2JFWA

Crystal structure of enterococcus faecium glutamate racemase in complex with tartrate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
total genus 96
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA01
5EVCA 3UHOA 2JFWA 1JFLA 3OJCA 1ZUWA 5HJ7A 3S7ZA 2GZMA 5HQTA 5ELMA 2DWUA 2OHOA 2JFQA 2VVTA 2DGDA 2OHGA 1B73A 2JFYA 2DX7A 2JFPA 2EQ5A 5HRAA 3ISVA 3OUTA 2JFVA 2OHVA 2JFNA 2JFOA 2JFZA 2JFXA 3UHPA 3HFRA 4B1FA 3S81A 3ISTA 5HRCA 2ZSKA 3UHFA 2W4IA 1IU9A 5ELLA 1B74A 2JFUA 5IJWA
chains in the Genus database with same CATH superfamily
3HDHA 3HVJA 4AUKA 2EIHA 3K70D 2Q3HA 3EBLA 1M2NA 1VJGA 2JHCA 3D81A 3HL4A 1T4GA 2EC5A 2H7CA 3CUKA 3PQ4A 4BMPB 1GZDA 4EUNA 5LKAA 1VLJA 2GPSA 1DFGA 3DLAA 5T5QA 4LISA 1NURA 2Y9PB 3ASVA 3CSUA 4TS3A 4DUZB 5JISA 1X6VA 4BL5A 1A4UA 5KTRA 2HLDD 4JQOA 1R88A 1AGYA 2H7VA 2PSEA 4NY1A 3UJ3X 4BO1A 2FRXA 2GCGA 2N46A 1CZNA 3MWDB 4CCWA 3WISA 1Z75A 7GPBA 1P1CA 1OWNA 1RP7A 1JALA 5FFFA 1M66A 3PXGA 3E2PA 3R3SA 4NZ9A 3N6RA 4O8CA 4MWCA 1KY3A 1ES9A 2DP4E 3EGDA 4URUR 1U90A 1YBFA 4JXZA 4P7JA 2E85A 3X1DA 4JGBA 2GJ8A 2OB1A 1ZOOA 3AY0A 2OM2A 1EVYA 1WPRA 4Q39A 1JU3A 3ZQ6A 1I14A 3DOHA 3SC3A 1RQXA 3IKVA 4NC9A 1QIHA 4P58A 3U4AA 2YBDA 1U1DA 4ZYLA 2IK8A 5LQCA 3AMVA 1U1GA 4GG1A 2IYZA 4L57A 2WJHA 4Q6WA 2IHKA 4CM9D 5EUBA 1FCJA 3AK4A 2AA3A 4O2BB 3BK1A 1TQ6A 3GLUA 3PWKA 3S2EA 1ZS9A 1T2UA 5E0KB 3D5QA 4BNJA 4IIVA 4TYQA 2AI2A 3UWMA 3A4IA 3JYQA 3HXKA 2LPMA 4F2GA 3FY4A 1JZQA 4HGOA 1P7PA 2J3EA 3NV7A 3PDHA 3PYMA 4LGVA 4Q9NA 4UHCA 5GQSA 2QVYX 2DCMA 5FHQA 1E7SA 3U7JA 2Y1OA 1KEPA 1H42A 1G17A 2OECA 3EDOA 3RG8A 1PUXA 1U1IA 4ENWA 4C07A 4WLUA 1Y6JA 1JECA 2I7TA 3CB2A 5IN5A 4ZOEA 2A1TS 5KYYB 1YFJA 5ELXA 1PL6A 4KR6A 4Z8XA 4QNNA 2A0FA 4N7JA 4E11A 2G70A 4AAYA 2ZG6A 1Z0KA 4TXHA 3J81k 3MGKA 5GY7A 4F7DA 3Q3CA 4MVJI 3GFVA 5KKAA 3TPFA 4EFLA 1EM6A 4NZNA 5C31A 2VAVA 4ZEMA 1F9AA 3BWYA 3OH8A 1X38A 3FLEA 3Q5DA 5ULLA 2QAJA 1K66A 1JUDA 2OAEA 2X8AA 4RKYA 4G1FA 4QA9A 3V9AA 2JNWA 3OBIA 3GLIB 4PC6A 4XRGA 3WIDA 4LXQA 4DJJA 4EP1A 3KZOA 2ZSDA 1YB7A 2Y1EA 4L9SA 1CETA 2B2XA 3GJ6A 4R8KA 4JR1A 3ZX5A 4CF3A 1G9XA 1UBFA 2EHDA 2I4LA 3EEIA 5FL3A 3RBVA 3DTNA 2B2CA 4C6TA 4UHKA 3RYCB 1C3XA 3O5AA 3IQIX 4HGNA 1XG5A 3B1XA 3QG5A 4M7PA 1CUUA 2BCGY 3VRHA 4D3XA 4F11A 3K9BA 4NU8X 2W4IA 2A33A 2Q49A 1OT3A 3HB0A 4G0WA 5JSYA 4KVAA 4RPKA 4JA0A 1GUBA 4OMCA 2V8OA 2OQRA 2O8FA 3TLYA 2AEMA 1Y6QA 2PS1A 4M37A 1RTTA 3TCNA 5PNTA 5LLDA 3EGDB 3NHJA 1O5OA 4P38A 4LYHA 5CVTA 1L1RA 3RH0A 4C4PA 3ICPA 4KIWA 1SCUA 3LYAA 4KO1S 3WGGA 4ZIRB 3FSGD 1QFZA 5LB2A 2P1ZA 4RLFA 1LW7A 3HXTA 4EATA 3M1YA 3O8QB 1OPXA 3JQ8A 2DF8A 2JKYA 4GS5A 4O2LA 5IARA 2QTLA 3AESB 5TGDA 3H4VA 3FIJA 3I5AA 1ZRHA 2M6RA 5JS8A 2B69A 1BXZA 2YDYA 4K9RA 5I5GA 5HNKA 3CX7A 3IKLA 4R1TA 4AO8A 3T9AA 1Q0RA 3D2AA 5C5DA 1T9GS 2JS7A 4BZPA 1FXSA 2HIHA 4FB5A 1QZTA 5K2MA 3VVCA 3U3RA 2EFYA 3TR5A 1UAAA 5ENDA 1G5TA 4E15A 1BTOA 1NOJA 3FAKA 5EKDA 4DLKA 3NHYA 5EE1A 3RSLA 5HBGA 3OPQA 3ZHXA 5FI5A 1B93A 3PUYA 1BA3A 4BFCA 1FP4A 3RKRA 1KPIA 1P17A 5JS2A 2PWPA 3G6WA 5SZHB 4H1TA 4WZAA 4GHWA 5FTNA 4OJYA 2Y9MB 2BTOA 1P61B 3UMCA 1SUEA 2X0JA 2F9MA 3R6WA 4HZUB 4QQFA 5E3HA 5BP7A 5F23A 1ZD8A 3KWLA 4YVFA 1FEZA 5BOVA 1E9RA 4X1YB 4YAKA 1A9OA 5C8YA 1CZUA 4WASA 3C98A 1YHYA 3JQAA 2HDOA 4JI1B 1DCFA 2GMWA 4MVCA 1S4QA 1EDZA 1OVGA 1XZKA 1ZIXA 3QX8A 4D9JA 4C4SA 3LXRA 1JEJA 1M2JA 4E21A 1G41A 2I87A 2P5UA 2WILA 4MHTA 3KX2A 3KM0A 2O0LA 1E8MA 2YMQA 3L0OA 4B82A 2L18A 2LXNA 4V3CA 3ORHA 4I4IA 4KLZA 1D2AA 2D06A 2XMSA 3AONB 4OK5A 2FW1A 3DONA 1PK7A 4Q3KA 4TV8F 1GTL1 1E1KA 1PG5A 1MX3A 4X45A 4G0NA 5HJ5A 2AFIB 2F1HA 1EFTA 4GE0A 5DYNA 1R00A 3IPLA 3LH5A 2G40A 2FPSA 2ANBA 1JWLA 1N2OA 5DM1A 3WK9A 3M8KA 4DRYA 3GA5A 4RFVA 1IHXA 3O93A 2I76A 1TKRA 2P9TA 2VO1A 4LF9B 2HN9A 2NPOA 1YL7A 1RXVA 4MUFA 3EZ6A 3ONNA 3U9LA 5LOVB 5DM60 3B3AA 5GOTA 3F1LA 1YJAA 4RY9A 3KCQA 3L0DA 4KUGA 2HCFA 1V1RB 2JCVA 4EW6A 4KR3A 3KOZA 5BVGB 4X7RA 1MQSA 2VYNA 5JPDA 1YVUA 2ODTX 5E7JA 5KYNA 1U9ZA 3PQ3A 2JK0A 3BICA 2ZXEA 4HUJA 5TARA 1NAHA 3GDFA 3C7DB 5BURA 3VR6A 4C7VA 1G55A 1Y1PA 2PZFA 3QV2A 4GEKA 4NMLA 4Q9LA 5LMCA 1TAQA 2CCGA 4K6KA 1QMGA 2WSLA 2ZJ8A 5F2KA 2VSYA 1H5NA 2VA8A 3Q8WA 4AQ7A 4LCEA 3EPRA 3C3XA 3RSFA 4MRPA 3NNDA 3IAM6 1YZUA 1QVRA 2I3ZA 3PQ6A 4HR7A 4UUNA 4EKGA 4K03A 4V24A 5HJEA 1VXOA 2FSIA 1NNI1 2BMDA 1NVAA 2QTHA 3R4VA 5A02A 1XE3A 1DTSA 4NVRA 5DNDA 1IYZA 2PYZA 1G4UR 4D99A 1JJFA 3ID6C 3RS3A 3TL3A 1SUSA 1C1HA 2FWMX 3DWFA 4YBRA 1EUCA 3CNQS 1JA1A 3NT4A 2B35A 2H0RA 3D1LA 3GDWA 3GUYA 3K53A 3CIFA 1SOMA 2AOTB 3VU9B 3ZVMA 4JI0B 1XLUA 3FZEA 1W8IA 2BR4A 5I8WA 3JPWA 3QEAZ 4LGCA 1SR8A 5LQSA 1VCOA 3MUNA 1S2GA 1PEDA 3FG9A 3GEPA 4DA4A 2VZEA 5LDGA 3MUOA 4NATA 1H8HD 4I50B 2NU9A 3MRTA 1XDSA 1LPAB 3L4BC 5LP6C 1QBKC 1TYBE 3O26A 5IAOA 3MUEA 3WLMA 1L7DA 1A2KC 3MJEA 3D2LA 4J6FA 2V4UA 4PRZA 2CYCA 4YPFA 1H2YA 5I7OA 1IY8A 2YN0A 4ZVOA 1KY2A 1SZJG 3RVNA 2XWSA 2XYPA 3HY6A 3ASYA 4FYJA 4GBED 4EX6A 2LCQA 1ACMA 2D0IA 2R1ZA 4RSMA 4RU1A 1H0SA 1V41E 3D8SA 3IQZA 4YK7A 5CDHA 2EGGA 5JY1A 1QLJA 1T3LA 5KQMA 4ID9A 2H08A 3VAYA 1ZJ6A 1YL5A 2W93A 