2CCJA

Crystal structure of s. aureus thymidylate kinase complexed with thymidine monophosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Structures of S. Aureus Thymidylate Kinase Reveal an Atypical Active Site Configuration and an Intermediate Conformational State Upon Substrate Binding
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ccjA00
4NZYA 5HCIA 5JWOA 2EFGA 4QRHA 1A4RA 4URXR 3FKQA 5A4JA 3T5DA 4DCVA 2WJGA 1JPJA 3QKSB 5HCNA 2ZJOA 1NBMA 4GRAA 1X3SA 5KDOA 2CJWB 3B2EA 1OH8A 2C9OA 4B48A 1W1WA 2J0UB 1AZSC 1N6LA 2AKAB 3B7GA 1UDWA 4IDOA 1QF9A 2H92A 4RD0A 4H1UA 2F43B 4LPKA 2O8BA 3S1AB 3QVUA 2KWIA 2GDJA 1R6BX 1WDTA 2YC4C 4HUQB 1DAMA 1OH7A 3FPAA 2VP5A 2XJ4A 2J0QA 3SN6A 5L3SB 5L3QA 1Q1ZA 2QTVB 1RJ9B 4F4IA 3M0EA 4ZCMA 1E2NA 2JJ8A 4FW9A 4ZIRA 3CBQA 2XAUA 2OFOA 5H70A 1XMIA 4P31A 1ESMA 2G9NA 5TY0A 3L0PA 2JJ1A 1LF0A 1E0AA 4DHEA 2VSXA 4Q4JA 2JLWA 3L2OB 1P4SA 3BB4A 3B8HA 4PX9A 1N6NA 4ZDKA 5CK4A 3KQKA 4BE7B 4M1OA 3OEHD 4QM6A 1ZUNB 4IJMA 3R9IA 4NYJR 4LHXA 3NG1A 3GJ4A 5J40A 2NPFA 1XMJA 5EZ5A 4JVMA 3W3ZB 1RRGA 2AFIE 4RZXA 3FKSA 4Q7KA 3PUYA 4GI7A 4X8LA 4XVQA 1DE0A 5F2EA 1ZMXA 2NZ8A 2OHFA 4D25A 1TF2A 1K5GA 4WOPA 3WNCA 4HLUC 4KHZA 1KMHA 3ZYCA 1DEKA 1C1YA 3HYTA 4M2LA 2JLUA 3QVVA 1XB2A 2VP9A 2PMDA 4HZUB 1W48A 1G8YA 4NHOA 4PTLA 2WJVA 5DIFA 1KY3A 1XWIA 4LX0A 1P9RA 1OYWA 4Q1DA 2KBEA 1AQUA 1UKEA 2C95A 2GJ8A 3MRSA 4XH9B 4BFTA 1U99A 1W44A 1NN1A 1UJ2A 1ZCBA 2GCNA 2IK8A 2N46A 2XOKD 3QF7A 3FFAA 3QKRA 1Z63A 5IRCD 2ZJ2A 3ZGXA 1BKDR 2EWWA 3ZS8A 2DHRA 4FINA 4MDFA 5CLLA 3T1OA 2D4HA 1O87A 4URZR 2BMDA 2Q3HA 1J7KA 2HLDA 3KB1A 4Z1MD 2ZI6A 4NYIQ 1OXVA 2VIIA 3THYA 2P5TB 3AV0B 4OHVA 5DNYB 5E7MA 1D6JA 4QG7A 1E2PA 4HSEA 1U94A 2WOJA 2HT6A 2ZS7A 2GXQA 4JZKA 1ZD1A 3VHLB 4PZZA 5KOYA 2XSZD 4LC1A 4OQXA 5LPNA 4C2TA 1IY2A 1XCPA 3LH5A 3UKDA 2ERXA 1Y63A 3RANA 2B92A 2R6DA 4HATA 4YONB 3GD7A 4C0JA 4TLAA 4JSTA 4Q4HB 1IJEA 3PEVA 1J2JA 3LWNA 1GZSA 3TMKA 2ONJA 1IOZA 2YOFA 4A0HA 1Z3IX 1GRNA 2I3BA 4ASUD 3NDPA 3U60B 4A6PA 2J1LA 3ZZ0A 4GSYA 2OESA 1DS6A 4P0TA 4Q48A 4O25A 1CXZA 1EFRD 4DDTA 2FPLA 3QEOA 3CH4B 1JALA 4M8NE 3CRMA 1Z06A 1CBUA 3HU3A 2QTFA 2F6RA 3LY5A 4O2RA 2CL7X 2YC2C 3GJ3A 3ZIAA 3GJ8A 1E1QD 2JCSA 4P4SB 4BFYA 4RCYA 5GADl 2MSEB 5FL7A 4V0NA 1E9AA 3DEFA 4DIEA 2O52A 2JLQA 4EQ6A 2QBYB 2PZFA 3SFVA 1KGDA 1RE0A 5KSPA 5JRJA 3GLIE 4Q4AB 2GF0A 2QROA 1AS2A 4JLMA 1Q0UA 1ZUHA 4NP6A 3QSYA 2ZR0A 1I4LD 3H4MA 4HAZA 1ZM2A 1Q20A 1YZQA 2BCJQ 1NMXA 1GWNA 2VO1A 2WWIA 1X86B 1P72A 5D3MA 3U2QA 5C46F 5ELXA 4DC9A 1E2LA 2F1IA 1XTSA 1Y3AA 2OUKA 3Q3JB 4ZO4A 3B1XA 5FTMA 5H1YA 1SXJA 1Q3HA 1VKJA 3TK1A 4LRWA 2FSFA 4JLDA 2CBZA 3CLVA 1QBKC 2ZUBA 2N1BA 2FN4A 3TH5A 5FTLA 1B23P 1XRJA 1G5PA 3R7WB 3M6AA 1YJ5A 5E7JA 1VG0B 4Q9LA 4ZKDA 4RFSB 2V6IA 2E1RA 1N0UA 2QMEA 4A6XA 5LB2A 2QI9C 2RGXA 3HPQA 3NH9A 3AKYA 2BKEA 3ONWA 1F3OA 3EPHA 1NMZA 4CW7A 3QF4B 2VPPA 5C4GB 3CR8A 4MRPA 3MWJA 3T61A 1ZD9A 4A8JC 1KO7A 4PPGA 1R0WA 5EE3A 4EPVA 5FOWA 1VPLA 3K9NA 4JKYA 3A1WA 1XXHB 4AYTA 3FKSD 3V00A 2GXSA 2OG2A 3EZ7A 3UWOA 1Q1EA 1ONBA 4TZ0A 2XJ9A 2D62A 2C03A 1NF3A 1GRRA 2FSGA 4HZIA 4RSGA 3VR3A 2JLRA 2XGJA 2B21A 3QG5A 1KSFX 1NIPA 4WZAE 5FI0B 2DY1A 4WVFA 5CDFA 3RS5A 2H57A 2VRWA 1KI6A 2LKDA 4GFDA 5GVSA 5KYKA 3K70C 3D3QA 2XZLA 3B6EA 2Q9CA 4C0KA 1QHNA 4IOJA 4QHSA 2QNRA 1XD2B 2WOOA 3DL0A 3LBIA 3PIRA 1G291 4HEJA 4DLYA 1OXSC 4YXWD 3LNCA 3LFUA 1KI7A 2FFHA 1AZTA 1OKKA 3U44A 2LCFA 2BJWA 3QXXA 4KBFA 1R5NA 4PQRA 5DN6A 1OLOA 4YMTA 3DOEA 4XWOA 3HDTA 4LCBA 4Q1CA 3OIWA 5KNDA 5JSZB 3UK6A 4EPRA 2O8EA 121PA 4Z54A 5BXQC 1XDBA 1U2RA 4IRUB 3HJNA 5KDDA 2WICA 2CXXA 1ZRHA 3B1WA 3Q5DA 5UKDA 3ZJYA 4GL2A 2G6BA 4D26A 4B32A 2HLDD 3GLHA 2D74A 1X8JA 4Q5IA 4AK9A 5P21A 2RGNC 2GCPA 2BOVA 4CEIA 3IIJA 5J4KA 1G3IA 4ZDIA 1KTVA 2JIZA 3DM5A 3DM9B 1XTJA 5CB6A 4OHWA 5FL3A 2J9RA 1RRFA 2V9PA 3SU8A 4B2IA 3PUZA 2NO6A 2AD5A 3VFDA 4D4LA 4Q00A 3SYKA 3OFND 4A0GA 1CJVC 4ARZB 4Q47A 2ZITA 4EIWA 2IS6A 1LV7A 1YZNA 2A78A 4ESVA 2J46A 1DADA 1Z0KA 4LJ6A 2F1HA 5B2ZA 4Q18A 1BH2A 4NE2A 6Q21A 3X1XA 1CR2A 4EFMA 1G7RA 4ZCLA 4DCSA 1PUIA 2ZSAA 1ELOA 1IQPA 2AWNA 3HYRA 4K8OA 4LYFA 2VSOA 5TARA 2C9CA 4V0OA 5BN5A 3BC1A 3ZD6A 4TMXA 1ZM9A 1JECA 3I5XA 2IS4A 1WXQA 2WMNB 4M1TA 2ANBA 1ZD8A 4KYUA 2O8BB 1VTKA 1W2GA 1ZNXA 3QNUA 1S3SA 1U9IC 3OAAA 4JVLA 4LWZA 1N2CE 3HR8A 1ZCAA 4OQLA 1U8YA 3TRFA 3MMPA 3L8YA 3B13B 2ZI5A 3KKPA 2FV8A 5GJWC 2EU8A 4V0KA 1T6NA 4ZV4A 4BFXA 1NL3A 2YWFA 1G8PA 4ZIRB 4DSOA 4WA7A 1ODFA 1U8AA 3RSOA 2ZUDA 2GBLC 1S8FA 4IVRA 4TQ9A 1PJRA 1YZGA 2C5LA 3K70B 4C4PA 3SJAA 1DELA 4G5SA 1TQ2A 1G64A 1W47A 3B1VA 4D2IA 4H9GA 1P2VA 4UNRA 3UMRA 1BOFA 2D2FA 1R8QA 2I4IA 3WRXC 4B3FX 2OM2A 3B85A 4PR0A 3W6PA 3DO6A 3B1ZA 2Z0MA 1KZ7B 3CX6A 3EIQA 3HU1A 3RLFA 2WJYA 5D3QA 4YDSA 2OFXA 2QP9X 5AJWA 3AKEA 3UWKA 1K5DA 4DLTA 3EZFA 5KNCA 2ANCA 2PH1A 1RYFA 5JBQA 2IYRA 4LK2A 1AK2A 4JBXA 4KAXA 4G0NA 4HDOB 2DFKB 1L7VC 3K1JA 3QXSA 3RWMB 1SVLA 4Z8YA 1I2DA 1II8B 1F48A 4MRNA 2Q9BA 3GMTA 2J41A 1U98A 3DKPA 3WXMA 3D6TB 4I4LA 3LO5A 3FWYA 1UKVY 1G19A 2ZS9A 2FEOA 4XSGA 2ORIA 1E9EA 3VR6A 1KI4A 3EC2A 4W5HA 1JXOA 2BHRA 1QZXA 4LC0A 