4Q05A

Crystal structure of an esterase e25
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
327
Chain Sequence
ENSWQIGPRTLPAPSGASDVLYNIISKTPTPVPTINLNLVPRTESEWRAAITQLDEGKVDMAREISKQLSVSVEHGVIEGVSVYYVTPVEVAPDLEDKLFVHTHGGAFVLNGGEAGTIEAIVIATLAKVRVLSIDYRMPPSHPAPAARDDVFTVYQHLLKQGSAQKIALGGSSGGANLTMGLVQHLIEQEVDLPGALFLGTPGADMSKTGDSYYINDGIDRNLVTYDGFLEAAVRLYANGRDLKDPLVSPLYGDLHGFPPTFLITGTRDLLLSATVRTHIKLRQSGVVADLFVYEGIAHGDYAVDLTAPETQHAFAELNAFLLQHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords esterase E25
publication title Structural basis for dimerization and catalysis of a novel esterase from the GTSAG motif subfamily of the bacterial hormone-sensitive lipase family
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 118
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q05A00
4ETWA 5ALSA 1BEEA 3OTQA 3W2TA 1L7AA 2VSQA 2H1IA 3C6XA 2FJ0A 3I1YA 5I7UA 4LHEA 4X91A 5ISMA 3G0CA 1MJ5A 4FKBA 5C8XA 3WYNA 4L0CA 3IIIA 4NZZA 4Q3LA 4ZRDA 3NOXA 2J4CA 3D59A 5AJHA 2WQZA 5CH3A 2WIDA 4UHCA 4BE9A 4H7KA 3GROA 2PSDA 4DYHA 2PSFA 4NVRA 4ZV7A 2HHAA 3DKRA 1VKHA 4C6HA 3IUJA 3QVMA 1LZLA 3I6ZA 5LZ4A 4MQMA 3ESBA 4X90A 1F6WA 3HI4A 2G63A 3I2KA 3BWXA 1IVYA 5HF5A 3WL7A 2XUGA 3K2IA 4AO7A 1QIKA 1VXOA 5AI8A 3KDAA 1WPRA 4CG2A 2GBGA 4H7FA 5K3DA 2WG1A 4GDMA 4BC0A 5LZ5A 4K2AA 2B9VA 3CN9A 1PV1A 5DLPA 2WHRA 2HA6A 4ZI5A 3C5VA 3M3DA 3H2KA 2QT9A 1A7UA 3WI7A 3PF9A 2BGRA 1CUJA 2D5LA 4RE6A 2G5PA 4OUKX 1QIDA 2XT0A 3R3VA 3H1AA 4XWGA 3ZLUA 1YR2A 2XQJA 4P93A 1QFSA 2PVSA 4J0GA 4P08A 1GPNA 3W9BA 1R9NA 2HA2A 3VVMA 4BVJA 4E46A 3KWJA 4GBGA 3FLEA 3HACA 1HPLA 4FBMA 3PF8A 4LIPD 2H7CA 4C4YA 3QMMA 4X85A 2WSLA 5LLSA 4B85A 1GT6A 2BUAA 2VT7A 1W1IA 1E89A 1QOZA 4HAIA 4XVCA 2PUJA 3STXA 4FFVA 2X5XA 1U8EA 3WIOA 4F21A 4B7ZA 3TGLA 1XRNA 4QLAA 1TCAA 3FLAA 3ESAA 1ZD4A 2PKYX 4UBNA 5AKXA 1JJFA 2XLBA 1QIGA 4PF1A 5KBYA 4ZXFA 2BFNA 4QDUA 3VJLA 5HKBA 1R4ZA 4BCBA 1L7QA 4BATA 4ZGBA 2O2GA 2WTNA 1CVLA 4HVTA 4FMPA 1CUZA 1Y7IA 2G5TA 4Y2XA 1ZJ5A 2OQIA 3OPMA 3H17A 3UUEA 3O9MA 4AZ0A 4ARAA 1ORWA 3G02A 5LZ2A 1BCSA 2IITA 3R3YA 4O08A 4EUSA 1IUOA 5EHZA 5IVKA 1GXSA 1EA5A 2CMFA 4EY6A 1TCBA 1CUDA 1XLUA 4MWTA 3WIBA 3D7RA 1WB5A 1AKNA 1UOOA 2QJWA 3E3AA 1WM1A 1XZFA 4FDMA 5EIHA 3AUKA 5T4HA 1XZMA 5JALA 5ALQA 2OXEA 1YSCA 3WYDA 1KEZA 4GW3A 3NGMA 4EY4A 4UBJA 1W6RA 3IUMA 5SYNA 4Y2JA 1GPKA 4Q1VA 2JF0A 1ISPA 4Y2PA 2CEKA 2QXUA 2QRUA 5JAPA 4B9EA 2ZYSA 2WFMA 2GBIA 3BDVA 1JMKC 3OM8A 4QWMA 2X8BA 4HRXA 3AFIA 4FFWA 1RP1A 2ZJFA 1M33A 3DL4A 1ORVA 4UPDA 4H7HA 1O6FA 4IH1A 4BVLA 1UK6A 4AMZA 2Y6VA 1F0NA 3E4DA 4UFOA 5JASA 5AIBA 2C0QA 2QMQA 2HFKA 2CKMA 5DYTA 3WK4A 3FBWA 4EA6A 2FJPA 1ODSA 5AI6A 2D0DA 2LIPA 3YASA 5HF8A 4KE6A 2H7XA 2PL5A 4Q82A 1LZKA 5AKZA 1OCEA 4M0FA 3M81A 4U2DA 4DIUA 2YYSA 4QDXA 1XROA 1VJ5A 3G9UA 1DWQA 3MGAA 2WUFA 3QZUA 1XQVA 4U2EA 2WM2A 1Z68A 3I28A 3BF7A 4C01A 4E15A 1SC9A 3H2HA 3G9TA 5EGNA 5CMLA 5C8VA 4FHZA 3G9XA 4E11A 2PX6A 3JYHA 5FDFA 1MX9A 5AM2A 4Y2VA 3PUHA 4ZWNA 2VAXA 4B0OA 5JZBA 5HK9A 5AICA 1C7JA 2ZYHA 1QIHA 4HXFB 1R1DA 2OAGA 2H7YA 5AIAA 2OGSA 2H9YA 3JWEA 3L1HA 3RARA 4Y2RA 5D3ZA 5FUMA 4WFJA 1BS9A 1TKRA 4JYPA 2XQIA 4S0XA 2OPHA 3SWWA 5HFNA 1T4MA 1Y37A 2XUFA 4UHFA 5DYYA 1XZCA 1EVEA 2HRRA 1QIMA 4QZVA 3WL5A 1FFAA 5AKGA 2HU8A 2BCEA 1HBJA 5A6VA 5IH7A 1JI3A 2R11A 4UFNA 1QIFA 4IO0A 4J0JA 2C5FA 3DNMA 1QZ3A 4G8BA 2WIKA 3BIXA 1FJ2A 5HQ3A 3L1JA 1CPYA 3I2HA 3QITA 4G4JA 2BKLA 1RWQA 3DD5A 1U2EA 3WKBA 2PM8A 3CXUA 1DTEA 2I3ZA 5ALDA 2GYUA 2WILA 4CCWA 3K6KA 4LKOA 2XUIA 5EI5A 2BJHA 1LPMA 2O7RA 2PBLA 1MN6A 3ILSA 1GGVA 3O95A 3ESDA 1MNQA 5H3HA 1LPAB 5A62A 4AB1A 5DYWA 3HSSA 4N8DA 2QM0A 4OSEA 5FLKA 1H22A 3GUUA 2Y2UA 3WKEA 1WB6A 3VDXA 1CUVA 4WCVA 4BE4A 5BWCA 4OYLA 4KAJA 3ESCA 4GEGA 1H23A 2DHDA 4AN1A 3WZMA 3BE8A 2WLSA 1MO2A 3RK4A 2YASA 3H2GA 4G8DA 4PV7A 1CUUA 1GKKA 1ZD3A 4BDSA 1A8QA 2NW6A 4MXDA 4F5ZA 1Q83A 4L9AA 4FNMA 4J3JA 5CW2A 4N5HX 1VA4A 3HEAA 3L1IA 2DFPA 1BEZA 2QJRA 1AC5A 5ALGA 3FAKA 1WPXA 1ETHA 4J03A 4EHBA 2WFLB 1LPPA 1MNAA 4G4GA 1J1IA 5ALMA 3V1MA 3WKDA 2XUJA 5K5EA 2HL6A 4UHEA 3NWOA 4Y7DA 1CFJA 3ZV7A 1TIBA 1YS2X 1ZJ4A 1XZAA 3O4HA 2ROQA 1CV2A 2W6CX 1CUXA 5K3FB 5ALPA 2RAUA 1B6GA 1ZOIA 1ODCA 4X94A 1VE7A 5T4FA 2IX9A 1QIIA 1EDBA 4WDRA 3D5EA 5SYMA 4BB0A 4EB0A 3WWOA 3SC2A 1WOMA 1AGYA 2HA0A 2WIGA 1QJ4A 2HM7A 3DL7A 3IA2A 2ZJ7A 2O2HA 2ZJ6A 1ZD2P 2RONA 3I6YA 4H0CA 4J0IA 2C0PA 5DJ5A 5JANA 1DQZA 3MUOA 5AKYA 1CUSA 4OB6A 4LXIA 2X76A 1XRLA 1CUGA 1USWA 3WJ1A 1EHYA 2VTVA 1Y7HA 4EBBA 2YXPX 1AQLA 2HA4A 1Q0RA 3DJYA 4U2BA 1YCDA 3FYUB 4BAGA 1KU6A 5D6OA 3S8YA 4HS9A 5AM0A 1LBSA 3GZJA 4M0MA 3C6BA 3IB3A 4KE8A 4L3WA 4DSZA 1ZIYA 2QUAA 3H0CA 5ALUA 3STUA 3HRHA 3DYVA 4OB8A 3P2MA 4N8SA 3JW8A 4B81A 2QS9A 4B82A 1DU4A 1SFRA 1UWCA 1E8MA 1TRHA 4LYEA 4MWSA 4C88A 3X3HA 2DCMA 3ZLTA 5AKLA 3R3XA 4XX1A 1MX5A 1X2BA 4OU5A 4EY5A 1HLGA 1ZI9A 3FWHA 3T52A 4DNPA 2WG2A 1BN6A 4JH0A 5AK5A 4DMFA 5E4YA 3E1GA 4V2IA 4MQLA 5JD4A 5HKAA 1E8DA 1K8QA 3DEAA 3FOBA 3W04A 1TAHA 4L72A 2FUKA 2ACKA 5C81A 5AOCA 1U65A 1FFDA 4X00A 4X3CA 5KWJA 4J7AA 1QGED 1EX9A 4QEKA 1EXWA 1THGA 2W22A 4G8CA 3D2BA 4J0HA 4BDTA 4OU4A 4BCCA 1EI9A 2JGIA 2XUQA 4X92A 