4HDCA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk: compound 41)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 84
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdcA00
3EASA 2ZI6A 5L3RA 4POAA 4U00A 5BW8A 1X1RA 4TMTA 3HPQA 3AV0B 2VYFA 3UPUA 4EDHA 2Q3MA 3NDPA 2ZYTX 3N2EA 4JVNA 3PITA 1VCMA 2GEDA 4LBVA 3WMFA 2ZSEA 3ZS8A 3DEFA 5JJIA 1UDXA 4R2HA 4DB4A 2BEJA 2UKDA 2P65A 4C0SA 5AR1A 3WMEA 4Q9HA 4F38A 3QEOA 4DDWA 4JL5A 3H0KA 1W48A 1FP7A 5F3WB 2CHQA 1P2SA 1XB2A 3P4XA 3FFBA 2VPPA 5HE9A 1Q22A 2Q21A 5JRZA 2QM8A 3T34A 4PX9A 4GOKA 1UADA 2QI9C 2CL0X 4B47A 2IYZA 2IXEA 2WAXA 1ELOA 1NN0A 1TQ4A 2HCJB 1X3SA 2F1RA 2H17A 3EC1A 1NRJB 2WJJA 1AKYA 3SBDA 1R0ZA 3FMPB 4JZKA 4KVAA 3VR5A 3G0HA 4EJSA 2MMCA 3L0PA 2B21A 2V4ZA 4AYTA 1OB2A 2BDTA 3LD9A 4KHZA 4JL8A 1MKYA 2DWOA 4Q7MB 4TTQA 1ZM9A 1SXJB 1I2MA 4BZXA 1KHTA 2NPIA 1S0UA 5AUNB 4AYXA 1FOEB 5C1BA 2ODBA 2HLDD 4GOJA 1ESMA 3T5DA 3BGWA 1VKJA 1G7TA 1A4RA 4IOJA 5EE1A 2GTPA 5KNCA 4P4UA 2F9LA 3MWLA 1T0JB 2IYLD 3P20A 4PPQA 3DKVA 4TYPA 1P3JA 1XEFA 2JCSA 5DYIA 1CJMA 3FHOA 2EFCB 3L8YA 2AR7A 4LBWA 3FE2A 1IOZA 4ASUA 3ZIAA 2WKPA 2QROA 1PLLA 3R8CA 1VTKA 2UZ3A 4OI4A 2XNDD 1XJQA 2G1JA 2GCOA 2KB0A 3CPJB 2FMXA 3B1XA 1KJZA 1T9HA 1KY3A 1WCV1 3D3QA 2ERYA 5CB8A 2IS6A 2C78A 2P3SA 3IBYA 3SN6A 5TVKA 4LZZA 1W0JD 5FOVA 3L8ZA 4GP7A 5JI2E 1Z0DA 1XCPA 3PUZA 1G8FA 3EW9A 4N0DA 3QKTA 1L4UA 4B48A 1FQJA 4JT2A 3PFIA 3DKPA 4PZZA 3CONA 2NO9A 3U5ZB 3PXGA 2OCAA 4O3MA 2WSSA 3SFZA 3AVPA 1F2UA 4UJ3A 3ZVNA 1CRQA 1VCIA 2WAYA 4KCGA 1VYVA 5CJPA 3TQFA 4AD8A 4FXPA 1Z2CA 4CT5A 1JPJA 5GJWC 4UQOA 5JBQA 4L5BA 2OT3B 3AKEA 3OIWA 4G1UC 2LKCA 2HF9A 1E2GA 5CM8B 1C1YA 1P7CA 2ZROA 2PCJA 3IBGA 4QNRA 1VIAA 2MSCB 2JLUA 2BWJA 2BBTA 3QI2A 1XD2B 5AUQA 4DC9A 1HYQA 1G5RA 1N2CE 2E87A 5CLLA 1KI4A 4KITB 1VYUA 2AX4A 2YC2C 2GJ8A 2QU8A 2F1HA 2Z4RA 4ON9A 4DDVA 2FN4A 4B3DA 2ZPTX 2PBRA 2DPXA 1EFRD 1ZMXA 1VCNA 2ZRFA 1JQLB 1GVNB 3GLIB 4IDNA 1XZQA 2OLKA 1KO4A 4BFYA 4HUQA 3CO5A 4WVFA 4M1MA 3GLFB 1ZD9A 2JA1A 3T1OA 1IAQA 4E22A 3THWA 1NIJA 1GOTA 2OSBA 3GJ0A 4J0QA 4Z1MD 2ZJAA 1D2NA 1KSHA 1KSJA 3LXRA 4RJLA 1W4AA 4Q4HA 2DBYA 1SHZA 4YC7A 2G9NA 2YC4C 2XZLA 1D2EA 1NN1A 3TBKA 1E9DA 3UANA 1NIPA 4ZDJA 4R7ZA 1KI6B 2ZS9A 1E9RA 3QPVA 1NL3A 4GNKA 3WBKA 3FMIA 3MGCA 1GRQA 1I4DD 4JLPA 2VF8A 2YINC 5GJCA 5EZ6B 5UKDA 3TVTA 4P0TA 5TMPA 1GKYA 3JZMA 3T61A 4ZCIA 4ILEA 2DHRA 1WBDA 1YR8A 2ZRPA 2YWFA 2IX3A 4DDTA 4IW3B 2WJVA 1MO4A 2R6FA 2O8DB 4PR0A 2ZUCA 4P4SA 3CH5A 3FOZA 3GPLA 4BLQA 1M34E 3DZDA 4WAUA 4AIIA 5JS8A 2AK2A 2QP3A 1GL7A 4Y0VA 3H1TA 5JI3E 2IXFA 4G5QA 2JJ8A 4KYUA 1Z0IA 1IBRA 1Z6XA 1Q1BA 2SHKA 5AWFC 3ZQJA 3NIBA 1M6NA 4O0MA 3AVVA 2ZYWX 4C2UA 4XTRA 3N5CA 3U3RA 3BFVA 3B6EA 4L15A 1OFIA 1QF9A 4KYIB 121PA 4HDOB 4MGYR 3QBTA 1COWD 1I4LD 5A4JA 3PIRA 4TTPA 3AVUA 4C0QC 3HR8A 2QG6A 2BKUA 1IM2A 4IDOA 1AJEA 1TQ6A 2ZETA 3CPEA 1U90A 2ZANA 1Z2AA 3VR6A 4TQUS 4ESVA 3QENA 4QBFA 1UKZA 1JXOA 2ANCA 3QKUA 3ZZTA 3A8TA 4A0GA 5EUQB 5AUPB 3MCAA 1XCGB 3I3SR 5DH9A 4PC3A 1E2MA 2BKEA 1CRPA 2B6HA 1XZPA 3O47A 2JASA 2RMKA 4XIGS 3H4MA 4N0EA 1UBGA 4MKGA 1E0JA 2BV3A 3CNOA 3IDQA 4PPGA 3I73A 1VPLA 1PV4A 2N42A 2QPAA 5GJBA 1U81A 3K0CA 2YNMA 2QORA 1NY6A 4MYHA 3KXKA 3QSYA 1U8AA 3Q3JB 1N5IA 2XX3A 2YWHA 3T35A 4W5JA 1DAFA 1WE2A 1XJCA 3VU9B 4IEIA 3TUIC 4V03A 4LC0A 4D25A 4EPRA 2ZJ5A 2J7KA 1RJ9A 1WF3A 2GKSA 2EU8A 4ZDIA 1OH8A 4BPBA 1EFHA 5JCZA 4IVPA 4LV8B 2EFDB 1A2KC 3MLEA 1KK3A 1XXHA 3LQQA 3GJ5A 1NMYA 3IUYA 1OLOA 2YOHA 2QEQA 4KLNA 3RHFA 2G0NA 4KO8A 1AZSC 2QAGA 1ZAKA 4HEJA 4RCYA 2ZXUA 4M4SA 2ZEJA 3O8CA 4M0LA 1XF9A 4L16A 1ZU4A 3B9PA 5L3SA 2C5LA 1ZJ6A 2E9SA 2GWHA 4PZLA 1SXJA 2OBNA 2R2AA 4D4MA 2WWGA 3R8FA 5HE8A 521PA 1G5TA 1KOFA 1E4YA 1VHLA 4TQAA 5IRCD 2AWOA 5JJLA 1KJWA 2QTHA 3W9YA 4FMCF 1T5IA 4PQRA 3AGPA 3PEWA 2ODNA 2JDID 3F0TA 1FPMA 1BYUA 4E07A 1DO0A 1G8GA 2IYXA 3ONWA 4IVQA 1Z07A 1SVSA 1GFIA 4F4JA 4IDHA 4B3BA 2VH5R 1BMFA 1HT1E 1ZM4A 4M53A 1JNYA 1S9DA 4OKSA 1LTQA 4LV6A 1Q3TA 4LRWA 1W0KD 4KFRA 2VSFA 2C98A 2I1QA 2QGZA 3R7WA 1DS6A 1NSTA 1YHNA 4TWZA 4C3ZA 4AWXA 2O8FA 3ZDQA 1RRCA 4JVMA 1E0AA 2MMGA 3U44B 1KDRA 3ZD6A 1M74A 4XSHA 2D7CA 3SC3A 1OIXA 4Q7KA 1II0A 1G19A 3GLFE 2WOOA 2OHFA 3EC2A 1UKYA 1E79D 1OYWA 3TMKA 4FW9A 4QJ5A 2HEIA 4TMKA 3THOA 1VG0B 4C0HA 2DY1A 3A4LA 3CR8A 3NBXX 4FN5A 1Z6GA 3BBPA 3KXLA 4II7A 2AFHE 3L82B 4TLEA 2OLJA 3FKSD 1CIPA 5JZVA 1P4SA 5EZ5A 5FH9A 2XZPA 1GL6A 2BMFA 2REBA 4CEHA 3W3AA 3IQXA 2YYZA 4MGKR 1EX7A 4YMVA 3MG9A 1G9XA 1MABA 5FOXA 2QSYA 3KL4A 1CJTC 2GF0A 3LWNA 1QHIA 3Q7PA 1SXJC 4I99A 5HKKD 4MKFA 5FI0B 5JSZA 4D0NA 5FL7D 5G3YA 3THYA 5E3HA 2OESA 2PT7A 1OXSC 2HLDA 5DGXA 2W0MA 4OHVA 4ZKDA 2W6IA 3SJBA 5F98A 2XJ4A 4IFEA 4CIDA 3TNFA 2JLRA 5AUOB 3LBHA 1W4RA 2C95A 2UZIR 3QPWA 5JEDA 1B23P 4O25A 2V55B 2NZ8A 1XEXB 3RRNA 3AB3A 1S8FA 3LW7A 2J7PA 4EFMA 4XVUA 1CJUC 5K8UA 4TYQA 4TYWA 2VP5A 3KXIA 3OIVA 4C0JA 2ZJ8A 3QKSB 4M21A 2CEAA 2QM7A 1M2OB 2DFTA 4LDJA 1XD8A 1E0KA 4BFUA 4E09A 1P6XA 4JJZA 2C96A 4EPXA 1Q57A 1XTJA 2F7SA 4U02A 3ETLA 2XB4A 3CZQA 2D74A 3K09A 2GDJA 4LJ6A 3SFVA 4US2R 5JFGA 4Q9JA 1TQ2A 4DLYA 