1UPTA 4HNUA 1SJ9A 2G4CA 2QOEA 3B1JA 3HUEA 4HZUA 2XKJE 1O57A 2HADA 3BSFA 1QZXA 1EFVA 5TB5A 3TUJC 4DN6A 3Q3GE 2ATXA 4LNUA 1BEUB 2BIFA 3ZIDA 4AJ1A 4BJ1A 4D80A 4F3CA 1HEIA 4NHOA 1U5AA 5KYUA 4QPJC 5GGXA 1Q3TA 4HP8A 1RZRA 4Y7CA 2ZIFA 3IDFA 4M7WA 4PPQA 4U8GA 3ROQA 3VU0A 4BGDA 4K9NA 5DMHA 3KAPA 1V5EA 1SU6A 2BCEA 4QUHA 4X3PA 1JPJA 4X9XA 1AQYA 5J5AA 4ANFA 2KWIA 1JMVA 5IEBA 1IUOA 1NA5A 3OX4A 4I4TB 4QVGA 3AI3A 3QBVA 5HBRA 3MJRA 3PVZA 4BWGA 3UGJA 3F6SA 5A4JA 1DX6A 4Y9TA 1KZ9A 4TMWA 1GEGA 4MQFB 5TV2A 1J49A 3V7YA 4BYMA 2BUCA 3ZD8A 5D7NA 5H81A 5BSFA 1ZGBA 1SXJE 1I4WA 1YDHA 3I9V6 2HR1A 2HA3A 3IXQA 1F8GA 3VHRA 3QKRB 2YVLA 4O0MA 3MSCA 4AP6A 1DV2A 1RLUA 1ZBQA 3SYMA 4MIEA 2HSDA 2IV7A 1SEVA 2AX4A 3NX4A 5ALYA 5ALZA 3D3JA 1U8YA 3HDQA 3OFKA 5AOAA 4YREA 5I7FA 3OU6A 2ZGVA 5GM2A 4X85A 3GDHA 2P5TB 3CISA 1FW8A 2P79A 4OFBA 1V5GA 1VE7A 1MJGA 1ZGZA 3EHDA 1BXGA 3FVQA 3O38A 4RCYA 4DCJA 4LJ8A 5I7UA 2XGMA 2AOXA 1OQAA 1SELA 1G42A 4RGBA 1WBDA 3RANA 1VCHA 1Z34A 2O1EA 3GP3A 5C1IA 2IYTA 2ZP1A 2KS6A 5K8TA 3G0OA 5JDCA 4IWYA 1SUWA 4ZQIA 2BFDA 2A59A 1KI9A 2DY0A 3PEUA 2OV6A 4G63A 4K1XA 3R7AA 3BFKA 2Z98A 3HDGA 4CV0A 5THKA 5AW6A 3COZA 4L4RA 3JQGB 2WAOA 3N75A 5EKSA 5CLHA 4LZAA 1SC1A 4PTLA 1DBSA 3H6HA 4KXWA 4P80A 2I9PA 1MTOA 1YIOA 1M1ZA 2VBFA 1DKOA 4HWKA 4MVJP 1D2HA 3IGFA 3QMPA 1G8SA 2FWRA 3O7WA 5BQPA 3TVYA 4A0RA 4YT5A 4W9NA 2BONA 4H1HA 1TM5E 3F4BA 4KHZA 1N4AA 3PRKE 5I9BA 3L49A 4GXTA 3FMVA 4AMUA 3OIGA 4C5AA 5CFZA 1WUJS 2BEWA 1FRQA 5DTQA 3EVEA 1ZISA 1VPVA 4HGQA 1T5DX 1K6MA 3Q4GA 1KSGA 3ZDEA 1WF3A 1TTTA 1I33A 3U48A 3ZR4B 2YQZA 3PFHA 1PQ4A 4IKEA 5JSZA 3BHMA 4AG6A 1ZWKA 3TINA 1YT5A 4K9PA 1E1LA 5C8XA 1LQ2A 4LV5B 3K15A 2ADFA 5DK4A 1A7AA 3UYLA 5TLSA 1OXXK 1ZOIA 1EFDN 3A9CA 2Q1XA 3OJCA 4RM3A 1Y5LA 1M2GA 3BJIC 3KG2A 1RCTE 4EFMA 1L4GA 4NL4H 1KOJA 1YS2X 4JVNA 3M6WA 4KGXA 3WWCA 2GEDA 3QXCA 4IV0A 5TY0A 4C14A 5MHTA 5ICFA 4QNMA 2F67A 1COWA 1IN7A 4WY8A 1G7CA 3BXZA 1XJWA 3ENVA 1PR4A 2PSSA 4IJKA 3SXUA 5A7FA 5ALVA 1Q7RA 1ZPDA 5I01A 2ZUDA 1CUDA 1Z3CA 4CTMA 4FFOA 4M36A 2EF0A 3L1UA 3PFCA 2WJ6A 1SURA 4PW0A 5A3VA 5B1YA 1AKMA 2FU5C 2GCNA 2BFEB 3IOBA 2H1CA 3FPBA 3N05A 3NDPA 3KR1A 3JR7A 4ESEA 4FC7A 4EYGA 2RAVA 3AVVA 4PBTA 1UOQA 1H65A 1YRBA 3LUPA 2A4KA 4GQAA 1KI6A 3UMFA 4YJHB 1AOXA 3B1VA 3ASZA 1A72A 2EJCA 4ZO6A 1X80A 3VNUA 4B75A 4OQEA 2D0DA 1Z39A 3QWFA 4KV7A 3A6JA 4OOFA 4OX9B 2YZ7A 4K9QA 3BCSA 2DPLA 1HL3A 3CU5A 4KSYA 2N47A 1LBTA 4RETA 5K6AA 2EX0A 1RQPA 1W96A 2CJXA 2LIPA 4BOYA 1R0SA 2J85A 3PR3A 4N7BA 3DAYA 4PLHA 4UXIA 2AZ4A 2ZE6A 4ND6A 4FT4A 4JYAB 1NBHA 4M22A 1I5EA 4RTJA 3HWX1 1IQRA 3HJFA 5EJ9A 2KB0A 4RSGA 5F1OA 5C7IO 2G67A 4JI5B 1ZXXA 1AQJA 2NZ8A 4FHGA 1EBFA 2CXSA 4MUGA 3PVCA 4EQ6B 1PJLA 3DTYA 2XNSA 2GXAA 1LA2A 3GQBA 5EINA 2A7XA 4E4RA 4D26A 5J63A 2CL0X 5JI3E 3R40A 1HE4A 4RORA 5IULC 1EVLA 1RXCA 2IODA 4KFTA 1DMRA 1A2QA 1BOFA 2K2QB 4IX1A 4KPFC 1IUKA 2HLPA 1XTPA 1YXMA 1XVAA 1GPWB 3I0ZA 2OD2A 4RX1A 5JWHA 3CCCA 4JLDA 3LYUA 3DE7X 4D9MA 1PGPA 5IMBA 3IQHX 1IQUA 2JVJA 3FSRA 3COWA 1GVNB 3EPLA 1SIBE 3VPSA 5EJ7A 5AVOA 2QI9F 2W2QA 1GXSB 4KDCA 1E9VA 4MI6A 4RQAA 4M0LA 1R5BA 4QLAA 1M76A 2R8PA 2JLCA 1NUUA 3RC2A 2PRYA 1LV8A 3FVWA 1NHWA 4YAFA 3EB9A 4WCFB 3OLQA 2R84A 3EXHC 5FA8A 3SX4A 2K4MA 5HK9A 1ZU5A 2WNSA 1X39A 1Y3IA 3NAMA 2YV5A 4OKIA 4YRNA 5CYGA 5I3CA 4U2FA 3AOGA 1DT5A 3E2IA 3O74A 1RAIA 3N5KA 4LECA 1E6LA 3H4MA 3GGDA 3L6CA 1D3AA 2WOJA 4YO8A 2PLFA 2A9QA 2YVAA 5BQ3A 2BP7A 2E1RA 4BVJA 1X13A 1X19A 1ZD9A 3ME5A 1WTCA 4FHCA 1JDZA 1GL9B 3M3PA 3JD2A 5JCPA 4XWKA 1W52X 2P6RA 1T29A 1OT5A 2VDWB 3ED5A 1XK7A 3DLIA 3KEGA 3V8MA 5BVGA 3SMVA 4AXBA 4RABA 3G9XA 3L9WA 3T6KA 3OC0A 1WMBA 2E4YA 2TECE 2JCYA 4IJQA 1EJBA 2PY6A 3DL0A 3NHLA 1AUPA 4GWGA 4DSUA 1MQ9A 3KFLA 4HLUA 3LFUA 1FTGA 2PGNA 2PKXA 1JR3A 1RHMA 5DLDA 4NPAA 1XZCA 4UVGA 3FKSA 3LLVA 4DILA 5L3QA 2WQ7A 5IH3A 4CQLA 1RW4A 4CIBA 4HTFA 4Q4JA 4CKYA 1ZEMA 3IELA 3N8NA 3DDWA 5EZYA 3SVTA 5I8ZA 4FOSA 3UV6A 3B36A 721PA 1F7UA 2B6HA 1R6TA 3W3ZB 4RTNA 5BWCA 1ZGAA 3FIUA 4IINA 1I0LA 1C30B 1OBFO 1EQ2A 2WA2A 1K3TA 3DCJA 3F0TA 3F4LA 3JQ6A 3K0CA 1KL7A 1PN3A 3LBHA 2RI1A 3R8CA 1HFJA 4RFLA 3FPKA 1NVKA 5CX4A 1CP3A 2O48X 3BEOA 2A9FA 2Z2JA 3IT2A 1N6NA 4BMDA 1NE7A 1X7YB 1XMSA 1L7XA 3O8NA 1ECCA 3G0IA 3Q7RA 4PYQA 4XR9A 3W2EA 5EJFA 4C9BA 3THWB 1P0IA 3QXXA 3R6TA 3JD4A 1RD4A 4YJ3F 4DL9A 1R15A 2ZRKA 1NT2A 3FNQA 1AKRA 1XDGA 3LK7A 4YQYA 4YROA 1C1DA 2W22A 1Z15A 3A25A 3WGLA 1BDBA 3EA4A 4C7MA 3GPBA 2ONCA 4PN7A 3TTSA 2VH1A 2ZW9A 4TLEA 2I2AA 1U4OA 3JQ7A 2XLCA 1MC1A 4TLAA 1XD2A 2OP1A 4PYNA 3WVNA 1B8UA 1PYDA 5IT4A 3K0FA 4URXR 1V16B 5AICA 1Z35A 1FVHA 1QF6A 2YH2A 3PQ2A 1OBCA 1V8BA 1G21B 2NXWA 421PA 4EITA 1NVEA 4LQDA 3SHVA 5A6VA 3ZZTA 5KX5A 2HA7A 1YR6A 2IYPA 5EHQA 3SYLA 2X4IA 3IDAA 5IJZA 4TZTA 1KAEA 1NQ5A 4KH0A 3QLVC 1QDUA 2XJ9A 2IHZA 1OGIA 3ETLA 1K7FB 3ICCA 2JJYA 3QVUA 1EJ6A 2EX4A 2CLHB 2OORA 4KL8S 4KH1A 1G6Q1 2W6JD 2WW8A 4NOLA 3FPHA 4KXLA 4HLCA 3PC8A 2JB9A 1CY7A 1I3OA 2H65A 4HBZA 4BEJA 1EP1B 5HK8A 3ENWA 3PC8C 3AB7A 4WA7A 3B6EA 1ESEA 4KQJA 1BJKA 4H3SA 5CUQA 1HDIA 1C81A 3U7RA 4UBJA 2RJNA 3W8NA 