4HDCA

Discovery of selective and potent inhibitors of gram-positive bacterial thymidylate kinase (tmk: compound 41)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Discovery of Selective and Potent Inhibitors of Gram-Positive Bacterial Thymidylate Kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdcA00
1GUAA 1UFQA 3NC0C 2HT1A 1NIPA 1P2SA 4KFRA 3OEHD 3WNDA 3PFIA 4PX9A 1SVSA 1FUUA 1W2HA 2QTFA 1TQ2A 5BN5A 4MA4A 1W2GA 1TQ6A 2WTUA 5CIWA 1AA9A 1Z06A 5UKDA 1PUIA 4LYAA 3R8FA 3DZ8A 3LNCA 3FMOB 2QENA 1Q1EA 1M1YE 3B9QA 4EQ6B 3UPUA 2J7PD 1UKEA 1IM2A 3MUFA 5EJEA 4PQFA 1YR8A 3NH9A 2OZEA 3T1VA 2QI9C 4LV8B 3EASA 1FQJA 1VIAA 2B21A 2ZU0C 1RKBA 3AF4A 4DCSA 3B7GA 1KNQA 2HF9A 2V6JA 3KQKA 4GL2A 2H92A 1OKKD 2QP9X 4EPRA 1MRSA 3CKLA 5K8UA 5TVKA 4M9XA 1ZCBA 2Z5FA 3LLUA 4IEEA 2RH5A 2ODNA 1E79D 4A92A 3J81k 1DVRA 4GZLA 3PJRA 4DXAA 3BH7A 3U44A 1W36D 4HAVA 1UDWA 1NSTA 1XB2A 3QG1A 3ZVRA 3SYLA 2CCKA 4MKHA 2PL3A 3HP1A 3SZRA 1ZUIA 4MGKR 4Q7LA 5DGXA 1OXSC 1G3UA 1Z0KA 1ESMA 1TMKA 1VTKA 3ZD6A 1AGRA 2CLDX 3EIQA 3U2QA 3PG5A 3AGPA 1LV7A 1QHXA 4EQ6A 3C16C 2GAOA 2O8DB 4TLDA 2GVDC 3F3YA 5AJYA 3RABA 3EZFA 2JLQA 5E3HA 5IDVA 4C0QC 3UWKA 2WKQA 4BGDA 3CPHA 1G5PA 3OAAA 2B8WA 3GEIA 2DBYA 3L82B 5K8LA 1WRBA 1OH7A 3UKDA 1IY0A 4A9AA 4S2EA 1XPUA 1QHSA 1DE0A 2REBA 3BIFA 5EZ5A 1X1RA 1NY5A 2QTVB 1OSNA 2IYQA 2F3RA 2NMVA 1DAKA 2YV5A 3IIMA 4DDWA 2ATVA 3A4NA 2J41A 3X1YA 4ZDKA 2W6ID 2PJZA 3G5UA 4IDOA 1Z8FA 5D3QA 2GXAA 2VO1A 4JLBA 4EJSA 1DG1G 1U99A 4GRAA 1G18A 5DHFA 2QE7D 4NP6A 2GAAA 3K1JA 3K70D 3IPYA 2A3RA 1KMHA 2AXPA 4KBGA 4LK2A 3WY9A 2ZSAA 2VP5A 4DLWA 5JHHB 2NO1A 4H1UA 4PAQA 3TAUA 2Z4SA 2Q3FA 3O8DA 1NKTA 2WM9B 1PUJA 1MABA 4V02A 2A30A 2MSCB 2Q9BA 4GOJA 4MGZR 3TGPA 3HU2A 3DMNA 4LDJA 2IXGA 2W0MA 4M9ZA 5G41A 2GTPA 1JXOA 5IK2A 1E69A 1JI0A 2LWIA 3U7EB 2V4ZA 1J8YF 3U3MA 3THYA 1C9KA 2BC9A 4PO8A 1Q21A 2CVHA 2Q0HA 3QPUA 2WHXA 1F2UA 3NEJA 2XZLA 3ASZA 4XJXA 3CRQA 4ZKEA 1UBGA 5BN4A 1E9CA 2ZRFA 2G9NA 4FWIB 5GADl 1UJ2A 1ETUA 4GMDA 1P61B 2J1LA 4Z1MA 4CEHA 2VQSA 5AUPB 4YXWA 3WBKA 2W6JD 2OAP1 2FSGA 2JJ8A 2HYDA 4LPKA 4B3XA 1KSGA 4LHZA 5D3MB 4JS0A 3GLFB 1XCGB 3DEFA 4BQSA 1MO5A 4DDTA 5EUQB 1IN4A 221PA 1F6BA 2QQEA 1SVMA 2ZRHA 4Q1DA 1R8SA 4NONA 2QRNA 4EPTA 2RGXA 2FSFA 2GZAA 2IA5A 3B2EA 4OHZA 3HPRA 3X1WA 5JJKA 1GM5A 3B1XA 2VSFA 2R9VA 3C15C 2GEUA 4BLQA 1OH6A 1E0AA 3B85A 4M8NE 4X8LA 5FTMA 1KJZA 1X8JA 2GCOB 2JLRA 1MV5A 1NBMD 1SVKA 3FHOA 2XGJA 2F3TA 1L2TA 2YC2C 4LC1A 4JJKA 3GJ3A 2P5TB 3CX7A 4BLSA 2GJ9A 4YMTA 2W2TA 5GJCA 1GRRA 3GLGE 1N6IA 1U0HC 4RFVA 3ND8A 5SZHB 3QKUA 3I5YA 4ASUA 3EPKA 4L9SA 1JAIA 1E1QD 3LLMA 1OPXA 2CHGA 4NL4H 5C18A 3U61B 1ZU4A 1HE8B 2RMKA 5FPTA 1HQYE 3TIFA 2AKAB 5D3MA 1OFTA 3PUXA 2FGKA 2C8VA 2Q9AA 3M0EA 1Q20A 3GCGA 1VG8A 1GDDA 3W3ZB 1L4YA 1OIXA 1E2PA 1YE8A 3CWQA 3VR6A 1YZQA 1NL3A 3ZQJA 5E7IA 4HUQA 3RAPR 4ZCMA 3FKSA 3GEHA 2QORA 3TKLA 2QBYB 1XBTA 4M1OA 3FTQA 1P2VA 2HJGA 4WAUA 1UKYA 3KFXA 5KSPA 1G4UR 1IOZA 2O8EB 4AG6A 4KODA 4NCNA 4Q9HA 5HKKA 4QGGA 1W5TA 3CF6R 5CK5A 3EWSA 4DLRA 2OAQ1 1TPZA 1HYQA 3I32A 2L0XA 1EESA 3CPJB 1R6BX 1T0JB 4WZAE 4DCTA 5TY0A 1DG3A 4NYJR 2H57A 5GJBA 1G64A 1E2LA 3FHCB 2O8FB 2C9CA 1Z47A 4QJ4A 1TU3A 5CB6A 2IYVA 4RZ2A 3AKCA 4XD7D 4WIAA 1Z63A 1XEXA 5AR1A 5K8TA 4GNKA 2F43A 4P31A 4HAZA 1EX7A 2CDNA 3QKTA 5E4FA 3U3OA 4MQBA 1UDXA 1VECA 4ZIRA 4DB4A 4IVPA 4Q7JB 3TK1A 3IGFA 4IDQA 1F2TB 1M2OB 3THWA 1W4CA 5CITA 2QN6A 2O0JA 2RCNA 3QF4B 3DPUA 4IOJA 3RSLA 2G1JA 4BZXA 1RPZA 4FMBB 3PEVA 2QBYA 4FN5A 4TLEA 5LD2B 2F1RA 1NMXA 2B8TA 4JVMA 1S9DA 1FFHA 3U3RA 2D2FA 1Q44A 1RJ9A 2DHRA 3K0AA 2G6BA 4QL3A 1Q1ZA 1OE0A 3I4LA 4E07A 3GJXC 3AVYA 2BMFA 1CS4C 2GF9A 1EFUA 4B76A 4A6XA 5JWRA 2GRJA 2XB2A 3HJNA 1S3GA 2O8FA 5AJZA 3VNVA 2QGNA 1G5TA 3ADCA 1OB2A 2JLVA 1D9XA 4OQNA 1A5TA 5FTJA 3BRWD 3S1AB 3DO6A 1T5LA 2HLDD 3SJAA 4OHYA 1BMFD 2JDIA 4B3CA 1XMJA 1OXXK 2JIZA 5G3YA 3H84A 4GOXA 5KDDA 3VAAA 3ZDQA 2CHQA 2ZQ5A 4LSGA 2FFHA 3DM9B 3TUJC 3QF4A 3PV0A 2P67A 1I2MA 5JI2E 2HJVA 4OI0A 3WNCA 1AKEA 4RD4A 4TMKA 1P72A 2ZJ8A 1J90A 5KPJA 3AKDA 3TVTA 4U02A 1Q1BA 4JLVA 2ZS9A 4EIWA 2Z4RA 3DDCA 5HTKA 3CIOA 5HE9A 8OHMA 1N0VC 3UIEA 2REXB 5ELXA 1Z3IX 2WMNB 3FFAA 1W0JA 1UF9A 2P6UA 1AK2A 5EP4A 1CXZA 1N3BA 2HT6A 1G20E 3VTKA 1K6MA 2YZ2A 3AVVA 4AWXA 1TU4A 2ODEA 2ZANA 2JAQA 4FIDA 1YZUA 4DBLC 3C7KA 5B30A 4DZZA 3WMFA 3V00A 3WHKA 4AK9A 4PPNA 2W2XA 2GILA 2VIIA 4IVQA 5FUXA 2MMGA 3VFDA 4U7DA 1JPJA 1Y3AA 2VP2A 3AF1A 5H70A 5KNBA 2AN9A 1LW7A 4G0NA 3N2IA 3X2SA 1T8TA 2NQ2C 2GBLC 4IEIA 4BPBA 2AWOA 4B3DA 1B0UA 4A2WA 4LRWA 3CNLA 3SHWA 2AFIE 3CR8A 4US0R 2FX3A 4BLOA 2XTZA 2XXAA 3FFBA 1Z5ZA 3BFKA 4R71A 4DCNA 1H8ED 4PQRA 2OLKA 2NO7A 3E70C 2IL1A 3H2YA 3Q5DA 2QEQA 3QI2A 3I62A 1O3YA 3MCAA 4ABYA 1MOZA 4QNRA 3WYFA 1GSIA 1X86B 4ACAA 1T4GA 4ZDJA 1RRFA 1Z6AA 3C8UA 4NYIQ 3GMTA 5TARA 1OH8A 2F9LA 421PA 2YC4C 5JWOA 2A5FA 3QVVA 3LA6A 1ZRHA 4K46A 1TQ4A 3OIYA 4CF7A 1P5ZB 3UANA 1BYUA 1LY1A 4WA7A 3VHXA 2G88A 1XPRA 1IN5A 4M1TA 2KB0A 4WVFA 1MH1A 3FHTA 1EFTA 1GNQA 2DWPA 2QSZA 2WVJA 5AWFC 2GXQA 4F4JA 4OI1A 1E9RA 4GT1A 4UKDA 1BKDR 4P32A 3Q7QA 1S8FA 4FMCF 