4Q05A

Crystal structure of an esterase e25
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
327
Chain Sequence
b'ENSWQIGPRTLPAPSGASDVLYNIISKTPTPVPTINLNLVPRTESEWRAAITQLDEGKVDMAREISKQLSVSVEHGVIEGVSVYYVTPVEVAPDLEDKLFVHTHGGAFVLNGGEAGTIEAIVIATLAKVRVLSIDYRMPPSHPAPAARDDVFTVYQHLLKQGSAQKIALGGSSGGANLTMGLVQHLIEQEVDLPGALFLGTPGADMSKTGDSYYINDGIDRNLVTYDGFLEAAVRLYANGRDLKDPLVSPLYGDLHGFPPTFLITGTRDLLLSATVRTHIKLRQSGVVADLFVYEGIAHGDYAVDLTAPETQHAFAELNAFLLQHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords esterase E25
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Structural basis for dimerization and catalysis of a novel esterase from the GTSAG motif subfamily of the bacterial hormone-sensitive lipase family
pubmed doi rcsb
total genus 118
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q05A00
4OCZA 1WB4A 1ACLA 3EQ9A 1A8QA 3LCRA 5FP0A 1GPNA 1LNSA 1YS1X 5KREA 1QJ4A 1GKKA 3P2MA 4N8DA 4U2FA 4FFWA 2ZSHA 2OXEA 1N1MA 1P0MA 4FDMA 3TJMA 3B3QA 4KE7A 1Y7HA 1MN6A 3WA7A 4H7HA 3IIIA 4W63A 3T52A 1LLFA 3BF8A 4HXGA 3F97A 3M81A 3FYTA 5SYMA 3ZI7A 5CBKA 2QXUA 1J1IA 1AC5A 1DINA 4GHWA 2XLBA 3K9BA 5KWJA 1CUDA 4MXDA 3O4GA 5AKKA 4E11A 4AN1A 3WK7A 3W06A 3I6MA 4N5HX 4UBMA 4H7DA 3QVMA 4K6KA 5AK6A 3I2GA 4WFJA 5BV7A 3FBWA 1AUOA 2HA4A 1XRRA 3QM1A 5HKBA 1XZBA 4PV7A 5E4YA 1MPXA 1CUSA 2ZJFA 1LPAB 1Y37A 1CUGA 2WHRA 3A2MA 2OCKA 4UUQA 2PSHA 4DMCA 4AXBA 4IH1A 2JGEA 3S2ZA 5K3CA 2WHPB 3I2JA 4N5IX 1Q83A 2GZRA 2WHQA 3EQ8A 3WK5A 2WU3A 4DM7A 3TEJA 3V48A 5HF8A 1UK6A 1BS9A 5EI5A 1S8OA 4U2CA 1GQRA 4B83A 4DLNA 4J0GA 5JARA 1TQHA 2HHAA 5HF5A 4X7BA 2GBCA 3OURA 5ALNA 3WMRA 4QNNA 4Y2QA 4IH9A 2C5GA 3DNMA 1OCEA 5AOBA 4JYMA 2QZPA 1VXRA 5JD6A 3H17A 1CQZA 3AUKA 4OYYA 4MQLA 4DNQA 4U2BA 4X71A 2BKLA 3WZLA 2ZYSA 2Z8XA 4PSUA 3A2NA 4PNZA 4INZA 4HS9A 1HBJA 3FSGD 4CIBA 5CT9A 3VKFA 3ESCA 2JF0A 4QDTA 4Y2SA 2BUBA 2XUPA 5A71A 