2JFWA

Crystal structure of enterococcus faecium glutamate racemase in complex with tartrate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Isomerase
total genus 96
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA01
3S81A 2OHVA 2DX7A 2DWUA 3UHPA 3OUTA 4B1FA 5HRCA 1IU9A 2JFUA 5HRAA 2OHGA 3UHOA 2OHOA 2W4IA 2JFXA 2JFZA 5HQTA 2JFOA 2VVTA 5ELLA 3ISVA 3ISTA 2JFPA 5ELMA 1B73A 5HJ7A 1ZUWA 2EQ5A 2ZSKA 2JFQA 2DGDA 3HFRA 3OJCA 5IJWA 2JFYA 1JFLA 3S7ZA 5EVCA 2JFWA 2JFNA 2JFVA 2GZMA 1B74A 3UHFA
chains in the Genus database with same CATH superfamily
4DV1B 3ST7A 5DGTA 2JJMA 3CLUD 2YS7A 4YH1A 5DIFA 2F43B 3NHSA 3RIHA 3A9CA 1IQRA 3PGLA 3BMCA 4HAIA 4IG4A 1XG5A 4RYDA 3WGLA 4TMTA 1IRIA 1UPFA 1TVEA 1O8CA 3L7YA 3UCEA 3TUZC 3NTRA 1VBKA 3KXDA 4NP6A 3DOEA 4MOWA 1FMFA 1CF2O 3NRJA 5HKKD 4EY3A 1X1SA 3TNYA 2ZWAA 3MTAA 1G8GA 1RBMA 1EVLA 2RIPA 3MW8A 3SR4A 2PUDA 3BGDA 1TZ2A 3E5MA 4BMOB 3EODA 3GNTA 4MAAA 3TSOA 3DA8A 4CIBA 2NXJA 4L3WA 2XUHA 1D4OA 4IZHA 4XEHA 4S0ZA 5BW6B 2G0AA 2IOQA 4UNQA 1RMTA 1XL0A 4G6ZA 4H3VA 3Q40A 2GF9A 4Q9JA 5JXWA 2YWBA 2J59A 3MAJA 5AP9A 2H1HA 1E2PA 3OCYA 2EFEB 1Q2UA 4XIJA 4DC1A 5LQCA 2PUVA 4Y1RB 2NUAA 4IH9A 3NIWA 4R01A 3BIWA 1ZMBA 1N2CE 3IUEA 3AB8A 3RC9A 3BJRA 1ZBDA 4MR7A 1GQSA 2QRLA 1Q0QA 2XUFA 3EXHC 4H7FA 4HD8A 2YQ5A 4KAXA 4L9WA 2M6LA 3SC3A 3SKXA 5LN1A 1XMSA 3MTIA 4MI1A 2M6SA 1U3VA 4EI9A 2NNWB 3EA0A 3A1FA 3GG2A 1WQ3A 5DBEX 5AKLA 4DCPA 1TQ8A 2JJ8A 1F1BA 4UBJA 2RHHA 2VZ8A 3KTOA 4JGIA 5GIPE 4Y9UA 3TM4A 3UGTA 1OY1A 1LZLA 2EHDA 1JG7A 1U31A 4QODA 3DLHA 1J2TA 2FI1A 3K32A 3RDPA 4IHJB 5A9TA 1KO7A 2PMBA 4EEKA 2BZ1A 5L3SB 3CGWA 1YE5A 4OQEA 5DBOA 4R1PA 3TW8A 4C1NA 3ONNA 2B5WA 1VLVA 3RGWS 3UKOA 4Y2VA 4GGMX 2RBKA 2YS6A 1S9DA 2BHRA 2NSHA 3JZDA 4XSHA 2WF6A 2BSAA 3EVBA 3ISJA 2JFZA 2OHHA 3MIZA 3NOXA 1XTKA 4TSFD 2L2QA 4EITA 5IJAA 4KVZA 3AP2A 4UFPA 2PYDA 1ONNA 1PKEA 3MTQA 2RHMA 3MHTA 4M0CA 5JMPA 5BSRA 4YT8A 1ZRSA 5CAEA 4RX1A 4HC4A 1T9HA 3UUGA 2GBGA 4RA6B 1T5BA 3WNDA 4B82A 2VHVA 1E1YA 3JQPA 1S2DA 3NGLA 3QBEA 1TD1A 4HAZA 5FUBA 5JS6A 2GZMA 1SOVA 2WVAA 2ZE6A 2FRXA 1XI2A 3DE5X 6NULA 5JTUA 1AMOA 5D5QA 1CPYA 1J49A 4F6CA 2C07A 1GY8A 3NAMA 3KO8A 2OQRA 4C7XA 3E23A 5BWBA 3K71B 4DCJA 3EFHA 1SHLA 5JC8A 4KR2A 4OQXA 2O0JA 3JZAA 3IELA 3STUA 2ASVA 2I6XA 3OU7A 4MUHA 1IEWA 1Z4NA 1TUBB 1QO7A 1WCIB 2A7QA 2N3ZA 5TPZA 5FNVB 1ELOA 1KYIA 4IR7A 4BBJA 4KTVE 2QE7D 3V3KA 1QIKA 3T54A 4NKRA 5JPIA 3WAGA 4GPD1 3KSBC 3HWWA 1FS6A 3W6UA 1BA3A 1Q84A 1E2DA 2ZIFA 3AETA 3R6TA 4J94A 1C9DB 4N5NA 1G8HA 1G6Q1 1P7YA 4URFA 4O5AA 2DQKA 1PJLA 3PSAA 3MJCA 4JJ7A 4UVHA 1HNNA 1DPFA 2WLTA 3QFFA 2BKEA 3KEFA 1Z45A 4MX8A 3WWCA 2W5UA 3QPWA 2OM6A 4Q7JB 5K20A 1RD4A 2VXYA 2GCOA 2P67A 4R1OA 2L18A 3L6UA 2ZKIA 2VRWA 2GXAA 3TUJC 3U0BA 4GT1A 2D13A 1ZONA 2ZRCA 4RJLA 3ZE0B 2E5FA 4AWAA 3E22A 2F9LA 4KQXA 3LA8A 1P2GA 2OGWA 5HDQA 2J0UA 2FUNB 5HJ7A 2CV2A 4Q48A 1PZNA 3TJRA 2NACA 2BUBA 2WIBA 1T36B 1WSDA 1GDHA 3GLIB 3L8ZA 1L5YA 3HEBA 1Q12A 3K72B 3NWBA 1JRLA 2Y1OA 4KQEA 2D2FA 4F92B 5BVGA 3VR6H 4UMEA 1EX7A 2K7FA 1PU2A 2OK8A 3D4OA 1IG3A 5GY7A 3A26A 2IV7A 5BWMA 2ZSUA 1JWAB 1OYVA 1VI5A 4BE4A 1NTOA 4F38A 3EDRA 5C8VA 2PS1A 1WD7A 7ABPA 2ZS9A 5AW6A 2AD5A 2AXPA 4KO3S 1CUAA 1PT5A 2J3JA 1N4AA 1OKKD 2YXDA 3WGVA 5AVZA 2VK1A 1JG1A 3FIUA 3L7DA 4KMSA 4G24A 3Q9LA 4C22A 3R7NA 2O5RA 4E94A 1T25A 4CLOA 2EU8A 2WG1A 3NHFA 3VPSA 3FLBA 4IUBS 2D2VA 4KR9A 3WFJA 1VL8A 4NL4H 2QSYA 1QM5A 3HY3A 2GGSA 1AKNA 1LPSA 1V8DA 4JC0A 4TLCA 3L1VA 5EJ8A 2X13A 2WJPA 4HUQA 1RZRD 4D9KA 1WSWA 2HMUA 3DMGA 1V3QE 4WN9A 3BK2A 5IJ0A 1W8DA 2LRHA 2ZR9A 2ACVA 2WD9A 1Z8DA 3L5OA 1HMYA 3PXDA 4OXXA 2Q2OA 1KGSA 4UCFA 2UAGA 1Q50A 6REQB 4X6XA 4YT2A 5C1OA 4F5ZA 4LV5B 5TQJA 3COWA 1K7FB 1WVMA 2AZDA 2XDQA 3ML1A 4S24A 2VSXA 4R8SA 5HW0A 3IPYA 3KPYA 1EE9A 3MAAC 2FUKA 1XOIA 4OJMX 1B8PA 2IYSA 4J7AA 3ZKWB 4E09A 2J5XA 1MX5A 1XJWA 4UULA 5E7IA 1U8FO 4R1NA 4QTTB 1ZGGA 4DMMA 1V39A 2B7CA 2R4TA 2A9PA 2G5TA 1L9KA 2CHUA 1V7CA 4R6XA 4XTCS 3EBLA 3SCZA 3NKFA 2J3DA 1VECA 3W7AA 2O8NA 2C9OA 4I50F 5ESWA 4PHCA 4J16A 4OO3A 3UGJA 3RU3A 5C80A 1SAYA 2X23A 4I1IA 4Q9AA 2GF2A 1NN3A 4IFTA 4AULA 1RDFA 1NP7A 2AI2A 4HXYA 4M6WA 3W6ZA 1XB2A 5J4VA 3COPA 2AXEA 1XCBA 3MRTA 4YCLA 4NSNA 2I66A 1ZUNA 2VQ6A 4RM3A 4EJSA 1NRJB 1T0UA 2HGZA 4W1SA 2ARKA 2SCUA 1PL6A 3O8OB 3DF7A 5G1NA 3ZWMA 2I4RA 4B75A 3U7FB 4Z4FA 2BEUA 1FQWA 4G37A 2P8SA 3MJHA 4JBGA 5AJHA 5DCWA 5KTPA 3W04A 1UDWA 5DGXA 2OWDA 4NHEA 3DT6A 1XPOA 4D0LB 4N7RA 3O2JA 2VNAA 3N9IA 1TO6A 3WGOA 2PMDA 1U7PA 1JFFB 2CMFA 3OLZA 1CY7A 4DPLA 1GA1A 1PJSA 2MYTA 4RF4A 3CV3A 3N7UA 4DA8A 2Q7DA 3UFXA 1TX4B 3QVWA 4ZKDA 1KEZA 1LJUA 3SJCA 1AKTA 1NN0A 2RH9B 3QMWA 2P6OA 3ICCA 1JQ5A 4BZQA 4CDRA 5LZ7A 2PIDA 4G25A 2A58A 1R0BA 3LGXA 2OV8A 4ZU3A 2FWJA 1FW6A 5LZ8A 1BWSA 2QKYA 3GC6A 1SXJA 5J1TB 4UVGA 5AK3A 1XTVA 2ZI6A 4IZOA 2VAWA 2O8FB 4R8MA 4ARZB 3CVOA 4ESEA 1QTNA 1NR5A 1T35A 2PO5A 5JSHA 3UUWA 4LSZA 3UWSA 1CY1A 2Q5FA 4QG3A 2PR2A 2C7RA 1RHMA 5LBUA 2JKVA 2ZB7A 2DFVA 3FHCB 3QFSA 4Z6KA 5IXJA 2YOGA 5EIBD 3H05A 3RFXA 4YI5A 5CDTA 5EWJB 3OF2A 3C14C 4B2LA 4X20B 1IXSB 4NC9A 