4HDCA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk: compound 41)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
195
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdcA00
1K5GA 1MRNA 2DWQA 1A4RA 3CO5A 4HLQB 3DL0A 3EAQA 1NN0A 1T8TA 4N0DA 4IKEA 2EFEB 1IJFA 4DCSA 2GZAA 5H1YA 4C7OB 4ABYA 1OE0A 4XTRA 3GJ7A 4ESHA 1OXTA 2ZETA 3U7HB 1DAIA 2PBRA 3ZD6A 5JJIA 1G20E 3RWMB 5AUOB 1HT1E 4PR0A 4OHXA 4X8LA 3RDPA 4WZBE 1FZQA 2J7KA 2IYLD 5FOSA 3UXMA 1W5TA 5DGXA 5J4LA 1IN7A 3VHLB 3VX3A 3SN6A 5DYGA 4DB2A 2XOKD 1M7BA 3EASA 2E1RA 2D74A 4QXAA 1E3MA 2CVFA 4DLXA 1ZCBA 3VR5A 1WA5A 2ZU0C 3UATA 4CDGA 1KO1A 4I4LA 2PT7A 4MKHA 3KZ1E 3L8ZA 1XCMA 4F92B 2ZRMA 1NKTA 3QKSB 4HUQB 3QEOA 3M4YA 1KDPA 4AWXA 3HP1A 4JSYA 2J3EA 2NIPA 2PEYA 4WA7A 1A5TA 5G3ZA 3KFXA 2DFNA 1AM4D 4PX9A 2ZUBA 1YRBA 1FX0B 2G0TA 3LA6A 4MKIA 3KQNA 5FOUA 2NZJA 3H2YA 3DOEA 3TAUA 5KPDA 3N2IA 1G7CA 2C9CA 1N6OA 3ADKA 3PVSA 4M1YA 4OHWA 2PX0A 2R8RA 4Q19A 3S1AA 1AQYA 1P2TA 4B3FX 2DBYA 5DYIA 1C9KA 4C2TA 2BBSA 4YQFA 2OSBA 4JVNA 2ZJBA 5K8TA 2QSZA 5FR1A 4KI0A 4B32A 3VFDA 3X1DA 2C98A 1P2VA 2Q3HA 4MGZR 5EXTA 1G17A 2EU8A 5CDFE 1CRPA 2QGZA 4Q4AA 3BWDD 3UG6A 5KNCA 3THWA 4KFTA 1D9ZA 2ZROA 2OBNA 3MLEA 2QAGA 4OQLA 2OHFA 1NMXA 2VSFA 1KAGA 3B13B 4HAZA 1YR9A 1LF0A 3EC2A 2RHDA 4ACAA 1YZGA 4M4SA 3CWZA 4TN1A 4BGDA 2IYRA 2QENA 4NKRA 4BZXA 4F4CA 3NBYC 1J8YF 2WJHA 4FMDB 3QG1A 4M1OA 4POAA 3NKVA 4P31A 4TLAA 2JJ2A 4Q4HB 4ASUD 3R20A 1G3QA 1KI8A 4V0KA 2P2LA 4MGYR 2ZYUX 4V02A 5IF9A 4TYNA 4LJAA 5IRCD 3HPQA 3UG7A 1GZSA 4DC9A 1IXSB 2B7BA 1Z6AA 2F7SA 2ZEJA 4GZMA 1S2MA 1N0WA 4JBXA 3KJIA 1G3IA 2MSEB 3H86A 1HURA 3ASZA 2R6FA 3M6AA 4I1VA 4M1TA 3VHXA 5EXSA 5C46F 4EPVA 4JL6A 4GDFA 3RC8A 4TLDA 1PUJA 3CLVA 4II7A 3PJRA 2JLVA 4QJ4A 1KY2A 1I4LD 3BXZA 3HYTA 4IDHA 1YZQA 2A3RA 3DPUA 1LV7A 4CYMA 1E2EA 5JCPA 2A7QA 3CX8A 3V9PA 4I1UA 1B0UA 2AK2A 2OAQ1 3QXSA 4CZ2A 2ZJ2A 2A9KA 5BN5A 2AFIE 2YC2C 1MRSA 5TY0A 3AM1A 3PFIA 2WAXA 1FTSA 1DAEA 3VMFA 2YYZA 1CEEA 3CZPA 3PUZA 5BYJA 1O87A 3QXXA 2NO0A 3VU9B 3I61A 1CJMA 2V6IA 1GFIA 4HZIA 4MRPA 4LV8B 1FQKA 2JA1A 4N3NA 1NLYA 3NIBA 4JJKA 3W3AA 4TL9A 2WOJA 4GRAA 2OBLA 5TB5A 3BD9A 4I1OA 4MYTA 1XEXA 2PMKA 1R0WA 3C41J 1NSFA 1WF3A 4FMBB 2VP5A 2ZS7A 3OAAA 4IVPA 3CM0A 4LBVA 3ZVLA 5KHOC 2OE2A 3AP2A 3AKYA 3QKTA 5EE5B 2IWHA 1JXOA 1LVGA 4C7OA 4ESVA 1VMAA 4LHYA 1W46A 2GK7A 1UFQA 3RRMA 3TVDA 1PLLA 3PG5A 1KSGA 4Q02A 4A0RA 3DMNA 3NVAA 3SS8A 2D7DA 5KDOA 1W5SA 4GMXA 4A8JC 3I73A 4EUNA 3B60A 1RC8A 3FMPB 4MGKR 2W6JD 3SNHA 2RH5A 4IOMA 4EAQA 3P1JA 4AURA 3QF4B 4V03A 1H8HD 1S9HA 4TSFA 5CJ2A 1U99A 3TR0A 3GP8A 2J7PD 3GLFE 4D82A 4RKEA 3KUDA 1W48A 2Q3FA 4RKFA 3QKSA 3B8HA 4RD3A 1OPXA 1ZMXA 4TT3A 1GUAA 4JT2A 3TLXA 1R0YA 2C5LA 3LX5A 4OI2A 3LD9A 3RHFA 4DDWA 4UNNA 3GEIA 4QNRA 4OHVA 2FMXA 3ZYCA 3EPKA 2ZYTX 4HLUC 2ZXUA 2JLRA 1FX0A 3EPJA 4URXR 5FUXA 4DLRA 2RGXA 4GMDA 2D3WA 4R2HA 4UNPA 5BWMA 4KLNA 5J4VA 4DLTA 2HUPA 1Z0JA 2ZJZA 2ZRFA 1TPZA 5EE3A 4ZKEA 5DN6D 3R8FA 1R7RA 2H5EA 4A0GA 5E7MA 5AUQA 3GJ3A 2N46A 2OV2A 4DHEA 2ZR0A 1XJQA 3U44B 1FP7A 1CR4A 1KYIA 2BVNA 1ZD9A 1ZM4A 3L0PA 3KB2A 5L3QA 2FX3A 4B6EA 2BBWA 2VHJA 2GJ8A 3U7GA 5AUNB 1T3HA 5IK2A 1EFRA 4Q4JB 1KSJA 1PLKA 4GP7A 4HATA 3LH5A 2GRJA 3CWQA 5FI1B 4BFWA 4LWZA 5FUWA 2HYIC 5AJXA 1ZVQA 4DT1B 1AQUA 3FKQA 5JI3E 3X2SA 1Q1EA 1J90A 3LDAA 5KPJA 1TF7A 1HTWA 1SVOA 2ZU6A 2HLDA 4OQFA 3HJNA 1GITA 1Z0KA 3ECCA 5LDDC 2OFXA 5EZ5A 1ZM7A 3IIJA 4Q4HA 3SHWA 1JAIA 1Y63A 1ZNZA 3PEUA 1RVDA 1E2DA 2YOHA 1AKYA 4XD7A 4M9SA 2CE2X 1AKEA 1KSHA 2BIFA 5HE8A 1NF3A 1CJTC 3TE6A 2H1LA 4KV9A 1S3GA 3EA5A 4NCKA 4URUR 4OKSA 3MFYA 3THOA 2A5FA 4JIMA 1CJKC 1KKLA 1KDRA 4LHZA 2N1BA 1G21E 4M53A 4F91B 3AV0B 4OK3A 1TMKA 2EWWA 4D4MA 3DKVA 1U90A 2GAAA 4C0KA 1Z2CA 2FZ4A 2ODWA 4Q9LA 3WHKA 4QRHA 4DSTA 3B1ZA 2G77B 2BMFA 421PA 4EQ6A 2WSMA 3CR7A 3GD7A 3O8CA 1KIMA 5KSZA 2VHCA 1B23P 2FF7A 1SULA 2F6RA 4FCVA 4GT1A 1T5IA 2J5XA 1TX4B 4QFMA 3NBZC 1UAAA 3TRFA 4G5QA 1DO2A 2G0NA 1GKYA 3A4NA 1UDWA 4KYIB 1FP6A 1FTNA 4DEXA 4NP6A 3NC0C 3T5DA 2PJRA 3PEVA 2KB0A 3T15A 4KBGA 1G8GA 2VP0A 1E0SA 3KJEA 3LFUA 4P3YA 4PHGA 3Q72A 5GJCA 2R6AA 1G1MA 3K70C 4L5BA 3SDZA 3IKJA 4B71A 3KUCA 3TQCA 3AUXA 1YU9A 4QHSA 2XX3A 4BASA 4BFTA 4LDJA 2GXQA 5D3QA 4B3BA 4HZUA 4H1UA 4EPWA 2FG5A 2IEYA 1Q44A 3RS5A 1KNQA 5J4HA 3SJBA 5K8LA 1Q1QA 5HCIA 3GFOA 3ZQJA 1CULC 3PV0A 2QT1A 4A15A 4N1AA 4YLGA 2OXRA 1JXMA 1ZIOA 2OCPA 3WNCA 2H7VA 1E0JA 2GCOB 2H92A 2OT3B 4KBFA 2GHIA 2GJSA 1LY1A 3AUYA 4LJ9A 1TQ4A 2C95A 5KUTA 2IYWA 2R6CA 5FOXA 1Q20A 2BWJA 1JR3A 4ON9A 1HQYE 1P4SA 3B85A 1DVRA 2JJ2D 2EWVA 4PSKA 1SVKA 2DPXA 1Z06A 1US8A 3LO5A 5KDDA 1NNEA 4NE2A 521PA 4YC7A 5H70A 4QOSA 1VTKA 3E70C 1GKIA 2ZRKA 1G8FA 1NIJA 2C8VA 4LK2A 1RYHA 2J0UA 1R8QA 1QHYA 4Q9HA 5JFGA 2D4HA 2A5DA 3PUVA 5CLLA 4P4SB 1MABB 3WMEA 1GM5A 3DMDA 1UBCA 3HDTA 3QF4A 4HAUA 2QBYB 3CBQA 3WY9A 2RGEA 2AFHE 3VR6A 1MOZA 1GRQA 3O47A 4M9XA 1SVMA 1MH1A 3FB4A 1GOTA 4QBIA 5AJYA 1OFTA 2ZRDA 3KJGA 3I8XA 1G8YA 2PJZA 2Z0MA 1VCNA 2DFKB 3RS2A 2F1RA 2PCJA 3DM5A 4LV6A 4CIDA 1OB2A 2ZRCA 5HPYB 4XSHA 5FH9A 4AYWA 5CB8A 5L3VA 1E94E 