4TZ0A 1J7KA 2JGNA 3OIUA 4D6PA 1MO6A 4RSGA 4HB3A 1OFUX 5KUTA 521PA 2PBRA 5TMPA 1S0UA 3EW9A 2OUKA 4ZDIA 3NC1C 2X1VA 4A15A 3HR7A 4MRVA 5FOTA 4PPFA 5E7JA 1KI9A 3X1XA 5FL7D 3KKMA 3CH5A 3EC2A 4TMVA 5JRZA 4RVCA 5DSZA 2Y8EA 4TQ9A 2NPIA 3NKVA 4JLAA 4QC2A 4RD0A 3W5IA 4G5SA 3BERA 3V9PA 4W9MC 1I2DA 1A2BA 3KKQA 4OQFA 1XX6A 4KSBA 2QG6A 5EUMA 1ZVQA 3GJ6A 4LGMA 4PXAA 2CVFA 1UKVY 3N5CA 4YMWA 1R0ZA 3RC8A 4A0FA 4D26A 4N1AA 4RZUA 2A5YB 4JL5A 3ZGXA 1LB1B 3KKNA 5FUYA 4CVNA 3W3AA 1U8ZA 1D2NA 3R7WA 3U4QA 2NZJA 2F55A 3WMEA 1L4UA 1KO4A 4PTLA 4DSOA 4R7ZA 1YRBA 4C0SA 4GFDA 1E2EA 3GQBA 3KXKA 3QUSA 1NY6A 1IN6A 4D81A 2REOA 3L8ZA 1AQYA 3LWNA 4ZKDA 2QNRA 3THOA 1N25A 2ZXUA 2K5UA 4U00A 2H17A 1JB1A 2R8RA 1ANKA 4MYUA 3I72A 4ASUD 3EX7C 4P4UA 4HAWA 1XMSA 1IXSB 3PXGA 2EWVA 4ZO4A 1CP2A 5DN6A 5K8IA 4KCGA 2G83A 4D0NA 4QHYA 1D2MA 1OXTA 1P3JA 4WOPA 2D4HA 3Q9LA 5DE3A 2AXNA 3F0TA 2OFOA 3T5GA 1FUKA 1PVOA 1Q3HA 1VMAA 1KO7A 1NSFA 3I3SR 3K09C 1T91A 4DEYA 4TSFA 2DFTA 4TL8A 2VP0A 4JLDA 3ZZTA 1XP8A 3W90A 5IT5A 2W00A 5HCNA 2ZRMA 1NVUQ 4P3YA 1M7BA 1PLJA 2PH1A 4OJKA 3GJ5A 2VH5R 1FX0A 1T3LA 2PLFA 4JVLA 3FE2A 4RCZA 4NDZA 1CJUC 1V43A 3AEZA 4BUJA 3TVDA 4XVQA 3LDAA 1HV8A 5FUWA 2MMCA 1ZNXA 2CNWD 2QMUA 1D5CA 5F9HA 1P9NA 2YWHA 4HI0E 4A1FA 1SVOA 3M4YA 3A1SA 3QKRB 1CEEA 3VR4A 1SKYE 4MRRA 3ADKA 3RVBA 4ARZA 5JECA 1IXZA 1E9EA 2OCBA 1E2DA 2XEXA 3IIKA 5AUNB 5IF9A 2H18A 1N6KA 1RYHA 3C4JA 2JATA 4NMMA 2OBLA 2CCJA 1E9SA 2PMKA 1XD2B 4NKRA 1E0KA 3W8NA 4KVGA 1G17A 4DWJA 1G6OA 1OLOA 4M21A 2A5JA 4KV9A 2FMXA 5JJLA 4BE7B 3RS3A 4JMPA 2FZLA 4Q1AA 2R62A 4D4JA 2Z83A 4GBMA 4BRWA 1JR6A 1P9RA 2C96A 2BEKA 2OCAA 4N0DA 4UJ3A 1COWA 1MT0A 4MKIA 3IILA 2QSYA 2ZEJA 4RZ3A 4OQMA 1KMQA 3OZXA 1VYUA 2AR7A 3GLHA 3NDPA 4FW9A 2ZSBA 1RRCA 2FA9A 5KO2A 1JR3D 3NBZC 3K0SA 4BFTA 3BORA 2BHRA 4US2R 2XTMA 4URYR 3SQXA 1P7CA 5FUVA 2ZTSA 3QVUA 1ONBA 2ZE5A 3CRRA 1W36C 4KI0A 4OK3A 4C0BA 1OHHA 2P3SA 3B5JA 4TLCA 5EP1A 1LS1A 3ND9A 5JMTA 1RE0A 4GP7A 1F3OA 5FTLA 4QKQA 5G40A 4B34A 1HA3A 2WJHA 1KSJA 1E1RA 1TAGA 2EFEB 3LBIA 4CT4B 3SDZA 2A2ZA 4C0AC 3ZVMA 1N5IA 2VF8A 1KI3A 1JBKA 3IHWA 3IEVA 3GLGB 2ECKA 2WICA 2R2AA 5EXSA 3TUIC 4RKFA 5FBVB 3LAWA 4HLUC 2OCYC 4EPWA 4BFSA 2OFWA 5E95A 1FNMA 4XH9B 2E1RA 3W5JA 2IYWA 1ZM2A 2OSBA 2ZE8A 4NTZA 5J4KA 2VEDA 3LRPA 1G8YA 2IBMA 2BV3A 2IXEA 1WBBA 2ZE6A 4UJ5A 3EAQA 1AS2A 4PC1A 3SC3A 1OF1A 4PQYA 4QGAA 2JLSA 2YWGA 4Q01A 4PC3A 1D9ZA 2KE5A 3QXJA 4DUGA 5A0FA 4CW7A 3IQXA 1NKSA 3OE7A 4XVRA 1M34E 3DMDA 4LJ5A 2YJTD 5EXXA 3OIWA 4DRZA 2G1KA 2FSIA 3RWMB 4BLRA 1Q0UA 3GP8A 2CK3D 1SULA 1E9BA 1ZYUA 2RGNC 4XTRA 3U44B 1R5BA 3GJ8A 1E94E 2FJUA 2QT0A 4LJ4A 2ZVPX 5EE0A 3SJCA 1GVNB 1G3QA 4NE2A 2H8KA 2BWJA 4DKXA 3RS5A 2F1IA 1CRQA 2F6RA 2ZU6A 2QU8A 2XZOA 1GKUB 4W5WA 1UBFA 4IDHA 2WJVA 4L8GA 1LF0A 1XDBA 3LQQA 4Q9IA 4AKHA 2ASEA 4TL7A 2ORWA 4RCYA 1ODFA 1OFHA 2A9KA 1NVVR 1TL7C 2YYZA 3I61A 1ZM3A 5CM9C 821PA 1NRJB 4PANA 2V7QA 3AQ4A 3LW8A 4KU4A 3PENA 3P4YA 2IYLD 4Q47A 2ZI4A 3ZYCA 2CL0X 3IBGA 1XMIA 3IBYA 1GIAA 4I1OA 3RYTC 1EK0A 2ONJA 1KY3A 5EQTA 1E98A 2HUPA 1ZBDA 1G21E 2GF0A 4GZMA 3WP1B 2J0UB 2EYUA 2FFBA 2ZRNA 1BS1A 1KO1A 3NWJA 2LKCA 3P1JA 3IQWA 4B74A 3OEEA 3RLFA 2XNDD 2ZE7A 3T1QA 1ZU5A 5JJIA 2HXYA 1E2NA 4F91B 3K9GA 2C95A 4NYMR 5A5GA 3FYHA 4XSHA 1KIMA 2PEYA 5BW8A 2DYKA 4LHYA 5DHAA 1NVXQ 3B60A 4KHZA 4EJSB 1ZP6A 2FEMA 4OJQA 4P0TA 1XWIA 2ONKA 2IS6A 4TTPA 5JFGA 2ZRBA 1KYIA 1KMHB 4ZI2A 1GL6A 4XIGS 3OFNA 3T35A 2CCGA 4HEJA 1BYIA 4PHTA 1T9HA 4B43A 4KO8A 1NN3A 4JT2A 4DCVA 2GA8A 2YINC 4G5QA 3W6OA 4Q4LA 4I1SA 2WWGA 1CR4A 3CX6A 2J9RA 5KYKA 1MABB 2ZROA 4DC9A 2FU5C 1ZD8A 2ZJ2A 4F7WA 4KFTA 1N2CE 4CRWB 4DB2A 3B1ZA 1H8HD 2J0UA 3BB1A 4V0KA 4JVSB 3C5HA 1E2IA 3SU8A 2BIFA 1YU9A 2C04A 1RW4A 3BK7A 3WBJA 3THYB 4TMXA 1QHHB 3U6KA 2WKRA 3CONA 1Z0AA 5HZKA 3JZMA 4AC9A 2ORIA 3QE0A 3T34A 2XSZA 1F2UB 5FOSA 2C5LA 3SQWA 5F9FA 4FMDF 2ZITA 4JBXA 2FGJA 2MSDB 3SBDA 2ODWA 1T3HA 5AUQA 3DVLA 1VCMA 2ZI5A 4AURA 2J5XA 2WOJA 5SZKB 1LFDB 2G77B 4CEHB 1QVAA 4URVR 1I4TD 3WYAA 1XMVA 3QIAA 2OBNA 3MWYW 1U9IC 1XJCA 4B47A 4H1VA 1SXJC 3CF2A 1KO8A 1GKIA 3IO3A 2GK7A 3GLHE 4MITA 1J99A 4OYHA 5FOVA 2IS4A 4TMTA 2C9OA 5CLLA 4IXMA 3NIBA 1ZD9A 5AK0A 1UM8A 3KXLA 3TW4A 5DN6D 4URZR 1FOEB 2QL6A 4WW0A 4XWOA 5CYPA 2FE4A 5L3SA 2B6HA 4TT3D 2XOKA 1QHHA 1CJVC 1YR6A 1K5DA 2EVWX 3DKVA 2NOAA 2O8BA 1KI6A 4XTCS 3AB3A 2CJWA 4GMXA 1LVGA 3QSYA 3PITA 3PUZA 2D7DA 1X1SA 1GRQA 3LV8A 5JWHA 1CBUA 1QBKC 3KJGA 3PVSA 4V03A 5LB2A 1KI1A 2QY9A 1QVRA 2V1XA 3EZ7A 4JSTA 1XPOA 2GNOA 2C98A 4RD6A 1S3SA 2DR3A 3OHMA 3D6TB 5JCZA 3KJIA 2IEYA 4DLYA 2ZAOA 3ONWA 1Z0IA 1YZGA 2WIAA 4AI6A 3QG5A 1W47A 4Z51A 3IEUA 1I4LD 2H1LA 3ZS9A 3B6EA 3RANA 5IRCD 4HUQB 3P32A 3TRFA 4BWYA 3TUZC 3I1FA 1HQCA 1R8QA 2BJWA 3AUXA 4LWZA 1S9HA 3AF3A 3PQCA 2ANBA 1S1CA 2W0SA 4ERNA 2G3YA 2P2LA 4PHGA 1W0KD 5FR1A 1DADA 1FP6A 3GEEA 3T5DA 4LBYA 2PJRA 1E2FA 3EG5A 3LVRE 4KVAA 1ZNYA 2R65A 2R6DA 3OF5A 4BFVA 2WSSA 1XEXB 1G19A 1E4YA 4B33A 4A8JC 1DAHA 4G3XA 2F43B 4U5XA 1CIPA 3T1OA 4EPVA 3AV0B 3BXZA 3AP1A 4IOMA 4ZIRB 2Z6VA 1AKYA 1TUIA 4LJYA 5KHOC 2A5DA 4DJTA 1NMZA 1T5IA 1G6HA 