2XMSA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
281
Chain Sequence
b'AKTHSVETPYGSVTFTVYGTPYPYRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN NDRG2
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
total genus 90
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmsA00
1TCCA 4Q34A 4QDXA 1THTA 3GBSA 3AILA 1E8MA 1WCYA 2OXEA 1SCKA 3ICVA 4B85A 1E66A 3H04A 4UUQA 1I6WA 5FPQA 4C01A 5CW2A 5AI5A 1ACJA 1DQZA 3V9AA 1LZKA 3WIBA 3WKBA 4BVKA 4BP9A 1UKAA 5JZBA 5ALZA 5D3ZA 2XQIA 5K3CA 2XDWA 1USWA 1XZAA 4H7DA 5EHZA 1ZD3A 2JGLA 2VJDA 2PSDA 2WUGA 2PUHA 1YB7A 3H1BA 5IKXA 3LIIA 2C58A 5JARA 5DTJA 1L7QA 2RIPA 5JZ9A 4MXDA 3G02A 4IO0A 4ETWA 3GELA 1MO2A 3V48A 4JNCA 3W05A 1O6GA 3STXA 5AKXA 2JEZA 2OAEA 1AQLA 4M0FA 5JASA 4DIUA 3K6KA 1CUUA 3TRDA 2QKYA 5LIPA 3VVLA 5YASA 1JJIA 3KXPA 3PFCA 5IH7A 2XMDA 2Z8XA 1F8UA 3WK4A 1WB5A 1J06A 3WYDA 5KWJA 1UFOA 3C6YA 5CRIA 3PUHA 4UFOA 1YAJA 3IVMA 2ECFA 3G0IA 2JGJA 2ZYSA 4XJVA 3I28A 2R8BA 2VAVA 3I2HA 1R50A 3FYUB 3DS8A 2Y2VA 3O9VA 1ZGBA 3DL7A 3H17A 4B82A 4KEAA 1XQXA 5J3JA 3O95A 1C7IA 3NWOA 3IUNA 5DYYA 1BEEA 5A6VA 1L7AA 1BU8A 1DTEA 1QIJA 5LZ8A 3FSGD 3C6BA 1XRQA 4KE8A 4B9AA 2HFKA 1W75A 5EHXA 2G4LA 3WL5A 4AX4A 5LZ2A 1CUBA 3QVMA 1VE6A 3DNMA 4G8DA 5ALHA 5HQ3A 1X2BA 4WY8A 4LKOA 3TEJA 4L0CA 4WFJA 5HCUA 2E3JA 3GZJA 5HKBA 1GXSA 5ISMA 2PSHA 5AI4A 1M33A 2I3ZA 2VJAA 5KWIA 4Q3KA 1DT5A 4MJ3A 4K6HA 4G1FA 4MYSA 5DNUA 2DHEA 5AKHA 2XUPA 5FOQA 5EHNA 3RK4A 4J7AA 4EY7A 1CIJA 4X90A 4W1SA 4CG3A 1A88A 2BJHA 1G4HA 1XQYA 2JGFA 1JMYA 1W76A 3PF9A 5JD5A 2WG2A 4JYPA 4GEGA 4J3JA 4UBMA 3FYTA 1CUWA 3FVRA 1VLQA 6YASA 4LXHA 1MX9A 1EI9A 2BGNA 3A2MA 3OURA 1EXWA 4KRYA 4KJXA 3NUZA 2HU5A 5AP9A 5EI5A 1N5MA 2CEKA 3WK7A 2QVBA 4JYMA 1H22A 2ACKA 1HQDA 1QLWA 3SK0A 2IIVA 1UOQA 4X91A 5AM4A 3W2TA 4BBZA 1Y7IA 4EHBA 4E11A 1WPRA 4ZXFA 4EY5A 3F8SA 1CRLA 4W1QA 2XMBA 1CUDA 2XQJA 4N8SA 3AZOA 1XRLA 3YASA 1MJ5A 7YASA 4J0KA 1QE3A 3QYJA 4PO3X 5ALDA 1CVLA 1ZIXA 3WMRA 3D4LA 4ITVA 5ALGA 1TKRA 3WI7A 3ZLVA 5AK5A 1ZD5A 2QJWA 4CCYB 1QFSA 3F67A 4XWGA 4Q05A 4FDMA 3R40A 2XUHA 3WKAA 2XT0A 1UZAA 2QJRA 3A6ZA 3V1LA 2O7RA 3G9XA 1S8OA 3ED1A 4ZWNA 1AUOA 3M81A 2K2QB 2JGIA 3S2ZA 3HEAA 2B61A 1K63A 1ACLA 1FFDA 4G5XA 4C6HA 5BOVA 4HXFB 5AM5A 1E3QA 1AKNA 1A8SA 1W52X 2P8SA 5AKEA 1YR2A 4X95A 2OCIA 5KREA 2G63A 1XZDA 1XQWA 5ALQA 1ODSA 2XUOA 5HF9A 1XLWA 5ESRA 4BCDA 1AX9A 1TAHA 1DWPA 3WL6A 2GBCA 1WB6A 2QM0A 4EY8A 3DEAA 3OC0A 4M0MA 3I2JA 3ZI7A 2OG1A 3T4UA 1CLEA 3C6ZA 2OGTA 2OGZA 2HA6A 4DSAA 1EK1A 4BZZA 5BWBA 1WOMA 2WTMA 4DMHA 4J0DA 5K3EA 2VJCA 3ZV7A 2ZSIA 1YSCA 3C5WP 3P2MA 1DINA 4YASA 1QIFA 3TGLA 4DGQA 2ROQA 3LS2A 2DHDA 3VVMA 3WA7A 5C8VA 1HLGA 4GXNA 2XLCA 3DD5A 2ZYHA 3O0DA 1CPYA 1E8NA 5A7HA 5SYNA 3K9BA 4C89A 3BXPA 2WIKA 2Y6VA 1XZGA 4PQEA 4Y2PA 2GYUA 1R9NA 4OB8A 1XRPA 2W6CX 4P92A 4ROTA 2EEPA 3WWCA 3JYHA 1LGYA 3VJKA 3ICWA 1A8UA 4H7IA 4GW3A 5AM2A 2WKWA 3UMJA 4UHCA 1LPMA 5EGNA 1LPNA 3FNBA 1UOOA 4KE9A 2WIDA 2HU8A 1UOPA 3IB3A 4OB7A 4LXIA 1N8SA 4BAUA 2XMZA 4X3CA 2CB9A 4BVLA 1BCSA 3N0TA 1VZ2A 2Z5GA 3WK8A 1ZOIA 5AKZA 4Y7DA 4BC1A 5HKAA 4B84A 1JJBA 3MGAA 2OCLA 2VT7A 4LHEA 5CT4A 5D7BA 5HFNA 4YPVA 1J07A 2WFLB 1OILA 1MAAA 3AINA 1VA5A 1HDEA 5AKLA 2QOEA 1YS1X 1QOZA 1YASA 3HYSA 2RHTA 2XUAA 2Y6UA 2XQGA 3WL7A 4PSCA 5T4EA 4P93A 1FFBA 1GKKA 4AZ3A 1DQYA 4U2GA 5LZ9A 2DQZA 3E4DA 1LPAB 3HLKA 3C8DA 5C7YA 2ONCA 1P0MA 3QPDA 1ZGCA 1MU0A 3STYA 1NU8A 1LBSA 4CI9A 2VQ6A 4PSUA 2WUDA 1H2WA 2C4HA 2XQFA 3DYVA 4MEAA 2ZJ6A 3U0VA 1MAHA 4BCBA 2HRRA 5ALFA 1XZKA 1VXRA 4HRXA 4G4IA 4LYEA 4LIPD 4FNGA 3E3AA 1G66A 1EHYA 3DLTA 2CZQA 3C87A 3KDAA 4AMZA 3QBJA 5HF8A 2XMSA 3NGMA 3SWWA 3IUJA 3EQ8A 4HAIA 4MWTA 4J03A 1YB6A 1RYYA 4E15A 4ARAA 4U2EA 2GYWA 4UBKA 3RLIA 5IVHA 5ALUA 4H7HA 3M3DA 3V1MA 3D2CA 4A5SA 4UHBA 3GUUA 3H18A 2HADA 5T4BA 4RE6A 1LPOA 3OOSA 5T4FA 1BN6A 4J0CA 2X8BA 4UHEA 1RP1A 4XIIA 2RI6A 3MUOA 1FFEA 3WK9A 4HXEB 4AZ0A 3FLEA 4OD0A 5EHQA 4K6GA 3G8YA 5LKAA 3WQHA 3HI4A 4PW0A 1QFMA 1BS9A 4U2CA 2YXPX 4X92A 1BEZA 1XLVA 3IUMA 5AK6A 2XE4A 5LLSA 2Z3ZA 1DWQA 1VA4A 2VA9A 1JI3A 3R3ZA 3WJ2A 5K3BA 4OSEA 1FJ2A 5CURA 4QDUA 4B7ZA 3BIXA 5EIAA 3WYNA 1N5RA 2QXUA 4I19A 3WWPA 4JUIA 1K8QA 5ALRA 1UK8A 3L1HA 2VSQA 4H0CA 5AHXA 4A23A 1NX9A 2XI4A 4F21A 3FCYA 2C0QA 2PKYX 3AIOA 2W22A 4X7BA 5H3HA 2RONA 5SYMA 1SCQA 4H18A 4AXBA 4W63A 1CFJA 3AFIA 1AZWA 1C7JA 5E2IA 3V1KA 2FX5A 1MN6A 2XUDA 4PV7A 2WQZA 1P0PA 4RE5A 5LZ4A 5HK8A 2RAUA 3VISA 5FPPA 1CUAA 1WHTA 3W9UA 2DHCA 4QWWA 2WILA 4HRYA 5AIBA 3O4JA 2D0DA 4H7KA 1TQHA 3AIMA 4UBJA 5ALEA 4OPMA 3QITA 4WCVA 4MWSA 3ESDA 4S0XA 1XZLA 1HL7A 2J4FA 4BVJA 3VXKA 3DQZA 4O08A 4N5IX 2WUEA 1C4XA 2AJ8A 1QIEA 1GZ7A 3PE6A 2JBWA 5AIAA 1N1MA 5K3AA 4A16A 4BRSA 2RHWA 4GWLA 1K6EA 4IH4A 4BE4A 3PUIA 3UUEA 4ZGBA 5LZ5A 2ZJ7A 1CUSA 3WKDA 5K5EA 1H2ZA 1A7UA 1VE7A 3AIKA 1VJ5A 2WHQA 4CG2A 3DKKA 1TK3A 3FWHA 2J4CA 1XRRA 3R3VA 5AI9A 4B0OA 4DNPA 4NS4A 5HFAA 1GPKA 4G8BA 3R3WA 3KWFA 5DYTA 1Q83A 3E0XA 1Q84A 5LP1A 4HS9A 2FJPA 3F98A 2V98A 1E89A 2RGUA 3EQ7A 3QZUA 1H23A 3FAKA 4NVRA 4Y2JA 4BZWA 2JGMA 4ZV9A 1PJAA 4FWBA 1PFQA 1QIGA 2WHPB 3R3YA 