2JFWA

Crystal structure of enterococcus faecium glutamate racemase in complex with tartrate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecium
total genus 96
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA01
2JFWA 1IU9A 2JFOA 3S81A 5HRCA 2OHGA 3ISVA 3UHFA 2DX7A 5HQTA 5HJ7A 1B74A 2JFQA 5IJWA 3HFRA 2DGDA 1ZUWA 3S7ZA 2VVTA 2OHOA 4B1FA 2OHVA 2W4IA 2GZMA 5ELLA 2JFYA 2JFPA 2JFZA 3OJCA 2JFVA 5HRAA 2JFUA 3UHPA 3ISTA 3OUTA 5EVCA 2EQ5A 2JFNA 2JFXA 3UHOA 1JFLA 5ELMA 1B73A 2DWUA 2ZSKA
chains in the Genus database with same CATH superfamily
1YIAA 4WFJA 3VZQA 3D8HA 1HDYA 1XEFA 2CDBA 5CJJA 4AJHA 4FFPA 5KMGA 1JS1X 3CX3A 3SZMA 3FUCA 1RWVA 2GN4A 2I03A 3EGIA 4F5ZA 5BR8B 4JT4A 3UGKA 3FNFA 4CF5A 4RX1A 3CA8A 3Q85A 2AJDA 1TXGA 4HLDA 1M7BA 1H3NA 1JZTA 2WWIA 1VPVA 5T4BA 2ZZNA 2DUMA 1UZLA 3FYUA 2ZQZA 4QD3A 1XLUA 1QIKA 1Z4LA 3F78A 3E7DA 4GL4A 3OC0A 4LJKA 4RMNA 3TEFA 3DZCA 1MA3A 2PWZA 3QH4A 3RWOA 3PJGA 5JAOA 3FVTA 4F2WA 3EPPA 2CBZA 3C70A 1A27A 2C1XA 1QDLB 2I29A 4GPD1 5COQA 1QIJA 1HMYA 4K9SA 4TQGA 4PX9A 2I2WA 4F4FA 1E69A 3I42A 1GRQA 1RXCA 1L4HA 3OU6A 4V0MA 4E7OA 1CT9A 1D1PA 3FLAA 3N3AC 5L4SA 1MKYA 1THMA 4LZOA 4OVKA 6LDHA 2N46A 4ZU3A 4WD3A 5LJLA 1C30B 3FX2A 5CXQA 3KJQA 2VDQB 4V0OA 2FQQA 3HCBA 3P0JA 221PA 1D9ZA 2K5UA 3QPCA 1TU0A 4HZGA 1FU8A 2OQRA 3PWKA 1E66A 1I1NA 3PBKA 1PHRA 4JWTA 5FUXA 2JKZA 1IHDA 2QGNA 4RGVA 3EC2A 3SHVA 3SJ7A 2Z9BA 5LD2B 3EZNA 4KVZA 3TFQA 1Y9EA 1A69A 3O6VA 3AHHA 4JCCA 4UNNA 2C9MA 5L53A 4FJ1A 4RTNA 2WD7B 3U1VA 1J07A 2ZUSA 1IN8A 1J8QA 3G23A 5A4AA 3MWLA 1M6EX 2IS2A 1FS6A 5I51A 4HQNA 2HC9A 3MELA 3WY9A 3AKZA 3UAOA 2IZZA 3EZFA 4G0WA 1MJ5A 2EFDB 2FHSA 3SN6A 2ZVQX 1M7GA 3U26A 1YZYA 4KSYA 2ETVA 3GLUA 1M8JA 5DGXA 4XB1A 5CAEA 3E3NA 1OWNA 3E5RA 3Q3EA 2I1WA 1X14A 5HPYB 3L7OA 2FRXA 5BR1A 3G82C 3WLMA 2EZTA 2V65A 1E9BA 1IOLA 4P58A 3U7JA 3B48A 1ETHA 3OTGA 3L7CA 3U4MA 3D4NA 4EVIA 4LE1A 2VSOA 4RKQA 1AQIA 5HMMA 1H2WA 3U80A 3WK5A 2OV1A 1RHUA 1FYWA 3CM0A 4C1NA 1LPPA 3QPAA 5LQSA 1X15A 2JANA 3AVQA 3DA8A 3TFOA 2HDWA 2PMWB 3JZFA 2WU4A 3KZCA 3F7MA 3GLHE 4EPTA 1QTNA 2QVCA 2XA1A 4BFCA 4BX8A 5C32A 5HJ7A 4YRNA 2QP3A 1D8TA 4YYZA 1KIFA 1B0UA 1UJBA 5CM2Z 1WO8A 1E7RA 1XJ5A 4RVNA 4COOA 3P4YA 2FK7A 1YVPA 4PVDA 4MS1B 1LJLA 2OZEA 4ZZ2A 2HA7A 2IHZA 5E9WA 4S12A 5BUQA 5CCXA 5BVGB 1F60A 1HGXA 3TSWA 3VOAA 1QANA 2B6HA 1ZL2A 5KTKA 1KFBB 1U4OA 1SCUA 4B33A 1GHTA 3MGGA 2NADA 3LC1O 4LJAA 4M4SA 4OQPA 4QFDA 3ZX4A 4IDQA 4BB0A 1B73A 3Q3GE 4LUCA 5DM2A 1LS6A 3E3AA 1CZNA 2GBPA 4L5IA 4O4JB 5EERA 4YHBA 3X1YA 1EK2A 1BHQ1 1ST3A 1KERA 3JQFA 2D1YA 2O0HA 1NW6A 3H8WA 3HSSA 3TAXA 2F4VB 1WETA 3BFPA 1RPAA 2P9ZA 2B83A 4Z0TA 3WAJA 3EZ9A 4GRAA 1QTRA 3DHEA 3H6KA 1XXHA 5LL6P 1AZTA 3KO8A 1HE1C 1LA2A 1MVNA 4U7JA 5DOVA 3U0BA 3HO6A 5BYJA 5LDGA 1MB3A 4R9SA 4CN8A 3HZOA 1EUDA 1NSYA 1KO5A 1P7PA 3PC7A 1D2NA 4ZANA 1I6LA 3ISTA 1KGSA 1Y3AA 4RPJA 2QT9A 3A6HA 1XCMA 1SY7A 2RCNA 3F2IA 2HJHA 4MYHA 2VQ3A 5EFOA 4LZWA 4CDGA 4L8WB 2VJLA 4F4DA 1OFUX 2BZ0A 3DMTC 5COAA 5EEGA 3HSYA 3DNPA 2DRIA 4GQIA 1ODKA 1N6RA 1KAHA 3TM4A 1O97C 2HQRA 4ZMRA 4QEKA 4QATA 1CRWG 3P9XA 4ZEMA 5FBLB 5ES4B 1AN0A 2ZE8A 5LR6A 1PJBA 2WM9B 2FFQA 2HA0A 4OK5A 3FCOA 2NTEA 4PG6A 4X1KA 2EARA 3KT0A 3V34A 2IHBA 4KXUA 3BCRA 5IFLA 5SZJA 4EEXA 2WFMA 3T3EA 2ZCUA 3WRYC 3ZIAA 2XADA 1A2OA 1SULA 4MCHA 4BQEA 2RGGA 1JZSA 5JO9A 1P4JA 3LFUA 2IYVA 4KV9A 4KO1S 3W1WA 4M1MA 3PPYA 1FFXB 3EVNA 3KVYA 3LE8A 3H2KA 3HVHA 1J25A 1FF9A 5KSPA 2E5WA 5KPDA 2PL5A 4XGRA 2EKLA 3C3BA 3G2HA 4IYRA 5KHLB 4LHYA 5GWXA 1WCYA 4TTPA 3ND8A 5DRYA 4RTSA 2XB2A 4ARIA 1BOOA 4JDUA 1ABBA 1K97A 1Y6ZA 1XWIA 1N9GB 5AIAA 2RB4A 4CM9A 1N2GA 2GCPA 1YQ9A 3C8DA 3FMGA 4CFZA 1DP4A 2P8SA 2XVZA 4I9HA 4JP8A 3KL4A 4GX5A 5CVTA 13PKA 4RJKA 4YECA 1U11A 5B57C 2A14A 2G7ZA 2AGVA 3PNSA 5A2GA 1NNI1 4GVLA 2VOEA 4Y1RB 5CFQA 2Z9DA 2C3YA 3UWPA 3F3SA 3FYSA 2C54A 2Z2JA 1TUBB 2A9RA 1PRYA 2CJWB 2PMBA 4ZQFA 3D3EA 3U39A 5HG0A 4WMLA 5LXTA 3W4KA 3RS3A 3ICPA 5J4YA 4HQFA 2IY9A 3BHIA 1CJSA 1NYQA 2H0AA 1GCGA 1XD2A 3ER6A 4IZIA 3EW7A 3VAYA 2QL6A 4EEZA 3Q40A 4Z4GA 2X5XA 4N9QA 4D3XA 3SVLA 1T13A 1EXVA 4YY3B 5AW0A 2V54A 2UDPA 3W3AD 3ORQA 4YAFA 5LOVA 3AI2A 4OL0A 3MLAA 2QM7A 1USKA 3E8XA 5C0OE 2FI1A 3H7AA 4YJDA 5IH3A 5TR9A 5FL7D 1AURA 2B8TA 1A8QA 4MWSA 4B71A 4RSHA 4ZYWA 3R7DA 2V6IA 3SNKA 3GGOA 4YROA 5E3HA 3C3MA 3HJAA 4KQJA 5B3AA 3FY4A 3S1AB 1P62B 2QVYX 3DW1X 5AVVA 2UZ1A 1GTMA 4DJFC 1K4MA 2O7SA 3OP4A 4LK3A 3B53X 4Q1CA 4TL9A 3NTLA 4J0DA 5EKSA 3AUAA 3RIYA 4B34A 4M0LA 3PX3A 4ECEA 2I1VB 4QUGA 4ZDIA 5KOHA 2NSDA 3QPBA 3M3DA 3G5AA 1N5MA 3UUEA 1EZ1A 4FMDF 2Y77A 4FB5A 3OPVA 3KPYA 2GARA 2RHRA 1T0IA 2GZ1A 1TO1E 1VHJA 2Z5GA 5K0CA 3GUVA 3FRJA 4IKEA 3ZWBA 4ENVA 2QX4A 2BEUB 5K03A 3BIOA 1SZDA 4M0EA 1E5XA 1U5AA 1UMCA 1IEWA 4ID3A 2C2XA 4IMIB 1K3UB 4MW2A 2Z4RA 4OGFA 3WK9A 1F12A 1MOSA 1PWHA 4JN6B 4IM7A 5FBQB 4BRZA 2AS0A 4HB0A 1TT5B 3G8YA 1XP5A 3H9QA 4Q39A 4EHBA 4BE9A 3L1JA 1JKFA 3RVQA 1RI2A 2H4JA 1Z39A 4AZSA 3SXUA 4RE6A 4IHKA 2MSKA 4D3ZA 4ZKDA 3FXAA 1XB2A 3IOCA 5J4VA 4LVUA 2XBMA 2EJWA 3DV0A 2P2SA 4EY4A 1XO1A 5M5BA 4CG1A 4OJQA 