4HDCA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk: compound 41)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 84
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdcA00
1CIPA 3KQLA 4LK2A 2Z43A 1SKYE 4B3FX 5HE9A 1N6LA 4AG5A 2ZSEA 5FBWB 3MCAA 1JNYA 2ZRHA 3KQUA 3AVPA 3TLXA 4G5SA 5JBQA 2XTNA 3BGWA 5AK0A 3IHLA 1ZUHA 3PUWA 2JJ1D 4AIIA 2ASEA 5JWOA 1TTTA 4WXRA 4V02A 4US2R 4DJTA 1NP6A 4RKFA 4IRUB 2HEIA 4CVNA 2A9KA 2QPAA 4I1UA 4PQYA 1KZ7B 1ODFA 5DNYB 1H8HA 4M9XA 3NBZC 4JLOA 4EPTA 3U44A 2MSCB 3LD9A 3R9XA 5H1YA 1I2MA 3ZD7A 3T12A 3OIVA 1XF9A 1GAJA 1TNDA 3JZAA 1BO6A 2FFAA 2ZR9A 3BH7A 5KSOA 1NVXQ 3RS7A 3BB1A 2YWGA 3DM5A 4Q1EA 4Z54A 2JIZA 2VH5R 3CX8A 3BWDD 1QVRA 2AN9A 4G3XA 4OHWA 5CIWA 4TQAA 1UM8A 1XJQA 1HUQA 4YXWD 1ZM7A 1P2VA 2UZIR 1MABA 4HAVA 2GNOA 2ZYVX 4HUQA 4W5WA 3RWOA 4D0LB 4B71A 1Q0UA 2IYXA 4DLWA 1KIMA 3TAHA 3TSOA 3TKLA 2ZU0C 4OHVA 4TLEA 4CIDA 3SR0A 3GLFA 1ZBDA 2PLRA 1FZQA 4BRWA 1KY2A 1W7AA 2VHCA 1XTIA 2VLIA 3H1TA 3FVQA 4WIAA 1KDTA 2DWOA 2BEKA 1Z07A 3H84A 4JLDA 2ZRGA 1G5RA 1E99A 1EFTA 3PJRA 3Q85A 3K0AB 3O8DA 4V0LA 2FU5C 3RABA 4QFMA 2H92A 1W2HA 4M1YA 1XTRA 1N5KA 3RSOA 1Z8FA 2WBLC 3SN6A 2ZI4A 4QJ3A 4YMTA 3R8FA 2GVDC 3A4NA 3BH0A 5D3QA 1OIXA 3MG9A 3PQCA 2O8EA 3K9HA 3NXSA 1RRFA 4PPFA 3EA0A 4LJ9A 4HLDA 1XX6A 4OK5A 1SULA 2IF0A 5JS8A 2VSXA 3V4RA 2EFHB 4DUGA 5EZ5A 3ZJYA 4HUQB 2IHYA 4MYCA 2J0UA 4XSHA 1QRAA 4HI0E 3C15C 3TH5A 1DTSA 2YZ2A 4BFSA 1YKSA 2XZLA 4IDQA 1M7HA 3K9LA 5JS7A 1G17A 2O8CA 3NH9A 2UKDA 2A3RA 4R9UC 3SC3A 2V1UA 4LY6A 3FKSD 1W0KA 3K8YA 1P9WA 4QNRA 4EFMA 3KQHA 1OHHD 3O8CA 1ZC3A 1VG1A 2EWVA 1KJWA 4RFSB 5FUXA 4HLQB 1Z0IA 5FUYA 1X3SA 2P5TB 5JCZA 2QRNA 2JLRA 2IW3A 4RD1A 4L8GA 1NF3A 2R6CA 5GVRA 1U0JA 2AWNA 3LW8A 4B76A 3NBYC 4EFLA 3N70A 1ZINA 3THXB 5CJ2A 3GJ8A 2WIAA 4MGYR 4TL8A 2H8KA 3TNFA 1ESNA 3WP1B 4B2PA 4QGAA 3L82B 2ECKA 1YRAA 2YYZA 2ZXUA 4ZDKA 3CRQA 3AEZA 2VEDA 3RS5A 3RRMA 1IOZA 1TUEA 2B8TA 4NL4H 2OLJA 4LJ7A 5J40A 2A7QA 3EC2A 3KX2A 3CNNA 1YR7A 3B5JA 4WAUA 3OE7A 2AKAB 2FPLA 2DWQA 3VR3A 1NN5A 1UAAA 5J5CA 4QXAA 5DSZA 2WWXA 4HDQB 1ZRHA 3VR2A 4HATA 1ZM4A 1E2MA 2FOLA 2QY9A 2ZJ8A 4ASUA 3EWAA 3C4JA 1TMKA 1YE8A 4LJ5A 1Q22A 2C8VA 5HKKA 4B47A 3NC1C 2IF2A 3AF1A 3B1WA 4QJ5A 3HU2A 1FQKA 1U0LA 1YZKA 4JT2A 4P4SB 3K0SA 2WV9A 3UXMA 3ZZ0A 3EG5A 1MV5A 3X1YA 4O25A 1VG8A 1ZD1A 4X8HA 4BLSA 3KL4A 2KBFA 1VG9B 2ZTSA 4EQ6B 2GJ8A 3K0AA 4W9MC 3BAFA 1G16A 1S1CA 1SXJE 3B60A 3RRZA 2J7PD 2WWGA 1CRPA 2ZUCA 2C77A 3PUVA 3AF3A 4PSVA 4R2IA 4BZQA 2HDNB 1AA9A 4K81B 2EFEB 4NDZA 4II7A 4TMTA 2XB4A 4NCHA 4CW7A 2GXAA 1SVKA 1WBDA 2B6HA 4EPYA 4D6PA 2IS4A 1KSGA 2PT7A 1EESA 4NYIR 2X19A 2VHJA 4QBFA 3FPAA 1R0XA 5HKKD 4Q7JB 4NP6A 2IS6A 4NCIA 1G7RA 2FSFA 3F8TA 1Z06A 3IO5A 3CW2A 4MITA 4Q1AA 4PSAA 3TUJC 2ZSDA 4CEJB 4YMUA 4GMDA 1XXHE 1XJ0A 1BYUA 3P32A 5KSZA 1FQJA 1YRBA 3DOFA 4YQFA 1UKVY 2ANBA 3WBJA 1JPJA 2H16A 2IK8A 2ZUBA 4DCNA 1KHTA 1SXJB 1DBSA 4H1UA 1XEXB 1XZQA 1ZW6A 4ACAA 3U6KA 3ZVMA 2OBNA 4TLBA 4B3BA 3V00A 1VDZA 1G5PA 4LBWA 3RDPA 4RZ2A 2QP4A 1AKEA 3U60B 4KVAA 3PEYA 1N0VC 1E1RD 1L8QA 3CB4A 2CHQA 4ZI2A 1LFDB 5TV2A 1XDBA 2H5EA 4HLUC 5KDOA 2FG5A 1NY6A 2O8BB 4A15A 2FDCA 4ILEA 4UNPA 2WWHA 4DSOA 3EZ9A 4PHHA 3WNDA 2QU8A 3K0FA 4MQBA 4Q18A 2WHXA 1V43A 3R9IA 4DB2A 3EIQA 3BK7A 4JJZA 4TMKA 4C30A 3M0EA 4BFTA 2O8CB 3QF4A 4IOKA 3D31A 3ZVRA 4U5XA 4CEJA 4Q4HB 3SZRA 1CR1A 1R8QA 2PCJA 5DHAA 3UG7A 5E3HA 1R5NA 5HR5A 2HYDA 1T91A 3GLIB 3BS4A 4U02A 2PJZA 3NHAA 1G4AE 5FBLB 1AS0A 4MRVA 4PC1A 4L9WA 1OH6A 4Q4LA 5KUTA 1EX6A 2ZE7A 2CK3A 3CWZA 3X1DA 1TQDA 3R7WB 3RAPR 3OIUA 1TQ6A 2W0SA 4C7OA 4ZCLA 1G3MA 1KK1A 4GSYA 4ZCIA 4DCSA 4D4LA 5AUQA 1Q12A 3GLGB 3TVDA 4DDVA 3Q5DA 4DUGD 3B6EA 5H70A 4EPVA 1ZCBA 2EU8A 4M0LA 4PTLA 1M7BA 5L3QB 4CEHA 3LWNA 1GL7A 4JL5A 4OJKA 1QHXA 2JJ8A 5C4GB 4M9QA 3THWB 3IIKA 5B57C 1J8MF 2D7CA 4C0SA 4AG6A 1E9EA 1J70A 3B9QA 1TF7A 1GOTA 3GLHE 2QGNA 3IQWA 3RHFA 4TYPA 3FKSA 2OM2A 3LVRE 3CH5A 1KO5A 4RD2A 2DCUA 4PAOA 4F93B 2GJ9A 4A8JB 5F98A 4YMVA 3GJXC 2JLSA 5KPDA 1NN1A 2PZGA 1TUIA 1QF9A 3B2EA 4G5OA 3O8RA 1E2GA 3ECCA 4UNQA 4UXHA 5CK5A 5L3QA 4CEHB 2WJVA 2N46A 2AK2A 4KV9A 3W8NA 1YR9A 3GEEA 1A2KC 1JI0A 3DL0A 1R4AA 2G0NA 3VU9A 5LD2C 4P3YA 2BWJA 2FPMA 4Q9HA 4JJKA 3AUYA 4C7OB 1JBKA 1A1VA 3GLGE 3A37A 1NI3A 3IEUA 4GL2A 4OQXA 2I1QA 4QHYA 2GWHA 1NRJB 2ZJ5A 2R2AA 1U8YA 3BE4A 2DWPA 3LV8A 2P0EA 2XXAB 2I4IA 2YOGA 4URWR 5FTNA 2CHGA 5KU1A 3SS8A 3D7MA 1QHHA 1EFRA 1G8GA 4FWIB 4DLYA 3KQKA 1MRSA 1Q1BA 2ZYUX 3GLHB 1R10A 3R9WA 3RSLA 1T9HA 4KBGA 4IHQA 4PO9A 4TQ9A 1II8A 5JMTA 4BLPA 2GEVA 1CR4A 1TF2A 1U98A 3QF4B 4OYHA 5FTKA 1NG9A 2V6IA 3DOEA 1Z28A 5BWMA 3K1JA 5EE9A 1KDPA 2OV2A 1W36C 4LCBA 3BBPA 3A8TA 2VBCA 2AHOA 2WZQA 2CVFA 4OI4A 5CDFE 1I4DD 3L43A 2OBLA 3AF0A 4N1AA 3I5YA 3RNLA 4HZUA 4DHEA 3BORA 3AM1A 1R0ZA 4Y0VA 2PBRA 3NVAA 3Q7PA 1VYVA 1XFAA 3PITA 2IYYA 2ZE6A 3CR8A 1CEEA 5JJIA 3WYGA 2V55B 3DHWC 1Z5ZA 3CPHA 4EJSB 3DEFA 1ZC4A 1XEWX 2ZI6A 5HE8A 3CX7A 3VHLB 3P4YA 3THOA 3V4FA 4A0RA 1KDRA 1E9CA 1TAGA 1W47A 3CX6A 3JVVA 1N6OA 1XMJA 2Q3MA 4MRNA 3TW4A 5A0FA 1CS4C 4HYYA 2Q0HA 2KI5A 