1T2CA

Plasmodium falciparum lactate dehydrogenase complexed with nadh
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 112
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2cA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2cA02
1OC4A 4CM4A 3TFOA 1Z73A 3LT0A 3ZV4A 3PJGA 4ALJA 1K6XA 3K9QO 1E0DA 4W9NA 1YKFA 1LQTA 3PIIA 2C2YA 1U3VA 2CZCA 2X5JO 3CKYA 4E2YA 1IL0A 1QRRA 2B4RO 1GQ2A 1U2DA 2AMFA 2I3GA 3V5NA 1GCOA 1GV1A 3CPSA 3MJCA 4PFJA 5BSHA 5DN9A 2G5CA 2Z1NA 4FBGA 4XQCA 4BB5A 3GFBA 4CUJA 1H6AA 3FBGA 4AJJA 4DBZA 1O95A 4R9RA 2HMUA 1LX6A 1HYHA 2P9GA 3HDJA 1D8AA 5J23A 2G17A 2W8ZA 3KYCB 1S7CA 5JBIA 5CDTA 2W2KA 1CEQA 3AK4A 4UUOA 1E6EA 1IYZA 2YQ4A 1M6WA 3BA1A 3HUDA 7MDHA 2GCGA 4TRJA 5KKAA 4YDRA 2VRCA 1O0SA 4BKPA 2QYTA 3OJFA 1V3TA 2EP5A 2ZATA 2JJYA 4GAEA 1VL6A 2HJRA 4WLNA 1R6DA 4A10A 2ZYDA 3DAGA 1GY8A 3GEGA 3ZZNA 1V35A 2OBNA 3O4RA 4BNHA 5L7WA 2E48A 1R0SA 4W4TA 2C0CA 2Y1CA 4CV3A 4EUFA 1LDMA 5AXCA 4D45A 2QX7A 2ZB3A 3PLNA 2GN9A 4KUEA 3TNLA 3A4VA 3DOCA 4CMEC 1NFQA 4ZQGA 1ZFNA 4K1LA 3P5SA 4J2HA 3V8BA 3GN2A 3P2YA 3SX2A 3AY6A 3UAGA 1PX0A 1EUDA 2VTDA 3ZWWA 5IN4A 1NPYA 4B7XA 3JQEA 3OJOA 4ZQEA 3HSKA 5BT9A 2VNAA 4JBIA 4CM1A 3U0BA 2VZ9A 5KVSA 4EZBA 5BNFA 2WYVA 2B5WA 3VPGA 1LJ8A 4L4RA 5IF3A 2JFGA 1X1EA 1RM3A 3VC7A 2VZ0A 3OBBA 3TL2A 3KOUA 2NTJA 4JJGA 2OMEA 4WLOA 1HDCA 4ND1A 1QV7A 4B3JA 3ICCA 1HLDA 1X0VA 1X7GA 2O7SA 3JQDA 2E4AA 4NPCA 1EVJA 4NBWA 3GY0A 3JD2A 2FSVA 2JKVA 4IJKA 5EPOA 4IXWA 5I7SA 4MVJA 3RVDA 4IDDA 3G1TA 1VM6A 2W4QA 2WJPA 1PS8A 3H3JA 4GWGA 3AJRA 3DBHA 1B2LA 3ZV5A 7ADHA 3E5RA 2VHWA 4HX5A 4M86A 2X4GA 3RBZA 4KTTE 1YBAA 5JFOA 1HRDA 4HFMA 1A7AA 5G4LA 1O94A 4JCOA 3I4FA 3AM4A 4BO3A 2O3RA 1LI4A 3ZCXA 4GX1A 1QORA 5EQFA 4TMFA 4OO3A 3OP4A 4PG6A 1DIRA 3BZUA 2X0RA 3G49A 4FFMA 4ND2A 5FI5A 5L3ZA 3PI7A 4W99A 3RUDA 5HWSA 3HN7A 5ENDA 2RAFA 1DJQA 2O3SA 3E9QA 1UUFA 5DP1A 4MINA 2Y99A 1A9ZA 1IZ0A 4LRTB 4UVDA 3VHRA 1KBZA 2O50A 3JYOA 2FRDA 5TT1A 1TI7A 2Y1OA 4FOOA 2J3HA 3FNFA 3UOGA 3HDYA 3PHGA 4YAGA 2CMDA 5DBFA 3GA0A 1KEVA 3I6IA 1F8FA 5IDXA 4GWKA 4EUEA 1DRWA 5ILOA 3D64A 3Q11A 2ZYAA 3V2GA 1E3WA 1WZIA 2JCXA 3ZU2A 2JL1A 1Y5RA 1ZUD1 2PGJA 4DMLA 2WWRA 4ZD6A 1YDWA 3C24A 4GPD1 4WOKA 4I5EA 3A14A 1ENZA 1H6DA 4XD2A 1PEDA 3DBRA 3K31A 2PK3A 3G1UA 3GLQA 3BMNA 5TRTA 2YHUA 3AUUA 1BTOA 4YJHA 1QMGA 1WNTA 4HP8A 2X0NA 2WMDA 4N7RA 2HMWA 1H2BA 4PLGA 2B37A 2BFPA 4CMIA 2ZKLA 3CZMA 1I24A 3AU8A 4DVJA 5IZCC 1IPEA 5C3MA 3AM5A 1L7DA 1PGJA 2NUAA 1U5CA 5TS3A 3AFNA 3DMTC 5L45A 4CPDA 3IMFA 2EXXA 4GVXA 3CSDA 3A28A 2AHRA 1ADFA 3FN4A 1BXGA 4MVJH 1B8UA 1EK6A 1NASA 2XPCA 4D3FA 4UAGA 4EUHA 4ZHSA 3BIOA 2EW2A 1ZBQA 3M6IA 2EEZA 5CDGA 4Q3EA 1LXCA 5TNXA 5I7FA 3U09A 3WOHA 3AOEC 4XR9A 5FYDA 1H2HA 1C0PA 1WAMA 1Y9AA 2Q4BA 1ENOA 2C54A 3H9UA 5GY7A 1ZMTA 4Q3NA 2YHIA 2X22A 4KP7A 3JQGA 3WNQA 4ALMA 5L4NA 3GAFA 5EJ2A 3VTFA 2GDZA 4AJPA 4DUPA 1K6JA 1LLCA 4BNLA 2O3UA 3BHMA 5LDGA 3RUHA 3W1VA 3WICA 5HS4A 3ADOA 1C1XA 1I01A 1ZCJA 4CQLB 1E1LA 1GZ3A 2I99A 3VVBA 5F21A 4YXFA 1NR1A 5DOZA 3IOYA 2AG5A 3EAGA 4KWHA 3GRPA 2Q1WA 5F5NA 3DMTA 2G76A 4WNCA 1ADGA 2HAEA 4Y67A 3F5SA 3HDHA 1NWHA 1ID1A 1YO6A 1PZEA 5JY1A 1N7GA 1KVUA 2B69A 4G2NA 2GZ1A 4ND5A 5DDIP 3JQBA 1QLJA 3OM9A 2YY7A 3EDMA 4RPLA 4CLXA 1NVTA 1QYXA 4DXHA 3SXPA 4KTVE 1G6KA 4PLPA 5HRUA 4FB5A 1VL8A 1N2SA 3EK2A 4IJUA 3CIFA 1P1RA 3VDQA 2J8ZA 1T2CA 2YW9A 2FSSA 4CV0A 1ZXLA 3JD4A 4FJ2A 3V2UA 2Q45A 1D1SA 3CINA 2RIRA 3G17A 4WECA 1GADO 2O3TA 4NDNE 4J4BA 2GN6A 3RI3A 3R1IA 3MWEB 3GVCA 4BNXA 4ZJUA 2OBYA 5COAA 3AI2A 3OQBA 1SNYA 1JKFA 3FNEA 3ANNA 1ZNQO 4R9SA 1OOEA 1UAYA 3WWZA 4DYVA 3RUEA 2QRLA 1XA0A 1YQDA 4PN3A 2VYNA 2YQ5A 2VN8A 1AXGA 4D0RA 1V9LA 3EC7A 5G0WA 5B4VA 4CLDA 4MIEA 5EMHA 4FN4A 3TJRA 3RUAA 4M89A 3KSDO 4U6SA 3LC2O 3V1UA 3PTZA 1JWAB 1FDVA 1LDGA 5DCWA 4Q9NA 4B8ZA 4OOEA 4RVGA 2VUUA 3UKOA 1XGKA 2GO1A 4O5OA 4Z0PA 3KYDB 2AE1A 3ZWPA 3AY7A 1YQXA 2DAPA 4JBGA 1ZMOA 4CL8A 4TZTA 1H9BA 3ZW9A 2P4QA 1C3VA 3EZLA 5L51A 1Y8QB 3RFXA 1IY8A 1P0CA 2O2YA 1A71A 3GG2A 1T4DA 2P5UA 4II2A 3TZHA 4B8WA 4AJOA 4A7PA 2G82A 3B1JA 1NNUA 4XX0A 4BGEA 5ITVA 5JYEA 4AICA 1P77A 5H83A 2DUUA 3JQAB 3IUPA 5CHEA 4RF3A 2QZ9A 3D3EA 1E7WA 1J6UA 4PCVA 2P4HX 1PS9A 2I67A 1ZSYA 2PGLA 1V0JA 3L9WA 1R4NB 4R1UA 1LLQA 1DFHA 2DBQA 1Z82A 2LDBA 3GOHA 3FPCA 3ULKA 1GR0A 1PJ3A 3IUSA 1OI7A 2GNAA 4XA8A 4BQPA 4Y8VA 3VAZA 5BR7A 2DUWA 1NTOA 4BKQA 1N5DA 4MDHA 2I66A 4FPXA 4MVJP 4ZU3A 3JQ9C 4UEOA 2EW8A 4BO2A 4YJGA 2BD0A 1TLTA 2RCYA 5THKA 1ZK2A 3IAHA 4WCFB 2SCUA 4UVIA 5IZCA 4E30A 2O23A 2YZ7A 4O0LA 4P22A 4DTIA 1T1RA 4ZA2A 4PZDA 1Z45A 1LSUA 1T26A 4RL6A 1I32A 2UVDA 4ZICA 3TSCA 5GZ6A 3B1FA 5H82A 4I08A 5JCJA 2R2GA 4J49A 1G0OA 1QXSA 1B15A 4J9UE 4BMNA 5L4SA 3WGIA 3DBLB 3KYDA 2FZWA 3Q1LA 3KEQA 3ICPA 4P38A 1BRMA 5JMWA 2EKQA 4NZ9A 1Y8QA 1FMCA 1P31A 4CM3A 3EGOA 3GG9A 1IULA 1A9YA 4B3HA 1EVIA 4BNMA 2E37A 4LVUA 3NKLA 4HKTA 3NEPX 1PJTA 3TFQA 4C7JA 5ER6A 3I9JA 4ROSA 1B8PA 3GDFA 3D0OA 1IHYA 5TJHA 2NU9A 3KUXA 3QWFA 1SB8A 4NJMB 4U8GA 2AEJA 5EL0A 4I1IA 4W6ZA 3GNTA 3MCVA 3ZH2A 3WSVA 1EFLA 1R4NA 4PRLA 4FFNA 1GQQA 3D3WB 4BKRA 