4ZYTA 2ODBA 4OREX 4QM6A 4I5EA 1FUKA 2XB4A 4JC5A 5DLQC 4EAAA 3ZN2A 4EEZA 4YXFA 4XIIA 3KT8A 5C7LO 1P2FA 2PLAA 4NCBA 4HVLA 3SN6A 4E13A 1L5OA 3AOEC 2V8BA 5FBHA 2VJAA 3EG9A 1P77A 1XROA 3HSKA 4D82A 2QW0X 5BSEA 2GD0A 1T91A 1TB4A 3JVVA 1CG6A 5FD8A 1V7CA 4WZBE 1FJ2A 3MCVA 1A5BB 5HOQA 1VBFA 2ZU0C 4PXAA 5HF6A 3P9KA 1J2TA 4MPDA 1RR6A 1XZFA 4N3NA 4FN5A 4YN3A 4ZOQI 4C7KA 3VAZA 1ZC4A 1J23A 1XPUA 3NEPX 2AJCA 3FYSA 4QELA 2WEKA 3K0HA 1BN6A 2XRMA 1B3BA 2VTEA 1B42A 5DLPA 1RI2A 1ZEJA 5BV0A 4CYMA 4NCIA 5A0FA 2XOKD 1MMFB 4CGYA 1ZHFA 4BB6A 1N2GA 3UA4A 4MQEB 3QM1A 1KMMA 5DW3A 4KI7A 5AK0A 3QHAA 4YRQA 1HI9A 3VR6H 1RIFA 2JAOA 1Q2UA 3DAFA 2HU2A 1OLUB 1T6BY 4EYEA 2C5GA 3GELA 1I7DA 1N2ZA 4CEJA 2Q6VA 2GCOB 3FPJA 3LF2A 4L8FA 3WLAA 1UT8A 5C1DA 5IF3A 3SQWA 1T9CA 2QMOA 1N9ZA 3UUEA 1PWYE 3U7GA 2P30A 3SBOA 4COKA 1OOEA 2PRJA 1K06A 2JLBA 5CNIA 1NXWA 1IHDA 1UP6A 2H06A 4TROA 2W6QA 3GT0A 3VX3A 3M4JA 2Z58A 2PYDA 4TTVA 3VUFA 5CFQA 1YC2A 5L7YA 4C88A 1AZSC 2F3RA 3JWHA 4WK0B 4Y6RA 1GTSA 2GEVA 4QDUA 2JPDA 3OHSX 3WQQA 4WBNA 3BH0A 4NU0A 1W5EA 2IXDA 2VQDA 2GAJA 4X8MA 2B98A 2IXGA 3P20A 2QTZA 2YIMA 3ZUGA 3KE9A 2BEUA 1RBQA 4KX5A 5GAJA 1GCGA 1TLLA 2C4MA 3ZWWA 4AM8A 1DPFA 4I9GA 2GS9A 2AEJA 4ZV7A 1U0NA 1PT7A 1I30A 3KB1A 5KHAA 2P9ZA 3DT6A 3GJSA 1ZSNA 3P9NA 1K7CA 3EMKA 4QUBA 2C2YA 5KVQA 2Z9DA 1FBNA 5BR1A 4PCAA 3NVKI 3HMKA 1HX7A 3GROA 5LKRA 4TMVA 1CRLA 5DHPA 1ODIA 4H1UA 5A1JA 5IW8A 16PKA 2QTWB 2I8LA 3OIVA 1L3BA 2BZ1A 3F6BX 1SKAA 4ZAXA 4WDRA 4PONA 1IUNA 1NW8A 1Z5UA 2DTXA 1KXJA 1QG2A 2W2KA 4V39A 4ZPXA 3VU8A 4CUJA 5BO5A 3TS1A 2D74A 2P91A 1JSZA 2FDXA 3I3OA 2GZSA 2QNBA 1TO6A 3L7AA 1W9MA 1XT6A 4L07A 3TJZA 1H05A 1WOYA 2O9JA 3A1UA 3VDNB 2ZM6B 4CMKA 3U9TA 2NN3C 5JAPA 1UFRA 4H77A 2C7BA 1UCFA 3KOOA 3ZHVA 3WZ2A 4C5BA 4D4KA 2O2ZA 1CX9B 4UFNA 3F98A 4WAUA 4Z4GA 3NIFB 4XGRA 1FJHA 4CMEC 3GLFB 2IH4A 3BYZA 2YWGA 3WDLA 2CE2X 2DPHA 4DAEA 1D2GA 3GQBB 3PU6A 5U1PA 1JQ5A 5B3LA 1JIVA 3MJTA 4J90A 3S1AB 3DE2X 4WD3A 5JYBA 1IB6A 4HNQA 4AYWA 1DFHA 2ZYHA 2EDAA 3TZLA 2QVLA 1V11B 1THGA 2W6ID 4CMIA 1EFAA 1L0BA 2BKVA 3KTAA 5A4MS 3Q6IA 4A7PA 2YICA 3GLTA 1ENYA 1QU3A 1EDBA 4G24A 3PS9A 1NW3A 2HIMA 4ZQFA 3TAHA 1UUFA 4OA8A 1ECFA 4F1WA 5IFLA 3HV0A 2J45A 2Y99A 4X8LA 4PNEA 3JCZA 3N3BC 1FQOA 1JZSA 4XYGA 1CF9A 1QZ3A 3SIRA 2FSVC 2QW1A 2A9KA 1J00A 4GZ6A 4V0KA 5INTA 2AR9A 2BFCA 4JGIA 4R4JA 5EY5B 4EUHA 3DD1A 4RTOA 3NETA 2PBFA 2IZ7A 1P45A 1DLJA 1ENPA 1Q7CA 4E1VA 3I5XA 1JJIA 2I5PO 3CEAA 4FHEA 5FA5A 1BU5A 1SD2A 2W6CX 3UW1A 1R6UA 3F9IA 3ND7A 4BZWA 1SB8A 3U5TA 3L82B 3AP1A 5G40A 5HKOA 3PDIA 3LV8A 4BNYA 1CDDA 2DSNA 2INGX 3HCFA 3SMQA 1DBPA 1E4EA 5CJ2A 3HBAA 4LOAA 3Q5EA 4ITRC 1ZA2A 1DAEA 4YFVA 5GJCA 5B1EA 1R4ZA 1QQAA 1WZCA 2RH5A 1E77A 1CBUA 5EJEA 2EKDA 1WLYA 3TM4A 4KFCA 4ALIA 1HT3A 4YDRA 4B3DA 3L7MA 4UREA 3RRJA 2WAAA 1Q1ZA 2QHXA 2XUZA 2FN9A 5J5VA 3E0XA 4Y2TA 3RSGA 3BULA 2IZ5A 5K3AA 3EXFA 1SQ0A 3P2YA 5C4IA 3MTAA 3AY3A 3T1NA 2QN3A 2MYPA 4F6RB 2EIXA 4KSCA 2Q46A 4BJHB 3TUZC 1E5TA 1NUAA 2HTEA 2ILTA 1IOLA 2VT3A 2WFAA 4A0SA 4C7BA 2ZI6A 3D6UA 1JLHA 1B76A 1S8AA 3EH2A 4GXQA 4DLWA 3D6AA 4ZVMA 1VLZA 2QM7A 2QT9A 3DCNA 3CRZA 4Y0VA 2YTZA 4MVJM 1VECA 2VHQA 4RLHA 1NQAO 5CCXA 3K72B 1YS9A 4RM2A 1SU8A 3RARA 3W5BA 3U61B 2HHAA 4URHA 3EDMA 4RA9A 5ALQA 1J1UA 3WWYA 4LX0A 3GLFA 3OFSA 4TV8B 5GZ3A 1QGZA 1X3SA 2PL1A 2ZUBA 3KVYA 1BX1A 3OF5A 5COQA 4C43A 4DIMA 1OREA 5BWLA 4K9MA 2E4ZA 3A9UA 3BJEA 3RUDA 2P2YA 4KGDA 5CA0A 3D7MA 2JRLA 2P2NA 2V7QD 4BNDA 1W85A 2JD0A 1TJ4A 5BNIA 4AG3A 5IDQA 1WBBA 1UAYA 2CCKA 1BCSA 1UC4B 2J6IA 1S7GA 3O2SB 4HXYA 3MWEB 4RCVA 2SICE 1EM8B 2I4MA 4FDLA 3TZCA 1CUVA 4AO6A 2O0KA 5BNFA 1BA2A 1CDOA 1DBQA 1DL5A 1G5RA 2VEDA 4M1WA 3RK4A 5CD9A 4M86A 4CM3A 3HUUA 5DRYA 3QPVA 2FFHA 3CUWA 4LY3A 5C8DA 4PZDA 1Y5NA 2R25B 3AY6A 2ZYDA 4KKXB 4LCJA 4NBUA 3S8EA 3VOAA 3KKQA 3UTDA 4B2IA 1EQAA 1GV0A 3O3OB 4BP1A 3WAGA 4U9UA 4WLNA 1QCCA 3QUAA 1HYQA 1R0YA 4B7CA 1XZBA 3ENZA 1M2VA 2ZJZA 4M0FA 4IDPA 2FWJA 1DXOA 5A6SA 1AHPA 3QU2A 2JDIA 1DP4A 4IO0A 3UEOA 5AFSA 2C2BA 2MINB 1PZGA 3GJ5A 1GZ4A 2KMLA 2O0JA 4TV9A 2GA8A 4R5MA 2R44A 1S2NA 3B8EA 4YWJA 1UAGA 1NGSA 5KNLA 1YVRA 3F3SA 2Q99A 2MU1A 4FK8A 2HT1A 4UTOA 3LKBA 1NU8A 4WTOA 4N8SA 4ZV9A 5G1PA 2CHVA 1TOAA 3IUSA 3MJCA 4ZFNA 1M8JA 3GPDG 2IGBA 4A91A 5KMGB 3C24A 5KNDA 4G97A 4RDHA 4MR7B 3NIGB 3ZHSA 1K9SA 1TUBB 2X0NA 3DEAA 3GLKA 1UKBA 2UYGA 4S0XA 1NN0A 4P2GA 3EK2A 1SVSA 1V39A 3VSEA 4CL3A 5AO9A 4YLEA 4F4UA 2HXYA 2CDBA 1AIPA 3N0WA 1PTJA 4BMOB 1SKQA 2AJLI 1VHTA 2X0EA 2MSNA 1CV2A 1RMQA 1VL5A 3MWDA 3OM9A 2V7QA 5IBPA 4IDQA 1K92A 2P9JA 3VOTA 1TX4B 3RSZA 2MYTA 3BREA 3HU2A 1P2VA 4KR2A 3V8EA 1YFKA 1P8JA 1NW6A 5IYZA 3ZDDA 1Q0LA 2VPQA 3RSHA 4A0FA 1Y7HA 4BO7A 5AW1A 1S8NA 3B7WA 5HFJA 5K8IA 4U63A 3F97A 3FLMA 3CUUA 1OI3A 3BWCA 2DFLA 1VIAA 2JEOA 4R8VA 5HFNA 5ITZB 3NJRA 4PZUA 1GJRA 4LBZA 1ULTA 3T3GA 3WHIA 3T0IA 1WNFA 3KKKA 3QMMA 2BBTA 4I50A 3ZIUA 3SC2A 5J59A 3ZW9A 1QP0A 4BC1A 4MK4A 4MYRA 4JITA 1P5FA 1P62B 2I4IA 2V4MA 3DLPX 2X23A 3NMUF 3V48A 2GUGA 4RVFA 3TTVA 1XAIA 4MUIA 2XGJA 3TGLA 1JFFA 4HDNA 4DLVA 1NF9A 1UQRA 1T9KA 2BM0A 2XITA 