2CCJA

Crystal structure of s. aureus thymidylate kinase complexed with thymidine monophosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Structures of S. Aureus Thymidylate Kinase Reveal an Atypical Active Site Configuration and an Intermediate Conformational State Upon Substrate Binding
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ccjA00
3KKQA 1E2LA 4E03A 5EXPA 3HWSA 1SKYE 3FHOA 4E5UA 3U60B 5KYKA 2YOGA 1YKSA 2BBSA 2UVQA 5IK2A 3SE0A 4PFSA 1ZC4A 2JCSA 4YMSA 4L16A 4RCYA 2ZYVX 4HAVA 2NO7A 2GKSA 4FMBB 3C7KA 5CYPA 3KQHA 3CH5A 1WB9A 1XZQA 4A2QA 2IS6A 1NRJB 1NF3A 3K53A 3QG5A 3QPUA 5BXQC 2D2FA 1H8HA 1JALA 4US2R 4EPYA 1TUIA 5FTNA 4B3DA 2IYVA 1B23P 1XDBA 4QJ3A 3DM9B 4FN5A 5GVRA 2DWOA 3RWOA 2KBFA 1CRQA 1GWNA 1E2EA 2Q6TA 4OHWA 1CTQA 4NCHA 4P3YA 3IQXA 2P5SA 3V9PA 1TUEA 2ORWA 2F43A 1N25A 1KZGB 3B1XA 3GJ4A 2QAGC 4NYJQ 1G5PA 1IY0A 3G5UA 2NO6A 1OYYA 3MAAC 1C4OA 1FP6A 2FSFA 4YONB 1RRCA 1ELOA 2Z0MA 1T9HA 2MMGA 1JR3E 3QEJA 4BFWA 5J4YA 4R71A 4URVR 1QHYA 5CJPA 4X8MA 4NKRA 2ANCA 5KTYA 4QBFA 4R7ZA 5JJIA 4NCJA 2ZRDA 3A58B 3BC1A 4HLUC 4NYMR 5LPNA 1X1RA 1XBTA 2QU8A 1E9CA 5C46F 3THXB 4DT1B 1NN0A 2VP6A 2XAUA 4DC9A 2RB4A 3Q8XB 3A4NA 1ZC3A 3VR5A 4DEYA 5F3WB 2KSQA 1RZ3A 1ZIPA 4PC2A 3Q7PA 5EXTA 1BKDR 1AM4D 2DFKB 1H8HD 1ZD9A 3K0EA 1XX6A 4AURA 1XMSA 4PXAA 4FCTA 2ZJYA 3A8TA 5EE1A 3U3KA 2GF0A 3ADCA 2J0UB 1RPZA 2IL1A 1KDTA 1H8EA 1K8RA 3AP1A 1G41A 1W4CA 2NO1A 4PSAA 4ZDWA 4Q00A 3QEOA 4MRPA 3KTAA 3OEEA 3RANA 4HDOB 5FR2A 4BFTA 3OE7D 5DYGA 2VP5A 3BBPA 4HEJA 3IIMA 2VSFA 4LC0A 2A5YB 4PHHA 4Q9HA 4OQLA 4OI4A 4Q03A 4C0JA 4GL2A 2X1VA 3VR1A 2ZJBA 3ZIAD 1T0HB 5EZ6B 2XGJA 3ADBA 3IHWA 3QXSA 3PEUA 2DYKA 3QKSA 5EP1A 2F6RA 3QUSA 4ZCLA 1UKEA 1Z0JA 3MMPA 3WP0A 3A1UA 1CJTC 4TTPA 2NGRA 5EZ5A 3IPYA 4PPNA 3A36A 3I3SR 4GP7A 4V03A 1XCGB 2XTMA 3LO5A 4G1UC 3N5CA 1VPLA 3EARA 4PQFA 3D3QA 4K46A 1H8ED 2GA8A 2QBYA 4GRAA 1ZW6A 1XRJA 1QVRA 1QDEA 1W0KA 3EIHA 3OEED 3NC0C 3U7HB 2B92A 4RJLA 2I3BA 3R8FA 3VMFA 4DVGA 2X8AA 1G3IA 3NEYA 1CBUA 1II8A 4DRZA 4TMZA 4EFLA 1EFUA 3AQ4A 2P67A 2QY9A 1W5TA 4LI0A 4Q01A 4TLEA 3M0EA 3K0AA 1T0JB 3B7GA 1SVKA 4QGHA 1IONA 2AK3A 1C9KA 1XPOA 4Q1CA 1K5DA 1GRNA 1XNJA 1M7BA 2W2XA 3GLIA 1N6HA 2OEPA 4JZKA 3NEJA 2ZYUX 2BDTA 1XTJA 2IS4A 1CRPA 2VP2A 4Z8XA 1G7RA 2BCJQ 2I1VB 3KJIA 3PXGA 2R2AA 4EFNA 4KSBA 4B3XA 3ZVNA 3SFVA 1E9AA 4OJQA 1X6VA 3W8RA 1WDTA 4ZKEA 3WHLA 2O5VA 2FSIA 2VBCA 5C4GB 5KSYA 3GLGB 1KAOA 3HJNA 4UXIA 4OYHA 3U7GA 1U2RA 5AJYA 3R9WA 4HLDA 5F9HA 3ICEA 5AUQA 3UANA 4GMDA 1W0KD 3OEHA 2PMDA 2ZRJA 1WP9A 3IEVA 4KHZA 4AKIA 3LVRE 1PZNA 1AIPA 4IDOA 5FR1A 1FX0A 5J5CA 2PH1A 5G41A 1KSFX 2ONKA 1GVNB 4A82A 4CEIA 5B58C 1ZYUA 1VG8A 2ZRAA 4G5OA 5JS8A 1O3YA 2ZU6A 4GZMA 4KLNA 3R7WA 3CIOA 4JLOA 3QJYA 1N6PA 4B3FX 3B1ZA 3PUZA 1IHUA 4Q18A 3MJHA 5FPHA 4MITA 1YZUA 1J70A 4O25A 4LJ8A 3FPAA 3C8UA 1A1VA 1W7AA 2BMDA 4K81B 1FMLA 4JBXA 1QHHA 4DB2A 1BYUA 1MRNA 4A0FA 3L43A 4F92B 2BJVA 5TB5A 3K9GA 5D3MA 2OFOA 2ZR0A 4QXAA 1CLUA 1F2TB 2WWXA 2AD1A 3GJ0A 2YINC 1GM5A 3LQRA 1GL7A 2BWJA 3DPUA 1HURA 1AKYA 3DVLA 1OSNA 2VF8A 1VDZA 2WBLC 3W9YA 3TMKA 3THWB 4OHZA 2V9PA 1KTVA 1LTQA 1P7CA 5AJZA 1W1WA 4XWOA 3KKMA 2RGBA 5FPSA 1WCV1 1L4YA 4XWKA 3SI7A 1G8GA 2H5EA 2Q3MA 4TL7A 2O8CB 2FZLA 3E2IA 4CEHA 3GJ5A 1IBRA 1OJLA 2RGXA 2QN6A 1RJ9A 1UKVY 4PO1A 1F2UA 2KWIA 4M0LA 4TL8A 4UNRA 1LW7A 1Q22A 2OFXA 2B8TA 3SJCA 2OO7A 4D4MA 2BIFA 4B43A 4KITB 3FMFA 3KFXA 2QTVB 2Z4RA 2REBA 2PBRA 4PZLA 2QGNA 3BH6A 3QG1A 5JSZB 3LW7A 1QVAA 1R10A 2ODEA 1GILA 2OAP1 1SXJA 3AF3A 3N2EA 4QBIA 5FOSA 5BQ5A 3T1QA 4CF7A 1LF5A 4OHYA 2BMJA 3ZVMA 3CRW1 3Q5DA 4MQBA 2OT3B 1XTQA 5AUOB 3HP1A 2H92A 1Z06A 3ND9A 1SZPA 3SQXA 3NXSA 3FOZA 1JJVA 3FDIA 3T61A 4HB2A 5IT5A 4BLPA 4L8GA 5JCZA 1VYVA 2JIZD 3ND8A 3VHXA 3QXCA 5FUXA 4OHXA 1UBGA 2HCJB 4RD2A 4AY2A 2DWQA 1J8MF 3U3OA 3BB4A 3QF4B 2NO0A 2IUTA 4A0GA 4BFVA 1X1SA 2X77A 5LD2B 2C03A 1OFHA 2PX0A 5FUVA 3D31A 3TW4A 3VX3A 3X1WA 1Z0FA 2ZIAA 1KSGA 2PX3A 1E2GA 1G20E 1IOZA 2ZSDA 1Q12A 2QEQA 1ONBA 4HB3A 3UG6A 5M04A 3I5YA 1Z63A 2GZDA 1JI0A 5H68A 4PPFA 3TH5A 2IWRA 4QM7A 4LJ5A 1E9DA 3FVQA 3U7EB 1SXJD 2D4HA 2FE4A 1IY2A 2N42A 1XFAA 3W90A 1VCNA 4BRUA 2ANBA 5DI9A 4Q1BA 1HYQA 3QXJA 3NBYC 4DLSA 3FHTA 1GDDA 2ZRBA 1Z0KA 4QHYA 3IIJA 3IEUA 1Z2CA 4DCSA 4MKIA 3KB2A 4CW7A 4M9SA 2F1RA 4LPKA 3RS2A 3DZDA 3Q72A 5G3YA 2BJWA 4C0BA 2GXSA 2YKGA 1GNRA 4NTZA 4WZAE 2WIBA 1CJMA 2ODBA 2IYQA 1BMFA 4LOAA 4AKEA 1TF5A 4F7WA 1TEXA 3GEIA 4PSVA 1GZSA 2EFCB 4D4LA 4C7OA 1B0UA 4R98A 2VEDA 4QGGA 3OFNA 3IDQA 4R2IA 5SZKB 3AKEA 1SVLA 4HDCA 1UPTA 1S96A 2G0TA 1FUUA 3WNCA 4LX0A 1Z0DA 3PV0A 2LKDA 3W34A 1ZRHA 1SXJC 2FG5A 2V6JA 1E2NA 2HCBA 1E9SA 4YMWA 3QSYA 3DO6A 4HZUA 2QUZA 2ZXUA 4I1SA 4JLNA 2XOKA 3RSOA 2QP4A 3JVUA 3MRSA 1YRAA 3U44B 1YZLA 1DELA 1UDXA 2ZI4A 4L9SA 1AZTA 1F6BA 1Q1ZA 821PA 5KUTA 3GPLA 3FHCB 4GMXA 1M2OB 1DG1G 3BH0A 3VU9A 5LBIA 2P65A 3FKQA 1KI6A 1DAKA 1E0KA 2AR7A 1GTVA 3HDTA 1AN0A 1ZCAA 2B8WA 1I4LD 4OI0A 2VP4A 3VAAA 2HT6A 3EX7C 3I73A 3OFND 1OXSC 1G7CA 4PTLA 4CRWB 3AP2A 5B30A 3CRQA 5HR5A 3TR5A 3E70C 5FL3A 4P4TA 3PG5A 3TR0A 4ZIRB 1XMJA 3RC3A 4D0GA 