5JCJA 2IBSA 1XKLA 1T0BA 4O3MA 4OU4A 1LBTA 2PGXA 4G0PA 4QQNA 2DEUA 4IOKA 2QYOA 2D62A 4GQAA 3ZK8A 1E1LA 4IKOA 3OLQA 3USZA 3L4SO 5IAEA 4BNLA 4CKWA 1OB2A 3OM1A 2WZCA 1LPPA 1MB3A 1ZUWA 2XKAA 4ISCA 4W1RA 5DOVA 5DT2A 1KNXA 1S3SA 4X91A 1L1FA 1VM6A 3MF4A 3WO0A 4GOLD 2GK3A 4EKNB 3PEUA 1PJ8A 3H2HA 2XVMA 2WVGA 1T6ZA 4MUMA 5F4ZA 3C85A 1RHKA 2C0PA 4TZ6A 1Z08A 2C4NA 2IYZA 1TO1E 2WFLA 2OBMA 1PK9A 3MTEA 4E6EA 1TYZA 1O9GA 3W5DA 3BX1A 4JYPA 2R7NA 3QMVA 3ZI7A 2CDBA 5AI0A 5M3BA 5P8WA 3ZE2B 2PLAA 4DV6B 1KMHA 3PNSA 3CTPA 2E37A 1KZ4A 2BUAA 3DWGA 4MHOA 4RZSA 4V0OA 3WLHA 1ZD8A 4ZVVA 1JECA 3WIOA 1DXOA 3KEOA 5DBIA 3RFUA 1U28C 2Q5QA 4IMIB 4BFCA 3HXQA 4LIPD 4NBKA 2IH4A 4OQMA 4TWAA 5ITVA 5JD3A 2EBWA 3M83A 1QB8A 3QBTA 3U48A 4AJ4A 4QHTA 2W2OA 4RGBA 2VUHB 3U17A 2ZTVA 3S99A 2VXCA 4RFSA 2ZAOA 3KR9A 3SC6A 4LF6B 3CJRA 4M1ZA 1A8SA 3NHPA 2BGKA 1XU9A 4FZRA 4C0XA 5HQ3B 3TXXA 3QEJA 1QRUA 4K0KB 4Y1FA 4DTIA 3F1KA 1H3NA 4F8EA 4ZEMA 2Q5OA 1BSVA 5AVYA 4D26A 5AK0A 2VJAA 3RARA 3A06A 2COKA 2HHAA 2YYSA 4M0UA 3TX6A 4QYIA 3Q88A 4EY7A 4M8SA 3TRFA 3WRVA 4WNAB 5LMCA 5F3RA 4NK5A 4AT1A 5A2QA 2XMZA 1UXKA 2RHBA 3I72A 3NTUA 4CTOA 4OXNA 3IP9A 4S12A 1HLFA 2OZLA 4DCVA 1BD4A 1PUIA 2OBYA 1VDMA 4QUHA 3FPFA 2VP6A 3OHMA 1EB9A 2CWDA 4PFSA 1QHXA 1VYHA 3BMCB 1KETA 3SOZA 4ALJA 4B7ZA 5HA5A 1GCIA 3NG1A 3DOFA 3CTMA 4H3KB 3E7PA 2CMHA 2FVXA 1B6TA 1NG1A 3MQ4A 1W36D 2NLOA 2O2DA 3JD4A 5FTKA 3NAGA 4YACA 5LCXA 3WNVA 4K26A 4D8YA 3KYBA 4QXMA 4S1PA 1L5GB 2GM3A 4FCCA 5CJJA 3IKMB 2CL7X 2FVYA 3BQMB 4RDIA 4RVDA 5FBWB 4ARIA 3GLGE 4C0AC 4YJFA 3WICA 3CRRA 4P4GA 2BMVA 3CM0A 5DSZA 3ZGYA 4L50A 4W7HA 3KBBA 2W6CX 2C00A 4EUHA 2WAAA 5ELXA 3DYBA 4URUR 3MWYW 4ENPA 3WDKA 5ANRB 1APBA 3O3NB 5J5AA 1VYVA 3IHLA 2QBYB 4Q7QA 4MKRA 2OECA 4KRXA 5IYZF 4KUGA 2Y1CA 4CVNA 3G0OA 4ZVNA 3FWKA 1ZKDA 5D85A 2CKDA 2PXAA 3H86A 1FP2A 3SHQA 1U2PA 1ULBA 2A57A 2IYXA 3HCEA 4C04A 5H3CA 4RZ3A 1QFXA 3GB9A 4UBNA 3TXYA 1YONA 4KFUA 1GQQA 5IW8A 4UOEA 4WADA 3IHWA 3FGNA 1C8LA 2BGLA 2Y9MB 4JJ8A 1OILA 2OP1A 2A1IA 5AI6A 4BECA 4MGZR 4NARA 4BO9A 2Y99A 5I9MA 3RC1A 1U1IA 2B4TO 2I80A 3G8BA 2JFYA 1T10A 3FHLA 4UE6A 2A3NA 2C3YA 5GWXA 3QOWA 1L4KA 1POXA 1R18A 2O05A 3PR3A 4Q7LA 4FS3A 2YJNA 3G9TA 821PA 3VV2A 1UXOA 1X42A 2GX6A 3SYLA 2WWGA 3KWFA 1SCKA 4QNRA 3ZD9A 1XMVA 4LRSB 4EHIA 1HEIA 1NXOA 4B6SA 1CCWA 4MGHA 4Y0AA 1FIUA 5HF6A 1OWOA 5CXSA 5EXTA 3NNSA 4FEAA 4EYOA 4OQNA 2M6RA 4MKHA 3D3QA 4CLDA 3PX2A 3MUEA 5BYJA 3T3GA 1M2OA 1H6BA 4A2WA 4CU2A 1E6UA 4CUZA 4G9BA 2A92A 5FBZA 4DGSA 2NPFA 2IPXA 4G89A 3HVRA 3VSAA 5A4DA 1U2EA 1M2VB 2Q28A 5ERYA 1E7WA 3OOEA 4KX3A 1ZCBA 3DFZA 1CIPA 1JPNA 3ZWXA 3K9LA 2NIPA 1KZ9A 3KKEA 5K99A 3IEUA 3QJGA 5LOVF 2DFTA 2IY7A 2NMVA 1VMKA 4N9WA 1U3WA 4LSMA 2YR0A 1K6EA 3UMFA 4DANA 1KEUA 3MTDA 4NU6A 2XDYA 4NBRA 3UAOA 4ID9A 5HF9A 3EQ6A 4DE5A 2FSVA 2QUBA 2ZRBA 3BD7A 5BUSA 2GRUA 2V4UA 3CRZA 2XZLA 1KXZA 1NVVQ 2FN8A 3BULA 1KBOA 3ET4A 3DAGA 1YJCA 4YJ2B 2CVZA 2H9IA 4KGVA 3I12A 4BZWA 1CYEA 3EF1A 3SF0A 3WK5A 1E0KA 1JBKA 3VHXA 3WQSB 3FOEC 5ECGC 2AG5A 1R0KA 4KFTA 5JDCC 3HFRA 4PN7A 4HWOA 1PJBA 1ENPA 3AVPA 4EHAA 1KY2A 2P11A 3KTDA 5FPHA 1X13A 2P4QA 4OMDA 5I01A 4CL3A 2G4VA 4EPRA 1H6DA 2IVZA 2VOJA 4IVRA 3PHJA 3DNFA 4QBFA 3UJAA 3FOBA 5EKUA 5TQ2A 1VCMA 4LNHA 5JNLA 4UZSA 4ZPXA 1RYYA 1TZCA 1NQOA 2OILA 4CF7A 2ZS8A 4RDCA 1HT2E 4LX0A 4PN3A 1M7HA 2XNDD 3DF9A 2F59A 1QFMA 2UVQA 2R751 3HKEB 4J1NA 4JUFA 4R69A 5EIWA 5EPEA 2X2EA 4C0SA 4BX8A 3GT7A 1YIDA 2DPGA 3EBOA 2I8LA 1I24A 4XVQA 1MVLA 4I36A 2VG8A 4H4EA 4C7OA 4LAFA 4PLWA 3KSRA 3K9CA 2NUBA 5L40A 3FDIA 5EJAA 4DLSA 3KPJA 4EZEA 4RV5A 1Z38A 5CG2A 5LXTA 5CFRA 1NDHA 1YZUA 4KNWA 3HWX1 4XIGS 2YHAA 5BN5B 3GQBB 2AFHE 1FE8A 4HN2A 4P86A 3TIGA 2W8BB 1DAIA 2OZVA 1VE5A 3EB9A 3PQ2A 3QOXA 4ND2A 2XW6A 3TW6A 1JLHA 2BI8A 2JIRA 3BE6A 5K6RA 3QPUA 1X9HA 2HCBA 1Z17A 2CKMA 2VHYA 2I6FA 2OFWA 4YECA 3TPFA 1KDPA 2NO9A 4HUQB 3B1VA 2B9VA 4CEIA 4QECA 1J23A 2B0CA 1UM9B 3FD8A 5CP8A 3BORA 1LS6A 2KPOA 1NJGA 2Z5GA 1YS6A 1KFCB 2PVSA 2Q41A 3G5AA 2R8OA 4GI1A 1D2RA 2BF4A 3W8NA 2XXAB 1XKQA 4EO7A 1UKAA 2XDQB 1KO8A 2Z1DA 2FPKA 4DPMA 5I3CA 4Z3OA 5AHXA 3F67A 4OSPA 1GPJA 4GI7A 4F85A 1E0DA 1TCCA 1VJDA 5A7GA 3TIXB 4H1WA 1IYZA 1WLYA 3VTFA 4K86A 1U2RA 3U39A 3DT9A 4BNJA 2VJBA 5HCIA 4OATA 4DBLE 4YCNA 1UDAA 2ZTMA 1EZ4A 2ZSJA 3PR2B 2YMPA 2R6GA 3QU4A 1U7ZA 1WP9A 3Q3GE 3SIXA 1Y8AA 2ZSKA 1V8BA 5IFLA 1EVKA 4L02A 2E6KA 3JQ8A 4M76B 4BFSA 2R8ZA 4M2LA 3AF0A 3G5UA 2BKUA 1L8XA 3A6ZA 5DHPA 1MJGA 3JASA 3HA3A 4QYXA 4ZANA 4F21A 4QVIA 2C9MA 4BQQA 5F23A 1KVTA 2IYQA 4OQDA 1SK9A 5B6JA 1JSXA 1T2CA 2H1FA 4I55A 4UATA 3V8RA 4NICA 1T4MA 1FLVA 4EA9A 4FM9A 3N2NA 1NA5A 1RE1A 1BE0A 1SHJA 3BHJA 5JG7A 2BN4A 1QV6A 4LXHA 3JXEA 4RL6A 1Y6RA 2IVFA 4Q4AA 2GFQA 3GELA 2FK7A 2ZT6A 1FYXA 1SXHA 3RU2A 4V2IA 4FQ8A 3GH3A 4MAMA 2DMRA 2PAAA 3C2QA 2JAUA 5A9SB 3FLMA 4ERNA 3T5AA 1ZC4A 3BWCA 4IZ6A 4RGYA 2OEPA 3GIWA 1ICEA 5KNLA 2VDNB 4RMGA 3WRXC 3RGGA 3RANA 4B3HA 5AK6A 1K7XB 2IYFA 3UFXB 5DN9A 5LSAA 4Z53A 3EXEB 2P9EA 3BXPA 1PR0A 4JJIA 4RHFA 3NOQA 4JVNA 3UJ6A 2BI4A 4EW6A 5B55A 1AKEA 2HZBA 1DRJA 4CM8A 2KQUA 1SVSA 