4C88A 5AKIA 3RKSA 3V1MA 1H2ZA 4BVJA 3SWWA 3DYVA 3HI4A 3M83A 1DX4A 3R3ZA 5EFZA 1YR2A 1VE7A 1L7AA 4KACA 1A8SA 1J07A 3ICVA 3CN9A 3FVRA 2DCMA 2XQGA 1IZ8A 1MJ5A 3DDUA 3DQZA 3UUEA 1G5FA 4E14A 1ZJ4A 5EHZA 2OQIA 2XI4A 5DTIA 5FOQA 5AI0A 4NMWA 3CCCA 5DNVA 2JGMA 3AIMA 5DWDA 4QDOA 4X6XA 3IVMA 4HAIA 4QWMA 2XMCA 4ZREA 1HLGA 2QJRA 3WKAA 4G4JA 1HQDA 1CUVA 1JFRA 2OCLA 3EBLA 3E3AA 4QEKA 3I6YA 1CUBA 3PI6A 4H7JA 5EHQA 1RYYA 4LHEA 2I3ZA 3AZQA 1BCSA 4H7IA 3NOXA 4PSCA 1JMKC 3O0DA 4I3FA 3DKRA 1N5RA 5JALA 4EBBA 2BJHA 3R41A 5ALDA 1W6RA 2WIGA 1L7RA 1DWQA 1Y7IA 2GBGA 3GUUA 5D3ZA 3HLKA 1VLQA 1XZGA 4OB6A 3KWFA 4K5QA 1XZKA 4UBLA 4EUSA 4AO8A 1CVLA 1DX6A 1XROA 1IUOA 3X3HA 3F8SA 2VJBA 4JEIA 3I2FA 4U2EA 2AXEA 5JYCA 5JZBA 3IURA 2IX9A 3WZMA 4C01A 2B61A 5K3EA 1OILA 1XLVA 1ACJA 4BRSA 4LXGA 3JWEA 4HTAA 2OLEA 5AI5A 4Q3OA 5LZ7A 1UK8A 1ZI9A 3W05A 5HF6A 5JANA 2QXTA 1AZWA 3VJMA 1LGYA 4X6UA 3WWPA 1R50A 5AKHA 4OYLA 3WL8A 1Z68A 4UFOA 5C8VA 5IVDA 2VATA 5ESRA 3OTQA 5ALRA 4XJVA 5AJHA 3E1GA 1YAHA 4C4YA 1WB5A 1LPNA 2DHEA 5AH0A 1XRMA 5FKJA 5HCUA 4DNPA 4KE8A 4TGLA 3SX4A 4DSZA 2Z8ZA 1EDDA 2WTNA 5LZ9A 2AJCA 1W4LA 3I2HA 4DMFA 2OGSA 4KAAA 2RHTA 3M3DA 5K5EA 4HRXA 4BCBA 3VISA 3G7NA 3ESBA 1FFDA 1VJ5A 5BWCA 2VF2A 2RI6A 5CT5A 4BDTA 2VEOA 1ZIYA 3QH4A 2XUKA 5JIBA 3DOIA 5AM5A 2EEPA 3IDAA 4Q3KA 4W9RA 5AP9A 4GW3A 2XQFA 3IBTA 1BE0A 4KE9A 1EVQA 4I19A 2XDWA 5K3AA 1W1IA 4NS4A 1EX9A 1TCBA 1QZ3A 4EY7A 3DD5A 3WI7A 2QOEA 1P0IA 1IVYA 4WCVA 5CH3A 4QE3A 3AIKA 2WUEA 1KEZA 1EVEA 4Q3LA 3D3NA 4Y2TA 3D7RA 2VSQA 3I6ZA 1QIGA 3BDIA 2CUTA 1XFDA 2VAXA 1MTZA 2HDWA 3H2IA 3WKEA 1UKCA 3QPCA 1F6WA 5JAHA 5JZ9A 4H77A 4WJLA 1LPSA 5ALIA 1ODCA 4XIIA 2P8SA 2JGIA 2O7VA 5ISMA 3CCBA 1L7QA 4RNCA 2AJLI 3DJYA 5HQ3B 5J3JA 1XRPA 2JIDA 1CR6A 2XLCA 1PV1A 2Z5GA 3QPAA 2WQZA 2DSNA 3I2IA 4JUIA 4XWGA 4G5XA 3STUA 2H7XA 3WA6A 1BROA 3M82A 2R8BA 4IO0A 3WWCA 5IVHA 1CRLA 3IUNA 4J03A 