4LBYA 2O0KA 4TMTA 2H8KA 2VHUA 2YV5A 4JJKA 2GDJA 4DIDA 5C18A 2XOKD 3SDZA 4A6PA 2R62A 3KJEA 3VR2A 1YRBA 2ZYTX 1DEKA 2HLDA 2RKOA 3FWYA 4RCZA 5DGXA 1OH8A 3C15C 3GLHA 1E6CA 4HLCA 1P5ZB 2HYIC 2QP9X 2D06A 1ZINA 3MCAA 1NN1A 1QZXA 5EUQB 2CHVA 3WXMA 4M21A 3SJBA 2GXUA 1UEJA 5EXSA 5JJLA 1KI2A 3O8RA 1XMVA 5SZHB 1OIWA 2REOA 4XSHA 3U6BA 1FW6A 4U7DA 5B57C 3AEZA 1E94E 4RD6A 5CLLA 4LYAA 3VNUA 4V0KA 4FI3C 3CF6R 4AG5A 4PHFA 3LQQA 1A7JA 3X1ZA 4DLXA 1EX6A 3H84A 2WSMA 3S1AA 2BC9A 4OKSA 1CJUC 1XJ0A 2RAPA 3VFDA 3KXLA 3QPWA 1E2QA 2J3EA 2HLDD 4HDQB 1NMXA 2NIPA 2YC4C 4EJSA 1AQYA 3R8CA 4EPWA 1W36D 1VTKA 2WHXA 4EIWA 1P73A 3VR3A 4OQMA 4ARZA 2D3WA 2FJUA 3AF1A 3EPHA 4ZDKA 2CE7A 4OK3A 1HY3A 4B33A 4WXPA 4DDWA 4HAZA 4TYNA 4F4JA 4DZZA 2R6AA 2P3SA 3ZD6A 2PMKA 4MYCA 1P3JA 1XP8A 2ZUBA 1PUIA 3ZJYA 4FMDB 3PEYA 2KI5A 3W6PA 2VLIA 4EFMA 4D0LB 1JEEA 5KSOA 1UDWA 4S35A 4Q66C 2MSDB 3PFIA 4CEJB 1P75A 1VYUA 2XXAB 1S1MA 2J45A 4UJ5A 1TTTA 3IIKA 4JYCA 4W5JA 4KJZA 4IFBA 4QJ4A 1KSJA 3K70D 4Q4HB 2OXCA 5CDFA 3SNHA 1WMSA 1R6BX 3CH4B 3ADDA 1N6KA 3CZPA 5JEEA 2ASEA 1VKJA 4RZ3A 4V0ME 2ZITA 1Q21A 4QHSA 4FMCB 4KV9A 1FZQA 1G1MA 2BBWA 4TN1A 1QHXA 2CL6X 4AWXA 3TQCA 1KDPA 2ERYA 2ZS7A 5CM8B 1CULC 2QPOA 5LB2A 4XTCS 1W36C 1E2JA 1JQJC 1Q44A 1Z8FA 3HR8A 3UIEA 2QENA 3NBXX 4WW0A 2JLRA 2JGNA 2BVNA 5JHGB 5SZIA 4EQ6A 1CIPA 2YYZA 3FMIA 4JLBA 2AKAB 1FNNA 4B3BA 1HE1C 4FW9A 4HUQB 4LHXA 4LZZA 2ZRMA 5AJWA 1WXQA 2FEMA 1VECA 4MYHA 1TQ4A 3ZH9B 4RFSB 4HZIA 3BGWA 2EVWX 5FI1B 3CO5A 1KKLA 2F7SA 1XTKA 1L4UA 2R6DA 1COWA 3LVQE 2NPFA 5FFMA 1E99A 4FMDF 3K70C 3WBKA 2Z5FA 3MWKA 4URWR 4NYIR 1XD9A 1GL6A 2ECKA 1IN8A 1Y63A 1OV4A 4Z51A 2VHJA 4OL0A 4IOMA 2SHKA 1G17A 2WM9B 4EJSC 2N1BA 2FU5C 1GFIA 4UXJA 1M7HA 3AUXA 2IYRA 2ZUCA 4TLBA 2P2LA 1XPUA 1G9XA 2TMKA 4M9QA 4OI2A 3TNFA 4LV6A 4P31A 2JLSA 2ZREA 2Z83A 5AJXA 1A82A 1OXTA 4F4IA 2CBZA 1FPMA 3LLMA 1CEEA 2FFQA 4FMCF 2RHDA 2YNMA 4C4PA 3BXZA 4IJMA 4QFMA 3VR6A 3BS4A 1ANKA 1XEWX 2RGGA 2XTNA 3GCGA 4EKDA 5J4VA 5CDFE 5HZHA 2OFWA 1S3GA 2FZ4A 1XTSA 2GEDA 2ZJ2A 5EJEA 2RGCA 3RS7A 3BJIC 4H1VA 1YHNA 4I4LA 4IDQA 3D8BA 4KXFB 2O8EA 3SZRA 2JJ2D 1VHLA 4JT2A 4Y0AA 3V4FA 4B34A 3SBEA 5J47A 1KMHB 4P4SB 4QNMA 4IRUB 1G8FA 1ZAKA 5LDDC 3QKRB 3KX2A 3MWLA 3CF2A 2OXRA 721PA 3ZVRA 3THYA 2AN9A 1KI7A 2J46A 2CJWA 4GOXA 5FTJA 4O3MA 3DEFA 1WF3A 1FTSA 3SEAA 3QKSB 3SHFA 3CLVA 3P4YA 4JIMA 2VYFA 1EWRA 3F8TA 5HE9A 1OT3A 2QI9C 2BKEA 3WMEA 4TMKA 2K5UA 3A1VA 2I4IA 4A15A 2A78A 1J8YF 2GAOA 4MDFA 4PANA 1XF9A 2C95A 2J87A 4TQ9A 4LJAA 5DI3B 4NU0A 2X19A 4MRVA 1XJQA 1LF0A 3BE4A 1S0UA 3H4MA 1Q20A 4MYTA 5FPTA 3UWOA 1MO6A 2F55A 2J0SA 3KJGA 4TLCA 2G3YA 3UKDA 4B73A 4DDUA 2JASA 2EYQA 1UKYA 4QC2A 4NZYA 3A1SA 1P6XA 1U81A 3MG9A 5JS7A 1II8B 1MABB 3V00A 1YR7A 1LS6A 5CIQA 5DLQC 5HZKA 1NNEA 4I99A 2FMXA 3NKVA 4JL6A 4LJ9A 4LPSA 2XZLA 2QL6A 3NDBB 1GKIA 5KOYA 4BFZA 1EFRD 5G53C 2F3TA 1R0WA 4YXWA 2FX3A 4TYPA 1NP6A 4BZQA 3N70A 1IN5A 1N0UA 4G5SA 5F9FA 5CITA 1LY1A 3BERA 3BIFA 2BBTA 1E98A 2HT1A 2QMEA 1AQUA 1LFDB 1DO0A 3KKPA 4DDTA 3CONA 4GZLA 5E4FA 1TEVA 2G6BA 1E2PA 2J1LA 1WE2A 1A5TA 3EC2A 1SVSA 3OE7A 5L3QA 2IHYA 1KI3A 2YWFA 5F98A 4LV8B 2YOHA 2IYLD 3VR4A 1ZVQA 2F9MA 3IUYA 4BEJA 5BN3A 1VG9B 1W2GA 4C2UA 2C99A 1PJRA 5KU1A 1UBCA 3RSLA 1N0WA 3RAPR 1RKBA 4OHVA 2JLUA 3CWQA 5GJBA 1FX0B 3IBGA 5K8IA 3ZIAA 4DUGA 2FA9A 1X8KA 1EWQA 4Q9IA 1OB5A 1RYFA 1TL7C 1XZPA 5EP3A 4DLTA 3GLFE 5L3SB 1G5RA 4Q4AA 3LBHA 3I4LA 1M7GA 3QENA 3GFPA 3GEEA 3R7WB 4BASA 3KL4A 4DLVA 5JWRA 1NY5A 3B8HA 3KXIA 4B44A 2OZEA 1JQLB 2ZI7A 4YXWD 1E69A 5TV2A 1FOEB 5TY0A 1G3MA 3SFZA 1AZSC 4JL5A 4WA7A 4JSYA 3U3RA 3ZVLA 3EIQA 2WJVA 4XD7A 4UKDA 2OUKA 2D2EA 1XXHA 4EUNA 2HXYA 3B60A 4KFTA 1CS4C 5BN5A 2ZSAA 1W49A 4BRWA 1ETUA 2ZE6A 2W00A 1G3UA 5DSZA 1PVOA 1T8UA 3D6TB 5JCPA 5EE9A 1NMZA 2F1IA 4LJYA 2GJ9A 3CZQA 4O2LA 4M1WA 1CJVC 2MSCB 3B1WA 4N1AA 5KO2A 1XD2B 1N6IA 2FPKA 3X2SA 3U61B 1U8ZA 2AK2A 3U5ZB 2CHQA 1G3RA 5JI3E 4Q5IA 2FV8A 1Z6YA 3P26A 4GNKA 4ABYA 4IDNA 4DUGD 1OXXK 2XNSA 3UK6A 1G16A 4Q7LA 5E7MA 1GL9B 3CNOA 4TQUS 4US1R 2Q9AA 3PIRA 2IW3A 1DAEA 4U00A 1R0XA 3TAUA 3KKOA 2NQ2C 1RJ9B 1E4VA 1E0JA 4PQYA 1F2UB 1TQ6A 3X1YA 2C9CA 4Q1FA 3DOFA 3SR0A 4XD7D 1IN4A 1XB2A 2A9KA 2BBOA 4M53A 2O8FA 2O8DA 2O8BB 1US8A 4J0QA 4OBEA 3QBTA 5F2EA 4C0SA 621PA 3AVYA 3QY0A 2V7QA 4YMTA 1DO2A 3GQBA 4O0MA 2G77B 4LHYA 4BFYA 5AUNB 1E0SA 2DFNA 5DIFA 5DO9A 5GADl 3SU8A 1OE0A 4MA4A 1S9DA 4A2WA 2IS1A 2ZUDA 3B9QA 1XEFA 4XH9B 5G3ZA 2CVFA 3NDPA 3PVSA 1GRQA 1W5SA 1YQTA 4MKGA 5J4LA 4MRNA 5H8WA 2BEJA 1GKYA 1Z5ZA 2UZIR 1Q57A 2VRWA 2GJAA 2AXPA 3GFOA 1NY6A 3I72A 3RDPA 3MGCA 2PLFA 1IJEA 3TUJC 3CPJB 4I1UA 3FTQA 1KO4A 4B35A 3AKDA 4KFUA 1DAGA 4JLAA 3KQNA 4ZCMA 1W0JA 3IBYA 4FCWA 4A8JC 3ZZTA 1JAHA 1GAJA 4KODA 4UNSA 4V0NA 1T5LA 1ZCBA 1OF1A 3LX5A 2V7QD 1E2DA 2R6CA 1QHSA 2NO9A 4B2LA 3C5HA 2IBMA 4UJ3A 2AL7A 2FFHA 2PJZA 2WV9A 4IKEA 2GNOA 4O2RA 4RD0A 1F5NA 2CLDX 5TXGA 3RS0A 1MT0A 4URYR 4C0AC 2QE7A 1P4SA 2OBLA 4W5HA 4MH0R 3LNCA 4P32A 5KNBA 2ZJ8A 2VH5R 1H65A 3OIYA 4DSTA 2WKPA 4D4JA 2V6IA 3ETLA 2WTUA 2ZR9A 4C0KA 2VO1A 4M4SA 3EA0A 1CU1A 1U0LA 1W0JD 2D74A 