2JFWA

Crystal structure of enterococcus faecium glutamate racemase in complex with tartrate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
b'MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
molecule tags Isomerase
source organism Enterococcus faecium
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
total genus 96
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA01
2DX7A 4B1FA 1IU9A 2JFNA 3ISTA 2JFOA 2DGDA 3OUTA 2JFPA 3OJCA 5HRCA 2JFWA 2JFVA 2OHVA 1ZUWA 2OHGA 5EVCA 5HQTA 5HRAA 2DWUA 1B74A 5ELMA 2GZMA 3UHPA 5IJWA 2ZSKA 2JFQA 5HJ7A 3HFRA 3S81A 2EQ5A 2W4IA 3S7ZA 2JFXA 2JFZA 5ELLA 3UHFA 1JFLA 2JFUA 2OHOA 3ISVA 2JFYA 1B73A 3UHOA 2VVTA
chains in the Genus database with same CATH superfamily
2C3UA 3SLRA 2XQGA 1SB8A 4XQ0A 5CEFA 4NX2A 5FNVB 1QG0A 2G4CA 4BQPA 1BE1A 4F4IA 4JSYA 1TT7A 4C4ZA 3GEPA 4QTXA 1M33A 1KAOA 5LUBA 5AJXA 4F2DA 2IPNA 1AUQA 1J00A 4R8KA 1U7ZA 2HGSA 2OSVA 4XX1A 1H2EA 3INYA 2AGVA 5G02A 3P9IA 2BSQA 3GUUA 5ARCA 1M54A 2J31A 4RGVA 2RHMA 1LNZA 5CTAA 9ABPA 1J07A 1PFKA 2O2CA 2VPTA 3U4IA 4HAIA 4GZLA 1OI3A 1HYHA 2VZLA 4ZVTA 1UJ5A 4BXOB 4RMIA 4BCDA 2FVYA 3REFA 2BCEA 4BAZA 1E3DA 1Y5MA 2QG4A 3FUTA 5IM4A 1KS2A 2O50A 3EF0A 4B40A 4LRUA 3TO5A 3L0OA 3T1OA 4M60A 4JLMA 3GC6A 4JP8A 3IDAA 4KQHA 2OY0A 1PEYA 3VI4B 3LZCA 4L07A 3WMWA 1JA0A 2C5AA 1U65A 1SCJA 1V6AA 3C6ZA 4HD8A 2DPHA 3O8OB 2JI9A 3QI2A 3V55A 4RTNA 5KAPA 2GPAA 3ZJVA 1W4BA 5SY6A 3KD2A 2XB4A 4KKVA 4L08A 4NDAA 3KQKA 5HJ7A 4H9GA 1NP6A 1I9GA 4EO9A 3FUXA 5B1IA 1HKHA 2TYSB 1Q83A 1SC9A 3FFWA 4ZXFA 3NG1A 3DEKA 3G9QA 1AH2A 3A9TA 3KTAB 3LT2A 4LCEA 2JAWA 4FDMA 4X7RA 4UKDA 1ZESA 1I8TA 1DXHA 2F64A 3NBMA 1XQ9A 4WXYB 4B1FA 2LNDA 3FCOA 1ZN2A 4R8RA 3IAXA 3WL5A 3GP8A 4LV6A 4YRNA 1UM9A 1PNTA 2F1IA 3DVQX 2J4CA 1F8UA 2JHCA 3EFOA 3F4BA 3I37X 4HDKA 4XYEA 2NTNA 2A1UA 3BD6A 1QYIA 3B85A 4MAFA 4BBAA 2RGBA 4CKEA 1Z68A 2PV0A 4BZWA 2VUSA 3O1HB 5IC4A 3GLIB 4TS9A 3T3NA 2G5GX 3W2FA 2PXCA 5HZGA 5ICEA 2IV3A 3BMQB 2GDJA 3JRWA 4ARVA 4R8LA 5IC6A 1RYNA 3SVTA 1CQZA 3BFJA 3PLRA 4RZSA 4G07A 2BLLA 5BN4A 1RZRD 4Z4GA 1SOVA 2RG7A 2DBQA 1QTRA 2HK6A 5EQDA 2II6A 2Q3FA 4ASUA 1L5WA 3DEIA 4K7JA 3VR4A 1IY9A 2IHNA 2YYAA 3N8IA 2EX4A 3T5CA 4K9OA 4ZARA 4IIHA 3R3XA 4H6VA 2IWHA 1UMCB 2HJGA 3R3JA 4EIWA 4WK6A 3U3ZA 2X15A 5K2OA 2CCKA 4EUSA 5EWMA 1NWCA 3OU7A 3F6SA 4YTEA 4J4HA 3U4HA 1NQAO 1PWYE 1ABEA 2Q5CA 1FF9A 4MYHA 5CLQA 3ZHTA 4CKCA 5BURA 1Q0TA 3OIVA 1X92A 2N42A 4INAA 5KJCA 1FPMA 4GGPA 4MPPA 2NXEA 3WYAA 4C0AC 2HU5A 2K6GA 2OSBA 1XTQA 3SFVA 4XX0A 1PW5A 5CA1A 5K0EA 5AM1A 4OLJA 3ROXA 1I7PA 2VRWA 3G8BA 3ZLTA 4EZEA 5I7HA 1W76A 4G5OA 4GX5A 1QAQA 2YBEA 4OFWA 5MFZA 2LCIA 2OAEA 1VOTA 3BSYA 1U63A 2GLXA 1RXEA 2W9XA 4LI0A 2H65A 5HF8A 5ALYA 4MVJE 3TXAA 1FP4B 3QMPA 2C5EA 5B1YA 1P7VA 1U0OC 3CV3A 4MVJP 2H0RA 2JVIA 5CJPA 3I30X 4XDHA 1L4YA 2D1SA 2PGOA 3AK4A 5J59A 1JEYB 4MAAA 1LU9A 5LXTB 3DCJA 2RBGA 4K86A 1ECGA 4ARSA 2WJWA 3ENNA 4TLDA 2QZSA 3T34A 2WNSA 4ZHSA 2GD0A 1A72A 4C6SA 4X95A 3NANA 3L4JA 1RWMA 4G81A 5DF1A 3V7YA 1QV6A 3G2LA 3R7WA 4MA4A 3LY9A 1CERA 4FPXA 4OJKA 4E70A 1UEJA 1HZZC 2FRVA 4HLCA 3ZJ4A 2QT9A 2CUKA 1Z0DA 1BGXT 2RJOA 3IRUA 1EUZA 3PUKA 4IRUB 5K0TA 5L95A 2AZ4A 3JCZA 5INTA 2HA2A 4A16A 3LKZA 1FBNA 4PPYA 3PGMA 1LV8A 1XLTA 3HE3A 3TVDA 4JJIA 1JRLA 2VPQA 3MLAA 5AI9A 1R0YA 2RAVA 3JASA 1M2JA 3KKMA 4A03A 4FYPA 4H4DA 4R1UA 1CY2A 4JL8A 4B3MB 1IJBA 3AVWA 1ZG3A 3V8MA 4XYMA 3ANXA 1FP1D 1PLKA 4I1YA 1ZW6A 3C14C 5FL7A 1Q77A 1BE8A 1E64A 3TMAA 4BASA 4B6EA 1MO6A 2ZTUA 4YXFA 1Y3BE 1T43A 1OBHA 2NSHA 4GBJA 2WLSA 1GVNB 3CNLA 3NP9A 2ZIVB 3LQ4A 5SY9A 3R7SA 4E31A 5AW1A 1JR3A 2PWBA 3RV3A 2EFCB 1APBA 1BMDA 4GI7A 3ZI4A 1FFDA 4QGFA 4EFLA 4KPUA 5E2IA 4HEA6 4MWGA 4B17A 4AZSA 3E7XA 3OEWA 4GP7A 4JEMA 4BTLA 3CRQA 1QPGA 3EFBA 3LOUA 3T7SA 3CO5A 1QSGA 2QX6A 4B2LA 2F9FA 3C4JA 2PJRA 4PLPA 3WLIA 2ZW9A 3O8OA 4FKMA 1E99A 1ECBA 5FL7D 1SVKA 2JI4A 3DUFA 1QVWA 2DFVA 4G8DA 1W47A 1GYQA 2OAQ1 1HSZA 2WB4A 1BO6A 3DHEA 4NMHA 5BPFA 3OM8A 4OYHA 1BMFD 5AOCA 3GGDA 4R05A 5JLJA 3CIFA 3C41J 3ISTA 2ZUSA 3KTAA 1SUSA 3DF7A 2WP8J 4R9RA 4TXNA 5CXQA 3FOFC 1K4YA 3CUEF 4C7JA 2CV0A 2YS7A 1XEWY 1FVFA 5A71A 3ENVA 4RTQA 1OAKA 5F7JA 3JQPA 3INTA 5CIQA 5EIAA 4XDZA 3AR8A 4M76B 2EWVA 1M0TA 3RU2A 3NJ4A 3OCYA 4DWJA 1Z2EA 4TM7A 1P60A 4QG7A 2A1UB 2FZEA 2NUAA 1ANKA 2NUPA 4KR7A 2HWXA 3T3GA 3GLIA 4BQRA 5FHQA 5B37A 4R0MA 4CEJA 1PZXA 5C46F 1L4NA 1U8UA 3KB1A 1R9GA 1WBDA 2Z5LA 2L82A 4JNKA 3PTZA 3RSZA 1RWQA 2Q4DA 3CZQA 3K09A 2N75A 3R77A 4TSFD 4BWFB 4EPWA 2IXGA 2Y2UA 3C3YA 2VJCA 4TMVA 2FR8A 2H6EA 1E8MA 3VV2A 2QG6A 1QRUA 3M82A 4WOKA 1CY0A 2I55A 3C1UA 3GYBA 5JALA 2A88A 5FOUA 4KWEA 3DUWA 3CZRA 1CUSA 1WPRA 3ZD7A 3RJZA 5G53C 1BVRA 1L4GA 3DH0A 5KJ6A 5KTSA 4DR4B 2DHDA 2ZZKA 2QTFA 4KXWA 4PGMA 3UJAA 1BEUB 4EGJA 4PLHA 3DYBA 2PO5A 4OOFA 4N9WA 1MOQA 4DLPA 2QIOA 1H94A 3I8OA 5EKUA 5ICFA 1N34B 5CA1B 3LDGA 2IE8A 4IVNA 2C7VA 2JDID 1TTPB 1ADBA 2P4SA 2H5LA 3SBXA 3ZIUA 1SA0A 4CDRA 3GEIA 4O2BA 2DFDA 2H85A 3EZLA 4HWPA 3HCNA 1K4KA 3GF4A 4L8GA 2P9BA 4MQBA 3IT2A 4YEDA 3U1BA 3BGOS 2BUAA 1W5FA 2EFEB 3K96A 4QUBA 2ZAGA 5FBQB 4EFKA 