1EINA 3WK6A 1BCRA 2OQIA 4UBLA 4E46A 4K2AA 1EDEA 5K3FA 1GT6A 3O4IA 2O2GA 3HC7A 3IIIA 3G9ZA 2WJ6A 3GROA 4G4GA 1QTIA 2FJ0A 2BGRA 5BWCA 1QZ3A 2VTVA 4FFWA 4OYLA 4CG1A 2G5TA 1UKBA 3QH4A 1OXMA 4AO7A 4UHDA 3IDAA 3AZPA 4QWMA 5AM1A 1XRNA 5AKIA 2ZYRA 4H7JA 4UFNA 3EF3A 4DLNA 4U2BA 5HF6A 5FLKA 1BRTA 3LP5A 1AURA 4FMPA 1ORWA 2GBFA 1E8DA 2WSLA 2XMRA 1XZEA 3BL8A 3SX4A 3A70A 3FYUC 1X70A 1DT3A 5LKRA 5KBYA 4Y2XA 3KD2A 2XUKA 1J1IA 3HJUA 4PNZA 3FLAA 2C7BA 2ZVDA 1QIDA 4X93A 4JH0A 2WFLA 4BCCA 4GHWA 2IX9A 3BF8A 3OPMA 4X6YA 2WG0A 5C8ZA 1YA8A 5ALLA 3M83A 1CR6A 5JATA 3QPAA 2DFPA 4AO8A 4Q1VA 4UBOA 3QM1A 1R3DA 1DU4A 3C43A 4RNCA 4EY4A 3QPCA 1MNAA 2XMQA 2QS9A 3GA7A 2WG1A 4AO6A 1QJ4A 4UBNA 5IVDA 1MNQA 1VZ3A 2BCEA 1UK6A 5ALTA 5JIBA 5HQ3B 3WWEA 5JADA 2O2IA 3CXUA 1YS2X 1PV1A 5CT8A 4IQ4A 3H2KA 4HZGA 3JW8A 4DMCA 3R41A 1O6FA 4QA9A 2WTNA 4EUSA 4B83A 2CUTA 3I1IA 2DQYA 2OAGA 3VJMA 3W06A 4MEBA 2ZSHA 5FXMA 2C5FA 3R0VA 2BAGA 3PFBA 3WK5A 2AJDA 3HRHA 1IUOA 1R1DA 3KSRA 2XUQA 4PSDA 5AK3A 5CTAA 3M82A 2AJCA 2WJ3A 1XZJA 1K4YA 1LPBB 3UUFA 3C70A 4LXGA 4GECA 1W4LA 4D9JA 1XQVA 5A2GA 4GLBA 5DJ5A 1J2EA 3FCXA 3CN7A 2D5LA 3A2NA 3MVEA 4QDOA 3I6ZA 3HACA 4C4YA 1QO9A 2BFNA 2HM7A 1XKLA 4OYYA 2Q0XA 2UZ0A 3F97A 5AOCA 1QIKA 4MQMA 4YX9A 2Z3WA 1CQWA 3ZLUA 3H19A 4Y2YA 2GZSA 3FVTA 3CN9A 5AI6A 4BAGA 2VF2A 3H1AA 3H2IA 4DNFA 4BTLA 1IZ8A 2WJ4A 3FSGA 3S8YA 3D7RA 4F0JA 5ALNA 4BDTA 5JYCA 2HDWA 1EB8A 3D59A 5C8XA 3L1IA 3N2ZB 3Q8WA 2HL6A 4BTVA 3G9TA 2WIGA 4UHFA 3WIOA 1JKMA 3OG9A 1W6RA 4WFIA 5CT5A 4QEKA 1FFAA 1FFCA 1Q0RA 1X2EA 2YYSA 4EA6A 1LNSA 5DLPA 4C88A 5I7UA 1EK2A 4PF1A 3I1YA 4KYVA 3EIOA 4I4CA 5CXXA 2Y2UA 5IVIA 2CBGA 2H1IA 4KAFA 4Y2SA 2HA7A 2PBLA 3R3XA 2WUFA 1ZD2P 1ORVA 4AN0A 2XB6A 3BDIA 2ZJFA 3BIWA 5C81A 2R11A 1D07A 1EB9A 3H2JA 3QMWA 1ISPA 3A2LA 2QUBA 3C45A 3F96A 4J0HA 1P0QA 4CFSA 3ZLTA 2HU7A 5T4HA 1XZIA 4X00A 4C4XA 1MX1A 3C5VA 5ALIA 5JAUA 2WIJA 1FSSA 1CUXA 4X85A 2IITA 2X5XA 3R3UA 1IUPA 2QTBA 2BUAA 2I78A 1U8EA 2PPLA 2XUGA 3EBLA 2YH2A 2H7XA 1XZMA 3HZOA 1QIHA 3G0GA 3W04A 3VJLA 1XZFA 3LLCA 1WM1A 3G7NA 3KWJA 5AICA 3IBTA 1JJFA 5DWDA 1MTZA 3SC2A 1NU6A 1UKCA 1ZJ5A 2WM2A 3D5EA 4L3WA 3VKFA 3ZWQA 3K2IA 5FRDA 1XROA 5ALOA 1T2NA 4DMKA 4UFPA 4Y2VA 1QONA 1B41A 1XKTA 3WKEA 4DTCA 5DNWA 1XZBA 4F60A 4WFKA 1B6GA 3G0DA 4G9GA 2VEOA 1JT2A 3BWXA 2H7CA 1EVQA 1TCBA 3FOBA 1QGED 2ORYA 4GDMA 4YK7A 4AB1A 3IURA 3PDCA 5JALA 3WZMA 2QRUA 3D0KA 5D3KA 3D3NA 1CUGA 2PSJA 2NW6A 4EB0A 3G0CA 4OU4A 1IVYA 3H0CA 1CUCA 4MYDA 4XVCA 5CBKA 1IUNA 1CUVA 5AKGA 1CUEA 1F6WA 4EZIA 4DSZA 1XZCA 4N8EA 3W9BA 3WA6A 2XUJA 3T52A 5DYWA 3WL8A 3H2HA 5I9IA 5LYYA 2PVSA 4J0GA 5FV4A 2OLEA 1UK7A 3OM8A 1H2XA 3LCRA 1KU0A 3O4GA 2J3DA 4FLMA 1G42A 3HXKA 2OCGA 4BRZA 1K5PA 1CUJA 1XRMA 4L72A 5FKJA 2VAXA 4B81A 1DX4A 1MX5A 1HKHA 2HA2A 1LBTA 3WZLA 4WDRA 1UK9A 3DKRA 1AMNA 4BDSA 5FUMA 1GKLA 4BE9A 4IH1A 2OGSA 4WJLA 4Q3LA 3QMMA 3NOXA 3WKCA 4XX1A 1U4NA 2X76A 2BUBA 3O9MA 5AOBA 4FBLA 2HRQA 1ZD4A 3G0BA 1YCDA 2CJPA 4FOLA 1CEXA 3WWOA 4KRXA 4CCYA 1CUIA 1SCIA 4QNNA 3PICA 2VT6A 4IH9A 4F5ZA 2YASA 2JGKA 2WFMA 2BUCA 3DDUA 3L1JA 4QE3A 4K5QA 2C5GA 1AC5A 2WIFA 2PSEA 4EY6A 4X71A 4B9EA 2Z8ZA 3PF8A 5K3DA 5ALYA 5JAOA 3MUNA 2HA4A 4DM7A 3I6YA 3C8HA 5CH3A 4FNMA 4INZA 4BB0A 3FLBA 4Y2TA 4ZI5A 2B9VA 4FBMA 2CMFA 4J0JA 4DYHA 2V9ZA 3BJRA 3F9CA 5CT9A 5A7GA 4KAAA 4IHAA 5JAPA 4Q3OA 3BF7A 1XZHA 4N8DA 5AM0A 1Z68A 2AXEA 3GFFA 2LIPA 2XUIA 3RM3A 3DYIA 5LZ7A 4L9AA 2VATA 1ODCA 5A7FA 4H77A 2G5PA 1ETHA 3DOHA 4OUKX 1GPLA 3D2BA 2HA3A 3AJAA 1WPXA 4GI1A 5AO9A 4I3FA 1IZ7A 1RWQA 3B3QA 2ZYIA 4TPKA 1UXOA 2BKLA 1QIMA 3IULA 2V96A 5E4YA 4BATA 1EX9A 3BDVA 1ZICA 4FLFA 1EDBA 1CUFA 4V2IA 2QXTA 4QZVA 3DOIA 4Y9SA 2WU3A 2QT9A 4U2DA 2ACEA 1U2EA 4X6UA 5HF5A 1TIBA 1W1IA 4ZREA 1CV2A 1E5TA 3OTQA 4W1RA 4FTWA 1ZJ4A 4OB6A 5JD4A 3STWA 3PI6A 2FUKA 2H7YA 3FYUA 2JIDA 3IUQA 3HSSA 5AKKA 5ALKA 1YA4A 3ZPXA 4P08A 5JZSA 1BN7A 3G9UA 1ZI9A 2C0PA 1WB4A 4JEIA 1MT3A 1VXOA 5AOAA 5AK4A 4Y2QA 1SFRA 4MQLA 2PX6A 5CT6A 5ALXA 3V1NA 3HABA 4HVTA 1ZI8A 2PL5A 5ALPA 4ZV7A 1LPPA 1JFRA 4KAJA 5E4JA 1MPXA 4B6GA 5BV7A 4E14A 2PU7A 2XLBA 2GBIA 4QDTA 4DNOA 1WHSA 2EDAA 2GZRA 1P0IA 3STVA 2XQKA 5IVKA 3ANTA 3CCBA 3TJMA 4NZZA 1DX6A 2B4KA 3STTA 5A71A 1XLUA 5FP0A 5I8PA 5AI8A 2QMQA 5JAHA 3I6MA 2Y1KA 2HIHA 1R88A 4H35A 4CIBA 3JWEA 4W1PA 2PSFA 1G5FA 5ALJA 1QO7A 1H2YA 4BC0A 5CH5A 2O7VA 2OPHA 5JANA 3U1TA 2CKMA 2WFZA 2GYVA 2PUJA 4BYMA 1LZLA 2JEYA 4DNQA 3KOOA 3ANSA 1KEZA 2PM8A 1DWOA 2QZPA 3I2KA 1SC9A 1BE0A 1EVEA 4RGYA 5EFZA 4RPCA 2VJBA 1F0NA 4HXGA 4QLOA 3STUA 4FFVA 4QDZA 1SOMA 4K6KA 5AH0A 1Q0ZA 1VKHA 3E1GA 3QMVA 3D2AA 4M0EA 1YAHA 4FLEA 1JU4A 2J3QA 3DL4A 1BROA 4AMYA 2O2HA 5JD6A 5EIEA 3B12A 5A62A 4TVKA 5F4ZA 5CXUA 2DSNA 5FDFA 3FBWA 1OCEA 1TRHA 4HTAA 3X3HA 4UHHA 4B80A 1HBJA 4G4JA 4P9NA 5DNVA 1T4MA 1AGYA 1GQRA 4H7FA 2HA5A 2QR5A 2WU4A 3C6XA 1HPLA 1IMJA 3CCCA 2HHAA 3BJMA 4W9RA 1LPSA 1XFDA 3EQ9A 4U2FA 3RARA 3AZQA 2DR0A 3Q0TA 3I2FA 4N5HX 3I2IA 4UBIA 2XMCA 1QIIA 4Z49A 3WJ1A 1L7RA 2B20A 2XUFA 1JU3A 1EA5A 2JF0A 4NMWA 1THGA 4X6XA 2PU5A 3DCNA 1Y7HA 5D6OA 2AJBA 1A8QA 3AUKA 1GGVA 4GBGA 1GQSA 1CUYA 1QTRA 5ALMA 1Y37A 4DMFA 4EBBA 2H9YA 1LLFA 4OCZA 4G9EA 4AQDA 2ES4A 5AJHA 5HZGA 5AKJA 5AM3A 5CMLA 2WHRA 3IA2A 1EH5A 3LIPA 5DTIA 1CUZA 4FHZA 4QLAA 5AKYA 2OQVA 5CH8A 4Y2RA 4KE6A 3DJYA 4KE7A 1EDDA 3I2GA 3ILSA 3RKSA 4TGLA 4BP8A 1ZI6A 4Y2UA 3WLAA 4KACA 4FKBA 2XMGA 4G8CA 1VOTA 2JGEA 4LYDA 2QUAA 3VDXA 4ZRDA 4Q82A 4B0PA 5ALWA 4CCWA 2WLSA 3ESBA 2HA0A 3BE8A 4WDQA 3H2GA 5K3FB 3ESAA 1ODTC 4X94A 4AN1A 3ESCA 4KR0A 2V97A 2DCMA 3O4HA 1CUHA 4C4ZA 2EDCA 5EIHA 4C87A 5ALSA 3WWDA 2GBGA 1KU6A 2I03A 5HK9A 1ZIYA 1UT6A 1JMKC 4X97A 4UPDA 4CIAA 2I3DA 1GPNA 1UWCA 4ARBA 1R9MA 4OU5A 2OCKA 1CQZA 5E4TA 2HFJA 4BAZA 4WY5A 2AJLI 3B5EA 5AI0A 1R4ZA 4J0IA 5ALVA 4H7EA 1U65A 2WHPA 1F0PA 1TCAA
