2JFWA

Crystal structure of enterococcus faecium glutamate racemase in complex with tartrate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Isomerase
total genus 96
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfwA01
2JFQA 2JFPA 2OHGA 2JFWA 2VVTA 3ISVA 3OUTA 5HRAA 2JFXA 2DWUA 3UHPA 5HJ7A 2OHVA 2EQ5A 5HRCA 5IJWA 3UHFA 2GZMA 2JFVA 2ZSKA 3UHOA 3OJCA 2DGDA 1ZUWA 2JFOA 1JFLA 1B74A 5ELLA 5EVCA 3HFRA 1IU9A 3S7ZA 1B73A 2JFUA 3ISTA 4B1FA 2JFZA 2W4IA 3S81A 2JFNA 2JFYA 5ELMA 2DX7A 5HQTA 2OHOA
chains in the Genus database with same CATH superfamily
3PQFA 4TLEA 4D92A 2WIFA 4P8RA 4O8ZA 1UBNA 1BWQA 3ELWA 1IM5A 3ZE0B 4G8JA 1ECCA 1L5HB 2XV1A 1OGYA 3ZZ1A 4KREA 1VIYA 2R87A 5DMXA 1YQEA 2FFAA 3TTSA 4QTYA 3X1WA 2X15A 5I7SA 5JT1A 5KQPA 1LVGA 5GJBA 3N1UA 5AW1A 4CIYA 1QYRA 2F9FA 2EX1A 2J0UB 5HS6A 2XGOA 3D0QA 3NORA 2RC6A 2IPOA 1TO1E 3PX3A 4UVHA 3U26A 2C1XA 4BNTA 4DKJA 2R8PA 1QU2A 1A7KA 4UZEA 1KKLA 5G3ZA 1OBHA 1TADA 1H6DA 4ATNA 3EQ2A 1MB4A 3NRCA 4G36A 2DUUA 1GTZA 4TMFA 5CEFA 4D0RA 1Y7IA 4R1UA 3TOVA 1TEZA 1ZZGA 3BL5A 1NU8A 4Q7JB 5A7HA 2A0WA 2A5JA 2WIJA 1QTQA 2SICE 3M6AA 2GH1A 2BBSA 2GA9A 5KYYB 4D8WA 5HFNA 4CQLB 4KW7A 3T5CA 3F0TA 4EEKA 1M3SA 3G9XA 1JHUA 3R7SA 4UZFA 4EA9A 4V1CI 5B3JA 1L7BA 3CCFA 5CIQA 1KR5A 2ARKA 5DP2A 1KWGA 2I99A 3BJIC 2G82A 3GJ6A 1YHZA 3DOCA 1E2IA 2VCEA 4MICA 5EPUA 2M6SA 3KSZO 1YCHA 2WU3A 3WC4A 2EXXA 4RO0A 3CLVA 2XVXA 4Q6WA 5TVGA 3ROXA 3ABOB 2PD3A 4QA9A 3BHNA 1DRUA 4QYIB 3VAZA 1FJHA 1SUSA 2Z9DA 4YT4A 2EDAA 1E9RA 1JHQA 2L2QA 2Q5QA 1UMDA 3WL4A 3A06A 4Q7LA 2HPVA 2PZ8A 2H0RA 5FPQA 1XCGB 1U7WA 3EF1A 3O4IA 4MH0R 1DJLA 4FHFA 3KQNA 2QAIA 1C2TA 2AG1A 3EYWA 2OAQ1 2X2EA 2CNOA 4G07A 5DN6D 5DNDA 4WACA 4Z4EA 4OTZA 1E1QD 4G97A 2CYCA 2VWQA 1WUYA 2XMGA 1D4ZA 1E6LA 1ST3A 1PYGA 1V7QA 1G2QA 4QPJC 4YRNA 1OAAA 4MS4B 3QWIA 4OREX 4RGVA 4RSGA 5M5BA 1W2WB 1Z6ZA 3HRKA 5I45A 4M7OA 3QLUA 4Q4JB 1Y5IA 3AR8A 1ZXBA 3CISA 3UWKA 3EBPA 6GPBA 2NSHA 1NW8A 2XYPA 5F5LA 2XCLA 3E5MA 5LQCA 1A8IA 1KHHA 2R3SA 3OO1A 4U3JA 4B7XA 2GD2A 2JIZD 3OTQA 3HBJA 4LJAA 3HVJA 3OJLA 3OBIA 1Z88A 4JJIA 2FOXA 4HGRA 4I1OA 1JLLA 4CPDA 4C6HA 4E5VA 1FS5A 3H7AA 2QZ4A 4KQ2A 4EFKA 4QZVA 2JLVA 1NJ8A 5CH5A 4L3OA 5TGTA 1XMOB 1P7ZA 3DO6A 1KFKB 3K2BA 3VR6D 1WUKS 2W2NA 4D9EA 1VCIA 4JP2A 1TZ2A 1QOPB 4Z1MD 3EWSA 4FGKA 3QITA 5IARA 5CHYA 3HK2A 2WG0A 3A11A 3LBIA 1LPAB 4F1JA 1QG4A 1T34A 1N92A 3BQMB 4I5EA 1L0BA 4KPEC 4J0GA 3IDQA 4F2DA 4Y8VA 4JGIA 4ILKA 3TQFA 2EKLA 2ZUUA 1M8FA 5BVHA 3OZXA 2A9RA 4EWLA 2JBAB 3WBFA 2Z58A 1XKXA 3TZ6A 2FWAA 2W4IA 4J0JA 4JVLA 3O8RA 3T4EA 3TLGB 1H1LB 2YV3A 4GX0A 3ZE2B 1UAGA 3P2YA 3DQQA 1O77A 4PTZA 5D6OA 3E9NA 3KKOA 3WRYA 3SG0A 1JG4A 3X44A 5K3OA 2K7ZA 3TLAA 1SUFA 3V4OA 4DZTA 4QNNA 1OD6A 3W77A 4R1PA 1Y1PA 1L3CA 5ALHA 1E6UA 2G1KA 5I7WA 4UDNA 1OBVA 3RJMA 4G81A 3BDIA 5AKEA 3SPXA 1M54A 1VCNA 4YRSA 3IVXA 2P4UA 3QMWA 4FYMA 3TVYA 4Y9DA 6ADHA 1C80A 1MGOA 4OMFG 3I52A 3B2QA 4OA8A 4X44A 3TQSA 1W94A 4KTVE 3UHAA 1RXEA 4CKXA 3H6HA 3L0IB 2O05A 3EHDA 3BE8A 4JELA 1VDMA 5JJKA 4X1YA 1UC4B 5HF9A 1UOPA 5EEHA 2HA7A 4Z4HA 1I9CA 1G6Q1 3RIXA 3JR7A 3FKQA 2QWXA 3QJGA 3FWYA 2XTJA 3AC0A 2WJ6A 4KPGA 4RTRA 2WSSD 2XJ4A 1M8GA 3PE4A 2IYOA 3RIYA 1GDDA 3TNJA 3DL0A 1AQJA 3WLAA 2WVAA 1PJ4A 3GUVA 5JO0A 2C2BA 1V5WA 3D6MA 3IUBA 1MO3A 3THYA 3ZGZA 4BX0A 1MIOB 2WMDA 4GT1A 1R18A 4RXUA 2R6FA 4MGIR 5ALTA 5J3JA 1SG6A 4CNBA 3CH5A 4DUZB 5K0GA 1DAKA 2DGDA 4RQBA 4DZRA 1E64A 3B13B 4PGGA 2V4MA 2ZJ5A 3KAKA 3LSTA 5AW6A 4MITA 5JJ5A 5AUQA 1XXHA 4PNPA 2YHUA 3H87A 4JUBA 2D6FA 3REGA 3RTEA 5KWSA 1L1EA 1EP9A 1WU8A 1A8SA 2M9MA 3JQCA 1T4DA 3CUVA 4MMYB 3K0CA 5I9TA 4D79A 4KJZA 1HNXB 3H6GA 5IBQA 1BYUA 1W88B 1O96B 4GL4A 4EO4A 2DT8A 1GPBA 3QEMA 2A88A 1ODIA 3AEQB 1MJHA 1TA4A 3BCRA 4AKIA 1HEYA 2H1CA 1J8QA 1JRLA 2QRVA 2X9QA 2VNIA 4E2YA 1S2DA 2VCYA 2WV9A 2B98A 2LBPA 3AI3A 4N9WA 3NJ4A 3NEYA 4DXHA 3V4VB 3ILXA 5CVUA 3FBWA 3A1UA 1S0UA 4E5YA 2V1UA 2QJRA 1PZMA 3MJHA 2GT1A 2II6A 3KCNA 4RC9A 8MHTA 4D80A 3H7IA 3ZW9A 5GINE 1GVHA 3HTXA 1E4OA 2HZ7A 4KMSA 2FYTA 2I0FA 4UBLA 4YJHA 3QKUA 3THXB 5TMEA 5IKOA 3IJRA 3EODA 4KU4A 5CNKA 3W9YA 5HHTA 2GD1O 1VMAA 2Q6OA 3O92A 3GCDA 4B83A 2NTEA 3L0PA 4BAUA 3DMDA 5CT4A 1F7UA 2AFHE 1L4YA 4DDHA 1MO6A 4BQOA 3R5XA 4ZMRA 4FFBB 4ZRDA 1E9BA 4QGGA 1W7AA 1BJKA 1S1MA 1B3RA 2OT3B 4GEGA 4PLHA 3EFEA 1PN3A 1RWXA 2B0CA 4OMUA 2J4DA 4XLZA 4A27A 4K0KB 2P2SA 4FTWA 3D5TA 3JQQA 4ZYUA 2J87A 3HLYA 3IEPA 4EABA 5SYNA 3AOEA 4RAOA 1V11A 2W2OA 3FCOA 2ERCA 3FVTA 1CNEA 4QRDA 3V1LA 5EZ5A 3QV1A 4HV4A 4YT2A 4RQUA 1ISHA 1VIAA 2BHTA 4HH1A 4E5UA 5F7JA 1FBTA 4W6QA 5DBHX 5DI3A 3AQIA 3IE0A 3ZXUB 3N2KA 2GK6A 1E0DA 2MR5A 2XKAA 1RJDA 1LZKA 2X23A 4P84A 3GIWA 3LCMA 3ZCPA 3PUHA 2ORYA 1Q6YA 2COKA 1U3DA 4BASA 1I0LA 2PIAA 1J56A 2AOVA 4FNGA 2P40A 3TTUA 3ZHVA 4UFPA 3AUFA 2BFDB 4IGEA 1HMYA 4GRAA 3SJUA 1D3AA 1HLPA 4IH4A 1YQTA 2W6QA 2X9GA 1H2ZA 3EE6A 4TWRA 2HA2A 1XYVA 3ICWA 3AR6A 2Y1GA 3L7MA 1TRHA 4ND6A 5G0WA 1IPHA 3TS1A 1SIOA 1ZD4A 2NU7B 3B1ZA 1USWA 2GTPA 2PRIA 5JRJA 1RJEA 2XKBA 3ZQ4A 1F2UB 2AKAB 4Y2UA 3ZV5A 3MCZA 4AY6A 4JI1B 1Q0ZA 4B47A 1PGPA 3OBBA 