1ZNWA 2DR3A 2OEPA 4Q66C 1TADA 3DZDA 4OK6A 1LF5A 5C4GB 4WXPA 2DYKA 1R8SA 3QBVA 1P72A 1AIPA 3CW2A 1HY3A 5C4MA 5LB4A 1E69A 2ZI6A 2FH5B 1J70A 5JHHB 2ZVPX 5ELXA 3U44A 3NXSA 2I3BA 3QNUA 2F9MA 2XGJA 3AVWA 1D2EA 1QDEA 1UADA 3CRW1 5IHPA 1K6MA 2XTMA 2Q6TA 3RS0A 2W83A 4HLUA 2X2EA 2X1VA 4JLKA 3SZRA 1W36C 1F60A 3BORA 3VNUA 4CW7A 4GOJA 2P5SA 4Q4JA 1DAMA 2JJ1A 3NEYA 3GEEA 5FUVA 4F4IA 1GNQA 3K0SA 4XVQA 4WAUA 2AX4A 4E03A 4GPTA 3CF6R 3U7EB 3E1SA 4TLEA 3NH9A 3VAAA 1XX6A 2FSHA 1XTJA 3MAAC 4PQFA 4Q7JB 3OAAD 1Z22A 3X1XA 2ZS8A 4XVRA 3IDQA 2KWIA 3SC3A 2QUZA 4BQSA 4D80A 5FOVA 2FSGA 5SZHB 3C8UA 3TSOA 1M6NA 4KJZA 1SVLA 5FBLB 3RS3A 3T1TA 5EP3A 1J2JA 4LRWA 2NG1A 4NCHA 4PC1A 1E9CA 1VPLA 1G4UR 1QG2A 1MV5A 3VR4A 1S1MA 1KI7A 3T06B 2DWOA 3RLFA 2IXEA 3IQWA 2ZSFA 4QM7A 3UWOA 5JZVA 1MT0A 2QROA 1KNXA 1CU1A 2C04A 2WM9B 4KSCA 4BFXA 4TSFD 3SU8A 3KQLA 4MRVA 3LX8A 2V8OA 4YDHB 2KJQA 1U94A 1WQ1R 1XU4A 1II9A 4CVNA 1IJEA 1PZNA 2OXCA 4P4UA 2Z43A 4TT3D 2RB4A 5FI0B 4AKGA 1SKYE 3S1AB 3AKCA 2ZRBA 5DLQC 3A4MA 4OJQA 5AWFC 3NEJA 3SQXA 3K9HA 3OEEA 4A4DA 2GEVA 1WMSA 2GJ9A 3CR8A 4RSGA 4CEHA 3ND9A 1OFIA 1W4BA 4W7SA 1ZU5A 4HB0A 2NTYC 4BUJA 4HB2A 2IF2A 3WNDA 3GJ8A 5FBWB 3THWB 1P9NA 3EZ2A 4K8OA 2ZE7A 2ZJOA 3CRMA 4US1R 4LY6A 2QAGB 1Z5ZA 2J59A 3QPVA 1TL7C 4UJ3A 2JLWA 3CNNA 3FDIA 2R6GA 4IOJA 1LFDB 4RZ2A 1S0UA 1EFUA 3GFTA 1VG8A 1QHXA 2Q9AA 2D2FA 5EZ6B 3LVQE 1HEIA 4V0NA 4ZO4A 1KAOA 2CL6X 4GP6A 5IK2D 1EFRD 1GP2A 5CM9C 3VKGA 4PPGA 5CITA 4YXWA 2GCOA 4YMWA 2ATVA 2QA5A 3WYFA 3MRSA 1NVWQ 2BCJQ 2VLIA 3KXKA 4PFSA 2HLDD 1FL9A 1NRJB 1W4CA 3IPYA 4JL8A 1XDBA 5KSPA 1P2UA 3AVXA 4PXAA 2PCLA 5G41A 1YZNA 5FFMA 1S4QA 3KDSE 4XD7D 2CE7A 2IT1A 3W3ZB 3W6NA 4P4TA 1R4AA 5G53C 1E2IA 2O0JA 1G9XA 3Q8XB 3IBGA 4GOXA 1ZC3A 4B76A 2OFOA 3B7GA 3VR2A 2AHOA 4H1VA 3T61A 2AWOA 4P4SA 4FCWA 4DUGA 3KX2A 3B6EA 3NG1A 5JHGB 2ZRJA 3MWLA 4B74A 2X19A 2QBYA 3NWJA 2BBOA 5JECA 4B34A 3K53A 1SVSA 4Q47A 1ZM3A 3RAPR 3CF2A 3AVPA 4TMZA 1II8A 4DLYA 2D2EA 4Y0VA 2RGDA 2Z6VA 4B3CA 4DXAA 2FJUA 4DB4A 4PO1A 2ONKA 2OO7A 1YZUA 2QP9X 2ZIAA 3KTAB 1E2HA 2A78A 3PIRA 4LPKA 4LUCA 1UKEA 1QHHA 3E2IA 4V0LA 1Q21A 4OBEA 1VCIA 4DDVA 1L8QA 1A2KC 1R5NA 3IPXA 3ZS8A 2DY1A 3FHCB 5JBQA 3VX4A 1HUQA 1ZYUA 3W8RA 1BYUA 4UKDA 1OXVA 4US2R 3QJYA 3BJIC 3CB4A 3RNLA 1IXZA 1DS6A 1AJEA 1ZD1A 1XD2B 2BMEA 4HAVA 2KI5A 2QQEA 2WWXA 3ZZUA 4U7DA 1M8PA 1SZPA 2V55B 5GJBA 1VIAA 2ZJYA 1L4YA 2GNOA 4G01B 2ZAOA 1F6BA 3BAFA 3O8BA 3AQ4A 2IYVA 4RD1A 3BB3A 4OQMA 1UJ2A 2RGCA 4Q00A 4HYYA 4AD8A 3F8TA 4DEYA 4XWAA 3PR1A 1OFUX 4WZ6A 4C0QC 2NPIA 3JZMA 4WVFA 2G9NA 4YMVA 1XPUA 2UZIR 3TVTA 2WKQA 2WOOA 1JR3D 5DH9A 1N6RA 1WE2A 2PZGA 2XNDA 4RJLA 1SKQA 2ANCA 3PUXA 2CLSA 1MO4A 1D8TA 3LLUA 3TJZA 3CF0A 4Q9JA 1X8LA 2EVWX 1EFHA 3CRVA 3R8CA 1VG9B 3ZIAA 3MUFA 1OW3B 1JJVA 1FUUA 4M22A 2EFCB 1XJ0A 4PZYA 4L4UA 3TMKA 1OH5A 2O8CB 2NO7A 2YWFA 5EQTA 3SBEA 4CEIB 4UQOA 3T1VA 3IHWA 1P9WA 3VR3A 2ZSEA 4M1SA 5GADl 1FFHA 2ZRNA 5EE1A 4BLOA 4DLSA 4FMCF 3TR5A 1HH4A 2QPOA 5CIWA 4Q4LA 1U0JA 3IQXA 1E9AA 1KHTA 2P6UA 4RFSB 3L2OB 3TNFA 2ORWA 4TTQA 2GWHA 4BLQA 4BECA 5EXXA 1QVRA 4KSBA 2ZUCA 4OHZA 3LQRA 3W5JA 1NVXQ 1QHSA 3CRQA 2NPFA 3FYHA 2ANBA 3U5ZB 2QG6A 5L3QB 4ZI3A 2IXFA 5GJVC 1PLJA 4FCTA 2FFBA 5UKDA 3CPHA 1KJYA 4TMVA 4H9GA 3BOSA 3OIYA 1OXXK 2HCJB 3QSYA 3P32A 4MDEA 1NN3A 2CXXA 1Z28A 2CEAA 1JJ7A 1MO5A 2QEQA 1CJUC 2IS1A 2Q9BA 5AJWA 1LS1A 2XEXA 5BN3A 2NGRA 1GL6A 1UBEA 1V43A 1ZUHA 2Z4SA 3SHFA 2EFHB 2QP4A 1YR6A 3BFKA 2VPPA 3MJHA 4W5HA 5FL7A 3ADDA 2JJ1D 2A5GA 4RD0A 5D3MB 2QGNA 1OFHA 3LBNA 1TUEA 4KCGA 1X8JA 4PHFA 4EJSC 5KSYA 2HXSA 2CHVA 3REGA 5CK4A 1COWA 2FSIA 2F9LA 2KBEA 4DCNA 1IAQA 3B1XA 2IX3A 1XD9A 4X8HA 1BS1A 1R5BA 4PO9A 2REOA 4HAXA 3KJHA 5KU1A 1Z63A 3BGWA 1G4AE 3AVVA 1NBMA 4DZZA 3K1JA 1E99A 4WZAE 4BRWA 3GLGA 4AIIA 2QSYA 4A6PA 2PX3A 1TQ2A 1H65A 1I4TD 1G64A 1G6OA 2QZ4A 4QNMA 3UMFA 1KDTA 4YONB 1IN4A 2RKOA 2FDCA 2CL7X 4YMSA 4B2PA 1ZU4A 4RZ3A 3V00A 2OG2A 4EJSB 3O8RA 4R7ZA 1YRAA 2WJGA 4NMMA 4OQXA 4A1FA 2G83A 1JR3E 4EQ6B 1L4UA 4A92A 3RRYA 3AVTA 2W0MA 3QIAA 2FGKA 2ZYWX 3W9YA 2OCBA 2DB3A 5H8WA 4LYHA 4DWJA 1YZTA 4JSTA 1RRFA 4AYTA 1M34E 2ZSAA 3A37A 1ZNXA 3BK7A 2IYTA 2VTKA 2ZUDA 5EE0A 4JYBA 1XEFA 3EZ9A 5EUMA 4PZZA 3GEHA 1SXJE 4DCUA 1ESMA 2WHXA 1E0AA 3KTAA 4KVAA 1TF2A 1PUIA 5EE9A 1YHNA 1NL3A 2V7QA 3OEED 3WRYC 2W2TA 3CNOA 1G3MA 3LXRA 3L8YA 4NDZA 4CRWB 2FA9A 4B44A 3FWYA 1UKYA 3B1WA 4EFLA 5F9HA 1G3RA 2F1IA 2ZJAA 2TMKA 1Q22A 1SQ5A 4HZUB 3ZVNA 5DE3A 2FV8A 1ZUIA 1W4RA 2CK3A 2IYQA 4DCTA 2CCKA 1XD2A 4AKEA 1QRAA 3HYRA 2RGBA 2WJIA 4BFUA 2ZRGA 5TMPA 1Q1BA 4MH0R 1KK2A 1D2NA 1UPTA 2IHYA 3SEAA 1SXJC 3RSOA 4DDUA 2XTNA 5G3YA 4HDCA 1SHKA 3CX6A 3SJAA 2JLYA 1G6HA 1OT3A 2AL7A 4HLDA 4TYPA 4LGMA 3U7FB 4MA4A 3SFZA 4YXWD 1XBTA 2GXUA 1US8B 4U5XA 1D5CA 4PC6A 5BYKA 4ZKDA 3AVUA 3IILA 1NY6A 3EC1A 1OH7A 2KBFA 4C0HA 3QG5A 4URWR 4ZCIA 2KE5A 1X86B 3DO6A 1FMJA 2WZQA 3KL4A 4Q5IA 4AI6A 2J0UB 1IY0A 2YKGA 1SXJB 1W47A 3CIOA 5AJZA 1E32A 2ZRPA 1JEDA 1OSNA 4Z8YA 3U3RA 3AF0A 3BH7A 4QKQA 3WYGA 1XB2A 1T91A 3QY0A 1CIPA 1KK0A 5IDVA 1AA9A 4U02A 1E2QA 2FFQA 2CMKA 