3HZRA 3EH1A 4G5YA 4WE3A 3TW8A 4AY2A 3C14C 1RQNA 2PH3A 5HRCA 2Y27A 1E9BA 1GZSA 1CQIB 2ZIZA 1QJ4A 3CA8A 3CZCA 4JY7A 4CTOA 1D5CA 5KKCA 3OCXA 5KYXA 3FKJA 1FUIA 1GGKA 1WP4A 1NMQA 5TGTA 3SQNA 1DEKA 2AXNA 2AMJA 2BBSA 3AKZA 3C3AA 1TVKB 4LXUA 3LVRE 4G01B 4ENTA 2J3QA 4FIDA 3CLTD 2DUUA 4YV0A 2JLWA 1K3UB 1KP9A 2P2SA 3A2NA 4TTIA 1G5QA 4H7EA 1JQEA 1M2VB 1GZ7A 2G9VA 4IXWA 4PZPA 1L5KA 4E14A 3SJZA 1FYFA 1O96B 1FFHA 1B6GA 3W8DA 4DT1B 3TTUA 3HB5X 4KYIB 5JCJA 1P6UA 5ALFA 4G26A 5DM70 4K6MA 3EUWA 3ZHCA 2Z1NA 3WLSA 4A8PA 3PXAA 2XZOA 2FDCA 2H7YA 3WGTA 2CLKB 3DYIA 5EJIA 5H9WA 3PYXA 4C0SA 4R2KA 2IY9A 4KDFA 4BQQA 1XNRB 1JYEA 5EERA 2VSFA 2VPTA 3G0BA 4MGEA 4OJMX 3DOFA 3S68A 3ZBTA 5ICSA 1L7OA 1LPOA 2P0YA 2Q3CA 2DUNA 2PMKA 1LWNA 2ZK7A 3HI6A 4MP6A 4X63A 1MLDA 5J9FA 5AUNB 1I10A 1JDPA 2AMVA 2VIIA 2ZRHA 1CB7A 3CLHA 3KU4A 4IRXA 4QUAA 2P9EA 2XYVA 1MB0A 1OXSC 1Q92A 1Y3BE 2QV7A 3CC8A 2VR1A 5FOWA 3G1TA 1O54A 1TZCA 2QRQA 3EG5A 2J33A 3AQIA 5G0VA 3RYIB 3SJ7A 3MS7A 5JH7B 2ZBUA 3JQRA 1GNPA 4M46A 1KI1A 1LX7A 1KO4A 4NPHA 4ZMBA 4XVCA 1DHRA 1OXBB 2W5UA 3S81A 1N6HA 3D3WB 3JQ9C 2X2FA 5GIPE 1FRNA 4JD5A 3ZH9B 1RFLA 4I1VA 1E2FA 5F7ZA 2ASVA 1XNHA 3AINA 3DCYA 5JQGB 1ZXBA 2A84A 5EKTA 4PR0A 4ZV4A 5E1DA 3RJMA 2I71A 2XF2A 2Z57A 4HFNA 5EAIA 3VZQA 4I36A 3AVOA 1EAMA 1YBHA 4O59O 3HA7A 2IU3A 5A5GA 2C2WA 1LSSA 4Y1FA 1EKXA 3L8CA 1DARA 3EZYA 1BW9B 1E60A 2E55A 2FX5A 1LLDA 1NRJB 1ZUD1 2JBHA 3M9LA 3BQ9A 3MN1A 3WHLA 4C0QC 1EGHA 4X1YA 3UWPA 4WCVA 1LC3A 1FSPA 4PG5A 4MX8A 1P7YA 3CR3C 3F74A 3QKRA 3NALA 1YI0A 1T1EA 3K1AB 3LNTA 3RG2A 3NBQA 1GN9A 3CONA 2CZQA 1QNLA 3C8DA 3PHCA 4ZRMA 2XNJA 2ODQA 2N1MA 1M2KA 1GGEA 1DBWA 4DBVO 4B8WA 3PT9A 2IE0A 4X93A 1VIDA 5BV8A 4R01A 1U2GC 1E5QA 2C5BA 4ZC1A 1P74A 2QV0A 5T67A 4HUQB 1E3DA 3DBLA 3QFFA 4IKPA 4KMMA 3SQXA 3QVOA 2PZJA 3EXAA 4LXHA 5IJ9A 5FUYA 1NBME 1Z7BA 4OU5A 1I1OA 3L40A 2QPLA 4S1OA 4F5DA 4R1QA 2QORA 2Z8YM 1YMQA 4BO5A 3BXPA 2R8ZA 4RQTA 3RJZA 2CUNA 2QU7A 1TCVA 4D02A 3PJGA 4KVFA 1T2NA 5CPBA 1CY1A 1PWZA 1ZMBA 2FDRA 3R4CA 4K6CA 2D8MA 3D7RA 3OEED 3AHHA 4RF5A 3GJRA 2WKWA 1J21A 3STVA 7AT1A 1QV7A 1P2BA 3O9VA 1SUBA 1XZPA 2XYHA 1QYRA 1JLLB 2ZAIA 4LTDA 5KQSA 1JXQA 1FYDA 1LVUA 3BWXA 4R3NA 3WL8A 3CT6A 4RTQA 1Y1KE 4OLAA 2WYWA 1N75A 5E9QA 1W0KA 2RBEA 3ZV5A 2Q29A 1ZNXA 3BSWA 3QELB 3GXOA 5L6MB 4Q18A 2O8EB 1F8XA 3K9QO 1EGMB 2VHZA 5D3MB 3R2JA 3ACDA 1CEXA 2JCXA 1F2UA 3CO0S 1UINA 2P3LA 2VP6A 3ANNA 1JRLA 5IJAA 3NRBA 5FQOA 4GOJA 3SDSA 3GC6A 1ND6A 1O4WA 1PK9A 4X3CA 4B3SB 4AS1A 1OHHD 1IIRA 1YQ9A 3IXLA 4NF2A 1N78A 2AG5A 5D3MA 4C05A 3U6KA 5U4QA 1E1QA 1T9AA 4BBJA 4LDQA 3PTZA 4F45A 3D4IA 3PNMA 4OHKA 3AVQA 2JD1A 1QGAA 4TWBA 1YF3A 2HO5A 3NVMB 3SYKA 5I7HA 5AW5A 1GA6A 2H0QA 1BW9A 2NO0A 3NGMA 4CU5A 4D44A 5HOEA 1UIRA 1D1PA 2YWBA 1N9GA 1CXZA 2V7WA 4LBVA 4RK0A 3Q0TA 3VHXA 4A10A 4HSEA 5KKNB 4KZKA 1EXDA 3L02A 1N3LA 2OESA 3G68A 4S1VA 4ASUA 2BEKA 4J8PA 1FMTA 2VRNA 3VHLB 2HK9A 3L92A 2JEZA 4G0XA 4CM8B 1AZWA 1NMYA 3L05A 1JU9A 1NUQA 4XTCS 2ZUTA 1DI0A 3LUJA 2A5LA 2D54A 3GUHA 4JEMA 3WGYA 5JSUA 1C30A 2OLKA 3FTQA 2W2LD 3P19A 1Z8DA 3W5VA 2N3ZA 1VFPA 2I9KA 4A2WA 1U0LA 4N82A 1B1AA 5L4LA 2IYAA 1G8GA 3A1EA 4FFNA 4OHUA 5DVZA 3RU9A 1E9EA 2QIPA 1BMTA 4QXOA 3TMKA 3VYSB 4JNCA 3TCKA 4BNMA 4PX5A 1HOXA 3TYXA 4HT3B 1JDSA 1UDBA 4H7PA 4QBTA 4YQZA 4TT3A 1N25A 3DUFA 1B6SA 1L5QA 4IUBS 1EJ2A 2OPHA 4TVSA 1KYZA 5CBPA 1FX1A 1ZMOA 4QBKA 4UDOA 4RK6A 5BSRA 2PNJA 1IE3A 3WLFA 2B1JA 3R76A 1XYYA 2FPUA 4HY3A 3FR8A 2FLVA 4JT4A 4Q21A 3UN1A 1K6JA 3ZU6A 2BI8A 3ELUA 1E0SA 2IQ5A 2ZWPA 3KKLA 4FDAA 4JBHA 3A28A 4UC0A 4WXEA 4Y2PA 4YASA 4M0PA 4MP3A 4P1ZA 3W8FA 1FJXA 2IIVA 5EXEA 1JX6A 3N53A 3IPYA 1C3JA 5MGNA 3UMSA 2WQZA 4II7A 4PC2A 4C4XA 4P4TA 3QKSB 1LTKA 2C5SA 2LNDA 3TQSA 3AHEA 2CB0A 4XVUA 2MYUA 1QJCA 4FGKA 3SJBA 1JBEA 4PHGA 3UGQA 3ZNOA 1VFNA 4EAQA 1V26A 1WU8A 2WABA 3EGWA 4AJNA 3QLUC 4PG8A 5EJ6A 2C5LA 1M34E 3HADA 1KJ9A 4ZVTA 2WE7A 3TL6A 3MT0A 1GR0A 3ZE9A 3GAZA 1RRMA 1V1JA 2GK7A 2FE4A 3BB4A 2B37A 1SA0B 1NJ5A 1LSUA 1NM5A 1OBVA 3DPUA 3NKFA 4FXPA 3OX1A 2HEIA 5FCDA 4YJDA 2YX1A 3X2FA 3E84A 4GRDA 4DA6A 2EP7A 2QE6A 2UYQA 3ZI7A 3OE7D 4TT8A 4D6XA 4QDXA 4EG7A 3H2SA 3SQLA 4JUBA 1UOEA 2VDWA 1CKEA 3NOQA 1MN6A 3P5SA 4PPGA 4LGYA 2WT8A 5D85A 1ZGJA 1FUEA 4WOPA 5T6BA 4BV8A 5IVPA 2J7KA 3GFTA 2WA1A 2VHYA 1K1EA 4N54A 3DXYA 1KK3A 3RKSA 3UJ9A 2WTXA 2ZIVB 4DMMA 2M32A 4ON9A 2FMXA 4FUQA 3EVNA 4FZ3A 4QREA 1JW9B 5AKJA 3U60B 3F9RA 1UBSB 3ROZA 2CEKA 5DHTA 5JE8A 4B6PA 4D46A 1GUZA 3A6KA 1C8LA 1H2ZA 2P35A 2YMPA 1DAOA 4X6UA 3MCZA 4G6ZA 5ERXA 3V4LA 1Z4JA 2HGZA 2JAHA 4BDSA 1FQJA 2R6AA 1NYLA 1OFIA 3KU1A 2OV8A 3QXGA 4JIGA 4N47A 4ZI7A 3K5WA 1S8FA 4OHCA 2AF3C 1FNSA 1IG0A 4IQ4A 2O07A 4XFDA 3BXXA 4JS0A 3OUTA 3WGJA 1E94E 1RADA 1W73A 4G1VA 3RSQA 3ZHUA 4MCIA 10MHA 4G0VA 2R0QC 2C98A 2P6NA 3FUXA 3GARA 4HNSA 4DNFA 4RJKA 3RYTC 1CIJA 4DC1A 3GVHA 3GEHA 4WZBA 4DABA 5IK2D 2YVKA 3RBZA 4AWAA 1YQDA 1SCJA 4YMSA 2EZUA 3IC5A 2J1LA 5EVCA 4M8KA 1QH1B 4KYTA 2FSSA 3KUDA 2ZEJA 4KHPB 3B12A 4TL6A 2VBGA 3ZLBA 1TK3A 4MMXB 2V03A 3DO5A 3ZHQA 3ZY4A 4E2YA 1J0BA 1XSEA 2CNNA 2W2MA 2ONKA 