1T2CA

Plasmodium falciparum lactate dehydrogenase complexed with nadh
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 112
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2cA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2cA02
1DDOA 2PGLA 1CDOA 4K28A 4R3WA 2DTEA 3T4EA 4WECA 3PGJA 4Y67A 3A14A 4WE3A 3GVPA 3PQDA 4BGIA 4WCFB 2NWQA 4GMGA 2CDCA 1EDOA 2W8ZA 1P1RA 1WZIA 2YY7A 5GY7A 4B7UA 1UXKA 1XHLA 1I24A 5HBRA 2J5KA 3UCFA 1YB5A 3ZW9A 3IS3A 1QV6A 2OP1A 3NT5A 2DBRA 4ZJUA 1OC4A 4CV3A 3MWEB 4CV1A 4RVGA 1WMAA 4FD3A 1XQ1A 2O3QA 3PRJA 4D41A 3VPXA 5I9NA 1EDZA 4BVAA 2HU2A 4I9HA 4PVDA 4E5KA 4TRNA 4I9NA 1LTHR 4LMPA 3WBFA 1HXHA 1KEVA 4GX1A 3CSDA 1VSVA 1U5CA 5DP2A 5JXWA 1YWGO 5CEJA 1U2DA 1ZK1A 4XR9A 1U8FO 3PJGA 4WKGA 3BTVA 2BFMA 3LZ6A 4EEXA 3TPCA 3I6IA 3OICA 3WQSB 4ZVVA 1RKXA 3GVIA 4JQCA 2VZ8A 3G3EA 3RIHA 3LT0A 2JHGA 5LC1A 1JDJA 3DMYA 3CZRA 3JQAD 3AM3A 3GAFA 3HN7A 3ZHZA 2GCGA 3GRKA 3GEDA 2NV6A 3H2SA 3HDYA 4R4JA 3UVEA 2I5PO 2DLDA 3GPDG 1U3UA 3D3WA 3I9NA 3OJOA 4NHEA 9LDTA 4H3VA 1YBMA 1JTVA 4BGUA 1CETA 4FDAA 1IL0A 2CD9A 3V5NA 2DFDA 2NVUA 3P2OA 4Q3EA 3O8QA 4HFMA 4OSPA 3MZ0A 3ABIA 2VWGA 3WWZA 1ISMA 1IOLA 4FR5A 1DFHA 4Q3DA 4MVJI 2HK9A 4XCVA 2I65A 3RAJA 1F17A 3D4NA 1T2AA 4R69A 1EZ4A 3PK0A 4QTZA 4OXYA 3JQEA 1GPJA 1JN0A 4LN1A 4OQZA 3GGGA 1I3LA 5TT0A 1GAEO 3QA9A 2CFCA 5LDGA 1W6UA 1RPNA 4XQGA 3ASVA 1VM6A 1YJQA 5EQFA 2TMGA 1KBZA 3AY3A 1C0LA 1LC3A 1UR5A 4NZ9A 2VUSA 1R66A 2NLOA 3H9EO 4K6FA 3BMCB 4BNYA 1E3EA 3MTJA 4ZD6A 3ICPA 2QX7A 3JYLA 3RBVA 1PL7A 5FEUA 5ICMA 1YDEA 3U5TA 1OBFO 4PRLA 1ADBA 1KC3A 3IMFA 2WTBA 1U2GA 3PJDA 4BO4A 4XYLA 4W7HA 1YJ8A 3DL2A 1I10A 2IZZA 2PA3A 2VWQA 4L0QA 5KJCA 3GDOA 3SJUA 2GNAA 1YH3A 5CHEA 2NM0A 1NFQA 4PZCA 1LDMA 3IP1A 1QSGA 1M6WA 3RI3A 4CR8A 4Y6PA 2YV2A 2IE0A 4FJ2A 5I8ZA 1A5ZA 1Q7BA 1VKNA 2A35A 2DQ4A 5F1KA 1JWBB 3CMCO 2NVBA 1A4UA 2EP5A 1LC0A 4E6PA 1X7HA 1DRWA 4FSHA 4ZN6A 4FCCA 2Q99A 1NR1A 3DHYA 5ES3A 4LCEA 4ALKA 4JNKA 4OKIA 3GH3A 3GN1A 1WMBA 1K89A 5KVQA 2PKQP 3LF2A 3FN4A 1LRKA 3NGLA 4LCJA 4RL6A 1FMCA 4UVGA 1GCUA 1P0CA 4E0BA 2ZATA 3E5MA 2OP0A 1SCUA 2P4QA 2PNFA 4ZQFA 1BXKA 2V6BA 2JKVA 3OEYA 1N9GA 2FPGA 4Q3AA 3A1NA 4YAKA 2Y67A 2I99A 5IZCC 4ZQBA 4I1IA 1YQGA 3ZI0A 4JK3A 2CUKA 3BIOA 1V3TA 4E33A 2VRCD 4U5QA 1BXZA 3HUDA 4CODB 2UV8A 4XIJA 4QO8A 3ENNA 4RVSA 1MFPA 2GR9A 3E8XA 3OETA 4YXFA 3TFQA 4BL5A 1X7GA 4P4LA 5HS6A 2G5CA 4UUOA 4ND3A 4B79A 1DB3A 4P38A 1PQWA 1TB4A 2VZ9A 2P68A 4IQ8A 3BA1A 3V2HA 1HYGA 1C1DB 2IZ0A 3W8EA 1Y5RA 4NBTA 5A5EA 1K5HA 1VC2A 3VDRA 1ZSVA 1A7AA 3FTPA 1F14A 1I30A 2ZIZA 1R16A 2WE7A 1MC4A 3JSAA 3W6ZA 2C82A 4J3FA 3ZU2A 2YFHA 2XAAA 4OHUA 3U4CA 1UDAA 3JD4A 1PR9A 5EL0A 1PGJA 3KZVA 1TT7A 5DCYA 3I9OA 2B0JA 2GLXA 4BMNA 1M6HA 2DU8A 5IG2A 4O1MA 4YT4A 3DZJA 7MDHA 5A3JA 4CR7A 3JD0A 3GA0A 3QSGA 1SBYA 1T4BA 3F1LA 1G0OA 3F5SA 4W99A 1RM0A 4JROA 4BO3A 4A03A 3ZCXA 3L4BA 5BNTA 2QRJA 4ID9A 1VE9A 3X2FA 3FHLA 3I4CA 1NAIA 2VZ0A 3H3JA 2C5EA 4YDRA 4GX0A 2WWRA 2CDBA 4J4BA 4RCVA 1N92A 5TT1A 3QWIA 3N7UA 1T1SA 5CAEA 3QVWA 1O89A 1PJTA 3P7MA 5EQDA 3GDFA 1C3VA 4OM8A 3ANLA 3PIDA 2PD3A 4BS9A 3GEMA 5CEEA 3NX4A 5EERA 2B5VA 4MINA 2X8LA 3PPIA 2IZ1A 4YRDA 3OJLA 2A92A 4OXKA 4II3A 4F6CA 4RZHA 4E30A 2CY0A 3GFBA 1VLLA 4II2A 1FJHA 3ZHBA 4Z0HO 3IKTA 3I1JA 3HSKA 2W90A 4YAEA 1A9YA 1PZHA 1WPQA 2X9GA 1O8CA 2PV7A 4IJUA 4X54A 2Y0EA 2PK3A 1JA9A 1T2DA 1AUPA 2O2SA 1NVGA 5IDYA 2EKPA 4A2CA 4DIOA 4GVXA 3AI1A 4UAGA 1A71A 1E3LA 2PD6A 6ADHA 3V2UA 3L6OO 5T8KA 1B16A 2H9IA 2O3JA 1PS0A 2VNAA 2ZJ1A 3W8DA 1K6JA 4J43A 4L75A 2QIOA 2VYNA 3PHLA 1DIRA 1A4IA 4D42A 1QMGA 3DC2A 5ADHA 4LW8A 3WJAA 2H5LA 4R16A 3WQRA 2ZB3A 1MG5A 1RM5A 4TROA 4DRYA 4WK6A 3NDRA 4FC7A 5FI3A 4KTTE 3BXXA 3GMSA 4N5NA 1DC6A 1LX6A 3FBTA 3KYCB 3EVTA 3U09A 4CLOB 3OQ6A 4RPGA 4OKNA 1SOVA 4WUVA 5JMWA 3WB9A 1B14A 1UDBA 1PZEA 2X58A 3S2EA 4JLWA 1DFIA 4DBVO 1HE2A 3CUKA 2OUIA 3OA2A 1SAYA 3OM9A 2O4CA 3Q2KA 1I2CA 4ZQHA 4NU5A 3OIGA 5CEFA 3CINA 3ROPA 4E2YA 4TVOA 1EUDA 2NVWA 5B12A 3BHMA 5CG1A 1LXCA 4AL4A 2X5KO 3CE6A 1VRWA 1VJ0A 1XA0A 4UEJA 4PLZA 4IZHA 5C3MA 4GPD1 4J0FA 3A06A 1XWFA 1NHGA 4LSWA 3H3FA 3DBLB 1Y1PA 1C14A 3CEAA 1A27A 1ONOA 4PZEA 2PZKA 1C0IA 1J49A 5C7LO 2FMUA 4XRRA 3D4PA 3F1KA 1BW9A 1IULA 4IM7A 4BGEA 3GF4A 3INRA 4MO2A 3TF5A 5IXYA 1JAXA 2FWMX 1A7KA 1I5RA 1Y5MA 3GRPA 4J1QA 5L9AA 3GR6A 4CLRA 4WCFC 3LK7A 4M55A 1LEHA 4CLDA 1TI7A 1EUCA 4H15A 3UICA 1SMKA 3ZU5A 1EFLA 2E4AA 3LQFA 4YCAA 5T64A 3DBRA 4MJLA 3RKUA 3O4RA 4Q3BA 5K0ZA 3HADA 3EC7A 4YAIA 1PL6A 4J1TA 3VKUA 3LLSA 4PFJA 2J8ZA 3ZWCA 1U9JA 4GGPA 3SC4A 5L7WA 4KP7A 3ZWNA 2WJPA 4I9UA 4BB6A 1AGNA 5CDSA 2VHWA 1U28A 3MJTA 4MVJP 4A0SA 4BO0A 2P91A 5A4DA 2AXQA 1RYDA 4IGFA 4Q9NA 1O94A 1ISIA 3ST7A 4M49A 5LDHA 3KEQA 4FOSA 2VCYA 4ROSA 2UDPA 3PDJA 3GG9A 2HQ1A 5EESA 3ULKA 4RJTA 1DSSG 1KVTA 3SEFA 2YZ7A 1N2SA 3TN7A 3KO8A 2GZ1A 3BMQA 4IDGA 5ER6A 2G1UA 2H1SA 3LC7O 2JJYA 1LDYA 4K9DA 1FF9A 4OIMA 2BGMA 4Z3KA 5ITWA 2JFGA 4JXKA 4CQLA 1LUAA 3JYOA 1SNYA 2ZB4A 3DHNA 1XYGA 1N8KA 3BHJA 1JVSA 4IUYA 1EUZA 4BMVA 3H2ZA 1JW9B 4R1UA 1T2CA 2YDXA 4N7RA 2IRWA 2OMEA 1S6YA 