5LBIA 4WY2A 2KBEA 5C8DA 5HHTA 3LVBA 5EWJA 2HLNA 4H2DA 3T94A 1G5FA 3VNBA 5AHRA 3PHHA 2V7XA 4IO1A 3WWYA 3E9EA 1U1DA 1HQYE 4X9XA 1S6YA 2I2AA 5ETJA 1OLXA 2YYYA 3NBMA 5TSDA 2VUIB 3UFXA 1V9SA 4F06A 1CJBA 1OA1A 1T25A 1XU7A 5B2EA 2F3UA 5KOJB 1XCGB 1HL7A 3R7AA 3TLBA 4AQYB 1EH5A 2PLFA 5DBIA 1EKXA 4CLOA 1UDBA 1SUEA 4BVGA 1E2KA 2GAFA 4ESEA 3R3HA 5DXFA 5DN6D 1E6UA 3MT7A 2ZE7A 5LKAA 1TGYA 2G17A 4TM8A 4LY9A 4YV7A 4JI5B 1Y8CA 3U16A 3I83A 5D3ZA 4XUGB 3ZHBA 3JQGB 3D3QA 1D4FA 3PTLA 1E1QA 1KJQA 1CZLA 2FMXA 2AFHB 2QTBA 2ZYAA 3EZLA 4MVJE 5IAJA 5GZ3A 4IFBA 4NS1A 2F7SA 1SNYA 2C7QA 4YASA 3DQPA 3TZKA 2V0GA 3SBXA 4M53A 1L5RA 3R23A 1NA5A 2MT9A 4YR9A 2IZ0A 3FH0A 2G67A 3QVVA 1PGQA 4KAFA 1S3IA 3F71A 3IPXA 1VI6A 1FYDA 1E9DA 1XU9A 3KAQA 4HGOA 4M60A 4RNCA 3LRTA 4FZ3A 2DBVO 4PY2A 4JT9A 1UFKA 3RUEA 3VR6A 2JH9A 1FDVA 2XUIA 3Q9LA 5KYGA 4CQMA 1T24A 2VHXA 3LFHA 5BOVA 4MV5A 5LJIA 1A82A 2R8RA 2JRLA 3O3OB 5EE0A 4DRXA 4AKTA 4BXOA 5AW7A 4PSUA 3VH4A 1KS2A 5KTOA 5DFAA 1XYGA 2G9VA 1H66A 2GAIA 4BBZA 2FB9A 4F9TA 2JFHA 2NX2A 3UG7A 4RLHA 5FPYA 4GYKA 4DL9A 5E2IA 2XNHA 4TLAA 1XMVA 1JEOA 1KEPA 2JFGA 3EUFA 1X8LA 4J0KA 3I34X 4MAFA 4OQZA 2BCJQ 1XJWA 4DKXA 4PBSA 4DWWA 3I72A 4AIRA 2VTEA 1SUBA 3ADOA 1KR5A 3M8KA 1L5FA 1Q57A 4WLUA 5ER6A 1RQ7A 3FFXA 2E85A 4FLFA 1MC8A 4JBWA 1A9OA 1ZC3A 2B0CA 4HI0E 3H0KA 3FNQA 5EJMA 1VDMA 2EBWA 2WU1A 3WGTA 4JJ4A 2D7CA 1AKYA 4U3JA 4OH1A 4IEIA 2H18A 2R44A 3QQ5A 4FZJA 1H8HD 1ELOA 3NIDB 4UUBA 5EXSA 4OG2A 4PC3A 3D7LA 3C3PA 4M7OA 3ILSA 1PTJA 2F6RA 2ODAA 3I4FA 2D06A 5ALEA 4IZHA 1YC2A 1QHSA 1PL0A 1N92A 2BISA 2P6RA 3PFGA 4E5MA 2JIQA 1Y5MA 3AM4A 2BFNA 2LVBA 1UK9A 2Q45A 2HQSA 1TJ5A 1RRMA 3GAZA 4X3PA 2W4MA 1UJMA 2QXYA 4KR0A 5T5QA 3V8RA 3D6AA 2XZPA 3VUEA 1V1RB 3CX8A 3EAFA 4PE5B 5LBUA 4JL8A 1EWQA 3K09C 3KB6A 4PC2A 1GTSA 2HWYA 1LPOA 4C6TB 3IO3A 3U7HB 1D2AA 2Q3CA 2Y99A 1BEZA 1RYYA 2D3TA 4V2UA 4ZCQA 3HA2A 1Y3IA 1KDRA 1LSJA 4EMBA 4D9GA 1L7QA 2Q4TA 3UJBA 3UY4A 3F8WA 4DXAA 4CF4A 1RNLA 4MQMA 2CSXA 2CK3A 3JQAD 4H27A 3NHSA 3BIJA 3DXYA 4QUBA 1E7SA 3FYDA 5BN4A 1VG9B 5F2NA 3NDRA 1U0RA 2GZSA 1P0CA 3OX3A 2VK2A 5KDDA 5KDOA 1PFGA 2J3DA 4LIPD 1Z2OX 1PWZA 4RAOA 3EDOA 3SHTA 3SOZA 3VH1A 2I33A 5AW4A 3HXTA 3NI2A 4JBHA 4OK3A 3Q72A 1XZDA 3ESDA 4FN4A 4R0NA 1VKOA 4R01A 4YDSA 5DDIP 4YMHA 4GIBA 3C15C 3DUFA 5KAPA 1RAGA 3I9FA 1A9PA 2E1RA 3OJ0A 5FQNA 3HNRA 4BNWA 3A9VA 3DBHB 2XB8A 1MV8A 4QULA 3QLVC 4ZT6A 3SX4A 1KYXA 2P9BA 4FKMA 4F96A 2OHGA 1C29B 1LDBA 3PC8C 4WKGA 2V6JA 1WULS 3ABOB 1PT8A 4ZO6A 2VWGA 3VVLA 4D82A 1E3DA 2JDID 4KQHA 3JRNA 4D9CA 1CRPA 2PWBA 3WK8A 2DT8A 3NEYA 3D31A 4JI6B 3ECAA 1AU9A 4U2KA 1B26A 2WV7A 4XDYA 5EKDA 1W2WB 4DLVA 3LECA 4YLGA 3NAMA 3S5UA 2XKJE 3K92A 1OFUA 3SHFA 4B84A 3E9QA 2RJOA 4RXTA 3SZGA 2ALJA 1SAYA 1R27A 2HZ7A 3HKEA 4Q18A 4TZ6A 4HNRA 4G5RA 1ENZA 2L17A 1T1GA 4LA4A 4MR8A 5IYZA 3O73A 1M1YB 1EK6A 2WG2A 1IG0A 1C7FA 1NJ1A 3IAS6 5FBKA 3ZV3A 2Q0HA 1MW9X 2WT8A 4Y30A 1E9FA 4MH0R 2DSTA 1APBA 1OGJA 4CIYA 3DOJA 1EE2A 2A1UB 3MTBA 4G0ZA 4W9NC 1L4FA 4MP6A 4UU0A 3TD2A 3ZNQA 1K3TA 2JI8A 1B0ZA 2VBIA 3QF4B 4M1WA 5GJVC 3PGKA 4UPEA 1EHIA 1Z6QA 4JLSA 1D8AA 5JATA 4Q16A 1HKHA 3UCXA 5BMOA 3MILA 1V8FA 3OOWA 2NVWA 1MOQA 3BJMA 5F12A 2EP7A 2RIRA 3DQZA 1P8JA 1WQ4A 5CH3A 5FOTA 3TXXA 5K4HA 3I53A 3RQIA 2V4UA 1KF0A 2X3FA 4NZPA 2VNAA 1S8NA 4CRWB 2QQGA 3PUKA 4CKYA 3I0ZA 4FCCA 4FSDA 2FW8A 5AKZA 2PX3A 5KJCA 1GY8A 1DIHA 3W2IA 1DAFA 1II8B 4BVEA 3RADC 3DWGA 4NG4A 1Q91A 1L8LA 3IMEA 1FEZA 2V9PA 1HYGA 4X61A 3DCIA 3W8RA 2ZYTX 3UH0A 2BGGA 4RHYA 3UMSA 5BN5B 1KQNA 4DG5A 2H00A 3O74A 5AKKA 4W7HA 3OE5A 4GE0A 2RHOA 4DUYB 1BC5A 2CE7A 1LNZA 2XH8A 1F4LA 1JSCA 2NSJA 2IU4A 1JXMA 1QZXA 3E7PA 4GNRA 4LRWA 2EDAA 2R2GA 5KQRA 2QJOA 4D9BA 3Q2OA 5EQJB 4YX9A 1J0XO 2NZUG 2R8PA 3V8NA 3W6UA 1HNXB 2FQYA 3QXCA 1ISRA 3GA5A 4MA0A 3IRUA 5KWJA 3IQHX 1T15A 3IMGA 3QSGA 3K09A 1Y6QA 1A9SA 4F0JA 9GPBA 2PSFA 1XTVA 3FZEA 2UYOA 3LKDA 5LQAA 4DT1A 4B79A 4LJSA 5A02A 3VDXA 4AULA 4ZA2A 1CK4A 2PS1A 3FROA 4OMCA 1T5IA 3SDSA 1JQAA 2GZAA 1ZH4A 2BR5A 3CBGA 4BO6A 2YJGA 3T54A 1P9OA 1YL6A 3RT7A 4AMGA 3OHSX 1ZAYA 3MHTA 3G2KA 3C1UA 3DEAA 5B58T 3U1BA 2Q3BA 3DTYA 3WK7A 1C8LA 3CVYA 4KVAA 1GYRA 3ZXYA 5KYNA 4WJLA 1X7ZA 3P2YA 1D6JA 2C2HA 1ZDMA 5GY7A 4R2KA 4WKOA 4F84A 1KMHA 1N8TA 2ZWIA 1TM3E 1EXWA 2NT4A 4IJQA 3RTEA 3ZZUA 4CIXA 1NXXA 4LRTB 1E3QA 1T10A 1L8QA 1QX4A 3HQ4O 2ZR7A 2VEDA 4ZI5A 3TR6A 5TIIA 3A27A 1ZGBA 4GZ6A 2YXNA 4QKQA 2NUTB 4DR6B 1A8IA 2RGRA 1TYAE 1AJEA 2PZKA 1FLDA 1DG9A 2H0RA 1IMOA 3A4TA 4FFBA 4MGKR 3QLVA 4MS4B 4CLEA 1NXTA 4ZAYA 1YRLA 1PJ4A 4KXMA 4LNUB 4PAQA 1LBSA 1X0VA 4PLCA 3HP4A 4YP0A 8GPBA 2IV2X 4D6PA 4DG8A 3GD7A 1OR8A 5EHQA 4BLUA 3KUKA 5K0EA 3I6ZA 5KEIA 1KQPA 3BIXA 2HKIA 1QGOA 3Q12A 4MLZA 1Y8ZA 4GPZA 2XW6A 1D0VA 1T0HB 3W9YA 2XNDA 2WY2D 1UJNA 1NFFA 3TUJC 4C2BA 1BEEA 4KO3S 2MTBA 3CZAA 5E9QA 3NAQA 1MCZA 2OV3A 1RQNA 3I92A 2E82A 1INLA 2HV9A 4I99A 2B98A 1IEXA 2L69A 3NOQA 3L4EA 2D7JA 4IDPA 4TWIA 2XUGA 4D02A 3NM6B 1YRHA 2ZYHA 5IYZF 2I2FA 4E08A 1F0YA 5C5DA 3T0FA 1KZ1A 3OZ7A 4XJVA 2CZGA 2J9FB 1LTKA 3TXYA 4ALNA 2IYEA 4E4YA 1DV2A 1WEHA 5C8XA 