4LYFA 2ZRLA 4A8JB 4QGAA 3EW9A 1ZAKA 3QENA 4DUGD 2O8CA 2H16A 4AG5A 1S8FA 1U8YA 4CEIA 4M1WA 5TV2A 1M74A 1XCGB 2Z4RA 1JAHA 1FOEB 4DLUA 3R7WB 2KSQA 1GKUB 1TEVA 4PC2A 3QVVA 5B30A 3U61B 1G5TA 2IYSA 2XNSA 4Q21A 3RVBA 1AZSC 3EZ7A 2YINC 1FNMA 1ANKA 3OHMA 3QEJA 4RFSA 3U60B 1QHGA 1S1CA 1E2PA 4NHOA 4MKGA 5JWRA 1KI9A 2P65A 2ZM5A 1E9DA 4MRRA 1DEKA 2XJ4A 3TUIC 2D7CA 1WXQA 1UBFA 4ZPXA 4MYHA 4LBWA 2IYUA 2VEDA 3U6KA 2IBMA 5FOWA 1Z6TA 5KYKA 3FVQA 1WRBA 4KVGA 3SOPA 5FTMA 1RIFA 2NZ8A 2QY9A 4LBYA 1M7GA 1FNNA 3CPJB 2QN6A 1LW7A 2FPMA 1XFAA 4LBZA 4QBFA 4D2IA 3ZD7A 1V5WA 3NC1C 4DSNA 1E9FA 4IEIA 3MWKA 1P75A 1Z83A 3EIEA 2JLXA 4XSGA 2GTPA 3QPUA 2ODBA 3DM9B 4U00A 5AR1A 3CONA 4TL6A 4TMXA 1RPZA 2WMNB 1GRRA 5D3MA 5GJWC 1OJLA 3GPLA 4Q9IA 3PEWA 1P5ZB 1UDXA 5DHFA 1G16A 4AYXA 1BYIA 1T0HB 2ERYA 3BIFA 1AGRA 2DCUA 1P62B 1N5KA 2J87A 2ZS9A 1UEIA 3IO5A 4BZPA 1HT2E 3Q7PA 3A1WA 4NL4H 3I5XA 1KZ7B 3RC3A 2NO1A 5F2EA 5J4KA 1OF1A 4I99A 3H4MA 1Q0UA 1W36D 2O8BB 5BN4A 2XNDD 5GVSA 1Z2AA 1F2TB 1K5DA 2QU8A 1U0LA 2BMDA 2UZ3A 4ITRC 4RVCA 4EPTA 4ZDIA 1ZW6A 1JPJA 3LXXA 4EJSA 4OYHA 2H18A 3V4RA 4C0LA 1YZKA 4GL2A 2BM0A 2CCJA 2W6ID 3ZIAD 2ZANA 5CYOA 4JLDA 3OIWA 3U4QB 3KXLA 1GNPA 4KITB 4JLJA 3X1ZA 4Q1DA 1CTQA 2QRZA 2VF8A 2JDID 3DEFA 3MWJA 1OIWA 2HF8A 4B48A 4ZDJA 4CEHB 1VYUA 3TBKA 1JPNA 4LCBA 2ZRAA 2AD5A 1T5LA 3THXA 1W0JA 2J1LA 1KY3A 1XCPA 2QM8A 4A2QA 2J46A 3MJRA 5AUPB 3F5FA 3OIVA 4NPHA 2GDJA 5FBRB 2YNMA 2GVDC 2P67A 1CRQA 1KJWA 2YWEA 4BWYA 4LHVA 4O25A 1KO8A 2IYYA 3EG5A 4HDQB 5SZJA 1K8RA 2GEUA 5EP4A 4LPSA 4ZCLA 2B92A 3EPLA 2ZRIA 5K8UA 5JCZA 1DG1G 1TTTA 1Z0IA 1E2KA 1S96A 5JJLA 1GG2A 1VYVA 2IHBA 4LJ7A 1I2DA 3FPAA 1T9HA 3WP0A 4JT4A 1FMLA 4ACBA 2HT6A 3K70B 2AXNA 1RJ9A 2GESA 2QMUA 4KFUA 4HSEA 2CCGA 4FI3C 2BKEA 5FL7D 2REBA 1AGPA 3CZQA 2ASEA 4UJ5A 3U3JA 5JJKA 2HXYA 3KKQA 3PITA 5P21A 4FIDA 3UMSA 3A36A 3ZVMA 5B57C 3B1VA 1COWD 1Q1ZA 2CBZA 2RCNA 3T35A 1W2HA 4M21A 2O8EB 1KK3A 1NLFA 2WWWA 1NBMD 1Z0DA 4JL5A 4NYMQ 4A6XA 1VCOA 1SXJA 1XPRA 3OIUA 3QKRA 2D06A 2OCAA 2R62A 2ZPTX 2WWHA 2XB4A 5EUQB 1KJZA 3BS4A 2ZVQX 3IO3A 3B9QA 1FQJA 4TTPA 5FTNA 3VKHA 3ONWA 1II8B 2LWIA 1KI2A 5J40A 4Z51A 5CM8B 5FPTA 5KDLA 1A2BA 5FPSA 1OXUA 4Y0AA 5B2ZA 1NY5A 1E4VA 2L0XA 4A8JA 1E1RA 4A2WA 1F3OA 4LJ6A 1KO7A 3OF5A 2ORVA 1ODFA 3CRRA 2CVHA 2PH1A 3R7WA 3QQ5A 5DNYB 3ADBA 4RD6A 5EJEA 2ZI5A 3SJCA 1QHHB 2CJWB 5L3SA 4G1UC 2GILA 1BKDR 4HAWA 3ETLA 1HA3A 2WIBA 2R6DA 4LJ8A 2HYDA 3A8TA 4TMKA 4YMUA 4AKIA 4JYCA 1NN5A 5LB2A 3OE7A 4FW9A 4PC7A 2OBMA 3IGFA 4E22A 3OZXA 4CGZA 2V7QD 1N3BA 3F0TA 3AF4A 4OK5A 4KXFB 3N70A 4YMTA 2VHTA 1AN0A 2C2HA 4NCNA 5F9FA 2VRWA 3R9IA 4OHYA 3SQWA 2O8FA 4ARZB 821PA 1ZINA 2CK3D 4NCJA 3D6TB 5HE9A 1XP8A 5BW8A 4CT4B 2QPTA 1DAFA 3P26A 4O0MA 4EFNA 2VSXA 4Q03A 1KKMA 4G5RA 4BLRA 2GXSA 4PC3A 2PZEA 4E07A 4Q1BA 1E2LA 3JVUA 4JLVA 3TH5A 3GJ5A 3FHTA 3FGNA 3Q3JB 3B9PA 1W36B 2BV3A 3KKNA 3AB3A 1UKVY 2JAQA 3B2EA 2CNWA 1J8MF 2JLQA 2ZTSA 1UF9A 4Q7LA 3X1WA 3ZQ6A 4LC0A 4QM6A 3RS7A 3K8YA 3UANA 1XTRA 3TK1A 2JLSA 4V0ME 2QP3A 4S2EA 3O8DA 2WAYA 4P0TA 3U3KA 2QT0A 1XTKA 1KZGB 4MYCA 1XMSA 1YR7A 5JWHA 3FOZA 5JEDA 1XRJA 2O8BA 1JBKA 1E2MA 1IONA 1F2TA 5DHAA 4DLZA 4D25A 3MGCA 3ZGXA 2GETA 2REXB 5FTLA 2AKYA 1ZM2A 2LKDA 2GZDA 1W49A 1IQPA 1XXHA 4JLAA 4RZUA 1NBME 2QL6A 3TGPA 1XF9A 4BFVA 3GLGE 1EWRA 3U4QA 2NO9A 1DOAA 1NJFA 1G7TA 3FE2A 1N0UA 4G5SA 4EPRA 4XH9B 1CLUA 4JKYA 3QI2A 3RS4A 1E1QA 4PAOA 1CF4A 4URYR 2B8TA 4M9ZA 4JKIA 5M04A 4Q48A 1A1VA 1ZIPA 3EWAA 2G1JA 3Q5EA 5KNDA 4BPBA 4DSOA 1IN6A 3IHLA 2CDNA 2O5VA 2IUSA 4IDNA 2IWRA 2F1HA 4M8NE 4OJKA 3SE0A 2WKPA 4BFYA 1E79A 5LD2C 2VYFA 2E87A 1OB5A 4RZXA 2IEZA 4BFSA 1QG4A 4A9AA 1SVWA 4AG6A 2I4IA 4RCYA 2C77A 2WPDA 2EQBA 1N5JA 2GF9A 1EWQA 1XZPA 2X2FA 3GJXC 2OAP1 4GZLA 3L0IB 4C0BA 2K5UA 2W58A 5DO9A 5A5GA 1OHHA 1XMVA 3AP1A 2GJKA 3K0AA 3EX7C 5JI2E 1EX7A 2WICA 4IJMA 4EPYA 4PO8A 4L8GA 3HU2A 5J47A 3A1TA 3CH4B 4HI0E 1II0A 1HE8B 2X77A 3DVLA 4BRUA 4DVGA 2F3RA 3GLGB 1XEWX 4K81B 2O8DA 4IOLA 5KOYA 4Q01A 2CLDX 2WV9A 1DELA 4A82A 3QVUA 1XNJA 4UNSA 5DSZA 3LV8A 2WWGA 2O8EA 5H68A 3FFAA 4CF7A 3Q85A 4JVSB 2Q9CA 2UVQA 2GAOA 3H0KA 3P4YA 4LJYA 4TQAA 2JLZA 3B78A 4ZV4A 4NYJR 3OFNA 4OL0A 4BEBA 4EIWA 1MO6A 4JVMA 1JR6A 1LTQA 2C9YA 3NHBA 2A30A 3HWSA 4J0QA 1EFTA 3ZLJA 3T12A 3L82B 4GSYA 2ZE5A 3RRNA 1H8EA 1UM8A 2FGJA 2IW3A 2N42A 3FTQA 2ERXA 3PENA 4FXPA 2I1QA 1VECA 2YVUA 1EGAA 4B33A 1NVVR 2HV8A 1IY2A 4CEJA 4HDOB 4C4PA 3SR0A 5KSOA 4DDTA 2BCGY 4M0LA 2CJWA 3GJ0A 4JVLA 1HE1C 1YQTA 3T1QA 3DKPA 4LJ5A 4MRNA 5HKKD 1F2UA 1IOZA 4KYUA 1ZM9A 1NLZA 2QMOA 2PLFA 3AGQA 3RSLA 3W90A 4QL3A 2BMJA 2VBCA 1W0JD 2QE7D 1ZUNB 1OH6A 2IK8A 4Q1CA 1ZRHA 1VCMA 4FN5A 4OI1A 4ERNA 3AVYA 2J0QA 1GDDA 1F5NA 1FPMA 1RYFA 1U0HC 2UKDA 2B7CA 2BEJA 2OM2A 4DLVA 2OCYC 4ARZA 4C0SA 3OEHD 2AK3A 2OLJA 2HJGA 2YJTD 1CR0A 2C99A 4PAQA 4Q1FA 3P4XA 4W5JA 3K0EA 3NDBB 4R98A 2EW1A 3RABA 3PUYA 3NBXX 4NTZA 5HCNA 4Q1AA 3SFVA 2I1VB 1UBGA 2O0KA 3A58B 2R2AA 1P3JA 1XTIA 2WKRA 2ZSDA 1ZC4A 4XOIA 1U98A 3NBFA 2IS4A 1WBBA 4RD2A 2PL3A 1XJCA 4QJ3A 3H1TA 1RFLA 1VKJA 3I5YA 5KNBA 1EK0A 1KMQA 