1FFCA 4H7EA 1ZD5A 4YX9A 1ZI8A 4HXGA 3C87A 4ROTA 5K3EA 2XLCA 5ALTA 4INZA 5AK6A 3I2GA 3HYSA 4KE7A 2WJ4A 3HJUA 1K63A 4UBOA 5DTIA 4H77A 3AZOA 5CURA 3RKSA 4WFKA 3WA6A 4UBLA 5FPQA 4PSUA 3DYIA 1LGYA 1XZDA 3PDCA 4K6GA 4XIIA 5AKKA 3OOSA 2XMDA 3HLKA 5K3AA 3D2AA 3B3QA 1BN7A 1BROA 2J4FA 3BIWA 1XZKA 3FCXA 4DNQA 1R3DA 5AOBA 3F96A 3M83A 1N5MA 5AI0A 5EIAA 4CIAA 3G0DA 3WZLA 3IVMA 3DOHA 1EDEA 1D07A 2OGTA 2JGKA 4BTVA 4W1SA 4BAZA 2VATA 4D9JA 4X6YA 4RPCA 4C87A 4BP8A 4JYMA 1K5PA 2OG1A 2WU3A 3A6ZA 4W9RA 1DT3A 7YASA 3F9CA 3QH4A 5JARA 1QO7A 4OYYA 3QPDA 4A23A 4H7IA 3C70A 5LZ9A 3BDIA 3E0XA 5ALOA 1BE0A 2V97A 2CZQA 3FNBA 4K5QA 3FCYA 1THTA 3WK7A 4WY5A 3C8DA 1ACLA 5LIPA 2VF2A 3MVEA 2RI6A 1H2XA 2VEOA 5JD6A 2FX5A 2P8SA 3O4IA 1L7RA 5YASA 3FVRA 4AXBA 4J0CA 1QTRA 1BCRA 2XI4A 4BZZA 3F97A 5JAOA 3IDAA 4Y9SA 5JAUA 3WL6A 3WKAA 4I4CA 5T4BA 4UUQA 4B6GA 4J0KA 4GXNA 4A5SA 5AP9A 1YASA 2WJ3A 1UZAA 2C7BA 1J2EA 5AK3A 4AO8A 3H2JA 2VQ6A 1CQWA 3WK6A 2Z5GA 2Q0XA 3ICVA 4A16A 3PFCA 4Y2YA 5DTJA 2EEPA 2WFZA 4H7DA 4Z49A 3BL8A 1LPBB 2WHPA 2XUHA 4TVKA 1NU6A 4Q05A 1XLWA 1XZBA 1MT3A 2IIVA 1CUCA 1IMJA 5A7HA 2ACEA 4UHDA 1FSSA 1DT5A 4G4IA 4DTCA 1HKHA 2PUHA 1DX4A 4BAUA 4UFPA 4HXEB 1C7IA 4BP9A 3H1BA 2V98A 4ZREA 2XQKA 4DNOA 5AM5A 1FFBA 5LZ8A 2JGMA 4DMHA 2VJBA 5AH0A 2OCKA 2J3QA 1I6WA 3FYUC 1YB7A 1E66A 4Q3OA 1GQSA 1E5TA 2XQFA 1BRTA 5ALNA 3U1TA 5AI9A 4FOLA 4CG1A 1QIJA 3PI6A 2DHEA 1K6EA 2VAVA 5CT5A 3LLCA 4QDOA 4UBMA 3I2IA 4K6HA 3TJMA 1P0PA 2QVBA 1W52X 3AIOA 3WWDA 4AX4A 1GPLA 4GWLA 2B4KA 3GBSA 3EF3A 3R40A 5A2GA 1G5FA 5CBKA 3W06A 1H2WA 4UBKA 2JGLA 4BVKA 1OXMA 2I78A 3STTA 4QDZA 5EHQA 2PU5A 5CT4A 1AURA 1VA5A 2RIPA 1ZIXA 3G0GA 2DR0A 2V9ZA 4GECA 4GLBA 3TEJA 4OD0A 5CRIA 1MTZA 4UHHA 5AM3A 5FV4A 4GHWA 4TGLA 3IBTA 6YASA 1ZGCA 3QPAA 2AJCA 1PFQA 1UK7A 2WFLA 1VZ2A 3AILA 3V1LA 3SK0A 1UKAA 1YS1X 3HABA 1T2NA 1XRMA 2XMSA 4B0PA 3O4GA 3W05A 5JZSA 5ESRA 4YASA 1CLEA 2GZRA 2HADA 4FTWA 4AMYA 4KYVA 4WY8A 3VXKA 2WUEA 1WHTA 3I2FA 1Q84A 3UMJA 5DNUA 1JJBA 5ALFA 5K3CA 3AIMA 1R50A 2WG0A 2Y2VA 4MEBA 3ZLVA 1P0MA 2K2QB 5ALWA 1W4LA 1S8OA 5DNWA 2G4LA 3O0DA 4PW0A 2HU5A 2QXTA 2HDWA 5HF9A 1WHSA 2VJCA 2WTMA 4B84A 3WA7A 1ODTC 3WL8A 1G4HA 3BJMA 5EIEA 3TRDA 2ECFA 2WUGA 4DGQA 4EZIA 1EDDA 2AJ8A 3DQZA 3KOOA 5BOVA 3A2MA 3QBJA 4N8EA 3IUNA 1RYYA 2ZSHA 4DM7A 4TPKA 1CUEA 5HK8A 3G9ZA 1SCKA 3WWCA 5CXUA 1LBTA 1XQWA 4QWWA 5EHXA 1UKCA 3B12A 1N1MA 5AOAA 2PSJA 1HL7A 2AJLI 2JIDA 2HFJA 3ANSA 3DDUA 3IULA 5CH8A 3HXKA 5ALLA 1DINA 2I3DA 1N8SA 4QNNA 3GA7A 4U2FA 5JAHA 1WCYA 4MEAA 4ZV9A 3HC7A 4UBIA 4X7BA 3C6ZA 3I1IA 4BYMA 2QZPA 1UOQA 1EK1A 1EVQA 1IUNA 4Q3KA 4KACA 5E4JA 1ACJA 4X95A 2ES4A 5FP0A 2PU7A 4F0JA 4KJXA 4NS4A 3EQ8A 1CRLA 4Y2QA 2XUDA 5KWIA 5IVDA 5C7YA 4XJVA 1EINA 2OGZA 4CG3A 4IH4A 2Z3ZA 5IVIA 3D0KA 4QLOA 3U0VA 2DQYA 2UZ0A 5C8ZA 1B41A 3AZQA 3WK5A 1P0IA 5LYYA 3R41A 3ED1A 5LP1A 1A8UA 4GI1A 2CB9A 2ZSIA 2R8BA 1N5RA 3VKFA 3C8HA 5LKAA 1UOPA 2OCGA 5AHXA 3FSGA 1UXOA 2ONCA 2HIHA 4PO3X 1O6GA 2VJAA 5AKHA 2XB6A 1XZLA 3ANTA 2OLEA 2Y1KA 4MJ3A 1XFDA 4H35A 3OC0A 1EH5A 5CT8A 2V96A 5DWDA 4Y2TA 4CCYB 2CJPA 4IQ4A 4Q34A 2Z8ZA 2CBGA 1GQRA 3AZPA 4G9EA 4C4ZA 2DSNA 1ZI6A 3D2CA 3VJMA 1CUFA 1XZIA 3BJRA 5DNVA 2XE4A 2EDCA 1XQXA 2WHQA 1XRPA 1X70A 2O2IA 5T4EA 4KE9A 4LXHA 2XUAA 3I6MA 5FKJA 1W76A 2PSEA 2JEYA 5HFAA 5EFZA 2I03A 1KU0A 5AKEA 4BBZA 3WKCA 2JGJA 2XUOA 4X93A 3B5EA 5ALXA 3F67A 5LKRA 2GYWA 5ALVA 5BV7A 3STWA 2AJDA 5I9IA 5JD5A 3D3NA 4OPMA 1C4XA 1E8NA 3QYJA 4X97A 1TCCA 4CIBA 1MAHA 5J3JA 4HZGA 1CIJA 1ZICA 5CT9A 1R9MA 4OCZA 3RLIA 2Z8XA 2JEZA 5CXXA 1MAAA 3WLAA 2VT6A 5CTAA 1W75A 5AI4A 2RHTA 3QMVA 3WQHA 2OCLA 1AMNA 2QTBA 5FOQA 2BUBA 3AINA 2WKWA 4BRZA 2BGNA 1H2YA 5BWBA 3FVTA 1XZEA 1DX6A 3SX4A 1U4NA 5JIBA 2B20A 1UT6A 3PFBA 2HA5A 1CUWA 1MU0A 3EBLA 1DQYA 4JNCA 3DS8A 4DSAA 3LIIA 4X6UA 3GELA 4KAFA 4QE3A 3VVLA 3Q8WA 5ALZA 2DQZA 2ZVDA 5A7GA 3WWPA 3ZI7A 2RGUA 2BUCA 3G8YA 5LZ7A 2B61A 3A70A 1R88A 5AM1A 1LPSA 3BXPA 2GYVA 1JT2A 4MYSA 2RHWA 3LCRA 2WIJA 1QFMA 4KR0A 2VJDA 2C5GA 1VXRA 1SCQA 3KD2A 1CEXA 1DWPA 4BC1A 1IZ8A 2XMBA 1J07A 4G5XA 1CR6A 1BU8A 3STVA 2XDWA 3PICA 4I19A 2AXEA 2ZYIA 5HCUA 2QOEA 3V1KA 1YAJA 3GFFA 5FPPA 1CUIA 4YPVA 5IKXA 1AX9A 4G1FA 4UHBA 4B9AA 3O4JA 4B80A 3BF8A 4BRSA 2VA9A 3O9VA 1XRRA 4CI9A 1CUAA 5ALJA 1A88A 3DKKA 3KXPA 4HTAA 1IZ7A 1VZ3A 1LPOA 1NU8A 2HA3A 3A2LA 4BTLA 5ALHA 2GBFA 4LYDA 3EQ9A 3F98A 5CT6A 4U2CA 2XMCA 4RGYA 1VLQA 3H04A 4IHAA 5D7BA 1SOMA 4PSDA 1H2ZA 4WDQA 3FYTA 1QIEA 3NUZA 4KEAA 5AI5A 3KSRA 3A2NA 1CQZA 1YA4A 4K6KA 1UK8A 3D4LA 1G42A 1XZHA 5D3KA 4IH9A 5K3BA 3CCBA 1HDEA 3Q0TA 4JUIA 1F8UA 3H19A 1QLWA 4EY8A 4JEIA 4PQEA 2WIFA 2OCIA 5A7FA 1CUYA 4H18A 3EQ7A 1MPXA 5AKIA 4PNZA 5ALEA 5HF6A 2AJBA 2YH2A 5F4ZA 5IVHA 4BZWA 3V9AA 4KAAA 4KRXA 3DLTA 1OILA 4ARBA 2Z3WA 1A8SA 3ZPXA 2QR5A 1JKMA 2OAEA 4G9GA 2BAGA 3CN7A 4WJLA 1J06A 1JU4A 2GZSA 2XMZA 4P92A 3STYA 2EDAA 3IURA 1JFRA 3AIKA 5A71A 3CCCA 3H2IA 3H18A 2JGFA 5JATA 2Y6UA 3KWFA 4BCDA 1QTIA 1K4YA 4FNGA 5JZ9A 1QONA 3WK8A 4OB7A 3K9BA 1G66A 5AO9A 3VISA 4EY7A 1X2EA 3R3WA 1JU3A 2C4HA 4YK7A 3G0IA 1EB9A 1UFOA 4RE5A 1XKLA 4B83A 1XQYA 3R3ZA 1LLFA 3C45A 3FLBA 4AQDA 3OURA 1DWOA 2WJ6A 4FLMA 