3EASA 3L8YA 1EESA 4CIDA 2D62A 1YVDA 3A4MA 5HE8A 1GITA 2VSOA 5EQTA 2P5TB 1EXMA 1E9EA 4OJKA 4XJXA 2EFDB 4DT1A 3THXA 4IFEA 2BOVA 3NH6A 1NMYA 1NLFA 2W6JA 1Z83A 5KSPA 2NZJA 4ON9A 2GXQA 4HZUB 2VHCA 4AYTA 2Q0HA 4NYIQ 3WNBA 2JIZA 3CPEA 2V1UA 2QE7D 2J0UA 3B85A 4P4UA 5JJKA 3GLIE 3REGA 4B75A 4PX9A 3PEWA 1LV7A 1IXRC 1K5GA 1G3QA 1G4UR 1KK1A 1ZD1A 3L0IB 3EZ7A 4LHZA 1IXSB 2VF7A 2ZI5A 5H70A 4E22A 3AF2A 2XB2A 4URZR 1HH4A 2E9SA 1N6RA 3W3AA 5D3QA 3I61A 5FTKA 3QXXA 4ESHA 1OIXA 4TSFA 2F3RA 1Z07A 3ZS8A 2BV3A 3L8ZA 4H9GA 1JXMA 1Z6AA 1E1RA 1ZUHA 2CEAA 3TKLA 3KKNA 2JA1A 4LYJA 3EIEA 2C04A 3WY9A 1Z08A 5CK4A 1HV8A 1UBEA 3FE2A 4HUTA 2W83A 1TPZA 2UKDA 2YZ2A 2WIAA 4YDSA 1HEIA 1QF9A 2W6JD 1MOZA 2B21A 2CCKA 2GVZC 3HR7A 3LLUA 5DYIA 4M1YA 3I32A 4NE2A 2WJIA 4TTRA 4KFRA 4IW3B 3DM5A 5FBWB 4MYUA 1KO1A 1N5JA 3VX4A 2IXGA 1TX4B 1XEXA 5KSZA 2EW1A 2P6NA 3AM1A 2PT7A 4RY2A 4PAOA 1W36B 1DAIA 4KYUA 2GZAA 2J7PA 2VHQA 5CYOA 2E87A 2QMOA 3GJ8A 5CM9C 4KI0A 2WZQA 4M9ZA 4DEXA 2HJVA 1CF4A 4CVNA 5KDOA 3RWMB 1VG1A 4TSFD 1I4TD 4Q4JB 3WP1B 3RHFA 2HDNB 2IYYA 3EZ9A 5KDLA 1E1RD 3I1FA 2QRZA 4PC7A 3U4QB 1BS1A 1T8TA 3CKLA 2BEKA 3MD0A 2ZE7A 1F60A 5K8UA 3NBZC 1C1YA 4NL4H 4HATA 2PLRA 3KQLA 1E9BA 1ZM3A 4TMWA 2PEZA 3W5JA 1PLLA 4UNNA 1ESMA 3I5XA 2FFAA 3DMDA 2IYWA 4DXAA 4KVAA 1OPXA 3S1AB 1E2MA 1ZD8A 1NLYA 2RGNA 2J5XA 3WMGA 2ZRHA 2G83A 1DPFA 3K9HA 5JZVA 1G7SA 1GKUB 3NTUA 1CR0A 2OCYC 4Q02A 4UXHA 3QNUA 4PSKA 5E7IA 2GILA 2J7PD 3U3JA 4CZ2A 2ZE8A 3ASYA 2H1LA 2WPDA 2ZSFA 3GJXC 2A5FA 3VNVA 1XEWY 2WAYA 4NDZA 5KDDA 1SXJE 2NZ8A 4QGFA 1D2MA 5FOTA 5E95A 5BYJA 3EZ6A 3SYLA 4KO8A 4C9BA 1S2MA 2EQBA 4Z1MA 2A5DA 2BKUA 3QPVA 3CRRA 4Q7MB 2ZTSA 4D82A 2IEYA 2JJ8A 1AGRA 1E3MA 3ICQB 1YR9A 2ZJ5A 3VKGA 3UPUA 3NVAA 5IDVA 3U7FB 4M1MA 5KNCA 3WYFA 3P20A 4BZXA 4NONA 5FTLA 4L4UA 1KKMA 3AB3A 2FSGA 1BH2A 2HYDA 2ZI9A 4A92A 2JLVA 1E1QA 4NYMQ 4QJ5A 4B71A 4D6PA 3KDSE 2GJSA 1Q1QA 1AGPA 3VHLB 3AVVA 2Q9BA 2WPDD 1R4AA 4GFDA 2AFHE 1DAMA 3HYTA 5A5GA 4L5BA 2PCLA 3DKVA 2RGAA 3DMNA 4YC7A 3THWA 2VQSA 3QQ5A 4JYBA 3ECCA 2JLQA 1JR6A 1EG7A 3ZZ0A 4TMXA 1YR6A 3F3YA 3MLEA 5AR1A 1SULA 2R6FA 4C2TA 4IVRA 2O8CA 4ILEA 4Z1MD 4TLAA 2P6RA 4UNPA 2ZJZA 5KPJA 5FL7A 1Q3TA 2NMVA 2OV2A 3P1JA 1JB1A 1P9RA 1Z47A 3MUFA 3MSXA 2H17A 2GWHA 4IXMA 1T6NA 1NKSA 3DL0A 1U94A 2G88A 1G6HA 4TLDA 5JSZA 2GEVA 2W58A 3GJ7A 4NCIA 2RGNC 4DLWA 3THOA 5DE3A 3CR8A 2E1RA 1E1QD 1OKKD 1SKYB 2Z6VA 4KU4A 1D2NA 1Z6TA 1KI8A 1OHHA 5JWOA 4A6XA 4M1TA 4P33A 1FMJA 2QSYA 1UADA 1NLZA 1SKQA 2AHOA 2IX3A 4G5QA 3FFBA 2RMKA 3LA6A 1I2MA 1N0VC 4NBSA 3AGQA 2H57A 5FL7D 2QAGB 1G291 3PQCA 4D26A 4WZ6A 2F1JA 2OBMA 3G82C 4Q19A 2JLXA 1X8LA 4BQSA 5DISB 4B3CA 1NVVR 1ZUIA 2OSBA 1D5CA 1JNYA 4OI1A 3W8NA 4WZBE 1UFQA 2QTHA 2R44A 4X8LA 3KXKA 3B9PA 1GUAA 4Q1AA 1ZM2A 4A1FA 3AVUA 1OHHD 4H1UA 4R9UC 5FTMA 1KAGA 4M2LA 2Q9CA 4LJ6A 3C41J 3GLFB 1Q1EA 2C5LA 4HAWA 4YQFA 2IA5A 5JI2E 3U3MA 3CM0A 1YU9A 1RRPA 1XCMA 3VQTA 1T3LA 4A9AA 2GCOB 1SVWA 1M6NA 2CCJA 1S4QA 1F3OA 2OBNA 4YMUA 2GK6A 2W0MA 4DLUA 4YLGA 1OLOA 4Q47A 4TL6A 3CX6A 1GNPA 1Z22A 4FCVA 4QBHA 1G19A 3R20A 2WWGA 4KYIB 3IGFA 4RD4A 1ZNYA 2QORA 3GLHE 5IRCD 2C77A 1E9RA 2ODWA 5HTKA 4ACBA 3MJRA 2ZI6A 3IQWA 2G0NA 5AK0A 2ZSBA 2FWRA 2PEYA 4C3ZA 1SVMA 4KBFA 3TSOA 2PT5A 3GP8A 4IVQA 4HLQB 2XZPA 4BPBA 1NVUQ 2FSHA 2FGKA 5FBRB 4JJZA 4LHVA 3C4JA 4MUBA 1SHKA 4JLJA 3B2EA 1RVDA 5FUWA 4NP6A 5JBQA 4I1VA 3KUCA 3NG1A 2JEOA 1N6LA 3BK7A 2QG6A 4GPTA 2FGJA 4F4CA 2P0EA 2FNAA 4IOLA 1M8PA 1KNXA 1SQ5A 3U44A 4V0LA 3KQKA 2Q3HA 3G0HA 4N0EA 2QROA 2EWVA 1GSIA 1QG4A 2PL3A 5C4MA 4MKFA 4NCKA 4F91B 4TYWA 2VSXA 3AGPA 2YWHA 4ZI2A 4JSTA 1G64A 2DPXA 2XTZA 3P32A 1XU4A 1Z6XA 2F43B 2D7CA 3AKCA 3TUIC 3ZS9A 5L3QB 4AKGA 4BWYA 1BIFA 1SGWA 1KI4A 2H16A 2JJ2A 4LUCA 4W5WA 4ZPXA 5FI0B 3SS8A 5LD2C 4G3XA 3Q9LA 3CRMA 5FPKA 8OHMA 4B74A 1X86B 4PHGA 1YJ5A 5E7JA 2I1QA 2V3CC 1FFHA 2VHTA 4CT4B 2QNRA 1PLKA 2Q21A 5J4KA 5EE3A 4ZIRA 2DR3A 1QG2A 3NHAA 1P9NA 4Q4AB 3TIFA 2JJ1A 2YVUA 3ZQ6A 1NJGA 3LBNA 5GJCA 2YC2C 4WOPA 3EZ2A 3ZZUA 1JECA 2O52A 4BEBA 4FWTA 4NHOA 1SHZA 3TLXA 4NCNA 4ITRC 4B2PA 4C30A 1S9HA 1FQJA 5DN6A 3ADKA 3NH9A 3CF0A 2ZSEA 4M1SA 4M9XA 4LJ7A 3EC1A 4LBWA 3SN6A 2OM2A 4DBLC 1WRBA 3TGPA 1IM2A 1YZKA 3KTAB 4M8NE 1AK2A 4B2IA 3W6NA 2EFEB 4XVRA 3FGNA 2ZU0C 2NG1A 4E09A 2C98A 2XNDD 2WOJA 4Q7JB 1J7KA 4LYFA 4IOKA 1R8QA 2CLSA 2GEUA 3ZLJA 1VCOA 2VL7A 4HAUA 5EP2A 4TWZA 4B3GA 2C2HA 3K0FA 4ZDIA 4JVMA 3GD7A 1G8HA 4XIGS 1EFRA 3OZXA 2WSSA 3MFYA 3NBFA 4HAYA 4JVSB 1TAGA 3R9IA 4JLPA 1R0ZA 2JJ1D 3Q7QA 4KLZA 3NHBA 4POAA 1A2KC 4RZUA 2J0QA 4N0DA 3RVBA 2V1XA 3EAQA 2AD5A 3KB1A 4PC6A 2BMEA 1TNDA 3CUEF 1S1CA 4GT1A 5JRJA 2XITA 3OIVA 1OXVA 1D2EA 2G1KA 3EXAA 5FBLB 1US8B 4DLYA 5BN4A 4JBWA 2O8DB 4QGAA 5DN6D 2KJQA 1E4YA 4B47A 1JR3A 1ZBDA 2QBYB 1ZM9A 4TTQA 4CGZA 1N3BA 3U6KA 3CRVA 3LW8A 2ZRFA 2B7BA 1Z6GA 3O8CA 1G21E 1XD8A 2OCAA 2PZFA 4BLOA 1LNZA 2GESA 3HPRA 4NH0A 2GF9A 4CYMA 3A1TA 1KDOA 1TU3A 1DAHA 1XMIA 2IT1A 1Y3AA 1A4RA 4AC9A 2OESA 4CEJA 1VHTA 4RD3A 4PQRA 1W4RA 1ZU5A 4Z8YA 1NKTA 3RS3A 3EZFA 2XXAA 1U98A 1W47A 1NJFA 5J40A 3WBJA 2WSSD 3K0AB 4S2EA 1VCMA 1L2TA 4RFVA 