5ALFA 1G42A 2ES4A 2RGUA 3HACA 1K8QA 3NUZA 4CG3A 4QWWA 3ZV7A 4H18A 3IUJA 4IH4A 2WJ3A 4Q05A 3L1JA 2B20A 4LYDA 3U0VA 4GWLA 3PICA 5AOCA 1W76A 2OCIA 3FVTA 3WK4A 2AJ8A 2G5PA 2OAGA 1R88A 2B4KA 1GXSA 5CRIA 2VT6A 3GROA 3AILA 2BCEA 3Q8WA 5DYYA 2OGZA 1UZAA 5AKEA 4C6HA 3PUHA 4PQEA 1VOTA 1BEEA 4B9AA 3QPDA 3RLIA 4W1PA 2WLSA 4JYPA 5LP1A 3R3WA 1JJIA 5ALTA 1XZIA 3GELA 1ZGCA 3Q0TA 5F4ZA 1EB8A 1NU8A 1A88A 2I3DA 3V1KA 2HU5A 5AM3A 3TRDA 1VXOA 3C5WP 2OG1A 2BUCA 1T4MA 4FFVA 3DL4A 5AM4A 2QM0A 3FCYA 1IUPA 2WJ6A 1ODSA 2ACEA 1KU6A 2I78A 3MGAA 4FTWA 3W9UA 3ZLTA 4BC1A 1T2NA 4MEAA 2LIPA 1ZD4A 4MEBA 1DT5A 4G9GA 4X6YA 5ALOA 1UFOA 2XQKA 3QYJA 1XZCA 4ZV9A 3STYA 1X2EA 3KOOA 2PPLA 2ZYHA 4ROTA 3RK4A 5CXUA 2PL5A 1FFEA 3LP5A 1G66A 4BAZA 3T4UA 2XUJA 3A6ZA 1R4ZA 2QKYA 3HJUA 2BAGA 2YXPX 4G8BA 4K6GA 3HRHA 1UT6A 2PSEA 4G8DA 1EDEA 4Z49A 5JAPA 2ZYRA 3H04A 5LKAA 1R3DA 2VA9A 4DNFA 1YA4A 2YH2A 5E4JA 1TCAA 3O9VA 3VXKA 5HZGA 4U2DA 1BN6A 2Z3ZA 3CXUA 3I28A 4CG1A 3HZOA 2G4LA 3L1IA 4KAJA 2HL6A 1J2EA 1XZAA 2CJPA 2ACKA 1QIFA 2QMQA 4LXIA 4Q34A 2FUKA 3C6ZA 2XUFA 3DCNA 2CB9A 1TKRA 4FLEA 1ZICA 4DMKA 3WK8A 4GDMA 1A8UA 4X85A 3C5VA 2DFPA 4OU5A 3ED1A 3KSRA 3B5EA 2HADA 4BE4A 4B85A 4KEAA 4P9NA 5ALHA 3RM3A 1ODTC 2I03A 4GLBA 1QTIA 5AM0A 4C4XA 5IVIA 1VKHA 3F98A 2Z3WA 4W1SA 3PFCA 4QDUA 2IITA 1ZI8A 4Y2PA 3MUNA 4CCWA 1A7UA 1XZJA 2Y1KA 2CMFA 4FKBA 3V1LA 4UFNA 3DL7A 2FX5A 5AI8A 3NWOA 4M0MA 1QGED 2ZJ6A 1F0NA 2D0DA 4ZRDA 1OXMA 1RWQA 5CT4A 1EDBA 5ALQA 5A7HA 2C4HA 2WG2A 1XRQA 3V1NA 4WFKA 4P93A 4ZWNA 4KRYA 4CIAA 2GYWA 5IH7A 3WWDA 2WKWA 3FYUC 3JW8A 5ALGA 2W22A 5AKJA 5AM2A 1XQWA 1QLWA 1YB6A 2J4CA 1ORVA 4X92A 5DJ5A 3OG9A 1CUYA 2HRQA 4WDRA 3HEAA 1BCRA 5EHNA 1E8DA 1P0PA 3IULA 4EY6A 3OM8A 4EZIA 4P92A 5D7BA 1MX5A 2VQ6A 2WIJA 4UHBA 3G0GA 4XVCA 2Y2VA 5AO9A 3F96A 4UHCA 5CT8A 1CIJA 1ZD2P 4BP9A 2CKMA 3WIOA 2XUOA 3ZLVA 5AK3A 1F0PA 1BU8A 1ZD5A 3FLAA 