5B6IA 3L8EA 3AWDA 3UAVA 1HG0A 4QOSA 3VVLA 1VG0B 2X5XA 4LF7B 5I7SA 1QCYA 5L40A 3B2NA 2K2WA 1USKA 3EDRA 4CIVA 3CH5A 5ESRA 2VYFA 2FMHA 3WLJA 3BZWA 2ODPA 4MKRA 1XVVA 4JLJA 4MP6A 1ZIXA 2CXRA 4ZZ0A 4MO9A 4B7UA 3OZ7A 2XE6A 3HBMA 2EJUA 2YOFA 4MI3A 3AVPA 3D4BA 4WPGA 1ST2A 2WIJA 3X3HA 4N5NA 4BTEA 1P8AA 4PQEA 2A0WA 1O95C 1W7AA 3T8YA 3T7KA 4MA0A 4KPFC 3MT0A 5EWLA 1I3KA 2LE0A 3UJ6A 2JA1A 2NTVA 2X19A 1MH9A 2DUJA 5TXGA 1UAAA 5JZOA 1PJ2A 4UDYX 1CF2O 4D4MA 5CFOA 5JUWA 3WWPA 1E3LA 3OJFA 3SEFA 1BW9A 2XCUA 1N5DA 3GLGE 3IAEA 1Z6QA 3AVQA 3JWHA 2H18A 5H02A 4TZ6A 4TWAA 4O59O 3BJEA 1K1EA 4CL0A 4CR8A 5BVGB 3F1KA 4FHFA 1N92A 1QFYA 3B3QA 4FEGA 4PZ9A 1E77A 4RPIA 5DISB 3PUYA 4H18A 3ZGOA 5CJ2A 1U3TA 1MN6A 4EFNA 3G5LA 3PC8C 4MJLA 1VJDA 1E2FA 5HCIA 4DLAA 1G3UA 1G5HA 3QVOA 4IG4A 5G0UA 1LPPA 4DLSA 4HT3B 2H1CA 1DIRA 1FU8A 2GHRA 2ZG6A 4RVHA 4HPWA 4RVNA 5L8VA 4E07A 3D0RA 1M1YB 2R4QA 4RENA 4AP6A 4TV8F 1IM5A 2O6HA 4RQBA 1YS4A 3FIJA 4Z54A 4V3CA 3VPSA 1P1KA 2N1BA 4FP9A 5TF0A 2W8BA 1CR0A 4K9RA 4J16C 5HUHA 1YDFA 2L19A 1KL7A 3CEAA 4DV5B 1QTNA 2B5WA 2RJ3A 4Y2YA 4YONB 1NBAA 1PWXA 4GM0A 4RGYA 4Q7LA 4X41A 4F45A 3Q11A 5ITSA 1U04A 3G2JA 4HTFA 2YN4A 3GVIA 2BMWA 1A3CA 1G5FA 2VXBA 1GQFA 3CVJA 1DAHA 1B0AA 2G5PA 3FUCA 3CEPB 3KELA 1IUOA 4IGEA 4BJHB 3WS7A 4QBTA 5CP8A 4IOLA 4XB1A 2DQZA 2WM3A 3KD3A 3MJDA 5TS2A 2PJDA 1D8TA 2ROQA 3A6ZA 3NYIA 1E2PA 2UVQA 3FB4A 4DG9A 5IAAA 1V0JA 3KYJB 3ZBQA 5AI5A 3DOIA 1SCQA 4MS3B 5ER9A 1HTBA 2FKNA 2FWRA 2P5SA 3OF3A 4M1WA 1RE1A 5CB4B 1X42A 3VKFA 4NPCA 2VH2A 4PG4A 1JT2A 2EZ4A 1T8SA 2I3GA 1EVYA 4MO2A 2NUAB 1JI3A 3RI3A 3VYUB 4BZXA 4KJZA 1USGA 2XKKA 1MVOA 4JROA 1NJSA 2ZUWA 4DDVA 3LT4A 3WWEA 1XMXA 4XJTA 5LQSA 2YWFA 1KTIA 4RTKA 1UPBA 1NXVA 3CIOA 1U3GA 2IEYA 2YRWA 1BVUA 3UHJA 3GW8A 2OZVA 2V5VA 1XCLA 1H1LA 4N82A 5GONF 1U9IA 3QY0A 3YASA 4ALNA 2XB8A 2DR2A 3IIEA 2QMOA 1WMFA 4B3SB 1P3Y1 4NP6A 2O3JA 4DSNA 1UT6A 3I3OA 1UBKS 4GMFA 5HM8A 1Q0HA 5DHRA 5IKXA 1O6BA 1P73A 3WOVA 3PFIA 4D74A 2IY7A 1T9KA 3AM5A 3LDAA 3QG5A 4MJXA 5I7VA 2NADA 3FI9A 5CGZA 3QLTA 2G88A 3NHFA 1Y6ZA 2ILTA 2OV4A 1KQOA 2WM8A 3PPXA 1WCWA 2ZT7A 3UWOA 3ZV6A 4ZVUA 4B74A 1XB2A 3V5NA 4CBVA 2I4NA 2A9FA 1ZH6A 4UHBA 2H5JA 4UATA 2YWHA 2IHBA 1BDJA 3IKVA 3B9QA 1URPA 2OG2A 3AR2A 3OHPA 1T13A 4NCXA 5J1TB 3STTA 3UGJA 2PRSA 3UH1A 4HUQA 2ZSUA 2WYHA 4M0EA 5DSZA 1LLFA 4KIGA 1OB2A 2X8WA 3FG9A 1PDWA 1ETUA 3EBOA 1SPXA 1YBFA 4GI5A 3JTMA 1EINA 4G5QA 5C4MA 2AFHB 1NI4A 1ODIA 1VFPA 1ZK3A 2HJ9A 2X7XA 5HIJA 3R7FA 3ZCSA 1P5JA 4OI1A 4HSGA 2C7GA 5IH3A 3HWRA 3T7RA 4DJJA 2P78A 3A2KA 1TXGA 4IGIA 4PYQA 3VDQA 5LYJA 1GNTA 1X7GA 3DV2A 3MCUA 3WGTA 3O03A 2RHWA 5EIBC 1FRNA 2IOYA 4ZAWA 1QF9A 5T57A 1DL5A 2XIJA 4F5ZA 2PUEA 5A7FA 3O9MA 2PRIA 4WGFA 4U7JA 2ZULA 3KUDA 2IEIA 3OFVA 4EUKA 4RF4A 4EG7A 5DT2A 3P45A 3VAAA 1YCFA 4GI1A 4I36A 3GAZA 1XWFA 4Q3AA 3WWCA 4PYNA 1JEDA 4EG8A 4ZYLA 6YASA 3SBOA 2Y77A 4JASB 4GQAA 5G41A 1KYZA 2VJPA 2VDOB 1DBSA 4FOOA 3E05A 2H1SA 1P1JA 4NG4A 2G8LA 2C3PA 1YRBA 4UE3S 2X3UA 3CR8A 5TC4A 1D6MA 4YFYA 2MSEB 2YOHA 1N9ZA 1PL7A 4UEOA 4I2NA 3U7EB 2O54A 2ZJ3A 2OBBA 5DWQA 2ORWA 4NHEA 4CWAA 1VIMA 2AJBA 4N6NA 2ONJA 2NU7A 3PNSA 2IYUA 4HGNA 3OPXA 2GYWA 3JU3A 5HBGA 4OAPA 3ZYCA 2MR5A 1XCGB 1C4KA 1QPZA 4UVIA 2YYZA 1JPVA 1FNNA 1RAAA 4RK7A 4BKRA 2J7PD 5CA0A 2FWAA 5C5DA 1UODA 1J2EA 2AR9A 1LS1A 2AW3A 1IK6A 1M1YA 1F2UA 3MWGA 4OA8A 5CR9A 2QRQA 1XDBA 1M2HA 3ND5A 4LOHA 1D5CA 3ZI7A 1ORHA 4TKMA 2W8BB 2ECQA 2FK8A 4C7XA 1X7YA 3H65A 3OETA 4TLLB 5KTMA 1R0SA 3ROGA 4CLOB 1PT9A 1JXQA 3QX9A 1AN0A 1DRKA 3HSKA 4JLOA 4JL6A 2FFBA 1PFWA 4K9NA 3TZQA 1KZ6A 5TPWA 1M2OA 1RLJA 1L7QA 3VO8A 2QTMA 5A4MS 3DT6A 5E38A 1BXKA 2ZS7A 1OA0A 3PKZA 1TEVA 1RACA 2OCDA 3EVGA 4CM3A 3IV7A 1GEEA 3Q6MA 4PRKA 3R6LA 5CYFA 5FHRA 5JBQA 2WTAA 3QEMA 3OM0A 1CZRA 3C87A 1B8PA 3MPOA 2D0PB 3AG6A 3BTOA 3FZNA 4R2IA 3VR0A 1UWVA 2Z08A 4ETMA 1HOTA 4BMOB 5LN1A 1XRPA 1YR9A 1S6YA 3NC4A 3K35A 1Y1QA 3NGXA 5AW8A 1QK5A 3UGQA 1X7HA 4ID3A 1UPTA 3S1LA 2QVCA 1RAIA 4KFSA 5F3RA 5IN5A 3RHSA 1E18A 4R9NA 4OBXA 4QARA 1AQJA 1BTOA 1J2TA 3UC5A 1KGSA 2PBLA 3CLRC 1N2XA 1QM5A 1NBME 3N7TA 3IPAA 2IWRA 3C7AA 4RCZA 2UXBB 1E1MA 3O2QB 3U4AA 1SHUX 3NC1C 2E5FA 4MVJD 3O1JC 4GEGA 5KYXB 3F67A 2X0DA 4F38A 3TFOA 3KNZA 1NDHA 4TVSA 1H69A 1HH4A 2YJ4A 2A5YB 1B2RA 4OG2A 3K8YA 1WXXA 5D7NA 2HGZA 5A5GA 1LBQA 4UZEA 3HN6A 2XNDA 2OPBA 1GWNA 1M6EX 1Z75A 1ZGJA 3A58B 4OKIA 3D7LA 3S81A 3A3KA 4JYPA 4Q9NA 4ZTZB 4W9RA 3A4LA 1IZYA 1RWPA 4W5NA 4EGFA 3OEHA 2W58A 2QQEA 2J67A 4X8HA 2HJWA 2RAPA 4WHMA 3E9QA 2ERXA 3QXXA 1ZIYA 4G9BA 4JYAB 4EYEA 1LF0A 1LDBA 1FW6A 2M6SA 2XW6A 1E63A 3MJFA 4GPZA 4G63A 2QYHA 3EDYA 1F6BA 5TGTA 5AHXA 4I1VA 3DPUA 3K6SB 3M1AA 1SUIA 1CR2A 1J70A 1KO8A 2Y9PB 3B3AA 1LQTA 1N2OA 3QKSB 4JR0A 4WEOA 4G9GA 2FZLA 4U2CA 5IJ0A 2O2JA 1PQUA 2AS0A 3NRCA 1CZNA 1V5WA 5EKSA 5JAIA 1ETHA 5J2TB 4R83A 3D8TA 3T7CA 3EGOA 1JILA 4Z9YA 1ODFA 2JEYA 3BE6A 3RTCA 1N4DA 3VXKA 2RD2A 1XR3A 4F3YA 1DBWA 1REQB 1K5GA 2GDZA 4AZ3B 3U3KA 4YO7A 3CY6A 4AUKA 4CEJB 4KU4A 4S12A 1SCDA 1A76A 4BRSA 5B7PA 4Q21A 1V37A 5KVSA 2DTEA 3R9XA 1Z25A 5J2UB 3N2ZB 3PTLA 1GGEA 2GPYA 1CQIA 