3EPJA 1J90A 3QOFA 3WYAA 1N6OA 4TT3A 3LRPA 4IVPA 2J7KA 2PJRA 4Q4HA 2CL0X 3T1OA 1W4AA 5CIWA 2IF2A 4EPRA 3O8BA 3GLIB 2W2TA 4QHTA 1CR2A 1NBMA 2QZ4A 3T35A 5EP4A 1AS3A 3BH7A 4QBGB 3TQFA 3OF5A 2J9RA 1KGDA 3DDCA 3WHKA 2ZRLA 4DLZA 1QBKC 2HJGA 2GZHA 1I4DD 4X8HA 1P62B 1P2TA 1TF2A 5HKKA 5IF9A 5K8LA 1TADA 4ZCIA 3AF0A 1JR3D 2A7QA 3BFVA 3EG5A 2REXB 1XJCA 4R2HA 3AF4A 1FL9A 5FOWA 3OAAD 3AVQA 2C8VA 3AKYA 1UBFA 1T3HA 4HUQA 5DHFA 2ZI3A 3NC1C 1E79A 3H0KA 2YJTD 4ASUA 4CEIB 2ZEJA 5HCNA 4RFSA 4ESVA 1G8YA 1HA3A 2VP9A 1R5OA 2R8RA 2DCUA 4PO8A 3VKHA 1FNMA 1ZNXA 2DHRA 3AVPA 1AJEA 4TMVA 4TT3D 2ATVA 4Q7KA 2GAAA 4BLQA 4A8JA 4BE7B 2G1JA 2ZS8A 2F1HA 1XTRA 3PCRB 3KQUA 2ZRKA 1RRGA 2OE2A 3PJRA 5H1YA 1NBMD 1QHHB 4LV5B 4M1KA 5L3RA 1YZTA 5IK2D 3QBVA 5D3MB 4DHEA 3NWJA 4EPXA 2KBEA 3AVOA 4PAMA 1KO5A 1M34E 2MMCA 5HKKD 5CB8A 3K9LA 4PPQA 1D6JA 3SYKA 3PUWA 2HF9A 3T1VA 1KNQA 4C0LA 2JATA 3R9XA 1CJKC 2ZRIA 1Z0IA 3NIBA 4PZZA 3P4XA 2Z4SA 4TZ6A 2IS2A 1T91A 3OIUA 5TMPA 3O47A 4LJ4A 1RFLA 4M1OA 2FPLA 1E79D 2YWEA 3A4LA 4URUR 1MR3F 4ASUD 5FOXA 5J4HA 1PV4A 4D2IA 4TYYA 1GNQA 2IHBA 1E32A 1NSTA 1G8PA 2IYZA 3QKUA 4Q1EA 4F38A 1JXOA 1NBME 1YE8A 2FF7A 4CEHB 1Z3IX 3GJ6A 4YDHB 221PA 1EFHA 3BORA 3O8DA 4KSCA 2QTFA 1KY3A 4LK2A 4TYQA 5TDHA 1OFIA 4II7A 2LWIA 1CKEA 1KMHA 1P72A 1UM8A 2XEXA 2IXFA 1SVOA 4JT4A 4P4SA 4Q1DA 4QRHA 4D0NA 3EW9A 5A0FA 3QKRA 1YR8A 4PAQA 5B64A 3WYGA 2ZRCA 4LC1A 3Q3JB 2XJ4A 3CW2A 1SXJB 6Q21A 1J99A 1KK2A 5JFGA 1E2KA 1NIPA 5UKDA 2P6UA 1T5IA 2VP0A 2WJHA 3M1IA 1N6NA 2BM0A 3N2IA 4MGZR 5L8VA 1OYWA 4XTRA 2WWHA 3B1YA 1Q1BA 4EAQA 2OHFA 2WWWA 5JECA 4MGYR 1LB1B 1NVVQ 5DI3A 3TSWA 1KO8A 3UG7A 1XEXB 3HYRA 3OHMA 4RZ2A 2V55B 3T06B 1VYTA 3ZD7A 5FUYA 1V5WA 1XXHE 2WMOB 2IEZA 4DSOA 5JMTA 2L0XA 2Z43A 1RE0A 3L82B 3EA5A 2XB4A 4L15A 2RCNA 2YHSA 1WBBA 1EFCA 1FQKA 5FBVB 1MABA 4KVGA 4QKQA 2FOLA 4BLTA 3KZ1E 1MO4A 3MWYW 1KK3A 3BD9A 1G18A 4G5GA 1QHGA 2JDIA 4WVFA 5FPYA 1MKYA 2H18A 4QL3A 1OH6A 2OLKA 3GMTA 1JJ7A 2FEOA 2ZETA 4ZKDA 3DOEA 2W6IA 1TQDA 1D9XA 2IXEA 3UMRA 3X1DA 4EDHA 1OFTA 3PUXA 3X1XA 1E2IA 1HT2E 1T4GA 1AS0A 1P61B 4BLRA 1E2FA 4K8OA 5EUMA 4D25A 3BRWD 2EFHB 1QHIA 3SYNA 1YZNA 5GJVC 2WMNB 3L0SA 1JPJA 2Q3FA 5TVKA 3Q5EA 3HU2A 2QGZA 3A37A 1KSHA 1HTWA 1II9A 1KOFA 2ZPTX 3ZGXA 1V43A 2OLJA 2QT0A 3GEHA 4BZPA 3CPHA 3CX8A 2AX4A 2HUPA 4KBGA 1X3SA 4QNRA 2DFLA 1VIAA 3PITA 4HB4A 3BOSA 3LX8A 4C7OB 1S8FA 4TL9A 4JKIA 1ZP6A 1M1YE 1AKEA 3B13B 3ZDQA 4BLSA 5DHAA 4TQAA 2DWPA 2GCNA 2ZROA 1IJFA 5L3SA 3M4YA 2JDID 3RRMA 2VTKA 4IDPA 2LCFA 2WAXA 4LGMA 4HSEA 2W6ID 4ERNA 3UMFA 2XZOA 4I1OA 1OXUA 4LBVA 4UQOA 3RRZA 2WJYA 5DH9A 1R8SA 1P2VA 5JRZA 1DE0A 3DZ8A 3LXRA 4JLMA 2WWFA 4RKEA 1D8TA 3CR7A 2ZVQX 1GOTA 2WJJA 2QMUA 5B2ZA 4AI6A 3TVDA 1Q0UA 4LCBA 3VU9B 5L3VA 1AA9A 5BYKA 1XD2A 1KI6B 4JVLA 5CK5A 3OEHD 3H86A 2G9NA 1JBKA 1U9IA 2V4ZA 2EU8A 4A36A 4B48A 3W3ZB 4RZXA 4DCTA 3CX7A 3QE0A 4URXR 4MGIR 1RYHA 1U8YA 2CNWA 1ZMXA 4OQNA 1MV5A 2DFTA 4AIIA 1G7TA 1GP2A 1N2CE 1RRFA 2EWWA 4LHWA 1KI1A 3A1WA 4GBMA 1P9WA 2BMFA 2JLZA 4RSGA 1DBSA 2GK7A 4W9MC 3L2OB 1QRAA 1R7RA 1TF7A 1U90A 2FFBA 3IO3A 5HPYB 2NTYC 3TUZC 3WRYC 2GRJA 1L7VC 4A2PA 4QM6A 2O8BA 2GHIA 4B76A 1P2SA 4AYXA 3E1SA 3B82A 3RS5A 3RNLA 3UMSA 4JVNA 1VG0B 2FPMA 2EFGA 3GLHB 4PC1A 2ZANA 3B1VA 5AWFC 4RKFA 1ESNA 1KJYA 3T1TA 2WOOA 3T34A 5GJWC 1E96A 5CB6A 3RRNA 1KIMA 1ZJ6A 5GVSA 2WWIA 4ACAA 5K8TA 1YZQA 2AWNA 2C96A 1WA5A 3D7MA 2CDNA 3LFUA 4W7SA 1BOFA 3RYTC 1W44A 4U02A 1DAFA 3C5CA 3QVVA 1DTSA 3K0CA 2ZVPX 3AVWA 3VKWA 1CR1A 1GRRA 3BB3A 1KZ7B 3KFVA 4Q9LA 2CNWD 2ZRNA 4B6EA 3OIWA 3LBIA 1NN5A 1TMKA 3AUYA 3J81k 4GSYA 1HT1E 1NVXQ 3B6EA 4G01B 2C78A 5EE0A 3K70B 2ZS9A 4BFSA 2CCGA 1LVGA 1XTIA 2GBLA 2ATXA 4AK9A 2B7CA 3QIAA 2JLYA 4AKHA 2BCGY 3CNNA 4BUJA 1IQPA 1NI3A 4JS0A 4DWJA 2GCPA 4GI7A 1DARA 3GLGA 2WWYA 4EJSB 4I81A 2YWGA 3AVTA 3FB4A 3CB4A 1CP2A 1JPNA 3BWDD 1IN6A 2AFIE 3TAHA 1RIFA 1S3SA 4ARZB 2DB3A 3SBDA 2QRNA 2D7DA 3BFXA 4NMMA 3C14C 1DOAA 1XCPA 5JEDA 2IUSA 1Q3HA 2W2VA 3REFA 2ZRPA 5DNYB 2DBYA 5CJ2A 1KDRA 4Y0VA 421PA 2RH5A 4BFUA 4X8OA 2ORVA 1EX7A 4PPGA 1U9IC 3CBQA 3LV8A 4OK5A 4XWAA 4FXPA 2X2EA 2BHRA 2RGDA 2VPPA 1HQYE 2MSEB 3AVXA 1SVIA 2ERXA 5IHPA 2PZGA 3K1JA 3PEVA 4MUAA 2QPTA 1U0HC 3W5IA 5AJVB 1DG3A 1KO7A 1OB2A 2XX3A 3K09A 3V4RA 1G6OA 2CHGA 2QQEA 3ZYCA 2O0HA 3P27A 2KB0A 1ZM4A 2QSZA 4JBYA 1F2TA 4D81A 2GJKA 3EWAA 3T5DA 4V0OA 4E07A 1OKKA 3LD9A 1LS1A 4Q9JA 3BFKA 4NYJR 2A3RA 4HYYA 1TQ2A 4XVQA 1I2DA 1EFTA 3RRYA 2B6HA 1Z28A 3A6PC 1KHTA 4UNQA 3EPLA 2R9VA 1CR4A 4EQ6B 4RVCA 3BAFA 3WNDA 2WKRA 3UWKA 2NOAA 4MGKR 3UXMA 3K0CC 2GJ8A 3AV0B 4P0TA 1A2BA 1AS2A 1W46A 4DLRA 1BO6A 3HU1A 1XWIA 3B5JA 2W0SA 1OH5A 3DKPA 3SJZA 1UAAA 1N5LA 4GP6A 1OH7A 2ORIA 3GLGE 1BMFD 1NN3A 1ZM7A 1UKZA 4PO9A 4C0QC 4QG7A 4IDHA 5KNDA 2ZAOA 4YMVA 4RD1A 2KE5A 4IXNA 2GBLC 2N46A 1NSFA 4Q21A 5TARA 3FKSA 1G5TA 3I8XA 2R6GA 5C2JB 3HU3A 4B6FA 4GOKA 2ZM5A 2ZRGA 2QM8A 2AWOA 2FN4A 1NG1A 1W2HA 3LY5A 3WRXC 4D80A 2HF8A 3QKTA 5JHHB 2PCJA 4KCGA 3C16C 3FMOB 2O0JA 4IHQA 2CL7X 2CK3A 3I8SA 3TW8B 4OQXA 2HEIA 1F48A 2QMHA 2WVJA 4DSUA 5BWMA 1JEDA 4WBSA 1KY2A 3GJ3A 2AKYA 2CVHA 