1P33A 3QWHA 4MVJE 1XKQA 3PZBA 1WW8A 1HSZA 3OQ1A 3PLRA 3ZNOA 3M1AA 1Q0QA 1MFPA 1E7RA 2X5KO 1K3TA 3OIGA 3PQFA 4YEDA 5A03A 4PGFA 4CR7A 4D0SA 4BL5A 5BQFA 4TVBA 1SOWA 4A03A 4MJLA 5F3RA 4E6PA 5HTOA 1UR5A 4JLWA 3AUTA 1Q7GA 2VNSA 1WVGA 4PZEA 2JFHA 3K8ZA 3O03A 3JQBC 3WG9A 3LF1A 3FR8A 1GQYA 5T6BA 5DP2A 2X86A 4RF2A 3DR3A 1PWZA 3GFGA 4YJFA 1XEAA 2ZK7A 3G0OA 4OQYA 2Y1GA 2BI8A 1T2AA 2ZJ0A 4CM9D 2R00A 4AJNA 2WE8A 2G1UA 2OGUA 1WDMA 3ROMA 1B26A 3ASUA 1YJQA 3HNPA 5JCJD 2X9VA 3ZHBA 2J3KA 4H16A 4E2WA 2P5YA 2V6MA 1IPFA 1DC4A 4XJTA 5JAIA 4B79A 3U4CA 3B20A 5G0SA 4MOWA 4GKVA 4RO0A 1W73A 1H6CA 3NGLA 3AFMA 3E9MA 1AN9A 2HMTA 2I6TA 2NLOA 3AOGA 3FI9A 5TJ9A 4DC1A 4DRYA 5A9SA 2PZKA 3C1AA 3WTBA 2EKPA 1J0XO 3ENKA 1NR7A 3CH6A 5JYDA 2HMVA 1K0UA 4R5MA 5TC4A 2EWMA 4IXTA 4CV2A 1J49A 2X9GA 1YONA 4L75A 4MPDA 4DPKA 2D5AA 2HKIA 2OO5A 3A1NA 3NGXA 4EW6A 2DM6A 5DF1A 3RU9A 2EHDA 3WLFA 2DVMA 2O3JA 4CLRA 3W8FA 2P2SA 3INTA 5CG2A 1I2CA 1XQ6A 2UDPA 1K5HA 5L9AA 2GZ2A 5G0UA 1D3AA 1ULUA 4WUVA 4E31A 4E32A 3L6DA 2UV8A 1O5IA 1PL7A 2FPIA 4AVYA 2J3IA 2HCTA 4AFNA 1YGYA 4AJHA 1YE3A 2R00C 2EP7A 1UZNA 1RYEA 4GX0A 5IFLA 3GHYA 1UP7A 2PV7A 5JSFA 1DHTA 4J0FA 5IZ4A 2NVWA 2X58A 2V6FA 3N58A 4IPTA 4W7HA 5EN4A 3GVHA 1E77A 2BGLA 3N7UA 3PGJA 2HRZA 4XIJA 1I8TA 4MIOA 4ILKA 1B0AA 2ET6A 4CM7A 3QVXA 2PD3A 3SJUA 4KUHA 3PWKA 1W8DA 1BG6A 1E1KA 2VOJA 2YV2A 3WYBA 4FQ8A 3TZCA 3WGHA 1P1FA 2B0JA 4NHEA 4YWJA 3PHHA 1YS4A 2FOIA 3E03A 2W90A 2VUSA 5JLAA 1M76A 3KYCA 4ONEA 4CLRB 1NHGA 3E6AA 3ZU5A 2JHFA 1N8KA 4Y6SA 3ROKA 4DC0A 2GN4A 1EQ2A 1ML3A 4OSOA 3EUWA 4LMRA 1S6YA 1NPDA 3JD1A 2DC1A 2HDHA 4ND3A 1EVZA 1QG6A 4RPJA 1PGPA 1PIWA 2IZ1A 2X0JA 4PVDA 2DTXA 1E6UA 3PPIA 3IKTA 4RQUA 2C07A 4I9UA 2NVUB 1HETA 4M49A 1EE9A 5U1PA 4YRAA 3DBVO 2FHSA 1DIGA 5GMOA 3VVCA 2C29D 1X15A 2VYVA 2IEBA 4DQUA 4H7PA 2O4UX 4XR4A 4IDEA 3VH1A 4GMFA 4TKLA 1KC3A 1Y5MA 2XF8A 3Q9UA 4URFA 3O8QA 4Z0TA 3TRIA 4DREA 4RVHA 4CM6A 1ONOA 1FDWA 3C1TA 4RPKA 4QO8A 4EEZA 4UUNA 3VH2A 2A9FA 4RZHA 4BVAA 1Y8RA 1YXMA 4ZQFA 4I9HA 2BH9A 4EJ6A 3VDRA 2JHGA 4EJMA 1EE2A 1OMOA 3GPDG 2NQTA 3BMCA 1JA9A 1E3IA 4RF5A 4J1QA 3QRWA 1NPTO 2C7VA 5CPFA 1B16A 5CEFA 3DBHB 3ZNQA 2UAGA 2I5PO 4IDCA 4XWYA 4WCFA 1LDEA 5KJCA 1W6UA 1D1TA 1R4MB 3TOZA 2JAPA 2ZB4A 2J6IA 1MX3A 2GASA 4KQXA 2B5VA 4HY3A 1KEWA 5IJZA 1H93A 5A4DA 3H9JA 1NP3A 4M54A 1U8FO 1GUYA 1PS0A 1BSVA 1X14A 1JVBA 3ZW8A 5A5FA 3S1LA 3HFGA 4TQGA 3P19A 4LRSB 4WNIA 3SC4A 1I2BA 3ORFA 2WE7A 1HKUA 1BVUA 3FPLA 4PLWA 2W2LA 4LMPA 1QV6A 2O2SA 3FR7A 4FJ0A 1U3UA 1EMDA 1KY5A 1V8BA 1EDZA 4CMKA 1Z7BA 3D5TA 1LU9A 3O8QB 1N1GA 2NQ8A 3PIDA 1ARZA 3OJ0A 2Q3EA 3PJDA 5DCYA 5TIIA 1SAYA 3MJEA 1DFGA 3GAZA 2C7GA 3W6UA 4S1VA 4BNJA 3MTGA 3VTZA 3COSA 3ITKA 4O6VA 2GUGA 1MV8A 3CMMA 3DZKA 4CM4B 4BO6A 1R0KA 5COQA 4PLHA 3P7MA 5JW6A 2PKQO 1E3LA 4O63O 5CDUA 2R6JA 4BUCA 3ZU3A 4XGIA 2QYSA 2Y0DA 1PL8A 1L1FA 5AYVA 5A5EA 5GZ3A 1ZEJA 3F4LA 1M66A 6LDHA 3GZNA 3LSYA 4YAEA 4QECA 1SO8A 4P4LA 3OETA 3LLVA 4WKGA 3NJ4A 1N92A 4KZPA 1CWUA 3GEMA 2PZLA 2NU6A 1KERA 4DIBA 1G0NA 2PD6A 6ADHA 5KOIA 1PJCA 1I2ZA 4E12A 3A06A 1GV0A 3PP8A 2QRKA 4TRNA 2CVQA 3K2BA 2A94A 1H0KA 3GK3A 3L0DA 3NDJA 4MKRA 3WTCA 1GTMA 3S55A 5HM8A 3OMLA 1XYGA 2DTEA 5MDHA 3WBBA 5ICSA 4A5OA 4IS3A 5JAMA 4LK3A 4E13A 3QWIA 4WGGA 1J5PA 4BGUA 4NU5A 4RDHA 3ITDA 3INRA 2HQ1A 5A1TA 3QQPA 2ILTA 1GU7A 1DB3A 2NNLD 1A27A 3KLPX 4PIVA 3DMYA 4XB1A 3S2GA 3GUYA 3SLKA 4PG8A 1TEHA 1Q7BA 3MJTA 5C7LO 1O8CA 4NFSA 3JQAD 4A73A 1LSOA 3GNQA 1YL5A 4BIIA 4FS3A 1H9AA 1QP8A 3EYWA 4E5PA 1R12A 2WYUA 3GGOA 3MOIA 3NDRA 1GFSA 4J91A 2I3AA 3WYEA 9LDTA 3DAFA 1DRUA 1HLPA 2J5KA 4JGBA 3KM0A 4DA9A 1L7EA 4N54A 1LDNA 5G2OA 3UVEA 3LZ6A 4GL4A 1GYPA 5AQ1A 3DO5A 4XCVA 2RBEA 1DC5A 1BW9A 2DT5A 2LDXA 2HSDA 3H4VA 4DIFA 3AUSA 3IDSA 4ALKA 4YRBA 1D4FA 3AY3A 4CLOB 3WQRA 3PYXA 1PJQA 1KC1A 4BO4A 1P45A 1IOLA 3U4IA 4IDAA 5DCUA 2RHRA 3RBVA 4YT8A 3ZWAA 3BYZA 1NQTA 4F6LA 1CDOA 1HWYA 4BNFA 1LRJA 3JD0A 2Q1UA 1R16A 4EGFA 4JP2A 1X7DA 2GGSA 4QUKA 1PGQA 4NBRA 1NQAO 1YOVB 3W8EA 3JTMA 2ZTVA 4R4JA 4R54A 1SOVA 3RCBA 1CRWG 1ZKMA 5DOVA 3DTYA 4RPGA 3ABIA 1ZSNA 3R3JA 1SPXA 2CF5A 3KRTA 4F3YA 2VRBA 4CQMA 4WLUA 2OZPA 1HEUA 1KVSA 1HZJA 3FNHA 3FF4A 3ANLA 3QA9A 4RVFA 3MJ4A 4DWVA 4XRGA 2I65A 1GUZA 4B4OA 4R3WA 5EERA 1V3VA 1EBFA 3HB5X 1KVQA 3QVSA 1A4UA 3I3OA 1NFFA 2X7HA 3DZFA 3EY4A 3GNSA 4B7CA 1PGNA 4D79A 3JQFA 3PEFA 2Q4EA 1DLJA 4R5HA 4YAKA 4MKZA 3QJ5A 1RM5A 3ONDA 1V3UA 4IDFA 5ICMA 4RCVA 3CXRA 3H9QA 5LC1A 5I7VA 3JQCA 3TWOA 2OHXA 1XIVA 2DKNA 3G3EA 2PFGA 4H3VA 4YJHB 2JD2A 3HE3A 5JDIC 1LSSA 1LC0A 2BI7A 3M2PA 1GDHA 4B4UA 1VLLA 1DFIA 4D42A 4YRDA 2NV6A 1GPDG 4XKJA 2F1KA 2Y0EA 1RM0A 1OAAA 4MP6A 3QE3A 3B1KA 1Q2XA 3RROA 3S2FA 3PFWO 3WFIA 1PR9A 1U28A 1I5RA 3CE6A 3DZJA 3I9MA 5JO9A 4DPMA 1GUFA 1ZK4A 2C2XA 2H6EA 3RD5A 1GYQA 2Y05A 2BELA 2HK8A 1JQBA 1Y6JA 3QY9A 2VWGA 3PYLA 1ISGA 1TA4A 4RF4A 3RC2A 4R16A 1WP4A 3ZV3A 5L7YA 4P4NA 3RBXA 1A5ZA 2PLAA 1HSOA 3DAPA 2IEDA 4IZIA 3LYLA 1U4OA 2Q46A 5IG2A 5KTKA 4BQRA 5T8KC 2JAHA 3E8XA 1PJLA 4UUPA 1R0LA 2IZZA 1EBUA 2V6GA 3TZ6A 1PJ2A 4ALLA 3JQFC 1IZ9A 4DBVO 1I3KA 