4C43A 1XQ1A 3LOQA 3O2NA 3HR4A 1E6EA 4PLFA 4L3WA 3NS7A 1E2KA 4UTRA 3AF0A 1DOAA 1SIUA 1UMDB 3IMEA 3BYZA 5KS2A 2IEBA 5DM0A 4Z99A 1P91A 5DM2A 3PHIA 1XKTA 2JAUA 2A14A 4CVNA 5G0SA 2VSYA 4URHA 5LUAA 5MN6A 4DLWA 2PH3A 1MDFA 4AWBA 4TN5A 4RIEA 2C2WA 1SXHA 3UJHA 1VYUA 4D9HA 2NOAA 4CNBA 2PWAA 1WB6A 1YRAA 4DDMA 3PNOA 1Z2DA 3NDJA 1IBSA 2CCJA 4TWBA 5GOTA 3X1JA 2OGTA 3BEOA 1Q20A 2BR3A 2PU5A 4LE2A 4I99A 1QU3A 2VWPA 2E37A 3VR6A 2B8EA 2OCPA 5B7GA 3SXUA 2GN6A 4EP1A 4HGOA 3SJUA 2I6GA 3JZDA 1UH5A 4KQKA 5ED0A 5JH7A 3VZRA 1QGAA 5KHOC 1IHYA 3W5BA 1E4EB 4WH0A 3UWKA 3Q7QA 2R96A 4GRIA 4J94A 4JLVA 4AY5A 1W2HA 4F5EA 3LL4A 4LVOA 3JW8A 2P0AA 3A0UA 2GPWA 5DCLA 4Z4CA 3TJMA 1A4RA 1AXEA 1P72A 2RKOA 3Q2OA 4WKOA 4L9AA 3UMFA 3LK7A 5F2NA 1GEGA 2YV2A 2WD7A 1T8PA 3D81A 4KE6A 1DKOA 1F2UB 1TJNA 3DBLA 1T3HA 2H4WA 1RC0A 4G89A 4I0WB 1RZUA 4I55B 3T06B 1FJHA 2EL9A 4L51A 2UYOA 3UCEA 4CRWB 3CVVA 3F73A 1ZM9A 2QKYA 3NHBA 1YGPA 1MR3F 1SD1A 3CLHA 3AEUA 5DX1A 2X1MA 1WTAA 1YFKA 4GYWA 2YFHA 5SICE 3VPDA 2I62A 3AONB 3IXMA 5BNZA 3AESA 1JE1A 1LZLA 3TOCA 1FFCA 1ZR4A 3A1EA 1ESCA 2C84A 2W11A 3UXEA 2XVXA 1R0CA 3I8XA 4Z6KA 2W2LD 2W6ID 2NYUA 4FFNA 4YHBA 1T1GA 2PX6A 3VR5D 2CL6X 3IEUA 2ZYVX 4M1YA 2GJKA 1FEZA 1QH9A 2OQRA 2REQA 2VI5A 2FR8C 3GLHE 1O95D 1OZHA 4OJYA 3G02A 3JWPA 1UEIA 4O8ZA 1JL3A 3RVPA 3BSWA 4TVKA 2Y8EA 4DTIA 4HP8A 3E9YA 4GPD1 3SEQA 1JJBA 4NBVA 4D92A 1XNRB 1JJVA 1OAOC 3A6KA 3Q12A 4ENSA 1KGDA 4TWIA 2BFPA 3QSGA 5ITZB 4P31A 3FJYA 4QUHA 3IUBA 2V3CC 4B5KA 3KL4A 4LQDA 1NW3A 4FT4A 1HYBA 1ZD2P 1X3LA 4FOTA 2YHUA 4F3CA 1LWOA 2VP9A 1JV2B 4IIEA 4Q7EA 5AHRA 2NXJA 3GRFA 1TF2A 1QCDA 4JUBA 2DWOA 3KP1A 3M5CA 3FSEA 4ZAYA 3CXUA 3D0OA 1H0SA 2CNWA 3D6FA 4HQ0A 2FN9A 4NRDA 1NY5A 1LX6A 2H06A 4G37A 1C3EA 1Q0UA 3ZHZA 5C1DA 1Q91A 2VHXA 3F90A 3AFOA 4Q12A 1JSLA 4XSGA 1SJ9A 2QAGB 5JSUA 5HBRA 1QFXA 3H5WA 5GADl 4D9IA 3AHCA 5KTOA 3CJTA 2WVGA 3U44B 4R81A 4CE6A 3ZXXA 3TQQA 3NXSA 4HRVA 2GBPA 1UZNA 1VBKA 2O7SA 1Z28A 4BZZA 4JI1B 3BJRA 1J42A 2CL0X 3FGPA 1ZONA 4EK9A 2A9JA 4UM5A 1BFKA 2IEGA 4HLDA 3K6SA 1NJ2A 2ZRMA 3FYCA 2C8KA 4WN3A 1US8A 4ZI7A 1B0UA 2C83A 2PY6A 2FSHA 3T7AA 1AV7A 5IK2A 4QTYA 8GPBA 4Z4QA 2V1XA 2WPNA 4TL9A 4HAUA 4WESB 2JFZA 1C14A 1MC4A 2FCRA 2GUGA 2ZE8A 3NC0C 4X1OA 2BZ1A 1GTZA 3GEEA 3UH0A 1A9ZA 1NSFA 3A26A 4BMXA 2Q4TA 3PIDA 3GCZA 3SF8A 4EB3A 3FTCA 4E46A 3QSYA 1QH1B 2O5CA 3OFKA 3PPWA 4P4SA 2VSFA 3I23A 1E6UA 4Q4AA 3ZH9B 1POWA 4TWRA 1YJBA 2MSCB 1YT5A 4NOLA 1B15A 3O8DA 4L6AA 4G0WA 1I4DD 1CS0A 4R0VA 1EVIA 2BCJQ 2VJBA 3DZKA 3AY6A 3FTDA 1YNOA 1WJGA 4XPIB 2EGHA 3RYIA 3WDLA 3PXCX 5JDIC 1SVWA 3LVQE 2BM0A 4D26A 4ZKEA 3IYLW 3GJ6A 1AA9A 3DDCA 3L04A 3TR6A 4A82A 2PH5A 1QQ5A 4FDVA 4IX1A 2QL7A 3SKXA 2FFAA 3PKIA 4IILA 4JI5B 2D5AA 4P93A 1QQTA 1QOZA 5KNCA 3C97A 1QNLA 4YI5A 1JB1A 4ITUA 4JZYA 5B55A 2PLRA 2DJ5A 1D9XA 3C6BA 2JZNA 2WHYA 3E61A 3RREA 16PKA 5TPZA 1JAXA 1YS7A 2XKJE 2DFTA 2NP7A 1NVWQ 1IAQA 1GRVA 2ZJ0A 4LWQA 4RY0A 4A0RA 4BO7A 1X1EA 3RT9A 3ZOZA 3WNDA 3RAJA 3K8OE 3GLSA 1VJ0A 5FPHA 4C9BA 4I08A 3IIIA 2ZAYA 3IP8A 3IQWA 4I4LA 3WL8A 1R0BA 2HF7A 2VPPA 3VHLB 3ZW9A 2PL3A 3HKBB 2YN2A 3JYHA 3PIIA 4IINA 3TPCA 4FVTA 2JD2A 3PXAA 2XTMA 3UJNA 1Q95A 1VSTA 2JJ1A 3U1VA 2G3YA 5AT1A 2MYNA 3B3FA 3ZIAA 1WVGA 3AU8A 3KVOA 3FWZA 1U7DA 2NZVG 4MHSA 4QEKA 5DCYA 4HAVA 3IOYA 1T9ZA 4FHZA 5IEBA 4NBUA 5DLQC 2ZT6A 3HBLA 4AKIA 1JPUA 2P2ZA 2QX9A 4Y9RA 5DYWA 3PVZA 4LXHA 4U9IS 5K03A 3AY7A 1NX6A 2JKYA 2J6IA 3U39A 3JWEA 3WKAA 2C3MA 1VKNA 2I67A 2NT4A 3A4MA 4JUDX 1C3OB 5NLLA 1HDZA 1VIYA 4CM6A 1CEQA 4HR7A 4HDKB 3AB7A 1KJQA 4LDZA 1J1UA 1R6VA 2BVNA 5KDOA 1EFDN 2FF5A 2X8JA 1CYDA 3GFOA 5CTJA 1E3EA 2BDEA 4Q7QA 4Y9DA 4BQOA 1WUKS 2L42A 1VP3A 4LJ7A 4W8GA 4M9UA 1FFAA 3E1KA 3NEJA 4DLUA 4JC8A 3PQ8A 4KBYA 5JMPA 3FLMA 1RXSA 5AVJA 5IAKA 1NMZA 2HDOA 3ABRB 3TZ6A 1NBIA 1SXJB 2YVUA 3FF1A 4QRHA 1QVRA 3ZXYA 1LBEA 4FQ7A 1YI8A 1UK6A 1JBQA 4RXTA 5H16A 4A2WA 5AKXA 2NO1A 1WBJB 2C4WA 3WAKA 4JP1A 4YASA 3K2IA 1R3UA 4UUMA 1I6LA 2IU3A 3ZGYA 3GEGA 3HR8A 4EF5A 1P9OA 3QNUA 5FTJA 3DEHA 3L4SO 5IJXA 4D8VA 5BYAA 4GMKA 1WB9A 4B0OA 4JB2A 4TV9B 3AJ8A 3ZU4A 5ALVA 3T35A 3NEAA 2XUQA 1U81A 3O0TA 1PNQA 4BMYA 4BBJA 3MOSA 2W6NA 2R68A 4I1OA 1ZLXA 3O93A 1XLWA 1Z2AA 3L05A 2IZ5A 4MRVA 4U2EA 1X7XB 3NT5A 1TQDA 2BFBA 2IHZA 3ZW8A 2V6BA 1R8XA 2CDBA 5KREA 3PPVA 4A5SA 4FE3A 2F62A 3EW7A 4W7SA 4CLRB 1C8VB 1X7DA 2CCGA 2K2QB 2BFWA 2ANCA 3C3BA 4LGMA 3ZD8A 3RRJA 4DANA 4FWTA 4HFJA 2YZ7A 1HLPA 1P3JA 3FMFA 4TL8A 5FI0B 3FJOA 1YE8A 1EEHA 3BHIA 1ZINA 3CU5A 2ZB8A 5JAQA 1FP4A 2ZOSA 5FNZA 2FAXA 5CFNA 1GP2A 1BOOA 2Z6UA 5EOVA 4ZFNA 2V5AA 3STWA 1YZTA 3TGLA 1HFWA 2VPYA 1X1QA 1DBIA 5IPFA 4IDBA 1PTJC 4BMCA 1S4QA 4NFSA 3GVCA 1D1TA 2N46A 1FB5A 3MMPA 3H2JA 4E5UA 1ABBA 1H65A 3HUTA 4YJ3B 4ZCRA 2F3TA 2PMBA 3QE4A 4QFCA 1VIVA 2FPLA 1Z4OA 2F4NA 1I2ZA 2HBQA 5HFJA 5B1EA 1GARA 1QB8A 4MVCA 2ATCA 4URZR 1T1SA 5E1OA 5BXQC 3CF2A 1D07A 1QJ4A 3LPMA 1WZIA 2VHJA 1CJCA 3MJHA 3EGXA 3QZUA 4WZBB 2X0FA 4U7GA 4GOMD 4PZUA 1J21A 3BWYA 3DL4A 4Z53A 2ACVA 2BHNA 1K5DA 2QRZA 3MINA 2VNAA 1JA1A 1Y3HA 4FNAA 3KT3A 5EYPB 4J0IA 1HQCA 1WVMA 2JJMA 1NUTA 2ZFUA 1IB6A 1Q0SA 