1VI2A 1WRBA 4MQUA 4WT7A 1M6NA 2J31A 4TQAA 1ZWLA 3CJQA 3FA2A 3OIFA 2YWCA 3WL3A 2YOHA 3GLVA 1G7SA 1EE9A 1Y6RA 2QTBA 3O1HB 1YOBA 4FKMA 4JOQA 1GYRA 1UXOA 4LPSA 4UDNA 5DO9A 5LUBA 4LFAB 2J9GA 1EK0A 2HRCA 1VL6A 3RGWS 3RWOA 3UMJA 4Z1OA 5C35A 5TVKA 4A1FA 5FX2A 4H7IA 2QP9X 1L4LA 2Z83A 1RHRA 4QYIA 3AJDA 1DINA 1MZVA 4JSYA 3OECA 5EQTA 1LW6E 3K8ZA 2AMLA 1FP6A 3LCUA 1ZDMA 4KLCA 4LOJA 3ZBUA 4UFPA 4MMYB 3SHTA 3ZCVA 3I4LA 3R7DA 4B44A 3GEIA 1U8XX 4AC9A 3UJPA 1I8TA 4B32A 5HS6A 3TLKA 3TFQA 3DEFA 3O7MA 5EPUA 3N6VA 4DG9A 2D13A 4N18A 1OZ0A 4D9HA 2GCIA 4CCAA 2VF4X 4I1IA 2O2YA 1GGVA 2LKDA 3TQHA 4KXXA 3F71A 5FORA 2Q5CA 3C7CB 3QZUA 4G41A 2XD9A 5ALGA 3NM6B 4WMLA 1JQKA 4ILEA 3RYFB 1FMCA 2YYAA 4QDJA 2GD1O 2XIQA 2XE4A 3NT5A 2RSLA 1J2YA 2ARKA 1MBZA 4M89A 3TMAA 5AI8A 3U19A 3IBFA 1PFVA 3WKDA 2HF9A 1HE5A 3AP3A 1TVEA 3OA0A 4Q9DA 4DMCA 5JIBA 2IQIA 1XD9A 2P0EA 1FMJA 4H16A 1OYVA 1N3BA 1XMVA 2GPYA 3BWEA 3IHTA 3LOPA 3GZTB 3H5IA 3JAWB 3OOJA 1P9LA 1QR6A 2PKYX 4JODA 1FDUA 3VR5D 4OP2A 4RA6A 1W4LA 4P3PA 1IFXA 4GPAA 4EI7A 2V1UA 1Y8AA 5JG7A 2R1VB 2JAQA 2PKRA 3FDZA 3VR5H 1KGSA 1JHDA 4OHXA 4BIMA 3W5AA 3F7NA 2RH4A 3B6KA 3HWSA 4MDHA 5J4HA 3GA0A 3ML1A 4CBVA 2JKVA 1V1MA 2HNAA 3DEHA 4MJ7A 1ZIDA 4EFKA 1JG3A 2EHJA 3L5KA 4UMDA 1UWCA 1DJOA 1XQ6A 2J3MA 3DXXA 3NOOA 4UHBA 5D84A 2IEGA 1T0JB 1DEXA 1O9GA 1V35A 3W2FA 3C6XA 1HETA 4JENA 5A7GA 5KDDA 4FGWA 4FM9A 1SUPA 4MQ4A 4YUWA 1GV1A 2UZAA 1I4TD 1F38A 1CUHA 1TZMA 1UK7A 2FEAA 4OBXA 4DUGA 1GFZA 1TZJA 3B3JA 3INGA 4NEGA 3N8GA 4H7HA 5HKBA 3QBTA 3D3EA 4B85A 4S04A 4Q02A 1KK1A 1ZI9A 4GECA 3BM5A 3EZXA 3LY9A 3NPAA 4CXMA 1U8CB 1G2QA 1YZLA 4HLQB 1NZDA 1RT9A 1IN5A 1NOKA 3OCJA 3P27A 4H3HB 1FVXA 2PUFA 1GZUA 1KJ8A 1WDTA 2XADA 4JYPA 2P9HA 4DR4B 2OXCA 3CRRA 5C81A 3DFFA 4EW3A 1TM7E 1NDQA 1HTWA 2V5AA 2XV1A 2IF0A 3EE6A 1UT5A 9MHTA 1EVZA 3BK7A 2BMAA 5L3SA 4EKIA 2BEVA 2GAAA 4RVHA 3TZ6A 3H2IA 2WUVA 3LWBA 3GGSA 2P3QA 1U6KA 2Y0EA 2LCIA 3W04A 2A5FA 4MXDA 1WZ2A 1DNPA 1TTQB 5AI4A 1COZA 5L3ZA 1NY6A 3B38A 4BB9A 2W98A 3IUMA 4WBSA 3TR0A 2F1IA 3DWIA 5B7QA 1LJUA 1KKLA 1VMIA 1JHAA 1ND5A 4P4SA 2YUTA 2R3SA 4BUCA 4BTVA 1NVWQ 4ZKDA 3IJEB 3D7SA 4OXYA 5AR1A 1PR1A 6Q21A 3JAKB 1G60A 2QW8A 2R68A 2PX0A 3DBLB 1X2EA 2IHTA 1NXTA 2P78A 3IUBA 3PDIB 1KRHA 1Q57A 4BVBA 2BUBA 4BXOA 5A0TA 3LKVA 3V1MA 4HMQA 2J0QA 4BO3A 4EA9A 1OWMA 1GCAA 1MZPA 1JR6A 3PIDA 4QTZA 2FN7A 4O08A 2BHTA 2IUEA 4UQOA 1MQ8B 4OXNA 5DSXA 5C3MA 2F3TA 2RHJA 4NIMA 3K2QA 4FMPA 4UXHA 2OA0A 4Z5XA 4QBIA 1OLXB 3ND9A 4ML3A 1THZA 4QU5A 5A6SB 5F78A 1Q77A 3J80A 3BXFA 4XRRA 2AYZA 4XCVA 3HL0A 4M3NA 3H1FA 4EELA 5DYYA 1VM6A 5AM3A 1W88B 1VQ1A 2IDJA 3FCOA 1RWPA 3H4TA 4HDKA 5TT1A 1CUXA 4WESA 4KGVA 2H1OA 1TYCA 5HP4A 4A8JA 2D6FA 4P5DA 4E4TA 3IRVA 1VA4A 1R5OA 4ZTZB 1U28A 2A78A 2CNBA 2R7LA 5E4YA 5GJBA 3EXIA 3FWKA 4YJ2A 4D5GA 3I5UA 1DOZA 3BRQA 2CZCA 4R1NA 3L6BA 4UD2A 2C97A 5ALSA 3B60A 2AHOA 2ODEA 5FWDA 1RAGA 2P0AA 2CDAA 4B6FA 1CHNA 3MA0A 3AV0B 1JQAA 5K8LA 4A2PA 2ISCA 3GEDA 1B8VA 2IKSA 1YGPA 4KIGA 3UJCA 3D0RA 3T3OA 1F12A 3V32A 3P2MA 4A2QA 2QUIA 4PHCA 2RG7A 1VP9A 1ACJA 1MT0A 3BAZA 4BWFB 3B3FA 1J6UA 2H85A 2PVCA 4PRKA 4AU1A 4UHHA 3HRHA 3WXMA 1F48A 2XEXA 2AFIA 1EP3B 2FJPA 2HUNA 2QN7A 3Q10A 1QIJA 2GPWA 3HYNA 3OT5A 4FCVA 5KSPA 2IP4A 1DRVA 8GPBA 2C1EA 4BNTA 1Y4AE 4NR0A 5EN4A 4ESHA 2A92A 5KPDA 1FDOA 2A9OA 1O94C 2I3GA 2Z5FA 4AY5A 4KN9S 1PFKA 5JS6A 4E31A 2QSZA 1FTNA 3GY0A 4M0CA 1UOOA 3ZCXA 4CLRB 2BFPA 1P7WA 5AK3A 4YX9A 3QYFA 3R0QA 3H7IA 3W34A 1NXPA 4PIPA 4N9WA 4I55A 3MHTA 4HDAA 2V9PA 3QJ5A 2J09A 1ORVA 2QSUA 4LY6A 1D4ZA 1DLIA 1NXQA 3OPXA 4IZ6A 3X3HA 1KERA 1MV8A 3TSCA 1JB1A 1MF7A 4HJRA 1W7AA 3NWBA 1CQPA 1N0IA 1DGQA 3KTFA 1RXWA 1A9TA 2PA3A 4F86A 5EXXA 1I3CA 3I6YA 4X65B 1QO0A 3ISJA 1AUVA 4N4AA 4HAUA 1XU4A 2ZJ6A 3I8XA 3D1JA 4GI3A 5H83A 5CVUA 3OCZA 2R6R1 1EB9A 1D4AA 3QPWA 2YXLA 5K0BA 3TSWA 4BN5A 2YRXA 3BMXA 2HMSA 3ZWMA 4L27A 3H18A 1WXFA 2KHZA 5AVTA 1YR9A 1UDXA 4QUGA 4RJIA 4GYKA 3O8LA 4JLAA 3OP4A 4INOA 2PG3A 1T2VA 1DPGA 1PJCA 3L18A 1J70A 2QLMA 1LNSA 2P2CA 5FOSA 4UM8B 1UM9B 2NADA 5E1OA 1KYTA 4WKNA 2ODAA 4IVPA 1GA4A 4MW5A 4R84A 4QHYA 3PIIA 4Z49A 4ZODA 3M4XA 2NYAA 2NQ2C 5TQ0A 3EHEA 4JV5B 4JCCA 5KO2A 2CYBA 5FO1A 1S01A 1F60A 2JGIA 4AJ4A 1CJSA 5J40A 1PT6A 1TVMA 3O95A 4DIOA 1MJNA 2P9BA 4L5JA 5E38A 4JUDX 4FQ8A 4JU9A 2R11A 3UXEA 4Y1RA 1Z29A 1G2PA 3W79A 4EUFA 4GDFA 4BLVA 2PR2A 1CRZA 1JJVA 4EG1A 1E9SA 2F00A 3CUYA 3H2KA 3PZBA 3K8QA 4QJIA 3EWAA 4QICA 2QM8A 5BSGA 5EWJB 4E6EA 5HQ3B 1Z5OA 2VNJA 2PM8A 3K1YA 3NTUA 1SXJA 4J1SA 1KVRA 2P6PA 3DOJA 1BRTA 2B3DA 3H8SA 4M88A 3RASA 4HLNA 2FPWA 3FCUB 5HF9A 3TBKA 3TNFA 7YASA 2BELA 4FWIB 4M49A 1ML4A 2X86A 4YT8A 1SXQA 3SC6A 1NBMD 5JVDA 1QTRA 2OZLB 5G3ZA 1KPGA 1T34A 1UJMA 4TSKA 1W59A 4DXHA 3FETA 1A3CA 4MUNA 1UKYA 3FUTA 1CP2A 5IMSA 5HDQA 4I9HA 1MXHA 5I8PA 2A0YA 1K4KA 2E21A 5A2GA 4UEQA 2Y05A 1QYCA 4EPXA 3H3JA 4F1KA 5KWSA 2C4WA 2PXCA 3BSYA 1MEOA 2ZRIA 3ELWA 1ATZA 4TKZA 2R87A 4TV9B 2W43A 1DOHA 3C3MA 2HHJA 3DEZA 4HNAB 4YRJA 2YWJA 2JIZD 2O2EA 3PNSA 4ZOBA 1E6KA 3FSEA 2LP4Y 1KWKA 3IURA 1QYWA 1KH2A 2R8BA 3UTCA 4AY4A 2FPGA 