4W7SA 2ZJAA 2G0NA 1HURA 2NTYC 3GFOA 4WXRA 3KQNA 3M1IA 4HDOB 3BD9A 3THWB 4WXPA 1TF5A 3LX5A 4HAXA 2C78A 4MGYR 2A78A 2QAGC 3VX4A 2R6AA 4OK5A 3KQUA 4ON9A 2IYRA 4B48A 6Q21A 3NEYA 4C0LA 4M2LA 1WQ1R 2C2HA 2PCLA 3EA0A 3HYTA 3B13B 3K0CC 5EZ6B 1E9DA 4JVNA 4JZKA 4MGIR 2QMHA 1RJ9B 2ZUCA 3K0AB 4HZUA 4BZQA 2YHSA 5FTNA 3U7GA 2J0SA 2GWHA 3ZIAA 3BH6A 3DZDA 1NVWQ 4QGFA 3B1YA 1R4AA 5GJVC 5ANRB 3TAHA 4NH0A 1J70A 5KOYA 2VYFA 3GJ4A 2RHMA 2RGDA 1UBEA 4QBHA 1L8QA 5F3WB 4LY6A 4TYYA 2F1HA 3RS4A 1VYVA 4I4LA 1FMJA 4QFMA 4A6PA 4NCIA 3K53A 2GJSA 2GJ8A 2GETA 1Z6TA 1V5WA 4XVUA 1UEIA 3W34A 3MWJA 3CNNA 4BLTA 5TDHA 4M4SA 4DUGD 4Q4HA 2JJ1A 2ZUDA 5JBQA 1HT1E 2ZRLA 2ERYA 5GVSA 4R98A 5F98A 2WSMA 4CDGA 1IXRC 3H0KA 3JZAA 2WJIA 3W6NA 2AFHE 5FBWB 4B71A 5H1YA 1CR0A 3F8TA 4V0NA 1WA5A 2ZSFA 4QNMA 4D4MA 1Q3TA 5FBQB 1IN7A 5KPDA 1ZUNB 2CE7A 2EW1A 4ZPXA 4ZCLA 3VQTA 3AVXA 3V4RA 3AKEA 4HATA 2D62A 1JJ7A 1SKYB 4PZLA 4NPHA 5J47A 4PC2A 5FPYA 4Q4AA 5DISB 2OHFA 1W49A 2EFHB 5DLQC 1SVIA 1EFHA 1FP7A 1XXHA 3REGA 2BBTA 3P20A 4Q1BA 2ATXA 1KDOA 4E03A 3AVWA 2IHBA 1XTQA 2FEOA 1F48A 2ZAMA 3EC1A 1E2JA 4CYMA 3LY5A 3THXB 4NCHA 1KKLA 3A6PC 2I3BA 5J4LA 1G8HA 3BBPA 3BWDD 5CLQA 1NLFA 1T8UA 2WPDA 1ZNWA 2IWHA 4O0MA 4AKEA 4TYWA 1GITA 3CZPA 3GJ7A 1P9WA 1XTKA 3SHFA 4URWR 1YR7A 4L15A 1KI2A 5CM8B 3NBYC 2XXAB 1XD9A 1G16A 4LJ9A 3CLVA 3RNLA 3ZZUA 1GAJA 1NF3A 4TTRA 2Q9CA 4DT1B 4CEJA 2QQ0A 4URXR 4LHVA 3RDPA 1YRAA 4RZXA 4TL9A 4V0MA 3O47A 2KSQA 1T0HB 2IC5A 1AS0A 5JRJA 5DYGA 5C4MA 1D8TA 1ZIOA 5TXGA 2GCNA 4LYFA 4IJMA 4FCTA 2GJAA 4V0OA 2XTNA 5FBRB 1G5RA 2JJ2A 2ZI7A 4LBVA 2PZEA 5B2ZA 1IQPA 1E0JA 3T15A 1QG2A 3K0FA 3CO5A 4JJZA 1XCMA 2O0HA 3NXSA 3UMRA 4BFUA 3OAAD 1UADA 1MO3A 3BS4A 4F92B 1TADA 3THXA 3K09A 3RSOA 1QF9A 1P2UA 1Z22A 4PHHA 2J0VA 5HR5A 1HEIA 3AVUA 2QAJA 1SKQA 2J45A 2OFXA 4FCVA 5JS8A 2PEZA 5C2JB 1P73A 2BEJA 3KX2A 5SZIA 1G3RA 2XZPA 4DT1A 1G4AE 1QHYA 4D80A 1ZM7A 4TYQA 3TQFA 1ZD1A 2X8AA 5J4HA 2HF8A 2XSZD 3CB4A 1NN1A 4GP6A 2GXUA 2JEOA 3ETLA 1IY2A 5HE8A 1N5LA 4ACBA 2FPLA 1DO0A 1GKYA 3CBQA 5FTKA 3RHFA 1Z83A 4DLSA 1GTVA 1EFRA 1XJQA 1R0WA 1FZQA 1KGDA 3CWZA 2R6CA 2CLSA 2ZR7A 4MUAA 4BRUA 1E0SA 1E9AA 4LJ8A 3BOSA 5FI0B 5KDLA 1KSHA 3QEOA 4NBSA 1DAEA 2QPOA 4O25A 5CJ2A 4IRUB 3FB4A 1US8A 3V4FA 1Z0DA 3D3QA 2ZVQX 2X19A 1NP6A 3H1TA 3L2OB 3MRSA 4A2QA 2FDCA 2D2EA 1VG0B 3QNUA 4RD1A 4YDHB 3KTAB 1W46A 2CL6X 2VTKA 2FF7A 3BAFA 5IK2D 3R7WB 3U4QB 4TQUS 2A5GA 3BH0A 1OKKA 3IO5A 3MLEA 4BFZA 5CB8A 2IYTA 4B44A 2O8CA 4C4PA 1DAMA 1E79A 1FW6A 2HV8A 3CR7A 1OXVA 2OXRA 4AKGA 2I1QA 1OXUA 1XEWY 3OESA 3P4XA 621PA 5JEDA 1Z2CA 1SVLA 4Z1MD 1Z2AA 2C9YA 4YXWD 3TSWA 3NBFA 4A2PA 3A4LA 3PEYA 5A4JA 5JZVA 3MMPA 1AM4D 2ZSDA 4BFYA 1WE2A 2QP3A 3NHAA 3EWAA 4DSTA 3RS0A 1OYWA 1TEVA 2YOFA 4HLUA 2N1BA 4JBYA 2JLXA 2CXXA 3SOPA 4LUCA 1KO5A 4GDFA 1IJEA 2ZYUX 5EXPA 3QKSA 3VKWA 3KTAA 4B75A 4AIIA 2H5EA 4M1MA 3K9NA 4EUNA 3D8BA 2D3WA 3B78A 2D7CA 2XJ4A 1W1WA 2IYZA 3O8CA 1IONA 3A1UA 4PC6A 5IHPA 2BMDA 1CJTC 1KI4A 3A58B 3QF7A 1FX0B 1ELOA 3F5FA 4G1UC 3UWOA 4UNRA 4FI3C 5C1BA 1CULC 4I1VA 1YHNA 3SYNA 3ZZ0A 1W4AA 4NYJQ 4C9BA 2YWFA 2SHKA 4D0GA 1GOTA 4PZZA 4OKSA 3ZLJA 2PLRA 4HB2A 2ZYTX 4JL8A 2WIBA 4D0LB 2RGNA 3A36A 1ZAKA 2NO9A 4ARZB 4CZ2A 2W6IA 4OQLA 5CDFA 4UNNA 1DARA 2DWQA 5JCPA 3KUCA 1DAGA 2BCJQ 5LBIA 1OH5A 2IF0A 5LD2C 5JEEA 3UXMA 4C2TA 1NI3A 4O3MA 2QE7A 1XXHE 5DYIA 2IEZA 4L4UA 4XSGA 2Q3HA 4B2LA 2ZRAA 1XTJA 4QOSA 2UVQA 2GCPA 3L43A 3FKSD 2OM2A 4LV5B 3CX8A 3D31A 1HT2E 2OT3B 3T1TA 4C7OB 1XEFA 5TB5A 2ZS7A 3I92A 5HKKD 3AKYA 1YVDA 2AHOA 4KLZA 1F5NA 1RRPA 3IPXA 3RRYA 1W44A 4PAOA 1P2TA 2J7KA 2GK6A 2GZHA 3SYKA 3CUEF 4UXHA 3GLHB 4LYJA 4QHSA 4TYNA 1TNDA 3DHWC 1E2HA 1GL7A 5LPNA 5FPSA 3PIRA 3LBHA 2VPPA 2ZRGA 4MH0R 5DIFA 4V0ME 1II0A 1N6RA 2BBOA 3UMFA 4L9WA 4P4SA 3BE4A 1NIJA 1R0YA 3PCRB 4RKEA 1MR3F 3QJYA 1WXQA 2WZQA 1AZTA 3W9YA 1SVWA 3R8CA 2W6JA 1TEXA 4FMCB 4Q1EA 1CKEA 4AKIA 2OBMA 4X8MA 1ZCAA 3K8YA 4QBIA 3L0SA 1W4RA 3ZVNA 3KB1A 1QRAA 2GKSA 1LS6A 2HEIA 4B35A 4HDCA 5EP2A 4C7OA 4HLCA 2PX0A 1FL9A 1EFCA 5AJVB 3TW8B 4BECA 1QHIA 3SJBA 2ZETA 1IN8A 4K81B 1SXJB 1Y63A 4PHFA 4EPXA 5JI3E 2QA5A 1N6OA 2VHUA 3UG7A 3B9PA 3IUYA 4TN1A 4D4KA 4OL0A 1GWNA 4I99A 4B6EA 4KAXA 2NIPA 1NBMA 5FH9A 3LO5A 1J2JA 2C99A 4PO1A 1XNJA 3DOFA 4BEJA 3Q72A 2JDID 2RKOA 2JLUA 1KDTA 1OJLA 3JVVA 2GXSA 2JIZD 4POAA 4Q4JB 2J3EA 1TF2A 2OO7A 1KDRA 4MYCA 4NHOA 2KBEA 2FNAA 3QPWA 1OV4A 1E1QA 1X3SA 1VCNA 2FH5B 4Q48A 1FNNA 1L7VC 1FPMA 2WWHA 4MRSA 4AYTA 2F9MA 3AGQA 2UKDA 2IX3A 2Z43A 3FVQA 4TZ6A 4JLJA 1WMSA 2AWNA 2FFAA 4W5JA 1AQUA 2CMKA 3MWLA 5H68A 3CRMA 2GESA 2Q3MA 1U9IA 2BDTA 4H9GA 3CM0A 4MRPA 4TQAA 3EIEA 1SXJA 2H16A 1O87A 3CH4B 2P6RA 3TR0A 1ZMXA 1MRNA 1U2RA 2EFGA 2NO0A 2OESA 3AP2A 5DI3A 2NG1A 4ESHA 721PA 5J5CA 3ICEA 1YZLA 1BIFA 1RZ3A 1RYFA 1XEWX 1W0JD 2IS1A 2VLIA 3AF2A 5DO9A 2FPKA 4YLGA 2V3CC 1OW3B 4LJ7A 4I81A 3E2IA 1I4DD 4A0GA 2JJ2D 2FOLA 4JLMA 4Q4JA 1LF5A 5JHGB 4XD7A 2VA8A 4ITRC 1KK0A 1LNZA 4JYCA 2WBLC 2CEAA 3WNBA 3AUYA 2IYSA 2OEPA 1A2KC 4B2PA 3BB3A 1KY2A 3QOFA 4PAMA 5CIQA 5AJWA 3GPLA 2FFQA 2RGAA 4A8JB 3HYRA 2FSHA 3GD7A 4FWTA 