1E2LA 1L4YA 1Z6YA 2FSIA 5KNBA 4XVUA 1G7SA 3HYRA 1F3OA 1RZ3A 4PPQA 2C03A 5D3MB 2EQBA 1ZU4A 5EXXA 4URUR 4NYIQ 3B78A 1NVVR 2EW1A 3SJZA 3UMSA 5B58C 3UKDA 1OKKD 2VRWA 1M34E 3CRRA 3QF7A 1Z47A 3L8ZA 3SJBA 2DBYA 2FMXA 2AXNA 2FNAA 5DISB 4C0HA 2QP3A 4L4UA 2F1IA 5GJCA 2CCKA 2XITA 5LB2A 2TMKA 2HT1A 1G19A 2OO7A 4L9SA 2QG6A 5K8LA 1H65A 1IN7A 2J7KA 1J7KA 2XSZA 3RLFA 1G3RA 2ORWA 3QXHA 1QDEA 2QZ4A 1N6HA 1OIWA 4AD8A 3ZIAD 2A2ZA 4S35A 2ZE8A 5FPHA 1GKIA 3AVXA 1AKYA 2XNDA 1S8FA 1MABB 3QXJA 3NWJA 2ZJBA 3HR7A 3QG5A 1UBGA 3PXGA 2GVZC 4Q9KA 5KSYA 5CIQA 4LHXA 4G5GA 2VQSA 3QE0A 1DAMA 1P6XA 1XD9A 2GZHA 2QBYA 2OG2A 3UATA 4JIMA 4C0KA 2WWWA 2ZRAA 4M1SA 4QRHA 1ZM3A 1GWNA 3PG5A 5G53C 3QBTA 1IONA 4M9ZA 1OXXK 4PR0A 4TQUS 1GKUB 2KWIA 1W0KD 3MFYA 3AVWA 1Z0AA 1JR3E 2BKUA 2GK7A 2R6FA 5E4FA 5KHOC 1P4SA 4I81A 2ZVQX 3OAAD 2BIFA 3IIMA 4HAUA 3FMPB 1LV7A 3NKVA 4NE2A 4PX9A 1W36D 4UNSA 4N3NA 1RRPA 4AYXA 1HE8B 4NYMR 1R7RA 1E2EA 3P4XA 1T5LA 1SKYB 2QUZA 3PEUA 4Z1MA 2VTKA 1LB1B 1H8ED 3F3YA 1KKMA 1RJ9A 2XJ9A 2GJKA 4ON9A 2RCNA 2ZI5A 4QJ4A 4QM6A 1EWRA 2W6ID 1VYUA 3H86A 2MSDB 3F5FA 1BIFA 3HU3A 1ZU5A 1KK2A 3BERA 2D74A 4Z8YA 3GJ3A 1AZSC 2FGJA 2GBLC 5A5GA 1TL7C 2DFLA 2XXAA 5FL3A 2MSEB 4IXMA 1OHHA 1RIFA 2YHSA 3SYLA 3LBIA 2JLYA 2J87A 2OAQ1 4FIDA 221PA 3K9GA 4ZI3A 1PZNA 2YNMA 3G5UA 4A2WA 3GD7A 1RPZA 3VU9B 4RKEA 4ZO4A 5GADl 1AIPA 4IEIA 4MA4A 1AN0A 1S3GA 2BM0A 3ADKA 4HDOB 4HEJA 3E5HA 1RRGA 1TF5A 5C46F 3EPJA 1U9IC 3WRYC 2CLDX 2ZIAA 3A36A 2GCNA 1LTQA 5DHFA 1XJCA 1S96A 4PPNA 1M2OB 4DB4A 4EPXA 1DEKA 1KJZA 821PA 3MUFA 2VP9A 3NC0C 3CWQA 2G77B 1T4GA 2QQEA 2WKPA 4TLCA 1DE0A 1GVNB 3DZ8A 2WPDD 4A2QA 4Q19A 2FFHA 3EC1A 2FA9A 1F2TB 2AD1A 2PZEA 5HCIA 5BYJA 2DY1A 4E22A 4A1FA 1AK2A 1Q3TA 2GF0A 2ZANA 2HCBA 4TWZA 5FH9A 2OILA 1IY1A 2GZAA 4TZ6A 1OLOA 5CYOA 3MWYW 2WVJA 1EXMA 3AP3A 1S2MA 1XCPA 2F3TA 4PQFA 4Q66C 1WA5A 4NYJQ 2JLVA 3KJGA 4B74A 4V0ME 4KVGA 2A5DA 2HT6A 1KK3A 3FFBA 4DLRA 4B75A 3LLMA 3X1XA 3I5XA 1I2DA 2QMHA 3NDPA 4ZDJA 1EK0A 3J81k 3ZVNA 3QXCA 2Q9CA 2O52A 1PVOA 2V8OA 2GAAA 4DLSA 2ZM5A 3EPHA 3IBGA 1SQ5A 1SXJD 4L15A 2CDNA 4KODA 2NG1A 1GSIA 1OPXA 4Q7LA 4PAMA 4ERNA 2CNWD 2QGZA 2NO7A 4BFUA 4EUNA 4GOJA 2XTMA 4M8NE 5KYKA 1Q20A 1BS1A 2ZYWX 4R71A 1G4UR 1LS6A 3A1WA 5JJLA 2ZS7A 2J5XA 2N42A 4HZIA 1ZAKA 1CLUA 1NIJA 1XEFA 3GCGA 4IOJA 4KJZA 4A4DA 1JR3A 1MO6A 1ZP6A 2H17A 2GCOA 2VP2A 4FN5A 5E7JA 4O0MA 2ZS8A 1XEXA 3CBQA 1HYQA 1NMZA 2QROA 4CYMA 1E9BA 3T1OA 6Q21A 2VHQA 3QPWA 2WAYA 1JECA 4HAWA 3QY0A 3K70D 4NKRA 1SVMA 2BDTA 1VYTA 2XJ4A 3KDSE 4OBEA 5E7MA 4B35A 2OFOA 1JJ7A 2CL7X 4WZAE 4XJXA 2QBYB 5EE3A 1DAGA 3U3JA 3C8UA 2WAXA 2ZS9A 4LJ6A 1MT0A 2J45A 3QVUA 1VPLA 3TRFA 1DAHA 5TB5A 5JWHA 2ERXA 5HZKA 4H9GA 4DT1B 2HJGA 3UMRA 4DCTA 1GZSA 1F48A 2FH5B 1Q3HA 3LVQE 4HAYA 3AP2A 3CZPA 4D4MA 2NGRA 2QPOA 4ESVA 1GL6A 4AKGA 5EXSA 3CNLA 4QHTA 3B7GA 3UWKA 1TPZA 2CEAA 4RFVA 1U2RA 1JQJC 1Z0FA 2QSYA 4BEJA 2J9RA 2OSBA 3SEAA 1JAHA 1JB1A 2W0MA 3UG6A 4D0GA 2RGCA 3EZ6A 5FOUA 4TT3A 1DELA 1NBME 1UFQA 4RVCA 3QBVA 5DIFA 2D7DA 1DAIA 2FSHA 2KB0A 4MGIR 5EE0A 3SHWA 2QN6A 5SZJA 4AKIA 1WQ1R 4QBGB 2VYFA 4ZIRB 2QT1A 3R7WA 3FGNA 1Z83A 1FUUA 2V7QD 4B6FA 3RS2A 1XMIA 2NPIA 3EW9A 4KBFA 4MH0R 3EARA 4RZUA 2GDJA 1KMHB 2SHKA 3B8HA 3C5CA 3U3KA 3NIBA 4RCYA 2W58A 2FFQA 2ZYTX 3IPYA 3ADCA 4N0EA 3SJAA 3U61B 3FHOA 1DPFA 4DDUA 4UXIA 1KI1A 2F43A 1SZPA 4X8OA 3I73A 3NHBA 4EKDA 2IWRA 2JLXA 2RGDA 3WYFA 1JXMA 4WBSA 2VP5A 3CF6R 4G01B 4OQNA 3MSXA 2Z83A 2NQ2C 5ANRB 2WIBA 3K09A 2VSOA 1MO4A 2R44A 3B85A 3KTAA 4GFDA 4K46A 4C0AC 2P6NA 2WTUA 2ZPTX 3CKLA 4FINA 5FI1B 5JI3E 3BB4A 3BH6A 3ZS8A 3SBEA 2GCPA 4XOIA 5EUMA 3GMTA 4HLCA 3HU1A 1W48A 2Z4RA 5DLQC 2IX3A 1WE2A 5BN3A 5K8UA 2Q21A 4Q9LA 1DO0A 1JPNA 1OXSC 3I92A 4GNKA 2X8AA 4GOXA 2B7CA 3LBNA 4DIDA 3W5IA 3REFA 3K9NA 1W5SA 1VHLA 2XSZD 3OEED 1KGDA 5CK4A 1I4TD 1J99A 2XZOA 3LXRA 1E94E 5FPSA 2ZRKA 1FOEB 4AURA 2FFBA 1E2JA 4FMCB 2FPKA 1COWD 3RS4A 4Q5IA 3PUZA 4R2HA 4PANA 5EE5B 2RB4A 1XZPA 3KJHA 1VCMA 2EFGA 1KSHA 1ZYUA 2R6AA 3VR5A 1F6BA 4DSUA 3DMNA 5EJEA 1FMLA 4Q4AB 4B2IA 4WW0A 4UQOA 4JLPA 2Q6TA 5SZHB 2YV5A 3U7GA 2GBLA 5C2JB 2WMOB 3AGQA 2ZJOA 4F7WA 1CJVC 1N6KA 2FZLA 2JIZD 1FNNA 5UKDA 5E95A 2NIPA 2AK3A 4JL8A 2ZSBA 1BKDR 2IL1A 3HPQA 3WNBA 3MWJA 3T1TA 1IXSB 1GRQA 2WSSD 4LZZA 1M7GA 2GRJA 4I1VA 1ZIPA 2B21A 5IF9A 1OYYA 2Q3HA 2YOFA 2BJVA 2IXFA 1MO5A 1Z2CA 1GIAA 4N0DA 2H57A 2ATVA 4JS0A 4H1VA 3SHFA 3M1IA 4W7SA 1CBUA 4X8MA 3NTUA 1P62B 3ZS9A 4O3MA 2V6JA 2H1LA 2PX3A 4IFEA 4QG7A 1W1WA 3GLGA 1UKYA 3DPUA 5BXQC 4AYTA 4TL6A 4JSTA 1V5WA 4YDSA 3A1VA 3GLFB 3PVSA 1XU4A 3OIWA 4GI7A 4L5BA 2WWYA 2Z0MA 3TK1A 1KDOA 1US8A 3UPUA 4DKXA 3QPUA 3W3ZB 2PMKA 2C2HA 1PJRA 1E4YA 1GNQA 2WWIA 4FCVA 5EP4A 1HY3A 2IXEA 2ZR0A 1Z6AA 3ZQJA 4C4PA 2XEXA 2Y8EA 2J46A 4JKYA 1WB9A 4KSCA 4Q9JA 3CONA 2F7SA 5DH9A 1II9A 1X86B 2XTZA 4D0NA 3ZYCA 4EPRA 2CE7A 1ZVQA 3DKPA 3TBKA 1PLKA 2ZREA 4BFZA 4ABYA 1ZMXA 4Q1BA 3FKQA 1YR6A 2IUTA 1U99A 4URYR 3SFZA 1IXZA 1XPOA 2OCBA 1HV8A 1JXOA 4O2RA 2C96A 2IA5A 4PAQA 2R62A 1AQUA 4ZV4A 4V0KA 2G0TA 4C3ZA 1UEIA 4P4TA 2WJYA 1VCIA 5FUWA 1Z63A 