3ETDA 2PCLA 2KM1A 2IZOA 4EW2A 4E5DA 5I9IA 3QBDA 1O08A 2EATA 3C8UA 3DKRA 4OI2A 4AJJA 1Z7GA 4ZCPA 1JP7A 5LVAA 4IJ5A 5LP6F 5CDFA 1G64A 3ZGYA 4EY8A 3U9SA 3HBMA 2FUKA 3AUKA 1GGFA 2GVZC 2R1VA 4YRSA 3KSUA 3PFWO 1GKIA 4LXTA 5KTMA 1FA9A 3H2BA 5I4CA 2AK3A 2I7DA 3BCHA 4MI1A 1GZHB 2ZYWX 2E48A 4BCDA 1EWYA 4JP8A 4JOBA 3SLKA 4BV2A 5IN4A 2VWQA 2HJSA 3WGUA 4NAUA 4B6SA 2B99A 2QX9A 4UUAA 3CKMA 4PLGA 4BLWA 5HRUA 1TT5A 1ISPA 3F5SA 4X0EA 3VZBA 1E96A 5J58A 1V5WA 1EVEA 4FE4A 4LBYA 5KOHA 5HJ2A 3DB2A 3JWPA 4JIMA 4CM9A 4DMRA 1Z4IA 4RMIA 2XZTA 1C3OA 4W8OA 3NHPA 1FRVA 3EPKA 2QRVA 5CB4A 3K9GA 3EX7C 1C0IA 3DKPA 4FFPA 3MWGA 3QX3A 1XZGA 4GSLA 2P5SA 3U7FB 4I4NA 1UBUS 3SSOA 2FZKA 3BCUA 3M9XA 3AHFA 2GEJA 2EZTA 2HBYA 2WSSA 4FX5A 4L0DA 4Q12A 1WDKA 2TMDA 1Y6FA 2X42A 1U6JA 4FYXA 1IPFA 4EHJA 4GYJA 4NOKA 1GZ3A 3IUYA 4GO1A 4GBJA 3KT0A 1C9DB 4IHJF 3DMYA 6NULA 5LZ5A 1M6WA 1N6IA 4U9HS 2PA0A 2F4NA 3EA5A 2AZTA 3CGGA 3QPCA 4H4EA 4M53A 2F6RA 5H7XA 3RLIA 3PD7A 3UPDA 3EULA 4J1QA 3ZJ5A 5KB3A 1WU7A 3OIYA 3ZZUA 1E9FA 4G0QA 2H18A 3A9VA 4Q4AB 4B31A 2BBWA 1JT2A 2G1AA 2IYRA 1Y4UA 1WXIA 5K1ZA 5T3YA 2AN3A 1LBEA 3WV5A 4KWTA 1UMDA 2J3JA 1XEFA 2YASA 4MRRA 3TE6A 3ZD7A 4Q34A 5L45A 2G1PA 1HEYA 1JLSA 4GZ5A 1B0UA 4IKOA 5AOVA 3CX4A 3KP1A 2X7HA 1JDBB 5G2OA 4KFSA 3AUSA 5KPJA 2IEIA 2VHEA 3O90A 4AJKA 1F8YA 5DCUA 5B6PA 1Q7BA 1TGVA 3IMGA 1F20A 1VKHA 2BGNA 2QL5A 4FYYA 1ST2A 2AR7A 1XRLA 5KQPA 4MJLA 1O5TA 3IXMA 4CIWA 1RSZA 3D5TA 4PQFA 1F7VA 3S2FA 4YMLA 3AETB 1Y63A 1L5WA 1RE1A 2A88A 2OWDA 3CE6A 4AW9A 4CT5A 2FSPA 3NM4A 4U6QA 4YMWA 1NP6A 2AQKA 2I6QA 1JBKA 2WAYA 1N6RA 1ADCA 2YYZA 4J0EA 1F8FA 2OCKA 3U4QA 1T0IA 4TRJA 1QIFA 5BT9A 1EZ4A 4B47A 1HNWB 2NP6A 4C30A 2UVQA 4N8DA 4XIYA 2QVBA 4HL6A 1W44A 3LI2A 4XUDA 4ZALA 2G72A 5LIRA 1JH8A 1XF9A 1XMXA 4YJFB 3Q8LA 3C41J 1X1BA 3U4QB 4YJHA 3BZWA 3Q11A 4G4JA 2WNHA 2YNMA 4CVNA 4RS3A 1PQYA 1P1KA 1M6HA 1TF2A 2AOUB 2QPAA 3GJZA 5FP0A 4R1LA 5I4KA 4G2TA 4DW8A 4CPDA 3RVMA 3EGXB 2VDPB 4EB6B 4QO8A 1PGQA 2XCTB 4V1CI 5EHIA 1E62A 3RAEC 1WMEA 2V3WA 2X5XA 1AQNA 2B94A 1PE0A 3AM5A 3JTEA 4DJAA 4EKYA 4RPHA 2HB6A 3LQQA 2OSBA 1D2MA 3OM0A 4NNJA 5KDLA 4LJ6A 3I37X 1I1QB 2I6TA 4J7UA 4KG7A 5EUMA 5K0TA 2DGDA 3IOYA 4Z3OA 1YRQA 3D6MA 1QZUA 2XE7A 4OYHA 4ZVKA 4YRBA 2R7KA 1IN1A 2QTRA 5EPEA 1BCRB 4FFRA 4KX3A 1M3SA 1BDJA 2WF7A 3QI2A 4Z9AA 3ZQJA 3DEKA 5CXXA 4H1WA 4QTUB 3KLNA 3GLIA 4BRZA 3QA9A 4IIEA 1AKQA 1XXHE 3D8RA 3MINB 1E8NA 5AVKA 4H7KA 4F3NA 4H3KB 3LWDA 2RGXA 1YQUA 3OTWA 3CG0A 1VE9A 3JQFC 1LDMA 1O2DA 1QH0A 5G0SA 1R8SA 3TOVA 4B3XA 4P36A 1H6AA 1RQLA 3ER6A 3WFJA 2CBXA 4KNYA 2AMFA 1WZIA 2O8BA 5EZYF 5FWAA 3RLFA 3FUWA 1BMFD 3K6SA 1U63A 5H5JA 5DH9A 2X6TA 5JLAA 4RGYA 4CLDA 4UCWA 3C5VA 5IVDA 3K70C 3WLTA 2AB0A 3T52A 3Q7TA 3BIFA 1Q5PA 3A2MA 3GJTA 4PAMA 1Z4QA 1M75A 3KJIA 3QVJA 2UZIR 1ETHA 1U7DA 4RVUA 4EYOA 5AJXA 1GTG1 5KVCA 2P9CA 5CG2A 3IEXA 5KYGA 1E3SA 3HN2A 2NV0A 4EHKA 2IOHA 1KZ1A 2HEGA 3AHDA 1NXXA 5AIBA 1RABA 3NIBA 4KXFB 4ZCRA 6YASA 2ZSBA 4ZDWA 3EQ9A 3OVMA 4U3JB 4O2BA 3UW3A 4MTCA 3KJGA 5E6RB 2BSAA 3ZWCA 4A92A 4HSGA 1OGJA 1D2EA 1ONOA 3BGVA 4KQCA 1L6RA 2CXRA 3JQDA 2IPMA 2FEMA 3KZKA 1TYDE 4NYMR 1ULSA 3THOA 4FLMA 1JQDA 1XRMA 4UCQA 4DCVA 1NQOA 4G8BA 2FEPA 1B8OA 1H9CA 2YWHA 5J2TA 1P29A 1FSGA 4V2UA 2BGIA 4P4SB 4RKRA 3DHNA 4DQKA 5IFKA 5JYEA 3OZDA 1PF7E 4F2WA 1IEWA 2OUIA 1B6TA 2BTEA 4ASUD 5CB6A 1EVJA 4XCQA 4EBFA 1I4DD 3EIWA 4OXKA 2X9LA 1RI1A 1CNMA 3IERA 5I9LA 2DBZA 3HBLA 1AN0A 1MW9X 4OAQA 4DWOA 2WWIA 4IZHA 4ZIRA 2JFUA 1QTIA 4XM2A 3N59A 2YVQA 1LZLA 4HDOB 3VHXB 1Q19A 2R4QA 2C5HA 1JMYA 2XMCA 1U3TA 1Z2PX 5CCDA 3ZHYA 1N5RA 4C0LA 3SQOA 2NT4A 1AQIA 1TPYA 4FBGA 1IL0A 4WXRA 1C1XA 4ZEXA 3PD0A 2DFKB 1USKA 3DXZA 1Z82A 3HKBB 3ACBA 3G5UA 1JQLB 2JRCA 3OLZA 3I1YA 3N2EA 1M8PA 3F78A 4Y2GA 4Z9BA 1RMYA 2YWXA 2WZQA 3UUFA 3CLUD 1FF9A 3N2KB 4NBKA 1NKSA 1YS1X 2RIRA 1WWKA 4OH1A 1ZCZA 4G1MB 5TNXA 1JXOA 2Z3ZA 1U8EA 5C5EA 1X3LA 2BKLA 2EW8A 3ROFA 5LA6A 4NP6A 2HRZA 5F98A 2C2KA 4MLPA 1PVVA 1VE3A 1NVVQ 4KQKA 3FSJX 4MW9A 3Q9SA 4R2XA 1GDDA 2QVCA 1NYRA 4CDNA 5E9WA 3DDCA 4MUYA 3C6MA 3Q40A 1M5TA 1R8XA 2FRDC 3BRWD 2E9SA 1X1CA 3HDJA 3P0FA 1PV4A 4HRVA 1QHSA 5J3JA 2Y1LA 1Q1GA 4CIVA 1M5UA 1E2NA 2CFCA 4HHEA 1NIJA 2PGAA 4EHFA 1KOLA 3DZBA 3EZFA 4LJ9A 4XDGA 4BX8A 1WOMA 3P1JA 5FJJA 4CFYA 2G5PA 1C2YA 3W6PA 1A4RA 2JGJA 1Z7WA 2Q5FA 4RKQA 2B21A 3NOXA 3G82C 3PNPA 4TZKA 3WYGA 5CCBA 1NJFA 4AJPA 4CIDA 5H3CA 4IEFB 4JL8A 3W5UA 3FDZB 4IHKA 1T9DA 3RAFC 4KR0A 3PT5A 3LCJA 4QXAA 3TFOA 2C59A 1U9YA 2IYUA 3UJ8A 3GN2A 2B9EA 1EX1A 3WMWA 2DFNA 3LSTA 4RD6A 4FINA 2IHJA 4J2TA 4HH4A 3ZGNA 5CDYA 3IDSA 1I6MA 2ZVJA 4BKOA 4ZVRA 5FJIA 4PHFA 4IIJF 1YO6A 5KNBA 1LDYA 3SNHA 1K7XB 5ENVA 4UHDA 1RCFA 1Z13A 2O3JA 1AGXA 3ZEAA 4CNQA 1ISJA 3RIGA 5BN1A 1OUMA 2NXCA 3A4TA 4L2IA 4OHMA 5CR9A 1YZYA 2M1ZA 3LMKA 2R97A 1T2CA 4EPTA 2QJWA 3ND6A 4R54A 3Q41A 5CLQA 5TS2A 4L76A 1Z83A 4DSOA 4OU4A 3MIZA 4K40A 4QECA 1TKBA 4JBWA 4KBGA 1U1FA 2VPWA 4DV5B 1WSAA 2C5EA 4OB7A 3NWPA 3SYRA 2QSJA 2L42A 4WCFA 4J43A 1KQOA 4QG3A 4URZR 2DHDA 2WIGA 1F6BA 4B80A 5FADA 3ITKA 1EQUA 4MW7A 4UEWA 2EBWA 1IOZA 