3GD7A 1O94D 3A9SA 4UUBA 3NBXX 2VWQA 1UKZA 4D46A 1ONOA 3Q3IA 4MMZB 4UQOA 2V4ZA 3B3QA 2YV4A 4QPNA 2QN9A 4XGIA 5BV0A 5FOWA 1SA0B 3Q11A 3MUNA 3RC3A 3EVEA 5EZYF 4I4TB 5CT8A 4D0SA 1GPLA 4IWNA 4RPLA 1YIAA 3KEGA 1YHYA 4CN9A 4E2WA 4YPVA 2ZQ5A 3H6KA 3O93A 16PKA 4C2UA 1QCCA 3DH0A 3TIIA 2GRJA 5E4TA 3HKDB 3Q9NA 3ENWA 5TC4A 1DQYA 1XWIA 5BV8A 2MSCB 3JWIA 3HYNA 1XZAA 1ZN9A 2F17A 3G89A 3PQEA 3RJZA 5JWOA 3U3DA 1VB5A 1EVJA 1LSOA 3GEHA 2E5WA 4CKWB 4FR5A 3IT0A 5EY5B 1Q6ZA 4MWBA 3IULA 2BFFB 5GOTA 3QUSA 4AY4A 5TDHA 4EO4A 2UUBB 5DEIA 5FUQA 5KYXB 1AH2A 5CA1F 4M22A 3RWMB 3WB0A 3CZCA 4ATNA 2C5LA 1NQUA 4D45A 5LJLA 2WFLB 2CLEB 3GLVA 3VNUA 2ZI9A 3H1PA 4MKZA 4MW4A 3RTBA 4OI0A 3QPCA 2BELA 4JJEA 1XMIA 2RGBA 1SG6A 1YUBA 2VDUE 3EVFA 4L0MA 4WOJA 1L5KA 4I8DA 1JL3A 5JNTA 1OVGA 4DHWA 4PC1A 2QVYX 4YFVA 5IF3A 3AVQA 2A67A 3NDJA 4KVGA 1ZC3A 2CLDX 1XA3A 5IBRA 3Q7PA 5LFAA 3L6CA 3P9RA 4RFSB 4QQKA 5K3SA 3PDIA 5C4MA 4ARBA 2A1UA 4NU0A 4ETIA 5CIQA 5JU6A 1H8ED 1QWOA 1YZFA 2VCEA 1XRRA 1KZ6A 2F2TA 1WG8A 4FXOA 5CVTA 2PVCA 4OLAA 5I5EA 1GUZA 5LQUA 2ECOA 4I5DA 3I61A 3AXTA 1MHPA 2IW3A 3GPBA 1M34A 3I09A 4I6GA 4KQIA 3U16A 1F12A 4Z4EA 1NMXA 1VTKA 4K6KA 4OSEA 2HJSA 1F2UB 2ONKA 2W90A 3HR4A 2ZRJA 2CLMB 3TZEA 3W9YA 9LDTA 2ODPA 2OV4A 1XF1A 4HQFA 3KUKA 3WGIA 3FKSD 4GZ6A 3E9QA 3ZY4A 3I0ZA 2OZLB 2JHAA 5IKMA 2KM1A 3EQ9A 1TVKA 4M98A 1BHSA 3A2MA 4KITB 2P1RA 3PLRA 1E4YA 2GHIA 4JFRA 4ZARA 3N6RA 5E1MA 3RU9A 4RTNA 2E89A 1X1QA 4PYMA 1T29A 1LSJA 13PKA 1IN7A 4UPDA 3ZWAA 1M10A 3CRW1 2AQKA 2QP3A 5FFFA 2ZJ4A 3RASA 4XD2A 1VSQA 1G8KA 1TCBA 4MROA 4OKIA 4AQ7A 1IHDA 1WNFA 1FFHA 1FFSA 1Z73A 1UQTA 1G21B 2HDOA 1F6BA 3GGDA 4TYQA 4X1YB 3P45A 1XL1A 2GPWA 3SICE 4ZHSA 5I3ZA 2ZLBA 2I4OA 3N6XA 3GJSA 1T9CA 4G07A 4QFBA 4UUOA 5CDSA 3K1AB 1IZZA 2E6UX 2D2XA 3LT2A 2FPXA 1R0RE 4MVJH 4YRGA 3LQRA 3CXUA 2C2KA 3CR7A 4ND3A 1RS0A 2A0UA 4UM9D 3QF4B 4ZDWA 3L7IA 3N2IA 2QW1A 2UZ1A 3ZBQA 5KDLA 2CY0A 1EI9A 3MS4A 5FTJA 1IOVA 1XRSB 4YV0A 2FRVA 3P8ZA 5IT4A 5EYPA 2C96A 3NBUA 4TRNA 5HBGA 1XYVA 5JSUA 3WS7A 4WKPA 3UCXA 3ZY5A 4N5HX 3QPVA 4DCTA 1DXQA 3CW8X 4PHHA 1ZK4A 1FLAA 3F74A 4I5GA 1QIGA 2ERXA 4Y2HA 4REQB 2O20A 1IEVA 4BV2A 2QM0A 3DKIA 3ZIUA 4Z9FA 5G0WA 1VHTA 3HDGA 3U80A 1M2EA 1E5VA 4YXWA 5I8PA 1W5TA 3U3XA 2H85A 1M6VB 5ARCA 4C05A 3H4TA 2JIBA 4HQLA 2GO7A 4PV7A 4BTEA 1J0DA 4AMUA 2SBTA 1V7PC 3K09C 3T12A 5BT8A 3ID6C 2FZ4A 1U5BA 3MQ2A 3LIIA 4HH1A 4BX0A 5LM3A 3FTDA 4V1CA 4EMTA 2D00A 4PHFA 1EEXB 4QU5A 2FWRA 4XWYA 4QRIA 5IJXA 4WBSA 1OX6A 2HU8A 3ZVKA 4RH1A 2BFEA 1B43A 4DSTA 1BFDA 1XZKA 4OI4A 4D3FA 2RH4A 3TTUA 3EDMA 3WLOA 1QQ7A 3UICA 3JYHA 3UAZA 5G4KA 1JI3A 1G1AA 2DLNA 4RSMA 3FHTA 4UHBA 4D4MA 1E2BA 5JH7F 1NBEA 1XU7A 2I03A 2XGSA 4XJTA 5A0FA 4BIIA 1NYTA 1JIQA 1ISMA 4UM5A 3MT0A 5DI3A 2AUTA 3NGXA 1Q1ZA 1RLMA 1O5IA 3DCNA 4V3CA 1UWLA 1NVFA 2RCNA 3KLMX 1SKMA 3FTCA 4UTVA 3LHSA 3ZCSA 1F7UA 3OICA 1ZH0A 2I34A 4GVXA 2EFDB 4FZVA 2JGDA 3NUZA 4O2AB 2JLUA 3R3YA 3RADC 5A3JA 2J5KA 5HIAA 1VMDA 1LXCA 1RRCA 3OA0A 4FDTA 2D1SA 2EARA 1MNAA 2HTFA 2HH9A 2I71A 1KC1A 2QN2A 3I1FA 5LA6A 2YNMC 3G3EA 1J2EA 4BQFA 2EX0A 1OIVA 3VHXB 1U65A 2G67A 3TR0A 2PFSA 4DMLA 4QJBA 4LZAA 3PNLA 4PPFA 4AJIA 4EOGA 4C14A 4Q6BA 4ZTZB 2DU8A 3TPZA 1PFVA 3KD3A 3SDZA 5J4LA 1S4MA 4YJHA 1O58A 1P7PA 4O8CA 3DLCA 3COJA 3OMLA 1NPTO 4MYRA 4QBIA 4DLPA 4EMBA 5C3MA 2H52A 2WILA 5JAHA 5KIAA 1KFKB 1PN3A 3EUFA 5L7YA 2CXSA 1V95A 2NSJA 4P3XA 3P4XA 4QWWA 2WJWA 5BWOA 4RK7A 5T7BA 4RO0A 1LLCA 4JU8A 4KU4A 4Q12A 2VDMB 1GRRA 3BZUA 2DPXA 4YO8A 3TSWA 4MW0A 3IBCA 4R1SA 5KQMA 5KSYA 1IN4A 2JIQA 1FJ2A 2NOAA 1UBFA 3F98A 5K0EA 3THSA 2A0WA 2BM8A 2Q6TA 4N4AA 1NBIA 5FEUA 3MT7A 3H11A 1SB8A 2PZAA 3F2IA 1ATZA 1N7HA 2J4DA 3JQRA 2DTXA 2J3IA 2W98A 4JCOA 2G09A 1GQOA 2QD4A 4PAWA 3SPXA 1Q7BA 4JY7A 1AQJA 2CT8A 1CUIA 3ZDBA 3QG5A 3FUWA 3SQLA 3E7XA 4HDKA 4LVOA 5FAXA 1HL3A 1NVEA 4WKBA 4F3RA 1D0VA 2WNIA 3CVJA 3ZE9A 2KLHA 4EQ6A 5HKLA 4BHTA 1DX6A 2P5UA 3L9XA 3MFYA 1XR3A 4HNSA 2AOTA 3V8QA 4E2YA 4FSHA 2BDEA 2PDAA 4U8HA 4ME6A 4L5CA 4RFLA 2YWGA 3TDKA 2D5AA 4QHSA 4DR4B 1UQUA 2ZYDA 2EIXA 5B3JC 2HB6A 2XUQA 2FZLA 3R6DA 5H4HA 1V16B 2QQ5A 5E38A 3C70A 2G9RA 1FVFA 1NURA 5JQGA 1DKRA 5I7HA 5E6SA 5B12A 2MDTA 4XA8A 5CFOA 4OFZA 3H99A 4X3OA 2JI6A 5IDVA 1CQWA 3HBAA 3NHUA 5J47A 5HS4A 2PUFA 1L7QA 4U9IS 2I76A 1ZCFA 2QMZA 2ZAGA 2DVMA 3DV2A 3LJKA 1ZR4A 5ALEA 4PG8A 1NUTA 1FMJA 5BQ5A 2WF7A 5CBPA 4IQGA 4H7DA 2FJ0A 4G0VA 1NP6A 2AZMA 2MIIA 1N5IA 1IFXA 3W8EA 2AHOA 1TJ5A 4K9NA 5HVNA 1MG5A 1R0YA 3SZRA 3TSZA 4NZYA 3WQHA 3VJMA 1MOPA 2EYQA 2RH5A 2WSYB 3C3KA 1U0LA 2O1XA 1R6TA 5EA2A 2QD2A 4F4CA 3ZV5A 5HZGA 5G1OA 2PBFA 4FZ3A 3Q3VA 5FBLB 4N0MA 1W75A 3VBEA 2QSJA 5DMXA 1Q1AA 4LJSA 3G0HA 2KX7A 4XZ3A 4MICA 4D9BA 1MF7A 2V6BA 5BQPA 1SXQA 4GOXA 3OA2A 1FXWF 1SULA 1A5TA 2HN9A 2QW8A 4JVMA 5FBQB 4EVSA 1Y8CA 4WUVA 5CCEA 1AXEA 5EZ5A 3SFZA 3LLCA 1IBRA 5F3DA 3LUBA 2BMAA 1P1JA 5SZKB 4PC2A 3ZU4A 2GPSA 1RKBA 4EBFA 4UNRA 4Y9RA 1Z47A 2O6HA 2XODA 3T7EA 3QOFA 2Z04A 4EJ0A 4R5MA 4HUJA 1P4SA 1E3SA 2C5AA 1DLJA 1U1CA 2XB4A 3B3GA 1XVUA 1VPEA 3CZRA 3DEJA 5GGXA 3QXSA 5JDCA 4BMVA 4P1ZA 1QRRA 