2XMSA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPYPYRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN NDRG2
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmsA00
1K5PA 3STUA 1DWPA 4I3FA 2R8BA 4DSZA 1ZGBA 1XZLA 2WTMA 4X71A 1ACJA 3GUUA 3U0VA 2HFJA 2Z8XA 5K3FA 5KREA 4RE6A 3WK9A 3H0CA 4Y2RA 5AH0A 5CT6A 4GWLA 2IITA 1E8NA 4EY6A 3H2JA 3C5WP 4QDUA 4QDXA 3WJ2A 1FFCA 1G4HA 1EK2A 1NU8A 4Q82A 4XX1A 5K3BA 5ALEA 1WHTA 5CMLA 3WK8A 4IH4A 4X95A 1XZHA 4JYPA 5LYYA 1EH5A 3PF9A 1C4XA 3CN9A 5C7YA 2RAUA 1FFEA 2WJ4A 4BCDA 4J0JA 3FYUB 3ESAA 2O2IA 4AO7A 1NU6A 4B83A 3I6MA 1G66A 2DSNA 5HF8A 4OYYA 4AB1A 1KU6A 4UPDA 2G5TA 2OCLA 4FDMA 3UUFA 4DLNA 3RM3A 1YAJA 3H04A 1AMNA 5CH8A 4WJLA 2HRQA 2WILA 1ZJ5A 3AILA 5AM1A 4BZZA 1YS2X 1LPOA 1SFRA 3G0IA 4G9EA 5I9IA 4U2FA 3R40A 1P0IA 2VQ6A 1Y37A 4H7FA 2BKLA 3BIWA 1ORWA 1RWQA 3QVMA 4F21A 2HA5A 4F0JA 3FYUA 4B0OA 1UK8A 3SX4A 1E5TA 4LHEA 1VE6A 3M81A 4X93A 4Q3LA 4UBIA 2QRUA 4JUIA 1CUCA 2AXEA 1JJFA 1F8UA 3OG9A 2PSDA 5AICA 2ZJFA 3S8YA 2HA4A 3QYJA 3KWJA 3PDCA 1R9NA 3G9TA 1VZ3A 2Y2UA 1THGA 3BF7A 5BOVA 1VZ2A 4C89A 2PBLA 3RK4A 3WIBA 4FLFA 1UOOA 1R88A 2W6CX 3S2ZA 3NGMA 4DMKA 4H77A 3HYSA 2GBCA 5CRIA 5EIEA 1MTZA 1ZJ4A 3M82A 2D5LA 4FKBA 1IMJA 2GBFA 3AIMA 2BJHA 3WL5A 4H7DA 5FPPA 5K3EA 1QIEA 5DJ5A 1CVLA 2C0QA 1GZ7A 4K6HA 5ALDA 2XMQA 3OC0A 1XROA 3AIOA 1BS9A 3I6YA 4QEKA 1QTIA 4FBMA 4V2IA 4Q3KA 1Z68A 2VEOA 4J0DA 5LLSA 4KE6A 2WJ6A 3WKCA 3H2GA 5DNWA 2JGLA 2C5FA 2G4LA 2QZPA 5IKXA 5A62A 5CXXA 4H7HA 3WK6A 4FLMA 2VT6A 2HU8A 1R50A 1VA4A 3DS8A 2JEYA 3VKFA 3V48A 5AP9A 1CUZA 5ALPA 4G8DA 2O2HA 4W1RA 5JASA 3PUIA 2QUBA 2HU7A 5ALRA 2AJDA 3BJMA 2I3DA 1O6GA 3A2LA 3K9BA 6YASA 4OUKX 1OILA 4UHCA 1R3DA 5ALMA 1AKNA 3CN7A 2XDWA 5ALSA 4B82A 5DTJA 2FUKA 1XZEA 3PFBA 4M0EA 2BUAA 3OTQA 4Y7DA 1FFAA 3NUZA 5T4BA 1QZ3A 1ZIYA 2DHDA 3PE6A 3ZPXA 4BVLA 1HPLA 1E8DA 1BRTA 3DOIA 4DNQA 5FLKA 4XVCA 4FWBA 4MQLA 3EF3A 4CG2A 4QE3A 5ALZA 4N8EA 1DQZA 3FBWA 3WKBA 3EBLA 1UOQA 3FVTA 2WFMA 4X97A 1X70A 2QM0A 3R3YA 2AJ8A 4DMFA 3IUQA 1THTA 5E4YA 5HZGA 4ZV9A 4WDRA 2G63A 3M83A 3D4LA 4IQ4A 4UHHA 1UT6A 4O08A 4B0PA 5AKJA 4TGLA 4W1QA 2QT9A 2AJLI 2Z5GA 5A71A 2OXEA 2ONCA 3KDAA 5BV7A 3IUJA 3VXKA 7YASA 2O7RA 1C7JA 2XMGA 2YYSA 3WZMA 1MNAA 3E1GA 1YAHA 4EHBA 1EDEA 4X7BA 1ZD2P 3STTA 1R9MA 1DINA 2PSEA 4U2DA 2GBIA 2WJ3A 1LBSA 3F9CA 4UBLA 4U2CA 3GROA 3JYHA 1GKKA 1U2EA 1IUNA 5F4ZA 1MJ5A 5AI6A 4H7KA 3KXPA 2H9YA 1EX9A 1XLVA 1W6RA 2VAXA 2ZJ7A 4P9NA 2JGIA 4EY7A 3D59A 1MX5A 4X91A 3SK0A 1QIFA 3C6XA 1XZFA 1UXOA 4KAFA 1X2BA 5AKEA 5FDFA 1XZGA 4HXEB 1VKHA 5YASA 4NZZA 3QMMA 2QMQA 2XUJA 3F96A 3EQ7A 5ESRA 3OM8A 2OCIA 4F60A 3WKEA 4YX9A 3T4UA 3QMVA 3U1TA 3VISA 2XMZA 4W1SA 3HC7A 4CCYA 4EZIA 4PSCA 2RIPA 1ACLA 5DNUA 2E3JA 4C4YA 4H7EA 3UMJA 5DYTA 4TVKA 4E46A 3LCRA 3G9UA 1O6FA 2C0PA 4RPCA 1EVEA 5JAHA 1BEEA 2ZYSA 1QIGA 1SCIA 1MU0A 2D0DA 4KYVA 1WB4A 4DNFA 3C70A 4INZA 4Q3OA 4KEAA 1NX9A 5AOBA 2OCGA 3DQZA 4Y2JA 2AJCA 5ALOA 3C6BA 3DKRA 2RHTA 5K5EA 5KWIA 3TJMA 1EVQA 1MX9A 1XQVA 4ETWA 1EB8A 5IVHA 4Y2PA 3A2NA 1QIDA 4KE9A 1F0NA 4ZI5A 2GYVA 4HRYA 3O4GA 4UHBA 3NOXA 4BP8A 2OPHA 4OYLA 4GW3A 4BDSA 4Y2QA 4DNPA 2XB6A 1MNQA 4DYHA 5BWBA 2CB9A 1QGED 3W06A 3BJRA 1XZBA 1BEZA 1DX4A 1R1DA 3JW8A 3A6ZA 5BWCA 4IH1A 2RONA 4KACA 2PKYX 3G0GA 2RI6A 1E89A 2B20A 2CKMA 2BUCA 4FTWA 5ISMA 4KE8A 3E4DA 3BF8A 4WDQA 4CG1A 5JALA 3D2AA 2J4CA 2RGUA 1RYYA 4F5ZA 1BN6A 5DWDA 3OURA 1EB9A 3GELA 4AMZA 1VE7A 5J3JA 1XZIA 2WIJA 1DQYA 1H22A 1C7IA 4HAIA 1XKTA 2Z3WA 4FFWA 3H2HA 2XUOA 1S8OA 2IX9A 2ZSIA 5HFNA 1T4MA 3QPCA 1B41A 4L72A 3V1KA 1ZI6A 4C01A 1VJ5A 2ES4A 1YSCA 2XMSA 4FFVA 3C87A 2X8BA 3DL7A 2ZYHA 4MEBA 3I2IA 5ALNA 3BE8A 3DOHA 5EIHA 3IDAA 2QUAA 4DMHA 4DIUA 4E15A 1CUBA 1L7RA 1T2NA 3H2KA 1UK9A 4KAJA 1EDBA 3DYVA 4PSUA 3FLBA 1CUGA 2WLSA 4BB0A 1E8MA 2V97A 1Q0RA 1R4ZA 3PUHA 4BAUA 1VXOA 4EBBA 5C8XA 1QTRA 4J0CA 3STYA 3LLCA 4AZ0A 2YXPX 1XZKA 3SWWA 2H7XA 1L7QA 2WUEA 2WG1A 5AKIA 2WUDA 3I2FA 5HCUA 5LKRA 1G5FA 1N8SA 3DYIA 3WYNA 2X5XA 1XKLA 4I4CA 4UBOA 3ILSA 2ECFA 4QA9A 3STXA 5AI5A 3FSGD 4S0XA 1D07A 1LLFA 4PF1A 5JYCA 5AM2A 5D3KA 2VJCA 1QO9A 1PFQA 2GYUA 1UOPA 2ACEA 1Q84A 2WTNA 1XZDA 1UKCA 5HK9A 1H2WA 2VA9A 2Y2VA 4GXNA 5ALHA 4ZXFA 1JKMA 4LYEA 2QTBA 1CUJA 1SOMA 3E3AA 5AKLA 1W75A 2QKYA 1FFDA 2WIKA 3FWHA 4J0KA 2BCEA 1DT5A 3G02A 4BE4A 5DYYA 4X6XA 4X00A 3FCXA 1JMYA 4N8DA 4B80A 2WU3A 1EINA 3PI6A 2ORYA 1GT6A 5IH7A 1DWQA 2WIGA 4DNOA 4J0GA 5AKXA 1ZD4A 3HXKA 2XUKA 3DD5A 4PV7A 5T4FA 1JU3A 1QO7A 3HSSA 2HU5A 1N1MA 2EDCA 3F97A 4AXBA 4DMCA 5CH5A 3KD2A 5E2IA 5HKBA 3ICWA 5ALVA 4LXHA 4Y2YA 3R3ZA 4BVJA 4GDMA 4W1PA 4Y2TA 2H7CA 3BL8A 5ALLA 5ALTA 3IB3A 1XQXA 2JGFA 4L9AA 3TRDA 1GQSA 4C87A 2XI4A 1TCBA 3VDXA 3MUOA 4YPVA 5CT9A 5FKJA 2XUPA 4UBMA 2GZRA 3G8YA 3WKDA 4GLBA 2OGTA 1XZMA 4BRSA 5CH3A 3HABA 4QLAA 4N5IX 1YASA 4Q05A 4G4IA 5CW2A 2WG0A 1MAHA 2WSLA 1H23A 4J3JA 3Q8WA 1WHSA 2JF0A 4MYSA 5A7GA 3AJAA 4A23A 3ZLTA 3I1IA 5LZ9A 2VJAA 1GPLA 2OGZA 1GXSA 2CEKA 1G42A 1PJAA 3FOBA 3I1YA 4QLOA 4UBKA 2IIVA 5SYMA 2HL6A 2QR5A 5HKAA 2WQZA 1ETHA 1BCRA 1VXRA 1KEZA 4DM7A 2X76A 