1R8QA 2WMOB 2B8WA 3A4NA 5J40A 1GG2A 3X1WA 4A15A 2ZJBA 5HCNA 3DMNA 3X1XA 2RCNA 1QBKC 4B35A 1OT3A 2HT6A 3A4MA 3U3OA 2OUKA 4ZIRB 4DLZA 3V00A 1U2RA 3EXAA 4JT4A 2D2EA 4NHOA 3BH7A 2C03A 1QHHB 2WWXA 1MOZA 3E1SA 1LB1B 3IPYA 4NCIA 4RD6A 4W5WA 1OW3B 4I81A 1GAJA 3RC8A 1W5SA 1JXMA 1WDTA 5F9FA 1KYIA 1R10A 3TH5A 2IYUA 3TQCA 3PEUA 3CIOA 4DXAA 3ZVLA 2PZFA 2WICA 3V9PA 3G82C 4V0MA 3SQWA 5KO2A 2HF8A 3NHAA 4UXHA 3EZFA 1J8MF 4LJ8A 1YR6A 2FU5C 3W34A 3TSWA 4TLCA 1G4UR 1M7HA 2CHGA 4UJ5A 4Q9KA 4DLSA 4DT1B 4IXNA 4NBSA 1EFRA 4ZDWA 1CR0A 1I4TD 2QP4A 1EK0A 4A0HA 1HUQA 3LO5A 2Q3HA 2GJKA 1OHHA 2QN6A 4NYJR 4LHZA 3O8BA 1RRFA 1DVRA 1ESNA 4DDUA 1Q0UA 5CDFE 4UXIA 2PCLA 1XTQA 5B57C 1OXVA 2GESA 2VP0A 1G8PA 3B1VA 2EFGA 3GJXC 3I32A 1Z0AA 1G291 3FHTA 4HDQB 4Q18A 1TUIA 3D7MA 4PFSA 2A5YB 4FCVA 4Z1MA 4LWZA 2ZVQX 3EA5A 2V7QD 4B32A 2OXCA 3FPAA 5CB6A 1OIVA 1XTKA 2XTZA 4X8HA 3AVQA 2GILA 5FPTA 2MSDB 2DFNA 3GJ4A 4QHTA 1XX6A 2GF9A 4DCVA 1CULC 2IL1A 1F60A 3Q9LA 2W00A 3WNBA 4EFNA 3GFPA 3QXJA 1PLKA 2J59A 4YMWA 1IXSB 3UXMA 4JBWA 3MJRA 2CE2X 1PJRA 1ZBDA 2ANBA 2OZEA 4Q47A 5H68A 1PVOA 2DWQA 1NBMA 1P5ZB 1BYIA 4A8JA 1II8A 4Q4JB 2ZRCA 4NONA 4HZUA 4PSVA 5TV2A 2IXGA 4HLDA 3MWKA 4QBHA 2O5VA 1OE0A 2F43B 3LX5A 5KNDA 4ZV4A 5FTMA 2REXB 1EWQA 2J87A 4KBFA 2QE7A 4MYTA 1QRAA 3ADKA 4R2IA 4RVCA 3BRWD 1KDPA 4DLRA 1TL7C 3L43A 4V0NA 1KKLA 4UNSA 1JR3A 1T3HA 2ATVA 2WBLC 3IQWA 3KTAB 3QKRB 1XBTA 1WP9A 1E9CA 2P6UA 3CNNA 5D3QA 2X19A 5IDVA 4D0GA 1KZGB 3FYHA 2NTYC 2A78A 4H1UA 3TLXA 3CPHA 3CX8A 4EPWA 5EQTA 3P27A 2QL6A 4HAVA 1G7CA 4QJ4A 5B2ZA 5L3QB 2V3CC 1UJ2A 4B3XA 4HAYA 3A1VA 3AUYA 1YE8A 1E1QA 2C04A 2O8CA 1RYFA 4BUJA 1VG9B 2KWIA 3BH0A 1FP6A 1SVKA 3GQBA 2VLIA 1GRNA 1HEIA 5BN4A 1AN0A 1Q44A 1II9A 2VP4A 3CNLA 2YV5A 2V6IA 5AJXA 5A0FA 4BFXA 4JBXA 3QNUA 1ZINA 2ZRBA 2QMEA 5IK2A 4B3CA 1J90A 3KQLA 2D7DA 2QAJA 2RGNC 2IBMA 2XSZD 3B82A 2CL6X 1U94A 2D4HA 2A7QA 3RNLA 1IN5A 4LHWA 2PX0A 1VG1A 4MKIA 4QGHA 3ZYCA 2R9VA 2AXPA 1TUEA 5FTKA 4YQFA 2WIAA 5FUYA 3QOFA 5CYPA 2BCGY 3KQHA 1GDDA 1TF2A 1VG8A 1KO1A 2PZEA 2VSOA 3REFA 3U6BA 3AM1A 5SZJA 2JGNA 3RDPA 4LOAA 2GXAA 4XWOA 1E2JA 1MT0A 4TT3D 4PTLA 1OV4A 3C16C 2JLVA 2IUSA 4JLDA 4LPKA 3CF2A 3ZS9A 1E2QA 3P4YA 5EJEA 1HT2E 4RZ3A 4CEIA 3VNUA 4TZ0A 2ONKA 3BC1A 3CWZA 5JMTA 2VIIA 3GD7A 4BRWA 4DSNA 5JS7A 1E1RD 3WNDA 1OJLA 1DEKA 4JYCA 1JJ7A 3IIJA 2YZ2A 4Q66C 3SQXA 2ERXA 1SHKA 5FR2A 2JLSA 2W6JA 4OHZA 2Z5FA 4URUR 4MRRA 3LX8A 1M7GA 1L4YA 2OAQ1 4C30A 2FJUA 4RD2A 1IY0A 4ZCLA 2E1RA 3N2IA 4HB4A 1VMAA 4EAQA 1W4BA 1DAKA 2DFLA 2RGCA 4PPNA 4RZ2A 4TL8A 3C15C 3WRXC 3GLHB 3A36A 4MITA 1OFUX 3EARA 4LHYA 3NKVA 4NH0A 4AURA 1Z63A 3CRW1 3KJHA 4NYMR 5EE9A 5BQ5A 1HTWA 5FUXA 4IDQA 1EXMA 2XOKA 3TIFA 1XJ0A 1Y3AA 5BYJA 1UPTA 1G6HA 4C0BA 3D31A 1SQ5A 2R6DA 3LLUA 4NYJQ 5FUVA 5KPDA 5CIWA 3VHLB 4JLJA 4R9UC 1FNMA 3U3MA 1HH4A 1WB9A 3FKQA 1GIAA 2ODWA 3HPRA 3EPLA 4BLRA 1UDWA 4URVR 1SKQA 3LXXA 1W0KA 2QT0A 2AD5A 2CDNA 4Z8XA 1OH5A 1NMZA 2P6NA 3U7FB 4PHFA 2VHTA 3K0AA 3BWDD 4Q01A 4LYJA 3MFYA 1W36D 1ZNXA 1ZW6A 5JCPA 3TSOA 2NO1A 2QTVB 3RS7A 1DELA 4QOSA 3K0FB 4XJXA 5FPYA 4BE7B 1L7VC 3W3ZB 2NZJA 3VX3A 3ECCA 5BXQC 2VHCA 1KIMA 2D2FA 1YR9A 2FFHA 3CB4A 1A7JA 3PUYA 4QBGB 4B6FA 4UNRA 2CJWB 1NSFA 3QE0A 1AM4D 1QZXA 2X77A 4A82A 4TLAA 1F2TB 2PJRA 2OAP1 4RZUA 2Y8EA 5CK5A 4AYWA 3BE4A 4G01B 1NVUQ 4NTZA 1XMVA 2KI5A 2FPKA 3X1YA 1FX0B 4ARZB 3GJ8A 3CX7A 3VX4A 1RRGA 3OEHA 1IHUA 4I1SA 2GJAA 5AK0A 3REGA 4CW7A 1Q21A 3I8SA 3CBQA 5SZKB 4JVSB 3MSXA 4UNPA 4P4TA 4BWYA 5A5GA 4GL2A 3EG5A 2BBOA 1CJVC 1E9SA 2CL7X 2WVJA 4KVGA 1V43A 3FMOB 5FL7A 2O0HA 3GJ6A 4JIMA 2OEPA 1W5TA 3BS4A 2Q9CA 1GZSA 3U60B 3SR0A 2FZLA 5DI3B 3EAQA 2XEXA 2AL7A 1E98A 1ZD1A 3DMDA 3GFOA 4JLNA 1DE0A 3QUSA 3HWSA 3NWJA 3TUZC 1KY2A 2O8EB 2OXRA 3U7HB 1Q20A 2C99A 1U0JA 2F9MA 4DKXA 3R9XA 2WZQA 3K9LA 2X2EA 2H57A 3ZLJA 3TVDA 4NCKA 1R0XA 2XITA 2QBYB 1DG3A 1X8JA 1R8SA 3DVLA 2PL3A 5BYKA 1SVOA 2B7CA 3FWYA 2A5GA 2WOJA 2O52A 3GLGB 2OV2A 3AGQA 2FX3A 3LY5A 2FWRA 2A3RA 3QXHA 4FMDF 1DAHA 1JPNA 3AP1A 3FB4A 4JLKA 1W36B 3K8YA 3F3YA 4MUAA 4ESHA 3B1WA 3RSLA 4IFBA 3WYGA 1T3SA 1ODFA 3ADCA 1Z0JA 1HQYE 3SHWA 1T4GA 4CZ2A 2BJWA 1SVLA 4DUGA 5C18A 1RKBA 2C8VA 4D0LB 1T6NA 1ZRHA 1VHTA 4LBZA 4DEYA 4B3FX 4DLXA 4PHTA 1HA3A 1H8HD 1HURA 1LFDB 2IYQA 4PPFA 3UMRA 2BMJA 5CYOA 3NTUA 1ETUA 1YQTA 1Z29A 1T0HB 1NY5A 5G3ZA 3AP3A 4HAUA 2WWWA 4BFWA 2VF7A 4H1VA 2ZE6A 3A1UA 2XAUA 3UK6A 4LBYA 4GSYA 4C4PA 4W5HA 4OQMA 3LFUA 1RC8A 2WIBA 2CNWA 4FMBB 1CXZA 1CBUA 2ZRMA 4RFSA 1E2NA 3RANA 2OFWA 5B30A 3AVYA 2Z6VA 2OFXA 2XZOA 1W7AA 1UAAA 3WHLA 3WBJA 3PCRB 1TF7A 4Q4AA 3CZPA 4JL6A 4NYMQ 3PR1A 4LHXA 5FOSA 1AS3A 1ZNZA 1AS0A 1G5PA 4OHWA 3A37A 3RVBA 1H8ED 2EWWA 2JJ2D 621PA 5HZHA 1Z22A 4QM7A 1IY2A 2NQ2C 1SZPA 4MYCA 5EP1A 2ZRGA 3CLVA 2AWNA 5E4FA 4DVGA 4Q19A 2H7VA 2HXYA 3KUCA 5IHPA 3TGPA 3OEEA 3GLHE 3SBEA 3U4QA 2VP2A 2GZAA 2RHMA 4MUBA 4Q1CA 2CK3A 4XVRA 5DN6D 1S1MA 1WMSA 3TKLA 1HY3A 1GITA 1EG7A 1RE0A 2GZDA 3IEUA 2Q0HA 4IOLA 3MUFA 3LLMA 3SZRA 3I92A 2WJGA 2JLZA 2XXAB 4XD7A 5FBRB 4M1SA 1E2EA 2BOVA 2A2ZA 4RY2A 3EZ2A 5ANRB 5TARA 3OE7A 