2CCJA

Crystal structure of s. aureus thymidylate kinase complexed with thymidine monophosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Structures of S. Aureus Thymidylate Kinase Reveal an Atypical Active Site Configuration and an Intermediate Conformational State Upon Substrate Binding
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ccjA00
4DZZA 5K8UA 3GLFE 1IOZA 3U2QA 4A82A 1OF1A 4EQ6B 3TUZC 4JBXA 4PR0A 3ECCA 4N1AA 4IVQA 3EZ7A 2CHQA 1OYYA 3GLGB 4PHGA 2O8EB 2OG2A 5J47A 2FX3A 3AV0B 1EFHA 5FOSA 3W3ZB 3KZ1E 3ONWA 2C9YA 3AKDA 3V4FA 3JVVA 3TW4A 4UKDA 2MMGA 1IJFA 3QY0A 1E9RA 1BO6A 5IT5A 1XNJA 3B82A 3QE0A 1KI1A 1W48A 4KBFA 1MH1A 1H65A 3W5JA 2V9PA 4PPFA 1JECA 3OIWA 4A8JB 5L3QA 4TLAA 4Q48A 5KO2A 3CRVA 4P4SB 1GIAA 3UANA 1AQYA 1JALA 2JASA 2BHRA 1GKUB 2RCNA 4U02A 5DI3A 1NVVQ 2WSMA 4C0KA 1LS6A 4KV9A 4QJ3A 1E69A 2D06A 3HU2A 3MWKA 3Q3JB 2X1VA 4AWXA 5FPSA 2GAOA 2R6CA 4BQSA 1LFDB 4G5SA 2VL7A 1U0LA 3REFA 5FTKA 3THXA 3FFAA 2AXPA 3F0TA 3CX6A 2CL7X 4RZ2A 4UQOA 5AWFC 5E7MA 2PZFA 4CZ2A 4LK2A 3PUWA 2KSQA 4TL9A 4HUQB 4ACAA 1M7HA 2ZRNA 4EFMA 4ITRC 1G3MA 2JAQA 3RC3A 3TJZA 4EUNA 4ZPXA 2IT1A 1ZM2A 4LRWA 1QHHB 2YYZA 4KBGA 2ZI6A 2QROA 2WWIA 1BMFA 1XZPA 1Z47A 3EIQA 3EZFA 4QBHA 2WV9A 1E2NA 1KGDA 4F92B 1P9RA 1IXRC 1Z2CA 3RS3A 3QKRB 2Z5FA 4FWIB 5EP3A 2O8FB 4HDQB 4YXWA 4RCYA 721PA 2JLUA 2OLKA 3KTAB 4BFXA 4LDJA 1X1RA 5AUQA 1Q1ZA 1FL9A 4C2TA 5GVSA 1DG3A 1OLOA 1II0A 2GXQA 1CRPA 2ZRIA 4TQ9A 4KAXA 3CONA 3GLIA 3PJRA 2QE7A 2YWEA 1G8GA 1FW6A 2CDNA 2GKSA 3NDBB 3V00A 2CLSA 2NQ2C 2XNDD 1J2JA 4PO1A 1AZSC 2ZAOA 1DVRA 1S3GA 4QOSA 2D4HA 1FUKA 2FZLA 4HLCA 1EESA 3SE0A 1Z83A 4WIAA 1XX6A 3AKCA 5KDOA 4GRAA 1W4BA 2FF7A 3QVUA 1Z6TA 1R0YA 1RC8A 2WWXA 3TE6A 1G3RA 2VQSA 2ZREA 3GEHA 5FBLB 1MABA 2CE7A 2R2AA 3BIFA 3MJRA 3DMDA 2H17A 4PAMA 3CRW1 1QBKC 3QIAA 2KBFA 2WVJA 3LA6A 5JFGA 3UWKA 1FNMA 2QORA 2EFCB 2QZ4A 2ZUDA 3VU9A 2OFWA 4B6FA 4Q9LA 5AK0A 4MUAA 4W9MC 5TY0A 1SXJD 3VR3A 1P2UA 5B58C 2IXFA 4KFUA 1LS1A 2VEDA 4FMDB 4D0LB 2QBYB 4NPHA 1T5IA 5BN3A 2PZGA 3CPJB 3E1SA 821PA 3WYFA 2EFGA 1WRBA 2HYIC 2P5SA 1KI8A 4KVAA 3THYA 1G5TA 3B5JA 4M9XA 4M4SA 3FMOB 1D2NA 4C3ZA 4GMDA 4R2IA 1GRNA 1WB9A 3B8HA 1HT2E 2ANCA 4BFYA 3FPAA 4Q4AA 4LJ5A 2ZAMA 3SJZA 2GAAA 3U61B 3OHMA 3AB3A 4Q9JA 1OT3A 3GLFB 3H0KA 3T1VA 4DEXA 3NDPA 3LX8A 5LPNA 2J3EA 3SHWA 1YJ5A 3G82C 5C46F 2AR7A 3EC2A 2JLVA 1U90A 2WBLC 2ZANA 1NN3A 1WF3A 5IK2D 3IGFA 4RKFA 1OKKD 1PV4A 3QQ5A 2JJ1D 4LJ4A 3Q5DA 4CEJB 4NU0A 1FNNA 3PEWA 1Z0DA 1M6NA 1UKYA 3FHCB 3E5HA 3I72A 2A2ZA 3WNBA 1TF2A 1KI7A 3EZ9A 2G0NA 2O0HA 3MSXA 3B1XA 3WXMA 3SS8A 3I5XA 2XNDA 1XEWX 3SFVA 2BBOA 3DKVA 3WYGA 1IBRA 1VTKA 2FNAA 1N5LA 2Z6VA 1W36B 2J0VA 3RS0A 3BERA 1CKEA 1S0UA 3TSOA 4O3MA 3MWLA 1Z0AA 2QEQA 5FOVA 1IXZA 4KFSA 3EZ6A 4PX9A 2F1IA 3TR0A 3L8YA 5H70A 2XZLA 3K0FB 3TKLA 4RY2A 1AA9A 5L3SB 4BLOA 4IW3B 3KJHA 3NBXX 2ODNA 3DM5A 1JR3D 3L0OA 3T1OA 1ZC3A 1WA5A 2C5LA 1OHHD 4HZUB 2ZJYA 1JEEA 2R62A 3I32A 3WP0A 3ND8A 1Z22A 2JLRA 3MUFA 2WAXA 2IS2A 1SXJA 2AK3A 4QBIA 2ZITA 3TMKA 2A5FA 3GJ7A 3DDCA 4FMCB 5EP2A 4LI0A 2ECKA 3WHLA 1KMHA 3MAAC 4AD8A 1CJVC 5FR2A 5TB5A 5FOTA 1T9HA 5K8TA 1FQKA 3QPUA 5FTMA 3X2SA 4MYUA 1ZP6A 3B60A 2WKQA 3V9PA 3A1UA 4LYFA 1SKQA 4V0ME 5DNYB 1R4AA 3DZDA 3T1QA 3C5CA 1NLYA 4MGIR 2BM0A 4IDHA 1F3OA 5FBVB 4PPNA 2CLDX 1UKVY 4LBWA 4D4LA 3TIFA 4Q1DA 2GCOB 3SC3A 3F8TA 2NTYC 3WBKA 5IK2A 4OBEA 4S35A 2P65A 2WPDA 1OKKA 1VYUA 2AKAB 1G5RA 3LQRA 1GKIA 2JJ1A 2YOGA 2EVWX 2JLXA 2BBSA 3WMGA 4MYCA 2PX3A 3M6AA 1NIJA 4UXJA 3B2EA 4BRUA 1JXOA 4YMVA 4FD2A 2C9OA 3ZZTA 1LY1A 4V0KA 4M53A 3SEAA 4DT1A 2H92A 3VHXA 5E95A 4BFZA 1OB2A 4NTZA 5J5CA 2Q21A 4DSTA 2BKEA 3P27A 2G0TA 4DUGD 5KYKA 2GETA 1E2FA 1TUIA 2CNWD 2GNOA 1XMJA 2ZRDA 2Q0HA 2QP4A 3KQKA 3BGWA 2O8DB 1XMSA 4L16A 1BS1A 2QM7A 3CNNA 5KTYA 1I2DA 4X8OA 4M1SA 2I3BA 3X1ZA 2RHMA 4TMWA 1IN5A 1JR3A 3BH0A 5EE1A 2AD1A 4Z8XA 5B64A 4C0QC 2RKOA 4PZLA 2GILA 5BQ5A 1OHHA 4FN5A 4KJZA 1KKMA 1GNPA 1XEFA 4LYAA 2H18A 1X8JA 3NTUA 1S4QA 2BOVA 4MKGA 1GITA 5F9HA 1ZIPA 3RS7A 2JEOA 1E2GA 1FOEB 1VIAA 2QN6A 1NMXA 1SHZA 3N2EA 2GTPA 3AVVA 1P62B 2YWGA 4KYUA 5FL7A 3O8RA 5EZ6B 2J7PD 4WZAE 1COWD 1E2KA 1KAGA 3CKLA 3CR8A 1QRAA 4OHVA 1UDWA 2O0KA 4QNMA 1TX4B 3PUVA 1E9AA 2FEOA 3K9HA 3QG1A 4IOLA 2QY9A 3FB4A 3ZZUA 1Q3HA 4QJ4A 1R2QA 4NCKA 1NMYA 5J4LA 2MSDB 2GJSA 2NPIA 2PX0A 2ZETA 4ZDKA 2ASEA 2K5UA 1W46A 1DG1G 1KAOA 4GBMA 1KDPA 3QF7A 1IQPA 2F1RA 4Z1MD 2O52A 1ZVQA 3ND9A 4QJ5A 2AFHE 3K0EA 5LB2A 4M1KA 4YDHB 5UKDA 4NP6A 4BZQA 1A1VA 5CK5A 1GWNA 1GP2A 1N3BA 1Q1EA 3P20A 4TT3D 4A9AA 4PO9A 4I1UA 1TQ6A 1ZRHA 1SVMA 5JWRA 2WJGA 3AF3A 4HAYA 1N6IA 2JLWA 1DBSA 1II8B 1OXVA 3X1XA 2C77A 2WJHA 4Q4HA 1NMZA 1UBCA 2D7CA 4FWTA 1FQJA 4JSYA 3Q72A 5L3VA 3U3RA 4Z8YA 1US8B 4YMTA 4M1MA 2GRJA 1KJZA 3K0AB 2JLZA 1M7BA 3CWZA 4EPXA 3LO5A 1E98A 5FTJA 2CVHA 1MO4A 3LLMA 4KI0A 2Q3HA 3R8FA 3GLIE 1JPJA 4CT5A 3PVSA 1VG1A 4DUGA 1XEXB 2J1LA 2CNWA 1FTNA 4TLBA 1PLJA 1XPRA 4MRPA 3KKPA 3IIKA 3U6KA 4LY6A 2ORIA 4F91B 2CE2X 4IXMA 1NN1A 1JPNA 3NBFA 4M1TA 2B21A 3N70A 2ZR7A 2VSXA 3ZZ0A 1ZUHA 3Q7PA 1MKYA 5CJPA 5E3HA 1AKYA 2IUSA 