1XQYA 4AN0A 3DCNA 2PVSA 1A8QA 1Y7IA 2V96A 4CIAA 2V9ZA 4C6HA 1CUDA 3WWEA 1LZKA 3I6ZA 2WU4A 1CUIA 1ZICA 4LYDA 1ZD5A 1VOTA 2PUJA 4UFPA 5LZ4A 4Y2XA 2XLBA 1F0PA 2JEZA 1CV2A 1QE3A 1CEXA 4ZRDA 3BIXA 4BBZA 5CBKA 5AKHA 4UFNA 1CUWA 5ALFA 5JIBA 2CJPA 1MX1A 1ZI9A 1XRPA 3HI4A 1LNSA 1FSSA 2VSQA 1YB6A 2XUFA 4GEGA 1BU8A 2I3ZA 4K2AA 3WYDA 2QXUA 3GFFA 4HZGA 5ALWA 4GBGA 1EHYA 4AZ3A 3WA6A 3R3XA 4OB8A 3G9XA 1IZ8A 1UZAA 3AZQA 4WFIA 5K3AA 4X90A 3O9VA 5AIAA 1WB5A 5CT8A 5JD4A 4FMPA 1XZAA 3E0XA 5AKZA 4QWWA 5AOAA 1JI3A 5A2GA 1EK1A 2JGJA 2XUAA 3KWFA 1OXMA 4YK7A 3WIOA 2ZYIA 5LIPA 5LZ7A 2Z3ZA 4GECA 1BROA 2CZQA 3R3WA 1ODTC 4HXGA 1EI9A 1QLWA 5IVKA 2HFKA 3D2CA 4RGYA 1J06A 2HADA 3QZUA 3WWDA 3HRHA 1XRQA 3IBTA 2OAEA 2WFLB 4UHEA 1USWA 5SYNA 5AI9A 4GI1A 2ZYRA 4N8SA 4DSAA 4BCBA 4E11A 2FX5A 2PX6A 3C8HA 3LS2A 2Y6VA 4NVRA 3WL7A 2PL5A 2WHQA 4ZWNA 1YA4A 1LPBB 3CCCA 4HVTA 3KSRA 1GKLA 1ZIXA 3DNMA 3P2MA 1MPXA 3VJKA 3M3DA 4BTLA 4BC1A 5A7HA 1MN6A 2DQZA 5FP0A 3WKAA 2H7YA 3L1IA 1DU4A 3D5EA 4X85A 5AM3A 4LXIA 3G9ZA 4E14A 1LBTA 2WFLA 4G8CA 3OPMA 5CXUA 1HBJA 5AIBA 3FLEA 4DGQA 3EQ9A 2OQVA 1XLWA 3RKSA 4B6GA 2PSHA 4G8BA 4LIPD 1FJ2A 4EA6A 4PW0A 5CTAA 2ZJ6A 4UFOA 4B81A 4P08A 2XLCA 1W76A 1E66A 5JD6A 1AZWA 3EIOA 1EDDA 4WFKA 3STWA 1QIJA 4EB0A 1X2EA 3FCYA 2PUHA 4EY8A 1IUPA 1AGYA 1P0MA 2HA3A 3OOSA 3DDUA 2BFNA 4BC0A 4QZVA 3G0CA 1ZD3A 1B6GA 2VJBA 4EY4A 2XQFA 1CLEA 1AX9A 4WY5A 1ISPA 3B12A 1LPPA 4MJ3A 2DQYA 2PSFA 1XFDA 4PO3X 1U8EA 2WHPB 2ACKA 2Z8ZA 3WK7A 3IVMA 3ZV7A 2W22A 1HDEA 2XQJA 3DL4A 2CBGA 2NW6A 4DTCA 2R11A 2WKWA 1CQZA 2OLEA 1ODSA 2OCKA 1UWCA 3I28A 5ALIA 3IULA 3DKKA 1WPRA 4LKOA 2FJ0A 3W9BA 5E4TA 5AJHA 3R41A 1IVYA 4WFJA 4Z49A 1K8QA 1MAAA 1SC9A 3ZI7A 2B4KA 2DR0A 4UUQA 1K63A 1TAHA 1QIIA 4U2GA 4KAAA 4WY8A 3ED1A 2JGMA 4A5SA 3ZLVA 2XQGA 2K2QB 4FLEA 4QDOA 1EA5A 1LZLA 2OG1A 2WM2A 2C58A 4WCVA 5IVDA 3WWPA 4J7AA 5A6VA 1P0PA 3D0KA 4ROTA 3HACA 1BN7A 2XQIA 3I2GA 4XWGA 1YCDA 3L1HA 4KE7A 3F98A 4U2EA 1QJ4A 3LIPA 1BCSA 5LZ5A 3AFIA 2LIPA 4ITVA 1CQWA 1QIMA 2XMBA 3C45A 5EIAA 5K3FB 5JAOA 3L1JA 2HRRA 1E3QA 5LKAA 3WMRA 3VVLA 1J07A 3G7NA 1UK6A 1L7AA 1CFJA 2GYWA 1WM1A 2RHWA 5CURA 4YASA 1HKHA 4OD0A 3O4HA 1XLUA 5LZ8A 2HHAA 2PSJA 5LP1A 3W9UA 4EUSA 2B9VA 4L0CA 4BCCA 5HQ3B 3O4IA 3GZJA 4CFSA 4G5XA 2BAGA 4UHFA 1P0QA 4KRXA 5LZ2A 2QVBA 4NS4A 4HRXA 4PQEA 3WK4A 1Y7HA 3RLIA 4C4ZA 3O95A 4OSEA 3G0BA 2G5PA 1Q83A 3C5VA 1GQRA 5AK4A 3F67A 3QMWA 4MXDA 5IVIA 1W4LA 4U2BA 3BDIA 1CRLA 2XUIA 5C81A 2GZSA 1CUYA 1CPYA 4G4GA 3FNBA 2XE4A 2WHRA 2J3QA 5FOQA 4ARAA 3WJ1A 3H17A 5JANA 4X6UA 5HQ3A 4Y2SA 2FJPA 5I7UA 1BE0A 4G1FA 5AHXA 1W1IA 3MVEA 2I78A 1XQWA 4TPKA 4X92A 1CUHA 5K3CA 3I2JA 5HK8A 5AO9A 1H2ZA 4HXFB 3ANSA 1TCCA 3C8DA 1TRHA 3YASA 1DX6A 4PSDA 3HJUA 5JZ9A 4C4XA 1A8SA 1QOZA 4FNGA 2YH2A 3ESCA 3ESBA 4X94A 4M0MA 4B7ZA 3C6ZA 3QPDA 4JYMA 3BDVA 3QH4A 3CXUA 4H7JA 5C8VA 2BGNA 4K5QA 5EHNA 1YB7A 2J3DA 5AM5A 4PNZA 1U65A 5EHZA 5ALQA 3D2BA 2XQKA 1SCKA 3WL6A 2GBGA 1ZOIA 1I6WA 1AQLA 4OU4A 3KOOA 1TQHA 2HA6A 3R3UA 1GPKA 2DCMA 2EEPA 3JWEA 2HA2A 4BVKA 1AC5A 5D7BA 3H1BA 1LGYA 1MT3A 3VVMA 4OB7A 5FRDA 3B3QA 5DYWA 2BUBA 3WZLA 1J1IA 4Y2UA 2HIHA 1HL7A 5AI0A 2AJBA 5T4HA 2WFZA 1ODCA 3N0TA 2HM7A 3AUKA 2YASA 5T4EA 1JMKC 5DTIA 2EDAA 3IURA 5AM0A 2QXTA 4RNCA 1LPSA 4QNNA 3D3NA 3T52A 4X6YA 3TGLA 4IO0A 4NMWA 2O2GA 3K2IA 3K6KA 3ZWQA 4CIBA 1XRMA 3FYUC 1AUOA 1XRRA 4Y2VA 4D9JA 3WLAA 1CUUA 3B5EA 4XIIA 4RE5A 3STVA 5AI8A 4AO6A 4AO8A 5AK5A 4FHZA 3I2HA 1H2YA 2V98A 1TIBA 1A8UA 5AKYA 1JJIA 3WWCA 3BXPA 1AURA 1LPAB 2WUFA 4G9GA 2CMFA 3C43A 5AM4A 3PICA 3G0DA 5ALJA 3O9MA 2ZSHA 1F6WA 3ESDA 3VJMA 1CUVA 2JGKA 3V1NA 2OQIA 1QFMA 1XZJA 4J03A 4H18A 3RARA 4J0HA 4OB6A 5A7FA 1LPNA 5JD5A 4MQMA 2WUGA 4Q34A 3CCBA 1MO2A 4K6KA 3MGAA 2XT0A 1ZI8A 5AOCA 1LPMA 1JT2A 3Q0TA 4FBLA 2O7VA 1JU4A 2QJWA 5AK3A 4BYMA 1OCEA 5DLPA 2B61A 4B84A 1VA5A 1IUOA 4FNMA 1N5MA 1RP1A 1UK7A 3A2MA 4LXGA 1WPXA 4UHDA 2XMRA 3BWXA 4ZV7A 5JADA 2VJDA 2Y6UA 1CUXA 3R3VA 5C8ZA 2ROQA 5HF5A 4W63A 4IHAA 4X3CA 1XRNA 3O0DA 5EFZA 5EHQA 1WOMA 3N2ZB 1H2XA 1UKBA 2WIFA 3WK5A 5CT4A 1TK3A 3FYTA 4J0IA 3ANTA 2WIDA 1QONA 2VTVA 1WCYA 4G4JA 1N5RA 1K4YA 4AMYA 1Q0ZA 4KR0A 2VATA 3IIIA 5ALYA 1SCQA 3AZPA 5D6OA 3H2IA 4JNCA 1FFBA 3W04A 3F8SA 5H3HA 4K6GA 3WQHA 3FLAA 3C6YA 5D3ZA 3H18A 3W2TA 4BATA 3WL8A 1HQDA 5AK6A 2C7BA 4L3WA 3W05A 2I03A 2BGRA 2OAGA 1JFRA 3FAKA 5E4JA 3VJLA 4C88A 5JAPA 4Y9SA 5I8PA 1K6EA 2PPLA 1DT3A 4CCYB 3PF8A 1IZ7A 2H1IA 4H7IA 5EHXA 3D7RA 5EGNA 1ORVA 1J2EA 2VF2A 4P92A 1XRLA 4OPMA 5ALGA 3GBSA 2XUQA 2JIDA 1CUFA 2QJRA 3AZOA 4QDTA 2PU5A 1CUSA 2VAVA 1YS1X 3IUNA 3X3HA 4OCZA 2XMDA 3I2KA 5AKGA 4H0CA 2UZ0A 4UBNA 3QM1A 5JARA 5JAUA 2PM8A 4AQDA 3V1MA 3O4JA 4ZGBA 3QBJA 4EY5A 4BAZA 4W9RA 1QIKA 1W52X 2QS9A 2DHCA 3TEJA 5KBYA 2J4FA 2XUHA 4KJXA 3V1LA 2PU7A 3V9AA 4A16A 4JEIA 5FXMA 3WI7A 3QITA 3HZOA 2JBWA 4AN1A 4CCWA 3ICVA 2XUGA 3ZLUA 5HF9A 2DFPA 2OGSA 5FV4A 1UKAA 4ZREA 4H35A 4B9EA 4B85A 1ZGCA 1U4NA 1TCAA 2Q0XA 5AI4A 3PFCA 3DLTA 2Y1KA 4MWSA 1WB6A 1CR6A 4I19A 4CI9A 4HTAA 4BZWA 5K3DA 4XJVA 1HLGA 3EQ8A 4HS9A 5KWJA 1TKRA 3IUMA 3A70A 3DEAA 5CT5A 3AIKA 4KRYA 4MYDA 4JH0A 4UBJA 1QFSA 4N5HX 4FOLA 2P8SA 2HA7A 1YA8A 2CUTA 3IA2A 2XMCA 5ALXA 4CG3A 3FSGA 5HF6A 4QDZA 2XUDA 1CUEA 3H1AA 4QWMA 1GPNA 1VLQA 2WHPA 1JJBA 4Q1VA 1GGVA 1M33A 1UFOA 2ZVDA 1XZCA 5FPQA 4OU5A 3NWOA 3H19A 2HDWA 5FUMA 1YR2A 1A88A 2VT7A 3LP5A 3UUEA 3SC2A 3DJYA 1PV1A 3HLKA 4GHWA 5HFAA 1QIHA 3R0VA 3MUNA 4ARBA 3LIIA 5ALUA 1CUAA 4MWTA 1DWOA 4BE9A 3GA7A 2C5GA 4MEAA 5DNVA 4P93A 2DHEA 4IH9A 1DTEA 5EI5A 1EXWA 5JZBA 1A7UA 2WG2A 4BRZA 4BP9A 4M0FA 2HA0A 1KU0A 3FVRA 5ALKA 5JATA 5JZSA 2QOEA 3AINA 3HEAA 3WA7A 2JGEA 4BAGA 4B9AA 4BDTA 2C4HA 3WWOA 3QPAA 4AX4A 1CIJA 5AKKA 4BTVA