4FFPA 4R68A 3V2GA 1HSZA 1IPFA 2R00C 3L77A 5IZCA 4PLPA 3ZHYA 2PGDA 5L7TA 2OL4A 4IDEA 2AQ8A 4GWGA 4KQWA 2SCUA 1F8FA 1DFGA 3OJEA 4XJSA 5TJ9A 2HMUA 4FW8A 2UUPA 3WBBA 3WGHA 4CUJA 1VL8A 4E2WA 2X7HA 2BGLA 3PQEA 3CMMA 3JD2A 5I7EA 3F9IA 3OP4A 4WASA 4CL8A 2OORA 3GHYA 3IAHA 1B0AA 3GNTA 1YXMA 2AQIA 3NAQA 1CF2O 3QLJA 4MVJF 4E12A 4J90A 4NK4A 4IMPA 1H94A 2AE2A 1ZH8A 5KVVA 1UJMA 2WD7A 1ID1A 5KJEA 2V6FA 1S7CA 4G5HA 4Z0TA 1JKFA 3S2FA 1MV8A 1SEPA 1X13A 3DAGA 4XA8A 1DOHA 1FDWA 3ON5A 2ZJ0A 4AFNA 5KVCA 1B3RA 1D3AA 4FPXA 4Y9DA 2DPGA 4F46A 4CV2A 4BKOA 4R1NA 5DZSA 4XGIA 3UFXA 1E6EA 3AUTA 4FIZA 4Z9XA 1F12A 2WE8A 3UF0A 3VZRA 2VRCA 5U1PA 2GN6A 4J2OA 5H83A 3A9WA 1YDWA 5TNXA 5BSFA 1L7EA 3RU7A 1Z74A 4O5OA 4NPCA 5BQFA 1ULUA 4EI2A 1Z7BA 5G0SA 1FDUA 3RCBA 4CM3A 1H9BA 4HBGA 1ISGA 3CXRA 1WWKA 1EQ2A 3DZBA 4AJLA 3U4HA 3UUWA 4ESOA 5C7IO 1YL6A 3JQ6A 4WNCA 2C07A 1QORA 2HK7A 4LVCA 3WMWA 2X4GA 4YT2A 1BTOA 3RQSA 2XPCA 4L76A 2B4RO 4Q39A 3ZW8A 1Y81A 5T67A 1E77A 5T6BA 3G17A 3DFUA 1HYEA 1PGPA 1Y8RB 1ZEJA 4O0LA 1AN9A 3KSDO 2G17A 3I9MA 4Q3CA 3ZNNA 2Y1FA 1HTBA 2FPIA 2P9GA 3GC6A 1ZW1A 1EEHA 3RKRA 4NMHA 1GDHA 3K92A 4XYBA 4I5FA 1KYQA 2RH4A 4Y6RA 2FN7A 3LC1O 1BXGA 1PS9A 2EW2A 4GI2A 2PTGA 3X2EA 4CM7A 1ARZA 1IHYA 1DAPA 4UVEA 1R4MB 3WX0A 4RVHA 3AU9A 5TRTA 3ZU4A 1YB4A 3A4VA 2VQ3A 2GRAA 4YJGB 3E82A 5A06A 2Y1CA 3EYWA 1PJBA 5A9SB 1DLIA 3ZH2A 1JLLA 2P4HX 3AK4A 4D3FA 1I32A 4AJ1A 5IXSA 3SX2A 5A04A 4WEOA 2OZPA 2VT2A 3EDMA 4DGSA 1Y8QA 1ISJA 2QRLA 4H16A 1H6DA 2Q1TA 1DHTA 2YYYA 3OA0A 3E6AA 2OBYA 4GLOA 2NNLD 1M2WA 1HLPA 4ZRMA 4DVJA 2D5CA 2X86A 1NASA 1VL0A 3O03A 4ND4A 2NTNA 5F5NA 3RC1A 1SEVA 4TSKA 1YONA 1FXSA 4AJIA 3AU8A 2DKNA 5FF9A 1U8XX 2X1HA 1HZZA 1F06A 1MGOA 3WGOA 4S1VA 4L4SA 5T57A 1BGVA 4ZICA 2ZTMA 3RFTA 1DEHA 4N5MA 4YAGA 2G76A 1GUYA 1H0KA 1DJNA 4MVJH 3BYZA 4GLLA 4E5PA 4J6FA 4B7XA 2E82A 3INTA 1D4FA 3GAZA 3NGXA 5A9RA 3DOOA 1LSUA 3BHIA 4QECA 1KVSA 2BI7A 3KSZO 4HFRA 4WLOA 5GZ1A 2I3GA 4B3HA 1GCOA 4BOYA 4PN3A 4KWHA 2J3HA 3TFOA 2PR2A 1X0XA 3JQ8A 3VKVA 1X0VA 4BO6A 4U0JA 3WYBA 4ZQEA 3ZV5A 1N7HA 2EEZA 3HDQA 3PI7A 2EP7A 4HFJA 1EK6A 3JYNA 1FDSA 4IDBA 3DTYA 3FR8A 3TL2A 1I33A 2PKRA 1ONPA 3PXXA 2Q2VA 1PZGA 4GSLA 3B1FA 1XKQA 4BNMA 3D7LA 4C7JA 4CQMB 4WCFA 5A02A 4RF4A 3FRJA 3VH1A 4YACA 1AXEA 2QHXA 5IZ4A 4E31A 4GL4A 4YJHB 5KJ1A 4N18A 3RC9A 1WDKA 2EF1A 4O63O 1H2HA 2J3IA 3NYWA 3W4KA 3AI3A 2QZ9A 2GD1O 1GFSA 1LDEA 2Y1EA 2EERA 4ILKA 2VOJA 4IS2A 2HMVA 4RLSA 1PJ4A 5B1YA 2A94A 3GNQA 3Q3CA 1M75A 3PZBA 1GZ6A 1KOLA 5KNLA 3I52A 2BI8A 4G81A 1T1RA 2IEBA 5DDIP 5DCUA 3MJEA 1BWSA 1ZK4A 3O26A 5F5LA 5H81A 2DTDA 4HKTA 1X1EA 1E0DA 2YW9A 2X23A 3QW2A 1ZJYA 3K8ZA 1GPDG 1O5IA 3NV9A 1LRLA 2Q46A 3NDJA 3VH2A 5ENVA 1ZXLA 4QO7A 3AFMA 4XGNA 1LI4A 2B83A 4KTVE 1SB9A 3ROKA 1Z82A 1UUFA 3AOEA 2F00A 3ONEA 4PLCA 2X9NA 4KUHA 2BLLA 2FOIA 1WVGA 2AEFA 2ZYGA 4MVJD 4XGKA 2NU8A 5KVSA 3KLPX 2HO5A 2E49A 3ZN2A 5HWSA 5C5IA 1MG0A 3U0BA 1Q7CA 3MOGA 1E5QA 3QV1A 5CDTA 4J2HA 4P4GA 2AQKA 2PZMA 5ITVA 1XDWA 1PJ2A 2D0IA 1Z75A 2R00A 2EKQA 4CMIA 4CMGA 4DLLA 1E5LA 2ZCVA 4OAQA 4D3DA 3RUCA 3K6JA 1IY8A 1F0YA 4MDHA 3MOIA 3ZWXA 4IINA 4BNUA 2O50A 4WJZA 5THKA 4GKVA 3I23A 4D0SA 1E3WB 3D3WB 4JIGA 4B4OA 2BFOA 2FR8A 3D1LA 4AJOA 5KJ6A 3AUSA 2DBZA 3ONFA 1P3DA 3UKOA 3ZU3A 5A05A 1HZJA 5MDHA 1E7QA 2NVUB 1KVRA 4IPTA 3IIEA 3OIFA 4RV9A 3ZGYA 1T2EA 1LNQA 2UVDA 4WEQA 2O3TA 3FTNA 2I6TA 5JO9A 1UXIA 3RBZA 5DBFA 2BGKA 4GQAA 3RWBA 1UZLA 2VHXA 3R3SA 3TOXA 5F1PA 3HFGA 2G82A 4TWRA 1QLJA 1D1SA 3HB4X 1PJQA 4G65A 5KWEA 5COBA 4U0KA 2R6JA 2AEMA 4AICA 1MX3A 3NKLA 3HZZA 3SVTA 1QRRA 3GOHA 5LCXA 1LBEA 3KSUA 4AJNA 1ZKMA 1T2FA 1GD1O 1IE3A 3AY6A 4GGOA 4FJ0A 2ZTUA 2YJZA 1U3VA 3K73O 3PGXA 4NBUA 3T7EA 4UULA 9LDBA 3WIEA 3QWFA 4CV0A 2IDZA 1J5PA 3PTZA 2Y66A 1NHWA 4QX6A 3RJ9A 4KWIA 2PLAA 3R0IA 4R9RA 5TSDA 5ICSA 4FGSA 2OGUA 3WJ7A 3G0OA 3FF4A 5G0TA 2WYWA 1GEEA 5EJ2A 1R15A 4B4VA 1B8UA 1GYQA 1JU9A 3W6UA 4BNTA 5JCJD 3PHIA 1NPDA 3H4VA 4ZQGA 5G2OA 1R12A 2EHDA 4FJ1A 2P5YA 3QRWA 3VC7A 4DQXA 4E5NA 2CF6A 2O3UA 5CG2A 3NJ4A 1I01A 2CZCA 2ZKLA 3H8VA 4DBZA 4QEDA 3GMDA 5FWNA 3WTCA 4BNJA 1P33A 2J3JA 1C1DA 4GWKA 2E37A 1G6KA 4J7CA 1T24A 3ZWMA 2TMDA 3FNEA 2NUAA 2W2LA 1ENPA 1NQ5A 1W4ZA 1WXDA 3LDHA 1P77A 5L4LA 5G4KB 2JD1A 1DJQA 2WYUA 5JCXA 1ZEMA 1LQUA 4CM5A 4E13A 1U4SA 2EW8A 4NIMA 1G0NA 1Z73A 4EBFA 1RWBA 4XYMA 3RBXA 5DBIA 4KDEA 3DONA 1NBOA 1R37A 1BRMA 2FSSA 2EG9A 1E3SA 3DOJA 4HNHA 3VZQA 3F4BA 5DULA 5JDIC 1H2BA 3KTDA 3DZKA 2GGSA 3EUWA 2EKLA 3VZPA 1SO8A 2YUTA 4Z9YA 2OXIA 4CL3A 2UUOA 4P4NA 3JQBC 2FP4A 3JQGA 2X22A 4YBZA 3ANMA 4UEOA 4OGWA 5THQA 4CM9D 4BNKA 5K6AA 2XXBA 5A3VA 4FC6A 1DIGA 3IJPA 5JLAA 4D79A 1BVUA 1P1HA 5CPFA 1TVEA 3UXYA 3OFSA 4JJIA 5JAQA 2HUNA 1MC5A 2O2YA 1SB8A 1GTMA 3H7AA 4JX8A 1XG5A 5A5FA 1SOWA 3VHRA 1I3NA 4FBGA 4EDFA 1E3JA 1DRUA 3CTMA 3HB5X 3ZWBA 2DT5A 1GQQA 2Q2QA 1P1JA 3VOSA 2BF7A 3AUAA 5EN4A 1IUKA 1HE5A 2B36A 5F1OA 1E7SA 3DB2A 5KIAA 5I9LA 3TL3A 1ZK0A 1ZVMA 3EMKA 4PVCA 4LK3A 1QP8A 3HDHA 4J9VA 1O6ZA 4XX0A 4NFYA 2ZTVA 3QQPA 4PLHA 2HKIA 1R0KA 1D8AA 2IXAA 4PLTA 3HJAA 3WYEA 1OZAA 3KYDB 2FRDA 