2PJDA 1D07A 1PJCA 5IKXA 1Q1ZA 4MUGA 4U0KA 4J1TA 3IH5A 4HRVA 2J0UA 4GSLA 3S7TA 3VR6H 2ZXFA 3D7SA 3WTBA 1YB7A 2CHGA 5IJ9A 3VNVA 2R44A 2C9OA 2OILA 2K2QB 1DBIA 5KOHA 2ZR9A 4BZXA 3IHTA 2JFOA 3PUJA 4XYEA 5AK4A 4BAZA 4ENTA 3ONWA 3REQA 1B1AA 1M72A 3RH0A 4CT4B 2QVLA 4M8SA 4QUKA 1E9EA 4JP8A 4M38A 3VNRA 1F0KA 2GLXA 2I29A 1ZH6A 4JITA 2ATIA 3FGOA 2P0YA 1I24A 1TYZA 2O0KA 2O50A 2BIFA 2P3QA 5AVJA 4KSCA 1DWUA 1Z0AA 2WD7A 3H4VA 2CFCA 4P2GA 4EJMA 3S29A 3GLGE 2H06A 3DXZA 3K2EA 4I1IA 1P29A 1NUSA 5IH7A 3FCAA 1JG2A 4U0JA 1RRFA 3M8KA 1L5FA 4GF5A 1N8KA 3ETHA 4CQLA 5B55A 4LE2A 2AL7A 4TV9B 1NXOA 1K66A 3IURA 3V42A 2HSWA 3VV2A 2JLXA 3RC8A 2X2OA 2LIPA 1NX6A 4IKOA 1XVIA 2HU8A 1RWVA 1Q1NA 1YB5A 2D13A 5AJXA 3UHOA 4XGIA 4MW7A 5EE0A 1YR7A 4N3BA 3BB1A 1SEPA 4AAYA 2GEKA 3LX6A 4YXFA 1KZHA 1NV8A 2QN7A 2CGEA 4C30A 5FLXA 2QTWB 1FYFA 4DA7A 5B3KA 4MQMA 3S2EA 2CNNA 5A5VA 1O6CA 1IJBA 4FQ8A 3T7EA 3T94A 4G1UC 2M1ZA 1Y63A 1A4UA 2C5EA 4J1NA 5AKGA 3P4UA 3SJAA 3PSAA 4QGSA 1JF8A 4ZAYA 5HA5A 1PTJA 3LP6A 1Y48E 1QKJA 3CO5A 4MIKA 4H7PA 3EN0A 4B44A 2BV3A 2OBLA 2VPXA 3WHKA 5L7WA 1O0CA 3AVWA 2H1VA 4JYPA 3ZWAA 4DEVA 1NNSA 3PDCA 4EYSA 4LK2A 1QK4A 5K4HA 2H00A 2PX5A 3Q7PA 4MWZA 1ZJ6A 3A4IA 3SE0A 1JLHA 3OLYA 3VR5D 2DBQA 2XD9A 3MUNA 5DIZA 3RVQA 3ICCA 1E6EA 1MD9A 3V8NA 1U0BB 4Q4JA 2VJNA 5LMNB 1PD0A 2H1IA 1S1CA 2A1TR 4MQLA 2CXSA 2J3HA 4ME6A 5IAEA 4A73A 4E31A 3GARA 5HK8A 3ZDRA 4J7AA 1W5EA 4F5WA 3BTUA 3ETCA 4P7FA 1OZ0A 3VUFA 4ZVQA 3G0GA 3UOGA 2YDYA 4Z51A 3M1AA 5I01A 1G20B 2EP8A 1SMKA 2LP4Y 3RGWS 1XK6A 1TJNA 1AM4D 4PX3A 4R0VA 4F06A 3IE1A 4I5FA 1ZICA 4R9VA 4NEQA 3DBIA 1PBTA 3C3DA 5LQJA 1BGXT 4Y2PA 1IPFA 4OX9B 2Y9PB 4HNAB 4QLAA 3K0EA 4WWHA 2I1QA 1ZK4A 1G16A 4EFLA 3PV0A 1NLMA 1OA0A 1P77A 4YMTA 2AEEA 1LNQA 1CJVC 3VZPA 3NW9A 3R1IA 5G1PA 2IGBA 5FFNA 4GH5A 4GOKA 3HO6A 4ITUA 3GPCA 4DGSA 2IXAA 3TGLA 2O8FA 1GQFA 2BGRA 3KEFA 4M89A 2VJMA 5C9ZA 1J97A 1E5DA 1XDSA 2E21A 4YQEA 1VHQA 1YUNA 4H9GA 4RL4A 3IC5A 1D2EA 3UB3A 4LWOA 2C2HA 1CKEA 3WADA 4EAAA 4ONEA 2ZAMA 5JPCA 4ZVMA 1BHJA 3D81A 2FUNB 1G7SA 1Y3BE 1M67A 2BI7A 4N40A 2B6NA 2HMWA 3TAXA 2Q62A 2CZQA 2Y6UA 1C7IA 2A1UA 1G6KA 4JEHA 4RKFA 4XWGA 4UAGA 4AZ0B 3O3MB 4B9AA 3IB3A 4WEQA 1OIVA 5D3KA 3LT5A 4BNLA 4BLPA 3CF0A 4P3PA 4XTCS 1LNSA 2YN4A 4YCAA 3WJ7A 2A4KA 1P8JA 3VR0A 2AVDA 3IALA 4GNRA 4EI2A 1CE8B 3UBTA 3E7WA 2DX7A 1OHHA 2OD7A 3GLSA 2OXEA 4B7ZA 5JMTA 1DIGA 3AH8A 3UMJA 2JAUA 1DRVA 4HDAA 3UUFA 3UPUA 1ENPA 1T3SA 4G2NA 3RS8A 4OHFA 4L02A 4V3CA 1AC5A 4ZT7A 5JFGA 1X9IA 2FZCA 4M21A 4KCGA 3FYUB 2R8XA 3T4XA 1YQWA 2AW5A 4AKGA 2AHOA 4RPHA 4FINA 2FZKA 3V2IA 4KXYA 1V5FA 3ZHCA 2CF5A 1N8SA 3SZLA 4LTMA 4TM7A 3LY5A 2Q4TA 1E3EA 1YJXA 3DAFA 4MQFB 5IEJA 3TVDA 1OY1A 4JXKA 3IL2A 4CUKA 4CEHB 3AWDA 2W2PA 1XZNA 1P75A 4P35A 1P1IA 1U0FA 2OYRA 2CT8A 1RXWA 1SA0A 3RUEA 1YH3A 1I30A 4Z4CA 5HW0A 3H19A 1H2YA 4MV7A 2V1XA 1EUYA 1JEDA 4NFHA 1II9A 3WV5A 4KXUA 2GARA 1W88A 3V4ZA 1O96A 4BFCA 5JXIA 2EU8A 5JI2E 4ZOAA 3CQ9A 1B2LA 1JDZA 1W1WA 4P98A 4X6YA 2PKEA 5T8KA 3AEQA 1P1CA 1CLUA 1G21B 1REQB 1Z3CA 3K2QA 1PNQA 4HGQA 1C3JA 4L1KA 2ORWA 4HOYA 3V3TA 3WIUA 2E5LB 1Y98A 2V98A 5FI3A 1GG2A 3P9NA 3RC7A 4H1WA 3C6BA 5LVAA 2I78A 5FBKA 1AUPA 2NT4A 3BXGA 2IYQA 4YLYA 2P6UA 2NUPA 2BE9A 2AX3A 1V71A 4XCXA 2ONZA 3SZMA 4ENVA 1I7SB 1YS2X 2EJCA 2NUAB 3UJDA 1NVXQ 3NOVA 1EMDA 4ZV4A 2QGNA 4R0MA 1Y81A 4B9EA 4QQ8A 1D7AA 3T5PA 2J5KA 4X7PA 3UA4A 3MWDB 1F12A 2BJHA 2G8LA 4ZMSA 3THXA 1C8VB 2C2OA 3DA8A 2NADA 1RYDA 4JYMA 1HT2E 1RQRA 1QQ6A 4DLSA 1SQFA 3K9QO 4UATA 2XD4A 4Z0NA 3TQCA 3BTVA 3FTEA 4KYVA 2QJWA 5G4KB 1O5IA 1BX0A 4CKZA 1YKFA 4XX0A 2PAFA 3CZRA 1W19A 2NXEA 1QQBA 4ITRC 5IJXA 1CEEA 2IX3A 2CE2X 3AIIA 3G2MA 4P3OA 3Q5DA 3VJMA 2O0JA 3NHJA 2O8EB 1B73A 3AG6A 4UJ5A 5DGTA 4M9CA 2CHEA 3OLWA 5C34B 4LSWA 1UBCA 3B53X 2VDMB 3F5QA 4S04A 2J3LA 2HSGA 4MKGA 4EPRA 4JMLA 2CCJA 2DLNA 3JS5A 3U9LA 4RPGA 4EGFA 1T8YA 1ONSA 2R5NA 5AM5A 3L8CA 2I76A 4QOFA 3H0CA 1ZNWA 3IMEA 4REQB 5IK2A 2YC4C 4OK5A 3W5BA 5DKFA 1RM4A 1EVEA 1SXGA 1N1EA 3NDJA 4GG1A 2YOFA 4HGPA 2G9QA 4LOHA 4XI9A 4PRKA 5CK5A 5AJTA 2LCQA 5JQGA 3K9CA 4L16A 2NZ8A 3R7NA 1EP1B 5ILGA 1Q11A 5LZ7A 3B3AA 3OJXA 1W5SA 2AI1A 3PF9A 5L53A 1A04A 3RRBA 5EE5B 4W63A 2XMSA 3WK8A 1P74A 4IQGA 4YP9A 2LDXA 5EERA 4YWHA 3D5EA 5FH9A 2DWOA 4QJIA 4PQFA 2CV0A 3NGXA 3MBKA 2KWIA 2Q6LA 3TLBA 3ELBA 4HXGA 5JLAA 1JQLB 1H4QA 4N0PA 2GCGA 4OQDA 3SQOA 2C4HA 2AJTA 2ZJYA 3IP9A 4B4DA 2LUOA 3LC7O 4O4JF 1GUYA 5EG5A 5H3CA 2D4AA 1VJCA 3WQRA 4C0SA 4I9GA 1NJ5A 4LZZA 4PANA 4FEGA 4B87A 3NATA 3EG5A 4EA7A 3ELYA 4L28A 1C0PA 3QNUA 5HSGA 3EMBA 2VATA 4XDYA 8GPBA 4MWEA 2JCBA 1L8LA 2OCDA 3GA7A 4JBHA 4U02A 1MNAA 3A4TA 2ODQA 4HPJB 1NY6A 2YFQA 5DHTA 4CM4A 1KEUA 5DLEA 1BOFA 5BW6B 5FAKA 1Z2EA 5TQ0A 1E18A 3MELA 1AX9A 1F9AA 3VOTA 2VK2A 4XOUA 1S4QA 3D6HA 4IWXA 1YZUA 4H16A 3EXFB 3KKNA 3K94A 4P86A 1PG2A 4EEXA 3BRSA 5FF9A 3AKEA 2EGGA 4GYYA 4JJZA 1O9BA 1T8UA 3ZG6A 2PBZA 1IMJA 5BW5A 2AZDA 2D8MA 3BN3A 3OUUA 4NI5A 4DIMA 4JI2B 4E30A 2O3QA 3D6UA 5LQRA 1OI7A 3CMMA 1TGVA 2JK1A 2A3NA 2R8OA 3HFRA 4X7RA 4BVAA 4DHWA 2AW3A 2XUDA 5LP6C 1T5LA 2HRBA 