chains in the Genus database with same CATH superfamily
3K0SA 2HT1A 5INTA 3KX2A 3QHAA 1W0CA 4MIKA 1LQ2A 2TYSB 2O8BA 3BSYA 3U4QA 4UUOA 1ZGBA 1KQ3A 2ZSEA 2F9LA 3M6VA 1LX6A 4KUHA 4UNQA 4V0OA 5D2CA 4EHNA 5C9ZA 3EFOB 4OJMX 4Z9YA 2O9JA 3NHLA 4UAGA 3R9KA 2RK3A 3ZDDA 4IG9A 4PBTA 4TXHA 3OUTA 1Z47A 1AZLA 1ACJA 3GA0A 1M0TA 3SICE 3VAYA 3W5IA 2C0CA 4TM7A 5BSFA 4N0EA 1V6CA 3AUYA 4PO1A 3IV6A 4G0ZA 4O4LB 3G1UA 1ZIOA 4FX5A 4F11A 3SPXA 4ZKDA 2Z8XA 6LDHA 2VP3A 5K3FA 2P2DA 2P9BA 4Y2RA 1DAFA 4TYYA 1A4RA 5J58A 3ZQJA 4GWLA 1N4AA 4PYRA 2XNDA 4EY6A 3GXOA 2ZRQA 3H2JA 3I83A 2JC3A 4RA6B 2H48A 3QI7A 4QUJA 1L5MA 1FYEA 1Q7TA 4QDXA 2FB9A 1GY8A 2EJWA 3DH0A 3RJZA 5A3RA 3O90A 1NLYA 1P2DA 1FYVA 2IP4A 2XE8A 3GRAA 3LXXA 2HD4A 1FP6A 5K3BA 1DHRA 2VNKA 3ZNNA 3FMFA 3MG9A 3EPHA 1G6HA 2EGHA 1IN1A 2PYZA 4P7KA 1C30B 2C5LA 3KB2A 2AX3A 2EFGA 5CMLA 4YBZA 5FUBA 3WK8A 3Q7EA 4FW9A 2Q3EA 4X95A 5JQWA 5JSUA 2VK1A 1DADA 1W2GA 1NUHA 2QW8A 2CL5A 2Q4EA 1GARA 2ZWOA 2YNMD 3M9XA 3QBEA 2N1BA 1IQ0A 3EPKA 1FFHA 4IG4A 2MOKA 3TYXA 1N92A 2M6LA 3T9EA 1UZLA 1O57A 3ZX4A 2D13A 2GZ1A 2C20A 4UHJA 4IPTA 3RC9A 3RVNA 4BQRA 5I8WA 5KTYA 1IBMB 1X9HA 3EFOA 2H1RA 5BYKA 3OZUA 3IAFA 5KYXB 1NBHA 2CVZA 4J0JA 4BCDA 2Q8PA 2II6A 3K3PA 1OZAA 3O8RA 3FYUB 1HKUA 2YC4C 2YN0A 3DWEX 4JASB 3JALB 4MPPA 2VHTA 3C3YA 3ZDAA 2H4FA 1TLLA 2O2IA 2B5OA 4DJFC 1JHYA 1W85A 5FTNA 4FC7A 1TEXA 3CNHA 1GILA 3LHDA 4PCLA 2ORIA 5EWMA 1O4WA 3N6XA 3P2KA 4NHOA 2HV8A 2DSNA 2PR7A 3B2EA 4XGRA 4Y9UA 2FNAA 3SQNA 1PJZA 3A11A 1FSPA 4Q9JA 4RA6A 4IDDA 4QJBA 4EGQA 1BWSA 4I50A 1G7RA 4JI0B 1SVKA 2VZLA 2QF7A 5CJ2A 4NAHA 1NL3A 5TDHA 3UUFA 3V32A 1T6BY 2CCJA 3RM3A 2G0TA 1YKGA 3H04A 2ZRHA 1POXA 1AMNA 1RJWA 3VYUB 5L7WA 2HPHA 2R8EA 3PDJA 4R7TA 8AT1A 2PZLA 3AXSA 4U7FA 5LYJF 2A4KA 1PSWA 1ZG3A 1BRMA 3KR9A 2EKQA 4BZZA 3CVJA 3HHPA 1L7MA 2RJOA 3VVBA 4G9EA 2CNWD 4ABYA 3IEXA 1MC1A 1NE7A 4U2FA 4OJNA 4U5XA 2GMWA 5KOIA 1ILEA 1NVAA 5ESDA 4K9KA 3VO9A 1X6VA 1Y37A 1U5BB 4GM0A 5JXWA 4MX8A 3T3IA 4BP3A 4EMTA 2IE8A 1ORWA 1JMVA 2IU4A 1RWQA 2IWHA 4E21A 3GK3A 3BHMA 1CJMA 5K3SA 5A5VA 2G25A 3I5UA 7ADHA 1RYFA 3SQMA 3T5CA 3OKFA 1AB6A 3NDJA 4FT2A 4F21A 5IXYA 4F0JA 4GXQA 1MB4A 4NEQA 3FYUA 1RQXA 4HDSA 5BN4A 1T5IA 3JALA 1SC1A 3VPGA 4KQCA 3COPA 3I9NA 3MIZA 1SBCA 3M81A 3VBEA 4RANA 3AJDA 4MPTA 3W77A 3WGNA 3ZLBA 2PUAA 3CISA 2JHGA 3ZWOA 3TSCA 5G1PA 1JJFA 2NG1A 1NZJA 1EWKA 4ENSA 5C5CA 4DV1B 1ZH2A 3IP5A 4TMZA 3UJHA 1T8SA 2XEDA 3TOXA 1EX7A 4BO3A 5KVCA 4Y6RA 3V8MA 1G0NA 5BYJA 2F3QA 2QY9A 3H4TA 5AK0A 1HMPA 3M6MD 3S8YA 5CVJA 4WFQA 4JN6B 2NO5A 2Q49A 2FEAA 1RNLA 2FMKA 1R9NA 1A2OA 4QBIA 4JJ7A 4WKCA 3V1TC 1VZ3A 2QDKA 4BQQA 4E4RA 1KTIA 1WMDA 1TVKB 3QFRA 3WLQA 4JYAB 1JQDA 4RTMA 1CQXA 3OTWA 2BF7A 2HEIA 1AF7A 3BF7A 3GLHB 5BOVA 1EFPB 1SVOA 1XJQA 4Q6WA 1S2MA 3KTAA 4JP3A 4X1OA 5D1HA 4MS3B 2X41A 3OZGA 3WQRA 4CF3A 1GPDG 1UODA 1U3UA 2QYTA 3DFMA 2HTEA 3N7AA 5HIMA 1I3NA 2A8YA 3HDHA 1UOOA 4KVZA 1U5BA 5CFRA 1UMCA 4XASA 3NGMA 3IAUA 1M1UA 2X0FA 4OJKA 2JH8A 2VPIA 4NJOA 1WDKA 5FFNA 1WVGA 1UIRA 2NYAA 1C0PA 1H2AS 2AE2A 2Z95A 3C1TA 1OJ7A 1ZJ4A 2EX4A 3IPAA 5CRIA 4HGZA 2FPXA 5K2MA 3M82A 1ZCBA 2JJ2A 4O6VA 4AROA 1O0BA 2D5LA 5F1PA 2R5WA 2GBFA 4EMSA 3AIMA 4KN5A 2Q2WA 4EF5A 3FJYA 1WNTA 3H1FA 5KDDA 1J9EA 4UE3S 1XR3A 1A5BB 4URYR 1N6HA 3FNHA 4BVBA 4DLPA 5KJCA 3VPXA 4KSYA 3A58B 3NHBA 5KWEA 1DC5A 1LCIA 2E1PA 3CR7A 1VI2A 4JLJA 4BNDB 4D8TA 3UT5B 5HE8A 2O0HA 2FZ5A 1P7VA 4RZHA 1R4AA 1GZ7A 1TQ4A 5E6UB 3E7WA 4BEBA 3QQPA 1MR3F 3GW8A 1WG8A 3X1MA 2OKGA 2Q0HA 3CW8X 3GVIA 4IIYA 1FP1D 3CR3C 3D1VA 1RU3A 1XROA 4R1QA 4Q7JB 3ZU5A 3R75A 1DC4A 2XVZA 1QTIA 4FBMA 2W2NA 2AEFA 1KVRA 3L7JA 2OOKA 2A5LA 3GLHA 4V2IA 1EFPA 4DL9A 4BKMA 3VDRA 1EYZA 4JBIA 1KO5A 3LPAA 1O03A 1PNOA 4KQMA 2ZT6A 3INNA 4EEXA 4PFKA 4K0KB 4MVJP 3P52A 1V3TA 2RI0A 1KGSA 2XH8A 2MT9A 1K3UB 2WJ6A 1FXSA 2N42A 1GZ4A 4H9GA 5DNWA 2VO1A 5FT9A 3ULKA 3S1SA 2HW8A 1ZVVA 1O95D 2G4LA 3SX2A 1Y1QA 5CXXA 4DYDA 1ZJ6A 4B46A 1DOHA 4ODIA 4B71A 4HSGA 4J16C 4RDXA 4RS4A 1TMGE 4MVJH 5BYBA 1UCFA 4FLMA 3WK6A 1N1DA 2AYYA 4D57A 4FHCA 4ECEA 2RSLA 1KYYA 2WSIA 1E94E 4LDRA 3CH5A 3QOYA 1RD4A 3B70A 2OPBA 1K5DA 2XKKA 2LCQA 1TNDA 4QJIA 5HNKA 3EPJA 2YUTA 2JEYA 1E0JA 1OAOA 4U1RA 1JPJA 1Y42X 3JARA 1WW8A 5AP9A 1QB7A 1BOFA 1XAGA 2H0AA 3LBNA 4JXJA 4BGEA 2P79A 4BNDA 1E7RA 3KPWA 2OZPA 3GNQA 1IQUA 3KSDO 3OH8A 2O2HA 4G8DA 4J1TC 4KH1A 5FWXB 3KLOA 4Y1GA 5FHRA 1ZH6A 3PUIA 1YBFA 2QUBA 3KSBC 2F8SA 3GWZA 3ADPA 3PA6A 3NBKA 3U7EB 5L53A 