1M8JA 2JLYA 1IXYA 5K0TA 1IAQA 1M8PA 2IPMA 1KDVA 2D59A 4EHLA 1JXQA 4LY0A 2IEDA 3HY4A 1OFGA 2AMJA 3R7FA 3Q4GA 3UZUA 3QZUA 3ZHCA 1J33A 4RIHA 4OEHA 4CM8B 2OUIA 1FF9A 3EFEA 3W79A 3ZWDA 4QELA 2MOKA 4FFLA 2MWMA 2WJHA 2BAGA 1PDVA 2CCKA 4OAPA 1UJCA 2I2WA 2QUIA 5FBRB 4TROA 4ETMA 3OTWA 5KOHB 2OAGA 2JGNA 4N0PA 3D7NA 4FP9A 4IVQA 4WBNA 2OY0A 2P1DA 3KJNA 3PJDA 2D8MA 1I7LA 2GK7A 2P0YA 3AV3A 3DBRB 5EOVA 2D7JA 1O95D 2LZ0A 2SICE 1VA5A 3DL0A 3CUUA 4PPNA 1MVNA 2VLBA 4PZLA 4TMYA 4IP0A 2IV2X 2RGAA 1J2RA 2PSHA 3LYAA 4DYHA 4KDEA 4XSVA 4RESA 1X74A 3SNHA 1A4RA 1CVLA 1CY2A 1XZPA 4HDNB 2AOUA 2H63A 3HEMA 4H6XA 4GXRA 4EAQA 3QLVC 2ZAYA 4W9RA 3OIGA 4NBWA 2BFWA 4BVJA 1GPH1 5JFTA 3IJRA 1CF4A 1ZVJA 1YHZA 4JDPA 3CF4G 3I2JA 2C78A 2ZEJA 3LP6A 1S2IA 3T3HA 3DVAB 4F12A 1OGYA 2XAAA 5KQRA 1J0BA 2AD1A 2HWYA 4KQ6A 4M0KA 2SKDA 1EUZA 4DAEA 1LBEA 2GA8A 2XADA 3N8DA 3OMXA 1K9SA 4NYMR 4CF5A 5C1DA 2W6NA 3EARA 5L6LB 1QHGA 1NSYA 1XN1A 1E5XA 1E61A 4QQRA 1CUHA 4IG9A 3M1AA 3IIJA 2QDKA 3O0DA 4TS3A 3K6KA 2OB1A 2BFBA 1C30A 1Q0SA 1WUIS 1HFWA 4HN4B 5FWYB 4PINA 2O1WA 2A59A 2DJIA 3QWIA 4D80A 2ST1A 3VC1A 1G2PA 5ILGA 4ARAA 4D3ZA 2QX9A 2SHKA 2H2IA 3GFGA 3OSUA 4M21A 3TDNA 3HP4A 5IFKA 4QUBA 3WAJA 4FI3C 1WETA 1DOAA 4AN1A 1O0BA 4U1RA 3BDAA 1XD9A 1J9ZA 1SHUX 3DZIA 3SM9A 3UNXA 3DWFA 4U63A 4P22A 3PI7A 2X5JO 4JH0A 4R1QA 3N07A 1ORRA 4ALIA 4HWPA 4M0PA 4GYYA 5E7JA 3RYFB 3WG9A 4CG0A 4WERA 3TBKA 2CVOA 4Q7EA 5JI3E 4XOUA 3SMVA 3KB6A 2HGSA 4A0FA 1G20E 3HN7A 4UJ3A 4QOEA 1P5FA 5EZSA 2ZP1A 3BTSA 5IZ4A 1KFEB 1ZISA 3P9XA 1Y8RA 5I7EA 2CXHA 4ZT7A 1GGEA 1E63A 1H8HD 1QIMA 2OGSA 3ORQA 4JBHA 1T8PA 2W2KA 1MPXA 2B92A 3ZJVA 3CH4B 1HK7A 2COUA 1N2XA 4KQWA 4BTLA 1ULZA 1XQWA 4P82A 1CS4C 4JYAB 1Q0LA 2QAGA 1MFZA 4MVJD 3WIUA 1YQ9A 4EKDA 1TYCA 3C3DA 3G0CA 2Z3VA 3FYUC 5FPQA 2WWXA 1VCIA 2CXRA 2P2CA 3H8WA 3TQHA 2L82A 2JGAA 3QU2A 3WDMA 4AUMA 4IXTA 2Z56A 2ZSBA 5BVHA 3S7ZA 5F7XA 2P9CA 5LP6B 3W8DA 2OCLA 2G07A 4KQ2A 3QIVA 2WP8J 1YT5A 1I6LA 1KERA 1TDJA 1DCTA 1LZKA 2WWRA 3OZDA 3A8TA 5CEEA 5B7NA 1P1HA 4YMSA 3VTZA 3EEFA 1C1DA 5KJCA 1IBLB 4MW7A 4OHCA 3U7GA 5FNZA 3BILA 3TJMA 2RAPA 1PTJA 4S1NA 2V59A 4NZOA 3ZVRA 2WSSD 4M83A 3PNOA 3A3KA 1NASA 3UKJA 1U8YA 4QT4A 3ZQ6A 5IG2A 3O91A 5KJ1A 2DZDA 4MKXA 1LW7A 5I9IA 1H2AS 4RENA 2PGNA 3L6BA 3GMTA 3FWZA 2HIHA 2F6RA 4UZFA 5DVZA 3NJRA 1Y89A 3WV5A 2NT3A 4NE7A 1ZBQA 5A4IS 4HDQB 1HC7A 1Z6PA 2MTBA 4ZQHA 3T4EA 5CDHA 4X92A 5FBHA 1ZZEA 4D57A 1QC5B 5FA5A 4CLRA 3B9RA 1SG9A 1QS0B 3QMMA 1KEKA 2XRZA 3T0FA 1QF7A 3AFOA 1O6GA 3HK2A 1PW5A 2G40A 5IAOA 1S8AA 2R2AA 3F7OA 4NJEB 5FTMA 4PC7A 1GSIA 1Q83A 4P92A 1NJSA 1RYNA 1A9PA 3KDPA 4L95C 2WTMA 2EGGA 2R48A 5F9MA 5AM5A 2AS0A 1OWPA 3VNAA 2CV0A 4IJQA 1JIJA 1QRAA 4QHYA 3CRMA 3IEPA 3CZPA 1BKYA 3ZD7A 3KZVA 1JV2B 4NV1A 4PPYA 2VK4A 1EDEA 1G6OA 4I5EA 2FFJA 2ZVDA 2IU4A 2Z98A 3BK7A 2Y76A 3IPRA 3OBBA 3LPCA 4PXSA 5C7LO 4RK0A 2IU3A 5CA0A 2IBTA 2GLTA 1A2BA 4IDBA 3VH2A 4CMCA 3ZJTA 4WFKA 4LF5B 4Y6RA 1BYUA 3IAM1 2Z1MA 1X80B 2QUZA 3MJVA 2XGOA 2JB9A 1H2XA 3EYAA 3T5PA 1ZJZA 1HZZC 1PD0A 2H1SA 1SN7A 3AT1A 2XVYA 4UMVA 2DFNA 4J1TC 4HFJA 5J43A 1TECE 3F4BA 5KTRA 4LFAB 5AKIA 3VISA 2G1AA 2NSYA 3SJUA 3GLKA 5CFPA 4CCYB 4AI6A 3D4PA 4BVFA 3WK8A 3F4KA 3OU2A 9ATCA 3GF4A 1CZNA 4HSEA 1ECFA 4JCCA 4NPHA 4B34A 4YRNA 3WLMA 3CPEA 4UHEA 4QLBA 1CYDA 4IDGA 4IJUA 3T4XA 3WZMA 4C4TA 4CM4B 3PGKA 5CJ2A 1UBOS 3UW1A 3WWZA 4QU9A 1ILEA 1B1CA 4Z9XA 3BYZA 3VFDA 2EOAA 4OU5A 1Z2AA 1DC5A 1PDOA 1R4MA 4DQUA 4CHTA 2JCSA 3Q41A 1VL1A 1V8OA 2PUJA 4GM0A 4G1VA 1P9OA 1L7VC 3GNQA 3B6MA 4MLDA 2JLBA 4MH0R 1PNQA 3UENA 3IUQA 2VA9A 5DBGA 1S02A 2NAFA 1RLJA 5I9LA 1IIBA 1GL9B 1TMOA 2OUKA 2WSLA 3DBVO 3NC4A 4IYJA 4M86A 3KJGA 4YJHB 1WUKS 3HACA 1IJFA 5CG1A 3N3BC 1RWNA 4B6PA 1RAIA 5IKPA 2DSTA 3GVIA 3VDRA 4E15A 1T6YA 2Y67A 4U0JA 5JBNA 2DT5A 1H94A 4BL5A 1GV1A 2AYXA 1XTPA 2WFZA 2IEBA 3UOAB 4ZO9A 3PRYA 1PQWA 4DJTA 2RSLA 1P4RA 2JI9A 3PVCA 2WM3A 4LZNA 5JIBA 4NECA 4PYOA 5BOSA 2WA2A 2WI8A 3DNMA 3RQIA 4AJJA 4CQJA 2AR9A 5FUVA 1QPGA 5DNCA 5HX7A 3KHKA 2Q3HA 1YWGO 3AVWA 2PM8A 4HLNA 4BGIA 1EFCA 4CLXA 1P73A 2QRNA 1GYPA 3A6PC 2XWSA 4RZHA 1TTPB 3L77A 2G5PA 3RE1A 3SZ3A 4BEWA 4YY3B 1ZIDA 4JS0A 4OMFG 1VHDA 2P2LA 2CNWD 2J7KA 4J0DA 4I1YA 4ENRA 4OH1A 5BPHA 2IXFA 3HMKA 5GZ3A 5LB4A 5DM0A 3P9PA 3ASVA 1YBMA 4NYIQ 4DG5A 1FRVA 3GFVA 4DLKA 5C53B 3B51X 2A9VA 2O3RA 2VTBA 1FDUA 2ONYA 3VKUA 3AW9A 2YINC 3Q8WA 1G5IA 3TLJA 1NNI1 1H85A 2CUZA 2ZJ3A 4MGIR 3TLYA 4ZIRB 5HOQA 4LFBB 1P2DA 3M2PA 4I5IA 3PI6A 1W581 4AS1A 4ZQEA 1QLWA 4TZKA 3ROXA 2HQBA 1USGA 3H8SA 3B8HA 2G1PA 1X8XA 1MMFB 1YZTA 1XVTA 5FCDA 5F3WB 3FCXA 5EP2A 4A6PA 3DZGA 1Z8NA 2FWNA 2LDXA 2RI6A 1XV5A 2CB0A 3K73O 2PO7A 3QRWA 3V00A 1VFPA 3LUHA 1L7DA 1QHNA 3GUVA 4I4IA 5C5EA 3A9RA 4JEIA 3ZG6A 1A9ZA 4TSFA 3TR6A 4A6XA 2XCTB 2BEWB 3M6UA 3B5IA 3WL8A 1RBYA 3BZBA 5H02A 1Z28A 4C5BA 3OTIA 3BFVA 3HP1A 3KKNA 4JUIA 4AP6A 3G0IA 3TUIC 1C1XA 3ZCQA 5K3EA 2GXQA 4PCVA 2ZT5A 1N0VC 3DE4X 3GRCA 2J0VA 4EGAA 2C8LA 1VPDA 2Q3LA 4L4UA 1XRQA 3UH0A 1DUSA 4LGYA 4BFLA 5CB4A 1P7CA 2NU8B 2XNHA 1G6HA 4AMGA 4RCYA 3K09A 5GONA 4RTOA 2EG9A 4CTKA 