1YB5A 2Y68A 3OHSX 5JO0A 1FJHA 3PFFA 4NG5A 4RVUA 4G81A 4E3ZA 1MG0A 1YH3A 5C7IO 1NBOA 4JN6B 4UVGA 2GYYA 3T4XA 4FFLA 4XIYA 4CUZA 4EJ0A 3PRJA 3GQVA 3I9LA 4ZQHA 5JDCA 4WCFC 2C59A 4J1TA 1Z74A 1QYCA 2H63A 2Y93A 1VPDA 1YL6A 5ADHA 3JSAA 4IY1A 4ZRNA 4QQRA 5C37A 3JYLA 1HZZA 1FDSA 4HBGA 1IE3A 1AE1A 1BDBA 4FJ1A 1KS9A 3PWSA 2EGGA 2OFPA 2BF7A 3QLJA 1HDOA 3HG7A 5F5LA 1GZ6A 3O9ZA 4HFRA 4MP8A 1B14A 3DWFA 3RC9A 3WGTA 3LDHA 5IDWA 3UXYA 1KETA 1WLYA 3M2TA 2NU8A 1KOLA 2WD7B 1YL7A 4KMSA 3ENNA 1I33A 3FHLA 4FOSA 1QLHA 1TXGA 4D41A 5A3VA 3DC2A 4GX5A 4TSKA 2PH3A 2ZTMA 3TOXA 4E2XA 5EQDA 1CJCA 1QSGA 4BNUA 2YYYA 3UH1A 1IB6A 1XR3A 3AI1A 1ZH8A 1ENYA 1RKXA 4GQAA 3WXBA 3VPFA 2ZQYA 1O6ZA 3QW2A 4E5YA 2OORA 2CVOA 3ZHYA 1LSJA 4KUGA 3QV1A 4AJ1A 4J6FA 3NV9A 2AEMA 3HWRA 3R3SA 1ADBA 1WXDA 3NTRA 3KYBA 4UEKA 4YBZA 4K28A 2ZTUA 1M75A 2AQIA 3KSZO 2J5QA 1PJSA 5KVQA 3RSHA 5TSDA 1AHIA 1B7GO 3C8MA 5AVOA 3EHEA 2QRJA 2CDCA 4PG7A 4QX6A 1HE4A 5JAQA 2C82A 5H81A 2B4QA 2FPGA 4L4SA 4IJWA 4O59O 4EDFA 3LVFO 3EW7A 1BXGB 2D5CA 1PJ4A 1JKIA 1DC6A 2H5LA 1U8XX 4I5GA 1DPGA 4IS2A 2PKQP 3GN1A 4PLCA 3ANMA 1JU9A 4FR5A 2PKRA 2Y1EA 3PWZA 4QFDA 2EJWA 4XYMA 3WGZA 3GF4A 1DIAA 2YFHA 2GF2A 3NT4A 3ONEA 4AL4A 3SVTA 4KDEA 3VPXA 2Z5LA 1GD1O 3MJSA 1E7SA 1O9BA 4M8SA 1UXIA 1OZAA 4EBFA 1FDTA 3F9IA 3LK7A 2OXIA 4KQWA 1F8GA 4M87A 4A27A 3JQGB 4CMCA 4NJOA 3PDJA 5KNLA 1U5AA 1VJ0A 1LRLA 2AG8A 3FTPA 4OM8A 4QO7A 1NXQA 1YWGO 3H9EO 1PTJA 4BNTA 3KZVA 1X0XA 1JLLA 4XDZA 2E6UX 5A06A 4G5HA 3H2SA 5FEUA 2VHZA 4BO9A 1DBVO 2GPTA 4RLSA 4BNIA 4HV4A 5FWNA 4YAIA 4PVCA 4FC7A 4AJIA 3X2FA 3NTOA 1X7HA 1F14A 2VWPA 3VKUA 2NVUA 2QIOA 3I5MA 4I5FA 1C14A 1ONNA 3GDGA 2X6TA 3LF2A 1HDYA 4Y6PA 2BFOA 3EMKA 4C7KA 1ZXBA 2VQ3A 1I3MA 2NACA 3DL2A 3FTNA 5T5QA 2GN8A 4P8RA 5I9LA 2GERA 3RUFA 1NQOA 4N5LA 2Z1MA 1A72A 2RHCA 3K73O 1WMAA 1GAEO 1C0IA 1BXZA 2VHVA 1EEHA 2JFFA 1D7OA 4YVFA 3D1LA 3VZPA 4LCJA 4HNGA 3LT4A 4RLHA 1QKIA 4BO7A 1E7YA 2CNBA 2AQKA 1NM5A 2X5OA 1YDEA 2CDBA 3ADPA 4RZIA 4OSPA 3OH8A 4R68A 4CJXA 2NTVA 2DTDA 5A9RA 2YDXA 3Q9NA 3DXFA 4TZKA 4WASA 4J4TA 3WIDA 4AJEA 3CMCO 4R1SA 2V7PA 5DT9A 1B3RA 2P68A 4J43A 3GZ4A 1YB1A 4GKBA 5TF4A 1EDOA 3I4CA 2ZCUA 1H6BA 1EZ4A 3HQ4O 3DOOA 1B3BA 1C0KA 3UGKA 4YTEA 4F46A 1U7HA 5G0TA 3PHIA 3VZQA 1GEGA 2NADA 3C7CB 1VL0A 4W9NC 1KVRA 3ONFA 3JCZA 3KEOA 2WTBA 3GGGA 4R51A 3SLGA 2E82A 1MG5A 4EYEA 4YT4A 5JC8A 3VKVA 1SMKA 3WJAA 4ZGWA 4AJLA 4BV8A 1CYDA 1YVEI 5TQVA 3ZV6A 1R4MA 5IXSA 5BNIA 4Y98A 1NHWA 1CERA 2QZZA 2XXJA 4FSHA 2RH4A 3T4EA 4DQVA 2X1HA 5G4KA 1Q0HA 3DZGA 4A26A 2DPGA 4XB2A 1F12A 4RORA 3KLMX 2OUIA 1EUCA 2B83A 2BHLA 3GH3A 2CY0A 4OH1A 1IUKA 1OBFO 3UICA 1YQGA 3ETGA 1VSUA 3BMQB 1ENPA 1ZZEA 3L77A 4WLVA 3ZWVA 3JYNA 4ITUA 3ETDA 4A0SA 1FF9A 3W4IA 4NI5A 2WM3A 4EEXA 3B70A 3ZDFA 1K2WA 3OA0A 4A2CA 3GDOA 1YJ8A 4S3MA 3H5AA 2AA3A 2D59A 4LW8A 1LRKA 4TRRA 3KV3O 4Q39A 1C0LA 4BO5A 1BWSA 4BMSA 1N9GB 9LDBA 2PA3A 4MVJF 1I10A 5KJEA 3PXXA 5KKCA 3JQ7A 4BV9A 3GPIA 3BMOB 4LSWA 1Q7CA 3KTDA 3HN2A 3WNVA 4AG3A 3OJEA 4E4YA 2H9IA 3MZ0A 3F1LA 1DC3A 3WGYA 4Z9YA 1VKOA 3NT2A 4OAQA 1MP0A 2NU7A 3B6ZA 4HWKA 4PZCA 2PGDA 1ONPA 1Y81A 1BDMA 4I5DA 1DRVA 1HDXA 1K6IA 3D7LA 3IP3A 3KSUA 3QP9A 4I9NA 1EVYA 3CUKA 3S8MA 1UDCA 2EJVA 1B8VA 1PZFA 3MJVA 4H15A 4XEHA 4BNVA 1XLTA 2C5AA 4XYLA 4IMRA 5K6AA 2BGMA 3PVZA 4MVJG 5KCZA 2CF6A 3H5NA 3T7EA 8ADHA 3OIFA 3UF0A 4IGFA 4J7CA 2BRUA 1SEPA 3A9WA 1UAGA 3ZU4A 1LLDA 3WSWA 5COBA 1CETA 4M55A 4BS9A 1XELA 1ZK3A 3HADA 4X54A 4GMGA 3D3WA 4OL9A 4D46A 5B4TA 4CR6A 3K92A 1ZJZA 2NTNA 4FIZA 1ZW1A 4WLFA 4CL3A 5JDIA 4E5KA 1UXGA 1RM4A 5K0ZA 3DEYX 4CM8A 1RJWA 3C1OA 3U4DA 1W0CA 1GPJA 2GSDA 4U0KA 1KVTA 1V6AA 1MXFA 3ETEA 4FFOA 1PWXA 4J1NA 1E6WA 3JQ6A 4DLAA 3N74A 4RGBA 2X23A 1I0ZA 1PQPA 3H65A 3GHHA 3K96A 3KETA 1PSDA 1WDKA 3I6QA 3C85A 1X1TA 4J2OA 3NYWA 1DEHA 2PY6A 1MFZA 4II3A 4JXKA 1KY4A 4YQZA 2VT2A 1OC2A 1T24A 2FR0A 3ZI0A 2CSUA 4RQTA 3KVOA 5HS6A 4ID9A 1UDBA 3PGXA 1PGOA 2IRWA 1P74A 1ADCA 3CEAA 2UUPA 3DZHA 2HRBA 2TMGA 3F3SA 4GSLA 5MGBA 1E7MA 2DBRA 3TQHA 1I3NA 4R41A 1AXEA 1Y8RB 3GUCA 5KVCA 1VSVA 4NR0A 2BFAA 3SEFA 3Q2KA 3Q6IA 3O26A 3ON5A 1WMBA 2GR9A 2Q1SA 4J16A 3MEQA 4HFJA 4FFPA 1Z75A 3V2HA 5L4LA 3BMCB 3DONA 3AUAA 3L6OO 4D44A 4L76A 5K9ZA 4IGEA 1GEEA 4ZQBA 2P9CA 1SCUA 3DHEA 3OICA 1BW9B 2AXQA 5ER9A 1DSSG 4GX2A 2PNFA 2VT3A 1MB4A 4FD3A 5CDSA 4QSMA 4R1TA 4ZVVA 1SB9A 4CODB 4D43A 4TROA 3UCFA 2EF1A 4AJ2A 4YQYA 5CFZA 3ZHZA 4J9VA 4L74A 2I76A 4F6CA 3I9NA 5JCXA 3UFXA 3UN1A 2CVZA 4IDBA 4U5QA 5I9MA 1BXKA 3NJ8A 3QVTA 4W82A 1GCUA 3WFJA 2POQX 3W6ZA 2Q49A 3VH3A 1SBYA 5DULA 5A02A 5JY6A 1WPQA 5TGDA 1R66A 1XDWA 1ISFA 2WD8A 4BB6A 4YA6A 4CQMB 4NK5A 3DBRB 5CEEA 1JTVA 1DXYA 3BMNB 3O38A 4XRRA 3UHAA 3T7CA 4OIMA 1MC4A 1E5LA 1YOVA 1SC6A 1AUPA 3F5QA 4G65A 1M2WA 1BMDA 2Q1TA 3LU1A 4NFHA 1O89A 3WMWA 4GLLA 4QEDA 1VI2A 5L40A 2IXBA 4K6FA 1SEVA 2HJSA 2E49A 4U0JA 2GLXA 4BNWA 4FGSA 3VOSA 4RJTA 3GVPA 5THQA 2Q50A 4BKUA 3PHJA 2IXAA 4N5MA 5A05A 5DNAA 3G79A 3RKUA 4ALIA 4JIGA 3SC6A 4WEOA 3QSGA 5CEJA 3IIEA 4GI2A 1LBEA 3FNGA 1P1KA 4JK3A 4KWIA 2Q2WA 1WWKA 4Z0HO 4LGVA 1Y7TA 4NIMA 