2J5RA 1ZUD1 2BHLA 3E9MA 3JQ7B 1ISHA 5F3RA 3QJ5A 4BQRA 5TS3A 1LDBA 3INGA 3DBVO 4IXTA 4AG3A 3C85A 3TSCA 3KYBA 1XLTA 2D59A 4HADA 1WW8A 4RLHA 5L40A 1PTJA 1IZ9A 4MIOA 5HRUA 2ZB7A 3P19A 3KYCA 3NRCA 1GU7A 4Y8VA 1JAYA 4CLXA 2P9EA 1C0PA 3RUHA 3I9KA 2DTXA 4QSMA 1GZ3A 5IDWA 3ROQA 1B3BA 1IPEA 2D2IA 4OQYA 5G4LA 5L45A 3I3OA 1UDCA 2WM3A 3TWOA 4RPLA 4XDYA 1UZNA 3QP9A 1IYZA 5IN5A 3KEOA 2X5OA 4CQMD 2NU6A 4GKBA 2GO1A 4YRAA 1LSJA 1KEPA 5HTOA 2C7GA 3B1JA 3U62A 1TA4A 5BSGA 4HWKA 3WLEA 5I9MA 2YQ4A 3C24A 3O38A 1U4OA 2PFGA 3L07A 4TQGA 4QFCA 4DA9A 1H6BA 3R3JA 4JP2A 1HF3A 1PJSA 4CM6A 8LDHA 1X1TA 4Y98A 4E2ZA 1XU9A 1HWYA 3BTUA 4E3ZA 1AE1A 2EIHA 2EV9A 2Q49A 3IUPA 3PJFA 4E5YA 1Z6ZA 3D3EA 4DC1A 3GUCA 2FY8A 4A7PA 1Q0HA 3K5PA 4L8VA 3U49A 3UH1A 4B8WA 1YL5A 1YO6A 2O23A 4WGGA 3RUAA 4EUEA 3PIIA 5GZ6A 4MP3A 4DPLA 3DFZA 4J91A 4UREA 5KJFA 4RPJA 3ENKA 3OQBA 3CIFA 3WR5A 4A10A 5HS4A 2OO5A 3QWHA 3KHUA 4ZRNA 1GADO 1KETA 2ZB8A 3JCZA 3WWYA 4AJEA 3I9LA 1PU2A 3LLVA 5H82A 4OO3A 5JAZA 5TLSA 4RDIA 4DUPA 2BKAA 3D5TA 2G0TA 4IDFA 2YV1A 5EPOA 3DZIA 1YVEI 1KY4A 3B20A 1Y9EA 1EBFA 3ORFA 2C2XA 3QY9A 3JQAA 5TJHA 1R0SA 4YJDA 4EGFA 2YV3A 3GVHA 2Y93A 5IDQA 4MVJA 3FPLA 1PQPA 4J16A 4RORA 3TRIA 4D45A 4NNJA 4XR4A 4Z0PA 4BO8A 4PLVA 3H6KA 5COAA 2AG8A 1QYXA 4S3MA 3DDNA 1EVYA 4NFSA 1ZZEA 3L0DA 1R4NA 4BO9A 4XQCA 1ZJZA 3JQDA 1K2WA 1XEAA 4MIEA 1N5DA 3KVOA 2YHIA 3I4FA 1BDBA 4CMCA 1HDGO 4URFA 4NR0A 1ZK2A 2F1KA 1E6WA 1SPXA 2O7QA 1PJCA 3VTFA 1HYHA 5ILGA 1PL8A 3C3XA 2B69A 3NTOA 4M8SA 1XCBA 1BG6A 1WZEA 2HSDA 4MVJM 2V65A 1LLQA 4MKZA 1CIVA 4B7CA 1NPYA 2WEKA 3FCOA 5JS6A 4I5GA 1B8VA 3AUUA 1UXHA 3KBOA 3NT4A 4OYRA 4EJ6A 3LF1A 2HMWA 3GZ4A 5CFZA 5JYDA 1V35A 5G0VA 2O7SA 2Z1MA 1YOVB 3NJ8A 4LISA 3OMLA 3PVZA 2I76A 2OOSA 4LSMA 1PWZA 1X15A 4NI5A 1HE3A 1W0CA 3BMNA 3HHPA 4NJMB 3KLMX 3MJ4A 2NTVA 3IQDB 4NH4A 1ENZA 3L9XA 5JNLA 4IZIA 1GUFA 3ASUA 3LT2A 4L4RA 2VT3A 3G79A 2YFQA 4RVDA 4XB1A 3FNHA 3RUIA 1UP4A 4KDFA 3ONDA 4U7WA 1A72A 1LLUA 3OJ0A 5EIOA 5DP1A 4BKPA 4N5LA 4XRGA 2EXXA 1NNUA 3HNPA 2HJRA 3KV3O 4FFNA 2VWPA 1O9BA 1LLDA 3H65A 4PGFA 2GPTA 3K2EA 1H5QA 3F46A 2I67A 3KOUA 2DC1A 2Z1NA 1PEDA 3PYMA 2GN4A 4FFMA 5DT9A 4XIYA 5A1TA 3EHEA 3E1KA 3PEFA 3BAZA 3WMXA 1VL6A 2W2KB 4BV8A 2P2SA 1H6CA 2IODA 1J6UA 3EK2A 1C1XA 2XOXA 1M66A 3VPGA 2Y0DA 3IJRA 2VHYA 1D7OA 2VUUA 2AE1A 3GGOA 3OEWA 3S55A 3NTRA 3H9JA 5B4TA 4HUJA 4XDZA 4YA6A 4R3NA 1PR3A 4F3YA 1UXGA 3U4DA 4CMJA 1P74A 5GZ3A 2ZYDA 5DN9A 3AM5A 1LDNA 4ALJA 4BGVA 3Q11A 4QT0A 4YWJA 3GHHA 5A03A 3JQBA 1IHXA 2WD7B 3D4OA 3EW7A 4QXMA 3E18A 1YRLA 3F4LA 1EBUA 4XYEA 2DFVA 1V8BA 5AVOA 2X6TA 4J0EA 4CM8A 5IAAA 3PP8A 3SXPA 3W4JA 1DBVO 2I9PA 4PRKA 4HNGA 2HLPA 3FD8A 4M1QA 3QVOA 3FR7A 5KKCA 2JD0A 2C7VA 5AYVA 5HM8A 3C1AA 1Y8RA 2HDHA 4KOAA 4MKXA 4YTEA 1Z45A 1F8GA 1RJWA 1IZ0A 3DBHB 1LDGA 1PGQA 2Y99A 5GMOA 4Y6SA 3U9LA 1P44A 1XSEA 4TRRA 2PH5A 3S2GA 1E3IA 3QWBA 1V6AA 4LGVA 2JCVA 2WSBA 4AJ4A 1PIWA 3RUEA 1QR6A 3ITKA 4EUHA 2JAPA 3H9UA 4TRMA 4YJFB 2DBQA 1R4MA 3JQFC 4CM9A 3I6QA 4PG4A 4BO2A 1UH5A 3FI9A 2B5WA 1FDVA 3GZNB 4PCVA 1GYRA 4UUPA 4XKJA 3L9WA 3VH3A 3K9QO 2D5AA 3BTSA 5JO0A 4O59O 1JWAB 1FK8A 2HMSA 1ADGA 2NSDA 3G49A 1XQ6A 2LDXA 2O4UX 4WLFA 4I5EA 4Z3DA 1WP4A 4L4XA 4TMFA 3Q0EA 1BHSA 1BXGB 3RVDA 5JPIA 2D8AA 3DWFA 3IUSA 2JFFA 3LT1A 2OFPA 3DZFA 4DIFA 2BFAA 3H5AA 3JV7A 4JGBA 5DF1A 1J4AA 1MB4A 1YGYA 3LC2O 4ZA2A 3DO5A 2AEJA 3E03A 1XIVA 4E4YA 1E6UA 4GSKA 3BMOA 4I08A 4TRJA 4BMSA 3HE3A 2Q2WA 4ALNA 1HDXA 5CP8A 3WS7A 2QYTA 3OIDA 4CM4B 1TLTA 3ETEA 4LRSB 4YVFA 4XZ3A 3W1VA 1V3UA 3K2BA 4XEHA 4BNLA 2A4KA 3DZGA 4D0RA 4M54A 4UUNA 5JMPA 5BSEA 1CEQA 1B2LA 1H6AA 3ZHXA 3WICA 1YQXA 1TXGA 5IN4A 2PKQO 1UXJA 2PGJA 2Q4BA 2OBNA 3QIVA 1B8PA 4GBJA 2X5JO 4DYDA 1I2BA 1HEUA 4EJ0A 2Q4EA 4UUMA 3Q1LA 1NXQA 3B70A 3JYQA 4B8ZA 1DPGA 4BO7A 4CQMA 5KKAA 4AJKA 4QUKA 2EJWA 4IDCA 2IXBA 3MCVA 1TT5B 1HT0A 1NQOA 4MP8A 4NJOA 1PQUA 1RM3A 2VWHA 1CRWG 2Y1GA 1ZSNA 3PWZA 4YJHA 1OMOA 1NWHA 1ZNQO 2CF5A 4K26A 4BUCA 4IJVA 1NQAO 1JKJA 2IYPA 2QZZA 1HRDA 1GQYA 1EVIA 1HLDA 2VOEA 2X9VA 1NVMB 2ILTA 4A27A 4GVLA 4MVJG 1CYDA 4JP3A 1JQBA 3E5RA 3VPHA 4CLHA 4OOEA 5I7FA 1R6DA 1CQIA 3CH6A 4O6VA 4G2NA 2D1YA 2UYYA 1JVBA 2JCXA 2NQ8A 5T8KC 2W98A 3DOCA 2OHXA 3RC2A 4JCOA 4CMHA 4DMLA 3C7DB 2FZEA 3ICCA 3NUGA 3U3XA 3UCXA 1U5AA 2VHVA 3I83A 4CMBA 2NACA 1JKIA 3K31A 3R1IA 2WD8A 3WGTA 1VJTA 1O0SA 5T5QA 4PLYA 1BVRA 1E7WA 1QXSA 1MUUA 3ZZNA 2CVOA 2GYYA 4I5DA 3ITDA 4YB8A 4AJJA 2Z95A 3HFSA 4CUZA 2NU9A 1XGKA 3L6DA 1QYVA 4JBHA 3RFXA 3RFVA 2EGGA 4YAJA 3WSWA 4JBGA 3DAFA 3RD5A 3M2TA 5KTKA 3ADOA 1O95A 3ETGA 4IIVA 4W82A 2X0RA 4J1NA 4OSOA 3EVNA 2E6UX 4RGBA 4BHTA 5CDGA 2YQ5A 1PS8A 3TZ6A 3GN2A 4IMRA 4NG5A 4BNIA 1DO8A 2CVQA 3AWDA 4HY3A 3IOYA 2X0IA 3TZKA 1LA2A 3VPSA 3P2YA 1E3WA 1GYPA 3LT4A 3LYLA 5B37A 3WYCA 1L7DA 3AJRA 3KUXA 5I7VA 1YE3A 1VI2A 2FHSA 3D64A 4IDDA 5L95A 5L4NA 3UAGA 1I8TA 5AXAA 4WLEA 4DPMA 4JJGA 2NTJA 5IF3A 3GEGA 3LU1A 3EY4A 5EINA 4AJHA 4YYZA 4PIVA 5B4VA 4IBOA 3O8QB 4D44A 3BMCA 3SBOA 3WQQA 4BNHA 4CMKA 4BIIA 2FR0A 2E48A 2VHZA 4RPHA 4U6QA 4CMIB 3UGKA 3OHSX 1W73A 2AW5A 4JBIA 