5JWOA 3R9XA 4EFMA 1G3UA 3UMRA 4DJTA 1ZNYA 2C78A 2VP4A 4JLOA 1R6BX 2EYUA 3SYLA 4FMDF 1G5RA 1C4OA 2IF0A 1HQCA 5TXGA 3KFVA 4O2LA 4TMTA 1X8KA 1A7JA 2QORA 2W6IA 1GTVA 1IM2A 3MD0A 1SXJD 4URVR 4IHQA 4B43A 2PT5A 1TF5A 1Q3TA 4TMWA 5FUYA 3GMTA 2QRNA 1BO6A 1HV8A 5A0FA 2XSZA 1R10A 3HR8A 3L43A 4GI7A 2JDIA 3AF2A 4BLSA 5AK0A 1T6NA 4R2IA 4JBYA 5FOTA 1KGDA 2C96A 4OI0A 3V4FA 2JATA 5K8IA 1IN8A 1W1WA 4WOPA 1E2JA 3FMIA 3I3SR 1X6VA 4QC2A 1DE0A 1E1RD 1NI3A 2W0SA 1S3SA 4M9QA 2G6BA 2MMCA 1W0KA 1R5OA 2BEKA 4AKHA 1DPFA 2J9RA 4Q7MB 4I1SA 2AR7A 3GJ4A 4Q7KA 5EP2A 1PV4A 3AF3A 1AS3A 4MQBA 1EXMA 3VR1A 3AP3A 2YV5A 1E6CA 5DI3B 3GLIE 4A0FA 5DISB 2GBLC 3ASYA 2ZI7A 2DFTA 4G0NA 1GSIA 1TAGA 2MSCB 1DO0A 3OE7D 4XWOA 2XAUA 1KOFA 4B73A 2QAJA 2RGAA 3QXJA 4PTLA 2F43B 3C7KA 1FW6A 3CPEA 4LV5B 2EYQA 3LW8A 2JGNA 1NVUQ 2MMGA 4DCVA 3N2EA 4D81A 1WDTA 2ZITA 4V0MA 3SYNA 4C0AC 1UKZA 3EWSA 3P27A 1G18A 1S9DA 1G19A 3D31A 2X8AA 1UEJA 3C14C 3K0FB 1W7AA 6Q21A 4G5OA 3B82A 3K0CC 4XTCS 2WMOB 3T5GA 3C16C 2VHUA 2IA5A 3ZH9B 3A1VA 2JCSA 4Z1MA 4KO8A 2QTVB 4BZQA 1JNYA 5C2JB 3IIKA 1QBKC 1YVDA 1BIFA 3DOFA 4JZKA 2B6HA 5GVRA 3G5UA 2Y8EA 3BRWD 4IFBA 4O2RA 1TQDA 4IOKA 4O3MA 4UXJA 2CNWD 2ZE8A 2FU5C 1VYTA 4UXHA 3TW4A 4Z54A 5SZIA 1GL7A 1DAHA 2FFHA 3GLHA 5JS7A 3GLIB 2EFDB 4NYIR 2W2XA 2YOGA 4AK9A 1MO3A 4PANA 4IDOA 4DBLC 1PVOA 1FUKA 4FMCB 3FHOA 4A0HA 3P20A 3VNVA 1ETUA 3GJ6A 3EIQA 5CLQA 2IS6A 1OLOA 1P9RA 1KO4A 2FZLA 3CH5A 1XD8A 2WWYA 2EFGA 3KB1A 3THXB 3WBJA 5KO2A 1X1SA 1HYQA 121PA 5JRJA 1BH2A 3PUWA 4L15A 4NH0A 3SBDA 4L9WA 2AN9A 5HZHA 2R44A 1E1QD 3A1SA 3HPRA 3ND8A 2J0SA 2GJAA 1CXZA 3FKSA 3D7MA 3WXMA 4M2LA 4B6FA 2IL1A 2JJ8A 3T1OA 2WVJA 1GIAA 1YZLA 4PQYA 2C9OA 4TLBA 2OZEA 1E2GA 2HT1A 2P0EA 1QHIA 4QGFA 4UNQA 4Q9KA 5C1BA 2PMDA 3RWOA 1E79D 5FTJA 4WW0A 3VQTA 2P5TB 3VTKA 4HUTA 5JEEA 1P60A 3ZDQA 1P61B 4FINA 3TW8B 2OUKA 1VIYA 3GFPA 2QPAA 2ZAMA 2VH5R 5G40A 5DI9A 4E09A 3K09C 4D4JA 1RJ9B 5FPKA 2WPDD 1TEXA 3BBPA 2GXAA 2HEIA 3N5CA 1E98A 4F38A 2ZJ5A 3U3MA 4JMPA 3K9GA 2BJWA 2F3TA 2SHKA 1CR2A 1OHHD 4S35A 1BMFD 1DADA 4D26A 2V9PA 4DRZA 2JEOA 3TUZC 1D9XA 5CB6A 2G1KA 3K70D 4GNKA 4TTRA 3AKEA 2VSOA 3THYA 1KI4A 1N6NA 3ZZTA 1IHUA 1U2RA 4A2PA 2AKAB 2RAPA 2ZI3A 3X1YA 3EIHA 3K9LA 4RD4A 1N25A 3HU3A 1O3YA 3NTUA 3QKRB 3Q5DA 2XXAB 2IUUA 4EPXA 4XWKA 4FWTA 4LI0A 3RYTC 1M2OB 2ODEA 3DHWC 2P6RA 1N6PA 4LHWA 3WNBA 3U6BA 1GRNA 5CIQA 1QVAA 4F93B 3BFXA 5BQ5A 2QM7A 3TIFA 1U9IC 4MITA 2NOAA 3MMPA 3Q7QA 3H84A 3OFND 3FMOB 4P33A 3C5CA 2E9SA 4FD2A 1U8ZA 4TYYA 4JLPA 4KHZA 1J7KA 1LNZA 2ZREA 3I4LA 1N6LA 2VA8A 3QPWA 1RRPA 2V1XA 4W9MC 1H8ED 4YDSA 5L3SB 4JLNA 2J0VA 2A2ZA 4TZ6A 4KAXA 3LBHA 2WWFA 2GF0A 1X1RA 2HDNB 3ICEA 2GZHA 4TYQA 3U3OA 4KODA 1OV4A 1IBRA 1JB1A 1EESA 5EP1A 2OFWA 4HUQA 3WBKA 1N6HA 3LNCA 4IDPA 4IW3B 2JIZD 3IEUA 2VP9A 4ZCMA 1Z0AA 1KO5A 2YOFA 1E9EA 2FE4A 1XXHE 5DI3A 2HCBA 2R65A 3LVRE 1VHTA 1CBUA 2B21A 2A5YB 2FOLA 3BB1A 5EXPA 3IIMA 2W00A 1I4DD 3B1YA 2O8FB 4MGIR 4QBGB 2V54A 3U2QA 4ZIRB 2XJ9A 1VDZA 3WHLA 1DTSA 3ZJYA 2ECKA 3PEYA 4LOAA 2F43A 2YWHA 3TSZA 2CHQA 1N5LA 4V0OA 2RGNC 4IVQA 3G0HA 3ZZ0A 1Q57A 4DLWA 1OIVA 4RFVA 5SZKB 3I1FA 4D0NA 2AD1A 4D0GA 1R2QA 1CKEA 1A82A 2GBLA 2VL7A 3K0FA 1G8PA 1ZJ6A 1DG3A 2PLRA 4Z8XA 2GCPA 1JQJC 3NDPA 5E7IA 4EKDA 3W34A 4L9SA 2IC5A 4LYJA 2C03A 1W44A 4TYWA 3ZVRA 1LB1B 1MKYA 2BBTA 3GLFB 1IY1A 2OLKA 1GL9B 2BKUA 4L16A 5FL3A 4B75A 4HLCA 1W2GA 2Q21A 3WMGA 1DBSA 1KI6B 1SVIA 1D2MA 4IVRA 1YKSA 1YR8A 2G3YA 3AVOA 3LLMA 4JLBA 3RANA 3UK6A 4BLPA 4PPQA 1JI0A 5FPYA 1TNDA 1I2MA 1Z3IX 3UPUA 3K0CA 1XXHB 3GLIA 1G8HA 5FBVB 3W6PA 4JBWA 4WIAA 5FPHA 1XTQA 3LAWA 1E4YA 4KFSA 1OYYA 1IN5A 2ZYVX 3LWNA 2QMHA 4B3DA 3QOFA 2FEMA 2ONJA 4X8OA 2XSZD 3I92A 5HKKA 1KMHB 4I81A 1WCV1 3BFVA 4M1MA 5L3RA 2ATXA 4KU4A 1CJVC 4LJ4A 4DIEA 5JSZB 3KQUA 1EX6A 4IEEA 2QE7A 3QBTA 1NMYA 2BC9A 1OKKA 3L0OA 4NYJQ 5CDFA 1LS6A 4XIGS 1W0KD 4M1KA 3UKDA 2RMKA 3C15C 1JEEA 1E9RA 3LBIA 2FFAA 5F98A 3KXIA 4UXIA 3D8BA 3EXAA 5FR2A 5FBQB 2DHRA 3OEHA 1GVNB 3ICQB 2V1UA 3AGPA 1GAJA 2WSSA 3HU1A 4CT5A 5F3WB 5E3HA 4MYUA 4KFRA 4KLZA 1NVVQ 1OYWA 3K0AB 4IXMA 3T34A 3JZAA 1BOFA 1E2NA 1NJGA 2CLCX 2LKCA 5A4JA 1Z29A 2XB2A 3REFA 3VU9A 1T3SA 1OH8A 3MCAA 3TAHA 2O0HA 3BH6A 2VO1A 4K46A 4LSGA 5CYPA 1P2SA 3MWYW 1ELOA 2O8DB 4B35A 5LPNA 3BE4A 1RKBA 3BC1A 2XITA 4PHHA 1G7SA 2QI9C 2HJVA 3EPHA 4R9UC 3C5HA 3R9WA 1JECA 2GCNA 3FMFA 3AEZA 2Q0HA 1E9SA 4Z1MD 1NMZA 1VG1A 2JLUA 4TL7A 5BXQC 4GOKA 2IUTA 1E2FA 1F48A 1U8AA 1XMIA 4IXNA 3K09A 5J5CA 4NONA 3NH6A 4N0EA 5TARA 2XXAA 2ODNA 3UWKA 3CUEF 2ZSBA 4D6PA 1XZQA 2YC4C 2QNRA 4QJ5A 3NHAA 4B47A 2RHMA 2XOKA 1N2CE 1ZD8A 3QE0A 1W4AA 2GA8A 4RY2A 4D0LB 4B3XA 3JVVA 3KQHA 1Z08A 1T4GA 3A1UA 4IRUB 1RW4A 4NCIA 3EZ6A 1G291 2G88A 5TVKA 4B3GA 2ZR7A 3QXHA 4FWIB 1AS2A 2Z83A 4MRSA 4CEJB 1SGWA 1KDOA 2W2VA 3OESA 4JLMA 4MUBA 4C0JA 621PA 1AS0A 2FEOA 2DFLA 4E5UA 5B64A 2GKSA 1F2UB 1G7RA 4PAMA 2LCFA 1Z6YA 2ZQ5A 1CP2A 2GEDA 2VP2A 2D62A 3SI7A 3VKWA 4ZI2A 1Z6XA 4OQNA 4X8MA 1U9IA 5DIFA 3AVQA 3W6OA 2ZJ8A 2ZI4A 1RRCA 8OHMA 2QQ0A 2QMEA 2WIAA 3FKSD 3IUYA 1D6JA 5E95A 1L2TA 2IXGA 3E5HA 