4MVJI 1HDRA 1HDGO 2RH8A 4GBJA 3GGPA 1ZJYA 4YJDA 5I8ZA 3ZWYA 4O1MA 3GR6A 3F6YA 5AOVA 3KHUA 3KB6A 4YR9A 2VCYA 2PH5A 1VC2A 4BGVA 5TLSA 2OP1A 4FDAA 4XGKA 1HE5A 4XQEA 1LDBA 1QYWA 2JCYA 3ZWMA 1P44A 2GD1O 2FP4A 4IBOA 3L4BC 3ZWOA 2OOSA 1PQWA 3E82A 2HMSA 3WS7A 4CQLA 2D2IA 3JD3A 3CZRA 2Z95A 5AXBA 5T8KA 4XGNA 3KXDA 3LT1A 3FSRA 4E2ZA 4Z6KA 3LT2A 2AQHA 3PHLA 2BFMA 4NBUA 2NSDA 4NBVA 1T2EA 4Z9XA 1ULSA 1M6HA 3PK0A 3GRKA 4BMVA 5GZ1A 3DTTA 5LDHA 1BGVA 4PLZA 3U62A 3DB2A 2HU2A 3EZYA 1BHSA 4R3NA 5F1PA 2DPHA 2XXBA 4JQCA 2D0IA 1H94A 2H1SA 4MIYA 4EITA 3JQ8A 2DFDA 4NK4A 4CMAA 1ISIA 3U4HA 1DAOA 4WJZA 2IZ0A 4Q3DA 2V65A 1E92A 1JDJA 1NWCA 2AQ8A 2Q99A 4CM9A 4PG4A 2X0IA 5JNLA 3DZBA 4XZ3A 5JE8A 3RKRA 2Q2QA 4DPLA 2FMUA 5EINA 2HO5A 4RV9A 3E5MA 2BKAA 4W7IA 5EIOA 2EIHA 4E5NA 3JQ9A 3RASA 4IUYA 1QYVA 4OXNA 1KIFA 2A35A 3RJ9A 1OFGA 2O3QA 5KVVA 4N18A 1ISMA 1TVEA 1A7KA 4LISA 3ST7A 2PWZA 4HNHA 3VH4A 4IQGA 4XJSA 3WBFA 3RC1A 3L9XA 1T2FA 2YJZA 3U5TA 1YB4A 2UYYA 3E1KA 3BAZA 1LDYA 2IDZA 3L07A 3ROQA 3RU7A 3NUGA 2Y0CA 3HJAA 5G0VA 2G0TA 5KWEA 2YDYA 2ZYGA 1P1IA 2VWQA 4R01A 3SBOA 5A9TA 2WD7A 3K30A 1UZLA 5FI3A 4J3FA 1ZSVA 2P91A 1PZGA 1DHRA 2J3JA 3I83A 3PQDA 4CUKA 1LQUA 2I9PA 4BNYA 3HHPA 4C4OA 2BMAA 4M1QA 2VRCD 3WIEA 4BHTA 4CM8B 5CP8A 3WWYA 2VWHA 2C20A 1TT5A 3GVIA 1BVRA 3ZHXA 3JQ8B 3I23A 4DLBA 4GVLA 1P1HA 4I8XA 4Q3CA 4ND4A 1NVGA 2NVBA 1LNQA 4IINA 5IAAA 1RPNA 2NWQA 3IL2A 3PJFA 2W2KB 3TZQA 1E5QA 3W4KA 1YBMA 3HZZA 3RAJA 4ESOA 1XWFA 3K5PA 3TPCA 1MLDA 1DIHA 3H6KA 3WDSA 1C1XB 1HYEA 4CQMD 1RWBA 3GZNB 1XG5A 1Z7EA 1PQUA 4R69A 3S2IA 1EUZA 1DOHA 1VJTA 4RDIA 3TL3A 5I7EA 3IKVA 4CLHA 3QWAA 1F17A 1VJ1A 3OECA 3R0IA 4PRKA 3U3XA 5FFFA 1A4IA 1GL3A 5B1YA 3WGQA 1DAPA 2CFCA 4UUMA 4DMMA 2XAAA 3FBTA 1LLUA 1UP6A 4JJIA 1U1IA 1CQJA 1Q1NA 3AU9A 3IC5A 2WSBA 4TVOA 2F00A 3C7AA 3FD8A 1UXJA 3D4PA 3OQ6A 3DBLA 3QHAA 5U9CA 1XU9A 1EQUA 2IODA 4BO0A 5JC1A 4WOJA 1UJMA 4JJFA 3VZRA 2PR2A 4D3SA 4GLOA 1Y9EA 3RJ5A 5JMPA 1LEHA 1HL3A 1KEPA 4WLEA 3H7AA 5DBGA 4E0BA 3ZWNA 5EESA 4Z3DA 4OHUA 3PDUA 3GMSA 4U7WA 4IQ0A 1ZEMA 4J4HA 1XU7A 2VHYA 1YRLA 1PL6A 2B36A 5A04A 4MKXA 1XQ1A 3DHNA 3D4OA 4NJMA 4RVDA 2FR8A 1UP4A 4BNZA 1FDUA 1EK5A 1P0FA 3DOJA 3AM3A 3DQPA 3R6DA 3WR5A 4L0QA 2P9EA 3SJ7A 4JBHA 3INGA 4Q3AA 1NAHA 1ISHA 3FWZA 3VZSA 1RYDA 3OJLA 4OKIA 1PJBA 5AXDA 5KJ6A 3UCEA 3I9OA 1U3WA 1LA2A 2ZJ1A 3JQAA 2YUTA 2Y66A 4WCDA 4JROA 5C5IA 1ISJA 1P1JA 4B3IA 4JNKA 5T57A 2HLPA 1PR3A 3L6EA 4DLLA 3PZRA 4IZHA 2X8LA 1HYGA 2EV9A 3DZIA 3IJRA 4B7UA 3F46A 4MP3A 2X9NA 4PLFA 5F1OA 1VKNA 2JD1A 3EVTA 1UDAA 1TB4A 5KIAA 2D1YA 2QHXA 4FW8A 4NBTA 1SZJG 3D5QA 4GGOA 2FR1A 4BO8A 1HTBA 2PZMA 3RC7A 5I8WA 3QWBA 2XOXA 4UULA 2Y1FA 3OFSA 2NM0A 1U7TA 2DLDA 3BHIA 3QVOA 1VRWA 1LTHR 2UUOA 3GT0A 5JDCC 3GVXA 4IDGA 3F1KA 1DIBA 3RUCA 3ZWXA 3WLEA 3DHYA 2GZ3A 1HDZA 3WQSB 1WDLA 3ZN2A 1E3SA 2O48X 2Q2VA 1CQIA 4MVJM 1UH5A 4GH5A 3L4SO 4L4XA 1E3EA 1ZK0A 4TRMA 4RVSA 1NYTA 5FF9A 1UXKA 1I30A 3ZNNA 3QVWA 4CMIB 2HUNA 1M67A 3TZKA 1JW9B 3WX0A 3WYCA 2A92A 4CMEA 4IIUA 4K26A 3AOEA 4Z9FA 1P9LA 4IMPA 4Y9DA 4K6CA 3DDNA 2EKLA 5IDYA 1W4ZA 3M1LA 2FWMX 4FC6A 4GSKA 2V6BA 1Q0LA 1H5QA 1NX6A 4YT2A 1U4SA 3BMQA 2YHIB 4PLYA 4Q3BA 1T1SA 4LCEA 3MTJA 3OSUA 1U3TA 2J5RA 4J7UA 2PD4A 2YFQA 4P4GA 4F45A 4CM5A 1AHHA 4CR8A 1LC3A 1J4AA 3FRJA 4PLTA 4PG5A 4YT5A 4DL9A 2O4CA 2GRAA 3BTUA 1MC5A 1NAIA 4UVHA 5B12A 3NRCA 4IQ8A 3D4NA 4FGWA 3K2EA 1XCBA 5IDQA 1P3DA 1XHLA 4NMHA 2D8AA 3DFZA 3H8VA 4KDFA 1Z6ZA 1Y1PA 2Y67A 3JQ7B 5HBRA 4E21A 3RFVA 3BTOA 1DDOA 3BMOA 2VYVD 3GEDA 2VZ8A 3UCXA 2ZCVA 1I3LA 5JS6A 3IJPA 2PZJA 4OGWA 1DJNA 4WE3A 5B37A 5HA5A 4NU6A 5A3JA 5TT0A 5L95A 4AJ4A 4LVCA 5JXWA 2O7QA 5ES3A 3OA2A 1MXHA 5JAZA 3HFSA 4GGPA 4YAJA 4JP3A 1JWBB 2YV3A 3IS3A 4DYDA 3JYQA 1G1AA 5K6AC 1TT5B 4FCCA 3L4BA 1JAYA 2HK7A 1KYQA 2IYPA 5DZSA 4YJFB 1GZ4A 2DU8A 2EERA 3TN7A 3OEWA 3WGOA 2VYND 5A9SB 3TF5A 3KO8A 4L73A 3RQSA 1N7HA 4OYRA 2ZIZA 1E7QA 1T4BA 1TT7A 2DQ4A 3E18A 4OMUA 4CLEA 3LC7O 5DBIA 2WDZA 2FY8A 4XQ9A 4DGSA 2IYOA 2A4KA 2EGHA 2ZB7A 2IE0A 2C5EA 1PU2A 1FK8A 3C7DB 2JD0A 4UEJA 3NDIA 3ASVA 1T25A 2VOEA 2AEFA 5T67A 2WYWA 1CF2O 2AW5A 1PZHA 4CMGA 1ZVMA 4OJNA 2WEKA 4NQZA 5JPIA 3WMXA 1C1DB 3EVNA 2CD9A 3X2EA 4OXYA 4LN1A 3GMDA 3H3FA 4B4VA 3RFTA 3WQQA 3JV7A 4YB8A 3CTMA 3OF2A 5L7TA 1HE3A 5CG1A 3NT5A 2DBZA 4LSMA 4J1SA 4KOAA 4OXKA 3K6JA 1GYRA 3ROPA 1X13A 4D3DA 1KEUA 1HF3A 3IP1A 1NQ5A 3PQEA 4J0EA 3LQFA 4YCAA 5IN5A 5KJFA 3KBOA 2FZEA 3MOGA 1E1NA 2TMDA 1HE2A 1DLIA 4ALNA 4YPOA 4OOFA 2OL4A 3BTVA 4CV1A 1HT0A 3AI3A 3H9GA 4HADA 3LC1O 1CIVA 3I9KA 4INAA 4AJKA 4IIVA 1JN0A 3ZWBA 1U2GA 2W98A 1U9JA 2AE2A 2Y1DA 4J90A 1NFRA 2YV1A 4YJGB 1C1DA 3PYMA 3Q0EA 5LCXA 3WB9A 2ZTLA 3STHA 3ZNPA 2B35A 3NAQA 3TDKA 4HFNA 4IM7A 3W8DA 4BO1A 2QG4A 5T64A 2VTEA 4K9DA 5F1KA 4TKMA 3U9LA 5ILGA 4HUJA 3Q3CA 1K89A 1AGNA 1MA0A 3E9NA 5ENVA 1ORRA 4MVJD 4EI2A 4L9RA 4WPGA 2HK9A 2CDAA 2FPPA 3RIHA 4BKOA 4TWRA 4WK6A 3HB4X 5IXYA 2FN7A 2EG9A 3QIVA 5ITWA 2OP0A 3S2EA 5BSFA 1R15A 4HXYA 4ZN6A 1JAXA 3BXXA 4YYZA 1VE9A 2ZB8A 4QXMA 4NNJA 1MGOA 1MUUA 4J7XA 4UVEA 5AXAA 3V1TC 8LDHA 3MWDB 4E5MA 