3FDIA 1HQCA 3VFDA 2DFKB 3OZXA 1KI4A 1WP9A 2GTPA 2QMOA 2P6UA 3EAQA 4IFBA 4HAXA 2D2EA 1YZUA 2OT3B 4JBYA 3QJYA 1KTVA 4RSGA 2D3WA 5JEEA 3EIEA 1P60A 4A0HA 3FHCB 1ZIOA 5H68A 3W3AA 1E9AA 3AKEA 2RGAA 5BN5A 4PC3A 3TJZA 2FSGA 1A7JA 4B3CA 4Q00A 1J2JA 4UJ5A 5DGXA 3FTQA 3T35A 3PR1A 2BBOA 4PZYA 4JSYA 4QGHA 1U90A 5JHHB 4TTPA 4D4JA 1VIAA 1KI8A 4DCVA 5L3SB 5BQ5A 1MRNA 4QNMA 1E79D 2OHFA 3WHKA 2Q3FA 4XVRA 4TYNA 1SVSA 2MMGA 2J0UB 4OKSA 4LC1A 2VHTA 4XD7A 2O8BA 3O47A 4GPTA 1FW6A 4RJLA 4JLNA 4TSFD 5C18A 3QKSA 1W4BA 3L0PA 2A5YB 2FZ4A 3Q3JB 2JASA 2QM7A 3EZ2A 2IUUA 1G1MA 2LCFA 4JYBA 2BMFA 2DFNA 3LH5A 4LBYA 3C41J 1OW3B 4LPSA 2H18A 4GZMA 1KAGA 3W6NA 2VA8A 4MDEA 4URZR 2HCJB 2P5SA 3KFXA 1S4QA 3W90A 2V4ZA 2EFCB 1D8TA 3CRVA 3K0CA 4RD6A 1N5IA 2YOHA 1DARA 3VR4A 2DPXA 1OFHA 2IYWA 2QRZA 1UADA 2PZFA 5FR2A 4KITB 3KFVA 4C0JA 2JJ2A 1E2IA 1CJKC 1U9IA 3LFUA 1W2GA 1PLLA 5F9HA 5JSZA 3FE2A 1EWQA 3LDAA 1NSFA 4Q48A 3REGA 4AI6A 1RKBA 2R9VA 3U4QB 3IPXA 1JALA 4YMWA 3SYNA 3QEOA 1GNRA 1GILA 1KYIA 4AK9A 4XWAA 2WKQA 3AQ4A 3I1FA 2BOVA 1EFUA 4WVFA 1HT1E 1E1RA 3N2IA 1N6NA 4A6PA 4BLTA 3JZMA 4WOPA 3RRYA 1GDDA 4UNRA 5J4HA 1NIPA 1US8B 4GRAA 4JVMA 4JBXA 1NVUQ 2AD5A 3OFNA 4RCZA 3EZFA 1F2TA 4MRSA 1R5BA 1EGAA 3AP1A 3HJNA 3IHWA 2WOOA 1MR3F 2ERYA 3EZ7A 3OEHD 4Z8XA 2G6BA 4ZKEA 5CB8A 1Z0DA 1NN3A 4JLBA 1UKEA 1ZNYA 3LNCA 3ZZUA 4EFNA 2IYZA 4FMDF 1Q1QA 1W49A 2HYIC 1E9SA 1G6HA 1IY2A 3LRPA 3QQ5A 5GJWC 4FCTA 3IEVA 1NY5A 5GVSA 1GM5A 1KNXA 4CT4B 1G64A 3KJIA 4LHYA 3WNCA 3I8XA 4D26A 4LYHA 5FL7A 4BZXA 2W2VA 2CJWB 5FFMA 1H8HD 3TVTA 3ZD6A 2FV8A 5AJYA 1XTSA 1YZTA 5IK2D 1SGWA 2QE7D 4IKEA 4EDHA 2C95A 4IDNA 4PQRA 2RHMA 1P72A 5FPKA 4Q1FA 2A5JA 2HLDD 4MRPA 4P0TA 4W5JA 1N3BA 1F2UA 4ACBA 5J47A 1FP6A 2CLCX 5FPTA 1YZGA 4DEXA 2X2EA 3FMIA 4CGZA 1N0WA 3IGFA 5AUOB 1EG7A 1W46A 1KAOA 5EZ6B 2QMEA 4B48A 5DYIA 2V3CC 1P2UA 3VX4A 5IK2A 4B44A 1XMSA 5CITA 3WHLA 2WJIA 5TXGA 1XPRA 5KO2A 3MMPA 1KO7A 4KAXA 5BW8A 4HB2A 2WICA 5DE3A 3U3OA 2W6JD 2GF9A 3KXIA 3MRSA 2HXSA 3NEYA 4BWYA 4EIWA 2R6DA 2VHUA 3BD9A 3DO6A 4QHSA 2NPFA 1HQYE 3CO5A 3PUYA 1TEVA 1OH8A 3QKTA 2J59A 3DM9B 1CTQA 4Q03A 4KLZA 1EX7A 1ZNXA 2JLZA 4PFSA 2HLDA 3CR7A 1OFTA 4YDHB 4BFYA 3P26A 1Z6GA 1OH5A 1K5GA 5LBIA 4P4UA 1OJLA 3T15A 2GESA 2JDID 3AH8A 1DVRA 5F2EA 1JAIA 1KZGB 4JZKA 1B0UA 2AX4A 2RHDA 2HUPA 4NBSA 1E0JA 2PH1A 4ZDWA 1XBTA 2QI9C 1W0JA 4ESHA 1I4LD 1AQYA 2BJWA 1ZCAA 3H2YA 4JVNA 4F92B 3KKOA 2E9SA 3B1XA 4KSBA 4QL3A 2GKSA 3GFPA 3S1AB 1U8ZA 3HDTA 2PEYA 1T6NA 3HP1A 3Q9LA 4NCKA 5EXTA 1W44A 2BMEA 2XZPA 3CPJB 3EWSA 3QPVA 3U6BA 2JJ2D 1E2NA 1S9DA 1XPUA 4KLNA 2GK6A 1JJVA 4HDCA 1BMFA 1Z2AA 1W4AA 4Q01A 3WXMA 2WWFA 5DN6D 5FTLA 1NLYA 3GFTA 4GBMA 1VKJA 5JWRA 3I32A 4LI0A 4GZLA 2X77A 4FCWA 1OFUX 2QORA 5D3MA 5DN6A 4A0GA 4LHZA 3P20A 5KNCA 1KI9A 621PA 3WMEA 1G3QA 4M22A 5L3RA 1IXRC 4U00A 4UJ3A 4D25A 5L3SA 1NKTA 2J0QA 1FNMA 2BBWA 2J41A 5AJWA 4DSNA 2VP4A 1VG0B 2LKCA 2OXCA 4DBLC 1O87A 4PO1A 1M6NA 1IN4A 2ZJ2A 2WM9B 3A4LA 1KOFA 4EJSA 1VIYA 1XD8A 3SNHA 4GMXA 4DLVA 1XD2A 2D2FA 1OSNA 2OEPA 3IUYA 1SVOA 2J0VA 2IS2A 2JLWA 1IJEA 4BPBA 1U81A 2IBMA 1KI7A 3HWSA 3NG1A 5L3VA 5LD2B 5FOXA 3L0SA 4YLGA 2BKEA 2OFWA 2FX3A 2WJJA 4A9AA 1FMJA 5JRZA 4A6XA 3X2SA 5TVKA 5AJXA 4BGDA 2LKDA 3OAAA 1D2EA 4M9SA 1E2PA 1HEIA 2QPTA 2ZJAA 4Z51A 3VKHA 1IHUA 2P6RA 1G20E 2VPPA 3RVBA 3BOSA 4DLUA 4M1WA 4TLDA 4PC7A 5CLLA 1CXZA 4FI3C 5J4KA 4C2UA 1D6JA 4PO8A 4PHFA 2GZDA 3KQNA 3SDZA 3T5GA 2ODEA 3IQXA 3SI7A 1NLFA 4C0QC 4P33A 3LQRA 2RGBA 1Z0KA 3K70C 1MH1A 2VF7A 3CNOA 3KUDA 1P2TA 2NZJA 5F3WB 2D62A 3W8RA 1OB5A 2NZ8A 2JDIA 2OXRA 2PLFA 5A4JA 4AWXA 4LOAA 3MGCA 4AKEA 3D3QA 2R8RA 3GJ6A 4MGKR 2GAOA 1C9KA 3LBHA 3AVTA 1E4VA 2X2FA 3DMDA 3PEVA 3Q72A 2KJQA 2LWIA 4IVRA 1P9NA 4CT5A 1D9XA 1E98A 4DCUA 2OCPA 4D4KA 4DIEA 4LV8B 3TE6A 2X1VA 3RRNA 3BRWD 3AKDA 5AUNB 4LPKA 4OHZA 4IJMA 1IQPA 1XCMA 2ZRFA 2YINC 1NKSA 2ZRLA 1GL9B 1SHKA 3X1WA 5JI2E 2ZE5A 2O5VA 1DADA 4BFWA 3K53A 4FMBB 2BEJA 4LHWA 4LYAA 2GA8A 2QTFA 4P31A 3GJ4A 3OIYA 1NJFA 4NU0A 5FL7D 1E9DA 4KO8A 2VP6A 1UBEA 4KFUA 4LRWA 1XMVA 1HTWA 1NVWQ 2V9PA 1WBBA 5CDFA 1RYFA 3QEJA 3THYA 2ZAOA 1Q57A 1UF9A 1Z6XA 4DLTA 1DS6A 2RGEA 1E69A 1F60A 2QTHA 2ZJZA 4TMZA 1KY3A 3ADBA 1UDXA 2JGNA 1CJMA 3QXSA 2IWHA 2VL7A 1QHYA 2O0KA 3QKSB 5G3ZA 4OQFA 3RC8A 1EFCA 2AR7A 3EA5A 1LVGA 4TN1A 1Z22A 1YHNA 3D6TB 1D9ZA 1TQ4A 2I1VB 1BOFA 2F55A 4BECA 5JECA 1RFLA 4KXFB 4V0OA 1SKQA 1NSTA 2HF8A 3QENA 3KZ1E 4Q4AA 3OFND 3RC3A 1COWA 2ZQ5A 4C9BA 3KB2A 4POAA 1E2QA 2CMKA 3U3RA 1OXVA 1YZNA 4XWOA 4M1OA 1LS1A 4URVR 3BXZA 2ZI3A 4OI2A 1CJUC 1ETUA 1ESMA 2QP9X 4ITRC 5L8VA 5FOVA 3DKVA 3PENA 3CF2A 1EFRD 4LHVA 2BHRA 3MLEA 4TLAA 2XOKA 4NTZA 2CCGA 2F9LA 5FTMA 4K8OA 2NO6A 4Q9IA 5DO9A 721PA 4IDHA 1FL9A 4LJ8A 4BFXA 4LWZA 5EXPA 1KK0A 5FOSA 4MDFA 1UBFA 5IT5A 4UNNA 5IDVA 1W4RA 2ZRBA 2CL0X 4M53A 2C78A 5CM8B 2WJGA 2JATA 3I72A 4BEBA 4B2LA 1DAEA 1N6IA 2ORVA 4HB3A 3FYHA 1IY0A 3X1ZA 1NBMA 5GJBA 2ZI7A 2V54A 1PUJA 1A82A 3AUXA 3TGPA 1AS2A 2DYKA 1XXHA 2IS1A 2VF8A 3VAAA 5HTKA 1FUKA 1RW4A 5J4LA 1TADA 4IDPA 4IOLA 1G3UA 2C9YA 3W6PA 1T3HA 5IRCD 3LXXA 1DAFA 