1RIIA 2JLSA 3AUUA 4N6GA 1ZM9A 1UDWA 2KJQA 2QR3A 4KO3S 4KUHA 3OC6A 4JC4A 3PQ8A 3R8FA 1PSWA 2A0XA 1VSVA 2EKPA 3AETA 5ESXA 3CBQA 3MJVA 3TNDA 4Z7NB 4LXXA 4UNIA 5LQJA 2HMAA 2Y6UA 4PQRA 3CVUA 3HS3A 5L3QB 3K2BA 3N8DA 3OF3A 2B1RA 2JD2A 3ZW7A 1U2GA 4DC9A 1C4OA 2RC5A 1L9KA 4RA9B 4RD1A 3SAJA 3OJXA 4ROSA 4MW2A 1IY2A 3PDJA 5AW9A 4H0NA 5FI0B 1KR2A 1HC7A 2QM3A 2VHXA 3LK6A 5EGSA 3JSAA 2WWHA 4WLEA 5LLSA 2VF8A 3KJQA 1SG9A 1Z38A 3ESAA 1D6NA 3D5EA 3G1UA 1ISFA 3MMZA 2PUDA 1A96A 4UM9D 3W05A 3PNLA 1UBMS 2GTIA 3HYSA 3PRYA 4MYSA 5J4VA 3ZGLA 1KI3A 3EODA 4NRDA 4CFSA 3TLGA 2VDOB 1Q2XA 2V7BA 2FMFA 2XY4A 1L2TA 5C8YB 5ESWA 1VL1A 3IA7A 4HAVA 4YPVA 3OT4A 3ZOKA 1IATA 1GL7A 2Q4BA 4LKOA 1B43A 2FN8A 3GGPA 1VE5A 2GLTA 4FKBA 4ZT2A 4DADA 2WMDA 5ILGA 5DGIA 1X80B 2Z6QA 2NU6B 4GI2A 2IW1A 2RGAA 3GIDA 1S3GA 3KQPA 3UJNA 1HFEL 1AO3A 1GRCA 4IOKA 3S29A 2ORWA 3FMIA 2NAFA 1IONA 3KKMA 3OWHA 4JT9A 3O91A 4O1HA 4YJGB 1OZHA 4F60A 5JFOA 4MITA 2FWPA 2O8NA 2FWBA 1M1YA 2O6HA 1SRQA 3UF0A 2H4FA 2BGKA 2CN1A 1Z0DA 3AL2A 2HV8A 3UBMA 1VBKA 1ZHHA 3W9BA 5IF9A 1XNQB 2IL1A 2B7LA 2G0NA 3REQB 1NR5A 2IBMA 3AUJB 1Y3AA 3DDNA 3FRIA 2XNKA 2ZJ1A 4TXNA 4CKXA 4RTLA 1M1YB 5IVHA 5EXSA 2NTYC 2NM0A 2X5NA 3DUFB 1CR1A 1CR0A 1GZ6A 4QBFA 1VI5A 3BGIA 2OZPA 3FMFA 2FR8A 2DLDA 1K8RA 2FSGA 2WC1A 4XD7D 5LM3A 3OQOA 2OSVA 4PLPA 2PMFA 2ZJ7A 3HY4A 1P7ZA 3KPWA 1HKHA 2PX3A 1SA0A 3LL7A 2CLMB 4PX3A 5AWFC 2XJ4A 4CF5A 1RJDA 1DQYA 3F2VA 3OHMA 1XZLA 3NW9A 3FYDA 3OOHA 2KI5A 1KOFA 2F3UA 3R0IA 3PGMA 5SZKB 3SPXA 3WBBA 1I01A 3PWSA 3L43A 1HWYA 3MOSA 4ND8B 2M9MA 2GBIA 4JJIA 4PGMA 4W5WA 1E1NA 1XLVA 3JQAB 4UZFA 3TQCA 1BQ3A 1DWOA 4W1RA 2V7PA 3TW0A 4QASA 2C4VA 2DJ5A 3MJDA 4IUDS 1V11A 2J9FA 3GHYA 2J4CA 4OGGA 1U0OC 2GRJA 2MTBA 2Y67A 3NTOA 2IIBA 4U2KA 1T5SA 3DP7A 4EJ2A 2IYWA 1KOGA 1NDHA 2IPAB 5KJ6A 4ISCA 4PLYA 4RC9A 4ARUA 4JBGA 4R0MA 2PT6A 4GPEA 1NFFA 1X74A 1LC0A 3AGPA 4HQFA 1EXMA 1UM8A 1GG5A 4ERXA 4Z6KA 2WUEA 3AI7A 4X41A 2H2IA 3IP5A 4PWZA 2V7GA 4QHSA 2GM9A 4MDFA 1E6UA 4JX9A 4U6SA 4YCSA 1TLFA 5CB4B 1H66A 4NBWA 1BAPA 4UU1A 1ML3A 1XO1A 3P2EA 1KEZA 2R8OA 4YS6A 1B2LA 2J48A 4NK4A 3WLIA 2JI4A 1NW5A 3OQBA 3PF8A 1VLMA 4Q47A 4F3RA 3QX7A 2C8KA 2I29A 1CE8A 4W8HA 2GD2A 1VKRA 4FW9A 1LDBA 3LDFA 4E70A 2IYEA 2XMQA 4US2R 2XCQA 3NKVA 1DTEA 1N5OX 3P94A 3EVAA 3P9QA 3D4NA 3H9JA 2VEOA 1H3NA 3QELA 1KU0A 1JLRA 2CFRA 5K51A 2C2HA 3DDUA 1N32B 1OFVA 4LUCA 3N2GA 3O4IA 1Z36A 3MYYA 1T8YA 1RMTA 3G9QA 4G5OA 2OHOA 3OZAA 4JJ7A 2IXTA 5DTMA 3OICA 3NJ4A 2H9AA 4XLTA 4F2PA 2VUSA 1HDOA 2A94A 3TCXB 5JSZB 1RXIA 1ZW1A 3OIWA 3VZRA 4Q6BA 3BVPA 4ZARA 1GIAA 4HUTA 2WG1A 4G9BA 1GGJA 2D1TA 1T5LA 1IN8A 1O94D 3B2NA 3IUJA 1XEWX 5IM5A 1JAXA 1SBTA 1URPA 2PRIA 1FDIA 2MMCA 3Q7IA 2WSIA 3M9WA 3Q1KA 3R1IA 4QSMA 5DK6A 4B6JA 4F4IA 4PYJA 4CEHB 1S5PA 1Z0SA 1M8FA 2VF7A 3AUFA 5IX8A 5CK5A 2J9RA 1P7VA 2C4KA 1I94B 3HP4A 3GCGA 4Z7JA 2RC6A 2VLIA 4MIKA 4Q05A 4C0WA 2R5WA 1E32A 1OASA 4HO1X 5CBKA 4TRMA 3FFWA 5REQA 4QRIA 3WZMA 5IANA 4D4HA 1RLJA 3QHQA 2I1LA 1VPDA 2V5UA 1H94A 1O8CA 1Z16A 2J5QA 3CKYA 3CUTA 4L8YA 3HU3A 2Z08A 4G65A 4IS3A 2Z2YA 3PC7A 4WNIA 4CMBA 1YU6A 3CZMA 3E23A 5B1HA 1KF0A 3E3MA 1UMDB 3QLUA 3R7WA 2QN2A 3K1AA 4FMBB 4YECA 1GSIA 1NM5C 1QCZA 1KVUA 2NPIA 3BRSA 3GI1A 5IAAA 1U7UA 1QPGA 4CKEA 4M1OA 3ECCA 4HAIA 3EWNA 5AVXA 4ESVA 3L8EA 4MVJA 2J5BA 3HVIA 5D6NA 1MAWA 3MMXA 3QSGA 4Q1EA 5EESA 2XUPA 4GXNA 3L93A 4JELA 2PX8A 4QXMA 2GPTA 4RPCA 4RWEA 3A26A 3ZDCA 1K5HA 3L79A 4W99A 1ELOA 1QUEA 2ENUA 4MKFA 4ER5A 4Z7QB 1QMPA 4HNGA 1ISMA 2OVBA 4WACA 1HDEA 3AEYA 3MT7A 3WO0A 3V4PB 2R6DA 5FB3A 1J1IA 1MAHA 1YZTA 3W7AA 4W5OA 3O31A 5ARBA 4XGKA 1L5YA 1AUQA 3HCBA 1FP4B 4PZAA 1DE0A 4WV3A 5BR4A 1CSEE 4JI7B 3I8SA 5D5QA 5BSHA 5JEDA 3I9V1 4PV7A 1ZNYA 4NFLA 2XAUA 3T4XA 3LUCA 1GYQA 5E7QA 3LQ4A 2NV2B 4OUDA 2VWPA 3QUQA 4DTCA 1NLFA 5JANA 1VE1A 2CMKA 3AW9A 2POCA 4R5HA 5EHZA 3QEMA 5IS2A 4D8WA 5A5DA 3UIEA 3OZRA 3L7IA 1NUSA 1UXJA 1CY6A 4R41A 3NEAA 4AZWA 4MROA 4JOCA 4ZI7B 3H99A 2QX7A 2IDMA 3DPSA 1KQNA 3WJAA 2ZUFA 1ID8A 4FI3C 4KE9A 3RIMA 2X0DA 4DA8A 4MVYA 1K6EA 3ENNA 2YOGA 1RE0A 3RT7A 5ECYA 4X6XA 1I0ZA 3QENA 3A1NA 2VP0A 3V7FA 3C6BA 5EJMA 1CUAA 2GZ2A 1ONBA 1NTOA 3BBLA 4WRRA 4NE2A 2VT7A 3VNRA 3HDVA 3W5JA 1DIAA 1RYHA 3T8YA 3ETGA 4J94A 4KU4A 3MS4A 1SIUA 2WUFA 3G8CA 4B3RB 4D9CA 3S2SA 5AVRA 3ODGA 2AHRA 2WHPA 2ZRJA 3RTAA 2XUQA 5EYPA 1FLNA 1IBKB 2XOEA 4EB0A 4B4VA 1OLOA 2I4RA 1OFTA 1F6DA 3BZBA 1BS2A 1E79A 4X71A 1P72A 5AI6A 2YXNA 4G4IA 3U3XA 1XQ9A 3HEBA 3UK1A 4KN5A 3ZPXA 4ZCQA 3C16C 1OH5A 4HNRA 2J3DA 2ZPUA 3EIOA 1GTZA 2XVYA 4BNUA 4NSNA 4Q9AA 1KEWA 5D87A 1ZRSA 4GW3A 3GLGB 1O8BA 4U7PB 2QENA 2HSJA 1NG1A 3S28A 5FA6A 2IYQA 2QZPA 5FL7A 3UV3A 1JDTA 1T36A 2P4HX 3FE2A 4JYCA 4YUXA 1J09A 2HTFA 5M2QA 4JQSA 3ZHZA 4OQZA 1IB0A 1N5KA 1ORHA 3VPFA 4G1BA 1T9GR 1QS0B 1SBYA 4LHVA 1Z22A 4R9NA 3WYBA 4ZEOA 3TLMA 1VMDA 3LY5A 5C80A 3PPYA 3VGPA 5AJHA 4LMPA 2F4VB 3LS2A 4BV3A 2RHDA 1A2OA 1TVCA 1GP2A 4MQEA 1Y3DE 3TM5A 1T8TA 3KEOA 1BZYA 1JILA 1SOVA 4OHFA 5L3SB 2B61A 3P96A 1LBQA 2XE8A 1OAAA 3PX2A 4FGLA 3OETA 2VBIA 5EFZA 2GPBA 121PA 1RBMA 2CVHA 2GZAA 1L5SA 