2VIIA 4LCBA 1L8QA 4WXPA 1CF4A 4N0DA 2WJIA 2JLQA 1Z0KA 2IUUA 3SBDA 4AYTA 4DSNA 5GJVC 4JBYA 3A1WA 3QNUA 2C9CA 1P3JA 2IYTA 3BFXA 2FGJA 4BECA 1L2TA 3UMSA 2YC4C 4N0EA 2V1UA 3CZQA 4A0HA 4DCTA 2QI9C 4FIDA 4MGKR 4D80A 3BH7A 4TMKA 4DHEA 2YZ2A 1Z29A 2J7PA 3FMPB 1COWA 4LV8B 1F2UA 3RS5A 2J0UB 4KLZA 4NYIR 1ZCAA 1FFHA 1TPZA 4KU4A 4OI1A 4L5BA 4F4JA 1NRJB 3VMFA 5JEEA 4B47A 1W0JD 4PZYA 2ZUBA 2XTZA 5DLQC 4S2EA 5CYOA 4FMDF 4JLMA 2EYUA 2KE5A 1Q1BA 2HLDD 1X8KA 3LLUA 1J90A 4D0NA 2WJVA 4BEJA 4XOIA 1SKYE 5KOYA 5CLQA 2CL0X 1EG7A 1CLUA 1T8UA 2PT5A 4Z1MA 1SZPA 3QXCA 1Z2AA 4C0SA 3FE2A 2IHBA 3U7FB 1W5SA 1KO1A 1IONA 2YHSA 4TT3A 3BFVA 3QEJA 2QRNA 4LHXA 2RGCA 3QXSA 4PSAA 3G5UA 3C5HA 5K8LA 2FFAA 3AKEA 3SZRA 1YR7A 2A5DA 2NPFA 3K09C 4LYJA 5F2EA 5BW8A 3U5ZB 1NY6A 5KU1A 4LBVA 3W90A 1FZQA 1E1RD 4TTQA 3VR1A 5ELXA 2W2VA 4CEIA 3AEZA 2ZIAA 1GUAA 1Z3IX 1N6KA 1UFQA 4EPVA 2F1HA 1GG2A 1ZM7A 3GP8A 2IHYA 1ZW6A 1SULA 5CM8B 1RYFA 1MT0A 2ZSBA 2BC9A 4OJKA 4A92A 2P0EA 4DLWA 1ESNA 1NJFA 5FUVA 1XCGB 2JIZD 3FFBA 5BN5A 2WJYA 4N3NA 3SHFA 1XFAA 3ZJYA 2BCJQ 1AS2A 1E94E 2FWRA 3NBZC 2HV8A 2FFBA 4QHYA 1HURA 3SFZA 4B2LA 4TYNA 2JLYA 2VBCA 3EC1A 4U5XA 5L3QB 1CS4C 4GOJA 1QHSA 4LJAA 4XIGS 4JLAA 4HI0E 5DI3B 1RE0A 3EZ2A 4K8OA 3RYTC 5KNBA 1E2QA 4TTPA 3OFND 3M1IA 4MRSA 4E03A 2HEIA 2OCAA 1MO3A 3CLVA 4P33A 3TGPA 2IYVA 5FOWA 1U8AA 4DDTA 1EWRA 2F43A 1OW3B 1EFCA 2B6HA 1G5PA 1E0KA 1XD2A 3K0CC 3WBJA 4HAVA 4NE2A 3AGPA 2ZI5A 3I8XA 1UF9A 3KUDA 4F4IA 3EPHA 2PT7A 3KKNA 4ZI2A 5B57C 1BYIA 4M22A 2R8RA 4PAQA 1C4OA 1P2SA 2WZQA 4TQUS 5FI1B 2VRWA 3ZH9B 1SXJE 3PUYA 1P61B 1G291 3VR4A 1GSIA 1N5IA 4OHYA 1W0JA 3MCAA 3TAUA 2FSIA 1ZIOA 3GJ5A 1M34E 4KODA 3HU3A 4CGZA 2ODBA 1P73A 1HQYE 3EASA 4FMCF 2HLDA 3L0SA 4Q4JA 3ZYCA 2VYFA 4DBLC 5EE3A 2QAGA 2FPLA 5K8IA 2GJKA 1GL9B 5EXXA 1I4LD 4JL6A 1DAFA 3ADCA 1K5DA 4E07A 3DO6A 1N2CE 2O5VA 3SDZA 4HB4A 2WIAA 1OH5A 1G3UA 3RS2A 3ICQB 1W4AA 3F3YA 2Z4SA 1E9CA 1DPFA 3N2IA 1IY2A 2VPPA 4ZKDA 2GBLC 2ZI7A 5HTKA 2BKUA 1E1RA 3C8UA 1R10A 1WE2A 521PA 4D4KA 2PBRA 1XJ0A 4ZIRB 1J70A 3EX7C 1GFIA 1BKDR 2FN4A 1MABB 4ZCIA 4Q1EA 2QM8A 4M0LA 1VG0B 2H1LA 5FBWB 3ZGXA 4Q19A 2V7QD 4PAOA 1ZC4A 1AM4D 1U98A 3BH6A 4OI0A 4TMTA 3CPEA 2JIZA 3VU9B 4GOXA 1KZ7B 5JBQA 4MDFA 1KNQA 3IBYA 2ZM5A 5EUMA 4OHZA 2GXAA 1HQCA 3BORA 1KTVA 1UPTA 3GFTA 3K53A 1W5TA 1E9SA 3VR2A 1OIVA 4POAA 3WYAA 2ERYA 5KNDA 1AGPA 2JLSA 4J0QA 1GM5A 1LB1B 2IXGA 4IDQA 1SKYB 3OAAD 4NONA 3BD9A 4QFMA 4ACBA 1ONBA 3QXHA 3IPYA 4Y0AA 4PTLA 2BWJA 5B2ZA 1KY2A 2GJAA 2RGNA 3I1FA 3QI2A 4A6PA 2EW1A 2ZRCA 1JR3E 4GSYA 2H8KA 1W0KD 2BIFA 3D31A 1AS3A 3EARA 2GCNA 4JLJA 4RD1A 3AVPA 1OFUX 2ZRPA 3BOSA 5TDHA 4Q47A 4CDGA 3K9NA 5F9FA 2QQ0A 3I61A 3D8BA 2REXB 3DPUA 2PMDA 4C0JA 6Q21A 1JB1A 4B48A 2CBZA 1R5BA 4PC3A 3PITA 5L8VA 2IL1A 4V0LA 1Z0FA 4GT1A 2FDCA 3T5DA 1LV7A 1SHKA 1VCOA 4XWOA 2QU8A 1ZJ6A 1XTRA 2FPMA 4QC2A 2W83A 3K8YA 4II7A 4PZZA 4Q7KA 4DB2A 3W3AA 2EU8A 4NBSA 1CU1A 2BMJA 4LHZA 4YLGA 1QZXA 3BB1A 5FUYA 5HR5A 4B35A 2RAPA 4LJYA 4DCSA 3EIEA 4PQRA 4TMVA 2ZVPX 4XJXA 5C4MA 1OFIA 2X8AA 5JJLA 1QDEA 2ZROA 3CF0A 1YZLA 2R65A 2V8OA 1OH6A 1Z5ZA 2ZJBA 1G7CA 4IXNA 2X77A 4NYIQ 2GK7A 4CEHA 4D2IA 2AHOA 3J81k 3HR7A 2E87A 3R9IA 4OQMA 1QHNA 3GQBA 5CITA 3I8SA 1YZQA 4LYHA 4UJ3A 2ZXUA 2BBTA 4UNRA 2KB0A 3PIRA 4Y0VA 1HYQA 1E99A 3CBQA 3N5CA 5IHPA 2EWWA 4Q4LA 4B75A 4BLTA 1HEIA 2ZI3A 2V7QA 5DI9A 3SJBA 1FUUA 5JRZA 4B3BA 2WWYA 1W36C 3UKDA 2C78A 1DOAA 3KKQA 3NBYC 4FW9A 4AG5A 4RZUA 3LXXA 2W0MA 3CW2A 1NIPA 2Z43A 5FPTA 1VECA 2ZRBA 4US2R 4IVRA 2J9RA 3FKSD 4DXAA 2XXAA 3RANA 4GOKA 4HAWA 4MRRA 2OSBA 3IHWA 1KZGB 2XB4A 3OAAA 1IHUA 1XTSA 1Q57A 4EDHA 3CRMA 1CR4A 3HR8A 4OI2A 3VTKA 2FFQA 2F1JA 3T15A 2IXEA 1W0KA 3WRYC 3DL0A 2FEMA 2J41A 2ZE7A 4D81A 1R8SA 4G5QA 1EFUA 2C98A 1A5TA 1P60A 1G8PA 4PC1A 1F2TB 3AH8A 3QF4B 4C2UA 2VF7A 2WAYA 3SBEA 1B23P 4HLDA 1K8RA 1LNZA 1I2MA 2RGEA 3KQNA 2ZRFA 5DYIA 4CYMA 1FX0A 1F48A 3WMEA 2PEZA 4EKDA 1T3HA 2O0JA 5FTLA 4YONB 5JSZA 2PCJA 1ZU4A 1KO4A 4PHFA 3UMRA 5BYJA 5JHGB 3OIYA 4A4DA 4DLSA 2W58A 3E70C 1P5ZB 3SNHA 1T8TA 2ZTSA 4Q7LA 2OUKA 4KCGA 3B13B 4DT1B 2YWHA 1VIYA 2WWGA 3CR7A 3LAWA 2ZRLA 621PA 1XTIA 1KK3A 4C0LA 5JZVA 1WMSA 2P2LA 3AVQA 4Q00A 4TTRA 4BE7B 4MGZR 4A6XA 3GJ3A 1BOFA 1KSFX 2VF8A 5BXQC 1G17A 1K6MA 1KO7A 5JLJA 2EFDB 4QM7A 1U0JA 3HYRA 4MH0R 1R0ZA 4FMBB 4YC7A 3OE7D 2XGJA 2XOKD 1SVIA 3AUYA 1P6XA 3LNCA 1XWIA 4B76A 2J46A 4K46A 1QVAA 4RD3A 2JJ2D 3B1ZA 5LBIA 2VHTA 3AF1A 2A9KA 4DLXA 1R5NA 4Q18A 3K70D 1U8ZA 2J87A 2WMNB 4HUTA 5BWMA 3ICEA 2OBMA 4MUBA 1E2IA 2E1RA 2QAJA 2Q3MA 4Q21A 1Z63A 2FSFA 2QTHA 3PV0A 1CJUC 1QF9A 1DE0A 4RVCA 3UK6A 1KDOA 4PSKA 2I4IA 1DAHA 3FKSA 3O47A 3Q8XB 3H2YA 1TQ2A 1YVDA 4JMPA 3U3OA 1XU4A 1Z0JA 1Q21A 4DCVA 2BCGY 4B3GA 5HCNA 3VHLB 3AF0A 2C96A 3SQWA 1Z08A 2WMOB 1AS0A 2FPKA 4PO8A 5CLLA 5TV2A 3LXRA 1VYTA 1RRPA 1GOTA 4HB3A 3ZIAD 1CR2A 3U7HB 2YJTD 1F6BA 4EFLA 1XD8A 3ASYA 3RSLA 5JJKA 1KI6A 2DCUA 5G41A 1Z8FA 3QVVA 3GLGA 2EFEB 2O8EA 1SVLA 2HF8A 2QENA 3X1DA 4OL0A 2ORWA 1NI3A 1N5JA 2HF9A 1EXMA 4Q9KA 1JNYA 2XTNA 1JAIA 2GF9A 2D2FA 5E7JA 2GZDA 4BLQA 2DFNA 4D6PA 4V0OA 2WWHA 