2OAP1 3SQXA 2K5UA 4M1KA 4PC2A 4XD7D 3VTKA 5KDLA 4GP7A 1T0JB 2QT0A 4CRWB 2ZRDA 1IN6A 2BMJA 3F0TA 1E79A 3NH6A 4Q1DA 4DDTA 1H8EA 3NBFA 4Q7MB 1P3JA 5AWFC 2Q9BA 3QSYA 2VP0A 1E96A 1NL3A 1GTVA 2HV8A 1BMFD 4TT3D 5GJVC 5DI9A 2EVWX 3TR0A 1MO3A 3EPKA 1XXHB 4WZ6A 1KSFX 3ICEA 2FGKA 1J90A 3QG1A 3AKYA 2RMKA 4FWTA 2DR3A 4KCGA 1F5NA 3UIEA 1L2TA 4OQMA 4KYIB 3ZZTA 4NZYA 1CRQA 4JLKA 2F9MA 3BC1A 1GRNA 3PFIA 5G3YA 3SFVA 3N2EA 1R0WA 2GXUA 4F4CA 2ZRJA 3W9YA 4F4JA 2ZITA 1E9RA 3VR6A 3C7KA 4PXAA 1VECA 3H0KA 1UBCA 2XAUA 3WMGA 1XP8A 3W5JA 5EP3A 2DB3A 1UDWA 2B7BA 3QIAA 5K8TA 4KFSA 5JHGB 1WXQA 5BN4A 4NYMQ 4JMPA 1WDTA 4OK3A 4YONB 1OH7A 2REBA 5AUPB 4NPHA 4KHZA 3GLIA 1D2NA 1KKLA 1YU9A 1DAKA 4HZUB 3VX3A 2HJVA 4Q21A 2OCYC 2W00A 5F9FA 1KO8A 1N2CE 3Q5EA 3G82C 1FP7A 4MKFA 3R20A 4C0BA 1TU4A 1ZNWA 2HF9A 4JYCA 3C14C 3U2QA 4V0MA 3CUEF 1G18A 1WCV1 3RWMB 3VR1A 8OHMA 3I8SA 3RYTC 2CNWA 3AVVA 2G1JA 2AKYA 2CL6X 3ND9A 5FOTA 1N5JA 1L7VC 2G1KA 2KSQA 1XCGB 5FTJA 1QHHB 4D82A 4EJSC 2ATXA 2O8EB 1VMAA 2NO1A 4V0NA 2BV3A 1T0HB 4JLJA 3GEIA 2JA1A 3DZDA 3WMFA 3LO5A 4BLRA 1A5TA 4BUJA 1OXUA 4UXJA 5LB4A 3PIRA 3ETLA 3I61A 1JR3D 1Q1ZA 4OK6A 2PT5A 2F43B 4IDOA 4B73A 3EX7C 4V03A 4TTQA 4B3DA 3R8CA 1E0KA 3A1SA 1PUIA 2E1RA 3JVUA 1QHIA 4M21A 3CZQA 3IIJA 1XWIA 4XTCS 3T06B 2J3EA 4CF7A 2J7PA 1NN0A 3B1VA 5SZKB 3L0OA 5JZVA 3QKRA 4C2TA 2O8DB 4M2LA 1ZJ6A 1P7CA 4FD2A 4JLVA 4LBVA 2YKGA 4ZIRA 3KJEA 2KBEA 4B3GA 3SOPA 2W83A 2W2XA 2QNRA 5AR1A 5P21A 3B1YA 1N0UA 1S0UA 2WSSA 4LSGA 1E3MA 1MKYA 2ZI9A 1SVWA 3TAUA 1D2MA 2C5LA 4IVPA 3UWOA 1G8PA 4TYWA 1OT3A 4EQ6A 3U5ZB 4FMCF 2AL7A 4KYUA 3KXKA 4HLUA 3TQCA 4MKHA 2VO1A 2QQ0A 2REOA 3QXXA 5AJVB 2J0SA 5TMPA 1VCNA 3ASYA 3MAAC 4AC9A 3BIFA 3U3MA 4A8JC 2E87A 4EAQA 1YVDA 3ZLJA 2YVUA 4QGGA 4IOMA 3OF5A 2ZVPX 4TMWA 4BQSA 2FE4A 2ZRNA 4QBIA 4MUBA 3BFXA 4B3XA 2HXYA 2WPDA 2C99A 4LDJA 4QGFA 1DG1G 2NOAA 2GILA 1Z08A 2ZRPA 3TSWA 4QBHA 5JEDA 4QOSA 4RY2A 2IT1A 1DO2A 1U94A 3LY5A 5KTYA 4TSFA 4G5QA 4OL0A 4MKGA 4M1MA 1P73A 2BCGY 5BYKA 1X8KA 2QTVB 2Z5FA 3MWLA 3HPRA 3GPLA 1N5LA 1CP2A 4JT4A 3W6OA 2GCOB 3KKPA 5TDHA 1PLJA 1X8LA 2CBZA 3SU8A 2UVQA 3ZH9B 3U7HB 2V7QA 1AGPA 2A78A 2IEZA 2CJWA 3FMFA 5ELXA 4Z1MD 1QHSA 2G9NA 4B43A 1QVAA 2QAGA 5KPJA 5C1BA 4KFRA 1QHNA 3L2OB 2I3BA 2NO0A 2CE2X 3SBDA 4U7DA 5DYGA 3VKGA 3B9PA 3CM0A 2VIIA 2QM8A 3WYAA 4B6EA 2IEYA 5E7IA 1Y63A 1RJ9B 3IO3A 5HPYB 1P75A 2NO9A 2VSFA 2D06A 3BJIC 1NLZA 4Y0AA 1HE1C 1IAQA 1IBRA 1KO1A 3B1ZA 2AFIE 1NVVQ 5FOWA 5IHPA 3A4MA 1KJYA 4ZKDA 3VNUA 2WKRA 1E0SA 4ARZA 4DVGA 3NBXX 4AYWA 2NTYC 2OUKA 2RGXA 3PUXA 4Q4JA 1KI6B 1LNZA 1R2QA 1VHTA 4RZ3A 1ELOA 3LX8A 3ZQ6A 2FJUA 3Q8XB 1E2HA 4XTRA 4MYTA 1PV4A 3EXAA 3S1AA 3M6AA 2F6RA 2XB2A 5AJZA 3UANA 4PHGA 1W0JD 3K0CC 2FEMA 5FBQB 5EP1A 1VTKA 2RKOA 4HB4A 4I1SA 2DHRA 4JLMA 4CDGA 2KE5A 2ZU6A 1E1QA 3OESA 4Q4JB 3PV0A 4MKIA 4WXPA 3VHXA 3U4QA 2QAJA 4LUCA 2RGNC 1ZD8A 3AKCA 1OIVA 4LJ4A 5EP2A 2PEZA 2IYVA 3E1SA 5LDDC 2Z4SA 3GQBA 4NCNA 1Z6TA 1ZD9A 1N25A 4LV6A 3TR5A 1YQTA 3H4MA 3ADDA 2XGJA 1XTQA 4NCJA 2W6JA 5KNDA 3GEHA 4D80A 5KOYA 4IEEA 2P65A 4BLOA 3K70B 1KMQA 3FB4A 2IYSA 2YWFA 2O0HA 1VCOA 4LX0A 5SZIA 3MJHA 421PA 1O3YA 2OE2A 3AF4A 4Q1CA 1EFHA 3L0IB 3V9PA 1KO4A 2OBMA 3NEJA 1C4OA 2EYQA 4DT1A 4B32A 1KI6A 4A0FA 4OHXA 2IXGA 2JCSA 4ARZB 4PPGA 2B8WA 3ZIAA 4MRRA 4MGZR 2QEQA 3E70C 3BFKA 4E09A 2FF7A 1QG2A 4W5HA 4XWKA 2ZSFA 4BLQA 1Q21A 1OFIA 2BM1A 4LBZA 4NMMA 3MJRA 5B64A 4XH9B 4XIGS 4YC7A 2WSMA 2EWWA 4I4LA 2CCJA 3IKJA 4LYJA 4C0LA 5FBVB 3MWKA 2O0JA 1GKYA 1AM4D 4IVQA 5KDDA 1X1SA 2ONKA 3TMKA 4DEYA 4ZDIA 4GDFA 1TEXA 1ZNZA 3DVLA 2YC4C 3BB3A 2ZRCA 2ONJA 3W34A 1E0AA 4F38A 4TMVA 3UK6A 2OFXA 3C16C 1FTSA 4BZPA 4DLZA 4KFTA 1A4RA 3PEWA 2ANCA 4E07A 3N5CA 2BBSA 3RS3A 3KTAB 1R5OA 1QG4A 2F1JA 4DDWA 1P5ZB 1OB2A 5DI3B 3I4LA 3P27A 5K8IA 1G7CA 1GITA 1GRRA 1T3LA 1T8UA 4PSKA 2YC2C 2A5GA 4GT1A 3IBYA 4IXNA 3CH4B 3AVOA 1N6PA 1YZLA 1GUAA 2R65A 3B13B 3GLHA 1G8YA 1XEWY 3GJ7A 1JEEA 1UPTA 3WBKA 5B30A 1HH4A 3ZDQA 1AJEA 3OEHA 3QNUA 4NHOA 3QKRB 3AV0B 3KB1A 5LPNA 3ND8A 1M74A 1R0YA 4QM7A 2EYUA 1IN5A 1P2SA 5TARA 2AXPA 4RZXA 2FN4A 5CJPA 4ZPXA 3CF0A 1SVIA 2F1HA 121PA 2FWRA 2GETA 4F4IA 2JEOA 3FMOB 1MOZA 1W4CA 3KKMA 1SHZA 4JKIA 5G40A 4WA7A 3I62A 1TX4B 4QC2A 3NDBB 3UMFA 2BCJQ 2OESA 2RGGA 3GP8A 1IN8A 4NYJR 4TMXA 4FXPA 3CPEA 4TZ0A 4FMDB 2BBTA 4S2EA 1J8YF 3CLVA 2GJSA 4F91B 4PZLA 5FPYA 3T1VA 1KI3A 3LA6A 2QSZA 2YJTD 2O8DA 1G5TA 3A58B 5JCPA 3SE0A 2P3SA 2OCAA 3PCRB 2G83A 1TU3A 1Z0JA 2RGNA 3ZVLA 2P2LA 1UEJA 1CF4A 1R6BX 1KNQA 3MD0A 4E5UA 3RS0A 4HSEA 1Y3AA 2CXXA 3BFVA 1G7TA 3IDQA 4YMSA 1L4UA 4EPWA 3FOZA 2XOKD 1NMXA 3T34A 3AVYA 5FR1A 1XRJA 2AFHE 1S3SA 3AVQA 4HB0A 4US0R 1LW7A 4AY2A 2AWOA 3OHMA 4BE7B 4DXAA 1LF5A 2W6IA 2O8FA 2CLSA 1M1YE 2F3RA 5M04A 4WZBE 1SXJC 1TQ2A 1KI2A 1KSJA 1G291 1E9FA 1NNEA 2F1RA 3O8BA 1FTNA 2XNDD 2ZRIA 2PL3A 3AB3A 1CR0A 1LF0A 4TYQA 3WRXC 3SQWA 1FX0A 1II0A 2QA5A 3AGPA 1ZM9A 3K0FB 2UZ3A 3U7EB 2IYTA 1GP2A 1QZXA 1N6RA 1FX0B 1QBKC 1CU1A 1K5DA 4G0NA 5FBRB 5G41A 3HR8A 2CK3D 1XB2A 3EASA 1Q1EA 3A6PC 2C98A 4Q7KA 1BYIA 2JLQA 1CR2A 1HA3A 1II8B 