2AJDA 1QYIA 2GBLA 3H6HA 3OCJA 2X58A 2CLFB 1O6GA 1MOZA 3D81A 4WXRA 1E3TA 5EIBD 4TKMA 1RFLA 1H8ED 2ZI6A 2Y4NA 1PVOA 1MCZA 3S70A 1VE9A 1XCMA 3LC1O 5AMXA 5FBKA 1I3MA 4B3SB 3E27A 3GAAA 3K8YA 4NE7A 3NR2A 3OC6A 1UXIA 5F3RA 3PEVA 5ALSA 3W5BA 4ZYZA 1M2KA 2GRUA 1FY2A 4G41A 5DTJA 3VX4A 4ERXA 4QU5A 1GFIA 2CDRA 3GFSA 3EQ2A 3H13A 3O8OB 3L79A 3UMRA 5I47A 2HWYA 3TG2A 1KI4A 2X3FA 1FFAA 4LHVA 5HIAA 5I3CA 5JS1A 1R0ZA 4QTTB 2QN3A 3FN4A 3PVZA 1AMUA 4R1MA 4RZIA 4BO6A 2ZUEA 3RR2A 3EJ6A 4D8VA 4W99A 4AKSA 2OCXA 3DQQA 2QTLA 3H8VA 1I7PA 2QX4A 3UKOA 3VZSA 9LDTA 3FOEC 4AKGA 3FDZB 4K87A 2NTJA 2VCHA 3C7KA 4O63O 4UOQA 3ZV3A 1BS2A 3ZQ6A 4TROA 4F2HA 1QYXA 5J5VA 2ILTA 4XLTA 3TD2A 3JCZA 3OIVA 3T99A 1VCHA 3IUPA 4G1BA 2D54A 4FWBA 3IQIX 5EZ6B 3V1YA 4XVCA 4MQLA 4YJ3F 1P4AA 4RY9A 4MVCA 3AHCA 4GE0A 4NCJA 4DA0A 4JLUA 2GYYA 1YDGA 3AF5A 1GD1O 2PKWA 4JL8A 1OXSC 3L7AA 1ND6A 3SLRA 1VLMA 3TLEA 1Y80A 1RLUA 4XWKA 5AW3A 3RT1A 1GUFA 2BCJQ 2WFMA 1ZRHA 2OHIA 3CRQA 3QW2A 2XF8A 2REQB 2XYGA 4HBZA 4KQ6A 3UGTA 4YRSA 2K6GA 2G9UA 1NMSA 1Y63A 3GLFB 3LYAA 1FFYA 3HPRA 2NTYC 2AN1A 3ACBA 3N2GB 4ND1A 4NQRA 3P9KA 3ORRA 1JQLB 1RC1A 3WRVA 3RIXA 5U9CA 4XM2A 3T8YA 3WGGA 4I55F 4OMCA 5E4YA 5GJVC 4QTYA 1WBBA 2OV4A 2GEFA 2AQ8A 1G16A 1LDBA 2VH2A 1WCIB 2ATIA 2GHRA 3A26A 3O8OA 4K46A 4CF6A 4M55A 1XD9A 4HJRA 1IJEA 1DUVG 5JHGB 2IYTA 4KGVA 4WCFC 3KXKA 3I9OA 4RQAA 2BZSA 1UT6A 4UHHA 4AMVA 4B0PA 4DA7A 3DGFC 3MS7A 1FB5A 3CPEA 4DIBA 3RWOA 1Z4IA 5KKAA 2JIZA 3C15C 4BNXA 3UXEA 2P2CA 4AC9A 1M1ZA 2R1VB 1US8A 5JY6A 1YE8A 3D6MA 3DNFA 1C7JA 2GUGA 1RQGA 2R1ZA 3AUUA 3PPVA 5CYOA 1JV2B 2EWMA 1MNAA 3RBAA 5BSUA 3E1GA 1YAHA 3AQ4A 2BC9A 1I24A 2RAFA 4DJEC 3L43A 2ZRFA 2ZI4A 5AHRA 1K6JA 1G64A 1T4DA 2EZUA 3I04A 4FFOA 4X7BA 3WMWA 3PQ2A 4QSMA 4RORA 4CLXA 5AW0A 1IWOA 3ZWXA 3P2OA 1AJEA 1YRAA 4QNMA 3OTOB 3G5LA 3A0RB 3GCWA 1XNJA 3VO2A 1R8YA 4HN9A 3WG9A 1XTVA 1QG6A 1PK9A 3KK0A 3VR3A 2IBTA 3F9CA 5JJLA 3AMVA 2ZAYA 2VQFB 1VHDA 5T8KA 3JYHA 2DWUA 2QTWB 3ROTA 1U2EA 1IUNA 2FQQA 1KKUA 1Z0ZA 3OQVA 2V7PA 1GAJA 3BULA 4G01B 4MW5A 4OG2A 1TD9A 1QDLB 4OOEA 2EFDB 1N4DA 2AG8A 4AJIA 4IIVA 4BX8A 1Q6ZA 1WCIA 4HGNA 1C9EA 5AI6A 3JTEA 2PFSA 2EV9A 5HE9A 4GM1A 1GKIA 1T36B 2DM6A 1RAEA 4MULA 4F2PA 3CLTD 1W6RA 3F3KA 1TYBE 2ZJ7A 3C7TA 5B7NA 3FWNA 2DKNA 1Y9JA 2E5WA 2GEJA 3WMFA 3L4JA 1DTWA 4EY7A 2NO4A 1I4DD 2E89A 2NSDA 2Z2IA 2GJ8A 3CEPB 3G2PA 2Y68A 4YT4A 2Q62A 1W8DA 2I33A 1J0BA 2D7CA 3TQRA 1V8DA 1X2BA 4N65A 1Z82A 3BHJA 4NX2A 5DNAA 2QNRA 3GJSA 1NRJB 1K27A 2FLWA 3C3EA 5DTMA 3KP1A 5YASA 4LI0A 3NPAA 3QYPA 1MO6A 1KAHA 1NVKA 2CVPA 4PSVA 1PJ2A 2E6UX 4BVHA 3EQ7A 2ZB8A 5FHQA 2R7LA 5ESWA 3L07A 3OM8A 4UOZA 3EIHA 4HGYA 4B6OA 4F60A 2AW3A 3JTMA 4HGQA 4C22A 1L4LA 4YX9A 4QOFA 1UINA 3QMVA 1JR3E 2NXCA 1U90A 5IXSA 4KQIA 3U1TA 1ONNA 1HX7A 1E61A 1VGVA 4KDCA 1QPGA 1SUPA 3UJ3X 4WKNA 1KAMA 2XTNA 5DNEA 4LUCA 1K9SA 2GESA 5HZMA 2AHRA 3BFVA 1TZMA 4ZU1X 3WTCA 3SSMA 1ENOA 1OBVA 2GCOB 2PGXA 2YWHA 4GX1A 4MICA 4PSCA 1JN0A 4YWJA 1ACLA 1QP8A 3E7PA 2EWVA 2VUTA 1I2AA 3FKJA 1SUCA 4IV8A 2BGUA 3UEOA 3WZ2A 3UMJA 3H5TA 4AAYA 2XXBA 2VI5A 4UQPA 3U61B 1O6FA 4JHXA 2FN7A 5AJZA 2ZYGA 5L3QA 3UOWA 2C0PA 5AUNB 1PR5A 4LF6B 3GNLA 1DG9A 2Q5CA 1SBYA 3PC2A 2IBMA 2BDUA 4KFSA 1BEEA 4NBTA 3M70A 4RELA 3GFQA 1SQGA 3NKFA 8MHTA 1ETUA 3LWZA 4HB0A 4EPTA 1WB4A 1NR5A 1TT5B 1T8RA 3ADOA 3KQTA 3KV3O 1M66A 2P4QA 2FZEA 4J76A 4XYMA 4Q3OA 4INZA 4D8YA 5HUQA 4KEAA 3GJ6A 2AD5A 4G0XA 3M8KA 4HQKA 2PS0A 4UC0A 1CQJB 1Y6ZA 1P1CA 3HB1A 1N9ZA 4ZEOA 1JXMA 1LSUA 1VL8A 4IHJF 1RYHA 4RQUA 1XK7A 5JSFA 2FUEA 4Y2JA 5ALOA 1P9LA 4DJJA 1UQTA 3SCZA 3GI1A 1KJYA 4Q21A 3DKRA 2VF4X 4TZKA 3OZAA 1OH5A 3LAWA 2QMHA 4GQAA 9GPBA 4ZAWA 1U0BB 2AQIA 2YZ7A 2E0IA 4FUTA 3QNWA 4MWGA 4OQYA 4RF3A 5GM2A 1FMTA 3E8XA 4GOKA 4A0GA 4CIVA 4CEJA 5A4IS 5C7LO 1F7VA 5IVHA 3EIXA 1IJFA 1OX4A 4Y2PA 5HQJA 4HB2A 4GT1A 2R9VA 1XEAA 1WXDA 2XTAA 4TRNA 1RPAA 1PNRA 1NR7A 3OUZA 1OH6A 2ORVA 5TPZA 4GICA 2Z57A 4ZQIA 1F0NA 3UUWA 1X8XA 3QUSA 4LMAA 1GPH1 4DZZA 1M2EA 1RC0A 3CX6A 4C4AA 3L4KA 1MIOA 1QJCA 2ZTUA 3LW7A 1RSZA 3O4GA 4HRYA 4TQAA 3AB8A 3NT2A 3NOXA 3PV0A 1JDTA 3R0ZA 4IDFA 3MUEA 2OPHA 4IYRA 2WLTA 4KMSA 3SQOA 3WLJA 5CB4F 3W6UA 1R4MB 3QUTA 5L4SA 3HJAA 1IN6A 1QGED 4IVPA 2CB0A 4M89A 5LBTA 4PGHA 2VP5A 3C3KA 1T9BA 4N7BA 5EXPA 1BEZA 1E2BA 3UW1A 4RCZA 3HXQA 1MRSA 1BH6A 2I22A 3ST7A 4JVMA 1WX1A 3JQFC 3FROA 2XGJA 1CQJA 3KYCB 5K6AC 5KEIA 4HLDA 2FZVA 2LR0A 1V48A 2RONA 3G0GA 4IH1A 3IRVA 1LW7A 3MJRA 4O02B 4N7RA 4PVDA 3EXHC 4OO3A 2B8JA 1PN3A 1RHUA 2BUCA 1ORDA 4FTWA 3THRA 3JYOA 2WTUA 1PLLA 2JKVA 3E9ZA 2HWXA 5AFSA 3N2EA 3HDVA 1L4GA 4QYMA 4C7MA 4FD2A 2ZE7A 1EWQA 2FXIA 4RKYA 2V7EA 2VSXA 2PXHA 1ZJYA 1RYYA 1C4KA 4YV1A 3SEZA 1KP3A 2OWDA 1MDFA 4Z51A 1Y81A 2CUNA 4TYPA 2Y1GA 3GELA 3HKEB 1KZ4A 1Q1GA 4DEXA 4KXQA 3ZDFA 1KFEB 1EP3B 1N2SA 2CW5A 1M2JA 4RV9A 2VL7A 5KNCA 4LXXA 3W0LB 2H63A 1H22A 3DCIA 3MILA 4RMHA 1THMA 4QREA 4DCTA 4YUYA 1BH2A 4M8LA 3TOSA 1I4LD 2J0EA 4B17A 1GGHA 4M8KA 2BHSA 2Y9PB 3H2HA 4NG4A 5BW6B 2O2YA 5JVDF 4ZYYA 3IYLW 5B1YA 3P20A 4R83A 5HFNA 2GRAA 3M1IA 1OYYA 1R4MA 2IUEA 1VYHA 