3AF0A 3EW9A 1GSIA 5FUYA 4C7OB 3CF2A 3IIKA 4WIAA 2V6JA 2YWHA 2AN9A 5BWMA 4OJQA 5DHFA 2JAQA 2ZAMA 3OIYA 4DEYA 4JL8A 1AKEA 5AK0A 1TQ6A 2O0HA 4XVUA 2FSHA 3NVAA 3KZ1E 4BFSA 3M4YA 1JNYA 1NBME 2BEKA 2ZJYA 4LJ8A 4U00A 1N25A 3MAAC 4US1R 5GJBA 1Z2CA 2J45A 3B5JA 3I72A 1HURA 4CEHB 4KSBA 3WP1B 3GLFB 1XX6A 4EAQA 4JL6A 1QHYA 2IX3A 1SGWA 1SVKA 1T4GA 2JLSA 4L8GA 4KU4A 2WM9B 2ZRBA 3BBPA 1YU9A 1N5KA 4MKIA 1NJGA 1WRBA 1F5NA 1Z0FA 1MH1A 2J0VA 2BBTA 4TLCA 3QXCA 5HE9A 1T5IA 4WW0A 3U7FB 2KB0A 5JJLA 2W83A 3CRVA 1OKKD 2QAGA 1OHHD 3EASA 3L0IB 3LDAA 4TYQA 2UKDA 3U3RA 3RS3A 4DLVA 1R5BA 4Q7JB 2HJGA 1XJ0A 2CK3D 2A5DA 1YZKA 4N0EA 1YVDA 3ZD7A 4TQAA 2KSQA 4JS0A 2B8TA 4B76A 3P27A 2DFNA 4M1YA 1PLLA 4E09A 1OYYA 3KTAA 1KO1A 2NIPA 3D8BA 3KQHA 4TL7A 2GESA 1SHKA 1WQ1R 1TEXA 4MRRA 4A0RA 2BCGY 3LW7A 2CCJA 2WAXA 2FJUA 1GTVA 2VP2A 821PA 3L8ZA 1IY1A 3DZDA 5FPKA 3K0FA 3P32A 2P0EA 1UBGA 2NO0A 1XEWY 2QY9A 3GQBA 4QGFA 3ZVLA 1FP6A 2HYDA 4PPNA 1IY0A 3TE6A 2VA8A 3DHWC 1OFHA 5AR1A 5CYOA 1TF7A 4KCGA 4BFWA 1JB1A 3H1TA 3ZQ6A 1OXXK 3I4LA 4TYNA 1J90A 2VQSA 2EQBA 5DHAA 4FI3C 1ZNYA 3AUXA 4TL6A 4MRSA 1GL9B 4JL5A 2ZETA 2FZ4A 3FVQA 4AI6A 3B9PA 4ZPXA 2F3TA 5GJVC 4A15A 1KIMA 3AUYA 2QGZA 4P3YA 2IYQA 2Z83A 4C0SA 5D3MB 3U5ZB 1II0A 5G53C 3DMNA 1N6RA 5CK5A 2PCLA 3OAAD 3MUFA 4EPYA 3ZZTA 2FGKA 1Z28A 4OQNA 4JIMA 5SZHB 1P62B 4HAXA 4TL8A 3FMIA 4EPTA 1COWA 421PA 1ANKA 2DB3A 4B6EA 3GP8A 4A36A 4QM7A 3VU9A 3VMFA 4C0LA 1M2OB 2R6CA 2MMGA 2RH5A 5FOVA 4ZKEA 4OI2A 2ZR9A 4EDHA 3E2IA 1M1YE 4JT2A 5FH9A 1JR6A 4KVGA 3P26A 4G5RA 2RB4A 1JJVA 2ZU6A 4QNRA 2W58A 2O8FA 4TLEA 2JLYA 3CRRA 2N42A 2A7QA 3HR7A 5CYPA 4LBYA 4Q1AA 2ZYTX 1E0KA 2ZYUX 1ZVQA 2P6NA 3Q72A 1LNZA 3QXHA 1Z0IA 4D0NA 4OI4A 4QGGA 2QE7A 2Q21A 2EYQA 3TKLA 4NYIR 1CJKC 5K8TA 1KK0A 2Z4RA 1IN7A 4ITRC 3C7KA 1G5RA 1KK1A 1ZP6A 4DT1B 1L4YA 5JEEA 2AXNA 521PA 2ZE5A 5B64A 4C9BA 2FZLA 2LWIA 1N5IA 2WVJA 4LJ7A 3AF4A 3IQWA 3AM1A 3H84A 3K0EA 2GWHA 3ND8A 2IXEA 3AVOA 2G0TA 4DSUA 2Y8EA 3THWA 3V4RA 3ZLJA 1YR7A 5HKKD 3OHMA 4W5WA 3KXIA 3T1QA 3QJYA 1EFRA 4QHTA 5DH9A 4KSCA 4V0LA 3U44B 4MKHA 4WBSA 2AWOA 1CJMA 5TV2A 2QA5A 1E4YA 3EZ2A 5ANRB 1GUAA 2GK7A 2NO9A 2ATXA 2HJVA 2PX3A 1E2KA 3CWZA 2LKCA 4OJKA 3EXAA 1S3GA 1E1QA 5FI1B 4Q9JA 2R44A 3SI7A 1VCMA 4TQUS 4BLOA 1H8ED 1E99A 2BVNA 4NTZA 2VP0A 4QJ4A 2ZJZA 3RHFA 3TUJC 4G5OA 5E7IA 3F0TA 1Z0DA 4P4UA 2YOHA 2VHJA 3WBJA 1OFUX 3BB1A 1Q1QA 1IN6A 1T8TA 1DVRA 4MUBA 2HEIA 2IYTA 1PZNA 4XIGS 1KJZA 1SXJE 4IFEA 4PPQA 1CRPA 4TL9A 3BH7A 1SHZA 2A2ZA 2QQEA 4DB2A 3X1DA 2GAAA 1E2IA 3FHOA 3WY9A 4Q9IA 1FMJA 4I1VA 1CU1A 1DAFA 1E2MA 1P75A 2BBSA 4JJZA 5HPYB 3GJ0A 3FHCB 1P2SA 4RD3A 5FUVA 1MRNA 4G5GA 3ZQJA 4BEJA 4D4JA 4LHYA 3SQWA 721PA 1XP8A 2BWJA 1W4RA 2R6GA 3B78A 1E2QA 1KI1A 1GDDA 1OPXA 4JSYA 3W8RA 1CP2A 1W4CA 5DYGA 3KQLA 2GZDA 1NG9A 1T91A 1CJTC 2Q3FA 5KSZA 1NY6A 3K0SA 3K9HA 4WXPA 2VP4A 1MR3F 3CPHA 1IM2A 2J5XA 1XU4A 1R4AA 3LBNA 4FCWA 3SEAA 2PMKA 1GL6A 4HAVA 3ICQB 5FPHA 4AWXA 1FX0B 3RS0A 3LA6A 4F4CA 4IFBA 2OFWA 1RKBA 4KBGA 4MYCA 4PHHA 4RD1A 2HCBA 3LQQA 4QFMA 1CJUC 3LVQE 2BEJA 1I2MA 1W5SA 2F7SA 3KJEA 4JLVA 4DJTA 5CDFE 1E98A 1XTRA 2GKSA 1SVWA 2JLXA 4PPFA 5IT5A 2IYSA 2GCOA 3PUVA 4LBVA 1C4OA 4DLWA 1WB9A 1J8MF 4Q1BA 1N5LA 1W4AA 2QENA 3O8CA 3RC8A 5E4FA 1XEXA 2GZHA 4X8OA 3GLIB 1JQLB 3B1YA 3DVLA 2EW1A 1G3UA 1Z6AA 4MYHA 3THXA 2XNSA 3LD9A 2B6HA 4KODA 4AG5A 1BS1A 3RYTC 2P67A 2XNDA 4GOKA 3NC0C 3QG1A 2QRZA 5AWFC 4YXWA 3RC3A 4QJ5A 2X2FA 1COWD 1L2TA 1E9BA 1NP6A 1HV8A 3GLHE 3NWJA 4MITA 1KAGA 2FFAA 4KO8A 3ASZA 4NCIA 3TGPA 3IUYA 2J7PA 1N0VC 1DTSA 3UANA 1JAIA 1S1CA 3O8DA 4LJ5A 1T0JB 5DI3A 1RRCA 1US8B 4B3BA 3GCGA 3ADDA 3P4YA 2J87A 2ZRIA 1JPNA 1Z6YA 4JJKA 1EFUA 4ESHA 3C4JA 4LHVA 3K0CA 3CUEF 5HR5A 3SBDA 1AN0A 1KKMA 2EFEB 3CO5A 1MO6A 4RY2A 2GJAA 4F91B 1PV4A 2FMXA 1WA5A 1ZM4A 3P4XA 1YR8A 2HT1A 1E2FA 3FE2A 2OAQ1 2ZANA 3N5CA 2QE7D 3ETLA 3N2IA 2VYFA 3NH6A 4PZYA 3SHFA 3CWQA 5CM9C 5JWHA 3UATA 4C0QC 3OZXA 3AEZA 1ZNZA 3C5CA 4FN5A 2R2AA 3R20A 3GJXC 1NN5A 3LLUA 3OFNA 3FYHA 1SVIA 4C3ZA 5C18A 1DAEA 1RFLA 3IO5A 2GEDA 1O3YA 1RYHA 2R8RA 1PLKA 1OB5A 3QEJA 3RABA 1FTNA 3T34A 3A8TA 4L4UA 4QGAA 2WKQA 5J4LA 2G88A 4UXJA 4QBHA 2GF9A 3KUDA 3HWSA 3QENA 1G18A 4FMDB 1IXSB 4TSFD 1KAOA 5G41A 4A82A 4OKSA 1F2UA 1ZBDA 3BORA 4XD7D 2R9VA 1KDOA 4PC1A 1P7CA 1NVVR 3D31A 1QHHB 4Y0VA 2QAGB 4L9SA 1MV5A 1KHTA 3I8XA 3AVYA 2EFDB 1E96A 3QOFA 1LS1A 2Z5FA 4YMWA 3WMGA 2QU8A 5AJXA 2WJHA 3AB3A 3FMOB 1JAHA 4BLSA 3A4NA 4KV9A 5AJZA 4ZI3A 1W0JD 4AKHA 3CR7A 2WSMA 3NKVA 3PUWA 1MRSA 1OB2A 4UKDA 4V0MA 4URVR 1TADA 4XVRA 2O8DB 3K9GA 3W5IA 1UBFA 4QXAA 4N1AA 4EJSA 5J4YA 2WPDA 3MWYW 3CRQA 1P9WA 2ZRLA 3CPJB 3NBZC 4S2EA 4A4DA 4V03A 3IBGA 3A1UA 1HEIA 4DRZA 4F7WA 2WWHA 3PR1A 4HAYA 4PC7A 3W34A 5DI9A 3SYNA 1D8TA 3AH8A 4M0LA 4O2LA 4AYXA 2IYLD 1E9RA 4W9MC 4MGKR 1XZQA 2CL0X 2H17A 4OBEA 3G0HA 2V7QD 4DVGA 4MQBA 1Z47A 3SE0A 4CEJA 4RD4A 2RGBA 1CTQA 2FDCA 3RSLA 2IS1A 2PCJA 2QG6A 2ZRHA 3CM0A 3VNVA 1UPTA 1NNEA 1NLYA 2O8CA 2FFBA 4A92A 1D2MA 1HT1E 4MKFA 1DARA 2P6RA 1R8SA 2ZYWX 3ADKA 5FR2A 2QTHA 1CS4C 2O0JA 2OO7A 2XX3A 4B43A 2BJVA 3MSXA 4IOLA 