1L4UA 2NZWA 1QM5A 2J45A 2HHJA 3TZ6A 3V55A 2X2EA 4FWTA 1EXNA 3W2TA 3Q2IA 3IAFA 1SPXA 2IEIA 2Y1WA 5HJ5A 4O3MA 1R8SA 1T5SA 3OCCA 1FYEA 4X3CA 3IJEB 3J7AC 4CTOA 3GJ5A 3I9V6 5HGJA 2WD9A 4AO8A 4UATA 4KBGA 5IVIA 3LYLA 4AJEA 4MCJA 1OWPA 3G9UA 4EW3A 1Y1QA 5ALRA 3RYHA 2RK4A 4R81A 4W9NA 1C2TA 3CCBA 3GH1A 3TTYA 4MKGA 3N2GA 2P90A 3K0HA 1YF3A 5BOSB 3JQDA 1RAAA 1MD9A 4REOA 3EOAI 2F1OA 3B78A 3Q7TA 4WUVA 3R44A 4PG5A 3UMCA 2PD6A 3WDKA 3W8EA 3U7FB 3LQ2A 4BO9A 3MT0A 2NXNA 3AFNA 1IBMB 3K5IA 4US0R 5AVSA 5DULA 2ZIXB 3TGWA 2WPDD 3C6YA 1P2DA 4M0CA 5ITZB 3PUYA 1K3FA 1BX3A 1WRBA 4PFSA 2DFPA 3QBTA 4XX1A 4FFVA 2B37A 2PGAA 3Q0TA 4ZC8A 2Q2NA 5JG7A 3UXEA 5CR9A 2YBDA 5EPUA 5BMVA 1U9IC 1UXOA 4QICA 4C1BA 1ZOSA 2II6A 5DEOA 1Y5IA 2JHAA 3O8CA 3AR6A 1CRLA 1HY3A 1NFRA 2OWEA 3IKMB 1TX4B 3ZJ5A 1EVQA 1N6KA 2AN9A 4NHEA 4B6JA 2ZUCA 2B5VA 3E5NA 4JQCA 4UEJA 3UYLA 3MRXA 4ES6A 5KAMA 3EIEA 4I1RA 1JPVA 5H1YA 421PA 1RC1A 2PX2A 1TUGA 3K2QA 4HUQB 1A9XA 1EX7A 4F5DA 3OZBA 2B2CA 3VR1A 2O14A 3FGNA 3ZWXA 4HMOA 3RYFB 3EIXA 1CUGA 1EJ2A 1YB2A 5KVAA 4IXTA 5IC6A 3HYCA 5CB6A 3I2HA 1CDEA 1NDUA 1QQTA 3LXRA 4P84A 1CDDA 1Y42X 2ZPTX 4UNSA 1IU9A 3GU3A 1E1KA 1ORIA 2V8OA 2G80A 2WFLB 4AG6A 2D1FA 5KNLA 2P91A 2WOOA 1C1DB 4X7RA 4EA6A 4RE5A 1J0EA 1MV5A 1YVDA 4MA5A 4QJ3A 3DLPX 2A94A 4LI0A 3OQIB 4MQEA 5FF9A 1RVV1 2YX1A 3O2NA 4FDTA 4WXPA 5CNIA 3W5BA 3R3WA 2V7WA 1ONNA 2X8BA 1O2DA 2IOYA 1A9YA 3HEMA 1DJQA 1JQ5A 4UQLA 3IFSA 1FSSA 1KARA 2F8LA 1JHXA 4HX2A 3DMPA 3FPEA 3I5MA 4BC0A 3UW3A 3Q7SA 5IH7A 1N2JA 3U4GA 4RJTA 3BD9A 5JFGA 4DV5B 4KI0A 3KWLA 3UOAB 1NX6A 4BJ5A 3NOVA 3U7EB 3DTVB 1L5HB 4G1BA 4KXXA 5EJAA 4NATA 4B4VA 1TEZA 4AJOA 3B70A 1YH3A 3DOUA 2IUTA 4JK3A 4J9VA 4BCBA 5ADVA 4RTKA 5AKXA 5ELXA 3C87A 4DNFA 5FJJA 1IONA 2I5PO 2OYRA 2VWQA 4H0CA 1M1ZA 1RKXA 2QU7A 2QTWB 4KTTE 1MAVA 1S02A 1XZGA 3GPLA 5TEWA 5EE3A 1J2JA 4RKWA 5A03A 4UBKA 5EIHA 2VHUA 5FORA 4IXNA 5JT1A 3H13A 2OQIA 3T1HB 1P0IA 1N9KA 3DMFA 3NP9A 4A8HA 3ZEAA 2CLSA 2V6MA 2C5GA 4NCXA 4Q4HA 4Q6WA 3ZE7A 2J9GA 3K20A 1W87A 3KFLA 3IR6A 4B82A 4B31A 3AF6A 3ZVLA 1NXOA 2X0IA 1JTVA 3L0PA 2ATEA 3F1LA 4X8OA 3DO6A 3ZHOA 1M67A 3C8ZA 2Q62A 3AL0C 1WZCA 1VIMA 1XMSA 1ESMA 3RIXA 1T9KA 3AVTA 3H83A 4EO4A 4O2BF 3CVXA 1A88A 1KU6A 2R1ZA 5FOUA 4X8LA 3GJYA 1OYOA 3R5FA 3GMTA 4BBAA 3FPAA 1RR6A 2W98A 3G2PA 2V3VA 2RMKA 4HWOA 3TZEA 4DHEA 5ALSA 2XZOA 1SXJC 1UCFA 4H7HA 5ENDA 5LZ5A 3VTAA 4JX8A 1HM5A 2G36A 2A0FA 3GNSA 3AF1A 1DOZA 4GKAA 1VBKA 4O4HF 4UM7A 2ASEA 3Q7QA 4IIVA 1XQ6A 1DC6A 4M6WA 3CF2A 4I66A 3QK7A 2FEAA 4IW3B 4RU1A 3LZDA 5DV9A 4NZZA 2JZOA 5IT0A 1DXHA 3QKTA 4Z0HO 3KVNA 5IXYA 2ZS7A 4M8SA 3BE4A 4TWJA 3RK1A 2BMEA 3TW6A 4B74A 4Z7QB 3VSAA 3FMIA 1KXZA 2F48A 2WIAA 2FZ4A 1ADJA 3QKSB 4N5DA 4DMRA 4EB6A 3KVVA 5YASA 1IQ0A 2FMIA 3FTFA 4ED9A 3ITEA 4X3OA 2PZEA 5BMVF 3MMZA 5C8YA 1B8VA 2IEYA 5EUCA 2DTDA 2HBZA 1G3RA 3KK0A 4R05A 4ZYLA 1I4DD 2CJYA 2H1LA 5J3JA 2SNIE 3TD6A 1T8TA 4DMKA 2FCRA 2OP1A 5A5GA 4DUPA 4BB5A 1W47A 3DHNA 2VAWA 4PC1A 4FCTA 4E6EA 4MGZR 5FTWA 1PI3A 4C0XA 3BEOA 3JQRA 2HDNB 2NO1A 4YGYA 5FUVA 1FY2A 2IBSA 2X8WA 1KFJB 3ANYB 4H6VA 2O23A 4KQXA 5ALLA 1NYRA 2OXEA 4YMTA 5U4XA 2FOIA 3L7IA 4HTFB 4I6GA 4FBLA 2HCTA 3G6KA 2AFRA 1Z74A 2RGXA 3GQBB 1LH0A 2RHJA 2X5JO 1QWSA 3KKOA 3O2JA 4G65A 4LXUA 1H9BA 5ALYA 1CUJA 2PUBA 3MPOA 3PCXA 1ZW1A 4IMRA 4J1NA 4C0BA 5CGZA 4BAUA 1E58A 2MYUA 2Y0PA 3HZRA 3IESA 4U7TB 4Y67A 4TROA 1WDMA 4UQOA 3U9TA 4HTAA 4DCSA 5H3CA 4W7IA 4UNRA 2GCOB 3U5TA 2EATA 2JCSA 4TMWA 3LDUA 4ZT4A 1VE6A 3ROXA 1UMDB 2B9VA 1R9GA 2AN4A 3PUWA 2R6JA 3DBRB 1GNVA 3O8OB 5A4MS 5DK4A 3KFXA 2JL1A 3PNKA 4ZVQA 2WZQA 5EJFA 1GL6A 5A3JA 1G63A 4RVHA 4Y2VA 2R1UA 1L2TA 3AWIA 5DP2A 4DMUB 4MUEA 1QAMA 2AOTA 3OIYA 3OWOA 2YBEA 1KI2A 4GZ5A 4RD4A 4NAHA 5AUQA 5T4EA 5KQPA 1DX4A 3NANA 3D6NB 1RXYA 3OQBA 4L4XA 2WF9A 2H29A 3SBDA 5BQFA 5C37A 1EP9A 3BM5A 4GMDA 4I0WB 3STUA 1NQXA 1GQYA 2WF5A 2YHIA 4BFSA 2O8EB 4MDYA 2P4SA 3HXPA 4S35A 4MHTA 4K9DA 2MMGA 3VR4A 2PH1A 1ZXXA 4D81A 5KCZA 2G0NA 1PR3A 1VSTA 4JD5A 4MRSA 4IRMA 3WO1A 2C8KA 2SCUA 4PLGA 5LSAA 2BP7A 2QPLA 4AT1A 2IQ5A 3V8MA 2CDRA 4AK9A 2NZ8A 2PQ2A 4R1UA 1LQTA 2P6PA 4PQEA 1UFRA 5EPOA 2PKQO 2D2XA 4CTKA 5K3FB 3VQTA 3QWHA 1PD1A 1VGVA 4ZCPA 3LLCA 3GZNA 1V1JA 2GHQA 3VPAA 5LQDA 1PQ4A 2PX6A 2Y05A 4FGSA 4AUKA 3OEHA 4WH0A 2O1SA 5FO1A 2W6QA 2QY6A 2B30A 3VYSB 4Y7CA 3UW1A 2ZJOA 5CFNA 4PLZA 1K0FA 3LP8A 3LP5A 5K20A 2HPVA 5JS6A 1YZUA 1ZI9A 2XTJA 4H3VA 2J4FA 3BRQA 2ODBA 1I3MA 3OBIA 1CKEA 1EQAA 1NP6A 2NZVG 5LYJA 4BWYA 3T1VA 3GFOA 3SVTA 1P4SA 4E51A 1LK0A 2FEOA 4HSEA 4QXQA 3AJ9A 5FI5A 3ZY3A 1K2VN 1W88A 1UT8A 1UMBB 1IVYA 3A3OA 1I36A 3NHFA 4W99A 3UH1A 5LZ8A 4CUJA 1PFKA 4CDRA 4U7FA 1SXJA 4IH1A 1LLUA 2AC7A 2PS3A 2OO7A 1FRVA 2P67A 2QRUA 3ONVA 4IY1A 4U2CA 2G1AA 3RRNA 4ND2A 1L4EA 3OCYA 4OXYA 5CVCA 2GRJA 4PQYA 4UU8A 4Y0AA 4Y2XA 3ZZNA 5CDUA 2LD4A 2P5YA 5IC5A 4DYHA 2VDWA 1H2FA 1XDBA 1KRXA 3GFQA 1I3OA 1ILWA 1SWVA 2G6BA 5JZSA 2UAGA 1UKEA 2XCLA 4XWKA 3QNMA 3M5WA 2J31A 4V38A 5AIBA 3WNBA 4QUIA 2D5AA 2W6JA 3D02A 2N42A 4KH1A 4Q3CA 1GTRA 1YQXA 2E6UX 3L02A 4G0MA 2Z2ZA 4HY3A 1Q74A 2JGAA 1TKAA 