2GJ9A 4E09A 1QG4A 2RGXA 2VH5R 5TMPA 2WOJA 3K0CA 4MKFA 3GJ0A 4Q4HB 5CDFA 1CP2A 2VHQA 3GFOA 1YR8A 4JYBA 3PFIA 3WP1B 4M1WA 4WXRA 5FFMA 1CULC 1OXUA 1GDDA 1IAQA 4P4TA 2ZE5A 4B2IA 2O8BA 4BFTA 2O8CA 4PC7A 1ZUIA 2NO0A 4QL3A 1LF5A 1TF5A 2ZYWX 3CH5A 3HPRA 3K9GA 1OYWA 4V0NA 3NG1A 1U2RA 5ANRB 3T61A 4JLVA 2QA5A 4URXR 3AM1A 2AFIE 1N5KA 2OCYC 1EK0A 3VAAA 2CLCX 3OE7A 2XOKA 1Z0IA 3LWNA 5KSZA 5FH9A 4CW7A 4DEYA 4I81A 1E6CA 1JJVA 4QXAA 4HZIA 4UNSA 4HLQB 3AUXA 3QG5A 5D3MB 4PQFA 4MA4A 2ZUCA 4Q1BA 2GEDA 1N6RA 1YKSA 1N0UA 2OXCA 4KHZA 4ZKEA 4BWYA 3KB2A 3SQXA 1J8MF 1QHXA 4EPRA 5AUPB 1VMAA 2G9NA 1P72A 3KTAA 3U7EB 2GBLA 5EUQB 4NCIA 5DH9A 1E4YA 1U9IC 2BV3A 2IWRA 5AUOB 2HT1A 3LBHA 2HJVA 1F2UB 1OPXA 2D3WA 3KFXA 2YOHA 2A5JA 2P6NA 4W7SA 2BMDA 1EWQA 3RVBA 4DC9A 4D4JA 1Q22A 3QPWA 4DCNA 5KSOA 1KY3A 1NVXQ 1X6VA 4XSHA 4TMZA 1P2VA 5G53C 3FHTA 1MV5A 2CHVA 5AJZA 5C1BA 2C95A 4XTRA 2H57A 2P5TB 3FWYA 3ZIAA 1G16A 2G1KA 1TTTA 1ESMA 5DO9A 4IFEA 5JMTA 3SYLA 2WHXA 4ABYA 3I5YA 2DFLA 2BVNA 5H1YA 2HYDA 1XTJA 2JJ8A 1HV8A 2OXRA 1TEXA 3EA0A 1TU4A 4QGAA 2P3SA 1G20E 5FL3A 1PZNA 1P75A 1XZQA 2XJ9A 2G1JA 1MR3F 121PA 4JVNA 4M2LA 2ZYUX 3S1AA 1GRRA 3JZAA 2ZRMA 1Z06A 2PMKA 2DB3A 2FZ4A 2ORVA 4E5UA 2X2EA 1HA3A 4EJSA 4DB4A 2ODEA 1G41A 1MO5A 2W6ID 3MG9A 5GJWC 2GDJA 4KSCA 4CEIB 5HPYB 5LB4A 4DLTA 5DHFA 1GKYA 2OZEA 2QGNA 1KIMA 1RRGA 4RKEA 3MFYA 5AJWA 4OJQA 4F38A 1HE1C 3KFVA 1GTVA 1NNEA 1G3IA 4GZLA 4BFWA 4OYHA 3OF5A 1S3SA 4R98A 2OV2A 1M8PA 1XXHA 4CF7A 4L15A 4GP6A 5DHAA 5JRJA 2Q6TA 3OEHD 3X1YA 2ZSFA 1A4RA 4QHSA 4W5JA 2ZI4A 1N6LA 2IS4A 1ZD8A 2FOLA 3LH5A 4RFVA 4DSUA 2JATA 4GI7A 4YQFA 3PG5A 2CEAA 1LTQA 3VNUA 3AGQA 1U0HC 4FI3C 4LV5B 4G01B 2FFHA 2PL3A 2F9LA 2OLJA 5CM9C 1XD2B 2F43B 2ZSAA 4OK5A 4MITA 1UKEA 5C2JB 3AP1A 4KO8A 4W5HA 4QNRA 4OHWA 2R6AA 4PANA 3ZD7A 4Q9HA 5M04A 3CWQA 5DYGA 2IYQA 3IO5A 4HAZA 3W8NA 1RZ3A 1VKJA 2A7QA 3BS4A 3T12A 1NN0A 3I62A 1NP6A 1DO0A 5JJIA 1BH2A 3NXSA 1VCIA 4TYQA 1UEJA 1FMJA 1KK2A 1KSJA 2QTFA 1ZAKA 2B8WA 4MYTA 4BGDA 4Q4JB 4O2LA 4B33A 1DAEA 3ZLJA 2D74A 2NIPA 4OK6A 2QAGB 3U44B 3RDPA 1E1QD 2NG1A 1G18A 3HWSA 4PPGA 2DYKA 1A2KC 4H1UA 4LC1A 3CIOA 4NYMR 4AURA 2JDID 1NJGA 2P67A 2PJZA 3OIVA 2GA8A 5FPYA 2V3CC 4JJZA 1P7CA 4JLKA 3EG5A 4URVR 1GILA 2RGAA 4A2QA 1PUIA 2ZSDA 1JAHA 1X86B 2R44A 4I1SA 5CIQA 4ZV4A 3KXKA 5GJBA 4ZDJA 4F4CA 2KWIA 3IBGA 3FVQA 5H68A 3MJHA 3ADBA 2W6IA 3VFDA 1G6HA 1ELOA 1ZINA 2OHFA 4BFSA 3UIEA 2JGNA 4URZR 2H7VA 1HE8B 3UMFA 1T4GA 4BZXA 5AR1A 5DIFA 1GVNB 2D7DA 3R20A 3DMNA 1OE0A 1ZYUA 4L4UA 2IW3A 4DIEA 1YR9A 5KPJA 1OJLA 3OEHA 4LJ8A 1EGAA 5KDLA 2BMFA 1CJKC 4JT2A 5FOUA 2ZJ8A 4M21A 2P6UA 2QG6A 2QTVB 4IJMA 3W34A 1TMKA 3A4NA 1T0HB 1W47A 4URYR 3IILA 4EPYA 1DO2A 2AXNA 1R6BX 3VX4A 1KSGA 1ZNWA 3PQCA 3ADDA 3R7WA 4UNNA 4Q01A 1UDXA 3FMIA 1VPLA 5HZHA 2EWVA 3A1SA 2REBA 2QPAA 2XEXA 4Q7MB 4ARZA 1QVRA 1UBGA 1AKEA 3FHOA 4NCNA 5B30A 5HKKD 2G6BA 4TYWA 3SR0A 2HXSA 2VP4A 5IRCD 4LPKA 1U94A 4OQNA 1E9FA 4JYCA 1AIPA 4KLNA 5C4GB 1E79D 2FV8A 4G3XA 1Q20A 5SZHB 5JI3E 1GL7A 4BLPA 3NHBA 2CCGA 2C8VA 1CXZA 3CRRA 4QGHA 4UNQA 2LWIA 4Q1CA 2J59A 2IBMA 5SZKB 4F7WA 2WWFA 2IC5A 2OAP1 2UKDA 2UVQA 4JLPA 1O3YA 5H8WA 1E1QA 1N6NA 1P9NA 3TH5A 1IXSB 1II9A 1P9WA 3RRMA 3EIHA 2QL6A 2DR3A 2JDIA 2NO7A 3QKUA 2XTMA 1CIPA 2FA9A 4GDFA 4WA7A 1X3SA 1MO6A 4C7OA 1CBUA 2OFXA 1XJQA 2F7SA 3FYHA 3PUZA 1OSNA 3RRNA 1FP7A 2UZIR 3PEUA 5JS7A 3GLGE 2LKCA 2ATVA 4I99A 5IF9A 1YZGA 4CEHB 5J4VA 4JL5A 1GZSA 3IKJA 1OB5A 2ZPTX 3C4JA 2B7BA 2ZS9A 4JZKA 1E32A 3GJXC 2CMKA 2ZSEA 5CDFE 4PFSA 3THXB 4AKEA 1HT1E 2YVUA 3WMFA 4RD4A 3NEJA 4A8JC 2ZEJA 4AYXA 2DWOA 2W2XA 4I1OA 1DAKA 3NH9A 1UKZA 4KYIB 4X8MA 1J7KA 5EZ5A 3AP3A 3O8DA 1OIWA 1SGWA 1HUQA 3MWJA 5SZIA 2YV5A 3T5GA 2GVZC 1G3QA 3CB4A 4A2PA 1XTKA 4BFVA 5JI2E 3R9WA 3AVWA 2OBLA 1JBKA 3ZVMA 2BJWA 3IO3A 2ONKA 2VSFA 3BWDD 3R8CA 3K9LA 1YZUA 1DAIA 4CT4B 4ASUD 3UPUA 4CIDA 2XNSA 4TSFD 3KXLA 3GLIB 3ZDQA 1EX7A 1C9KA 4R2HA 5HKKA 1L4YA 2UZ3A 3QSYA 3W6OA 4HATA 3AVYA 5CB6A 3L43A 1LF0A 3B9QA 3BRWD 4JBWA 1E79A 3OEED 1QHYA 3B9PA 4C9BA 1NLFA 1W2HA 1FX0B 2QSZA 1L7VC 3Q9LA 4AG6A 3AVUA 4WW0A 4D26A 4B44A 4HSEA 3WY9A 1W1WA 2N1BA 3ZVRA 4XTCS 1NSTA 1XTQA 3B78A 3C14C 2QPOA 2C04A 4B3DA 5JSZB 2GK6A 1UBFA 2PCLA 2ZJAA 1T5LA 2A30A 3REGA 2W2TA 3TQCA 3B7GA 2FJUA 4LBZA 1ZUNB 4WZBE 4X8HA 2ZRJA 1U9IA 1KNXA 2IF2A 3DVLA 4KXFB 1YZNA 1IY0A 2IEZA 4B3FX 4RFSA 5AJVB 5JWHA 3SN6A 1NKTA 2CJWA 5JHHB 3E2IA 3NEYA 1R7RA 1RW4A 1WQ1R 3U3MA 3OFNA 2IYZA 1FP6A 3ZS9A 3IQXA 1F5NA 1KYIA 2NO6A 2IYLD 3THYB 1U81A 4IDPA 4FINA 5LD2B 1TNDA 1KJYA 4Z51A 3A58B 5FR1A 2LCFA 3A1TA 1N25A 1Z07A 3FMFA 3SJCA 2G3YA 3GJ8A 3UATA 2A78A 1W4RA 4LZZA 2EYQA 5EQTA 4YMSA 3Q7QA 2XX3A 1Z6XA 3CF6R 4Q4AB 4MGYR 3KKOA 4XSGA 2NMVA 4DLUA 4NYMQ 4R71A 1BMFD 2IS1A 1RPZA 4M1YA 2IYYA 2ONJA 5AJYA 1X1SA 3CRQA 4TQAA 3UXMA 1OIXA 3GCGA 4OK3A 2OT3B 3KQLA 4DVGA 3CO5A 2FG5A 3A4MA 3BXZA 1WBBA 2BEKA 4R9UC 3FTQA 1TF7A 2ZVQX 3LRPA 1NBMD 1XXHE 5A5GA 4HLUC 2VHUA 2ZE8A 3H84A 2WIBA 4NCJA 1RYHA 1T3SA 4H9GA 2HXYA 1GAJA 3KQHA 3W6NA 2Q9AA 4L9WA 2CK3D 4ASUA 3U7GA 3L0PA 2FH5B 4TSFA 3QUSA 2HDNB 1RRFA 1IN7A 1IN8A 