3LSYA 1QYCA 1YKFA 2HJSA 4E21A 1OOEA 3G1TA 3VVCA 4NFHA 5BSHA 5JBIA 1U3WA 4R1TA 3GDGA 4HX5A 2C5AA 5COQA 5L4SA 4RPKA 4QQRA 4QFDA 2H63A 1PJ3A 4Q3NA 4XYGA 2X0NA 3S8MA 1T25A 1P0FA 5L7YA 2IEDA 4EYEA 1ULSA 4J9UE 3DMTC 2I3AA 3UOGA 4GX2A 1NVTA 5G0WA 2ZQZA 3E48A 4R54A 1DIHA 2H6EA 3PJEA 4TZKA 1X7DA 5BR7A 3PLRA 2JFHA 1I2ZA 4BO5A 3A28A 3E9QA 1HDYA 3UN1A 3UW3A 4CQLB 3ZDFA 1E1MA 4OOFA 1EMDA 2RHRA 4B4WA 4WLNA 4L73A 2J6IA 2DUUA 3PYLA 4ZGWA 4M86A 2HRBA 3F3SA 4DIBA 1P9LA 3NTQA 5FYDA 5ILOA 2QG4A 3MTGA 3I5MA 5CDYA 4Z6KA 3VAZA 1HDOA 3OF2A 4YPOA 4FFLA 2BMAA 2PZLA 1P1FA 4MVJE 4RO0A 5EMHA 2Q1UA 3F6YA 1KERA 3VH4A 1E7MA 2QRKA 3QE3A 1HDRA 5DCWA 4OL9A 4ND5A 3WFJA 3W8FA 3ZWAA 3ZV3A 2BD0A 4KQXA 1DIAA 2C29D 4KMSA 1QYDA 1PSDA 2Y0CA 2JHFA 4A73A 3AOGA 2DBVO 1K6XA 3JQFA 4RZIA 3MJVA 3QVXA 1MXFA 1D1TA 4PLGA 1HE4A 1UAGA 3RASA 2O3RA 4R5MA 3RUFA 4ALIA 1AXGA 3HQ4O 1KVUA 2GN9A 2Q1WA 3VDQA 3ZNOA 2P5UA 2PY6A 3G1UA 3M1LA 4RF3A 5JDCC 1GV0A 5BNFA 4EZBA 5L53A 5G4KA 4K6CA 1N9GB 3IP3A 1P45A 4J7UA 3WNQA 3BTOA 4GAEA 3PHJA 3ZNQA 1Q0LA 3EGOA 1ADCA 4N54A 1C0KA 4MKRA 4B3IA 1A9ZA 3AI2A 4FS3A 1DC4A 3C7AA 1PGNA 1ISFA 4CMEC 4NBVA 3B6ZA 2ZQYA 1UP6A 1P1IA 2NU7A 1N1EA 3DEYX 1V3VA 2GUGA 1CWUA 4LMRA 4MPDA 4RQTA 1QLHA 2FSVA 2VRBA 3QHAA 2ZK7A 2A9FA 2VTEA 1V9LA 1WLYA 4UVHA 2RHCA 3WFIA 4DWVA 4IS3A 2Q45A 3S2IA 5HA5A 1U1IA 3MJCA 3KRTA 1GZ4A 4NU6A 2LDBA 5DNAA 1K3TA 2EJVA 4L9RA 5L3ZA 3V1YA 3SC6A 3VVBA 3F47A 3GGPA 3DAPA 2Q1SA 5TQVA 5BT9A 2Y1DA 2RH8A 5K9ZA 1LJ8A 4PG6A 4FGWA 4JJFA 3TJRA 1T4DA 2WMDA 1U3TA 2HMTA 5CDUA 5KOIA 3KETA 1BSVA 5JYEA 6LDHA 2ZCUA 3JQGB 4E5MA 5JY6A 5DOVA 2XXJA 4YEDA 3JTMA 5JSFA 1I3KA 4W9NC 1AHIA 5ENDA 1ZMOA 1DLJA 1CQJA 2NADA 5TX7A 2FPPA 1XELA 2Q3EA 3OSUA 1NWCA 2O48X 3TDKA 4WOKA 2VYVD 3H5NA 3W4IA 1OFGA 3GT0A 3L6EA 1BDMA 3KYDA 3RJ5A 4PG5A 2RBEA 1PGOA 3PHHA 3JQ7A 3OH8A 3OQ1A 2HK8A 4R41A 5CPBA 2CSUA 5AOVA 1EE2A 1U7TA 4NBRA 4OMUA 4R01A 4BKUA 1E7RA 1CERA 2HCTA 3FWNA 3N58A 2AMFA 1W8DA 3C8MA 3RSHA 4NBWA 5A9TA 3V1UA 3QVSA 1KS9A 3OECA 2GDZA 5I8WA 4BKRA 3WGYA 5TGDA 1LQTA 3ETDA 4CLOA 1DAOA 3AW9A 3WSVA 1EK5A 5JAMA 3GLQA 1B26A 3OJFA 1L1FA 2ZTLA 1V0JA 4DLBA 1HL3A 1KIFA 4OJNA 2PZJA 3JQ9C 4CM1A 3RROA 2C2YA 4UVDA 3WIDA 1PWXA 4HFNA 1KC1A 4YRBA 1NFFA 4PG8A 3KB6A 3DZHA 3WDSA 4IQ0A 5TIIA 1H9AA 2B37A 4UEKA 4BNWA 3PHGA 3Q9UA 4YQYA 3RU9A 3FPCA 4A5OA 2C59A 4ALMA 3PFFA 3C7CB 5C7OO 1SC6A 2V7PA 3FNGA 3Q6IA 4EJMA 4E2XA 4TZTA 3SJ7A 4E32A 2JD2A 5DBGA 4F45A 1YBVA 1PX0A 5FFFA 2D4AA 3STHA 3DBLA 3ZV6A 2VNSA 3H9QA 5F21A 1E1NA 2AQHA 3TNLA 1YBAA 4IDAA 4INAA 3E9NA 1NFRA 2EGHA 1OAAA 1Q0QA 3DTTA 2Y68A 5G0UA 1QG6A 1SZJG 1Q7GA 1Q2XA 4FFOA 2WYVA 2PD4A 1VJ1A 4J1SA 3ANNA 3VTZA 3GG2A 4FOOA 3WOHA 3JD3A 4C4OA 1R0LA 3WXBA 3H9GA 3CZMA 3CPSA 1Q1NA 4HXYA 3SLGA 5JC8A 1NPTO 4BKQA 2ET6A 1GQ2A 1XU7A 5IJZA 4BV9A 3WLFA 4DTIA 1DC3A 4ND2A 2POQX 4BQPA 1NM5A 5DOZA 5JC1A 5KCZA 3F5QA 2FR1A 1ZMTA 2QYSA 3FWZA 3UHAA 5MGBA 3AFNA 5JE8A 2X0JA 3ADPA 1BW9B 3M2PA 2GZ3A 2CDAA 4U6SA 3SLKA 5JAIA 2BFPA 3O9ZA 4WNIA 2FZWA 1PJLA 5TC4A 3V1TC 2D3TA 1BMDA 1ZFNA 4NDNE 4CLRB 4MIYA 3PFWO 1E92A 3K96A 4B4UA 3WTBA 1QKIA 3L4SO 5U4QA 2GN8A 4HP8A 5IDXA 1EVZA 5C37A 3IDSA 3I9JA 3DBRB 4H7PA 1E1LA 3JQAB 1YL7A 3RC7A 2DVMA 3U4IA 3DMTA 2YDYA 3GUYA 2HRZA 1LU9A 1Y9AA 4W4TA 3KM0A 4R51A 2BH9A 4GX5A 4RF2A 3PWKA 3D5QA 1LRJA 1K0UA 4PLFA 5AXCA 3PZRA 5U9CA 4NQZA 4CLEA 2NQTA 2PH3A 4BNZA 4NK5A 2BRUA 4I8XA 4IXWA 1R4NB 4MOWA 2Y1OA 4ND1A 4TKMA 2EWMA 4WLUA 2Q50A 1YOVA 2YHUA 4LRTB 3TOZA 3V8BA 3WGZA 4KUGA 3WNVA 1VKOA 2CNBA 5JW6A 2YHIB 1H93A 4P22A 7ADHA 1ML3A 3PYXA 4NJMA 1MLDA 2QQ5A 4J7XA 1GUZA 3UCEA 3RUDA 1KY5A 2B35A 1I0ZA 3R6DA 1UZMA 4P8RA 3GQVA 4IQGA 3AOEC 4ITUA 3K30A 4XB2A 4DREA 2C0CA 3COSA 2V6MA 1ZIDA 3BMQB 4M89A 4J49A 1Y7TA 1PZFA 2VTDA 1M76A 4YT8A 3IL2A 4BO1A 1VSUA 1UAYA 1ZSYA 2JCYA 3ZWYA 4EUFA 4AVYA 3WG9A 2W2KA 1KVQA 1B7GO 2ZYAA 3B1KA 1MP0A 4GH5A 2RCYA 3BMNB 3EZYA 3QWAA 4EEZA 1NAHA 2GZ2A 4C7KA 4DQVA 5JDCA 2QW8A 1E1KA 2RIRA 4LVUA 3DXFA 1DC5A 3BZUA 4OH1A 4CJXA 1X14A 4DYVA 1VPDA 3ZWVA 3PQFA 3ZWOA 1GV1A 1WNTA 3CKYA 1NQTA 2J5QA 2AG5A 3N74A 3HN2A 3MEQA 1HDZA 3Q2IA 4U8GA 2GSDA 4R5HA 1XR3A 4WPGA 1ENOA 4WOJA 4YT5A 3MJSA 4MP6A 4B3JA 4BNGA 1Y6JA 5AXDA 5JDIA 3NDIA 4CMEA 1Z7EA 5JY1A 4UVIA 5JCJA 2GERA 5FI5A 3NT2A 4FQ8A 1DIBA 1I3MA 4CMAA 4EW6A 4TVBA 4ZHSA 1DRVA 3DQPA 1C1XB 3ZNPA 1MFZA 1I36A 4FB5A 1CJCA 4RQUA 2J3KA 4PG7A 3DHEA 2V6GA 2VUTA 4W7IA 2GF2A 4XQEA 4D43A 3JYPA 3ZWPA 3T7CA 1T26A 3WGIA 4DMMA 3DBHA 3IKVA 1NYTA 4DXHA 1EQUA 2W4QA 5AQ1A 4RF5A 2C20A 4JN6B 1EFKA 3AY7A 4YQZA 4KZPA 4R1SA 3TZHA 1RM4A 4L74A 4ONEA 5AXBA 4ALLA 1N7GA 3Q9NA 4XWYA 2W2LD 4W9NA 4DLAA 3C1TA 1KEWA 2JAHA 2WDZA 4CM8B 4EITA 2VN8A 4YJFA 4FN4A 2AA3A 2JL1A 1GL3A 5B4UA 4DPKA 3TQHA 3LVFO 3GZNA 5BNIA 5ER9A 2Z5LA 4ZU3A 3EZLA 1ADFA 1N1GA 4XQ9A 1EVJA 4YJGA 4HV4A 5TF4A 5A9SA 4PZDA 2I66A 2O3SA 3TZQA 1HKUA 1NTOA 1LSOA 1P1KA 3FNFA 4R9SA 4CPDA 1HSOA 4IJWA 4AJ2A 4IGEA 4CUKA 1GR0A 2UAGA 2DPHA 3MWDB 3ZV4A 3EAGA 1ZO8A 5J23A 1IB6A 1K6IA 1KEUA 3GVCA 3PLNA 4RVFA 3C1OA 1J0XO 3HWRA 4YR9A 2DUWA 8ADHA 4J4HA 3GVXA 3KXDA 4F6LA 