1SVOA 2GJSA 3U4QB 2XTZA 4R2HA 3W5JA 1HE1C 2F3RA 4ILEA 2JGNA 1CEEA 4BPBA 4PAQA 1XZPA 1VYUA 4NCKA 3SQXA 1Z6XA 1G20E 4QBGB 3FOZA 4C0HA 4DIDA 3REFA 2VLIA 3LXXA 1W46A 4IHQA 4NKRA 4Q9HA 5EQTA 1G6HA 1YHNA 2WHXA 2ZXUA 4KI0A 2YWEA 4TTPA 3VU9B 5CITA 4Y0AA 2MMCA 2CLCX 4QHYA 1RRPA 5E95A 1KI9A 2CL6X 1GP2A 1W36D 3I73A 4DCUA 5FBRB 5FOXA 3AP3A 1YE8A 4M1SA 2OE2A 2VEDA 1VHLA 2ZQ5A 2ZVPX 1T3SA 1E9CA 2ZI9A 4NH0A 1Q57A 2IL1A 1IONA 2OCPA 2P6UA 3KX2A 2DPXA 3GEEA 2Z6VA 4RZ3A 3PEUA 2R62A 1QHXA 5AJYA 2ZRCA 1ZIPA 2QM7A 3ASYA 4R9UC 3WRYC 1QHSA 1DPFA 1EFCA 3FFBA 3JZAA 4JYBA 1RPZA 3E70C 3X1ZA 1G7TA 4MYTA 1W5TA 3C5HA 4LJ4A 2RGCA 1NLZA 4DCNA 2BMJA 4B2LA 2XNDD 2VH5R 2W6ID 1Z2AA 3M1IA 3BRWD 1TU4A 3CPEA 1OHHA 1XEWX 1WBDA 3CNNA 4DDUA 3SFZA 4FWTA 5F98A 5DYIA 5EP2A 1JR3D 1ZJ6A 2CK3A 2H1LA 2J7PD 4BFVA 3MG9A 4QL3A 2QAJA 1VDZA 5JRZA 4WZ6A 2NO7A 4FCVA 5EP4A 1N6IA 3E5HA 4W7SA 1OE0A 4HB2A 4X8HA 5FOTA 2ZIAA 4YMUA 5DSZA 4JLPA 3SHWA 3VX4A 1YZLA 1AIPA 2JDIA 1G16A 2V54A 2W2TA 4BRWA 2JJ2A 1XNJA 4BWYA 4A2PA 1EX7A 3HU2A 2QT0A 5EUQB 1E2EA 621PA 3VR2A 3C14C 1OT3A 1W2HA 2BC9A 2ERYA 3SDZA 2FEMA 5JFGA 3NHAA 4MRVA 3SNHA 1S2MA 4TYWA 4MDEA 2RGGA 3PVSA 1VYVA 4UNQA 2FGJA 3T1TA 3KKNA 4YQFA 4JLAA 1SKYE 4E22A 1UFQA 4UXIA 3TVDA 3GLGA 1CR4A 1GNQA 4BRUA 2NPIA 4JLOA 2WBLC 1DOAA 4MGZR 5G3YA 2K5UA 1X8KA 5BW8A 3QKSA 1NVVQ 1LFDB 4PSKA 3ZDQA 2CJWA 2QPAA 1FUKA 5AJVB 2DR3A 2H7VA 3RS4A 1UF9A 4IXMA 4L9WA 1FOEB 3ZS9A 3TLXA 3ZH9B 5AUPB 2C78A 3TNFA 4GPTA 4B3CA 1TQ4A 4KJZA 4D82A 1OIVA 1ZUIA 1G3RA 1OXTA 3OEED 5H8WA 1R0YA 1YR6A 1K6MA 2E9SA 3FMFA 3AVPA 2WJIA 1P2TA 2WKRA 1QG4A 2ECKA 2QP3A 4LV5B 1NI3A 2RHDA 4HUQA 3UIEA 3VQTA 4FMCF 2IYUA 5JECA 4PANA 2OCBA 5FPYA 4LSGA 5L3QB 4ZDJA 5KUTA 5L3SA 4GBMA 4US2R 1RJ9A 3A6PC 3FHTA 3PITA 1DG3A 5J4HA 4IOMA 4POAA 2CDNA 2OLJA 2OV2A 1U0HC 2QPTA 1TUIA 2DWOA 1E0JA 2P3SA 3BFXA 2WPDD 3MFYA 4Q4JB 3SJCA 1JI0A 4MGIR 2OT3B 3TSZA 2GNOA 5AUNB 4DLUA 2C96A 1D2NA 3BXZA 3G82C 3WYAA 4BECA 4GP6A 3WNDA 4JYCA 3UMSA 4BEBA 2ZI3A 2QMUA 4RKFA 1ZU4A 2IYVA 2FPKA 1SULA 1EGAA 2WKPA 4ZI2A 3IGFA 4HYYA 3JVUA 1XTIA 1KSGA 3EZ9A 1XPRA 2X8AA 2ORWA 3RRMA 1Q12A 4UQOA 5BQ5A 2G0NA 2IYZA 1Q1BA 2QMHA 3QPVA 4DBLC 1KMHB 1OH6A 3DZ8A 1G8GA 2QT1A 3MGCA 3RS7A 3A4LA 3PUXA 5F9HA 2WMOB 4HZUA 4QKQA 3L0OA 3BD9A 5FBLB 4IVPA 2AKYA 3VR1A 5B30A 3I1FA 1XEXB 2V55B 4IDQA 1OW3B 1VCIA 4LJYA 2ZAOA 2ZRFA 2HXSA 2IT1A 3ECCA 4MGYR 4O0MA 4M21A 1EK0A 2D7CA 2ODEA 5CM8B 4B3GA 5HKKA 5JS8A 2YOGA 2FSIA 2ZM5A 4XTRA 3QKRB 1FW6A 1T0HB 4A2WA 4A9AA 1KO4A 4PHGA 1X6VA 5K8LA 3DOFA 1PLJA 1DAGA 3PQCA 4Q1EA 1Z0AA 2JATA 1FL9A 4FD2A 4DUGD 2A5YB 4C0AC 4DDVA 5DI3B 3B9QA 4GMXA 4BLTA 3CF0A 3PEYA 1W0KD 1R0ZA 1SXJC 1Z22A 1YKSA 5K8UA 4FMCB 3TAHA 1LTQA 1XD8A 4PHFA 4GDFA 1H8EA 4UNPA 1VIAA 2FOLA 2W00A 3VNUA 4CT5A 4CF7A 3THYB 2H8KA 4QNMA 4NDZA 2BKUA 2FU5C 3BFKA 3FDIA 3I8SA 1HQYE 4PAOA 3RRZA 4YMSA 1YRBA 3AF2A 3KB2A 4GT1A 5F3WB 1A82A 2A3RA 3GEHA 4EPWA 2ZSDA 1NKTA 3F8TA 1U90A 3W90A 1B0UA 3H86A 4LBZA 1WMSA 3TVTA 3K53A 3NBXX 4LI0A 3EIEA 1L8QA 1UM8A 2XEXA 5SZKB 3BGWA 2REOA 2RGAA 1F2TA 1G8FA 3IDQA 4RCZA 1WE2A 2R65A 1ESNA 2QRNA 3TUIC 1M7GA 3NXSA 2OLKA 1PVOA 4IEIA 3SZRA 3Q8XB 4GZMA 1RIFA 2ZUCA 4G3XA 2AK3A 5FBVB 2ZS8A 1U0JA 2CLSA 4TMZA 5EXTA 2WV9A 2JDID 2A5JA 2QGNA 3JVVA 1G21E 2JJ2D 4FMBB 1U8ZA 1X1RA 5HZKA 2EYUA 1Q3TA 2IF2A 2NOAA 5DE3A 2IYYA 5FBQB 2HF8A 3AF1A 1FQKA 3TIFA 4GMDA 1NN3A 4LBWA 2WWWA 4LV6A 1G1MA 2A5GA 2IA5A 3BJIC 4R2IA 4F92B 4N3NA 5KNBA 3IHWA 2H16A 3J81k 1KSJA 4HAUA 1I4TD 4D4MA 5JLJA 5KTYA 4HLCA 1G4AE 3QKTA 1KI3A 3OESA 2ODBA 2RKOA 3TR5A 1N6PA 4EQ6B 1RZ3A 2X19A 3KKMA 1D9XA 2QZ4A 3UMFA 3X2SA 4DXAA 2HCJB 1NVWQ 4KFRA 5DO9A 2QBYA 2JLVA 4A2QA 5TDHA 5TMPA 5DLQC 2XB2A 3VR5A 1AM4D 4IXNA 4F93B 1FNNA 2ZRAA 5KDLA 2HV8A 1BYIA 2CNWA 4CT4B 1OIWA 2IF0A 3U7EB 4NU0A 4QBFA 2O5VA 3P20A 4TT3D 2IC5A 3CRW1 5BYJA 1CULC 2YWGA 2IUUA 1CR0A 2YJTD 1JR3E 3BS4A 1J99A 2ZI7A 1HA3A 1E9DA 2H18A 2F55A 1EWRA 3EPKA 1SXJB 3U6KA 4DLZA 2QUZA 4TWZA 1DAKA 3U3MA 3BFVA 1EESA 2QQ0A 4L15A 2IEZA 2QMOA 1YZTA 3LX5A 3BB3A 2OBNA 4TTRA 4BQSA 5FOUA 2BMFA 1KNQA 3KKOA 4M9ZA 4R98A 3TUZC 2HYIC 4EPXA 3RVBA 3BH6A 2ZJ8A 2WWGA 4LGMA 2VSFA 1A2BA 4MUAA 3QF4A 3ZZUA 5EZ6B 3DPUA 2PX0A 4XWAA 4LPSA 1NSTA 4LYJA 3T12A 3NBFA 1KDTA 2FG5A 5DISB 5SZIA 4JLNA 5HZHA 2IEYA 4AKGA 5IK2A 2RGDA 3OE7A 4HUTA 1W49A 2DYKA 1OSNA 1IBRA 2DBYA 3W9YA 3WMFA 2HF9A 2Q6TA 3O8RA 4OL0A 4URUR 5CLQA 4DZZA 1UKYA 4WXRA 5B58C 4M53A 1CLUA 1LS6A 2OBLA 4GOJA 4Q19A 4JVNA 2NG1A 3DDCA 3QY0A 4G5QA 4O3MA 3MCAA 1KI6B 1ZNWA 5FR1A 5AUOB 2ZRGA 1FP7A 4TSFA 3EPLA 1AS0A 3CIOA 4YC7A 1G17A 3T15A 4XD7A 1UDXA 1MT0A 1XD2A 1G8HA 2IWRA 2XITA 2CCGA 1U0LA 1KO5A 4YDHB 1G5TA 1E94E 2CHVA 4V0ME 3RRYA 3L82B 3AVVA 4RFVA 1G7SA 4GP7A 1WCV1 5JSZA 1ZYUA 2KJQA 2ORVA 2O8EB 4B33A 3AGPA 1W0JA 3U3OA 2IXFA 4IDPA 4RD2A 4TMWA 3AGQA 1L4UA 3EPJA 3GLHB 1CIPA 1S96A 4W5JA 3ICEA 4CEIB 1LY1A 2QN6A 3B60A 4HDQB 2ZRMA 4Q03A 4D0LB 5IHPA 2G77B 3F5FA 1IN8A 1G7CA 1R5OA 3W6NA 1Z07A 1GRQA 4MH0R 1Q21A 2VHQA 1XPOA 2OILA 3NHBA 1JEDA 1KKLA 4PSVA 1GKIA 3I32A 1JJ7A 2BMEA 1OIXA 2PEYA 3LBHA 3CH5A 3KXKA 2V1XA 2MSCB 