1OXTA 1X6VA 4YXWA 1WF3A 3GFOA 4OQLA 1JQLB 2DFTA 4B34A 3GLIE 4LGMA 2GEDA 3VQTA 3TQFA 2ZROA 1K8RA 1IJFA 4RD4A 1OYWA 4BASA 1QHGA 5HCNA 4JVLA 2JLUA 1SXJA 1S9HA 3TW8B 4CEIB 1NG1A 2PX0A 4A92A 2ZEJA 3QI2A 2W2TA 2ZJYA 3Q7QA 3FWYA 1XNJA 2IHBA 2V1XA 2YWEA 4M1TA 4LV5B 5B2ZA 4Q47A 4DC9A 2D4HA 3I3SR 4US1R 2GEUA 3T1QA 4PC6A 4PHTA 2GJAA 4GOKA 5TY0A 521PA 4Q02A 2P67A 5EE1A 2REXB 2Z6VA 1CULC 4G1UC 2JJ1A 3SJCA 2GXQA 4OI1A 4A8JA 3K09C 4IW3B 3VMFA 1JR6A 1FPMA 4KI0A 4P4SA 1M8PA 5JFGA 1X8JA 2C9CA 3ZGXA 4NH0A 4D81A 5J4VA 3QVVA 1E2FA 4JLAA 3KXLA 4R7ZA 1S1MA 2OLKA 4HAZA 2EFDB 2RAPA 2BVNA 4M4SA 2QE7A 4XSGA 1RE0A 5CLQA 4I1OA 3KKQA 3THWA 2H7VA 2ODWA 3LLUA 4LC0A 1G3IA 2MMCA 5FI0B 4BFVA 3TIFA 2ORIA 3A1UA 3TUZC 4OHYA 2XX3A 1ANKA 2GXSA 4AKHA 3LAWA 2WOJA 2QL6A 1ZUIA 1WRBA 3VKWA 2Q9AA 2L0XA 3L8YA 1Z29A 1YJ5A 1ZM2A 1ZUNB 1IM2A 2PCLA 5H8WA 2CHVA 2B92A 1XD2B 2G88A 2ZR7A 2PJRA 5EQTA 3FHTA 4HUTA 4LJYA 1NJGA 3OE7D 1YR8A 1GG2A 2PMDA 5FUVA 2BC9A 2C9OA 2WJHA 4CEIA 3CIOA 1NMYA 1XTJA 3OEEA 4B33A 4RD0A 2N1BA 4Q4HA 4X8LA 1JEDA 1OE0A 3T61A 2YWHA 5DI3A 2OZEA 1G41A 4DRZA 2IYLD 2IYUA 3CRMA 4D2IA 1E1QD 2GHIA 2BMDA 3B82A 4DZZA 4UKDA 4RFSA 2ZETA 3T5DA 4ASUD 5KSPA 3THYB 4TYYA 4TL9A 3FFAA 2IUSA 1X1RA 3QUSA 1CJTC 1W5TA 1GFIA 4PZZA 3THXA 4I99A 4MYHA 1G8HA 1BH2A 2QMUA 1RVDA 4JL6A 4TL7A 4OI0A 1OF1A 3DDCA 1NBMD 3ICQB 3IILA 3C5HA 1AGRA 3G0HA 2A30A 3CRW1 3ONWA 2O8FB 1B23P 4BRUA 5HZHA 4TTRA 1G6OA 4O2LA 4L16A 3WY9A 1YZQA 2RH5A 4G5RA 3TSZA 4GP6A 3AF2A 3HYTA 3LX5A 3P1JA 4LYFA 1RC8A 1DG3A 4LJAA 2R6GA 4A82A 1AS3A 1Z3IX 1ONBA 3AVUA 3GLFE 2QENA 4JBWA 1E2DA 3RANA 4JVSB 2ZSAA 1P61B 5JJKA 1W36B 1OV4A 2IC5A 1XTKA 3A1TA 5CM9C 3SYKA 3QKUA 2J1LA 4J0QA 3K0EA 3TUIC 1HT2E 1KMHA 4RD3A 2ODNA 1E2KA 4XVQA 1G21E 2ZRMA 1E32A 1UKZA 2FEOA 2XNSA 3GJ5A 4KU4A 1LY1A 2ODBA 1RRCA 1HURA 5JSZB 1R8SA 3WP0A 1G9XA 1FFHA 3EIHA 3EPLA 2NMVA 1DOAA 2ZUDA 1T3SA 1P9RA 1CKEA 4MUAA 1E6CA 2WMNB 1U0HC 2JAQA 1D5CA 1UJ2A 5JLJA 5CYPA 2IYQA 3U7FB 3KUCA 5J4YA 3QOFA 1A2BA 3ASZA 4P32A 2QAGC 3GJ0A 3M4YA 1T5IA 2IYRA 4E03A 3KKNA 3E2IA 5EUQB 4A2PA 1OKKA 1T8TA 4ZCMA 4CZ2A 1K6MA 4DLXA 4NONA 2QAGB 5JRJA 4FW9A 4OJQA 1RYHA 4DWJA 3U44B 4R98A 4QKQA 2CVHA 2C04A 5C4MA 3LQQA 2A5FA 2ZAMA 1F2UB 1WMSA 1GNPA 1C1YA 1SVLA 3D8BA 4URXR 4A36A 3VNVA 5CB6A 3LW7A 1G8FA 1Q44A 1U8AA 1AZTA 2G3YA 4MYUA 4DSTA
chains in the Genus database with same CATH superfamily
4Q3OA 3KQLA 4K86A 1CUSA 1UXKA 4ZRDA 3RJTA 4LK2A 1IDN1 1AKTA 2Z43A 4N39A 3TQSA 3L8CA 2GPBA 2O0LA 3CH6A 3MCAA 2UZ1A 4G5SA 3RVOA 1YNSA 5BV7A 3R9XB 1V4BA 1ATIA 3E5RA 3LJKA 4BQFA 1MUUA 2FCAA 1TTTA 3TR6A 3M6IA 1CS0A 4ND8B 3Q41A 2CWWA 3LGSA 5D5PA 2NU6B 2Y71A 1R0SA 4KQWA 1M2VB 3FN4A 4U2EA 4UUOA 3DFMA 5H3HA 4CVNA 3F71A 2GNAA 1PAUA 4H7EA 1N4DA 2I9KA 4M8IA 1I33A 1R0LA 2EATA 4BN5A 2YZ7A 2VQ3A 1LVUA 3GK3A 3NBZC 4DQKA 5JSUA 3NOOA 3AIOA 4UDYX 5DGTA 4WN9B 5H1YA 3GX1A 4MQEA 1JKFA 1GLGA 3OIVA 3VM6A 4JWTA 1TNDA 4XFKA 3SEFA 1CCWA 3D2LA 3RS7A 1JHQA 2N9UA 3BB1A 3EAGA 3QKWA 4Z9AA 5CA0A 2VH5R 2FPGA 4C22A 1RJFA 4QLAA 4XWWA 1YFLA 2Z1NA 1K9SA 2F8MA 3DVAB 4NNPA 4KFCA 1OLSA 1T3TA 4OHWA 4ALKA 1XJQA 1VGQA 4O5AA 3OM0A 3CUSA 3M2TA 1ZD3A 4HUQA 2RB5A 2ZYVX 3RWOA 2VDVE 2R84A 3IP1A 3HG7A 4DLWA 4FT2A 3TAHA 3Q3CA 3F6EX 3MN1A 4MQFA 1K4YA 1Y1KE 2YDYA 1UMDB 2WVHA 4OHVA 1QP7A 3DC2A 2LIPA 4YQZA 5CT8A 3RF6A 2WSIA 4M0FA 2XYQA 3TBFA 2EBUA 3FVQA 1RYNA 3I01A 1N2IA 1DV1A 3H84A 4CFZA 4AJIA 2J5RA 4N0QA 4LTNA 4KACA 1CP3A 4YUZA 2EHJA 2WNHA 2TS1A 1GD1O 4Y18A 4MWTA 3RFVA 4F2WA 3Q85A 1O6ZA 3O8DA 3O8QA 3PJRA 2D5CA 1P7WA 2C7PA 3RYHA 2A8YA 2PX6A 4UBLA 1JMYA 4LWPA 1W2HA 2DULA 4XUDA 3V8QA 3SN6A 4A1OA 4B4WA 3L7LA 1ZVVA 5MHTA 1IB6A 4DABA 4GQIA 1QRUA 2JFBA 3E7DA 1C2TA 3HUTA 3PQCA 4MI3A 3G8YA 4XJVA 1PR1A 1ZK4A 3EAFA 3TTUA 2QNIA 2BFBA 2I0FA 1XX6A 4AS3A 4ESEA 2YIJA 4KREA 1LK7A 4FDAA 3I39X 4RXUA 2ZAYA 2EFHB 1W85B 2P2DA 3HN7A 3ZJYA 4MYCA 4CDRA 3WMXA 4XSHA 3F46A 3SOZA 3C15C 5BW6B 4P83A 4MW0A 2YZ2A 2H48A 4Q24A 3VHQA 4RETA 2PSJA 1YKSA 1Y80A 3THRA 1E60A 2EARA 5JAOA 4L5JA 3ST7A 3CS3A 1Y8RA 1G17A 1UFRA 2Q28A 3H04A 1N1DA 2E21A 3RROA 3VMMA 1UBUS 1I10A 2MSWA 3SC3A 3VNBA 3N8IA 1DP4A 3ZHSA 4LY6A 3TSAA 5EHNA 3PQFA 4X0EA 5L4NA 3D6MA 1OHHD 1O2DA 1QIMA 2DF8A 2FSSA 2X9LA 3D3JA 4TM8A 3O8CA 2GK4A 2EWVA 5GONA 3D6HA 5FUXA 4FC7A 5ARCA 3TB4A 3H1EA 5FJJA 2X13A 3RREA 3X1MA 1NP3A 5FUYA 3OWOA 1X3SA 2P5TB 2QSUA 4M49A 2LCQA 1FDOA 2OCXA 2WF5A 3FDZA 1Z2EA 3C1AA 1NF3A 3U39A 5L40A 4AQ7A 2SBTA 3I04A 1A96A 3Q88A 3KQOA 2WU1A 1JVBA 3N70A 3ASUA 4PTYA 1K8YB 3RVDA 1U3FA 4XAQA 2GRAA 5JLAA 1DIOB 4TL8A 3TNFA 3A4IA 1ST3A 1NF8A 3QA3E 3R3YA 3R5FA 4CM8A 3PHHA 3JVEA 4YAJA 4D9CA 3AY7A 1E58A 1H2YA 1T4MA 3A2LA 3C2QA 3OLYA 4CXMA 2ECKA 4IIJF 4KAJA 3KHTA 5AW7A 3MILA 5I7OA 3DAHA 2WVGA 3CRQA 4XX0B 3AEZA 4LDQA 2A58A 2PL1A 2VEDA 3E5NA 3E9MA 5T57A 3VO2A 2PVCA 3I0NA 3RVMA 1CZLA 2XUFA 4MSUA 4MR8B 4NL4H 1SAYA 2CLLB 3PIDA 4YVFA 4TRMA 3PICA 3LOPA 3RC7A 4HRAA 1F9AA 4UD6A 4IP0A 1K5HA 3EC2A 3FF4A 3KLOA 4DCMA 4DSZA 3WYCA 5KYWB 1PL6A 1YR7A 2HL6A 3B5JA 4WAUA 1SBNE 3OE7A 1SHJA 3IT1A 1NUPA 1QC5B 1GPAA 3AFOA 