3AM4A 2AHRA 3NEPX 1DXYA 2PWZA 2HAEA 4BNVA 1ZK3A 1AHHA 3JQ9A 4OXNA 4KUEA 1U7HA 4IIUA 4RVUA 1WDLA 1B15A 1NR7A 1NX6A 4A26A 4DQUA 4CR6A 5L51A 1E7YA 4WCDA 3VPFA 3ZWWA 2VYVA 3GY0A 1WAMA 4DC0A 1M67A 1QV7A 3GK3A 4TKLA 4WLVA 1MXHA 1UP7A 4FFRA 1NP3A 1Y8QB 4IY1A 4D3SA 2R2GA 2B4QA 2CVZA 4M87A 3TZCA 1HETA 4CM4A 1ZXBA 1GY8A 4D7AA 3HDJA 1RYEA 4W6ZA 3PDUA 3VZSA 3GFGA 3IC5A 4J4TA 3JD1A 1QYWA 2Y05A 4DL9A 4GMFA 1LLCA 3GNSA 2RAFA 4BNFA 4AJPA 1ZCJA 3FSRA 2P9CA 1YQDA 4PLWA 4BNNA 3T4XA 3QVTA 3L4BC 1DHRA 1WDMA 1YB1A 4IJKA 3FBGA 5K6AC 1ORRA 2DAPA 1EE9A 5JFOA 1FDTA 3BMOB 4RDHA 3S1LA 3ROMA 4D46A 1P31A 4XD2A 3PWSA 1MA0A 3DR3A 2CMDA 4K1LA 2DM6A 2VYND 3P5SA 2XF8A 2GASA 4BNXA 1TT5A 4BB5A 1TEHA 4XJTA 3JQCA 1ENYA 2C54A 3GPIA 3M6IA 2B4TO 3WGGA 3H5RA 1ONNA 1ZBQA 4Z9FA 1G1AA 3HG7A 5IFLA 1OI7A 3OBBA 5I7SA 2IYOA 3JQ8B 3D0OA 1HDCA 1OC2A 1YS4A 3M1AA 3WGQA 1LSSA 2BELA 1GEGA
chains in the Genus database with same CATH superfamily
2PGLA 4K28A 2B7BA 3KAQA 1ECJA 1I0LA 3EASA 5G53C 4WE3A 3GVPA 2UYGA 4BGIA 3PE3A 4JXJA 2NWQA 4L0DA 2ZRMA 1MC8A 1DBPA 2CDCA 2H1HA 1D09A 2HPHA 1ZXXA 1EDOA 1RQXA 5ALRA 1NTRA 3R5JA 5GY7A 2LCFA 1TCCA 4IR7A 3UCFA 1H0SA 3ZW9A 1FYWA 1G59A 5NULA 1SUDA 2DBRA 4RVCA 5FOXA 3MCUA 1RAEA 3DAYA 1OBHA 3I34X 5TVGA 1OD6A 4PO3X 1UC8A 3RSCA 1ZR2A 4CV1A 2IW3A 3QUCA 4C5CA 4ATNA 2ODNA 4DBLC 4GHWA 1USIA 1XQ1A 4A4DA 4MWBA 3PRJA 2BCGY 4D41A 1JJFA 2P75A 2BBTA 4JR2A 4DEVA 1N9KA 3JWJA 2OHGA 2ZGVA 3WZLA 5CLGA 1QE5A 1Z34A 3FPBA 1E69A 4UUBA 3WL3A 2G1PA 2W58A 1O96B 1U5CA 4KIFA 5IC5A 5DGCA 5DTEA 3SHOA 3G2PA 3ZKWA 4P6VF 3TPZA 1TM7E 3SBDA 2PEZA 3GI1A 2BHSA 5H4GA 2DLCX 1WW3A 3HVHA 3TPCA 3TNFA 3I6IA 3OICA 5DHRA 4A82A 4TS4A 3A1CA 2PO5A 4W1SA 1IBMB 3GVIA 2QMHA 2JZOA 2VZ8A 4G5FA 3GFFA 5HDBB 3LT0A 5LC1A 3JQAD 4JI4B 4G25A 3AM3A 4ANFA 4EF4A 3CNHA 3H2SA 5FBLB 5EIXA 1FRVA 1PT5A 2HT6A 2JA1A 2DLDA 1VJGA 3AETB 4KGVA 4R9UC 1XB2A 5AK5A 2VBFA 3WZ2A 1VI6A 4M1EA 9LDTA 1J1UA 4H3VA 1QRTA 5AO9A 3FBWA 4HDRA 2OV1A 4ZOCA 4QGFA 4GD3Q 4C30A 4AIRA 5GM2A 2P5SA 3JAKB 5FLEX 2C3OA 3M4JA 4Q3EA 4YYEA 1N7JA 5LJIA 1SOAA 1HURA 4HFMA 1RIFA 2HV9A 4OSPA 4F85A 3MT0A 2YWXA 1T9DA 1Y6ZA 1CP3A 3IXLA 4UU8A 2V97A 4FR5A 5CD1A 1DFHA 3KS9A 3HZOA 2PGAA 3ELYA 1G8FA 3AGPA 4IDPA 4XCVA 3WXMA 4L5AA 1F17A 1B42A 1Z36A 3O93A 4WL0A 2IHBA 2NZ2A 2Z4RA 3VHLB 2ZSKA 1RXWA 5ALNA 4DBLE 3FRIA 4IWYA 4L8LA 2BFWA 4KPYA 1OKKD 3IAEA 4CDGA 1BA3A 1I3LA 3KL2A 3TZBA 1WKCA 2XQGA 4OHMA 1ORTA 1YU9A 1NVBA 2WI8A 3NBKA 5K09A 3FCYA 1UR5A 4J1TC 5KMGB 2NPIA 1R66A 3H9EO 3O4HA 4M46A 3HEMA 4WOCA 5CH3A 3RVNA 3L7BA 3A3KA 3BMCB 1Y80A 4J16C 4EKEA 2QW1A 4TN1A 3ROZA 4BE7B 3SZMA 2H9AA 3JYLA 1PL7A 5ICMA 2HA6A 1ZR4A 4HLCA 3U48A 4G8BA 4LJYA 1Y1LA 4KYUA 4PRLA 1QF6A 5AQEA 2BFDA 3AYZB 5EIFA 1XFAA 5EEHA 3ZLUA 1MTOA 2B2CA 2BAGA 2UKDA 2E3JA 1C5KA 4MZXA 2GNAA 2MU1A 4BE9A 1GVNB 1AGPA 1NFQA 1P0PA 2HGSA 3F5DA 4FYMA 2ORIA 4P08A 1QSGA 1M6WA 2CDNA 4G23A 2O2JA 2P35A 3FPHA 3S44A 4CR8A 4FM9A 3A4IA 1P9RA 1MBZA 3F8WA 1A5ZA 2XQJA 1UBJS 2FUKA 4FYWA 2A35A 5FWAA 2CL0X 4JI5B 2DQ4A 3TQIA 3QX8A 6PFKA 1KP2A 3LDUA 4CQJA 1LTQA 1S0UA 2WFZA 1A4UA 1EFPA 1LC0A 2JPDA 2OG1A 3EEBA 4NP6A 1DRWA 2CK3A 2I7CA 3PQCA 4YGYA 4ZN6A 5AVTA 4QYXA 4EMBA 4AMYA 5DCLA 2Y4OA 3IKLA 3PSAA 2ZM6B 1U8ZA 3ND7A 5FNVA 4JNKA 4DC9A 1SM4A 4MI1A 2JBAA 5KJEA 5KWJA 5A5DA 1YK0A 3LKBA 4B3DA 1BX3A 3WO1A 5P21A 3THYB 3NGLA 4MUXA 1RWWA 3AHCA 1NP6A 1FMCA 3MMZA 2FMKA 5I7AA 3VHXA 1Q3TA 5I9IA 1P0CA 4KQCA 2ZATA 1F9AA 3L01A 3CEMA 1Z4LA 1SCUA 2OP0A 2P4QA 2PNFA 4GZMA 4R2WA 4ZQFA 2V6BA 3UXMA 4YMTA 2F1JA 4Q3AA 1ZGHA 4YAKA 3V4PB 1EUYA 3S6JA 4I1IA 1WO8A 2ZREA 1F48A 2BGNA 2ZG6A 3T7TA 3ZE6A 2CMGA 3MGBA 2ZYIA 1YZYA 1BXZA 3HUDA 1KH2A 3VYVA 3JRWA 4QO8A 3GH1A 3T5BA 1ZL2A 3ENNA 2K4MA 5BV1A 1II8B 3UYLA 4C5BA 3JWHA 3TFQA 4FK8A 3TGPA 1X7GA 3LY5A 5ECWA 1CP2A 2BN4A 4B79A 1TB4A 2LKCA 3BRWD 3WQHA 4DLPA 4B0OA 5ALSA 4IQ8A 2A1TS 3J7TA 1HYGA 1C1DB 2JFOA 5A5EA 4DV5B 3DDCA 4NBTA 2PGOA 4GFDA 1BZYA 5FR1A 1POXA 1TYBE 1XZCA 3FTPA 5AICA 4ZEXA 1F14A 2FJPA 1I30A 2X7JA 3MIIA 1IHUA 2WE7A 2WIJA 3FYSA 2AX4A 3JSAA 2KLHA 2QS9A 5AJHA 3W6ZA 1YIAA 1DG1G 1ZJ6A 5HIMA 2HHJA 2HIHA 2WLTA 4OHUA 5FA6A 4YRJA 1W5BA 2GPBA 3OOJA 1THMA 5EL0A 4PR0A 1D04A 1AZWA 1E5TA 1TT7A 2XITA 3K0KA 3KZVA 1YB2A 1JI0A 1N3IA 4JYBA 4OUKX 4M1MA 1EJ6A 1M6HA 2MSLA 2QUBA 2ZJYA 4ZODA 4BU0A 5IG2A 4YT4A 1ZVQA 2P62A 2B99A 3NB0A 1TJ4A 1QF9A 3F9CA 1Z3CA 4B83A 4HS9A 3QSGA 1T4BA 3S40A 2IU6A 2QXUA 1G0OA 1VLZA 2NU7B 2IELA 3F5SA 4K2AA 5JFTA 5JJKA 2FCAA 1N5RA 4N03A 4WZBE 3S27A 4ID9A 1KEEB 1VE9A 2IZOA 4TYNA 5IT4A 3FHLA 4F2DA 1TK3A 1QK3A 5CT8A 1QIEA 3TM5A 4OY3A 1ZMBA 3STVA 5J40A 1VLJA 2PAAA 3IVCA 4RELA 2AKAB 2BPOA 3L79A 3F6PA 2EKZA 1RLJA 4OLJA 3I61A 1VFNA 3GDFA 3C4JA 3RG8A 4MWCA 1NYQA 3IYLW 1TFUA 4OM8A 3VPBA 3ZZMA 1TO2E 3GL9A 4H4EA 3QVGA 4BS9A 2Q3CA 3TJMA 2E5LB 4NXNB 3NX4A 5FBWB 1GG9A 3PF8A 4MCHA 2Z8YA 4RSGA 4ZOAA 3R3XA 4N49A 4YRDA 2A92A 3H1TA 3AFGA 4IOMA 4II3A 4CCYB 2A78A 4E30A 1TEZA 5CB4F 3C7TA 2GBCA 1RMQA 4WX2B 1TQ8A 1M33A 5E8RA 1FJHA 1IIRA 1P0MA 1XZHA 2QMYA 4GOLD 4Z0HO 3I1JA 1JYFA 4NC9A 3NU1A 3IKTA 3A6ZA 