3T4UA 3QMWA 3G0BA 1P0QA 3DOIA 1XRQA 4F60A 4FWBA 2C58A 2HA7A 2WHPB 1XZGA 3HZOA 3PE6A 2PPLA 5AM4A 4PSCA 4LXGA 1YA8A 3N2ZB 3AJAA 5K3FA 5JYCA 4FBLA 5FXMA 4AN0A 2ORYA 3M82A 4Y2UA 3WK9A 2PSHA 1ZGBA 5E4TA 1UK9A 2XUKA 4X6XA 4DMKA 1CUHA 4FLFA 4QDTA 3C43A 5FRDA 4WFIA 3R3UA 1XKTA 2J3DA 5AKJA 1NX9A 4AO6A 4MYDA 4W1PA 2JGEA 4N5IX 2DHCA 5CH5A 1FFEA 2GBCA 1EK2A 3VJKA 5ALIA 1XZJA 1WB4A 4DLNA 2HU7A 4Y2SA 4HRYA 1HQDA 1LNSA 3QPCA 3DCNA 4W1QA 1TK3A 3G7NA 3ICWA 1QO9A 5ALYA 1VOTA 3FYUA 2XMRA 4C4XA 3V1NA 2JBWA 1AZWA 4CFSA 3OG9A 5HZGA 4ITVA 4J0DA 3F8SA 1XLVA 4H7JA 5I8PA 1MX1A 4QA9A 3V48A 5JADA 3W9UA 4RNCA 1F0PA 1GZ7A 5ALRA 3EIOA 4I3FA 2ZYRA 3IUQA 3WWEA 3FSGD 2XQGA 2QKYA 3C5WP 3RM3A 1YB6A 5HQ3B 1VE6A 3LP5A 3QM1A 4CCYA 2WU4A 2OQVA 3C6YA 4C89A 2CUTA 4AZ3A 4DMCA 2QUBA 1LPNA 1AUOA 4U2GA 5ALKA 3WMRA 3S2ZA 3LIPA 1JJIA 3MUNA 3PUIA 2XMQA 4M0EA 4X71A 1SCIA 5AK4A 4FLEA 2HRQA 4W63A 1CUBA 1PJAA 2O7VA 3N0TA 4KRYA 2XMGA 1Q0ZA 4NMWA 1UKBA 2WUDA 5KREA 5EHNA 1IUPA 1JMYA 3R0VA 1QE3A 3WJ2A 3LS2A 3ZWQA 4E14A 1EB8A 2E3JA 5E2IA 4DNFA 3I2JA 1TQHA 1GKLA 1E3QA 3UUFA 1YAHA 2XUPA 4W1RA 4P9NA
chains in the Genus database with same CATH superfamily
1NHGA 4ETWA 1H9CA 4IJKA 4MPRA 3F8WA 2QG6A 2Q41A 4ZI7B 2I7XA 2PRYA 4N49A 3QKWA 4ZI7F 1ADBA 5EINA 3E9RA 3C6KA 3ZNPA 3EIUA 2FJ0A 3AY3A 3SQWA 3IOYA 1KHHA 2V7UA 2ZT5A 1XRSB 4JC8A 4X84A 1PUXA 2ZSJA 4X91A 5LBTA 4ZMRA 3IP1A 5ILOA 4JDUA 1DTWB 2VHCA 1U9CA 4OSPA 1KWKA 3IIIA 4NZZA 1KAHA 3K0HA 5ESWA 3W1VA 1NULA 1ZUHA 4FPXA 4NYJQ 1R4MB 5GJCA 4P32A 2WQZA 3MWFA 2FG5A 4IJUA 5EG5A 1ZMTA 5JROA 2IXBA 3HB7A 1RXSA 2GFQA 4JT9A 2BW0A 4H7KA 2W83A 4EM6A 4P80A 1GT91 1QANA 2P4HX 4J0FA 1RPNA 1M2HA 2DUWA 3I1JA 4J76A 4P4SB 3ZE0B 5A3RA 1AHPA 4R7TA 3EGXA 1Y6FA 4KW7A 1WVIA 3I09A 1BGXT 2BF4A 2C2OA 3P27A 2DQ4A 2GCGA 1D2EA 3NEYA 2WSBA 3W6UA 3ISVA 2FQQA 5LZ4A 2EZTA 2HJRA 2MSEB 3ESBA 3R9KA 4ENVA 3MOGA 2IC5A 2HW8A 4EO4A 1QX3A 1F6WA 1WPGA 3ASZA 1U3GA 2G63A 4P7BA 2QRVA 1II9A 2QL5A 4MRAA 1TQ4A 1ZL0A 1BTOA 3D6HA 1R0BA 2QJFA 3QLVC 4DR4B 3DR5A 1H69A 5E6SB 3VDRA 3OF5A 4F9GA 3HCCA 4BMYA 5L7TA 5JNUA 1QIKA 1VXOA 4BJ3A 1R15A 4POAA 2W0SA 5T6BA 4FFBA 3ZW8A 4X24A 2AS0A 3ZUPA 5BT8A 5K3DA 1YJQA 2WG1A 4GDMA 1FFGA 2YC2C 3W79A 3BEOA 3HSYA 3D4IA 4F4DA 2OBXA 3UVEA 3UJCA 2AYZA 2IEDA 1L5HB 2VP6A 1Y6RA 3CM0A 1R5OA 3CN9A 4UEJA 2ZBPA 2IWRA 1MAWA 1P19A 3KAJA 2ZSUA 1GTJ1 3Q9LA 4RZ2A 4BEBA 1FFYA 2C00A 3GBPA 3O8OA 2WHRA 4ZHQB 2ZGVA 3F5QA 3QFRA 3OE7D 1GU7A 4EDFA 4LE0A 4ZHQF 1FXSA 2JIQA 3C5VA 4GZ6A 4NYMR 4YC7A 4G0NA 3KDPA 4L22A 2XVAA 3CUUA 4UTOA 2QT9A 4YCLA 4UMFA 1F0KA 2BI7A 2IGTA 4FOPA 4V02A 5JO0A 2D59A 1D1QA 1KYWA 2ZI6A 3EX7C 1A5ZA 4DDVA 3N74A 2GLTA 2OLKA 4JJ8A 1C0EA 2FN3A 1FFWA 1QDLB 1K7EB 2D5LA 2PQ0A 4ND3A 2LP4Y 2VZ0A 4OXQA 4UTXA 1EVIA 1I0LA 3KYDB 4OUKX 3SC2B 3CNOA 4HFRA 2TS1A 2XT0A 2YN0A 1U0LA 3VTFA 1DJMA 4NECA 4EPRA 2GEVA 1DC3A 1YQTA 1T0IA 4L95C 3VR1A 3EAFA 1PK7A 2W8BA 3OZFA 4FKMA 5KTNA 4BNGA 3EVBA 1QVAA 5GONA 5CUQA 4MYTA 1WNFA 3DBRA 3AF4A 4J0GA 4V0QA 1OI4A 3C6QA 3RHSA 5CITA 4C3VA 3F0TA 3ZY3A 1PJLA 4HQKA 4DSNA 3QLUC 1SXJE 4W9NC 3U4CA 2CXXA 3JQFC 4BVJA 1VMKA 3KQUA 4E46A 4GBGA 4WKOA 3ACDA 1T9CA 2R44A 1XD2B 1ZM9A 3DE4X 3PXDA 3SKXA 1A1VA 1H0RA 1UANA 2QU7A 2YUIA 3V4ZA 1DHTA 3PF8A 4IY1A 4GO1A 2A9KA 4Q4HA 3S2FA 4FJ2A 3R44A 4EW6A 3ORQA 2BM9A 1NA5A 1NLFA 1RTTA 1VPWA 4FCCA 1J6UA 3DV0A 3Q88A 3G2PA 2CVHA 3QMMA 3VU9B 4EHHA 3A9VA 2FFBA 4L73A 4U7PB 1CQIA 1GU1A 1PK9A 3L8MA 2J09A 1PHRA 1XU4A 1WF3A 5EYPB 3HXOA 4JFRA 2NO1A 5DXAA 3W8RA 1BX3A 1LBQA 1QGZA 1U94A 2JIBA 2BY4A 4HAIA 2YVAA 3G5UA 4HZUA 1NAHA 4QT4A 2Y27A 2XB2A 1M2JA 4EB6B 1V4VA 5ER6A 3LKBA 1VDMA 2RMKA 1IJBA 4OFZA 3ERCA 4C2AA 3E3MA 1U8EA 4YV2A 5DRTA 4FHGA 1NMSA 4B7ZA 2XTZA 4JSYA 4UPVA 4RM3A 1EEHA 1QE0A 2UZIR 1EM8A 4ZZ1A 4PQFA 4PCVA 1NYRA 3MCWA 3DVAA 3O1IC 4DUGD 5B2FA 1II8B 5AVSA 4DCUA 4DM4A 3ESAA 3IEMA 4TS3A 1TQ8A 1SAYA 2D1YA 4MLCA 2G7MC 3REQB 4ENTA 1MJGA 1WBDA 3R3JA 1S8NA 1KIMA 3OCCA 2PLAA 5KC9A 1OWOA 2E85A 1IOZA 2V7VA 1BXGB 3FPFA 1N5OX 1PJ8A 4PF1A 1U1EA 1N6RA 2WIBA 4ZXFA 2BFNA 4R1UA 2JRLA 3AESB 3A4LA 4QDUA 2V4UA 2IIBA 5EZYA 1GAQA 2RHRA 3QXJA 5HKBA 2BSQA 3AI7A 2ESRA 2FR8C 1T35A 4JJ6A 1O97C 1BA3A 4E5SA 1D4OA 4X6LA 4LRUA 1OT5A 1Z29A 3DBOB 4HQOA 4MJXA 4BATA 1QZZA 3QVSA 2Q2WA 3H99A 1PR1A 1ZNXA 2AFIB 3AL3A 4KI0A 4ZVOA 5CD9A 3X2FA 1QGYA 1P2SA 2VG8A 1G0OA 1ULUA 3BA1A 2A9RA 2FQ1A 2RHMA 1CEYA 1PNRA 3I9FA 4YXFA 1Y7IA 2B1QA 5B3AA 2RH9B 1NE2A 1AIPA 4V3BA 3G8AA 4MUJA 2AEFA 2ENWA 2OQIA 1BOFA 5TPZD 1D09A 2RBGA 3PL5A 1TA9A 3C1TA 2RGNC 3GGOA 4A3SA 3O9MA 3FTPA 1PSWA 4WK2B 4AZ0A 4MVXA 5CLGA 1GYRA 4MV8A 4JA0A 4Z3KA 2DLCX 2YHIB 3N0VA 3BZWA 3M5DA 2Q6OA 1REQB 1NVVR 1OWLA 1RPTA 2FG7C 2ZAYA 3G02A 4HX9A 4FHDA 4LOLA 4Q66C 2UVPA 3GJSA 3LO8A 3NJ4A 3JYPA 3EDCA 4MVJF 5F77A 4G0UA 5F3WB 4JQOA 4OJYA 4RMNA 5IYZB 4AP5A 1JAHA 4R41A 1EDZA 5DTEA 4CTOA 3QEMA 1RYZA 2IH5A 2IITA 1I1OA 3B70A 3N70A 2V0CA 1K2WA 5EHZA 4C4SA 4W6ZA 2FSHA 5KS2A 1EA5A 1G21A 3GFTA 1GL6A 1HQCA 5BY2A 1VL1A 2AB0A 5DEOA 1ABFA 2CMFA 3PNKA 1QRAA 4WOBA 1XWFA 3WXMA 1NMZA 1FA9A 1Y1SA 3OZTA 4JLMA 1ZD8A 1ZD1A 3TB6A 5EEGA 5AW2A 1K27A 2AJTA 1GNRA 2CD7A 1GR0A 1KR2A 1ZCAA 2EZ9A 