3DMRA 4ZQCB 2TRSB 3A9TA 5CVVA 2QR5A 1P6QA 2HDNB 1EFLA 2BKVA 1YQWA 2VQDA 5CM2Z 1MXFA 3WGKA 3LG2A 4DIEA 9ABPA 2WB4A 3IT1A 4FFSA 5H5JA 1D2GA 2LR0A 2VKQA 2DKOA 3EZ6A 4LTNA 4P2GA 1THMA 3L93A 1XTSA 4FPXA 3GEPA 1NI5A 3S2EA 5TE9A 1T1EA 4F96A 1GZDA 1QVAA 1XRLA 2QE7A 1E32A 2XA9A 3H65A 4P7GA 4UDYX 3HXMA 3ER9A 4YLGA 1HSOA 4HQ6A 5B37A 1CJVC 1OFUA 2CV1A 3RT1A 4F45A 4J76A 3C5CA 4C2AA 1DARA 3HC7A 2ZCUA 4MK4A 3MYRA 4ZQBA 4R54A 2NQTA 4C7KA 2I3AA 2YY7A 2Z8YM 3F46A 1T1RA 3BPSA 3TTTA 2PZGA 3OOWA 3QPDA 2PIAA 2PZJA 5HMLA 4L4RA 5L3VA 1HEUA 1JB9A 5A9RA 5LP1A 1P7WA 2XXBA 4EF5A 3E48A 3OC0A 1NVMB 3CISA 3S40A 1RRPA 1J2UA 2G8NA 4D6YA 5CDUA 1ZJ5A 1H4VB 1YUNA 4EARA 4X90A 3VKFA 2XA2A 4GMHA 5ICFA 1ECPA 1Q5PA 5L4SA 4BO0A 4RTJA 2WICA 1R50A 5C8ZA 4ZQIA 1BS2A 3D2LA 1CUSA 1FYWA 3P0IA 3RRBA 3GYBA 5AM2A 3GMDA 4L4YA 4BC0A 1PE0A 3C43A 4I81A 4P83A 5I4KA 3SF8B 1FFXA 1JP7A 3TECE 2HTEA 4JOBA 3I52A 2ZPTX 4LJ6A 1QAMA 4QDXA 4AJ2A 4XYGA 1V4VA 3GX1A 3W8FA 3WJAA 3CZ4A 3M5DA 1REQB 2W4QA 1NP3A 2Z30A 3KDSE 3MTBA 3R4CA 2QZ4A 2QN3A 4TM7A 3KV3O 1C0PA 1DKLA 4X7MA 1ZUD1 2AYZA 3QH4A 1NX9A 1T91A 1OKKA 2QZ9A 5F35A 2YJTD 3PUZA 2FPRA 3M7IA 3NR2A 2A9JA 4K2HA 3AESA 4BRUA 2VP4A 2WF9A 4DEXA 1GTG1 1HV8A 1HMPA 3QVGB 4EHHA 3N05A 1RJWA 4WOPA 1JIKA 2C0QA 2ORYA 4IDNA 3LQ4A 2O0LA 3KZMA 4JVSB 1V6SA 4D44A 2FG6C 4J6EA 1CR2A 2JAPA 2X77A 5FLEX 3E05A 1P29A 1JHZA 1Y1QA 2OV1A 5JAMA 3EIQA 1GAXA 4RWZA 4JLUA 3GPLA 1C0KA 1AN0A 5FTWA 3V2HA 2O50A 3C45A 1XMPA 3L7JA 1KS9A 2X1HA 3EVAA 3Q1KA 3T5GA 3ZW7A 4MMYB 1JQ3A 2GD1O 4CRWB 1EP9A 1NYLA 4GDFA 1W85A 2WV9A 3NM5A 4UDNA 5CPBA 4DRZA 3HZZA 3KC2A 3KAQA 5K0BA 2DYKA 1SD1A 3DJFA 2I1WA 1A9XA 2VBGA 2BZGA 4OHUA 4BNYA 2VT7A 4PLYA 2FN4A 1IDN1 4E3ZA 3JARA 5CUQA 2NNLD 2WNSA 2HK8A 4D1YA 4Z3KA 4GZ3A 1C8VB 1XD8A 2JLVA 4ZT5A 4DCUA 2X42A 1BX3A 5IDQA 4WNCA 2JLAA 3NVAA 3FFWA 3PIDA 2WWYA 2ZCJA 2BONA 4UBMA 4UUPA 2DLCX 1XXLA 2KW5A 3CEJA 2DFPA 4ZODA 4YRQA 1PRYA 5K0FA 2Q50A 5F2EA 2LXNA 2O2YA 2VYFA 3UJPA 2Z5VA 4KSBA 4GMXA 4IHJF 1OC2A 3OM8A 2ZSEA 4JYCA 4UUMA 2IELA 5ESDA 1CEQA 1P17A 3F0TA 3MFQA 4AMBA 3SR0A 1O96A 5E7QA 2AXNA 1U3FA 3OJ0A 2IS2A 2BFBB 1IWBB 1DAGA 1K6JA 2AGVA 2F1OA 3EE6A 5J3JA 1XZDA 1YB1A 3BJIC 3T94A 3DKRA 1C9EA 3V7UA 3ZZ1A 4KAJA 3G6KA 1D6MA 2ESRA 3RVQA 1CZLA 4A3SA 3DOIA 1SK8A 4A0HA 3KJZA 1SWWA 4HGZA 4LXGA 1E3QA 2R96A 1N8NA 1OPRA 1U81A 1ZCJA 4O4LA 5IBQA 1GPBA 4ZYVA 2CUNA 4WK4B 1H42A 1UZNA 3DGEC 2JI8A 4LHXA 4X8HA 4A15A 1R10A 3KWJA 2N47A 2J33A 1JZSA 4JN6B 1JI0A 1I3MA 2NYAA 2QOEA 2LBPA 1QHFA 2OV2A 1C81A 2CDNA 3EG9A 3FB4A 4OP3A 4YV2A 4MCHA 4PGMA 5BW5A 5HDBB 1U7OA 4I6JA 3CWQA 2VDWA 2DLDA 4PXAA 4TL8A 1JU9A 2J3LA 1CJBA 2LGJA 5JEEA 4IINA 1E1CA 2Q5CA 1X7DA 3HABA 3JQ9C 3II6X 2CN1A 2RHCA 3CUKA 2OGUA 1BJKA 1PKXA 2HHLA 1MC5A 1KI2A 1P77A 3IP5A 3L6RA 4RANA 4UHDA 4JI5B 2MYNA 1H93A 3UJ9A 3ZY3A 2O8BA 1GZ3A 4XW2A 3GUCA 3MAGA 3HVKA 3F9CA 3FTPA 3IBGA 5B6IA 1N2CA 2BJWA 5JISA 4CMHA 2PD4A 3E3MA 4OG2A 5B7GA 4I4CA 3W5VA 3ZZ0A 3HJFA 3AFGA 4CM9D 4BJ6A 1W59A 4GOND 3JYPA 4IGFA 3X1WA 2B2NA 4EHJA 4HH3C 4RZUA 3HADA 1IB0A 1XVIA 5EMHA 2IZZA 4GI2A 1XCPA 3CUEF 3GDFA 1AKUA 1Q16A 3ICPA 3NNDA 3EXIA 2CVFA 4MVCA 4P3PA 1ORIA 1I7NA 4NYJQ 3WJ7A 4RA9A 1TIPA 2OPBA 3GT3A 5EUCA 3UWMA 5K8TA 4L6AA 1JIIA 4E21A 2XBMA 3IMCA 4OKNA 4NCKA 1D1PA 5FB3A 3D8UA 5AESA 4CMIB 4DEYA 3Q8KA 1OC4A 1QGUB 3KPVA 3TOZA 1WVGA 1POWA 2XTJA 4IFBA 3ZX5A 4TWRA 3H5NA 1G64A 2JANA 5TQ0A 1KMCA 2ETXA 4DBLC 4GUDA 3DB2A 3I8OA 1PUXA 4UEOA 3H7IA 3UOGA 2HBYA 1ZH4A 2JGLA 2ZRAA 3NUQA 2QX4A 4F9FA 3WGJA 1QYIA 1D0SA 1SHKA 1O2DA 3GJ8A 3GJRA 3JR3A 1E2QA 3GXOA 5D1HA 1W6UA 4I4NA 3K20A 1E2UA 3LCVB 4XQCA 5CVEA 3I53A 4IEFB 1A97A 5UKDA 3GA5A 1R0ZA 2ZTSA 2ZRPA 3E9DA 4J0JA 4DTCA 2R1TB 4HVCA 4HF7A 5EQFA 1AHPA 2V7BA 3QWBA 2AH5A 1Y5RA 3PQ3A 1LPMA 3I42A 4U5XA 4EI8A 1XKTA 3NAZA 3TM5A 3V1KA 1NXQA 1LD3A 5D3MA 4LYEA 1Q17A 3A32A 1EIZA 1Y9AA 1XYGA 2QI9F 2WD7A 3CWCA 4PSUA 4GM4A 1OF1A 1Z5OA 3C3BA 4RPIA 5LP6C 1GOTA 3OKCA 1AZWA 1V1JA 3A0RB 1ORTA 1K92A 2IF2A 1E9SA 2F8TA 1WA5A 2GN8A 3L0BA 3R7LA 1MCZA 2E4XA 2I7XA 4L27A 4RM2A 2V9CA 1BXGB 4DL9A 1JYSA 1QYVA 2C7QA 3GAFA 4MVJP 4LKOA 5JAUA 3Q3JB 4CQMB 5KQSA 3CLKA 4X1IA 5IPFA 4X60A 2AQHA 1SKYB 3ZK7A 2MSNA 3IAS1 4EFNA 1N2JA 1UJ6A 3WGYA 1R8JA 4C7VA 4P32A 4BQIA 4RD6A 4UUNA 2EDAA 1JHQA 1LUAA 3CINA 4JI1B 5IKXA 4NQRA 5A06A 1XHLA 3T9BA 4CMEA 1YL7A 2ZI7A 1K3TA 4BQEA 3OE5A 4A8PA 1Y7IA 3D54D 3P20A 4FTWA 3PFIA 4B2IA 1GFIA 4PLCA 1DAOA 4HZGA 1XCJA 1AKVA 4ZVLA 3OPYA 2O3JA 3QXGA 4TXJA 1IHXA 5CT6A 3RIMA 5DHSA 1E2MA 2AVNA 1ZVQA 1ZJWA 2A5YB 2QEQA 2R1VA 3LOQA 4UVIA 3SS8A 1BMFD 3G1TA 4WLFA 4J49A 2V0NA 4S2UA 5A3QA 2IU6A 3TN7A 1IIRA 5EHZA 4E2ZA 3CUYA 5HFNA 3A2KA 4E5VA 3BDIA 3PTAA 3AVUA 4BVBA 2W6ID 1QZ3A 4WRRA 3C7KA 1WLSA 4FK8A 3AEKB 4IMJB 3AJ8A 3A05A 5D8DA 4C4PA 1DE0A 3GK3A 2R5WA 3ZOKA 4BNVA 2GPJA 3ULKA 2JZCA 2WTEA 3H0CA 1NULA 2L42A 2YN4A 3FB1A 1TYDE 4B09A 4B0OA 3EQZA 5C8YB 3VVBA 1DFHA 5IN5A 1RYFA 1DG1G 4YONB 1K7EB 3D8BA 4AJ9A 4EJFA 5IC5A 1JR3E 1M2FA 1VMIA 4KPYA 1GDTA 1SUCA 2RHOA 1YA6A 2CVQA 1BCRA 1NW3A 2XQKA 3T1QA 2QLMA 3INNA 3ZDCA 1LBSA 3GRVA 