4Q9LA 1Z8FA 1T3LA 1YR7A 2N46A 4WXPA 4B6EA 3AF2A 1X8KA 3OAAD 5C4MA 2P5TB 3CUEF 3R9IA 1E94E 2PLRA 4C7OA 5EP2A 1TX4B 1HE8B 2FGJA 4TYNA 1NVVR 4NDZA 5L3VA 3S1AB 4B3GA 4YXWA 4DCNA 4RD3A 1D5CA 1NN5A 2VQSA 3HU3A 5AJZA 4DLWA 4NYIR 1N5JA 1OPXA 2V54A 5J47A 1U9IC 3CRMA 3NEYA 2W2TA 2XGJA 5FTJA 5D3MB 3B1YA 4UXJA 1OXTA 4ERNA 4F4IA 821PA 1P2UA 3EPKA 4FWIB 3I61A 2PEYA 3PQCA 1US8B 4JVLA 2EYUA 2IT1A 2R6AA 3KKMA 4KJZA 2C9YA 2GA8A 4PC2A 2ZRKA 1KAGA 2IYVA 2ZE7A 1W46A 1Q1QA 3T15A 4TSFA 1GSIA 3HYRA 3Q5EA 1XXHE 2XTNA 2ZS7A 4GPTA 2P5SA 3QVUA 5FBQB 2ONJA 2AFIE 4RD1A 3K53A 3EX7C 2X1VA 4KV9A 3ADDA 3LRPA 1AQUA 1ZVQA 4AG6A 4DJTA 4HAWA 1ZD8A 4B33A 1PUJA 1JBKA 3AKDA 1TAGA 4OQFA 1P9NA 4Q48A 2OCPA 3I5YA 1LF0A 3NBFA 3SI7A 4BQSA 1JEEA 5BWMA 2GEVA 4DHEA 4Q5IA 4IKEA 4EIWA 3O8RA 2GVZC 2XSZA 1W4CA 3BB4A 4TL6A 5FPSA 2LCFA 3SJZA 5J4LA 1E9AA 1N6PA 3BAFA 5EXXA 2CXXA 2A5JA 3UWOA 1AGPA 1KK2A 4IVRA 1WQ1R 1QHGA 4G5RA 1E2KA 1KK1A 2EVWX 2YWEA 1TPZA 3QF4B 3DOFA 1Z6YA 2OBMA 3F8TA 2AKAB 4FIDA 4RKEA 1XMSA 2ZREA 2YVUA 3KUDA 3KJGA 2QP9X 421PA 2ORVA 4D4KA 4OJQA 1F3OA 1U8ZA 5JWRA 4QFMA 1KI2A 1KNQA 2ATXA 5KYKA 3GLGE 2IYSA 1E3MA 4QHSA 1E9FA 1R4AA 3QG1A 3ND9A 5E95A 2RGAA 2A5DA 4A92A 2EQBA 3LVQE 2JLYA 4UKDA 5JHGB 1NP6A 3A6PC 3PUVA 2HYDA 2RGEA 4JLOA 3UWKA 3K9NA 4DCTA 2VHJA 2HUPA 4OQNA 3TE6A 3P1JA 1KZ7B 2ZRHA 2J9RA 3JVUA 4NZYA 2JJ1D 4AKGA 1G1MA 1YZQA 3J81k 4JKYA 3I8XA 2QA5A 5DISB 2FNAA 1ZM2A 4YDHB 4ABYA 3A1WA 4B75A 3RRYA 4I1OA 3U61B 1IN8A 3EZ6A 1XDBA 4HLUC 4LUCA 5AJWA 5EE5B 2G77B 4MDEA 1KJYA 2CCKA 1FL9A 1TEXA 1XTIA 4QGGA 5K8LA 1ZUNB 5SZHB 3ZZ0A 2NIPA 4N3NA 4B76A 4FCTA 3PUWA 1TU3A 3W6NA 3T1VA 1Z0FA 1PUIA 3AH8A 1ZU5A 3SYNA 1U8YA 1E6CA 3CKLA 4TMWA 4EQ6B 3KJEA 4FI3C 2IYWA 4RD0A 4BZQA 5BN3A 4FINA 2QZ4A 3SYLA 4D2IA 2ZIAA 4QKQA 1HE1C 1KI9A 4CEJB 2ZITA 1U98A 1N0VC 1VIYA 5E7JA 4H9GA 5KPJA 1L8QA 2L0XA 1S2MA 1D6JA 1VECA 3ZQ6A 4EPTA 4DSOA 3FFAA 5E7IA 5GVSA 3TW4A 3OIUA 1FNNA 1S1CA 2F6RA 2N1BA 3WP0A 3ZH9B 1LY1A 1GNQA 2OO7A 3BK7A 1XD2A 2X8AA 3RABA 3VQTA 3GCGA 1KI8A 2VTKA 3ZVMA 2QMHA 2ZQ5A 1K5GA 5HTKA 3ZZUA 2J0UB 3HYTA 3K0SA 1FFHA 5F2EA 1J8YF 1NVVQ 4E5UA 3VKHA 1N6RA 3PG5A 4BFTA 1D9XA 3IO5A 2IF2A 1CJKC 4NYIQ 1Z6AA 2V8OA 2FZ4A 3EPHA 3ICQB 2BIFA 3LQRA 3W5JA 1SVMA 3L2OB 1JALA 1YVDA 1XWIA 3GLIA 1A5TA 2NO6A 4ASUD 2VHQA 1Q12A 3TJZA 5DHFA 3QIAA 4PANA 5FTLA 1E99A 3GLFA 5SZIA 3TR0A 2FFQA 4FCWA 1ZC3A 4G5GA 1V5WA 2XNDA 3QEJA 1NG9A 4BEJA 1NMXA 2VP9A 1LS1A 1MR3F 2JAQA 2REOA 4PO1A 3SOPA 4BLSA 4A6XA 3AVOA 3QXXA 1KI6A 4EKDA 1W0JA 1EGAA 1OSNA 3KFVA 3GJ3A 1QVRA 4HUTA 1AS2A 4P31A 1OKKD 2IYYA 2O8BB 1XD9A 3CF6R 4K81B 4RKFA 4QGAA 4DB2A 2RAPA 3MWJA 3C5HA 1WA5A 3BERA 1Z5ZA 3AKYA 1G7SA 1XCMA 2AN9A 2KJQA 2Z83A 1TEVA 2B7BA 1ZNWA 3C5CA 5FBLB 2KSQA 3FMFA 5B58C 3PJRA 4HYYA 3BD9A 2O8DA 5CJ2A 1W36C 2ZS8A 4WBSA 3K70B 3I5XA 2PLFA 1QDEA 1TNDA 3I72A 3IIMA 4R98A 1IJEA 4WZ6A 4EJSB 4ITRC 4MGZR 2WWIA 5FBWB 3RWMB 5CITA 1M1YE 4Q03A 3ZD7A 3TRFA 5FI1B 1P9RA 2EW1A 4C0LA 3TAUA 1F5NA 3NG1A 4QM6A 3ZGXA 3PVSA 5DIFA 4LCBA 4HAZA 3UG6A 1XTSA 4OBEA 1R0WA 4DEXA 4WA7A 1SULA 1TF5A 3GMTA 4HATA 3LAWA 1BO6A 1FUUA 1BIFA 4TMXA 1EFTA 2OBLA 4NPHA 3H86A 2GCNA 1NBME 1BS1A 1PLJA 5D3MA 5C46F 1MRNA 2GK6A 2P67A 1GTVA 1KMHB 2NG1A 3SJAA 3EPJA 3HU2A 2GCOB 1N6KA 5HPYB 2GBLC 5H70A 3UG7A 1G20E 5G41A 3WMGA 3B85A 3OHMA 4BFVA 2RGNA 1UBEA 3ASZA 3O8DA 4K46A 3A1TA 4HB0A 2ECKA 3KB2A 3W5IA 3GEIA 1JR3E 2D06A 1A82A 2ZSFA 4LK2A 2GXUA 4LJ5A 2ZU6A 4PC6A 1K8RA 5CIQA 2LWIA 2AHOA 4Q1DA 1F6BA 2G83A 2ZSAA 3FDIA 3L0OA 4NU0A 5DSZA 3MAAC 1Z47A 4HSEA 2IF0A 3IEVA 1E0SA 4GMDA 4U7DA 1YZUA 3THXB 3IHWA 3VU9A 1W44A 1P60A 3TAHA 4QC2A 4EUNA 3C41J 4OI0A 2A30A 4R71A 3T5GA 4Q1EA 3GEEA 1R5NA 1IJFA 3DM9B 4PXAA 2QQEA 3D8BA 3W90A 2H16A 1OH7A 2AD1A 1WBBA 5EE0A 4DCSA 2IYTA 4P33A 1G64A 1H65A 1C4OA 2VEDA 3LW8A 3NH6A 4XWAA 3P32A 4NE2A 2BVNA 4PQFA 2YWGA 4A4DA 4DSTA 3EIHA 2ZU0C 4NMMA 5LDDC 4HLCA 1P62B 3KX2A 4KFUA 4BASA 2ZYVX 4KSCA 4YLGA 1K6MA 4OI1A 1COWA 1RVDA 4BLOA 1G3UA 3QF7A 1Z3IX 2O0JA 2J45A 2MSEB 2BBWA 3WYAA 2K5UA 2FPLA 4GMXA 4BLPA 3LV8A 4O2RA 2ZR7A 3HU1A 4M1KA 2P6RA 4OYHA 5J4KA 3G5UA 2GXSA 2ZUDA 3THWB 4CF7A 4ACAA 1LVGA 1SKYE 5LB4A 3C14C 3MJHA 1KI3A 4Q4HB 1QHNA 3SYKA 3R9WA 1KI1A 1Z08A 1EFCA 3QQ5A 4TLDA 1JB1A 3UMSA 1XMJA 2NGRA 4MDFA 4L9SA 4B2LA 3U44A 3VR1A 2HDNB 1CP2A 3WP1B 1NLYA 1R7RA 4RD4A 3TUJC 5JWHA 4D4JA 4JSYA 1U0LA 2CVFA 1XTRA 4LYHA 4I4LA 5DHAA 1Q1EA 5DI9A 4O2LA 4DIDA 3KFXA 2AK3A 3LDAA 2B92A 5FOTA 3LBNA 1P2TA 2WTUA 2BMEA 3TSZA 5HCIA 4P4SB 4KLZA 2NO7A 2HT1A 4LJ4A 4Q1AA 2C9CA 3X2SA 5KHOC 4HB2A 2LKDA 4GZMA 1G6OA 5JLJA 4YMTA 1RW4A 5E7MA 1EWRA 3DM5A 4KI0A 3IGFA 3P26A 5FOUA 2H92A 1R0YA 3UKDA 4JKIA 3AP2A 3MD0A 2WKQA 4KAXA 3BIFA 2J3EA 3GFTA 1TMKA 2RGGA 1Z83A 3JVVA 2H18A 1KSGA 1NKTA 3FGNA 3H2YA 4ZCMA 3M1IA 4B34A 3K9HA 5EUMA 2CMKA 4AKIA 5K8TA 4S2EA 2IWRA 3VAAA 5K8IA 2W2VA 1OB5A 3AKCA 4US1R 3M4YA 3PEVA 3VR4A 4BLTA 2JDIA 4DWJA 5KSOA 2P0EA 5J4YA 2PX3A 4KXFB 1NG1A 4AKEA 1E4VA 4JJKA 5FUWA 3U6KA 1BMFD 1XEXA 1A2BA 3NBZC 3KQKA 3IIKA 4B74A 1KK0A 2JJ1A 2RGDA 3QKSA 5KDDA 1UM8A 5FBVB 2JLXA 