1A9YA 2H65A 5I3ZA 1PZHA 5DLYA 1WPQA 3PNKA 1IBRA 1ES9A 3W5BA 3AH8A 4ESHA 4YXWA 2QT9A 1JA9A 1SU7A 2W2TA 4XX0B 3WDLA 3I01M 3DO6A 3TCNA 3DV0B 4L5JA 1ZH4A 1FQOA 1R00A 3V2UA 5J2UA 3L6OO 5T8KA 2SNIE 4PTLA 4RMHA 1B16A 1PT8A 2H9IA 1OASA 2X9QA 4E08A 4C2TA 2ABWA 3QU5A 1A8UA 2VNAA 4B0PA 1CYEA 1ULBA 3W8DA 3OSZA 2XMDA 3PL1A 2A0XA 2D5BA 4QYSA 1LPBB 1CY0A 3BFKA 3A6EA 1QMGA 2QX4A 3IBGA 1V45E 2W11A 2QLFA 5EXPA 2IYUA 2CE7A 3E05A 2Q21A 2I8LA 4EJSB 4DTCA 3QOXA 4WK6A 3NDRA 4O2RA 3DV9A 4LKOA 5C1OA 3GLFB 1DC6A 4ZMRA 1LX6A 3FBTA 5A5GA 3U09A 2XWPA 1A96A 1C7QA 1SOVA 3R0JA 4OKNA 3LNTA 2I2AA 4WUVA 3MQ4A 3MT7A 5EXXA 4UPEA 1E2GA 1YB6A 4DM7A 1Z4PX 2AYXA 1J5XA 1FNBA 4D6XA 4QE3A 1HZZC 3TLMA 3QU4A 1G1MA 1U0LA 1HE2A 3ZLVA 1XEXB 3LLMA 5AI9A 1K8RA 2XODA 4XH9B 2O4CA 5M2QA 2OZVA 3KDAA 4LPKA 4KVZA 3X2SA 4NU5A 4UMEA 3DL4A 3R5HA 1HDEA 2B34A 4Y7DA 1QAOA 2O7NA 3CINA 4I36A 3ROPA 3ZX5A 3H2JA 2Z0MA 4PWZA 3QQ5A 4TVOA 2RGYA 4FT4A 4QPPA 1MPXA 1XTKA 3UJAA 3BXFA 3EX7C 4X41A 1GA1A 3FDXA 5GWXA 2X5KO 4TMKA 4UEJA 3VVLA 5B7PA 5C3MA 4I1VA 4X1YB 5JJBA 4J0FA 1WZ2A 1AZSC 1XWFA 2PXHA 2XLCA 4BNDB 3Q1KA 4LSWA 5JTTA 3DBLB 3HMQA 3IIIA 2OPHA 1TA0A 1XD8A 3CW9A 3CN7A 4WFJA 4UHFA 2H54A 1Y1PA 1MVLA 1DCMA 2NYRA 2QP4A 2AFIA 3CEAA 2R5FA 4RE6A 4ZMBA 5B36A 1I3OA 1P3JA 2WA1A 4O3FA 3UJ8A 4D1YA 3DOUA 1UFOA 1HQCA 4JLSA 4BGEA 3GF4A 3INRA 4MO2A 4U2FA 4V0MA 4KJXA 1CR4A 5EWJA 3S1AB 3TF5A 3UKDA 4OAOA 1JXMA 2XTNA 1A7KA 1V1MB 1I5RA 3SYRA 1Y3DE 3TUJC 1UXOA 2W2MA 2IP2A 4PIPA 4AF8A 4L07A 2BEVB 1C50A 4WINA 1S1MA 3A4NA 3M8KA 3BE6A 3HLKA 3L0YA 3ZWKA 1SMKA 4AQDA 1XTSA 4Z5XA 3LQFA 3B1YA 4JBXA 3QX3A 4WADA 1PG5A 1Z88A 2AJ8A 4XSHA 4Y9RA 4LTDA 4YCAA 3LFUA 4K86A 3DBRA 4AWBA 3RKUA 3O4RA 5DNUA 4BXOA 2BWJA 2YZKA 2YMPA 3PQ4A 2C88A 2VAXA 4MI3A 3S2UA 3VKUA 4QRHA 3KVVA 3REGA 1JWLA 1L4FA 5DWQA 4NPHA 1FJGB 4U39A 3TW6A 2YXBA 1YGPA 2X0DA 3OLZA 1Z5WA 2Z2YA 3IILA 5CD9A 1YD7A 1K2VN 1TQ4A 4RHUA 5B1IA 4WASA 1IN1A 4HXEB 1OXBB 5ARDA 1G38A 2QTVA 2RGGA 1GKLA 2OAEA 1VTKA 4C78A 1AGNA 4URHA 1DDIA 4TM7A 2JAQA 5I7HA 1YZLA 4HWGA 1OB2A 3FPGA 3NWBA 2G5GX 4S04A 4X6LA 1U28A 4A0SA 5A4DA 3UANA 3T3EA 3TR6A 1AO0A 1SD2A 2AXQA 5HBGA 1KHTA 2AUMA 1RYDA 1GRCA 4B2IA 1N5MA 5DTRA 2VYQA 4FOSA 1ODFA 5LQKA 3NH9A 3UAXA 2Q6VA 3TVTA 1K9SA 2QEQA 2GKOA 3IBTA 2OFWA 3GG9A 4ZAXA 5F23A 4M99A 1XX6A 5JQGA 2ZE5A 2RG1A 2OFOA 3IURA 1I7QB 3ULKA 4I4TA 2J4DA 5FKJA 3FHTA 4AP9A 3KO8A 1SUEA 3BMQA 4IDGA 3JU3A 4KO8A 1C3OB 5ER6A 2G1UA 2QY9A 2H1SA 1G5HA 1E2MA 4AC9A 3FUTA 3ZK9A 2KE5A 2WG0A 4MGZR 3MERA 1YF3A 2H57A 4OHCA 5ITWA 1SNYA 3DHNA 2R7KA 4HLUC 5KYWA 1IXYA 5HR5A 3MUEA 4JLMA 1P5HA 4S0ZA 1U7PA 4R1UA 2L82A 3CLHA 4LSZA 1W4CA 2IRWA 3BQMB 1Y3CE 3IMGA 5AVVA 1S6YA 5E9WA 4R68A 4DJEC 4GOMD 1BHO1 3BJIC 1L7BA 2QTNA 1QCZA 3M0EA 2ZIAA 2FVYA 1OXXK 3WMFA 3GT7A 4OUDB 2ST1A 2AQ8A 4HN2A 1R74A 1F8FA 1L3BA 1WV1A 3P5BA 2VA9A 2HMUA 4FNGA 2UUPA 4HJRA 4XJSA 5TJ9A 2TECE 1M34B 2BGLA 4FI3F 4MUAA 5HVNA 2P3SA 2PRYA 3CR8A 2O07A 3TW4A 4PHTA 5I7EA 1F1BA 5BP7A 1C4XA 5KVSA 3OP4A 1OGIA 1VXOA 3BEOA 3EEIA 2HIMA 3IX7A 4QDJA 1E98A 2WJ6A 4FKZA 3QTLA 3D8HA 3GNTA 1BD3A 3ZHSA 1J90A 3ZDDA 1CF2O 3WLQA 3AQ4A 1E89A 1RYZA 4J90A 3GEIA 1WY7A 1ZZGA 1PG0A 1QIMA 3RS0A 1HORA 4Z0TA 3OZVA 2XWJI 4BEBA 4QELA 1X13A 3E1GA 3DSRA 1SRRA 3R3VA 3JAMA 4AFNA 5L6LB 1JU4A 2I7TA 1D3AA 4FPXA 4Y9DA 3DTVA 2DPGA 2HHLA 3ZHOA 3L2OB 4JUAA 4BKOA 3CZAA 4R1NA 4IILA 1E79A 1M2NA 4XGIA 2AUNA 4PZUA 4ZKDA 2DFNA 3L82B 4FIZA 1N2ZA 3MT8A 5HXAA 2FPWA 3WMEA 1JALA 3UF0A 5AJXA 4P80A 3RT9A 4J2OA 1JEQA 3A9WA 5LZ7A 2MCFA 3FCUB 2BT4A 1L7EA 3AJAA 2J6HA 3T7DA 1Z74A 4O5OA 5DO9A 5K0FA 4BLTA 2JGEA 4XXHA 1DAHA 2GAJA 3RRXA 4D3YA 4PQFA 3QJGA 3U7QA 3K1JA 3RCBA 3ZBQA 5BNWA 3HVKA 5HJEA 3FYUC 4RJLA 4LOJA 5BT8A 4N3GA 1NJFA 5JSZB 1U63A 5EJ8A 1XMPA 2Y76A 4BBJA 5TEWA 4C4ZA 4AO7A 4WNCA 2HK7A 4PM4A 1F7UA 1LF5A 3R24A 2JH8A 5LUBA 5HFJA 4D6PA 3AERB 1PKEA 4OKSA 1UJCA 3A1FA 1JR3D 3A1UA 3C98A 4QM7A 1PNQA 4R84A 1J0DA 4IV5A 1Y8RB 1ZEJA 1W88A 4UAJA 4CF3A 3U1BA 5AD1A 2V4ZA 3KSDO 3NXKA 4FFBB 2Y1FA 3IBSA 3DP9A 4K6OA 3IAM1 4MH0R 4RY9A 1ZW1A 3MG9A 4ZQCB 3DWGA 3LY7A 2JI7A 1G9TA 2XGMA 3RTBA 1MO4A 3RKRA 4NMHA 1GDHA 3EZXA 3G2QA 1CUWA 3ZUPA 3A26A 2AC4A 1S3IA 2H4FA 3HXKA 3LC1O 5E6UB 5C46F 5IRCD 4JOQA 1T5SA 1YHNA 1Z7GA 4KR6A 2R1VA 4LY0A 4CM7A 1DAPA 3HN6A 5JJ5A 1JJAA 1C4KA 3OQIB 3WX0A 3FIJA 3AU9A 4RJ2A 5TMDA 4ARSA 5TRTA 4PYOA 3WLOA 3A4VA 2VQ3A 1KXZA 3IV9A 2GRAA 4YJGB 4UCQA 4LHYA 1YE8A 3ZH2A 1X2BA 1G8MA 2NAFA 2WK1A 5J5CA 3QJYA 4TTSA 4DNXA 3ZVMA 3HKCB 1KMHA 4RPCA 4WEOA 1USVA 3T0IA 1YZKA 3NO4A 4OD0A 2N9UA 2QRLA 4H16A 2IWHA 5IJ9A 2OZLB 1SCAA 1T2UA 4N6OA 3ZGXA 4MITA 2YYYA 5EAIA 3WNDA 4LE0A 4KC0A 5LNK1 1BH2A 1HLPA 4IGKA 4K1XA 4DVJA 5FWYA 2X86A 1NASA 3WRXC 1FPQA 2PUCA 2XZLA 1KPGA 2IDMA 2NTNA 4PAQA 3SVLA 4EK9A 4FYKA 4FDTA 4M60A 3WMGA 1FXSA 6YASA 3G1WA 3QEJA 1EWTA 1U8XX 2PKEA 4GYYA 3GEBA 5JXIA 3U7IA 4Y2TA 4RK1A 1W48A 2B78A 3V34A 1DEHA 3NBZC 2VO1A 3G02A 2OV2A 4O4IF 4ESVA 1KI6A 1ZG3A 2F8LA 3NM4A 2MOKA 3OEEA 2X0EA 2ZDQA 5LQRA 5K0GA 2GK6A 1YUNA 3ESAA 4QOHA 3INTA 3NKFA 4M76B 3WLIA 1QLWA 3DLHA 3BD8A 