2OCPA 2YOGA 2DY0A 3LK6A 3RVKA 2WSSA 1HQKA 2C58A 2OBMA 2I78A 5KMGB 2BHRA 2GMWA 1L7PA 4Y6GB 5P8WA 4KU4A 3W05A 6PFKA 5ICGA 1C4OA 1C7RA 1D6MA 5L3RA 5DTQA 3FYUB 4G36A 5JEDA 3HCCA 3T5CA 4P38A 3I4LA 3M6XA 1P2BA 3PXGA 5DBOA 4BEBA 1MFZA 1ZH2A 3N0WA 4N6NA 4OQDA 1ZZGA 3HPQA 4ZJPA 2E4AA 4TYYA 1M34E 5GGYA 1H1TA 1RLIA 4IEEA 2E0IA 2XWQA 3ODGA 1J8YF 2X0RA 3FBWA 4RK6A 1DI0A 4L73A 2OCLA 4YDHB 3BMNA 1LX7A 3CE9A 2Q9CA 2ZIAA 3ER8A 1D7AA 1OH5A 3HVIA 4NBSA 1DX9A 1OIWA 4D8TA 1AK2A 4R9RA 2B36A 5C52B 1G8PA 3SIPA 3ZWQA 3PCTA 1IRXA 4O0LA 4KL8S 4KXYA 5HKKA 1Z2NX 3EDYA 3IT3A 2ILVA 1V41E 2QE6A 4HGYA 5I9SA 1V2GA 5JCZA 1M5TA 4LQLA 1YKFA 3EXAA 4BMOB 3KD3A 3U3MA 4EVSA 1WXIA 4QEDA 1XTSA 4B87A 3DT6A 2Z1NA 3CQ9A 3DW3X 3NHBA 1PW5A 3NT2A 3E7WA 4I4CA 2ZBDA 1NUPA 1SUFA 2H9IA 5K09A 3Q7RA 4GP9A 4RXMA 5SY9A 4D0LB 4DF3A 5LZ2A 1CG6A 4HV4A 2EIXA 1TEXA 4FJ2A 3CR7A 7YASA 5K3AA 4N0PA 4PLWA 2BM0A 4QBFA 3QVKA 3OWXA 2MYNA 5JV5A 5DO9A 4EUEA 1E98A 4KKVA 2JGNA 2X4DA 5CM9C 4MUMA 2YJ5A 4AY3A 1G41A 1CU1A 3QG1A 5CAEB 3SYKA 2L2QA 3DFZA 3KKLA 1M10A 5I9BA 1NMXA 4OP1A 4DS3A 1MUUA 1WXQA 5KYUA 5JARA 4L9SA 5CD1A 4WGGA 4H6PA 4IINA 4RPIA 4G0NA 3JS5A 2R5WA 5CW1A 4CKWA 3O90A 5EZ5A 2ZB8A 4KLZA 4KMRA 1UPBA 4UEQA 3RW9A 5M3BA 1JMVA 1SKYE 2DQYA 1DE0A 3NP7A 2QN2A 3RJ9A 4DC1A 5K8IA 2YXPX 5M29A 2VQEB 2DPXA 1F8XA 4PR3A 5FLXA 1JJFA 1YZTA 2ZBPA 4QLBA 3ZN2A 3HJGA 4YCNA 4IRXA 1FNNA 4ENSA 4JYMA 4QSMA 3VO8A 1X8JA 4FYPA 4JB3A 2VHYA 3VO2A 4RVGA 3IP8A 4RSMA 4RUKA 1CERA 1AX9A 2HWKA 3A6GA 1SQ0A 3KVOA 1UKAA 5UKDA 4BNXA 3MUFA 2QTTA 4HF7A 2HIGA 3OX2A 5E6SA 2FEWB 2ZI6A 2BGUA 2NV0A 3F49S 2H2IA 1R8YA 3LFTA 5AUNB 4OATA 3DOIA 4K1LA 3K0FA 3NVMB 3Q1LA 4MQ4A 4NBTA 1XZBA 1A5ZA 1A97A 3CRZA 1SCUB 2XMCA 1LJUA 2H4ZA 2YJTD 3K53A 3HB9A 1GCOA 1EVEA 1P75A 4DPMA 1CY0A 3QLJA 2C4VA 4TYQA 1DT3A 1KVRA 4FMDB 3DL7A 1A98A 3URMA 1E2IA 1TIPA 1H93A 3BFKA 3JQ9C 3HV2A 5ED0A 2DX7A 2YOFA 2FUKA 2Q2OA 2Q2VA 2XV1A 2PZAA 1HLDA 4LCEA 4H6WA 1Z37A 1VP9A 3KKZA 3LBYA 1PEKE 4N01A 4XPZA 4B3DA 5JSUA 2GYUA 3MWKA 3R9KA 1OU0A 5EHXA 5JZMA 2H9YA 4NCJA 4BLPA 3QBVA 4X1OA 4QO8A 1E9SA 4LG1A 1MW8X 1EUDB 1YR7A 1HQDA 3KL2A 4J91A 4RKYA 1SU4A 5BUCA 1I7DA 3AQIA 4ZALA 3FA2A 3U44B 3OY7A 4GOND 4JI3B 2OAGA 2OSBA 4IAOA 1PWEA 1OFGA 3KM0A 3R6TA 4G67A 3DPUA 1V6SA 4MDFA 5GV8A 1EDZA 4LRYA 4G24A 5TDHA 1NWCA 2B4RO 1I4LD 3D6UA 4LHSA 3U6BA 5J4KA 3H18A 2QUJA 5DLPA 3WGLA 2WU3A 1GGVA 3B85A 1B00A 3P26A 1F9EA 1ZC4A 3SLKA 2ZYSA 3URKA 5IF3A 3GGJA 3MOSA 2PJUA 3DEKA 4GC5A 3FOEC 3K9WA 4F46A 2IYLD 3R7LA 4KQ9A 4I8XA 4KW7A 3ZGZA 4OXRA 3WBFA 3GRFA 4D4KA 3IPLA 1P1CA 3T5PA 4MYDA 1P0FA 5LB2A 1JIIA 1X7WA 4E32A 1H23A 4KEAA 3LUAA 3JWHA 4F45A 1X1RA 2F3PA 2OBBA 3KZOA 1Z75A 4IIBA 4YDQA 1YQUA 1CYEA 2AN1A 5CLGA 2OKCA 2I76A 2ZSUA 1PT9A 3D9QX 4XTCS 3AVOA 5FI1B 3TB4A 4G0PA 4ZAGA 5FBZA 1SPBS 2AEJA 2FSVC 2PIAA 4FHCA 3RHZA 4H16A 4MKIA 4W1RA 4XVUA 2PUCA 3FAZA 4URXR 1NW4A 3N76A 2XTZA 3O84A 3UAWA 5EIEA 4WCFC 3S1SA 5DNCA 1BVHA 5TV2A 4YUAA 3UVEA 4PPYA 1CRZA 2LTAA 1T3GA 4L22A 1PZNA 3L8ZA 1YBVA 2C5AA 1G20E 1K0UA 5DHQA 4KQMA 1YQWA 3L1HA 4CIWA 2GN0A 2FPKA 3NXKA 1RZVA 2FZGA 2WF7A 3K0CA 3G7SA 3BBPA 2YJ4A 3ZZTA 5DW0A 1M0WA 2R7LA 4LZLA 2B3TA 3IGFA 3AY0A 5K0FA 2C8JA 5JFOA 3BGVA 2ZSBA 4OAPA 2YMMA 4NJEA 5JH7A 2ZTUA 3ZCXA 2FUCA 4Z53A 1CLEA 1XD2B 3I1FA 4J76A 5TB5A 1NLMA 1W4CA 2HMVA 4PGAA 1EP3B 1N36B 1GSOA 1JT9A 4WUTA 6REQA 1JIXA 4BOYA 4C3OB 4TKZA 2XBLA 1P19A 1KMMA 3HJFA 1WX1A 3GJRA 1CUUA 1ZJ6A 2BSXA 3MWFA 3N8GA 3IC5A 4JSRA 5HOQA 1KRWA 1SUSA 1SMKA 2GASA 3GLFE 1XWFA 4ZHQA 5E4FA 3O0DA 5IABA 4JUBA 4E09A 1A8UA 3RC2A 1W44A 3DCYA 4M9UA 5GJCA 5K3DA 2UZ1B 3K1ZA 4YNBA 1X7YA 3D5TA 3ZCVA 4IOMA 1KJJA 4L28A 3X1JA 4EFDA 3WAGA 5KOHB 2XQJA 1HURA 3ZI0A 2NZ2A 4TQUS 5KJ6A 1SRRA 1YJAA 2B7CA 2XIQA 2ZFUA 2AR9A 1V16B 3FPBA 2ZB2A 4EHAA 5B4VA 2VPXA 4XIYA 3O4FA 2DUUA 4ZVMA 4J0CA 1KJWA 2P0EA 1YQQA 4G2TA 3LXXA 5A9RA 1CUAA 1ZK0A 1Z2EA 2HHAA 3SEQA 2VRNA 3PYMA 3BWCA 3WGHA 1JE1A 3CX6A 3UV3A 3PF9A 4MUKA 2XDWA 3A0RB 4KQEA 4L8YA 1VI5A 5BO5A 1WV1A 2JGEA 4OI4A 5AM3A 5FV4A 1YZKA 5IKEA 5MGNA 3JQ9A 1OH6A 4WCDA 4JUDX 3KOWA 2E21A 4FOPA 3MUOA 3N2ZB 2B20A 2QMHA 5F64A 4AZ3A 3JQ8B 5DASA 1W25A 3SXUB 3SYMA 1L9XA 1HDEA 3WLOA 3ANNA 2WE8A 3I45A 4DLTA 4C4YA 3T4PA 1YA4A 1KNXA 1ZVQA 3AR4A 5HKOA 3DV0B 5DSZA 1GPLA 3AETA 4EI2A 2XNCA 2N75A 3BE8A 4AROA 5GJWC 1HRDA 2IXBA 5EWJB 2VA8A 1SWWA 1JG6A 3BK1A 1MIOA 2W6ZA 4F86A 5C80A 3LW8A 2AD5A 4XVQA 1FVXA 2BTQA 1L4BA 3MYYA 2INGX 1HYBA 4L07A 1OLXB 4YQEA 1XQWA 1YHZA 2Z30A 3BA6A 2CB9A 5FLEX 3RASA 4YTEA 3VZBA 4BNUA 4C7BA 1SRQA 3WQQA 2B99A 1W49A 2PRJA 3UMFA 1VKZA 3QEOA 1I94B 2E4ZA 3LBHA 2IKSA 4OLBA 2WZCA 3ZOKA 1JYSA 4LJLA 2YL2A 3CO5A 3NJ4A 3NT4A 1RXWA 5AQ1A 4QOSA 4DE5A 5EWLA 4I9FA 3C1OA 1ID1A 1MJFA 2EBHX 3TX6A 2C2GA 2YY5A 4M83A 4I1OA 4U9HS 1ORHA 1RPJA 2AC2A 1ECPA 2GBCA 5IAKA 3LOUA 4K3VA 1YS7A 2IHKA 1U7XA 1Q77A 2GK3A 4EW1A 2XX3A 4J9UE 2ID7A 3CNBA 1YTUA 1MTZA 1E3MA 4OD0A 2DCUA 1W30A 3RRMA 3L8EA 3EOZA 3OZIA 3QUCA 1I5RA 5C18A 1Q6ZA 3OPYA 3R6WA 4RULA 4HAIA 1CSEE 4XQ9A 2FSVA 4FT4A 4GEKA 4D8VA 4HAYA 5EZ6B 1EX6A 4UZFA 4C88A 1HDIA 