3N6RA 1IK4A 2AG1A 5CTJA 3WYFA 4IKOA 5EP1A 5KINB 3HA3A 3HV0A 3WIBA 1WMSA 2HKIA 3ICEA 4EKDA 4OXYA 1WIWA 4DG5A 4JI2B 1G8SA 1AKNA 4URXR 4KLCA 2J1LA 2AG8A 4I1RA 4IDDA 2JFVA 3SD7A 3V7NA 4DCOA 1IEQA 1WM1A 2AQKA 2BHTA 1K9VF 2ZSBA 2JZOA 1VRVA 2FRVA 1L4HA 3D7LA 5HGXA 1X9GA 1Y7TA 1JEQA 1P1RA 2C2KA 3AHFA 4PO1A 3TOSA 4C4AA 3FM9A 3ZHXA 3B3JA 1UXIA 5ALQA 3WLEA 1J21A 3E15A 4DZRA 2YWRA 2BEUA 3QKUA 3G49A 2A2ZA 4MP6A 1B73A 2KE5A 4JLBA 4MGHA 3NCTA 4OHWA 1YMQA 2PKQO 3LUBA 1KEZA 3I3OA 3NIBA 4ZZIA 3RYCB 3AUJB 3IKJA 3IXLA 3JQGB 2PXCA 4P0PB 4KIGA 2A67A 3IELA 3NFYA 2SKEA 3K8ZA 1YU6A 4ZGWA 3D3EA 5SYNA 1N6NA 3QXCA 2BMWA 2PD3A 3GMSA 4FJ1A 5JPDA 3NJRA 4F1WA 4FOOA 5LLDA 1ZIPA 4MDYA 3FGPA 3WC4A 3OTHA 2IY8A 3TLMA 4NBUA 4V0SA 4J90A 3LFTA 621PA 3ZHZA 3FKJA 3KUDA 3DB2A 5HDQA 2J3IA 1YQUA 2PX2A 5SY9A 1C3OB 4Z2YA 1MORA 1PI3A 3FFWA 1NT4A 2C1ZA 4GRAA 1T1IA 4YBZA 2IYAA 2C4UA 4DLRA 2R60A 2F1HA 3I9V1 3T7EA 1X0XA 2BGMA 1Y1QA 1OX4B 2HTEA 4Z99A 4OP3A 3VZDA 1ITZA 5BQ3A 1JILA 2PMBA 2V3VA 4V1CB 3OI7A 3NYRA 4PICA 4JKIA 2Y0CA 3JQQA 2ZWIA 3PSAA 2OBBA 1QP8A 4AJKA 3AKYA 3DL4A 3HU3A 4Y7CA 1ORVA 2R8PA 3IS3A 1EGMB 1GM5A 2GCPA 4EX6A 1V9SA 4AMZA 1PNVA 2UYCA 3VTAA 4B48A 4R2JA 3KQHA 3B53X 4QU9A 3QHQA 1F0NA 3E4DA 4TMVA 1GY8A 4RMHA 3KVNA 3RODA 5AIBA 5JASA 4MDHA 1E96A 2JARA 4Q4AA 3LX5A 4N0PA 3D6JA 3L9WA 1LRKA 3TW6A 3QKRB 5DYTA 2N1MA 3H1GA 4NBVA 1YCHA 2IHVA 4KQCA 3GQBA 2EZ4A 1S0UA 3ZJYA 1RC8A 4F9TA 1QH9A 3K94A 4RTRA 1Z5ZA 3HKDA 1U2DC 4KO2S 3PC2A 1UDWA 2UAGA 2FZ5A 1ODSA 1RQNA 3I4FA 3IC5A 1DKOA 1H0HA 1EX6A 1X86B 4JB3A 3VKVA 5LQJA 2VF8A 2D0DA 2LIPA 2PKCA 1XSEA 3JZFA 3U4IA 4OL9A 3EDMA 4PLYA 2H7XA 4I8XA 2AOTB 2WE7A 2IP1A 3IPYA 2ATVA 3IXQA 3OCYA 3QE2A 4LMPA 4PYOA 5LBUA 8ADHA 1VHLA 2H7VA 4G5FA 4P3KA 4RAOA 4QYTA 1OCEA 1M74A 3BVPA 5B7GA 4B33A 4BHTA 3AKDA 4PG4A 2R00C 2VKTA 3JPYA 2R6FA 2O8DB 2MYTA 1KA9H 1WUIS 5CK4A 4ZDKA 5JV5A 1FU4A 5FX2A 4F85A 1HE2A 3K1JA 2JVIA 1KY3A 2QLTA 2GA9A 4MB6A 3SIRA 3OEHA 2WUFA 4F6CA 1DBIA 2KHZA 4BECA 3EUWA 3NB0A 4U2EA 2H1CA 4CTJA 2CVFA 3CH5A 2Q4BA 3AM5A 3U0BA 1A82A 2CJWB 3KYBA 3OKAA 4P82A 1ICIA 3SBOA 1Z68A 2B1JA 2V1XA 4F92B 2GNPA 3B2NA 4ZQBA 5JQGA 5IXYA 4AJ1A 2B30A 4J91A 3NCHA 4BKMA 4I50B 2CF5A 1E98A 3H2HA 1D8TA 4I50F 1C9JA 5EGNA 4HVCA 5I7WA 3J81k 2YCLA 5TMDA 2J85A 3JYHA 4DAEA 3FRIA 1SCAA 2BHSA 2NSDA 5FDFA 1D2HA 2ZJOA 3QELA 4RTKA 2OWDA 4Y2VA 1LB1B 2HX1A 5AYVA 3VJRA 5K0FA 1AV6A 3LOPA 1OKKA 3NXKA 3WL4A 2BTEA 5AJXA 1TAGA 2FUG1 4JLWA 2JVJA 1Q3KA 1VL0A 4PLHA 3ORFA 3I9OA 1MLDA 3ZZ0A 1Y6GA 3BH0A 1Z2CA 4ODIA 1RMQA 3U4HA 2OILA 3V46A 2CLFB 1W49A 1X80A 5TF0A 2WB4A 5AIAA 5DI3A 5HIMA 2IBTA 2B8EA 3NASA 5DO9A 2ID9A 3L1HA 3E05A 3SPXA 4DDUA 1TPZA 1RYMA 1HMYA 1NIJA 1NPYA 4TMWA 2UU9B 5EE9A 2ZBDA 4IRMA 5D3ZA 5FUMA 2IZ7A 3PIDA 3ZD9A 4C5CA 4CM8A 1BS9A 4YHBA 3FBGA 5FLYA 1EFRD 1W0JD 2XQIA 3HL0A 4GOXA 4JJEA 5L3ZA 2OPHA 2PG3A 5LD2C 5K6AA 2BH9A 5LQUA 1G0NA 2VZEA 1HFKA 4MNTA 1MMFB 4NQZA 2PHZA 4EGCB 3NS7A 2NAFA 4CU2A 1G20A 3BMQB 1H2RS 2GVNA 5IWCA 2WWXA 1M5RA 1PR6A 4M83A 3T15A 4YMTA 2M32A 5JLAA 3QTTA 4IICA 2HU8A 5HPYB 1HBJA 5A6VA 5JCXA 4NCNA 3FIUA 2HCBA 2FEAA 4KFRA 4UFNA 1XTIA 3RVLA 4RF4A 1TYAE 5ADWA 4N76A 3A6DA 3N2IA 3U44B 1K9SA 1DDGA 4CKYA 2QA5A 3LPCA 3ZDYB 1DAEA 1GLVA 4M7PA 1GDDA 3DNMA 5EPOA 1QZ3A 1CCWA 3GNQA 3AF2A 1NNSA 2GQ0A 5BSFA 1AHHA 5K4AA 1DE0A 4ARVA 1EU1A 1WQ4A 5C4GB 4JWKA 3I2HA 4Z7OB 2I62A 5I8WA 5K51A 5CDYA 2JBAB 3HVUA 4TTPA 4R2IA 4WOKA 3KEOA 3T5AA 4MCJA 5BR1A 5DZSA 1SOUA 2R6HA 4HN4B 4EVIA 2JLXA 4ABTA 4PYLA 1P4HA 2L17A 1QO0D 2XRFA 4JZYA 1BC5A 1NUTA 3I73A 1FQOA 1DAIA 3GLSA 1TEVA 1Q1ZA 2ID7A 4L7QA 4MV3A 3UOGA 3S40A 2J3HA 2ZSAA 4BS9A 2GYUA 1F1JA 2I4IA 2JGRA 3K6KA 2WVAA 2BJHA 2V7QD 3KXKA 3MJ4A 4JJ7A 1YDEA 4KN5A 3JSAA 1LPMA 1P17A 1C3LA 2O7RA 1SXIA 1P7YA 2CDCA 4K3VA 3ILSA 3OE5A 4QJBA 4WK0B 4LJ8A 5P21A 2YN4A 2M6KA 2MIIA 4AQYB 4FYMA 2FFRA 3K8YA 5J63A 3EFOB 4OQXA 3WGMA 4B71A 1G5HA 4LBZA 5BQXA 3O8CA 1VPLA 1T9HA 2QRJA 3OICA 2LTAA 4AB1A 4AJ9A 5A62A 1M3SA 1C9DB 3LGXA 1KEKA 3RADC 1GGJA 3EPPA 1QHSA 4GX2A 3T7AA 1KKUA 4OSEA 5FLKA 2IX3A 4TLBA 2P0AA 3QNWA 3EVCA 2KWIA 3IV6A 3ZIUA 4IZ6A 2F8MA 3AOEA 2ZOSA 2XIQA 1L5RA 3F1LA 4OK6A 4A36A 2ZTHA 2ZM6B 4HDSA 1UIMA 3SBDA 3GEDA 4BQPA 1UDRA 1WUHS 2B8WA 5KNBH 1E9RA 2EP7A 4IHJA 4LBWA 4BE4A 4UU8A 2M6LA 3HNRA 1AZTA 2Q1XA 5J2TF 3ZXYA 4QAJA 1O6ZA 2JIPA 2QHXA 4MJLA 2Q6TA 2H8GA 2FPUA 1AH2A 3RRXA 4NFYA 1SMKA 2AIRA 3DXFA 1T1SA 3DMRA 2P5YA 3L93A 7REQA 2J5XA 1H23A 3K0BA 3ZWPA 5D01A 2D2XA 3VX4A 2R85A 3AGQA 3W3AA 9LDBA 1MO2A 1N2BA 1KTIA 3RK4A 2QQGA 2H11A 3GFVA 3M2TA 4R84A 3RG8A 3WRVA 4E5PA 3ZW9A 4A8JB 2GO7A 4LGMA 4LKRA 1BHO1 3VR6H 3BGIA 4IJVA 4X1IA 1HSOA 3FWYA 4OMDA 2HWUA 3GI1A 3S70A 5GZ3A 1XP5A 4YRQA 1JIJA 4LI0A 4CF6A 1U7WA 3N2EA 5H83A 1RJGA 5CG2A 4J3JA 3AF5A 4KXFB 4BKQA 3BMNB 4M8IA 2DFPA 3AUUA 4KRGA 3OIGA 3TTWA 3PITA 1BEZA 3NONA 3VO9A 1GRCA 2PO5A 2QJRA 3TL6A 4YCNA 2DR2A 1USVA 3C1UA 3EAQA 4KR7A 5J2UB 3EVAA 3D7NA 4CMAA 2G17A 2VYCA 4CLXA 5J2UF 3ND8A 2AEMA 4ZKDA 1PVDA 4MUNA 2FB9A 2D5CA 4OJKA 5D5HA 3DDOA 4MA4A 2NUAA 4MVJM 3NHPA 3UUWA 2QZZA 2ID4A 4J9UE 1Y8CA 4JEUA 4JT8A 4ZIRB 4Y67A 2C4KA 5L4SA 1ETHA 2BKEA 3HWRA 1LPPA 1MNAA 