5A6SB 3UJ9A 3W4KA 2HPAA 3Q2KA 5IDVA 3UG7A 2CYBA 2VT3A 3ESYA 4P1ZA 4RLHA 4D43A 4CMGA 2H1OA 4UOEA 3UQYS 2IUSA 4FNGA 1DG1G 1X77A 4HF7A 3TUJC 4J75A 4K9LA 1FSZA 5FTMA 2HR1A 1ZH2A 2FZGA 2HPZA 4Z9XA 1RQLA 1KEEB 4DJTA 2OHVA 1YZ3A 1Q84A 4KE8A 4XA8A 4YJ2F 5IT4A 1WQ3A 2I2AA 2EEZA 1XPRA 3DSRA 2RJNA 3OFSA 1ISFA 1IXRC 1SPBS 2H92A 3DGFC 2H1VA 3IO5A 1MT3A 4HFMA 5U1PA 2GVZC 3K9NA 3OH8A 1F12A 1LB1B 4ZOBA 2SCUB 2ODWA 4ZDWA 2IXAA 2EZUA 5ALEA 3KKNA 3UENA 4N54A 4IUYA 4S3MA 1IXZA 1KH3A 4JQYA 5JXHA 1PNRA 3OPYB 4EW2A 1Q1QA 2K5UA 3JTEA 5GAJA 3HKDB 3BIWA 2GMWA 3CCFA 1RLMA 2B21A 2VAWA 3KPVA 4G0NA 1H0KA 2AOTB 2R4TA 1ZD5A 1AHIA 3TW6A 1YUMA 3STYA 1HQDA 1R4MB 4PYOA 4K9MA 3QU2A 4LQ4A 4BDTA 5JWRA 2WVAA 1LUAA 2FPOA 3THWA 3RS4A 2GN1A 4ZC1A 4NYIR 1B41A 1FP6A 2JC3A 1G2IA 2WMDA 3QU9A 1L9KA 2WWXA 3NYWA 3NAMA 1QDLB 1EVQA 3G0CA 3M34A 4LX8A 5A0FA 3EUAA 1V8OA 2BMAA 3BMNA 4QU8A 4D81A 1E2BA 3ECSA 1G5QA 2XVAA 3OIWA 4NJEB 1TT5B 3VVBA 3T5AA 4CNQA 3L02A 4UM9D 2W2KA 3KBOA 4DAEA 4WN9A 4I4CA 1RWXA 5AVVA 3GWGA 3QVUA 4EHLA 1UFKA 2X8JB 2D7DA 3DJYA 2F8MA 1WXWA 1Z29A 2IPXA 3IAM6 4I5DA 4QXQA 4IYJA 2BUBA 3ABZA 4L95C 4TKLA 1U7UA 4PCLA 1OLXB 4XVCA 4HLUC 1VPWA 4G6ZA 2P5YA 1PWEA 2DPLA 2ZT5A 5AKYA 4G5SA 3A0RB 3PL1A 1AKVA 4QO7A 3IO3A 4R5HA 3LI2A 3GROA 3ZN2A 3DE1X 4UTXA 4RDHA 1FDRA 2R8BA 3LPLA 1FMFA 5FWNA 2FRXA 1FTWA 4PQRA 3L4BC 1F1JA 5CM9C 5D3KA 4C6HA 2IGTA 4F0JA 5IT5A 3OMLA 3QJYA 1R0WA 1EQ2A 3NB0A 4AN1A 3P2IA 1STOA 2B2XA 3VMFA 4CM7A 5DTIA 5F7OA 1NUPA 1ATZA 2PCLA 4LWPA 4IVPA 4ZU6X 3R6DA 3SE0A 2GA9A 3EFEA 3V4ZA 4EHBA 3GJQA 3C3DA 4MWSA 4I6EA 4MQ6A 1NF2A 4WV3A 3C6KA 5A7HA 4HYEA 3UTDA 3STVA 4BX8A 4EM6A 3PEWA 4B71A 1UPFA 3OPYI 4IHQA 5HRCA 1ADYA 1N0IA 1OLUB 5GJWC 3ZTTA 3DLIA 1PDOA 4EB6A 1QG2A 3OZBA 2GKSA 4HWKA 5HZKA 2GD1O 3L07A 3IEPA 2JF0A 1UBEA 3AR4A 2O2XA 3IX7A 3AW8A 5HYVA 2CB9A 3IDFA 1XVTA 4IJKA 2JHPA 3JQ8A 3W2GA 3NUGA 4UREA 3KJIA 2BDUA 2JLAA 4HGZA 4JCOA 2WA1A 4V0SA 2YASA 3TL2A 3JZAA 3MWDA 4NU6A 4RTRA 3RVSA 3PJGA 2FWBA 2ZIZA 4YRBA 1LLQA 1YACA 2EYUA 4EKIA 1RWOA 4P83A 2AEEA 1PEAA 1IB0A 1OU0A 5JR3A 1UOEA 2JRLA 2NZ8A 4BQIA 1QYWA 3HXQA 4L9WA 3UAOA 4HMQA 5C1IA 5AI0A 5E8JA 4GDMA 4BVLA 1QAOA 1IJKA 2Z2ZA 4A9AA 4OH7A 1EPUA 1GVHA 3B78A 2FPIA 4N9QA 3WIDA 3ZHSA 1EFRA 3GK3A 4BMVA 4AKEA 4C76A 4YRFA 3DE7X 3KKQA 2PUHA 3FHJA 4IGFA 1ACMA 4OAOA 4NMMA 2EZ8A 1LSOA 4F60A 2NG1A 2PUFA 4ZHQF 1XMJA 3AVYA 1ZGGA 1YWGO 4JLWA 1PQWA 4WNAA 5G4LA 3RFXA 4BKPA 3M33A 1G9XA 3P96A 4IJMA 4CCAA 4S24A 4MH0R 3BXHA 3G59A 3FI0A 1N1GA 1X1SA 5FUVA 3V42A 5BSHA 2W5UA 4N7JA 5FTNA 2ONCA 1BCSB 3B60A 1F51E 1L4HA 5DULA 2HZ7A 4NENA 4C04A 2RSLA 2PCJA 1ZRNA 2VF4X 2O2GA 4P4TA 2GK4A 3LRPA 2NVWA 3BORA 4NU0A 3VSAA 5LWQA 2I6UA 4OI2A 1PJRA 2CXXA 4RA9A 3NV7A 4WUVA 3BRQA 4A0GA 1LLUA 4INJA 2B25A 4Z51A 5K0ZA 5HIIA 5IVPA 2J0VA 2XUGA 1RM3A 1A7AA 1BAPA 4INOA 1LC3A 3SN6A 2J08A 1ULUA 4JJ6A 3SQOA 1QRDA 2FSGA 1QWOA 3GWZA 2NM0A 3IBGA 2IRWA 3AERA 1CVIA 3GDWA 3DBHB 4PS1A 4XQEA 1SKQA 4C0WA 1GNLA 2YMMA 4BE7B 5JS7A 3PC8A 1YR3A 3VDRA 3GMTA 4I8XA 1A95A 4PR3A 3E7DA 4ONEA 2ISQA 3OWHA 4ZEMA 4KR3A 1Q7TA 3E18A 1AK2A 3BXGA 2ZRNA 2FW0A 3UPUA 2VDJA 3JY6A 1BEZA 4TX1A 4EYKA 5AVYA 4HKTA 4KXUA 4PICA 2O7QA 4RC9A 1PZEA 1GKLA 1NVKA 1WPGA 2PKXA 1UPAA 1S1CA 3ZZ0A 4JLBA 1LPAB 2HMWA 4EHNA 5TV2A 3SLKA 4OHZA 1Y37A 4V0LA 1NZFA 1RWBA 1CUGA 2ZPUA 3E3OA 2R5FA 3ZWMA 2P2GA 4N47A 4MYCA 1GO2A 3SFZA 3EDOA 2YJ6A 1Z3CA 3CWCA 2EVWX 3CCBA 4X71A 4YC7A 5IVIA 1EH5A 3RBVA 3ELBA 4ZOLF 1ULHA 1D1SA 1WF3A 2JS7A 2RG1A 2ZRCA 4L50A 3GLFA 1L5YA 4RAQA 3IERA 5MGNA 3N86A 4L3VA 3RC1A 5BVHB 2ZRQA 1X9HA 3PEYA 2XF2A 3WG9A 1JDVA 5FWDA 4AICA 3WJAA 3ND8A 2P9TA 2J6BA 4PNEA 1V1JA 2VK8A 4HNHA 4KWHA 4UVEA 2BTQB 4YN3A 4YCJA 3URMA 1T0PA 2DPMA 3JD1A 4RHUA 3SC6A 4V1CA 3NVKI 1ZQ9A 1EFTA 5DDIP 4JQCA 4Q1VA 3O91A 5JHHB 2JGNA 3GDOA 1YB5A 1AS0A 1EGAA 1PS9A 3GJ0A 3N9IA 4ALIA 4LJ8A 5I9IA 1AVTA 1Z73A 3I04M 3ER6A 3O4JA 4LWOA 1M2NA 1NATA 4QASA 2GRAA 2PPLA 3U3JA 4NXNB 3MIZA 5M29A 2CFTA 2FB9A 1DEOA 2VKTA 4FDUA 4YS6A 5C31A 3GA7A 2M6LA 5EIHA 1VLMA 2ZAOA 1M7HA 3JWIA 3DWEX 2VBCA 3A7EA 3NHKA 3OPMA 5EVCA 4DIFA 1JH9A 1R37A 2ZWVA 5EQTA 2OO3A 1QC5A 1VKRA 2OR3A 3C16C 3I0ZA 1VGVA 2ACWA 5FTWA 5K3FA 1F0NA 1SK9A 4O4JB 4ZRMA 4LJ5A 1MX5A 4E4RA 4L2IB 3EZGA 4TRJA 4XM1A 4DJ5X 2CT8A 2NO4A 4U2FA 1G291 1JTEA 1UMKA 1YTLA 3GPLA 5LD2C 5NULA 3COWA 3OCZA 4LE0A 5E8RA 1J90A 1ZD8A 3IUEA 5AP9A 4JVSB 4B5LA 1THTA 4KVGA 3WIVA 4C0LA 3RIMA 1IC6A 3WNVA 1DWUA 3ESBA 2PGJA 3L6OO 3INRA 2MHCA 3PCRB 3NEPX 2AJ8A 4JBWA 4MIKA 1JTFA 1TMYA 1YB4A 2FSVC 5CDUA 1W0CA 2XUKA 1KO1A 4R41A 4RD0A 3LDFA 4J1TC 3RVKA 4C20A 4K1LA 1YDMA 2Y1GA 4M1EA 4DUZB 1I5RA 4Z4IA 3WLNA 1AA6A 2OESA 4NQZA 1OVGA 1ZNYA 1KK1A 1TTHA 3EMDA 1XZCA 3ST7A 2M2IA 2O7NA 1YRHA 4ND8B 1D8AA 3V8BA 5K0FA 3C85A 3MUFA 5D1HA 4IIXA 4CFYA 4KMRA 3FNIA 2HHLA 4MLDA 4QYXA 4Y9UA 3KBBA 5G3ZA 2XH8A 1DBVO 1GN8A 1Z4IA 4RSHA 3I6MA 2CXOA 1ZP6A 3CNEA 5IKPA 1UBNA 1DOHA 3L1VA 4Q66C 3KYBA 1VHQA 2GFQA 3ZWWA 2Y1KA 5KQLA 1OXVA 4D8YA 1ZI9A 4YDHB 4QELA 1FOEB 3OZRA 4WZAA 2X7JA 3HU5A 1PTKA 1AK9A 1U2RA 1YONA 2R1VB 3JQQA 3LZDA 3FSJX 4S1WA 3UMBA 1DOZA 