4OHXA 1SZPA 1HY3A 3KKOA 3U7FB 4HLQB 3ADBA 3K70C 3L0OA 3SEAA 3GFPA 1CLUA 2VSXA 3KXIA 5FPHA 4LV6A 2XB4A 4KFSA 4KXFB 3WRYC 4MDEA 3WRXC 4TMZA 3NH6A 3RRZA 1GILA 3TLXA 3AP3A 3EPJA 2O5VA 1XRJA 4B3BA 1P62B 4Q19A 4Q1CA 3VMFA 3SJZA 3L8YA 3EA5A 4BEBA 1G8FA 4GPTA 2X2FA 1YKSA 1EFRD 4TL6A 2NO6A 3TH5A 1DO2A 1MO4A 1W48A 4TTQA 1N0WA 3SR0A 1EXMA 3P26A 2NPFA 2WJGA 3A4MA 4TLBA 3FMIA 5FOXA 1XCPA 1OT3A 3FKQA 2AK2A 2HLDA 4Y0VA 3SI7A 1BMFA 2IK8A 4QG7A 1JALA 4HLDA 4B3GA 3A37A 3QXCA 2EFDB 4M1KA 5EP3A 4BASA 5CDFE 4F4IA 3DM5A 1KJWA 1NG1A 4NCJA 4QM6A 1A4RA 4A8JA 1P4SA 3TE6A 1N6LA 3Q3JB 4ZV4A 2IT1A 3EZ2A 3REFA 4A36A 2Q6TA 4HZIA 1II8A 3QXSA 3ZVLA 1TTTA 5KNDA 1S96A 3LH5A 2GEDA 3PUYA 4EFNA 1JPNA 4JLPA 4QGHA 4YMUA 2BMEA 2IHYA 2ZJBA 2HCBA 1HUQA 1G291 2XX3A 2ODBA 4OK6A 2QAGA 3KJHA 2TMKA 4GSYA 1XD8A 3K0CA 3TBKA 2JLZA 3EXAA 4M1SA 2V55B 3W8RA 3PEWA 1Q1QA 1SQ5A 3KZ1E 4J0QA 1KHTA 1FQKA 3QQ5A 4IOKA 2QP4A 4KFUA 4FINA 1XTSA 1KTVA 2LKDA 1W7AA 2IUSA 2ZI9A 1KI7A 1TX4B 1PLLA 4IDNA 5JLJA 5L3SB 4G01B 3ADDA 1H65A 1N6PA 1EWQA 2IW3A 1YJ5A 3VKHA 2FG5A 4IXNA 4LJAA 4M22A 4CEIB 1KI6B 2O8BB 1IY1A 5GJWC 1U8AA 2CL7X 2CJWB 1AJEA 1G8GA 1XZPA 1QG4A 3WYGA 2DFNA 3VR1A 1E4VA 4KYUA 1C1YA 2BM1A 4KBFA 2P0EA 2ZYWX 4K8OA 1S1MA 3O8RA 1RIFA 4QJ5A 1EG7A 3IIJA 1TUEA 2EU8A 3MSXA 3WXMA 2IYYA 1JQLB 4UNQA 5KSYA 2WWXA 3RWOA 2EFCB 3G82C 3B1WA 2RGBA 1H8EA 2VL7A 2J0QA 4YONB 3T12A 2C77A 1ZC4A 3C41J 2ZRDA 4O2LA 3SN6A 4B73A 3AM1A 2GEVA 2WV9A 3T61A 3KKPA 1KK1A 2XAUA 5DI9A 3LQRA 5FL3A 4FD2A 3B8HA 1DOAA 1R5OA 5BWMA 2UZIR 1NBME 3SBEA 5BQ5A 1R7RA 1R2QA 4HAYA 5J40A 3BFXA 3R20A 2O8DA 2QZ4A 3HWSA 3M6AA 4PPGA 1NN5A 1Q12A 3EARA 4CEIA 3UATA 2ZJZA 2OG2A 5CJPA 3HR8A 4LHXA 4TSFD 2QT1A 4EKDA 4ILEA 1PJRA 3VHLB 3TR5A 2GHIA 5DNYB 3MJRA 2IXFA 3FMPB 1JEEA 2QM7A 4BZPA 2PZFA 2WWYA 4KSCA 121PA 1HE1C 1Z08A 1HTWA 2JLWA 5KU1A 2MSEB 1SXJE 1JQJC 2PCJA 4QHTA 2DB3A 2W2VA 3B82A 2VHCA 1DBSA 5FL7A 2E87A 1AGPA 1JECA 1DAIA 1FTNA 2NZ8A 2VRWA 4NYIR 4PSKA 4DLXA 1Z28A 2IS2A 3N2EA 4M9SA 2OV2A 1NG9A 1G1MA 4HZUB 3TQCA 4BLPA 2JA1A 3AVQA 2P65A 4DEXA 1OB5A 4PC7A 4E5UA 1GZSA 1PZNA 4LJ6A 4C30A 4XWAA 4DSUA 4FCWA 2ZRPA 1YZTA 2ZJOA 3BC1A 3G0HA 4D25A 1COWD 2E9SA 5EE9A 3TSOA 4E22A 3ECCA 1IBRA 2W58A 3AVTA 2XNSA 3RS7A 3UMSA 2GBLA 1LTQA 3MWKA 4WZBE 1NJGA 3H86A 2OXCA 2AD1A 4LX0A 4M53A 3EZ6A 4OQXA 4W5HA 1UPTA 4DIEA 4QRHA 5KDOA 1FMLA 4UXIA 4A0HA 2ZRJA 1NMYA 2QUZA 3CZQA 2QPTA 4PSVA 4Q4HB 2HYIC 3LVQE 2P6NA 1VCIA 2I4IA 2ZPTX 3R9WA 1RRGA 1OHHD 3HU1A 5BN3A 1VHTA 4DHEA 2ZUBA 1KAOA 2JASA 1AZSC 2GZDA 4LHWA 1A7JA 3VR3A 1Q22A 1E1RD 1E2KA 4ZDWA 1DPFA 3I8SA 4FMDB 3MD0A 1E2MA 1VG9B 3UK6A 2IWRA 1VIYA 2YVUA 4NU0A 2D06A 4A4DA 3GLFA 4HSEA 4C0JA 4PR0A 3RC3A 1P60A 2WAXA 1K8RA 4JLKA 1CR1A 1VDZA 2IYXA 3I8XA 3FMFA 3ZQ6A 5BYKA 1TF7A 5BXQC 1UEJA 1IAQA 2P5SA 4Q4AB 3R9XA 5EE1A 4XWKA 1P75A 4DVGA 1SXJD 2CE2X 2DWOA 1U0JA 3EPLA 4CIDA 1XXHB 2BM0A 2R6GA 4DLVA 5FPKA 1NVVQ 1Z0FA 3L0IB 4IVRA 4OBEA 4TLAA 2N42A 1U0LA 2VHJA 3LW7A 2QRZA 2V6IA 2GCOA 3W6PA 5DH9A 1BO6A 2Z0MA 4DDVA 4LBWA 1EWRA 3OE7D 1WF3A 3Q8XB 4RY2A 4Q03A 2BKEA 3LD9A 1KNXA 2VSOA 2CNWA 5BYJA 4HB4A 4R2HA 1ZIPA 1NN0A 1ZW6A 4II7A 4LBZA 5FR2A 4B2IA 3I73A 2R6FA 1JXMA 3IHLA 1E2QA 5J4YA 2RAPA 1YR9A 2V9PA 1C4OA 1DS6A 4JLNA 4CEJB 2WWWA 4PO9A 4EJSC 5JSZB 1OYYA 4NYMQ 2V54A 4PPQA 1YQTA 3EZ9A 4IKEA 4ESVA 5FOWA 1KOFA 5F2EA 1Z6GA 1W5SA 2HXSA 3CNOA 3NTUA 2DPXA 5KSOA 2IUTA 2OLJA 1GRNA 5GVRA 1X8KA 2F1JA 3TMKA 4EAQA 4JYBA 4DDUA 2I1VB 4Q21A 2WAYA 3UG6A 2O8EA 3K0FB 2Q21A 3DKPA 2V7QD 3ZH9B 4X8OA 1AN0A 1E6CA 2YOGA 2QTHA 3FPAA 3U60B 3VKGA 5B57C 4PFSA 2ERXA 2GJKA 4DLUA 2R44A 1JR3A 3SS8A 4KITB 1N6NA 2OCPA 2RGEA 3NBXX 3IKJA 2ZR9A 1G3IA 3ZS8A 3JVUA 3U7HB 1XFAA 3OEED 3CRVA 4JKIA 3RRMA 1GG2A 4LI0A 4Q02A 2BVNA 5L3QB 2OE2A 2VP4A 1VG1A 4UXJA 1NLYA 5C46F 4Q9KA 2PT7A 5JSZA 1Z6XA 4NZYA 1ZC3A 1F2TA 1RVDA 1WB9A 1PV4A 1II9A 5SZJA 2VHQA 3LBNA 3HDTA 4CGZA 2J87A 1CJKC 2WWIA 1JAHA 5EE3A 4MRNA 4YQFA 4LCBA 2RHDA 4QBGB 1GNPA 5H8WA 4P33A 4MKFA 3Q7PA 2N46A 1DEKA 2B7CA 2RGGA 3U3KA 2ZYVX 4AG5A 1XTIA 3OFND 4WZ6A 1XJ0A 1KKMA 2VP6A 1US8B 1KAGA 1Z29A 4RD2A 4IHQA 1N5KA 1YZNA 4G5GA 3GLIB 1Q57A 4Q00A 3X1DA 3AVOA 1B23P 4G5RA 2J46A 4CT5A 4O2RA 3E1SA 2PX3A 3S1AA 4TWZA 5AUOB 2ZI6A 1VHLA 3KQHA 3FWYA 3R9IA 3LXXA 5L3QA 2O8CB 4HB0A 3CF0A 1N5JA 2YNMA 4B32A 3SFVA 2CK3A 1AIPA 3E5HA 4DLZA 1ZUHA 4RJLA 1W36B 1WDTA 3AH8A 1E3MA 4UNPA 3MJHA 2ZM5A 2V8OA 2QGZA 3QEJA 4Z8XA 3OEHA 5EE5B 5EXTA 3MG9A 4F93B 3CPEA 2HCJB 4YMVA 4IOLA 3U5ZB 1KI8A 2KJQA 1UKZA 4DIDA 1DELA 5HCIA 3KL4A 1S4QA 4Z8YA 4XOIA 2J7PA 2QM8A 4FXPA 2BKUA 3K9HA 4LC0A 2BBWA 1U94A 1OIWA 4HYYA 3GLIA 1M7HA 3QKSB 4KJZA 4IW3B 3D7MA 2VF7A 3PUVA 1KJYA 1SHZA 2VBCA 1M6NA 3WP0A 4JL6A 1KSFX 1T3SA 4Z54A 1G8PA 2XOKD 1DAFA 3GFTA 2C03A 4WBSA 3U6BA 3VU9B 2BBSA 2B7BA 4TYPA 3IDQA 3RRNA 1SHKA 2XNDA 4D2IA 2ZI3A 2KBFA 4C0HA 1G3MA 1PLKA 2DFLA 4DCUA 3GLFE 1U81A 4S35A 1WCV1 1UBCA 3NHBA 1XZQA 2V1UA 4L5BA 3QPVA 3OIVA 2VP9A 5FBLB 3SFZA 3BB4A 1AS3A 4DLTA 1GP2A 1BOFA 2FWRA 2DCUA 3NDBB 5AJXA 2CHVA 1QHNA 3QXHA 3QXXA 1E99A 3SE0A 2EYQA 1GNRA 2PZGA 4HUTA 2BCGY 