2DWPA 4WAUA 3RRYA 5J4KA 3TSZA 2OE2A 4V02A 3QJYA 4BRWA 1I4DD 1XCPA 4JLDA 3RWOA 1KI6B 3CM0A 2C03A 2WM9B 3A6PC 2I1QA 4G5OA 3ZS8A 2CL6X 2NO1A 2AD5A 3OEEA 2DBYA 2IYRA 3I73A 1OXTA 1RJ9A 4IDNA 2QMOA 4LOAA 2QNRA 2FSHA 1N0WA 1DS6A 3K0SA 3L82B 3RHFA 5GADl 4TYYA 4TN1A 3MMPA 4ZDIA 3BBPA 1VYVA 4NH0A 1XBTA 1RRCA 5FPKA 3O8BA 4FCWA 1PVOA 2C2HA 2FGKA 4BZPA 4IOMA 2CXXA 1ZU5A 3QXJA 2J0QA 1RKBA 4HEJA 2GXSA 3THWA 3DZ8A 4H1VA 1SXJB 2SHKA 3IQWA 2O8BB 3VQTA 2O8CB 1G6OA 4K81B 4B3CA 4OQLA 4TL7A 4YMWA 1KJWA 2R6DA 1UAAA 1M74A 4JS0A 3P4YA 1KMHB 2E9SA 2X19A 4IEEA 1OXSC 3TVTA 3HPQA 1TQ4A 1AQUA 3R9XA 2XAUA 2A5YB 4O2RA 4WBSA 3SI7A 2QRZA 5SZJA 4LSGA 4B6EA 4BUJA 3RAPR 2NGRA 2R6GA 1CRQA 1S8FA 4P32A 4DDWA 3K70B 4BASA 4AY2A 3H1TA 1ZM9A 1N0VC 4QGFA 4Z54A 4A1FA 2CVFA 3PEVA 3LW7A 3RWMB 2ZR9A 2A5GA 3TK1A 2OILA 3DM9B 1W44A 3A8TA 3IUYA 3K1JA 3RC8A 1GNQA 1NBMA 4JLBA 1IM2A 3U4QA 1F60A 1TUEA 4B74A 3VR6A 3QKSA 4AK9A 2GESA 3B85A 2QQEA 1Q1QA 4MKHA 4PPQA 4URWR 1ZMXA 3ZQJA 1OH8A 2EFHB 2CK3A 4GP7A 4KVGA 2XJ4A 3HYTA 2JA1A 3TSWA 4HAXA 4LHWA 1YRBA 5EE5B 2DFTA 3C15C 3EA5A 1VCNA 2V1XA 2YNMA 2NZ8A 2FU5C 1B0UA 4XVRA 1E2JA 4O0MA 5EE9A 1NN5A 4DLVA 4ZIRA 2Z0MA 1DAGA 4B32A 5G3ZA 4P4UA 4IHQA 5HZKA 2Y8EA 1NG9A 1X8LA 2VSOA 3CF2A 4BEBA 1K5GA 1PJRA 3S1AB 4RZXA 3GLHA 4NCHA 4B43A 4IOJA 1E3MA 2PZEA 2Z83A 3CH4B 5L3RA 1R8QA 2WKPA 4EJSB 4XH9B 4OHXA 2GHIA 2VHCA 3TVDA 2FSGA 4JVMA 2OEPA 5TVKA 3PXGA 3RLFA 1XCMA 3RSOA 4LJ7A 4XWAA 4C4PA 3B1YA 4Q1AA 5EE0A 1AN0A 4DJTA 2REOA 4LUCA 3U3JA 2NO9A 1M1YE 1OH7A 1W7AA 3LVRE 3FGNA 4HAUA 1ZD9A 1U99A 4CVNA 4EAQA 3DKPA 1XXHB 3AF2A 2W00A 4DCUA 3IIMA 2PH1A 3K09A 1TAGA 1SVOA 1MOZA 4ZCMA 4TZ0A 2OBNA 5HE8A 1DAMA 1Q12A 2J0SA 4NYJR 3SOPA 4AIIA 3CUEF 4P0TA 5E7IA 4JKIA 1E9BA 3RRZA 1W49A 3QEOA 2FMXA 4P3YA 4QG7A 5DISB 1S9DA 2VA8A 2VHJA 4EQ6A 3BAFA 4AC9A 4U00A 1DARA 1G8FA 1JXMA 1W4CA 3P4XA 5JCZA 1AK2A 3GEEA 4OQFA 2Q9CA 1O87A 2G88A 3KJEA 1KI4A 3NKVA 1D2MA 2WPDD 2XITA 3KL4A 3DEFA 3B1WA 2ANBA 4LWZA 4XD7D 3KXIA 3TNFA 3A37A 3LDAA 4JKYA 1JQLB 1WDTA 3MD0A 5CIWA 3UWOA 3EXAA 1UM8A 2QSYA 3ASZA 3MLEA 3LFUA 4Q1FA 1IJEA 1ZCBA 2J45A 5BN4A 1WBDA 1JR6A 2AX4A 1VG9B 1ZD1A 3OZXA 1NKSA 1XJCA 2ZRGA 3DOFA 3GJ4A 1E2LA 1YU9A 1G8HA 2WICA 2D62A 1NVUQ 2D2EA 2QUZA 4A8JA 3CPHA 2BEJA 1V5WA 1ZNXA 2QP3A 1M7GA 4P4SA 4DLYA 3RS4A 2GJ8A 2MSEB 1G21E 1NY5A 4I1VA 4YMUA 4QKQA 4TZ6A 3PCRB 2ZU0C 3MWYW 3GD7A 1ANKA 4AKHA 5CB8A 1V43A 3WNCA 1KHTA 4TLDA 1EFRD 2HT6A 1HY3A 4IOKA 4UNPA 1E9EA 1ETUA 1XMIA 2Q9BA 2ZJ2A 1D2EA 5FI0B 3GEIA 5DN6D 3OESA 2VO1A 3C7KA 1NF3A 1FMLA 2IYWA 4A36A 2Z4RA 1NG1A 1Y3AA 3C16C 5J4YA 4EPWA 4B2PA 3JVUA 2N42A 4JLNA 2JJ2A 1J99A 2QAGC 3HJNA 4HUQA 2MSCB 1VHLA 3GMTA 3NHAA 4DSOA 3T1TA 2AK2A 5KHOC 2VP6A 2IX3A 4RSGA 3ZVNA 2VTKA 5JCPA 2BDTA 1QHHA 1YE8A 4DWJA 4JVLA 2YC2C 5FL7D 2ZQ5A 1D5CA 4TLEA 4NKRA 4BLRA 3QKRA 2O8FA 1E2EA 1NSFA 4A0FA 5EJEA 2DPXA 1KO8A 4AI6A 3AVOA 1G7RA 1WXQA 2OO7A 2NZJA 4RD6A 3KB1A 2QP9X 2ZRHA 1G4AE 2V6JA 4C0AC 1AJEA 4LBYA 2QT0A 2BMEA 2DHRA 1FTSA 1IY1A 1KI9A 5DSZA 5JEDA 5FPHA 3TBKA 3X1WA 1J8YF 4ZDWA 3QBTA 4IRUB 3WHKA 2ZYTX 3LVQE 1CJMA 1Q0UA 2R6FA 4A2WA 4C0BA 2AWOA 1F2TA 5A0FA 3TRFA 3QF4A 4GPTA 1W36D 3F5FA 5FUXA 8OHMA 1D6JA 1G8YA 5KUTA 3R7WB 1G64A 1KDRA 1XPOA 4LJ9A 1EFTA 4O25A 4MYHA 1KI3A 3TUJC 3D3QA 5J40A 1FPMA 4ARZB 3CX8A 4US1R 1JJ7A 3MGCA 4JL8A 1RIFA 2CHGA 3EWSA 4XD7A 2GF0A 3PR1A 4MKIA 2ZS7A 4EPTA 4G1UC 2ZI9A 2GVDC 5FUWA 1T91A 1E2HA 1CR0A 2WOOA 4C0HA 4IFBA 4D0GA 4LX0A 3LBIA 4HB2A 2PLRA 1E2PA 2GEVA 1ZNZA 4PHTA 2RGNC 1BYUA 2RMKA 1UEIA 3NC0C 1N6OA 3NWJA 1S1MA 2OCBA 4RCZA 3W8RA 5FOXA 1AZTA 3HP1A 2QBYA 1KO5A 1XB2A 2B7CA 4IKEA 4QRHA 5F98A 2LKDA 1XRJA 3QXXA 1YR6A 3I92A 4G5GA 2GXUA 3BK7A 2OFOA 1H8ED 5GVRA 1EFRA 3VR5A 2N46A 4HLUA 4C7OB 4AYWA 5DN6A 1E0SA 4AKGA 2H16A 3SU8A 3TUIC 1KSHA 4DLZA 3NIBA 4A0GA 4PC2A 4D25A 5LDDC 2PEYA 3GLFA 1A2BA 5AJXA 2ZR0A 4TL8A 3CX7A 1R5OA 5KNCA 1C1YA 1D8TA 4GMXA 5KSPA 1JQJC 1JI0A 4LHYA 2J7KA 2RHDA 2WKRA 1ZM3A 2RH5A 1GL6A 4TLCA 3VKWA 4Q9IA 3BJIC 2X2FA 4TL6A 1QHIA 3RABA 2KJQA 2DFKB 3C41J 1W2GA 4DDVA 2ZE6A 2EQBA 3M0EA 4I4LA 4CEJA 1E4VA 2G83A 2XSZD 3BB3A 3CNOA 5JWOA 3BFKA 5KDDA 3SYKA 1IN4A 2YWFA 3TAHA 1YZTA 2QGZA 4R7ZA 3DHWC 4GFDA 4HYYA 1M2OB 3CNLA 3UG6A 2IYSA 4Q02A 3QOFA 3D6TB 3T35A 4ZI3A 2AKYA 4B3XA 3EPJA 2QMHA 3AKYA 4QBGB 2BJVA 5G3YA 1EX6A 5EXPA 1XD9A 2C99A 1S1CA 1T3LA 1PLLA 3K0FA 1VHTA 4FCTA 2IYXA 4WOPA 3Q5EA 5L3SA 3LQQA 4LHVA 4TYPA 4MRNA 2OCPA 5C18A 3H86A 4PXAA 4JLOA 3IPXA 2QT1A 4HB0A 4B71A 1UBEA 4OKSA 4HZUA 1TEVA 1TQDA 2J5XA 4QHTA 4LV6A 1OV4A 221PA 2H5EA 5P21A 1GNRA 4ZO4A 1Z28A 4NYJQ 2AN9A 5DGXA 5EXSA 3SYNA 1NBME 1ODFA 1U8YA 2IEYA 3KDSE 1TL7C 2QPTA 3O8CA 2KBEA 3QENA 2PLFA 1LVGA 4M1OA 4QBFA 2IS6A 1E9DA 1VG8A 3AP2A 2HUPA 4IVPA 2VP2A 4WVFA 5FTNA 2IF0A 5HE9A 2YINC 4M8NE 3W6PA 4UXIA 1H8EA 4DDUA 3KJIA 2ZJ5A 4KFTA 3A1VA 1UJ2A 5D3MA 3VKGA 2V54A 2YOFA 4RFSB 2RGBA 1KOFA 2IWHA 2R9VA 1G7TA 2F55A 2CJWB 3A36A 1P2TA 2BM1A 2Q3FA 2XZOA 1VDZA 4CRWB 1PLKA 2ZS8A 2MMCA 4JIMA 1QHGA 3D7MA 4OQXA 5A4JA 4LGMA 3GLHE 3IEUA 2V4ZA 3KQUA 3UG7A 4RZ3A 4WZ6A 3L2OB 2IA5A 2BBWA 1S2MA 1Z6GA 