1NG9A 3RRZA 4G5GA 3EA0A 4A36A 2IS2A 2V6JA 3FFBA 4ZIRA 4PQRA 2B8WA 2ORIA 3DDCA 3WRXC 3SJZA 1GILA 5FTKA 2OESA 3BH0A 4PZLA 1OIXA 4PSVA 4C30A 2CL0X 3ZS9A 3KKPA 3UIEA 4C3ZA 1PJRA 2BM1A 4HAYA 2ZR9A 4AY2A 2WWIA 3I62A 4LYAA 1P6XA 4D4KA 2FPLA 2XTZA 3A4LA 4GFDA 1XPOA 4F4JA 5CJPA 1YJ5A 3WP1B 1RZ3A 4Q18A 4PSAA 1XWIA 3QKUA 2VIIA 4PPFA 1X3SA 3KQKA 2V4ZA 2YZ2A 4ASUA 1Z07A 4GBMA 2MSDB 2O52A 4NBSA 4JS0A 4BFZA 4DT1A 3SYKA 2FPKA 1P7CA 1QZXA 1T3LA 2AWNA 2IYZA 2RGNA 4D4LA 3J81k 4NU0A 3GLFA 4TQ9A 4ILEA 2Z5FA 2BDTA 1AK2A 1YE8A 1KSFX 1KI6A 2FNAA 3MG9A 4MKFA 3C4JA 5HTKA 2WBLC 3I8SA 4DSUA 1T0JB 3W8NA 2PEZA 2WJJA 1T8UA 2P3SA 1NKSA 4QGHA 3MSXA 1CR1A 2WTUA 3BB4A 2WJVA 5JS8A 2VQSA 1G5PA 5TDHA 5HZKA 1E96A 1NSTA 1XEWY 1IXRC 4LC1A 4PHTA 4QBHA 3PXGA 3QF7A 1VHLA 1DARA 2F1JA 2FSFA 2V3CC 1GWNA 721PA 4OI4A 1KMHA 4MDFA 2IYXA 1R0XA 3DZ8A 4JJZA 4QGGA 5JSZA 1MR3F 3GLHE 4R71A 4LZZA 1ONBA 1QF9A 4BLTA 1U81A 3D3QA 1WB9A 3GCGA 3LY5A 2QAGC 5L8VA 4NYIQ 4US0R 4XVUA 2XZLA 2DWPA 2JASA 1DAGA 4PPNA 1M1YE 1E0KA 1C1YA 3I72A 1CS4C 4UNRA 2FN4A 3TSWA 3AF1A 1P73A 1AZTA 2AXPA 5ANRB 1N0VC 3M1IA 5AJVB 4B2LA 1TU4A 3PCRB 1OXSC 1Z47A 4Q4AB 4WBSA 1NG1A 1Y3AA 1KK1A 1BMFA 1L7VC 1E9BA 221PA 2VF7A 5LD2B 5C18A 4QHTA 4F7WA 3TKLA 5IT5A 1Z8FA 3B5JA 4Q1EA 3TQFA 3G82C 3ADCA 2FWRA 4AC9A 2YWGA 3GQBA 5KTYA 1TU3A 1Q12A 1WP9A 2P6NA 1N6KA 2R9VA 2H57A 2XZOA 1KI1A 1GNRA 2BOVA 4TQUS 4TWZA 4QG7A 4HEJA 4B2IA 3LQQA 4NZYA 2H8KA 4LX0A 2PZFA 3CX7A 3IEVA 3GLHB 3QUSA 1QHNA 4DKXA 1G41A 1ZBDA 3WMFA 4BEJA 1SHZA 1KTVA 4URZR 2W6JA 3I32A 1Q3HA 2HF9A 3EARA 1XTSA 2J41A 4QHYA 3TUJC 1TUIA 1N5IA 1SKYB 2J45A 1J99A 1N6IA 4XJXA 1H8HA 2J7PA 2GVZC 1KI3A 1RE0A 1ZP6A 5JLJA 5LBIA 3CNLA 4IDQA 4HB3A 4P32A 1R0ZA 2JIZA 1XMJA 1MABA 3A6PC 5J4YA 4BE7B 2H17A 4MUAA 4ZDKA 2ZE6A 1WBDA 5E4FA 5B58C 3HR7A 2BHRA 2VHQA 5E7JA 1NP6A 3QXCA 4RCZA 1JQLB 3L0SA 3AH8A 1NN1A 4C9BA 2NMVA 2Q3MA 1NIPA 2RGGA 4HB4A 4TLCA 2VP6A 1OKKD 5DN6A 1M7HA 1EG7A 1VG0B 2NQ2C 2BJVA 5HR5A 4TL8A 4DIDA 3AKDA 2ZRHA 3IBYA 3PQCA 1Z0FA 2CHGA 4W5WA 2XZPA 1DAKA 3W5IA 4EDHA 2A5JA 5CK5A 1Z6GA 2ZI9A 4WXRA 1JALA 3Q9LA 3LRPA 2YHSA 4LHXA 2WSSD 2QTFA 3K9NA 3KKMA 2WJYA 3BERA 4IFEA 4ZDWA 2GK6A 4TZ0A 5JRZA 2QTHA 3F3YA 1EFCA 3WYAA 4C2UA 1XEXB 1ESNA 5JMTA 3M0EA 3EZFA 1ZCAA 3CKLA 4G3XA 3THYB 3KKOA 2OILA 1RRGA 4NYMR 1TQ6A 2NO6A 2F55A 3LW7A
chains in the Genus database with same CATH superfamily
1AKRA 1V8BA 2DWQA 3OA2A 3ZDEA 4AKSA 3S8EA 2QMYA 3HKDA 1T8TA 2YCBA 1IJFA 4DCSA 2R85A 1Z88A 2C3MA 1T9AA 4LZLA 4AP5A 4YI5A 5JJIA 1OXTA 3UOGA 1V5GA 2B61A 2PR7A 5H80A 1JDBC 1VJDA 3LM8A 4Z0TA 4GVPA 3RWMB 5AUOB 1BE6A 1XU9A 3MS7A 4FEAA 4DV6B 1KOGA 2ZUVA 2MR6A 4MWSA 1FS4A 4OUDB 3WGJA 2OBXA 2IYLD 4IHJF 3UXMA 1W5TA 5DGXA 1Z39A 1DDGA 3RHZA 1L8OA 2E5WA 1ZHOA 4QFBA 3LY8A 3SN6A 3ZE9A 4H7DA 2OXEA 4DB2A 1F0PA 2DY0A 2D74A 4IV8A 5AW5A 2VAMA 4J91A 4DLXA 3LU1A 2F59A 3O1JC 2FUCA 3BBLA 4RJKA 4UAJA 5EFOA 1H0HA 1KO1A 4MKHA 2PT7A 3EB9A 4BATA 4C7XA 1V41E 3VJMA 2CV0A 3F7MA 3N2YA 2YWJA 1EP1B 3LX6A 4MMYB 3IESA 4Z0NA 3MTAA 4HUQB 5KQPA 1VJGA 1KDPA 3M6FA 3DNFA 4AWXA 1RQNA 3HP1A 2J3EA 2O2ZA 4FX5A 1GZ3A 1A5TA 3Q0IA 3KFXA 1IH8A 4LJLA 4PX9A 5E9AA 3KOYA 4BO4A 3EVAA 1TTPB 3DDNA 1KZHA 2WF9A 3WL4A 1Z6QA 3KQNA 3L6UA 5FOUA 4EHAA 2RH9B 1YULA 3WGZA 3KEOA 5JPCA 1ZVKA 1IE3A 1G0NA 1W35A 5ECYA 1X9GA 1EGQA 1TJ4A 4RE5A 4M1YA 4XDHA 1P77A 3PVSA 4Q19A 1HZJA 1JJAA 3FOBA 1AQYA 4KITB 1LJLA 4YMIA 5DYIA 4RVFA 3DF7A 1U3UA 2R1VB 3G79A 4N9QA 4WK0B 4PZUA 2OSBA 3IS3A 4JVNA 5EWLB 1RYDA 2V7EA 2Z2XA 5CB4B 5FWYB 4LIPD 3VFDA 3RGGA 4Z0HO 2JAHA 4BNZA 3ZJUA 2HXGA 4ONEA 1CRPA 5DK6A 4UCXA 1G17A 1XVUA 1N8SA 2PZAA 2QGZA 3FLBA 3REOA 5JAIA 5IH7A 2AT1A 4L76A 3ITNA 4QYXA 4IGKA 1D9ZA 4YRJA 5CG2A 1F0KA 2QAGA 4DBLE 1ACLA 1VCHA 1UKBA 5PNTA 1L1FA 3GZ4A 1ZJWA 1NJ8A 2VSFA 1CY1A 2Q4BA 3O83A 1YR9A 1CUEA 4HAZA 4QECA 4DA0A 3EC2A 4YUYA 5JYEA 1IEWA 2RHDA 1KU0A 4NS4A 3UCXA 3CSDA 3GMIA 1PHRA 3M6XA 1H9AA 3ISVA 3O95A 4TWBA 2IYRA 2CLIB 1U0SY 3LUCA 1RAIA 2WJHA 3BE6A 2H06A 3BL5A 3SD7A 5JBIA 3D9QX 1HDGO 1SK9A 2HI0A 1F12A 4OSOA 3ZV4A 5EQJB 3E9NA 3PDHA 4JASB 5E1BA 3H11A 4TLAA 4ZT4A 1M2JA 2X3FA 3R20A 1QVWA 5F33A 3R7DA 4DRYA 1ORRA 2JD2A 3DTYA 1KI8A 4IIEA 4N12A 1KPHA 4C6TA 1QGAA 3NWOA 4U8HA 3BIJA 2Z3ZA 3BWVA 4FFNA 5AT1A 4LGVA 3SSMA 4HH0A 1WIWA 5IRCD 4AY3A 4FDVA 4CKEA 2B1IA 2F7SA 4GZMA 2Z8ZA 1S2MA 5AXCA 2YH2A 1A97A 1QAMA 4MV4A 4EVRA 1U1CA 1M1YA 1YBHA 1NDUA 2DBRA 2VPWA 3H86A 3FZYA 3DDZX 2PWBA 1PO7A 3ASZA 4WXEA 2YICA 3DZCA 4RGVA 5L9AA 2CWDA 4ZZIA 4Y2JA 3QVKA 1WW2A 3R4CA 3VHXA 4DA9A 1D09A 2F3SA 2VT3A 2OD9A 4JBLA 4ZWNA 4HFJA 1JEJA 4M8LA 2PXAA 1BWQA 3IMKA 4F45A 2IHKA 2Y0CA 3D8UA 1RPTA 1BVHA 1Z5OA 2BUAA 4RMIA 3EDMA 4YLYA 3W1VA 4KO4S 1T6XA 1T8RA 1KC1A 4I50A 3UAOA 4QJ4A 4EI8A 2RE8A 3VVBA 2C7QA 1KY2A 4GO1A 1I4LD 3O0DA 5FHRA 7MDHA 3KL2A 2DSTA 2IZ1A 3BXZA 1UBRS 3AX6A 4IDHA 4NFHA 5BQXA 1BZYA 1KZ9A 2VWPA 1CUWA 4RK1A 5CYFA 4MGEA 3TLMA 4E7PA 4UPEA 3QELB 5HILA 4AF7A 4I1UA 1WNFA 2YUTA 3QXSA 3C3EA 1ULZA 4RTLA 2J6HA 5BNFA 2A9KA 5JBNA 1MRSA 3LY7A 5TY0A 3AM1A 3PFIA 4NAUA 3KT8A 3MXTA 1JDPA 2WAXA 