3VNUA 2DY1A 2EQBA 5P21A 3K70B 3MGCA 3AVPA 3FGNA 2AK3A 3I5XA 1W4BA 2J59A 3O8BA 2YWEA 2ZJYA 3KFVA 3QENA 2ZJ5A 1WBDA 2F7SA 3DOEA 4JLOA 4N0EA 2OILA 2WJJA 1UAAA 4M9QA 4QM7A 2KI5A 1R5NA 5FFMA 1IHUA 4C0KA 5M04A 3C5CA 1H8HA 3VU9A 2GVZC 4EDHA 4Q7MB 1CTQA 1N6HA 2RGCA 1JEDA 3BGWA 4M1WA 3RS2A 2CBZA 1QZXA 5KTYA 1RFLA 1S2MA 1CF4A 1E9FA 3EIHA 1U98A 2WMOB 2WOOA 2WSSD 3VR5A 4Q1FA 3NVAA 3Q85A 4JBWA 2ZRIA 3CRW1 4Q9LA 3KJEA 4JSYA 3QY0A 4P4SB 1RC8A 2G0TA 3A1VA 3A8TA 5B58C 1ZM9A 3TNFA 4ZI3A 3A1WA 5HZHA 4YMSA 1QDEA 3MAAC 1G7SA 4YC7A 2HDNB 4X8HA 1E32A 2YKGA 2EWWA 1SGWA 2ORVA 3LX8A 4OI4A 4YDSA 1ZJ6A 5HPYB 4EFMA 4AYXA 1JJVA 4B6FA 4V0LA 4B3FX 4Q5IA 1XU4A 2AX4A 4MUBA 1EGAA 4M1YA 4GI7A 1JR3E 1YZKA 4A0RA 4G5OA 2RB4A 2WKPA 4MDFA 4OHWA 4Q7KA 4MKGA 4QXAA 3TJZA 4IFEA 5E7MA 3ZIAD 1K5GA 1Z07A 4US1R 2QROA 3QBTA 5KSZA 4TT3A 3A1TA 3WHLA 5CK4A 4JIMA 3TSZA 3DL0A 2IUUA 3ZJYA 1E2GA 2JLYA 4RFSB 3KDSE 2ZIAA 4JKYA 3B1VA 1XTRA 4AY2A 3QBVA 2LCFA 4Q18A 4E09A 4F4CA 2BOVA 3PUWA 4IFBA 2XITA 1X6VA 2YOHA 2FPMA 4UNSA 4QBFA 1P6XA 3U3JA 1CJMA 2ZRKA 4OI2A 2JJ1D 2JCSA 2ZR0A 2ZRCA 3CW2A 1VKJA 2B92A 5J4VA 3K9LA 4LPSA 1U8YA 3KUDA 5L3VA 2FZ4A 1JNYA 4IDPA 3GJ0A 1KK2A 3PR1A 3HPQA 1X8LA 4RD3A 1KK3A 1TQDA 2FN4A 2D74A 2QMOA 4EPYA 3LXRA 1NJFA 4N3NA 1D2EA 2O0KA 3L0PA 1Z6YA 5G53C 1E96A 1G9XA 4D4LA 3ASYA 1BH2A 1OIVA 1A82A 5C4GB 1DTSA 4HDQB 2X77A 5DI3B 4UQOA 4QJ3A 1HH4A 4TMWA 5CYOA 3T06B 3ZD7A 3H4MA 1G7CA 4PZYA 4Q66C 1W0KA 4BFWA 1EX6A 3ICQB 4DSNA 4MYTA 4RFSA 3C14C 2ZSEA 5KNCA 2QPAA 1KZ7B 2A7QA 3NG1A 2CLCX 2QMEA 2WJYA 1FTSA 1A1VA 1VYTA 1GFIA 3LFUA 2AKYA 1VCOA 1J8MF 2BJVA 2AL7A 1R10A 2O52A 3SNHA 1Z0JA 1ZINA 1NNEA 4LYHA 4ZCIA 1ESNA 1M7GA 3KB2A 3Q5EA 1CR2A 1G7TA 4I1UA 2UZ3A 3VX3A 2ANCA 4HAUA 4GOKA 2WPDD 1WP9A 4P4TA 4AD8A 3AF0A 3QKRA 1XF9A 4KLNA 2BMJA 3P27A 1M8PA 3GLIE 4R2IA 3VR2A 1N0UA 2NGRA 5LDDC 1M74A 1ZM4A 4JT4A 2VHTA 1GL9B 4LZZA 3X1ZA 5FI1B 4Q9JA 5L3RA 3FOZA 1XD2A 5B64A 1KZGB 2AD5A 3N70A 4PSAA 4R9UC 3WMGA 4M0LA 1OFIA 4EFLA 4Y0AA 4AYWA 1QHGA 2ZREA 1VPLA 2X2EA 1G41A 4L16A 4D82A 2IYUA 2PMDA 2XJ9A 2KWIA 4KYIB 5FOUA 3KQLA 1F60A 2PT5A 1CU1A 3HU3A 5G3ZA 1D6JA 5TV2A 5JS7A 1U90A 3MFYA 4BFXA 2H7VA 4NCKA 2ZS8A 1CRPA 2FV8A 2W83A 4A82A 2IF2A 2DFKB 1KDPA 2GDJA 4URUR 2WWFA 3EPHA 1ZNZA 4C2UA 1II8B 5LB4A 4LOAA 5L8VA 3BJIC 3FDIA 4OHVA 1R0XA 3K0EA 1IJFA 1MKYA 3PEUA 4C3ZA 3BFVA 4F38A 1T6NA 1NLZA 2QAGB 1G7RA 4MYHA 3GLGA
chains in the Genus database with same CATH superfamily
1GUAA 5K01A 1NIPA 2FEXA 2HMVA 4NPAA 1V71A 5BRAA 1O96A 3C6YA 3F5MA 4LSMA 1BVYF 6GPBA 3W4KA 2JIRA 1TQ2A 1E5TA 4KR9A 1X1AA 1N2GA 1W2GA 4XA8A 1TQ6A 1QH1A 2YJ5A 4E33A 3JQCA 3ELUA 5EWMB 3E7XA 5UKDA 1ZIYA 2HHLA 3PDIB 1N7JA 4H18A 3LNCA 1LWOA 4EQ6B 3B9QA 1M1YE 3UPUA 4FFPA 1JWAB 3BIOA 2D0IA 4X00A 2IHJA 5T5QA 5EJEA 4CFYA 2X0IA 1J24A 3TOCA 2A4MA 3C3AA 2NTEA 2JHGA 4IV5A 3T1VA 4LV8B 4DLAA 4EA8A 1FQJA 1VIAA 2ZU0C 1RKBA 1JHXA 2VHYA 3UGKA 3PNSA 4PY2A 4O4IA 4B3IA 1TD9A 3B12A 1BGWA 1OKKD 4EPRA 3CKLA 4NJMB 3OPQA 3WWOA 1NC1A 1ZCBA 1BD3A 4FJ2A 4M9XA 4XPZA 3LLUA 3O8NA 3LBFA 4YIHA 5K0FA 4JBGA 4F5EA 3G8CA 1DVRA 1TM1E 4COKA 4CMIA 4JV5B 3BH7A 3Q11A 3K16A 1Z5PA 1W36D 3PBKA 3JVIA 1NI5A 1UDWA 4HAVA 1QYWA 1ISRA 1XB2A 2O3JA 4QREA 1JTFA 3WLOA 3KJZA 1Z7EA 2CCKA 3SYLA 3W5DA 4MP8A 3HP1A 1EDEA 1NSYA 3Q1LA 1ZUIA 4MGKR 3WJ1A 4B7ZA 2GZ2A 1DV1A 2JFPA 4W99A 1Z8DA 1P4AA 3EG9B 3IULA 3JCZA 1A0OA 4PLYA 2WIFA 2NU9A 1VTKA 4Y6QA 3T5CA 3ZIUA 2ZJ3A 2AX3A 2CLDX 4QEKA 3U2QA 3PG5A 3T95A 2Q1XA 1VBMA 3NUGA 1YOVA 4EQ6A 4JBNA 1PWEA 2PJDA 3C16C 3L6EA 1RFGE 2XA9A 1JLKA 4KR0A 3VPBA 2CYCA 5A5EA 4GPZA 3D3WA 2ES4A 2WINI 3C45A 2JBAB 4L75A 4UULA 5ELMA 3UWKA 1I6LA 3QFHA 3OAAA 1RTKA 2B8WA 3OJXA 3GP5A 1OZFA 5EJ6A 3EMBA 3NHWA 3OTWA 1XCOA 4ZO7A 4N01A 2GYUA 5BSRA 3ONDA 5HS4A 5KKAA 1R8XA 3VO8A 4WFQA 4BQOA 4M54A 2CUZA 4MUHA 1DE0A 2QVCA 2W9XA 1TTPB 3TINA 1IRXA 2REBA 3CLRD 3DCNA 4KXNA 1IQ0A 1NY5A 4H3SA 1FFGA 2C61A 5EWLB 1F3LA 3ETEA 5BW5A 4QVIA 2OCLA 1LGYA 4QU8A 4QGSA 2I22A 2J5KA 2JGDB 2W8BB 3H8SA 2YV5A 2QW0X 2E1PA 3O73A 5IN5A 4F6LA 4ZYUA 2HW8A 2ATVA 1B41A 2M2IA 2H5IA 3UCEA 2J41A 2NZWA 3X1YA 4E08A 1GRVA 1X7GA 4IIEA 5I7EA 4NQRA 1FLAA 1MX3A 1OWOA 4ZAWA 2GXAA 4HXGA 3MJCA 2NAPA 4M0DA 2F3QA 4FN4A 2P40A 1NQUA 5DHFA 3BMXA 5KYUB 2JK1A 3ROKA 2GAAA 3IVMA 2AYZA 3EDMA 3IPYA 1WLYA 2HFJA 1PU2A 3INTA 4NV0A 4S1OA 1H2BA 4F4FA 2VP5A 2I80A 1OD6A 3AX6A 4NSNA 4H1UA 1H5NA 5T6BA 2YW2A 2WM9B 3IDZA 1MABA 4AJIA 2ZCUA 1UBLS 3W06A 2YJZA 1F1BA 5L4NA 2W0MA 2C7PA 1UBRS 4DPKA 1N2OA 5JDIC 4I4TA 2GTPA 1JXOA 5IK2A 2P9YA 2FWJA 2OV8A 1KAQA 4Y1EA 2V6FA 3O8LA 1WXDA 2LWIA 4KPUB 1MC4A 3U3MA 1UOEA 5EWLA 2GYWA 4MYRA 1ISIA 3KZKA 1Y9DA 4EDFA 2AB0A 2GD6A 2JLBA 2CVHA 3U4GA 4RJJA 1KEVA 1V25A 3G59A 3VH2A 4RF2A 3IDFA 1UBGA 5BW4A 5BN3B 3IP1A 4H1HA 1UMKA 2R5WA 3OZFA 5GADl 1ZJ4A 3ZCTA 1P61B 2W7TA 3AFGA 2VQSA 3PYXA 4F1JA 4DCGA 1STOA 4MQLA 5KTSA 4DNOA 3TXAA 2FSGA 1EVIA 2OB1A 1PI3A 3OPVA 3P9QA 4B3XA 4M0EA 1KSGA 4ZVPA 3D4NA 5TJHA 4D3FA 2XAAA 2BGKA 3NASA 4BQSA 1NW7A 1IN4A 3EXFA 3HN2A 5JNVA 4XKJA 3PUHA 2C94A 2ZRHA 4FPXA 4CCSA 3CEAA 3JZIA 3H2HA 2ZBGA 4DEVA 