chains in the Genus database with same CATH superfamily
2CNDA 5KCMA 2MSKA 4RKWA 4Q34A 4RHXA 4D6PA 2QQ0A 1UBNA 3JARB 1DG1G 1IB6A 2H4FA 3JQPA 4GQIA 4HUQB 4QHTA 5L7YA 2Z6UA 2VTEA 1FYWA 4NH4A 3U61B 4EO4A 3ENKA 4QUGA 4B85A 1E66A 2ZTVA 1SR8A 3WNBA 1I3NA 4HUQA 3H04A 2EBHX 3Q9SA 2HJVA 4MUEA 1S3IA 2B35A 3ZNQA 1AKVA 4BLPA 1SMKA 4BJHB 1FP4B 1P17A 1R5BA 1N6IA 1U5AA 2P4QA 3EPPA 3PQDA 3I5XA 4C01A 3OQPA 1ORDA 1J8MF 1ACJA 2O2CA 3A4IA 3EARA 1OVMA 3K9WA 4UU7A 2EATA 4B7AA 1Z2CA 3QYPA 4MR9A 3HMKA 3H4MA 3T9AA 1YMVA 3WB2A 4UXHA 3WIBA 5AWFC 3TNYA 3DTNA 3WKBA 4QJ3A 4XVUA 5J4YA 1TM4E 1V41E 5EAIA 1YE3A 1Q74A 2C99A 3I5AA 2ECKA 4TXLA 5D3ZA 5EZYA 4EL5A 2NO0A 2O6HA 5LLTA 4Z4QA 3M6MD 4Z8YA 1GD1O 1VDZA 3BSWA 3OM1A 4ON9A 4BO2A 5L3SA 2JG3A 4Q1BA 4RD6A 1YI1A 5CB8A 4J8PA 2VJDA 3OA0A 2WJYA 3KTDA 5DOVA 5FAXA 3V8RA 5EHZA 2AFHB 3EHDA 2PSDA 5H0IA 2E4WA 1BYIA 2UYQA 1SXQA 1X1DA 1YB7A 2J3KA 5TQ0B 4RA9A 2RB4A 5IHPA 1SVMA 3L7BA 2WJHA 4AP5A 1E18A 3NDRA 3TQSA 4BKUA 4AY5A 3HP4A 3WSTA 1I94B 1W0KD 4CXMA 3KHSA 3REQA 3A4VA 4TT8A 5M5BA 1W34A 3EF1A 2DFVA 2DZDA 3OY7A 3JQDA 5J4HA 4MUJA 4ETWA 1L5HB 4M7WA 1GPDG 5DHRA 1N1GA 3R7FA 1GUZA 4BLUA 2F9FA 3GV0A 3Q7IA 3W05A 3EEFA 3HFGA 1FMCA 4IWNA 2VBGA 5JSQA 3L8HA 4DJJA 3EX7C 5AKXA 1IXRC 4MRSA 4JR2A 1FUYB 4LA4A 4ZDIA 2JFFA 1AQLA 1T5OA 1LTQA 1EJ6A 4F6LA 3O82A 1CZRA 3IKVA 3GCDA 4GYJA 4WK2B 2J0QA 4JP1A 4YH1A 1CUUA 5G1PA 5ICGA 2H1CA 5K0ZA 3EOBI 2D8MA 1UQTA 3H8WA 4C6TA 3DCJA 3A3OA 4G5QA 3EZLA 1Z36A 1JIIA 1R9JA 1X8JA 1F8UA 1ULHA 1E4EA 2CBZA 4ZAZA 3WK4A 3R5KA 3OQBA 3ZUPA 5KWJA 1CETA 1HRKA 5TV2A 4NMLA 3FPEA 1ORIA 1PYGA 3OX1A 3ZHBA 5CYGA 1JTEA 2GARA 3PNVA 4YI5A 5GOTA 2JCGA 4H08A 3N7AA 1XTTA 5JV5A 4DFDA 1Q3KA 5J1SB 2FEPA 3AXSA 2ZYSA 1XF1A 3LVQE 4ZJUA 1WR8A 2FEAA 2EKPA 3MINA 4DPMA 1EQ2A 5L7WA 4J90A 5K4GA 2VL7A 4EFLA 2Z2ZA 2VWPA 1YULA 3DHYA 2BTOA 3DHEA 3OFNA 4KXQA 3I28A 3MA0A 5AXAA 5F5NA 4F1KA 2VAVA 1TU3A 3P0JA 3KPUA 4LF8B 5FNVA 3VC3A 1QP8A 2A67A 4H3KB 3FDFA 1Z62A 4FUTA 2WF9A 5H16A 2Y2VA 2ZAMA 4DMLA 5IFKA 1FFHA 5CA1B 4PYQA 3H17A 3OFVA 1CR0A 1KYYA 3GRYA 4UTPA 4IXTA 4ZV4A 1SUEA 1DADA 1WE2A 3EEIA 4KEAA 4WAUA 4AJNA 2ZEJA 4FYHA 3H3JA 1NXWA 3WLOA 1VL6A 1Q17A 3HY4A 3NPMA 821PA 5GQSA 2B1JA 2EFDB 2NWQA 2FSFA 2R5WA 3ZW9A 2PZBA 3SMQA 1GLVA 1R15A 2JVJA 3P9QA 2C04A 1X1SA 2X0FA 1QIJA 2CHGA 1Y8ZA 4CM1A 1B00A 1DEOA 2WWFA 1JNXX 2M2IA 2SECE 2ERXA 4FE3A 2A5LA 1ZHOA 1FP7A 4OHXA 1ONNA 2QTHA 1R0RE 4CU5A 3HCAA 1TM1E 2HFKA 4RTKA 3KQHA 4NFYA 1W75A 4DJEC 1S9DA 1JA9A 3GLHB 2B1IA 3ETCA 1WEHA 4AG5A 4QQRA 4HQ0A 4CF6A 1P45A 1Z06A 4NF2A 1R0CA 2G9UA 2YIJA 3L6EA 1D8AA 4CMGA 2FFRA 3MBIA 5IDYA 3ZDXB 4Z4CA 4OKIA 1NFFA 1VE6A 3Q3CA 2G28A 1Y6RA 1BMDA 2F1HA 5TARA 1XKXA 2WUVA 2PGDA 2WA2A 4IFTA 2BFMA 2PRIA 1IHXA 3KJNA 4CKWB 1TO1E 4YQFA 2ZBEA 1J39A 3KV1A 3TEJA 4YJHA 4L0CA 3DW3X 1KR5A 4JUCA 4NLLA 1Z7EA 2QX8A 5NULA 4V39A 4DYVA 1JEQB 4WFJA 5EIWA 5A03A 2H1HA 3ITKA 3MWJA 1NIJA 5JAIA 4WACA 1VL2A 3EZGA 4DDTA 4EVQA 2GXAA 1E99A 1W88A 1U1IA 3CX4A 3FW1A 2G67A 3TLAA 1E2PA 2P7IA 2JBAA 1BOFA 1AN9A 2BELA 4PLYA 1GXSA 4EO7A 5CD9A 1FLNA 1KO1A 2J3HA 4PPNA 1WSDA 1R18A 3EHEA 2D4HA 2W6ZA 2VJAA 3TINA 4D6XA 1NAHA 5KWIA 4JBNA 2J6IA 2FPIB 3KVOA 3Q2KA 2EHDA 4P1ZA 2R5FA 1DT5A 3M2TA 4RUKA 4B2YA 4A0FA 1L5WA 4L7VA 1CERA 3MJSA 4G0NA 4MYSA 4ZVOA 5DNUA 5CX1B 4QTUB 3N0VA 3PX2A 5F4BA 3SBXA 5AKHA 3ZH9B 4EGQA 4YMGA 5FOXA 5AUOB 2X22A 2G09A 1Z2AA 3WGUA 1F7VA 1NNI1 1QZXA 5TGZA 1JJVA 3HGTA 3ZOZA 3M0EA 4MIOA 3AR7A 4FJ2A 3L18A 1YIAA 2AC2A 2GM5A 1CP3A 1IN8A 4A6EA 1WKBA 3PDHA 2C5LA 3LUKA 1CIJA 4RF5A 1BHO1 3GWZA 2O57A 3VAAA 3LVFO 3TKYA 4KBGA 2BJHA 1XQYA 2BFDA 1T9HA 3I9NA 2PWPA 4E7OA 1ULZA 5KVSA 2DR3A 5JD5A 2WG2A 1NYRA 4NZOA 3PIIA 5FNVB 2RGAA 5HTKA 5ENVA 2D2FA 4GEGA 5IKOA 1WX1A 4PC6A 3ADBA 1KI6B 1NRWA 4QODA 4J3JA 2OBBA 5C37A 3ZH2A 2EFCB 1WUHS 1YQWA 2Q29A 3A1VA 2ZBVA 3ESQA 4X1YA 4E2YA 1HE1C 1SRRA 1OV4A 1JI0A 2R8EA 3LHSA 1BDJA 2EGUA 3BS4A 5LMNB 4Y2GA 1T8PA 1UP4A 4U39A 3LDHA 1EI9A 2DT5A 2XWSA 4OM7A 1SUIA 3A2MA 2AXNA 4B31A 3T3OA 3GRAA 3NUZA 1VSBA 3HUFA 1D4OA 4WLNA 4LXYA 1UBSB 2HU5A 4BQEA 3AYZB 5IZCA 1RAFA 4PZAA 3GXOA 4AIIA 3B60A 3NDPA 4D02A 4UM7A 5C5EA 1ABEA 2W8BA 4FQ8A 1U7XA 1QZZA 1F4PA 3BMCB 4G8JA 3S7ZA 2HR1A 2AG0A 4MYHA 5UKDA 1XNJA 4I81A 4WZ6A 1VJDA 1ISJA 2FMHA 3SJUA 4AKEA 1HNNA 4R7GA 4L5BA 3TBHA 4AF8A 3MTEA 3E18A 4G26A 1ZBDA 4RVHA 3AY3A 1X77A 2XRYA 4MW5A 1WF6A 