2J5XA 1ZI6A 4TLCA 3DMPA 4I81A 3DEZA 4WADA 5IC4A 3C87A 3CX4A 3EASA 4KO2S 3DL7A 1XHEA 1EP1B 3DV0A 4WOCA 2XE6A 2FQYA 4MEBA 4FN5A 4XQCA 2GEUA 2OY0A 3I2IA 3SHFA 4I4TF 4D9KA 1RRPA 4E3ZA 1CRQA 1IHOA 2JAHA 3JQCA 3IDAA 4Q6BA 2A7XA 1A3CA 1V16B 4S0ZA 2HLDD 2IKSA 4Q39A 4NV1A 4CTMA 1LBIA 1N5JA 3F0TA 1RS0A 3O6VA 4G09A 4L57A 5DOVA 3WRYA 1AD2A 1T6NA 2X9GA 5AHWA 4DIUA 1WPGA 1BMDA 1CUBA 1PG5A 4R1OA 3V97A 5FWYB 3SZGA 2VOJA 3H2KA 2YNMC 1QWOA 3B6EA 4ISCA 2FP3A 3BEDA 4JOCA 5EXTA 1CNEA 3I30X 4HDQB 3OEED 4D79A 3T5AA 3B78A 3DHNA 3HKEA 3EOZA 4P7JA 5FWNA 1CUGA 1QG4A 3STYA 3DP7A 4HH1A 4BB0A 3GDWA 4REOA 1GPYA 1J1ZA 1Q0RA 2YKGA 1NVTA 5KOHA 5FPYA 1LTQA 2WSSD 1UC4B 2G0AA 4D4IA 1CKEA 1QTRA 1A5ZA 1E4YA 2C8LA 2MSKA 3GPCA 4J0CA 1Q3TA 3LLCA 1VMKA 4RF2A 3TLZA 2C2HA 2YXPX 1UDAA 3SR0A 2ZIZA 3QLVA 4UAVA 1L5FA 2FPOA 1R5BA 2QYHA 2WUEA 3BTOA 3GT3A 3SYMA 4K28A 1KZ7B 2UZIR 5AW5A 5AKIA 4BFZA 3A3PA 2C7RA 1LFDB 3A1DA 1DBSA 1CF2O 2B6HA 5B4UA 2VHWA 2IYSA 4YT2A 3K0EA 1UBMS 3I2FA 2H5JA 1P0FA 3OM9A 5K8LA 2HUNA 3ZHUA 5LKRA 4O4LF 1XXLA 1Y1SA 1U8FO 4EG7A 1N8SA 1GU7A 3RIMA 3RS7A 3C98A 1EHIA 3WYNA 2OM6A 3KUUA 1R5NA 3GG9A 2C2YA 1MOPA 1XKLA 2I7CA 2Y71A 3KM0A 4J6FA 4JI6B 4BE7B 4LGVA 1ZOOA 5GTDA 3F73A 4UBOA 1AN9A 1V16A 3R4CA 3TWOA 4OHPA 2OILA 3VI3B 4HLNA 4IKEA 2HRCA 1P4SA 1OBCA 2J48A 2N0SA 2VWGA 3GRYA 3ILSA 4KLRA 3VC7A 4CHTA 2FEOA 5B2ZA 1ISMA 3S99A 2PCLA 5IX8A 4OXXA 4HO1X 3WBFA 1F2UB 1NXQA 2GK6A 2X7HA 4LOAA 1QQ7A 3TI7A 1PNQA 4AP9A 2IYYA 3QTTA 5FWYA 3DTVD 1JDBB 3OZ7A 3TXAA 3WMGA 5BUZA 3GUYA 4TWBA 3BH7A 3QKUA 3E3LA 1ZN2A 3N6VA 4X62B 2VJCA 3S0JA 1S2NA 3AB3A 5H68A 1M6NA 2OUKA 4LRWA 4R4JA 5AUOB 2P8JA 4TV9B 4C0KA 3ZVMA 4DLSA 2ACEA 3TRKA 1B6SA 2F1KA 4ND8B 4JJ8A 3IIMA 4HEA6 5I7EA 1XZDA 2DPYA 2ZUCA 3JV7A 1PS0A 3HXLA 1UKCA 3OE5A 4IV5A 1L5WA 3UG7A 2KLHA 4X64B 2OO7A 4B40A 5KJ6A 4BLRA 4YRGA 4Y0VA 5LU8A 3BDAA 5JWHA 3TTXA 2ZSDA 5KYWB 1JKMA 3NPMA 1GG5A 2IW3A 4J4BA 3ZHZA 4N40A 1XCJA 3O47A 4LYEA 1M2OA 2SKEA 2NO9A 5E9AA 4G0YA 2H5IA 3TAHA 2GF0A 1S3GA 1P73A 2DUWA 2QKYA 2QUIA 3DXYA 3MMPA 4FDLA 3T9AA 3FTPA 2I55A 3HA7A 5FAKA 1JHRA 1M83A 1X7XB 2ZBDA 3D3EA 4J0KA 4LYHA 1ZPDA 1BMQA 1TYAE 3HFSA 5KTPA 1FYDA 3NM6B 3FCXA 1JMYA 1OC4A 1P5ZB 1DELA 2YWGA 2WU3A 4EHFA 3NHRA 2VTBB 4PFJA 4P4LA 1Y8QB 4I5GA 3U3RA 4R8LA 3KALA 5LDDC 1P62B 4HAXA 4OI2A 2WIGA 4YB8A 3W78A 4CEIA 2ATVA 3QPBA 1KO4A 2V3WA 3HDJA 1T9GR 3HXKA 4MRMB 3T5TA 2I4IA 1SG0A 3C1OA 4OHBA 2IQ5A 2YJZA 4ZOEA 4ALJA 4PU0A 2G36A 1V5GA 1FJGB 5A9RA 2B35A 4ER7A 1Q74A 2EDCA 1M2HA 2PX8A 3L7LA 1H8HD 1UMKA 4X20A 1NJ8A 2DBYA 4FK8A 3ZUPA 2X6TA 4JR1A 4ZZ1A 3HQ4O 5JCJD 2H0RA 3RD5A 3KYJB 4FNOA 5KHOC 1RTTA 4TV9A 5DK6A 4B5KA 4WLFA 3UK2A 5CUQA 3I6QA 2P0AA 3LNTA 3PCTA 2ZROA 3OZSA 5BSRA 2X0NA 5EJGA 5DEIA 4UCWA 1MABB 2E48A 1P5RA 2GM3A 2R62A 1UR5A 2ZRIA 2H7CA 3BL8A 3R5KA 2ZBPA 1PWEA 3JY6A 3FJ1A 3GUVA 4HNGA 5EJFA 4TRMA 5BN3B 2B4YA 5ALTA 4TTJA 2JGFA 3HYRA 1COWA 1V0JA 1KS9A 2B8NA 2NV6A 4JIMA 4K7JA 3VR1A 4JIGA 3DE6X 4X8LA 4XQGA 4F8YA 5K2OA 1B93A 4LYGA 1ZO8A 2P6MA 4BFXA 4D3ZA 1S9DA 4Q15A 3ZE7A 1N7GA 2JARA 1RWWA 4ICIA 3VDXA 3NWEA 2ZYAA 1H65A 2OAP1 5AHOA 5TT1A 1ULSA 3A9SA 5CT9A 4C6TB 3GGCA 1Y1TA 2HBRA 2XUPA 3NDBB 2A84A 3R8XA 4MRMA 1J2TA 2GZRA 1E3SA 4RKRA 3DE5X 2WJGA 3R20A 5DSXA 3N2IA 4MHTA 4AKHA 4MOWA 4IFTA 2IU0A 3EDCA 3KOWA 4GLBA 2AZXA 2W0MA 2IKQA 3Q3VA 4H1UA 4LV5B 2CXNA 1O95C 1XZMA 2Z83A 3DZHA 2GXAA 1W34A 4ES6A 2QVGA 3EDYA 3B6MA 5CLQA 2ONKA 4RVGA 1FFWA 4N5IX 4QLAA 4TL7A 3E5RA 3R7WA 4Q05A 1AM4D 8ABPA 4EJ6A 4G4IA 5K3OA 2PIDA 5TGZA 1GDHA 2YJGA 4HR7A 1H05A 4YLYA 1DXYA 4TN1A 1MABA 4A2CA 2QROA 5K6TA 3JAMA 2C3OA 3CRRA 4B2YA 5KVVA 4EZBA 1L7OA 1QK3A 3LDFA 3ELYA 3W9YA 2IPLA 2OO5C 3R6GA 4URUR 3JVUA 3PRJA 5F77A 4UU8A 2JF0A 2RC6A 3J81k 4G1UC 2I4RA 1S1CA 1LWNA 4NNPA 4RTNA 3AJAA 4A23A 3OKCA 2WZDA 3PNVA 4I1PA 2AD1A 2QLFA 4UVIA 5KTMA 2PUBA 4KR6A 5KQLA 2ZJ3A 4HQLA 3WRXC 1Z13A 1I6KA 1XO1A 1GPLA 1TGVA 3I73A 3IE0A 1ZIPA 4RVDA 1RKXA 5I51A 4W5QA 3LYLA 1SKYB 1W88A 2CEKA 4MLZA 4JFAA 1PJAA 3O73A 4C6TA 2R8XA 2CXUA 4MYTA 2X15A 3GZ4A 5EMKA 4F4CA 5K8IA 2HL6A 2XYRA 1TLFA 3FUTA 5KTSA 1Q3KA 2EHJA 5CAEA 2IZOA 1ZRSA 3PD0A 3ELUA 2CFOA 2LXNA 5ECGC 1VXRA 5CEEA 4DM7A 1WUKS 4PZEA 1Z28A 2C82A 3FVWA 1HRKA 4LPKA 4W9NA 4XSVA 4UOEA 2F8LA 3DCNA 4MW9A 2J08A 5CG2A 4D0GA 4CIAA 2QE7D 2V9ZA 5A3QA 1TMOA 3K1AB 3WRWA 1FBNA 2CXOA 3E6AA 3T35A 4C6HA 7ABPA 3AI3A 3IAM6 1BO6A 4P0PB 3I6ZA 1EP2B 4IW3B 1L4YA 1VYUA 1ZGGA 3GP3A 3JQ7B 1NBIA 1AQNA 4DRXA 2CE7A 1V4BA 3W4JA 4ARZA 1CUIA 4AVYA 4DDVA 3BB3A 1R0RE 3RUDA 3W79A 5AJUA 4NKRA 5LBIA 2ATEA 2JRCA 2PUJA 2VUIB 2Q0QA 3HEBA 4XTRA 4UW9A 3UNXA 3WOHA 1S2DA 2GILA 2RG7A 2I5PO 4DN6A 1VSVA 2RHHA 1RAAA 3RS8A 4OK3A 5HIKA 1SZCA 4UEOA 5KU7A 4L6CA 3E9RA 1MA0A 4I66A 1DKRA 1VFNA 3EHEA 2OENG 1FVHA 4J75A 3UB3A 4JP8A 2UVPB 4AJKA 1ISSA 1E69A 1O96A 3BIXA 1KK2A 3KEOA 1UBSB 4AX8A 1M2FA 1SHLA 4UFNA 3H83A 1NWHA 1D6MA 2YJ4A 4UZSA 5ALFA 3JAKB 4FDAA 1JAHA 4M9ZA 3V7NA 1D4AA 3U7JA 3ZNQA 3OX2A 1EFRD 5B7PA 1BWQA 1HF3A 1C41A 2WA2A 3WXBA 1HE5A 5I7FA 4JT4A 2KJQA 3HY6A 5JH7B 1A82A 2HMWA 2AFVA 3CUUA 3UK0A 1X7DA 