3V1MA 3WYEA 4ZVKA 1GP2A 1XF9A 2HU2A 1T15A 4MVJM 4ND4A 3O92A 2BGIA 5EE3A 2FKNA 3JATA 5KOJA 1B8UA 1GGMA 3GPCA 4NOKA 5JCOA 4MS4A 1TCVA 1V1MB 4EZBA 1EUDA 1EJ6A 3L6DA 3LUAA 4G0YA 2HA7A 3FFXA 3MS2A 3V6MA 4ZICA 5GIOE 1CVIA 1MW8X 5KNDA 4FKZA 5L3QB 3VYRB 4ECAA 2CC2A 1JDBC 1WCWA 2A88A 2VF5X 3P2OA 1ZAKA 4GSYA 1Z12A 4L9SA 2GB4A 4OB7A 5ALKA 3UMRA 4UHJA 2Q1XA 4F6RA 5CLIA 1X2BA 4H9GA 4H27A 4HMPA 1ZA1A 4O2RA 1E6LA 2ZXEA 1RC0A 1THZA 4JGGA 3SYMA 2W6PA 5MHTA 4HVTA 2Q2QA 1DEOA 2OKCA 4KUEA 4M0DA 5CT4A 2J31A 1J1IA 3HVJA 4W9MC 2WE7A 1Z6TA 1CS0A 3SLRA 3V4LA 5ADUS 1UPBA 1G0OA 4KWTA 4DDWA 3I6IA 5J2TB 2BYTA 4B74A 4DC0A 2LVBA 1UOQA 1DO0A 4Y0VA 1YRLA 5AKKA 1XXHA 2O2EA 4OSOA 4M7PA 4MO2A 3C1AA 3BMOB 4G2TA 1RAEA 2EATA 1VP3A 2ZITA 2XMRA 1PL7A 4KXWA 4KXFB 4Y2PA 2E48A 5GPBA 2AZXA 1T34A 2EWVA 3G59A 2R2GA 3FG9A 1C41A 1YI0A 1NU6A 3MILA 4U2FA 2HY7A 1V3TA 1KJWA 4JOQA 4NDNE 3INTA 4QBTA 2J48A 3CBGA 4G1BA 3T7DA 4BMXA 4Y2GA 1VKOA 2PGAA 3MGAA 3QA9A 2W00A 2EBHX 5AR1A 3EOBI 3ZCPA 4DXHA 1WHSB 4UUQA 4DA4A 2BR3A 1YBHA 2Z2ZA 2CMDA 4LZPA 5D1NA 4F4DA 3EEIA 4J1TA 4LRUA 3RRXA 1P9RA 1MTOA 4NFSA 3KB8A 4K2AA 2Z9CA 2AA3A 1GR0A 3V1NA 1OQAA 4YP7A 2IH5A 4YJDA 3JQAD 3FWHA 4DV0B 1I2ZA 5ABPA 3WBJA 4CR6A 3BTVA 4AF7A 4EAAA 4ONEA 4QJ5A 3TRKA 2EEZA 2I87A 1JSLA 1M74A 2PKEA 4MCJA 4UREA 3VR6A 4A2CA 2O7RA 5TVKA 3RYIA 5JANA 3EWAA 2FPMA 4UTNA 1RIFA 3F6CA 4AFNA 1A5BB 5JEDA 3UPUA 1N8SA 5JAQA 4PZ9A 4PVDA 4FQ7A 4TSKA 1MO4A 4PLGA 3KYJB 2JRLA 1U9YA 3CLSC 5DM2A 1SBNE 1EIWA 3RTGA 2QF7A 1PSDA 5EMMA 2W42A 4RIIA 3PVZA 5EC8A 1Y3FE 1GRQA 2XNDA 3OX3A 4D5GA 2OD9A 3PNPA 3DDWA 4RS3A 1WUHS 5C7YA 2XNJA 2R8BA 3DMTC 4YASA 4JB3A 2BL4A 2FXIA 4WK6A 3GJ0A 5B64A 4HAYA 4B46A 3F47A 2LIPA 1YQDA 3WYNA 1XC7A 2OHIA 4RQUA 3T4UA 2Q0XA 1YQUA 4GWLA 1ZWLA 3I4FA 4O0MA 2IRWA 4HYEA 4BRWA 3NW9A 4E03A 5FL3A 3ZHTA 1MJHA 2AN5A 2BGRA 2RHJA 3GW8A 4FFDA 3EIHA 3TTXA 4EUKA 1X92A 3AESB 5ER9A 4HH4A 3ZJUA 5JARA 1JLLA 4TTJA 2WJIA 2X5XA 3HCFA 2P41A 3WKCA 2O3SA 3C5VA 3V1LA 2PQ2A 5ETJA 5DOZA 2JLSA 1CFJA 3HXTA 1K3UB 1TLTA 3L43A 1XEFA 4R3NA 3ZWKA 1KI9A 3U44B 1Y3HA 4J29A 1BE1A 4HB3A 2XHEA 5H16A 3N0VA 4RTKA 3NYIA 4LJAA 4M1OA 3L7CA 4X41A 1W0JD 1E9DA 1J2YA 1WXXA 2VPQA 2YW2A 4H3HB 1E9FA 1SMKA 2XGGA 2NAPA 3KOZA 4I8IA 4TT3D 4KYVA 1GT6A 1N5LA 5HUHA 4ZYYA 2F1HA 4R1MA 5FOQA 3KD2A 3GVHA 5FV4A 1DP4A 4L8VA 1D2MA 1I2CA 1JQBA 1NW5A 4ZVOA 3IP3A 4BE9A 4C4SA 4QJIA 1BX1A 4TLEA 5BP7A 1ACLA 3F90A 5K0CA 3CVVA 3AL0C 3AVYA 2HK6A 1C80A 2ZJYA 3VHLB 1YU9A 3TG8A 3NOVA 4JYBA 2R84A 1EFDN 1RZRA 1YDWA 3BFJA 4LBYA 1G17A 3IHKA 3I8XA 4P5EA 3VYSB 3ZTTA 3ZGZA 2R87A 4TKUB 4CIYA 5JI2E 3IC5A 1SCJA 2AN1A 3K5WA 1CUCA 3A6GA 3IP8A 2VAMA 4FBGA 4GMDA 2Q6VA 4KLRA 4LUCA 1T0JB 1QONA 2ON6A 5IAGA 3ZK9A 5KX5B 4LYDA 2BT4A 3U4QB 5H83A 4LJ9A 3SM3A 3WYAA 1SHTX 2A7XA 1KVSA 4KPGA 3P5SA 4R81A 1KOLA 3GARA 1X2EA 2TSYB 3CF4A 1J8YF 2Q3FA 1F8GA 4IV5A 3GY0A 5BUZA 1SD5A 4I50A 2IYAA 4EK9A 3G68A 1TRHA 2ORED 3AH8A 2YXEA 2G63A 1DJNA 2Z0MA 4L15A 1JQKA 3GEDA 3IPLA 4JP5A 4WDQA 5TR9A 3M33A 3M3PA 2JGEA 2VNSA 3CKLA 5BUCA 4JBLA 4I14A 1SUPA 3B9PA 3K9FC 1QG2A 3KJQA 3VMMA 1D6SA 4JFAA 1OH6A 4ACBA 1U8UA 4QXQA 1AA6A 1BC5A 3GLGA 4UW9A 2WJVA 4E5SA 1IPHA 5DJ5A 1E9VA 3O84A 4MJ7A 2GASA 2O8CA 3SI7A 3NCHA 4QJ4A 2BW0A 2H16A 1GQFA 3RBZA 1RI1A 5CJPA 1ABEA 5ITWA 5KC8A 3AEUA 3E9YA 3IBYA 3CO5A 3JVIA 1BEZA 2CMKA 4YJ2F 1U0NA 2ZWIA 3LCUA 4A2PA 4CIWA 5AJZA 4YP1A 4DLXA 4EYGA 2X22A 4AY5A 3TDMA 5DISB 5ALGA 1CLEA 2YFKA 1O87A 1AQUA 4N5LA 1S9HA 1O9HA 4JJZA 5TV2A 3KUDA 2P2GA 3ZCXA 5AUPB 5TJ9A 1T4CB 3WMWA 4BNXA 2YRFA 3SEAA 2O1SA 3BA6A 3UJ8A 1UUFA 4MNTA 2GEDA 4JENA 1K88A 2JFVA 4TXNA 3VH1A 4JITA 4DJEC 1UXJA 3A1EA 4CE6A 3RG2A 2CCGA 1YL5A 3TAUA 3Q7TA 4P7JA 1FW8A 1FDSA 2FCAA 1QG6A 2A1TR 3OLCX 4JJKA 1DBIA 4RA9B 5BWLA 1CZKA 5KQPA 1U2DC 1NFRA 4MQ6A 3RROA 1XLWA 2BBOA 1R9JA 2ECQA 2YY6A 4R41A 1RHJA 3I2FA 5CHEA 5ESXA 1UFQA 1ODKA 2IBMA 4FQ5A 5FI3A 1FDTA 4OHZA 5ALXA 3ESZA 1VE3A 4QUGA 3GROA 2H08A 1YB2A 2CLIB 3LUKA 3P2JA 2VHXA 1P31A 4B7CA 3C24A 4I3FA 1O97C 3QEMB 4TN5A 2E0IA 3QOYA 1FZTA 1I1HA 3DVQX 4XARA 3M6AA 4I6EA 2GDJA 3QNWA 3R0VA 1ZRMA 2BKXA 2J6CA 5DGDA 3KQOA 1E58A 1HE3A 1NW6A 3PL5A 4MPDA 2PQ6A 5SY4A 5EE9A 2WU3A 3BG5A 2IWHA 4JLBA 2BSXA 1G98A 4HB0A 3VAAA 3CLTD 5M04A 5D3MB 3VOTA 1J20A 3R2JA 2HJ9A 2Z9BA 2QQGA 2LTAA 3QTBA 2JAWA 1PEDA 3WMXA 5HFJA 3ZDZB 4LKRA 4PPQA 2PUEA 4YDHB 1G291 3WWOA 1EXVA 5A04A 4Z4CA 1UAYA 4WA8A 2HWKA 1L8QA 4KO1S 5JJKA 5AIBA 1P2UA 4P4UA 2XD9A 4HBGA 3TEMA 4M7OA 3EPPA 2BEKA 4XEUA 1V25A 3IDSA 1XO1A 2D5CA 2V1XA 3QMPA 1RRMA 1OXXK 3ANTA 1MEOA 1TEVA 3DMPA 4I7EA 4NPCA 1E89A 3QVXA 1QBGA 4BNNA 5GJWC 5BRAA 5JXGA 3U5TA 4Z4IA 4LWOA 4OXRA 1XDDA 3ZCTA 4B73A 2DY0A 2ZTLA 3RFFA 3W6PA 4KMMA 5KAPA 3ZQ4A 1QIFA 4Q1AA 1AUVA 2DT8A 2PZKA 4OBEA 4EFKA 4DUPA 2REQB 3S2FA 3G8AA 2RHTA 3FKSA 3PHBE 1TZMA 3ABZA 1NVDA 3CCCA 3N2KA 2F90A 3KQWA 1YE8A 4FLMA 2C58A 3A1WA 4IUYA 4WIAA 4WK0B 2O0KA 4D97A 4PS0A 4XGNA 2OB2A 3DM5A 2GCPA 4EHFA 3VYWA 2LUOA 2R1VB 2Q5EA 4YDSA 3KSMA 4QM7A 1IOZA 4L76A 1ZOIA 4F9TA 4PZUA 4FDUA 4WGGA 1GRVA 4QKQA 3EEQA 4RPCA 3DL4A 4C87A 1M2WA 