2PT6A 2C29D 3OQ6A 2OZVA 2WI8A 1V16A 1O89A 1PZHA 4QGFA 1AKTA 2XZDA 5A0TA 4LC1A 3GJYA 3W2TA 4P36A 1ZXLA 3OOEA 1XCLA 3FKSA 2FK8A 2DY0A 4ZOAA 3L6BA 4H7PA 3U4AA 3FXAA 5DX8A 1W5FA 3LYHA 4I50B 3B70A 5THXA 4DE5A 1GP2A 1WPRA 1JEOA 2G72A 2O8CA 4EY5A 3O4VA 3TZHA 1NSTA 1L5KA 1TUBB 2JH9A 3FA2A 3ZCXA 2Q1SA 1MAUA 1QCDA 4B32A 1DCTA 2ZTMA 5CR9A 1SQ6A 3PC2A 4UNNA 3VOTA 5CEFA 4KITB 4OK5A 2W6JA 1N78A 1NDHA 1E61A 1DBRA 3DTVD 3G9QA 3NPAA 3PRJA 3RG2A 1G8KA 4PZDA 3AZOA 3O74A 4WJKB 1HTTA 4I9NA 4XM1A 4Z5XA 3RIEA 1DIOB 2LDXA 2P9CA 4BVGA 1IOWA 3D6FA 3QKTA 4OMUA 1V35A 1ZLXA 3KELA 3PC7A 2RFLA 4G0MA 5DM2A 3LA8A 3QYJA 1NVVR 3W4JA 3QWIA 4J7CA 3T7JA 2FI1A 3OOJA 4ZMBA 1X7HA 2DULA 4YT2A 3VKVA 1HH4A 2IH4A 2RGCA 4TQAA 3K32A 1JZQA 2IYQA 1EP2B 1NG9A 1WSWA 2PZJA 3HRKA 3D4LA 1X9IA 5BRJA 1D2MA 3HO1A 4A91A 4L7QA 5KHLB 3D02A 3H65A 4EPYA 4EUEA 2A78A 2Y1GA 4RV4A 2FJUA 1RWMA 3AVPA 2ENWA 1TU4A 3E9CA 4CV0A 4I6GA 1X7YA 5KC8A 3VU8A 3GLGA 3RT7A 1USKA 3WKAA 1DUVG 1QKKA 1WTCA 3MJVA 1ZJ6A 4XI9A 2XT0A 3OQNA 2QJRA 5AW3A 2XCLA 1KEVA 2X7JA 2VQEB 1QK3A 3WGJA 2H0AA 3PT5A 2PQ6A 4HATA 3WSWA 1RM0A 2QX6A 3FB4A 1B74A 2G70A 2O7RA 5AUQA 3G9XA 3A26A 3IEKA 3D4IA 1N6NA 4IX1A 1NULA 3PTLA 1ZIOA 3DMTC 4KNVA 16PKA 3SAJA 1N2SA 4LQCA 3U3ZA 3C14C 1TB4A 2K2QB 2JGIA 1ZD8A 4RY2A 3G13A 5JTUA 3HEAA 2V58A 4QGBA 3ZQUA 1ACLA 1I4EB 1R37A 2WF5A 2FV8A 3BPSA 5EGSA 5FJIA 4BZPA 1NVEA 3DVAA 1RRCA 2QYOA 4ZK2A 4G5XA 4C6HA 5BOVA 2FNAA 3HTXA 4NY1A 3KZMA 2AKYA 1GADO 1AKYA 1U11A 2GR9A 3OKCA 4YGYA 2XXAA 2WWXA 2NP6A 2V7GA 1FB5A 2P8SA 3CZ5A 3M5CA 4DEVA 2OCIA 5E9WA 3AVQA 4WESA 3HEBA 4P4UA 3ZD7A 1QG6A 2YBEA 3KKKA 1QE5A 4BNDA 1JDUA 1YMUA 1XQWA 3OZDA 4J07A 4DGSA 5LQRA 3KLMX 1ODSA 1S7CA 3IR7A 3Q0EA 4GSKA 3N8IA 1XLWA 4E2FA 1AX9A 2XECA 2QQGA 1JX6A 4F6RB 1H0KA 1TIKA 3FY4A 1V11B 2A7QA 5KX5A 3BRQA 1RM5A 3IOCA 1GSOA 1JDTA 4P3XA 2DU8A 2NIPA 1Z22A 4XRRA 2VRWA 3MS4A 4IIJF 1GKYA 4CKCA 1U0GA 2VAMA 2OG1A 2QY6A 2VS1A 3KQKA 4CDRA 1RQLA 4YJ3F 1Z34A 4FR5A 2OGZA 3DXXA 1JAIA 1PFYA 2XV1A 3MWKA 1QPBA 1K1EA 2NXNA 3UBMA 1Y80A 3EW7A 1K7FB 4MJ7A 3UBTA 3SJAA 2JIRA 1ZEJA 4RH3A 1SU4A 1B23P 2WTMA 1NJ1A 1Q1QA 2VJCA 2LCFA 3WV5A 3ZV7A 5FAKA 2ZSIA 5IASA 2BYTA 2CHUA 5BQOA 1CEYA 1DINA 4YASA 5ICEA 5T64A 3TGLA 4LRWA 1RQGA 3NBKA 1UXIA 4TLMB 3SQLA 4DGQA 3LS2A 2AYZA 3F78A 2G9QA 4JOQA 4PNPA 4RJIA 3R5TA 4XW2A 2DXIA 1IZYA 4YECA 3WA7A 3O4FA 4MV9A 3I3OA 4LHSA 3TX6A 1ZUIA 2PQ2A 2QYSA 3OZBA 1SBQA 1SU7A 1ULSA 3L7IA 3W3AD 3EMVA 2GERA 1UEXC 2HF8A 2OVBA 5D87A 4EF4A 4QM6A 3RIHA 2ZYHA 4ENRA 4OGWA 1P9RA 3IAXA 1YI0A 1PQPA 5EQJB 1YDEA 1AGPA 5HMLA 3K9BA 1AV7A 1O5TA 1UT5A 2J9FA 1FTQA 2HLDD 4PVDA 5F7OA 4OQ4A 4LWQA 4XTRA 1QKIA 3G2LA 4LRQA 4XFJA 3KE9A 5E7JA 4A2CA 3VPXA 4CR6A 4AG3A 2QPOA 2XWQA 2IHBA 2QRGA 4I08A 4WBXC 2ZBDA 2R6R1 3BCRA 4OB8A 2PIDA 4ZO9A 1IZ0A 3ILHA 4P92A 4ROTA 1NBMA 3ZTTA 1GRRA 1JR6A 3JZMA 3HDHA 2NO6A 4HG2A 4KTVE 4EKYA 4RMIA 1SVIA 3JD1A 1KMIY 3RGGA 1JEYB 1NLUA 1J2JA 1Y8AA 3PRYA 4H7IA 1Q92A 3UMJA 5DYIA 4D1YA 1LPMA 2FZGA 2V55B 2WUWE 1LPNA 2QN7A 3B3AA 3FNBA 2HWXA 4MW2A 4K1XA 4MUFA 3NAQA 1SKMA 1S96A 4KNWA 3U3MA 4HAZA 3R0JA 2WHEA 2ZPTX 1UQRA 1XD2A 3D7MA 3MG9A 4QBGB 5CLIA 2MYTA 3NONA 3OSUA 3SHVA 4W5TA 2XMZA 2QRLA 5DNEA 1GG5A 2QTVA 1U0EA 2C7QA 5HRCA 3D8TA 1VQ1A 4DR4B 3WK8A 1ODKA 1ZOIA 1IMOA 1FDVA 4B7CA 4PBSA 1ZAKA 2FW1A 3A7DA 1A8HA 3KR2A 5IMBA 4NDAA 4P3KA 3E27A 4Q4JB 4YBZA 2Z9CA 1M5UA 1KEUA 3GAAA 1FNDA 1XEAA 2QTWB 3KOZA 5EUCA 3RT1A 1O08A 1JJBA 4IIGA 4Z2YA 4F8EA 3LDUA 1PWHA 5FV7A 1NNUA 1N6LA 1V48A 1Z88A 1P7YA 4LHEA 4WINA 1V8BA 3LWNA 2PNFA 2BEVB 3LI2A 5I7WA 3B36A 3M70A 4O4IA 4INOA 4UNPA 5C1DA 1IEVA 4PVCA 4X64B 2R2GA 2WFLB 1OILA 4FMDB 4G01B 1U8TA 2HRCA 3HA7A 2JCYA 1MAAA 4FFBB 4R9SA 5EJAA 3PV0A 1YASA 3K09C 1KJJA 2I5PO 3AJEA 3HYSA 2XUAA 4KG7A 4LJSA 4QOJA 3GU3A 2E6KA 4PNHA 3NHSA 1FY2A 3QWAA 4MPJA 2QL7A 3S4YA 1DXQA 4JBGA 1YB4A 2PL1A 4WSOA 4O1MA 2P0AA 3IERA 4R8KA 2F1RA 3NC4A 4L4YA 2ZE6A 4BX3A 1DQYA 3VPBA 2LWIA 3GRCA 2JD1A 2OCPA 4M1MA 5BR4A 3BAFA 3LKVA 2OZLA 4XQEA 5LZ9A 1Q7CA 2BHLA 2YN2A 4C0HA 1MV8A 5C7YA 1J0BA 1IHOA 1PQUA 4JJZA 4L57A 1P0MA 2IK8A 4R8SA 1FYDA 4Q1FA 3UJBA 4CU2A 4D9EA 5CB4F 1ZGCA 2ZSEA 2WVHA 3RUDA 3KB2A 1LBSA 1QVZA 1D2CA 4OXNA 3RPEA 1C3VA 2VZEA 3FFXA 1O6ZA 1ZGAA 4MV1A 2FR8A 3TSZA 4NIMA 4QM7A 1LDMA 2NT3A 2XQFA 3T7EA 2JNWA 3IDFA 3NOOA 4IDPA 3W5UA 3BJIC 1KZYC 5JCJD 1FFSA 3DYVA 4I55A 4BQSA 2FA9A 1MAHA 4BN0A 4BCBA 4BVBA 3ONVA 2HRRA 1AZLA 5ALFA 3VPAA 4EI9A 1ZJZA 3M7IA 1G1AA 1RD4A 3OPVA 1P9LA 1JFFA 4Q1EA 3T5CA 2YS7A 1IQ0A 1XZKA 2F43B 1XFAA 1YZFA 3OWHA 1XF9A 1JDNA 1TO6A 1VHJA 3CUWA 2J41A 5JEDA 3KJFA 2ODAA 2WYVA 3TKAA 2NNLD 4NBSA 5HTOA 1DUIA 3MJ4A 1IN4A 1XN1A 1LSUA 2VF5X 2F3SA 4LDAA 2HSJA 5HILA 1RYFA 4D99A 5FWDA 5LA6A 5H8WA 1KAHA 5TQ0A 2C3UA 5EZSA 3VMMA 1YIOA 1G66A 1AN0A 1KP3A 3H8SA 5K8IA 5G4LA 1Z6XA 4ENVA 2RJ3A 1EAMA 2ADFA 4HNAB 2WZCA 4B6QA 5B58T 2ZPAA 2P9TA 3KOWA 4C4AA 1Z18A 4IVQA 4PLCA 4YAJA 3VC2A 1D4ZA 3Q2IA 2LV8A 4U4AA 2BEWB 2JAWA 3CNHA 1PD0A 5TIIA 3VH2A 4GGPA 1T25A 2XMSA 3IHKA 4IAOA 4D45A 3SWWA 1NVGA 2O3RA 2HK6A 2DAPA 4MPPA 5I48A 4RD1A 3CU5A 4TV8A 2J7KA 