2WIDA 3C8DA 2JGLA 4EHBA 2GBIA 3WKBA 5AOAA 1C4XA 5HQ3A 1QFMA 2X76A 1FFAA 3O9MA 3I1YA 5JAUA 4O08A 1THTA 2FJPA 3ZLUA 2G5TA 4OPMA 4QA9A 3BJMA 5EGNA 4ETWA 5AIBA 4RE6A 1ZJ5A 3QMVA 3KXPA 4J7AA 1JT2A 2NW6A 2XMDA 4Y2UA 5JADA 1EI9A 1U4NA 5HFAA 3D2BA 4K2AA 1XRLA 5D3KA 4MWTA 3UUFA 3R3XA 1DTEA 4EB0A 4QDXA 2XUGA 1TK3A 4HRYA 4AQDA 2WUFA 1QO9A 4BBZA 3WIBA 4OUKX 1SCKA 3H1AA 1J06A 4F0JA 3AFIA 3D2AA 2IIVA 3DLTA 4BAUA 3R3UA 1I6WA 2E3JA 1THGA 4BRZA 5AI6A 1QIKA 2BUAA 4AO7A 2ZYIA 2RIPA 5AKXA 2PX6A 2HA5A 4FMPA 1AGYA 1SCIA 4CCYA 2JBWA 3BJRA 4H7EA 4HZGA 3WYNA 5K3FA 2FJ0A 3GZJA 5A7FA 2QUBA 3VJKA 1TAHA 3BIXA 4UHHA 4C87A 4FLFA 5FUMA 1PJAA 4J3JA 4B82A 2VJAA 3O4JA 2ROQA 1F8UA 1W52X 3WJ2A 5LIPA 5LZ8A 3VVLA 2RAUA 1UKAA 2WTMA 3L1HA 5AHXA 4BYMA 4MWSA 2J3DA 3WL6A 1U8EA 4X95A 3VJLA 4OD0A 3A2LA 4BAGA 1WHSA 3K6KA 4Y9SA 1QTRA 4EY8A 5LZ5A 4L72A 4Y2JA 1XQXA 4FNGA 1DU4A 4M0EA 4B0PA 3ZWQA 5BWBA 4BDSA 1MU0A 4B9EA 1CUZA 4YX9A 2HA0A 2VT7A 1QE3A 4PW0A 3WWOA 4WY8A 2DQYA 5KBYA 1EH5A 3FNBA 1X70A 2WHPA 2K2QB 3G0DA 1VA4A 3STTA 3LIPA 4E46A 4J0JA 3BDVA 2AJBA 2ZVDA 3QMMA 4FHZA 5C7YA 3BXPA 1LPPA 4N8SA 5DTJA 1K5PA 1XLWA 5K3BA 4BTLA 3R40A 2DHDA 3H2HA 3S8YA 2OAEA 5AKGA 1JJFA 3U1TA 4IQ4A 3C45A 3LLCA 2G63A 4DIUA 5AKYA 4UBKA 4FWBA 1IZ7A 1QIDA 4MYDA 3KD2A 3C43A 4Y2RA 5H3HA 3FOBA 3C8HA 1CUXA 2XMRA 3ILSA 5DNWA 1GKLA 1DWOA 4X93A 3SK0A 4UBIA 5FPPA 5HKAA 3G9XA 5C8ZA 4XX1A 1XZFA 5YASA 2X5XA 1JMYA 3WL5A 3G02A 2VTVA 4MQMA 2WFLB 4U2GA 4NVRA 5A2GA 3WKDA 2AJDA 5AK5A 1TIBA 3UMJA 4QDZA 1BN7A 5ALZA 1ZI6A 4DTCA 1XZDA 2XUHA 1LPOA 1H2WA 1H22A 1ZD3A 3ESAA 1XKLA 5DYTA 2QJWA 1B41A 5ALJA 4E15A 1BEZA 3AIOA 2VJCA 1SC9A 2CEKA 2VAVA 4H7KA 4GBGA 4X00A 3WLAA 2CBGA 3H0CA 4CCYB 3LS2A 4L3WA 4Y2YA 4BC0A 3N0TA 2WUDA 1CUFA 1O6FA 2XMGA 3DYIA 2HA7A 3OPMA 3VDXA 1D07A 2WFMA 1YAJA 2XT0A 3V9AA 4LIPD 5C8XA 2C7BA 4ZV7A 1Q84A 3C6BA 3HSSA 1XQYA 3H2GA 5CT6A 1H2YA 2PUHA 