1FSSA 1UKVY 3W7BA 1YB6A 3NHAA 2O0JA 3GMTA 1G63A 4HEA1 4KX5A 4P7FA 1TQ8A 4F45A 1NNEA 1YTUA 3I5XA 1U2DC 3GFFA 2EHDA 2V6IA 1GDDA 3DE3X 3SEQA 5JSYA 1UBUS 4BTEA 4ESEA 1ZX1A 2ERYA 4ENUA 2HQOA 3K1AA 2HGZA 5ALWA 4EHAA 3BBPA 2M6RA 1FX1A 2CXHA 2ZTVA 4FIDA 4RTKA 3R3XA 2I6UA 3EZ6A 3G9XA 1IZ8A 3M5CA 1UZAA 3ZIAD 4WFIA 4PWYA 5K3AA 1SXGA 2FEXA 2O6HA 3NUQA 3L8CA 3QJGA 4IGKA 2P65A 1EAYA 5AIAA 5D6NA 3IDQA 4MR7A 4QVIA 1BMFD 1UDWA 1OYWA 4RHUA 1FDIA 1WXHA 2CFTA 3IKMB 2QTAA 2UYQA 5EE9A 4BN5A 1SD2A 4JI5B 3KWLA 3I9JA 4K9PA 3TIXB 3HYNA 4HRAA 1XAIA 1XZAA 1FQOA 2UVPA 3E0XA 5A4DA 1RI3A 1N6IA 4S1WA 4U9HS 4BASA 5A2GA 5LJLA 2UZAA 4GOXA 2PQ2A 3FVQA 2ZSBA 4MLDA 2J45A 4Y0NA 2FDCA 1EK1A 3JAKA 1RRVA 2XA1A 2XUAA 3KWFA 3NMUF 3CRW1 3AESB 3GP5A 2E4XA 3KOUA 4GXRA 4IDCA 2I1QA 3P96A 4PE5B 3LC0A 3OOEA 3L6CA 3RABA 3WIOA 5JAZA 1HNZB 4S12A 5LIPA 2XYPA 4C0AC 5F51A 4AU1A 5LZ7A 5BR8B 3C3PA 1T91A 2Q4DA 1H4VB 3CZRA 3R5TA 3TIIA 1V4VA 2WAXA 3K09C 4L85A 4Y1RB 4BUCA 4BGDA 4ZAXA 4YMHA 4ZVSA 4Q37A 4Q02A 3ZBUA 1HOXA 3A6EA 3RTDA 4EA8A 3IOEA 5EHIA 5GONB 1UIMA 5IVKA 2IXAA 1NQXA 4DCMA 2AF4C 3LL4A 1J49A 3CLTC 2QHXA 1YBVA 3F4BA 3UJ7A 3IOBA 3ZEAA 1JQKA 3NJRA 2XGOA 4Q9HA 1BOOA 1MEEA 4IDPA 4Q0MA 2FW9A 4LOLA 3FGOA 1WCXA 1BJKA 1NUAA 1SKQA 4RAOA 1QV6A 1KFKB 1AQ6A 1Z6TA 2PX4A 1RAHA 3QX7A 4JCCA 4KI7A 4DDHA 4A0RA 4B4UA 5K03A 1XRQA 3CONA 4QQ8A 4NZOA 3KZMA 1T2DA 1KPIA 3C97A 3PNPA 2IUTA 2QN1A 2YN2A 5SYNA 4AWAA 2G06A 1D1SA 4COOA 2OESA 5AI9A 2GETA 3E3NA 4C4PA 1II9A 5FTMA 3V8PA 3E48A 3L0CA 1ATIA 3MAJA 1VMAA 3PC6A 3DW3X 3S2GA 3PVSA 4E11A 1RM4A 1TZ2A 2OE2A 4TYQA 4RFVA 5KYUB 3W6NA 2P2GA 1QORA 2FX5A 3C8HA 4FCVA 2PK3A 3LS2A 2IP2A 4JEUA 4FQ8A 3Q7RA 3NVAA 5I9LA 2Y6VA 2EGUA 1MAVA 1PF7E 1QK4A 2XKJE 3D0RA 2QMYA 4UDOA 4RLQA 3AESA 1Y3BE 1NI5A 1LPBB 2BD0A 1X8KA 3JQBA 3KSRA 3NGXA 3PC8A 2C8VA 3GAMA 3R3SA 5B58T 5HWSA 3JWPA 2Q8NA 3QG1A 3EZXA 4F7DA 4AJHA 3IA7A 4JEMA 4LQDA 2ZPTX 1WS6A 3DNMA 4A0QA 4Y1RA 2PRYA 4EA7A 5HTKA 2J32A 2OOSA 1AUPA 4GR4A 3DCYA 4II7A 3M3DA 2FWJA 4ZD6A 2ZB7A 5FP0A 1A50B 3UAWA 3ILYA 5TQVA 3RUHA 3Q2KA 3WKAA 2H7YA 3DNPA 1DIRA 2HMYB 4V0ME 2FAXA 2IT1A 5TQJA 3E9QA 1KRWA 2BFDB 3K0CC 3REGA 1DRWA 3I4LA 4JZYA 1XA0A 1DXQA 4D9BA 4ZIRA 3GJ7A 1S3SA 2W8BB 2VYNA 3SXJA 4QTUB 3CBGA 4RJTA 4E14A 4P54A 4FZRA 1E4VA 3U60B 4TV8A 3AF3A 1XX6A 3HUDA 3OPMA 4KQXA 5A4KA 2V4ZA 1G0OA 4O4JB 2ID8A 1WXWA 1R10A 5FUVA 1Q7GA 4PZZA 1VPDA 4RJLA 1IRXA 1O77A 1FMFA 3DHVA 3EQ9A 3HVHA 3WAKA 3CEMA 1V7QA 2GD2A 2L19A 4G8BA 2NXWA 2H1VA 3PQDA 2LRHA 2QU7A 2QTZA 2XB9A 4KGZA 3X1DA 3B9QA 2R48A 4Z4GA 1D4OA 3GRCA 3U4IA 4PW0A 5A0FA 2ZCJA 2K5UA 3C6KA 5CTAA 3AVQA 1NQOA 3QBDA 3QOWA 1KDYA 5JY1A 4B81A 3I92A 3ZHXA 3KETA 3IAM1 5H4GA 1OLOA 2GF2A 1E66A 1T2UA 1U0LA 1V39A 4G0VA 3FTFA 4FONA 1JG1A 3ZCTA 2H07A 1ML4A 4HX5A 4HNVA 1ODKA 2P6UA 3CT4A 3P27A 3STWA 1JTFA 4KQGA 3FCYA 4ZC1A 2F3UA 3MF4A 4J1SA 5C8YA 2X9NA 3M9WA 5BR4A 3LH5A 4CDMA 4DC9A 4US1R 1EVLA 3LW8A 4RK1A 2BFDA 5LSAA 1P0MA 3OOSA 4LTMA 4P33A 1J9GA 2HHHB 1V43A 1K8ZB 2FOIA 2ZAGA 5EJ8A 2HAEA 2PZKA 2BGMA 2Y76A 2BOVA 2FSGA 3WB0A 4FEGA 1ANKA 2TECE 3MCTA 4P1ZA 5E3JA 5EUCA 1O5TA 3G0CA 3NO4A 3PCXA 4GZ3A 4IXMA 5T67A 1NBOA 1ZD3A 1BIFA 4LNAA 4X60A 1TPYA 3G88A 4O0LA 3O1HB 4N0QA 3ZCUA 1CEEA 1TD1A 3L93A 2XQFA 3UWDA 2O3UA 3E2PA 2D1QA 2J46A 3QVVA 4CMBA 3GYBA 2AK3A 1YUBA 3VGJA 1SM4A 3ZXUB 2P9YA 3G23A 4N4AA 2L42A 2VNAA 5K8JB 3GPBA 2J4DA 1D2HA 1W4ZA 1LPPA 5D3MA 2H2IA 1HDCA 3HKBA 3IEIA 3K9GA 3R6WA 4G67A 4PC6A 2PKRA 1Q11A 5GV7A 1ECGA 1P1FA 4MV4A 1Z4MA 4KPUA 1G3QA 1YQWA 1U8EA 3MGKA 1V5EA 1RJGA 4MWEA 5DI9A 4BXOA 5AWFC 4M9QA 3B1KA 2A9VA 2E87A 3OOJA 2CJWB 3JPYA 2ECOA 3DOJA 1U3WA 4I14A 4IJMA 3NBFA 4REQA 3OM0A 1QQTA 4Q48A 3CBQA 3TRFA 4GLOA 3GYGA 5AW2A 1KDVA 4YLGA 5JC1A 2X7JA 3DT9A 1NN0A 1FQWA 2VBGA 1BE6A 1PZMA 3FGPA 5J2TA 4OQZA 4UTZA 5EINA 3GVHA 3DZJA 1REQA 1Z3IX 3IVXA 4J9VA 5JDCA 1AGXA 1NN1A 2BMJA 1QFYA 4IL5A 2OLEA 2JLZA 5KIAA 2C99A 1L4FA 3BCSA 4D7AA 4M9UA 2UZ1B 4F85A 5KQGA 5GIPE 4JLPA 3B3AA 4B76A 1WPRA 4B3RB 4PVCA 4QYTA 3R0IA 5KO2A 1WETA 1X1QA 4KO1S 2P41A 4DQVA 2Z5FA 3LZDA 1IVYA 1K8QA 1NV9A 3NBMA 1RPJA 1SOVA 3NGLA 2G1AA 1MAAA 4FIZA 4FQ5A 4E88A 1KIMA 2RG1A 4RFSA 3PUWA 3PGKA 5CXSA 1L5RA 2DR0A 5L7TA 1ZRMA 1DBRA 1GUAA 1I80A 4UUQA 4MVJE 1I30A 4EO4A 1QIIA 3U7FB 4WY8A 1P3Y1 1E7MA 5KYWA 3EISA 1A9TA 4YAJA 4MGIR 5MN6A 1OAAA 3ED1A 2XWQA 3KT6A 1QU3A 2YWDA 1UUFA 2X8JA 4D0NA 2P6RA 2B94A 2YWJA 4Z9BA 4ZU6X 2SCUB 4AN4A 2BEKA 1ZCZA 3IB6A 3RV4A 2LKDA 2P6PA 3T9FA 2XQGA 2O1SA 3I23A 2OCAA 1ZXBA 3G6WA 3UHFA 5K8UA 2CJWA 2HXYA 3ACCA 1EA5A 1LZLA 4IDNA 3LZ6A 4LDJA 1QYWA 3KAJA 3O1LA 1E20A 2OT3B 1TVCA 1SZJG 3JWGA 4UPVA 5TE9A 2WWFA 3OFVA 2YV1A 3IT2A 1N5KA 2CN1A 3DZ8A 4PCVA 5H3LA 1VHJA 3N87A 3OFKA 4N7MA 3URMA 4ERNA 2G09A 1XYGA 1KBQA 3EUEA 2F4NA 3ONNA 4MA5A 4WA7A 1BN7A 3VU1A 1Z6XA 3QVSA 2XQIA 4RVUA 5BR7A 2NV0A 4OV6B 2IYZA 1RYZA 4XWGA 4C0BA 5JAQA 5C4MA 1IY9A 4B3DA 4R1TA 2VNSA 1Z0KA 3AFOA 3HXPA 1YCDA 1OGYA 1TJPB 2UZ1A 3L1HA 2GFQA 4GUDA 3B52X 4JLWA 4RIIA 5BPFA 4QRDA 2BE7A 3D4OA 4XGKA 1D4FA 2ADFA 4YPFA 4KREA 2CL6X 3RVSA 5TMEA 3CZCA 3R74A 