1IONA 4MQBA 2OCYC 4MH0R 2DYKA 2R65A 2J41A 2G1KA 3SE0A 2QGNA 3BB3A 4B2PA 5EXSA 2GHIA 4Q21A 5DLQC 1G8HA 2ZSDA 3H84A 4KFTA 5ELXA 1XEWX 4JYBA 4OK3A 1NVWQ 4MRPA 3GEHA 1E79A 2O8BA 2QENA 3SU8A 3B7GA 4WOPA 6Q21A 4NCHA 2Q6TA 1RJ9B 4C0AC 1E69A 4URZR 3EA0A 1LNZA 2J0QA 2W58A 4BFZA 2QUZA 5KSYA 4ZIRA 4PAMA 1IN7A 3FKSA 2F3TA 2WPDD 1XXHB 2ZVPX 4JLAA 5EP4A 3QXSA 2HJGA 3SEAA 2AXNA 2BJVA 1QHHA 3QG5A 4FD2A 4BEBA 1UKEA 2ZI5A 3DHWC 2RGXA 2QAGB 1YRAA 2F3RA 3U3JA 1LS6A 1YJ5A 2EYQA 2OM2A 3D6TB 5FFMA 5L3SB 3IKJA 1SVIA 1NF3A 1KI7A 3CRVA 1VCOA 1KGDA 3DO6A 5HKKA 2ZUBA 3HDTA 4KODA 4TTRA 3TR5A 1JEDA 1N0UA 2CE7A 4TL7A 2RHDA 2W6ID 3FHCB 4IEEA 1IQPA 4PO8A 3ZVRA 4AG5A 1L2TA 4IXMA 1TQDA 4DT1A 2QMUA 2QQ0A 2Z43A 3X1DA 2PMDA 2J7PD 2J1LA 3OZXA 2D62A 4K8OA 1DOAA 3UIEA 1XU4A 3QJYA 3C8UA 3WHKA 3CRQA 1IY1A 5LD2B 4FMCB 4LJAA 4D80A 1KMHA 3R7WB 3BXZA 3DPUA 2ZI4A 3NXSA 5AJYA 2CVHA 1XP8A 1G18A 1KDTA 2O8FB 3FTQA 1CEEA 2ZRJA 4Q00A 4F91B 3KQNA 4G0NA 3HP1A 2IHYA 1UEJA 2HYIC 1MH1A 1YU9A 2FFBA 4C2TA 4FWTA 5KDLA 3U3KA 2J0SA 3TK1A 4AC9A 4Q1BA 1LW7A 1QHSA 2Z4SA 1NI3A 1OKKA 4E03A 4EPVA 2BC9A 1U0HC 4A0RA 5GVRA 1JJVA 2O0KA 2PT5A 3A58B 4V0OA 2JATA 3NDBB 4L4UA 3QVVA 2GRJA 4HB3A 5KSZA 3THXA 1Q3HA 2WKRA 4A6PA 3WY9A 4A2QA 4Q4JA 2FDCA 4CEHB 1GKIA 3K70C 4C9BA 4GOXA 1XMIA 1ZUIA 1P72A 3T1QA 2F43A 1ZM3A 4L8GA 1MABB 2VHUA 4EJSC 1E2FA 1OYYA 2YHSA 1DG1G 2A5FA 4Q02A 1S9HA 4NP6A 2GK7A 3QY0A 1U9IA 4D82A 1J2JA 4ACBA 4X8LA 4LGMA 1GNRA 1JQJC 3QKRA 3KTAA 1AKEA 2NPFA 5JSZB 3THYB 1R2QA 3CX6A 4LSGA 3KKOA 3V4RA 4OL0A 1M8PA 3WRYC 4P32A 2I1VB 2FE4A 2WJIA 4A9AA 3ADBA 3KKPA 4MRVA 1KKMA 2WWHA 2FSGA 5L3QA 4DCUA 5KTYA 1MRSA 2ZI7A 1O87A 1OHHD 2ZM5A 3HR7A 3WXMA 2FFAA 2FGKA 1I2DA 1UFQA 1G21E 2DCUA 3BFXA 1G3MA 4JMPA 4YDSA 5J4HA 2IS2A 2DWPA 4F4CA 4ZI2A 1BKDR 2BCJQ 1UBFA 4M9ZA 4BGDA 1RPZA 3BB1A 2IHBA 1T5LA 4PSKA 4KBGA 1IXRC 4Q9IA 4B2IA 2F55A 4GFDA 8OHMA 2J46A 1F48A 3LNCA 4HDCA 4OK5A 4Z8YA 2QTFA 4EPYA 5JHHB 1XEWY 3LH5A 4TMZA 1XPUA 2V7QA 1PZNA 221PA 2XJ9A 3RS3A 3EZ9A 2YJTD 3EIEA 1GILA 2NO0A 1W2GA 2OILA 2RGBA 1RRPA 5BN5A 2GAOA 5FPHA 2VSXA 1XRJA 1N6HA 2ZJZA 2FA9A 1ZC4A 4XOIA 1DO2A 5KSPA 2V9PA 4HI0E 4X8MA 1Z6TA 4M9XA 1GWNA 1NBMD 5TXGA 3LVRE 1CR1A 3B5JA 4PAQA 4KU4A 3RLFA 2C2HA 2ZR0A 2VRWA 2R44A 1X8LA 4GP6A 2IK8A 3CH4B 4Q7JB 1OXUA 2BMDA 3NVAA 3DZ8A 3VHXA 2ODEA 3GP8A 2QE7D 2YOGA 5CM9C 3PEYA 4AI6A 1EFUA 2GJSA 4RCZA 2FPMA 4MRSA 2GXQA 1T91A 2OG2A 1JR3D 4JSTA 4PHGA 4TN1A 4ZKEA 2R6GA 3ND8A 4XH9B 4QNMA 2JLWA 1KMQA 4DLUA 4PO9A 1YZLA 2Q9BA 1DTSA 3CRRA 5EP3A 2EWVA 2HV8A 4N1AA 5DO9A 5TDHA 1S3GA 3KB1A 2FOLA 4CRWB 3MRSA 2GCPA 3VMFA 1S96A 1E9EA 4CGZA 1NLFA 3L0SA 1E1QD 2WJYA 4PC1A 2HCBA 1OIWA 3AVTA 4TZ6A 3GLHA 4LYAA 3OFND 2V1UA 3K0EA 2IWHA 4DBLC 4WW0A 4QBIA 4CDGA 2FSFA 4A2PA 1HV8A 1CS4C 1W1WA 2EFEB 3B13B 4HLUA 4JS0A 1G4AE 1NLZA 3KDSE 1ZP6A 4XWKA 1FTNA 5IK2D 1SXJE 4KFSA 1UBCA 4LV5B 3BH6A 1CLUA 2ZE5A 4A0FA 5GADl 4PAOA 4NCJA 3X1ZA 2ZJYA 1AIPA 4MA4A 1TU4A 4S35A 1N6NA 1CR2A 1N6LA 1E2DA 2ZTSA 3EIQA 3VNVA 2JEOA 3RS0A 1C9KA 1WRBA 4KSBA 1SGWA 2Q3FA 5LPNA 1DARA 1EESA 1UF9A 1Z06A 2PZGA 3BJIC 1QG4A 4AKHA 1D9ZA 4F7WA 5TB5A 2CBZA 1GM5A 3ASYA 5DE3A 3RYTC 2H1LA 1GP2A 4JLBA 1D2MA 3ICEA 1NJGA 3T06B 2ORIA 5M04A 3K0FA 5FR1A 4JLVA 4TT3A 4A8JB 1II8B 1GL9B 4QJ3A 5HZKA 4HZUB 2G3YA 4D81A 3T12A 1DBSA 1Q1ZA 1CTQA 1GUAA 4GZLA 1FUKA 1FTSA 2CJWA 1OFTA 3SNHA 2ZAOA 1ANKA 3FVQA 4RSGA 1F2TA 2FG5A 2KBFA 1E1RA 4UNQA 3GJ7A 4XSGA 4BECA 2NOAA 1E2PA 1FX0A 2KBEA 1S4QA 2JIZD 2W6JD 2XOKD 4ARZA 4DZZA 5JRJA 2R62A 2WMNB 4BZPA 3HJNA 4F93B 1W2HA 1EX6A 2QY9A 4PHHA 1IN4A 4M22A 3IHLA 1GNPA 3B2EA 1LF5A 1JAHA 3Q72A 3U2QA 5G53C 1NJFA 2ASEA 4LY6A 1N25A 1KDOA 4ZI3A 4MYUA 2FSIA 2O8CB 4AY2A 5B64A 2V6JA 4M1YA 4D6PA 1NN3A 2BM1A 1J70A 2GETA 4CT4B 5JJKA 5DI3A 2GZHA 5EXPA 1OH6A 2F1IA 4X8OA 2XB2A 4XTCS 1G16A 1P2VA 3NHBA 2ZRNA 1ZIPA 4B44A 3T1TA 1IXZA 2O8EA 3EWAA 3RC3A 2XTMA 3N70A 4LX0A 2QNRA 4GT1A 3OIYA 1G41A 2DR3A 1QHXA 4M8NE 4M1TA 4B71A 3SS8A 1CU1A 3QXCA 3W8RA 2QBYA 2ZRDA 3SJCA 2CLSA 3JZAA 3GLIE 3LBIA 2ORWA 1G3RA 3GLGA 3RS5A 3R20A 2W0SA 3K0CC 1J7KA 3K70D 1AA9A 3M6AA 2G88A 3AVXA 4HZIA 1NVXQ 2GVDC 3B9QA 4UNNA 3KQUA 2WHXA 1ZUHA 3K1JA 4US0R 2QT1A 1E2IA 4D4LA 3RAPR 4Q7LA 1MO5A 3Q7QA 5IF9A 1QHYA 5GJVC 1XPRA 3DL0A 2H5EA 4W9MC 1X6VA 2IS4A 4CEIB 4DSUA 4LHVA 1SKYB 4GRAA 3NC1C 4V0KA 2D3WA 4XVQA 4YONB 3RRMA 1MV5A 2OFOA 3KKNA 1JAIA 4GDFA 1E9BA 4LC1A 1RIFA 5J5CA 1IN6A 1MO3A 721PA 2WPDA 2Z0MA 3OEHD 2EFHB 4OI2A 4QHYA 3SHFA 2QAGC 1AQYA 4WZBE 5G40A 1ONBA 2R8RA 1G3QA 2OCBA 2BBSA 4V02A 3VFDA 3C4JA 2FSHA 2VO1A 2FV8A 3W6PA 3IO3A 4HAXA 3ZIAD 4A1FA 5FPKA 1NNEA 3CWQA 3VKWA 2A9KA 3IILA 4OQLA 2ZYUX 1OF1A 1KNXA 2ZJOA 3W6OA 4B73A 1NKSA 4GBMA 2QPTA 5JWOA 4AK9A 2GBLA 4QL3A 4I1VA 2GAAA 1KTVA 5LBIA 3IPXA 1T8TA 3WNCA 3AQ4A 2PMKA 4CVNA 1RFLA 2RH5A 5DYGA 1FZQA 1DPFA 2IW3A 4V0ME 2PJZA 5LD2C 3V4FA 1WXQA 2ZAMA 3M0EA 2WWYA 3RS4A 2WSSD 4YMUA 2NMVA 3EZ7A 2G6BA 1N0WA 5JECA 1BH2A 1U99A 4V0LA 1N5LA 3K0AB 1W47A 4QG7A 4GI7A 2HJVA 1JR6A 3UATA 2I3BA 4Z54A 4PSAA 3QBVA 4WIAA 5AJVB 2P2LA 4PQYA 4LJ9A 1Y63A 1P73A 3KJIA 