3K2BA 5DP2A 5J5CA 3ZWAA 1FSFA 1MG0A 5CEFA 2RHRA 1QQTA 5KNBD 2WWXA 3BSWA 5IXJA 2K87A 5IWAB 4H0CA 2LIVA 3GNSA 3UGKA 2PZLA 1LCIA 4P35A 1HK7A 3KHSA 4EK9A 2ZJ1A 2C8VA 3HY4A 3G6WA 1J1IA 3B1WA 5LLSA 2GYYA 4AN1A 4B9AA 3RYCA 1J1ZA 1U0LA 1HDGO 4ISBA 2DP4E 1HO3A 4RTQA 5IZCA 3K0SA 5EWLB 2J33A 3SZOA 3UXMA 2N47A 3COVA 3EG5A 1MV5A 1NUUA 3X1YA 4O25A 1VG8A 1DXHA 2DQSA 3B3AA 4JX8A 4ZOLF 4BVLA 1YJ8A 2V7EA 3HJCA 1VG9B 3PKJA 3IQHX 2X58A 2M1ZA 2SNIE 1I1QB 3HFRA 3B60A 3LUPA 3RRZA 5IS2A 1E7QA 1CRPA 2AZTA 2ZUCA 2XNHA 1V7PC 2XQGA 2Z5GA 3OU2A 5AW0A 2XLCA 4KO4S 3TQTA 5CYGA 2CNKA 4FQ8A 2XB4A 3MXOA 3ZEIA 4CW7A 2RH8A 4MVJP 5ALKA 4EG1A 4GPZA 1SVKA 1TJ4A 2YXLA 3AOGA 3BIOA 4C4ZA 1WBDA 2FPSA 1FFXA 4EJFA 4EYKA 1X1BA 2VAPA 4RBNA 3IQGX 5KX5A 2HI0A 1ZK3A 4MVJH 1EESA 3WK5A 4NYIR 4MW4A 4HDSB 4GE3A 2B4AA 4YAUA 2IHNA 4RF3A 3WGJA 2HBZA 4YAWA 2C3UA 1E61A 5AHWA 3INTA 2LNDA 5HKKD 2BY4A 4NP6A 3TYXA 1BHJA 3UXHA 4FDLA 4CQNA 4C4YA 3DZFA 4PRLA 1P81A 1YAHA 3N58A 2ZSDA 1V9SA 4YMUA 4GMDA 2YHUA 5TMDA 1UJBA 2BTQA 3NGLA 4K9KA 5CH8A 3WBJA 2G80A 2NNLD 4YJGA 3ZI4A 3R40A 1CERA 4TTTS 4CM9D 4DCNA 1XQVA 2PUTA 2AOTA 5KBYA 1M1UA 1FJGB 4BYMA 2ZTHA 2OBNA 1E5VA 4BWGA 1SUFA 1HKUA 4FFBA 4O5OA 1KPHA 1K7SN 3MTEA 4U7PB 2Z4TA 1ULAA 4UCWA 1AKEA 3F4LA 3ICCA 5DXFA 4KVAA 3P9IA 5CLHA 2HSZA 3OETA 1YS7A 4YRDA 3H2IA 4AY3A 4ZI2A 1EM6A 1LFDB 4CZ2A 5TGZA 4AMUA 4WXEA 2O59A 2YTZA 1UAYA 3M3HA 5G0UA 1XALA 3IS3A 3N9IA 1QGOA 3E9RA 4FZRA 4PHHA 3WNDA 4YTEA 5IC6A 3SIRA 3R9IA 1D1PA 1GUBA 1VKZA 2FQQA 4RNCA 1BA2A 2W43A 3PQ3A 4G65A 2O8CB 4G86A 4IOKA 4EHIA 1GGVA 3D2AA 4U5XA 3EYWA 3QMPA 4R84A 2AOWA 3TW0A 4JZYA 4XM2A 2POQX 5E3HA 3L05A 3VNRA 1YCHA 2HYDA 1N2CB 3BS4A 4GL4A 3GLIB 1UBHS 2YHAA 3MINB 4Z1OA 3NHAA 3ZCUA 3JAWA 3OTOB 1MEJA 4URFA 1MJFA 1W85A 3BRCA 4PC1A 1OH6A 3F6PA 2RHTA 1V3VA 2X9GA 5IVIA 4CDNA 1USVA 1Z74A 1K89A 3JQRA 4MVXA 4B8WA 4YR7A 1EX6A 2ZE7A 2WUEA 4WDQA 2DPMA 1XRQA 1I24A 1QCCA 4MCIA 3QVMA 1QDLB 3QBEA 4BMYA 2P27A 4TUYF 3AI1A 1X19A 4WFJA 1Z0ZA 3PC8A 2DG2A 4P7FA 5E4TA 4ZD6A 4ER6A 3UYKA 1K7XB 4EHHA 5LLTA 1V3TA 2WAOA 4IZIA 2QE6A 3KJZA 1JE0A 2C8LA 4EG5A 2HWUA 1BROA 4IWXA 1X94A 2NLOA 2QD1A 1CE8A 3K73O 5LU9A 3Q7RA 3QVTA 3PXUA 3PRKE 4UVHA 5H70A 1E18A 1DSSG 4M0LA 4EOGA 3NOQA 1LDYA 3F9RA 3TQRA 4LSMA 5L3QB 1BQEA 3A2KA 3O8NA 4E32A 1CW2B 3M6LA 5HKAA 3HL0A 2JJ8A 3BL5A 3U4CA 3ZOZA 4HNSA 3PWTA 2COEA 1J70A 4MR9B 3VOAA 2IU3A 3B9QA 3NAQA 2I4OA 1IZ9A 4HSGA 4CNQA 4TYPA 4QRIA 4WLEA 4M7WA 4K9SA 3LVRE 5ALEA 1KO5A 4RD2A 4KR6A 2M98A 4LY9A 4R5HA 4B84A 2B35A 1A9PA 2GJ9A 4XARA 3GJXC 5KPDA 1YS4A 1JMVA 4DW8A 5KQGA 1QF9A 4EB6A 2JD2A 5CT5A 2AF3C 4G5OA 1ZX1A 3N28A 4O4JB 1BMTA 2FMKA 3ECCA 3IODA 3ZTWA 2CXUA 2XB6A 1ORDA 5JD3A 3SZGA 3OLQA 1NNUA 2IOYA 2DLDA 1SR8A 1QR2A 1YZ3A 2W2OA 4CGYA 2JGMA 4XLLA 1WNFA 4C7OB 5G4KA 1VI2A 1A1VA 4GL2A 3IEUA 1Q6ZA 3OC0A 3FX2A 3W77A 2GWHA 4YJ2F 5BYBA 4ARIA 4RTMA 4Y2YA 2ZYDA 3MNFA 4BU0A 3WA7A 3DL2A 2PS1A 2VN8A 3TLKA 2KHZA 2P0EA 2WFAA 2XXAB 1NOKA 2YCLA 1TM4E 1SKMA 4H77A 4ZAFA 4WERA 5KU1A 3D7MA 5SYAA 5JPIA 1UFOA 1Q1BA 2Y1EA 3N8DA 4K03A 3UHPA 1C7FA 3E3MA 2PUFA 4KBGA 4PO9A 4IZ6A 1II8A 1NVGA 1VM6A 2XRMA 4WK6A 3WTBA 4BLPA 2W22A 4FR2A 1GRVA 3BGOS 1NG9A 4F9EA 2BZGA 1I7LA 5ALNA 3HDVA 2RG1A 3HU5A 3HZZA 4RJTA 3FGOA 3RVNA 2VDWB 5ER6A 1KZ1A 1C81A 1SQGA 1TK2A 2J3DA 5CDFE 4QARA 5CVJA 2HNBA 5IJ0B 4B5KA 4JR2A 2OBLA 1YJQA 3AF0A 4N1AA 4HZUA 4DA9A 1FDVA 3GLSA 1RMYA 1UINA 2J3IA 1VYVA 1XFAA 2GUWA 3Q7PA 2FQXA 2AFRA 1OLXB 4HN4B 1HLGA 1V3UA 4M98A 3U9TA 4AZ0A 4O4HB 2R6JA 5LQKA 1VLZA 1WUTA 1Y8RB 2FX5A 3TKAA 3WYGA 3DHWC 5JJIA 1U1GA 1ULSA 2Y6UA 2PXHA 1DTWB 2FCRA 3CX7A 3VHLB 3N0RA 1ADYA 3P4YA 4IWYA 1KDRA 1E9CA 1DUSA 1TAGA 1C3XA 3JVVA 2C82A 4NBUA 4Y2XA 3MMZA 1JIKA 3ZX4A 3BTSA 3LCJA 4MRNA 4PWZA 2BFEB 5U9CA 5A0FA 4HYYA 2FK7A 1V39A 3BKXA 2KI5A 1E2LA 1YGYA 2RBGA 4IX1A 1Z17A 4XXHA 5GGYA 1CFJA 5IP5A 1GN9A 5G1NA 1C1DA 1HG1A 3HYRA 2IH2A 3B7WA 4KTVE 1GQOA 1DGQA 4NYIQ 1OR8A 3B78A 2EW1A 4MA5A 2QTZA 1OKKD 1T5SA 3L8ZA 3V46A 4WNIA 2AXNA 4C0HA 2E0IA 3I1IA 4XUEA 1P3DA 3KR9A 3JSXA 4L4UA 3HUDA 2CCKA 2G67A 4RULA 3DYVA 2VWPA 1GV0A 2A0FA 5CURA 5B2FA 1H65A 3FPCA 3C3MA 2J7KA 3R4VA 3UEOA 5CXUA 5BUQA 5JPCA 1I1OA 1G3RA 1NPYA 3OZSA 4GH5A 4CI0B 1JS1X 1GGHA 1QZZA 4QXQA 3SY8A 1U0OC 4L6CA 2QZ4A 3ROTA 2POCA 4DG9A 4YAIA 2PKQP 2XCIA 2PZBA 4NJMB 1GRCA 3BTUA 4TKVB 2UZ4A 1UBGA 2RI6A 5K2MA 4RKQA 5KSYA 4LHXA 1N32B 5LZ7A 5DTMA 4QUIA 3H9QA 4NRDA 4M7PA 3PNKA 1P6XA 4F3KA 3R1IA 2GZHA 2QBYA 1YUMA 4NENA 3S7TA 4C0KA 3EY9A 1I4OA 2ZRAA 1YMQA 3HTXA 3DP7A 1YL7A 4KLAA 4ZC8A 4JP1A 5IM5A 1J42A 1VB3A 4M9ZA 3IDAA 4F1JA 1SCIA 1W0KD 1BN7A 4DR4B 2YMMA 1ISFA 4BP8A 4W8GA 3W2EA 4YMIA 1JHVA 1SELA 5KNLA 2HQSA 2ZZMA 2AQIA 3JQ6A 4LZAA 1EA5A 3NKVA 1W36D 4J0FA 5FD8A 2AC2A 4GZ3A 4N3NA 1M72A 3QWIA 3ANYB 2HQOA 3PR3A 3H0CA 1EUDA 1ZPDA 2H7YA 4IDCA 4NPCA 4BTLA 2X3YA 3V1KA 5JNVA 2WM8A 3PX3A 1M33A 1SKYB 4JCOA 4RZHA 4Y7CA 3TF5A 1LB1B 4FR5A 1H8ED 2H0QA 4LVCA 5FWXA 5IT0A 4JI2B 1ONSA 3BILA 1W9MA 4S1NA 2QD3A 3AI2A 1QH8B 2BM9A 2O8NA 2XMSA 4QJ4A 3WYNA 5EPEA 4JJFA 4HNTA 3ZWWA 1OWPA 4I6JA 1W0CA 