3NGMA 1QFSA 4M0FA 1TCCA 4KJXA 4RE5A 3G0CA 4WFIA 4OB8A 3FCXA 2Y6VA 6YASA 3JYHA 1UOQA 3G9TA 5LZ4A 1FSSA 3WJ1A 1E89A 2D5LA 3WK9A 1ZIXA 4C89A 4B84A 1HL7A 1DT3A 2HA2A 4BATA 3MVEA 4X91A 3FYUA 3I1IA 5AICA 3TGLA 4F60A 4X97A 4N8EA 2C0QA 4MJ3A 4L9AA 2UZ0A 1AURA 4P08A 3C87A 5A7GA 5I7UA 1G4HA 3PF9A 1AMNA 3FYUB 1ORWA 5FLKA 1IUNA 3BIWA 2EDCA 4BP8A 1W75A 4LKOA 2OGTA 2PSDA 2PSFA 2OQVA 3D2CA 5FRDA 3ANTA 2PVSA 4ZI5A 1CFJA 2QRUA 2H7CA 4G9EA 3RARA 5FV4A 5CXXA 3BL8A 2QVBA 4AZ0A 4G4IA 5A6VA 2C0PA 5A62A 2HA3A 3FWHA 1QONA 5BOVA 3STXA 1XZMA 2XUQA 4A23A 1CPYA 2RONA 3AZOA 5JAOA 1E8NA 3WWEA 2EDAA 4QLOA 4ARAA 2V98A 1QO7A 3R0VA 4KRXA 1DQYA 4H35A 1XLUA 3AZPA 4OB7A 1WPRA 4RPCA 3H1BA 1FFCA 2O7RA 1NX9A 3WL7A 5KWIA 3EF3A 5CH8A 4DNOA 5ALPA 3LIIA 1CV2A 4JNCA 4BZZA 3KWJA 4HXFB 5K3FB 4I4CA 2R11A 2O2GA 3STVA 2GYVA 3QBJA 5LYYA 1MNQA 1QIEA 4L0CA 4CI9A 3AINA 1XZEA 2HM7A 1ETHA 1P0QA 5AKZA 3R3VA 1NU6A 5AI9A 2Y6UA 3DKKA 2V96A 1E3QA 2XUAA 2JGFA 4QLAA 5EIAA 3STWA 4CFSA 1XRNA 4G1FA 4BZWA 2GBFA 2BGRA 3PUIA 4AMZA 1WCYA 4EY5A 5JZSA 1EA5A 3IB3A 4W1RA 1YCDA 1ZGBA 4ZXFA 3E0XA 3GA7A 4B0OA 5CH5A 2JEZA 5JD5A 1E8MA 5FPQA 4BTVA 1HKHA 1CUWA 2QS9A 1VE6A 2HFKA 2H1IA 1YSCA 3QITA 5AIAA 2DR0A 4J0DA 5FDFA 2VJDA 4B7ZA 4PF1A 2H9YA 5LLSA 5ALMA 2XUIA 5LZ2A 4PO3X 5ALWA 4G4GA 4OU4A 1LPMA 1CUJA 5HF9A 2V9ZA 4B80A 4LYEA 5CW2A 2HA6A 3VVMA 1JKMA 1USWA 5T4BA 1SCQA 1MX9A 3W04A 3D0KA 4FOLA 4EA6A 1ISPA 1YASA 2ONCA 2XMQA 1H23A 1MX1A 3ZPXA 1LBTA 2JEYA 5CTAA 2BFNA 1K6EA 2CZQA 5T4EA 1UOPA 2PKYX 1QIJA 4AZ3A 3KDAA 2WU4A 4ITVA 1R9MA 2X8BA 4S0XA 1JI3A 1EINA 4B81A 3FLEA 3G0BA 1HPLA 4Y2XA 3O95A 4AMYA 2J3QA 4DSAA 1EK1A 3PFBA 5IVKA 2XMBA 3D59A 3WK6A 4X90A 1MNAA 2O2IA 4JH0A 3D4LA 4TPKA 1WOMA 2C58A 2QR5A 4X3CA 2V97A 3IUMA 1XZLA 3H19A 3OOSA 1H2XA 3YASA 1C7JA 3ICWA 4Y7DA 1QOZA 4ARBA 5IKXA 2PU7A 2RHWA 4H0CA 2OCGA 1CQWA 1CUEA 2DHCA 3C6XA 1Q0ZA 3E4DA 1K63A 