3E5HA 1WBDA 2RHMA 3PENA 1Z0AA 3QF4A 3CNLA 2IYXA 1KMQA 3GFTA 4US0R 2WKQA 1P2UA 4FD2A 4V0MA 5KPDA 1MH1A 4JLKA 2ZJAA 1VMAA 2WICA 2FDCA 4GOJA 4OQFA 5E3HA 1Z29A 3Q85A 2V8OA 2O8EB 4V02A 4Q4JA 2HXSA 121PA 4PR0A 3RLFA 3K09C 3U4QA 2ZYWX 3B78A 1E2HA 3FKSD 3I92A 3K0FB 4DKXA 1FTNA 1MO3A 2IYUA 4CDGA 3THYB 1G4AE 2CJWB 5CLQA 3ZQJA 3H2YA 3MWJA 1L8QA 3KUDA 5SZJA 3TSZA 3LDAA 4D4KA 1EK0A 5FBQB 4DSNA 4DCUA 2QA5A 3RABA 1RC8A 1YZGA 2CK3D 4LYHA 1NL3A 4WXRA 2V54A 2CXXA 3M6AA 1ODFA 3CWZA 3L0PA 1NG9A 4A0HA 1K6MA 1NVWQ 3U2QA 1GG2A 2QM7A 4WAUA 5P21A 3W6OA 2F9LA 1KJWA 1IXZA 3T5GA 2GVDC 2J59A 3TBKA 2A5GA 4CT5A 4JL8A 2IC5A 2UZ3A 3BB1A 3DHWC 1N5KA 1O87A 2LKCA 3IO5A 2GETA 1Z2AA 3LH5A 3K9NA 3QXHA 1U0JA 2OG2A 4B32A 3ASZA 1UEIA 1U99A 1UJ2A 3JZMA 2VA8A 4PHTA 2OCPA 4MKHA 3TVTA 2IUUA 4HAXA 1FUKA 4XOIA 2VIIA 2X2FA 4A0RA 3QF7A 1PLJA 3LXXA 5ELXA 2QQ0A 3F5FA 3K0SA 3HPQA 3EPKA 3RC8A 1OFUX 4EPTA 4KAXA 4HB0A 4ZV4A 1ZU4A 5ANRB 4EPVA 4G0NA 4JMPA 2QAJA 1DVRA 2OILA 1MRSA 4L9WA 4Q9KA 3IKJA 1FP7A 2AXNA 2CMKA 4BGDA 1R5BA 1GIAA 5FH9A 4F93B 4DB4A 1MO5A 2ONJA 1DADA 4LRWA 3KJHA 2J0VA 5C1BA 4NPHA 4AG6A 3AH8A 3AP3A 4PZYA 4XSGA 2XSZA 4MRRA 5AUPB 3TE6A 2XNDA 3TK1A 3WMFA 3SQWA 1E0AA 3F0TA 1XPRA 1DS6A 2A30A 2IK8A 4LDJA 4LY6A 4N3NA 4MRSA 1N5IA 4IEEA 4JKYA 1J2JA 4JLDA 5EXXA 2IYTA 4FINA 1TU4A 2R65A 1R0YA 1KYIA 2QPAA 1EGAA 4QOSA 3IILA 2OAQ1 4DDVA 2HV8A 4AD8A 4OK6A 2C9OA 3JVVA 2C9YA 4Q48A 2XJ9A 1BYIA 3ONWA 2H7VA 3IPXA 4A8JB 2A5JA 3T12A 2PZEA 2IWHA 1XXHB 4ZI3A 4HI0E 1QHNA 5LB4A 4TZ0A 2YOFA 1P60A 1NIJA 5A4JA 3SHWA 2GTPA 1VIYA 3LAWA 3TJZA 1KI9A 1ZNWA 1ZNZA 2FH5B 2QT1A 2Y8EA 3EWSA 2RGEA 4IOJA 3TRFA 2ODNA 2XSZD 3QVUA 3FFAA 1D9ZA 2IF0A 1HE8B 5FOVA 2ZJOA 1IN7A 2A2ZA 1R2QA 2QP3A 1W48A 2BM1A 4DIEA 3PUVA 4LBZA 3LWNA 3H1TA 2CLCX 4PC3A 4ZO4A 4G5RA 1M74A 2QAGA 3L0OA 2WJGA 3T15A 4BECA 4WIAA 5BW8A 3SC3A 4DCVA 1COWD 5KHOC 1HUQA 4A4DA 2ZAMA 4FIDA 1OIVA 1KK0A 3PUYA 3VTKA 3FMPB 4MDEA 4XVUA 1T3SA 3QI2A 2JAQA 4C0HA 4DJTA 5HCIA 3OESA 3PR1A 4Z54A 1ZIOA 2EYUA 4HLUA 2O8FB 5JLJA 4FWIB 1W4BA 4BFXA 1R5NA 3SJAA 2ZQ5A 1WQ1R 4JLVA 5G40A 3SOPA 3UATA 5EE5B 3RS4A 4LWZA 1ZUNB 2CE2X 3OAAA 2J41A 5JWHA 3GLFA 2OCBA 4GDFA 2DY1A 1IAQA 4Q4LA 2GXAA 3K8YA 1UF9A 1OW3B 4LSGA 1JAIA 1RW4A 2GCOA 2ZR7A 2ZE5A 3IHLA 3JZAA 4DCNA 1CXZA 4AYWA 521PA 1PUJA 1U8AA 2IYSA 4IEIA 1KJZA 4KFSA 2JLWA 1E9FA 4M22A 4ZDJA 3I62A 1VCIA 5FOUA 1X8JA 4U5XA 1IY1A 3FYHA 1HQCA 2NPIA 1II0A
chains in the Genus database with same CATH superfamily
3KKQA 4RE6A 4TTVA 3KLOA 2JH8A 3AG5A 3ESDA 1QGAA 1MTOA 1Q95A 1DZ3A 1U3WA 1XALA 2YOGA 4OQEA 2EV9A 3DONA 2JGFA 4QODA 4L16A 1ABFA 2AI3A 1GZ4A 2BFMA 2OR3A 3JRXA 2DPLA 1FDOA 2GKSA 2JFNA 2BM8A 3C7KA 3IBCA 1LRJA 1DFGA 3CH5A 1XZQA 1RQNA 4OKIA 3ZN2A 1XVAA 5EHQA 4NFHA 3VOBA 4DQLA 1WW2A 3VDQA 1SQGA 3U5TA 1GTRA 2LW7A 4Y6OA 1PR9A 1X7HA 4H35A 4G67A 4J9VA 4PRYA 4B3DA 4JYMA 4FN5A 1B7GO 2I6FA 1LPAB 3L6DA 5DYYA 3EEFA 4FKMA 3FLEA 3UK0A 3GNLA 1TLLA 1J06A 1QLJA 4P3YA 3NI2A 1E2EA 2VZLA 2ONCA 1CTQA 1ZD5A 2VC2B 4II2A 5D1HA 3N07A 5IC6A 5JLAA 1M75A 4DZRA 4NEQA 4WUVA 5DBHX 5JJ5A 2OGTA 4L5IA 2WQ6A 3AHFA 1KZGB 2NV0A 3B1XA 3GJ4A 4YECA 5FWXB 4DV5B 4MI1A 2I4OA 4PZ9A 1MUUA 2DETA 2GBPA 3VR5H 4YONB 5GV7A 3G2KA 1E3EA 1YHYA 1HK7A 1WOMA 2MMGA 3QEJA 4BTEA 4E4YA 4EL5A 1B76A 2WU8A 5CCXA 2Z57A 2ZIXB 4YWHA 1TCAA 2Y1GA 3S2FA 1X1BA 4NKRA 2FX2A 3JY6A 5CTAA 4NCJA 1D1TA 1YAHA 2DSTA 3A58B 1IWPB 3BC1A 3MB5A 4H4EA 4YV1A 1XBTA 3NIFB 3LK6A 3ZGYA 3H1EA 5JATA 3A6GA 1QIHA 4DT1B 1TLFA 2H1IA 2V4UA 4B7ZA 3RQSA 2CFOA 5F3WB 1F8GA 1ZC3A 1CQWA 2QDXA 3A4NA 5EPEA 2UVPA 1DX6A 5C8YA 1L8XA 1YI0A 4PC2A 2CB0A 5EXTA 4BQOA 1BKDR 3AI2A 5KTPA 1MVLA 3ZGNA 1Z25A 2HFJA 1H2WA 2FPPB 2MR5A 1SD2A 1VMEA 3MT8A 5KX5F 4AURA 3AC0A 1V47A 4HQ0A 1I3OA 2ZJYA 3BXHA 1A9SA 2GF0A 5F5LA 4ZXPA 3U3KA 1R00A 2J0UB 3EEQA 3ELWA 2IL1A 3G1TA 4MLPA 1VL8A 1KDTA 1H8EA 1RI3A 1ODCA 1G41A 2E37A 4P36A 2G25A 4YT8A 4BGUA 2FN9A 2I3GA 4X85A 3KTAA 4CR8A 4PNEA 4HDOB 1RPAA 5FR2A 4BFTA 2BSQA 3OE7D 3THRA 2VP5A 4HEJA 3GRCA 4GXRA 4MPRA 4U9UA 1L5ZA 4P3NA 5AXDA 4GKBA 3SXUB 1WVIA 1QNFA 1K9SA 1MTZA 2A5YB 3P2KA 3KNZA 3DTVD 2WZCA 1JEOA 2CBXA 4Q03A 3EAFA 5K0SA 3NHMA 4OFXA 4LOLA 4C0JA 5FNZA 5CLIA 4KAFA 1FPQA 4Q39A 2N1MA 1RKVA 1JYFA 3KWLA 3L92A 4DIKA 3PEUA 2DYKA 3NUQA 4ZCLA 3QUSA 5KYWB 4QDJA 1UKEA 1Z38A 2VJDA 3ZDXB 4IM7A 3WP0A 3A28A 2P2CA 5LA6B 2UYQA 1C81A 2Q41A 2UUBB 1A7UA 1V3VA 2AOTA 5EMLA 4UUPA 5EZ5A 3M9LA 2HWKA 5GPBA 3A36A 2CFCA 2WINI 4ZWNA 5IJXA 3DFIA 3ENZA 4GP7A 4AF8A 1GR0A 1OZGA 2AJDA 4D3ZA 5BMOA 3BWMA 2D59A 2IYAA 3HCRA 4QDXA 3CMMA 3D3QA 3GGDA 3LPNA 3PUHA 3R0XA 4TLLB 1LLDA 1JT2A 3BCRA 5AMXA 1ZW6A 5F3RA 1K7XB 1JU3A 1XRJA 2OBXA 4IS3A 1QDEA 4M8SA 4ZYYA 2CUNA 3HCOA 3OEED 2Y2UA 1MOSA 2OGUA 3NC0C 3BZBA 2H4HA 1MDFA 3VMFA 4DVGA 3GPDG 3QIVA 1ZEMA 1R4ZA 4NABA 3TZQA 1II8A 3D1LA 3BSSA 4HXYA 3SGLA 4I1YA 5KVCA 3UMVA 4YJHB 1SC1A 2HHLA 4XDHA 3D0OA 4CDMA 3AQ4A 2P67A 1W5TA 3PBKA 4TLEA 3UK6A 1MGPA 1GGJA 2JFXA 4IIUA 3C3KA 1T0JB 3CVWA 2QKYA 16PKA 3ZX4A 1SVKA 2I7DA 1IONA 1AQJA 5EHNA 1GPUA 1PJ4A 4WERA 2C97A 1M7BA 1G66A 3HBJA 2VHEA 1U7DA 2ZYUX 1NYRA 