1ZLYA 4JHXA 1WPQA 4EGQA 2RGXA 2GZAA 3L7MA 3V1UA 4Y2GA 4EZEA 4Y7CA 2ZWVA 5JJKA 5B53A 2FQQA 1UBSB 2VSFA 4W8OA 3MS2A 2HMTA 2O57A 2YQ4A 2HDHA 3R7DA 4LJRA 3C3XA 1VQ1A 2JLRA 3KE9A 3NAMA 2EEPA 3FHOA 1K5HA 3LY8A 4DJ5X 2XGJA 4ALKA 1L2TA 4ZCRA 3CVYA 4JJKA 4DLLA 1UFOA 1QO9A 4YUZA 1W75A 4G4SP 1T8PA 2GJ9A 5I9SA 3DP9A 4X60A 2W2TA 4YMTA 1GRRA 4YS6A 5JCJD 4C2AA 1A9TA 4TUYA 5EQJB 3OI7A 3QKUA 5SZHB 3WLKX 3HCRA 2XXJA 2YVKA 2J3IA 3U61B 2IQ5A 1ZU4A 2QTWB 2WUGA 3K1TA 4Q7EA 3V8BA 1VXOA 3TIFA 1HQYE 4G1FA 4ER5A 4H7DA 4YGXB 3PUXA 1UT6A 1W29A 2C8VA 3EVNA 3RUHA 4F21A 2EKZA 1Q20A 2X9VA 1OLUB 1L4YA 4HEQA 4YAKA 7MHTA 3Q5GA 1O9BA 3OPNA 4HWTA 4MAMA 3CWQA 3IOEA 4FYIA 5AOVA 3TGWA 4YV2A 2H8GA 2XKAA 3EW7A 1K92A 3HJBA 4HUQA 4ZCMA 5LA6B 2UYCA 2QZSA 5CJJA 2QORA 5EJ2A 1R74A 2HJGA 1LRJA 4WAUA 4EJ0A 3JU3A 1UC8A 2R79A 1IOZA 3ZZ1A 2O8EB 4DBZA 4AG6A 1EQUA 4Q9HA 1D07A 1YQDA 4QGGA 3WLSA 5F23A 1TPZA 1MX9A 2L0XA 2NWQA 5L53A 1T0JB 3OUTA 4I36A 1YJQA 4WZAE 4HH4A 1VBNA 2DR2A 1WCWA 2IHUA 4GMKA 5EMMA 4AFNA 5ICEA 1NVAA 2H57A 1C0LA 4WVLA 1E2LA 1SMKA 4DCMA 1K6XA 1E1MA 2C9CA 1TU3A 2NYVA 2X3FA 2IYVA 3LGSA 1H2WA 5ALVA 4QDZA 4WIAA 4D1YA 4RKRA 2VQ6A 5AR1A 3FNEA 5LDGA 5IJXA 2F43A 3W0LB 1EX7A 2JLCA 3U3OA 3JR7A 2FPGB 3V1MA 1URPA 2R84A 3SEFA 4ZIRA 3ABRB 1F0PA 3KDAA 4TS9A 4Q7JB 5I9LA 3TK1A 3LC2O 4WLUA 4IDQA 3SICE 3SK0A 1BA3A 3FVVA 5A4AA 3QF4B 2RCNA 3P94A 1DX6A 1YVUA 4WOJA 2PUJA 3GUHA 5AXBA 3UH1A 3AWIA 3BWVA 3HWRA 3RSLA 2NO4A 4R5MA 3Q9UA 4BRZA 2AH5A 3PEVA 3SYMA 3V1YA 4NS1A 4BZXA 3QXGA 4TLEA 3CISA 3ITDA 3FYUA 4L3VA 5ECGC 1DKRA 4GZ3A 1L5KA 3S8EA 2R5FA 4JVMA 2V03A 2C8KA 1R37A 1MT3A 4QPPA 1L8OA 1Q44A 2D2FA 2DHRA 2F1OA 2G6BA 3K0AA 3B8EA 4NH4A 6AT1A 2RGWA 3JS5A 3QITA 3PFKA 1PGPA 1CS4C 5T3UA 4JBHA 5JS2A 1UKBA 1IHXA 5JWRA 4KIJA 3U37A 2RAVA 3RUIA 1S3GA 4IY1A 5AJZA 3GRAA 2X0RA 1MAWA 3DT8A 3ADCA 3PICA 4HZGA 1RBMA 5EJGA 2HIHA 2FCAA 2F8TA 3BRWD 1QYRA 3S1AB 3DO6A 3CXUA 4PAWA 4YJFA 2C7VA 1K9SA 2A0KA 3M1YA 3CUUA 1EK2A 2J30A 2ZXEA 2IUYA 2JCXA 2ZBVA 1GSHA 3K0KA 3K71B 2ZQ5A 4LSGA 3K2EA 1W4ZA 2A8YA 4EB3A 1EX1A 2B6NA 1BDIA 1O95D 2MSNA 1Z4LA 3QF4A 5I51A 3ZGVA 2JFVA 3FXAA 4M0MA 2FMKA 2P67A 4W9NC 1EFAA 4EYGA 2F48A 1AKEA 3G02A 4DR4B 3PZBA 3B1FA 2Y92A 2GERA 3QEAZ 2GFHA 2A94A 2BTQA 2ZWAA 2DVMA 5GZ6A 1Y3IA 1NUQA 3GPBA 3MCTA 2EKPA 2FN9A 3BA1A 1DJNA 5JH7F 1Q1BA 2YVLA 4JLVA 3CIFA 2FQWA 1C7RA 3P9ZA 4GPBA 1NW6A 2P2YA 2UAGA 4I14A 3FD8A 8OHMA 4UM9B 2LRHA 1MB0A 2REXB 3E9EA 3QU9A 1Z3IX 1QKJA 2Q4RA 4KQ6A 2WMNB 3FFAA 1PR9A 4KE8A 1UF9A 5EP4A 3G8AA 5EMKA 3U3XA 2QI9F 1ZHOA 1Q1AA 1AKQA 1KYVA 1UPCA 2IH5A 4AWXA 3AVVA 5BNIA 2OHOA 2ODEA 5A5VA 5IF3A 5IZCC 1QP7A 1Y7TA 3OUUA 3GGJA 1NW9B 4L9AA 2YXLA 3V00A 3WMFA 3QEBZ 4AK9A 2PV7A 3VFDA 4LXUA 1Z16A 1HDXA 3AF1A 5H70A 5IWAB 2AN9A 3AY7A 4UDOA 5ITWA 1FJ2A 1DKOA 1LW7A 1UBHS 4G0NA 4B84A 3G0IA 3X2SA 2NQ2C 1GFSA 2HJ9A 4QECA 5AI0A 4YJ2B 1D8AA 4BPBA 4HDNA 4KGXA 4YCBA 5JAPA 3DD5A 4B3DA 4A2WA 3MT8A 3H9EO 2LVBA 3SHWA 1OBVA 2AFIE 4US0R 5G4KB 4HRXA 4W63A 4UVIA 1F0YA 4B6JA 2RD2A 2BEUA 2ZYRA 4CLDA 4DCNA 4J91A 1PJCA 3TQIA 4RH3A 2INGX 1AO0A 5JAIA 4PQRA 5A3RA 2OLKA 2BGUA 2EKQA 1FMFA 3HA7A 1YF3A 4RTQA 2H85A 4Q1VA 5AT1A 2LCQA 1V6SA 4GDMA 2DX7A 3IUMA 1E1NA 5JZ9A 5H4GA 1DIAA 4Z1OA 1MOZA 4QNRA 5JPIA 4MIKA 1GN8A 4OHFA 1T4GA 3V34A 1RRFA 1PQPA 4JX8A 2OCIA 3VU0A 2CF6A 3M4ZA 3T7KA 3C8UA 1DZIA 2W2NA 2C2YA 4NYIQ 5JWOA 1Y5IA 4HGRA 3CX4A 3RSFA 1JWBB 4K46A 5AOCA 3JZFA 1TQ4A 1M2VB 4CF7A 4F4HA 2HY7A 3DDHA 2J67A 4WQMA 2KB0A 3G8DA 4FFSA 2VT7A 3UYKA 5HQ3A 4RU1A 2B5WA 3FHTA 1RHQA 3K9CA 2RAUA 2ILVA 3DVRX 3GEDA 2H11A 1QE5A 3GT7A 1GA4A 4BMVA 4BC1A 4UUOA 2BL4A 3Q7QA 5KNLA 3I2JA 1S8FA 1JVSA 4OX9Y 4U3JB 1N2SA 1WF6A 2MWMA 3F98A 1J7KA 3GGSA 2WT8A 1DU4A 1MO6A 2J09A 3OIUA 4O2BF 4D6PA 2NTVA 3KU1A 1UL1X 2P91A 4RGYA 5KUTA 1IPEA 3PTLA 2HAEA 3AHEA 4OMFG 1S0UA 3EW9A 3R7NA 3N8GA 1FFCA 3H13A 1RI3A 4MAAA 5FO0A 4DILA 2E3JA 5E7JA 3KKMA 3CH5A 3R6DA 4MV5A 3WFJA 1XRMA 4HH1A 4RVCA 2DLCX 3E27A 2MYPA 3TTYA 2QLTA 4G0VA 2GPAA 2NPIA 1RHJA 3NKVA 2Q45A 2ZBRA 1UZUA 3GI1A 4O4JB 3IUEA 2WB4A 3NTRA 3IAFA 3BERA 3V9PA 4W9MC 1I2DA 3URKA 1A2BA 5IUJC 1PVDA 3K70B 2OYRA 1XX6A 1UJ6A 1VHWA 1GUDA 2FQ1A 4PXAA 3BWMA 1UKVY 4UREA 5ADVA 2ATEA 2XECA 2XYPA 1NU8A 1PW7A 1VL2A 2VYNA 1QGAA 3PFGA 4FDVA 4A0FA 4BBJA 3ZGXA 1WMBA 1B8NA 3OJOA 3E3MA 3KKNA 4GPEA 5GP1A 3WZLA 2RGUA 2CXPA 1D7OA 3W3AA 1DBQA 4B8WA 4C04A 2PBZA 1A4XA 4JEMA 2I54A 1AVTA 4ZQBA 6REQA 2Y0DA 1DT5A 5EHZA 4CQMD 2AZDA 1XP5A 3KZOA 3LUKA 1YDWA 5ICGA 3WK7A 1IN6A 1CY0A 1MHPA 1JSLA 1NQVA 4JWTA 4XR4A 4MVYA 4RL6A 3LWNA 4RTNA 2ZXUA 1N25A 2QTMA 4FYYA 4EGCB 5AK5A 1J9ZA 5F2NA 1TW3A 1JB1A 1DKNA 5LIPA 2VF4X 2AG6A 4RZQA 4ASUD 5FWYA 2CNOA 3VR3D 3DEZA 4EUFA 3EX7C 4HAWA 1QWSA 3QJ5A 4XDYA 1CQIB 4H0NA 1PR1A 4XWGA 4RMGA 5T67A 4O08A 3J7AC 3PXGA 2VDQB 5BWBA 3T7DA 1BZYA 1NHGA 3IUJA 3O3CA 4JP2A 2UUCB 2HWUA 4AZ3B 1M2JA 3ISTA 5K8IA 4RA6B 4XASA 5FQOA 1ZITA 1XFDA 4X3CA 4QHYA 3KPVA 1MG5A 4HMOA 3C0KA 4KEAA 3EQ8A 1Y1TA 2D4HA 2P41A 1KJ9A 1XDUA 3KEFA 2AXNA 4E3WA 3VZBA 3F0TA 3VO2A 2ODAA 5JPDA 2R68A 2FLWA 3SKYA 4EYEA 5L4LA 3OT1B 2O50A 3LYLA 