2BKXA 3P2MA 4TYMA 4F3CA 4WCFA 3TIXB 1UJ4A 5DTJA 8ATCA 2B5OA 3QYPA 4IIJA 3KAKA 4ONEA 4PHTA 5G02A 3K1TA 3SMVA 4BPBA 3FM9A 4WZZA 5ADWA 5I7SA 4PZYA 4DRXB 1H0KA 3FPHA 4FHDA 4H18A 1XLTC 3HYLA 2X8LA 4FIZA 1V45E 4IKOA 4O0MA 4OP2A 4RHEA 5ESXA 4C0JA 3SKVA 1CEXA 2JATA 2TYSB 3T9EA 1DAIA 4I36A 2BGIA 3A0UA 1HYEA 1JHAA 4ZDKA 2XYHA 2QV0A 1K7FB 5EINA 1RYMA 1GUYA 2M6KA 4FGLA 3TQHA 1PL7A 4YI5A 3RSLA 3PLRA 4A0FA 1ADBA 2BELA 2QQEA 3FNBA 1IAQA 5ALJA 4QG3A 5I9IA 5CT9A 4KZPA 2BH2A 4EY7A 4MHSA 1KOLA 4QVKA 1RJFA 4B7CA 4QPNA 2PT5A 5C7OO 3KKEA 3W9BA 4R0MA 1K4YA 3KELA 3T9BA 1OXKB 1E6MA 2BDUA 3CB4A 4J8PA 4PC7A 3VH2A 3WLSA 3S0JA 2CL5A 4DDMA 1Q7EA 2PRZA 2Y67A 4K81B 2IIPA 3KKKA 3IQGX 4RANA 5JPCA 3WYEA 2VRBA 3GI1A 2QVGA 3JW8A 3ZGYA 4GGPA 4AUNA 4NP6A 4OPMA 4DLZA 4U3JB 3BOSA 4MZXA 4HX5A 4I9GA 1T3ZA 2EYQA 3LBFA 4MPTA 3RTBA 5H59A 3G49A 4JLVA 2AG0A 4F11A 2RKBA 1XPOA 1IN7A 4U9IS 5H82A 4ZAZA 3N2KA 3GLFA 4UCXA 2OXIA 4LJ6A 3R2JA 5JXJA 4Y9TA 3M1LA 3MFYA 4OI0A 4R8SA 5BNFA 1P60A 4IP0A 4JBIA 4NNPA 2BZGA 4DABA 4YR7A 3BXZA 5FPTA 1RXVA 3KBOA 1DZ3A 4HC4A 1LJ8A 4OCZA 4RM3A 5FJIA 4HLUC 4AU1A 1IXYA 5K0GA 1A4IA 1ZITA 3C6XA 1JR2A 2WZDA 4NMHA 5ALPA 3WHPA 2OK7A 3UMGA 5CLFA 3CNQS 3V48A 4B1FA 5JVDA 1NP3A 2PUVA 4AQDA 4M0UA 5ELLA 2GN6A 4O2AA 1E4EA 5HDBB 2QUIA 3ILHA 3K6RA 5SYAA 6ABPA 5ECWA 3KUDA 4DLYA 2QK4A 2WHYA 4MGHA 4I5FA 4EDHA 1GGEA 1SUDA 1JMKC 1Z18A 4K7JA 4MVJG 4KQKA 2KLHA 3HI6A 1B42A 3P4XA 4KMOA 3TTUA 3BIFA 1PLKA 4DLUA 4DMGA 5C4MA 5ADHA 3KZVA 4JYPA 1AKQA 3UWSA 1QP7A 3TQIA 5LC1A 3F5MA 5BN4B 4RPHA 3CVJA 4Q00A 4QNNA 1K6JA 2A9FA 3JAKB 3W90A 4RTOA 1NURA 2PMDA 1XJQA 1K6MA 4N3AA 1XN1A 2E55A 2QR5A 4OQQA 4NVRA 5PNTA 3RVRA 3GFTA 4E5UA 4WLNA 3U7RA 1Z6YA 4I1YA 1UADA 3AVVA 4UUPA 4HPJB 2WD8A 1OASA 3DUFB 3OIGA 3QVWA 4LC0A 2VJMA 1E96A 2CVOA 3LPDA 4N47A 3WKBA 4BQRA 1N6PA 4K8RB 4X62B 4YFVA 1JDPA 2C4WA 4V03A 4DZRA 3EFOA 1QHIA 1GGMA 1T4CA 1TJYA 3FFAA 4KWHA 1K8RA 3C3XA 5AO9A 4PZ0A 2XOKD 3LP6A 4G1EB 5KWVA 1IQUA 1PR2A 1E3WA 2QV7A 3SVZA 2Q41A 3C4QA 4U7WA 3LVRE 3RVDA 3N86A 4LMAA 3MHPA 3ZJYA 3WICA 1KI7A 5C3UA 3BD7A 5P21A 4ZGWA 2J9RA 2EF1A 4RS3A 5L3SA 1XCLA 1ZGJA 1YC5A 4QJBA 1A8SA 2QL5A 3N70A 2ZUEA 1IUKA 3SQXA 2WHPA 3AM5A 4CMHA 3P19A 3LHDA 4IIJF 1FJGB 3TH5A 4D9MA 1ZRSA 1XDGA 5H81A 4JUIA 2LP4Y 4PLFA 4XEUA 2BE9A 1WMAA 2K4MA 4DAOA 2CEKA 2UU9B 1AN9A 4N0QA 4D6YA 1F4PA 4MR8B 3UV6A 5IYZB 4D56A 1H85A 1XIVA 3TKAA 1LRKA 4ER6A 1KPHA 4QDTA 4GKKB 2ZRQA 4ARBA 3CV3A 4FTWA 4PWYA 4DRYA 2K87A 3WS7A 3BD8A 1XLTA 2C4HA 3E3MA 5HNKA 5HA5A 3DDSA 1QIHA 3QI2A 1QK5A 1M2OA 2ZUBA 4PVCA 5D51S 3GN1A 2HLDD 2D3WA 2WB2A 3CLUC 2BPOA 3UENA 1B15A 4WNAA 4NNOA 3O0TA 4D46A 3QZUA 2G40A 2YZNA 2QM0A 3U4QA 4HGRA 2XQVA 4MWGA 5T67A 5IHPA 1RM5A 2L0XA 2QPTA 1WKVA 3FLMA 1ZJYA 2PT9A 3NTQA 2Z2KA 3M9LA 3HRKA 1Y6JA 1Q84A 2W5UA 2EFEB 1O8CA 4ZN6A 3EQZA 2GWRA 2ZJZA 5K05A 1MFPA 4QT0A 3L8MA 3WIDA 5EUQB 5BSFA 2JAOA 1UBMS 1R4NA 4O5AA 1WW8A 5IWCA 5JWHA 3JY6A 4WECA 3ZXSA 3LQYA 2P4EA 4JROA 1RI3A 1QKIA 2QKYA 1HLPA 1VPLA 4M76B 3KQTA 2P68A 4LRXA 4ENPA 4N3GA 5KC8A 3VJMA 2VYVD 2RGNC 4LFBB 1JAXA 1DLJA 3R7WB 2LIVA 4GBED 1Q1BA 2I3GA 4XDGA 2ZRJA 1NQVA 4PO1A 3C1TA 2HX1A 2ZATA 4MQ6A 4WOCA 5LQRA 5JVDF 1GZUA 4HKTA 1UBFA 4HQLA 1XELA 3OQPA 3PEYA 1PR5A 4H7EA 4O2AF 1T0UA 1P6XA 4HLUA 1Y7PA 3A32A 5T41A 2BFAA 4CODB 3CONA 3HWRA 3OZSA 1G6KA 3RV3A 2IPLA 4ZAFA 4CE6A 3VKVA 2CLFB 1NQTA 3RS7A 1Z5VA 4Q4CA 4B6SA 4DT1B 1BFKA 5FL7A 3V7WA 1U2ZA 3LUFA 4RY8A 2HPHA 3PQ5A 4GRDA 2LDBA 2H85A 4H77A 4Y2GA 4Q21A 1OXUA 2KPOA 4KPUA 4OKIA 5ALKA 4A73A 5D1HA 1NXPA 2YXLA 4G0OA 3PEFA 1DXQA 2O2GA 2J5KA 1Q7BA 3KZ1E 4G0XA 4XWAA 3DMNA 4EHFA 1XRQA 1RT9A 3QVOA 4FE4A 1GL9B 2VBCA 5IM5A 4OYHA 1O95D 1X7ZB 2FLKA 2EX4A 3AF2A 1VSUA 1ZH0A 3GJ4A 1KMHB 3L1UA 4IS2A 3GOQA 3BC1A 3L7YA 3RSZA 1N5LA 4YAIA 5T57A 4PC6A 4H4DA 3PDIA 2BKUA 1P6UA 1T3TA 1RWOA 3JX9A 4LZJA 4B4WA 1S0UA 2AT1A 4NYMQ 1IXKA 2PX5A 4KITB 2CT8A 5AM2A 5MN6A 3K96A 3K9CA 1PVVA 3E9RA 4E3WA 2GBLC 1KI8A 3UB3A 2OZLA 3VR4H 1ADFA 1JALA 3W78A 1ZL0A 1E2BA 1CEEA 5TQ0A 2OGZA 4M0FA 4FFBB 5LIPA 2HRDA 4KBFA 4LYAA 2OG2A 2ZIUB 1A76A 2G9ZA 2ZGVA 3GJXC 1DDOA 1TUEA 5CDHA 5CLHA 4Q3NA 2PYIA 4EPYA 2OV8A 4WESB 1QCCA 3A1TA 1T2AA 3HBNA 1ZD5A 3NTVA 3UUWA 2X13A 3ZU4A 1J24A 1PK9A 4C7KA 1DG3A 2H4WA 2HMSA 2A0WA 3ETEA 1VLZA 3JCZA 3L49A 4DR5B 1JKJA 2P2LA 4DR7B 1OLOA 2J6IA 1DKNA 4KDFA 4G26A 2QVLA 3V9AA 1RCFA 2O4UX 4C6HA 2UYHA 3K7EA 2R47A 3STTA 1S2DA 1FPQA 3RG2A 1DAPA 2QR2A 3FUWA 4JAVC 1GAEO 4E2WA 2NP6A 2J9ZB 4L1KA 2VUSA 4ZCRA 2HN9A 4L27A 3IEXA 3AWDA 5KYTA 1XLVA 4BO0A 1TJPB 5CEEA 1TTPB 1E3LA 2QTVB 3HACA 4QQFA 5AOAA 5DN6A 4O2BB 3R74A 2ZRFA 2E4YA 3CE6A 5DX1A 4LQCA 4RACA 5C5IA 2J07A 1VE3A 2AR7A 1DO0A 2ORVA 3HSKA 4U8GA 3SM9A 2AR0A 3RYHB 1YQTA 1FSZA 4DTCA 3GEHA 1HO3A 1U8TA 1NPTO 3GV0A 3TM5A 2ZIGA 2ZQ5A 4PAWA 3N2GB 2X41A 4L5JA 1EDOA 1ZAKA 4R3NA 1JT2A 1ORWA 4MEJA 1M66A 1CNMA 1VOTA 1JR3D 1T26A 4LHXA 4O4HB 4P2GA 4YJKA 5HFAA 3RYIA 4O8ZA 1XKTA 2O07A 2XYRA 4X00A 2OBYA 2Q5FA 2WM3A 2GZMA 4ILEA 4RCYA 3ACCA 3VNRA 4UTRA 1MA0A 4KYTA 4AZVA 5J63A 1U8ZA 3M7IA 4X97A 5KHOC 3LQQA 2FWRA 1PSZA 