1YB5A 2IVFA 4LDPA 2IU6A 5IG2A 4BO5A 2ZKLA 3SZ3A 3GUHA 2LIPA 3HJHA 4NBRA 1CQWA 4Z5XA 4NWIA 4IDGA 1Y9AA 1QF6A 1E6UA 3AEXA 5JXGA 3C45A 1XQ6A 1DC7A 1JF8A 3FPSA 1RHKA 1BYUA 1C1XB 3A0UA 4M1QA 3VO8A 1RXEA 5AVXA 2WWVD 3MCWA 2B21A 5JAOA 1WP4A 2WEKA 2IS1A 5L3SB 2HLHA 4ENTA 2DU8A 3ASUA 1JYSA 1DXOA 3LCMA 4JJAA 3NDPA 1ZHFA 1JLKA 4OHMA 5ECWA 5HMLA 2O8DB 1RYNA 2BGJA 1AGNA 3QEJA 4HAUA 5KPJA 1UK6A 1G2IA 2SCUA 2P9GA 4BLSA 2ZZNA 2G1JA 3UQYS 3LLVA 5EJMA 4C05A 1Y3FE 5IFLA 2HDOA 4WZ6A 2H8GA 4P81A 3DAPA 2OFPA 2G5CA 3WSTA 1UPTA 1WM1A 1AKTA 3N3BC 2RHWA 5DBGA 4EHHA 4R0MA 2XD9A 2JEOA 1R9JA 3L4BC 4L5JA 3SHQA 4CR7A 5B12A 1XRSB 4OD0A 3AF6A 3IVRA 3CB4A 4XR9A 3I58A 4EZEA 4KQ9A 4QDJA 2D6FA 1KZGB 1NNUA 4G0MA 1RP7A 4DCGA 4CEIB 2OBNA 5KVSA 2CSUA 2BGIA 4L8WB 4IVRA 1KF0A 4YA6A 5GMOA 4W82A 1J00A 3E81A 3W9UA 3G2KA 2PIAA 5GZ1A 3IQWA 5FL3A 2FFJA 3CSUA 5HQ3B 1KOJA 3O4IA 2BKAA 4TQGA 4Z53A 1ZN9A 4KXNA 3TKAA 1Z36A 4CFSA 4CYMA 1D5WA 1FLAA 1F3OA 2OFOA 5KVQA 2QRJA 1D2AA 3HVJA 5DT2A 3EIFA 3MBIA 2BAGA 1SUDA 4UHFA 4LHWA 1GRVA 5J5CA 3KFXA 5E0KB 5JJIA 2V8BA 1HDOA 4KRXA 1ZUWA 1WSWA 2IXDA 4LE2A 3U81A 3A9CA 4NS4A 3NHZA 3TQFA 2VKQA 3RV3A 2D0IA 3LGXA 4PQEA 5IJXA 3GY0A 5KINB 1U8TA 1YQEA 2PT6A 4Y6QA 4KR3A 5L3SA 3BD9A 5IZ4A 2P6OA 1VSQA 1YRLA 3OFND 4LS3A 4DPKA 1VP9A 4RIEA 1QPBA 3G0BA 5ICCA 4X7PA 2JVKA 2JKZA 3QVKA 1Q83A 4B5LA 4JV5B 3G82C 3EVBA 4GBMA 3ZY2A 4BMYA 3GEEA 2CFSA 5CLIA 3QMWA 3SYKA 1PVVA 3KQMA 4FYHA 4ER0A 1MJGA 4L74A 4PXSA 1MH9A 5C34B 5FR1A 1W4LA 3W2GA 1BU5A 1HM5A 5TVKA 1OIWA 1W8IA 5KNDD 1JX6A 4ARVA 1YQUA 3PJDA 2VTKA 4D4LA 1IK4A 1Q7EA 1V9LA 3R09A 3ZEIA 2CBZA 2GO1A 3P5SA 1QO0D 4BIMA 2ZTHA 5KX5A 4B79A 5GM1A 3FNBA 4HNRA 4D9CA 4ZAGA 4MR9B 5WRFA 2XXAA 1ZSNA 4ZO4A 3HU2A 3QBTA 5A1TA 5DH9A 3MQ2A 3F49S 4B3MB 3H17A 1IK6A 3IP7A 2RGEA 4TV9F 5JANA 3ND7A 5HQ3A 1PJ8A 1XNQB 5F2OA 3N5KA 3PNOA 2RH4A 2YHAA 4EABA 1KI9A 4OOFA 4JB8A 4TKVB 4WJKB 1BE0A 4R3NA 3DG9A 3CRVA 5AHXA 3TZCA 3EGXA 2WB4A 4I99A 4TWAA 1IN7A 3MVEA 4ABTA 1CF4A 2KB0A 2XNJA 3JQRA 2AFHB 4OQFA 4XIJA 3ANXA 4MV6A 4K1XA 4WV3A 3IHKA 3MW8A 5LB2A 1GGMA 1AIPA 1E6EA 2PQ6A 1EP9A 2BWJA 2PH5A 4QJ5A 5BWMA 5HK8A 1VJGA 2PJUA 4XB1A 5IF3A 1H2ZA 3DMHA 3ANSA 2ZBUA 2PS9A 4MVJI 4YRCA 3BCHA 1QC5B 1W93A 3M7IA 4FZ3A 4UMDA 4WL0A 4B44A 5DHTA 2FMHA 1KR2A 3HCBA 1QOZA 4IDEA 1PDOA 2W2XA 5E9WA 1PSDA 1Z0DA 3ESCA 4HFMA 2QIOA 3IKTA 4U63A 1QKKA 5JNTA 2D5IA 2PNFA 1OV6A 2CCKA 3QXJA 5EFOA 2CXTA 2JI6A 5AOVA 2DBQA 4YBRA 2DUUA 3IJRA 4DBLC 3CXUA 4H7JA 3TTWA 4F4IA 2J09A 3DDSA 3ZDEA 1G3UA 4KGDA 5ECDA 4ZJPA 2JGDB 3ENWA 4DMUB 1OIVA 1NUTA 2J3DA 4IQFA 4KFRA 4Q24A 4PNZA 1VE1A 5ELLA 2G9NA 4KVGA 3RSQA 4BV9A 5EHZA 4W5TA 4KZPA 3MXOA 1P1JA 3TTUA 1WUTA 3JZAA 1YNOA 3WYGA 4DHEA 4IEIA 3O8DA 3NBYC 4K26A 1A8HA 1E9AA 4IZ6A 2J0QA 2PRJA 5EKUA 3WL6A 2JD1A 3TG8A 1QGOA 1VP3A 1B0PA 2X4GA 1IBSA 1SKAA 4KBFA 4O4HF 5T3UA 2PGAA 3A9VA 1P3DA 3OCCA 2AFHA 2NQ2C 1BFKA 3QLJA 2BVNA 2O05A 4H16A 5DTQA 2XZTA 3MSCA 4Q3BA 1T4CA 5BSKA 4E6PA 1VBFA 2CVOA 3DZDA 2YX1A 2C7QA 2GGSA 3FD8A 2B98A 3P9IA 3L8EA 5F21A 4AP5A 2CD7A 3WLNA 5FUWA 4NPAA 4EYSA 2W9XA 4F5DA 3NVKI 4QPCA 4GOOD 4AUEA 3ENZA 1AC5A 4IGAA 4MMYB 3RFUA 1QC5A 1GEGA 2Y1XA 4I1YA 4LX8A 4W8HA 1VL5A 3HCAA 1HYGA 4RXUA 4YI5A 1AQIA 4JT8A 1JYFA 3NOQA 5BSGA 3T7IA 1PAUA 3O4FA 2FUG6 1PWYE 1VMDA 2DUNA 2I9PA 5HIIA 4J16A 1UXKA 3KT8A 1PQYA 4JVSB 3AR3A 4OB7A 3B3QA 2BE9A 5DYWA 3LCUA 5FRDA 2NUAB 3VYTB 4DC0A 3VH1A 4JLOA 1QF7A 2PKEA 2JDID 4A1FA 3ERCA 4FOPA 2OTCA 5LQAA 1PR2A 3DO8A 3ZD8A 2R68A 5I7OA 4YCSA 2ZDGA 3F1KA 1DB3A 2WD9A 4XSGA 1PS9A 2QUJA 1OLSB 3W4IA 4E1BA 1TVMA 1NYRA 5BNWA 1N6OA 1IHUA 3AP1A 4B2IA 1H93A 1Q17A 1XP8A 4TMYA 1QLJA 3OT1A 1TUBA 4J1TA 2AV6A 4HOYA 4MYCA 5G0TA 4BRUA 3BQMB 3EC7A 3QVTA 3KQNA 1UDRA 2HSZA 1OFHA 3FXAA 1NMEA 3FIJA 3A3KA 3B1YA 4PQRA 3CH7A 2GEDA 4IO0A 1G291 3G2MA 1NXXA 1T8YA 1W5EA 3O2SB 5TQ0B 3ZWQA 4NS1A 3PJFA 1CS4C 4RL4A 1PTKA 1AUOA 3CH6A 3TXYA 5DI3B 3PHGA 1ZNYA 1PEKE 4OHRA 3U16A 4D9JA 3P26A 4HJXA 4YMLA 2XQVA 1H3NA 1TYCA 3B5EA 1L8LA 1CHNA 1QM5A 2CUKA 1J0EA 3EGVA 4FGKA 4XX0B 1E2PA 5CNJA 1T13A 2ZZMA 1DKQA 4RE5A 1TIPA 1D8AA 2YWCA 2QSYA 1V4NA 5AI8A 4AO6A 1JSRA 2H18A 4AO8A 3F8TA 4QIHA 5CBPA 1XVIA 3WLLA 4E09A 5BNTA 2VCEA 2NGRA 2ZSAA 3GXBA 3UN1A 3ZI0A 1GZUA 1ZGHA 1P19A 4Y6GB 5HXAA 2RGGA 1PJBA 4EVSA 4QOIA 2AWNA 1N6LA 3UWOA 3WWCA 3OZIA 1C0EA 1PR1A 1IONA 1RWKA 4OHXA 1RYMA 3B1FA 1AURA 3D2LA 4RPKA 3V7FA 3CNLA 1M10A 4YMVA 1SIWA 5A9SA 3LXRA 2UUBB 1Z83A 3ROGA 1SVNA 3HUUA 1N0HA 3IVCA 1GCAA 2XCIA 3Q40A 5DM60 1YNSA 4G9GA 2O48X 1D2RA 1OLSA 1TQ2A 3E18A 2RGXA 3CT6A 4XEHA 2YHSA 5IWCA 2FSHA 3NWBA 4KH0A 5IS2A 2EOAA 2YFYA 4TTSA 2IS2A 1QRSA 3IP6A 4KR7A 5TQ2B 2FPUA 3I1JA 2BM8A 1UC9A 2IXFA 4IIFA 4KCGA 3EAQA 3HGQA 4UXHA 3EZ7A 3IUSA 1AN0A 4UPEA 3ZDBA 1M76A 4OLHA 3N0WA 3OTHA 3TQCA 5ALJA 4L15A 3KJXA 2WU0A 2ZSHA 1FA9A 5TQ0A 4BQPA 1PZFA 1N77A 1F6WA 4NL4H 4BPRA 1RZRA 4IHKA 3TGPA 1QYRA 3LF1A 3N2YA 2CD9A 4IVQA 2VHJA 2X5NA 4HAZA 4YAWA 2DG2A 3FYCA 2JGKA 3S55A 3VU9B 3P0HA 1TADA 1V41E 2OQ2A 3KJZA 5CNKA 5L9AA 1Z62A 4XX0A 1QFMA 1GVHA 1RVV1 3JD1A 3V8BA 1USKA 3KZ1E 4TS1A 