4G1EB 2FQYA 2L82A 1DAEA 3VYUB 4UBMA 4KFCA 4R2KA 1FFSA 3I9FA 1DJLA 5LQCA 1XJWA 1ISRA 1OI7A 3QXXA 3UVEA 3VU9B 2F3PA 3PR2B 2YVLA 1GFIA 3SQDA 3VYRB 5B4UA 2IEGA 5A5FA 5LNK1 1EMDA 2NQ8A 3H1PA 4N3NA 5JCOA 1NLYA 4D02A 4DV4B 2Y1WA 4EOGA 4YT8A 2GZ2A 2ZAGA 2HL6A 2GARA 3GD5A 3PDUA 4BWFB 3RKSA 4RDXA 3E5MA 4CKZA 1BFDA 1SU4A 4G9GA 1R0WA 5GINE 3C41J 2RDMA 3H2KA 3QY9A 4D9JA 1G38A 2DUUA 1J22A 3DV2A 3LVFO 3PFCA 4CF5A 4ZOLA 3TTWA 3VAYA 2XWBF 3OAAA 2AN3A 4IVPA 4DJDC 3DS8A 4LBVA 4PU0A 3HBLA 3LZDA 2OE2A 3AP2A 5DT2A 3QKTA 2EBFX 2CXHA 2IWHA 1YF3A 3U7JA 3KE8A 5DMXA 5T64A 3NAZA 3T4EA 3R0VA 1W46A 3AL3A 1K6EA 2C88A 3QBDA 1C8KA 4F3YA 1FZTA 3SS8A 4BQOA 3FJOA 2VF5X 4BYGA 1N2BA 2RBEA 3L1JA 5F7ZA 2CD9A 3EIXA 1E1YA 3B60A 2JBAB 1EWYA 3IV6A 4WADA 4X45A 4ESOA 1FX1A 1OX5A 2RAFA 3MTIA 3T3DA 1YB1A 1VRWA 4KE9A 3ROFA 3HABA 3P1JA 1AE1A 5DIZA 3RVLA 1T9DA 5F7JA 1S9HA 4IYRA 4NDAA 4TYMA 3TR0A 4U4AA 1E3SA 1K98A 3E9CA 5FNVB 4IIBA 3GLFE 3HADA 2DPYA 2CFSA 1Q84A 3C6YA 4IH1A 1MP0A 2ORED 1H22A 4HFRA 4DVJA 3K35A 4RKFA 4K3UA 4DDMA 4UMFA 4EARA 4KX5A 1N8TA 4TT3A 5IYZA 4K7JA 4EB0A 4OM8A 3WDMA 4UNNA 3V46A 4QNRA 4WLOA 5L7TA 4JR1A 1NVAA 4OHVA 2RC6A 3DTVB 4X1OA 2JLRA 3WKAA 3GR6A 2Q4TA 3OUZA 5FUXA 2BI7A 3T7DA 3WJ7A 2D3WA 1FDOA 2K2QB 4R2HA 5BWMA 4KLNA 3U7RA 5CXSA 5J4VA 2ZRFA 4M87A 1TPZA 3CFYA 4RKYA 5BN1A 2OCXA 5E7MA 2PFKA 5AUQA 3WLFA 3GJ3A 2VSQA 3H5VA 5LZ5A 4E33A 4DHEA 1KS9A 2R1VA 10MHA 1SQSA 1PTJC 2IU4A 5F5LA 4J0FA 5CB4A 2BKVA 4ALIA 5FWYA 3IAM1 3QYAA 4UFPA 1TC1A 3ETJA 3U4CA 4AJ2A 4O33A 4B6EA 1UZLA 3FYUB 2VHJA 3NUQA 3U7GA 1CRLA 2VDJA 3KPJA 4RZIA 2CXNA 3GGJA 4UDXX 4IQ8A 1KXZA 4D46A 4KIUA 1EFRA 1PBNA 3B9RA 3EW7A 1ZK0A 1C7IA 4L75A 1KSJA 3BA1A 3BG5A 4I36A 4OXRA 3CWQA 3NYWA 4LWZA 5FUWA 4B83A 1SUSA 1ZVQA 3D0OA 3PLNA 1F14A 4MI1A 1TGVA 3FHJA 4NATA 3TLCA 4BGUA 4YJ2A 3C97A 3JAWB 1PDOA 1Q1EA 1RI2A 3NTVA 4LQLA 3EXHC 4WXHA 1AOXA 3BFJA 1J90A 1TEHA 2Y0EA 1IBCA 1DQZA 1VQ1A 4OQFA 4HGNA 3T54A 3WK5A 1VPVA 4R0MA 1X7YB 2GD1O 4M88A 1Z0KA 2B0JA 3ECCA 4QTZA 4LXHA 1M2WA 3IIJA 5HJ2A 4WBNB 2EGGA 1W85B 1ZNZA 1A8HA 3HJBA 3PEUA 2AXEA 5E6UB 5AW9A 4BVLA 4DA7A 2OENG 4P7FA 1ZQ1A 3C8MA 4NX2A 2ZBEA 2J3JA 4BVFA 6REQB 1UAGA 3I83A 2V6FA 1AKEA 1N2HA 1RMYA 1JKMA 2VLBA 4DYVA 2J4FA 4TV9B 5A6VA 1K8QA 2JLAA 3AHJA 4IMRA 3THOA 1QYCA 1GPAA 2BFBB 4AZTA 4EEKA 1KKLA 1RAHA 1U3VA 1NVKA 4GI5A 2P9BA 4LHZA 4HS9A 1U0NA 4M3NA 4GSKA 4S0ZA 4M53A 4Y98A 4ZHSA 2ZT7A 1ZXBA 5J58A 3AV0B 4R9NA 4GOND 3Q11A 1U31A 4D4MA 4WFQA 2WT8A 2H00A 5KVQA 3UGJA 3O31A 2G04A 1LXCA 1PKEA 4UU7A 4Q9LA 3WHKA 3T0GA 3VJLA 3GW8A 4X0EA 2G77B 3IVXA 2GFIA 4EQ6A 1OA1A 3CR7A 2VXCA 3GD7A 4Y9SA 5ALIA 4JU9A 4EHNA 2IZ5A 1QWOA 1JSLA 4PX3A 1FYVA 1T5IA 3KUKA 1K97A 4UMDA 2J5XA 4QFMA 4D6XA 5LC1A 4E6PA 3VPGA 3VYWA 1PGNA 3DZBA 3QELA 2O6LA 4RHEA 3N0VA 5DV9A 1GKYA 3T5CA 5LA6B 3WK6A 3M9LA 4YRTA 1FP6A 2A84A 1C3OB 3AERB 3CTMA 3NC0C 4NP6A 2PJRA 3PEVA 4M7PA 1ULAA 5HQJA 3V42A 1E0SA 2XE7A 2O59A 4PHGA 4Y1GA 3G2KA 1NJ1A 3Q72A 5LYYA 1XTBA 2BI4A 3EGXB 1O9HA 4L5BA 3ND5A 4A1OA 4B71A 3LPMA 3C98A 2AI3A 3TQCA 4YRCA 1WVIA 3AEUB 2DFVA 2PYZA 1GZHB 4PNZA 4GHWA 1TA4A 4JYAB 1E5QA 3ANYB 4HZUA 2GLUA 2IEYA 4ZEMA 1JFFB 1Q44A 3C6MA 4IIYA 1KNQA 5J4HA 1D7OA 3IXQA 2VH2A 5HCIA 3GFOA 3ZQJA 3BCSA 4D8TA 2A88A 3BTVA 1CULC 4JI7B 1J1ZA 1EA7A 2WUFA 3FWNA 2Y3IA 2PRZA 3PVCA 3IP6A 2Y4NA 3A10A 3JYLA 4FSHA 1R74A 2YVQA 4L8VA 2OCPA 1JH8A 2CXTA 1C30B 1Y48E 3ABIA 5HJ5A 2H92A 1JLKA 3NNDA 5K51A 3IL2A 2CF5A 3V1LA 3UEOA 2OCKA 3OWXA 4X93A 4O4LF 4FGSA 1U2TA 1Y37A 5KUTA 2CXUA 5K0EA 2GYVA 2R6CA 3C87A 1FXWF 2GF2A 4D43A 2HFJA 1H66A 3PXUA 3PC8C 1HQYE 2Q6KA 4L5YA 1QFZA 3OX2A 3IFSA 3FIJA 4PSKA 3B38A 3CNBA 1Z06A 4UQPA 1PT5A 4ZZ0A 521PA 4QOSA 2WEKA 3E70C 3KP1A 3N86A 1X77A 2XF8A 4AU1A 3ABRB 1GKIA 3IMFA 4CCWA 5K6AA 2JBAA 3QYFA 1UXKA 1ZLXA 1Y81A 4BKUA 2J0UA 1VLZA 1R8QA 1CRZA 4LY0A 3MRXA 1IHPA 2D4HA 5JFGA 1DX4A 1F20A 3DMDA 1DBPA 2HPZA 4IQ4A 1M1NB 3CBQA 4RTPA 1B1CA 4MUMA 1XZNA 2XI4A 2QYOA 1E5XA 2FRXA 2OV6A 4J3FA 2HWXA 4M0FA 1QAQA 5FNVA 1GRQA 1IIBA 4KR7A 2OGWA 2Z5LA 1SVMA 2QRVB 1YGPA 3FB4A 1GOTA 2XUKA 3NB0A 2UYCA 2PL1A 4G09A 2GHRA 4IJQA 4YCCA 3MINB 2PJZA 1YHYA 1HNNA 1JV2B 3TDNA 2DFKB 4EI2A 3NTXA 1Z2DA 2P6PA 1PCXA 4E5VA 2ZRCA 2EXXA 2Q50A 1HXHA 3L49A 4XSHA 1MH9A 2VDWA 2RCYA 2HB6A 4A6DA 4GOLD 4BO5A 1ZNWA 2XGOA 2F9FA 3DTVA 4NENA 3WKCA 4Q66C 3ORRA 4B4DA 5AW1A 1KKUA 4OK6A 1KH1A 1P5JA 3W5VA 1K3UB 3CVUA 3CE9A 5KWEA 5AI4A 3B6ZA 2DYKA 1YZFA 1R8SA 3MMNA 4MVJF 3QBVA 4FYVA 1AIPA 4K9DA 5C4MA 1Q0QA 5LB4A 2PZ8A 3PPXA 5FT9A 4QWWA 3R74A 3MAJA 2Q5HA 1G9SA 1SCUB 2FPIB 4X1IA 4PINA 1YJ8A 2ENWA 3I37X 2I3BA 3QNUA 1GEEA 2A33A 2F9MA 3HLYA 1RXYA 3P71T 3PLRA 1QDEA 3CRW1 4RU1A 4OGKA 3RS0A 2QUBA 3PGVA 2H2HA 2W83A 1S3IA 2JVKA 2X2EA 1O0SA 1VB3A 3HY4A 3AIMA 4IIGA 5TR9A 3RIHA 5J2UA 1F60A 4CW7A 3RC7A 2FZCA 3LS2A 3NHYA 4KV7A 2FEPA 1HOTA 2IH4A 1PSZA 1J0XO 4DV5B 1JX6A 5TVGA 2BEVB 2K7FA 1JEYB 2GEBA 2I99A 2PZBA 1NW6A 1GYQA 1J09A 1UPXA 3JAWA 3T0FA 2HD4A 2QQ5A 3E1SA 3W5AA 3NH9A 3ZI4A 2JIDA 2FG6C 3LWDA 1M76A 3D6NB 3GXBA 4YB8A 3UCEA 4Q7JB 3GC6A 3Q15C 3OAAD 1Z22A 