4EG5A 2EFJA 4HEHA 3IOYA 4Q3EA 2YMMA 2BOVA 2JL1A 3FIJA 3QFTA 4LYJA 1RXIA 2QJRA 4X64B 1JE0A 1RWBA 4Z7QB 1O0SA 5ITZA 1DG9A 3AUAA 2EERA 4OD0A 3I5XA 1JF8A 2ZR7A 1KQOA 2H92A 1KI1A 4TLMB 1W9MA 3H84A 2OCYC 4D79A 1ISGA 2RB5A 2V7XA 5JRJA 4PCLA 1JA0A 1OXKB 4YHBA 3MJFA 4QASA 2QLJA 4XX0B 3PFNA 4TMXA 4BEJA 3UAWA 1PR9A 1ETHA 4DJAA 4QPZA 1XQ9A 4UHHA 3RHFA 4NU8X 4R9RA 4LY3A 3BEOA 4X6LA 1MT0A 2BP7A 1NRIA 2VHZA 1ZGZA 1ZCAA 4HX2A 3RPEA 3C16C 3Q98A 1BOOA 3ZUGA 4RULA 4MS4B 3KTAB 1CQJA 3IPXA 4R2MA 2ZBQA 2B94A 1T5OA 2WWFA 2PKXA 4L57A 2OC9A 3G8YA 3MTJA 4XUEA 3R8CA 3STHA 3LRPA 4XWGA 3BICA 4YO7A 1CQIA 2GCNA 2XCIA 2YXLA 2W6JD 3HI4A 2IYYA 1I2BA 1T43A 1U3TA 5TB5A 2YUTA 5KB3A 4UM7A 3BL5A 1ISHA 4NI5A 5IYZA 1SVUA 1GNQA 3R3UA 3E5NA 1F0PA 4MYTA 2WHRA 2WT4A 4AUEA 1VSTA 2FJUA 3EDCA 2HSZA 2P9QA 3MWFA 4MA0A 4MQLA 4FHZA 1T8WA 4EKIA 5BMVA 1M33A 1II8A 2RJNA 4HGOA 2ATXA 3W5HA 2GN1A 3FR8A 1T6BY 1H2WA 1I9CA 2YXBA 4GNKA 5HGXA 2QRKA 1R4NB 2ERCA 4OJYA 1YO6A 2C42A 3CUWA 3VUEA 4HDSB 3L1IA 5GMOA 1AXGA 3D4BA 3JRXA 3O6VA 3OZWA 3P7MA 5DNDA 4C0HA 1D2CA 1SZPA 2P6MA 3BOSA 3L84A 1OTHA 2X6RA 1ZK3A 3BT7A 4Y6SA 4BYGA 2HIGA 2Q0SA 4IIEA 1UMCB 2NTYC 2NPIA 3BAFA 3IE0A 3MWKA 4RF3A 2A8YA 5HEKA 5HTKA 2IODA 4EY6A 3QW2A 3AUXA 3NB0A 2O8DB 3OZBA 3L82B 1UEJA 2Z8YA 1KYZA 4NTZA 4ETNA 1N6LA 2HPZA 2LPMA 2Q1YA 2D3WA 1MIHA 2B34A 4FUQA 3M89A 3MVEA 4HZIA 5DX1A 5JFGA 5KTMA 5M34A 5ALRA 4OGKA 2HCRA 3IUSA 3JWJA 3LQFA 5E7MA 1SCUB 1NX6A 4BV8A 4KUHA 2RKOA 4OHPA 3SVLA 4P53A 3CVWA 1B6SA 3U7HB 3G2KA 1EA5A 2A35A 4WLVA 4H7JA 1NI3A 1TD9A 2GHRA 5G2OA 1NV9A 2PS9A 2QNRA 3K70D 1E9EA 1CNFA 2OBLA 1E94E 4RKQA 2NXCA 2RAUA 4ZI2A 2FDRA 2P78A 5FUYA 5AVQA 1UCFA 3QLUC 3R5SA 1F2VA 4LISA 4BAGA 4XLTA 4B84A 2FUG6 2H2AA 2VPZA 1OH7A 3V9AA 5LOVA 2BSQA 1EZ1A 1XTUA 3JQBA 3OX2A 4YAUA 3LX5A 4OPMA 4U7GA 5AW9A 1TXGA 3EASA 2C3UA 1ADGA 2OO5A 4Q3DA 1QDEA 1AGRA 4ZVPA 4QA9A 4G3XA 1I9GA 3KQHA 3RHSA 4ITVA 3DP7A 4RIFA 5F1OA 1G42A 5KAMA 1S5PA 3RYIB 1GXSB 1GV0A 5MFZA 1KAOA 4PIMA 4W5RA 4AZVA 3X43A 3QM1A 3NANA 3WDLA 5DXJA 1TM2A 2XDAA 1M8KA 4EB6A 2NVUA 2V96A 3I28A 3EAQA 4DCMA 1G9SA 4CV3A 2G88A 3WLTA 3ET5A 1A77A 3DE3X 2ZTHA 5GQSA 3I04M 3AB3A 4GO1A 4OFWA 1SIOA 1U4OA 3ZTYA 2OWEA 2D7DA 1Z4LA 3J80A 3FMOB 3RWBA 3WZLA 1A0OA 2WQ7A 1YIOA 1ZGCA 2XX3A 2G28A 4WPGA 1W4ZA 3H2SA 5C81A 1E3EA 1P0QA 3N8GA 4Q9KA 3EZ2A 4A4DA 5IDYA 7MDHA 5HM8A 5C52B 5FLXA 2VHEA 1Y1KE 1QO9A 4GVPA 1SIBE 1UKVY 1EPUA 1GEEA 1Q19A 3L0CA 4DLAA 1Z18A 4KCGA 3ZD6A 1QU3A 5K4HA 1IQPA 1CRLA 1FSGA 2PKQP 3M4ZA 3N7TA 5JZSA 3RFCA 5C34B 5I9BA 3NBYC 2QPLA 3CBQA 5MN6A 4TVOA 2NO6A 2X9LA 2QAIA 1AIPA 3EISA 3ENQA 4MKFA 2YX1A 5BT9A 2O9JA 1G18A 5FULA 1N78A 4KQCA 3FPHA 4KQ9A 3K5PA 3AY7A 2DKNA 4GZLA 3R3JA 3IDOA 1IY9A 5AT1A 2FP4B 3K0BA 2QLNA 3ZLBA 3HA2A 2IZ1A 1WKVA 1P5ZB 2D5LA 2YBEA 2II6A 1S6YA 3FVWA 4RHYA 4BNKA 3BB4A 1AQ6A 1EVIA 1T2EA 3MJEA 3KYDA 4YQYA 3D4NA 2JH8A 3VU8A 5K51A 4HMOA 3U37A 3ZZNA 4LYFA 4F8JA 4V2UA 7REQB 5JOQA 3WKDA 1EXWA 3TFQA 4DV3B 4N5MA 3ZVLA 2WDPA 3KKPA 1R9NA 4KV9A 5EEGA 3DWEX 5A1TA 4JI8B 1CHNA 1CRQA 4HNAA 5KWJA 4YWHA 4RV9A 3KLBA 3Q3EA 2XMSA 2OGTA 1VYTA 4LE2A 1AU9A 4F7WA 3L8MA 2QZPA 5ECDA 4A0SA 4R2JA 2H7YA 2V45A 1NG9A 2CFTA 4M55A 4WXEA 1IXZA 1SU8A 4Y18A 1DX9A 2AEFA 1E9AA 1NVAA 2V98A 2XE6A 2ONCA 2QYTA 3CSSA 3IMFA 4NY1A 2H2WA 2J9ZB 4LCJA 4U8GA 5DTEA 3RV4A 1A7KA 1N2EA 1Z6XA 2DQZA 2CF6A 1QZXA 2YYZA 4IIJF 1AK2A 2AKYA 3OURA 4LV6A 4WLOA 4RD0A 5L7TA 2HSDA 4AF6A 4LY6A 2PPLA 5DSTA 2BH2A 2H1LA 4N39A 1UZMA 4CNQA 1SM4A 4R2WA 4BO4A 3Q3CA 2J0QA 2P9JA 3EWNA 2AG0A 3EQ7A 1N9GA 4BKUA 2PKWA 3NWOA 2E4YA 1RLTA 1JNYA 2GAIA 2OLJA 3G9ZA 3MLAA 3WISA 1Z4OA 2Q4TA 4KODA 5EGNA 3M6XA 3FH0A 1XPRA 2CLFB 3O2QB 4J0GA 3E58A 3RVJA 5K2OA 3LT4A 1JNXX 4B6QA 2EKQA 2CDAA 1OI4A 2W2LD 1ONSA 1SQGA 1M2HA 3LDGA 3Q6MA 4I50B 4MP6A 3TKYA 3HU2A 1V9SA 1TC2A 4BKMA 2OMEA 1CDEA 1KZHA 2I4MA 3FZGA 1SCDA 3HSKA 2JW5A 3EQ2A 2P5YA 3QFRA 4L6IA 4CTJA 3SDSA 3GNLA 4RSGA 1E0SA 1MENA 3QLEA 4G5HA 4DILA 5ARDA 4ZCRA 1OLUB 4IFIA 3DV0A 2FWBA 1VDZA 5F21A 3D6AA 3KEMA 3LVRE 2O8CB 2OFPA 3B53X 1XBTA 2UDPA 1MGOA 4LZOA 3VO8A 2IIQA 1T8SA 4IV0A 1F5NA 4MDYA 4HOYA 5AI5A 3ICOA 4QAJA 3K35A 4JMPA 3ENKA 1QNLA 1VSUA 2AJCA 2HMYB 3IEKA 3EEBA 3GJ7A 1XWWA 1LX7A 1MOSA 5AHWA 1QGYA 1OFHA 2F1KA 3J7AC 4B31A 1VXRA 4Q0MA 2Q2VA 5HE9A 3RFTA 1DEKA 4Q9LA 3EPJA 4HVLA 2E4VA 2NXWA 3TAXA 4PQYA 4DMHA 5CDFE 3EXHB 1V48A 1UPUA 4J0HA 1B3BA 1NVUQ 4JUAA 2WTXA 3VPFA 4EEXA 1O95A 1NXVA 4YRTA 1WMEA 2Z95A 2PX6A 4FSXA 2NZVG 3HM9A 5D6OA 1OBFO 2VWPA 1JEQB 1N2GA 1P44A 1Q20A 2Z3WA 3B3AA 4Y6QA 5LQKA 4WVLA 4NV3A 4U7TB 1QYDA 1O9BA 1LDMA 2H2HA 1P18A 1XYYA 2J67A 2QTAA 3IDQA 4NPAA 5DYIA 3UV7A 3KKQA 1FX1A 5JXIA 2Q5JA 2QRQA 1D09A 3CH6A 3LKDA 5EHXA 4PSDA 2EW2A 3O9MA 2KMLA 2PKRA 3BD8A 1VKHA 1OXUA 2J3QA 2NX2A 3C41J 3WVNA 5JXHA 4AM8A 3OT4A 4C20A 4WXHA 3U7RA 3ANYB 1OX4B 4MW6A 3FX2A 1CP3A 2ZROA 4NEGA 2FYTA 3OOSA 5DNWA 3S2UA 3T7CA 3UA3A 1XRNA 1ZSVA 1YB7A 3LV8A 5AKJA 2RAVA 4WKNA 4K6HA 4GBGA 4IAOA 3DKKA 3NPAA 4HO1X 4X8MA 3FGPA 2X7HA 4PAOA 1B0UA 3E0QA 1YV9A 3GUZA 2GEFA 1VJTA 2FPPA 3LWNA 2B4QA 4PLTA 3R3ZA 