1PVOA 1QAQA 2C3OA 1KO7A 5J63A 1W1UA 3K09C 2AI1A 3TS1A 4TSFA 3LUJA 4TL8A 1XP8A 3W90A 5IT5A 4ZEWA 1LBSA 4GC5A 3SMVA 4FSHA 2AZTA 2QR3A 4P3YA 4MWTA 3JRNA 4Q6WA 3I6IA 3M4JA 3OMWA 2PFGA 4OJKA 1QFSA 2VH5R 2YCLA 3BHNA 4RCZA 3FE2A 4Y6PA 3U9LA 5BSHA 3H9JA 4NDZA 1CJUC 1SD2A 5BURA 5CFZA 1AD2A 5DXJA 3H3XA 5B1EA 1P1RA 1JILA 3FWNA 4PBSA 1N8SA 3LHIA 4FDUA 3RC9A 4EOGA 5F9HA 2YWHA 1O89A 4PLGA 1SVOA 2AVNA 1BW9B 1GTL1 1R4NB 3AJRA 3VR4A 5ES4B 1KTIA 3WQQA 1Y3CE 1LZLA 1IXZA 3ANMA 3IE1A 4UTRA 1E2DA 1WW2A 1HYHA 1K7XB 2XEXA 4IDDA 3AINA 3OZVA 2C82A 1B76A 3ZU6A 4BKMA 5IF9A 3U4IA 4V0QA 4OYRA 2V3VA 4KX5A 5L9AA 2VJCA 1AGXA 2NZVG 2YDXA 4W6QA 5DNWA 3RC2A 1YVPA 2WJPA 3OZTA 2GD0A 1JQDA 5E3JA 2Y1LA 1FMCA 1SIUA 2QTGA 1SXIA 1L7AA 2DJIA 4NKRA 4Y1RA 2JD2A 5BR7A 1ZONA 4P7FA 1G6OA 2A5JA 2V97A 3LPCA 5IFLA 2FMXA 3VJLA 5BSFA 5JJLA 3RS3A 3VSDA 3LKZA 4JMPA 2AQKA 3GIDA 4MUJA 3UWMA 1CB7A 5I7UA 2PUDA 1XF1A 4GBMA 3PX2A 4BRWA 2D59A 1NUHA 2C96A 2FWAA 2OCAA 2YQ5A 1PNTA 1COWA 4N0DA 1R1DA 2H1CA 4QOFA 2W6PA 2R8YA 3IPAA 3F46A 3TEMA 1ENZA 3TXYA 1JLHA 2HWXA 2QSYA 2ZEJA 4RZ3A 1BH6A 2Y1GA 4HVAA 4MPJA 2V9CA 1XLTC 2FA9A 5KO2A 1JR3D 3H3FA 3QWFA 5IXSA 2SBTA 2DTXA 1SU4A 2XTMA 1KEUA 3HJRA 1A5BB 1ISSA 2FW9A 3Q2OA 3H8JA 3AIIA 3P96A 4AJLA 1OXMA 3QVUA 3D43A 1W36C 3JQ6A 4MEJA 3DAPA 4MS1B 3B5JA 4LQDA 4TLCA 5EP1A 5HFJA 1QAOA 3V8VA 3R5FA 5CRIA 4QDUA 3H5TA 4U7GA 3HTXA 1ZR2A 2WJHA 1DB3A 1KSJA 5CR9A 1E1RA 4CT4B 1GCAA 2A2ZA 3TQHA 3ZVMA 3U1BA 2VF8A 1Q95A 1JBKA 2F00A 3JXEA 5E38A 3RTCA 1VRCA 3KUXA 4L6IA 1I1HA 1GPLA 4N3BA 2R2AA 5K0BA 1EWTA 3UTCA 3IAS6 4RYDA 1CEQA 2XWJI 3L40A 4EPWA 3EBPA 2FMIA 4FOTA 5IKEA 2E1RA 3WBBA 5MFZA 2I78A 1A72A 1WMDA 1I8TA 4J0KA 2VEDA 2P2ZA 1CCWA 1G8YA 1SQ6A 3WHPA 4CUKA 4DRYA 4DQDA 2BV3A 2ZE6A 1RZVA 2BGRA 3GOQA 1AS2A 2Y4OA 1Z5VA 2J9XB 3KP1A 4PYKA 1QQ5A 2H7YA 4PQYA 4EMUA 1EFKA 4Q01A 5DYTA 2PUFA 2XCIA 4PC3A 5HJ5A 5JDIA 3LT4A 5EZYF 3IQXA 3CLRC 1T2AA 1JPUA 2O7NA 4JMLA 1NT4A 4WASA 2C29D 4WY8A 5K3BA 2VZ8A 1F5SA 1CERA 2IXAA 2ZATA 2AS0A 4DRZA 2O8VA 1J20A 1C29B 1NVKA 3TAXA 3WXBA 2CK3D 3AO0B 2RGNC 1ONPA 1AF7A 5SYMA 3UFBA 3L4BC 4H7HA 1YE5A 4KQXA 2GT1A 1BFUA 2ZB8A 4B82A 3UGJA 3GJ8A 2DKNA 3H2JA 3RU3A 2QHXA 4OL9A 5M29A 4KN6A 2ZVPX 5EE0A 1VBFA 3VJMA 3G5LA 2BHTA 1JSCA 4EL0A 2DXIA 5AXAA 1KJQA 4LDNA 1TA4A 3QLEA 4K5QA 1J8FA 4RJKA 1CRQA 2QU8A 1QGZA 3ZY2A 3ROEA 4W5WA 3QGMA 4L8GA 1LF0A 1I4OA 3M5WA 5EHNA 3ZQUA 4BAUA 1E58A 3V4SA 4J0FA 1UK7A 4PSDA 5TR9A 1ODFA 2A9KA 4KSYA 3ZCXA 3I61A 3O1HB 5DSXA 3BE6A 4XM1A 3CVWA 1XNRB 1MCZA 1DJMA 821PA 2BRUC 1ZUD1 4BVEA 1ZJWA 4KPYA 3SQMA 5KQGA 4CM4B 1GZVA 5KJEA 2ODTX 3AM4A 1K7EB 3P4YA 3PENA 4RQTA 2BUBA 1LI4A 1XAIA 4Q47A 4ZJPA 1XYYA 3EY9A 4H17A 4XYMA 2CL0X 2GYVA 3GDWA 3PFNA 4GU5A 3ILXA 4RM2A 4PLTA 2JJYA 3CZ5A 3N53A 4ZVUA 4JYAB 2ZIUB 3E0QA 3I9JA 3WP1B 4BNXA 1A9XA 2J0UB 3UNXA 1BS1A 1KO1A 5EIAA 4FZ5A 3OEEA 3T1QA 4F8YA 2QD3A 2QN1A 2WTXA 5JJIA 4FHDA 3TNLA 4TWRA 5BMOA 2VA9A 1WPGA 1M8GA 1C41A 4FYJA 2F1KA 3W2TA 5DWQA 2PSJA 1GV0A 4UM7A 2DYKA 4BMYA 1GTZA 4L8VA 3LXMA 1XK6A 5HUQA 3JZDA 1Y8CA 1EKXA 4ZMRA 3F3MA 2CWDA 3HB9A 3DMGA 1JU3A 1SB8A 4KHZA 4QU0A 2FEMA 4UBIA 2IXDA 2QY6A 2XT0A 4M38A 4P0TA 4UDXX 4TTPA 2P8SA 2QYSA 3BE8A 4HNSA 3FZEA 4P7KA 3DWGA 3BDAA 3THSA 1VGRA 5CFOA 2PH3A 1T25A 4BKQA 2R48A 3TDKA 4CM4A 2L42A 4PHTA 4GLBA 3Q6MA 1EVZA 2Z09A 5LZ8A 4X1IB 3NGMA 2YCBA 5FWNA 1CR4A 1U7TA 2J9RA 3UT6A 1CZHA 3UAGA 4KK3A 4CRWB 1CSEE 1UDRA 4HVCA 1W25A 2J0UA 3D4OA 1W7AA 2FP3A 2G1AA 2QD4A 3BB1A 4JVSB 2DAPA 2P1DA 3SU8A 3UY4A 3QK7A 3H2ZA 5DNCA 3AMVA 2NU6B 1UOOA 4IUYA 2Q2OA 4GGPA 4OYLA 4AC9A 1L5QA 1P0MA 4L5JA 3T34A 2HQOA 5FOSA 3SQWA 2OPHA 1J2TA 3PCTA 2XYVA 4GZ5A 3TLJA 4HDRA 1WR8A 3JRWA 4URHA 5EZSA 1W93A 4AURA 4OMCA 5AKJA 3HQ4O 4CCWA 4WK6A 1NXTA 3T7EA 2XRYA 1LD3A 1YFKA 4R3NA 2E5WA 3B2QA 2PVSA 5DM60 1U9IC 1I7QB 4C1BA 3SX0A 1ZHHA 1QZUA 3FFTA 2AMVA 4DLKA 2DULA 2J6BA 1DKPA 4ROTA 3UMCA 4Q6BA 1PIWA 3M89A 3ES9A 2QX6A 1OTYA 3PUIA 4IMJB 5J9FA 3GLHE 4D8WA 1E3LA 1OI2A 2D13A 3UGTA 2C7RA 2Y77A 3DAFA 2HZBA 1J99A 4CQLB 3NQ41 4N6NA 3W2EA 1LDBA 2C9OA 3UM9A 1W5BA 3NIBA 3UC9A 3JARB 1ZD9A 2AMYA 4ZOLA 5CFNA 3ICVA 2GNAA 4NOKA 4N5NA 3WGHA 5LN1A 1FOEB 4WN9A 2JAHA 2QL6A 3E3NA 1P31A 3OCYA 4WW0A 5CNKA 5CYPA 3GRUA 3HSKA 2YIDA 4TT3D 3V42A 1B93A 4MZXA 1S01A 5AJHA 3EGDB 3ZCUA 1ZQ9A 2JFQA 5HX7A 2O8BA 2FEWB 4X6UA 3O74A 4K2HA 4O33A 2O7SA 4GSLA 2FKAA 2H2HA 1X1SA 2IDMA 1YAJA 1MUUA 4RIFA 3WICA 3QP9A 1PT6A 3KJGA 3O4GA 3PVSA 3OTGA 4LZJA 2V1XA 1QVRA 1XPOA 1WX1A 3O8QB 4HTFA 4AJOA 3SIPA 4QLBA 2XQIA 2C98A 3M9XA 4JR2A 3RSZA 4JP1A 4AO8A 1KFKB 4FMPA 4QUDA 3OLXA 3DV9A 4IIGA 4KQKA 3O38A 3UJ3X 4W9NA 4R8RA 1M10A 1D0VA 1K3FA 3T4EA 3ZU5A 4A23A 1FXSA 1EAYA 1VI6A 2HMYB 2GTIA 1L4GA 1OT5A 4CQLA 4Z51A 5IRCD 3B6EA 2LW7A 4YMHA 3DCJA 1XQXA 4PFJA 4RIEA 3ER6A 3TRFA 1A8SA 3IT0A 3FBTA 1J00A 4UDYX 3G13A 1KIFA 3ZCPA 3HXMA 1VPTA 3EIOA 3LPAA 3ML1A 1EWVA 2IPLA 4YAFA 2DUMA 2I87A 2IE0A 1Q6ZA 1S1CA 3PRYA 1CC1S 1DC4A 3T3MB 2JFGA 5TIIA 3SSMA 2V4MA 2PL1A 2DPYA 1DADA 4X64B 4IXDA 3L0CA 5KNCD 4K2AA 4ND8A 1QQ6A 3EIXA 4R1UA 4KVAA 4I55A 5G1OA 1K3UB 1KC1A 1M5TA 