1L1RA 1MIOA 4IDBA 5D6NA 4BNNA 2FW1A 4Z8XA 1G7RA 1CRPA 4AMZA 2GZRA 2CSUA 2I1VB 3KJIA 3FWZA 3VO2A 3ZVNA 3E2MA 1E9AA 2O57A 3ROGA 3WLSA 1VPDA 1DEXA 1X6VA 3ZEIA 2PXXA 3NDRA 3W8RA 4AN0A 2VBCA 2FSIA 2PJUA 1V4NA 4X00A 2O1EA 1YU6A 1KAOA 3HJNA 4UXIA 5DTEA 5KSYA 3DMGA 1AH2A 4YLYA 2KQUA 3HDYA 4NH4A 4RPHA 2Z8YA 2XVZA 1FRVA 1CE8A 5F9HA 2FPXA 1FU8A 1X7WB 3HBNA 4KLRA 3RYIB 3OEHA 3OZFA 2VDNB 2ZRJA 3KM0A 4IQ0A 2Z6UA 4KHZA 4OX9Y 1CQIB 2EZUA 4B85A 1YS9A 2RHJA 3HCWA 1U3DA 5J5CA 3OX4A 4M86A 3EDRA 2ONKA 1GVNB 4A82A 2P9YA 3QW2A 2E6KA 4R1LA 3TMAA 2GZMA 2O23A 2WF8A 5JS8A 4Q6WA 1O3YA 1AU9A 4HRAA 4UEQA 3DMFA 1ORIA 1VLJA 3IV9A 2P4SA 1VKHA 3CIOA 4WFJA 7MDHA 4JLOA 1RPNA 2BP7B 1E64A 5G4KB 4EHDA 4E6PA 3AHHA 1YZUA 4MITA 1LJ8A 3KWJA 5B4TA 1A1VA 4I6JA 2BMDA 2YHUA 8ATCA 1FMLA 4JBXA 3DHYA 4L85A 4CV3A 1YULA 4RH3A 4ZJUA 4EYEA 3OUTA 3PIDA 3R3YA 3WWDA 2X86A 1Z4IA 5COQA 3K5HA 3EDCA 5EZQA 3HUEA 3ON5A 4GR5A 4QXAA 1SNYA 1F2TB 3CZ4A 4UM9D 1E4OA 2FW8A 3SC4A 2WWXA 3UAGA 2HJ9A 3MJTA 2AD1A 3GJ0A 1N5DA 3QBEA 5WRFA 3LQRA 1GL7A 4E0BA 4EBBA 1GM5A 2BWJA 3MLBA 3Q4GA 1P4GA 4NFSA 5BRNA 4MW9A 4EGSA 1P1BA 4MV9A 4HS9A 4MSUA 3HVKA 4KQXA 2VF8A 5JJCA 5KOHA 3QU5A 3BEOA 4M0KA 3AL3A 3SE7A 3W9YA 2VYVD 1JHZA 1VKZA 4ZYWA 1MJ5A 4R8LA 2V9PA 2DFVA 5CHEA 1WZCA 4FDVA 1LTQA 1P7CA 5E1OA 2IZ7A 5AJZA 3RFUA 2RGBA 3BGOS 1XAGA 4XWKA 2YJNA 2H5EA 3W5UA 2O8CB 3E2IA 1JTFA 1RM4A 2I7VA 1Y34E 3ZE2B 3WOHA 5C7LO 1WQ3A 2AJLI 4CEHA 3OX1A 1RRKA 4MYSA 1OJLA 2RGXA 4UBOA 1ZOOA 4NPAA 4OLJA 1UKVY 4D0RA 1FJ2A 1EUCB 2KWIA 4OBBA 4UNRA 2BONA 3LXMA 2OFXA 3SJCA 3CO0S 1HR0B 2Q4EA 3KB8A 3CZCA 3TPCA 2QTVB 3ZQ4A 2REBA 4DYDA 4DYHA 1H3EA 3OWXA 1Z74A 1KYYA 2QGNA 3QG1A 2I6XA 1RWQA 3DBHA 4KV7A 4RDXA 3UT0A 2IUFA 3QMWA 5D51S 2YTZA 1NI5A 3T1QA 2YVAA 1BVRA 1LF5A 3ZHOA 1FBNA 1L4HA 7AT1A 2YFQA 3ZDYB 4OHYA 3Q5DA 3LDUA 1UK8A 2A33A 4MQBA 3A0UA 2OT3B 1XTQA 3Q6NA 4NPCA 2PHZA 3UMJA 2YV3A 2I7XA 3K6JA 3GU3A 5KWSA 2HPZA 4DZTA 4ER6A 4Q93A 1KP2A 2QR5A 3FDIA 3QE2A 2FLKA 4BLPA 1QP7A 2E55A 1GZ3A 1XRPA 3DA8A 1FX1A 1VYVA 2YWJA 4FOTA 4BO5A 1B1AA 3VHXA 1I51A 2OGSA 4GEGA 4EM6A 1B0PA 2OKGA 3BXGA 2KM1A 4PRZA 4RD2A 2DWQA 2JL1A 3AFHA 3HXQA 4TKVA 4D8YA 1XAJA 2GPJA 2NO0A 1Z0SA 2X77A 3DXXA 3ZG6A 4EG5A 4GMFA 3N2NA 3ZJUA 3VX3A 3TW4A 5BRAA 1ISSA 1KSGA 2PX3A 3NVKI 1E2GA 4QU8A 1J8VA 1VBNA 2BGGA 1Q12A 5M04A 4HB3A 4YJ3A 4HWOA 3V34A 1C3OA 4CG3A 4PPFA 1CETA 4J4BA 4R83A 5HA5A 1E4EB 2W2NA 1SXHA 3CZMA 3ENQA 3PNLA 1ENPA 2QB5A 4GPBA 5K3BA 4IINA 1VPTA 2D4HA 4RMHA 2XXBA 4RO0A 5H02A 1OYOA 3R9KA 1LRKA 2FE4A 2N42A 1WAMA 2EEPA 3DP9A 4OY3A 3ZOZA 1VCNA 2EFYA 1N2XA 3EXHA 1YCGA 5DI9A 4BRUA 2X0DA 1HYQA 5GM1A 3LCVB 1GDDA 5AH0A 2HR1A 3AYXB 1ULZA 4EB3A 1XWFA 1D2HA 4QHYA 2DUWA 3CTPA 3KB2A 1E61A 1ILWA 3HKBA 1A4UA 3DZDA 5ADWA 4CMGA 2WVHA 4C0BA 4PZEA 1OQAA 4D74A 4NTZA 3RAJA 5DRTA 1YHZA 3HXOA 2GPNA 1CJMA 5T8KA 2W37A 4F9FA 1GQRA 2IYQA 1N1EA 3U1VA 2YYAA 1JR2A 1WZEA 1L4LA 2WI8A 5ALJA 1BJRE 2E85A 1TEXA 4O1HA 4DSAA 3GEIA 2QXYA 1GZSA 2AF4C 1KBOA 2W4QA 4C7OA 1U2TA 1F9AA 3PLNA 4FFWA 4JOSA 4R98A 5AJTA 5I7FA 5SZKB 3I04M 3AKEA 2FKNA 3UOAB 4HDCA 3KBBA 1UPTA 1I3MA 2UAGA 3FGOA 2F3QA 2Q2NA 3L6BA 4X0EA 5E2IA 2G0TA 1FUUA 4FE7A 4GXTA 3VI4B 1QYWA 2I8AA 2PNJA 5BSMA 1UAGA 4N6OA 1ZRHA 1SXJC 3GPBA 2NSLA 1Z7YA 1E9SA 4WD3A 1ML3A 5MFZA 4YAUA 1L5HA 1C80A 3OQ1A 1BE1A 4J75A 3SOZA 4YPOA 1UZNA 3HJUA 5AHOA 3RSHA 1YRAA 4CQMD 1FLDA 1YZLA 1UDXA 2ZI4A 1CUIA 1G1AA 1AZTA 1IYZA 1F6BA 1GV1A 1IEXA 2A9FA 3G6WA 5FRDA 5I8ZA 5BSHA 3ZE9A 4J7AA 4E14A 3H7IA 2I2AA 4GMXA 5EIBD 1FTYA 1U9YA 1OBOA 1XKLA 1N5OX 3AUJB 5JH7F 4FDAA 3PYXA 4R1QA 1SBNE 2QXUA 4ISBA 3FKQA 1KI6A 2OCXA 3X44A 3DXFA 1EDBA 4G1CA 3AKZA 3BWCA 4JB0A 3HDTA 1IMJA 4YV2A 4QLAA 1L6RA 1GA1A 3WLQA 4MW7A 4NAHA 4NESA 4C7KA 3KDAA 2I4LA 4X7PA 3GP3A 4ZAYA 3NAQA 5AVKA 1L7QA 1FU7A 1OYVA 2JFVA 2QTCA 1OXSC 3OFND 1XT6A 3ROZA 3AFOA 3EX7C 4CRWB 1H6CA 1U7UA 3RYHB 3A4YA 4K03A 4TV8F 3TCNA 4CLRA 1UFVA 4OGWA 1P81A 2BMAA 3TR5A 1E92A 3TR0A 3PG5A 3AUFA 2OZKA 5BR7A 2VTDA 1QX3A 4EHJA 1UJBA 2H29A 4JQZA 4TMTA 2IXAA 1A69A 2YV5A 3ERCA 1N8SA 1VE1A 1XWWA 3H5AA 5B7NA 2WE8A 2XOKD 1C1XA 3WKBA 5C18A 1ULBA 2R62A 3KJEA 3VR2A 1YRBA 2WP0A 1A5ZA 2COKA 1XZNA 4DY6A 4O8CA 1NU8A 2QG9A 4AZ3A 3B6ZA 3SKVA 2QE6A 5GIPE 4MVJI 3U4HA 4YGXB 1LDBA 3GLHA 2AN5A 1M2VA 1U0SY 1QTNA 1X87A 3KVYA 1RWMA 4HLCA 1D7OA 1P74A 3O31A 4R4JA 3STWA 1TFRA 1KEPA 5AI5A 4UZEA 2QP9X 2Z5VA 5HKBA 5BR8B 2Y0BA 4K2HA 5EJ2A 1RAFA 3AEKB 3E82A 3BGIA 1PFVA 2J48A 1FFXA 2DHQA 2I55A 1TYCA 3SJBA 4LFBB 1KI2A 2J6CA 4YB8A 4M89A 3VPFA 4BO0A 3O8RA 2Q1UA 2YUTA 3II6X 3IQZA 4A5OA 5LQRA 4OX9B 1H93A 2XI4A 4FJ1A 5B57C 1Q5PA 2XMPA 3AEZA 1OX4A 3UJAA 3WB1A 2OV4A 3GFRA 1E94E 1K86A 4RD6A 5CLLA 2V0CA 4LYAA 1OVMA 2X5XA 2PUJA 4QEKA 1DUSA 3GDHA 5J3JA 2OCIA 1TCCA 5FEUA 1AHNA 1R8JA 2XRMA 2X8JA 3Q2IA 4O4IF 3BQMB 3HNRA 2H3EA 5ER9A 1TQHA 3U31A 5JVDF 5LNK6 1N77A 3FVWA 5I45A 2NP7A 3FBWA 3DGEC 3GGSA 3CVVA 3CQ9A 2RAPA 3MBIA 3VFDA 1C8VB 1L8OA 3QPWA 1BZYA 5IHXA 3DYBA 3Q1KA 3FUXA 1JB9A 1DHTA 1IB6A 1Z34A 4HS4A 4OL9A 4V2IA 4CM3A 4V0SA 4BP8A 1D4ZA 1VTKA 3BXOA 3T9FA 1W36D 4OQMA 1Z16A 1BH6A 3EPHA 