5LB2A 4DLTA 4F92B 2XXAA 1ZIOA 1Z0KA 3C7KA 4DIEA 4DUGD 4QRHA 3Q8XB 3AVWA 3DDCA 4WXRA 3AF3A 1FW6A 1G17A 4ZDKA 1W49A 1KO5A 5KU1A 4L9WA 2QRNA 3S1AA 5C2JB 1N6IA 5KDOA 3WYFA 2BEKA 2C9OA 1H8HA 1N3BA 2X2FA 1XFAA 1R6BX 5FL3A 1KAOA 2KE5A 4RZXA 2IEZA 1GKUB 1DAMA 2FEMA 1B0UA 1HQCA 1AK2A 5KUTA 2QMOA 4IHQA 1X1SA 5IT5A 4D26A 1UEIA 4PC7A 1XNJA 1OFHA 2V1XA 4LJ7A 3NH9A 2CNWD 2WV9A 1O3YA 4G3XA 2IS1A 3K9GA 2FEOA 1E96A 1CKEA 2CCGA 5FOWA 1US8A 5EE3A 2AKYA 1YZKA 3CR7A 2ZSBA 4IJMA 4JLMA 2QPOA 3Q5DA 1E32A 4JBYA 4G5OA 1DAGA 1CR4A 1JI0A 1P9WA 3B78A 1LV7A 4NKRA 3MMPA 2W2XA 2IEYA 3Q85A 1H8EA 2JJ2A 2IUUA 1DADA 4LYFA 4M1OA 1S3SA 3B60A 1T8UA 4OK6A 3OEED 4Q1FA 4C0KA 5P21A 2TMKA 3W8NA 1F2UB 4M9SA 3AF1A 1G3IA 1VDZA 2CK3D 2IYRA 3K09C 1TTTA 1KSFX 3U7GA 5H1YA 3RSOA 3RWOA 4LPSA 2ZI9A 3SDZA 4IRUB 1P75A 5DN6A 2CLCX 1YZTA 1G7RA 2PH1A 4NCNA 2YKGA 4OHYA 1UKVY 3AF4A 2VP6A 1D8TA 3OF5A 3UMFA 1DAIA 1KO7A 4XD7D 4IOKA 4MKHA 4QXAA 3EWSA 4IDPA 4TLBA 5FTNA 3A1SA 2VBCA 3CM0A 3OE7D 2WM9B 3RS2A 3LA6A 4Z51A 4W7SA 2OE2A 4DRZA 3QF4A 3PUXA 3I1FA 2WSMA 2ZRAA 3AEZA 4LJYA 3F5FA 4FMDB 2IUTA 3OAAA 4CYMA 2Q9AA 2GNOA 2ZR9A 4QGFA 2YOFA 4YXWD 5CDFA 3L0IB 3MWYW 3E70C 5J4VA 1K5DA 2BM0A 1G8YA 3PENA 1SVWA 1X86B 5CK4A 4URYR 3BOSA 3I62A 1RZ3A 2CLDX 3QPUA 3I4LA 2GEUA 4TL9A 2WJHA 3B8HA 1ZCBA 4PZYA 1CF4A 3NEJA 2DB3A 5EXTA 2ZI3A 2I4IA 4HUQB 1MO6A 1JECA 2B8TA 5C4GB 2ZE8A 4OQXA 1DAEA 4YMSA 3U7EB 2GJ9A 1N6OA 1KO8A 2JLQA 1OXXK 5L8VA 4M1WA 3AF0A 1A1VA 1AZTA 4RFSB 5KOYA 1M7BA 3ZJYA 4TSFD 4M2LA 1E2HA 1ZYUA 2HXSA 4OHXA 5HR5A 1FMLA 4Q4AB 1AGRA 2R6CA 4MRNA 4RFVA 1VYTA 3OFNA 3B1ZA 3PV0A 2RKOA 3AUXA 2FF7A 2VA8A 2ZRLA 3VKGA 3RRZA 3VR2A 2PEZA 4BRUA 3DOEA 1R5OA 4URXR 4TQ9A 2RB4A 1R5BA 1Z28A 5F9HA 1FMJA 3E5HA 1N5KA 4URWR 3VTKA 2VL7A 1P61B 3U4QB 3OESA 2QRZA 1FQKA 4HLQB 3BORA 4EQ6A 4BFSA 1YZGA 3KZ1E 3E2IA 3CW2A 4IOMA 1TADA 4OJKA 3VR3A 4Y0AA 3CF0A 4WZAE 5DNYB 4B43A 4LI0A 5H8WA 4CEJA 1J99A 5KNBA 1YZNA 4M9QA 4TMVA 3KKQA 2WWFA 2H8KA 2F1JA 1QVAA 4ZO4A 1XPOA 2FH5B 1ZM7A 2DFKB 5JEEA 1BOFA 4EFLA 4Q4LA 4A36A 2G0TA 4C7OB 4A8JC 3TW8B 4I1UA 1ZNYA 4P3YA 1SXJD 1E2LA 2CHVA 2CCJA 4DLVA 4TYYA 1YKSA 2J0VA 2ZJ2A 1QG2A 5TY0A 1GRRA 1RYHA 2C77A 2J0UA 2BHRA 2QSZA 2ZRIA 1YRBA 2IC5A 4G5SA 4NL4H 4MGIR 2UVQA 4A2WA 2IA5A 2W83A 3BFKA 3NBYC 2J5XA 4U5XA 2XNSA 4ZPXA 3NC0C 1ZCAA 2JIZA 5CLQA
chains in the Genus database with same CATH superfamily
4JYPA 1YR2A 1RZRA 2ZI6A 5DW0A 1LSOA 2OVFA 2V45A 4POAA 3PWZA 2JGDB 3A9UA 3IAXA 2O8VA 1OI2A 3INNA 3EMBA 3HPQA 3OJCA 4GQIA 4TMTA 4F3NA 1CQIA 1Y4AE 5JAHA 4EA9A 4AY5A 3F4LA 2QQ5A 4Q0MA 4E88A 4F3KA 2FSUA 3N2EA 2WFLB 3Q9UA 4JVNA 2KM1A 1QRUA 3P0FA 2GEDA 2HK8A 3O75A 4LBVA 1ZGAA 2JGJA 2ZSEA 3DEFA 4G1CA 1XQVA 3B5IA 3I4CA 1ODKA 4D8WA 1KTIA 4R2HA 1MZPA 1P2GA 2BEJA 2C5HA 4UZSA 1UMBB 2P65A 4DE5A 1M34B 2WJ6A 2VUHB 2B30A 2HQOA 3FYUA 5FDFA 3IKMB 4YIHA 5FULA 2CDBA 4DDWA 5JBNA 1RAHA 2YRFA 1FP7A 3GRRA 1VSTA 3PGKA 4X93A 1NE7A 1XB2A 5DZSA 4FGZA 1EP3B 3FFBA 2IOHA 3CUWA 1PT9A 1X7XA 5D1NA 5ITZA 2HRCA 1U7PA 3WA6A 1JZQA 4QT4A 4UNIA 2DUJA 2OCXA 3ZV4A 4IP0A 1KMCA 1XK6A 3DPIA 2X0EA 2D7DA 1N32B 5A0TA 1GG5A 2JFOA 1C4KA 2WAXA 5GZ3A 3B9BA 5CHEA 1NN0A 3RWBA 1VHDA 3ZC3A 1X3SA 2F1RA 1ZN2A 1CY6A 4DLRA 1GPJA 4BC0A 1A2QA 4YMLA 2A0UA 2I3DA 1NVAA 2I6QA 2Y4NA 2PTGA 3EIFA 3VR5A 2EJCA 4AW9A 4ESEA 2MMCA 3L0PA 3SLRA 3ZKWB 2QZPA 2BDTA 4BX8A 4F2HA 4E2WA 1DEAA 2GDZA 4BZXA 4S12A 1WUYA 1KHTA 1K7CA 1WDLA 1FOEB 2FMHA 2JLBA 2QR5A 4KRFA 3HL0A 4B6QA 4WKGA 4EA8A 1WMAA 1TQHA 2C7VA 4ANFA 2Z5VA 2IQ5A 3M3PA 1ULSA 4CTJA 2NSJA 1BWPA 2F9LA 3MWLA 4L2IB 2C31A 4DR7B 2IYLD 2RAFA 3HK2A 3H1FA 4ZD6A 2YW9A 1C9MA 3D8TA 1XZBA 4TYPA 5LNK6 4BMPB 1CJMA 5KMGA 1RC0A 2J67A 5AVUA 3UJ3X 2BFEA 4EI2A 1KBQA 3U17A 1P5RA 4FR2A 3PLNA 3N74A 4OIMA 1BOOA 4HLNA 4JBIA 1FDVA 2HSJA 2VZLA 3KJFA 3C1UA 3QK7A 2H63A 4NZ9A 5EHIA 5L95A 2FMXA 2G1AA 2IPNA 3AHGA 3F5MA 3LDHA 4UPDA 2CL5A 3P2IA 4X9XA 4MQEA 3SN6A 5TVKA 2NUPA 5FOVA 2B37A 3L8ZA 2RHHA 5JI2E 1GGEA 1G0OA 1P19A 3FYCA 1G8FA 5EMNA 4DABA 2EGUA 3TRIA 2VWQA 1FQJA 1D2HA 4PCVA 3IHTA 1P6UA 1WPRA 2Q4EA 3O21A 2QXUA 4KXXA 4X7PA 1Z88A 5JQGA 3W5AA 5PGMA 2NO9A 5FORA 2UXCB 1ONOA 2YX1A 2IIVA 1PFGA 4ENRA 1IULA 4HNQA 2IX9A 5DXFA 2WAYA 1ODCA 3HKBA 4KCGA 5CJPA 4AD8A 4B82A 1FP4A 5KQRA 3MCVA 1Z2CA 1JPJA 1I4OA 1QTNA 2NZXA 2JKVA 5GJWC 1BCSB 3OI7A 1Z37A 2IP4A 4L5BA 2Y66A 3EVCA 4DA6A 1NONA 1NGSA 3OIWA 3JY6A 4XVHA 1ZX1A 4PLYA 2IZZA 3JTMA 4BVEA 4ENTA 1P7CA 2ZROA 3IBGA 1E59A 3EXIB 2MSCB 5D00A 1CY7A 2CXNA 2HZBA 2O4UX 1JPVA 3EEFA 1VZ2A 1ETHA 3WQBA 5NULA 1G5RA 5KYXA 2CF5A 1TFRA 1PL0A 2GB4A 2GYUA 4CG0A 1SZCA 4OTZA 1VYUA 2YVLA 5KOJB 1ZL2A 2QU8A 2I6UA 2O2CA 2F1HA 3I1YA 2OXTA 3E3MA 3WL3A 4C78A 1CNEA 3O2SB 1M0SA 3AUUA 3L84A 2DPXA 4J0IA 3DTVA 1EFRD 2AV6A 3EXFB 3I0MA 4AECA 3KV1A 1NUAA 5A3VA 4E08A 4CEIA 1VCNA 2GKOA 2ZRFA 3GP5A 4TUYF 2HWUA 3Q40A 1DAPA 2H2FA 4XWWA 4ABTA 1XZQA 2DPHA 3KUXA 1Z5NA 4JT9A 2OLKA 2FLWA 3I9V6 3PGXA 4BFYA 4PLCA 3CO5A 1S8OA 2DF8A 2V7EA 1J42A 3EIWA 4E4RA 1V11B 3T1OA 2V5VA 5KJFA 3INTA 1IAQA 3G1UA 4P7BA 3UEOA 2FW0A 4E22A 5FEUA 4QEDA 1GOTA 