2CE2X 3K09A 2V7QA 4FIDA 3AP1A 3FTQA 3U61B 4PFSA 4ARZA 1CF4A 1IAQA 1E2JA 2FNAA 2GJKA 5KPDA 3BOSA 5LD2B 3LQRA 3A1TA 3A4MA 2X77A 2RMKA 4I1SA 1QG2A 2OEPA 1N3BA 1NRJB 2IYWA 1R10A 4V02A 4NMMA 1S0UA 4TMKA 2C2HA 2CVFA 4PSAA 1F6BA 3IBYA 5EP1A 3KQNA 3U3KA 1HUQA 2IHYA 2A9KA 4A8JA 3SS8A 1HYQA 2BV3A 2QP4A 3SC3A 5EXSA 5JCPA 1KZGB 3NEJA 4OHYA 3IKJA 4B47A 1LF5A 1A7JA 2HDNB 1KO8A 2QEQA 2W6JD 4IDHA 3IPYA 4E03A 2VF7A 4JVSB 4AC9A 5C4MA 2JLZA 4XTCS 1IN4A 4ABYA 1FMLA 1SVSA 5SZJA 2IUSA 1G3MA 3I3SR 3CB4A 1VMAA 1YRAA 1P73A 3TJZA 2E87A 1A2KC 1KDRA 2CVHA 1XJCA 2ZSBA 4WZBE 4D0GA 4FCTA 5JHGB 3H2YA 2QAGC 1E2GA 2XTMA 2VHCA 3MJRA 3IEVA 2OCYC 2PLRA 3U3JA 4FMDF 2BM1A 2YZ2A 2W0SA 1EG7A 2BDTA 1CRQA 4CZ2A 4QGHA 5JHHB 3A1VA 2VP6A 4A0FA 1GOTA 3W8NA 4PO8A 4R7ZA 2CNWD 4MA4A 5E3HA 5FFMA 4TLDA 2Z43A 1U81A 3EZ6A 2QORA 2XZOA 1FQJA 2W2VA 4HB0A 3UG6A 4L5BA 3CX8A 1RW4A 1E0SA 3LW8A 3MJHA 3TSWA 1E1RA 3RS2A 1Z8FA 2WAYA 3TBKA 1YZUA 3ZVRA 5KO2A 4LHWA 1S4QA 2W6IA 4M1KA 5KHOC 4B3XA 4RKEA 1II8A 3SYLA 2UZ3A 3Q7PA 2I1QA 4E07A 2C9YA 1S1MA 2RGNA 2ZE7A 1IN5A 1JR3A 2VF8A 4PZLA 4S35A 3TR0A 1S9HA 5EP3A 4TMVA 4K81B 5B57C 5EJEA 5JMTA 3RWOA 1WBBA 5GVRA 1XCMA 2C98A 5KSYA 1P61B 3KL4A 2GXAA 4EFNA 4DSNA 3IEUA 1E79A 4K46A 3KDSE 4AG6A 4RZ2A 4C7OA 4BFUA 2ZJ5A 3P1JA 1Z83A 4M9QA 1VG9B 1A5TA 1MO3A 3GLGE 4DEXA 1VG8A 1TPZA 4OI0A 1CKEA 1GNRA 5IK2D 1I4DD 2NGRA 3OE7D 1T3LA 2IBMA 4AKEA 3EWSA 2C77A 2GVZC 4UNNA 4AYWA 2DFTA 1H8HA 4CEHA 4QBIA 2FE4A 1E9FA 2O0KA 3T35A 3PENA 2ATVA 4KFSA 3VKWA 3GLFA 1J70A 2WWYA 1OH5A 3TSOA 1YQTA 4CDGA 1QVAA 4ZCIA 2GRJA 4OK6A 3KQUA 1LW7A 4KYIB 5TB5A 1FNMA 2AL7A 1M7HA 1U9IA 1GM5A 1NG1A 4B2PA 3G5UA 3BWDD 1SZPA 2PZEA 4FWIB 5FTNA 1EFHA 1IHUA 2BBOA 3QQ5A 5J47A 5FUXA 3OEEA 3EG5A 1T3HA 3V4FA 1BO6A 4IVQA 2Q0HA 5G3ZA 2GBLA 2GTPA 1XBTA 1F2TB 2CHGA 5AUQA 4AURA 2AHOA 4I99A 1P5ZB 5TVKA 2YINC 2NMVA 2GEUA 1UEJA 4OHXA 3KTAB 5M04A 2OAP1 2QM8A 1OJLA 2J0SA 1BMFA 1P60A 2GZAA 4B6FA 2REXB 1T8UA 3AP2A 2D2EA 4C0BA 2ZJAA 2V1UA 1NSFA 2IHBA 3X1YA 4D81A 3VKHA 3K0FB 1UKZA 2FX3A 4NONA 4RD6A 5EE5B 2WIBA 4JLBA 4F38A 3L0SA 3Q85A 4M22A 2J7KA 2GJ9A 1Z29A 4TN1A 5FPSA 3GFTA 4TZ6A 4H1VA 4HDCA 4HLDA 4URWR 3R8CA 2ASEA 3SJBA 3CNOA 2GAOA 1TAGA 1GITA 1GKYA 2I1VB 1KJYA 3BIFA 4TTQA 5JS7A 2XB4A 1NLFA 2BIFA 3JZMA 1NBMD 1Z6GA 2ZROA 4B71A 4M1WA 4EUNA 5BYKA 1HT2E 3MLEA 4B3DA 1SKYB 2VHTA 2H5EA 4XJXA 3HP1A 1MABA 1AQYA 5BN3A 5A0FA 5TXGA 3A36A 1KYIA 1XTKA 2MSDB 3AF3A 1DG1G 2RGEA 2V4ZA 3R9XA 1N6KA 1Z0JA 2JASA 3DKVA 4B75A 3AVQA 1C9KA 1P2UA 4KLZA 4TYYA 1CR1A 3GEIA 4ON9A 4PO1A 5EE1A 2ONKA 3NTUA 4B73A 4BLQA 4YLGA 3OF5A 5FBWB 3E1SA 1II9A 3EAQA 3NIBA 1TQDA 3NEYA 2EFHB 3WP0A 4KITB 1ZW6A 2FF7A 2OXRA 4BUJA 3K09C 3UPUA 3QI2A 1XTQA 2TMKA 2D06A 1ZIOA 2P5SA 4NYJQ 1LB1B 1HY3A 1HE8B 2CMKA 2GETA 2JJ1D 3LX8A 4HB4A 4LDJA 4B44A 4DUGA 3K70D 3LV8A 1W0KA 1QVRA 3CW2A 3C41J 4KXFB 2ZVQX 1JXMA 1TEVA 3QKUA 4UXHA 1SKQA 3I92A 4HB3A 4DWJA 2O8FB 1AJEA 1DAHA 3X1WA 2AR7A 4BASA 3THOA 2CLDX 4BZXA 4URYR 5DGXA 3RRNA 1Z6TA 2ZR7A 3C8UA 4QJ3A 3TQCA 2QSZA 4IW3B 2WZQA 2OZEA 1E1RD 1WP9A 4JKIA 3FGNA 1K8RA 1W4BA 2B8WA 2ZEJA 3IQXA 4UJ3A 3VHXA 3PEWA 3RNLA 3GJ7A 5EUMA 4DT1A 4G1UC 4OK3A 3BE4A 1N0WA 2ZRJA 3GPLA 5EE9A 2FWRA 5EE0A 1XEFA 4KFUA 4CIDA 2J3EA 3K0AA 4JLKA 3RDPA 4ACAA 3AKDA 3GLGB 1T9HA 3WBKA 5FPTA 1Q22A 3PV0A 5HTKA 1TL7C 4DB4A 1W36C 1MOZA 5H68A 2ZE6A 5CB8A 4U7DA 1D9ZA 3FMPB 1E2HA 1R2QA 1E79D 3KKQA 3THWB 4HI0E 4LY6A 1NIJA 4PC3A 1GVNB 2X2EA 2Z4SA 5FUWA 2NTYC 4BZQA 4NPHA 5CJ2A 3AVUA 1GL7A 1AS3A 2A30A 4PC2A 3AQ4A 2F9MA 3UXMA 2XZPA 2ZJBA 2ZSEA 4F4JA 2XXAA 4U02A 2GHIA 1H8HD 4LOAA 4NYMR 5F9FA 4PAMA 2ZRPA 2EVWX 2GILA 4Z8XA 5LDDC 4EKDA 3EWAA 1HTWA 1AA9A 2CCKA 2ODNA 4OYHA 2R6FA 3AKCA 3B82A 3MWKA 2WSSA 1XJQA 4TMTA 2WJJA 5JWRA 2QPOA 1R0XA 1ETUA 4ERNA 4DDWA 2J0UA 4LJ9A 3A58B 1E2DA 2IUTA 2V3CC 4P33A 2IXGA 3AVTA 4GZLA 3IHLA 3VAAA 3V9PA 4TT3A 1SQ5A 1DBSA 3K0CC 4XOIA 4C30A 2GVDC 1KK3A 5EXXA 3NBYC 3EA5A 3OIUA 1E32A 1QHIA 2F43A 3R8FA 1G6OA 3S1AA 3KJGA 4GNKA 2VL7A 1FUUA 3Q9LA 3ADCA 1TX4B 4PHTA 3ZVMA 2WTUA 4XSHA 5EXPA 1V43A 4YMVA 5KU1A 1ZAKA 2P65A 2WIAA 4LZZA 4BZPA 3U7GA 4OQFA 2YKGA 1BMFD 2RAPA 1VG1A 2JA1A 3O47A 3QXJA 2FH5B 3WHKA 1M8PA 3EX7C 4IOKA 3F3YA 4A8JB 3AVWA 3R9WA 4NL4H 3QPUA 2G83A 1TNDA 2GXUA 3BK7A 3CZPA 4D4KA 2V8OA 2ZE8A 3VTKA 4C2UA 1XXHE 1P6XA 2NQ2C 3ZIAD 3LAWA 1GAJA 1VHTA 2DWQA 2WWFA 3Q7QA 4Q7LA 1ZC4A 2D3WA 2GEVA 3LXRA 2F1RA 1FPMA 1KI8A 4HAWA 5FL7D 5LB4A 2W0MA 3C15C 4LJAA 2IWHA 1FX0A 1M6NA 4BLPA 4Q02A 4IKEA 3CX7A 1BYUA 3GFOA 1W36B 1Q44A 3TW4A 2W2XA 1J8YF 3T06B 2ZSFA 4GOXA 1GNPA 3SBEA 3MD0A 2GCOB 1V5WA 1GFIA 3K8YA 3PXGA 5JCZA 3SOPA 1EWQA 2YYZA 2OBMA 2A5FA 3IIMA 1UBCA 1TTTA 2P2LA 4OK5A 5G40A 1NY5A 4G01B 4AD8A 2BBWA 3OIVA 4EJSC 4B34A 1MO5A 3GLIA 3THXB 3N2EA 2ZRDA 1XPUA 3KFXA 2C04A 4I1UA 4KVAA 4P4TA 4Q9KA 1GKUB 3SR0A 2G1KA 3PG5A 2Q9AA 4OI1A 8OHMA 1SXJD 5IF9A 2PL3A 4KLNA 5FTKA 2G3YA 3T1VA 1KJWA 2ZTSA 4LV8B 1S9DA 3H0KA 1GIAA 4AIIA 1OFIA 1UADA 4JLJA 3KJIA 3TQFA 1NMYA 2QSYA 2YNMA 1KI2A 4JBYA 4LYHA 1MKYA 1US8A 2VHUA 1NN0A 3U6BA 1TMKA 2KE5A 4P32A 4CRWB 5J5CA 1RC8A 1TUEA 4R71A 