2IKSA 3F5FA 1BIFA 3HU3A 3I53A 4GNRA 4W6QA 5EYPA 4D3YA 1IU9A 3OTHA 4YH1A 2WTXA 4J16C 5I9BA 5K3CA 4NF2A 5KYUA 3DLTA 5FAXA 1UIRA 1T2AA 4Z8YA 2I7TA 2FKNA 1A04A 1Z45A 2VDUE 4TKLA 3SGLA 3T7RA 3TTTA 4G0VA 5A71A 2GBLC 5A5GA 1BN6A 1RMQA 2Z04A 1XLTC 4CG3A 4ZOAA 4N0MA 1TL7C 2VI5A 2DFLA 5EHIA 2PYZA 3W1WA 3PQDA 3L1VA 1Z38A 2JIBA 4I9FA 3SJ7A 5HJ5A 1DJNA 2JLYA 3RW9A 3T1YB 1K3UB 2QRQA 1HZZC 1ODJA 2OAQ1 5DYWA 4ZOEA 2NP6A 2ASVA 2CMDA 1OAAA 1AMOA 4ZI3A 2K7ZA 3FCOA 1X14A 1CLEA 3GD7A 1URPA 1RAEA 4AZ3B 3DKIA 4HOYA 1AQNA 4X6UA 5GADl 5E6RA 3SM3A 3EE6A 3UJ3X 3WJ1A 1IM8A 3ADKA 2OKCA 2I3DA 3DBRB 2P6OA 1T5BA 4RGYA 3E22B 2BHSA 5IUNC 2AFVA 3EPJA 3WK8A 1VL6A 2CLDX 2H3EA 1NI5A 1RXIA 2VT3A 4G4GA 3DEHA 5JXGA 2ZIAA 4J7AA 1XTBA 4IO1A 3NTRA 2JCGA 3GR6A 1S96A 4PPNA 5G2OA 4DB4A 4RTJA 2ZRQA 4EPXA 1DEKA 4X1YA 1RYMA 4PG4A 3KJXA 1FSZA 1S2DA 2IYFA 3STWA 1QF6A 1XVUA 3WKEA 2JFVA 2Q1TA 4MIOA 3CWQA 4JLKA 1IULA 1T4GA 2JI7A 1WHSA 1GVNB 3ABZA 1MH9A 3DZ8A 3H9GA 4KK3A 1MDFA 4KQXA 2P1DA 4P3KA 1SOMA 2FFHA 2WT8A 1SVUA 2HC9A 5G02A 4W8OA 5JSFA 2AD1A 1BWSA 2CFCA 3WLTA 3A32A 3G0BA 2DY1A 3L77A 1VLMA 2MSNA 1X80B 2IVZA 4NDNE 2BFMA 2CFTA 2QMYA 3CVYA 1JAYA 4PBSA 1IY1A 4MRAA 7YASA 1ODTC 2P9ZA 2WVJA 1XCPA 4Q66C 1WM1A 1X1QA 3DWGA 2X41A 4I5IA 2JLVA 3LUKA 2HSWA 4R9NA 1WSWA 3NNDA 4B74A 3BCUA 1NURA 2A5DA 3LYUA 2HT6A 3FFBA 4G1CA 4B75A 3X1XA 1B1CA 3RRFA 1KEPA 3EOAI 4C4RA 2PZAA 2QMHA 1QSGA 2X76A 4K9OA 4LQCA 4NBRA 4PWYA 4U5QA 5B12A 5KC9A 2WVAA 3ZVNA 1QRSA 3RGGA 2ECFA 3LUCA 4DLSA 4Q7EA 2X0EA 2KYRA 4JX9A 2VBFA 1SXJD 5CMLA 4EEXA 5AVXA 5ALVA 1RRMA 1RDFA 2QGZA 5JARA 3LRTA 5BQFA 3PLAE 4GOJA 2XTMA 3HKEB 4GHWA 4YRAA 4OXQA 4FNAA 4S1VA 4TRRA 2WD9A 3V8RA 3I3OA 3DTVD 5EHZA 3K1TA 1LS6A 3FZNA 3SLRA 1G2PA 3FUXA 4UEOA 4AJLA 3WMRA 1IHOA 2N42A 1M6WA 2OV4A 3C1UA 5CVEA 3J81A 1FDIA 2AFHB 4ZCTA 1NIJA 2F62A 2Q5HA 4IOJA 3IVMA 1LZLA 2FZWA 4A4DA 2O2YA 4RYLA 4YP1A 2GCOA 2NYRA 4X3PA 5E7JA 4O0MA 3VO1A 1ISGA 4UREA 1XMPA 1A1SA 1F5SA 1HYQA 2I6TA 3DTVB 1E9BA 3FNHA 3REOA 6Q21A 2WAYA 4YJGB 3ESYA 5CX4A 3DUFA 1Y6QA 4HAWA 5D87A 5MN5A 3K70D 1SVMA 2B4QA 3ZW7A 4AMYA 1ESZA 4URHA 2GN6A 2PBFA 3WIOA 3ENZA 2NQTA 3IAEA 2DH6A 2V6GA 1XLTA 4B35A 5FA6A 3ET5A 3M6FA 2CL7X 5TJHA 2QBYB 2AUMA 1B43A 1SZJG 3N53A 5EE3A 1DAGA 5EIBD 3DOUA 1YL6A 3C8UA 5KJFA 3UAZA 3NFYA 4G0UA 2ZS9A 3KELA 5HVNA 1P2BA 4JBGA 1VPLA 1GZHB 1DAHA 5TB5A 1Q7RA 2OO3A 4HEHA 4CT0A 3OTGA 4E6PA 3B6KA 3BXEA 1OD6A 2JG3A 1YI1A 2HJGA 3TI7A 4YP5A 1GZSA 2J3JA 3EEQA 2HF7A 1FFXB 4QUKA 5B3JC 1F48A 2V7WA 3GG2A 3RPEA 4Z4HA 1PNRA 2WYHA 5DK6A 1HSZA 1RM3A 3D4IA 2Y99A 4IJKA 3KAQA 1LK0A 4QHTA 4OF4A 4OXXA 3AERB 4Y2VA 2NUTA 4RFVA 1PT9A 1Z0FA 2Q8PA 2QSYA 4LWOA 1J33A 5D01A 2R79A 2OSBA 3SEAA 4NULA 1JAHA 1N2OA 2FPIA 2W0MA 3A3NA 3PA6A 4D4IA 4D0GA 3JD1A 3MWDA 4F04A 4TT3A 1KOLA 1NBME 1VJDA 1M8GA 2D7DA 4RH0A 1DAIA 5THQA 5HEKA 2XKBA 2KB0A 2R87A 4WZAB 1PDOA 3SHWA 2A92A 4ZIRB 1C8LA 2QT1A 2JZNA 1N2JA 2REQA 2ZDHA 2VATA 2NPIA 2EKBA 3EW9A 4NJMA 4YBZA 3C70A 4FDUA 4JXKA 5MDHA 3B8HA 3MIZA 4ZICA 3U3KA 2EEZA 3NIBA 4RCYA 2EP5A 1TKBA 1T9BA 1JYEA 1T1EA 4N0EA 5HOEA 5HRUA 1BOOA 2JHAA 2FW0A 3H3JA 3O1IC 4X95A 3W7VA 4PX3A 4MP6A 3MGKA 4L4ZA 1X0XA 4MV9A 4WCFB 5EEGA 1M2GA 1P18A 2PSFA 3WGVA 5FXMA 2HSJA 4HRVA 1YZFA 3HRKA 2E4XA 5BOVA 1NXXA 3KR1A 2YASA 1VBMA 3CF6R 4FGJA 4OQNA 3MSXA 4RWEA 5FPQA 1RYDA 4BBPA 4BQEA 5CAEB 2QD4A 1KIFA 1PFKA 3H11A 1O58A 5IDWA 4MV3A 3WWEA 2WTUA 4QQFA 2YFHA 2GZ1A 3P71T 4ETWA 3RVJA 3BB4A 1YHYA 2H52A 3GMTA 3CVXA 5ALFA 3R5TA 1F9EA 2PLAA 4UUPA 1H85A 3MF4A 4YRBA 1AKQA 1DU4A 2Y2UA 3EXIA 4H4EA 5BN3A 2IX3A 3CX3A 5K8UA 2DUUA 2C7RA 2EZ4A 5IKOA 2G9QA 3GW8A 1QFZA 3QYAA 4OGLA 5KVAA 4E15A 2Y1OA 4YUXA 4JP3A 1SXHA 1P9LA 3CW9A 1SD1A 1Y9JA 4GVLA 3W5IA 5K0NA 2BKAA 4DM7A 1W5SA 1VHLA 2XSZD 4E33A 3FUVA 4YA6A 1I4TD 1J99A 5C80A 2XZOA 1CWUA 1QQBA 2ZRKA 2F2TA 3PXBA 3NRJA 1FOEB 3Q12A 2FFBA 4LZJA 1E2JA 2WM2A 3PNLA 4FMCB 1H2ZA 2FPKA 2VK4A 4YLYA 3SK0A 3D3WA 4I4IA 4Q5IA 3PUZA 3LC2O 4PANA 4DIFA 1I5EA 2RB4A 2QTGA 3DTTA 4V0QA 1VCMA 3D8SA 5EE5B 1ZSVA 1RWMA 1ZYUA 3M5DA 2V03A 1OI3A 2GVNA 1Z7YA 4Q4AB 4ZDKA 4TXMA 2H2GA 3B70A 3U7GA 1X7DA 2VDWA 2YV5A 6YASA 2OP0A 1Z4PX 3R0ZA 3ZK9A 2O7RA 3BREA 5T8KC 1CJVC 1H1LA 1N6KA 2QVZX 5L7YA 3R3JA 2IU0A 2JIZD 5JQWA 2YJ4A 4HFJA 5E95A 4RPCA 5JADA 4W9NC 2AK3A 1BKDR 1PD1A 1RWVA 2IL1A 1YB2A 3RYFB 1IXSB 4W1PA 4PYJA 1FK8A 2A1UB 5FBHA 2JH3A 1MP0A 5IF9A 3ETJA 1Z5PA 3OCWA 2BJVA 2E3JA 1U8TA 1ACJA 4L28A 6ADHA 1Y5NA 1RMTA 5DCUA 4DAOA 1S6YA 5H59A 1NU8A 1U2ZA 3V4PB 1IBMB 2ATVA 3CKMA 4FOTA 4JS0A 4ND1A 4B6OA 1KERA 3SHFA 3M1IA 2Z57A 3OJCA 4XE5A 1M2JA 3VJKA 1U3VA 4X8MA 3F73A 4EUKA 1ZO8A 3PJDA 1EMDA 1H9AA 3FBWA 1W1WA 2IZOA 5CCBA 3DPUA 4B0PA 4YDSA 3A1VA 5I7UA 2JRLA 4KOEC 3PVSA 1GQSA 4GI7A 3ZI0A 3OX2A 5LZ4A 3SBXA 3GGCA 3TK1A 1NUQA 1US8A 4QVIA 1WXWA 3EIXA 3UPUA 2IH4A 1V41E 2Z5LA 3I6YA 2VG8A 1X74A 3QI7A 1XA4A 1WNTA 4M1ZA 5A4AA 3M5PA 3LO8A 3AEQA 3G9QA 3HKCB 4C4PA 1KU0A 1Z6AA 1U2TA 4B4VA 2Y8EA 3C3KA 4ZAVA 3U44A 4KSCA 3CONA 1OLSB 2V5UA 3AY6A 2YWRA 4PSCA 2ZBFA 4OB8A 3TBKA 4HX9A 1E62A 2M32A 2MINB 3FUCA 1P1BA 2EJUA 