3ESZA 4J0QA 1ECPA 3Q7EA 4MW9A 1VPVA 4RJLA 2A0YA 1QCDA 1SHZA 3WISA 1KVUA 3JQEA 2XZLA 4N8EA 3TBKA 3UN1A 1E9DA 1UT5A 5BY2A 1KI6B 2GCEA 2ZWVA 2YHAA 3WL6A 3ZNQA 2PJDA 3HYCA 3GT7A 5LSAA 4YYEA 3A9WA 5B4VA 4LW8A 5GJCA 4B17A 4OP3A 3UUEA 4MEJA 2LNDA 1UMDA 1GKYA 1DQPA 4FGLA 3WLOA 4F60A 4FLMA 1AQNA 2XUHA 4J2HA 2VJPA 4JI0B 2DHRA 1WBDA 2ZRPA 4KP7A 4EHHA 3H3XA 2ENWA 5GAJA 2WTAA 1FRQA 3OFSA 3NONA 1O03A 2JHFA 1K97A 1MO4A 2JLAA 2LPMA 3C6XA 4PR0A 1P0MA 1PR5A 3Q0TA 4I55A 5ALDA 5TPWA 3ROZA 2FPXA 3AHDA 4AIIA 1W4ZA 3DR3A 2LD4A 4IR7A 5CLHA 3L7CA 1G1AA 4G5QA 1TCBA 3C6MA 4NEGA 2FPIB 3BICA 4UREA 3E7WA 1POXA 1TD9A 1ID8A 3BGSA 1OASA 2XGGA 1M6NA 1ZXXA 3NIBA 4QUJA 2PJUA 1MQAA 1OA1A 3NNDA 3OO0A 4ZP1A 5IARA 2JRCA 1Q0LA 5ITVA 4LMAA 2J3IA 3B6EA 5AM1A 1WMBA 1QF9A 1CFJA 2CLKB 4KYIB 3NEAA 1P0IA 121PA 4WLVA 3SIRA 1NW4A 4N8DA 4AMUA 2VXOA 1COWD 1I4LD 4D9KA 4R9NA 2GARA 4MVJA 3TD9A 4B6PA 1O94C 4BU1A 1UP6A 3R3WA 4YRIA 2X7XA 4JUCA 1QIJA 4UEOA 2BKUA 1XO1A 1BSVA 3SC6A 4EG8A 2DOKA 3MT8A 2V7VA 1EQUA 5I8PA 3CPEA 5ALSA 2Q5CA 1Z2AA 3VR6A 1N2SA 1NHWA 1UIMA 2I8LA 1D2RA 2CMGA 2MYPA 1DX9A 2PBLA 3DLCA 3JQBA 1JXOA 4NPAA 4P35A 3GLVA 3OU2A 3ZZTA 4A0GA 5AUPB 2B1JA 1NJ8A 3I3SR 4PC3A 1E2MA 2FZCA 1C0EA 3WL4A 3SE7A 3F78A 5JR3A 1E62A 2VXYA 3QSGA 3DL2A 3O47A 3NAMA 1SXQA 5F64A 2Q7XA 1J49A 3H4MA 5T4FA 4G63A 4N0EA 1UBGA 2JL1A 3B38A 3IAM1 4P92A 4X20A 4DMUB 1P29A 1E0JA 5GOZA 1P1KA 2Y05A 1VPLA 5LMCA 2NV0A 3UHFA 2N42A 3OJLA 1EVIA 1OAOA 1U81A 3K0CA 4MUYA 4D8YA 4R2MA 1NY6A 5TIIA 1RQRA 5THKA 3QSYA 2Z3VA 4RS4A 5TMDA 2XX3A 2YWHA 3GUZA 3T35A 2NSLA 4MB2A 4L8YA 2AZDA 2ABWA 4FKBA 3ZN2A 3MPOA 2QM3A 4XQ0A 3VU9B 4IEIA 4CCAA 2JGRA 1NJ1A 4M76B 1PK7A 1X7YB 4R1PA 4D25A 2EDAA 2J7KA 1WF3A 1LBHA 1JDPA 1SK8A 2GKSA 4FYYA 4YA6A 3RU9A 4C5BA 1XKTA 5DGTA 3I6ZA 1NVTA 1YK0A 1ZN8A 3QU5A 2AEFA 2OP0A 4IVPA 3KZOA 4OF4A 2EFDB 4D79A 3MLEA 3ZPXA 4FLEA 3RUHA 3LQQA 2C9DA 4NVRA 5JAUA 4ZTUB 3QX9A 4WXEA 2QK4A 3L4BA 4NE7A 4TSRA 4LISA 3SEZA 4B09A 2Q46A 2H3EA 3AEQA 1VL1A 3AWIA 4GGOA 3RHFA 3PNKA 4A91A 4I6EA 1FYXA 1BGXT 1Z7GA 1WCWA 3IXLA 4M4SA 3L4EA 4M0LA 3AETB 2FW9A 4M9RA 3HJTA 4Y2QA 4UHCA 3B9PA 4FE7A 2OBXA 4ARAA 1O9GA 4ZXPA 2WTEA 4C3VA 1E2UA 2VNAA 4D4MA 521PA 3KOYA 2KLBA 4TVOA 1G5TA 1KOFA 1E4YA 4TROA 3UA4A 2AWOA 2YZGA 3F96A 2QTHA 2WUGA 4ES6A 2IXDA 1EZZA 4J1SA 5E8RA 5KKCA 4RTMA 1Z07A 2QPLA 1DJOA 5EOVA 1GFIA 1C7IA 3C97A 3JASA 1QRRA 4GVPA 2BMVA 2PKWA 4IDHA 1JSCA 5F3RA 3VUEA 3WAJA 4JD5A 5AKHA 1M2KA 3QBDA 1QH9A 1JNYA 4CDMA 3Q41A 3T7KA 2CUZA 3MYYA 3PYXA 4GMGA 1W0KD 3I28A 2C98A 2QGZA 1P74A 5CVVA 1HLPA 1DS6A 3EJWA 5HNKA 1R64A 4RA6A 5ALOA 3DBOB 4PLGA 1C9YA 3GMIA 1DT5A 3NP9A 3ZDQA 1CHNA 4F5YA 3P2YA 2ZKIA 4CGYA 1G2OA 2UYCA 4KWEA 2X0FA 4J8PA 4BKMA 2FMTA 1BKSB 1OIXA 3HBLA 2QYTA 1H05A 4GL4A 1G19A 3G9UA 5E6SA 3SBOA 4ZZ1A 3EC2A 1A72A 1UKYA 4MGEA 4PFKA 4FW9A 3R0XA 3THOA 1PR0A 2H1FA 2WVAA 1JHUA 3L04A 4C0HA 5CXUA 2DY1A 2PM8A 4CF5A 1E1LA 1HXHA 1LH0A 2EEPA 2AFHE 5U4QA 4YP0A 5DGCA 3DAFA 1ZUWA 2VNSA 3FKSD 1RQNA 1CIPA 1Z5VA 2ZJ7A 1P4SA 3EFHA 5EZ5A 4JODA 1ES9A 2XZPA 5DWDA 4C4SA 2BMFA 3HXQA 1AKQA 1C8BA 3KD3A 5KVCA 2MWMA 4BVAA 5ENVA 2CLOB 1RXUA 3LQYA 3VH3A 3BL6A 1WMEA 4WKNA 3ZDBA 2OQ2A 1YB5A 1OFGA 1CJTC 2ISQA 5HBGA 1QJ4A 3SJ7A 3E48A 3KBBA 4UHDA 1D7OA 1TA4A 2A14A 2F64A 4PS1A 3FA2A 3NHWA 4BNTA 5K3FB 2AOTB 4EGSA 3GAFA 5JSZA 5FL7D 3U4GA 2ROQA 2W7TA 5E3HA 5JZSA 2OESA 2OG1A 4AKSA 1E6LA 1JWAB 4XWYA 4C06A 3MTJA 4C29A 5K3BA 2YZMA 1SMKA 2X1HA 1LWOA 1FA9A 1XCLA 1N2OA 4AP6A 4RGBA 5K6AA 3B3QA 3W77A 1MB0A 3LBHA 3GAMA 1D2CA 2C95A 3QPWA 5FADA 3TINA 5JEDA 1B23P 3CLUD 3TECE 2G28A 3O4GA 4O25A 3R5XA 3IEMA 1VL2A 1XEXB 1M0EA 4RV9A 2CEKA 1S8FA 3DT8A 3LW7A 4XVUA 2HZ7A 1JIQA 1H6CA 4TYQA 1IJKA 2VP5A 2SKEA 2YR0A 2ZJ6A 4LNAA 4N40A 5DXAA 3WJ2A 1AUPA 4C0JA 4AQ7A 3QKSB 4IIJB 2FZVA 2XCRB 5LQNA 4G67A 4LDJA 2AMVA 5B36A 2Y68A 4EPXA 2HWKA 5DCLA 2P8JA 4TVKA 2I2WA 1NV9A 4V3BA 1QXSA 1Z15A 1DX6A 3MK31 4LJ6A 4B0PA 3O90A 3D5EA 1AXEA 3QOYA 1O4VA 1N78A 4YRZA 2EGHA 3T4PA 2PFSA 3II6X 2XGSA 1SOVA 4F3CA 1J8FA 3K5WA 4Z49A 1N75A 3VDXA 2G6TA 3LC2O 1UJMA 5HCNA 3DMNA 5AW6A 3LGSA 5C34B 3X1XA 2RCNA 4QFBA 1SU7A 4RTJA 3G5TA 1BMQA 2JIOA 3GZNB 3CEAA 4X90A 1QRTA 3C7DB 1EB9A 2HT6A 3ILYA 4CF6A 5BVHB 2QW0X 4HX9A 4URHA 4FHDA 5HA5A 1J0XO 1A69A 2R6R1 3OT4A 4QDJA 1SXGA 1VIDA 4YT2A 1JHVA 2BFPA 4Z1OA 1M2GA 4BHTA 4BX9A 4RTOA 5BVGB 5A7GA 4NHOA 5L45A 1V8PA 3BH7A 2WWXA 3IPYA 3L8FA 1LB1B 4JEMA 3D4PA 4J91A 4I81A 3JQ8B 4L0CA 2R5NA 5LZ8A 1GAJA 1NNI1 2VPTA 4L1KA 4RGVA 1WDTA 3HKCA 4CUJA 5JSUA 2VK4A 3A7EA 3RQSA 2JCYA 2ZQZA 3JYPA 2XUGA 4NABA 4DXAA 2AZTA 5CFMA 4LS3A 1K2WA 2PZFA 1IOWA 1Q19A 3DFFA 3DWGA 4NJMA 1JE0A 1LSUA 3RJZA 3L02A 4V0MA 2C2GA 5C8YF 1ZJZA 5KO2A 4Z4CA 3ZHXA 4TV8A 3B70A 3H05A 1VMDA 3EZFA 4O8CA 2DFPA 4WXYB 1J8MF 4ZQIA 4DYVA 3NPAA 2FU5C 3LNTA 4KH1A 4MP6A 4QTTB 3TSWA 2QRUA 1M7HA 4IQ0A 4Q9KA 3E23A 3UV3A 4DT1B 1BS9A 3KQMA 3GVIA 2BHNA 4HEQA 1CR0A 5CW2A 4ZDWA 5K03A 4N5HX 4CXMA 1IRIA 1PWEA 3GEBA 4PLFA 3I05A 1ZHOA 1OHHA 4F3TA 5CJJA 4EG4A 1KC3A 2XUQA 1ESNA 5ADVA 2D0IA 1TPYA 5A06A 4GKKB 1XTQA 2IVFA 