1KSHA 4MKGA 2B7BA 5A5GA 1MO4A 1BIFA 4BFZA 4IEEA 4Z51A 2GK6A 3CF6R 2J59A 4LYAA 2F1JA 4A1FA 5KPJA 4NCHA 4QOSA 3LVRE 4II7A 2OCAA 1IXRC 1EXMA 1FZQA 3GFPA 1VYTA 2NZJA 2ZPTX 1XFAA 3NC1C 3VKGA 4Q21A 1KOFA 1TU3A 3W3AA 1QDEA 1YR9A 1OXUA 1P9NA 3EA0A 1X1SA 5FOSA 4Q4HA 3QE0A 3AVXA 1M7BA 1XMVA 1TF5A 2WWXA 4TYPA 4U5XA 4XWKA 5JI2E 5J4VA 221PA 3KJHA 5IDVA 4RVCA 1H65A 4TLBA 2ZU0C 3PCRB 3WYFA 4JT4A 1KMQA 1HH4A 4US0R 1F2UB 3CNLA 5JJKA 2IYXA 3QBVA 5C1BA 4CGZA 1N6HA 4D6PA 3PJRA 1QHHA 4NYMQ 3N70A 4DSTA 1R7RA 2EWVA 5DN6D 1KY2A 5JZVA 3FB4A 3EARA 2W6JA 4ZDWA 4D80A 4X8MA 3GJ6A 1OFTA 3RAPR 1E6CA 1LVGA 4PXAA 5CIWA 1G41A 5JEDA 4HLUA 4NCJA 4Q4LA 2DFLA 4IDNA 2HUPA 4P4SA 4HLQB 1E9SA 1IJFA 1VECA 1E69A 1OF1A 1DO2A 2CE7A 3LRPA 2VTKA 1ZINA 3CONA 2PT7A 2CHQA 2D7DA 5JJIA 2PJRA 2DCUA 4PQFA 2KBFA 2O8DA 1NKSA 3IILA 1KNXA 1KK2A 4EJSB 1SVMA 4NBSA 2WSSD 5C2JB 2JIZD 3QPWA 4NCNA 3GJ5A 4Q01A 4Q4AA 3CKLA 4Q66C 3QIAA 4LUCA 4BGDA 2R6AA 5CJPA 1ZM7A 5LBIA 4CVNA 3OEHA 1ZM3A 4OQMA 2IW3A 2ZREA 1XF9A 3Q5EA 4E5UA 2EFCB 4UJ5A 2B7CA 2ZYVX 1D2EA 3HPRA 4Q7MB 3WYGA 1QHGA 4CEJB 3BERA 1N6OA 4QC2A 4UNSA 3BAFA 4L16A 1AGPA 1NVUQ 2PJZA 4DLXA 2OSBA 3BH0A 3WNBA 1NVXQ 2O8CB 3I62A 3WMEA 2NO1A 4ACBA 1VCNA 1P3JA 2JEOA 4FXPA 1Z08A 1G3QA 2ZRNA 2G1JA 2PZGA 3KXLA 5HE8A 3REGA 4DCTA 3I61A 4AY2A 2PLFA 1MABB 1NJFA 3O8BA 1X8LA 1N5JA 3R7WA 4M9SA 2AFHE 4M4SA 4PO9A 2FFQA 1G4UR 2AXPA 4RFSA 5LD2C 1GILA 3A1SA 3U4QA 3TAUA 4DKXA 3QBTA 5L3VA 2PEZA 3WHLA 3SJZA 3NDBB 1EFTA 1M34E 2C8VA 2YVUA 3LLMA 4EFLA 3QUSA 2XOKA 3VX3A 4AKIA 3IPXA 2YHSA 2C99A 2UZIR 3CZQA 3UG7A 1E4VA 3GLFE 4N0DA 1XMSA 4JBWA 4MYUA 2RHMA 1M74A 1T5LA 2UVQA 1XXHA 4JMPA 1JEEA 1XD9A 1JQJC 1WF3A 2FA9A 4PC6A 1KDPA 3I5YA 5GJCA 3KFVA 1UBEA 4Z1MA 3K9LA 2REBA 1FFHA 3ND9A 4I1OA 4CYMA 1G9XA 2AX4A 4Q1FA 3DMDA 2PBRA 1XCGB 4RJLA 3EC1A 3PFIA 3T5GA 5BN4A 1DO0A 1ZU5A 3W6OA 4LHZA 4PQYA 2BM0A 2ZRKA 4RZUA 1QRAA 2OXCA 1Z5ZA 3D7MA 3MWLA 2XSZA 4J0QA 1PUJA 1GG2A 3TW8B 2HXYA 2KI5A 3IO3A 1FTSA 2DWPA 3C16C 5L3RA 1AKYA 4B74A 2AK2A 1HQCA 4DLSA 2GA8A 5K8IA 3K0AB 1UEIA 1UAAA 3A37A 5FTJA 1RVDA 1JBKA 2Q3MA 3U7HB 3L43A 2QL6A 4KFTA 2ZI4A 4M9XA 1AGRA 3ADBA 3ZVNA 1D5CA 2PT5A 4ASUA 1OV4A 2ODWA 1W7AA 2VBCA 1F60A 5L8VA 4DLRA 1A1VA 4I81A 1ZC3A 2FPMA 3EIHA 4OHZA 3VR4A 2CEAA 4WAUA 1DAIA 1VCOA 2L0XA 2X1VA 3KUCA 4BLRA 2SHKA 2F9LA 5JI3E 2YV5A 4B35A 5CIQA 2RCNA 2XTNA 2XXAB 1E3MA 1EX6A 1VIYA 1IXZA 2IS2A 4M1MA 5KSOA 2AD1A
chains in the Genus database with same CATH superfamily
4Y6SA 2EFGA 2P1ZA 4LOKA 3MMXA 4JOBA 1A4RA 3D8HA 3FKQA 1QFZA 2G40A 1G42A 4ZOLA 2WJGA 3QKSB 5HIAA 2NM0A 3FGPA 3H1PA 4LHSA 3K92A 2NU8B 3D6UA 4PYKA 4C21A 3SAJA 1VLJA 2XUPA 5AW8A 1OH8A 4LNUA 3PTZA 2DLDA 2XNCA 3BWMA 1CVIA 3D0QA 2FOIA 2GX6A 2GEBA 2P6OA 5H4HA 3STTA 4TTSA 1N6LA 3ICVA 1KVRA 2KS6A 2J4DA 1YB4A 2AKAB 1BMDA 1UDWA 4YJFB 4OMDA 1QORA 1CUUA 3BSSA 3M8KA 4GRDA 1O94C 4J2HA 1XXLA 4W6QA 2YIDA 2WILA 2HA0A 2X5KO 4UD2A 4WNIA 4W5QA 4MYRA 1IOVA 4HUQB 3PQ5A 1DAMA 4JROA 1OH7A 1Z34A 3RFXA 2XJ4A 2TRSB 1WXIA 2ZYHA 2NP7A 4WOKA 4I55F 5L53A 3LOQA 1XZDA 4AMBA 3STXA 5H70A 3DTTA 1XMIA 4XM0A 2G9QA 2R5NA 2IPOA 2G9NA 3OQVA 2J8ZA 4YPFA 1E0AA 4DHEA 1NYLA 4ODIA 4Q4JA 2EIHA 2VWGA 4RTMA 3AZOA 2ADMA 2WU4A 4OAOA 3ZWOA 4F6LA 1PJSA 3DF9A 1P4SA 3BB4A 3B8HA 4Y2RA 3HA2A 2VT2A 1BDJA 5CK4A 4JN6B 4P7BA 3GRKA 1K8YB 4DM4A 4M1OA 3QV2A 1QU2A 2QM3A 3R9IA 2ZIWB 1V8DA 1HG0A 2NO4A 4NYJR 1HTBA 1PJ2A 1U9CA 4MJXA 3VPCA 4FKZA 2VNJA 2I80A 3A2LA 4J7AA 3AJ9A 2ZUWA 5BNFA 1GTRA 1PFUA 3NIGB 4JVMA 4U2BA 1RKXA 4XFDA 1S3IA 5HKBA 4XB2A 1XTBA 1Z5UA 3FKSA 2VYVA 1DE0A 2CHUA 3AUKA 1DC4A 2NZ8A 2HSWA 1YK1A 1FY2A 2CD9A 3CC8A 1DT5A 2IHJA 2ZB8A 2ZIXA 1K5GA 4G25A 5EKXA 2NYVA 3WNCA 2O8NA 4L74A 1EJ0A 1KMHA 3F6SA 4GPZA 2WHPA 3RG2A 1KPIA 4J3NA 2GPWA 3ER6A 1C1HA 3DEYX 2FKNA 1DXHA 4HZUB 1W48A 1G8YA 4UDYX 2C2GA 2YYSA 3B9BA 5T67A 4J0DA 4LX0A 1OAOC 4Q1DA 1ZH8A 1LQUA 5IKXA 4ZVRA 1Y6FA 4FNAA 2KBEA 4GGMX 4MQ6A 3IPLA 1FYWA 4N7BA 3EBPA 4XH9B 1U99A 1UAYA 2B8NA 4UM5A 3ZEIA 4WL0A 1NN1A 4RXTA 5DBEX 1VJRA 2N46A 4Z0TA 1A8PA 2GB4A 1ZI9A 1GPMA 4PM4A 3HKBB 3U17A 3SWWA 4PBTA 1WZEA 3BF8A 1N4DA 3I9KA 3I42A 4LMPA 1KMMA 4MQFA 1E7QA 1KYYA 2EWWA 3ZGXA 5E9AA 2DHRA 4GVXA 1R0RE 5CLLA 4FR5A 3C70A 1M34A 3KJNA 4RQTA 4DA9A 2HHHB 1O87A 4IH1A 4O4IB 3KKZA 4URZR 1B3RA 1CHNA 4P7GA 1JSRA 5E4YA 4XYLA 3BZUA 2BEVA 4PLVA 3R6DA 2NTVA 3ID6C 4BPRA 3NXKA 4EG7A 1NX9A 5A6SB 5FP0A 2ZI6A 2G4VA 1N2GA 1GFSA 1BNCA 1H2XA 2XR1A 3AR8A 4YI3A 3ZNQA 5CG2A 2R0QC 4I3GA 2II6A 1XK7A 3BKWA 4C07A 4Q3BA 1B2LA 1D6JA 3WWEA 1EVJA 3ZGZA 3FCEA 1QX4A 4HSEA 2W37A 5HFAA 2ZS7A 3U4IA 4DQDA 1KEKA 1MAAA 2GXQA 1N7IA 4KOEC 5CBKA 6REQA 1P0MA 4TZKA 5KOYA 4AWAA 2A59A 1XCPA 3UKDA 3LH5A 3VYTB 2ERXA 4D9NA 3H5OA 3DFKA 4RH3A 2JFPA 4G4IA 4YONB 4JU8A 3DZFA 1XDGA 5LZ4A 3HDHA 4Q4HB 4G63A 1IUNA 3W2HA 2JFQA 3T5BA 3TMKA 1ECPA 2R1ZA 4P98A 3TLCA 2QL7A 1YBHA 1IOZA 2VRCA 3NBKA 2YOFA 4L5CA 1GRNA 1GTL1 1N2EA 2R47A 4CG0A 2CXQA 1GN9A 3E4CA 2HF2A 3IAFA 3ZKAA 2VDNB 2J1LA 2R97A 2F17A 2VDWB 4PCAA 4GSYA 4S3MA 4YAJA 3V32A 2PM8A 1DS6A 5CG1A 5IDQA 1J5XA 1U28A 4LNHA 3QQPA 4Q48A 4PS0A 3DA8A 