA 1U2GC 3KKZA 4ETIA 1N1EA 1YGPA 4GBJA 2DETA 4D9IA 1NWHA 4TKUB 3RKSA 2GSDA 3UW3A 3MUFA 4PSAA 4Z3OA 1E7SA 1DJQA 5I7HA 3K70C 1DXYA 3SBOA 3QUCA 3B1ZA 4AF8A 4ZJZA 4QXOA 4BB9A 1WMSA 1OH5A 3F2VA 3L4SO 5EYPA 1GUAA 4ZALA 1WSDA 2BKLA 1TZ2A 2D0IA 5J5VA 4BNNA 4JP2A 4JXKA 4O6VA 1VXOA 4ARZB 4EKDA 5HUJA 2ZJZA 1JKIA 2Z30A 1BDIA 4AXBA 3V4FA 1S8NA 2WI8A 3U7JA 1MV5A 4KN6A 3OZSA 2WR8A 5I4KA 1DKRA 1S3SA 3NAZA 2H17A 2NO7A 3LDFA 1TI7A 1HOXA 1TKCA 1VPVA 4U2BA 4YJGA 3MRXA 5CNKA 4EGAA 4C88A 4F5WA 5J2TA 4FVTA 2XDWA 4YQFA 1K63A 1PT6A 2I4MA 1NWCA 1YZ3A 4KEAA 1YS9A 4DSNA 3DFUA 1ZMTA 3VKFA 3VOBA 2B69A 2D0DA 4KSCA 1Z6PA 8GPBA 2RGRA 1K6JA 2VPTA 4FW8A 4HWPA 4BO1A 3I1IA 1S7GA 2NO6A 5G4KA 1UDAA 3KALA 4ESHA 2FSHA 3V97A 1XP8A 2QU8A 2FKAA 1QPZA 2HYIC 4DIFA 4DWOA 3KXPA 1OWNA 1XWIA 2DH6A 2F43A 3N2GA 3PNPA 1F51E 1HYQA 2C88A 1Z6YA 1BX1A 5LP6C 2CJXA 4D9BA 4KH1A 1N4AA 1E3TA 2CK3D 3QH4A 4JI8B 1ZD9A 3OJFA 1LF0A 3ENQA 4RD2A 3WQHA 4XB6B 4BZZA 2OHOA 4L0DA 3KHUA 4FFOA 3L79A 4M88A 5AJHA 5E3HA 4BMZA 1M8GA 5HVNA 1OX6A 2QW0X 2V5UA 3BMOB 4CR8A 2L0XA 3AVPA 3IIKA 5JLAA 1CF4A 3ZHOA 1UT8A 1IVNA 4BX9A 2E82A 2EQBA 2FRDC 1PK7A 3AUXA 2RIRA 4AXXA 4B3XA 2G0TA 1EA7A 1G38A 3M2TA 1L4KA 1MLDA 1EXNA 5FWNA 4X54A 4ZOCA 4ZQGA 1WOMA 2AJTA 5HKLA 3SR3A 2YDXA 4WW0A 2JB9A 4CKXA 2XMBA 5JO9A 3VJKA 3GPDG 3FG9A 5JPCA 3I5XA 1VHQA 3MELA 2WT4A 1KFKB 2GEJA 2JZOA 3ONVA 2WVGA 1U8EA 3OEWA 4PEVA 3UWMA 3ZWAA 1YIOA 1I94B 4HNGA 4PFJA 1Y63A 4JVNA 1LY1A 2W93A 3DW1X 1TUBB 4LSWA 3IBCA 4B75A 4K9SA 2C9DA 1TZJA 4ZVVA 4C03A 4C4ZA 1SC1A 3QYJA 3SVTA 2SCUA 3GVHA 4L74A 3NM4A 1UXKA 2CXRA 3AW8A 3F1LA 4A2QA 4TS1A 5A3RA 1VA4A 9LDTA 2RSLA 3M4YA 2V74B 1XZFA 4DJ5X 2ZRQA 4RK6A 5GJVC 5JAZA 3DFFA 5FP0A 4D4KA 2ZSIA 3A6ZA 5JS2A 4B76A 4QGBA 1PJZA 5KJFA 4PGHA 1KTIA 1ZUWA 4OIFA 2CBGA 5JQGA 2PXXA 3GYGA 4RF3A 4EFDA 3L8CA 1A98A 1I0LA 3TQTA 2PBFA 1KC3A 3ZW8A 1Z6GA 4Z0HO 1THMA 1W5BA 4CCAA 2H5EA 1YB7A 2JEZA 2PK3A 3B9BA 3V2UA 4TLDA 1GTZA 3EZ7A 3GMSA 2QVLA 4WKOA 3F3MA 3VZSA 2Y1LA 3R3XA 2PFGA 4NI5A 5FOUA 3FMPB 1OASA 3PF8A 4FPXA 3P52A 2UUCB 3WQQA 1FS5A 1JJFA 4BO8A 5LC1A 4X60A 3GA0A 3F98A 4X1OA 3U7RA 1E20A 3KZKA 3LQQA 3GLFA 2SKDA 1SXJE 3A14A 1FUKA 3FCSB 3I6QA 3KT0A 5AESA 3U0VA 5B55A 4D9CA 3CVOA 1SHLA 4IXNA 1ZZEA 2AF3C 1HI9A 2IU6A 2OCLA 5KQSA 2BT4A 4CCYA 2UXBB 3FKQA 2XOXA 1XZHA 2WIJA 3HBNA 1P45A 1DBQA 3OURA 1Q0HA 2WWWA 3ANTA 4BFXA 5F12A 1CV2A 1AGRA 2P1DA 1Z7BA 4OXXA 4WNAA 3VVBA 1P3Y1 1GYQA 3QPBA 1IUKA 5LMNB 4TMYA 4ANFA 3EDOA 2B5VA 4DSOA 1IDN1 3FM9A 3U1BA 3GOHA 2OYCA 4Z4EA 3UFXB 3OHMA 1YA8A 2CNOA 4WOPA 3GROA 3B1VA 4J4BA 1XTZA 3FI0A 5KPDA 4AF7A 5JALA 1BN6A 3B6JA 3ROZA 1YMQA 1P1CA 1MOPA 3DV0B 2AVNA 4KVFA 3VOTA 1FNMA 2O7SA 3DVSX 3DF9A 4WIAA 5AO9A 5A2QA 5DCWA 4NBLA 1W85A 4JLDA 3MINA 2P9CA 4GI1A 3UJCA 3DTTA 4Y7DA 2W6OA 3CH6A 3EDYA 5DBFA 5AJZA 4FR0A 1DL5A 5CLHA 3RVNA 1Y7TA 2ZSEA 1IK6A 1PWEA 1QF7A 2P41A 3QPDA 5HILA 1B1AA 4EBFA 1YZNA 1KGSA 1XNJA 5SZHB 1SKYB