3JW8A 4L22A 3FKJA 1CUCA 2UVPB 1KZ4A 2BI7A 2OFXA 1W59A 3KSZO 1JTFA 3V97A 1KBQA 2EIXA 3GUUA 4G09A 4B6QA 1GCOA 3VNRA 1D2EA 3LECA 2RG7A 5EHNA 4KIGA 2POCA 1PV1A 4C4AA 3IDZA 5CBKA 4HAXA 5HOEA 1X0VA 2HF7A 5FUYA 4PW0A 4YBRA 2JGRA 3EF1A 1Z4OA 3HDQA 2FX5A 4NY1A 5D2CA 3UAZA 4EPXA 4HFJA 1ZAYA 1SK8A 4G0VA 3P9PA 2R5WA 5GJWC 4E5VA 2BKXA 2PO7A 1I33A 1BVYF 3A9TA 2YIMA 1FS4A 1P62B 1N6NA 2FEOA 2YXNA 2DQSA 1WS6A 4IVPA 5K01A 3ODPA 4GSLA 2A2ZA 1Q92A 2E7ZA 3DCNA 1H05A 3D5EA 3FH0A 1G8AA 2XD9A 4TUYA 2OYCA 3TTYA 3IAS6 3GIDA 5A02A 1WCIB 4GP6A 1CDDA 1TK2A 4IKPA 2AJBA 3ED1A 4GKKB 5CH8A 2ERXA 3ZQ4A 2QAGB 4K0RA 1FTNA 5CM9C 2JIMA 1XMXA 4N18A 4BV2A 2W6ZA 5AK6A 2RB4A 2VP0A 1T3LA 3QENA 4CKEB 1WQ3A 4ZK6A 1EFUA 2QB5A 3ZDYB 5BWNA 2HBYA 1QOZA 4R8SA 5JNLA 4QARA 1G66A 4TTVA 3BDAA 1FW6A 3TDNA 2XKAA 4IF6A 1YFLA 4XVHA 3ISTA 1DTWB 1SIOA 2J30A 2Q5HA 3KPUA 3Q3HA 4I8DA 4Y2YA 2CHUA 4DUGD 3DAHA 2GJ8A 1UQTA 1L4UA 2IOHA 4YRPA 1GZ6A 1KOLA 5DNCA 1OTYA 2OHIA 3T3GA 1Z08A 4H08A 5KNLA 2V74B 3GUVA 1FCJA 1P6XA 3KXKA 3L3BA 4G81A 4IDNA 5FO1A 3ZJ5A 4EFLA 5FEMA 1KPIA 2IYRA 4QOFA 3X1DA 3V1NA 1MA3A 1O96A 2C8JA 5BVHB 1R9JA 4KX5A 4RZ2A 3AB8A 1QFJA 1VHJA 1BWSA 1ZIPA 1CY8A 4GR4A 1AQJA 3GELA 1MEJA 1YHYA 2OKCA 4IZOA 4Z86A 2YW9A 2Z6VA 4OHXA 5HKLA 3K8ZA 2H4WA 4ITVA 2WUGA 5C9ZA 5HZHA 4GZ6A 3HCDA 1G4AE 2JLSA 1AGYA 4I7EA 1XL1A 3LOUA 4XGNA 5KOHB 2B21A 2NZVG 2PT9A 2KPOA 2WZQA 1UUFA 3WOVA 2ZXFA 3AOEA 1N0UA 4YMGA 4X64B 3I62A 1KSHA 2GZHA 3G85A 1ZOSA 4KUHA 4NNPA 4XM1A 3HRIA 2H06A 4QODA 3GFRA 2OQIA 4HTFB 1ISRA 3WRWA 1YCDA 2E49A 2WU8A 1NXOA 5HWSA 3IQIX 1S3SA 3FYTA 3JAKA 2PJZA 2QJTA 1WHTB 3BPSA 3ROEA 1GNTA 4C0QC 5AIAA 5J63A 3MOGA 3UPUA 3QV1A 4DMKA 2B82A 1CUGA 5ITVA 3Q7SA 1QJ4A 4QU5A 4ZREA 3NBUA 2C2WA 2D0IA 5CH5A 3ZY6A 4BN0A 3DLCA 2ZIUB 4LBWA 1E5LA 2GEBA 2VAPA 3G5AA 1J06A 4XLTA 5IAEA 3OIUA 3FGZA 3K6JA 3MILA 4ACAA 1ZC3A 2JIBA 3MOIA 4AKHA 4EVSA 5CLFA 4BNUA 2O50A 2XE6A 3A1WA 5EXTA 1J20A 5A7GA 3SR0A 3L7AA 3OC6A 3ZCVA 3O47A 1SKYE 4D0SA 3FGPA 4CG0A 3DBIA 3ELUA 2BI4A 3D3WB 2XBLA 1RZRA 3HACA 4UTPA 2YOHA 3IXMA 4FI3C 3A6GA 3W2TA 4NHOA 3WIOA 1P3DA 3UKOA 4V3BA 5KMGA 5MDHA 5BXYA 4GEGA 1V37A 1ZD1A 1KVRA 2G9QA 2O2ZA 4H4DA 4RV9A 1GCGA 4TV9F 2FFBA 3CH5A 3N87A 4OLAA 1QX4A 5JVDB 3ZGYA 4QRDA 4MW7A 2CFRA 3N0VA 4WEQA 2WKWA 4L02A 4UM8B 4IXNA 2JLVA 1L7PA 1EP2B 1VGRA 4WJLA 3QF4A 5JO9A 2V4MA 4WXHA 4LDNA 5DBFA 3HP1A 4WBSA 4A6DA 1GT91 2NO9A 3UJ6A 2HU7A 4RJIA 1Z13A 4QPNA 4JLVA 4KQMA 5F1PA 6CHYA 1UDRA 3SXUB 3FUCA 3HFGA 3MLAA 4TWRA 1QLJA 1HX7A 1DBQA 2C4VA 2Z6QA 3DTNA 3W78A 3NRBA 5DGIA 3HZZA 4RWEA 1QRRA 4ECEA 1KBOA 4HI0E 4OI2A 3WL6A 1D2NA 1LBEA 4G5SA 1ZKMA 1OVMA 2BH2A 1IE3A 2B2NA 1H8ED 3O73A 2FFAA 3PGXA 2XUFA 4EO9A 4QQKA 5BW8A 5GOZA 3T7EA 3JAWB 3BSFA 3WB0A 2R4QA 1NZFA 3D0KA 4G1EB 1MJNA 1OXVA 4QQFA 4FGLA 4LFBB 1I51A 1NMSA 2PR7A 3TLZA 3U2QA 4Z9BA 4MCIA 2O54A 4QX6A 4MAFA 4KWIA 3ZY3A 2PLAA 4BNDA 4E88A 3THYA 3A6LA 4IHQA 3GFQA 3IL2A 1Z6AA 2WTEA 2OCIA 1COZA 1QTNA 2H08A 5KHAA 2OGUA 5ICSA 2V5UA 1I7DA 2ZAMA 3G0OA 1USKA 2J9YB 2W4MA 2XD4A 1K5PA 2WYWA 3FCAA 2Z98A 4P5PA 3T9CA 4MVYA 4QXOA 4LF8B 4W63A 4JI6B 3TTXA 1RWOA 2PFSA 3LPLA 3PHIA 2YZGA 1WL8A 3H4VA 3BM5A 5FL7D 2WTMA 2PUDA 4B73A 4DQXA 4E5NA 1MABB 4L5YA 3PEEA 2VTVA 3NJ4A 1B0ZA 1K8QA 1E58A 2ZKLA 3MELA 4TMVA 4X91A 5FWNA 1CUHA 3BFPA 4B84A 4O4JB 2RE8A 1ZAKA 1C1DA 1WSDA 2O5VA 3HCWA 5KQSA 3M3DA 5CDFE 2G71A 4GWKA 4H35A 5FI1B 3ZD7A 1G6KA 1T24A 2PMWB 3HB0A 4ROTA 4GICA 3FNEA 1NVVQ 2G1KA 2W2LA 3G82C 1H8HD 3LPDA 1NRWA 3OLQA 4H1TA 4O29A 3GP5A 3OPYB 3N3AC 2Y6VA 1RADA 1IN4A 2VNKA 3H1EA 2CVPA 3L7KA 1Y42X 5CJPA 2JD1A 1DJQA 1U8EA 3EDQA 3PXUA 3WWEA 1N77A 1LQUA 3ML1A 2NUPA 2CXSA 4UTOA 1QIDA 1XMSA 2BCJQ 4G0XA 4M22A 4D8UA 1E5DA 3OY7A 4P3NA 5DVZA 4G85A 3OOSA 4R1LA 3RBXA 3BC1A 3DVLA 3DONA 4UMFA 1MVOA 1R37A 1Z6QA 1BIFA 2MINB 3NANA 3OVMA 1BRMA 2FSSA 2EG9A 4C03A 2O05A 4YRNA 3ZTTA 3F4BA 5DULA 3JWEA 3GLUA 5H8WA 3DZKA 2GGSA 5BSVA 2LUOA 2YUTA 1XJ5A 2FN4A 3KR9A 2OXIA 3FMIA 2UUOA 1J33A 3H11A 2PMBA 1EG7A 5DGXA 1KEEA 3ZHUA 1CVIA 3C45A 1TMKA 2X22A 4BX3A 3I2JA 4OGWA 1TM4E 2NXNA 2I0FA 4HGRA 2XXBA 2BMFA 5A3VA 4AJOA 4OA8A 3RGWS 1E1QA 4M8IA 5JLAA 4ZV4A 4HAZA 3CZCA 5C81A 4ER0A 4ZAYA 5CPFA 2PXAA 3BORA 4TTAA 4WWHA 3T0GA 5B6IA 4GIBA 5JAQA 1QBGA 3C16C 5D1HA 1WMEA 2O2YA 3U17A 1WZUA 3W6NA 4F11A 1R0BA 3ESZA 1UKVY 4JX8A 2YYZA 2O7RA 2C04A 2O8CB 5I51A 1I3NA 3WK8A 4OGGA 1YRHA 3HDTA 3WKAA 5AM2A 4Q82A 2XZOA 3P4UA 2FWPA 2WP8J 1OBCA 5KQPA 2DT5A 1GQQA 5BUQA 3GPLA 2FMXA 1XJCA 5FNVF 1DAGA 3QXJA 4KQGA 4MV0A 3M49A 3RV4A 2VTBB 3DE0X 4OGFA 3P9XA 4Q12A 5J2TB 1ZVMA 4HNQA 3GJZA 2GHQA 2MSWA 5CVJA 2PSDA 3HDHA 2E1PA 4UOZA 1O6ZA 1P1BA 4XX0A 3KUCA 2HF2A 4XUCA 3PNBA 4OX9Y 1XNJA 2ZTVA 3DV0A 2CMKA 1HFEL 3RHFA 2EX4A 1E66A 2FPPB 1FYFA 3BK1A 1UFVA 3X1WA 1R0KA 5EEGA 3PC7A 4EHFA 3IOEA 1SXQA 1PDWA 4TGLA 4HZUB 3KYDB 1YRAA 3LUGA 4W5RA 2FRDA 1YZQA 2J5RA 3JQ7B 3GXBA 4IX1A 4G84A 1PJ8A 3P0JA 3D02A 3GOQA 3DPUA 3L8FA 3NM6B 3Q5GA 4KVAA 3KELA 4U3JB 5TS3A 4CTOA 1LDBA 1A9PA 2BM8A 1L5KA 1OZFA 1SUWA 3KQPA 5IU6A 3DJFA 2J4CA 4RD1A 3FNRA 1A04A 1XLTA 3QKIA 1WW8A 