4O25A 3WGGA 1T25A 1OC4A 2FPLA 2HMAA 2JGEA 2PT6A 4M8NE 5EIOA 1NFQA 1Z06A 3UK7A 2H2AA 3DEAA 3N05A 2IKQA 3HCFA 3PD1A 2F6RA 3A0UA 1TIPA 3C24A 2PKXA 1E1QD 4GZ6A 4XASA 3E0QA 4BFYA 4JBIA 4FFMA 3SYTA 2MSEB 5H0IA 3E1GA 5FL7A 1R4NB 5GADl 4V0NA 1E9AA 2H2FA 3RYHB 2QF7A 5K05A 2V74B 1PTJC 2O52A 1RU3A 1RXIA 4JJEA 1F8UA 2A3NA 3IT3A 4RK1A 5KC9A 5ABPA 3VZRA 3WHIA 4G2NA 2PZFA 4ER6A 3DKIA 1KGDA 2QTLA 4GXQA 5KSPA 5HFNA 1PJCA 4QUJA 3KPWA 4TTJA 3RAJA 3S28A 2EBWA 3DZGA 3VR5H 4BKMA 3SIPA 2HADA 1IBCA 3AFMA 1NZDA 3LHFA 2Q5EA 4LG1A 3L6DA 3MQ4A 1H2YA 1O1YA 3N0WA 4YGXB 4HAZA 1IQ0A 4BNHA 3DULA 4O4JF 4DYHA 5LSAA 1T24A 2HCRA 1Q20A 4J16A 4NH4A 5TPZD 3MTGA 3OI7A 3UMCA 2HZBA 2VO1A 4A27A 1IHPA 4IR7A 1ZSYA 2XEDA 1XKLA 2F1IA 3O3OB 4ZO8A 4BEWA 2L17A 4TXHA 4WQMA 1N7GA 5FTMA 4QPPA 1Q3HA 1ZOLA 3ORQA 3NO4A 1EGMB 4JLDA 1EYZA 3CLVA 1L3IA 3GRZA 4Y2QA 2FN4A 1BW9A 1V5FA 2OGWA 1XV5A 2Q5LA 4X85A 4C3UA 4DUZB 1EQUA 3HBFA 1B23P 4RL4A 5D2CA 1MH9A 4CPDA 5J2TA 3EG9A 1YKGA 2OZKA 4KXYA 3N8IA 4UHJA 5F73A 3OX2A 4KUEA 1VG0B 4QRDA 4RFSB 2V6IA 2E1RA 3GLSA 1N0UA 1NXVA 3P5SA 1IU9A 1C81A 2QI9C 5LB2A 3NH9A 3IULA 2PD4A 5DLDA 4AICA 4AWBA 3NWBA 3DDZX 1P8AA 3KQPA 2EOAA 2VPPA 1PEYA 5T7BA 1JF8A 4K6MA 1JWAB 1DC7A 4GMHA 5SY6A 2C4KA 2MHCA 3T61A 5C8VA 5L3ZA 1O0BA 3I1YA 4O5AA 3NHPA 5A9TA 2R4QA 1CLEA 4EPVA 1GU7A 1VPLA 2QD1A 3CUSA 3L05A 4NATA 5I48A 3DH0A 3S6JA 5EYPA 2OQRA 3EZ7A 3WSVA 1Q1EA 1WS6A 2DM6A 1C9NA 4TZ0A 3O83A 3I05A 5AKJA 1EDZA 4AZWA 2D62A 4FFNA 2H9AA 4HZIA 1NF3A 1GRRA 4CMCA 3LPMA 5BUZA 2EWMA 1JDSA 2FWBA 3Q6MA 4INZA 5E6RB 4C06A 5GIOE 1UFOA 3ORYA 4WZAE 3ZV7A 2AE2A 1TVKB 1FVHA 3DW3X 3LCRA 3OVMA 5CDFA 2AW5A 1L8LA 2VRWA 1NQWA 2LKDA 3QKIA 1U8CB 3GJYA 4Q9NA 1BMTA 4XRRA 5GGYA 3QK7A 3PHBE 4K7JA 1E1YA 4QHSA 5HM8A 3GEDA 1BCSA 1G98A 4BGEA 4E3WA 4WCFA 5D1HA 1G291 3CSUA 3ESZA 4X6UA 1L5KA 4DLYA 5KX5F 5ALJA 3SIWA 3U44A 4LK3A 2LCFA 2BJWA 4IWNA 4EMTA 4KBFA 1OLOA 1PZGA 2P1DA 3HNRA 3HDTA 2G17A 5FJIA 5JSZB 1NE7A 3OU2A 3GY0A 1ZXXA 4HGZA 4PVCA 3ZN2A 5ESXA 121PA 2WINI 3OE4A 3GAAA 3ZCPA 4Z54A 3P52A 4MVJF 3HJNA 2WICA 4N0PA 3ZJYA 3Q5DA 1VQ1A 3O9ZA 2ZB2A 1EP1B 2OV6A 2JFUA 3SXUA 4B32A 3L92A 5K45A 1X8JA 1JWLA 3ANNA 5CPFA 4Q5IA 3RFFA 4AK9A 5AW5A 1N2ZA 1M2VB 3DT9A 4EENA 2QZPA 2NLOA 5IYZB 3S2YA 3JX9A 1ZK2A 5DGHA 2JK0A 4JB2A 4AIRA 3EEFA 3DM9B 1KOGA 3DXYA 5T6MA 3VR4H 2BSXA 1U2GA 4GYWA 2HA2A 2HKIA 1KAQA 4AUEA 4JYPA 5IKMA 1VHJA 4RTKA 3NBUA 4E2YA 2DBQA 1FMFA 5K6RA 4R83A 4B2IA 3RS8A 3PUZA 3D7NA 1SBCA 4S1OA 3VFDA 5IT4A 2DTXA 1NRXA 3EB9A 1JA0A 1RJDA 3FI9A 3OFND 3SYKA 3WBBA 2O59A 2I71A 3B8EA 2DY0A 3DSRA 4W1QA 4AN0A 3WL3A 2ZITA 4EIWA 2DQSA 4EX7A 2IS6A 1YZNA 4HGYA 4FW8A 5B4UA 2J46A 2POCA 1Z0KA 4KPUB 2F1HA 1VGRA 2VOEA 1BH2A 2DZDA 5HDQA 4JI4B 2R7NA 4UU8A 2G9ZA 2BFDB 1OI3A 1T26A 3DG9A 2WKWA 4K8OA 4LYFA 2Q5HA 2VSOA 2C9CA 3ZD6A 5EZYF 4GQAA 1N2IA 1JECA 2PRSA 2PR7A 3QOWA 4ZAGA 1DPGA 3M2TA 4O59O 4RJKA 3AWDA 2QX9A 4M1TA 4A16A 2Z5VA 1ZD8A 1TCVA 1TO1E 2O8VA 3L0BA 4BO7A 1ZNXA 2RIRA 4D1YA 3KDPA 4FFBA 4JITA 1QTIA 5CFRA 3OAAA 3ZCUA 2VNIA 1P74A 4KYVA 3HR8A 2LRHA 2BKLA 1JLMA 2B2XA 2IHZA 2ZI5A 3KKPA 5IEBA 4V0KA 4DR2B 3QX7A 2O6HA 5LA6B 1X94A 4AFNA 2AB0A 2DHEA 4DSOA 4Q3LA 3LUBA 2A9FA 2QV7A 4QATA 4WA7A 1ODFA 4D92A 4EW3A 1FP2A 2FRXA 2KHZA 1P7PA 1TT5B 4RU1A 2VR1A 4IVRA 4TQ9A 4EHAA 2LD4A 2C5LA 3JU3A 4G8CA 3TI9A 4G5SA 4D2IA 1UOQA 2JEZA 2UUPA 3LGSA 4FE3A 4JODA 3UICA 1BOFA 4YJKA 1R1DA 3I5AA 3TD2A 1CSEE 5HF8A 4PR0A 3TFQA 5DBHX 3LTNC 2ZWMA 4FYJA 1SJ9A 3J7TA 4MVJH 2PQ0A 3U3ZA 3CX6A 3EIQA 5DWVA 3L6CA 3RLFA 1E1KA 4YDSA 1JHOA 4B83A 3PGA1 1YSCA 5A9SA 4DLTA 5B1HA 5EZQA 1L9KA 1SG0A 1WMFA 4LK2A 2XCUA 3PSAA 2ORYA 2VC2B 4HDOB 4KAXA 2Q3LA 2VZ0A 1EKXA 2G6TA 2O7NA 4KGZA 4CTOA 4FDTA 3K1JA 3VYSB 4A1OA 5CFPA 3UBTA 1RXWA 1SVLA 1RD4A 2XUAA 3B52X 3L77A 3STYA 1LEHA 3TXYA 2G9VA 1KQFA 1GKKA 2PRKA 3ZE1B 2J41A 4WINA 2C1XA 2YJGA 2Y1OA 3IP9A 4NRDA 3WXMA 4GXNA 1YRWA 4XFJA 3DFFA 2I9KA 1E3EA 3ECAA 3U9LA 4D7AA 1I7QB 2PZAA 4CTKA 1ICIA 1Y6QA 2ORIA 1E9EA 1TYAE 1YMQA 3DMTC 3VR6A 2PH7A 3EC2A 2J3JA 2WJWA 4W5HA 4G0WA 3QEKA 2HUNA 5FUBA 2BHRA 4LJSA 1YVEI 1G2QA 2CJYA 3E2PA 3A1CA 1XVTA 5FUYA 5GONA 3WAGA 2R00A 4WNAA 1IPEA 3IIKA 2D0IA 3JQAA 4PY2A 3TRJA 3W5AA 1ZAYA 3R0IA 3HB7A 5I7FA 2QVYX 4E6PA 3R74A 1RHRA 4C87A 4OJQA 4ZV9A 2C9MA 4MKRA 4UUOA 3PS9A 2I4LA 5DMXA 5U4XA 4YCBA 3I58A 1V7PC 5AK0A 1ADYA 1RXEA 5AOAA 4XVUA 2FSHA 2EZ8A 3KZ1E 4OKNA 4BFSA 2IW1A 3LIIA 3P7MA 5CFNA 3M4YA 2IHKA 1NBME 4LJ8A 4RTSA 3DVAA 2PU5A 3MAAC 3LPLA 1JVSA 1Z2CA 2YRXA 4MDHA 3I72A 4CEHB 3OECA 2RH4A 4KSBA 1U63A 3L0CA 3WP1B 3NYQA 1I3LA 3GLFB 4OPMA 1UPXA 3F7NA 1SCDA 3NV9A 3MT8A 2LZ0A 3I23A 3NW9A 4JEMA 4TV8F 4UM9B 1SGWA 3LK7A 2HR1A 4PQEA 3HRHA 2ZIFA 1T4GA 2EEZA 1ULAA 4EA8A 2VWHA 2AT1A 4C5AA 4GD3Q 5FAXA 4AP5A 2ZRBA 3HA3A 2VZ8A 4XIIA 1KDVA 3AB8A 4G2TA 4MKIA 2CXNA 1NJGA 2J0VA 4FGSA 4FNGA 3SPXA 1F2VA 4TLCA 3QXCA 1T5IA 3ROGA 2G1AA 4E5SA 3CRVA 1QXSA 4TZTA 4AUNA 1U65A 3RS3A 3SQLA 1CWUA 2VF5X 2PFSA 2XZTA 1CUDA 1KZ4A 1Z7WA 2PL1A 2VHXA 3TD9A 4N0EA 3ZD7A 3QPCA 4TQAA 1HPLA 4JS0A 2B8TA 3FOBA 3GPDG 3PB3A 1DRJA 2I6FA 2ID9A 1PLLA 2QTCA 3P27A 