2Q5QA 3L4JA 5G1OA 1XNGA 2BRUC 1XXHB 1AB5A 1IWOA 2R87A 4XWYA 1ZH0A 5KIAA 2P4EA 4FI3C 3T4PA 2L2QA 3RYIB 3WKDA 3ZWOA 1B6TA 4OYRA 1EJBA 1A7KA 4LHXA 4Z53A 3NWOA 1T2AA 4GRDA 4RW0A 2ZKLA 4DLLA 2A0KA 1SVUA 1SCBA 3ONVA 1O6BA 3OFVA 1QCDA 1B76A 2WNSA 3LHSA 3LDUA 1XZAA 1MVOA 3GEPA 3O4HA 4ZALA 3DYBA 4PLFA 2FPRA 1VCHA 4L4UA 3R24A 2OB1A 3NPAA 1CV2A 4PE5B 3Q8MA 3V2GA 3VPGA 4J2OA 4KAXA 2IDMA 2NZ8A 4PC3A 1LI5A 3GCGA 2FOLA 4FD3A 5LJIA 3P0IA 1HWYA 1ZJYA 1KH1A 2I29A 2RAUA 1B6GA 1Q6ZA 3DDHA 5DHSA 5GVRA 5L51A 4IUCS 5EJ6A 5EJAA 4TL6A 3AVXA 1DC8A 5JS1A 2FPOA 4QXPA 3IOEA 4Q0MA 4QBHA 1EDBA 3NBXX 4D4HA 1G41A 5CA0B 1JHYA 1TZMA 1EWYA 3P94A 1EE1A 4HDCA 1V5EA 3KJEA 2P9GA 3MELA 2QT1A 1U2TA 4UOQA 5JAZA 2HA0A 5IP5A 4AU1A 5BYAA 2X7XA 3JQEA 3BYZA 4EYQA 1PFVA 2D2FA 1K2VN 2HK6A 4YLEA 2VKQA 5C7OO 3C3EA 4UVGA 3T4EA 4D4MA 6LDHA 4EGJA 1PW5A 1MX3A 1XUOA 3O90A 4N0QA 4YP0A 4J0IA 4KQMA 4NRDA 2HRCA 1NXXA 3U61B 3DR3A 4MGKR 1F12A 5EJMA 3NM6B 5JANA 3KJIA 2IEZA 1LW6E 4OB6A 5TPWB 3TIVA 3V34A 3IHLA 4PFKA 2OY0A 1XRLA 2DTDA 2HNAA 2OFXA 4AY6A 3A1TA 1CUGA 2PZGA 4EARA 3WJ1A 2X0RA 1EHYA 2VTVA 4KDFA 4MIOA 1Y7HA 5KX5B 4G0WA 4GI3A 1OW3B 1GCIA 1XF1A 2PWAA 2ZDGA 1SNYA 3BXFA 3P9QA 4EBBA 2C7RA 3W5UA 1SZCA 3NIDB 3GOHA 4L27A 4QSHA 1T9BA 3H2SA 2HA4A 4F56A 5AW5A 1K8RA 4IEEA 4J16C 1N5JA 2VJOA 3DJYA 2PUFA 3ZQUA 5GPBA 1IEWA 4P5DA 4U2BA 1EUDB 1UP7A 4BRUA 1K5HA 5D6OA 5IJAA 3S8YA 5GMOA 1QV7A 3LBHA 4HS9A 3VA7A 3IAS1 1LBSA 2YQ5A 2E89A 4FFNA 1KEWA 1GL7A 3GZJA 4Q39A 1SQ0A 1ODFA 2C7GA 4L3WA 1HDYA 1ZIYA 2IKQA 2JLUA 1Y8QA 3IIJA 4OG2A 4EQZA 4AICA 1Y6JA 2EG5A 4CHGA 4LDPA 1F60A 2ZRMA 3BRWA 4QX6A 1GGNA 2AE2A 4DIFA 4CUZA 1C4KA 2TMYA 3CA8A 3WQBA 3JRNA 4FQ7A 3OCUA 4KQXA 2EL9A 2ZIXA 3DYVA 4C9BA 2QR2A 4HUQA 4OB8A 3P2MA 3I83A 1FZTA 5I7HA 3FNIA 4UEOA 4FFMA 4IS2A 3TZLA 1M76A 3UFBA 1M0TA 2JFFA 2FLVA 2WD8A 3QKIA 5DTQA 1CBUA 4DLSA 4LC1A 3O83A 2C4NA 1IEVA 2GO1A 4CWAA 1YVDA 2C9ZA 1P4JA 2IHJA 2OC4A 2VL7A 4WNCA 4LYEA 3X2SA 2AN1A 1OF1A 3HBNA 3NNNA 1IOVA 2PA3A 3E61A 5ED0A 1IN7A 2OM6A 5SZJA 2C5AA 4B87A 2IQIA 1SO8A 3BGDA 3R3XA 4YP6A 2QRLA 4YO7A 1M6YA 2IV7A 3RBZA 2DPHA 2R3SA 2VXCA 3VO2A 1WEHA 4CM3A 2H2DA 1YZKA 3OTOB 4TXHA 1TXGA 3RNLA 1XEWY 3IP6A 5D5PA 3T35A 3FPBA 1EYZA 3LSYA 4FDUA 3IE1A 5FI0B 3RU7A 1HLGA 4NYIQ 5ECWA 5F1YA 5JMWA 2O57A 1N7HA 4O1MA 4L6CA 5DGDA 3IQZA 1A8HA 1ZHHA 2PRIA 3DE6X 4GZMA 4RSHA 3K8QA 4RK6A 1J0EA 4US2R 1DARA 4JH0A 3U16A 4HLNA 1OZAA 1Q95A 1WAMA 3M5CA 3NBFA 4ZCPA 4KN8A 3KQMA 5E4YA 1KZ4A 2GN4A 3FRHA 3I4LA 3JVIA 3UAXA 4QDKA 3EHEA 4BLVA 3OLVA 1AKTA 1BW9A 4HNAB 1GSHA 5FI1B 2WA1A 1Y8RB 3FF1A 5EZQA 3DPSA 2ZRNA 4GGMX 4HNGA 5HKAA 2OHFA 1UEJA 1GPJA 3B6EA 4GPIB 5F78A 5I45A 2BP7B 4OGWA 4Q1BA 2D5BA 4YN3A 3SVZA 1ZN8A 2IODA 2GHRA 2H5IA 4MKRA 2QY9A 4BFCA 1Y4DE 2AXPA 1TAHA 3LT2A 1E18A 2ZWOA 1O87A 4TV8A 3KNZA 3LLSA 4WA8A 1NFRA 3GD7A 4XQCA 3TYXA 1N8KA 4BFYA 1JV2B 1AKRA 2QN1A 4FCTA 1WL8A 2ZITA 3BKWA 3F2VA 4I0WB 4JJ4A 2ZUFA 1QVZA 3SS7X 2J41A 3PKIA 1R8YA 4EYSA 3AR5A 2O0KA 4N01A 4OAOA 5KVQA 4KR3A 3AKCA 3NNSA 4Z9BA 3SAJA 3R9WA 3K7EA 3IDZA 1QGED 3WOHA 3CUYA 4QEKA 2LR0A 3OQHA 5M34A 1AKQA 3LH5A 3BERA 1T8TA 1D2AA 2FWAA 1N32B 3D2BA 2X86A 2RK3A 4Z1OA 1I3LA 1G2PA 2XKBA 3LY8A 5FPHA 1HDIA 4IIJA 2Q07A 1N6OA 4B6RA 4HNUA 4ZT6A 4REQB 1TF5A 5GIPE 4OU4A 3N8NA 4FR2A 2JGIA 4GQIA 2EFGA 2BGIA 4UEKA 3CXRA 1YVPA 4JYCA 4XIGS 1HTTA 3V4LA 4CEJA 2H57A 4ISBA 4LWPA 3UWKA 1U1FA 5TDHA 4PONA 1LVUA 1NLMA 5DB4A 2DZDA 2YWJA 1EUZA 3ET5A 4D3FA 1NZJA 3B5JA 3O74A 4YX9A 1ZI8A 4QUAA 1IY1A 4TSFD 1YE3A 1PJBA 1S01A 2D54A 3QVGA 2JCBA 1UAYA 1PT5A 3H1EA 4IKPA 2W48A 1L5FA 1NATA 1OR8A 5F2KA 2JLVA 4AY2A 5ALTA 1B4DA 3CH6A 4M8NE 1N3YA 1F3OA 4KE7A 2XGOA 4K8RB 3HZHA 4Z7NB 1GCGA 6ABPA 2VNIA 2BDUA 1FQWA 3KJQA 3RC3A 4YNBA 2O0LA 2X2EA 4OQDA 4B32A 1SCUA 2C88A 1SUBA 1E3WA 1WCXA 3E2PA 4OVKA 4WFKA 2AHRA 4UBLA 1D2MA 4OF4A 4GOMD 1Y4AE 3PXGA 3LX4A 3KYCB 3OZCA 3CW2A 3DYIA 3MS4A 2Q45A 4IFTA 5JNWA 5CDUA 3P2EA 2ILVA 5D1NA 1XZDA 4BVHA 2H08A 1A77A 1ECBA 1V2HE 3O8QA 4LS3A 2BGTA 2ZTLA 5HIIA 3BE5A 3BFPA 3WLPA 4XIIA 2PX8A 2OCBA 1K08A 3ELDA 1I14A 5U4QA 3FMPB 4OHCA 1BG6A 2ARKA 2O8FB 1JGTA 4LJ5A 3U4MA 3CLUC 3NH9A 3OLYA 4X60A 2FP4B 4RVOA 5EJ9A 4N3NA 4N5MA 3HDHA 3ZVLA 3RR2A 3HLKA 5DIFA 3AEZA 1OBCA 5D2CA 1RVDA 3OQOA 1BMFA 1JNXX 2GWHA 1F2UA 1YIDA 2ACWA 3PZBA 4O4JF 2F1OA 2XWSA 1IJEA 1UT8A 4RTOA 3BUSA 2YWCA 3FCXA 4BVEA 3ROKA 3ZQ6A 5KWEA 4IZHA 1QRUA 5JMTA 3H2ZA 1JR6A 1ZPDA 3JVUA 3LT5A 3M83A 5BRNA 4BNMA 2JBHA 4RF3A 2A7QA 4Z0NA 2Q5OA 1XEAA 4NP6A 3BD8A 3WP0A 2PRKA 4KMSA 5LA6A 3DOHA 3PFNA 4L6AA 1Z37A 3GG2A 4M2LA 2OGTA 2PZMA 3BMOA 3LY7A 4UU0A 4EUEA 5JNLA 3PEWA 1YGPA 1KKMA 4BAZA 1UBFA 2F62A 2VATA 4D9JA 3CLHA 4TWAA 1FS6A 1KOGA 4UJ3A 1TB4A 1SVOA 2Y1XA 3KLBA 3P1JA 3IMCA 4X6YA 5IBRA 1X8JA 2VLBA 4RPCA 2BTQB 1RVV1 3RIMA 1V1RB 3V9PA 2QTAA 1K5PA 1P3JA 5DN6A 2WU3A 4W9RA 1DT3A 3OOEA 1TNDA 3F9CA 3Q6MA 2P2SA 4PGAA 5CHEA 5AT1A 5EWMA 4L4RA 4ZOLF 4CZ2A 2SECE 4C7OA 3N75A 2GF9A 1P5FA 1XG5A 1NXSA 5FUYA 4MQ6A 4F04A 2POCA 1XHLA 1W8DA 3HTXA 5FNZA 5JWOA 1FP4B 3RAJA 3AW8A 1RABA 3L9XA 3MUFA 2C2WA 2F67A 4PHFA 5KAPA 4F38A 3A05A 2AMYA 4XGNA 2GAIA 1S8FA 4J49A 3TLEA 5FWYA 4MMZB 2HJ9A 