2XI4A 2BCGY 3CVWA 2J3JA 1N32B 1MX3A 3PI6A 5IP5A 2D5IA 3HY3A 3RHTA 2XGJA 4YNBA 3L43A 1MOZA 2GN4A 2Q3CA 3GJ8A 1ADJA 1HF3A 5I4CA 1YCDA 1G20B 3CW2A 4JVMA 4L8VA 1YS2X 2HHHB 4J0DA 1WZNA 3CX8A 3GUHA 3ZHBA 1RAEA 4LGVA 1G20E 4I9UA 4LSGA 5HDBB 3K53A 1CJMA 3TTUA 4BNXA 2IITA 1SGWA 1DTSA 4BNTA 4RCYA 4IHJF 4BWVA 2DUNA 3C5WP 4B3DA 2ZJZA 1A8IA 4Q01A 4GXNA 2P90A 2RBEA 4Q47A 4WFKA 4X1YB 1H2WA 3ZCVA 1ONBA 4LZPA 4TZ0A 2WJYA 3SK0A 4P7KA 4BNWA 1OA1A 5K6AC 4GL4A 3T3PB 2GEDA 3RWBA 2VTBB 3M89A 5FQOA 3JALB 1FP2A 2B94A 2ONKA 1Z56C 4J76A 1H4SA 2ZUEA 4PO1A 2AG1A 5FJIA 5KI6A 1JQEA 2CFCA 1JDSA 1TB4A 4EQZA 3I58A 4AJOA 1QUEA 4EA8A 2GCGA 2A7QA 2V6FA 3AVUA 3LX5A 3GD5A 4JKOA 2VDPB 4UPDA 1SXIA 2IHTA 3CSUA 3Q87B 4KR0A 4DXAA 1FFXB 4X7BA 1FTSA 4FD3A 3QVXA 1JQ3A 5DOVA 4E0BA 4P2BA 5IYZB 1TYAE 1PVOA 3PL5A 5FLEX 2EX0A 1XMVA 1KOLA 5JOQA 3V2HA 5LQNA 3SIRA 3DBOB 5AVOA 2O8BB 1W52X 3AF5A 1YFLA 4LKOA 1SCAA 1WBBA 2PKQP 2ES4A 4R6WA 2Z9DA 3EQ7A 3FGNA 3RKUA 3LM8A 5CDGA 1XMOB 1XI2A 4IEFB 1QV9A 4AULA 1Z5WA 1L1FA 4NQRA 1NBEA 3K4PA 4MK4A 1SUAA 1MAHA 2YJGA 1WMBA 3GGOA 4V0MA 1VSVA 2C97A 3A32A 5DXJA 1T1RA 1ZZEA 3KJNA 3T9AA 1N6LA 3TFWA 3CUKA 3QKIA 4C89A 1UBMS 4V1CB 4M6WB 2IS2A 1TO1E 3FPJA 2B4KA 2BMFA 2X9NA 2ZUUA 3DOUA 1VMEA 3BXFA 4OXYA 4WDRA 2J7PA 3PGXA 5TJ9A 4L4YA 3JD4A 3PQ2A 2AHRA 3AUSA 3IDSA 2AX4A 2WJ4A 2EKQA 4Z7JA 3CF6R 1HY3A 4GKAA 3EPLA 2QD3A 3QNWA 5CDHA 3KAKA 5ANRB 1GUZA 2FPUA 2QXTA 2D5BA 1YMVA 3MMZA 4GH5A 2BRUC 4X90A 2HF2A 4ADSG 3FCXA 2VK2A 5JVDF 1ACLA 4YRKA 4TQUS 4GZ5A 5HDQA 2WWHA 3LW8A 2IT1A 1UJMA 4KWCA 2H7VA 4YPVA 1ZMOA 1MA3A 5CVDA 3GI1A 4HZUB 3FOZA 3QKSA 1B26A 1RJ9B 3I6IA 5JYEA 3HBJA 1PJTA 2IYEA 3MMSA 5J2TA 4NE2A 2PUDA 1A9PA 4RETA 1M74A 5ADVA 5JROA 4Q1AA 2CVFA 5KZMB 2HWYA 2V9CA 3TNJA 1UIMA 3TW8A 3TUZC 1DKLA 4LRWA 2WUGA 1GFSA 4WCFC 2ON6A 3PHCA 2WB2A 3UWPA 2FTKE 4DCCA 1EEXB 1NQXA 1ZRMA 1XNJA 1RYEA 1AT1A 3DS8A 3R76A 1Z4QA 4I4TA 4QDZA 3F2VA 2VJQA 3S2UA 1Y8ZA 1Z36A 1IM8A 3FNBA 1TM7E 4B4WA 2VDUE 4BFVA 3DKVA 4MVJI 1S7CA 4ZCQA 2H2IA 4US1R 4EHHA 4ABTA 2YVQA 1OFHA 1ZGCA 2ZK7A 4WXHA 4ZMBA 3HVKA 4ZCPA 4ZVLA 4JIMA 2R0QC 2O8CB 1DKUA 4EPYA 4G09A 1Z5NA 3HCEA 1EXVA 2D2VA 3W78A 4H7FA 5CNKA 3IJRA 1SY7A 2DU8A 3PNBA 3QWHA 1BD4A 4IJUA 1H5UA 3EY4A 1VC2A 1UMCA 4G36A 4QXRA 2Q07A 5EHGA 3SC3A 4B4VA 2XVMA 5EWMB 3W04A 5A9RA 1IE3A 1A8SA 4OMCA 3USES 5ESWA 1E79A 5FNVF 1WUYA 4FGUA 4WCFA 3QBVA 5IN4A 3CA8A 1YULA 4FJ0A 3TWOA 5E9AA 3VR6H 3WLRA 4A6XA 4BNDB 4PGGA 3U0VA 2H00A 1JKJA 2W6PA 1NKVA 2DQSA 2VCYA 4XIFA 3RUHA 1QMGA 1WB4A 2P11A 1RWKA 4TQAA 3SBEA 4JI2B 1YOBA 1OLSB 2DJIA 4G9EA 3AV0B 5FAXA 2O14A 1OIWA 2V8BA 2PGXA 3LUGA 3A4IA 5C7OO 4F5WA 1KBOA 5FI3A 1M8JA 3RUIA 2VDLB 3TCXB 3UA4A 2NV2B 2C0QA 2LKCA 2F3PA 5DXAA 2R1TA 2XVZA 1E94E 4YP0A 5BV0A 1ZJYA 1SVNA 4FN5A 3CUUA 4YMIA 5ALHA 5JJCA 4URYR 1TE2A 4C7MA 1SBCA 4RK4A 3TZHA 5A9SB 2PRJA 3LUJA 3B9RA 4LTNA 4YRPA 3R09A 2VQ3A 2VRCA 3SX2A 4ZA2A 3GGGA 3WB0A 1AK1A 3AEUB 3PGJA 1XZDA 2Q6TA 1EJ2A 1TKRA 2BFDB 2C0CA 5KTTA 4Y2SA 3FDFA 3CLRD 3VX4A 3ZK9A 1RABA 5IF3A 2RGWA 3ONNA 3HJHA 3G5TA 4LVNA 1M76A 2PT5A 3LY8A 4GPEA 3ETLA 4MCAA 5ALZA 2HOQA 2O6LA 1XMQB 4WCDA 4I2VA 2Y0PA 3ZS8A 1E69A 5FV7A 4IDDA 3AB3A 2XUFA 3RLIA 4KLRA 2C20A 3I4CA 1UK9A 5CUQA 2GLUA 3WIOA 3ZDQA 1JJ7A 3CS3A 4G2NA 4ZVQA 1U0EA 2REQB 3U7IA 2OD7A 1XD2B 1J7JA 4BE4A 5C4IA 1U8FO 3PRHA 1P4HA 2VL7A 1PR0A 2D5LA 2O7RA 5ULLA 4JSRA 5H4GA 3QVGB 4I7EA 4FCWA 3IPRA 1OBCA 1TKBA 4R4JA 5GPBA 1L5QA 3U4DA 5CIYA 2Z30A 5IYZA 3R74A 2NPOA 3QE2A 3O31A 1QIFA 3CH7A 1G66A 3CBGA 4WBSA 1JG6A 2RE8A 4DSUA 4L5AA 2H9IA 1R1DA 4RY2A 4DZTA 4PG8A 1FX0A 3KKKA 4YFVA 1TYDE 1U2GA 3ICPA 5C5CA 1XJWA 5J58A 1UXJA 2PMCA 4QL3A 5L6MB 1AHHA 4HGRA 3RRXA 2PZFA 4RPJA 5AK3A 3ZHXA 4HWSA 1P44A 1SBTA 1ZJ4A 3N53A 2Y0DA 3I01M 1UBFA 4M6WA 1H6AA 2CMDA 1Z47A 2D8MA 4GRAA 3EIFA 3VZBA 5IAEA 3ZGLA 4KR6A 1M9NA 4FONA 4PC6A 4HGYA 4H7DA 1ZMTA 1BKDR 4WLEA 5FO1A 1Z6PA 5KYYA 1I2BA 3KXPA 1KI7A 3F5SA 1DBRA 4X66B 2HT6A 1O4WA 3WP1B 2XCIA 2FSUA 5AK4A 1SOUA 5E6RA 5TVGA 3TTSA 3ZIAD 2OCGA 1DWQA 1E5TA 4F6RA 1TGVA 1N2CA 1MAWA 1QBGA 1R8YA 5K8CA 3TN7A 4AS2A 4WK4B 3IXQA 4F3TA 2H17A 1MZPA 2PWZA 3LAWA 2XDWA 1C4OA 4H17A 4QXPA 4IUDS 4DRZA 5EVJA 5EERA 2P1RA 4GOXA 1VKZA 1XCBA 2ZVJA 3L0PA 3OT1A 3JQBA 2MCFA 1W1WA 3QTBA 4GPBA 1XL1A 1TM5E 2YVKA 1U8AA 3QJGA 2B8TA 1QGDA 3C74A 3STHA 4AWAA 3HDVA 4N5IX 2IBSA 1PV4A 5TPZD 4BFYA 2WVJA 2G7MC 3UM9A 4JLDA 3RVJA 2PSJA 3UJPA 1OT5A 1NLFA 2HCFA 4O3MA 2I7DA 1DBPA 4DCOA 1TQ2A 2IIBA 3I9MA 1KMIY 1N5JA 1Q3HA 2GCEA 1V9LA 4MRSA 4QDOA 1MABB 5BNIA 4C06A 3A1VA 4MUEA 3HG7A 3H9QA 3OD1A 4YB8A 3W5JA 1QWSA 1QMPA 3U19A 4NBRA 5D5QA 4KX3A 4ZO6A 3K30A 3GG2A 2HLDD 3C3EA 5HZHA 3GVPA 5KNDD 1LPOA 2BKAA 5TMBA 1P2DA 3D6HA 3E9ZA 4ZAFA 4ZEOA 1LXCA 3K6JA 1YE5A 4B9AA 1N3IA 2NYVA 4EENA 3Q8LA 4G0VA 1VL2A 2HU2A 3T1TA 1BHQ1 1KDRA 3HDHA 4FLEA 4JY7A 3FWNA 4IWXA 3WADA 1K8RA 1GNPA 1YZGA 2JFQA 1HDOA 2ISCA 3O75A 4RYLA 5FPQA 1HZZA 3F6PA 4PO8A 1C0KA 3GYGA 2V8OA 2YFKA 3OMXA 4ND4A 5JS6A 1PG0A 5JHGB 3T1HB 1JEQA 5FUBA 1XALA 2XBMA 1CNEA 5AIBA 2WW8A 1C1DB 1FQWA 3WHLA 3DXYA 1GPYA 5CXSA 2NU9A 5TE9A 3DKIA 4IDAA 4CCYA 