2GCOA 2RB4A 3EW9A 4KFRA 4KSBA 4ERNA 1QG2A 1D9XA 1XDBA 4DRZA 1GRQA 2CCJA 1KKLA 2XSZA 1MRSA 2VP0A 1NVVR 3KKMA 4A0RA 3WNDA 1H8HD 3EWAA 2I1VB 3KJGA 1ZBDA 3B1VA 4LC0A 1XF9A 1Y63A 1YHNA 1E2DA 3ADKA 4YDSA 4A15A 1TU3A 1XMVA 4ILEA 1G19A 4Q7JB 4XVUA 2VP5A 2ZRAA 5AUNB 5KSYA 2B8TA 1OFTA 1ZNYA 3GJ6A 1JEDA 1G1MA 4HDCA 2HCJB 4TMXA 5LD2C 5F3WB 1HH4A 5TXGA 3G0HA 1BIFA 5D3QA 2F3TA 3ZQ6A 3V4RA 1DTSA 4XWKA 1KK0A 2RGGA 2GZHA 4Q5IA 3M4YA 1DADA 1KI2A 4ESHA 3ETLA 1L4UA 5G40A 1R0XA 4B73A 2IK8A 2O8DA 1E0AA 2ZJOA 3W9YA 1KMQA 3L8ZA 4PQYA 5GJCA 4HDOB 1NLZA 4FCVA 1MRNA 3ZD6A 3LY5A 4BLSA 1DELA 1CEEA 3QPVA 3A4LA 4PC6A 4IDOA 2WWWA 4IEIA 5CK4A 1SVKA 1TADA 4PHHA 3THOA 4NHOA 1RJ9B 2KI5A 3I4LA 3GPLA 2GCPA 3QBVA 4Q03A 2PJRA 4TWZA 2P6RA 1G4UR 2XZPA 1E0JA 3B6EA 3BE4A 3CZPA 2F6RA 421PA 3PEYA 4QM6A 3JZMA 2ERXA 1D9ZA 3LD9A 2RGDA 3I3SR 4MRVA 1R0WA 2YKGA 3PENA 4GZMA 4B34A 3NC1C 4U7DA 1AGRA 4MQBA 3P1JA 4JVSB 3THWB 4US0R 4RJLA 2QMUA 4MDEA 2ATXA 4NL4H 4LJ6A 1IN6A 3IDQA 3Q85A 2W6JD 4NMMA 2XXAB 2QMEA 3AVTA 2FE4A 1SVSA 1I4TD 2W0SA 4RD2A 3AQ4A 1YRAA 3LX5A 4V03A 2IYUA 5CJ2A 1HTWA 2OAQ1 5TARA 4G0NA 2V55B 5IDVA 4EIWA 3LV8A 3AVXA 2AWNA 2WSSD 1DEKA 2ZYVX 1SXJC 1ZM4A 1YQTA 2DY1A 3KX2A 3VNVA 4ESVA 4M9SA 3RNLA 3NH6A 3NVAA 4DLRA 1N6HA 1II8A 1WCV1 3HDTA 5DE3A 5FBQB 1H8HA 4D82A 1VCMA 1UADA 4X8LA 3FOZA 4L9SA 4G5RA 3FKQA 3U6BA 1US8A 4GNKA 1S9HA 2V6IA 3U44A 3K0AA 3U4QB 4Q66C 2ZRKA 3QKSB 1CJTC 1PUJA 3W5IA 3K70C 3EPLA 1E96A 4JJKA 1Q44A 3T06B 2TMKA 2G77B 1XEXA 3VX3A 4P31A 3DOEA 4URUR 1WP9A 5JECA 3FDIA 3OIUA 3KUCA 4BFUA 3T34A 4UJ5A 2JCSA 5EP4A 1KK1A 1YZKA 3IEVA 3EPKA 1A7JA 1A82A 3LW8A 3U60B 1KDTA 4JT4A 5EXTA 3TW8B 5JS8A 1N6PA 1RVDA 5FBRB 4E22A 3P32A 2XB2A 2F3RA 4AKIA 1SQ5A 2GEUA 4BPBA 2F9MA 1XP8A 4RD0A 3L0IB 3GFPA 5E4FA 1OXXK 1CR1A 4V0MA 4NDZA 2B92A 3SJAA 4C30A 2IUTA 2L0XA 1S96A 3EAQA 1Z6YA 3MRSA 5BYKA 5HCIA 5J4HA 3TLXA 4JSTA 1G7SA 1E2MA 3H4MA 4PSVA 1NL3A 4KITB 3BB4A 3GLHB 3U3KA 4EFNA 4XVQA 4NZYA 2NOAA 4D4MA 3WRXC 3TQFA 2OESA 2OM2A 1T6NA 3PUXA 2HJGA 2J0UA 3IHLA 4M9ZA 2WJJA 1CTQA 4OI4A 4UXHA 2GWHA 3AF4A 4W5WA 5KPDA 2CCKA 2VLIA 1NVWQ 2GZAA 4FXPA 1Q3TA 1LW7A 2AL7A 1OFHA 1XEWY 2VP9A 5EP1A 4YXWD 3IIJA 4LPSA 2W6JA 1XPUA 4GL2A 2ZU6A 3VKHA 4EJSC 1SVWA 4F93B 1G9XA 1Z6AA 4ON9A 3BC1A 4DIDA 5CYPA 2QE7D 1T0JB 1RFLA 1P4SA 3HU1A 3LBNA 2WTUA 3TR5A 4L8GA 3P26A 4QGGA 4M9QA 3QKTA 3ZVLA 4DKXA 2HCBA 2A3RA 2WSSA 2ZJZA 2ODWA 4ZCLA 2DWQA
chains in the Genus database with same CATH superfamily
5K8UA 3AFHA 4AZ0B 4D9GA 1OF1A 4EQ6B 1FFWA 3C7CB 1PK7A 4UPDA 3KHKA 4K9QA 1XE3A 2GSWA 2Z57A 3EZ7A 3T5MA 3V7YA 3P9PA 4JT9A 5J4HA 4B3JA 5E6SA 4PHGA 4ZJZA 4JB2A 3KUUA 5BWLA 2CVPA 2XVXA 3QKWA 5ALRA 3TSAA 4ZYWA 1XZBA 1ZQ1A 2IH4A 1EFHA 1FY2A 3HXLA 3KZ1E 1ITZA 3COWA 4LMRA 2C9YA 4F9FA 3EF3A 4O1MA 3AKDA 4CKZA 4NE9A 1J97A 5K0BA 2VAVA 3QY0A 1E9RA 1BD3A 1OWPA 3DLIA 4UEOA 4MR7A 5ALPA 5DU2A 5DRTA 5AVJA 2PR2A 2Y4OA 1XNJA 3B82A 1JEYA 4R41A 1MH1A 2FCRA 2H07A 5IF3A 1V7PC 2VK4A 4RJTA 5K4HA 1G9TA 3AIOA 2COEA 3MQ4A 4PPFA 3IVXA 4UBKA 3FPBA 4FX2A 4RBNA 3CRVA 1R37A 4U6SA 2X6RA 4KH0A 5TPWB 4Z54A 1GKUB 3T8YA 1A96A 1N5OX 4TVKA 1YR3A 2WSMA 2BEVB 3ZI4A 4QJ3A 3ZE7A 1O6FA 1EJ2A 4QARA 4I5IA 3W9BA 1GG5A 1KC3A 2HA0A 2Z2IA 3B48A 4OJNA 4ANFA 1VPWA 2GAOA 1BNCA 1GNLA 2AQ8A 4G5SA 3RT9A 1U0LA 2IUFA 3HLKA 2AFHA 1YO6A 2HREA 4YCDA 1GTG1 4K9DA 4HF7A 3DUWA 1DKLA 5AWFC 2CL7X 4BGEA 1XL1A 3DW1X 1GPJA 2PZFA 4LK2A 4MCIA 2KSQA 1RHMA 3EIXA 2ZRNA 3C8HA 1NE7A 4ZCSA 4EUNA 4RA9A 2BKAA 5T4FA 1ZM2A 1JDBB 1Q2UA 1PTJA 3F7MA 4I8XA 3H1GA 1QHHB 4FGKA 4KBGA 1Q0SA 3JQCA 2QROA 3Q1LA 3TFOA 4QBHA 4F92B 4I9NA 1E2NA 1DQNA 1KGDA 1IXRC 1KIFA 1Z2CA 3DF9A 3GEGA 3HHPA 2M1ZA 3MTJA 2XOEA 3N59A 5AIAA 4QTXA 1DKQA 4WI1A 2JLUA 2X3FA 4PYNA 4E0BA 3FNBA 2GNPA 5BUZA 2NZVG 2RJNA 1II0A 1N2EA 3DHVA 1CRPA 4C29A 1E6LA 2DSNA 3PJRA 1G8GA 1ENZA 1KYXA 5IAAA 1X42A 1UPCA 4DZTA 3GFSA 4MUEA 4ZVSA 1M1NB 3NDBB 3UKOA 2NQ2C 3DE6X 1J2JA 5AXCA 4BOYA 4PO1A 1QZ3A 1AZSC 2XV1A 1W6RA 2GLTA 3HL0A 1R0CA 3OPYI 3IXMA 3QQPA 1TMYA 4MWBA 5G0SA 1V48A 5HBGA 4ZHQF 4KMOA 4DJ5X 4XRGA 4HLCA 1Y9JA 1EESA 1EUYA 1Z83A 3OJCA 3HUUA 4IGEA 4WIAA 1U3TA 4ZVTA 5GM1A 5KDOA 1W4BA 2FF7A 4WLNA 4WLUA 3TTWA 4XASA 1WULS 1Z6TA 4KR3A 1CUJA 5K03A 4BNUA 1P0FA 3N2YA 5FULA 3TE6A 5AIBA 1W25A 3AXTA 4B4UA 2VQSA 2R5WA 2ZREA 5FBLB 4A23A 4GLFA 1MABA 4CQMD 1WZEA 5C4IA 4GZ3A 4PSCA 4S2UA 1XKQA 1YCFA 1TFRA 2YJ4A 1L5SA 1UFOA 3DMDA 4WXEA 3CRW1 1BA3A 1CERA 1P4AA 4KUEA 1XXLA 2E85A 2QORA 4M1EA 4OJMX 4B6FA 3FA2A 2FPIA 4WQMA 1F8XA 2OR3A 4QZVA 3PT9A 1SXJD 5TY0A 3Q7SA 2GTIA 2V6MA 4KFUA 1UC5B 3I2FA 4PYRA 2FR1A 1GQQA 3FLEA 4EX6A 4AXBA 1J25A 4D0LB 4NPHA 5K3DA 4P80A 5F4ZA 3G02A 2IU6A 3CPJB 3FD8A 3WYFA 5I3CA 1U6KA 1J0XO 3JZFA 3LUDA 1E1CB 1KI8A 4ZTBA 3AEUB 1CNMA 2XQVA 2YS6A 4KVAA 1I01A 5L4SA 5DMHA 4KEAA 2WYHA 1FS4A 2G4VA 3DZGA 4M4SA 4M9XA 4PRLA 4WN3A 2H48A 4ZEOA 3QWIA 4UBMA 1GGHA 4CQNA 4L27A 1T9DA 2I7CA 1TAUA 4JHLA 4BFYA 2JHPA 5IZ4A 3MRXA 1M6VA 4KUHA 5E4JA 2HR1A 1FLNA 1TT5A 2GAAA 3CO0S 3U61B 1OBFO 3WIDA 4AF8A 4CIWA 3T1VA 4DEXA 3L1JA 3NDPA 4RKYA 3W4JA 3SHWA 4D5EA 1YJ5A 1P18A 