1Z62A 3JXEA 3MMNA 3MGBA 2V97A 4H1VA 3TH5A 2OK7A 2W42A 1XVAA 5BQFA 4TQUS 1IN6A 4Z2AA 1ZFNA 4IG4A 1SUDA 4BP3A 2ZJ4A 3OEHD 1M2OB 5HHTA 5JXHA 2OV4A 3EXHC 3HI6A 3L92A 2MR6A 1NKSA 3JAWB 3WK7A 1AB6A 4IFEA 2AN5A 4WZAA 2QLNA 1J90A 2FE4A 1VP3A 1E79A 3WJAA 4W5NA 4KGZA 2VF2A 4RTNA 5IMBA 5JY6A 2PYDA 2QTNA 2JNWA 4J4HA 2RI6A 3AKZA 1VM6A 3COWA 4W9NA 3PQ5A 4MUGA 5I8ZA 3JQFA 1UWKA 4WV3A 5AHRA 4KK4A 4A6XA 3GARA 4RH3A 3A11A 2ZUDA 3MGGA 3ENWA 8ATCA 4IIUA 4X7PA 4YEDA 4UAJA 2IIQA 4QFCA 2YWDA 2M2IA 3FVRA 3TE7A 3OETA 3AUFA 3BN3A 4J0CA 4M0LA 2CBZA 3L8FA 2HF9A 3H11B 4JOSA 1MB0A 4QYXA 5G0VA 3W0LB 1OKKD 4YQZA 2ZZMA 4PNPA 3KAQA 1O5TA 1PJSA 1Q3TA 3F71A 3LX8A 5ELLA 5K0NA 1DNPA 4RTQA 3FTFA 3ZWWA 4HH1A 2QTZA 1OI7A 4W8OA 2CSUA 4HAOA 4MW9A 4R98A 5DHUA 4CGYA 4Y9SA 4CQMA 3NC0C 1T0BA 3LQ1A 5B1DA 1I3MA 2NACA 4LYYA 3OX1A 3X1JA 5KWSA 3C7TA 3VTZA 4CIWA 1YBAA 1P75A 2BMAA 3CF0A 2UZ1B 3KL4A 4GMXA 5DYNA 3RJ9A 4A5SA 1KOFA 5LOVB 4TRJA 3EGEA 4NONA 3T3HA 5LOVF 2PLFA 3ZEAA 2H4YA 4KIFA 1UZAA 3MA0A 1Q0TA 5FNVB 2Y4OA 1W5BA 4CT4B 5HILA 1YR9A 1L4EA 2EKLA 4YR7A 5FADA 2VDMB 4FP9A 5DX1A 5AUOB 3H2JA 3U9TA 1OTHA 2VQ6A 2FFQA 1F4VA 3AQIA 5DCUA 1Y5RA 3TCXB 2DJ5A 3W8NA 4A16A 1NRWA 2R62A 3PFCA 4V39A 2JIOA 2ZYAA 1BDBA 1VYUA 3R0IA 2ZIWB 1M1ZA 3AF1A 3TW8A 1EVZA 1SXQA 1G5TA 3LPDA 2O59A 1O3YA 2PXHA 4ZYVA 3SU8A 3K70D 3KXIA 1EZ1A 1KJJA 2Z1NA 1V8BA 3IQGX 3FNRA 4LECA 1XMPA 4RL6A 4AIRA 4TLCA 5I9NA 1WO8A 4L50A 4Q05A 2NV6A 1XLWA 2FR8A 1U98A 3RVRA 5KSOA 5DDIP 1MT3A 1Q5PA 2Q3JA 2VYNA 2JH8A 3JAKA 4MV5A 3R7FA 2C03A 1UL1X 3PGLA 3EZYA 2O0HA 1GHTA 1L7NA 3EPLA 4IDBA 1G38A 1JR3D 1NW6A 3DCYA 4AULA 3P4YA 4F4FA 4NICA 3EZLA 1L5QA 2AEJA 4IOLA 4UHDA 3TCNA 1V25A 5KNLA 2ONZA 2WV7A 4IGEA 1DT5A 1RU3A 3NHSA 3P4XA 4TOIA 4Q02A 4C76A 3ILHA 3IJPA 2FFAA 3UV7A 3G1UA 1DX4A 1O08A 3VNRA 1I3KA 2ZSEA 4RFLA 3FNEA 1RHJA 5ARDA 2JJMA 3H5TA 3TSYA 4UFPA 1AF7A 2RGNA 3P2IA 4I08A 4HXEB 2I1QA 3QA9A 5EE0A 3EVTA 1HDZA 1NGSA 4RMGA 1TW3A 3FYDA 5HYVA 4BP9A 3U7EB 3KC2A 1V47A 3JQAB 1VSQA 3NBQA 2HO5A 4R71A 3BK1A 4QSMA 3WYEA 4P3XA 4JQCA 4TM7A 5CVCA 5CCBA 2ZSDA 4GWGA 4WIAA 2COKA 4K9NA 3QVVA 1I2DA 3OU6A 3HCAA 2CUKA 3WSWA 4U7GA 1Y48E 2OCKA 5FR1A 4CQJA 1YB7A 2HV9A 2J0QA 4Q3OA 4IJWA 2XQFA 3T4XA 1GQ2A 3FSRA 3C4JA 1BRTA 1SZJG 1HOXA 5EZ6B 3U1TA 3ZTYA 3KCNA 2W11A 7GPBA 4CMEC 3GDHA 5HCNA 1EXNA 2G08A 1O9HA 4HDRA 1SVIA 3PI6A 2DHEA 3VAYA 1MOZA 2OSVA 4GWKA 1SXGA 1FDIA 1Z0AA 2M9MA 2L18A 3PB3A 2O3QA 3BM5A 1PJ2A 2OHIA 5CT5A 5MF6A 4ESOA 3RV3A 1ZGAA 1BNCA 3I2IA 4UBMA 2ZAMA 2B21A 5BSEA 3LECA 3PJFA 4HDOB 5I7SA 2QP3A 3AIOA 4QYIB 1AHNA 5KYYA 2YZ7A 2ZJ2A 2MSCB 3BG5A 2PZKA 3FE2A 4TYMA 1M2EA 1RTKA 3WWDA 1NC1A 4GVXA 3SF0A 1SUSA 2GD2A 4GWLA 3R7WA 2X1VA 2Z2YA 3EF3A 1H8ED 4AMUA 3R40A 4KKXB 2RHLA 5BW8A 1Q7GA 1K7XB 2Q27A 3AI2A 4W8GA 1E1CA 1H2WA 1UMKA 4YRDA 5A0FA 4DCNA 5B3KA 4MGEA 4Q1EA 2F4NA 1RJFA 3W3AD 1R5NA 1GDTA 2Z08A 3R5XA 4JI1B 3LMKA 3AB3A 2A0YA 2Q46A 2O48X 2I78A 1GIAA 1F7VA 4IXMA 4DPKA 3DHYA 3ZU5A 4F9EA 2FETA 1CR4A 3DZCA 3E58A 3PT5A 3RVNA 2CJXA 2BEWB 2PU5A 1SUEA 1NBWB 2QBYA 1L3IA 5KI6A 2NYRA 4URUR 1PR5A 2H9AA 2V9ZA 2PT6A 2E9SA 2VDOB 4GLBA 4FEGA 5BMVB 4D97A 1W581 5CYGA 3A6LA 4FR5A 4L5BA 4E32A 3GPDG 3QU7A 1JBQA 4XWKA 5LB4A 2BFFA 1DG1G 5FV4A 2F43A 1UJNA 3CPHA 1KZYC 1GZ5A 4FVTA 2DSTA 5DGCA 2BISA 1LBEA 1B3BA 1J70A 1O95C 1T6BY 2P5TB 2WFLA 3HJBA 3QVJA 3AILA 1RWKA 3C3DA 2W37A 4AX8A 2VCHA 2D1FA 1L1EA 2Z8YM 1UKAA 3AYXB 3G2IA 4K1XA 2ZJZA 1CJMA 3ANMA 4XGQA 2J0UB 1CB0A 3Q85A 3GLHB 3SQOA 1RXWA 3UG6A 4DF3A 1XRMA 4BGIA 3G2QA 4R9SA 5MHTA 1IG0A 1U7PA 1PTKA 2I67A 1QG2A 2GZDA 3DNPA 4KPUB 3RC2A 3HKBB 3PNOA 3TDKA 2ALJA 1OJ7A 4EEKA 4KXUA 5E3HA 2BYTA 3W05A 2N47A 5C9ZA 1JHRA 3O7MA 3TQHA 3GRRA 1CLEA 3VV2A 2HADA 4PX5A 3SHVA 3LK7A 4BO5A 5KJCA 1V39A 4TLAA 4F12A 3LUJA 1ZRMA 1VBNA 5TT1A 3DO6A 3OIYA 4YJDA 3VZQA 3BHMA 3LSTA 1RWVA 1CRPA 1ZK0A 3WGHA 1U2DA 5DNUA 3W5DA 2A4MA 5KOIA 2QGNA 3PQEA 1V11B 3F6CA 2VDKB 2B0CA 2YHBA 4BPBA 1C3JA 1K7SN 1YE5A 1MO3A 4B44A 3H05A 3KQYA 3TCKA 4Z7JA 4Y9TA 1MKYA 3CG0A 1X87A 2JVKA 3LO5A 3EC7A 4RCYA 1R50A 1E2DA 1JR2A 2AZMA 1NXWA 3F9IA 4EENA 3A4VA 3H1FA 4EA8A 1CDZA 3QWAA 2ATXA 3OQIA 4NMLA 1DELA 1NASA 2GM9A 5CDFE 3KKLA 1JQAA 3HJGA 4PPNA 3RTEA 1E4YA 2R00A 4KR9A 1RWOA 3EA0A 4B4DA 1ZO8A 5JSFA 1YZTA 2ZG6A 3KYJB 3AJ9A 2R66A 1F06A 4KKVA 4O4HB 5K8LA 2CV2A 1VHTA 5EIOA 2Y68A 5G53C 1DO0A 4UUNA 4Q37A 5ILGA 3TBHA 1S8OA 4CW7A 1MFZA 1QGAA 4B74A 2R8OA 3F5FA 1I4OA 4ND8B 2WINI 4U00A 3IPRA 3GJ0A 4RD0A 2VUTA 3TINA 2PFSA 4P58A 3ZNNA 2IWHA 1IAVA 1SA0A 5F1OA 1J1ZA 4I4TA 2HDWA 5HF9A 3HKEB 2WTMA 4UARA 4BFVA 1ETUA 1XDDA 1H9AA 4BJHB 5FCDA 1Y82A 3ODGA 1U1IA 3TOVA 1UM8A 1SU8A 1UMCB 1RPAA 2VPQA 3NAQA 1FCJA 3IDOA 3WL8A 2VDVE 4YYEA 3VDMA 3V4RA 4KR6A 4LF4B 2XE8A 3Q3CA 3C8MA 1JIUA 1KI2A 3LDHA 5K2MA 1AKWA 2GJ4A 4GG1A 1RHKA 2AMFA 2DULA 5DGIA 1IBKB 1RBZA 5BW4A 4TZKA 4QQNA 3VR0A 3QPVA 1X0VA 2YJTD 3TTVA 5JHHB 3IT2A 3CKKA 3RGGA 3DVQX 3COVA 2AOXA 5CCXA 3A2MA 3RFUA 4NBSA 1YBHA 3F4KA 5TNXA 3ZCSA 3IUNA 1PD1A 3TQFA 5IDXA 3LCUA 3PLRA 3U3DA 3O5AA 3D3KA 2VDRB 4ZEMA 3BRWD 5FBZA 5HQJA 2IVZA 4KGXA 2YV4A 4ZJYA 1DAOA 3LFHA 5K01A 3VR4D 2UUPA 4HQLA 2HXSA 1BDMA 4PG8A 4DCMA 2H52A 