4WT7A 3OJFA 1QV6A 2Z5LA 2XDQB 3SVLA 3QBTA 2QSJA 4K40A 4S1OA 3RC3A 5FWXA 2Q3CA 2X19A 4PO8A 4LISA 1Z7WA 5DCUA 4ZZ0A 5EZYF 4QQ8A 4H7HA 4IWYA 1YBMA 3ZTWA 3D2CA 3JQEA 4A5SA 2GN0A 2YWRA 1DBIA 1USIA 2RG7A 3D31A 2HADA 2BEVA 3GP3A 5KDLA 5BN3B 4JUFA 1RPJA 1Z6QA 3OLXA 3CW8X 4DZRA 2ZJ3A 2CLOB 4UPEA 3O84A 1R0XA 1LPOA 3K0AA 4Z4FA 3NIBA 4EUKA 4LF7B 3F3KA 2ORIA 1QGZA 2IRWA 2EX0A 2EBUA 1VLMA 1T5BA 4UHEA 5SICE 4CT0A 4URZR 4RMNA 4HEA1 3GLFA 4NOLA 2ZRHA 5TE9A 3CH5A 1UBEA 3OIFA 4MWCA 4OJQA 3TAUA 4DCVA 2OHJA 4KRGA 2X9GA 1SK9A 2I6UA 5HGJA 4WEQA 2JRLA 3O47A 3KG2A 1QKJA 3DVQX 2EJVA 1H3EA 4MHOA 4AAYA 4JY7A 4WOJA 1RXIA 2CMDA 1RLTA 3W5AA 2X9LA 1QUEA 1U3VA 2Q0QA 2Q5HA 4JX8A 1SC6A 3JQCA 3E2MA 1STOA 4I9GA 2B8WA 3WQHA 3DLPX 2PKWA 1VBFA 3JQQA 4MV8A 3VZPA 5BMOA 1WPQA 1BS9A 3H11B 4TXNA 4MQ6A 4GKKB 3TGWA 5AVSA 5LSAA 1XJCA 1Y42X 4B6JA 3KTAA 3HO6A 1GA6A 2NTNA 4HNRA 2FPPB 3AFNA 3DYBA 3A9SA 1NONA 3KPVA 5LLSA 2IXAA 4US2R 1VA4A 4M0PA 4BO8A 4EW6A 1M7BA 3CLUD 5AFSA 3O31A 5AVVA 5FA8A 2NO4A 5C7OO 1JI3A 4QRHA 5AVXA 3OEED 4CLEA 3K9FC 3KC2A 3L1VA 4B47A 1GZUA 3WJ2A 4G1UC 1VL1A 1X7GA 4OSEA 5EPOA 3ZE7A 1RM4A 1ZH4A 4N5DA 2QHXA 2X9VA 3NC1C 2HMSA 1AS3A 5AJYA 5HE9A 3GDWA 3L07A 3UGTA 4R3UC 3CUTA 2H6EA 3QKSB 4IJ6A 2E4XA 3V2IA 4BV3A 5JR3A 2Z6AA 5CPBA 2CVHA 3B1WA 1GRNA 4DRXA 3M9XA 1BWRA 3PSAA 4X7PA 1TA4A 1MB2A 4XARA 3RVRA 2HD4A 3IEIA 3QFFA 2Z8YA 1HFEL 4A15A 5ESDA 4YJ2A 1V8OA 2XVYA 3WGOA 1U1CA 4WN9B 1XAGA 1JSRA 4R8VA 5HIIA 1G3IA 3LFUA 1FBTA 1N92A 3VAZA 3ANLA 1YJBA 4S0ZA 1PR5A 1GAWA 5BY2A 4NFHA 1N8KA 4PZEA 1YL6A 3C8UA 4MQFA 4U3JA 1Z4JA 2HXYA 2WJGA 1A2OA 3SNHA 2NZWA 2A88A 2EJCA 2J0UA 4PTZA 5JS8A 3TDNA 1SUSA 2OCYC 2O07A 4MRVA 1CFJA 2OAQ1 4P81A 5BSEA 3G0HA 1SXJA 5IK2D 5KTMA 4FWTA 1C0KA 2F1JA 4QUEA 2EZ9A 3P2YA 4AD8A 4JX9A 4E30A 1SXJE 4NICA 4WOKA 1X7ZB 2IPAB 3DKPA 2ZR8A 4ADSG 5IF9A 2J3IA 1LKZA 1C1DB 4KXYA 4P22A 4CQMB 4CEJA 4NBKA 1I6LA 2CUNA 1EJ0A 2QVGA 4QGAA 5E2IA 3L0DA 3A3KA 4FEEA 3RI3A 1HE5A 3F73A 2VP0A 1OWOA 2J5BA 1MN6A 4BRUA 3OJLA 1PP4A 4PQFA 4PYIA 5B1SA 3JPWA 5JVDF 3GH1A 4JAVC 4RE5A 4GQAA 5LZ4A 4R2HA 1SCUB 1TW3A 2A1UA 1PS8A 5IANA 2NYUA 2RAUA 1OI4A 2GS9A 2Q41A 1A71A 4XPIB 1KYZA 3DVSX 2P2LA 2HCBA 3K53A 3VISA 4DV3B 4WA7A 3H6KA 2QVZX 4NU0A 2IBTA 4FCWA 3U40A 3EVFA 1R6BX 2UUPA 3OLWA 2YJNA 3MXTA 5FI3A 1FP4A 2EAUA 3ZWCA 4IXNA 2B8NA 3LGSA 5FR1A 2ZBGA 2ZZKA 4TKVB 1Q20A 3SC2B 1U8FO 2G9ZA 1M76A 2PS9A 3ESDA 1XYGA 5BV2P 3F7TA 2PEYA 4PZYA 4JUBA 4UCWA 1BE1A 5I7SA 1QRRA 3ABSB 3KFLA 4GPEA 1SD2A 1ZXBA 2C3OA 1HL7A 4D44A 1N6PA 1Z4KA 3VM6A 5L7TA 1EGVB 2BMWA 3TTTA 4N5IX 2O3QA 3HUUA 2QZJA 2VH2A 3BCSA 1AXRA 2CNNA 2XBUA 3FLMA 5L3SB 4CQJA 3IIKA 1IY8A 4LVCA 3L0CA 1CDDA 1QIEA 4ZA2A 2AE1A 1GZ7A 2Z5VA 5C1PA 2JI4A 5TQVA 2VUUA 5EYPB 2HKIA 5BPHA 4MUNA 4EECA 5I6DA 1T9GR 1AU9A 4A2PA 1JZTA 2XB2A 1N1MA 5G0VA 4FYJA 4A16A 4UATA 1L8AA 3W5SA 2RHWA 5HE8A 1OJLA 4BRSA 4R2KA 3D8RA 2M9MA 4TYPA 4U6QA 1YB5A 4BE4A 5EJ7A 2IYPA 1O97D 4QYMA 1NM5C 5TMDA 3MAGA 1BVUA 4WXYB 2Q2NA 3P9XA 5LZ5A 1D1PA 2WOJA 1U2DC 1L5HA 3DVLA 1H1LB 4BNNA 1KZ7B 5DISB 5A5VA 1A9YA 2XE8A 1VE7A 1GPWB 3S81A 4NE9A 2YDYA 3AEKB 3R0XA 4Y9TA 5IJXA 4YAKA 1LRKA 1E9RA 5CX1A 4OI2A 1Y5RA 5JNLA 3C7DB 1QCYA 3CF4G 4HDSA 2GUWA 1XO1A 5M7EA 5C1IA 5LJIA 2OORA 3R3VA 5HZKA 1WXDA 5AI9A 4QPCA 3ZU5A 3GRPA 4B0OA 3MTDA 4XEUA 3ELBA 3ECAA 4NS4A 1RRVA 2UZ1B 5F78A 1EHIA 3FD8A 3GQBA 3K6JA 3LGAA 4LNUA 1YRHA 1PNTA 4HGOA 4YAWA 4B2LA 1CC1S 2HQBA 3R9XA 4CUKA 1Q83A 1MO4A 2QRVB 1DARA 4URWR 1G7RA 1IK4A 1BG6A 3DE7X 2PUFA 5H83A 3NT5A 1N36B 5BURA 1P4JA 2N47A 4LE2A 5IT5A 3LW8A 5EP4A 2V98A 3LWBA 2RGUA 3RE1A 2W6OA 2Q3DA 4LS3A 1B0ZA 1VHQA 3IEXA 5E6UB 2JAHA 1EPUA 2FMIA 2C94A 1TPZA 2H5IA 3QTBA 1I6MA 2WAMA 2QQ5A 3FAKA 3BICA 4R7TA 1ES9A 4NVRA 3TLBA 4PPYA 3GGDA 3PQ3A 3OECA 1TQDA 2VJLA 2W2PA 4L8GA 4PQYA 1YR7A 1Z8NA 4PLPA 4ENTA 5HVNA 3NH9A 8OHMA 5K6RA 4BMNA 3LG2A 4NECA 3GLGB 2LKCA 1G9SA 1GTJ1 2AI1A 2V7UA 4KGDA 1BKYA 1PFQA 3D8SA 4RACA 2WW8A 1SCUA 2A1UB 2FW7A 2CJYA 3R3YA 4WJZA 5B4UA 4E31A 1LQUA 1OZGA 4HDRB 3BK1A 1BCRA 1PJLA 1F20A 3U17A 3IAFA 3MC1A 1OLUA 5L95A 3ND8A 2FPUA 3PZBA 3TXAA 2ZIUB 2QLJA 1VIAA 2OQIA 2EVWX 1WXIA 3W8NA 1TQ2A 4IXDA 1RXSA 3EMKA 4E46A 4IIDA 4LZOA 1WP9A 5E9JA 1UMDB 3WGIA 5LDGA 3EUAA 4P54A 3SICE 5B1YA 3L04A 4E1VA 4WZBB 1VLHA 4F4HA 1KYVA 1Y6ZA 3U4HA 2WJ6A 4XIGS 1QTIA 3KVNA 4OSPA 1N8TA 1YK0A 1N2XA 1VYVA 1Y8QA 3UW1A 5AW4A 2VTVA 5B1HA 4C3ZA 2VCYA 3ZVLA 2BZ1A 4IZHA 1PSWA 3PGKA 1GRQA 1Q1EA 2FUEA 3QH4A 4FILA 4AO7A 1RKXA 5IAOA 4L78A 2AC4A 4URFA 4YYEA 4B33A 5J43A 2QQEA 4PAQA 2RGNC 3SXPA 1BA3A 1J20A 1LJ8A 4LBWA 4BNKA 1TADA 4J3FA 1LNQA 2ZYRA 4UFNA 5A4JA 1NUQA 4FCTA 1PT7A 2ACWA 1VBKA 4IQFA 4YVFA 3B5JA 4B4KA 4B5KA 1YH3A 2IXDA 2XH8A 4WHMA 1M5RA 1CB7A 1NVMB 1BRTA 3LP5A 2NU9B 4XX0A 3CRQA 4MIYA 1T4GA 3LLMA 3LQKA 4KX5A 4A8PA 4TTVA 4PSAA 1F1BA 3ZGNA 1DEXA 1E8DA 4RFVA 3IMFA 5BT9A 4B1FA 4EVSA 4JP3A 5ITZB 1PR0A 4CEHB 1YDFA 2O1WA 4N6GA 3B8HA 3H7AA 4PN7A 4ZIRA 9LDBA 2QWXA 4QT4A 3LT0A 3GZNB 4DCCA 4HUTA 3L93A 2E37A 3J7TA 3NAMA 5DCYA 1T6NA 5CB0A 4JJAA 1IRIA 4ZAXA 1NFRA 3RUCA 2I7XA 5L4SA 5L8VA 2XUKA 4JI3B 