2SBTA 3ZXIA 4AMVA 1O96A 3SF0A 4BFYA 1J25A 1AE1A 4U7TB 4DPLA 4IWNA 2IYLD 4FEYA 3GGGA 1UKVY 4S05A 4A2CA 3G2HA 3W2HA 5ALDA 4NFHA 4W5NA 5B64A 4WNAB 2BI7A 3WV4A 4XDYA 1I2MA 1YUNA 2Y4NA 4P83A 1PJBA 3W6ZA 5LPNA 4FC6A 1T15A 3AV3A 5E6UB 2O2GA 3PGJA 3NBFA 5GZ1A 1W4BA 1JKIA 4WKBA 4W4TA 1F8UA 1PQUA 2ZJ0A 1BFDA 1C5KA 4NJMB 1VCMA 3ADCA 4CKBB 4ZXPA 1M0SA 1KEVA 3I0NA 4QPZA 4XPZA 3Q7SA 5T7BA 1WMAA 4ER3A 2IUSA 3RADC 3DAGA 5DDIP 3VPBA 5E2BA 1QRTA 4HWSA 1H2BA 2E0IA 3U3DA 1DXYA 1U3WA 4EJFA 3WXBA 4BGEA 1OA0A 2F43A 4PQGA 5CB8A 1HDGO 4A8HA 4V1CA 3G85A 2DQ4A 1F14A 2MYNA 4TSFD 4FBMA 2H5IA 1B26A 5KNCH 1VPTA 3T94A 1MNQA 4C08A 1A9ZA 2FSUA 3DZDA 4BMZA 2HMVA 3PWTA 4QYMA 3EEOA 2HPHA 4FFWA 4OAPA 4FLFA 1UJ6A 1P9OA 1HG1A 2A5GA 2QT0A 2NV6A 3RVJA 4UVHA 3VSCA 3ZI0A 4ARZB 3DFIA 2BRUC 2RK4A 3ZWAA 2XRFA 4RA6B 2PD3A 1YRYE 2FUG1 1I32A 2RB5A 2WAMA 3V8PA 4BLPA 1PFWA 1QOPB 4I6GA 2WE8A 3HXOA 2HUPA 3BGDA 4B7AA 5HM8A 1JIIA 2RH9B 1H0KA 4WCFC 1MO3A 1W0CA 4WFQA 4OAOA 1ODJA 1OXUA 5K6RA 1FS5A 1FYXA 2IX9A 3PQDA 3Q7QA 3EG9B 1TM1E 3QH4A 2PXXA 1V43A 2UU9B 3IBCA 4RDCA 1CQJA 1Q0UA 1UZLA 4PVDA 4US0R 4MJ3A 2IY8A 2GKGA 1T9ZA 1QE5A 1L8XA 3V7UA 4FYPA 5IRCD 4XCXA 1CF2O 1PX0A 1Z9BA 1T6XA 1J8DA 2OHGA 4D97A 2ZLBA 5EE3A 5DNCA 4E07A 4JR0A 5JASA 2ZE5A 2C77A 3JZIA 1GCOA 2XDYA 4EDFA 4ZI3A 5ITVA 1RWNA 5LOVF 1E3MA 2D62A 2B0CA 3EW9A 1GTVA 3RQSA 4B87A 4CEHA 5FPHA 3OT1B 3JQBC 1QCDA 4O1MA 3E27A 2PYIA 2GILA 1M1UA 2WINI 4PZCA 1R16A 2W00A 1O0BA 3H84A 2OFPA 5BV2P 3V8VA 2PKQO 1MH9A 1PTJC 3I76A 1LI5A 3A70A 5BN5A 1NI5A 3JWEA 3B52X 3QNWA 1U5BB 4HXGA 4BX9A 1DIRA 2GESA 4B40A 4HH1A 1APBA 4NXNB 4ND8A 2GZMA 5E3IA 2C2MA 1OY1A 5YASA 3ES9A 4GL2A 1EEHA 1QOZA 4JLUA 3LCVB 4LV6A 1RWQA 2KYRA 1GQFA 3MTQA 4IUCS 4P81A 3QEOA 2IHYA 3SZRA 3H3XA 2ZKLA 3E3AA 5LLTA 1AC5A 3VR2D 2ZRQA 3VJRA 5BYAA 2SCUB 1PG0A 2O3UA 2P2ZA 5EG5A 1H93A 2XUGA 4EL0A 1Q91A 1WCIB 2DLCX 1PJTA 5IT5A 5KNCD 2QRJA 1IWBB 2R47A 2XB9A 4ER7A 1YFLA 1Z0ZA 1UPCA 3CMMA 3UNXA 3FFTA 1GKYA 4MO9A 4D2IA 3H7AA 3GLIE 1O0CA 3LOUA 5FOXA 1E4EB 1NW9B 4UNSA 2FEXA 3HR4A 4XKJA 4E2ZA 1UC5B 3JSXA 4AQDA 1LI4A 3UA3A 2MMGA 1TEVA 1LLCA 3ZWBA 3ICOA 1VBNA 4RHYA 1X1SA 1UEXC 2WM3A 3CNHA 3HBNA 2QQGA 2ID7A 1XLWA 2WICA 4IIJA 5JCOA 3EQ6A 2J0UB 4G23A 4L16A 4YRTA 3DNFA 5LQAA 2RE8A 1DWQA 4HWOA 2HYDA 3MILA 3SR4A 2FW9A 3GNSA 2X9GA 2ZXFA 1V8FA 1ZN8A 2QR2A 3H16A 4NYIR 4P34A 1SBQA 2GI4A 5JQGA 1TKCA 4NEQA 4JFRA 5HFAA 3RS0A 5LJIA 3WDMA 4MGYR 3GN1A 2ZS8A 1IPHA 5EGNA 1A82A 5ED4A 3M6IA 4L51A 2WWGA 3ZNPA 4CZ2A 4GYWA 5H3LA 3TXXA 5JJKA 3VC1A 1OAOA 1EBUA 2AW3A 4HDMA 1O77A 1FX0A 4RDIA 4PSVA 4DF3A 3OAAD 4D9FA 1NN3A 1Q7TA 1WL8A 1ORWA 2Q9AA 1YB4A 2CLSA 2YBEA 3A36A 3OZEA 5DGCA 3UK2A 4B09A 5F7OA 4QPDA 4HGYA 3T5TA 4QEDA 1H6BA 3CIOA 1ECJA 4UPEA 3N87A 3ZCRA 4P0QB 2GZHA 2GKSA 3IP8A 1CDEA 3OQNA 3TOCA 2EFDB 1BXRA 2IXAA 2JI8A 2LBPA 5FL7D 3X1MA 4I19A 1BIFA 3Q3HA 1G7RA 5AXAA 4EHHA 2ZUWA 1FNBA 4W5HA 3DG9A 3OTOB 2DCUA 2BH2A 5TF0A 2R751 2J08A 1BO6A 4PLVA 5AVZA 2NTJA 3DMRA 4Q03A 1B23P 4N6NA 4NARA 5EL0A 2HA2A 5EJ4A 2ZS9A 1UBLS 3MWJA 4U6NA 3T3DA 3E53A 4Q4HA 4TKMA 3ZDBA 3DMTA 4M1TA 4E6PA 1C7IA 3MEQA 1KY5A 1TJNA 3DJYA 3ZGVA 1RAEA 4PY2A 4Y6SA 2AVDA 3TEMA 4DCTA 3U49A 2DPXA 2NZUG 5DXJA 4FE3A 1P75A 3IPXA 4P7KA 4PZZA 1N8NA 5E4FA 3PFNA 4HYQA 5J2TB 3LQRA 2WF9A 5C1BA 1HYGA 4IOJA 1PJRA 4YI3A 1PW5A 1W46A 4RLSA 2ZATA 1XQXA 5B3KA 1RQ7A 1FU4A 1QTNA 3TMYA 2OD9A 2Q4OA 1WXEA 5ALEA 5C0OE 5HILA 1OYYA 4KC0A 5LP6A 1BJRE 2G04A 1P5RA 1OI7A 1XNGA 2WYUA 3IBYA 3T9BA 1ENOA 3I9NA 2ZR0A 1E7WA 5K0NA 3WA7A 2BMEA 3S44A 4P98A 1WPXA 3B7PA 1SXJC 1E61A 8ATCA 3NR2A 1CIVA 4Z1MD 1VP3A 3K4PA 2C94A 1S96A 3G5MA 2P8JA 3IIMA 2C2ZA 2HU5A 2OYSA 3HJAA 4LNAA 5ER9A 3TG8A 4R9SA 2OZEA 4FOTA 4TV9F 3BFPA 4U0JA 5EKUA 3CEJA 4ZI2A 4NCKA 4HX5A 4K86A 3R3XA 4XQ9A 1LLQA 4CMHA 4EFNA 4P86A 2GEBA 2MOKA 1RWWA 1DT3A 2CSUA 2WG0A 3PUJA 2ZCVA 4HQRA 4AMZA 2KSQA 1XKTA 2IX3A 4CQNA 3E8SA 3S70A 4B79A 3KZVA 3I9JA 4WY5A 4JSTA 4Y9UA 2XHEA 4ND5A 1YDWA 3ZGOA 1HSOA 5H4HA 3VNSA 3REGA 4DCUA 1A9YA 1FFCA 1VI6A 3VA7A 3OLYA 5TMEA 2PUCA 4HTFB 4Q4JB 5TR9A 1UMCA 4ZRNA 3VM6A 1TA9A 2QRLA 2V1XA 4JDPA 5D1HA 2ZJFA 4REQB 1HZZA 3MK31 4BTEA 3NEJA 4TVBA 2ZSJA 3TIXB 2V7XA 4BQPA 2Q5QA 1QH1A 2FXVA 4QWWA 3EPJA 4KOAA 4QGSA 2CHEA 2YXPX 3NATA 2ASEA 4AXXA 1F3LA 1LBHA 2VP2A 4QUJA 3AR4A 1KIFA 3OQIB 1KHTA 1TC2A 3HYLA 1EB8A 3OZTA 3ZE0B 3SDBA 4U7FA 3VI4B 4ARZA 1N2BA 4BE7B 1QDLB 2Y71A 3LUGA 4MDEA 1RAAA 2H48A 1DFIA 1Z08A 2EU8A 3GRUA 2OMKA 5JC1A 1I4LD 5F77A 2DUMA 3TX2A 3EC7A 4BHTA 3LHKA 3WBJA 3RABA 1GY8A 4PSCA 1U2PA 5SY6A 1HKUA 5A3RA 1SQ5A 4GPIB 1F0PA 1RI5A 3H5TA 4KSBA 4RWZA 2Q2NA 4PLWA 1J42A 5DNEA 2GYUA 3P0EA 2CV0A 2WLTA 2X5KO 3LPNA 1V6CA 4TL9A 3OEWA 1Q1AA 2V0CA 2K7FA 3ZVLA 4YCLA 2BDEA 4Q82A 1E6MA 1UKEA 2JIOA 2Q6OA 1AKTA 4I4TA 5ALUA 4DZTA 5BWBA 4AMYA 3JS5A 4WVFA 3PVSA 3WADA 1DTWA 1YMUA 2YHBA 2HSGA 3ILSA 3FCCA 3QFRA 4MLCA 4QPPA 3WP1B 3GP8A 3IUNA 1KRXA 1MD9A 3LSYA 1B14A 4RHFA 3TE7A 1BMFA 3RTEA 5B37A 4OATA 2G9QA 1N0HA 2G09A 2AH5A 3L46A 2ZWMA 4R71A 2PUWA 1SZCA 3GRPA 3CZRA 5COAA 3N7UA 1U6IA 1QZZA 4WN9A 2IFTA 1KKUA</