3JCZA 3LFHA 3NTXA 3WOVA 2GAJA 2V58A 1HBJA 3UPDA 4PXYA 3P71T 2ZWPA 3DTYA 1IJBA 1M76A 4ZALA 2ZOSA 4AP5A 2Q4EA 3IO3A 5D5PA 1VKJA 1RTTA 3X1KA 4DT1B 3T1YB 1IOLA 2XXJA 4QOSA 3O8NA 5ED0A 1TVCA 4N3GA 5F33A 2ZUFA 3K0HA 2A3RA 1WXEA 2A30A 3O82A 1QKIA 2XD4A 4MINA 3NP9A 2F64A 1OFIA 1YDEA 2HXGA 2G1JA 1JDZA 4N01A 1P0CA 2I9PA 3NEJA 4PNPA 2QJOA 2JFHA 5E1OA 2WQZA 3M82A 4GI3A 5D00A 2BI7A 2QRJA 3IIIA 3DHVA 2ZIXB 1KKUA 2O3TA 3FJYA 2VF7A 4HFNA 3DT8A 4I8XA 1VFNA 3IKVA 4IMRA 5DHRA 3PXGA 1YF3A 4A10A 1BH6A 1T5HX 2J8ZA 4QXRA 4B3RB 3KYCA 4ZRNA 2VAXA 4L5IA 3W2IA 3P9ZA 3VMFA 2GXSA 4F9GA 1H8HA 2C8KA 2F3SA 1B1AA 3L4KA 2HSWA 2VDVE 1KU6A 2TMDA 3OCXA 4DEVA 1E3LA 1ZD4A 3MTGA 2CLKB 5G0VA 3LOPA 1G55A 3HO1A 4MUEA 1E8DA 2JEOA 4MVJA 3E15A 4GMKA 1KY4A 2WHPB 4RTMA 5FYQA 4JNCA 1PQ4A 4GM1A 4IXNA 4G0MA 4NZPA 4Q03A 3G0GA 3KSUA 4ZI7F 1GCOA 1NN1A 2NVBA 2IX9A 1B15A 1W19A 4WZBA 1VKRA 3E81A 3B7GA 1VLZA 3UOWA 1EWRA 4LHEA 5DFAA 2EBUA 1ZVMA 3K9BA 1FTWA 3GRKA 1MB9A 4R2LA 4ROSA 2ZIWB 3RVDA 2IOYA 2ORVA 4KAFA 4WESB 2QG4A 5D7BA 4MRVA 1RJFA 4NCIA 1WTCA 4A7PA 3KP1A 2PX0A 1JG3A 1ZGJA 1HDCA 2J3HA 3BERA 3UK2A 1UJ5A 3BRWA 4XR9A 5LVAA 2C4VA 5JSZA 4DQDA 3OVMA 4OAOA 4OBBA 4IDFA 1WV0A 2D1RA 1UIRA 3N0WA 5C7IO 5JV5A 5FBVB 1WCV1 3E3OA 4EGFA 4IIFA 4P80A 3B6EA 1E69A 2XMPA 4NMXB 3V32A 4BJ3A 3GJ4A 1NMSA 3GEBA 3S7TA 3NASA 2WKPA 1JA1A 1SOAA 3R5HA 3GAMA 2XZPA 1NUHA 1DQRA 1RQ2A 4LFCB 4WFIA 5CT5A 2OGZA 3TLBA 2ZVQX 4G4IA 2QM7A 4QFMA 2Q9UA 3SIRA 5LD2C 2B1QA 2X58A 4GOMD 4HXEB 1CQIB 1QGED 4IF4A 2CCJA 3JYLA 3KXPA 5EXDA 4OQFA 4W1PA 3ZIDA 1XCOA 5KU1A 4ZPJA 4YREA 1Y82A 1Z5ZA 4JEHA 4D9CA 5JLAA 6LDHA 5IYZB 1P2SA 1CETA 4UJ5A 2CZGA 4M38A 3U4CA 1LRKA 4M1EA 1P1CA 3OEYA 3BBPA 4XPZA 4XJXA 3CNQS 1GKUB 3DO8A 3W0LB 4OX9Y 2CHEA 1N9ZA 3L0SA 5I7RA 3TK1A 4AJNA 4CCAA 3W3AD 4RGQA 2D0PB 2J09A 2ZDHA 3CRNA 4NEHB 3RUDA 5AW3A 2NXEA 1EWQA 3OJWA 1HI9A 4ZXPA 3HCBA 1OI2A 2GCEA 1WXGA 2ETVA 4M0MA 4ZEOA 3ZDYB 4EPXA 4QEDA 1QH9A 1NQWA 1AURA 2PVPA 5CVUA 4DCSA 4XRGA 1KRWA 1RNLA 2CXNA 4FMPA 4A1FA 4BFUA 1AKYA 2LD4A 1PS0A 4OQ4A 3W2TA 4Y6GB 5TEVA 2B98A 1FUEA 3AP1A 4L8FA 2YTZA 4X7BA 3SE0A 3OE7A 2XOKD 3MGCA 5DF1A 3RI3A 3VI4B 4ALLA 2OHGA 2I4IA 3K53A 3IA7A 4PZ0A 1TIBA 4WN3A 1XZCA 4M46A 2EVWX 3LWZA 1INLA 5TMBA 1TADA 2WKQA 2UUOA 4N41A 5J40A 3JZMA 1C7QA 1E6KA 1S2LA 2MYUA 3WGNA 2R6ZA 2Q4BA 2G5GX 4Y9TA 2XUJA 3FI0A 5H82A 4QBHA 1E6MA 4AZSA 4FFNA 1KI7A 1UBJS 2CEAA 1H69A 2FF7A 5KNBH 3TB4A 5FFMA 1SKUA 1M1XB 2FFBA 3FSJX 3NI2A 4NOMA 3J7TA 3KZKA 2NU7A 4YUYA 5JH7A 5DHTA 2I78A 2V6IA 1P0PA 3PF8A 5LOVB 4FN4A 1QUFA 4TVSA 3IUMA 3AF6A 2CF5A 3ZZMA 1HPLA 4C9BA 2XUIA 4R2IA 4P5DA 5JYDA 3G8DA 4TKVA 2QE6A 3EZ7A 5KYUA 3DXZA 1QH1A 3VR0A 1JTVA 1PDWA 3K9QO 1H2BA 1MEEA 3EMKA 5HE8A 1PFWA 2NYRA 4TLLB 2DRIA 5BRJA 1IVNA 1EFRD 1TIKA 1Z75A 2C57A 2QMHA 3M34A 4WWHA 2RJOA 4PCAA 1AGNA 3TIVA 5LUAA 2QRPA 1K08A 3WMFA 4JXXA 3MCVA 1YZHA 4BN0A 3SD7A 2NVUB 3RSGA 3VOSA 4OXQA 2F3TA 2EZ8A 3G17A 1NJFA 4P6VF 5L7WA 4Q1CA 1JEYA 3CHYA 3B9QA 1KZ7B 4ZA2A 1HM5A 4BWGA 5EN4A 5AVJA 3IMKA 1DRUA 1A82A 4JSRA 2HT6A 4E46A 1EVYA 3P2KA 2FQ1A 4R51A 1WXWA 2W2NA 2GZAA 5ALHA 3K0EA 4LCBA 5CYPA 2VZ0A 4I4LA 4Q00A 4A6DA 1TT5A 4NJMA 2X9VA 3W90A 1X7YB 4RGVA 1Y7HA 4ETWA 4S1TA 1XU4A 4O63O 3QPAA 2IY9A 4EDFA 2QIPA 3AR4A 1WU8A 1Y9JA 5FWNA 4ABYA 4DLRA 1DEAA 2QL7A 1FFEA 1DZIA 3O8QB 3NIBA 3FA2A 5L53A 4K28A 2ALJA 4O5OA 5A71A 4WKGA 2ZBGA 1YB6A 1W35A 1SGWA 4W5HA 3UB2A 3WNQA 2UYOA 4ER7A 2BGNA 3FUXA 4DMFA 1NKVA 3GGCA 5U9CA 3BH6A 3LQKA 3FFBA 4R0NA 5HKAA 4IOLA 2E1RA 2FEPA 4L8WB 1LC3A 3R20A 3FPLA 4DUYB 1LX6A 4XM1A 1VG8A 5SYNA 3VRHA 1J39A 4MHSA 2QMYA 1Q7CA 3SQWA 1AVTA 2XLCA 2O8VA 1RACA 2NPOA 2BJHA 2BY4A 3A9VA 3KYDB 4KRYA 4ZVSA 1JJFA 1QUEA 4S05A 1LDEA 1LV8A 2IYLD 4N5DA 1JR6A 1E60A 1ZA2A 3H9JA 2PMEA 1QHSA 1UBEA 1KH2A 3SN6A 4JWKA 3PU6A 1PF7E 1WDKA 4NHOA 4JOSA 2VPIA 3ITDA 1YJXA 2LWIA 4HNAB 4DCNA 3WGUA 3GMIA 4Q4JA 3I5MA 1C9KA 4AQYB 4PYJA 2XEXA 4DG9A 4E2XA 2O2GA 3UM9A 3GPIA 3EFOB 4UC0A 1Z6YA 3DFUA 3VU0A 5D87A 2IYVA 3HNOA 4ZOQI 4C43A 2QRUA 3IQZA 3HKCA 4XM0A 1YDHA 2HMAA 4I66A 1X15A 3VDNB 4DZTA 3HO8A 1U5CA 2RGGA 3Q87B 5CTAA 4BFTA 3BRSA 5KWSA 2MSEB 1G8PA 3B38A 4XIYA 4D43A 4D4IA 4O4JF 1A96A 1BFUA 2YCBA 2WMDA 4GFDA 1YZLA 2X0KA 3OPYI 4ZMSA 3RTCA 2YOHA 1FA9A 4REOA 3QUCA 2WIJA 2HLDD 4R84A 1N9KA 1ZMTA 2W2XA 2XNKA 3PRHA 4PG4A 4D9GA 4G9EA 3PC6A 4JD5A 1CUDA 1J99A 1KJNA 3NRBA 2AUNA 1ECCA 5CFZA 5A5VA 1FS4A 1M7BA 4RKRA 6YASA 2J9YB 4PM4A 1SC1A 1CV2A 1ORWA 1K8RA 4WXRA 4V0ME 3BSWA 5E9QA 4D41A 3H2KA 1RADA 4NCBA 4Z9BA 3D5EA 2FSIA 3SWWA 4PSVA 3ELUA 2QPOA 3I4LA 3FZEA 5AH0A 3VR1A 4GU5A 1ZCZA 2ZSIA 3QX3A 3ND7A 4UE2A 4A91A 1MIOA 1GKLA 2XYHA 1G7SA 3AZPA 5JCZA 1LNQA 4RAOA 4QUDA 3CLHA 4FE4A 2F8LA 1FXWA 3H3XA 3N8IA 1YCHA 2ZVJA 3KHUA 2UXBB 1ZOPA 5FO0A 1EKXA 1KR2A 3TZHA 4MUGA 2J08A 4MA4A 3WMEA 4FOTA 1Y3DE 4B87A 5KVAA 1GM5A 3JQEA 1VRVA 2VK2A 3G2OA 3GFOA 5K3FB 4BB6A 5IUJC 1SU4A 2VP0A 3JQFC 3TE6A 2DR2A 3LT0A 5AUOB 1LA2A 5FT9A 2G36A 3Q7IA 3EVZA 1SNYA 2RB4A 1F2TA 2ZZNA 3BF8A 3SYKA 3LLMA 5CLHA 1TJ4A 2GD0A 3R09A 3FI9A 5TJHA 1L4FA 2ZE5A 3G0BA 4KP7A 4RIEA