1QP4A 3U7RA 1J1IA 1UZMA 1ANKA 4BQPA 4I50F 1Q14A 1YVDA 4E22A 4QJ4A 1THMA 3RUPA 1OW3B 3FLAA 3P0RA 3KAPA 1T1RA 3O3CA 5EHIA 3REOA 3WP1B 3M6XA 3JZAA 2TSYB 2ZRBA 2FRDA 4IDBA 2A30A 1E79D 4XIFA 1CE8B 1YT5A 1E1RD 4I1PA 3LHDA 1IZZA 2VK2A 3PC4A 4NAHA 1LJUA 2FYTA 1O5IA 4NATA 1K7SN 5HHTA 3OJXA 2ZTLA 4QXAA 3F6BX 4JH0A 5E9AA 3VOSA 1EJBA 1AH2A 2IX3A 4OHYA 4YRNA 1HE8B 1ZR4A 5HSGA 1V4BA 2OXRA 3RYHB 1OA1A 2Z6QA 3LQ1A 4MIKA 3UKJA 2AZMA 1L7NA 4PG8A 3CM0A 3M83A 4E13A 5E1DA 1XTBA 1WEKA 4U2KA 4AJPA 2P4SA 2HWWA 2Q9BA 2AH5A 3HCWA 2VTBA 5F52A 3JASB 4DR2B 4OLHA 3OPXA 1OH7A 3IAM6 4FMDF 4RZQA 1G5PA 4OEHA 4UREA 1NT2A 2YMMA 3AKEA 3BL5A 3C43A 1JE0A 2GAOA 4RNCA 2ZVQX 2WSSA 3VR3D 2OFFA 3VU9B 1ABFA 1QPGA 4BRWA 1W19A 3GA7A 1K68A 2GNOA 3HBJA 3A36A 5HZMA 2ST1A 2OQRA 3ETHA 4ER3A 1QJ4A 1V1MA 4UBNA 4XXHA 3QVJA 5B53A 3SZLA 2XE6A 2E55A 4MZDA 1LX6A 1MNQA 2H17A 1PT9A 2BCEA 3EXFB 4FEAA 2FEOA 3SJ7A 3WTBA 4HH4A 4JP2A 2QN9A 3O2SB 2WU1A 1T4DA 3K7EA 4IV5A 5ALTA 5HQ3B 3F5QA 2C8VA 5JADA 3RR2A 4S24A 4LMPA 5DBEX 3U3DA 4YHHB 1TEZA 1Q2XA 1KE2A 4BKMA 2FWNA 2PXAA 1G2PA 3UG6A 3CEJA 3OP4A 5CYOA 1Y4ZA 3JAWA 3IESA 2V1XA 3FUCA 3FNFA 1XC7A 2XOXA 3JW8A 1ZNYA 4DMCA 1Z6ZA 5FBHA 2B4RO 4YUAA 3EBPA 4EB3A 2ZE5A 3BHMA 2HQRA 3D3JA 4OHFA 4EUSA 1KJQA 3EISA 2CUTA 4M9XA 3EASA 1WDWB 1TYDE 2FF7A 1O95D 2O5VA 2FXIA 4KIGA 1DAEA 2GAIA 4RD4A 4OQZA 4X1KA 4PTLA 3C6QA 4AF6A 1KHHA 4TLLB 1Q7TA 3KKQA 4RIIA 3ECCA 1GY8A 1IPHA 5G4KA 2CEAA 4WZBE 3U56A 3UB4A 1OAAA 1SEPA 3E5MA 4FDUA 4PYRA 1PZEA 2CN1A 3U6KA 2JFWA 3R0VA 2MMCA 2JI7A 2BAGA 1SZCA 3PFBA 1P7CA 2NP7A 2VSNA 4YXFA 1MCZA 1UMBA 5F9HA 2ZZNA 2HBZA 3CSDA 2W6NA 3WGYA 4EG6A 5L6MB 3EGVA 1LVGA 1NTOA 1D4AA 3KSRA 1T4BA 2VDPB 5C7LO 3DR5A 2IV7A 4M55A 4QVIA 3M82A 3OQOA 2AJCA 4UD6A 5DCLA 1FNMA 4DJAA 1RKBA 3EFOB 1K4YA 1MH9A 2GHIA 3MYYA 2Y05A 2I1LA 1NW9B 2Z83A 2CXOA 2CLKB 3U31A 1QCCA 5LBUA 4LWZA 3BMNB 3UUFA 3W1VA 1VRVA 4I4IA 4LTMA 1TJYA 1FYEA 2BRUC 3ZNPA 5CB4A 4RTMA 1EA7A 3OI7A 4A36A 4Y9DA 3KNZA 4MKIA 5KSWB 2P35A 4LXGA 4RESA 3ZZMA 5FPKA 3TZCA 1NW7A 1JEYA 3AL0C 2I4IA 1SUAA 3PVCA 4U1RA 2RHHA 1YGYA 2C96A 4PR0A 3UM9A 2Q8PA 4F2WA 4NYMQ 2IU0A 1J2EA 3FCXA 3CN7A 1L9XA 3QA9A 3GDHA 4MV0A 4O0LA 4TMWA 2B8TA 3PWTA 4TTTS 5ILGA 1KDYA 3UMBA 3U5TA 1Y7TA 5ULLA 1X0VA 3B9PA 2BEUA 3AT1A 5DXAA 3I6ZA 1YR8A 5FOVA 2PRYA 5K0JA 1OXXK 1N6OA 4XM0A 5CNIA 4AP6A 3FMGA 4C4YA 1FLAA 2JLQA 4WBNB 5ABPA 1F2UB 2BFNA 2HK7A 4ESEA 1PKXA 2IEDA 1D6MA 1QMGA 3RYIA 4V0NA 1JIVA 3UAVA 2GESA 1ZK4A 3G7UA 1UC9A 3BHJA 3IDOA 3ROEA 4R3NA 1Y6FA 1TVKB 4O33A 3W8EA 2Q0XA 3S29A 5BNWA 1CX9B 4PONA 2H5JA 3JZFA 2CCJA 1QIKA 4MQMA 2QUJA 1E0SA 4YX9A 2HRZA 1EYZA 4TLEA 3RIYA 3HDGA 3TD2A 2IF0A 4PLTA 3ILXA 3I9LA 1ISFA 4Y2YA 5JANA 3A9VA 3QBEA 1R8QA 4RLQA 1JLSA 1E3SA 2YC2C 3FB1A 4BAGA 2IHNA 2GX6A 1PW7A 4HYEA 4NOMA 3E03A 1KBOA 1VJCA 1E3WB 2VF2A 5E3JA 5KQSA 1WDLA 3H2IA 1DTSA 4DNFA 1J8QA 1RKUA 1KQPA 4CM4A 4TYWA 1MG0A 2IEAA 4M1YA 3AEUB 3IPLA 1VG8A 1Q19A 3AP1A 1EDOA 2A0FA 2FKNA 2HPAA 3L02A 1SCDA 1CJUC 4CKCB 1DRKA 2G80A 1U8AA 2GUGA 5I9SA 5JYCA 5KYWB 3EGDB 4Y67A 1P74A 3Q2OA 3RODA 3G88A 5LJLA 5C8XA 2JJYA 1HDXA 2PGLA 1LSJA 4DDKA 1KO4A 4HY3A 4URXR 1V3UA 2PX0A 3AUAA 1M3SA 4TLBA 1ZCFA 4RJJA 5GGYA 3SX2A 3LYLA 4CFYA 4D4MA 1JKMA 3ZHRA 2VLBA 1FTSA 2X3FA 3IV7A 1DLJA 2XD4A 4AZSA 4HMPA 1I7SB 1UMBB 2XNCA 4GXRA 4HPWA 1N6RA 1ULAA 1XMVA 4RSRA 5H02A 1UODA 4RTSA 1V6AA 3EGXB 3I1YA 4KLZA 3OTWA 4YQYA 2PFSA 2OESA 3WQRA 4MO9A 3EIOA 4EQ6B 5KJEA 5EJ6A 1RHQA 4IFIA 4B7XA 3FIJA 4RZ3A 4C07A 2BTEA 3G2JA 3N59A 5KAMA 2E87A 1KFKB 1YACA 4ZVVA 1KFCB 3FDJA 2WE7A 1QF7A 2H1IA 4ZN6A 1X3SA 3BMNA 3A2KA 3A1TA 1AQUA 2W2NA 1CYDA 2ZRGA 3L3BA 4E33A 2BGTA 5F51A 4M8LA 3A3PA 2Y1OA 4OGGA 4Y2SA 3IMCA 5JY6A 5HZHA 1EESA 3VUEA 4F84A 1FVOA 1ZCBA 1ZVMA 2FZVA 3IMGA 1D7OA 2XVZA 2CVQA 4HGPA 2WUFA 4KLCA 4UVDA 5BORA 1FSPA 1OB2A 4K26A 2C54A 3BDIA 3DE3X 1F9AA 3K70D 2ZJFA 3UHAA 1CRZA 2DWQA 3QF4B 4G0OA 4NU5A 4RTNA 5A6SA 4C20A 3QOXA 4OBEA 1D07A 3H2JA 5DWQA 3GFSA 1UBJS 1KI1A 5KTKA 3IODA 3E0QA 1PL7A 3QLVC 4HK4A 3D1VA 3NVAA 1IEXA 2YQ5A 1UKZA 1KQGA 4Z3OA 2HF2A 2Q7OE 1A2KC 2QUBA 3BWBA 1Q0SA 2DFKB 2A58A 3F1KA 1I30A 3KU1A 1OZHA 3EZYA 4MTCA 4J0HA 2IYWA 2DG2A 4CFSA 1MO5A 2F9LA 3IT0A 4G3XA 4GRIA 4U5QA 2HU7A 3A6FA 5IKEA 4DRXB 1QTNA 4C4XA 2QVYX 1KR2A 3GT0A 3TM4A 4JT8A 1MX1A 2JLRA 2O05A 1X0XA 4Q7EA 4YWJA 5ALIA 3LY9A 3TCKA 4TKUA 1Q0TA 1FSSA 3FE2A 4K0RA 1NI3A 4C4TA 4LFAB 3EBOA 4JLNA 1NPYA 5F1YA 1GFIA 4DJFC 5DBGA 2X5XA 1YZHA 1L3IA 1M2KA 3A6EA 3R3UA 4ZZ3A 1IUPA 4EABA 1PW5A 3DO6A 5KNDH 4RVFA 4BGIA 2AZXA 1OGIA 2I78A 1VG1A 4HWOA 4BN4A 1QB8A 2AMFA 4UAVA 5CCDA 2YH2A 3OIVA 1T3GA 1VHTA 4EPTA 4F5DA 4ALMA 2OD7A 3G0GA 4O2BA 4O4JA 5DBFA 2AUNA 1REQA 3R7BA 1JKFA 3ABZA 3A1SA 3F4KA 5BXQC 3IT1A 5ER6A 3OEWA 3G7NA 1EVKA 2RBKA 3OEHA 4DCOA 2R3SA 3KVYA 2X9NA 3OZFA 2FX3A 1REQB 5HM6A 1KSFX 5DWDA 1JJFA 2Q5FA 1SPBS 1GCOA 1UKCA 5DEOA 1XXLA 4MDYA 3D5EA 4JXKA 1NV8A 3WMEA 3ZHXA 3EFOA 4YV7A 3K2IA 3GGCA 4O2AA 5FRDA 2DWUA 4MQBA 3T15A 1Q7GA 3KQOA 3K96A 8ATCA 1ESNA 4KQJA 1W6UA 1Y4AE 1TF7A 2DFTA 1B2RA 1XKTA 2JGDA 3I1JA 4HWKA 2C9CA 3JSAA 3K5PA 1X8LA 4KSYA 