3UCXA 1VSVA 2CBXA 2V45A 3EBPA 3IAUA 1LBTA 1U5BA 2JJ1A 4FMDF 4XXHA 3KWLA 1CS4C 3G85A 1S2LA 4KH0A 3AM3A 1ECCA 1N1MA 1ZK4A 1D0SA 1M2VA 1RKQA 3E7XA 5AOAA 3ZBQA 4O4IA 2XHZA 4KVAA 2H0QA 1ES9A 2YWHA 1DRKA 4R8KA 4TWBA 5TB5A 3VPBA 3U39A 4EHDA 4D74A 3NETA 4RDCA 3UHPA 4G5RA 5F2OA 5IDYA 1ID1A 2BKVA 2E55A 3ANSA 3MSCA 5G3ZA 3MGCA 1VGQA 4B4WA 4CKCA 3LKDA 2QTCA 4JSRA 1M2WA 4UQLA 4I5IA 5CH8A 3S7TA 3TM4A 4QRHA 5KCMA 4FW8A 3JQ7A 3FPEA 1R10A 1V8FA 3KKEA 1NKTA 4IWYA 1YTLA 4Q9KA 4Q1AA 4U2FA 5JAHA 1AHIA 1V3TA 2YOGA 4BZXA 1XC7A 2GK3A 4ZV9A 1FRQA 3GDOA 3HC7A 2C8LA 2QQEA 3CLTD 3JALB 4UBIA 3KKZA 3MWEA 4X7BA 4QYWA 3I1IA 4BYMA 1ZMBA 3K0FA 1Z2AA 3N8DA 4Q3KA 5CPBA 3MIIA 2HF8A 3ECAA 5E4JA 3WIVA 1ACJA 4R1QA 3SHTA 2DTEA 3M4JA 1KZ6A 4K28A 3TB4A 4DMGA 1NTOA 3PHHA 2MCFA 3QQ5A 5FP0A 3GUZA 2O6LA 4YJHB 4YCJA 4GKKB 4BL5A 1IONA 4UM8B 3S2YA 5BN1A 1JG6A 4B43A 1Z45A 1KPHA 1JLLA 3CNLA 4X8HA 4DQKA 2GPTA 1CRLA 3EQ8A 4WCFB 1UC5B 1YUBA 3S44A 4QOJA 2OMEA 1K6XA 2CD9A 4XJVA 1EINA 1NQUA 2OGZA 4M8KA 1Q77A 4BWVA 4PNEA 4KBYA 3EIXA 4BFXA 4F3TA 4XPZA 2J9YB 3IT3A 2FPKA 5FWAA 1Z6GA 2X0FA 3U0VA 1HURA 1QHHB 4FKZA 1M0SA 1UAGA 4MCIA 3AT1A 4B4UA 3FDFA 2UXCB 2DQYA 1NVFA 2FMUA 2JJQA 1UIRA 1PV2A 3DUFA 3ESXA 3TZCA 1DEXA 4YJ3B 4DREA 5JFGA 3WK5A 2UYOA 1VG9B 3CRNA 4YJ3F 4AVYA 5IKEA 1XDUA 5FOSA 2EKBA 1NX6A 3L8CA 1TT7A 2PYZA 1YULA 3FFBA 2G40A 4MWZA 4KSBA 1UXGA 3R7DA 3SXJA 2D5IA 1I2ZA 2OHHA 1LUAA 4BFTA 4C0XA 4KBGA 4HGZA 2I2FA 2CB9A 2NXNA 2H63A 2ZSIA 2R8BA 5FBRB 1TF7A 1J42A 1TRKA 5LC1A 3L6EA 4B6SA 1R8JA 5LKAA 2JI7A 1UOPA 2OCGA 3FUUA 4YECA 4XIFA 3A4NA 1MHPA 4M9ZA 4JCOA 1JR4A 1GTG1 4N7BA 3M34A 3NMUF 3JX9A 3EEFA 4ZICA 1IWBB 2ONCA 3KO8A 2HIHA 1GAJA 2PZ8A 4L15A 4IRUB 4DWOA 3SHFA 5K0CA 4XIJA 5LQKA 3THWB 1W8IA 3N6XA 4M37A 3E23A 4LRYA 3KR0A 3HE3A 1N57A 4IVPA 1GGHA 5DKFA 2P9HA 3ZKAA 5DXJA 3D4PA 1FW8A 2IF0A 3OC0A 3IHTA 5J5AA 1IY0A 2FGJA 2TSYB 3FVQA 2I22A 2O2YA 1M2FA 2RGDA 1PZFA 3C7AA 1YCGA 4IQ4A 3JQ9C 3KOYA 5T8KC 2ONYA 5CGZA 4GSKA 4LK3A 5H1YA 4BXOA 4HJXA 1VCMA 4YQYA 5AMXA 1GQRA 3DLCA 5JBQA 1PJQA 4RXTA 2Q1YA 4X54A 3LHIA 4FONA 5CNJA 1V9LA 3P9ZA 2DSNA 4PRLA 2PKQP 2RJOA 3DMDA 2FHSA 5BSWA 1RI3A 2CNOA 3M70A 5TQ0B 3BJRA 3FD8A 1FDSA 4W5HA 1L7OA 2D5AA 2RK6A 2WHQA 1HC7A 2BM8A 2PBRA 4LGCA 4RY0A 4OO3A 3SXPA 3TQQA 4E6PA 1BMFD 1X70A 1K3TA 2OUKA 3NV7A 1PR3A 2WMNB 1F2TA 2I4LA 2OE2A 3ADCA 5DGTA 4KE9A 1Q2UA 2FSFA 2HJSA 2GH1A 3C7CB 4YMSA 4LXHA 1Z47A 2XUAA 3I6MA 1G6HA 5FKJA 1KZ7B 1YJCA 2QD1A 3HBMA 3O0TA 1E2LA 5HFAA 2NXWA 4AKHA 3NM5A 1E4EA 3H83A 3JQ8B 3NBAA 2D6FA 1X38A 4OXXA 1DFIA 2K7ZA 3NVAA 5IJ9A 2RCYA 2JDIA 2IZ0A 3CZPA 4GZ5A 2NO7A 4X93A 3B5EA 2PD6A 3DOFA 4KTVE 4Q1DA 3B1ZA 3Q72A 2EW8A 4P2BA 5ABPA 4C0HA 5EE5B 3SE7A 4QICA 2BBWA 3NHKA 4KXMA 3STWA 2C4WA 2OWEA 1QYRA 1E9CA 2YQZA 5P8WA 4D8VA 5FH9A 4IIGA 4YAKA 3NT5A 5DN6D 1G2QA 1YS7A 2M6RA 3AM4A 2DTXA 1RJ9A 3MT7A 5I9IA 2W4MA 1YRBA 3D3NA 5JD5A 3L7YA 4E6EA 3GXOA 5GINE 2R6GA 3EXEA 4US0R 4OPMA 3ZWMA 2VZ9A 1X13A 1EQ2A 2IY7A 2ZVPX 2CLIB 4R7ZA 1FTYA 3ENQA 2DOKA 4D98A 2AW3A 4ZT3A 1MT0A 4X97A 2CNDA 4CM1A 2YRFA 3KQLA 1CR0A 1XIVA 1BVYF 4HMOA 5EPEA 4I5EA 3G79A 3D8BA 4AYWA 3R74A 3NGXA 1IMOA 3OT5A 2ZIEA 1UJ2A 1ZICA 1A4RA 1JHDA 4BVBA 5JUWA 1M0WA 3WNDA 1ESCA 2P3OA 2OZVA 3AVOA 1JR3E 2G04A 4FZRA 1DAPA 2GESA 2VK2A 1HL3A 3GGCA 5JSKA 2P7HA 2WMOB 3D5TA 1KJWA 1M34A 1OTYA 2ET6A 2V0NA 2VT6A 5CTAA 1GPMA 2WF6A 3QE4A 3R5SA 4PXYA 4YRMA 5C5DA 4C05A 4BB5A 1Q0SA 2O50A 3LUDA 1T3GA 3LQRA 1E79D 2IW1A 3QOFA 4MZDA 1W5SA 3AEUA 5GZ1A 2DHRA 3IQFA 2QRVB 3H8VA 3NHYA 4NDAA 1TJNA 2FPIA 4R0NA 4V0RA 4E5YA 2AMJA 5IMSA 1UXJA 4XVUA 4ZDJA 5KPDA 1EXMA 2Q2OA 3BD9A 3D1VA 4ZARA 1O57A 4PX2A 1E1NA 4NU0A 1EWVA 4S12A 1X39A 2FPWA 3L8DA 3OIWA 4HPXB 2GJSA 2IQ5A 1Z0JA 2I2BA 1BFKA 1KJ8A 2ZJ8A 3MT8A 4FFBB 2IZZA 1CF9A 3SCZA 4QQFA 1D9ZA 3IAM6 4J16A 4UNPA 3SX4A 4G1BA 1U4NA 2H4XA 4GMKA 1VHQA 1OI3A 2X7HA 3ZY2A 3LD9A 4EH1A 3O93A 1N33B 3MSXA 4JQSA 2B20A 3UAGA 1Q57A 2VQEB 4F5YA 3PFBA 1Q21A 1CUWA 3CIOA 3O8OB 4URZR 4XD7A 3VMFA 4HDKA 5AJWA 1KMQA 4CQMD 2HPZA 4EMTA 1DQYA 1ACMA 1VI2A 2BEKA 1A8PA 1J8QA 5FTJA 3DG9A 2FWJA 2H3HA 3LIIA 3LX6A 3LTNC 1YHZA 2IRWA 3AP1A 1RYFA 2N46A 2YWGA 3F90A 4ZOEA 3VVLA 1RWWA 3AF0A 4Z0PA 2ORVA 3KLPX 1EBBA 3MWGA 2RBKA 2BR5A 1WVMA 1NFFA 1LV8A 1YCFA 2DQZA 4IZOA 3M6VA 3HCDA 3LXXA 5DMXA 4TL7A 3PA8A 3G8YA 3FW1A 4QRIA 2J7PD 3ROQA 3UANA 1SIOA 2B61A 4NKRA 1XCLA 5JXWA 3A70A 2YV2A 3KFLA 3Q9UA 3DMNA 1UJ5A 3LPAA 3P9CA 1YB1A 3LHKA 3MFQA 2W8BB 5E8RA 5TR9A 1KRHA 3WV5A 2JFHA 3IILA 4QGSA 4B6QA 3S1LA 5GONB 1JT2A 3QU4A 3DBRB 1Z35A 5HCIA 4HNSA 2Z04A 4A8PA 4D0LB 3JSXA 1XPUA 1GQQA 3UMRA 3GBVA 3U3XA 1LQUA 2VJDA 2WKQA 3V55A 3NTQA 5BN4A 5JG7A 5J4HA 1RRVA 1VXRA 4XD2A 2FW8A 3KD2A 4RC9A 3OPYI 4ZAFA 5JU6A 3Q12A 5AW1A 3P2YA 1CEXA 1CETA 1DWPA 1UFRA 3CY6A 4A6DA 4Y1RA 4IP0A 2D0PB 3KRTA 2XMBA 3DVRX 2IXGA 5FTMA 1FLDA 3OQMA 4Q4HB 4Y2HA 1E1YA 5DCWA 2JLWA 2NQTA 2B2CA 2X5KO 3T34A 3DV0B 5CGQB 1ISGA 2UYGA 2WVGA 1PTJC 4AZSA 2Z9DA 3PICA 3ML1A 4L28A 4GUAA 3G2NA 1CQIB 1MO6A 3R7SA 1HFEL 1FNMA 1XZQA 3TLGA 2ZYIA 4UCQA 1E3JA 5HCUA 3L6BA 1OAAA 1QK3A 1YAJA 3HM2A 4QQ8A 2P9CA 4ZAZA 3GFFA 5FPPA 1HTWA 4L5AA 1G7RA 3WLSA 4YPVA 