3TNDA 5KKNB 3QU9A 2CE7A 5DM0A 3S2ZA 3OFSA 4QOGA 3GVXA 5J2UA 3GEMA 2A86A 5BV1A 4AB1A 4F4JA 4TYNA 1ZGBA 4IFIA 4B80A 3ZD6A 4PBTA 3ZJYA 1CY4A 1PUIA 2YIJA 1QJ4A 3NX4A 2KI5A 3B36A 5KVVA 2Q9UA 3CT4A 1RMQA 1J0XO 2VDQB 2HAEA 3EZNA 3VSDA 5DWQA 4D0LB 3OBIA 3ZV7A 4S35A 3PFIA 1T2FA 4V38A 3NM6B 1VYUA 3IERA 1S1MA 2Y9MB 4QU0A 4UJ5A 5E6UA 3IIKA 3M2PA 4RHUA 3DPIA 5JBIA 2DX7A 4IFBA 1LQUA 4EFKA 1KSJA 1G6Q1 4WLOA 1C2TA 1R6BX 4EDFA 1KS2A 3L9WA 1UINA 2EIHA 4EUEA 2ASEA 4YUYA 1PG2A 3WNVA 4BAUA 2JVIA 1UDAA 5EMNA 4DR1B 1C50A 2BKVA 4EY5A 2CL6X 5SYNA 4ZK2A 4CCAA 4H7JA 1KDPA 3OWHA 1EXVA 2JFQA 2PY6A 1DSSG 1FDWA 1O58A 4KPUB 1SCDA 2O4CA 4WK4B 5CM8B 1AKTA 4HQFA 2HHCA 1Z8FA 2W6PA 4U6QA 1E6EA 2HWWA 3FDFA 3KVNA 4WW0A 2JLRA 3I2KA 2QRUA 3VNBA 1XVVA 2JGNA 3ADPA 1XZHA 5SZIA 5B2FA 2YYZA 3B9RA 3TOSA 4AZ0A 4QTXA 1FNNA 4PRLA 2PRJA 1LQTA 4MW6A 1NAHA 3NTLA 4N9WA 4Y30A 4HNVA 4LZZA 4GAEA 2FMTA 1VECA 1Z39A 1E3SA 2FR1A 3SLKA 4O4HB 1T0UA 2EVWX 3BGWA 3BZUA 3P9YA 3WO0A 1F0KA 1H2XA 1KKLA 4JD5A 5HDQA 5TX7A 3VU3A 5LKAA 4AUNA 1FXSA 1JDJA 1L4UA 2R6DA 3ZX5A 4ZOQI 5J59A 2NPFA 3RD5A 3NOQA 3I1YA 3WI7A 3K70C 3EGVA 2XYQA 2BEUB 2HO4A 2JFBA 3TCKA 2FRDC 1XD9A 1I32A 2ECKA 3L40A 4OLFA 3C7CB 4NXNB 3KAKA 1OV4A 4LY9A 4Z51A 2YXNA 2CVQA 2VHJA 4RJIA 3QE9Y 4IOMA 4MVXA 3O1IC 2WM9B 1B3BA 3G0CA 2AFRA 3LQFA 1GFIA 1Q0PA 3HRKA 2AIRA 4A3SA 2IYRA 4EBFA 5DK6A 4TLBA 2P2LA 4UM7A 4ZQGA 1PVVA 3TNFA 3MYYA 4BDTA 4D9GA 2WA1A 4BVBA 2AN3A 2ZUUA 5EIFA 3DDNA 2ZREA 4OHOA 3X2EA 3ZXYA 3ER9A 2GK4A 4KQ1A 3WK6A 3WZ2A 4HQKA 3V8RA 1CEEA 4FMCF 2Y1CA 4C4PA 4QXPA 4YYEA 1P1HA 2OV8A 1M2EA 1NAIA 4BWFB 1ANKA 3ODPA 4IXTA 4LF6B 1I33A 1XEWX 3GEDA 4Q0MA 5J4VA 2FR8C 5CDFE 3PQ6A 5HZHA 4Y2QA 4K7JA 2FZ4A 2GHQA 1E66A 1IQ0A 3OJ0A 4BWGA 3B9BA 2JGIA 2GYVA 4KQFA 2Z04A 5HQTA 3AIOA 2X4LA 3RS7A 1YHNA 1JX6A 1VHLA 4JT2A 4Y0AA 5AW2A 3EGIA 4UHFA 3C87A 1DC3A 2HTFA 4EO9A 2EGUA 3F5QA 1XP5A 3IBSA 3Q10A 3RT1A 5IWCA 3PDCA 5LDDC 1ODTC 2Y76A 2DBZA 2YR0A 3C6BA 5K8CA 2D2VA 1N0HA 1TE2A 3KX2A 3MWLA 721PA 3THYA 1KI7A 5FTJA 4G0VA 4O3MA 5DV9A 4H6PA 3RNOA 4OLAA 3CLVA 1M1YB 4B6JA 1XCBA 4TMKA 2K5UA 1XOIA 4BNIA 2A78A 1J6UA 1GA4A 4HC4A 4U8GA 1VYHA 3WB0A 1BWSA 1K63A 1XF9A 2XUOA 1FC0A 4I5DA 2OA0A 4O4JF 3AZOA 4KQKA 3PZBA 4ZQHA 4Q24A 1XMOB 4YRQA 1LPMA 5L4NA 2FWBA 1MU0A 3VR6D 2FTKE 3H5TA 3MILA 4NU0A 3IVGA 1DJNA 5F21A 1M2KA 3EIOA 4GI3A 1IJKA 3WYCA 2FP4B 1S0UA 3FSGD 3JYOA 3AFIA 1L4KA 4MYDA 2EC5A 2G3YA 5ARDA 4B73A 3E9CA 4LY3A 1I5OA 4OKNA 1UKYA 4RULA 2XA1A 3A1SA 3BRSA 2O54A 4J91A 1U81A 5BOSA 1E1MA 5TRTA 3RSZA 4R2MA 5JS7A 1NNEA 4I5IA 1EQUA 2ZJ6A 1LU9A 3K5WA 4YJGB 5L7TA 1LX6A 1DAPA 4UTZA 2VJOA 5KJFA 5JT1A 1D4AA 1EFRD 4YUAA 1KC1A 3HXKA 4J1TA 1AUOA 2OCLA 2R1TB 1ISHA 4YXWA 2PSHA 4TYPA 2V65A 3L8GA 4I8XA 1NP6A 3TS1A 3I1IA 1QPZA 1Z8HA 2VAVA 3OVMA 4G5SA 2O0LA 2DQSA 1VLVA 2J4CA 4YACA 2O3SA 1LFDB 1N2CB 1QH0A 5EIOA 1Y9JA 1E9VA 3ORYA 4LK3A 4DDTA 4HY3A 4ZTBA 3GG2A 1TEVA 5E4FA 1JT9A 4EYKA 1YR3A 4TOIA 5T3YA 2J1LA 3HRIA 3DVSX 4D44A 5GP1A 1HE3A 1A5TA 3WWOA 5AFSA 4BJ6A 4ENPA 4NBRA 4OXQA 3ULKA 3WBKA 1XZFA 5F98A 2YOHA 5BN3A 2F9MA 4BEJA 3GRUA 4QOEA 1PJRA 3HCCA 2L42A 3RSLA 2H59A 2RKBA 3EBOA 1E7MA 1JQ5A 2JLUA 4DUZB 5GJBA 4G56A 1RHMA 2IVZA 3ZIAA 2XYVA 1SY7A 2JBHA 3NAZA 4YP5A 5IT0A 4M88A 3S2UA 3HWWA 1RYFA 1XZPA 4RQBA 1G0NA 1G5RA 4Q4AA 5L3SB 3LBHA 3O0DA 4LJSA 1KTIA 3C7TA 4RTJA 1D6MA 1NVFA 2HIAA 2W9XA 3EAGA 1NY5A 3B8HA 3L6RA 4GZ6A 4YXFA 4ZVMA 4CV1A 3L6OO 1E69A 1FOEB 1Z8DA 1AZSC 3CKKA 3VC3A 4NQZA 2EAUA 3SVLA 2HXYA 3B60A 4FN4A 5KYUA 1PFKA 1RCFA 5AW5A 1C30A 5BN5A 5JQWA 2GUWA 4ZO9A 3DDOA 1HSZA 3EGWA 4UD6A 4UDXX 3V2IA 1R66A 1CUWA 3F6PA 2WP8J 2IELA 2QYTA 3FPSA 4BU1A 4L3VA 1T8UA 3D6TB 3OKCA 5EE9A 1NMZA 3FH0A 4LJYA 2PNFA 1J20A 3CZQA 1EVLA 2HU5A 3V1YA 2HV9A 2PBLA 4K6HA 2CF6A 3X2SA 2O6HA 1VLMA 3U5ZB 4RPGA 2RHCA 3BWXA 5F7JA 4N76A 3C3EA 1L7NA 4KYVA 3P26A 3KEOA 2PV7A 4DUGD 4A10A 3K20A 3ZXSA 1H5UA 2ISSD 3FYUB 4GMHA 2FWMX 3VZSA 1G16A 2XE4A 4MVYA 1GL9B 1SO8A 1ODSA 2G17A 2XUPA 4GVPA 4DREA 2FWAA 3PIRA 4G5FA 3HA2A 2YV4A 1J23A 3EODA 5D5HA 3KKOA 1P31A 4N7BA 3DCJA 1F2UB 2DSNA 1TQ6A 4Q1FA 5BUCA 1DPGA 3ZY4A 4JIGA 1FNDA 3CN7A 3DOFA 3FMGA 4WZAB 5E6SA 5FWDA 1XB2A 1UODA 2O6LA 1VE9A 1J1IA 1FLVA 2O07A 5F2EA 4J0QA 3KPJA 3QBTA 1KH1A 4CIXA 3AVYA 1OY1A 2V7QA 1U9ZA 1DO2A 4O0MA 3RI3A 4REMA 1RYMA 4BX2A 1RI1A 3PD0A 2ZTMA 2C0QA 3V4LA 1T2VA 4D3DA 3SU8A 4EGCB 3NFRA 1OE0A 4MA4A 1S9DA 3ITKA 4PWZA 2H11A 1AUXA 2YY7A 3MWFA 4GBED 8MHTA 3UJ8A 1X94A 3ND7A 3NDPA 3AEUB 3WK9A 4MKGA 5H8WA 3D4OA 3Q1LA 1ZGJA 2B83A 1Z5ZA 3ELUA 3DLTA 1AKQA 4KWEA 2CLHB 4XIYA 3TD2A 2ZBPA 4LDQA 1H0SA 1M6YA 1ZI9A 3KTDA 1M76A 4QA9A 4UPVA 3T4UA 4CUZA 4X65B 1ML4A 1NDHA 1XLTC 2QK4A 3PDJA 2PLFA 1FP4A 2XUIA 3DF9A 3ZWAA 3TUJC 1PEAA 1R3UA 1I3CA 3IOYA 3FTQA 4B35A 3R40A 3M81A 1ARZA 3QEKA 4Q3NA 3AKDA 4KXUA 3GNSA 3PLRA 4PCVA 3QK7A 3FLBA 4JLAA 4P86A 1JIKA 4RQUA 4YQYA 5LIPA 4A8JC 3ZZTA 1FA9A 5A4MS 3HH8A 3HEBA 4W1QA 1GAJA 5FF9A 5TJHA 3R24A 3VKUA 4KODA 1Z8NA 1IZYA 1Z4MA 4C5CA 4GIBA 4N39A 1O5OA 1OF1A 3FMVA 1QR2A 4HQNA 3EDQA 4KMMA 4ZOCA 5JTTA 6YASA 3AF6A 1I5EA 1QHSA 1QLWA 2X5OA 3JQGB 