4TN5A 1VLLA 1XCMA 2D3TA 4KFRA 4RGBA 5GGXA 1G7TA 1PYOA 3OMLA 4RTJA 4YJDA 2QBYB 4F60A 4HX2A 3FMPB 1EBBA 3PQ2A 4GOLD 2BGLA 4KQKA 2QEQA 1B6GA 1ZZGA 1XVTA 2Y9MB 3KSZO 3OJEA 2O8EB 1YZUA 1WBBA 2CFCA 2W2LD 1H2AS 3BWXA 4IMPA 1TLFA 1YJCA 1YB1A 1ZGJA 4RK5A 4ME6A 4JC5A 5TEVA 2DGDA 1R0SA 3G68A 4AY6A 5EG5A 2RHBA 2VXOA 3NV7A 3GEMA 4BKRA 1RWPA 3D4OA 4AB1A 1JQAA 3MWLA 2PZKA 2YJ5A 2VIIA 5JH7F 3OJCA 2I1QA 2L0XA 2FPOA 3F7NA 4G1MB 5EJ9A 3EXAA 3IIEA 4V0SA 2JLWA 2CXNA 1BHQ1 2QRUA 2VDLB 3N05A 4YMWA 3QE9Y 3FAZA 3ZWNA 2AOVA 3MWEA 3DAGA 3R24A 1HC7A 1HT1E 2IYLD 2F48A 2A5FA 2P67A 3MTIA 3RSQA 3NRJA 2I29A 2IEYA 1WOYA 3RTCA 3OZAA 3WDMA 4BMZA 1Z4LA 3TLYA 3JD2A 1IVYA 3VVCA 1BDIA 1CUCA 3WIEA 3JTMA 1Z37A 2ZR9A 3GNQA 3L8GA 3RRBA 4DDUA 1F0KA 1XXHE 4DLPA 5CBKA 2FPLA 1QM5A 3OLYA 1OBOA 2HNAA 2P9JA 3PNLA 3LLUA 3QE0A 1WMBA 3E05A 4AZWA 2JLXA 3G6KA 4QYIB 1CUEA 1F6WA 2ZATA 3LXUX 5I4IA 3DB2A 4CTKA 3VZDA 4ENWA 1D1QA 1FFXA 1USGA 2H16A 5I7HA 1VPWA 4AMUA 3B89A 4GWGA 2BONA 4K86A 4CKXA 4F04A 2EL9A 2IXFA 2I7CA 1SXJB 1TUIA 3WA6A 2XUJA 2R8YA 1ZJWA 3T52A 3FUWA 3R5FA 2BFWA 1SVWA 4WZAB 2QSZA 1OH5A 2CNOA 3MUFA 5JE8A 5A1TA 4I1UA 5C1OA 4BU0A 3EGWA 2P3OA 3CNBA 1QS0A 3H2HA 4E07A 4LXQA 3DKVA 2PVSA 5PGMA 5C4IA 4IVRA 3NYIA 2BMAA 4J0GA 2WZDA 3CX3A 5FV4A 4CJXA 4PIPA 3TTXA 4TMZA 1EFPA 1T4CA 2OUIA 1H2XA 1V39A 3F3YA 3LCRA 1RCUA 2PX5A 2ZJ0A 2FLVA 2GLXA 3O8QA 4BFLA 4D0SA 1DB3A 3ORSA 3A9RA 5U4QA 1KI3A 1JRLA 5EJMA 4FLMA 1OYYA 1U2DA 1RTTA 1H4VB 1JG7A 4HQ6A 3TZ6A 4JI8B 2Q6LA 3I72A 3K2BA 4RHYA 4TLAA 2FE4A 4L72A 2MT9A 4OXXA 4C30A 2Z1NA 4QRIA 5IBCA 3T7IA 2IEIA 2XODA 3MS2A 4DCJA 1HKHA 4AJ4A 2IYXA 1NTRA 1EUZA 5AK0A 3QW2A 2CFSA 3ZK9A 4BLQA 4LCBA 2YUTA 1UPCA 4C3UA 4UARA 4WDRA 1ZSNA 4ZKEA 2BH2A 1RACA 2PDAA 4PTYA 3SU8A 2NAFA 1W5AA 3DKRA 4GWKA 3OLQA 5HPYB 2I65A 4AJIA 5J2UA 3FMFA 2C3MA 3KR1A 1XZPA 3IPXA 3KS9A 3OZWA 5FUMA 4ZKDA 2GD6A 1T29A 2FQ1A 1R0LA 1TA9A 5LP6F 2ZUEA 1R0KA 2PMCA 1RNLA 4NEQA 2X8WA 2C5AA 3D3EA 5ARBA 1G4UR 4FCCA 3NOXA 4LZAA 2WSBA 1PSZA 2YY6A 2R0QC 3WKCA 3VJRA 5F2NA 4IEIA 2W2MA 4GRDA 3VRHA 1R00A 4Q01A 4YCJA 2AN3A 1MJNA 2B83A 4JJ6A 4BMVA 5AJTA 5DN6A 3E7FA 1UJ4A 1KK0A 2FLWA 2ODPA 2OFOA 4CLRA 4FBLA 2HRQA 4LOAA 4PC2A 4Q15A 5EQDA 4QG3A 4WFQA 1O95C 1DUSA 1AQJA 3R3HA 2PH5A 1E6LA 2EG5A 1ZD4A 2ON6A 5FUYA 2CJPA 3B1FA 2NX2A 2BBOA 1CEXA 1JHMA 1N2CA 4BQRA 3G8CA 2B34A 1WZEA 5C51B 2E5FA 4ZQBA 3PX3A 4MINA 1OYWA 1X8XA 4PU0A 3IC5A 3RVLA 4YMVA 3BH7A 4CCYA 3ZWYA 4GP6A 4LRXA 4QNNA 1BVYF 4KQEA 2QNIA 3WAKA 3F9IA 4GOJA 2VT6A 1RQ7A 1FNCA 1QFJA 2X15A 3OT4A 4IH9A 2JGKA 2WFMA 1TVCA 1U31A 2ID4A 1SRQA 1IFXA 3LUDA 1U5BB 2QY9A 3RAFC 5CA0B 4MHTA 3QX8A 3BGDA 2Q1WA 1IWBB 1CTQA 3A06A 3L1JA 3PXXA 4HRVA 3EXIB 4K5QA 1B8UA 4L51A 4N0PA 4DQVA 4PC1A 1KYTA 1OREA 1N6HA 1KDZA 1VP9A 5CIYA 2B78A 3P1JA 1TYEB 4EY6A 5KJ1A 5KNLA 4KU4A 4X71A 2NVOA 1Z38A 2J45A 4B9EA 3BBLA 1OH8A 2UVDA 4J1QA 2HIGA 5K3DA 5JAOA 5T3UA 4FS8A 4WXMA 3MUNA 2EJWA 1Z5WA 5KOHB 3WGLA 4C7OA 3WLJA 5CB4B 1SM4A 2JFNA 4C0WA 1U3DA 3N0RA 2GBLA 1B2LA 2HMYB 3HN6A 1KIAA 3RRNA 4D4LA 4N6NA 4E88A 1X9HA 3IQZA 1DG3A 2BMJA 4Y2TA 4ZI5A 3ISTA 4JCOA 2B9VA 4FBMA 4A6DA 2FMFA 1NHWA 3COJA 4P4NA 4IRXA 1PFVA 4TKVA 4J0JA 4DYHA 1ZGGA 4C5BA 4UCQA 1FVFA 1K4MA 1KDRA 2P6MA 2YWJA 3F9CA 2WB2A 1NMXA 1CY6A 2VFAA 2UYCA 4MEJA 4QGHA 1PWXA 1NYQA 3T99A 4HTFB 3WLMA 4PZZA 1DC7A 3F49S 1VKNA 5CDYA 1Q6ZA 2VHWA 4JKOA 4LJ5A 4TMXA 3RV3A 2PK3A 4L50A 3S8MA 2Y67A 3WRXC 4EAAA 1E6EA 2CBXA 1RI5A 1IVSA 2YW2A 4YRMA 5CYFA 4YRKA 3E81A 1UPTA 3AKCA 1IN6A 2GJ4A 3MTQA 4MS4A 3R8XA 4FW9A 3I52A 4WNYA 4MW0A 4NBRA 5B2FA 2DUJA 2P9YA 1AKMA 5AT1A 3VYRB 2NM0A 2DPHA 1M8GA 1KF0A 4GNKA 3K70B 1NY5A 4MS4B 4Z9FA 5HBRA 4F3RA 2XVXA 4D0RA 5CFQA 2BFCB 2Q3MA 5LU9A 1E1KA 2AEMA 1E94E 2P1RA 2Z95A 2A1TS 3IR5A 4K2HA 4L9AA 5B55A 2GWHA 3ILYA 5F12A 2B5VA 3C3CA 2YXNA 3L5KA 4YRRA 3ZWPA 2YS6A 2EOAA 1FDTA 2F55A 4LYFA 2N46A 3UANA 1E96A 1TD9A 1U98A 3TFQA 1JFTA 3PI7A 1KC3A 4JXJA 2P0EA 4NOJA 1DZIA 1GPLA 5KNDA 3U81A 4CEHA 3UJNA 2V4ZA 2V6FA 5I7RA 1CQJB 4R2XA 4Z0TA 2V6IA 3AEKA 2B3DA 4TMKA 4AT1A 1EE1A 4JU9A 1IRXA 1MG5A 4GICA 5DTMA 1SKBA 3DQQA 3EXG2 4I3FA 4EPVA 1S3GA 1HEUA 4JD5A 4MQUA 2LE0A 1CQJA 3KU4A 1YGPA 4F97A 4LEIA 4GXTA 1RRFA 4NU8X 3LQYA 4G5SA 5B64A 4KXLA 4LSWA 1JB9A 3BWMA 1T4CB 4QIHA 2H54A 3S1AB 1DAPA 5BQ5A 4BX8A 3QKRA 3UK0A 3NETA 4XFKA 3UB3A 2F90A 4F4DA 4DMRA 2HQOA 2C82A 1B1AA 1FDSA 3SYNA 5A3SA 3BB4A 3UWKA 3GRRA 4UEWA 2XX3A 3U09A 3DE1X 3BDVA 1ZICA 1CULC 1WO8A 1Y9EA 3KM0A 1XDZA 5TQ2B 1ZCZA 2GILA 1EDBA 1PNVA 1GUDA 2IPLA 3OE7D 2O8DB 3DDHA 2QXTA 1XE3A 1RW4A 4JGBA 4PNEA 2VRBA 4R1LA 5KKAA 1ZN7A 4NNPA 2X1MA 2WU3A 1LDBA 2QT9A 3BVPA 5LA6F 4CG0A 2G5GX 3ZJ5A 2GWRA 2C5SA 3CY6A 1I9CA 5K1ZA 3R3JA 1U2EA 4H6WA 2AN5A 4D82A 1OPXA 2PFGA 4GPBA 5HF5A 3RC2A 3ZWMA 1CV2A 4CIVA 1E5TA 1VPVA 4MVJP 1ZX1A 1OC4A 1TDJA 1U80A 3ZY4A 1PR1A 1TCVA 2ZT7A 1ECBA 3PI6A 2D74A 1TTPB 1N7GA 3IQEA 3LRTA 1PGNA 1ZH6A 5K01A 3ZU6A 4GL4A 2R44A 1U1DA 1U2SA 4BJ3A 4ZTBA 5AW0A 4FINA 3FRJA 3LC7O 4RQBA 2C03A 3IUQA 1J8FA 1O54A 1PFUA 1PGOA 2IOHA 1W93A 4IOLA 2IU4A 2NUBA 5ALKA 5C7IO 4D6YA 3LUBA 3GJ7A 4Q9AA 