4MW1A 1ECCA 3VO2A 1UXOA 3NAGA 3D8BA 1P29A 3IVXA 5HS6A 5C8XA 3CLHA 3OFJA 5COBA 1WQ1R 5ELMA 3B51X 2PUVA 3TPCA 3UTDA 5T6BA 1D2GA 2X7XA 3VYUB 1AZLA 1A69A 5KVQA 1VKHA 3GLTA 4F6RA 5LLDA 1GTVA 4AJ9A 821PA 1KYZA 4Y2HA 3DZDA 2BFEB 3NBQA 4QYWA 4NS4A 2V0CA 3WJ7A 5CCEA 5FPKA 1OI4A 2OK8A 1PSDA 2OO3A 2Y0CA 2O2HA 1OY1A 2NO0A 1XEWY 3K0FA 1SK8A 4MCHA 1NHGA 4NULA 3DE0X 3X1MA 3K1ZA 4YJHB 4LXYA 2FN3A 3BGOS 4M7WA 4QGFA 1NJ6A 2DVMA 1PGNA 2WYVA 3NEAA 4NEHB 2VA8A 3DD5A 2HWUA 4KYTA 5CYOA 4BFWA 1JB1A 1AV7A 3H1TA 1KFCB 1OXXK 3RR2A 3ZQ6A 9MHTA 1BFUA 1LBQA 3M82A 3E3OA 4XEUA 4GI1A 4TYNA 3DL4A 1GDTA 2QYOA 2EQBA 4F1KA 4G0UA 1M8FA 3IMFA 4IJ6A 2O7VA 2P6MA 2AI1A 1O9HA 4W8OA 5CFOA 1X2EA 5HK9A 4AI6A 5F1OA 2QE6A 4OG2A 4TS1A 4D96A 3H2HA 2HC9A 5BQOA 4RUKA 4KR6A 1KIMA 3GLRA 3KU4A 5FB3A 1A2QA 3JZIA 2YMPA 1FP4B 4B3IA 1LDNA 5JH7B 1GT91 4C0SA 5TRTA 3U5ZB 2Y77A 2OFFA 1Y9EA 1ZI6A 1OZGA 2K2WA 4OD0A 2PGLA 3DMNA 1JGTA 1XZ8A 2B8EA 5CK5A 2NX2A 3LPDA 4ZOBA 5LBTA 5LQUA 1QK5A 2LIVA 4GPAA 3I83A 2QVCA 4OQNA 3GPBA 3DT6A 4BVKA 1ZUWA 3FMIA 1V26A 3KD3A 1QCCA 4TL8A 4CHTA 3Q2KA 421PA 1ANKA 1U0FA 2NSYA 3E9ZA 3RUHA 5DX1A 5KWSA 3GP8A 4EB3A 5A3RA 2GD2A 1QDUA 2R6CA 2A35A 4BAZA 4FXOA 2MMGA 3H16A 4DARA 3HA7A 1WBJB 2IYOA 3BXOA 1MMFB 5L4LA 3ZE7A 4ANFA 4OI2A 5A62A 4S1PA 5AT1A 4PLTA 1DOZA 3WWYA 1JR6A 1BX1A 1O96B 2JAHA 4C88A 1J49A 2QXTA 2RAFA 3I5UA 4QNRA 1XYYA 2VLBA 3BFPA 1MEEA 1V7ZA 1ZKMA 1K5PA 2ZSUA 2OGUA 3HBNA 4LRUA 2ZYUX 4NBNA 3CE9A 5KTNA 4H7JA 4MVJI 2CV1A 4WLEA 4D0NA 4CU5A 1YUBA 4QGGA 2Q21A 1GQQA 2EYQA 4LYYA 4WKNA 4NYIR 3UYKA 4LSMA 1CJKC 5F7ZA 2Z4RA 4J0GA 3C7KA 4RSRA 5EWLB 3GYGA 3SR4A 4DT1B 4RLSA 4BJ1A 3E9EA 4DWOA 3CINA 4HN2A 1U02A 3PRYA 2YWCA 1MB0A 3R3XA 4V0QA 1LJ8A 1AUXA 4WXYB 2WNHA 1ZJJA 2WVJA 4JBLA 3AF4A 1C9YA 2L42A 3HB1A 3IQWA 3CS3A 5FD8A 5TT0A 2NU9B 1I7DA 1ZK3A 1OCEA 2XH8A 2AZMA 3GRVA 5AJTA 1G8MA 2DJ5A 1GQ2A 2G0TA 4JOQA 5D1NA 3OA0A 3ZK7A 1BAPA 4B85A 4DBLE 3ZI7A 1T2CA 2FSSA 2ZLBA 3KXIA 3GDWA 2QY6A 3QJYA 2V7WA 1EFRA 2W6OA 2XNJA 5D8DA 3UB3A 5BWCA 3LCVB 5BSMA 2IYPA 4WBSA 1WW3A 1CJMA 3KQVA 1ABEA 5TV2A 5AKGA 1N8SA 4N18A 3SKVA 3BMNB 1GUAA 1Y7PA 2UXBB 3EGXA 2ATXA 2WMYA 2HJVA 1E2KA 3CWZA 5KQGA 3G8YA 5T4BA 4OJKA 1KEEB 3EXAA 1AHNA 1EHCA 1BMQA 1LX6A 2WFLA 2Q0XA 2C4UA 4Q9JA 5D3ZA 5FI1B 2VNHA 1A8IA 5BYBA 4L0DA 3GRPA 3BMOA 4DV4B 3FCYA 1H8ED 1R37A 4NTZA 2GYUA 2AFRA 5G2OA 5K3BA 2OAGA 2H1FA 2FX2A 2PMCA 3L7OA 3MWDA 4FDMA 5E7IA 5IMBA 3KB8A 3OQIB 4P4UA 1TU0A 2VHJA 3BXEA 1DWPA 3HJUA 4QQNA 3WBJA 4DQ0A 1ZONA 2Z57A 1HGXA 2VK8A 3P4UA 3BB1A 1KVSA 5EPUA 3DMRA 3D8NA 1T8TA 1DVRA 4MUBA 2HEIA 3CNQS 1ZLYA 3ESBA 2I33A 1L7OA 1KJZA 4IFEA 4TTVA 1NT4A 3EXFA 1JKIA 1EGVB 1CRPA 4TL9A 4TT8A 1W87A 2WM2A 3GXOA 2CD7A 3K0HA 4ZCSA 4TLLB 2VPXA 2PUDA 3U19A 4Q9IA 4DHWA 1CU1A 3K3PA 4JJZA 1P75A 3O8LA 4Q4DA 4ZGBA 5IVDA 5BMVB 1P2SA 4ZT3A 1MRNA 3U81A 1VI6A 1LPAB 2P3LA 3U16A 2YWBA 5DEIA 721PA 3WLQA 1GGKA 1QYXA 1JBEA 2MSKA 4R7TA 1QP0A 2M1ZA 3FKJA 4HTFA 4MB0A 5L95A 1NM5A 2UZ1A 3A11A 3NDRA 5I4CA 3WGHA 3KV3O 2JHAA 4JSYA 5ALKA 1XA4A 1TGYA 3SF8A 5JAMA 1LRJA 4RWEA 3KQLA 2GZDA 2I66A 1NG9A 3U31A 5LVAA 1G5FA 1VIMA 3IJPA 2V7UA 1ZXLA 2Q3FA 4FONA 1Y48E 4OA8A 2BFCB 1NY6A 3LVFO 5E8JA 1BC5A 1MJNA 3K9HA 3EXEA 4OCZA 1KH1A 4DC1A 3P2EA 5FA8A 1CUAA 2AXEA 4Y0NA 5KNBD 1EVEA 4FB4A 5K0FA 4LXIA 1GEEA 1HK7A 3WV5A 1MX3A 3MWEB 1GL6A 4I5GA 5FPHA 1KYXA 1HFWA 2VH1A 1NYTA 4D9FA 3ZOKA 4YRZA 3EAFA 1ISSA 4F4CA 4TKUA 5E0KB 2XNHA 4MYCA 4RVDA 2QV0A 4LXHA 3K5HA 3L0ZA 4RD1A 4ZQEA 3WICA 5BV7A 3ZWAA 3PNMA 4PYJA 5LQAA 4YRRA 2JA2A 2H08A 4FYWA 1MVOA 4EA7A 4H7DA 4RVHA 3VR5D 3G2JA 5E2IA 4LBVA 3FTFA 4HDMB 4DLWA 1PF7E 1J8MF 4E08A 2JGMA 2C84A 2ZKLA 5LN1A 3GJRA 2HK7A 3RC8A 4HJXA 3V3TA 5DTEA 1XEXA 2H00A 3UA3A 3OLQA 1MOQA 1ZH0A 1XFDA 2KQUA 3DVLA 1G3UA 4KODA 4JB8A 4AG5A 4D3ZA 4CM3A 3RYTC 4F8JA 3NJ8A 3ZCTA 1LNSA 3WAKA 3I3OA 2P2ZA 5DWQA 5AWFC 1HXHA 3OQJA 3UGJA 1NT2A 1COWD 1DMRA 1E5XA 2H2WA 4U0KA 1RP7A 1E9BA 4L6CA 1TI7A 2HREA 4IP0A 2YN4A 5I7SA 1PGPA 4E7OA 1A95A 1PQYA 1NW6A 4RHXA 5CNJA 3LT1A 2X5NA 2AE1A 3UFXB 5CX4A 1T0JB 4CM4A 1NUAA 1OOEA 1QC5B 3ADDA 2GD1O 3LX6A 5AHRA 1Z5OA 2ZRIA 1JPNA 4HDSB 4JJKA 1EFUA 3C4JA 5FLKA 5GQSA 3CUEF 2DTDA 4TXNA 2EFEB 1MO6A 3LBFA 1B76A 3C7TA 3DC7A 3IT0A 5BSFA 5IM4F 4PZDA 3JQDA 1D6MA 1WDWB 2YFYA 2P68A 3BQMB 3JAKA 1M6WA 2D00A 1CY0A 3PHLA 1IB0A 1YI8A 3N2IA 1A7KA 1IBSA 3EFBA 4M6WB 4HUTA 1JT2A 4C0QC 5E6UA 1ZOOA 2OBBA 5JWHA 3WGLA 1AV6A 4QGSA 3C5CA 3I5MA 4FN5A 4I4TB 1VMDA 1OA0A 3PQ8A 1WHTA 3LLUA 1JQBA 1YMVA 2D1RA 3AHCA 3FYHA 3A31A 3W3AH 3HXMA 1N5DA 1DAEA 1IJBA 2Q3CA 3IO5A 3NEPX 3CLKA 4CT0A 1RYHA 1UMDB 3A3YA 2R8EA 3T34A 3JD1A 1N3IA 1ULZA 3WSWA 4WKOA 3UAOA 1JW9B 5TGZA 4QBHA 4YREA 1CY4A 5HXAA 3WV4A 3ZC3A 2FSVC 3QENA 3GBSA 4RVNA 4J0IA 4LIPD 4FMDB 4A82A 1KAOA 3L46A 3MHTA 4BBAA 1Z39A 3PC4A 4XD7D 4AZ0B 2X0EA 1KDOA 4KV7A 1AQLA 1LA2A 1X19A 4KQHA 1XDUA 3KC2A 4WESB 4YK7A 2J67A 3GPCA 1TW3A 2QAGB 3KAKA 1MV5A 5KKAA 3ZEAA 1XRLA 4UDOA 1F9AA 4EDFA 1A9XA 1E96A 4GQBA 4EJ0A 2NVWA 4B80A 3DP7A 5BWLA 4CKCA 5EL0A 1X7GA 2AOTB 2B3TA 3AWIA 5KYUB 2XBMA 2G67A 2YHUA 4QARA 4WBNA 3PUWA 1QPBA 