1PUJA 3OPMA 4G0PA 1G3UA 3ZVMA 1L2TA 4EKEA 3DMTA 2HBQA 1N5IA 5GJWC 3QUBA 2HY7A 2LCFA 3BIFA 1UPUA 4GPD1 5HE9A 3DBHA 4L3VA 4V02A 1DG1G 3E1KA 1PG0A 4MWCA 2HPZA 4O4LF 2QF7A 4NBSA 3U16A 4Q02A 1JFFB 2ADFA 2PNFA 3BULA 5FLEX 3CX8A 5CLGA 3BB4A 2X19A 2W2LA 4BRUA 1BN6A 3DYBA 4URYR 4RV9A 3VDXA 2XHZA 5I4CA 3NI2A 2R6R1 4HXYA 1NHGA 5ALYA 1KAGA 4JI3B 3WGIA 2WVHA 2XMCA 3T38A 2UUBB 3QELB 3LFHA 3QE3A 2ATXA 1B4DA 4ER7A 2Q1WA 3IT0A 5B2FA 4AX4A 2JAXA 1IBRA 1FUUA 4XGNA 1DHRA 1RXSA 1SBCA 1J33A 2G1UA 3HSYA 5LYJF 1PR0A 2UXDB 3IEVA 3U37A 1UJCA 5C46F 3JAMA 2UYHA 4JUAA 4OKSA 2AOUB 2VVTA 2ZS7A 1EKXA 2HF2A 3AL2A 2QRZA 4NL4H 4RFVA 1UXGA 3LDGA 5IANA 3R5HA 3SC4A 2WZDA 4HTFB 1W1UA 1ZNZA 5TT1A 4BBAA 3NIFB 3C3MA 3KDPA 3GT0A 1Z56C 3LGSA 3R6DA 2XEXA 3HNOA 4HNAA 3L8EA 2IVZA 5NLLA 3J7AC 1Y5LA 1N78A 3H8SA 1YHNA 5AP9A 1SIUA 1JN0A 1DV2A 4IF4A 4UREA 2AQ8A 2CY0A 4ZJYA 1OUMA 4LISA 1NUQA 1ZMRA 4EUNA 1J06A 2C2GA 5CDTA 1L4NA 1YZLA 2BGMA 4MQ4A 1HA3A 2QENA 3M6VA 2O1EA 3C7DB 1GR0A 4FHEA 4PS1A 4R05A 4R1QA 1JNXX 2HREA 2QIOA 3HACA 3VDRA 1JEYA 4U9UA 5BYAA 4EJ6A 2XQKA 1DKUA 2XUAA 4MCIA 4GRIA 4HNUA 1QPZA 4BNUA 3LDUA 5TT0A 3D8RA 1KEWA 3KV3O 4MRVA 4ACBA 2H9YA 4JQYA 1YE8A 1VYVA 3UXMA 2RGGA 2RH8A 3WDMA 3WDSA 1OYVA 4HQFA 2PFSA 4MROA 1WD7A 1RP7A 3ZHOA 3GJ3A 4CKEB 4MW6A 3D9QX 3EIHA 4TLMB 1JJFA 1FDOA 4A0RA 3Q3VA 3VX3A 1BDHA 1I3LA 5FP0A 3OQNA 1ODCA 2WE7A 3TLJA 4BPRA 1DS6A 3EEYA 1FP7A 1CE8A 4B0OA 3UG6A 2IZ6A 3LHSA 5ELMA 4UOZA 3L79A 1U2DC 1UFKA 1PL7A 4OUDB 4KWCA 4BNNA 4IWNA 2IZZA 3W4KA 2VC2B 1V1RA 4HTAA 4FMPA 2HMUA 2D2EA 3TSZA 4DILA 4MV4A 4QWMA 3J81A 3KQLA 2D3TA 1OXTA 1MJNA 1UWKA 3AB3A 1YJCA 3FYUA 4B3JA 1O94D 3V7FA 3W8DA 1QIMA 2X0NA 3COVA 2JIMA 2WF5A 1E6MA 2J48A 1FDSA 5HQJA 7ADHA 2FOLA 1N6RA 3ILHA 3AI1A 5T3YA 2P9ZA 3KQSA 4MGHA 3ODGA 1GNSA 2FPGA 3ZCQA 5BWLA 1NRXA 5AK6A 4ZCIA 3J80A 1KIMA 2R7KA 1ZD5A 2ZJ3A 4KH1A 4HLCA 3V33A 3E27A 1YKSA 3IR6A 3R8XA 3FIJA 5JZSA 1XZPA 3L7NA 2GOYA 4CU5A 3DTYA 1U4OA 2B4YA 2I1LA 1CY0A 2FPKA 1KK1A 2WIDA 3NNDA 4U9HS 1UOOA 5ERXA 1YDGA 4E13A 4F6LA 1REQA 1MEOA 4BMZA 3AO0B 2F3PA 4RQAA 1RXUA 4JB3A 5F1OA 5KZMB 3AHDA 3VZRA 1W30A 3KETA 3GQBA 2DFKB 3UGKA 2GWHA 1RHMA 1AF7A 1PVVA 2VLIA 4PFQA 1V47A 1L8AA 1O89A 2GK3A 4IGKA 3UGJA 4Y2XA 4XYGA 1ZS9A 4IIEA 1SY7A 2NUAA 4CM1A 3L8MA 3CSUA 5ABPA 3EGDB 4G8BA 3LUKA 1IWBB 4Q7MB 1SXJD 1XNHA 4WKBA 1XKTA 3ZJUA 4Z53A 4PVDA 2WIGA 3UKOA 4RM3A 1QAMA 2R79A 2ZYUX 3H1BA 4BUCA 1EFDN 1TYEB 3DZHA 4TRNA 2QTVB 2N9UA 4DRXA 1YDWA 3EMDA 3QEOA 3BWBA 4QPPA 3N9IA 1BE0A 1UKYA 4W7SA 5KJFA 3PHJA 1WXEA 2C57A 4Z9BA 6ABPA 2P1DA 5KAMA 5G4KA 4TTTS 5ALJA 3IODA 5AIAA 1XMQB 4P5EA 4G0MA 5E6UB 1WS6A 1IBSA 1PQWA 1DJQA 1GNQA 3NBXX 2F3UA 3EWNA 3HZRA 5AKKA 4L5AA 5EMNA 2NP7A 2BFBB 1SC3A 3RIEA 4F9GA 4FMDF 3OIVA 2CHFA 2X5NA 2O8EA 1UKZA 3NBAA 1N0HA 3PUVA 4HB0A 3I9V1 1M75A 1GNTA 1TYAE 2DUJA 3KOYA 2PGXA 2V6GA 1E1NA 1U3UA 3F3SA 4JEMA 2OXFA 1H6BA 2QRMA 1PQPA 2X9NA 2AN3A 4JR2A 3KVNA 4INJA 4OL0A 5LC1A 3S2UA 2ISQA 4J2TA 3PT9A 3CRMA 3S4YA 4XM2A 2GFIA 2DWUA 4F7DA 4YROA 3FPHA 4REQA 1M6VA 2PEYA 3H9UA 1PQUA 4O3FA 4QDJA 5KCMA 4E7PA 5F64A 1SCNE 1QK5A 4XLLA 5AW4A 1RBMA 4KO4S 2JAPA 1O87A 1AZWA 5TNXA 3WMXA 4ZHQF 1KYZA 1O95A 4L9RA 2FSGA 1W0KA 1DFIA 1TCAA 3PDWA 3OCXA 2IUUA 3UC9A 1TCUA 4BNXA 1W6UA 2B35A 3FPGA 2XUPA 3FSGD 2ZJZA 3G1WA 4NBRA 4A1OA 1XVAA 1RM3A 2YJGA 1VHTA 4BNWA 4H7HA 2XXJA 2XKJE 3DE1X 5KHLB 3F6BX 4X00A 4DLKA 1KJNA 2EOAA 4GPAA 3HP4A 2AC4A 1OQAA 2FPRA 4LS3A 1FFSA 1SOMA 4R83A 4F86A 3NBFA 4WHMA 1LDEA 2YVKA 3AB7A 9GPBA 4AJ4A 4DA6A 1CR0A 4NAVA 3DEAA 2QUJA 4BP9A 1KXJA 3D7MA 5A9TA 3WNVA 3ADKA 4JU9A 1Q12A 2EZ8A 2C3PA 2RHLA 2ZYDA 5AVQA 4CHTA 3TG8A 1JH8A 1VJ5A 3QUCA 1WKVA 3SSNA 3INNA 4MS1B 2B1QA 3AFIA 3LC0A 3FPAA 1CVLA 1DAIA 1TGYA 3MT0A 3OQBA 4GP7A 1ADYA 2C4KA 4N3NA 4PC2A 2A92A 4PYKA 4UAUA 4B6FA 3X2SA 1FU4A 1L7AA 2Z1MA 1QAQA 1H8EA 1SCUA 3P9IA 5CM2Z 4QM7A 3FCXA 5LZ9A 2JFNA 1JEAA 1FYXA 1XMIA 2QA5A 2XBLA 3AFNA 3LQKA 4I5IA 2ID4A 4ZC1A 4B4KA 5CBPA 2QI9C 2ONCA 4MW2A 1JEQA 1NZJA 1XL0A 3BE5A 3C8UA 3DCJA 4WNYA 5J23A 4LXXA 1GTSA 3M6IA 3DMHA 3OURA 4M7WA 8ATCA 3MWEA 3EXFA 3R0JA 4PHTA 4S1OA 1CEQA 1JIJA 3L1JA 4QLOA 5LJIA 3SC2B 2Z3VA 5JCZA 4JFAA 2CE7A 4S24A 1T3ZA 2BDTA 3O8QA 3FR8A 5JZOA 2IS4A 2I2WA 3COJA 3UB2A 1TOAA 1UK8A 3GJYA 4HLUA 4MNTA 3LP5A 4LN1A 2L0XA 3GT4A 3K53A 1NN3A 2FPLA 5KHOC 1C4OA 1Z6YA 3OSUA 3NXKA 1ABEA 1CLEA 1EBFA 5B12A 5JNTA 4RULA 1JKMA 1PR4A 1VL6A 3CH4B 2FDRA 2VSXA 3NFYA 1YTUA 1GPH1 5CW2A 4IUYA 3UJAA 4HVTA 3T3HA 2H4YA 1FX0B 4RK1A 3BA1A 4EY3A 8AT1A 5JPDA 4CLHA 3A4YA 1NP7A 4K6GA 4QFCA 1FMFA 1TKBA 3M9WA 2HM7A 3IKLA 3ZI7A 1EUCA 3ADBA 3RS2A 2BTQA 3ETGA 4ZPJA 5KYXA 1P4RA 4TYQA 5C5DA 3BRWA 1VL0A 1D4OA 3CBQA 5EE3A 1MB2A 3TD6A 5JHGB 1AKUA 3OKFA 2CB9A 1XNQB 2V7VA 2NACA 5ALQA 3WGKA 1HNNA 3WS7A 3LBAA 3ZY3A 5ALKA 2B34A 3HKEB 2ZWIA 1AHNA 2BFPA 3TEFA 3VZDA 4MTCA 3EEBA 3OX4A 4BFUA 3PKZA 3HABA 1RFLA 3PUKA 2EAUA 5BNFA 3QKTA 1PW7A 1ZH8A 5F4BA 2IYYA 1AGNA 1XTIA 2FKNA 1EB8A 3DVAA 3GL9A 3FOAA 4LXGA 5CVCA 4C0KA 4D74A 2A0XA 3PT5A 2HU7A 1M76A 1X3SA 3FETA 5KREA 4GVXA 4X24A 4WUVA 2QX6A 1JJIA 