2G08A 2SKEA 2Q41A 1SCJA 5JO9A 5CA0A 5IJZA 2AR7A 2V7WA 5EJ8A 3U4AA 4BB0A 4PV7A 1R4MB 4KAJA 5IK2D 5K3FB 1J9ZA 2HHLA 2H1VA 3GJQA 3T7JA 1EMDA 3QQ5A 3E9DA 4NS4A 3IPCA 4DF3A 3FZYA 4EG7A 5D2CA 3FHCB 1RYZA 3K3PA 1UC8A 3GZJA 3WNBA 3VPFA 5F23A 4XDGA 1ZUWA 4J91A 4WASA 2PQMA 1SCIA 1JHOA 3FJOA 1FBTA 1ZCZA 2B1RA 1N32B 3SFVA 2BBOA 3PNOA 3V55A 3WG9A 4G07A 3WYGA 3COJA 2WD7A 4FPXA 1GUYA 3DFMA 1VTKA 3H5TA 1C1XA 3VPBA 1RQXA 1N5LA 1ES9A 1W36B 5A4MS 1NONA 4IUYA 2LPMA 4O2BA 4UUAA 1CKEA 2YMPA 2L2QA 3HLYA 4J1NA 5AOVA 3HK2A 2QEQA 3C3XA 4DEVA 1C0KA 2FPUA 3ESBA 1GZVA 3T3NA 2XUPA 3L8YA 2XZLA 3L02A 4ZYLA 2EX4A 3W8DA 1YQEA 5ICSA 4WL0A 3V9AA 3HWRA 3A06A 3LGSA 5JAMA 4WKNA 3U09A 2PD3A 4WJZA 4IIHA 4MULA 1CRLA 4KX3A 3WNZA 5JZMA 1KEWA 4HZUB 4EHKA 5F1KA 2GN9A 3G9TA 3H11A 2R62A 3MCTA 3I32A 1U0RA 1UOEA 3PCTA 1G5QA 4WVLA 3WP0A 3ND8A 1EGVB 1DV1A 5J5AA 1BMDA 4EVRA 1SXJA 4DMMA 4ENSA 3TMKA 3BGOS 5DM2A 3EGDA 4RFLA 1T1RA 4BHTA 1HORA 3WIBA 1T5OA 3AEXA 4D5GA 3KAKA 3VZQA 2CV0A 5BWCA 2O2DA 1IXYA 3KDPA 1V0JA 3F8SA 3CN9A 3AR6A 4LI0A 1TZCA 4FYWA 2EKPA 2JAPA 5LWQA 3D0OA 4LXTA 1H9CA 3ND6A 3VVBA 1YIOA 1EXVA 5ITZB 5FR2A 3L7CA 3R7LA 1Q7TA 2WRZA 3QBJA 3UC5A 1V26A 2P8JA 2IUYA 3IEKA 5FWYB 3OU2A 3QPUA 2QV0A 4MJXA 3UFXB 3WQSB 2BI4A 4UE6A 3RU2A 1ZOSA 5DLDA 3MD9A 2R00C 3V9PA 1YT5A 4NBWA 2J67A 4OB6A 4ZOLB 4RC9A 1AHIA 1CPYA 1JMKC 3DZDA 2NYAA 3T1QA 2VHXA 3JQ9A 4HXFB 4YGYA 1NLYA 3EQ9A 4MMYB 5LMNB 4CGYA 2P4EA 4IDHA 5FBVB 1CEYA 2GCOB 3RK0A 4HYQA 1T4CB 2NTYC 2PFGA 3CZ9A 3I5AA 3K94A 2QXTA 4XB1A 5EZYF 5H9VA 5IK2A 3UENA 3WZMA 4AN1A 4YJ3A 3HY4A 2PNJA 3X0DA 4KPEC 3I58A 1JFLA 3M3DA 2BBSA 1TCVA 2IYNA 1AO3A 4MYCA 3W1VA 2HGSA 4L02A 4D7AA 3DNMA 4BRUA 4PCUA 1DLIA 4RQUA 2Q28A 3FDXA 3OZWA 4JBHA 4ZWNA 2IXDA 2BGWA 2Y0PA 2QK4A 4HEQA 4JITA 4DT1A 4EATA 5E95A 1NMSA 1OB2A 2IE8A 4D9NA 4MLCA 1XZIA 5J5CA 2FZVA 1CQPA 3GLRA 4DSTA 4DDHA 4IFTA 4UVGA 1XIVA 2MYNA 2GLUA 3WDLA 4N76A 4Y2GA 5KYKA 3FUTA 1GUZA 3UCFA 2GNOA 5AVRA 4R2JA 4W7IA 3F6SA 3IRVA 2D5LA 2FJ0A 1TCBA 1L4NA 4AJHA 5CDGA 1IL0A 4KXNA 2I99A 3UQYS 5BRAA 3HJAA 3ZDAA 1N2JA 3TTVA 2I33A 4UREA 1T8PA 4Q3NA 2I3BA 2PL1A 3HL4A 3RUHA 5ITVA 3NALA 2RHMA 3OC6A 3O1LA 1ZGJA 4FHCA 4I4NA 4O3FA 4HLNA 1EJBA 5EE1A 1Q15A 5AW1A 3ONFA 4C0QC 2O1XA 3PGKA 3O8OB 2DQYA 5EUCA 4N8EA 1TJPB 1XEFA 1FF9A 4IDEA 4LYAA 1K3UB 1Z7WA 1LK7A 3ZBUA 2CUZA 1S4QA 3EMKA 1T8YA 3FDJA 3IAUA 1KPIA 2E6KA 1GITA 4RDXA 5J2TA 2RHOA 3H5OA 3JQBC 2PUEA 1NMXA 3KT3A 3N2EA 1X7HA 3AHJA 1SELA 1W94A 3M33A 5FL7A 1XCBA 3MILA 5EZ6B 2RBGA 3WB2A 1COWD 1KAGA 2B4RO 4ZEVA 3HC7A 3A1EA 5KQSA 4TWBA 1SU7A 4JI4B 2F9FA 2YASA 1QRAA 1UDWA 3AWDA 1TX4B 4XB2A 3V1TC 3DFIA 1T4MA 2FEOA 1ZNQO 3QG1A 2QY9A 4KN9S 5F73A 4COOA 2R4TA 6REQA 3MTIA 2MSDB 3IODA 5EXDA 3IJ5A 2O5RA 5AJHA 4KWIA 5CXSA 4G0MA 4V0QA 1ZJJA 3ZQ4A 3KEFA 1MA3A 3W8EA 4C2AA 4ZJPA 1FJGB 3AY7A 3OWXA 3ZGOA 2O52A 2WHPB 3ND9A 2NYRA 4CBVA 5HEKA 4QJ5A 4QTTB 3CE6A 4YDHB 3C39A 4W5QA 4IKPA 4RDCA 3Q2IA 4U8HA 1Q1EA 4IDFA 3OCWA 2WD8A 3Q3GE 2B5WA 4A9AA 1EWQA 1S2DA 4YFVA 3GZNA 2FXVA 1ZRHA 1PV2A 1RWXA 1H4QA 1B74A 3PUHA 1WZCA 3AF3A 2XB9A 4HAYA 5B37A 2DBZA 1SCNE 1ZH6A 1PD0A 2W22A 2JLWA 1KBZA 1OXVA 4GXQA 5B1DA 2WJHA 1L5LA 4DGSA 5EVCA 2D7CA 4Q15A 3W2IA 1AKRA 1VBKA 1X1QA 1Z6ZA 4ZANA 3AJ8A 4OHMA 1V35A 4Z8YA 4CWAA 5B7NA 1MDBA 4EI2A 4UAUA 4AMBA 1X7WA 4ZAFA 3ISTA 2IYFA 3DJYA 3IAM6 1C81A 3DB2A 1E98A 1Y4ZA 4D92A 1MO4A 1QOQB 3RE1A 3OIFA 4KXWA 5A71A 4EGCB 3ZLUA 4RAOA 1VG1A 4CMBA 3UHFA 4ZN6A 2J1LA 3G0GA 1XKLA 2I6XA 1M6HA 1EK6A 1OFGA 3CXRA 4GI5A 1XPRA 1J2YA 1X77A 3ABSB 1OROA 1S8AA 3NTOA 1TT7A 4IXMA 1NN1A 1MOSA 1P9OA 3EYWA 2C07A 4NMXB 1DT5A 3UB4A 1U5AA 4UOEA 3N70A 3RASA 3SIXA 2OQRA 3ZZ0A 5BNTA 1N9KA 5LMCA 1AQNA 5A3SA 4LCBA 1I2CA 1L8QA 3CKKA 1I36A 5D5QA 3IP1A 5DPMA 2JLQA 4AYTA 4G0OA 1F14A 1N75A 3B3FA 5I4KA 2QHXA 5GJVC 4ER7A 1RHKA 1ZW1A 2BFEB 4JBYA 1EWTA 2HJRA 2H54A 4WFIA 4FFLA 5BW4A 2FGJA 2YJ6A 1NR1A 4YV7A 2V1UA 3ZDZB 1ZGAA 3V33A 4RVDA 4A0HA 2ZSUA 4FFBB 5LP6A 1LUAA 4D80A 4UC0A 3LL7A 4L5JA 5M5BA 3UAXA 3JRWA 4JI7B 3K1TA 3IYLW 1Z6QA 1V9SA 2ZYGA 1K7YA 3GQVA 4UDNA 1COWA 1BWSA 1E7MA 4G23A 2WU1A 4KLZA 4HZGA 4NYIR 4PPYA 2I62A 3RS5A 1FFHA 1Q0ZA 3B5EA 3A7DA 5FPQA 4L5BA 5JISA 2P2GA 2UZ1A 3PDJA 3VMFA 1UAYA 4B47A 2XVMA 2PR7A 1YJAA 2NUPA 1GYPA 3N2NA 5FNVB 5CYOA 1XG5A 1D4ZA 1NA5A 4D44A 4ARIA 4HPWA 3EVZA 3LUPA 3LLUA 4P0PB 4E12A 1X8KA 4ESEA 1J90A 2VVTA 4YR9A 1QYRA 2CL0X 1ZK3A 2QZZA 1V5FA 2PBLA 4YASA 3RRJA 2PT5A 3UFBA 4Z1OA 3JY6A 1SZPA 2FPRA 3QXCA 4LDRA 4GZ5A 4Y7CA 1A50B 2VSQA 2ROQA 5K0FA 3P9NA 1CIVA 3QUAA 5A3JA 4JYAB 5CDTA 3MS7A 3U7FB 3BXHA 5LOVF 1UWLA 5ALNA 1Y1RA 2X4IA 2DPMA 3TOVA 1QGUA 2P4SA 5K3CA 1U2DC 1YNOA 3BFVA 2EKDA 3OICA 4ODIA 4R2XA 4G8JA 2YHAA 3KV3O 4ADSG 4TMFA 5K8LA 1PZGA 1EFDN 3AKEA 3SZRA 3ABIA 4CUJA 1N9ZA 4XGRA 2QRUA 1GRCA 2BF7A 3K09C 4LYJA 3CZAA 4AMZA 3K6SB 3LCCA 4LBVA 4TTQA 5E6SB 1ORIA 2EQ5A 3TFWA 1G63A 5ELXA 2G82A 4R81A 1JEOA 4ZQIA 1V8ZA 1JDJA 2ZIAA 4G25A 5HUQA 1HX7A 3KWMA 4GSLA 1UFQA 3STXA 2A0YA 3OE4A 2AUNA 2F1HA 3BWCA 3SR3A 1ODCA 1ZM7A 1BX0A 1KIAA 2QZ9A 3GP8A 5CM8B 1SULA 3BWXA 1MT0A 2EBFX 2BC9A 2WK1A 4OJKA 