3RAJA 3ZPXA 1BN7A 1RKQA 3DTYA 4G0QA 4QARA 5GZ1A 3ZEIA 4M0CA 4NENA 5BSKA 2CL6X 4IJQA 2ZJ4A 4DLVA 3OU7A 4JT4A 3W6PA 1B42A 3CRVA 1T43A 3BFJA 2R00A 1VXOA 3IHLA 4Y3UA 1OFUX 3P19A 3ZWVA 5IYZF 4Z1OA 1EP3B 4B34A 2IOFK 1SFRA 1J8VA 3SVTA 2ZSBA 1VJGA 2RGWA 2OO5A 4FFOA 4ZPJA 2OXTA 3B48A 4FFDA 3HABA 4JMLA 4KQCA 1FDOA 3SDBA 2E9SA 3KPYA 4Q18A 3DAFA 4JVMA 2Q4BA 3LUAA 1F2DA 2WMDA 3DL2A 3A9UA 3H2SA 3MSCA 4JEUA 4KQFA 4BO4A 3CTMA 3ZGZA 1W9MA 1A69A 3LSTA 1MPXA 2R9VA 2XEXA 3HJAA 3OZVA 1W87A 3KUCA 5E4JA 1E2JA 1KC1A 1HUQA 2QLLA 1U0LA 2ZIZA 5E6RB 4IFEA 5FBRB 1KMHB 2PU7A 1Y82A 3CX7A 3Q8MA 4JBIA 4FZ3A 2XLBA 3QOFA 3S2FA 4XX0B 3WGGA 4PLFA 3RLFA 3BCHA 2QN1A 1FVHA 3IQIX 4RMHA 5H59A 3HBLA 1R0WA 4QDTA 1WHSA 3VYSB 3DP7A 2GZRA 3R7NA 3A6HA 1XALA 3I4FA 3PR2B 4KMRA 4UMFA 4DLLA 3EXEB 2IP4A 3CCBA 3ND7A 4L0MA 5CCEA 1N2HA 1YRYE 4JLUA 3WAJA 3WS7A 3V5NA 1AKQA 1W0CA 1FFWA 1CYEA 3P2IA 3B3FA 1DX6A 2HSDA 2C61A 3HR8A 3U6BA 4OMCA 2Q6VA 2QRPA 4GP9A 3HKDB 4R69A 1ZM3A 4UUNA 5A71A 3A25A 1ZNXA 3CLHA 4PLGA 4W5HA 3FETA 1XLUA 3I5YA 1QHHB 2CK3D 1GQYA 1V7QA 2M1XA 5FP0A 2ODTX 1HQKA 1YOVB 3N7UA 3GRKA 2QMQA 4IR7A 3A3YA 4TMVA 1W36C 2I1WA 4FYWA 4LKRA 1BXZA 4RXUA 3RYCA 3NU1A 3ONNA 2CXXA 3I62A 2QAJA 1BMFA 1G5FA 4Q3DA 4QDJA 1FDIA 3RVBA 1KVRA 4QUIA 3CV3A 1QO7A 1H2YA 3O7MA 4B8ZA 1PLJA 1T35A 2V59A 3LXRA 1ZW1A 3IBGA 3NBXX 4NJMA 1O1YA 2OPHA 4DCUA 3B2QA 3U3XA 2CKMA 1W73A 4BNXA 1NF8A 2PUJA 2HNKA 1E6MA 4ND2A 2QYHA 1NMZA 1SHUX 2BWJA 3FWYA 2IWRA 3K4PA 3KEQA 3QWHA 1KEZA 3QUSA 2QMHA 4GGMX 1OMOA 4U9IS 3L79A 1DWOA 3GRFA 4AKTA 2C83A 4R1QA 1PK8A 3NLLA 3OX2A 3H4IA 4G36A 3TZEA 2ZQYA 5GJVC 3IDZA 1Y9AA 1UINA 5B3KA 3GPBA 2PZAA 1MIOB 5FULA 4AURA 1EVEA 2AQIA 2JAXA 1A7KA 4TYNA 5TPZD 5GV8A 4ISCA 2H00A 4Q4LA 1OX6A 3QEKA 1TLLA 2ZIFA 1O58A 1JDSA 1P1FA 3K0KA 3N76A 4R9NA 5BW6B 5CEEA 2YWBA 4QDZA 2BTQA 2NV0A 4K6KA 5AH0A 1YR1A 1KJ8A 1QRUA 1CJSA 3E1GA 2X5JO 5EMLA 1JN0A 3UOGA 1YR9A 4P4SA 4BQNA 3T3GA 4HLQB 2HC9A 4AS3A 4MUXA 3F2VA 3ZNOA 3MPUA 4BMDA 1W85B 4EFDA 1MV5A 2FWPA 3M4YA 1RHJA 3QTLA 3H75A 1J24A 2CL5A 1I0IA 4MP6A 4Z9BA 5JD6A 1HR0B 3SKVA 4C78A 4E94A 1CQIB 2CE7A 3LUFA 1FTYA 4RXTA 2H7VA 3FOWA 3QVKA 3BG5A 4JIMA 4CM5A 3H5LA 4E6EA 4YONB 2DH5A 4N5MA 3DLCA 1X94A 3HKCA 4IG9A 4IDOA 5F4ZA 4HDOB 5A62A 3AG5A 3HKEA 4QAJA 3M3HA 2QV7A 4KBFA 1RPTA 4KWHA 1OCEA 1TRHA 3OPQA 3UJDA 1JJAA 5LNK1 4UHHA 4YCSA 2WABA 3GGSA 3VDNB 1J9ZA 1U3UA 1SA0A 2OKCA 1KK3A 3G5TA 3IHTA 1HBJA 3LFTA 2KW5A 4QXPA 4G4JA 4GOOD 2SBTA 1OU4A 4PR3A 2Q07A 1C7FA 5AXDA 3E9ZA 4Z1MA 3RV4A 3KEMA 4P9NA 2V6JA 1XKQA 1P62B 4NBTA 4JJ7A 4RK1A 4B2PA 3CT6A 1GYRA 1K5HA 3IP1A 2OM2A 4CQMD 5EINA 1LCIA 9MHTA 2H8KA 3HGQA 1MVOA 2HA5A 3K1AB 4BNIA 2OHHA 5FR2A 5H68A 3VI3B 3WDKA 5KTTA 1MZVA 3TMYA 4CHGA 1YQTA 2A6PA 5F9MA 3OICA 1ZOOA 3DDCA 2VHEA 4C4RA 4KFTA 1DHRA 1E5QA 2ZUCA 4R81A 3DMFA 3AZQA 2FZ5A 1RRPA 1YZLA 4M1KA 2DHRA 3SDSA 3AF5A 2VH1A 1DIAA 5EMKA 4AJOA 4B71A 3MRSA 4OVKA 5BYAA 4B3RB 1ZONA 5JLJA 3I2FA 4EA7A 1JPUA 2ZDHA 3V9PA 4DV4B 5EKXA 1Z83A 1O96A 3MFQA 2XMCA 3RB8A 2I80A 3MHTA 1XAHA 4Z49A 4XUGB 5I8WA 4M1QA 4D8WA 5BWNA 1FLDA 2J7PA 2YJTD 1G18A 3V34A 1O96B 4TRRA 2NOAA 1PFKA 4XIJA 4ZHSA 3TIXB 3VNSA 1THGA 3EGOA 4ECAA 5KEIA 2R7LA 2PU5A 3ZK8A 2GT1A 3C24A 1HL3A 2DLDA 4QG7A 5JZVA 3A8TA 3UATA 4RXMA 3TW8A 3ND6A 1V9LA 1N7IA 2YXEA 4HADA 2X6RA 4AYXA 3AUUA 1MIOA 1GFSA 3BHIA 4C7VA 1RC8A 4BLVA 3FPLA 4FX2A 2FX2A 4OCZA 4OK6A 4MUHA 3KEGA 3OMWA 3TCNA 4OJNA 4HX5A 3D4BA 4U8GA 3C3BA 4MHSA 1LQ2A 1LWNA 5AJHA 5HZGA 1ZAYA 2EZTA 5AKJA 5DNCA 2WPNA 5HWSA 3P96A 1BMQA 2WHRA 3N6XA 4FHZA 4XD7D 1EP1B 1MT0A 3QF7A 4ZEXA 4TXJA 1NLFA 4OHZA 4KE6A 4DV5B 1DBWA 1W2GA 3RU2A 3AHEA 5H7XA 5A4AA 1RWKA 2X2FA 1A5SB 3AKDA 1OA0A 2GM3A 2I6QA 4N6OA 4QASA 3WQBA 3ZKAA 3WLAA 4NTZA 3ERCA 3AHIA 5EZQA 5FA5A 5I7FA 4IDEA 5K2OA 2B82A 3EDYA 3TZQA 4GL2A 1NBHA 1Y8CA 3ITDA 1ODJA 2JGEA 1QS0B 3VU3A 1UWVA 4L08A 1U2QA 1JHUA 3M4JA 1NW3A 3CZCA 3MCZA 4J9VA 4BB9A 4RM2A 1WBDA 4BMPB 2PS3A 4HR7A 2ZB4A 1RI3A 1TE2A 3HFJA 2FSUA 4MWOA 4PRYA 1HZJA 3ESBA 4CCWA 2AN1A 2FQXA 2CF5A 2BD0A 2CHEA 2HH9A 1YCGA 2JJ2A 3KALA 5AXBA 4BO9A 1YJQA 2VJPA 4F2DA 5JSHA 1NPDA 3DWGA 3LRXA 1NJ8A 2GEVA 2MTBA 4WDQA 2A0WA 2RHGB 6REQB 3GLIA 5JCOC 4CF3A 4DANA 2B5OA 3HZHA 2C4MA 1MA3A 3H2GA 4JITA 521PA 1US8B 3KUDA 2FF5A 3SM3A 1NZFA 4DQUA 5GY7A 3NEJA 3FN4A 2P5SA 3PC3A 4G41A 5D3MB 1JR3D 5L3RA 6REQA 3JRXA 5AVRA 3CVWA 4MKXA 4BNWA 3LK7A 1C8KA 1M0WA 3P9RA 1OT5A 5CK4A 3L6RA 4FZVA 3TSOA 1HFWA 5L3QB 3CNEA 4J9UE 1V6SA 3E82A 3JASA 3X1YA 1YONA 3UPDA 4DQKA 2EDCA 2CJFA 4BX2A 5EIHA 2ALJA 4O4HF 1YL7A 3H16A 3QVWA 2HJGA 5ALSA 3WWDA 2LTAA 3AK4A 4FN4A 1C2YA 3HU5A 4P3NA 4D3FA 4D57A 3SVZA 3T0GA 5KNBD 4RTPA 5ADWA 1NV9A 1SC3A 1J97A 1R3UA 2P6OA 1I4OA 2VH5R 5KHAA 4M88A 3BH6A 2CL7X 1CW2B 3CZ9A 1YC5A 3KOUA 4MRMB 3RRYA 1WUYA 4DMUB 3EEOA 1DAKA 2FUNB 5MF6A 3KT6A 1FS6A 4CIAA 1QYIA 4G2NA 3CISA 4FYKA 3ER8A 1XXHB 2ZYTX 2I3DA 2R97A 3QXGA 4J16C 4MRMA 2R79A 1NNLA 3B6IA 2UUOA 4NJEB 1R9MA 5K8JB 1UEJA 4OU5A 3GLIE 2RD2A 1CQZA 2D00A 3Q6IA 4D9GA 5K8UA 3NHFA 3GR6A 3FCCA 4OLJA 1UBLS 3IB6A 1P91A 2HFJA 3HUDA 3W8DA 4R2MA 4WY5A 3W6NA