3W4JA 3BHJA 3BTSA 3E48A 3WGGA 3IQDB 3Q2IA 3F4BA 3H2ZA 5BSEA 4WEQA 3UUWA 4RPHA 4N5NA 2VUTA 4XQGA 1N9GA 4E33A 1JVSA 3VPSA 4Z3KA 3JYPA 3GC6A 1FXSA 1E3JA 1DO8A 2BGKA 1NVMB 4XYBA 1QR6A 5BNTA 3AWDA 3C3XA 4JX8A 4QFCA 3DFUA 4OKNA 4YACA 4QT0A 4ZRMA 1ZK1A 4CMHA 1HXHA 3I1JA 3F47A 4BNGA 4BGIA 4CMBA 3WJ7A 3AW9A 3RUIA 2VHXA 1E3WB 1R37A 1I36A 2DBVO 1UXHA 1IHXA 3I52A 1F0YA 1XSEA 4BNNA 5BSGA 5B4UA 4XYEA 2D4AA 3NTQA 3OIDA 2JCVA 3RWBA 1UZMA 3U49A 2ZQZA 3HDQA 5L53A 1YBVA 4XDYA 3ZWCA 3P2OA 4NH4A 4CMJA 2BLLA 4DIOA 1E1MA 3LLSA 5I9NA 4U6QA 1EFKA 4MO2A 4OQZA 4NFYA 3OEYA 4FFRA 4UREA 2B4TO 2CUKA 4D7AA 4BOYA 5CAEA 1ZO8A 3PJEA 3NX4A 1LUAA 2PTGA 5TX7A 3VPHA 4PLVA 4IJVA 4B4WA 3H5RA 3ZGYA 1F06A 1T2DA 2W2LD 5CPBA 4DQXA 2QQ5A 1QYDA 4XYGA 4Y6RA 1WZEA 3V1YA 1JKJA 2D3TA 2QW8A 2DFVA 4R1NA 5C7OO 1N1EA 3FWNA 4CLOA 5U4QA 5CDYA 3UW3A 4BNKA 3FCOA 5KJ1A 4QTZA 1ZIDA 4L8VA 5G4KB
chains in the Genus database with same CATH superfamily
1OC4A 4Q4CA 4H3HB 3TFOA 3RU3A 3QXSA 1P6QA 2JGAA 4P84A 4DR2B 1RC0A 5FUXA 4X95A 4IEFB 3K9QO 4JT9A 2I4OA 2IDJA 2A5JA 2QMEA 4GPIB 1WABA 5LZ7A 4HQ0A 4ACBA 5C51B 1IJBA 3GUZA 1XK6A 5B3KA 1EM8B 4JAVC 2J6CA 4TV9F 5EE3A 4R31A 4OYLA 2ZZNA 1T36A 3W2FA 3LS2A 4US2R 1Y37A 1L5QA 1IZZA 2K4MA 4O08A 1PFWA 2PSFA 1SUSA 1PQ4A 2OV8A 2ZDQA 2H08A 2RSLA 3V5NA 2BMDA 2H2FA 4MRRA 4RDCA 4UQOA 4D9KA 2HW8A 2GYWA 1NKVA 4R9UC 3BBLA 1RWNA 3HCNA 5GGYA 5BSHA 1NTRA 2G5CA 3L0IB 4PTYA 5ICCA 4W5OA 5DGHA 2YZNA 1I2DA 4XQCA 3NATA 4CUJA 1JQ3A 3JPYA 4AJJA 2H3HA 4IRXA 3MHTA 3HDJA 2BGRA 3IAM1 4YRZA 2QJFA 2VC2B 4RCZA 2G17A 1A9QA 2B8TA 1CEQA 2D5BA 3WDLA 3ZX5A 1Y9JA 1FX0B 1M6WA 5KTTA 4WKPA 4I4NA 3F78A 2VRCA 1O0SA 2GTPA 5B2ZA 2H8GA 4BMOB 1RQ7A 2JIBA 1B43A 1QH0A 3HGMA 4YCBA 1P2UA 2CB0A 4PO8A 4D9CA 3EC1A 4WLNA 5SY9A 3N0TA 2ZYDA 3GEGA 1GY8A 4J94A 1AN0A 2QE7D 1BFUA 2VJCA 4YUWA 2ASEA 1UM9B 2OBNA 1A1SA 4BNHA 1XTIA 1IMOA 5K8CA 4CTKA 2KPOA 1NM5C 2HFJA 2WSIA 1O03A 3I1YA 3JRNA 4W4TA 4RSMA 3WGJA 3LXUX 3QOWA 4B2LA 2ZB3A 3O73A 4KUEA 3TNLA 3WIBA 1G4AE 5DTJA 3CLVA 1YZTA 2IEAA 3H97A 2XMSA 3MUFA 3TW8B 5KDOA 4OK6A 3RS8A 4D9HA 1PBTA 3WLQA 3V8BA 1RPJA 3GN2A 2DCUA 3MGKA 3PDCA 3REGA 5CX1B 1VMEA 1PAUA 3SX2A 3AY6A 1YVRA 3ZWWA 3EFHA 2YN2A 3VAYA 5IN4A 1XI2A 2WVGA 3M3HA 4B7XA 3EDCA 1EFRA 3HSKA 1UKZA 4CM1A 3KFLA 3U0BA 1EGAA 5GPBA 4EEKA 1GTVA 5KVSA 3Q7IA 2WYVA 2B5WA 2PS0A 3VPGA 4Y6LA 1BE0A 4L4RA 4R1QA 5IF3A 3P2KA 4JDPA 4RGVA 4BUJA 1GGNA 3BSYA 3SSMA 3VC7A 4X62B 3QX7A 1P3Y1 1EJBA 4KN9S 3OF3A 3FKQA 3CJTA 4FHGA 5I4BA 2Z8XA 3CLKA 4XVCA 2BGTA 2VLBA 2OMEA 4C2AA 5LP6C 1LK7A 1TF7A 4FE4A 3C3EA 1OJLA 1RQRA 4AKEA 1T4CB 1X7GA 3ETCA 1L1RA 2O7SA 1Z07A 3ZDBA 2RHGB 1EVJA 4PO1A 4G1UC 3DLHA 3IPXA 4GXTA 2FSVA 2JKVA 1H8ED 5EPOA 1V71A 5CDGA 3R7DA 1SZCA 3RVDA 3FSEA 5LQAA 1VM6A 1TTPB 2W4QA 2WJPA 3H3JA 4P3PA 1PDWA 5CX4A 1B2LA 3ZH9B 4ZALA 3ZV5A 1KRHA 1L7BA 1XVLA 2ES4A 2VHWA 1SVOA 2H54A 2XMZA 4L9SA 4HX5A 4M86A 4ZEOA 2X4GA 3B6EA 1ZX1A 3DPSA 4EG5A 4PYJA 3IKJA 2FPPB 1TRKA 4DDWA 1AGRA 3D6FA 1UM9A 3HCWA 4ZREA 5J43A 4C21A 4F3TA 3E7FA 3WIVA 2MU1A 1O94A 4MVYA 2OYRA 3QGMA 3RDPA 4EGSA 4EATA 4QLAA 3VR5H 3AM4A 4NBLA 1KDTA 4GPZA 5LZ5A 1FU7A 3RTGA 3UNXA 3ZCXA 1L7NA 5K0LA 4OO3A 3OP4A 2SNIE 1GPH1 3G49A 4U2DA 1OA1A 5KSYA 5J3JA 3PX2A 1ODJA 3KP1A 1CHDA 3HN7A 1NMQA 2PX0A 5CT9A 1DAFA 4UJ5A 5ENDA 4HT3B 2PKXA 4AN4A 4BMZA 2Q3JA 2E9SA 3LV8A 5CX1A 3L5KA 5DLQC 5DP1A 3VJKA 3FFAA 5DBHX 1A9ZA 1HTTA 1OSNA 2DRIA 3AMVA 3FWHA 4LRTB 1L5HA 1M7BA 1JFFA 1OLUB 5JSHA 1KBZA 2O50A 2GFHA 1P2DA 2W8BB 4RQAA 2R1TA 4MQ4A 4Q21A 1R0WA 1TI7A 4NE7A 3KZ1E 5CFMA 3FNFA 5FV7A 4EABA 2CMDA 2QMUA 2QLBA 4DLXA 3I6IA 1TQ8A 4EUEA 2I78A 3CEHA 4G0WA 5ILOA 2VJYA 2XADA 2QLLA 3Q11A 3QXHA 2PWAA 3O82A 3ZD7A 4Q7KA 1E2EA 2WWRA 4WOKA 2OQRA 3A14A 3KXLA 2E4XA 1Z6QA 1PEDA 3L01A 4BKMA 3DBRA 3ZBTA 5I9BA 3K31A 1Z5ZA 5TRTA 5C4IA 1RAEA 1CZKA 3O9MA 4YJHA 3RFCA 4B4DA 1RAFA 2WMDA 1NMSA 2P4EA 2Y92A 2HMWA 1H2BA 4FR2A 4JI4B 2BFPA 2UZIR 3R7FA 4CMIA 2ZKLA 2G07A 3TE7A 3JU3A 3O4VA 4MAAA 5LU9A 2WB2A 2VPQA 3GZTB 3DEZA 4XUCA 3SS8A 3N5CA 5IZCC 1L7DA 1DG3A 1M2GA 5DNYB 4O3MA 2F4VB 4G1MB 5HOQA 3AFNA 4G01B 3IMFA 4OLBA 4FFSA 2CXXA 4R7TA 4C5CA 5FBHA 2RHBA 5CUQA 1ADFA 1BXGA 4ZOCA 1OIXA 3MFYA 1KZGB 3OCJA 3MCAA 4X7MA 4D3FA 1W1UA 1WCWA 1RFGE 2VATA 4H3SA 5D3MA 4MV8A 1LZLA 4OXIA 5CT8A 4Q4JB 2R7NA 3M33A 1Q12A 1ZBQA 2EEZA 3C8ZA 3JVEA 4JB8A 4Q3EA 5TNXA 4BVBA 3MINB 1JBKA 5KYYB 1QKKA 1Z4OA 1E4EA 2C8LA 1N6LA 2DY0A 2NX2A 3A9SA 1OCEA 4GNRA 3R09A 1U5BA 1POWA 1Y9AA 2O9JA 2WDPA 1ENOA 3F8TA 4IFBA 2WKSA 2X3FA 2D2XA 1C4KA 2RHOA 4K0RA 4KP7A 5E3JA 4FMDB 3ILVA 4ALMA 1ND6A 4ZHQB 1JHPA 3O2SB 1T4MA 4Q01A 3RS7A 4AJPA 1E69A 3OCWA 1HNNA 1K6JA 1LLCA 2VLIA 4B6JA 3W5SA 1R9NA 3QEKA 3BCRA 3U60B 1RQXA 3PD0A 2JJMA 3ICWA 2ZWVA 4KKVA 1D6JA 1KDRA 1YVPA 2PBFA 5FTMA 1GZ3A 1SVLA 2I99A 3OPVA 1EH5A 1G2QA 2YJTD 3OZSA 3AUJB 1BVYF 5G1PA 3RVLA 1I80A 3D8RA 2AG5A 3UJNA 5CIYA 4KWHA 4NAVA 1B23P 5F5NA 3I32A 5KWSA 1ICIA 3T5AA 1T9KA 4RD4A 2CLHB 2HAEA 2FSPA 1ATIA 2O2DA 4WKCA 2OYSA 4EG0A 1YO6A 3CWZA 2YL2A 1KA9H 2QTHA 2XQVA 4MUMA 3AO0B 2J4DA 2B69A 2HSEA 4G2NA 5IULC 