1VHWA 2CHUA 4G56A 2AA3A 4HTFA 4QBTA 4ZQEA 1EXVA 2O59A 4LHXA 3VMMA 4QFDA 2I71A 3IQGX 5D7NA 3S40A 3SD7A 1YDHA 2XCOA 3NDIA 4FX2A 4I6JA 2QYHA 4QGAA 4GOJA 1OKKD 4PG8A 1HNWB 2IHYA 4GL2A 5JS1A 121PA 4X8LA 4EVIA 3CG4A 1F7VA 1Y7HA 2X1LA 1CC1S 1U8YA 2SNIE 1XU7A 1FNMA 2IITA 1U98A 2ZYGA 3CEMA 1WMAA 4HYTA 3MN1A 3OX3A 1TJPB 3N87A 4PGAA 3R7WB 2F7SA 4GLFA 3V34A 3ZBTA 1C50A 5J4HA 1K3TA 2JFZA 2AEMA 3HN6A 3Q40A 3QA3E 1DI0A 2EX0A 4TSFA 3UYLA 5I9LA 2QBYB 4G5SA 3RS9A 2QG9A 3K30A 3OE5A 3P4YA 3V7NA 3W6ZA 1KRWA 1GOTA 1K92A 2F1HA 4FR2A 4K6CA 3KHKA 1JSLA 3UK0A 3VC1A 2D5BA 4B3GA 1I13A 1B6TA 1RI4A 4QPDA 4Y1FA 2H5IA 4Q6BA 5J4YA 4HAWA 5KTTA 1YOVB 4WJKB 4RW0A 3OCJA 1NW9B 4FZVA 5LZ2A 4ZEXA 1OF1A 5ITZA 1ZVQA 1JAHA 3NALA 5A4MS 1NKSA 3UTCA 1JA1A 1IZ8A 3GROA 3K0FB 5BUQA 1SEVA 2JI4A 2QRUA 1NBAA 4MRMA 5CDYA 3G49A 5DHUA 4R7TA 4TS3A 2NN3C 4PCLA 2UYCA 3RVDA 3W9UA 2AWNA 3F1KA 1H66A 1WBJB 2WNHA 5L3ZA 5K0JA 3GJ7A 5KQLA 2VOJA 4E3WA 1NJGA 2C5BA 2FHSA 3O93A 1ORTA 1TAGA 2PNJA 1ZN8A 1SUEA 2D7CA 3N2IA 1XZKA 4YP1A 4EA8A 1FDRA 3W5UA 2WYOA 1T6BY 3HBAA 4KN8A 4LNAA 3AJ9A 4MW9A 5F78A 2JAQA 3ITDA 1SOVA 1KS9A 1O1YA 2G4CA 1G63A 2JIOA 1QQTA 5KNBA 1PV4A 4KMOA 5FOUA 3KLBA 3OQIB 1R50A 4L6AA 3AFHA 1WXQA 4I66A 1DTSA 3MMNA 2ZM6B 1XVUA 4EMSA 3GG9A 3P97A 1YQQA 3OCUA 3A14A 3UW3A 2ZUCA 1WRBA 4I1PA 1YZQA 2C8LA 2JASA 5K0LA 3RSQA 1GKUB 4CI9A 2ZUFA 3FVRA 2OCYC 2H57A 1QH1B 1YUBA 2ZRMA 2IU4A 1PW5A 5CTJA 3SY8A 5DNEA 1EVYA 4L75A 2X0EA 3QGMA 2AT1A 4XE5A 1XRMA 4ESEA 1E5TA 1V4NA 3OSZA 3KQMA 5DTRA 1JWLA 3WA6A 4P93A 1PQ4A 3F67A 3S1AA 4M0PA 2ZBVA 1F48A 1AZSC 1QQ7A 3HZOA 4B74A 3GEIA 1FTYA 2GVNA 4AZWA 3MRSA 3TNYA 4Y2RA 1B15A 5CVEA 5A62A 3ESXA 2NTVA 4AS2A 1K7XB 1QHYA 2HQRA 4YCNA 3ECSA 2FMIA 2REQB 1DO0A 3H5RA 1EVKA 2CNWA 4Q19A 2C77A 4Z54A 1VB5A 3LW7A 4PGMA 3WYCA 4ABYA 4A15A 2X8JB 3EGDA 2ZCUA 5FADA 2P4SA 3JYLA 3NYQA 3UJHA 1MLDA 3KL4A 2XX3A 1ESMA 1QMGA 3LQFA 5FOTA 4WVFA 2IS6A 1WPRA 4IHKA 3ORSA 1CVRA 6NULA 1T26A 5D5QA 3S1SA 4QGHA 1LS1A 1CUFA 2QP9X 1JBEA 3M1YA 4IIBA 3ZPXA 5ICCA 2J46A 3EWIA 2R751 4AUKA 1IOZA 3EISA 4U6SA 1NMEA 3AKCA 4WBNB 1ZU5A 4LBWA 1WB4A 5FV7A 3LPAA 2JIPA 1C4KA 1TAHA 5E6UA 2YMQA 2ZRFA 4ZGGA 4O4LB 3KLNA 4G4SP 1ST2A 1JGTA 5GGXA 4UPVA 3D4OA 4FCCA 3SZOA 2YJ6A 1GL3A 2BFBA 1C81A 4WZBA 3ZZNA 1EFVB 2NQTA 4FK8A 1V9SA 1D8TA 3CVUA 4JLUA 5J4KA 4FOPA 2J67A 2W2VA 2AYZA 2VHYA 2A9PA 4B8YA 4LC0A 5IRCD 4Z2AA 2PJUA 4PZ0A 3KSDO 3L0CA 2N42A 3A31A 5C7IO 2A9OA 1OU0A 2R4QA 4B3FX 5KINB 1RPNA 3LBFA 5T5QA 3TXYA 1TM2A 4DV5B 1T2UA 2Z2YA 1L5OA 3PPVA 1L4LA 2GX6A 1TTQB 5HK9A 5HFAA 2Q1TA 4H1TA 4RD0A 1B6SA 2WM2A 2GFHA 3QU5A 4D57A 4XQ0A 4ZI7F 3IBGA 3KAJA 2OL4A 3CNBA 1HYQA 1PJLA 1V8BA 3FOCA 3HA5A 3BOSA 3IVGA 4GU5A 4UM5A 4DKXA 1T9CA 1MW9X 3RPEA 2PGJA 1OXKB 1GPNA 4CV1A 4HZIA 2O7VA 4MWOA 2CBZA 3SFZA 4A8JB 5A9SA 4NK5A 3WLNA 1XZLA 2HRDA 2GTHA 3EQ6A 1WUTA 3ZBUA 3NHBA 4RZ3A 4D4GA 3PD0A 4X45A 2EX4A 1QYWA 4XVCA 3FWKA 1OTHA 3L4BA 4O08A 3D1LA 2GYVA 1ZQ1A 1GD1O 2I7DA 4G37A 1IEVA 1XD8A 1QYCA 1I9GA 2O5RA 2WZCA 3ABRB 4DT1A 4ZOQI 1B41A 2XBUA 4M1KA 4GYWA 2I3DA 4WUTA 2G1PA 3IQFA 2XYVA 3LQQA 2NSLA 5H80A 3JWHA 4EYGA 3RSGA 2MYNA 3OU2A 3H9JA 3BKWA 4NBUA 9LDTA 3GK3A 1K6JA 1YZTA 2I8CA 1XSEA 5SYMA 3EXEB 1NNEA 3S2SA 4KN5A 1Z6QA 5A3VA 1Z75A 3BE6A 3LLSA 4NJEA 1L5NA 3RC1A 2IYNA 1I6LA 3ZE6A 2PA0A 4CN8A 2FWBA 3SSOA 5FL7D 2HGSA 3WB0A 4QG7A 5GOTA 1GKYA 4GKBA 3J7TA 1DJOA 3O1IC 3IHLA 5C1OA 4WZ6A 1VCOA 1KJ8A 2XOEA 5ADHA 3IS3A 4LX8A 3ZV3A 5IBPA 5E7JA 5I7HA 1RHUA 4OQNA 2PMEA 3RANA 2OXTA 3ETDA 4ZQGA 4PBTA 1PZFA 4Q9KA 1X13A 2H65A 1G64A 2QLLA 2PYDA 4BU0A 1NT4A 2HBYA 4GPEA 2RHOA 3VNSA 2HX1A 4UCWA 2C0QA 1NYQA 2IFTA 3PLRA 3UWSA 2YICA 1EK0A 3LCJA 4QJ5A 2CDBA 3PQ4A 4JUDX 3TW6A 1Y5RA 2VYNA 4DDMA 1OIXA 5B5SA 1X74A 3CLUC 2FPPB 2XODA 1TO6A 2NO4A 4RZHA 1JZTA 1BS2A 2HSJA 4UTXA 6AT1A 3PFNA 4AMUA 2V59A 4X7MA 1C7ZA 1KFEB 4CQMD 1HYGA 1QP7A 1GHTA 1LVHA 2DPXA 4QIHA 3B3FA 1KYXA 3HCEA 3JSXA 3C7CB 3JZDA 3MSXA 2YHIA 4HNQA 16PKA 1ZA2A 3KT0A 3OZEA 4FYHA 4CM7A 2B2XA 4FMCF 3VKVA 3PI6A 4PIPA 3MJVA 4GZLA 3PA8A 3B1VA 1VE9A 4OXXA 4ESVA 1DKOA 4U7TB 3BJEA 3DAHA 2Q6IA 1E79D 3KYCB 3U3XA 1ARZA 4JLPA 1TUBA 3PKIA 4J43A 4CMJA 2YZGA 3KLOA 1IZ9A 3Q7QA 3G0BA 4PLVA 2DHEA 3R9WA 3DKRA 3P9KA 1XTJA 1FUEA 5JAUA 1E58A 1G4UR 2FW8A 2G0AA 3SHVA 3SLKA 4B7CA 3HB7A 5GV8A 3FMPB 3ZE1B 1LTHR 2CNDA 5KVVA 4YN3A 1ZR4A 1IAVA 5WRFA 1UIMA 4ZCLA 1AUVA 1UWVA 2GUGA 1DB3A 3ZWMA 4G0YA 1JKXA 2N46A 1SN7A 1LC3A 2QM3A 4LYAA 3I01M 3ZGXA 1XWIA 3PNBA 2WF9A 3IQEA 2H1LA 4DJTA 1W75A 1J0EA 3ETLA 4I4TB 2OOKA 3HN2A 5E0OA 2TRSB 5DWQA 1EEXB 1MEEA 3ANMA 3MUEA 3OT4A 4JBXA 1WXHA 4XD7A 2QVCA 2ZYVX 4DC1A 2IPNA 1M2OB 1PGQA 1M6HA 4TKMA 4G0NA 3LPMA 3VO1A 1GDHA 4BJ3A 3FJYA 3OF5A 4E5KA 5KJ1A 4CL8A 4O3MA 1IQUA 1LDMA 2WMOB 2I2FA 3K1ZA 4X3PA 1IVSA 2Y0PA 3K1JA 1Z62A 3FROA 1ECFA 1P0IA 2MOKA 4DG8A 1FA9A 2GLUA 3GLHB 1YOVA 3SHTA 4C9BA 5AHRA 3ADDA 3CZPA 4XIIA 4F1KA 3EDMA 1BE8A 4GR9A 1DAMA 2R25B 4BLRA 2IHUA 1WG8A 4KFSA 2BD0A 3K0FA 1P2GA 1SBYA 2QS9A 3BYZA 5FI5A 3ZLJA 1UFVA 2P2NA 4HS9A 4ID3A 3JU3A 1IHPA 1MPXA 1FX1A 3GMIA 1UXIA 1AK9A 1IN5A 