1MMFB 3PD0A 3QVMA 2GZMA 2WSSA 4GHWA 2XYGA 3OQPA 3RBZA 4B33A 2BTOA 1DAHA 1VLJA 4AB1A 4G0UA 2RHTA 3HZOA 4G3XA 4IEFB 4MP6A 1NWCA 1WUIS 3M2TA 4YRFA 1O95C 1R50A 2VZ0A 3Q0IA 3ND7A 4G97A 4LI3X 1RLJA 4TXNA 1L7DA 1TUIA 3NEPX 4LJYA 1IBMB 3UXYA 4BV8A 2XEDA 3O3MB 4UCFA 4DBVO 2Z1NA 1HURA 4WXRA 3QX8A 4HYQA 4CR6A 2WYUA 2B9EA 2E89A 3E7PA 2C84A 4WXPA 2WEKA 1DTWB 1TF5A 4FTWA 5AKEA 1ONSA 5JROA 1N36B 1Z13A 3G9UA 3ONFA 3IE0A 3WNVA 4ON9A 4B48A 1CDDA 6Q21A 1QZ3A 2I1WA 2RB5A 3C1TA 1WQ1R 3EA0A 2PCLA 1VDMA 4JEIA 4MUEA 4TMFA 5EZ6B 1UPFA 3NC4A 4MP3A 4K9MA 3GV0A 4JZKA 1IPHA 3WIUA 4BATA 4MGIR 3K2BA 1RJ9B 2H2WA 4ENQA 3DZGA 3OKCA 3AIOA 2ZKIA 3Q6IA 1CEXA 5IMSA 2P2GA 4L76A 3SC6A 10MHA 2GWHA 4P54A 1NVWQ 3EFBA 3B1YA 1RAHA 1TVKA 3EFOB 3QOYA 2ZFUA 2B8JA 1UZMA 4CL8A 1A77A 1FNDA 4H6XA 1NJSA 4NH0A 3WFIA 2B0JA 3F7MA 5LXTA 3W5CA 4U8GA 4B4KA 1J70A 3A1NA 3ESZA 2RHMA 2RGDA 3A04A 3ENNA 3ZDEA 4ARCA 3VPXA 5F3WB 1P0FA 2GS9A 2F1HA 3RS4A 4I4LA 5JR3A 1FMJA 2FSVC 4U7HA 2GJSA 2GJ8A 3I4FA 4M7RA 1V8FA 1Z6TA 4QUGA 4XLLA 2H1OA 4UBNA 1UEIA 3W34A 1K66A 1RQ2A 2GK4A 2QWXA 3FWZA 4NEHB 4M4SA 2XVMA 5TDHA 3PHIA 2VQEB 1L4KA 2ZRLA 5GVSA 2IPAB 4AS3A 4BJ1A 4CLXA 4R98A 3SHTA 2WSMA 1V5EA 4PVCA 1LNSA 4WLEA 1B6RA 2WJIA 2W98A 2PXCA 3N87A 4HN2A 1DUVG 1BE8A 1M6VA 3AHIA 5COAA 2AFHE 5FBWB 3QTTA 1BSVA 1GQ2A 3CA8A 4EGJA 1ZSYA 1IBCA 1Z34A 3UJ7A 3IV7A 4YK7A 1WA5A 2ZSFA 2HF2A 1PDVA 2XY4A 4FDMA 4N76A 1TZ2A 5FBQB 2VQDA 4ENWA 1JMYA 1OI4A 3AYXB 3PXCX 1NVBA 2GZ1A 4JAVC 2EW1A 2CE7A 2YTZA 3SP1A 4F60A 4IGIA 3S6JA 2V7VA 1X38A 3QPBA 4ZPXA 4CV2A 2GPYA 4G25A 3MGBA 3V4RA 3FGOA 2Z6UA 2DR0A 1V7CA 1YRWA 2HRDA 4HATA 5DNAA 5LQDA 2P77A 3CJRA 1BTOA 1JA9A 2OB2A 3V2HA 2JHAA 5CXUA 3IJRA 1S89A 2A9VA 4PC2A 4B5KA 5FPYA 4Q4AA 3A32A 2X3YA 4WNYA 1MVNA 2OHFA 2OXFA 3QRWA 4KZKA 1W49A 3DAHA 3ESYA 1QIHA 2D1FA 2WJ6A 4G0OA 4QODA 2QDXA 1SVIA 1MIOA 4NQZA 4DLNA 3REGA 5BSMA 3QY9A 4GPIB 3P20A 4J7UA 3RQIA 2ESRA 5LNK1 3OM9A 2D5AA 2HADA 4G81A 4B9EA 3MAJA 4QYIA 2N9UA 1XTQA 4LY0A 1F48A 2ZAMA 3KJXA 1I33A 3FSEA 1E2JA 4ZAZA 1HLFA 4RL4A 5K0LA 1RNLA 4CYMA 1B00A 2L17A 4NCHA 4XUDA 3V8RA 2I3BA 4L72A 1EJ2A 3FHLA 1G8HA 3H6GA 4BMCA 5LQMA 2WYHA 1NLFA 4I1YA 4ZT3A 4DV7B 4AKEA 1JYEA 3KLNA 4TYWA 3K1YA 5GOZA 3SHFA 1YR7A 5CM8B 4BNJA 4YRTA 4AS2A 4ICIA 3ZHSA 3D5EA 3OT5A 3CLVA 3RNLA 3MNFA 2XXAB 1FP4B 1GAJA 3E3OA 3UCFA 4C7MA 4EUEA 2O5CA 5K5EA 2KS6A 1EXDA 4RXMA 3I01M 1G5HA 5CH3A 4NS4A 4LHVA 1I10A 3RDPA 3M6IA 4LOKA 4LSWA 5ERYA 5BT9A 1CNMA 2Y66A 3KCNA 4LZPA 3RB8A 4O2AF 2H00A 3P0IA 3TQTA 5LIRA 1VSTA 3KR9A 4J3NA 4C0WA 1PL7A 2O2IA 1ZIOA 1T4BA 2GCNA 2E4AA 4MHTA 4FNOA 4LYFA 4EB8A 1VM6A 4RY9A 2XTNA 2V3WA 4ADSG 3OWHA 4LNAA 4TTSA 2PS1A 1SH7A 3DEKA 1E0JA 4S24A 4TROA 5DASA 3CNEA 1JQ3A 1M6WA 1ZDMA 2O0HA 3U4DA 3T1YB 3KWJA 3NIWA 5JYCA 4MK4A 3K09A 2ZZKA 2BGLA 4UBLA 3RSOA 3USCS 1QF9A 3TN7A 5K3SA 4ZGWA 3KPWA 4JITA 2REQB 2VZLA 4U7WA 5AI6A 1EXWA 1ADGA 5CLJA 3HGQA 4W4TA 3RUCA 4BJ5A 1J2UA 2OFXA 1Z0UA 1V11B 5HFAA 5KYYA 1MPTA 5BVHA 3O2QB 1NFQA 4BXOB 2Q2NA 2D0OB 4NEGA 1R66A 5SZIA 3HR4A 1G4AE 3JD0A 2I4TA 2JFYA 2X15A 3T7JA 3FUWA 4IIJB 3I2GA 4JP8A 3IOBA 2BKVA 2X8AA 5AKZA 2HF8A 5J4HA 1HFWA 4CF3A 4GP6A 1P6QA 4HPXB 1UPAA 1TLLA 2VRCA 3DBLB 3L8FA 5HE8A 1M34B 3L0YA 1DO0A 1X9GA 2ZYDA 4C5BA 1B2LA 3ANYB 3GLUA 1P74A 4BBZA 5JC1A 3C3JA 1A88A 1V4BA 1OTXA 4XQGA 1GTVA 4WNIA 3ZV4A 1Z45A 3TX2A 4DBLE 1YS6A 2QN8A 4MZDA 3SPXA 1LTKA 3ZDBA 4BRUA 1JN0A 1E0SA 1BFDA 3BOSA 3FROA 4LJ8A 5KDLA 2V9ZA 2F8SA 1ICIA 4D41A 1RRMA 4NBSA 2PX8A 3QWBA 4AW9A 4O25A 3G9ZA 5CJ2A 2IEGA 4IRUB 1RP7A 3OOWA 2HKIA 4NABA 3U7QB 2J48A 1H22A 1M8FA 1VG0B 2JFFA 1CS0B 1IUPA 2UYYA 3KTAB 3OKFA 5FB3A 4C4TA 1F9EA 5DCYA 3ILSA 2YWRA 1TM3E 1XMOB 2GEJA 4FFOA 2F17A 4XQCA 4N6OA 5KC9A 3W5AA 4R4JA 3MLEA 1OKKA 1Y1LA 5CB8A 1XLTA 2W2KB 3TX6A 4WUTA 2J9GA 4M6WB 3ZJTA 3ITNA 3GQBB 5JCZA 1O2DA 3OOYA 2AI3A 2CVZA 1OXVA 1SA0B 3WX0A 1KMCA 1NTRA 1OXUA 3R5XA 3DB2A 3DBLA 1IOLA 1PR3A 3FY4A 3JYQA 4EVSA 1T9AA 3WJ2A 621PA 3N3BC 2O2SA 4LVNA 3UPDA 2IEBA 4LOLA 4C4YA 4Z1MD 1HL7A 1Z2AA 5CPBA 1YDHA 5PGMA 3NS7A 2H5LA 3LIIA 1GGMA 3A4LA 4PF1A 2I8AA 1MU0A 2JC3A 3CZAA 1N0IA 4A2PA 3FPBA 5A4JA 1HNZB 3GUVA 1AM4D 2ZSDA 1JEYB 1ISMA 3CZCA 3HXKA 2QP3A 5C1DA 4Z6KA 1TA9A 2QMQA 2IHKA 3RS0A 3CLUD 1OYWA 2KLHA 2YOFA 4X6YA 2ZYSA 3EFHA 1XNQB 5EJ9A 4OAPA 2IDZA 1D09A 3H2KA 3RGGA 1H2FA 1IJEA 3W6UA 2ZYUX 2EEZA 5D5QA 4D98A 4DAEA 3VKWA 1BCSA 3KTAA 1WL8A 1KP9A 2WHYA 3QUBA 4WLNA 4Q4CA 3E61A 1WW8A 1Q0PA 1EUZA 3AR2A 3K9NA 4L85A 4EUNA 4NF2A 2D3WA 1QP4A 1IPFA 4JDUA 3N8DA 2D7CA 2HHJA 5LYJF 2RHWA 2I6FA 1VKNA 1WCIA 2ZTHA 1RCTE 3LK6A 3VYTB 5DBOA 2MJLA 4YHBA 5DOVA 5ALLA 2O2HA 3A1UA 4PC6A 4GIBA 5DJ5A 1CJTC 1U65A 3D7LA 2RH4A 1FX0B 3F5FA 1QXSA 1Q84A 1EA7A 2CFIA 4U0KA 4RH0A 3RIXA 1CULC 2X8JB 3FIJA 4CG1A 4OXKA 1N3LA 1W4AA 4NYJQ 2X5NA 4C9BA 3SEQA 2GBGA 3MXOA 4MMXB 3T9BA 1JRLA 2B3DA 2H7CA 3GVPA 4FR0A 4OKSA 4QFCA 4XM2A 1QQAA 2FN8A 4IFTA 2AJ8A 3CZRA 3MJTA 2RGNA 3E1GA 4HNQA 4KXLA 5TX7A 3L4BA 4A7PA 5CDUA 1J4AA 5A9TA 2GARA 4BKOA 4CZ2A 4FK8A 2AOXA 1JEYA 4PCAA 5CDFA 1ORTA 4HQFA 5J2TF 3O2NA 5ALIA 3GNSA 3ZXIA 1DAGA 4AY5A