3IQEA 3TD9A 5CIWA 3OM9A 4P08A 3RHTA 2Z4SA 1NVTA 2Y9PB 3DT8A 2WKQA 3SXPA 3NKVA 4FZ3A 3KWFA 3ND9A 4OHBA 1VL8A 1CLUA 1ML4A 1TNDA 1ZIOA 3EK2A 4DMCA 4ETWA 3VDQA 4F97A 5JD4A 1QHSA 4F6RB 3DE0X 5BRAA 2Q3HA 3BX1A 9ABPA 5AVWA 4FJ2A 5IX8A 3Q8MA 2H9AA 4QU0A 3EVAA 1BGWA 1D1SA 4DDVA 4IEIA 5LM3A 4ZC1A 2HDNB 2ZTSA 2GEUA 4LBWA 2O3TA 3CR3C 1OB5A 1FFCA 3HL4A 4L02A 4A92A 3MWEB 3ME5A 1XAJA 5REQB 1E4EB 4ZJUA 5COAA 3RU2A 1JKFA 2H7XA 2XWSA 2F1HA 4O33A 1OOEA 1UAYA 4K9QA 4QKQA 5K4HA 2QRLA 1XA0A 1J0DA 1YQDA 2VL7A 6ABPA 3S8EA 4JLSA 1OYWA 2H2GA 1FB5A 2OORC 1JT9A 3NWEA 5DM2A 4G1FA 1HEYA 3HJBA 5A3RA 5E7IA 4MIEA 2MSCB 4REQB 2GEDA 3ANXA 1Y33E 1NJ8A 3W2EA 4FM9A 2WBLC 1SD1A 4L2IB 1CR0A 3LQ2A 1ZCBA 1FDVA 1LDGA 1P4RA 5T6MA 4PW0A 4KR3A 4RVGA 3K0HA 1NJ5A 1QGYA 2GTHA 4DJAA 2RHJA 2VZEA 3ITEA 3KYDB 4Z0PA 1SKQA 1G5HA 3R5SA 1L1QA 4RMGA 4Z54A 5C5DA 3EEFA 1DKNA 1RMTA 2VBFA 2QM8A 3R41A 4I4TF 5CT5A 1PFGA 4DY6A 4HDAA 1L3BA 4KXLA 4GKJB 3EZLA 4PIPA 2I6GA 5L51A 1JNYA 5IH7A 3S1AA 1W46A 1RVDA 1IY8A 4Z4HA 3OPQA 5EGNA 4K3VA 3UAXA 1P0IA 1Y6ZA 3TZHA 4B8WA 4A7PA 1A0OA 1NW6A 2G82A 3RIEA 4OM7A 3IAFA 5H02A 3VR4A 4AICA 2C9CA 2OR3A 3MWGA 3EXG2 5AI6A 2J7PA 2REBA 2LCIA 2DUUA 2HCRA 3JQAB 4G0NA 4JITA 2WNHA 4J07A 4GOXA 4HDRA 1E7WA 3QU5A 3EZ7A 1GZSA 2P4HX 2YRFA 2XT0A 3FVRA 3EIOA 2A0UA 2XQKA 1QWSA 4C14A 2BAGA 3VQTA 1Z82A 3GOHA 2SKCA 3JWPA 3FPCA 3NI2A 1WQ1R 3EPJA 1XZKA 1QQ7A 2GNAA 1FE8A 1R27A 3MTQA 1U0LA 5C8ZA 2DUWA 4MUHA 1GXSA 1GVNB 2QD4A 4EENA 3EAQA 3PQ6A 4JJ7A 2I66A 4EW2A 1CS0A 1T13A 4MVJP 4TXHA 1HYQA 1UFVA 4ZDKA 1UBSB 1YB6A 3JQ9C 3TTSA 3RAEC 3UMYA 4JJAA 3H99A 2BD0A 3FETA 4XE5A 2M2IA 3IAHA 5A4JA 2V0NA 4ZYYA 3NHSA 2FGKA 4OHZA 2O23A 4O0LA 3RODA 4KAXA 1T1RA 4RNDB 3TBHA 4L5IA 4R1PA 3QELB 2F1JA 5LQNA 1JEJA 1UFRA 5GZ6A 4QDUA 4LJ9A 4NEGA 2OK7A 3HJUA 2JIDA 4FCWA 3G6WA 1USUA 4ENPA 1G0OA 1QXSA 2Z5FA 4J9UE 4BMNA 4D74A 4OHVA 2DF8A 1N2HA 3EB9A 3LXRA 1QRSA 1X87A 5K0BA 8OHMA 3OJCA 3A9RA 3O8BA 3V55A 3R3ZA 3ZDCA 1C4WA 1K8YB 3C4VA 5BN3A 1L4LA 4Q6WA 3IT1A 4FNMA 2IYSA 4P7JA 3WHIA 3E2IA 3G7SA 3HFJA 2XGJA 3F5MA 4KLAA 3BPSA 4GF5A 1KFCB 2E37A 4Y2JA 5F33A 1BIFA 4LF8B 3E7XA 1NBMA 2J4FA 5AUPB 1PJTA 1U9CA 1K8XB 1YI8A 4KO1S 2NTYC 4TUYF 2Z08A 3KLOA 4YRCA 1BMQA 2CDRA 2MHCA 2YWDA 4B6SA 4EB8A 4H1TA 2Q4TA 5E4TA 1HGXA 3AY0A 3JASA 5EL0A 2ZRNA 4WOPA 2JBHA 1KNQA 4W6ZA 4LQ4A 4B17A 5KNDH 5L8VA 1UOQA 1KJIA 2QGZA 1GQQA 4BKRA 2BM9A 1XKQA 2BEKA 5KTSA 1HSZA 3PVCA 4ABTA 3OQ1A 3PLRA 2N42A 3QU9A 3N0VA 4Q15A 4QPZA 4D97A 2AGVA 3DLPX 7YASA 5LNK1 1XDGA 3I39X 3PQFA 3Q3EA 1M5RA 1CDEA 3TRDA 2E4YA 13PKA 2FJPA 1J8YF 1V5GA 3W2TA 1XVIA 4BL5A 2DWUA 3C39A 3UAWA 4NY1A 4A03A 2YFYA 1JR6A 4E6PA 1JEQB 2EGUA 1JQAA 1UR5A 2Q4DA 4ILEA 2NO6A 2WFLB 4JLWA 4V0OA 3IUNA 1W88B 1Q7GA 3EDOA 1GAQA 4PZEA 4G2TA 4ZAZA 2GXQA 2OHVA 3FR8A 4DIUA 5EIFA 4CEHA 1TAGA 3LCCA 4DT1B 2HWKA 5IU6A 4YJFA 2ZK7A 1DKRA 3G0OA 4TV8B 1QH1B 2IHBA 3HABA 4AJNA 2WE8A 1NKTA 5LPNA 1WDMA 4CCYA 2BKEA 3WGLA 2N46A 2XYPA 3ZQKA 2DQZA 4Y1RA 5IKOA 4A6DA 3VGJA 1JMKC 2YOFA 4EYGA 4EHKA 1H2XA 4R0MA 3TXAA 2DE0X 3URKA 2J3KA 3KWMA 3LA8A 3LVBA 4YIHA 5IWAB 3W5VA 4ZI3A 4QBGB 1SJ9A 4K6GA 2V6MA 1R9JA 4EZEA 4PQRA 5K0EA 4PBTA 4E2FA 3IBYA 3L8GA 1RQLA 3EIUA 5CB4A 3KAPA 3PXAA 4DLRA 2KQUA 1VTKA 3AFMA 1N9KA 3E9MA 3OP1A 5F73A 2X4IA 1AN9A 2HA0A 2I6TA 2NLOA 3WKBA 4DC1A 4CFZA 1BQ4A 4I4CA 3EPKA 1RWVA 4B34A 2LE0A 4IEEA 1U1GA 3DTVD 3EXEB 1Z34A 4IVPA 4DUGD 3O8OB 4E6EA 4HS9A 3DVAA 4URWR 3TS1A 2DETA 2YWBA 3RB8A 2Q9CA 3VBEA 2NOAA 4E22A 4R5MA 5TC4A 2QAJA 4L75A 4I3HA 1FP4B 3E8MA 3NHBA 4MPDA 1FYFA 2ZSBA 2FHPA 3FPAA 1QMPA 2HKIA 4WNAA 3C3DA 4OGLA 3R74A 3MG9A 4IL5A 3R7SA 5BMVB 5LQJA 2JJ8A 2EF0A 1RIFA 1R74A 3LHKA 5DF1A 1KH3A 1ZM7A 2X6QA 4XWWA 4CLRA 4GECA 4S1NA 3A9CA 3NGMA 1NLYA 3INTA 4YI5A 3VNBA 1I2CA 4L5BA 4D0NA 2XTJA 2QTFA 4QRHA 1D3AA 4WUVA 2Q8QA 2F43A 2R25B 2PUVA 4K87A 2UV8A 1O5IA 5IVIA 4E32A 3H19A 4HPWA 2XUPA 2HCTA 1XCJA 1YGYA 3I30X 3CX8A 1FJ2A 1T1EA 5CD1A 2HJWA 4GX0A 3NO4A 1EHCA 2YVKA 1WSAA 3OOHA 4QOFA 4CG2A 2NVWA 3NHRA 4LJ5A 2HNAA 4W9MC 4HD8A 3COYA 2Z8ZA 2RGNC 2CSXA 1CYEA 1U0JA 2BGLA 2H7YA 1U7WA 3AF2A 4TMTA 5LUAA 1QH1A 2PTHA 4C4TA 3U3JA 2VDVE 5HSGA 3EEQA 3IULA 4ILKA 3U1BA 2ZSKA 3CE9A 2V03A 1OY1A 3BRWD 2PD3A 4CM7A 3A6ZA 4KUHA 3PWKA 4UHDA 2IE8A 1VE6A 2Z6AA 1W8DA 1BG6A 2HLDD 3L0ZA 1G2OA 2VPTA 3ZGXA 2VOJA 3ZDDA 1RYYA 4IW3B 1GPYA 4U7JA 3R3YA 1U11A 2JASA 3H2HA 1J00A 4I99A 3RABA 5IKMA 2B0JA 4YWJA 3BILA 4AI6A 1W76A 2XZOA 3H18A 1W7AA 1K4YA 5JNUA 1JP7A 4ES6A 4K2HA 4AZ3A 3B1VA 3ZU5A 1L4HA 1N36B 3UHFA 3G2KA 5ALGA 3ROKA 3R77A 2ZVQX 3LHSA 2WOOA 4ARVA 2LPMA 5A2QA 1U7OA 5DHSA 3FKSA 2FPIB 4UD2A 1VDMA 3BXOA 3WAJA 4EJFA 1YZNA 2DC1A 3D7RA 4JXZA 1ZDMA 1PIWA 2X0JA 3W34A 3EZ2A 3Q85A 3UA4A 4AS2A 1MB3A 3VR1A 3TPZA 2C07A 4UDOA 1HETA 3VRHA 4FYPA 2A9KA 4M49A 5TS2A 3UT5B 1E8MA 5FQNA 4DW8A 1WUKS 1U6KA 2NAFA 4OHMA 4NCJA 1TUGA 3R9KA 1XBTA 3TLKA 5D01A 1V8DA 4D4GA 5CA0B 1E6CA 4DQUA 1H85A 2VJQA 3IT0A 5FAXA 2B7CA 3UWMA 3I05A 4KXFB 1T3SA 1UAAA 1NC3A 4V02A 3WLOA 4TL8A 5JALA 4RIGA 5BQOA 3V4OA 1TEVA 2R6FA 2QTBA 4DREA 1ZHFA 4E88A 3JY6A 1J2JA 