3A9TA 4RV5A 2ZS8A 3I9V6 4XVRA 1X7YA 2BFPA 1P44A 2L42A 3F7OA 5KJFA 1B42A 4ZVNA 3P9RA 4WBNA 1TZBA 4U8GA 4FR5A 2GPYA 2I6UA 1OJ7A 1W85A 1Y9EA 1YB5A 2QUZA 3DE0X 4ISCA 4OQQA 3TNLA 5L4LA 1L7RA 1U7HA 1X7WB 2EJTA 3GN1A 4FDLA 2HSWA 2YYSA 4KJZA 4PSUA 5FBLB 1Z8DA 4LZNA 5AI6A 3RBAA 6REQA 1C1XA 2Q45A 4M8IA 4LRWA 4NCHA 3MB8A 1YIOA 3ML1A 4TV9A 5DF1A 1A71A 1ICIA 4C43A 1DL5A 3VO1A 1G4UR 1QG2A 3I5MA 5ADWA 1DCTA 4MPRA 4KDRA 3VR4A 3Q88A 1S1MA 1I1NA 3T06B 2DWOA 3RLFA 1SVNA 2IXEA 2FR0A 2QMQA 3IQWA 4WKOA 1M2KA 3ROMA 3UWOA 4HK4A 1MW8X 2WQZA 1MT0A 1Y5IA 1KNXA 3DL4A 2WM9B 2QJOA 2B4TO 3NETA 2AHRA 3SU8A 3RAEC 4NU8X 4MRVA 3CLHA 5GONB 1U8UA 4F1WA 2KJQA 3A28A 4CVNA 1PZNA 5L53A 1SD5A 1Y4SA 2E89A 1UCFA 2RB4A 2WSYB 4TT3D 3BXHA 5T67A 1E8NA 3QPCA 1U63A 3TMAA 5AWFC 4OJQA 3NEJA 3K9HA 3OEEA 3QE4A 3ZU2A 2BN4A 1Y1TA 2GJ9A 1ZA2A 2HK9A 4Q3NA 3V9AA 1OFIA 2FWPA 5B1IA 2AQ8A 4C22A 5K03A 1PX0A 2I65A 2I80A 3SKVA 4BUJA 5LP6B 2NU6B 1N9GB 1U0FA 3THWB 1EQUA 3AERA 2PRIA 3JQGB 3CRMA 3H2BA 3PPWA 1KFCB 3TPZA 1MEOA 4J2TA 3IP9A 1K3FA 3QU7A 1H1LA 4AO8A 4MPTA 5JD5A 3EGXA 4X92A 2J33A 3RRFA 1Y3DE 3HRHA 5IP5A 3WIDA 3ZWWA 3AEUA 3OICA 2NO5A 4LI3X 4RZ2A 1S0UA 3S68A 3T3MB 5CEFA 3GFTA 4GZ6A 1DMSA 1KQOA 3NASA 1N2EA 4NXMB 2NZYA 2Q9AA 5EZ6B 1JFFA 5THKA 1USUA 4LOKA 3VPSA 5KYUB 3M3PA 3M5DA 3PQ2A 3M3HA 3C3JA 1EFRD 4GR9A 1V8DA 2FW9A 3HMKA 2IZ7A 4XQCA 5C8VA 1ESZA 5H59A 4B3SB 1C30A 3WO1A 1XVIA 2XPCA 4ER0A 4JJAA 4DV7B 3AQIA 1QFYA 5HUHA 2QA5A 2JI9A 5H9VA 3WYFA 3CVVA 3DDUA 4K87A 4XGRA 1IVYA 2CMDA 2BFDB 2HRBA 1XNHA 3DKIA 1RXSA 2PXCA 2ATIA 2WNIA 1XDBA 3ANSA 3DUFB 3GDGA 3PTZA 1G4HA 2RHOA 4JUFA 5DB4A 3RE1A 3T0IA 5I01A 2PCLA 5G41A 5IJ0A 4LQ4A 4R8SA 2R1TB 3R5XA 4OLFA 1REQB 3GL9A 3DZGA 4XB6B 3W3ZB 1OT5A 2D5CA 1DLIA 2APJA 2O0JA 3MXOA 4PCUA 1G9XA 4LXYA 3IBGA 3DWFA 4LVNA 3N8HA 3UV3A 3VR2A 4LDPA 4H1VA 3GDHA 3T61A 2HA5A 4EG4A 2DWUA 3KX2A 1M1NA 3NG1A 1ZXXA 1VHJA 2ZRJA 2X19A 3A9CA 5DWVA 4BB6A 4IZ6A 2BBOA 5JECA 4B34A 2O5RA 2HSGA 1ZI6A 1ZM3A 5BNWA 5FQOA 3V4LA 1DQPA 2QRVA 3MM4A 3MT8A 4TMZA 5BOVA 4Q93A 5AXBA 4DLYA 2WIKA 3AR7A 1F1JA 2W37A 2XE8A 3MTEA 4WVLA 2J3IA 5KNDH 1XHFA 2WT4A 3A2LA 2O2YA 1Z16A 3DD1A 2BMWA 3E9MA 2BZ1A 1WXIA 5J9FA 4EUSA 2COKA 2P2DA 4LYDA 3ZN2A 1L1EA 4R6XA 4R1MA 1UXJA 5BMVA 3KTAB 1JEOA 3QMWA 2A78A 4G23A 4OJTA 1YQEA 2CLMB 3PUKA 5IF3A 4KRFA 1UKEA 3H5TA 3HBJA 5IABA 4G1BA 4XEUA 1E5VA 1KF0A 3NDIA 4M49A 3G17A 3DMGA 1Q21A 4QTXA 1QVVA 4IZOA 3GRRA 4OBEA 1NM5A 4JX8A 4AX8A 3GLKA 1HUQA 4RS3A 1ADCA 1W0CA 3IE2A 5I7OA 1JL3A 1EVIA 2C42A 2FPIA 3KHSA 4FE3A 5DJ5A 2QE6A 3RNLA 3WJ2A 3IALA 1XD2B 2C31A 4HAVA 2ZWPA 1IPFA 3ZZUA 6AT1A 2EF1A 1SZPA 2COUA 1RM5A 3HMQA 4QX6A 3GNQA 1DKQA 3CY6A 2FWNA 2ZJYA 3O4VA 1Y3CE 5D85A 3UH1A 3JYPA 1ECJA 1P1JA 2YJGA 3A4YA 3KXPA 2VNAA 4WOCA 3G5TA 3O8BA 4KWTA 4ZXFA 1I36A 4FFPA 3OLXA 2FG7C 2Y76A 3LHIA 3NPMA 2QS9A 3ZWPA 4Z4FA 2LBPA 3W7VA 1T2NA 1H6AA 1ZA1A 2BEVA 2RGCA 2A9VA 3OUUA 3QITA 4HRVA 4OQMA 4F3CA 5IASA 3VBCA 3GPIA 3I6YA 4KXQA 3WYNA 1N2XA 1WMFA 3M89A 2I76A 3IRVA 3PR1A 4ZV7A 4WZ6A 4C0QC 5I47A 3HKCB 4NVRA 4ZEOA 1YZVA 1RMTA 2NPIA 4WVFA 4I46A 5B4VA 2Y1CA 4KUHA 4DANA 2VFAA 5CFRA 3JQ8B 4YMVA 4RVNA 2PL9A 3HC7A 4X3PA 3HVRA 2WOOA 4KN9S 5DFAA 5HF6A 3MUNA 1W73A 1KC3A 2FZ5A 2W5UA 5FI5A 2Q4OA 1N6RA 3NORA 1Z38A 2CJFA 3A1EA 1E77A 2E48A 2I3DA 3F5DA 2G1AA 4JC0A 4M7OA 4IP0A 2CLSA 3SF8B 5K4HA 1Y5LA 4B81A 4I9FA 1SN7A 3KT0A 4Q9JA 2JW5A 3CUSA 1E61A 1KU6A 1UMBA 3CRVA 3UMBA 1GUYA 4GLJA 1JRLA 3T7KA 2Q6VA 2EHJA 3DONA 3G23A 3ZEIA 3MT7A 4ITVA 5KOJB 2FPXA 4MOWA 4CR8A 1P4GA 2FFJA 1I7LA 2M2IA 1HOXA 3QNMA 4PZYA 3TMKA 2NO7A 3V7NA 5CFMA 2YV3A 3T1VA 2AMVA 1AMOA 3OX3A 1J39A 1NQWA 1XHEA 4M1SA 5GONA 3TSCA 1Q0ZA 2HDHA 5GADl 1YBFA 1C4KA 4FMCF 1E2UA 1Y7HA 4OATA 1IXKA 3IVMA 4OV6B 3TR5A 5CIWA 2ZM6B 2CNKA 2ZIWB 4GEKA 4EUFA 5DCUA 4BN5A 4LE2A 3L2OB 4JQCA 5ARCA 2HJ9A 3TNFA 2Y1XA 4BLQA 4EK9A 3N9IA 3PA6A 5EXXA 3ZE0B 3ZWYA 2BL4A 4EW6A 4KO1S 1F8UA 1RS0A 5TLSA 2WF8A 3K1YA 1MJGM 3DTVD 2Y0BA 1GO2A 1ZWLA 2R11A 5E3IA 3LFHA 1B15A 1RI5A 3G0OA 4EGFA 3U5ZB 4LCEA 5L3QB 2NU6A 3LT5A 3QJGA 3EBLA 1P0IA 1U6JA 3EFHA 3ZXIA 5K9ZA 1C7JA 2WUGA 3CUKA 4TTSA 1WTAA 1KJYA 1USKA 4TMVA 3JQGA 4H9GA 3PHCA 4RM2A 1Z4KA 3ABSB 3P32A 1NN3A 5IJAA 3R4VA 4NG4A 1K8YB 1L7BA 5K6TA 2QEQA 3OLZA 1CJUC 2I6XA 3QTLA 4H3VA 4CV2A 1C3XA 4NECA 1LS1A 2G6TA 1UBEA 1N1DA 2RAUA 2YWRA 3NI2A 3ZV3A 3LHKA 5KS2A 2QAIA 5K5EA 2FRDA 3UJ6A 5KYUA 3BFKA 3I9OA 2LDBA 2ONYA 2B9EA 4MO9A 4D4GA 4MW9A 2OQRA 3TL6A 1KL7A 4R1PA 3K5PA 4Z6KA 3SYRA 3ZW9A 1JBQA 1X2EA 2QGNA 1SC6A 4RMGA 3CS3A 4NE7A 4GX2A 4DCNA 4O2AF 5EMKA 1IAQA 2ARKA 1GA6A 1MHTA 2WYWA 1XD9A 4PO9A 1LK5A 2REOA 4HAXA 1A7UA 1ZH2A 3BGWA 4OREX 3DHNA 1G4AE 1PQYA 1J2TA 1JHDA 2PUWA 1HMPA 1WULS 3ELBA 3HEBA 2VNIA 5E9QA 4GC5A 3RC2A 1E99A 3DUFA 3GLGA 5JPDA 4JUCA 2QSYA 4AIIA 2OGZA 3GX1A 2C9ZA 4ZK2A 2XVZA 5L4SA 4O08A 4E13A 1PJ4A 5CDHA 4QNMA 3M7IA 1NI5A 4I4CA 5IVPA 4ZEXA 1LI5A 1REQA 4MWTA 1QB7A 4YMSA 4B0PA 1NUHA 4RZ3A 1Z6PA 4RPLA 1YRAA 3UB4A 2GCEA 4NMMA 1NASA 3MMXA 4NZOA 1HKUA 1RJEA 4UTVA 4FPXA 1JR3E 1NU6A 3JQBA 3NAMA 3AIOA 3VR4D 2Q6LA 