1YOVA 2A86A 4HDNA 1VP9A 4LNAA 2HC9A 2I03A 1GG9A 5FB3A 3NPMA 2JBWA 4YAUA 4U8HA 1SC4A 1ZVQA 2AOUA 4M87A 1DX4A 3BIJA 5JY1A 5B1SA 5CJJA 4R1MA 4NLLA 5AQEA 1E2QA 4MUJA 4A8JA 1VMIA 4UMDA 2WT9A 4F9TA 3DWIA 2QYOA 1MQAA 3RGWS 1NR7A 4YIKA 1U28A 4JI6B 1GAEO 1X15A 2ZQZA 1O9BA 3FAZA 1WW3A 3FYDA 4U6QA 5D87A 3ZJYA 5K4GA 4AKHA 4R7TA 4QYTA 2QN8A 4R1TA 1F9EA 2B6NA 3ZWVA 5JC1A 3FTPA 1EWVA 5E7MA 4E14A 5K3SA 4HFRA 4M9QA 4XUGB 3L7OA 1JHQA 3VR3A 4CEHA 1JQBA 3DE5X 4TTJA 1EFUA 3HLKA 4K3UA 4PHHA 5TGDA 2BEVB 5D86A 1TD9A 3ORYA 4UEJA 1G9TA 1Z5GA 4AMVA 5LBTA 4DEXA 5A2QA 3K9CA 1YSCA 2WU8A 1J5EB 1NNSA 3LOPA 3QVGA 4KWTA 1I2DA 5AM4A 1U0SY 3D3JA 3DNFA 5CD1A 3MM4A 1AQ6A 2W4MA 2YIVX 2XT6A 3ZY3A 2NXCA 5EE3A 1EFVB 2VK4A 4HY3A 4BEBA 3T7EA 3ZHQA 1H9CA 4IDHA 4K2HA 2GM5A 1FTNA 3WLPA 2ZRGA 1E7YA 1LRKA 1OWMA 3DZDA 4B47A 5BSKA 4Q4LA 2FP3A 4WY8A 5DYTA 1XNQB 4MI9A 3QVTA 5JECA 3K1AB 1LK0A 2ZVQX 5JG7A 3VTFA 4YY3B 1NPYA 5KBYA 2JCVA 3MYYA 3SXPA 3MWEA 4BIMA 3LLSA 1D9ZA 4DSAA 1X0XA 3KALA 5KVAA 1H1TA 5JSYA 4DL9A 3H5LA 1II8B 3LHSA 1MQSA 1OWPA 2IP2A 3R6WA 3PVSA 2VDWA 2Y92A 4GYJA 2KBEA 1NYLA 3SCZA 4B31A 5F3WB 1WCXA 2C3YA 3FCUB 1U4OA 1JALA 1Z37A 3G88A 4OP3A 4HTFB 4BLPA 5HSGA 2XSZA 3IVCA 5KYYB 4FFMA 3F9RA 3C8HA 4Q4HB 4ZREA 1GJRA 1KJZA 3CEMA 4H35A 5D2CA 5ALSA 5A3SA 1Q92A 3KK0A 1CR4A 1K7YA 1A9OA 2C29D 3ID6C 4H7HA 2J46A 2IYNA 4ZV7A 3OAAA 1N2CB 3OQ6A 4CMJA 2Q2NA 3TZLA 3A05A 4EW1A 1CS4C 3OLYA 1JJFA 4D80A 1HX7A 5E6SA 2QN1A 3PDCA 3C3JA 3QWAA 5AVUA 4L57A 4K6CA 2VUUA 2YW2A 1HZJA 2PLAA 3IVXA 3KFLA 3OT1B 5G0VA 2IUYA 4JGGA 4R68A 1NXQA 3MXTA 2V7XA 4B6QA 1CQXA 3TD9A 3ZC3A 1PL6A 3TECE 4MUHA 5KVVA 3VGPA 4FMDF 1JFSA 2ZI5A 5TRTA 1P6XA 3C3KA 4Q3BA 5B3KA 2DY1A 3NKVA 1EM6A 4MS1B 5AI8A 1W48A 1W36D 5DM60 1DC3A 3AZQA 3QVSA 3L6DA 3RARA 3TQIA 2PLWA 3I01A 1ZN8A 3CYFA 2PSFA 4HDRB 5CPBA 5IAGA 5HILA 4WINA 4B33A 3KZOA 3C6QA 4IHJB 4ND3A 4AURA 3F6YA 4ZYUA 4IFEA 5LQDA 4UVGA 5FOSA 5DLEA 2V65A 4H0CA 4CM9A 1N2BA 1TVKA 2GVDC 1F20A 1JPJA 1VL1A 4YMLA 4CM8B 1Q14A 4CLEA 3DEFA 4HMPA 4ZCLA 4EB0A 1JR4A 2WU0A 1FNMA 2XR1A 3GGPA 3OJXA 2DWQA 3PRJA 3GA5A 1K3TA 4HI0E 4MV0A 4TYPA 1ZN9A 1SOWA 1FUYB 4XCXA 3WLHA 1XPOA 1W85A 1YTUA 3IXLA 4PSCA 5G1NA 3TYXA 1HDXA 2AYZA 1HKUA 2Q2VA 4PEVA 8ADHA 4WVLA 3RANA 2C42A 3UICA 3FMIA 2IYYA 3IA7A 3RWOA 1Y8RB 3P4XA 1DKMA 5EPUA 2WBLC 2Z6AA 4C5AA 3UKOA 4Q4JB 2PXAA 4DUPA 1I5EA 5LA6F 3D1VA 4DCSA 4PGFA 1U11A 1JA9A 3RVLA 3ZVRA 4Y0AA 3V48A 5K4HA 3QA9A 1L4LA 4DUGD 3E15A 5C5IA 1PZFA 4JOQA 3RCBA 2UYQA 4ZK6A 1GRCA 2OV8A 4MV9A 3QE0A 1U8XX 2AYXA 1KXJA 3I83A 3IIMA 4QNRA 4Y2TA 2B3DA 1N5MA 1VL5A 3NM4A 4ASUD 2C5HA 4UCWA 1YMQA 5JATA 1IK4A 3OIGA 4YQZA 3U56A 5F73A 1FDIA 2ZB4A 3OE4A 1KU0A 3GBSA 4ZEWA 3ZKWB 4DCMA 1JEYA 4QU9A 2DUUA 2AJDA 2YXNA 3A9SA 1D4ZA 1I01A 4UNNA 1RBMA 3TX6A 3ZX5A 3I5XA 1S2NA 2PIDA 2F8LA 1I14A 3E9DA 3I92A 4M9CA 4PG7A 5DBIA 1QK4A 2RFLA 2Q3DA 4KRYA 1A82A 3AIMA 4FE7A 4L75A 3TEFA 2ZSAA 3ZQ6A 1NE7A 5FOTA 3LWZA 3WLFA 2Q41A 4HBGA 4XLZA 4PG6A 1ZLYA 1HE5A 1DLJA 2XGMA 4A1OA 3HVHA 4LZAA 4US2R 2EDAA 4RJKA 3WYEA 6PFKA 4I1SA 2GZHA 2JCGA 3GJSA 2Q99A 1SUPA 3QKRB 1T2UA 2Z4RA 4G26A 3Q0TA 3ZTWA 3ZZ1A 3ZE8A 1SXPA 1PQYA 1U90A 3I9V6 2D2IA 2I2DA 1T8WA 3WZ2A 1F3LA 3KXLA 3JASB 3ETGA 3QWIA 4MV8A 2JCBA 2PRZA 3EXG1 3PQ4A 2NTEA 2A94A 2EV9A 1W5TA 3NJ8A 2W2VA 2JNWA 2R84A 3O82A 1RJEA 5GZ6A 3URKA 2XMPA 5E7JA 3SOZA 5AXBA 4QXAA 1HDCA 1L0BA 4D6XA 4IIBA 1JIXA 4WLUA 1LBHA 1ZAYA 1ZRSA 3FY4A 3VR5H 4U2DA 4C2AA 2HFJA 1EG7A 1PJQA 2BR4A 4Y1RB 5KDLA 1YBHA 2YYYA 3T5TA 3HHPA 5IUJC 1OLUA 1PUIA 1II8A 3LQQA 2CE2X 1E2UA 3BK2A 4E5YA 2I54A 1AE1A 5AK0A 3BH6A 2IIPA 3DVAB 2EQ5A 1GZDA 4Z9BA 1FFWA 1B0PA 4BQFA 1K6JA 4B79A 5KC8A 3F46A 3IUMA 3BK1A 4PTLA 2DF8A 2F59A 3ZR4B 1L7RA 1SBIA 3EODA 5FR1A 3UV6A 2V7GA 2XE4A 2UZ1A 1G4HA 2REXB 5I4IA 3CLSC 3I2FA 2J5XA 3GVHA 3ZKAA 4B2PA 1J09A 3AUUA 3K1ZA 2ZSFA 1JR3E 2D3TA 1K2VN 4HAXA 5DHTA 5IKEA 1RYYA 4OHCA 4JIGA 4ITVA 2CDAA 2HL6A 3BE5A 3R23A 3THRA 3VZDA 4TTSA 2QJFA 4FZ5A 4Q9JA 2OBYA 2XITA 4AYTA 3CNNA 4GEKA 5DLPA 3BRWD 1ZEJA 1GFWA 2XA9A 3AT1A 2C5LA 4FOSA 3VX3A 1DIBA 1U8ZA 1Q0PA 1XZAA 1YQEA 2CL7X 2Y1OA 3IPCA 4XR4A 4YMTA 2EHJA 1L7PA 3LGSA 3VO1A 3T95A 1GQ2A 3F8WA 4U2GA 2GHIA 4DNXA 3WRVA 1QB7A 1SNYA 2CMGA 1CUXA 4XARA 3GV0A 4FUTA 3DE4X 2V7QD 1GGJA 1DHRA 2O8NA 4NMLA 4PTYA 4F84A 6REQB 3OPVA 3UMGA 5EMLA 3FTEA 2IPLA 2FOXA 3E9RA 4JT4A 2R6FA 4LXGA 1X2EA 2JL1A 1QGYA 3K92A 3KT8A 4EI9A 3HCAA 4B6JA 4F6LA 4C0QC 3OECA 5DNWA 1Q17A 1SBQA 3AETB 2GF0A 3AFNA 3FYTA 3I2KA 3PHHA 3G0GA 2GAJA 1UT8A 2FFQA 3BWBA 3MCAA 3MWKA 4GBED 2BT4A 2AVDA 4X5OA 1XKXA 1O6GA 5EEGA 1KRWA 3L0SA 4KR2A 2RK4A 4RELA 1MW8X 4CN8A 4KV7A 3EMKA 1ZUD1 1YKFA 5ALUA 3M6MD 1W85B 3IIJA 2SKEA 1N0WA 3EWNA 4OUDA 1XZHA 2MSKA 3AVOA 3F6RA 1NP7A 1T2DA 1Z6YA 2NAPA 4X20B 1K97A 2SECE 3TOVA 2A9KA 3BTUA 4AW9A 1E1QA 2XRFA 1XMPA 1ODTC 1KAGA 3E5MA 4J16A 4D0LB 4QECA 1U4NA 3A6DA 5EZ6B 5BSUA 4PZYA 3O4FA 4DREA 1ISMA 1UDCA 5EMHA 1OE0A 4J91A 4DOMA 2XV1A 4IEIA 4UBKA 1XVLA 2YQ4A 2RHRA 3DMHA 1DRJA 4G0QA 1K9VF 3SDZA 2LV8A 1V3QE 1P6QA 2YZMA 1AD2A 3FYHA 4UBOA 4AZ3A 4KO3S 4FI3C 2YVAA 3WFIA 1SIWA 3JZMA 