5E1OA 1P4HA 3T9CA 2IUTA 2AT1A 1QAMA 2ESRA 3S27A 4E7PA 1IXZA 2PO5A 1Z37A 3C6QA 1XPOA 3BTOA 1HV8A 1QIDA 4OKNA 1Z6ZA 4JELA 4PAQA 4PQGA 3O8OB 1AQUA 1E4OA 1Z2OX 3PGKA 2AC4A 1MTZA 1D6MA 2QVCA 4CFSA 2G0TA 4M9RA 4C3ZA 3BMQB 4OAPA 1MQAA 2HH9A 5HFAA 1N33B 2PSHA 3BGVA 1SOAA 1S8OA 3FSGA 3EYAA 1PJSA 2DM6A 1Z63A 2HX1A 4PF1A 4IFBA 4WN3A 3SPXA 3EAQA 3I5XA 4M89A 4EI2A 5JEEA 1EJBA 2BHLA 1KTVA 5EJMA 3HN2A 1CUFA 3RBZA 1ZIOA 2EAUA 4HYTA 4CU5A 5BYAA 4NARA 5BV2P 1D8AA 1OVMA 1U3UA 2A35A 3GBPA 4EKGA 5INTA 2FSGA 4IH1A 2F3PA 3EIWA 1QX4A 3T35A 3PR1A 5ER9A 5L53A 3EXFB 2NSHA 4PZYA 4RL4A 4TPKA 3O84A 3ZDAA 5LP6C 4ALIA 1KZYC 2VA9A 4O4IF 4TTPA 2G4VA 3OLWA 4UM9B 2GD0A 1BH6A 4DCVA 3HM9A 3NKFA 4Z5XA 1MRNA 2X1HA 1U1CA 1J22A 1W4LA 1AH2A 2B20A 1RXUA 1T34A 2Q3FA 3CN9A 4XVRA 5ALJA 3HY6A 1SVSA 3MIIA 2WIDA 4NJOA 2GM9A 3ZK8A 4OKSA 1ES9A 2J0UB 2A0XA 3HXPA 2RK4A 4XD7A 5K4GA 3QPAA 5IG2A 3OIDA 4HQFA 3FG9A 3IOYA 4FOSA 3JASA 3W2IA 3M4JA 3QLUC 5JAZA 1TQHA 3JALB 1OC4A 4MZDA 2FZ4A 4YQYA 1Y34E 5HGXA 2JASA 2QM7A 2ZR8A 4XM0A 2IUUA 2BELA 1G1MA 3KD3A 4ER5A 3FJYA 2Q1UA 1OBOA 4PHCA 1OPRA 4F84A 4MDEA 2VDLB 3W6NA 4D02A 2JJMA 3WK9A 1EFPB 2HWXA 3KFXA 1KAEA 2I1LA 3CSUA 4NZZA 2Z95A 3CRVA 4IIHA 2GD1O 1DARA 2IPLA 3VR4A 2DPXA 3JRNA 1WHSB 3R7BA 2IYWA 4EW3A 2PUAA 3DMTC 1YE3A 1MA3A 1PK7A 1M34B 1RC0A 2O54A 1USWA 3LFUA 2DX7A 1PLLA 1YFJA 3FE2A 3OX4A 1NSFA 3FOEC 4AI6A 1CY8A 1E8NA 3EUFA 1A8QA 3OQMA 2ATEA 4COOA 2IITA 4E2ZA 1PFGA 2RC6A 4YMHA 3N87A 3KZNA 3SWWA 2CDRA 1VBFA 4NZ9A 1MC1A 1USKA 4TXLA 1DCFA 3QEOA 3Q7EA 1GILA 4XWAA 3I1FA 3F67A 1R8JA 2DCMA 4WVFA 3IAHA 4RM2A 4H1WA 1E1RA 1ILWA 1EH5A 3E9YA 5KYVA 2JIQA 4AG3A 4UNRA 1GDDA 3F7TA 3V97A 3EVNA 1NIPA 3E23A 3KLBA 4HFMA 1ADBA 1TZKA 5CD1A 1NVUQ 2QXYA 3DFZA 3ANTA 4ZP1A 4AIRA 3IAFA 1MHTA 1DFGA 2J3QA 1NBHA 4Z4QA 3ZV5A 4RCZA 3U9SA 3EZFA 4DXDA 5LZ2A 2JRCA 3OZGA 2ZB2A 4MRSA 3CEMA 1DJLA 1VIMA 4XLZA 1QGED 2WOOA 3RH0A 4B79A 1B8OA 1U8XX 4GXTA 4UHBA 5B4UA 1P39A 1K2WA 3MMXA 1N57A 3EZ7A 3OEHD 3Q6NA 1MJGA 2IP1A 3W05A 5CB8A 5KVVA 4TV8A 3K1AA 4BVFA 1NN3A 4HR7A 4RF4A 2B61A 5AKHA 1O0BA 1UKEA 1U2EA 5DFAA 1K68A 5HW0A 4Y9SA 3ZZUA 4GMKA 4GDMA 1YAJA 2Y0PA 4RUKA 3G2LA 2A1UA 2RJOA 3AERA 5B58T 1E9SA 2QZJA 4E7OA 2BEUA 2O6HA 3RI3A 2XGOA 2X4DA 5GJWC 2GHTA 5CLJA 5JISA 3S70A 3T3IA 5I9SA 3RFTA 4ZT2A 5ECWA 5GVSA 1GM5A 2QTTA 2Q8QA 1KVUA 1TA9A 4D9IA 5FL7A 2QU7A 2W2VA 1VL2A 5B1DA 4QXOA 3GVXA 3C5VA 2FV8A 3LPNA 1WU7A 3QTLA 4ND7A 5HNKA 2GEBA 2H9AA 1SCJA 2ZW9A 2QG4A 2AG8A 1NE7A 3B7PA 3G2HA 4BO2A 4EDHA 1T8YA 1Z12A 2C95A 3DA8A 4X63A 1K5PA 2PWPA 3MCZA 4WBXC 1JLKA 1AY0A 2A5JA 2HLDD 1UPFA 1O97D 2QQFA 3FM9A 3GMSA 3L7AA 4P0TA 4P86A 4IM7A 2Q1SA 1K4KA 4W5JA 5DW0A 5I5EA 4EI9A 4GM4A 1QGDA 1F2UA 4GPD1 1M75A 5C7YA 4RPHA 3VPCA 2CLCX 2FR8A 1IM5A 1R6DA 1C30B 2X2EA 3FMIA 3PLNA 1V9LA 1N0WA 3JSAA 2X8WA 4ID9A 5F77A 3ZH2A 3TLJA 3RC2A 1V8FA 4C87A 5AUOB 4JUFA 4YCLA 4KH1A 4PG5A 3DUWA 2J4CA 4AF7A 1DWQA 3FWNA 2HFJA 3WLPA 3S28A 3LCUA 3LC1O 1ZDMA 2C9MA 2J31A 2Z2ZA 3BXFA 4XVHA 3VYUB 4OHKA 5GPBA 2WC1A 3PE4A 5IK2A 2QTNA 3OE5A 4X3OA 1IWPB 4M1QA 4A6EA 1XPRA 4Z4GA 1Y8CA 2H1FA 1J09A 5IVDA 2RD2A 2VJNA 3MMPA 3NJ4A 5I8PA 1QZUA 2ZVJA 1YI0A 3IAS1 4HB2A 2WICA 1PK9A 4FZ5A 2KQUA 2W6JD 4BWYA 5HUQA 3F8SA 4TS1A 3GARA 3HDYA 4C1NA 2PS0A 3OBBA 2R6DA 1XA3A 3BD9A 4H3KB 3DO6A 5KIAA 1TEVA 1BWPA 3QKTA 2J59A 2JLCA 4GRIA 1QKJA 4MW2A 1G21B 3DM9B 3H8WA 5BRAA 1CTQA 5I4IA 3LF1A 3BMNA 5E7QA 1ZNXA 3BE5A 3SXUB 2JLZA 3VTAA 3CR7A 1OFTA 4BFYA 4F72A 1BXGA 3O5AA 2XUPA 1NULA 1AUQA 5FUBA 1K5GA 1QKIA 1ZMRA 3FMVA 3GH3A 3L4SO 4GD3Q 5LBIA 4AJ9A 1GAEO 4F4FA 2CXNA 2Q2NA 4AWBA 3W5CA 4TM7A 3I0MA 2Q5OA 4FE7A 1HDCA 3A3OA 4JJ7A 3FSRA 5F2EA 3W1VA 1ECFA 1KZGB 4JZKA 4WASA 4EG0A 2AX4A 1VPEA 2HUPA 4PTZA 1CEXA 2GBPA 4MS4B 4NBSA 2PH1A 4OFWA 4NCAA 4ZDWA 4BV8A 2VF4X 5CLGA 3DULA 2NZYA 3OKAA 4C3UA 1YB7A 2XI4A 1KH1A 1U04A 5A5FA 3VGJA 4GOMD 3TZEA 4LF7B 4AZWA 4ENRA 1C0EA 2G8NA 1RQGA 5T6MA 1QORA 1YB1A 3GFPA 3S1AB 2GARA 4CN8A 4EG6A 4LFCB 4OXRA 2VAXA 2CBGA 3MGGA 2G1AA 4EGFA 1M1YB 2QLTA 4LZOA 4XI9A 2NTVA 1F51E 2FUNB 3CPJB 4BRZA 1VHDA 2Y1GA 3EWSA 3ISJA 1K97A 2IP2A 2JJ2D 1UOEA 1GT91 1S9DA 3GN1A 4KLNA 2GK6A 3WFZA 1SBIA 4Q01A 1YCFA 5DWVA 1W4AA 3LCMA 4OFXA 3WXMA 1UJ5A 3ZXSA 1GPNA 3VOBA 2IXDA 1YQ9A 3GBSA 5DF1A 2NV2B 4LI0A 5JWRA 3GOHA 1S8AA 2X77A 2QQGA 2XCLA 3ERCA 5E1MA 1Q74A 1ULBA 4KI7A 4BMZA 2EW8A 1DBPA 1KEZA 1NR5A 4PXSA 1AKMA 1KEVA 1QRTA 2IUYA 1H6CA 2O6LA 2I3AA 2FSUA 3QE2A 4OB6A 4FOLA 4X1KB 3WGTA 5BSFA 1RWNA 1FXUA 1SVNA 1NVEA 3L3BA 3DCJA 4RORA 4DSNA 3ZDXB 4EYGA 1VG0B 3JZFA 2CDAA 3HGTA 4HS9A 1RWXA 5B36A 2RG7A 1DINA 2VJYA 3BMCB 1IN4A 3IYLW 3L7IA 4PYLA 5FV7A 4BFLA 1KOFA 1NVDA 1ZGJA 1NP7A 3VR4H 3CRNA 4Z4IA 3NHLA 1QU2A 5JD6A 1K86A 3A3PA 3TINA 3DE7X 3KV1A 1XD2A 4PZCA 3IAUA 4UE2A 3ZHTA 2ID4A 1SVOA 4H1HA 2JLWA 1IJEA 1F6WA 1U81A 1CUBA 4J1TC 1ZGGA 2EOAA 1GXSB 2OTCA 3HWSA 4QRDA 4LOLA 5LC1A 3KWFA 4D45A 2B1IA 4EWLA 3S8YA 4G4SO 3AIKA 4QUJA 3FDFA 2OOKA 2WJJA 4D7AA 1GQ2A 2HRRA 4RVHA 4BEWA 1IJKA 4BGDA 3IPRA 4F96A 4M9SA 4Z51A 2WP8J 3U3ZA 4DRYA 2ZJAA 1AHPA 2DBZA 2CV2A 1T1IA <