2J67A 3FNGA 5SZIA 2IITA 3T35A 5A4FS 1YHNA 3E2PA 2CV0A 2ENUA 1W8IA 2VYND 3GPBA 3MC1A 4JOQA 1GDHA 1UJ6A 5J2UA 3QLUC 1XEWX 2W2KA 1LSOA 1U8UA 4FEAA 1X1BA 3UWMA 4URUR 2A57A 2PLRA 3ISVA 3W6OA 4TSRA 5G53C 5BMVB 3NHJA 2OBNA 1NJ2A 2RGNA 1GNSA 1Z5PA 3AHDA 1JEJA 2DPGA 3BILA 2ISQA 2F1KA 5DIFA 1G21A 1KFEB 1QC5A 3QY0A 4TS9A 2B3DA 3CIOA 1F2DA 4IQGA 4X93A 4ARUA 3VJKA 4G5OA 2O3TA 1WPXA 3DV9A 4KFSA 1H3FA 3DR5A 4F7WA 5D85A 3ITNA 3FSJX 3LBAA 3TW4A 3K72B 4M9RA 2QW1A 1QRSA 4HATA 2XZLA 1A9XB 3ZK7A 3GNTA 1COZA 3IOYA 4HNVA 3WB1A 3B8EA 4QDJA 1U8AA 4R1LA 1CJTC 1Y1KE 2FSPA 5TMDA 4YV2A 2VPIA 3M89A 4MWDA 1N5DA 3ID6C 2P4UA 1XQXA 1BKSB 1MRNA 4CV2A 3OTHA 4E11A 3ZWVA 1HE5A 1C0IA 1E5QA 3KJHA 4FOTA 4CTMA 2WTEA 5HM6A 5IX8A 5CXUA 2PUDA 2C07A 2VDRB 2E37A 4ZIRB 1Q7CA 4MQEB 4LHWA 1UBUS 3W34A 2FGKA 3GEPA 3DLIA 1VHTA 1T9DA 2IV7A 6ADHA 3U81A 4JYZA 4HLQB 4IYJA 1UEXC 4QX6A 5GAJA 4B47A 1Z47A 4B3SB 2RHCA 2H1SA 3U6KA 3SCZA 4RY2A 2IXFA 2B8EA 3U3RA 3ADPA 5F3RA 3RYCA 1NLUA 2E1PA 4QNMA 5CH8A 1OBCA 1FX1A 5E95A 3EXHA 3RUPA 4KPYA 4OX9B 4PAMA 5TMEA 4H7JA 1R4AA 5EJ8A 1P4HA 2C88A 4BFYA 1Z3CA 3UK0A 5HQTA 3TE7A 3VC3A 2GBLA 1SELA 3F6BX 1KY5A 4IVRA 1XGKA 2Q1WA 4JLMA 4KQGA 1P81A 1P9LA 3N3BC 4G9GA 2GPSA 4BO1A 5K5EA 1PJCA 2JI9A 3SXJA 4MP3A 1VPEA 4E4RA 3D54D 1II0A 3SMQA 4WSOA 5B30A 4KR3A 2P41A 4IXMA 3IIJA 5JDIC 1TVMA 4X85A 1R0WA 4E5PA 4QDXA 5KU7A 4BVKA 2R8EA 3A05A 2ZULA 1DPGA 5ELMA 3T3OA 1VCMA 3AEQA 4QVGA 1J0CA 821PA 3LQFA 1QDEA 5IFKA 3WV4A 1G2IA 3KHKA 3KQOA 16PKA 2ZAOA 4KQ6A 1IJFA 1Q1ZA 1KVQA 2QXUA 2YHUA 5ITSA 4TV9A 4QU5A 4DWVA 5HBGA 2XUFA 1P2VA 5KOYA 4D2IA 2BBSA 2P77A 2VFAA 2Y1OA 2W7TA 4EYKA 2OHOA 4BKQA 3EIWA 4N7JA 3LT4A 1VBMA 4EJSA 1CUFA 2OAQ1 1VZ3A 4WZ6A 4X94A 1G5HA 1GPMA 4C5BA 4URWR 3ZD8A 5JMOA 1EWTA 1KC3A 4EEKA 1OV4A 1ZY2A 1X7XA 4JC0A 2CLDX 2IWRA 3BWXA 4FLMA 2W00A 4M6WB 2X9GA 2XUDA 3BB4A 3QMMA 4XUCA 4V0RA 5EXTA 2XVAA 1DWPA 4DLSA 3IBFA 3MGKA 1Y82A 9LDTA 1BWRA 1IK6A 3SEAA 4BNMA 2PMFA 4EHJA 2IY8A 3B2NA 4D99A 1HQCA 1J22A 3JWJA 3GRCA 2PKCA 3MTQA 3A37A 5J43A 2GTPA 4IOJA 5JMWA 2VDPB 5J2UF 4COKA 4EB6B 4RELA 1EWYA 3HB1A 1CJMA 3OOSA 2WLTA 4HHEA 2ZBRA 2QS9A 2GRAA 2CF5A 3ET5A 3DAYA 3ETCA 3G0IA 1FYVA 1X8XA 4YQYA 2ZPUA 3G8DA 3HR8A 3RQSA 2XYVA 3VPGA 4NTZA 4C76A 2WP0A 2PRKA 2P1DA 1C1HA 2R6CA 2YC4C 3D0OA 3F3YA 5BW5A 4BLWA 3G2IA 3T9CA 1NF8A 2UUBB 1BHJA 1I6KA 3CRVA 4EG6A 1KYVA 1WZIA 4R5MA 3RS5A 1EBUA 3DTVD 3IDFA 4IJMA 5A4IS 2X77A 1FMFA 2V03A 3E2IA 1T5DX 1Z33A 4LJ5A 4FFMA 1XUOA 4I8IA 3VPXA 2B2NA 3QFHA 4MRRA 4U02A 2OV4A 2VAPA 4YRRA 2B8JA 4GBMA 1KJ9A 1SQ5A 4R8MA 3N05A 5K8JB 2H4HA 4AMBA 4ISCA 4P8RA 3RM3A 1NI5A 1EU1A 2GDZA 2FPRA 1GAWA 2C2KA 2MOKA 4JLBA 1GL7A 2RHDA 3PCRB 3B6MA 3L1VA 3TL2A 2DLNA 2JVIA 1A9QA 1TIBA 4ZDWA 3OJOA 4HO1X 4CL3A 2G63A 4UFOA 4BATA 3OFVA 5AK3A 5AKHA 2WJIA 1VL5A 2VYFA 3COJA 1V3UA 2PBLA 2BMVA 3QBJA 4UJ5A 2R8ZA 1OLSA 1IPEA 2VUHB 1OZHA 4D0GA 1BXZA 4FR5A 3O3MB 4C87A 2I4LA 5B3JC 5LNK1 3E1SA 1R0ZA 2IU0A 4DLPA 2AOTB 4PEVA 4QGFA 4IIXA 3S6JA 1OI3A 3ZZ1A 3GLIE 1NVBA 3PQEA 4AB1A 5JD6A 1LXCA 3K4PA 2WWXA 3CLVA 3YASA 3ZZMA 1MENA 1LLFA 2GM9A 2C98A 2VUUA 3BAZA 2YHIB 4KE8A 1P0QA 4B3GA 2P4HX 1J70A 3NEJA 4QYTA 1UBRS 1W94A 3D6MA 1U3UA 2BV3A 3OEED 4JL5A 3DKRA 5ERXA 2QZSA 2XEDA 3V3TA 2B4YA 1S9DA 4XQCA 1MIHA 2YWDA 1R0LA 3L79A 2VTVA 4BVJA 4MB6A 4BFVA 5ALXA 3OA0A 2SCUB 6AT1A 2R7NA 4HRAA 4MA4A 4V39A 4L9RA 4YACA 1EWVA 3HPRA 4N7BA 1BIFA 1U6KA 2YIJA 4PCVA 2FP4A 3VKUA 1USGA 3NHWA 3OIDA 1G7CA 1LPAB 5DT2A 5EP3A 2QPAA 5ERYA 3RU7A 3WMGA 4PG7A 3R09A 3GZNB 2ZJAA 2G04A 1ICIA 1QGED 3EMKA 4EG3A 2P3OA 4ZRDA 3GGCA 1FZTA 3B1ZA 2I4TA 3IOMA 1O5TA 2F8SA 2JFYA 2ZTVA 1D09A 3QEMB 4HS9A 1FU7A 4JQZA 4TV9F 1C41A 2C2YA 1HZZC 3GLSA 2BGMA 3QU4A 3IJRA 5GJBA 4TKUB 1VE9A 4E94A 1ZHHA 4RCVA 3LYAA 4CMJA 5C5EA 4HQRA 1Q16A 3MTDA 3OUUA 1S7GA 1UKBA 1N6OA 4RMHA 2DR0A 3NCTA 3T06B 3WE7A 3WDMA 4D97A 4P3XA 2R7KA 3C3AA 4K6MA 1IHOA 2I7VA 1JLKA 4Q1VA 3F3MA 5JSHA 1HK7A 1TF5A 2C20A 2D1QA 4FU0A 1ZCJA 1G8FA 2C3OA 2M6RA 3KZKA 4YI3A 2JGDA 2QZ4A 3O4IA 2XWPA 4FD2A 5DNWA 1SXJB 2Z58A 3EH1A 2FPWA 2IYXA 1JFFA 4DJEC 4W9RA 1OT5A 4YMUA 3PQ3A 3FZYA 4B5LA 3X43A 3EX7C 3I64A 1JJBA 2ZR9A 3HWSA 1T5OA 1PK8A 1VYHA 3MWGA 4A2CA 4O5OA 4XFKA 4GLJA 1NM5A 1PJQA 1ZVMA 2XCIA 3AHGA 3KOOA 1EUZA 4MX8A 1VYVA 1SOMA 4PTYA 2WKSA 4D7AA 1KZYC 1K9VF 2GEVA 2GD1O 2OMEA 4PLYA 1B0PA 1XZIA 3LGXA 3O4GA 1DQPA 1R9NA 5EL0A 2CN1A 1CFZA 4G2NA 4RKFA 3NHUA 4YQZA 4ZAWA 4DC9A 4BNKA 3EEYA 4KMSA 4BGIA 1T9AA 4C4ZA 3NH6A 1CY4A 1W75A 3IT1A 3U9SA 4I81A 1Y1SA 2HF8A 5J1TB 2I22A 4WXMA 2DLCX 2CLHB 5D3KA 3RS2A 1F7UA 2RH9B 3T9AA 2LE0A 3IMCA 2W9XA 5CNJA 4L76A 1H2XA 1O87A 4TL6A 5J4HA 3TQQA 3N53A 2VKQA 4JFAA 5CLLA 2G4LA 3TDMA 4QRHA 5A62A 1YJ5A 1H9CA 5FO0A 3PNVA 2Y2UA 4RJ2A 3HLYA 4L9WA 1U28A 3OSZA 3LQ4A 3OHMA 4TL7A 2X14A 3N0RA 4PBTA 3A9TA 4FVTA 3ROQA 2LV8A 2OLEA 3BMNB 3VU0A 2X0KA 3ASVA 1GKIA 3FIJA 3K73O 3KSMA 5EYPA 1NC1A 2CMDA 5L51A 4NBUA 3P5SA 1TRKA 5JR3A 5CDSA 2NWQA 1KR2A 1YQEA 2R00C 1KNQA 5JYBA 1S1CA 1KMCA 4EDFA 3UOWA 5KBYA 1N77A 1RIFA 3JAMA 1FLAA 1ULHA 4AI6A 4JI4B 1K8ZB 3H4MA 1ZJZA 3O4JA 