2BBSA 2HDNB 4CMHA 3UFXB 2OORA 3R9XB 4AT1A 2Y66A 2MWMA 1OZAA 2CLFB 4BVBA 2H4HA 2PGLA 1AMUA 2ZYGA 1KFKB 2BSAA 3N6VA 2CDRA 5CT5A 3KIPA 4DEVA 2EG9A 2ZU0C 2NIPA 1EK5A 5HVNA 2Z8YM 3ZKWA 1T25A 2H1HA 2ICAA 2VF7A 5U4QA 4KR9A 4IPTA 1EGHA 1UBGA 1RCUA 3L8ZA 4TUYF 1BDBA 1G3RA 3CTPA 1FDWA 1KJJA 2AE1A 4ZQGA 4EATA 1QX3A 4KQEA 1H2HA 3U4MA 2WUEA 2CLOB 3KSZO 1NXXA 1B6TA 4AY4A 3B1FA 1QIJA 1UR5A 5LBIA 2V7QA 3VNRA 5BVHA 1TKAA 2X40A 3TIVA 4PF1A 3WIUA 4D3FA 3R8CA 5AW0A 1PAUA 1TGYA 2DECA 1TAGA 2BFEA 3CC8A 1W34A 4OGKA 1NXPA 3TSYA 3ADKA 3MD9A 1JFTA 4CR6A 4NL4H 4OHWA 4OX9Y 2GPNA 2B99A 4UE6A 2C4HA 1CT9A 2ZI9A 3BXOA 2RIPA 1T8TA 1YXMA 3HACA 4G5YA 4JC4A 1V48A 4YBRA 2FN7A 3E4DA 4JKIA 4Q7MB 5JD6A 3EPHA 4KXFB 1ZIOA 2PVCA 2VK1A 2K7ZA 4Y6PA 3M3PA 5L3RA 4BX2A 2ZPTX 2H2WA 5D5HA 2VTVA 3MJVA 2VP6A 5I9BA 3THXA 5H80A 3EYAA 4EI7A 5BUSA 3ONVA 1PR5A 2XB2A 1T9GR 1TAQA 2EF1A 3PI7A 3WSTA 4AG3A 1GG5A 1LJLA 4IUBS 3ME5A 5A5EA 3RTDA 1GSIA 1FU4A 1CKEA 1XLVA 5LQMA 4X1KA 3H7IA 3PQEA 3H42B 3GQBA 2AQ8A 4K0RA 3EFHA 4J0GA 2HLDA 4DGQA 3G2IA 3IMGA 1T24A 2HPVA 1KA9H 1ST3A 5JYDA 5T6MA 2DKOA 2CDNA 4NYJR 2O06A 3IQDB 1DZ3A 3CR7A 1N5RA 1ZM7A 2OCAA 5F2EA 2IYZA 3AESB 3QJ5A 1R0XA 5J3JA 4YA6A 5C8XA 4E7OA 4J49A 3A3PA 1P0MA 1DSSG 1S2OA 4P82A 5HGJA 3A70A 3GFGA 4HGQA 3W9UA 1QU2A 4OYYA 1CZUA 3EXFB 3N58A 1EVKA 3KSDO 1I36A 1VYTA 4RZUA 4G56A 4W5RA 3Q1LA 4H0FA 1MXFA 4L4XA 1I33A 3DAOA 4K3VA 2PZBA 1P1RA 2VJNA 3RUAA 2DFPA 3GBPA 1DKPA 5M04A 8AT1A 3NHWA 4YYZA 1H3NA 3UOAB 1KI6A 3L7KA 2D7JA 5KNLA 4MS3A 4FT2A 2QBYA 1P7WA 2HBYA 2VS1A 4HCJA 1L7MA 4G2TA 1FRFS 2FPPA 4PTZA 3VR5A 4AJ1A 4FBLA 4D9NA 5A3RA 3HJBA 3PR1A 4YMHA 3MBOA 1Y7IA 2W2LA 3B9BA 1Q11A 1QTQA 2BDTA 4NBWA 2XUOA 2P3LA 1O97C 2Q49A 2QLMA 2WYWA 4HRAA 1KAMA 1EDEA 2I0FA 4PW0A 5JAPA 2XGSA 5LP6F 2D54A 4DQXA 4M1TA 3BCRA 2IUUA 4KQ6A 4ZC8A 1SKYB 3Q3VA 3QHPA 4XWGA 1F8GA 2BLNA 3OQVA 4DF3A 5KQMA 1V11A 4MXDA 1XXLA 3MMNA 2XA2A 5E95A 3PLNA 3COZA 1T2EA 5FBRB 1KBZA 3HVUA 1GQSA 5CFPA 2OK8A 3H5VA 5I3CA 3E1GA 3I39X 1PE0A 5CT9A 5AKJA 2RH8A 1ZO8A 1WP9A 4OB6A 2E1PA 3TSOA 5J43A 3U44A 1PN3A 1B1CA 3FNFA 2JIDA 3N2YA 4MMZB 2G4LA 3DXZA 1IJEA 4JB8A 5L7YA 3USZA 4Q3DA 5CFQA 2QMZA 5JQWA 1CB0A 1EXNA 3DW3X 2HQ1A 1SUFA 2RKWA 4MEBA 4URFA 5DPMA 3HV0A 4C3VA 4DLBA 4D3XA 4BHTA 1KY5A 1XZBA 3E27A 1Q15A 4ID9A 4UDXX 2JDIA 3H1GA 1Q1BA 4C2BA 1P31A 3O8LA 3H86A 5LIPA 3SIWA 5AJVB 3D59A 3V33A 3LWNA 5IABA 2GSDA 1LNQA 1LTHR 3CSDA 1X8JA 2J0UB 1XLUA 2FF7A 4V38A 2E89A 2OUKA 1R0ZA 1U9YA 2R7LA 3FAKA 1N2JA 3ZBPA 4ALMA 4AXBA 3LCMA 4L9SA 2R6CA 1R6AA 4G0PA 4MVYA 4Q4AB 3KM0A 2YICA 1NI4B 2AFHA 5D3QA 1M8PA 4CMBA 4G4JA 4RFLA 2ZUTA 3HCPA 4QEZA 4UU7A 2FJ0A 1ML4A 3WNQA 5JJKA 4RF5A 2KM1A 3TR0A 2OD2A 2YUIA 1EQAA 3L7NA 1P4GA 2JAHA 3PE4A 1QR6A 1NSTA 1DPFA 1O5IA 2X23A 3E53A 3N74A 4YRQA 2P6NA 9MHTA 1KJNA 3KKPA 4L85A 1HE4A 2FWJA 4D6PA 5CG1A 4FYWA 2C92A 1B00A 1QNFA 1FYFA 5ALTA 3EVFA 4U6SA 2HF9A 2I2CA 5DW0A 1QGOA 2GGSA 1H5NA 3BF7A 1ZIDA 3ESDA 1RVV1 2FX2A 1EFCA 4WUTA 2ZJ6A 4WD3A 1E5QA 4YP1A 2OXTA 1U28C 2FPWA 3SP1A 4DV2B 1P77A 1N3BA 4QQRA 2YHIA 2Z4TA 3LT1A 4OK5A 2ZE7A 3PTAA 4Z4EA 2I71A 2C31A 2EJBA 2ETXA 4A8JC 4CKBA 4DA9A 5DYGA 2VAVA 3Q98A 4CODB 1OX5A 4V0OA 4CKYA 3WIEA 3BJIC 1FLDA 5E2BA 1GYPA 3H9JA 5EP4A 5BR7A 1UC5B 1S01A 1IEWA 1TCUA 2AN1A 2P9CA 1KDOA 3AJRA 3PHGA 4BRWA 2HXSA 4IWYA 1E79D 4MDHA 5KNCH 4ENQA 4YUZA 3G8YA 3PLAE 4EX7A 1LFAA 2VPZA 3GELA 2JLXA 4TGLA 2UUAB 1C0LA 4M1ZA 3WAJA 8ABPA 2H9AA 2IS4A 1Z0ZA 3JQ9C 3K0KA 2B82A 2MYPA 3E70C 2A0XA 2EKPA 2XYGA 2GLTA 3CVOA 1QIKA 2QT1A 5M34A 1E8NA 1G2PA 1F7UA 5CT4A 3TRKA 1KARA 5EI5A 1PK9A 2GBLC 3A28A 3B53X 5K0GA 5SZJA 1T1EA 1NU8A 3E0QA 1L7BA 1QDEA 4H4EA 1KQPA 2Q5OA 1RI4A 2V4MA 5DCWA 2Q0SA 4MS4A 3L0BA 4IIUA 3BAZA 5TDHA 3WL6A 1M6VA 1XDZA 1WKCA 3K16A 3OLCX 4KK4A 5IXSA 4MRMA 2PWPA 3SM3A 4HXGA 4O2BF 4C4TA 5K3DA 5D00A 5EMKA 3V2UA 2H08A 4OHOA 3NIDB 3OKPA 4PCAA 1RKQA 1A9TA 1WWKA 2NXNA 1K6MA 2PH7A 2CXNA 3G2HA 1YKGA 3FUUA 3I9LA 1UFOA 2AHOA 3IE2A 1Y7HA 5CU7A 4AIRA 4AJHA 5HJEA 4DA8A 3QI7A 1LPBB 2IU4A 4PSUA 4K9SA 5LLTA 3EPKA 3M70A 3ELDA 4EARA 5JNUA 1XQVA 3KZMA 3AUAA 3MBIA 4BMDA 4Q9HA 5K8VA 4YXWD 3ZDAA 3OQIA 4NKRA 4KREA 1MAAA 1FXSA 4BFTA 1RBZA 2B20A 2C1ZA 3NTXA 4IQ0A 2VHWA 4QD3A 3WNBA 4JXXA 3ZHOA 4ZYZA 1F9AA 2ESRA 3V1UA 4NMWA 3R20A 5KOJA 2V59A 2BEUB 5TQ0A 1KYQA 1RS0A 3VKVA 1JLSA 1YS1X 4TUYB 4NONA 5ALKA 1ZSYA 3MEQA 3QPAA 4GICA 3VPCA 3JYOA 4YDRA 3NMUF 2JFBA 4EGSA 1L7DA 4ERXA 4KOAA 4RTLA 2YQZA 2QRLA 2X58A 2ODBA 2W37A 4OM8A 4RABA 3CB4A 3W0LB 2Q4EA 1NBWB 1MAVA 1WXFA 2B1JA 1VCHA 4RV4A 2XXAB 4PBRA 3I2IA 1JW9B 1Y89A 3QY9A 3WBKA 1BX3A 1U6KA 1BROA 4ETNA 3BHMA 1QIGA 5TQ2B 1EUYA 3PFWO 1PL8A 1JBEA 4BGIA 3Q3CA 1OGIA 4DV7B 4DCVA 4IM7A 4KN8A 4I1UA 1Y7LA 3WB9A 1R64A 2B37A 3QLVA 3D31A 1YE3A 1GA4A 1ZOSA 2VT6A 3EVTA 2QWXA 4HQFA 1G7CA 3U31A 1OBVA 4DHEA 5EJ8A 3QIVA 4RTMA 2OAGA 2YHSA 4ZEXA 1E7RA 4ISBA 1OMOA 1PZMA 2JI8A 2JJ1D 3KXDA 4KFRA 1P80A 1T5SA 1NQTA 2QG9A 3FCCA 4W8OA 2BY4A 1GGFA 3F3YA 4ITRC 4OQEA 4KIUA 2GEKA 3EXHB 4UEQA 4X85A 5K3AA 1DHTA 3L77A 4Y1EA 2VSXA 2NPIA 3AR7A 3RSSA 2P1DA 2D1YA 4ZKDA 3D8RA 1I9CA 4TVBA 