2VP0A 3B1VA 1JBQA 2E85A 2P9EA 2MYNA 4K05A 1Z0AA 4KIWA 4HDQB 3C6BA 3I45A 4L76A 3D7MA 4PFSA 3ZHBA 2A5YB 1PJBA 2QG4A 3AOEC 5DLPA 4Z1MA 3VNRA 4B4DA 4KHPB 1WHSA 2ZBDA 1PKXA 2V7QD 3OEYA 4B32A 4QODA 1OIVA 4EF4A 2XTZA 4X8HA 1MHTA 3GYBA 1X39A 2GILA 2FMIA 2R5FA 3DOIA 2C9MA 3UHAA 3HYNA 3EDYA 4P1ZA 5HXAA 5JCOA 1UWVA 3R77A 2JFXA 2GF9A 3WKBA 1CULC 4CQMA 5ER6A 4DY6A 1F60A 4AWAA 4W6ZA 1ULBA 2C5FA 5EZQA 2PUGA 3GFPA 3ORYA 5IXSA 1PLKA 2ONYA 1R6VA 1IXSB 4YMWA 5K4GA 3UXMA 1JHAA 1R4NA 3B6MA 3OZFA 2GPTA 2I33A 5AM4A 5HCUA 1OLXA 2HDHA 1KAQA 1EVZA 1USKA 2LIVA 4FU0A 3MJFA 4UDYX 5G1NA 1ZI6A 2PAFA 1PVOA 1SUBA 2OENG 1BYIA 4ZV9A 5KWEA 2B4RO 4Q4JB 1R8XA 1U6JA 3O3CA 4RF4A 1TEHA 2EFYA 3DBHA 1AT1A 4NONA 4XJVA 5IAKA 3WWPA 5BOSA 5BT8A 1H0SA 5YASA 4NARA 4NE9A 4RW0A 4E6PA 3LX5A 4XM1A 4ZV4A 2EX1A 5FTMA 1AB6A 1E7MA 4KNVA 1R15A 1W5FA 2G04A 4KBFA 5F1KA 4MYTA 4RVCA 4F3YA 4MNTA 2AMFA 4ZA2A 4NMXB 5E4YA 3SY8A 5L3VA 1O08A 4MS4B 4V0NA 1JR3A 2FAXA 1FFGA 3H3FA 3QKRB 4XA8A 5GY7A 1KR2A 1PBNA 3AL2A 1WP9A 4OKNA 3CNNA 5D3QA 5EKUA 1KQNA 4D8XA 5IDVA 4HDNA 3FYHA 4I4CA 3P0RA 1J25A 4K2AA 1IHYA 2VDLB 5B1SA 1VJGA 1WUIS 1IY8A 2PQ0A 2QLFA 2QN7A 3CPHA 1YZ3A 3EE6A 3FSJX 4B6JA 5IH7A 1XNRB 3P27A 2QL6A 1W6RA 3KB8A 4QJ4A 5B2ZA 2V3CC 1UJ2A 1A5SB 1H42A 3E9MA 1E5XA 3OURA 3AUYA 1YE8A 1E1QA 2JFVA 3H17A 1RMYA 4P81A 3O9MA 4P8RA 2VF2A 1T25A 3BH0A 4U7GA 5CLJA 2OK7A 1FP6A 3RF7A 2PMBA 4MW4A 3SVZA 2X9LA 4R2JA 1J2TA 2JFHA 4QEZA 1II9A 3CVOA 1TEZA 4BVKA 5A0FA 2V6IA 2O2SA 3QNUA 5CAEA 1KJ8A 1RBZA 2C29D 2QMEA 2ZRBA 5IK2A 3VO2A 4OBBA 1J90A 1Q50A 1SHTX 2QAJA 2WF5A 2IBMA 2XH8A 4K3VA 4MWTA 4RJKA 5EKSA 1U94A 5TEWA 5AW2A 5IYZF 1OX5A 5I9NA 1PJTA 1K75A 1JKFA 1KFBB 3OPXA 4GNRA 4ZGBA 4BVLA 4QYWA 3EFOB 1XG5A 2PX0A 3NAZA 2VDVE 4IH1A 2C7RA 2DPYA 2YVQA 3QE2A 4NK4A 4UAJA 5EHNA 4BNLA 4MKIA 4QGHA 4DRYA 4XJSA 4REQA 1BKYA 2FEPA 5FUYA 3PL1A 3ROGA 3PDIB 3PXEA 1VG8A 3Q88A 4JZYA 2J08A 2HNAA 3H7IA 4B0OA 1Z2PX 4CLOB 4M46A 3U6BA 3EFEA 3EGDB 5JD3A 3VKVA 3D3NA 1IDN1 2VHYA 3KPVA 3IR7A 5I7VA 2GXAA 1X9IA 4JDPA 4MMXB 3NBAA 4TT3D 5DASA 4PTLA 3F6BX 1L4BA 2JLVA 1Z7WA 1V1JA 1HOTA 1VA5A 5E9WA 3GVPA 5HKLA 1JKJA 1PGNA 3HY3A 3CF2A 3KPYA 3TFWA 1E2QA 6REQA 1MJHA 5IJZA 4B3TB 3JQGA 2ONKA 3BC1A 4OB8A 1XHLA 1HKUA 1TKBA 1Y89A 2O7QA 4JR2A 4U6NA 3L1VA 3DHNA 4A73A 1YQQA 4BCDA 1E1RD 1OJLA 1Y3FE 4WUVA 1B43A 1PW7A 1NOIA 4JYCA 2X2PA 1JJ7A 3VNSA 4Q66C 5DYWA 4EBBA 2OD7A 3EXG2 4QPZA 4KSYA 4Z3KA 1VJ0A 5FR2A 1AE1A 2BE9A 2GAFA 4LDPA 4YAJA 4OHZA 4D99A 4AY6A 5A3SA 5A9SB 2DY0A 3GRVA 3BSSA 5IPFA 4BB9A 1SOAA 1GYRA 2NT4A 1YU6A 1WPGA 3JQFA 1W4BA 2BGUA 4TZ0A 4NZNA 3T3PB 2ZUUA 4CN8A 3JRNA 3A36A 2CJPA 3ID6C 4MR8B 3G0OA 4RXMA 1ZJ5A 4LHYA 2R4UA 5INTA 3ONDA 2F8SA 1J0AA 3L8GA 2X3FA 2E3JA 5FUXA 2PSFA 3WKCA 2VNHA 2O8FA 1R4MA 1XJ0A 3BJEA 3G7NA 4MDYA 2PQMA 3IJEB 4C0BA 2R6DA 3OOWA 1Y4DE 1NQTA 3LLUA 3P2KA 4IIVA 2HY7A 5CIWA 4YJ3A 2N0SA 1OLSB 4JLJA 4S1PA 3VHLB 3AR9A 2C4KA 1LPSA 3MYRA 1F0NA 3TRJA 1WB9A 4XRGA 3GR6A 1ZK3A 1P1JA 3DW3X 4EJMA 5FWXB 3HXOA 1FMTA 3ESAA 2RBEA 2P91A 1KARA 4EG0A 2PRIA 3M5WA 4BLRA 1OBVA 1UDWA 2C1ZA 3HB4X 1CS0B 2BUAA 1PGPA 4GXTA 4OKIA 5SICE 4EZEA 3BZUA 3UC5A 1BVRA 5LIPA 2CDNA 2PWZA 4Z8XA 3VPDA 3BA1A 1QX3A 5T3UA 4PHFA 5C32A 1LWNA 4YAIA 2NZVG 3BWDD 2FN3A 2IOFK 5CG1A 4PGAA 4JJAA 1LX7A 2O7SA 3MFYA 4IUCS 4ZU1X 1W36D 1RMTA 4G0QA 3KUKA 4U6SA 2NO1A 3E0QA 4X1KB 2NP7A 2HN9A 1DELA 1UXIA 4QOSA 4ZQBA 5CR9A 5EUCA 4EVIA 3RVSA 2GNAA 2UUOA 5FPYA 4IGIA 4YH1A 3UV6A 1I0ZA 1K7XB 3W3ZB 4V1CA 1J2RA 3ZHCA 5C3UA 1Z3CA 1TZJA 1HOXA 3T5DA 2NZJA 4WBXC 1KYQA 2OXFA 2X4IA 4KB5A 2X86A 1Z73A 2VHCA 2D2FA 3KSDO 3VX3A 4ZZ3A 1A7JA 2H4ZA 4UNRA 1NSFA 5ADWA 1QZXA 2X77A 3DUFA 1ID1A 2O9JA 3N0RA 3VC3A 1U2PA 4IJQA 4A82A 2OAP1 4W63A 3FPKA 2KI5A 4RTLA 4Q3NA 5I7OA 1IHUA 5BPHA 1PJ3A 2A4KA 2NU8A 2E37A 3REGA 3QFFA 3PE3A 1LZKA 2IIBA 3DV9A 3MSXA 4UNPA 5EZSA 1DPGA 1JPUA 2QV0A 4Z9YA 1E9VA 4DDMA 4UTPA 1KU6A 4PE5B 1L7AA 2PIAA 3AW9A 5HILA 4BE9A 4CKWA 2VI5A 2CL7X 1JDZA 1JX6A 4AF8A 2C92A 4KVGA 4UHEA 4ZT3A 2CY0A 2IGBA 3L1HA 2O0HA 3CYFA 1MOPA 3WLEA 4D1YA 2EOAA 1C7ZA 2K2QB 3DQPA 1GZSA 3I9FA 4JHXA 4ETNA 2CBGA 1Q6YA 2GJ4A 2AL7A 2DQSA 3R7FA 4PVDA 1E98A 3QHQA 1ZD1A 4QYIA 2OCIA 1WMDA 3GH3A 3QUSA 3TUZC 3HWSA 1M1XB 5J2UB 1E61A 2JARA 4E1AA 5C7YA 2OXRA 3C1TA 3MAJA 3U7HB 2AG6A 2DH5A 1N4AA 4DR4B 1U4SA 2XKBA 1V6SA 1U0JA 4HYTA 2WZQA 3LT2A 2QL9A 4JBHA 5C1PA 4NCKA 2FPPB 2K7FA 4EKGA 1C2TA 1GTJ1 3L6UA 5F7ZA 3TLAA 2QBYB 2JG3A 3QTTA 3SYTA 5BYKA 1SVOA 2B7CA 5IZ4A 1K08A 3UT0A 1DQRA 4C6SA 2O52A 2OV2A 4Y1GA 2ET6A 4TYMA 3LPNA 3C2QA 4CMJA 2PA3A 1HFJA 1P1FA 1Z2OX 4KFCA 1W36B 4YEDA 2XYHA 3F3YA 2WYWA 2VC2B 5DGIA 4MUAA 3ZUPA 2V7PA 4FYWA 3ZWQA 2VT3A 3IH5A 1T3SA 2WYUA 1PJCA 3BDAA 4QU5A 3IKVA 2OVBA 1VI2A 4C07A 2Q3LA 4KLRA 1MFPA 2BJWA 2EGGA 4NFSA 5FFNA 2Q2NA 4CCSA 5B6PA 5K01A 5C18A 4EZIA 5E1MA 3Q7RA 2O1WA 2PGXA 4ZREA 4DEYA 3QX3A 3D8UA 1P44A 4EL0A 4C7KA 3A3PA 5KOIA 2O6HA 1WOMA 4FGWA 1FBTA 1HA3A 1H8HD 4FGKA 2IYQA 4MVJI 4PPFA 4EF6A 4OX9Y 4JXZA 2BMJA 3E6AA 5LVAA 3BT7A 1LK7A 1Z25A 2ZQYA 2IHKA 2CDAA 3AZQA 1BWRA 1GTSA 1T0HB 2A9QA 