4GPTA 3CISA 1SIBE 2R87A 3SIWA 1R6AA 4RZHA 3K1ZA 3CUYA 5ALDA 2YY6A 1L5SA 1YXMA 2TRSB 3ZJ4A 1ZM4A 3D59A 2CL7X 1X94A 1KMHA 1X92A 1EE2A 2JHGA 3CEJA 4BJ3A 4ZHQF 3G5AA 3LOQA 5EE1A 1UQUA 2EATA 4RF5A 5AT1A 4G5YA 4J1QA 3EXHC 3L7MA 4PM4A 4RS3A 2C7VA 4RZQA 1N1DA 5AW6A 3ZNQA 2OCBA 2UAGA 2FKAA 2QY9A 3AEKA 4GS5A 4M3NA 4XWYA 5BWLA 2RKOA 1ECJA 2P77A 2CE7A 3FAZA 1W6UA 5KJCA 3N2EA 3AVTA 1ZR2A 1G98A 1MVLA 1EA7A 1PT9A 2KW5A 2WT8A 2EQ5A 2ZB4A 5EKDA 4JJ8A 1KJJA 2OCDA 4L4UA 5JNSA 4DTCA 2BTEA 3B12A 3R5JA 2C61A 4TS9A 5A4DA 1AKRA 1N2EA 4HVTA 4HUTA 1YS1X 1DS6A 3TE6A 3KKQA 4YMGA 3H9JA 2PT5A 3ET5A 2K2WA 1S2NA 1UDXA 1HQKA 4QGBA 3T5GA 4DDKA 1OASA 1VE1A 2KMLA 1PJ8A 3NCTA 4EVIA 3GJ8A 1BDJA 3O84A 1BSVA 3MT8A 4LC1A 3HFGA 4GICA 2HBYA 2MSKA 2P9FA 2H92A 1VKHA 2Z5GA 3QFHA 1P5HA 1C9NA 1XTKA 1I2BA 1LCIA 4PICA 2WE7A 3DL0A 1FDOA 1VSBA 3AHEA 1LQ2A 3EMVA 3N39C 1JDSA 5LL6P 3FPLA 1DAGA 3CEPB 3VSEA 2ZUDA 1EUCB 1E1DA 1U3UA 3U4AA 4TYWA 1AUVA 4B32A 1KY5A 3FLBA 4DV0B 2O0JA 1Z7BA 4U9IS 2NU9B 3D5TA 4KIUA 1U8TA 3Q8WA 3FY4A 1A88A 1LU9A 2VSQA 1NT4A 3O8QB 3QUBA 5FBVB 5GONB 1N1GA 1DZ3A 2FNAA 3FUTA 3PIDA 4QDOA 5HJ7A 4QBHA 3TIIA 1K7SN 3PJDA 1ZIYA 3LLUA 1RHKA 4C0BA 4FDUA 3W6UA 2HNBA 4MMYB 1NVVQ 1L7QA 1UWLA 4G9EA 1O95C 3V8QA 5DVZA 3SMVA 4ZJPA 5AW1A 2PYZA 4LJLA 3UK2A 3PA6A 4RD0A 1KE1A 3L4JA 2ZGVA 1FQKA 3GYGA 4RZ3A 1NRJB 4L8FA 4LQCA 4P6VF 1IN6A 2HA7A 1SCNE 4PLHA 5A2GA 1W88A 2HJVA 3GYBA 2CV2A 5H0IA 4TLLB 4Q1BA 1P7ZA 4B3TB 3WGMA 2P8JA 4BUCA 3S7ZA 3W6NA 4AZ0A 5CFNA 1FLVA 3ZU3A 4ZARA 1F8UA 1RYZA 4EYSA 2RONA 1QZUA 1SU7A 1GZHB 5KO2A 3PB3A 1Q44A 1W48A 4NXNB 4ZEWA 3N3AC 3GZNA 3LPDA 3VNVA 2QOEA 3T9CA 2WOJA 4QECA 4YAEA 5EFOA 2ISQA 3OFKA 4P4LA 1YOBA 2ZR9A 4WKGA 1GTL1 4FR0A 2DOKA 3KZCA 4KZPA 4W1QA 2B30A 3GEMA 2V5VA 2PZLA 4AT1A 2LVBA 2EZ8A 4DIBA 1U94A 3NWJA 3BXPA 4HNAB 4BJHB 2PD6A 3BFVA 4BZXA 2JF0A 3CNEA 5KOIA 2B1GA 4MVWA 1I6KA 2QRKA 4ENSA 3P96A 5HKAA 1ZUHA 2CVQA 2EX4A 2OSBA 1H0KA 3T3EA 4EPRA 2BE9A 3AHDA 3BREA 3E1SA 4H31A 4D9FA 4D9JA 2JNWA 3TZLA 3DVAB 1GTMA 1MH1A 2JGIA 3EQ7A 4LG1A 5HM8A 1UKEA 1Z0KA 3A3NA 3OM1A 3P2EA 2CJXA 3DNMA 4QICA 4UUAA 4M53A 3LLMA 3DNPA 4IS3A 3WLJA 2FQQA 2GARA 2JZOA 2UKDA 1CUIA 5CT4A 2JJ2D 4E3WA 5JAMA 2ZBGA 3C6ZA 3FRHA 3QOFA 3NG1A 4WGGA 4BGUA 1RXWA 4TS4A 4KREA 4RDHA 1DAHA 4FYJA 2FPKA 1TC2A 2ONZA 3D43A 2HQ1A 2EAUA 4JT4A 2LGJA 2P2GA 4Y2RA 1OXSC 1UBGA 3QQPA 2ILTA 5A1TA 4PIVA 1VE5A 3H16A 3ZHOA 1R0CA 3D6VA 4C1NA 4C20A 3GUYA 3SLKA 3V32A 4ESOA 5K6AC 1SBTA 2I03A 3G0DA 4JKIA 5CBPB 1PZMA 1XZQA 3JQAD 4ZCMA 1K27A 4B80A 1GCGA 1LSOA 3NIFB 4BIIA 1T1GA 4MCJA 1UC4B 3HCPA 4MW0A 4N8SA 4QBKA 4E5PA 2AFIA 2MR5A 3MOIA 2GLTA 1VRCA 2YYZA 3NDRA 4XFJA 3T7RA 3VYRB 2VP4A 2NZJA 3I8OA 5LOVB 1F7UA 2I7CA 3THYB 4IX1A 1WDTA 2IPXA 3AHFA 1L7EA 2VA9A 1M73E 4HDNB 2ZG6A 3UVEA 1CC1S 3N2IA 1GYPA 1Q83A 4D56A 3E9ZA 2W43A 3OE7D 2BDUA 4TL9A 3X43A 5AQ1A 1CUGA 1QPBA 2ACVA 1NVXQ 3BE6A 1PUXA 3EGEA 4XCVA 1VHDA 5IKPA 3GOQA 4JJEA 1VG1A 1R5NA 2HSDA 1IIRA 1CUUA 3LQKA 1A77A 3AUSA 1P2VA 1UADA 3PUJA 4YRBA 3UGJA 3QBDA 2CLKB 2XY4A 3OD5A 4KBGA 3RE1A 1QGZA 1AA6A 2BUCA 1N5JA 4RKFA 2FF7A 3SU8A 3BWCA 1M34B 4TKVA 1V1MB 3B8HA 5IHXA 3DM9B 3FMPB 2RHRA 1K97A 2H1FA 1PTJC 2C4TA 3I8SA 5THXA 3WIOA 4YT8A 3AB8A 1NQTA 3W6OA 2Q3LA 3CX7A 1A2KC 3DG9A 3QG5A 4HNRA 4OTZA 1LRJA 5I9TA 3SHWA 1R16A 3TNDA 4MPTA 4MGHA 1QOZA 5GJWC 2BCGY 2BM0A 1X7DA 1VIAA 3C15C 1T36B 4NBRA 4W5HA 2QN7A 2QAGC 2YWFA 1JXOA 1Z29A 1IRIA 2HRCA 3DCIA 5FL7D 2M6KA 3T7TA 1ZM9A 1UEIA 1JR2A 2R62A 3I4LA 3LTNC 4LZPA 1KK1A 2ZUBA 3EQ2A 2CCJA 5BN4B 3ZK9A 4PYNA 4L5CA 2XCQA 4H6VA 1SR8A 1TZCA 1LVUA 3QBEA 2CJWA 3DXYA 3V8NA 4F85A 3UJ7A 3U9TA 1KEZA 1KVSA 2W2QA 5BSFA 4ZMSA 3BGIA 2B6HA 4DWVA 4EW3A 4MUFA 2I65A 4NOLA 5FUWA 4XD7D 3VXKA 3HI4A 3OJWA 1V3VA 1EBFA 1DGQA 3LRPA 5AM4A 3X1ZA 4GR9A 3VSDA 4IZ6A 3JQFA 3PEFA 1SQFA 2Q4EA 1JHVA 4XOUA 2G8LA 3KD3A 4R5HA 2BFCB 4ZCTA 2ZRIA 5AVTA 4UTZA 4C0LA 3QJ5A 2GRJA 2ZE5A 5ITZA 3T5MA 4E70A 4DLZA 1GXSB 5HCIA 1D1PA 1V3UA 4IDFA 5A4IS 4MCIA 4RCVA 2B25A 4PYIA 1PX2A 4KXVA 1YU9A 4MQ6A 1MC1A 3JQCA 2OHXA 1OREA 3G3EA 2XUGA 1NJGA 2PFGA 4H3VA 1JALA 1XP8A 3PRYA 4G0VA 4MW7A 5LB4A 2D8MA 2FQXA 2BI7A 3IPLA 4MR9B 4AW9A 3LGAA 2QDKA 1DFIA 2NPFA 4D42A 3I0NA 2REQA 2Q5LA 2YXLA 2ZS7A 1AD2A 3TTXA 4PNEA 2JJQA 2NV6A 2ZIXA 3IVCA 3FJYA 3BEOA 4HI0E 2AN4A 3TG8A 2X2PA 1D4ZA 1V37A 4FKBA 1OFTA 1YR8A 1DADA 2EKBA 3IGFA 4UBLA 5DWQA 2OEPA 4DB4A 1M1ZA 1U28A 1YA6A 2JI4A 3I9MA 3QW4B 5JO9A 2CVFA 3ZKAA 4AZWA 1BA2A 4MWBA 4OB8A 1GYQA 3BD8A 4Y3UA 2Y05A 1HDIA 2BELA 1JQBA 1Y6JA 3LFTA 2HF7A 3QY9A 4W63A 4BFYA 4CBVA 5ADUS 4P4NA 2I7DA 4RXUA 4IZIA 2C77A 4ISBA 1L7VC 2PX3A 5ALRA 1QBGA 1SC9A 1U4OA 1EP3B 3NHAA 3RTAA 5IG2A 5KTKA 3FFXA 1YIOA 1S8OA 2JAHA 3FZQA 2WJWA 4GUAA 3T3DA 4G0XA 2HREA 1KJWA 4FB5A 1V6SA 3PHCA 2LWIA 2RGYA 1J97A 3QYPA 1ZESA 1EBUA 1KY2A 2IZZA 1J07A 3COPA 3SJAA 2JFZA 3K09C 1CX9B 1MRZA 4L16A 4QYSA 2OFFA 4DV2B 2Z8YM 1ZIPA 4G5XA 4DBVO 1KFBB 5MN6A 4BB0A 2R4QA 1YB5A 3OHSX 4EY8A 1PFVA 1RJGA 4JUAA 2I9KA 3IEPA 4E3ZA 3IIJA 1MG0A 3KZNA 2FE4A 1KU0A 1P4GA 1NBOA 1X7YB 2GVNA 4UVGA 3MINA 3CZ9A 2VJNA 