4UHBA 3ND7A 4RV5A 4JIMA 4AJJA 4B9AA 5HVNA 3OF3A 1PAUA 2OZLB 4X9XA 2B7LA 3F2IA 1K6JA 1PGJA 2BMEA 3O9VA 4S24A 1CUAA 4CM7A 4DRYA 3DKKA 4WQMA 1NRJB 1M8PA 1A71A 1RHMA 2FQWA 2Q6VA 1N0UA 2ZCVA 4H0FA 4H6XA 1JX6A 2JAQA 4N6GA 3VI3B 1U5AA 4MWDA 1CULC 1Z75A 2W2LA 4KQKA 3L0PA 1LPOA 3DVAB 4IMJB 4JC0A 7ADHA 4OHRA 5BO5A 2CGEA 2GBFA 3QEKA 4LY3A 2WYUA 1L5GB 1SXJC 4UM5A 5GV8A 3MWDB 4M0CA 3LLMA 4XB6B 2CHVA 2EATA 1IBMB 1IZZA 5D7BA 3C7DB 4US1R 2VUUA 1KE2A 2QRQA 3K6SA 3JWGA 3NDPA 4PSDA 1RZUA 4TSRA 1Y4UA 3ZC3A 2ZS8A 1H6AA 2PIAA 4F3RA 4Q9AA 4RNDB 1ICEA 3FOEC 1Y5LA 1E9BA 3L8HA 1W35A 1JXAA 5FTKA 3T7JA 4O2BF 4QPDA 1LD3A 1PR2A 4PR3A 5EZYF 2X9GA 2JFNA 3WNQA 3SXUA 4DT1A 5C1OA 2P6NA 2WIAA 3QEJA 3HU5A 4PRKA 5TGDA 1B7GO 2B8JA 3DC7A 2W6OA 4E4TA 5DTMA 2A0UA 4IH9A 3UJ3X 4Q4CA 2PGIA 3GLKA 4TT3D 3ZDDA 3EY4A 3UT6A 1P5HA 2QM3A 2QZ9A 5JSUA 1DGQA 2H4FA 4HYQA 3TDNA 3E7WA 4DQXA 1BD4A 1QLWA 3DW3X 3I9KA 4A10A 1PFWA 4LY6A 3UCFA 3QI2A 4EB3A 4QUBA 5IF9A 3VYWA 5G0TA 3GLGA 4U2KA 5LP6C 2OCIA 3CZ4A 2Z09A 4AZ0B 3S68A 1XMOB 2H48A 2IHTA 2K2WA 3CX6A 4QXRA 5TMBA 1CUYA 2H5LA 3EQ7A 5AKIA 2EJVA 3LT1A 5IZ4A 2D74A 2QRZA 2CW5A 3WBFA 4PNZA 2UVPB 5ALEA 1V2GA 2WMYA 1YZHA 5HF6A 5A3VA 1TJPB 2UVDA 3EASA 4DUPA 1T0JB 2FSIA 5F4ZA 2XKKA 1WZUA 3QEMB 1TMGE 2GT1A 4RKEA 4HAYA 4ACAA 1HG0A 4KAAA 1Z0ZA 3HYTA 8LDHA 1QNFA 4FM9A 2PUVA 2X9LA 2P69A 3H4TA 3RD5A 4M89A 5K0BA 4GVPA 3COPA 1G21B 1WB9A 3KR1A 4MVJP 4O02B 4EPXA 4Q01A 3IXMA 3VC3A 2EFCB 2J59A 1L3CA 2VF7A 3A0UA 3KZ1E 4GZ3A 3LCMA 3ZE2B 1T5TA 1HA3A 3KU4A 3CR3C 5TS2A 1SHKA 1ZDMA 2BEVB 3DCIA 4G9GA 1V7QA 3RS8A 3TM5A 3P2JA 3LUCA 1ZONA 2RGEA 1QAQA 3DBHA 1O2DA 3KJZA 4LZZA 1J06A 3GUYA 3VOBA 1DJQA 3HBFA 3RGWS 1FXWA 1XELA 3KLMX 3BDAA 1KDZA 3S55A 2GZSA 3TLKA 4EITA 1PRYA 2O3UA 5DYIA 2C0CA 1V3QE 3E48A 2QLFA 2EDAA 2ZJ3A 1BEUB 3AMVA 2VJMB 1JEQB 3AIKA 3DULA 2DWUA 3KS9A 5DHAA 4CLOA 5A71A 2VDJA 1KEEA 4DV3B 3COJA 1FMJA 2J5RA 4CV2A 1KJNA 5KTPA 3A31A 4OLHA 4Y6QA 4K9RA 4Q00A 2FUEA 1G7SA 4C6TA 1UINA 3R5TA 2QSJA 2JGFA 3IUYA 5JATA 2PLRA 4B35A 3K3PA 4MUAA 1NOKA 2DKNA 2YFKA 2VBIA 4EG5A 2WW8A 1FTWA 2PQ2A 2W6NA 3MYYA 2AKAB 3K6RA 3O3OB 3OZAA 1PDVA 4HVLA 1IXYA 3HXTA 1HDXA 1WCIA 10MHA 2AD5A 3JRWA 1Y63A 3C16C 4GNRA 4N1AA 3WK8A 3DDCA 3DZGA 3OQNA 3A06A 4QOEA 1YB4A 3G9QA 5TJHA 5ECGC 2OHJA 3AXTA 2RG7A 4YWHA 1SC3A 1XYVA 2VS1A 1W96A 4Y18A 4E88A 2X1LA 3A26A 4NBNA 2I1LA 2P9YA 2VHXA 4P4LA 4RDHA 5TQ2A 1X2EA 5D6NA 4EY7A 1D6MA 1GPYA 1THMA 3IDSA 3LNCA 4CDNA 4YK7A 3PK0A 3R6WA 4Z9AA 1EJ6A 4ZO9A 3WYGA 2BKUA 3EXHA 4RACA 4N47A 2XF8A 4C1NA 1KJQA 1OHHD 5JTUA 1EB9A 1XKLA 1IBSA 5DCYA 2X0IA 4ALLA 3S1SA 5JXGA 4AW9A 1XQYA 1DXQA 2RI0A 2H18A 1JN0A 4LNAA 1SJ9A 3GVCA 3G2KA 3MYRA 3MT9A 2XW6A 4WVLA 2QX7A 2PD4A 3OURA 3PU6A 1TCUA 3NHMA 1JHOA 1E0SA 3RRYA 3IBFA 5LIRA 5JOQA 4L7VA 1JMVA 3ESYA 3VUFA 2WJ6A 4G0QA 2A78A 2Y1DA 4FW9A 5IK2A 4PAGA 4P81A 4Q4AB 5BW5A 4B7CA 4RTPA 4KTTE 5CR9A 1RKXA 1DC7A 1Q0HA 2C7QA 1A72A 1GA4A 4L02A 4P7FA 2P0EA 5LU8A 4RSMA 1PZEA 5CNIA 2HWWA 3GQBB 3BRCA 3PQFA 3FDJA 3P26A 2ZCJA 4NXMB 3HKDB 1USGA 2ZU6A 3OEWA 3QE3A 5A3QA 4ZCLA 3LU1A 1YNSA 1N3LA 1CFZA 1XZGA 2EBHX 2Z1DA 3GXBA 1KMHA 4MUEA 1I1QB 1XTKA 2PVCA 4P34A 3TQTA 4BFWA 1WWKA 3T61A 2ZQYA 3N0RA 5CVDA 4RVGA 1Q20A 3KXDA 1E60A 5T3YA 2WDPA 4B3SB 4C43A 1MGPA 3OZEA 3VOTA 2JJ1D 4JC4A 2E6UX 2PO7A 4ZAGA 2GXSA 3AP2A 4WLUA 3AJAA 5K3FA 4LCEA 3IAHA 4XUGB 2EBUA 3RG2A 1CKEA 1WLYA 3K35A 2ACVA 3C3WA 4ZQEA 3UB4A 2H5JA 4AN0A 4XM0A 1SVLA 3T1HB 5DHFA 3IQHX 4XVHA 4P98A 4D3YA 3LYAA 2O8EA 1C0LA 2G76A 4B2YA 5D3QA 3E84A 4EG7A 2EGHA 3PUZA 1WY7A 1G59A 3IIKA 1A0OA 5EJFA 1ZLYA 4QGAA 1KRXA 1ZS9A 4PR0A 1V8DA 4PIPA 1UK9A 1U9JA 2XUKA 1SZPA 3HP1A 1SKUA 4FYJA 3H0KA 5JQGB 3LW7A 4FR0A 2PWYA 2W58A 5I7EA 2ORWA 4BX2A 5JQGF 1RI1A 4QGHA 4WY2A 1CUHA 3HN7A 5C31A 4D9NA 1A9XA 4NPCA 1WV1A 3I45A 1A04A 4DS3A 2SCUA 3AJ8A 3FRJA 3P20A 3VYUB 1AGNA 4WFIA 1W9HA 4ZTUB 5AKJA 2C1XA 3L4EA 5F9HA 3PHJA 4CT0A 2B8TA 1PL7A 1J33A 1KIAA 1C81A 3QELB 1D1TA 4XR4A 4N5IX 2VH2A 4LISA 1TUIA 2ZUBA 5CH5A 3IQXA 4RA6A 3RPEA 1ELOA 5ULLA 4AG5A 3ZS8A 5KYTA 3VJKA 4XFDA 3AB8A 2V03A 3BSWA 3MBKA 1SKYE 1E3TA 1XZJA 3EMBA 2A5DA 4AJOA 2C2MA 1T29A 4YV0A 4CKWA 4G2TA 5L45A 2Q4DA 1P2DA 1L4BA 3RHFA 1YZVA 4LYHA 3MRXA 5FHQA 1X80B 3NWPA 4GXTA 2XCOA 5DI3B 5HKLA 3EG9A 3T1VA 4E4YA 2PRJA 4JYZA 1E58A 3GFQA 5ERGB 4W1QA 5ARBA 1Y5NA 2VPWA 1TK3A 3NATA 3QW2A 4FGWA 4XLTA 2WTBA 3DUWA 1QO9A 3B48A 4CM8B 5ALYA 1VOTA 5U4XA 3DQPA 3OM9A 3KUKA 1N2CE 3OMXA 3QLEA 1YQWA 3S3TA 2F00A 3TEFA 1SG0A 1C9EA 2I6QA 3GO4A 3MTIA 1AZWA 3V8MA 1EXDA 1E7MA 4HAXA 4CMEA 2H59A 5F3RA 5AFSA 3F8SA 1E61A 4ZVRA 1J9ZA 1DFGA 4QA9A 2WTEA 1G20B 4NLLA 4BNKA 2FSGA 3IE2A 4CKXA 3M1IA 4C0BA 2QAJA 5LMCA 3K70B 1V16A 1PWXA 3JVVA 2IEIA 4RXUA 2GCOA 1XU9A 2Q9UA 4NBTA 2NLOA 1LRLA 1PYDA 5ALRA 3QRWA 4ICIA 5FUVA 3TI7A 5GJVC 2ZYRA 3IUQA 1G5PA 3ZHSA 4ZVMA 1WUJS 4QUKA 2C2HA 3T5CA 3T3PB 5ERYA 3B6MA 1G19A 2A7XA 3JWPA 5E1MA 3OO1A 3U7IA 1CIVA 1YB6A 2Q0QA 3L6UA 3O8NA 4CFYA 1ZCJA 1W94A 4H16A 1DIHA 3QX3A 2GN8A 4X7RA 5MN6A 2A9FA 3PRYA 1UBCA 1D0IA 4XX0A 1V1MA 3ZZTA 4GIBA 2WU4A 1NQWA 2ZPTX 3G2LA 2NZVG 4JL6A 1Q16A 1Z5GA 2CUTA 3X43A 4AZ3A 1JAZA 3EMKA 4H6WA 3GH3A