1J42A 3C5HA 3NEAA 1P7PA 2HSJA 1H2HA 5AQEA 4UJ3A 3DAFA 4PNPA 3NUGA 4N8SA 4ZOAA 3V3TA 1R8XA 1ZGZA 1J0DA 2R3SA 3BG5A 5F1OA 3ID6C 4RY8A 1GNTA 1ECPA 3PDIB 1BCRA 2PKQP 5IUKC 2JVKA 1OFVA 3O95A 3JAKB 1VIDA 2FPIA 5LP6C 1KU6A 3H5VA 2BTQB 4BO6A 2CNKA 3NV9A 3Q9UA 5JAUA 2POCA 5DTMA 2OY0A 1WSWA 2WKPA 3DE2X 1T1GA 1AXEA 2XMRA 4NR0A 5FYQA 1THGA 2ZR9A 2VO1A 4I9UA 5A4KA 1YGPA 1W0JD 2ZWMA 3EASA 2D74A 4AQDA 1EESA 4N7MA 4TKLA 1Y6FA 2Q1WA 1YVDA 2I4RA 2NV2B 3ONEA 3DC7A 5C3UA 1OR8A 5KHLB 1E3LA 3CUVA 4JX9A 1RZVA 3B70A 2VSOA 3I9V6 1KEUA 1E60A 2P5TB 1KERA 2JI9A 5PNTA 3THXA 1NQVA 3NHUA 2PU7A 1Z6PA 4JXXA 3NW9A 3NXKA 4LWPA 1NLFA 1Z83A 3L49A 5KSPA 4O1MA 1Y1TA 4F8JA 1H1LA 2C00A 1Y37A 4CR7A 1KRXA 2WSLA 3HN2A 3W3AH 4DAOA 1C7IA 3GDFA 2JJMA 1DC4A 2JFZA 2HLHA 2JIZA 4CIBA 3RU7A 1OAKA 3O4IA 3B85A 1SU6A 3EHDA 4YRGA 4CG0A 3VZPA 2G7MC 4ZI7F 5B55A 3K2QA 1E6LA 4X1IB 1G3QA 1ZD1A 2AZMA 2DT5A 3L0IB 4I3HA 5H70A 4BNYA 5KNBD 4YRZA 3E1KA 4E22A 4MZXA 1HH4A 4UBLA 1N6RA 2J3QA 4ARUA 1JHQA 2NTJA 4YTEA 3OQBA 4ESHA 1S7GA 2HK7A 4I6EA 3MA0A 1Z07A 3ZS8A 1JXMA 4TKZA 1CZLA 1E1RA 2XUZA 2VJCA 3MWDB 4JCOA 3ABZA 1UBRS 3PJGA 2JA1A 3HJHA 3TKLA 1LDGA 3OLZA 5FOQA 4M8IA 5LOVF 3EEIA 4NOMA 3E22A 3HY6A 3OPYI 3WLRA 3C7AA 3I04A 4QUGA 4UZSA 1EWVA 1Z08A 3AIIA 4MPJA 5CK4A 1UBEA 3SYRA 5JSUA 3E84A 3H9QA 2NYRA 1HEIA 1XZGA 1MAVA 2CCKA 3HR7A 3LUCA 1YBFA 2VRNA 1COZA 2ID8A 3L7IA 4CKCB 5CX4A 1KVQA 1YQEA 2WHPA 3N8KA 3OY2A 2EJVA 5DM60 1TIPA 4IW3B 4B45A 4L4XA 4HOYA 4MYUA 1N5JA 3QVJA 1MH9A 3ABQB 1V35A 4EG7A 3AM1A 3DE0X 1XVUA 4RY2A 1ZGAA 3D1VA 3Q88A 4FI3F 1YDHA 2GNAA 3AETB 2E87A 5CM9C 3TLEA 3IESA 4KI0A 1PJZA 5D8DA 4OHPA 1SJ9A 2OMKA 4FNGA 3RWMB 1HMPA 2GZSA 3EDOA 1EWYA 3KYIB 3Q6MA 4Z4HA 1I4TD 4RJ2A 1NVMB 2MYPA 4P3KA 1XXLA 4DFDA 1SCBA 1NYTA 2HDNB 2IYYA 1L5MA 1VSTA 3UO8B 3PWTA 1RTKA 4OH1A 2C5SA 5CXSA 1UKBA 3UTCA 1V37A 1U2EA 2L17A 2NPOA 3HZRA 3CKLA 4K2AA 3KKKA 3LFHA 2FCRA 5JNTA 3KCNA 3MPOA 2ZE7A 4GOMD 4ZEXA 3L7JA 4BNWA 7YASA 3NBZC 4NL4H 1T5SA 1XTTA 3KSDO 4FGJA 1YF3A 1ZM3A 2G5CA 1CUCA 1AQIA 1PLLA 1P1JA 3T54A 5HWSA 1ESMA 2FFAA 3N87A 2HH9A 4IIJB 1IBLB 2XODA 3IP5A 1AHIA 2XA2A 4X6UA 2VK4A 4RGQA 4BRZA 4EK9A 5ITWA 3DLBA 1E2MA 1ZD8A 2RGNA 2ZT7A 2J5XA 1JDBC 4MQEB 5JCJD 2RHHA 4M7OA 4J0KA 3BWYA 1G7SA 1X13A 3CYFA 1CR0A 1Q92A 3K4HA 1H2EA 3NTUA 4FZ3A 5E7IA 1SG9A 2MINB 4I1IA 4MQMA 2ZE8A 5ELLA 5FO1A 3ASYA 2H1LA 1H22A 3OM8A 2HOQA 3QLUA 1ZGGA 4N3BA 4HN9A 2A5FA 4QSMA 1XEWY 2AQHA 2WAYA 2D8AA 4ZOLB 4F4IA 2XF8A 4L8VA 5KDDA 2G09A 1G9TA 4QGFA 5COAA 3UGKA 2Q3CA 5DNEA 5C5IA 4Y6PA 2O2DA 3IX7A 3N76A 5KQMA 3EZ6A 3SYLA 1F5SA 2PIAA 4WQMA 3QI7A 2PRIA 3V8MA 4X6XA 1DI0A 1NZFA 4OUDA 1K5PA 3PGMA 5IAGA 4G24A 2GRAA 4MRAA 1DC7A 4I6GA 2X3UA 4OGGA 1ZLYA 8ADHA 1SHLA 4GSKA 2IY9A 4N5DA 4Z9AA 2P4UA 5JS2A 3A10A 3Q98A 4EI7A 4DTIA 4Q15A 3L8FA 5EQDA 2W6CX 3QV1A 2NVUB 5IDVA 4YRTA 2B82A 3WLEA 3ZLBA 1FSGA 3GGCA 4FC7A 4C43A 1EJ6A 3DKRA 4GI1A 3WYFA 2ZUSA 3W4JA 3DOCA 4RVGA 3UMYA 5FTLA 2XT0A 1E20A 4A92A 4XD7A 5A02A 4X64B 2XVXA 4IWNA 3UN1A 4BX9A 2VDVE 4HGNA 1R0KA 4NYMQ 4QJ5A 3JASA 2WF6A 3VDRA 4WCDA 3DFMA 4D6PA 1BKSB 4KDEA 1NBAA 4FKZA 2Q9BA 5CP8A 4QRDA 1C9YA 1R64A 4W1SA 2AFHE 2DP4E 2RD2A 3F7MA 4L5BA 3W5BA 2EG9A 3QQ5A 1N1MA 2IKSA 1U5BB 4BKMA 2Z98A 3CU5A 2CMDA 4BNLA 3GCWA 3VU0A 1SOVA 3F3YA 4OOFA 4XLZA 2R6FA 4OMUA 2HSGA 3R5SA 4RS3A 5KINB 4C2TA 3I8OA 3IRUA 1O5IA 1PJ3A 5KSWB 1FJXA 1QO0D 1Q3TA 1L4FA 4J0EA 1VSQA 2I76A 2H2WA 2JGJA 2OO5A 1P9RA 1FNSA 3ZI4A 1Z47A 2R8XA 3LUAA 3MUFA 4IMRA 2TMDA 3QSGA 4RORA 5GMOA 2CUZA 3WIOA 4PYIA 2F8SA 1DIOB 4OA5A 1O5TA 4IXMA 3PJFA 5I9IA 2C2MA 2VPIA 1NKSA 2X1HA 1U94A 5KNCD 3UGTA 5JSZA 4KTVE 3B5EA 3IR7A 3QVGA 4QOFA 5BQFA 1P7VA 4NCIA 1VM6A 2Z3VA 1T36B 1JQKA 5E4YA 2FEKA 2Z2XA 5AOCA 1SKYB 3ZVKA 1IZ9A 2TRSB 1PDOA 2MOKA 1RJDA 4BVFA 3VNRA 5JWOA 5L4LA 2POQX 1KPGA 2ZYGA 2C07A 4KQHA 3FCXA 2E4UA 4O3FA 1FFEA 3WGIA 3TCXB 4CM7A 1JLHA 3GHYA 4K0KB 3KK0A 5CXUA 4FLFA 4Q05A 1BHO1 2OORA 1NC3A 4KI7A 4N8EA 4PS1A 4XEUA 4TZTA 4U63A 2RMKA 3LA6A 4FDMA 2BFPA 1I2MA 3U49A 3FOCA 4F5YA 4BKQA 1N0VC 3P9NA 1R3DA 4LZPA 1C9JA 1IZ8A 1EK5A 1F38A 4RK4A 2QD3A 2QI9F 3BMOA 2QAGB 5CAEA 5DASA 1T4MA 3PWZA 1F8FA 1OXBB 4K3VA 4PTZA 4OP1A 1FFGA 3G82C 1UXGA 5AI8A 5K3CA 3MMNA 1NR7A 5SYAA 4GLBA 1C7RA 1SCIA 1P3Y1 5HJ2A 1PJCA 3LQYA 4MS1B 1MENA 2I2WA 4R8VA 2WK1A 4AJEA 2YL2A 4JENA 4BC1A 2J6IA 4X8LA 4RETA 1QR6A 4UE3S 4LDRA 1YE3A 4Q1AA 1EBFA 4P2BA 1ZM2A 3KKLA 2K87A 1NLMA 4H1UA 5FTMA 2O5CA 1KAGA 3A3NA 2NXNA 2Q9CA 3B1FA 3PK0A 2G9UA 4QZVA 2NNWB 4UTPA 1MAUA 3D43A 2RI1A 5F73A 2C5LA 4HAWA 4DRYA 3UWSA 1YU9A 5B6IA 3MUOA 1XCMA 1OU4A 3UV6A 5BP7A 1M6NA 2CCJA 3ER8A 1UR5A 2OBNA 2GK6A 2PO7A 1JA1A 1M73E 2DF8A 3COVA 1OLOA 3BF7A 1NWHA 1NOKA 4B17A 1XZJA 2D13A 2FLVA 3G9TA 4FCVA 4WN9B 4OXXA 3V8BA 3I28A 3IE0A 3O2JA 4FFSA 2NUAA 3VGPA 3UKJA 1V2GA 3DR5A 2BFCA 1RP7A 2G9VA 3F1KA 2NT4A 3F6BX 3OQIA 4FFDA 4JN6B 4OATA 2C77A 5IRCD 1PNQA 2OENG 3FWNA 4DN6A 1JQBA 2G0NA 2Q50A 3FHLA 1KMMA 4DLPA 2FWRA 5EMHA 1VB5A 2PEYA 3PFNA 4MR8A 1XDDA 4YALA 1QNLA 1E8DA 2PT5A 3MTAA 1WXGA 2NTVA 3BYZA 3K31A 3TXAA 3WA7A 4BPBA 2FGKA 3GFSA 5FBRB 2P9J