5IBRA 2AC7A 4CUZA 4EJ0A 1TMGE 3DE5X 4NU8X 4JI5B 4J1TA 1XEFA 4UUQA 5F7OA 5ITZB 2EBHX 3QXJA 5LYJF 1KFKB 4QODA 3SVLA 4EWLA 1NUQA 1I4LD 3NBXX 1VHQA 1FDSA 2QTVB 3E9RA 3M6XA 4ZO9A 4FEGA 2GTIA 3PWSA 3CXUA 1CZOA 2O1XA 4G5OA 1HDOA 1JQLB 3HG7A 5ECWA 3E9YA 1FBNA 4I8DA 5IW8A 4FKZA 2JBAB 4ZWNA 1WKVA 4KLNA 5EP3A 3DWFA 1SN7A 3WGTA 2WABA 1ABFA 4IVRA 2R68A 4J8PA 4JUIA 1RBYA 2NU8A 1YL7A 4PZ0A 1ZW6A 3JR3A 1UMDA 2ZIGA 2NU7B 3GJ3A 3KT3A 1I33A 4K7JA 3V97A 4ZCIA 4HGQA 2XCIA 2O14A 2HBQA 5A3VA 5FDFA 1XP5A 3KU1A 1BKDR 2PH3A 3FPFA 4GOMD 3TOXA 3VR0A 4YDSA 3ZHCA 1PJAA 4B82A 3I2IA 5EQDA 1Q0TA 3COJA 5DFAA 2XQIA 2ODTX 1N2OA 4DSAA 4UMFA 4Q4AA 1BDIA 5FP0A 2B1IA 3G9UA 1IB6A 1XR3A 4G63A 1QIGA 4R7ZA 2IHYA 1U8AA 5EPEA 4GQAA 1QVAA 1TKRA 1XVTA 3BE5A 5K3CA 2O5CA 3EG9B 5JBNA 4QARA 2ZQYA 1J09A 2QQGA 3ZQUA 2VF8A 1QO7A 3GDHA 3MERA 4E5YA 3EA0A 2OORA 1HG0A 5BP7A 2WUEA 4F4JA 4KUGA 2JIPA 2C1XA 3OKAA 2PL1A 4X41A 5KQGA 2OENG 1Q74A 1E4VA 4JI1B 4BTVA 1DCMA 4BBJA 1BO6A 3NTRA 3KYBA 2R5FA 3MC1A 4UEKA 5CTAA 4HEA6 3L7BA 4K28A 5EJMA 4XWOA 1FU8A 1M75A 3IV7A 1GKUB 3OZWA 1PJSA 2PGOA 4OLFA 2NP7A 3IOBA 1TGYA 2GPYA 3BJEA 1P0MA 5JT1A 1FUIA 4KV7A 4JT2A 1OAKA 1A8HA 4AP6A 4R83A 4EMTA 2WHXA 4PG7A 4QX6A 1WD5A 2RHWA 3SE0A 3RS2A 5LB2A 2FPGA 4ENRA 3GAMA 1R64A 1NXTA 2RGGA 3N2NA 4L4SA 4O59O 1BZYA 1UIRA 2HQOA 3PQ2A 4QDJA 4PX5A 4V0SA 5EY5B 2CFRA 2AF3C 2XUZA 3BN3A 1BXGB 4YCDA 2VNJA 1TOAA 2ZWOA 3IVAA 4F60A 2OGSA 2IQ5A 3FYTA 2A8YA 4QFDA 2Y1EA 4XYMA 3CLTD 4A8TA 1DIAA 1CPYA 2YFHA 3TLGB 5DGIA 3EOZA 1KAQA 1VLJA 2FEMA 2W5UA 2ODAA 2HGSA 4FOTA 4NV1A 1I7LA 3VPXA 3G0IA 1XMJA 5E1OA 1O9BA 1SK8A 1CE8A 1EFCA 4UTXA 1MGPA 2JI6A 5TARA 5JAUA 1A50B 1DDGA 3LK7A 1W44A 3HU5A 2IHJA 2NSLA 4A27A 4MUIA 3QPCA 3NB0A 4NJOA 2FWPA 3F4KA 4DVGA 1H22A 4CEIA 4M0DA 2JLAA 1RRPA 4N3BA 1UMKA 1VJ0A 2AG8A 2JLVA 2HF8A 5GONF 5ALKA 3HP7A 2EG5A 1OXKB 4A16A 3UK1A 4XDZA 2E6UX 1IK4A 4G5HA 1CY2A 2ATEA 2WJ6A 1PCXA 1QK4A 2AN1A 2VHZA 1DBVO 1G7CA 4JOBA 2AR0A 3A32A 1IBRA 1TVKB 1WHSA 3FIJA 4FW9A 4BNIA 5ADWA 5FWNA 3C6MA 1MTOA 4X7BA 2ZLBA 4A8JA 3AHGA 4TWAA 4LNUA 3WYFA 4AJIA 3LO8A 5CLLA 1DZIA 2VO1A 3QE2A 3UJ9A 5B7GA 1F14A 2YXDA 3VKUA 3JS5A 1HA3A 3UWOA 3W1WA 3I5MA 4KIJA 2ZYUX 3U19A 5KREA 4B6GA 2WZCA 4LWPA 2ID7A 4FYHA 1WXFA 1M2NA 2F9MA 4Y6PA 1IHOA 3R75A 2NZWA 4WZ6A 2DMRA 1TYEB 2IXGA 4UNSA 2YWRA 5AW3A 1RBZA 5JYCA 4EFNA 4YALA 4S2EA 2FFRA 2GN8A 4AIRA 2UZAA 3RUFA 2ZS8A 3B60A 4H7DA 4ZPJA 1H1DA 3CKLA 2AXNA 3C48A 4B3SB 2IUTA 4EQ6B 1VPWA 2PRYA 3IXQA 1VGVA 2CNKA 1D7OA 2OBLA 1SVWA 2RB4A 3D1LA 1AX9A 1TD9A 4FE7A 4LCJA 4IR7A 5FUVA 3W6PA 1QKIA 3TGLA 5TMBA 2Z2JA 4BO7A 1E7YA 4LHVA 5T4BA 1T5BA 3K16A 4LGYA 5EZ5A 5F9MA 2IBTA 4QSHA 1YDEA 2YOGA 4TX1A 2LIPA 1B93A 1MAUA 3ENQA 1E3QA 2YDXA 1T10A 3G2JA 2J0UA 3SYMA 3DXFA 3PPXA 4TZKA 3SF0A 5BXQC 2ASVA 2XJ9A 3B6KA 4REQA 4U2GA 3AP3A 5DT9A 3TCNA 2LXNA 2IU3A 1V47A 4OQFA 4UHFA 3TMKA 4EGJA 1MN6A 3DCYA 3TUIC 4RL4A 5H9VA 3HN6A 3LX8A 3ZBQA 3QVVA 1RZRA 4F46A 3VZQA 1QRDA 4J0CA 4K9PA 2C7BA 2F6RA 1ESNA 1YZLA 2AOWA 2NADA 3C7CB 1KVRA 5EZSA 4QDKA 5FPKA 1LNZA 3GGGA 3MB8A 4FSDA 4P3XA 3SLGA 3W2HA 2E82A 3Q5DA 4F92B 2OLKA 3O93A 5JC8A 3AL2A 3GBVA 4C08A 4LSZA 3COWA 2OQIA 4Y9RA 4ITRC 3BDIA 5TQVA 4L7VA 4ZOAA 3RSQA 1IJKA 2RHTA 4Y98A 4FSHA 5H4HA 2XXJA 2VTKA 4PO9A 5BUSA 1MO4A 2X1HA 1FEZA 4YBRA 3DZGA 5A7FA 2DPGA 1F12A 1K75A 1CZLA 4N12A 2J9RA 1EUCA 3TZBA 4RYLA 1IUKA 3UICA 4AKIA 2QIPA 3BMXA 3FLAA 1JG3A 3CF6R 3WDKA 4KN6A 6REQB 2JLUA 1ZZEA 2WTEA 4LC0A 3VBCA 4WLVA 2XNKA 5KYVA 3U44B 2EFGA 3ETDA 4FFBB 3EA5A 3GFOA 4IXNA 5B1HA 2OK8A 4A0SA 4CGYA 5B5SA 2CFIA 2G9VA 1DNPA 3Q9SA 1U2RA 4NBSA 4ZVQA 5HCNA 3ZDFA 1FFBA 5CH3A 1R0BA 2QDXA 1RI5A 3EH2A 4S3MA 2YXEA 2AA3A 2QN1A 3C16C 4RK7A 4A9AA 3WB1A 4BNDA 1C0LA 1EBBA 4IYJA 4BO5A 2B94A 4YP1A 5A3SA 1Z26A 5LP6F 3RNOA 4M1ZA 1G5FA 3AZOA 9LDBA 3GFFA 1SC4A 3A26A 5IEBA 5KJEA 4YRGA 2WJHA 1US8B 4OFWA 2BEUA 3HKDA 5FB3A 3UV7A 1J7JA 2HYIC 1Q3HA 2D1RA 4N48A 2P9BA 1Q7CA 4RHCA 1BCSA 3J7AC 2XRFA 2O52A 5KB3A 3N28A 5KKNB 4G1VA 1VECA 2Y1WA 3OJEA 3T3GA 2R8OA 1MDBA 3MZ0A 2R1VB 3F1LA 5A0TA 4OAQA 4L7QA 4LXXA 2I87A 3BGWA 1I1HA 2NU7A 3PE4A 2IPNA 1UKCA 2PGDA 1DRVA 2UYQA 4S0ZA 4KFSA 4MQBA 3SCZA 3UAOA 2HB6A 3DW1X 1EVYA 3CUKA 2EJVA 3BK7A 2QVGA 3U6KA 4AC9A 2BJVA 4IIEA 3SPXA 2P0AA 4X7RA 5C52B 3W9UA 1PZFA 1ZLYA 3VOTA 5JRDS 5K6AA 2P6MA 1XLTA 3UZUA 3MUNA 5KCZA 5BWCA 3CLUC 3H5NA 5IBPA 2H1LA 3T7EA 1N32B 1J9ZA 5EJ7A 4IGFA 4J7CA 4NMLA 2F2TA 3K32A 3A9WA 2FX2A 5AJZA 5AKEA 1PZXA 4HH0A 4F9TA 1UAGA 4H7HA 1LLDA 3V4SA 2GCIA 2OO7A 5KYXA 4X61A 2WLSA 3HEMA 5C1PA 5AICA 5FH9A 1V96A 1ZK3A 1SQ0A 2FFQA 4CT4B 4MI3A 3LUGA 2RJOA 3TI7A 2E5WA 1SKYE 1X74A 1ZW1A 4WLFA 3OIUA 3CT6A 4MHSA 1YACA 2GWRA 1UXGA 5JDIA 4JVSB 1RM4A 1S2IA 5K0ZA 3WRWA 4CM8A 4ZTUB 1JDNA 2E21A 5DM0A 1V48A 2WTXA 5FNVA 1PSWA 2G7ZA 2VNIA 2ZXEA 4J0DA 5DU2A 1PG0A 4U0KA 4J1NA 4DCVA 4DLAA 3VFDA 3N74A 3BSSA 1YI1A 3I9V6 1I0ZA 4Q7EA 3AT1A 5F76A 2YNMC 3H1PA 1PSDA 4J2OA 1PDVA 4CIDA 1C7FA 2H29A 3QE0A 3TRHA 3QVGA 4XVRA 1EWVA 3FZEA 1GRNA 2VT2A 1QG0A 1CJVC 1LBQA 3JR7A 4PNHA 4PQFA 4V0RA 3HXQA 2FR0A 4RKWA 4RLQA