2P9TA 2QRJA 3EVZA 1I3CA 3E5MA 4KK3A 4JLWA 1Y9AA 3A6DA 4R1OA 4ZPXA 4YAKA 2AN3A 2FPSA 2G08A 4L57A 3UA3A 4TXNA 2D00A 3F46A 1YCHA 3I09A 1AO3A 1W1IA 3PNBA 1HDRA 4LZZA 4WNCA 2QSZA 4MCAA 1MT3A 5B3JA 2NUPA 4B4DA 5SICE 1OD6A 1XMQB 3GT0A 4LFAB 5AYVA 1WG8A 1C3JA 3U0VA 4GX1A 3WYNA 1XJ0A 3MVEA 2WF8A 4MJ7A 4TRNA 4OY3A 1M9NA 3ZD7A 3R40A 1LK5A 2VC2B 2OE2A 4WOKA 5J5AA 3VPDA 2EJCA 4EGJA 3LGAA 3N2LA 1NT2A 4QPCA 4LOKA 2JLRA 4HDRA 3IKLA 3BGWA 3K4HA 3ZQUA 1ONBA 2KJQA 4HBGA 1B41A 2Y3IA 1DOAA 2K7ZA 5EXDA 3OLYA 1OTXA 1JXQA 1ZD3A 4YJ2A 3GLIA 3DLBA 4HNSA 5BY2A 2J41A 4LRSB 3WGYA 1DC4A 4EQ6A 5A1JA 2DBZA 1JQBA 3EEBA 3KAJA 3NHLA 1IRIA 4WI1A 5CU7A 5KYUB 1YDGA 1Z7EA 3CJRA 1ZFNA 4UMVA 2F3TA 2PH7A 3K2EA 4PPQA 1Z73A 1UDRA 5DHFA 3ZS8A 4K9KA 4MUXA 4ROTA 2WWGA 3VGPA 2EW2A 3FOCA 4B3RB 3QVGA 4CCWA 2JI6A 3A9RA 2RHHA 3IILA 4LRUA 4CCAA 1PLLA 3FB4A 3HFGA 4LWPA 3CW2A 4Z9BA 1HH4A 1QGZA 5EIBD 3QTLA 4M1EA 1XMIA 2OFXA 1DC7A 4BMPB 3TOSA 1X94A 4J3FA 2I2DA 4PYLA 1YZHA 4Y98A 1HZZA 4OHPA 1XNQB 2H0QA 2NLOA 2VKTA 5CBPA 2Q1YA 1AMUA 1V25A 4EL0A 3B12A 4O02B 2CHVA 4M1QA 3S2SA 3CVUA 2BFBA 3VNVA 1AHNA 5E6SB 5CD9A 5JYEA 5LDHA 1G6Q1 4IDGA 4E5YA 4HNAA 1B16A 4XYLA 1Y6FA 3S7TA 5CLJA 4QAJA 3R5TA 1VJCA 2BOVA 4Q37A 2SHKA 3CPSA 1V9LA 2QNBA 3I1YA 1YZFA 1QMGA 4JELA 3ZBUA 1HE3A 2EZ4A 3ZLVA 2QZZA 3G9QA 1SCIA 3IDAA 3LVFO 5DYGA 1H6AA 1Z9BA 3NHRA 5AJWA 4MS3A 3WLFA 4IX9A 4RTLA 5I48A 1BXGA 4MWEA 1E5LA 2HCJB 4CG2A 5I4BA 2I2BA 1SD5A 2IA5A 4HYYA 3RGWS 4BO3A 1T2NA 2P3QA 2HRCA 4AO6A 2WE7A 2P69A 1XNJA 3AU8A 3M6WA 4CMEC 1ZESA 2YZ7A 3IPRA 2DBYA 3G79A 3IUYA 3KKPA 2ZETA 1G5QA 3PL1A 3QKRB 3MOGA 4DADA 1OGIA 3DZ8A 3ZCQA 4WVFA 4DQUA 5K2OA 1HX7A 3GP5A 1LTHR 1PGPA 2A84A 3ZNOA 1JG7A 4R68A 2CYAA 4WNYA 2FNAA 3VTZA 3WNQA 2IPMA 1QRTA 1N1EA 1IXZA 2IS4A 1ES9A 1LLQA 3QE9Y 3DM9B 1E6WA 1JEEA 1WV0A 3L7KA 4I3GA 4GQBA 4IO0A 4F9GA 1V4NA 1I5EA 3G2NA 5LZ9A 3I9OA 1X86B 4J16A 4WZBA 5BQOA 3P9QA 4F6CA 5F5NA 8ABPA 3M1IA 3KB8A 2RI6A 3M4JA 3PJFA 5DHSA 5K6AC 3W5CA 3KB2A 1VPWA 1HKUA 4ZMSA 5AKJA 1N6IA 5KJ1A 4AKEA 1BMFA 1C8KA 1IB0A 2PWPA 1E2DA 2REQA 2GCEA 2VDLB 3HJTA 3K6SA 5EWMA 1BSVA 4CKZA 1DB3A 5LM3A 4R7GA 1FFAA 5TS2A 5LKRA 2ZAIA 3THWA 4GLFA 1P72A 1TPYA 3AFHA 1JAYA 4B3TB 2YVLA 1T5TA 4UBLA 5H3LA 4MV0A 3L0BA 1H1LA 4X65B 3U56A 1O6CA 2C4TA 4I4TA 2W93A 4LSGA 1CY7A 5AW1A 1NBMD 1K7CA 1A1SA 4R2JA 4S0XA 3F1KA 1B6TA 1M2VA 2DUWA 4I19A 3RKRA 4TRJA 4NKRA 1CZUA 1GZ4A 2QZ9A 4WWHA 1E0SA 2V6BA 1R8JA 2FSUA 4Q3OA 4L8FA 2IEZA 1LPNA 3FFTA 3MJEA 5AI8A 4L4SA 2QNRA 4OBBA 1BS2A 3D6TB 1SCKA 1Y34E 1RADA 1VSBA 3ENNA 3G0CA 1EBBA 3AI3A 2OWDA 4RZXA 3HJHA 4LOHA 3L46A 1JLLA 1T9GR 2CYBA 3F6PA 4YJ2F 5EMNA 2XZTA 3EGXA 3RSFA 4DLKA 3PT9A 3A1DA 1FX0A 1TCUA 3VR5D 1GXSB 3UWOA 1Z5GA 4CEHA 5K0NA 2GKOA 3ZDXB 1J33A 1MDBA 2B6NA 1C5KA 2FOXA 3Q1KA 4D74A 3DE0X 5K6RA 2K6GA 1AB6A 2JLVA 3BL8A 4MULA 4AWXA 3WGGA 1GT6A 4CU2A 1AKMA 1LS1A 3QSYA 3WG9A 3NPAA 2H2AA 3T9DA 3HJBA 3P0HA 3WLLA 5A6VA 5C4IA 5A0VA 5F1OA 4CW7A 3NHPA 1F14A 1PJLA 1XMXA 3OECA 4YJHB 1P77A 3L0YA 3HU1A 5KUTA 3HWX1 2WSYB 2Q28A 4HB3A 3VHLB 1P2SA 4P6VF 1AS0A 1D04A 2YDXA 4BNIA 1HSOA 2AOWA 2I4OA 2ZSFA 1KPGA 2PNJA 4X20A 1IMJA 1CZRA 1L5YA 1VECA 2DR2A 5IXJA 5ARCA 5CA1F 1DTSA 4ZHQB 5LP6A 4HB2A 2FW0A 5TVKA 3WKDA 5CW2A 3TGLA 1GA4A 1JLSA 1RQXA 3BXFA 1X7YB 1T8PA 2G4CA 4L5BA 3BHJA 4M7PA 3T7AA 3TLGB 2XAUA 3DL0A 2NV6A 4OXIA 4QPPA 2A67A 2O2HA 5E6RB 1PZGA 5CM8B 3SKXA 5T7BA 4UU1A 4M86A 2F1JA 2MSWA 2WHRA 5E1MA 4P36A 3AVXA 5BWLA 3MA0A 2MU1A 5I4KA 3GRYA 4AX8A 3IAUA 1T34A 4NU0A 4M0MA 5CPFA 3TW0A 2R48A 3R5KA 3RLFA 4BP1A 5JYDA 5KB3A 1EJBA 2LCIA 1SOUA 4DIDA 4M88A 1BAPA 1ZOPA 1FQKA 2IYFA 3F6CA 3PZRA 3ZIAD 2ZIFA 1FTSA 3I05A 1T3SA 3GYBA 4JB0A 4LXGA 5AJXA 2DQSA 3MJ4A 3GVXA 5EJ5A 1JI3A 3MIZA 3W3AH 4JP1A 5JYCA 5AI9A 5J23A 4M9CA 1YASA 1HEUA 1NN0A 4M9XA 4AZ3B 4HCJA 3EMBA 3GLTA 1U2GC 3FOZA 1KI6B 1QHFA 1KAGA 3H2IA 3HN2A 2B69A 4TT8A 4CMEA 4Y2TA 4LMPA 3N39C 2CXUA 1ZLXA 1A8PA 2JB9A 2QX7A 2VPYA 3AETB 4PR0A 1H65A 1CHDA 1GFSA 3LIIA 3U40A 1MQSA 2W2OA 2XGMA 4CM8A 5F23A 2DQZA 2ORIA 5MDHA 3H5VA 1IIRA 2H7CA 1E3IA 2WJWA 3H8JA 2PYZA 2JHPA 3WJ2A 4OH7A 1DMRA 3KRTA 3RS4A 2BTQB 4EB3A 1DKRA 1L4LA 1V7CA 2J09A 2YJ3A 3BGSA 4FE3A 4G1VA 1ILEA 2PCJA 2C9DA 3M5PA 5HK8A 3WTCA 4F5YA 1KEEA 1SQ6A 2IHVA 3KC2A 1UAAA 3T1NA 1PFWA 1DL5A 1I7LA 2IPNA 3EMDA 3GJ8A 3NKVA 4DR2B 3PLAE 3FZNA 1I2AA 1TB4A 1JZQA 5FHQA 2Z5VA 5K6AA 2F8MA 4GF5A 1G5PA 5D87A 4YP5A 4Z99A 5EWLB 5LUBA 1K6IA 4I4TF 1NYTA 4R8KA 4V0NA 5DF1A 1J09A 3Q4GA 2B4QA 3HB5X 3VNUA 3L6BA 4YWJA 1ICEA 3HYNA 2EYUA 1JHMA 3BN3A 1SO8A 2ZSAA 3M6UA 3I0MA 4HNGA 5I4CA 3IVCA 3ZQ4A 1ISPA 3MMXA 3Q0IA 2HSGA 1EFHA 3OKAA 2X3YA 3CZ9A 4M49A 1EWRA 1KOFA 2Z8YA 5TPZD 1AXEA 3V3KA 4L4ZA 3OPYB 4DQKA 1IE3A 1YTLA 2EZ9A 5BWNA 1KTIA 2CGEA 3EGEA 5IDVA 3JAWA 2CLCX 4C2TA 1U3GA 3UICA 4DV7B 1YE3A 3L0CA 3X1WA 4WCFB 3KQLA 4D92A 2A9KA 5JAHA 4IIJB 1L3CA 4PN3A 2Q3JA 4IVQA 1QP8A 4ACBA 1LBQA 4MR9A 1YB7A 4JODA 1A7JA 1PVOA 3G6WA 2O0KA 4OM8A 1M5RA 5DZSA 1Q7TA 1QHEA 4NCAA 2V9CA 1SBCA 3R1IA 3MAJA 4J0GA 4AICA 2BY4A 3TDNA 3ZDRA 1YNSA 3AB7A 4O2RA 4MUBA 1KIMA 3OX1A 