2XDAA 1ZXXA 4CIBA 3A1EA 2Y2UA 3T1HB 1VKRA 2WHEA 3PEUA 3SZUA 1FP6A 1OREA 1FXSA 1JJ7A 4XDZA 1OBOA 2M6KA 4UPEA 1GP2A 2V6BA 3CB4A 1XQ6A 1TLTA 2CFIA 4KQ1A 5D5PA 4XJTA 5C51B 2MSCB 3KB2A 3OQIA 4FXOA 2IZ5A 5K3DA 4AROA 4E7OA 3KOZA 4DSOA 4ETWA 3U7HB 1COZA 1T1IA 2HWUA 1QLHA 1AKRA 1F9EA 2H7CA 4J1SA 3O8BA 2IXGA 4MRSA 1TEVA 2O0HA 3BMQB 3OT1A 1K7YA 1ZI9A 1HTTA 2FR8C 2I2DA 4IW3B 1MB0A 3WB2A 3M3PA 1FTQA 4GVLA 3DTNA 4X92A 3ZGNA 1Z17A 2YCBA 1RU3A 1QHFA 1NMZA 2GO1A 2YV4A 3D8NA 3OLCX 3V8EA 5A7GA 4UQOA 5K3AA 2E2WA 4O4JA 5FR1A 4EGSA 1JHZA 2VT6A 2BOVA 4IJVA 1W29A 5IMSA 2N3ZA 4DRZA 4V39A 4MQBA 3F46A 1RQXA 2B30A 1V48A 2BLNA 4BBJA 4H2DA 4AG5A 1T91A 3SYTA 4C6TB 2YY7A 3O90A 1KXZA 3B2EA 2C2ZA 5DXAA 5DHPA 1ZHOA 2Q5HA 3C1TA 2AOWA 3ES9A 3K71B 2FUEA 4GQBA 2J4FA 3ZNQA 1Y6GA 2X41A 1D03A 1V3UA 4FT4A 3DHYA 5SZHB 1QLJA 4HZUB 4YV0A 1GPJA 3OJFA 4FFDA 1UC5B 3SHQA 3TLMA 1EM8B 1TO2E 4BB9A 4EMUA 3B1KA 1GTG1 2REQA 2XUHA 4DMFA 5HIMA 1ISFA 1RPTA 2KPOA 2JFUA 3OE4A 2Z2KA 2I67A 3ZJ5A 1EJ0A 3RW9A 3FR7A 3ZVLA 3OQJA 2QRLA 1T9KA 3P1JA 2XE4A 2J32A 2WUDA 3CW9A 1WCWA 1DBQA 1FC0A 2LPMA 3T7CA 5ITSA 4F4FA 3LIIA 2CDAA 3INGA 4L0MA 3U7QB 1JZQA 2DC1A 4E03A 4L8FA 4N9QA 1DCTA 1VKZA 3QWFA 3V4RA 3HB9A 2CVPA 1UMCA 1VDZA 3ILVA 3P2JA 4KZKA 1RXVA 4FIDA 3PNQA 3TTWA 4FT2A 2OPBA 1II8B 4V0ME 5EJGA 3SQXA 5E4JA 4BO1A 5C4MA 1J0BA 3ZK9A 1S6YA 1PZNA 3AR4A 3NBUA 1ZUWA 1CFJA 1R5BA 2NO0A 2VO1A 3QUSA 4RJ2A 1U0OC 1KMCA 2IYWA 3NUQA 3REOA 3OA2A 1EFVA 4D56A 1YT5A 4J8PA 5HUQA 1W76A 3E61A 2BHLA 1RRKA 4GGOA 2J31A 2I6FA 4KI0A 4D46A 2BGKA 2C88A 4R9RA 1KJIA 2QTZA 1T9DA 3ZK7A 3UEOA 1JKJA 3DMFA 1OFTA 2OZLB 4TKZA 1NG9A 4RHCA 3ONVA 4MI1A 2I7CA 3PF8A 4Y6RA 2B9EA 2O4UX 4W8GA 5LYJA 4CNQA 4BX9A 1YDEA 1PUIA 5KNDA 1ATIA 4GD3Q 1KERA 4L27A 4MW4A 1QYIA 4C7MA 2EWWA 2GRAA 3C6XA 2WICA 3FMFA 3O2JA 4KMRA 2Z5GA 5IH3A 1L5KA 4BRZA 2B61A 4EHHA 4FFOA 5BQ3A 3EAFA 3BS4A 3YASA 1PF7E 1QZZA 3PXEA 3NTOA 4LSMA 5ECGC 2VDKB 4L76A 2IXDA 3I6IA 4NULA 4GOOD 4MR7B 4WN3A 3RS5A 2JD1A 3SYKA 3UJ7A 3DSRA 5H82A 3UQZA 4DMCA 1BMFA 2WD8A 4HK4A 3U56A 3C7TA 4KQXA 3K6KA 2XWSA 3D3NA 3G13A 1HT0A 3H4IA 4ZEVA 2PPLA 3EVTA 4RKEA 5E2AA 4K28A 5IT4A 2BMDA 3IT3A 5CB4B 2PZMA 2GHTA 1BG6A 3P71T 1VLLA 2FY8A 3AJ8A 1NURA 3C6QA 4U7FA 5JSYA 4N0QA 4KC0A 2WZQA 2K5UA 1YC5A 1SURA 3L41A 2ZUTA 2IVFA 2BFOA 3WQHA 4EB6A 4GRDA 2BMJA 2OE2A 4PF1A 5AKZA 5JD3A 3EXEA 2B7CA 4TV8F 4URZR 4F4IA 3HY6A 5JWOA 2HU2A 1DQSA 4YCCA 1O9GA 2ZB8A 1SK8A 5FWXB 4REMA 3A6LA 4IOJA 3FRIA 5MN6A 3OESA 3IULA 1TF2A 1DDOA 1G291 1N2CE 1I1QB 2ECKA 5FYDA 2DY1A 3JALA 3DUWA 3ZVRA 5C32A 2GXAA 3D0OA 3HXLA 3JARA 2O48X 4HUJA 1XFDA 4FKMA 5G4LA 1I2DA 1VMKA 1M2NA 2LV8A 4M55A 3ZHUA 3OA0A 1NTOA 1JLMA 1TK3A 2RHMA 3NTVA 1H0RA 4HGZA 1IVYA 1RLIA 2Q2WA 3MHPA 5A3SA 5KOJB 3L8HA 3VAAA 1LSJA 1UJ6A 1SCKA 5D1HA 2DXIA 2O6LA 4YMGA 4LVNA 1KARA 1H6CA 1Y42X 4M6WA 3KEGA 4ZT2A 3QQPA 1BX3A 4RTNA 1PWHA 3G0DA 4Y2VA 2J0VA 4YR9A 2M1XA 3EMVA 2QDXA 3UGTA 2DPHA 2EVWX 3DVSX 4Y6PA 5JBIA 4BNIA 2FPPA 3GB9A 3IAS6 1Y6JA 1Q7TA 4EY8A 1JLKA 1HE1C 3GLIE 1XZBA 4GUAA 3LGAA 5T3UA 1CS4C 2Z9BA 4UXHA 3NM4A 3SK0A 4LXUA 4BTEA 2JLSA 4GO1A 2OECA 3RARA 3AEXA 3KR1A 4OM7A 5DTMA 2ZI4A 4LZWA 4I0WB 3T9CA 4CMGA 2IF0A 1M6NA 2C4VA 3DQPA 3SJZA 4YPOA 1E9DA 3NBQA 2WJJA 2JGDB 1EE2A 4EATA 4EITA 5J2TF 2IY9A 4N18A 2PWBA 1AS3A 3I9FA 2D1SA 2AOXA 2QXYA 4OHMA 1VRCA 2GEFA 3SQMA 2FK7A 3G02A 4M37A 5K51A 3TBKA 3KQUA 2JAOA 2JFQA 4YBZA 1PJRA 4UXIA 1FUKA 1SUPA 3AETB 4JXJA 4UHJA 3TVTA 4PPNA 2GM5A 3GF4A 3O47A 4DIEA 4BRWA 4DWWA 3MA0A 4I8IA 1YL7A 4E2ZA 4N5MA 1P18A 2FEWB 1DBRA 2P75A 4HWRA 3BMXA 5E8JA 1P72A 2YV1A 3CW8X 4EHNA 1R8XA 1U3FA 2WJ4A 4YGYA 2Q29A 4U2CA 1KWKA 2BFCA 4A8TA 3NS7A 4RYDA 1LBEA 3KT8A 3LXXA 1IY1A 3TZLA 3FNBA 4XUCA 3K20A 2M32A 5B58T 3V7YA 4TSKA 3JAKA 4XQGA 5CDFA 3NH6A 1WUJS 1JEOA 2PUEA 1N2OA 3P0HA 4NCBA 5L7YA 4PZAA 1EINA 4NZNA 3K9LA 3MCAA 3MJSA 2VZ8A 3N6XA 4KZPA 4NBKA 2GVDC 1G5RA 3GEBA 1M2OA 4C4AA 4LDJA 1C1HA 3EGCA 3Q1LA 4KI7A 1HT1E 1XVTA 2AJDA 2YS6A 1KGSA 1SXJE 3ROTA 1B6GA 3L8YA 4UEQA 2PMDA 2VXYA 1GWNA 3K92A 5J1TB 1I32A 3MD9A 3IUPA 3I0MA 3K31A 3KPUA 4AB1A 1LEHA 4D0GA 5DXFA 1XTPA 1Z07A 2OYCA 2OAEA 1PZXA 1LV7A 1HDGO 1VRVA 3DFUA 4Z4QA 1Q0RA 5FIUA 3TCNA 3GLHA 3C5CA 2MCFA 2VQ6A 2EFHB 4X85A 1E9FA 5TQ2B 4BJ1A 4ETMA 4YT8A 3EPHA 3TQIA 2HF8A 3IAAA 3V3KA 3WB9A 4FCWA 2GRJA 2QL6A 4CJXA 4YRKA 2NOAA 4ESOA 1A50B 2QGFA 4CVNA 4NCNA 2VH1A 1K97A 1O03A 1PCXA 1GQSA 3AL0C 5DCWA 3EY9A 3IMCA 4OHVA 2FRDA 4HRAA 1JPNA 4BFTA 4ZHQA 1I6KA 4E46A 2WTUA 1SR8A 4KIWA 4Z99A 4EVQA 4UKDA 4ZI7B 3DCIA 4YUZA 1RMTA 3U1TA 3UMVA 4NYIQ 2R47A 4PLZA 1OX4A 3I5XA 3SKYA 1D1TA 1DC4A 2X7XA 3HB1A 3RUCA 1XZAA 1HGXA 4HDRB 3AU8A 4EH1A 3U4QA 3CJTA 4Q47A 1ZMOA 3HJFA 1UJBA 2CDCA 5CMLA 2QN6A 1F1BA 3GLTA 1N0WA 1YSCA 3A1NA 4PG4A 3BMQA 3KKKA 1DCMA 5JY6A 1FNSA 2QEQA 3GGPA 4RKRA 5KNCA 2B78A 1N6IA 4O5AA 4N5NA 4RPCA 2VDNB 3IBSA 4G09A 5H5JA 2OV6A 2PSJA 4DG9A 2WWHA 7AT1A 1PHRA 1XFAA 2VR1A 4KL8S 1MJ5A 3ICEA 1LWNA 4EFNA 4KRXA 1U1IA 4YFVA 1F20A 1Z0DA 2FR0A 3BXZA 3HLTA 4IXMA 4XA8A 3SF8A 1QK3A 4RE5A 5ALPA 3AYZB 1JX6A 3WA7A 4MR9B 4WX2B 