3AVTA 1WG8A 1OX4A 4G4JA 2H4FA 5HJ7A 2NXCA 3EHEA 4GW3A 4DIFA 2PGAA 2WU1A 3DGFC 2FR1A 3RSQA 1P2BA 4GPD1 2DB3A 1SCJA 4MKZA 5B6IA 4JSTA 1A9TA 4AYTA 5IMBA 4UC0A 3FPEA 5HFNA 4KH1A 4KZPA 1ZNXA 5I7FA 2GEKA 2X0JA 2VTKA 3C1UA 4ND5A 5I7AA 3RWBA 2J9ZB 3WL5A 4JYBA 1EFAA 1XEFA 3EZ9A 4B6JA 1F51E 4EY6A 2H08A 1LWOA 1GPNA 3Q3HA 5KOHB 5FEUA 2QD4A 3KTAA 3KOMA 4MQLA 2P3QA 3O4HA 4OHFA 1MF7A 4IS3A 2A94A 3DEHA 5DCLA 1G8SA 3OEED 2V7QA 5E1OA 1W8DA 3SNKA 1E92A 3TTYA 2FP3A 1S01A 3L05A 1Y6RA 3LPCA 3DPIA 3FWYA 2GAIA 3RU2A 1VJ0A 3E0XA 4W4TA 5AKLA 4EFLA 5F9HA 2H54A 1ULBA 3GRPA 4R01A 1SQ5A 1T25A 4CM3A 1TVCA 2BTQA 2ZPAA 4KAJA 3N6VA 1ZUIA 3AHCA 3AHHA 4IILA 2IYQA 5IM4A 3NOOA 2VUUA 2QIPA 3BREA 4MRMB 2CCKA 3NPAA 1XD2A 1D4FA 3KAJA 1QRAA 4PS0A 3H4VA 5KNCH 1O8CA 2QZZA 2RGBA 2WJIA 3C39A 4EHKA 1Q7GA 3SSOA 2B5OA 4RKWA 1KK2A 3HYNA 2IHYA 4ZK6A 3UYKA 1WY5A 3HDVA 3UTDA 4DDUA 3KQPA 4R0NA 3HGMA 3SJAA 1QPBA 2JLYA 1G6HA 2AL7A 3WSWA 1NBOA 1UT5A 4LGMA 1YMQA 1XKXA 3BWEA 4F5EA 2Q41A 1RWNA 5D51S 1JZQA 4X62B 3U7FB 2QJTA 2PKWA 1OC4A 1XBTA 3OD1A 5MHTA 1D5CA 3HKCA 5EJ9A 5LKAA 1N7IA 2IVFA 3HKEB 3ITDA 3QG5A 3LP8A 5KJEA 3LUJA 1CW2B 2JI8A 3B3QA 2G8NA 4PZCA 2WZQA 4JQZA 2YWBA 3LSYA 2HRDA 3HN6A 2YKGA 1KA9H 1AF7A 4O4HA 3CIOA 3DLPX 2RHBA 2XQJA 2ZRPA 4ZOCA 4DB4A 3KTFA 3U4AA 3FRIA 4PG4A 3SF8A 3BH7A 3NALA 4X7RA 1CIPA 1JU3A 5IDVA 3ADOA 4MUXA 3RUFA 3WTCA 1A98A 1E2QA 1IEXA 2GUWA 3FMVA 1NRWA 3HY6A 4LZJA 3VR2D 3E84A 4WY5A 1TYDE 2YCLA 3UWMA 3QENA 4E5DA 2H16A 2P9CA 4YJ3B 1GG9A 2V7PA 2VJAA 1WQ3A 4M1WA 4HDSA 1M74A 1XCGB 3TLJA 2Y1DA 3L92A 3L04A 3L18A 3RTCA 3KD3A 1CF9A 2LZ0A 2QTAA 4PC2A 4YJ2F 4DADA 4NJEB 3U61B 1M54A 2LV8A 5U1PA 1CDDA 1WDMA 2FPPB 4L02A 1MUUA 4V3CA 3E4DA 5EMNA 5JVDF 3PRJA 5CH3A 1ANKA 4ZCSA 1NNLA 3WK8A 2ISSD 3PYLA 1S1CA 3U3XA 4MCAA 4ERXA 1A96A 3A32A 3LC1O 1UPUA 3LT1A 1UK6A 1ZJJA 1K2WA 3L7AA 4MV1A 1Y89A 3R0IA 1Y9AA 5A0VA 3G5MA 1TM3E 4DCPA 1IG0A 3QHAA 4I5GA 4IJWA 2VEDA 3U6KA 4CL8A 1Z6TA 1SOMA 3DYBA 3OQNA 4HDKA 5KYKA 5IU6A 4Y2SA 4L28A 2B4AA 1RIFA 4FZ5A 1RHKA 4KQIA 1I7QB 4KB5A 1FNNA 2QN6A 4P5PA 2FPMA 4B4VA 4QBFA 4UEQA 3OKFA 5CVCA 2BGNA 1CUFA 4FQ5A 4OKNA 1JVBA 3VJKA 2J07A 2C9BA 3EIEA 4FDMA 3VPBA 2JLXA 3IQIX 4QXRA 2ODBA 1GV1A 3GGDA 3HVKA 5DP2A 5AIAA 2GO1A 1J7JA 1LNSA 1VZ3A 2VAXA 4J76A 4TL6A 1H2AS 3WGNA 3BK1A 1VJ5A 2BR4A 3A6DA 3UCFA 3NCHA 3HCDA 1JE0A 2WZBA 5BV8A 4BX8A 1JJIA 5DHFA 2A9PA 1G16A 2C8KA 4Q3DA 1AUOA 2ERYA 4YRNA 3A05A 1BS9A 1SUFA 4H0FA 2YV2A 4H7PA 3RBVA 1XTTA 1TM2A 1S8AA 5AVSA 1P62B 1N5KA 1JDJA 4BFCA 5FA8A 4AQ7A 5FPQA 3Q7PA 3DEKA 3A1WA 4YRBA 1LZLA 4NL4H 1JHQA 1VBKA 4EZIA 2E55A 3I5XA 1PG2A 2IDKA 3BX1A 3CXUA 5JU6A 2HNAA 4NCXA 2ZG6A 1MAAA 2CFTA 4I99A 3GHHA 1W36D 4DMKA 1KVUA 5BV7A 1PSDA 2O8BB 2CBXA 4D9FA 5GVSA 1K5DA 1T15A 2BMDA 1Z9BA 2QU8A 3ET5A 4EPTA 4ZDIA 4GMHA 1MT3A 3ZV7A 3HO1A 2C4NA 3L1VA 2R66A 1N3IA 4N7MA 1YZKA 4WGFA 4HEHA 4C0LA 4FI3F 1WAMA 1TKBA 3HDGA 4D9EA 5AW4A 5JY1A 4GL2A 3IAAA 3KUUA 1BQEA 3Q1LA 3H7IA 1FQOA 4HADA 4JLDA 3RROA 1N9KA 3AHFA 4J29A 2IODA 4YWJA 3UC9A 5A6SB 4E7OA 3FI9A 2R6ZA 5BV2P 2VF8A 1VMKA 1V1MA 3G0IA 4F86A 1VYUA 3DFIA 1XTUA 2HWKA 3N0XA 4EB8A 2R86A 3DD5A 3LA8A 4LCBA 4ETIA 5K3SA 3K73O 2R84A 3W8EA 4UBKA 5KOHA 3THXA 1U1IA 1W0JA 2ZIXA 5A4AA 1TM7E 2O20A 1E66A 1ZMTA 1QPZA 1F6DA 1EB9A 1T6BY 1IOVA 1VIMA 1W581 4HGZA 5IUJC 3VSEA 2YNMA 2TMGA 3AYXB 4MS1A 4ZHQB 2G9ZA 1KJWA 2P7HA 4RV4A 2Q5JA 2AI2A 1OI4A 3UXYA 1KO8A 2NUAB 2IYYA 4HDQB 1NJSA 2AEFA 5EP4A 5F77A 1XU7A 1YB2A 4TQGA 4J0HA 1PZHA 3NDJA 5K8UA 2AE1A 4IGFA 1PQ4A 3ZGVA 1TTTA 1E2KA 2A5LA 3M81A 1LQTA 5CA0A 3PNVA 1SC3A 3FPAA 3GJYA 3HB1A 3RQSA 4EYQA 2Y0PA 3INGA 1W4LA 3NUGA 1R50A 3PIIA 4CG2A 1JQAA 2FN7A 1B2LA 4E14A 1RPAA 3GGOA 1KMIY 1PX2A 5FLKA 4EJFA 4ACBA 4IIVA 1UBMS 4IKOA 4F46A 1CX9B 3EG9B 4Q00A 2QF7A 4H6VA 1NA5A 1Y1RA 3HCWA 3UFXB 3A0UA 2IHZA 4RKQA 1AGPA 2EKLA 2ASEA 3U3JA 3OPYB 2HSZA 3A36A 4RY8A 2BFAA 5JD3A 2LNDA 3DMPA 4KJXA 5ITWA 4TKLA 4PF1A 5LP1A 5E3JA 3HKEA 5FEMA 4ENTA 2O8EB 1ISFA 2V98A 5BRJA 4S1NA 2QTNA 3I2KA 4NYMQ 3RO7A 4YR7A 5D5HA 1U2GC 2J5QA 4HFNA 4KXYA 1JSCA 5ALWA 1KYQA 4U7TB 2GERA 4MHSA 2CBGA 2XB4A 3OPVA 2VDUE 3L7JA 4QU9A 4UUAA 3ZCPA 4KPUB 2P6MA 1P19A 3QE3A 3ONWA 1IBMB 3V1MA 3PQ6A 5D00A 1HLPA 3K0KA 5FPSA 3ZUPA 2PGIA 2B5WA 3IAUA 4Y0AA 3W79A 4D6YA 2L0XA 4A2WA 4F6CA 1F3OA 2C82A 2ZT8A 5TQ2B 4A5SA 3Q3CA 4UDOA 4EW3A 2ORVA 1JIVA 4YJ3A 3VKFA 1TJPB 3CRRA 5A9SB 2CVHA 3KJNA 2BGWA 1ML3A 4QYSA 2GN0A 4A26A 3QUBA 2C4TA 4F9GA 5EJEA 3QWAA 2ZI5A 3NO4A 1QHHB 1W1IA 4FD3A 5AVOA 3CNHA 4NJEA 5L3SA 3QFCA 5EZYB 1V4BA 2FPPA 3NOXA 4HAWA 4O4IF 2B6NA 2WIBA 1Z75A 4P2GA 3A8TA 2F1KA 4S2UA 3PL5A 5GIPE 4JHLA 1TAQA 3NWEA 5E6RA 3VU3A 4FW9A 4PC7A 2X6RA 1BMTA 2GRUA 3ZDYB 2D54A 2HO5A 4NJOA 4YRAA 3NHUA 3F5SA 3HFSA 4MVJI 2V7QD 1GTRA 1E63A 1N3BA 3M1AA 2WJAA 1CB0A 1VJTA 4LDZA 4Y6PA 1DCFA 2P2YA 1R6XA 5EJ7A 3N70A 2ECQA 5REQB 1TB4A 1C7EA 2NXNA 2XDQB 4FONA 1YCDA 2VRWA 1L5RA 1SJ9A 1Z4JA 2BFNA 3CLSD 3HXKA 1F06A 3CZMA 2CJPA 3OY2A 821PA 3EH1A 2A67A 3RKUA 1UZUA 4NCJA 1RBZA 1U3FA 5BW8A 3ZHCA 4E5PA 4DNPA 1DAFA 1FNBA 3P26A 4XQ9A 4O0MA 4EFNA 2VSXA