4URXR 3BN3A 4N7RA 1EVZA 1R4NB 4M98A 2JPDA 1I2MA 1VPDA 2F48A 2I22A 1IXYA 3IP1A 1Q1AA 3H84A 3ZVNA 1JLLA 1BGWA 5C8YF 2NUBA 1C9YA 1L5OA 2P2SA 2Q9BA 1Y7PA 5T4EA 3RYHB 5F9HA 3I1FA 4UD6A 1S3FA 1Q6YA 4YR7A 2KW5A 2ZRFA 1RQGA 2FSVA 1V1RB 5IAJA 3SFTA 5JNVA 1QHHB 2Z83A 3THOA 3V7FA 4NV3A 4ZQIA 1BYUA 3QW4B 1RRCA 1YGYA 4UFOA 4QLBA 1ZQ1A 4IV8A 5BSGA 1L5VA 1GLVA 1PJLA 2OFPA 1KXZA 4NTZA 1X13A 3SXUB 2CXHA 2H52A 3A11A 1NN5A 3H75A 1D4AA 1BX1A 1FQJA 4MPTA 5AKGA 3KE8A 4ZWNA 3TDMA 4WNCA 1FC0A 1HT3A 3IEMA 5DHFA 3UJBA 3AP3A 1X1RA 1L1RA 5LXTF 4RPGA 4EG6A 1DIAA 1DJNA 1NXSA 5CGQB 1TTQB 1Z0FA 4ZJZA 4KLZA 2IZZA 4F12A 5FI5A 3THWB 4BLVA 1E5DA 2LD4A 5KOHA 2F67A 2HDWA 3C8DA 4ZXPA 3EVCA 3QPVA 4YRAA 5F52A 1TD1A 5FUYA 3ERCA 3B1VA 5EN4A 3V4FA 3DAFA 4E4YA 3P20A 1G5TA 4YRSA 3IBFA 2IY9A 3HSYA 4LRQA 4MUGA 1CEEA 4LS3A 1RTKA 3SQLA 1F1BA 4KO8A 2Q3LA 3EFOB 2IYOA 4DNQA 1XNHA 3HCFA 4I3GA 4KQ2A 2G36A 2ZEJA 3CNHA 3CZ4A 1TYEB 3FMPB 4UHEA 2X6TA 5HKLA 3SE7A 5G2OA 4ILEA 3TG2A 1JQAA 2DZDA 4XWYA 5CDFA 1Z12A 3ZY6A 1AIPA 3BMQA 5IVDA 3QF4B 4NCNA 5DK4A 5JARA 3CUTA 2BGUA 5DBFA 3I61A 3P0EA 5F5NA 3S1AA 4IZOA 4HMOA 1YBVA 3L7CA 3TTWA 4D45A 3OLVA 4Q82A 5IRCD 1JFFA 1G3IA 1RRGA 3AXSA 1AQNA 1NI3A 1UKAA 1JDBB 2Q7OE 2BZ0A 1HOXA 4Z7NB 1C1YA 1WEKA 2WNHA 2JAQA 1K63A 3D8SA 3S44A 3AX6A 3A1WA 5L3ZA 2QRNA 3ZLUA 4EGQA 1C8KA 1UAYA 3H8WA 5BYJA 2V7WA 4CKCB 2ZQ5A 4MQFA 1F8YA 2FN3A 1ZC3A 1WIWA 2E5WA 3TQCA 4DMUB 4MVJG 1QBKC 1OFGA 1WHTA 4C03A 4EY3A 2ZBQA 4ERNA 2PTGA 1VSQA 3OCUA 4JYBA 5A5VA 2GYVA 4QWMA 1KVTA 4URVR 4L4RA 1KZ4A 4PGHA 4R1QA 1A2KC 3FWKA 2N9UA 1ADCA 2QNIA 5ICCA 2PE5A 5TLSA 2J4FA 4OXIA 2YV3A 4KGXA 1UK7A 4RDIA 3VHRA 4ZJPA 3KYCB 5JQGB 5EUMA 4BLTA 2PXHA 4OO3A 3B1WA 2G72A 3KLOA 4BNZA 4CF4A 2WJPA 3PD1A 4HDNB 4DARA 1ESNA 3S27A 2ZXFA 4GR4A 4DDHA 5K3EA 1XEXB 2C2OA 4AO8A 1LF5A 4AUMA 3UKDA 3WQRA 3G5UA 1CIJA 3TLJA 1Y48E 1B6RA 2JFGA 3KKLA 5TR9A 3VYRB 4URUR 3AY0A 3P9CA 2I8CA 4DDKA 3HYNA 5TQ2A 2I4LA 1Y4DE 1ZZGA 4OQDA 4HPJB 1UWKA 3ISVA 3K6KA 4AKTA 1S5PA 2QTZA 3MWYW 4ZGWA 1AZSC 3CRZA 1WHSA 3EGDB 2ZT8A 2UVDA 1JH8A 2HHJA 5D84A 3ZHVA 2NSYA 2L0XA 3H1TA 1EFRD 3EZXA 3I73A 1XC7A 5AI6A 4DSTA 4GYKA 1X6VA 2MIIA 5FWAA 3L01A 1O5OA 2I9KA 4KXLA 3CVUA 1QH1A 2V3VA 4OK3A 2DVMA 1C9KA 1GKKA 1P1CA 4BU1A 5LFAA 2JHAA 3FA2A 2AXNA 4GE3A 4RPHA 2FMKA 3DAPA 1NNUA 3HL4A 2IXEA 3E8SA 3SSAA 4LFBB 1M1YE 4RIGA 3NWJA 3TLEA 7REQB 4I8IA 3PUWA 1MFPA 2OCXA 3OEHD 1PSZA 5H82A 3REQB 2I1VB 1CP2A 2O2EA 1RJWA 1K98A 2GILA 3DBRA 3DDWA 3P9PA 3R0JA 1R6XA 1ZM4A 4NOJA 4MUXA 1NVUQ 1ZD3A 4OIFA 1N6HA 1XHFA 4LMPA 3HBAA 2Z6VA 2PZJA 3MIIA 1ESDA 1OVMA 2COEA 2OEPA 3A4TA 4OHKA 4JBYA 4I66A 4ZZIA 1KZ9A 3NLLA 4ODIA 1ZUNA 2RB5A 1JECA 4PN7A 4OQPA 5CCEA 4NVRA 4YV0A 1RHRA 1JKIA 1A5BB 2OCBA 1DADA 2CF5A 2QPLA 2ZJAA 3DL0A 1I3NA 3EQ6A 3FZYA 4HX9A 3OSUA 1LC0A 5D3MA 1W4AA 2B1GA 1DX9A 4KITB 1D2CA 4JVNA 5FWXB 1FS5A 3AM4A 2ZWOA 3F3MA 2PVSA 2RC6A 1HL3A 4DCNA 4CKZA 3B5EA 3LW7A 4JJEA 4KPUB 4DM4A 1KOJA 2QOEA 3GJRA 1GNRA 1WW8A 1XRSB 2IKQA 4P0QB 5EZYA 4PIVA 1W5AA 3WQHA 1MVNA 1V8PA 3LYHA 3ZS9A 1TX4B 1VPEA 3DA8A 3ETDA 2J45A 3O3NB 1IBKB 4PONA 1W8DA 1C1XA 4OL0A 4OU5A 3S0JA 3H1EA 5BUCA 3PWTA 2CZCA 1RC1A 1PJ4A 2I2XB 1K6IA 1MB3A 3AQ4A 3OTHA 2W0SA 1FZQA 3EAFA 2E4WA 1NPDA 2QX4A 4HNAA 4K6OA 2H4XA 4WECA 9ATCA 3ESZA 4KAAA 3PVCA 4Z86A 5F77A 1FS6A 2J32A 3CSSA 1Z7WA 2J3MA 1E1CB 1CX9B 3G0OA 3OKAA 1I7NA 3RK0A 4AZTA 1HDGO 3HVIA 5BSFA 4QX6A 5CXUA 1OPRA 1CUZA 2P91A 1KK2A 1S3SA 5HEKA 4E11A 1PCXA 5L45A 1VI2A 3GRKA 4X6XA 1TZCA 1BWQA 1SOMA 3GJ7A 1RPNA 1VPVA 4V0ME 4I3FA 5EG5A 2EIHA 3E82A 5F1OA 1PR3A 3CJQA 5DU2A 3ZUGA 4QT4A 3D2BA 4X64B 4KIJA 4OXRA 2CWDA 1O6FA 5FWYB 1JHPA 4MMXB 1W8IA 3UV7A 2G63A 2QTBA 4ZVKA 5JCOA 3U9LA 1OR8A 3KXKA 3VI3B 4DPKA 3AF6A 4BIIA 2QUIA 3L1HA 5ARBA 3QELB 2Z0MA 4HEJA 1QQ7A 2AEMA 3CRRA 3RUEA 3BF8A 3AYZB 3JAWA 1PKXA 3HNRA 5ISMA 4OK6A 2WHEA 5COAA 3RFFA 2HCBA 4EAAA 3NOXA 3LXXA 2AN9A 3HK2A 5IJWA 5JFTA 5DTJA 3RVOA 4ES6A 3OQPA 1JWBB 1M67A 2R00C 1RR6A 3QTLA 2O52A 4H6XA 4I81A 4RESA 4Y67A 4JI3B 3VA7A 2BW0A 1YL5A 5TY0A 2FSFA 5EXSA 4MQFB 2WSIA 5BOSA 4OHPA 2L2QA 3D6AA 4FX5A 4YAGA 4LBVA 4O4HF 5GONB 3OTGA 1CY7A 3ZH2A 1LPMA 1XZFA 2P30A 3D6TB 1T6XA 4WBXC 3UAZA 5EY5B 2HNAA 3L0DA 3GR6A 5BWLA 2QVZX 3PC3A 1NLUA 4BX3A 3B7PA 4ZCSA 2EG5A 4DY4A 4EJSA 3K9FC 1GM5A 4MMYB 5A5DA 3AUTA 2W2QA 3S99A 2GJSA 3AKZA 2BHSA 2Q5FA 4GWKA 4O2BB 1TADA 3LT5A 4O2LA 3OIFA 1PG5A 3EE6A 2Y68A 2R5WA 5DNDA 5ALXA 4DTCA 2E55A 2V7UA 2K7FA 1MOPA 1FTYA 2I6XA 5B4VA 2WQZA 4PYLA 5AXAA 3UN1A 1NHWA 4DRXA 5DGHA 2IF2A 2EW8A 1E9AA 3F4KA 1U0NA 2IF0A 5I7RA 1J2UA 2VWQA 1KEPA 1ZBDA 4R7ZA 1YNSA 2X2PA 1X86B 2C8JA 2FQ1A 1JHAA 3ZJTA 4HYTA 1QCCA 1UJNA 2XUIA 1O0BA 3NM5A 1A7UA 4GE0A 4MUBA 3PX3A 3OI7A 3W5HA 1JDPA 1NQWA 2IDZA 4L5JA 4XWOA 4DDUA 2ID4A 4JEHA 1G98A 3ANSA 4CU2A 4II7A 1KVRA 2XQFA 4ZT7A 3RUDA 3KSMA 2HA4A 3V1YA 2C7OA 1ZHHA 1GCUA 3BERA 4Y6QA 4KE7A 2LRHA 3ER8A 3KUKA 3O9ZA 3JVEA 1A2BA 5DIZA 4UAUA 4KAXA 4JU9A 4M86A 4B81A 4X3OA 5FUWA 3QKRA 1H93A 2IXFA 4PWZA 4F3KA 1ZDMA 4WY2A 2PBFA 3RIEA 4F9EA 1OH8A 3FBTA 1GR1A 1QH8B 1Y82A 2TMDA 2FR0A 3BWCA 4M9ZA 4P8RA 4BNMA