2Z4RA 4KJXA 2G5PA 2HBZA 3K9GA 1DG9A 2Q1SA 3GD5A 3GQVA 3KHTA 3KV1A 4CLEA 1OXVA 4MDHA 3M9LA 1YS9A 2PMFA 2PMBA 2W8BB 4LZAA 4WRRA 3WOVA 4BB6A 1SHLA 5CTAA 4RJLA 4HZUA 3RHFA 3C24A 3HCPA 3ABIA 1L5QA 3IXLA 1MW8X 5EVCA 4MKZA 4TN5A 1GCAA 4GMFA 2F55A 4HX9A 2V3CC 2C31A 2PWYA 4OYRA 4QECA 4UHDA 4HAIA 1JG6A 2QXTA 3EGWA 1HG1A 1KZYC 1WVMA 5TB5A 1LTKA 4PY2A 3NEJA 1L4HA 2ATVA 4MDYA 3ZDXB 3UXYA 4B80A 4F4JA 4HYEA 1RRPA 2QQ5A 3U7QA 4BTVA 4RTLA 4S2UA 4JV5B 2E48A 4DLUA 1QUEA 4M9UA 4RXTA 3NFRA 3KWJA 5JC1A 3G1TA 1YF3A 4BQIA 2RKWA 2WINI 1QYXA 4M53A 4RDCA 1U1DA 4LEIA 2FUG6 2HK9A 3ITEA 3OFVA 4KLNA 1TFRA 4KXMA 4PONA 2ZITA 5JXJA 1P6UA 1YR6A 2RAVA 2ZT8A 3RIHA 4UBIA 4IDEA 4HH3C 6YASA 2Y68A 4PLWA 3BHJA 2BLLA 1WM1A 4NJOA 5LSAA 1GGHA 2WYUA 2YWCA 1J8YF 3JQ8B 1MDFA 4KLCA 1EI9A 4X61A 5D3QA 1ESZA 2GERA 3K70C 4R8KA 1R0RE 4L9AA 1VTKA 4R41A 1QFJA 4OUKX 3SXJA 4FMCB 1GUZA 5EIEA 1RQNA 1M1YA 3HCOA 3PRYA 4G5OA 1LK7A 1BE1A 2OCPA 1GTVA 4QU5A 4YJ2B 1YC2A 3VO9A 2WG1A 1NVVR 2IOQA 4F4CA 2VRBA 1IK4A 1CB7A 3E35A 2Q3BA 3RU7A 1E7MA 3N8KA 3QOXA 5JSZB 3TJMA 2VRCA 3JQGB 1RWQA 5EN4A 3T34A 1KZ1A 4QOIA 3WLTA 4E09A 3E9EA 3HPRA 2FOIA 4D97A 3NJRA 3O1JC 5LQDA 2ZB2A 2FSPA 1DOZA 4FLFA 3RGGA 1WB6A 2PVSA 2H4HA 4KDRA 4BO7A 1YD7A 2F8SA 2VFAA 1Y7PA 1NF2A 2R6DA 4XWKA 1V8OA 3EFOB 4MR7A 3AX6A 2DY0A 1HSOA 4UASA 2PH7A 1N6LA 3SEQA 1U02A 1GGFA 4XSVA 3IMFA 1YZVA 3LCCA 3FVQA 3GLFB 1PK8A 5TARA 4CCWA 3GVCA 4FFMA 2OGZA 3M1IA 1PWYE 3JD0A 4YASA 2VDVE 4FGJA 4WECA 4OAOA 2VA9A 1NGSA 2Q4DA 5EAIA 2Y6VA 1D5CA 4YRBA 4QBHA 4RHTA 5DPMA 3V2GA 3BRQA 2E1RA 3OJCA 5JSKA 1TT7A 3MJCA 4Z49A 1KETA 4BKPA 2MMCA 5AW2A 2VHQA 5EIHA 5HIKA 4P4NA 13PKA 4YP0A 4FS8A 3Q5EA 3E9YA 1BSVA 4IDHA 1IU9A 1EFUA 4B6RA 3TZKA 5E1BA 3PXUA 2FQWA 2WU4A 4I1YA 3Q2IA 1P7CA 3AFOA 4HL6A 1TQ6A 2RMKA 4URWR 2W70A 4BLWA 1OMOA 2ALJA 2UZ1B 2RAFA 1X3LA 3QVOA 2RB4A 2XNDA 2A5DA 1ACJA 1BDJA 3QXCA 4RS3A 4BOYA 5D3MA 2Y1KA 4RFSB 4D4IA 2WP8J 2GK4A 5JD5A 1E7RA 3KVOA 5KQGA 1I2ZA 1CUXA 2HNBA 1P44A 4AWBA 5B4VA 1LDBA 4L4XA 4CTMA 5KOJA 4OYLA 2BBTA 3ZNNA 1NQWA 1B76A 1Z8FA 3M1LA 1XCPA 3M6UA 4N0EA 4BEBA 5M2QA 4ZYZA 3EWAA 4ZANA 3QKWA 4C7JA 3OJOA 3K1AB 1NW7A 2WU8A 3T5DA 3MWLA 2RSLA 4M1MA 4PVCA 1SXIA 2ZT5A 3Q1KA 3SKXA 2C03A 1AB6A 5CFZA 1J70A 1CUSA 3WISA 1BXGB 4R6WA 4X94A 2VWPA 1UKAA 4TL6A 4UVEA 3EZXA 5BPFA 4CFSA 1ZRMA 1U8ZA 3PNMA 1Y1KE 1RM0A 1YZFA 3W7BA 3PGXA 5EYPB 5LWQA 2FX2A 2C96A 4MRRA 3EVBA 1JHRA 3DFZA 3MJRA 5FRDA 1B16A 4DCOA 3K09C 3I64A 4KPUB 4LBZA 2IXBA 4EBBA 1L7VC 1UBEA 2KLHA 1J23A 2JGDA 1WEKA 5ENVA 1Y1SA 1QGED 4RIFA 3H6KA 3I83A 3BXEA 2OHXA 3HU1A 4IIJF 3DZFA 5CG1A 1IB0A 4C7BA 3OMXA 1NA5A 3WICA 4CMIA 4E5DA 4WY8A 1QVWA 5J2UF 2I4NA 4KR2A 1HXHA 4LGCA 3FPLA 3P32A 3Q7TA 3AETA 4EJSA 5FB3A 2B99A 2MSEB 3I5AA 2GNOA 1E6KA 3DV0B 1FFXA 1Z33A 2O3JA 4OP3A 1RBQA 2YWEA 3VNBA 4PSCA 2DFPA 4B0PA 1FLAA 3FYSA 3Q9LA 5FPTA 4RLHA 2ZTMA 4LOJA 1DQYA 1HOTA 1Z29A 1ZLYA 4WOKA 4X6LA 5FQNA 3T7AA 2AF4C 2V7TA 1X92A 3G82C 1CEXA 2BFWA 2H11A 1HDOA 3AI7A 4F3CA 3DZBA 4FN4A 5NULA 1T8TA 3T5TA 2HHAA 5G0VA 2EL7A 1KI2A 1NLUA 1ORHA 3H05A 4NJMA 4FBMA 2EJVA 1PSWA 1KP3A 2OAGA 4K9NA 2OO5C 2PK3A 5BXQC 4R71A 4F71A 3U81A 3QVLA 4V0RA 1JUDA 2VDRB 4KAFA 4K9OA 3WMEA 3LY8A 3LFTA 2WHXA 1KO4A 2WZBA 2C9ZA 2AN9A 2HF7A 2I7TA 3TRIA 3EGIA 5JS6A 3B6KA 1YFKA 4D4JA 2E55A 3PDHA 4P58A 2OBXA 1A7JA 1G98A 1KZ9A 1SBHA 2V6JA 4FI3C 1MRNA 4JVSB 2ZU0C 2ZWVA 1OI2A 1UJ4A 1OHHD 3PXCX 1N7GA 2HK6A 5JZ9A 5LP6B 4LWZA 1R8JA 3CM0A 5BN4A 3GCWA 5JV5A 1Q20A 2WSYB 5TQ2A 3RYFB 1GV0A 4CEJB 3CEHA 3K8QA 3EVGA 3QBJA 2JDIA 2GZ3A 2I22A 5F1KA 1P60A 5C1DA 1N57A 3BAFA 2ACWA 2Q5OA 3EFHA 1R1DA 3ZHRA 4EJFA 2ILTA 4C7VA 1YVPA 4B4WA 2FUCA 3BXHA 3UV3A 2Z2XA 4MYDA 1UH5A 3DOHA 1PLLA 2AJLI 2X1MA 4KO2S 5EVJA 3SBDA 3UZUA 4ZI7A 4OL9A 3UUWA 3PYXA 4ZDKA 3DE7X 3CCBA 3AONB 3FTPA 2C54A 1BXRB 1WX1A 4MW5A 1EDZA 1EUDA 1X38A 1SQ6A 2HQBA 2QNBA 1FF9A 3R3YA 2XVMA 3SQLA 4JBNA 2XGMA 3UFXA 2H2GA 1SKYB 4V0NA 1XUOA 3UHJA 4TS4A 1AMOA 3UUGA 3WWDA 2C29D 1ADGA 1FDTA 1FK8A 4QODA 1J0CA 3GXOA 1JILA 1DIAA 1HORA 2DHDA 2IEIA 4UEJA 3A3OA 4Z7JA 1XAIA 2HXYA 3CZCA 4Y1RB 2V7QA 3PWKA 1J0DA 1TZKA 2OCLA 3T5BA 4D3DA 3KYBA 3U44A 3LU1A 4EI9A 2FTKE 2QRKA 2V5UA 3W6NA 1C14A 4KQFA 4BATA 4ETIA 5JH7F 4HUQB 1R10A 1RTTA 2DETA 2X9LA 5EZ6B 2VTBB 1BEUB 1QR6A 4NDZA 3OU6A 4O4HB 1ZG3A 4TV8B 3BZBA 4RGBA 3FY4A 1H2RS 4RESA 4EMBA 2VUTA 4BO0A 2XZOA 3QOFA 4ZOLF 1SKUA 3UMMA 3TGWA 4D9BA 1P80A 1VJRA 1BQ3A 4E12A 5HRCA 1S2OA 1IUOA 1JDSA 2GZMA 2J07A 4RZ2A 3TJZA 1A1SA 3ZDZB 2R68A 1KS2A 1WPQA 5L45A 4CM5A 5C8ZA 3CX7A 1U8FO 4L08A 4WBXC 4KK3A 4FN5A 4FDLA 3QH4A 4KQEA 3IEIA 5C7LO 1JLSA 1M34A 3DBVO 5FNVB 4A23A 1KO8A 1NWCA 2KMLA 2WPDA 4IDPA 2RBKA 4URUR 4GLOA 1RXYA 2D2FA 2AG8A 1QB7A 2I34A 2POCA 4Z0TA 2BJVA 2Y1FA 2NNWB 3GAZA 3OZSA 2PCLA 4D5GA 1WUHS 2HRRA 2RI0A 4OH7A 3TR0A 3TTTA 2YVQA 1ZK3A 4IL5A 1SBZA 4DV4B 2PWAA 5DASA 4JHXA 3W3AA 1NL3A 2IE0A 2C95A 3D6NB 3KQVA 3D3EA 2R62A 1IOVA 2WT9A 3FYTA 4KQGA 2H2FA 1SPXA 1WKCA 4KWTA 4OSEA 3X1ZA 4ENPA 4XFDA 1UFQA 4CF3A 2WAMA 3I58A 3RF6A 4RZXA 1K0FA 1WP4A 4GR5A 5IK2D 2YKGA 4GMXA 4N6NA 3N7UA 