3PRHA 4HAUA 4D9JA 2OYSA 5FNVB 4BFWA 1TYEB 4H1VA 4HRYA 5HHTA 4MJ3A 4TVSA 5B7QA 4FT4A 4ECAA 2XAUA 4ER7A 5CFLA 5CNIA 1GQYA 1UMKA 1ORHA 2AG5A 2WIBA 1SJ9A 4INPA 2ZRMA 3OU7A 1U3WA 1CQWA 2EBWA 3ZNOA 5KTPA 1E2NA 1RJWA 2POCA 1YULA 2OFWA 3IT2A 5B30A 3IMCA 2OFXA 2AFHB 4GXNA 3GO4A 3VR4H 1IPFA 3TTTA 2V3VA 1EJ2A 2B83A 3K1ZA 4RENA 3IA2A 1Y4SA 4YQYA 1ZNZA 5JYBA 4RE5A 3A37A 3JD4A 2ECFA 1ULZA 2BN4A 4G1MB 4OU4A 1J6UA 1JMYA 1RQLA 1I2BA 3P0IA 3A6DA 3WZLA 1SZPA 3P2OA 4MYCA 4ZK6A 1VLJA 2ZRGA 3V2UA 2F48A 4QXRA 4AJEA 3Q87B 1Z38A 3KYCA 2O2IA 1PHPA 2XZDA 2HXYA 1X15A 3AMVA 3D9QX 3LK6A 3NQ41 4HN4B 4I2VA 5KYWB 3U4QA 2VP2A 1UODA 4RVHA 2ODTX 3NHYA 2P0YA 3EZNA 5L51A 4Q1CA 3ZDDA 1O95D 1IL0A 4PLTA 1T2FA 3TKLA 4DRXA 2AZMA 1FNBA 2BFOA 3ANSA 1JDBB 3HS3A 1KOJA 2XUKA 3LLMA 2PRYA 1U2GA 3P2MA 4MP3A 2CJFA 3BTOA 2JLZA 1EK2A 3L6EA 4M1SA 1U9JA 4QT0A 3CT4A 2X0JA 3N28A 5K45A 2IFTA 4CCYA 5H4GA 1BQ4A 3IURA 2Z09A 4Q9LA 3OQOA 1T3LA 1YR7A 2MSWA 2N46A 4B6EA 1Y4UA 4IQFA 1DRUA 1X8KA 3MXOA 3BEDA 3R9IA 3WB1A 4IXDA 3K0KA 3T3GA 3KBOA 1XTTA 4C7OA 2VWGA 3DCNA 1UFKA 1RI5A 2FGJA 4D3XA 3TW8A 4AL4A 1YNOA 3AB8A 3PXBA 1SBTA 2X5NA 3HRKA 3GGJA 4B3GA 5AJZA 1NN5A 2XUFA 3N2GA 4JBLA 4Q3LA 2JGAA 4CKBB 3PWTA 5AVOA 1T9BA 4QICA 1QH8A 1PDOA 1YOBA 3PUKA 1FZTA 4Q16A 1AQ6A 5E1DA 2GM3A 3ZE1B 1WR8A 1E4EB 2XGOA 4GMHA 3DONA 3FCOA 3O7MA 3ZZ1A 3VPXA 2EJVA 2VZ0A 4QBTA 1ST3A 1YI1A 1OXTA 4ZAWA 4Y0NA 1VKRA 4KTTE 4AUMA 1VPWA 1PFUA 1DXHA 1OCEA 1P2UA 1GYQA 2FWMX 3AV3A 3OZTA 1JGTA 3CX4A 2Z6AA 2OPHA 4JVLA 1US8B 1IHOA 1L5RA 2ZB7A 3EQ6A 2OGZA 3R24A 4RMIA 4WNAA 3TCKA 5KNCH 5IM4F 5BUSA 1FU4A 1YUMA 2ZR8A 3C3BA 3HKDA 4TSFA 3W0LB 3RG2A 4Q4CA 4BJ1A 1Q0SA 2ZS7A 3A28A 3LBAA 5FPQA 3EHDA 1NUSA 2FY8A 3QVUA 4OFWA 5GP1A 2ZT5A 5FBQB 4RD1A 4XDYA 4J3NA 4GGMX 2GA9A 4KV9A 3SYRA 5LIRA 1ECFA 1FDSA 2DETA 3GK3A 3HZOA 2A9RA 4AG6A 2QKYA 2JIMA 4FFDA 1JL3A 4U3JB 1UUFA 1PUJA 4GPZA 3AKDA 4B33A 2XMDA 3QLEA 4CL3A 1H2WA 5LQRA 4UVIA 3A1CA 3H9BA 3K4HA 4FILA 4IICA 3AERA 1V95A 4Y6GB 4KK3A 4A8TA 1JEAA 4BKRA 1Z13A 2GEVA 2M2IA 4DHEA 5LQJA 3O8RA 2XSZA 2ZBVA 3BB4A 5AXDA 3GJZA 4LC9A 3IV7A 1OU0A 3VR3D 2BHTA 2FUEA 4K6MA 4XFKA 4ZVQA 1JFVA 2CXXA 3FBGA 1AGPA 1YS1X 2HU2A 5C7IO 4IS3A 1TM5E 1HPLA 2IE0A 3ZDYB 4BXOA 1PR9A 3DFKA 3FPFA 4RL4A 4C6TA 3EH1A 4F12A 4G5RA 4YJGA 2R1VA 2DERA 1E2KA 1RKUA 2EVWX 2JFNA 3AHCA 1Z6YA 4HUJA 2BFDA 1N2ZA 2F62A 2A4MA 2FG6C 3E22A 1ZRNA 2ZREA 2ZUTA 2YVUA 3L4JA 4JX8A 5TQJA 4JJ4A 2QP9X 3NHPA 4L8LA 2ORVA 5K3SA 1N2GA 2XECA 1F3OA 5DF1A 3TSYA 2ETXA 2RK3A 3RREA 2JHPA 1SUEA 1GEGA 3V33A 3JW8A 3QY9A 5KYKA 2C7QA 4LXIA 3RT9A 4UVGA 1RJGA 1YIDA 3IAAA 4DJJA 1BFUA 2DG2A 1DKQA 2C5AA 3DVAB 3TMYA 1SUAA 5IEJA 5H9WA 5KYTA 1T3TA 3E35A 4ZMRA 2A5DA 3KT6A 2EQBA 1A2OA 3HV0A 3LVQE 5JW6A 1L4NA 2QUHA 5JHGB 2JLYA 4Q3BA 2HGSA 2KW5A 3L0ZA 5CDGA 2ILVA 1CEQA 2Q99A 4YX9A 3EAFA 1VKZA 4TXHA 1RZRD 2WI8A 4KR7A 1MDFA 2HUPA 3KQQA 4OQNA 3TE6A 3P1JA 1KZ7B 3QP9A 3N6VA 2ZZMA 2J9RA 4H1WA 1UT6A 4DV6B 1TXGA 4H77A 4OQQA 1KP2A 3RUPA 1L7QA 2PS1A 3E5NA 1BA2A 3ER6A 3I8XA 4WSOA 5TEVA 1ODSA 4TS9A 5JY1A 1YS4A 1XEAA 2WVGA 1RJDA 3PDWA 4I1OA 3K05A 3HWWA 3JQ6A 5E7QA 1PW5A 1XTIA 3QELB 4H16A 1QC5A 3KIPA 3MB8A 4L3VA 5FPPA 1WIWA 2I55A 3S2EA 2E4UA 4N3NA 4XPIA 1YKFA 1IAVA 3LT1A 4FCTA 3W6NA 3T1VA 4B76A 1BG6A 3ZY5A 6ADHA 5D5HA 4HQFA 4NZMA 1U8YA 3SYNA 5HKBA 1E6CA 3ASUA 4KDFA 5JDCA 1C7EA 1NATA 3PYMA 4YJFB 1GTG1 3E4DA 3LQ4A 3KJEA 3L7YA 3I53A 4UHHA 1L5FA 4RD0A 3F5QA 4UFPA 1E3WA 1DFHA 4INJA 3RIYA 1UAGA 1QYRA 3SYLA 1U3DA 1DKLA 1NXXA 4CEJB 1HE1C 1KI9A 2W11A 5CNJA 4LTDA 4URFA 1VIYA 4RK0A 5IJ0A 4XVCA 1NW5A 3RC9A 5KPJA 2L0XA 4E5VA 5DX0A 1S2MA 5LUAA 4K28A 5JRDS 1TJ4A 3OVMA 3VR5D 3G6WA 3FFAA 1OXKB 5EJGA 1QDUA 3OICA 3TW4A 3C98A 4E30A 4PO3X 4CKEA 1H2YA 2C4NA 3RABA 1XD2A 1ZA1A 3MWGA 4G1BA 2CVQA 3VQTA 4FUQA 2A1UA 5FAXA 2R79A 1AGYA 2QMHA 2DT5A 2ZQ5A 4QQNA 2IPLA 5COBA 3WZ2A 1K5GA 5KNLA 4PTZA 3HYTA 3FSRA 4J3JA 2NTVA 3GLSA 4OM8A 1DBIA 1V7ZA 4IFIA 1XMQB 3IO5A 4QA9A 1NRWA 1WCXA 4NYIQ 4XOUA 2FZ4A 5FYDA 4YHHB 1NW3A 2XT9A 3W5JA 2ZIWB 2J0EA 1Z17A 4R1QA 4EYGA 4Y9SA 4BMZA 4IZHA 1M1UA 3F2IA 2NO6A 1PN3A 1UZAA 1TA0A 1L8LA 4JOQA 1IVYA 4UHBA 3HCDA 2NSYA 4EUFA 4M83A 1E99A 2WC1A 3CNQS 1CQIB 1Y8QA 2H4XA 4AJ4A 5SZIA 4B40A 4D9HA 3GLFA 2BKAA 1R8YA 3EMVA 2FUCA 4FCWA 5CT6A 1YVUA 5EIHA 4YRNA 1ZC3A 4EBFA 3Q1KA 2YMQA 2XNDA 1DRVA 3QEJA 1IH8A 4WGGA 4QG3A 4G9GA 4DLNA 3OBIA 3DOUA 1Y5LA 3DMFA 5D84A 4PO1A 3WDSA 1KJJA 1SCUA 1Y80A 4A6XA 1OT5A 4YMGA 4KR3A 4N48A 3FYUB 3QXXA 1LSSA 3BZWA 3KFVA 4KMOA 1QVRA 3PPWA 4R69A 1OKKD 3JYLA 3G8YA 3CF6R 2GS9A 4WZBA 4QGAA 3HBNA 1WNTA 2RAPA 5DLDA 1JT9A 1ISMA 3DKIA 1EM8A 1X7XB 4GZ5A 3PI7A 3C5HA 4WWHA 1WA5A 4A27A 5ITZB 4N41A 3U4MA 4KIGA 1G7SA 3WLPA 3ZDAA 3BQ9A 3EXEA 2RH9B 1GARA 1J09A 5AQEA 1CQPA 1TEVA 3DDWA 1DXYA 1P5JA 4FKMA 4PYRA 3ZHYA 1M1NA 1SOMA 1U7OA 1LBIA 3WYBA 5B58C 5DNVA 3FDXA 1PJ4A 1K3UB 4IDBA 3ON5A 4O4LA 2ZS8A 5K2OA 1SU6A 1VBKA 2EERA 1W36C 4WFJA 2M9MA 1POWA 2PLFA 3K73O 4E2ZA 1IXKA 3RC7A 3LP8A 5PNTA 3UWSA 3DLHA 1IJEA 4ITRC 4K9KA 3EQ9A 2EARA 4MGZR 5FBWB 5G4KA 4KMSA 3EQZA 3I9LA 4HEA1 4C0L