4MLDA 3ODPA 1ESNA 1NJFA 4DILA 6GPBA 1XCGB 2MINA 3FFBA 4MR7B 4QTUB 4E2FA 1MB0A 4M8KA 3S5UA 3SHFA 4C20A 1JEYB 1AS2A 3OU7A 3HWWA 5BV7A 2PGJA 5IU6A 1HURA 4TYMA 4IO0A 4TYNA 1HDYA 2JLYA 3WISA 4U5XA 2FYTA 4EHAA 1R3UA 1QHSA 5JCJD 3R2JA 1LDMA 3R5KA 4XIGS 2Q5OA 5KNDD 1LVUA 3TZLA 1YFJA 3V2HA 3EZ2A 2WWRA 3M1IA 4MRSA 5EKUA 1TC2A 1TKAA 2VAPA 3LS2A 4LISA 3ZNPA 2WZDA 4EY6A 3UBMA 2IYVA 4LE2A 2EBHX 1DC5A 1JV2B 3R7BA 4NBTA 4E6PA 7ABPA 4YR7A 2Q4TA 1OW3B 4NQZA 4ONEA 1E0KA 2AFHB 4HAVA 4NE2A 1MX5A 1X92A 1H2HA 3I8XA 2PT7A 4FHZA 3KU1A 4M22A 4EEXA 4LOLA 1OI4A 3QVKA 4WY5A 1I6LA 3KE8A 4XVHA 5AKKA 4ETNA 4R0MA 1A95A 2IH5A 3A6FA 3JQ8B 4MB0A 1MIOB 2DLNA 4IFIA 5DGCA 4PNPA 1Z8DA 2XXBA 3MCAA 3Q41A 2XTAA 1ULSA 5BV2P 1ZIOA 2X8WA 4TKLA 1M34E 1Y6FA 1GA6A 1M8KA 1Y42X 1P73A 1RACA 3WQRA 3ZYCA 4WACA 3L0SA 4B4WA 3RHZA 1LI4A 2NXJA 2WDZA 3TPZA 2FWBA 5THXA 4AN4A 2DHDA 3NANA 4D6XA 2X41A 1ZCFA 4EO9A 1JKIA 1YZ3A 3AERA 3BREA 2GQ0A 1YCHA 3R0QA 5K8IA 5LP1A 5EXXA 1EI9A 3IXQA 4QPZA 1YC2A 4PZPA 4GBED 3T0FA 4E07A 4K6MA 1N2CE 2ZIXA 2Q49A 2ZBUA 4A91A 2P30A 4CL0A 2WIAA 3G0BA 4YROA 4EHBA 3JU3A 4KW7A 4UHCA 5JXGA 1EDDA 3PS9A 3FKJA 1OH5A 3KUKA 3L8GA 3T9AA 1YFKA 1QVZA 1SUDA 1T6BY 2WNSA 4LF5B 3C5WP 4JP2A 4AP5A 1YVRA 1I7PA 5BV8A 5JXWA 2VPPA 2GBLC 1A9TA 4KIGA 2J4DA 3CRNA 2F3SA 4EY8A 3GFVA 1SHUX 3C8UA 3UMCA 1JZQA 1XJ0A 3IA7A 3EX7C 3QWAA 2HRCA 3QU7A 1GPAA 1MABB 2LP4Y 2L69A 4Q1EA 1QIMA 1HZZA 1P2FA 2QM8A 2PWYA 1GCGA 3BT7A 4TSKA 1FRNA 3ZGXA 1T10A 2V7QD 5G02A 4PAOA 3PQFA 1U98A 5HJ7A 4OI0A 4TMTA 4GMFA 3I39X 3PLNA 2VT6A 2PFKA 4GOXA 3VDQA 1KZ7B 4OFZA 1JVSA 3SYMA 1F4PA 2ZM5A 1EA5A 1HFWA 2PGAA 3AFNA 5EUMA 2GXAA 1UCFA 2Q5EA 3GBVA 3BORA 1KTVA 1N0HA 1UPTA 1W73A 3NEPX 1W5TA 2GD2A 1T15A 3CUWA 2B5OA 5JCJA 1D7OA 1J42A 1N2HA 2ZTMA 3K5WA 4POAA 3WYAA 5KNDA 1AGPA 2JLSA 2O5EA 5SYAA 4J0QA 1GM5A 1LB1B 2IXGA 1T0PA 4N5DA 2Y77A 3PCXA 4JBIA 4WFKA 1P17A 3P52A 1KY4A 1S02A 5MDHA 3IPYA 4YAKA 2BWJA 4ERXA 3MPOA 1KY2A 2GJAA 3F78A 2RGNA 3N05A 5ICCA 3U37A 1WKCA 1C29B 1ND5A 3I1FA 3GVHA 4D45A 4TV9A 1X9IA 1HK7A 4YFYA 2PWPA 3EARA 2FMKA 2HJSA 4R5HA 1KL7A 1M6VB 3AVPA 1P1FA 2EG5A 1B8OA 1JPVA 3O93A 2NSDA 2X40A 3F9CA 4CDGA 5LQJA 4HQFA 3QUQA 5A0TA 1Q6YA 1RJFA 2IY9A 1CUIA 2REXB 1HDCA 5CA0B 4QXPA 2PWAA 5E3IA 2P3QA 3HCOA 3ABQB 3ZCQA 4NBUA 1DCFA 4WKBA 2ZSHA 4V0LA 4FM9A 1Y1QA 5KWEA 1ZHHA 3T5DA 1L5QA 4BE9A 1OTYA 1SHKA 1VCOA 4L2IA 1ZJ6A 4L0QA 5FI3A 2P90A 2W83A 4LI3X 3NT5A 3A0RB 4Q7KA 4DB2A 4Y2HA 1AKQA 3L7NA 1I4OA 4IH9A 4NZPA 5LZ5A 1J06A 3O3MB 1S2GA 1YB5A 2WUDA 4YLGA 5BPHA 4QG3A 5HR5A 2C0CA 1P0QA 2WKSA 4JEIA 2XYQA 2A9JA 4L50A 4II3A 2EP7A 1L4FA 2PO5A 1E9VA 2ZVPX 1H3NA 2O50A 3HRHA 4KQ2A 4XJXA 2WD7B 3ROTA 1EEHA 2HQSA 3H19A 5CW1A 5B6IA 4KRXA 4BO4A 2Z2YA 3DKRA 4HFNA 1OH6A 2ZJBA 4O2BB 1Z2NX 4DUPA 4Y6OA 4ZYXA 3ASVA 1VL5A 2CWWA 4D2IA 1X80A 3IEMA 2E87A 3R9IA 4OQMA 3WC4A 4BX8A 5CITA 3B5IA 3I8SA 2VJYA 5FO0A 1IPEA 2ADFA 1NLUA 4LYHA 3PFBA 2AE1A 4UJ3A 5AM1A 1ZIXA 1NVEA 3HQ4O 4Y0VA 5U4QA 1E99A 5IHPA 1ZHFA 3N2KA 1N9GA 2NSLA 1PNTA 2EWWA 4BLTA 4ZI7A 1YJ8A 2C7GA 2YHBA 3L6UA 2V7QA 4J0EA 5DI9A 4HL6A 4YIKA 3SJBA 3WBBA 4JI8B 4Q9AA 4C4AA 3QYJA 3H11B 2C78A 4F5DA 3LUFA 2I4MA 3MUNA 1KQ3A 1EWYA 4CM4A 4RKQA 3CW2A 3E7XA 3FBWA 2H2DA 3MELA 4IP0A 1D1TA 1HLPA 1QR2A 5FPTA 3EGDB 1REQB 1ST2A 3JSAA 1QNFA 3L8MA 3CTPA 1JKJA 1XVIA 1Z8NA 3LP8A 3VNAA 4A3SA 4DXAA 4HWSA 4H1WA 2G4CA 4GOKA 2O5CA 4MVYA 2JIDA 3TGLA 4BAZA 4MRRA 4G56A 4ZICA 2JZNA 3EIFA 3BSWA 2OSBA 3IHWA 5CLIA 5JAHA 5KC9A 4ITVA 3TM4A 1OU4A 1XTBA 2C4VA 2XB4A 4M89A 1OBHA 1USWA 4MUHA 4EJMA 5K0GA 2AOXA 3HBJA 5B3JA 2P7IA 3AONB 4PQGA 3MCZA 4IQ4A 3OIGA 1AOXA 1G0OA 2HDWA 3HUFA 4JSRA 3L40A 3BG5A 3T15A 4QDKA 3GCDA 1SWVA 4C7XA 3NHMA 2YH2A 1A5ZA 2IXEA 1ZAYA 1AF4A 4PGFA 1LLFA 2J41A 2Z04A 2ZE7A 3BCHA 4D81A 2W2QA 4Y0NA 2Z5LA 1YHYA 2QL5A 2IZZA 4H4CA 4PC1A 4L9RA 1F2TB 4FFOA 4OHPA 1BD4A 2GAJA 1MEJA 3EBLA 3IAAA 3HN7A 4WD3A 5BO5A 4HLDA 1LNZA 5J59A 2QIPA 4L57A 3E8MA 2RGEA 2ZRFA 2IP1A 1HT3A 3CPSA 5DYIA 4X64B 4E2WA 1FX0A 3Q9NA 1EVYA 2QX9A 4GX0A 1L1FA 3M9WA 4P7JA 2PEZA 1T2VA 5DLYA 1VRVA 1T3HA 2VYVD 3M4JA 4YJ3B 3HNOA 1R8XA 2G40A 3ABRB 5BNZA 2KYRA 3CF4G 3DT8A 1L5OA 3IBCA 3P97A 5KMGA 1JAYA 2O2HA 5EI5A 3UMRA 5JHGB 1H05A 3CLKA 1JHXA 3HH8A 3TNYA 5I01A 3E70C 3SNKA 1T8TA 2ZTSA 1B6TA 3W5UA 1SEVA 2OUKA 1FYFA 2P78A 5DSTA 4DT1B 2ZRLA 2NYVA 3KZKA 1OFVA 4MKRA 1XTIA 621PA 3SWWA 3AVQA 1CE8A 4W8GA 4TTRA 5EHZA 4PXSA 4MGZR 2FE1A 3OFJA 4ZMSA 3M7IA 4A6XA 4UZEA 1Z5NA 5DNDA 4DV5B 3W5CA 4RY9A 4I1PA 5JLJA 4G67A 2EFDB 4ZZ0A 1FTYA 1E66A 2AN5A 3FTCA 4BP1A 4QM7A 4YRLA 1AMOA 3F6BX 1U63A 2ERCA 2C97A 2VDUE 5C7IO 5IKXA 4HMOA 4O6VA 4YC7A 3OE7D 5DM4A 4QQKA 2ZSIA 2IDKA 3P45A 3LNCA 4PN3A 1FNBA 1QVAA 5AI5A 5C8YA 1SOWA 3GRVA 1CJSA 2P0AA 2A9RA 2X4GA 3K70D 1U8ZA 2J87A 2WVAA 5BWMA 3PIDA 3MMZA 1E2IA 1CUFA 2QAJA 2Q3MA 5AVYA 1DKOA 3IQGX 4J0CA 2QTHA 1SUAA 1I0ZA 1I2BA 3OM8A 2GYWA 3CVWA 2QUBA 1UXHA 4IL5A 1MOPA 4LQCA 4CMKA 5J2TB 2PKYX 4PSKA 3W5DA 2ZUEA 4I5EA 4GL4A 4IJVA 3L8HA 3Q8XB 5ERYA 7MHTA 1ADYA 1YVDA 4N0QA 4JB3A 1Q21A 2A59A 3NO4A 2BCGY 5HCNA 3DV0A 1ECFA 3AF0A 1FU4A 3VHLB 2IVZA 