2E6UX 3OY2A 4YDHB 3VNAA 5CFPA 3JQ9A 3K0BA 3MPUA 2E7ZA 1KJQA 1U2GA 3H4MA 2X13A 3PQ6A 2JLCA 3HCDA 3RWBA 2A3RA 2J9RA 1SD2A 1VECA 2AGVA 2ZIZA 1E4YA 3F74A 4PFSA 4HAZA 4UZSA 5CT5A 1DXHA 3COYA 5CYPA 1W36C 1NY5A 3E9RA 3IJPA 4WK6A 4MVYA 4AO7A 4ADSG 2VG8A 5B7NA 5ITWA 1NC3A 2VN8A 5DBOA 2ZANA 3HB5X 1P7YA 1NPYA 2Q2OA 3P2EA 1ESEA 4D8XA 5D3ZA 2A7QA 4PRYA 4K81B 4ZVPA 3MGKA 1Y80A 3N2GB 5G40A 3ZWXA 1DUSA 2JGAA 5HWSA 5EJFA 1XLTC 4ARSA 4MJ3A 4MUAA 1NONA 1CF4A 3D43A 5HKKA 5LBIA 5AQ1A 5AUNB 3EFOA 2W6IA 5A03A 4IQ4A 2O3TA 3IOMA 4XCQA 2YY5A 3G2PA 4G5QA 4WVLA 3UV7A 3U7GA 1NJFA 2GZSA 3B6ZA 1EFHA 1ICEA 4OMDA 4AN4A 2PRSA 3D6TB 3GEGA 4K9PA 1KI4A 1LSUA 3RVLA 1FVFA 1T5DX 3ZZMA 4EPWA 2XCSB 1XZHA 5T4BA 1YIAA 3FZNA 4R1LA 3VTZA 2WUWE 5HZKA 2O3UA 4QULA 4OX9Y 2AD5A 4L6IA 3NEPX 3U6BA 3FTFA 2V7EA 1WQ4A 4X64B 5JSHA 2FEKA 4DMKA 621PA 5KJEA 4KBYA 3Q72A 1M2KA 2XDQA 3QK7A 4ND3A 5K8JB 3SBOA 1GEGA 4RH1A 2R4TA 3TO5A 3L5OA 4F04A 3UMFA 4ZGWA 2QLTA 4RPJA 5GMOA 3WFJA 3GW8A 4XSGA 4BJ5A 3DMGA 3FXAA 2DBRA 2FG6C 1HYBA 1JAXA 3M89A 1F2TB 1YA6A 4Q12A 1E1CB 4Q7KA 2EZUA 1ABFA 3PJGA 3LZCA 4RFSA 4L8WB 2Q5IA 5CFRA 3AVUA 2IY7A 2WYVA 1MHTA 2A94A 2QSUA 2RHDA 4XB1A 3ZGYA 2BFEB 2YJ5A 1ODKA 1DCFA 2IHTA 4JIMA 2EL9A 3RVPA 3KUDA 1ECGA 4WNAA 4XW2A 5LYYA 3WZ2A 4B34A 1NASA 2P68A 1Y0BA 3NAQA 2W2LD 4ZCSA 2A35A 4H7FA 4AP6A 3FVWA 3WL3A 1EB9A 1PR9A 3JPWA 1Y4ZA 3QBVA 3K1AA 4RUKA 3SX4A 3WQQA 1MX3A 3QQ5A 4I1RA 4Y30A 3DLCA 4BNVA 1YRLA 1CJMA 3W5SA 1MO4A 2FLKA 3BWXA 2WJVA 4OB6A 4AZ0A 4DWVA 1RAFA 4XIYA 1L3BA 2OCXA 2GXSA 1JB1A 5DYYA 3ZDYB 3WLSA 1MU0A 1ZOIA 3WRVA 1MX5A 1XRJA 5EWLB 1Q74A 3U3JA 1NUUA 3O9ZA 5EXSA 2JVJA 4N49A 5EYPA 1QVRA 2P2GA 4NZZA 3GFQA 5AHWA 5D85A 3QU2A 3GVPA 5DM60 4EW2A 3CNHA 1Q0TA 4AMVA 1HE8B 2HTEA 4P9NA 1K7FB 3UW1A 4GIBA 1M1NA 1KEKA 5BYJA 2ZEJA 2J9FA 3GGCA 5SZIA 1GSHA 1KIAA 1OXMA 2B1IA 3ENWA 4LDRA 5F2EA 3T9EA 3ED5A 3QP9A 1QFMA 2VJAA 1R0BA 2R8YA 4MV9A 4N4AA 4BKUA 4R2HA 1VJDA 2FV8A 4Y9TA 4TRRA 4AN0A 1V4VA 1C30B 1KQPA 2HDWA 2WBLC 2I6GA 3MWJA 3QFFA 4PU0A 4MB0A 1KJZA 2D4HA 2W2XA 3TIVA 4BFLA 3KEMA 1A9XB 1L5WA 2JRCA 1JIQA 1D1SA 4CU2A 5HTKA 3CKLA 1L5VA 5PNTA 1QFYA 2DUWA 5HCNA 3JQDA 5BSEA 3PD1A 4B31A 1H0SA 1GU1A 3I6ZA 2BR5A 5C5IA 1OH8A 4N7MA 1AOXA 2FH5B 4IIXA 1G8YA 3LA6A 1ODSA 1U8AA 2B4TO 2P9HA 3LW8A 1FQWA 1ZHFA 1UBKS 2Q49A 2CJFA 3B1WA 4QTUB 4DANA 3KTOA 1E4EB 4IIUA 2AX4A 3AGPA 4W9RA 1XE3A 3L8FA 1HNZB 2KBEA 4GECA 1TYDE 4IZIA 1YU9A 2CVFA 3LH5A 4G5YA 4AKEA 1GU0A 1XMXA 4LOIA 1ENYA 2FK8A 2C00A 1XX6A 2JI6A 1YXMA 2D0PB 3IAHA 2D54A 2CNBA 4PAWA 4M1WA 4X71A 3AEUB 5EKXA 4ZZ0A 5FPKA 5GADl 4WT7A 4YV2A 5M7EA 4BO9A 3RYFA 3PWSA 5DM70 1ISIA 1U80A 1WZUA 1W8DA 4WLUA 4CEJA 5BNWA 4A8HA 1Y8ZA 1TU4A 4MS3B 3PQ5A 3IQIX 1A4RA 2F3TA 5C3UA 2AK3A 3L7IA 2G28A 2DAPA 1J21A 2ZBDA 4NVRA 4OI0A 3DS8A 3K5HA 4QBGB 4H6PA 4UUNA 4BDTA 2PJRA 1FSSA 1GQYA 1ZJ4A 1ZM3A 2OB1A 3OIGA 5BR7A 1BXRA 2BKLA 2YS7A 4A10A 1XTSA 4C01A 1H6AA 1K2WA 3AMVA 3IIMA 4FFNA 2RKBA 4KXLA 4Z9YA 5K20A 4JDPA 2DFNA 2YH2A 3WL8A 4YMHA 2RH5A 1YE3A 4YAJA 2D59A 3L7KA 1CZLA 5KTOA 1EFLA 1M74A 4DHEA 5EJ6A 1GCOA 2RE8A 3RT9A 2FZ4A 4IX1A 2YHBA 4OFWA 2O4CA 2YFHA 4Y1RA 4YJ3F 1XP5A 3IERA 1LRLA 2FAXA 4YH1A 1V6SA 1JHOA 4P22A 3CR7A 3F3YA 3K6RA 1OA1A 2FPIB 3SGLA 1M1UA 2PZGA 3LQ4A 3STXA 2YBEA 3KSRA 4YMIA 3UC5A 2JBWA 5JFTA 1WUIS 1DCKA 1SKQA 2ZTHA 3TWOA 1ULBA 2XKKA 1VPTA 4U2GA 1Q84A 5FFMA 4QOHA 1SD1A 4PZDA 3ZJYA 3VGJA 2Y77A 4QASA 2HV8A 2Q7DA 4C4SA 1WHSA 1KYIA 4FEAA 4EA6A 1K8YB 1RI2A 3J81k 2AMJA 4YUVA 3KIPA 2TMDA 2YXLA 3JVDA 5ECYA 1O7JA 3R8CA 5BWNA 3WNBA 3KYIB 3RVNA 3AJAA 1S9HA 4OHWA 1RCUA 1Z6PA 2EJWA 1PL6A 1N33B 3SF0A 5F77A 1JU3A 3ET5A 3HJTA 1I0IA 2QTRA 4YV7A 2GJ8A 5KYWB 4ECEA 3FLBA 3L05A 4EL5A 3TLZA 1S8FA 4DV6B 3MCWA 1IHXA 5TGZA 1OFUA 4RK7A 4BLSA 1VE1A 2EBHX 1K1EA 1CZOA 2CUKA 3I8OA 1JR2A 4MRAA 2Z08A 4RX1A 4W9NC 2QVYX 4JOBA 2OV3A 2X42A 4R4JA 5TVKA 3LT4A 2J9YB 2WAAA 5A02A 4IJUA 4X20B 1JIXA 3PYMA 3QNMA 5EPOA 2CSUA 4JJ6A 1SOWA 1Y6ZA 1UKVY 3DO8A 4JT9A 1WCIB 3SC6A 4DV1B 2NO7A 4DCVA 1J07A 2AXNA 1ZM2A 1USIA 4WADA 3KXIA 3OZBA 3PFIA 1JQ5A 1LQ2A 2XZTA 4L73A 1FMLA 2FMHA 5JWHA 4AECA 1T4BA 4C4RA 1VP9A 1R7RA 2XE8A 2AG6A 5LB2A 2W6CX 3WRXC 5I51A 1U3CA 1CCWA 4L22A 4WZAB 1O95D 4DAOA 2VJOA 1W0KD 3VJLA 3FJ1A 1KYWA 5K9ZA 3I09A 1ZN9A 5J2TA 3EW9A 4IIJB 1VLVA 1IHYA 3A0RB 2GEJA 2I2AA 2R4UA 5J2UB 4EK9A 3T12A 1W47A 3EVDA 3S5JA 1N1MA 1UBMS 2C3YA 1W5FA 3RT1A 3FCSB 4X1IA 4QXRA 1H3NA 4MCHA 2H8GA 3PDIA 1L4GA 1SUCA 2QK4A 1T0UA 2D1TA 3ZWQA 4KO1S 1K2VN 4GQAA 2B7BA 4DIOA 1GPWB 1QS0A 1CS0A 3T7RA 1TE2A 4MAMA 1FJXA 3IMKA 1DRWA 4PFJA 2F1RA 2A5FA 2QNRA 1SUBA 1RI3A 3FX2A 3AF6A 2PYZA 3C1OA 3A25A 5MGBA 1FSZA 3BMCA 2WHYA 4Q18A 3RYIB 4D3ZA 4BIIA 1H8ED 1JVSA 4PNEA 4R68A 1PGOA 3ZE7A 4HMPA 1MTZA 1GADO 3ZWVA 4PHFA 4E32A 4U4AA 3PNPA 4EHBA 5CDSA 4EHDA 2ZTLA 3DLAA 1P0CA 2ZJ1A 4ND1A 4N3AA 2RAUA 3F6PA 4E1BA 1OWPA 3GJTA 5AMXA 3N0XA 1CDEA 2I5PO 2WTAA 5BWOA 1QZ3A 2CJWA 5LOVA 4L8GA 1KQ3A 4P3XA 5JE8A 1PRYA 5FXMA 4RWZA 5B2EA 1Q3HA 2PQMA 4PYRA 5JAOA 4TYWA 4IHJF 5HKLA 2ZM5A 1CIVA 1UIRA 5H16A 4QHSA 1J8MF 1P3DA 3MTBA 3QEBZ 