3P0JA 4IDQA 1ECPA 5AHKA 5AW7A 4PAOA 2VUHB 3AHGA 3THXA 4WCFA 3F5DA 5JD5A 4JS0A 2AMLA 3LDAA 5KHAA 4UTOA 4FDUA 3NYIA 3EGCA 2WUGA 4GFDA 1FSZA 4E7OA 4Q34A 2NTNA 3DP9A 2LNDA 1SA0B 5JH7F 3I0MA 3TUJC 1XBTA 1S02A 3RHFA 3G9QA 4G65A 3CVVA 5IZCC 1CFZA 4CIDA 1IM5A 5B57C 3PFFA 3W5SA 3IP1A 2XZLA 1VGRA 5JO0A 1C80A 2J5KA 1IHXA 1JU4A 1RHQA 4X9XA 1Z22A 2LD4A 4IIEA 4EOGA 2FH5B 2Q5EA 5AK3A 2JHAA 2X5JO 5F73A 4BYMA 5KOJA 4KYTA 1FVXA 3AR8A 2AIRA 1T5OA 2MDTA 2RB5A 2B61A 1J0DA 5DLPA 2O2CA 1L7BA 2UXDB 1RP1A 1XTKA 3IP3A 3A36A 2CLDX 2HIGA 1CULC 2QSZA 3A2MA 3FTCA 3IPXA 3KIPA 3NU1A 3M6IA 5K4AA 2UU9B 1X3LA 5I9SA 3RG2A 1SNYA 4J49A 4UHDA 4U7DA 3PYMA 1C4WA 4V0MA 4EUFA 2XDYA 5FTWA 1GUDA 1YL5A 2QP9X 5JXJA 2LGJA 1X1TA 3DR5A 3OAAD 5GY7A 1Y3AA 5TXGA 3WO1A 4F9FA 2I62A 2VPPA 1YI8A 2YCLA 3F9RA 2IV2X 2XAAA 4LF8B 2K7ZA 4EECA 3OF3A 1FRNA 1NAHA 3VOBA 3W8RA 3BMCA 3WGYA 1QU2A 3S27A 1TO1E 4X3CA 4G26A 1GTZA 3AR6A 4BNJA 1XKQA 2OXTA 3WL3A 1SRQA 2QD3A 4MS1B 3WK5A 2EZ9A 2UVDA 1TK3A 5K7SA 3GARA 2K2WA 3K5PA 3RYCA 3A6FA 3SE0A 1KYVA 2WTXA 3ANTA 5IJ0B 2JBAA 2WIDA 5C1BA 4MSUA 3P9CA 1UDXA 1YBMA 2FLVA 2NV2B 4G4JA 2QT1A 1J7JA 4JD5A 4OQLA 4U02A 3EC2A 4XLZA 5DW3A 3V1UA 1QHHB 1USUA 3UFXA 1KOFA 4Z54A 5JYBA 3WGLA 4S24A 2OZLB 5TY0A 3IIJA 5ITSA 4IIUA 3UAVA 1J9ZA 3VR5D 3TBKA 5GONF 4EHLA 1EVZA 2J3MA 1YZFA 2OYSA 2VATA 4Y8VA 1SCBA 3GU3A 2C1XA 2RKWA 3UHOA 4FFSA 4G5RA 2QZ9A 3WIDA 3AZPA 2BLLA 1PR0A 3EHDA 3BIJA 3H2IA 1D04A 5D6OA 4PYNA 2TRSB 1JECA 1FFBA 1FF9A 5FB3A 2W2VA 3F8SA 4P7GA 2YBEA 5HRUA 3U3XA 2WNSA 3OLVA 4JU9A 4YACA 1B15A 2P9CA 2Q6KA 1S4MA 3C6YA 2QZ4A 3EZFA 4J07A 3GEMA 2JH9A 1DNPA 1I4EB 2PKXA 2VP6A 3OZCA 2WJZB 2HIMA 3SQDA 3ML1A 1QANA 3ZVKA 1L6IA 3OJOA 4GRIA 1JJ7A 4A8TA 5MFPA 4D0RA 3GLGE 4LTDA 5BPHA 2PE5A 1L7DA 1ZK2A 1L4MA 1IL0A 1T1IA 2GBPA 5KU1A 1T0PA 2ZLBA 1N3BA 3H6GA 4LK3A 3AG5A 1RE1A 1XWWA 3W05A 3I04M 5IJ0A 1JH8A 3SEFA 4ZDIA 3EEQA 4R2JA 2AB0A 2P5UA 4JX9A 3UTDA 3UV3A 4RX1A 5H9WA 5KYTA 2UAGA 4ZEVA 1QHHA 2QN9A 1VPLA 1A9QA 3A4IA 3K31A 1FDUA 3IBCA 4G5FA 4C88A 2WM9B 3IFSA 3O8NA 3PNYA 2PPLA 1Q20A 3U19A 4O0MA 2X2EA 2HPZA 2REBA 1IZ7A 2ZZKA 4H6XA 4G4SP 3D7RA 5EGNA 2AA3A 1WCV1 4QTZA 1ORVA 1XLTA 2FOXA 2VF2A 4MTCA 4WCDA 5AJWA 2XDAA 4FR5A 1ENYA 2P1ZA 1XRLA 4OPMA 1ESMA 5TMPA 1J8YF 2GPBA 2FCRA 1TZBA 4Q9DA 4X8OA 2G40A 1P2VA 3ZKAA 3VU8A 5JTUA 3SGLA 3ZGZA 2AE1A 2CDAA 3JZIA 3COVA 2DVMA 3IVGA 1EGVB 3HA3A 1A7KA 3ZW7A 2W90A 2JK1A 3EPRA 4O4JF 3W9SA 3CB2A 3B7WA 5ED4A 2QJRA 2XB4A 3GLKA 2AK2A 3KKPA 1SR8A 1CZKA 2QEQA 1G20B 2PU5A 1CUSA 2QI9C 2Y0BA 3FA2A 3H97A 2VAVA 1YS1X 4KTTE 5FR2A 3ASYA 3MTQA 1LXCA 1W2HA 4WNYA 1K89A 4DQXA 3ZXSA 1NVMB 1Q1AA 3IUNA 3QBVA 4X24A 3TPCA 2YZMA 4A2QA 2YRXA 1X0XA 3BREA 3WSVA 4DBVO 1L5YA 2CK3D 1XQ9A 2D1YA 2H31A 2ZT5A 4HPWA 4N39A 4XPIA 3WLEA 1WMAA 3PX2A 2K87A 4GPIB 2UZ0A 1EFAA 1DFGA 1UPAA 1WU7A 1IM8A 4PG4A 4XYGA 5J1TB 1FC0A 2J87A 2P9ZA 2PM8A 4OFBA 4AQDA 3O4JA 2HO5A 3SDZA 1OTHA 3QBJA 3P2IA 2KQUA 4C9BA 1E3MA 4PHTA 1G8SA 1ZVQA 1W52X 2QS9A 4NNJA 1NI4B 1R4NB 4J0FA 3UA4A 4D99A 2XZDA 3A05A 3GPIA 1KJNA 1TUGA 4GQBA 4ZT3A 3T3MB 2NSYA 1C14A 3KKKA 3NT5A 1NVWQ 3NOOA 3E9DA 4CT5A 4MW7A 3WNVA 4TSFA 3JQFA 4JKIA 1D2GA 1B1AA 4P0QB 1E1KA 5DO9A 4GL4A 4A16A 2COUA 2B92A 3Q7TA 3LA6A 1E9FA 2ISSD 3SDBA 2JA1A 2AI3A 3EXHA 1ZEMA 1DBPA 1BQEA 4IZOA 4QUEA 5E8JA 3TAXA 3OCXA 4R7GA 3HZOA 4QOSA 5CK4A 5CXQA 1JDJA 4LZLA 2XUGA 4TT8A 3SF8B 3NFRA 3OQ6A 5IT0A 3G59A 3L7IA 1JEYB 1BXGB 3EF0A 2H59A 1NNI1 3DA8A 3MMXA 3LZCA 4BKPA 4KV7A 1G1AA 3QXCA 5FV4A 4P82A 2WJIA 2VZ9A 1AE1A 4ZREA 4B9EA 3C7AA 1X3SA 2PV7A 2KYRA 2WDPA 1YHZA 2IUYA 1BHQ1 4HS4A 1RWXA 4E5KA 3MHTA 2IGTA 5AI4A 2D1TA 3DLTA 2Y1KA 4QPNA 3ANNA 4I19A 5FTLA 1EVJA 3HUTA 2YIDA 4EVIA 1NT2A 3L7CA 4KIGA 3ZW8A 4CL8A 2QVZX 1FXWA 1GYRA 1X7GA 4RK7A 1K75A 2E37A 2PGOA 4QO8A 4JBLA 1DXHA 1LDGA 4NFYA 4KSCA 2GXUA 4BZWA 4XJVA 3OO0A 2KWIA 1GZ5A 3SC2B 3L18A 1KNQA 2P75A 3Q87B 3LF2A 2QUHA 5JT1A 1C0KA 2R2AA 3RHZA 2V0GA 1UL1X 6REQB 2BEWA 1R4NA 2IUFA 3EQ8A 1VLHA 3KWMA 1RBQA 4HQ0A 4XYBA 4CQMD 1QKJA 1ZOLA 2LUOA 2PJZA 1KA9H 4G0QA 3NHUA 4HH4A 2GCIA 5KWJA 3CFYA 5KWSA 1TKRA 3ZOZA 3IUMA 5B4VA 5DRYA 4XDHA 1DBWA 4ND3A 4TKUA 3PKJA 1GGEA 2Y0PA 4N5NA 2SKCA 1EFHA 3LQFA 2AXQA 4MYDA 3WHKA 4A10A 4CM6A 4S04A 4RTPA 1HYQA 3G5AA 3S4YA 4KN9S 3THSA 2ASVA 3EZGA 4FW8A 1YJQA 1TYEB 1I8TA 3OIUA 3OTGA 1EVYA 4MDHA 3SF8A 1MQ9A 1YA8A 2P3OA 2ETXA 4QX6A 4ND7A 3WGJA 1IDN1 5IK2D 1BXGA 1JEYA 1AK9A 2E82A 2O23A 3K2QA 4CG3A 5JBIA 1MJFA 4LOHA 4GAEA 4QARA 5HM8A 4QDZA 3IOCA 3AV3A 2YNMA 5JO9A 2CXSA 1G2OA 4OQDA 1DRKA 5DHFA 5JNWA 5C4GB 1KYZA 1PT6A 2J67A 4HUQB 2WHPA 1OW3B 4HYYA 1ZZGA 4PZLA 2IH4A 1GGVA 2HBYA 2I7TA 3FR8A 4OKSA 3ZLJA 2ZVDA 4PLHA 1N5LA 4LHZA 3TAUA 1YB4A 3EC1A 1ZESA 4FOTA 1YRYE 4P4GA 1TM7E 2EL7A 3F6SA 1DRUA 2M6KA 5F9FA 2FSUA 4QO7A 4M8NE 3HDGA 5B3AA 2CLCX 4M8SA 3T15A 4OJQA 4GU5A 4TLEA 3DFZA 1X94A 2G1PA 4IR7A 1OF1A 4P6VF 1A88A 3F2VA 3SC2A 1PV1A 1ODLA 3HLKA 1YR6A 3OA0A 2A59A 1P5HA 3MYYA 4BLTA 2CJFA 1N8TA 1UPXA 3B20A 3GNSA 1ZINA 4RA9B 1KEPA 4CGYA 4LJKA 3T1QA 4F71A 6REQA 1JR4A 1QIHA 2R86A 1I01A 3R0VA 4YYEA 3U44A