4HGPA 2P40A 4MIOA 1GTJ1 1B0PA 4B40A 2ZB7A 3P19A 4CG2A 3GLFA 1GU7A 2H5JA 3WC4A 1PVDA 1CRLA 1ZD4A 1JHVA 4HXFB 3EZ9A 3I9KA 3IPLA 1SUAA 3W77A 2X8WA 3I5YA 3X44A 3M6VA 1CEXA 2QTMA 3ROQA 1IPEA 4JBLA 2D2IA 4A91A 1C7JA 1UDCA 4S1NA 4D96A 4MGHA 3TTSA 1L5HB 3CRQA 2WMOB 5EZYA 4FEGA 2IP4A 1I1NA 2X5OA 1X86B 1Z8DA 1EIWA 1QG4A 2Q3BA 5P8WA 2GO1A 3NAZA 3T5DA 1LSJA 5EP3A 1KEPA 2UUAB 1JR6A 3RWOA 3WLJA 2G04A 1LPAB 4ZCPA 5FFMA 1EVLA 2B4AA 4BAUA 1WY5A 4PO9A 4EATA 1LW7A 3DXXA 3AF5A 1JSLA 3LXUX 5I9MA 2YQ4A 1DO2A 2NZWA 4JT9A 3I04M 3L8MA 3BVPA 3TSZA 3WISA 1H6BA 1L7OA 3R3JA 3L4JA 3FHCB 4CM6A 4E2ZA 3PIRA 4E3ZA 1HWYA 3BTUA 3IEUA 5F2EA 1AE1A 1OV4A 3H8JA 3JZIA 2EV9A 3PJFA 1FQJA 2C3UA 4E5YA 5JI2E 4IF4A 3LAWA 3TNJA 5ALVA 4ER7A 2F90A 4WZZA 3U49A 4L8VA 3VNBA 4B8WA 5LD2C 5TMBA 5J3JA 4YP9A 1ZM4A 4JJ7A 4G9GA 5LYYA 5EGNA 5JSUA 2CDRA 1H42A 3H0CA 3IT0A 3RSFA 1OU4A 2RGBA 1KH1A 2HPAA 4JVOA 2OD9A 5JYCA 3S1AA 5I9BA 4DPLA 2FAXA 3SICE 2JGDB 4J91A 5CT6A 2OEPA 4UREA 3ENKA 3OQBA 3LYAA 1MJFA 1FVHA 3CIFA 2X76A 4A10A 4G1CA 2BEVA 2OO5A 3QWHA 2IS4A 3IEPA 3TTTA 1GADO 1U7UA 3IRUA 4AJEA 3AUXA 1WNFA 3D54D 3I9LA 4F1WA 4OO3A 5JAZA 1TGVA 1Z6YA 4DUPA 2BKAA 3M6LA 2YV1A 1S9DA 2HA0A 4RENA 1Y8AA 3ZDAA 2IYXA 1EBFA 2EDCA 3DULA 4FVTA 4NMMA 4CDRA 1W9MA 4QU9A 4YJDA 4K9MA 2DCMA 4EGFA 1DUSA 2R8EA 3GVHA 1NMYA 3D7RA 4FDLA 4MVJA 3U37A 3BB4A 1PQPA 2BSXA 3FPLA 4D45A 5AVUA 3HPRA 1TDJA 2FPUA 2XRMA 3L06A 2CHEA 4H7HA 4WA7A 4XR4A 5DNVA 3H6KA 1M72A 5J2UF 1E5XA 3VAYA 1QYXA 3C3PA 1UPBA 2GXUA 3DDNA 1CD5A 1GGHA 3QHPA 4HPJB 4MYUA 4OQQA 3U19A 2XZPA 2IDJA 1NVUQ 1Z4QA 1U6KA 5AK4A 5C5DA 3EHDA 1HMPA 5E6SB 3T94A 2A1TR 1XEAA 4MIEA 1EHIA 2RB5A 2F48A 4L8FA 4TS9A 2OXFA 3GEHA 1D9XA 2ZU6A 5E3JA 1FY2A 2X2PA 3BCRA 3L84A 1GP2A 5BWBA 3W2HA 1E6WA 3U6KA 4UNPA 2Z4TA 4MQ6A 5KUTA 2JK1A 1HYHA 4RZXA 1PL8A 1YB7A 1UM9A 5ILGA 3LUCA 2JLRA 4N8EA 2ZJFA 5GONB 2HT1A 3CVYA 4MHTA 4JYCA 2XB9A 1BG6A 3E3AA 3ZDRA 3NBXX 1WZEA 1YZHA 3SI7A 4M6WB 4NS4A 3M81A 4M7PA 4OHOA 1VBFA 4Q7MB 4WT7A 4BBZA 5K03A 4I5GA 3ADCA 1P61B 1T0UA 4K9SA 2C95A 3KBOA 4IIFA 5DM0A 3RIYA 2HMWA 4XI9A 2YCLA 1NW8A 5CVCA 3I58A 1V35A 2O7SA 2A86A 4PEVA 3T7RA 4HGYA 3PVZA 1SCBA 1NBEA 2IEYA 1TU0A 2E89A 1W0CA 2ZI5A 3HHPA 2A1UB 3WYGA 3MJ4A 3IKMB 3B3FA 1KI2A 3GCXA 1CK4A 4QPJC 4OUDA 1P2DA 3KALA 3TIVA 1QHFA 3EGCA 3VR6A 4JDPA 4WK2B 1WDTA 1J0CA 4W8HA 4U7WA 3ZVKA 1CQPA 1CJSA 5DN6A 1GPYA 1M34A 2WIBA 3OJ0A 4ENTA 1AKTA 1CJTC 2KX7A 4QIHA 3YASA 1QUEA 3HUEA 1NNUA 1VCHA 3KV3O 4FFNA 2VWPA 1O9BA 2H2GA 5KX5F 3SQWA 1RCFA 2LNDA 2PG3A 3OZWA 3FMGA 4KSBA 4MGIR 1O97D 2JLAA 5MN6A 3KOUA 4FZRA 4CQLB 4YMVA 1ECFA 1PEDA 2Z1NA 5F4ZA 5DT9A 1DXQA 3ZWDA 3D6HA 4XIYA 3R09A 1V41E 2FB9A 2KLBA 2QUZA 3BAZA 3E1KA 3PEFA 3WMXA 4DS3A 3A4LA 4F56A 4CKCB 3AKYA 1EDEA 1BXRB 3PQ5A 1YZ3A 1TD1A 1H6CA 1R4AA 1A9RA 5AKJA 3MM4A 4UXJA 1J6UA 4UKDA 4A8JB 2EYQA 1TUGA 4E1BA 3MTAA 2WTUA 1M66A 4UBOA 1D2MA 2WF5A 3IJRA 1Y7PA 1D7OA 2VUUA 3OE7A 1XD2B 2WWXA 1RWVA 1MH1A 4RQAA 4A15A 1J09A 1YQUA 1N2BA 2FCRA 2P2NA 2HXGA 2BM1A 2YC2C 5E7QA 1ATIA 5IJXA 4ZDIA 3LTEA 1GLGA 1NNEA 2AHOA 1N2CE 1RWMA 2REQB 1LTKA 2YWGA 2I4LA 3QBEA 4X84A 1K27A 1N7IA 2QP9X 1IN5A 3F6EX 3RPEA 2HQSA 4JWKA 3EFBA 3K9BA 4QT0A 1S4MA 4WXRA 4HNRA 3ZHTA 4B33A 4RS3A 2YWCA 1A5SB 5DLPA 2WD7B 1W5SA 1YRLA 3F4LA 2ZQ5A 1EM8B 4B76A 2PGXA 2ODWA 3ILHA 4GOXA 4XUDA 5E9JA 1S1CA 5AVOA 1KK3A 2X6TA 1AQIA 3LVBA 4J0EA 3WHIA 4Z7QB 1FIUA 5EUQB 3CX3A 1YZUA 1GUDA 5CTAA 3SIXA 4EY6A 3P9IA 2R8ZA 1I1HA 2ZSHA 5ALYA 4TXJA 3ZOZA 4CZ2A 4EFMA 2HSWA 3AERA 3QVOA 3FR7A 4AKIA 3Q3JB 2JD0A 5DIZA 3FSGA 3SM9A 1UBHS 4Y1RB 3F3MA 1GWNA 2YS7A 5AYVA 2J6CA 5HM8A 3C1AA 1Y8RA 2HDHA 2XMBA 1A1VA 5EWLB 1Y34E 4CIDA 5JQGF 4FFBA 5DYNA 1LDGA 2B7CA 5ALLA 4D9CA 1V8FA 4UTNA 4HC4A 2I71A 1BCRB 2XX3A 2F4VB 2ID9A 3RRJA 3VI3B 1V6AA 1HQKA 4FE4A 5IKPA 4AY4A 1H1TA 3MOSA 2JCSA 1FNNA 3R5TA 1WM1A 4PHCA 1WXXA 2VPQA 5E6UA 4MUKA 5HYVA 4BZQA 2QN6A 4EFDA 2QX6A 2XZTA 2RGXA 2DJ5A 1YS2X 3LDAA 4P7KA 3RIGA 4JXXA 4YJFB 3K70C 3FKSD 3JQFC 3SX4A 4ZYLA 2EW1A 4H7JA 4KIWA 1ZISA 3C15C 3GZNB 1OWPA 3IPRA 1E2IA 3EPPA 4BFVA 2Z9BA 1GYRA 1S4QA 1Q15A 2CNWD 3R7SA 2R8OA 2NUTB 4M1ZA 1V8OA 5LZ4A 3FVRA 3K9QO 1Y4DE 1XRLA 3HKCA 1Q1ZA 1AS0A 4GWLA 1XCJA 2V3VA 4BP9A 4O59O 4I3FA 1QIGA 5K8UA 3GGCA 1ADGA 1CDEA 1AKRA 3QXGA 1U0BB 4GKJB 1GZ7A 2OZLA 4I5EA 3PL5A 4TMFA 3B78A 3T38A 2ANBA 2D8AA 1MR3F 3DWFA 3TRDA 4TWBA 4EI9A 1QH1A 2VJAA 3QY0A 4NEHB 1EZZA 1RACA 3EXIB 3IEVA 1R3UA 3DR5A 3IVRA 1Y3FE 2FN3A 1SCDA 2BFAA 3LNCA 1L7MA 3OPVA 3JV7A 4MHSA 1R18A 3HABA 3GUZA 1MOSA 1SXGA 2PSJA 5DF1A 1J4AA 3MAAC 4B32A 4RD4A 1JZQA 1YSCA 1RHJA 3URMA 5GADl 1XIVA 2RHLA 2VJYA 4KZKA 1BN6A 1MX9A 3MWLA 1XE3A 2ESRA 4H31A 4I08A 4TRJA 4DAEA 2W42A 4F4HA 3WLLA 3HE3A 3O8OB 4ALNA 2OOKA 1H4VB 5LYJB 3MS7A 5KNDD 2PMDA 3IPCA 2MMGA 2QJRA 4FMCF 2UVPA 4CM4B 3SWWA 3FIUA 5CA0A 4LDQA 3SKXA 3I6ZA 1A9TA 3K5WA 1XNHA 3W1VA 1V3UA 1X7ZB 2PBZA 4URXR 2Q27A 3MJHA 3PUIA 4NCJA 4XEHA 5AI4A 4DLXA 3DZGA 3D6VA 3MLEA 3CZ4A 3FCCA 4UUNA 1RHMA 5JMPA 4PSVA 1SCQA 5BSEA 1B2LA 2G5PA 2GEVA 2QGNA 1AIPA 2QN3A 3EXHC 1VKZA 3IJ5A 4YNBA 2CJWB 2BSQ