1Q92A 4TWAA 3GUUA 2R6JA 3DWGA 2ZU6A 1W4BA 1F2TA 3UK2A 3QFCA 1XD2A 5H9WA 3QNWA 3H5AA 3K05A 3G59A 3V7WA 4ZXPA 2WSIA 4ZYWA 4BNDB 5IC5A 4PCUA 5KO2A 1GUAA 2IY8A 2D62A 2DR0A 3L46A 3PVCA 4L4UA 4TKVB 5FLKA 4I2NA 2RK6A 2J4CA 4ZV9A 3TSAA 2C2XA 1H0HA 2NO5A 2VSQA 1YFLA 4Z4FA 2IELA 2CV2A 3K4QA 3WYEA 1NI5A 3ZY6A 1VBNA 2ZSDA 3SFVA 2VP4A 2Y99A 5KBYA 3VRHA 3H5OA 2BM1A 3ORHA 1LW6E 3GZNA 5F98A 2J0QA 2Y3IA 1VGVA 1U0RA 4CKCA 4GPBA 4PN3A 1WV1A 3AHGA 5L4NA 2P9YA 4HDSB 4PCAA 1RLMA 2D0IA 2AZTA 5FTMA 3VPHA 3ZW8A 2HI0A 3EXIA 2C3MA 3BEDA 2EFYA 4ZT3A 3CS3A 3HUEA 2HXGA 4JBLA 2WJGA 3HBLA 4ZU6X 3VR5A 1YZGA 2WMYA 4TTVA 3HDYA 2REOA 5EJ2A 1XKQA 4QRIA 4QXQA 1XRRA 1YBAA 1YBVA 1XXHE 2I6XA 4UBJA 1KDOA 4DJAA 4YMVA 1PU2A 5EWLA 3WLLA 3S2YA 3ZBQA 3E2PA 4B3XA 3DWEX 3UJ6A 1UMKA 2GJ4A 2OO3A 4LYJA 2JZOA 3S3TA 1T0JB 1E0AA 4TMZA 1EBUA 2ZJBA 2BC9A 1ID1A 1EWVA 4HAOA 4UCQA 4RIHA 1BCRB 4YP5A 2A4MA 3B78A 4GMGA 4ZYTA 5CDGA 1THTA 5E3HA 1LJUA 3GRUA 3W1WA 2DE0X 1A7UA 3L9WA 1B0AA 2F1OA 3F5MA 3TD2A 1C1XB 2VT3A 4DF3A 8ABPA 3FLEA 3ZD7A 3BIWA 3PFWO 1JE1A 1PGNA 2DKNA 3CLKA 3IDZA 3QYJA 4G1VA 4QNRA 2D3WA 3FCYA 4X1KB 3RIGA 5I9IA 2QPAA 2DLCX 4IIGA 3SFTA 3TKYA 1VG8A 2QHXA 3R76A 1C30A 1L9KA 2V96A 5JADA 3ZZUA 1M7BA 2OAP1 1TUGA 4LVCA 4TSFD 5F2OA 1D6SA 2XSZA 3VZSA 3W8NA 5AUOB 1A9XA 3S70A 4Y1EA 3THRA 1KNQA 1YZNA 2ZW9A 4FEYA 1G59A 1JG1A 2HU5A 1LRJA 3C45A 2B25A 4GSKA 3KSMA 5JNRA 1R3DA 1FYVA 1VC2A 3AUKA 5IXSA 2WF6A 4HUTA 5AK0A 2BPOA 3STTA 1BQEA 4MVXA 2ZIXB 1I1OA 3ABQB 3OPYI 3CH7A 4IDAA 5BN5A 3WG9A 1J8FA 4XZ3A 1E4EA 1WZEA 2IEYA 3MGBA 4B3CA 1QRAA 3GNQA 1LSSA 2J5RA 1GT6A 3JZMA 421PA 4FQ5A 3RHSA 1IONA 4A0QA 4I8XA 2W9XA 3K35A 4QOEA 1FFCA 4FE7A 1K5HA 4IIVA 2PO5A 3RF7A 2PFGA 2ZE8A 2QXUA 2AG0A 2RGXA 2SKEA 2I8LA 2JD2A 2Q9AA 2I3GA 1DKPA 1ZJJA 3IRUA 4GI3A 3DNMA 4AG6A 1SRQA 2P27A 4MS3A 3T1TA 4J6FA 5CDUA 2HA5A 3RS0A 4EUKA 5KNBD 3VU3A 1DMRA 3I2JA 2HFJA 2H4XA 4QUBA 3B8HA 3TSOA 2ZYAA 4F0JA 5JDIC 4UUAA 3C3JA 3ZDAA 2C5AA 2CMFA 1XJ0A 4G0QA 1ZONA 1LBHA 4P53A 3V4LA 1I5RA 3ZUPA 3S0JA 3V97A 3T5MA 2J5QA 4WLEA 3W5JA 3QVKA 2YVLA 5B4TA 5MN5A 1JTVA 3AVOA 4E14A 2ECPA 1NQAO 1DKLA 1NRWA 1R6BX 4NLLA 5JNUA 3LFUA 5KX5F 1PFYA 4OOFA 5FWAA 1RABA 1X8XA 1TD9A 3EIEA 4H7EA 4CG3A 1JJAA 9MHTA 2XHEA 4HPXB 4PYMA 3IP8A 2C5FA 3VXKA 1D2NA 1PSDA 3L6DA 1OAOA 3R0QA 4IIHA 2GPBA 3MTAA 1E62A 1TCCA 2AZ4A 4W5HA 3PTZA 3E22A 4II7A 5CLQA 1GR1A 3W78A 3UYKA 4I7EA 4KTTE 2DHCA 2DCUA 1KE2A 5BSFA 2ZS9A 4LHZA 5FOSA 1XV5A 3K73O 1AA9A 5K6RA 4WXEA 1QPGA 1M0WA 1S01A 2CNWD 2O14A 1D04A 2VPYA 2V0NA 2AFIA 2WSMA 2ZJ2A 2C42A 2WJWA 4FGZA 1TDJA 1UT8A 4NHOA 2FZWA 1ZGGA 3HYTA 4RVUA 4WEOA 4Y2JA 4CUZA 2XLCA 5I8WA 2NXNA 3HQ4O 4YRGA 4W82A 4ZZIA 4JOCA 3H65A 3LUBA 3WO1A 1QO7A 2NSDA 4FZ3A 2OGSA 1BRMA 3FYHA 4BXOA 3CRNA 3FOFC 2RI1A 2YIMA 1P91A 5BQOA 1E2PA 3EMKA 3DMRA 5LZ8A 4F8YA 2QQEA 3VH2A 4Q4HA 1U9IA 4A03A 3HADA 4I5GA 4QDXA 3EJ6A 4PQGA 4DB2A 2CXHA 2IF2A 1QIIA 4Q7EA 4CF6A 4IMPA 1ZGAA 5GIOE 1RLTA 5JCJD 2XITA 4NENA 2AFHB 5SY6A 4LX0A 1F0NA 1TVEA 2IODA 4Y2HA 1XDWA 2H4JA 1WZNA 1Z0ZA 3ZGVA 4X20A 1DDGA 4IWYA 4RLQA 3Q9UA 4CODB 3VI3B 3EUFA 1Q15A 1WCIA 5E4TA 2BFMA 2VHUA 3FD8A 3H3JA 5CXXA 3VI4B 2EKQA 2H1SA 3PC6A 4N5DA 5JCPA 5E7IA 1HFWA 2P1ZA 5M34A 5J1SB 2LRHA 1X9HA 1GSOA 3ZWNA 1BZYA 1A77A 1JQBA 2O9JA 3PE3A 2Z6QA 3DEYX 3OTOB 3PGA1 2ORVA 4WPGA 5EJEA 1HR0B 1MJGM 1O9HA 3BF7A 5CT9A 1UM9B 1A4XA 2RGNC 1PJ8A 1ZQ9A 3I4LA 4JBIA 2QN2A 1J9GA 1K6MA 1J22A 2ZRHA 3PNLA 4WZAA 5CIWA 1ZVMA 1YQUA 2JJ2A 2L82A 4J2HA 1OX6A 2DFTA 1C0KA 3C3WA 4TZTA 1OR8A 4HGNA 3UJ8A 1BS9A 3TMAA 5IAAA 4BMDA 3R44A 2R5WA 2X7JA 4IIJA 1ZP6A 2QE6A 4BP8A 5E9QA 2FF7A 2JZNA 4RNCA 5J2UA 3AHEA 3IA7A 4L4RA 1CJUC 4S1WA 4C2BA 2D5AA 5DM4A 1YVEI 2F67A 3TE7A 1XU9A 3K7EA 5BSWA 3KLPX 3PC3A 4Y2GA 3TPCA 2VP9A 4LAFA 3CVXA 2P62A 3U0VA 3BGDA 3CRRA 2V7UA 5FBHA 5CFMA 4LJKA 3K96A 3C74A 3FUCA 4R9NA 2V8BA 3QXJA 1T3HA 2H18A 2RBGA 5FBQB 3ZLBA 4JI5B 2C84A 2GM4A 5BORA 1XKLA 4WMLA 2E4VA 2FDXA 3N2LA 3NR2A 1HDEA 1R88A 1WSWA 4PG7A 5IAKA 2YJ3A 3TCXB 1PX0A 4B7AA 2J3IA 5E3IA 3MS4A 2DULA 2NNLD 4Q1FA 2YWFA 2WUGA 5EWJB 4G6ZA 5HZGA 5KDDA 4HEQA 1SK9A 1WL8A 2FMFA 3S99A 1FVOA 1WXIA 4OI4A 1K7CA 2HUNA 4M1YA 3MGAA 4RS4A 5I8ZA 2A1TS 1T15A 3WKEA 4LG1A 4CYMA 3AR2A 3EFBA 4ENWA 1JMKC 3NIBA 4GSYA 3AI2A 3LWZA 4C3VA 2GBGA 3HJGA 1KRHA 2XMQA 4LDAA 1YQXA 1Z18A 2IDKA 1BU5A 4TT3A 5J47A 3E2MA 3NYRA 4AN1A 1ZCFA 1QPBA 3A1TA 3UENA 2D2XA 1INLA 1BNCA 1N2XA 2WI8A 4JKOA 3RFXA 4BNDA 3TFOA 2LVBA 1SXJC 2ZUBA 5FWDA 1AU9A 3SQDA 1IK6A 2A30A 4TKVA 1QH8A 1XO1A 4WKPA 1A1VA 3T7SA 5JAIA 5HMMA 2EFJA 4C7OA 1JXOA 3QTBA 2VDJA 3UK6A 4I36A 1QONA 2Z8ZA 1HMPA 4RLSA 3LQ2A 1FFWA 1RHJA 1LH0A 3U39A 5BV8A 5HQTA 4UNPA 5AHOA 2AC7A 4A3SA 4NOJA 4RGQA 1PZGA 1U6KA 4Q82A 5KTKA 2A14A 4JLNA 3E3LA 3E1SA 3HJNA 4MV6A 3H2BA 3IMGA 4ZAWA 4HDSA 1E9VA 5KNBH 3UMYA 1FNCA 1EA5A 4LFCB 1CP2A 3PNYA 3WBBA 2HQSA 2ONJA 4WDRA 4KODA 2WWVD 3T15A 1XCOA 4YJ3B 1X1RA 2HA3A 4PZPA 3F3KA 2R7LA 3P0FA 4GBMA 3JYPA 5AD1A 5G2OA 3BVPA 4IYRA 1EVZA 2JLYA 2X76A 4HVAA 3HRIA 1NATA 4MEBA 1ML3A 4CN9A 5JH7A 4P5PA 3WRWA 1TU3A 3V2HA 1V8FA 2FSFA