3GD5A 3X1MA 1ACLA 3ZE0B 5ESWA 2DJIA 1QG0A 2I3BA 3GZJA 2VPWA 3LF2A 4HFJA 5C7YA 5CFMA 5KIAA 4W5OA 1KBOA 4OMUA 4UHBA 2GQ0A 1F8YA 4MLPA 5FPHA 5HCNA 4YV0A 1F06A 2F9LA 4WY5A 2R6FA 2QMQA 4LZPA 3TUZC 5I5EA 3HVRA 1X80A 3E22A 2H5EA 3W6ZA 2GZ3A 3VVCA 4JHLA 4D45A 2GEDA 2PIDA 3EPRA 5DHRA 3L4BC 5FA6A 2Q29A 2JGMA 3RF6A 1RLJA 1MC5A 3AXTA 3OZCA 4MARA 5FDFA 2YRWA 5KWSA 2PRIA 2ZBVA 3F9RA 3I58A 2PUEA 1P45A 2JAQA 3VR6D 1DIBA 2ZYGA 3AR3A 1H2AS 1PZXA 3N2KB 1Y4SA 4G81A 1PFVA 3OLCX 1FFYA 1J1UA 1JDZA 3R0QA 1N2CA 5TVGA 4UMFA 3G2JA 1O97D 3K05A 3OFND 3O3CA 3W8NA 3QVSA 1AK9A 1B3RA 1CX9B 1U2SA 4H17A 2BEJA 4WJKB 3CUYA 4OLAA 2RCYA 4QQ8A 1U4NA 2Z2IA 4PYNA 4Y1FA 2B4KA 1W36C 3NIFB 5JVDB 3DJFA 1P1IA 1CY2A 1JPJA 1JL3A 3O92A 1E1QD 1FYXA 1E4EB 4O2AB 3JZIA 3BCHA 3HCEA 1CQXA 3NJRA 2GT1A 4U7DA 2C1ZA 3N75A 4HZUA 3IAS1 5BRAA 4NONA 1ZR2A 2WJJA 1ADGA 2ZYWX 3TGPA 3AJDA 1Y6GA 1Z8HA 1GO2A 1U2GA 3NASA 3PFFA 2BHTA 5E38A 5FKJA 3JQEA 2W2PA 3QELA 3TZLA 3UG6A 2YIDA 2HLPA 2Y1KA 2D54A 4ZKEA 5FEUA 2DKFA 4PGHA 4MTLA 2PGLA 1WW2A 2QIOA 3PYLA 1JAHA 1VL0A 1KMQA 3HZHA 4OAOA 4X41A 4O29A 5E7MA 4AX4A 4B5KA 5A5FA 4K2HA 5DHTA 1BROA 4GP7A 3QYAA 4Y0VA 5AHXA 3ZJTA 1UIMA 2VDUE 1JSXA 3FOWA 4FFRA 1DADA 1TW2A 4R9VA 3U13A 2WG1A 4URHA 4RD0A 3BF7A 3ENQA 3BJIC 3IVRA 4KSCA 3RIEA 1RSZA 4L5CA 4ETWA 4I50A 2AYZA 4KRYA 1W29A 2FEMA 1W7AA 1ISIA 3IHWA 4LXXA 2WG0A 4Z1OA 2JHGA 1I4OA 5IMSA 1XTRA 1R16A 2CHFA 2WUWE 4Y0NA 1C30A 3EFOB 1T4CB 2ZI9A 4KB5A 3KPWA 3T4EA 3BDAA 4BMCA 1GGJA 3W6NA 1KHTA 4C6SA 4ZI7F 3ILVA 2HJGA 1E3WB 1OXBB 3LCMA 1Q7RA 5ITWA 3EVFA 5DX0A 4EW2A 4MW0A 4LFCB 4POOA 1CS0B 2HEIA 1ZUWA 2VBFA 3MBIA 1JLRA 4CTNA 3UO8B 1YO6A 1QYDA 2XMSA 3ITDA 3B3FA 4FYKA 4U9UA 1GVNB 4QXRA 5FD8A 4FP9A 3Q5DA 2UYQA 4EKEA 2JFZA 4L4UA 4XQ0A 4FWBA 4QTTB 3L3BA 3G1UA 2WHPB 1YE8A 2I4MA 3O4RA 4HN2A 3LUDA 1W4ZA 3DVAA 2JEZA 2LUOA 1E7YA 1NSTA 3OETA 4MVWA 1C50A 4ZXPA 4ANFA 3QFFA 3E9DA 2D0OB 3FWKA 3IEPA 1ZUIA 3HL4A 5FTMA 3BH6A 3C7CB 3RSQA 3NHZA 1NW7A 4MI9A 1H2EA 4Z4CA 4H1UA 4MYRA 4GKBA 5BUSA 3WSVA 1FNCA 1U81A 1R6BX 4NOKA 3I62A 4XOUA 2VWPA 3FDZA 1OMOA 4OUKX 2VXOA 1Q50A 3HDGA 4GSLA 5D3MA 1U8FO 4AWAA 5LMCA 2ZWVA 4V0QA 2YJZA 3U3XA 4DGSA 1POWA 2VSFA 3HUTA 5LQKA 1M2OB 2I8LA 1PFQA 1YCDA 3AZPA 4ETNA 4I2VA 4G09A 4WNAB 3H1TA 1KSGA 1GITA 4FNOA 3PXAA 3CTPA 3VBEA 1M5UA 1OWLA 5FNVA 5F77A 4JENA 2C2OA 2HNBA 3CVOA 4G1CA 1M6VB 4EI9A 1DIRA 4ZMBA 4NOLA 2VNSA 2GILA 1TFRA 2NUAA 3C39A 4JUAA 2X9QA 1U7ZA 3H7IA 1R6VA 4K1XA 1N2BA 4UVEA 5E3JA 4B17A 3D59A 3P9SA 1KEUA 3HXOA 1DRUA 5HFNA 4EUKA 1R4NB 3F73A 4GDFA 1JU9A 2OPBA 5TY0A 3AGQA 4J03A 5A3QA 3ZJUA 4Y2HA 3L4BA 4MLCA 3B5JA 1D03A 3PC3A 2NZJA 5BVGA 3QI7A 1KPIA 1KJ8A 3FN4A 5BVHA 4NU6A 3H2BA 1VJ5A 2H4XA 4F4IA 4JXJA 4G9EA 1DWQA 4LSMA 4RADA 4AZWA 1M8GA 2HMAA 2FX2A 5CB0A 1E7QA 5JCJD 3JD2A 3U2QA 3K30A 1RRKA 3JRWA 5D5QA 3V33A 3ZVMA 3ZV7A 1X7DA 3G0HA 1KE1A 1DAOA 3CRMA 4YT4A 2JLAA 1ULUA 4YBRA 5I9TA 2M32A 4DSAA 4UHKA 3ZCPA 3ZDAA 3U44A 5DH9A 1VKNA 3IMKA 4ZREA 1VFPA 3IH5A 2WHEA 4HAOA 1NIPA 3R7SA 3ZV5A 1HDCA 5K0SA 3ZVRA 4YPVA 3ORHA 5BSGA 3QE3A 4EW6A 4V0KA 4ZQGA 4IV5A 1GSIA 2CJXA 3LUHA 1V3TA 1W0KD 1ZBDA 4TVBA 1Z35A 2GUWA 4P83A 2BI8A 3TKYA 1OF1A 3I9V1 3NNNA 3WO0A 5COBA 4CKBB 4WDQA 4DMMA 1M0SA 2B1RA 4EUSA 1P1KA 2A86A 4AY5A 1Y48E 3O9MA 5AVQA 1ADYA 5EZQA 1W5EA 2Q49A 2ZB3A 4FCWA 1VA4A 3E7FA 2CFSA 5KJEA 1CS4C 1USWA 2B4AA 1IXSB 1GRCA 2RARA 4I50F 2JH8A 4MVJP 1A5AB 4TM7A 4ZZ0A 2Z8XA 4EO7A 2AFHE 2RD2A 2BMJA 1GPNA 4MPPA 2J7PD 2BI7A 1ZEMA 3L6UA 3G8AA 1UR5A 4H08A 3ITKA 3WRVA 4EG7A 1Q0SA 1D4AA 3QYJA 3KUCA 4DM3A 3M70A 4ENTA 5F2EA 3QUSA 2C7VA 2HDHA 1FL9A 3IERA 2OZLB 1DQYA 3IE0A 4F3NA 2RK6A 4P33A 5H0IA 5TQ0B 2QTFA 2ORWA 2Y1GA 5I9LA 4W63A 1DT5A 2R4TA 3R3YA 1CFJA 4OSPA 1GYPA 1GTVA 1NT4A 4FHZA 4MRMA 4P81A 4DPKA 1M1NA 1XV5A 4MAMA 3WP1B 3LC0A 3DEZA 4QUKA 1UPTA 1NI3A 2ANBA 2XNKA 4KXWA 3QNWA 3CVVA 2FQXA 4MRVA 4ZP1A 2QHXA 3TVDA 4XPIA 2LNDA 5LP6C 4C0AC 3MS2A 4NV0A 3ZJ4A 1N9GA 1ZD9A 2P9EA 1JKJB 3K5WA 1M76A 4DEVA 1RCUA 1G4HA 3DFFA 3E1GA 3W4IA 5EJ4A 3PKJA 3SKYA 1UJ5A 1TW3A 2R97A 1KJIA 2PQMA 3KG2A 4ZODA 4GOJA 2E48A 2FMTA 2Z6AA 1VCOA 2WP8J 4A2PA 3SG0A 2ZE5A 3QA3E 3W7AA 5JBNA 3HM9A 3OCWA 3LF1A 3OOJA 1VHQA 2XPCA 3Q11A 2EKBA 2OD7A 1L7NA 4R1MA 5CB4A 1LSSA 5CHEA 1L5VA 2C92A 3U31A 5KQMA 1Q19A 3FKJA 2VYCA 5FNVF 1G9XA 2PKEA 4HN9A 5JOQA 5AKEA 2FUEA 3F90A 2Q46A 1BDMA 2QR3A 1B8OA 1XA3A 3M2TA 4K6GA 1FTWA 3MCVA 2VVTA 3SOPA 4XR9A 3H0EA 3RYIB 2J0EA 2BGJA 3LZ6A 2NO7A 4ZZ3A 4QIHA 3EGDA 5ANRB 1G66A 4UC0A 1N2ZA 1QPZA 4DJAA 4TYWA 3S1AA 2PH3A 3OMLA 4PS0A 1XA0A 2W43A 2ZT8A 4XM2A 3B60A 5CT5A 1Q0QA 5IWAB 3A6LA 1P17A 3HRHA 3RSGA 1KYZA 5JRDS 5J2UB 2FFAA 3P32A 4C9BA 2VG8A 2CC2A 3AUXA 2PJDA 2A4KA 3EEQA 4NCBA 4Q9DA 4K9QA 3CWZA 4OQEA 1TQ8A 2P3SA 4NE7A 5AW8A 4FC7A 2ZYVX 4MWOA 2AJ8A 2CJFA 2I8AA 3G9ZA 5H4HA 1HFEL 2EAUA 2QN6A 3CZMA 1G21B 4A0GA 1QC5B 1D07A 5AVYA 4I1PA 4CCSA 2Q8NA 1CB0A 1PL8A 3AVYA 3NRBA 4MV1A 2JLBA 5FR1A 1HA3A 2A5JA 4R9NA 1KKLA 2ZE6A 3V4FA 1TT5A 4J3JA 3GELA 4LDAA 4OQLA 1Y3DE 2OVBA 3AUYA 4JOCA 5DNEA 3CGWA 5CX4A 3WBJA 4F6LA 1WZNA 3L18A 3LU1A 1AHPA