1L8XA 4MHOA 1IFXA 3WWCA 3VPSA 1Y0BA 3LBFA 3LUJA 4BRZA 3F73A 4AS2A 2PRJA 4PO8A 5CLLA 4EHIA 4L3VA 5DDIP 3ZN2A 3LXRA 3BHIA 4XI9A 4EVSA 1IAVA 3LKZA 3KTOA 3OCXA 1GOTA 3ZIAD 1K7FB 1CR2A 3P2JA 4UAVA 4XDZA 4EUFA 3DYVA 4WJLA 4XGIA 4GPIB 3BE5A 3IAFA 3UW3A 1X14A 3QTTA 5HBRA 3RSLA 4ISBA 2XCLA 2FSPA 4MEAA 1RT9A 5LZ7A 3GLGA 1X0XA 1WXXA 2RHRA 4F3TA 3MCVA 3ZU2A 4EEKA 3X1DA 3VR6H 1NI3A 5F1PA 3D8SA 4Q9KA 3RSHA 1JNYA 4ECEA 2XTNA 1CFJA 2FUNB 1U9JA 1JAIA 3GZNB 3KAQA 2GZDA 3F8WA 2DFNA 1NNI1 1P4HA 1XZAA 2VYVA 2WWHA 1XAGA 4WHMA 2PUAA 1QG4A 5TMEA 1OBVA 2BHNA 2WOJA 3K0CA 4B81A 1HKHA 4DBVO 1CP2A 3DMGA 1AUVA 2ONCA 3GFOA 4ZVRA 1MTOA 1DWPA 4N47A 2ZSJA 4MW2A 3PFIA 1YGPA 2WIDA 4M1WA 3FWHA 2PQ6A 1CULC 3GLTA 4MJ3A 1X7WB 4PLCA 1V6SA 2Y1GA 4B2IA 3QHPA 3O2JA 4V38A 1RVV1 2G71A 2QG9A 4C4YA 1Z2DA 3ZHXA 1CJCA 2O8BA 1UKBA 3HJTA 3I5MA 1SIBE 5IAGA 3TI9A 2NO0A 3OY2A 1XN1A 1K89A 1XNQB 1KOGA 2PRIA 2X0IA 4D99A 1YZHA 3K9GA 1PL7A 4IY1A 3VKVA 3NG1A 4RO0A 4US2R 4RETA 2BH9A 2X0JA 2QA5A 1QO0A 1CIJA 4R83A 1A9YA 2CLCX 3OE7A 4MZDA 2G09A 1Z0IA 3LWNA 2PBZA 4C14A 4CW7A 4DEYA 4XIYA 3EMBA 1E6CA 2BRUC 4QXAA 3P0FA 4ALKA 4GW3A 3I9LA 4UNSA 4E21A 1EINA 4HLQB 2ZPUA 2LVBA 1A9ZA 3VRHA 5KYXA 1K08A 3OOEA 1L6IA 1LK0A 2XBLA 1FRFS 2W6OA 4QU0A 1ZMOA 1H0KA 1CUZA 2GEDA 1T1IA 2P7HA 4E14A 5C8VA 1N0UA 2OXCA 4KN8A 4BWYA 2WD9A 3K73O 1W581 4EPRA 1JSZA 1QHXA 2C20A 4PLZA 1SIOA 1WCXA 4UTOA 3TBHA 5C5EA 3DXZA 4RHFA 5LP6B 3F4LA 3LC1O 1P72A 2OTCA 3UMGA 2UYCA 1P6QA 4NCIA 3BRCA 2SKDA 2IWRA 2HT1A 1OPXA 1QQ5A 2C7RA 5ARDA 3FB1A 2P77A 3W2GA 1NP3A 4W7SA 4EW6A 4EB6A 1HDGO 3RVBA 2UZ1B 4WEQA 3LECA 3QPWA 4BMCA 1NVXQ 5JC1A 1X6VA 2GOYA 3F1LA 4M0DA 3I09A 1N8KA 1P2VA 1QFMA 3FHTA 2CHVA 3R23A 1Y7TA 3ZJTA 1C9JA 3VHQA 2R48A 2UV8A 3S2EA 3L7IA 1QKKA 3ZIAA 4JOBA 4XYLA 4M3NA 3AJ9A 1KAEA 5TR9A 3I5YA 1U0OC 1XTJA 2HYDA 3BL6A 3BJEA 5D8DA 5HF8A 3S2IA 3VVMA 4YT2A 2DKNA 2ODAA 3FHJA 4QGAA 5ES3A 4YAIA 1G20E 2QW1A 1DC3A 1CUGA 4OO3A 1NXWA 1RDFA 2DR2A 1QGUB 2XB8A 3ZD9A 2G1JA 1MR3F 2B8JA 3IUNA 4OVKA 4R0VA 2JVKA 3ZWAA 1TO1E 3JZAA 4GMGA 1CY8A 2PMKA 2HIHA 1YV9A 4UARA 3Q3CA 5EFOA 1F8GA 2OCKA 1HA3A 4WY2A 4B09A 2GH1A 4RV4A 3D3EA 2ODEA 2R84A 1MO5A 1M5UA 2W6MA 1VSUA 4KSCA 3ON5A 3PFCA 3Q8WA 3V8NA 5HPYB 1O94D 2Z3ZA 2OZEA 5KYUA 1WIWA 4H3HB 1RRGA 4PBSA 4RKEA 3MFYA 4F38A 3TECE 3VV3A 5B2FA 2QW8A 1G3IA 1Y4SA 1H0RA 2XIJA 3H1AA 4G26A 3A6ZA 4BFWA 1AT1A 1GO2A 1SBCA 2G1AA 4OYHA 2PA0A 1MLDA 2KMLA 3TQRA 1XDDA 2XKBA 3I3OA 2Y1OA 4MV0A 4ZVMA 3HA5A 4LE0A 4QHSA 6ABPA 2PUDA 4TXHA 2PYIA 4F7DA 4PG8A 2EXXA 4RTKA 1YRQA 3PL1A 5JSYA 3DMPA 4YQFA 2J5KA 2Q1YA 4JUCA 5IZCA 4RKRA 1LTQA 1AUXA 1CUEA 4DMLA 1PU2A 3AGQA 1U0HC 4LV5B 1TIKA 2O06A 1U2QA 2XRYA 2OLJA 1PSZA 3AEKA 1JG6A 5ALIA 3CCCA 4MITA 3BRQA 1L5KA 1SBNE 1FXUA 1BWPA 4MQEA 2OC9A 3L9WA 4Y1RA 4PANA 3V3KA 2A1TR 4QULA 1XRLA 3ZD7A 4A0QA 3BMOB 3CWQA 2IYQA 3IO5A 2W43A 5KTRA 2VJOA 4WCDA 3BS4A 1WDMA 1NN0A 4IGKA 1PJBA 2BUBA 2R96A 1QYIA 3D8TA 4JJFA 2BW0A 5ALKA 1IHOA 4JUAA 3W04A 2G7ZA 1UBTS 1TUBA 3IVAA 2F2TA 3NXSA 2RHWA 1DZIA 1U3DA 3GRFA 4NIMA 1ZAKA 4RGYA 2VHEA 3UMBA 3WHIA 3L01A 3H7IA 4LCJA 1KMCA 3E9QA 4KR7A 3HLTA 5A1TA 2RI0A 3HGQA 4R9SA 2TMDA 3SIPA 3ZY5A 4D43A 4RK1A 5EN4A 3U44B 4BX3A 1TM1E 5IT0A 3AERB 5KOJA 2HMWA 3ANNA 1QTIA 2JGFA 2QTWB 5JFTA 3NTLA 3O26A 3RVOA 1NTOA 4I9FA 4AURA 1L5YA 4WK4B 4F4HA 2GA8A 2Y1WA 1PFGA 3NKFA 1J8DA 2BLNA 3DL2A 4IG9A 1OR8A 4X85A 1P7CA 3PE6A 4KE8A 3LBAA 2XUFA 5KKNB 1GILA 1PR3A 2OP1A 2C5BA 3OZBA 4GM1A 4I1SA 4NBLA 3KXKA 2XA9A 1VL0A 4HDRA 1E7YA 3JXEA 1HLFA 1KH2A 4I6GA 1UL1X 1V41E 2WHRA 4AJ1A 1LSJA 1MN6A 4BFSA 4ZU6X 4AF6A 3RT7A 4LZPA 1O94A 3W5BA 1ULHA 2FI1A 3RVQA 1BXGA 4UVDA 5BV1A 4NFLA 3UMFA 4KOEC 1L5NA 3WX0A 1I6WA 3WGIA 4IHAA 5ALVA 4BZXA 1O4WA 4C87A 3VXKA 1FW8A 3O4VA 4OJYA 1GVNB 3HRKA 3R20A 5IBPA 2C8JA 2VI5A 3IP3A 4B85A 5BR1A 3DMNA 1OE0A 4EBFA 4L4UA 1U31A 4Q7QA 3KS9A 1PO7A 2CL5A 1OJLA 5HG0A 4AZWA 5KPJA 2BHSA 2BMFA 2VDNB 2D5AA 2WJ6A 4QYIA 1EQ2A 2P6UA 3QFFA 1JG7A 3Q7RA 3G89A 2ID4A 2MU1A 4RVFA 3SX0A 3W34A 3GAAA 3T3PB 1KTIA 2V0NA 2O4CA 3LUHA 2Y93A 3G8AA 4IMJB 5AM2A 2QDKA 3H75A 5JCXA 5KB3A 5KNCH 1RI5A 2K87A 3JR3A 3VX4A 3CLTC 3X1JA 1WUHS 3N3BC 3C7DB 4FB4A 1JN0A 3ZDBA 2HU2A 2YHUA 3GG9A 3BM5A 3E22A 4JOSA 5HZHA 1PVVA 2EWVA 3A1SA 2ZBFA 1XVAA 3RC1A 4ARZA 2IOFA 4M49A 4L1KA 3D2AA 4I50A 4EB3A 2G6BA 3HXKA 1U2EA 1ZRNA 4PO3X 5HKKD 2I7DA 2WJ4A 4PFKA 1LW6E 2D1FA 3VGJA 2XMDA 4JYCA 2TYSB 2WF6A 2OA0A 3TE7A 2WSIA 1AIPA 1MQ8B 1TGVA 2AJTA 3RUAA 5JI3E 1R9GA 1GL7A 3NHBA 1XTUA 1EJ6A 4ICIA 3PD0A 3RIMA 2HHJA 2J3HA 4UNQA 1IU9A 2M32A 4HAIA 2J59A 1EUZA 4JLPA 2IC5A 2OAP1 2UVQA 3H5RA 4L2IB 1TCCA 2FW6A 4OB8A 4S3MA 1IQ0A 5H8WA 3FR8A 3TH5A 1IXSB 3S1LA 3RRMA 1TXGA 1I13A 1Y7PA 1XYVA 2VQDA 2DR3A 1WDKA 3IV7A 1YAHA 2BFAA 1YC5A 2FA9A 2PRZA 1BXKA 1JHPA 1H2RS 2B2CA 4ZYYA 5D6NA 1SURA 1EP3B 5C35A 5JASA 2HKIA 1JILA 1X3SA 1XQXA 4RSHA 1Z74A 3BXGA 1H85A 5KOHB 2XYGA 3PUZA 5C52B 3PEUA 2UZIR 4QUJA 3G0IA 1O03A 3WLIA 1I51A 1QPBA 4BJ6A 2JL1A 3QU9A 4BVHA 1WOMA 1VHQA 2C2KA 1LJ8A 2F3PA 5AO9A 1AXRA 1D8AA 2ISQA 1X80B 3HFJA 1I6MA 2BF4A 5CGZA 1R18A 4C78A 1VIVA 2I7TA