1RQ2A 2I8LA 1EVZA 3FZEA 4I6EA 5DGCA 5E7QA 4H6PA 2O8DB 4EKNB 3W5IA 3FAZA 4ZQFA 4F2GA 1XLVA 3I0MA 4WUTA 5C0OE 4UDXX 3F6PA 4FTWA 3BE8A 3MTDA 4S2EA 1L5YA 4LOLA 3IBGA 4JJFA 1K2VN 3R7BA 3AEUA 2HIHA 3S2IA 5K0GA 1U7PA 2Q5OA 3FA2A 3PR1A 4HAYA 4PC7A 2VRNA 3PWSA 4UTOA 3HY3A 2VHWA 4O2LA 2ZTLA 3DQQA 3T4PA 1DLJA 1G4HA 3TRDA 3LUGA 1BKYA 1I2ZA 1PD1A 4D3XA 1KWKA 3F1LA 3Q8KA 4XKJA 1CERA 5KQLA 1SOWA 1M6VB 4DVGA 4RZHA 3WXBA 3ZWDA 5A2QA 1YDMA 4CEJA 3J7AC 2F64A 4GC5A 3UJBA 4JKOA 4L57A 3C5EA 3RSLA 8AT1A 4GGPA 4R9RA 2IS1A 1L7BA 4RS3A 3VNVA 2EKZA 4GPD1 2CWWA 1CQPA 2IV2X 2JVJA 4RJTA 3QTBA 1QPZA 3E2MA 4MKFA 1DARA 1JIKA 3U4GA 1XCJA 1PT9A 3HJFA 1NUUA 1ZMBA 3D2BA 3LGAA 3C7DB 1FDTA 4J0FA 2OGTA 5FR2A 4OX9B 3JRNA 1G5IA 4JXJA 3O2NA 3ZTWA 4B43A 2BJVA 2O3JA 1T0IA 1M2JA 4IOLA 5J5AA 4H3VA 3SR3A 2BDEA 4NBUA 4RZIA 3CWCA 2H4ZA 1KERA 4PG6A 3EQ6A 2JGNA 3IQGX 4BPBA 4EVQA 5ER6A 1LWNA 2BFFB 1Q1NA 4BU1A 2UUOA 3PP8A 3GJSA 2CV2A 4J6EA 2NWQA 3TJRA 1O4VA 3FJYA 3FOZA 1EP9A 4C0HA 1LI5A 4IHQA 1W46A 4JWTA 2BR3A 4ZOLF 1FW6A 2WHXA 2QMZA 1YBVA 1OLSB 2XGOA 2YWEA 4KI0A 3VU9B 4Z7NB 5ENZA 2FWIA 4N54A 2NVUB 2AQIA 1WTAA 4KVFA 4JX8A 3FSGA 1LDGA 4F3RA 1YL7A 4FS3A 5E95A 5K0EA 1KI9A 1RQ7A 1Y7LA 1BDHA 3NFRA 1AD2A 1XN1A 1YE8A 1F2DA 2ZQ5A 3I2YX 3R7AA 2ATCA 3HN2A 2BGMA 2EP5A 1Q57A 2IL1A 1IONA 3CUUA 5DVZA 3ZU6A 1FNBA 1SHTX 1W9HA 2DPXA 1VKZA 2P6UA 1ESDA 3GEEA 4NBTA 4YLYA 3PEUA 4MVJD 5IC5A 2OVBA 2ZRCA 4R9UC 3U7RA 4JI0B 4JOCA 3JZAA 3FFBA 3DEZA 5DM60 1N9GB 5KAPA 3E70C 4ZC8A 1LZLA 1INLA 4ZO9A 4IIVA 4MYTA 4ZYWA 1IUPA 2HGZA 2XD9A 3IP6A 1OWPA 4LJ4A 1SHUX 1LJLA 2HBZA 1N5MA 2GN0A 2BMJA 3G9QA 1K7CA 2VH5R 5HK8A 1MRZA 4BO2A 3CPEA 1OHHA 1UMCA 6GPBA 1C4KA 2PKYX 1HYEA 4H77A 3TKAA 1BCRA 1CY2A 5LQCA 4FWTA 3CXUA 1ZJ6A 2H1LA 2JJYA 3QVGB 4ZZ2A 4BKQA 4WXHA 1VDZA 3IDZA 5BSVA 1CK4A 3Q2OA 4WZ6A 1C30B 1YS2X 3G17A 4FCVA 3FZNA 4KXNA 5JZBA 3PGLA 4HB2A 3H2GA 3JARA 4X8HA 5FWYB 4AP9A 3QBEA 1JZQA 1PK7A 1Y7IA 4FFOA 5DSZA 4YMUA 5KIAA 1KMCA 2MU1A 3ZGYA 3H8WA 3WK5A 1G16A 2ECQA 4UCQA 1Y4SA 3TWOA 1IOLA 1JHMA 2JJ2A 2RGYA 2XA9A 3AEKA 3RJ9A 1EE9A 3ZXIA 3UJ6A 1HM5A 3KLBA 2FUCA 4ZOCA 3HU2A 3UM9A 4F85A 5EUQB 3BIOA 1E2EA 4QDTA 4B7UA 1P1HA 3S70A 2ERYA 4ZQHA 2FEMA 4DTCA 2HFJA 5T3UA 5ITVA 3MTAA 4L75A 2J48A 1GN8A 3HN6A 1JUDA 1QYVA 2BGGA 1V39A 2OCGA 3PVSA 3SSOA 3SYRA 1VB3A 3TQHA 1M33A 2PRYA 4MJLA 4YQFA 4DV0B 4Z4CA 3GLGA 1GNQA 1VHWA 4KDFA 2KPOA 3WYCA 1U80A 3L79A 2WYUA 4UZSA 3RI3A 5JQGB 5G3YA 5BW8A 5EIWA 4JOSA 2I8AA 3PD7A 3IE2A 2OYCA 1WLSA 2C7OA 1LFAA 1TZMA 1V48A 2G70A 1R8JA 1FFBA 2O0LA 4KQ2A 5E8RA 3KLNA 4C7BA 3MUEA 2C78A 1JLRA 2BT4A 2XUIA 3OM9A 1IEQA 3SZUA 2D2XA 3G2MA 3GEMA 4J8PA 1CUGA 1OIVA 1ZUIA 3JAWB 3O6VA 3HLYA 3OEED 2IHUA 1R0YA 4AJOA 4ZJYA 4BC1A 2JB9A 4F45A 1GAEO 5DV9A 4Y2YA 1P2TA 1Q84A 3KEMA 4UZFA 4AUMA 2CL5A 1B43A 3LHSA 2ECKA 1VLHA 3ROXA 3KAQA 4PFQA 3ZU2A 2D1TA 4HVTA 1ETHA 1I4OA 3VQTA 4J90A 1ICEA 1Z5PA 2IYUA 1XRRA 3CQ9A 5TGDA 4ZDJA 2YDXA 4GBMA 4L0MA 1FFCA 4MO2A 1BTOA 3FHTA 3B36A 4EVRA 1EUDB 2CDNA 3HKEB 2OLJA 4J07A 4M1EA 3UANA 1TUIA 2QRPA 1E0JA 3MFYA 4D9MA 3IR5A 3AUTA 1BVUA 1JI0A 1XKXA 2OT3B 2GNOA 2GUGA 2H06A 5AUNB 5BNIA 3HDVA 3KYBA 4V1CI 2C96A 2K87A 1JKJA 2ESRA 4D9HA 3GDGA 1EAMA 1K7FB 1RHJA 1G21B 1TTPB 1AK9A 2PX8A 3O90A 4MRAA 3TSCA 2Z56A 2FPKA 2RH9B 1WXHA 3GB9A 3JWGA 1ZWLA 2X13A 1VMEA 1QRSA 4DUYB 2PS1A 4ZI2A 3IGFA 4CDNA 1PR2A 2PLWA 4YRBA 2NU7B 1KSGA 5CT5A 1XPRA 1PG5A 1VSBA 2OC4A 4LOHA 4C4XA 1X80B 3ZWVA 1JH8A 4YIHA 3FPEA 2IYZA 1PR1A 2CLEB 4LRXA 4K0KB 1OH6A 1B8UA 3DZ8A 1D6SA 4IRMA 4IF6A 4IHKA 3LQFA 3TZKA 1VJDA 3PUXA 4KR7A 3BJMA 3VUFA 2O19A 3BYZA 4Z9AA 3RVLA 4YLEA 5FRDA 1C1DB 1G5QA 3HG7A 3BTSA 1UL1X 4FOOA 4IVPA 1NPDA 5FNVF 2FEPA 2PKCA 3IVGA 5GV7A 3UZUA 5KYYB 1LTHR 1OW3B 1VCIA 1QOPB 1PR4A 3GNSA 1Q14A 3I8OA 1OFVA 4HNVA 5JISA 4ZHSA 2CXTA 4MGYR 4O0MA 5CM8B 1NP7A 2EKPA 5JS8A 1HSOA 2YOGA 4ZEXA 2G36A 4GBJA 4OXKA 1Y9JA 4MAFA 1JJFA 3KBBA 3NM6B 3CKKA 4YRAA 4A2WA 5I45A 1JFFB 3IE1A 2D59A 3K72B 3H3JA 3HQ4O 2VQ6A 2ZJ4A 1KO4A 4J16C 5AHKA 3WB1A 4PHGA 3RUPA 4UHHA 2YFHA 1UPCA 3PQCA 2DERA 1UC8A 3ESRA 3WGKA 2SCUB 3G2QA 4FD2A 2BEUB 2O3TA 3C3DA 1JEYA 5DI3B 5CEFA 1T9GS 3NI2A 3UHFA 3CF0A 3EAGA 1R0ZA 1Z22A 3ZY2A 1TLFA 4FMCB 1LTQA 4PHFA 2D6FA 2O54A 4FZJA 2XUQA 2FK8A 2W00A 6ABPA 5D5PA 3THYB 3CTMA 3BFKA 1J07A 1Z6QA 2R2GA 3FDIA 1HQYE 1LSSA 1Q95A 3I8SA 2H9YA 3PFBA 4YMSA 4B4UA 4S05A 4RTRA 3QWFA 2G80A 3D6FA 4H35A 8ABPA 4Y6RA 4BP8A 2PE5A 3OX4A 2G04A 2ZWPA 3RHSA 5JUWA 1D2RA 2QG4A 3H5RA 1D2AA 2CWDA 3AY6A 4GLOA 3L9XA 1QGDA 1B0UA 4ITVA 3TVTA 4EHJA 5J2TF 1RKUA 4MIKA 4C0WA 1GGMA 4FOTA 1RI5A 1UM8A 5IBPA 3BGWA 2V5VA 1E6WA 4K0RA 3HBJA 4Y6QA 4B17A 5CA1F 3O73A 1RHMA 4RCZA 3INGA 1WE2A 1FTWA 4H31A 2O1EA 2XUOA 3P9YA 4RNCA 4EMBA 5L40A 1RYDA 3O3NB 5GPBA 3IDAA 4YUVA 1PVOA 4IEIA 1BJTA 3D3NA 3VNSA 1IUOA 1D7AA 1RIFA 1FUEA 1PFGA 4JQZA 5I7VA 5FBVB 2AK3A 5EOVA 2CLSA 3AYZB 4FEYA 4Z7OB 2R1VA 1G2PA 2CXHA 2A5JA 1HDEA 2JDID 1G21E 2QGNA 2WV9A 3GCXA 3JVVA 3TB4A 3I1IA 1RZUA 1T6BY 5CHYA 3NTXA 1BHSA 2PZMA 2W71A 1XQYA 3K4PA 3MW8A 1MEOA 4PCVA 4RHFA 5ALNA 3VSDA 5JADA 2IF2A 3F9IA 1F12A 4JQCA