1R9NA 5E2IA 1HDEA 1VZ3A 1CUCA 1LBSA 1GPKA 2XB6A 3WYDA 3G0IA 4QZVA 1SOMA 3AJAA 3IA2A 1GPLA 5SYNA 3CN7A 4J0KA 1LZKA 3DEAA 3H2KA 1DQZA 1SFRA 3G9ZA 1E66A 4UFPA 2GYUA 4BVKA 1VA5A 1GGVA 1XZHA 3W9BA 3O4HA 3OC0A 3QZUA 4Y2VA 4WDQA 4J0IA 2GZSA 3K2IA 4LXHA 4BB0A 4DYHA 3ANSA 2XQJA 5EIHA 1C7IA 4DGQA 3WKCA 3H2JA 1O6GA 5K3DA 5AI4A 4C4ZA 2JGKA 1CLEA 5FXMA 1GZ7A 4PSDA 2PM8A 3MUOA 3QMWA 5HK9A 4F21A 1CUAA 2XMZA 2O2HA 5DLPA 2QT9A 1MO2A 5I8PA 4NZZA 4G8CA 5HK8A 2XQIA 1CUHA 2JGJA 4GECA 4BCDA 4DMHA 4A16A 1MAAA 1LZLA 1K4YA 2OPHA 4YK7A 2WIFA 5AKLA 3D5EA 3C70A 7YASA 3EIOA 1U65A 4KYVA 2WG0A 4UPDA 3B12A 2QUAA 2B9VA 3F67A 2HRRA 4BVLA 1UOOA 1AX9A 3HABA 2ZSIA 3I2KA 2ORYA 3HC7A 4CG2A 1GQSA 1YS2X 3IUQA 3H18A 1MT3A 1MAHA 2WJ4A 4H7FA 5ALUA 4YASA 1EHYA 1XKTA 3PE6A 4UBJA 3BE8A 4ZGBA 1RP1A 1VZ2A 1UXOA 5JD4A 2HU8A 4B6GA 4UBNA 2ZJ7A 3R3YA 4UHEA 1Q0RA 5ALVA 1QIIA 5T4FA 2WM2A 1ZOIA 1FJ2A 1UK9A 5C81A 2WSLA 4IHAA 1PFQA 1JU3A 4YPVA 3N2ZB 2WIKA 5CMLA 3F9CA 5AM1A 1GT6A 2PSJA 5ALKA 4FBMA 3HXKA 4AX4A 2Y2UA 3GFFA 1XQVA 3G9UA 2ECFA 1TRHA 1M33A 3EQ7A 1CUIA 3ESDA 2WUGA 5EIEA 1QIMA 3G8YA 4HVTA 4J0CA 4EY4A 3BWXA 1UWCA 2DQZA 4FLMA 2J4FA 5ALYA 1WB6A 1UKBA 1EXWA 4KR0A 4AN0A 1BRTA 2XUDA 1AQLA 3FSGA 3BF7A 4A5SA 4V2IA 1EK2A 4UBOA 1N5MA 1X2BA 5E4TA 4UHFA 5D6OA 1WHTA 1IMJA 2WILA 5ALLA 3DOHA 5DYWA 4GI1A 4KAFA 5HFNA 2YYSA 3W2TA 2Q0XA 3SC2A 2PUJA 4HXEB 1QIHA 1WPXA 5ALSA 4AO6A 5DNUA 1CUUA 5T4HA 3FLBA 3WQHA 4AB1A 3O4IA 2WG1A 2PBLA 1AKNA 1DWPA 2H7YA 2HIHA 5LKRA 3GBSA 1JJBA 1E5TA 1JU4A 1YB7A 1N8SA 1KU0A 2W6CX 4F5ZA 1WM1A 3HYSA 2HFJA 2QTBA 5AK4A 2C5FA 5I9IA 4J0HA 3PF8A 3A70A 3FAKA 1YA8A 2XMSA 4Q82A 4X94A 5JATA 4BE9A 2PU5A 4WY5A 4MYSA 4W1QA 5CURA 2BGNA 4UHDA 1UK7A 4TVKA 4GXNA 2HU7A 1U2EA 1LPBB 5ALXA 4K6HA 1FFBA 2XE4A 5EHXA 2WFLA 4RGYA 4GEGA 5JASA 1EB9A 2YASA 1R1DA 4FNMA 4KE6A 4OSEA 4FBLA 1CEXA 4BCCA 3PDCA 3C6YA 2WFZA 1B6GA 5ALEA 4Q1VA 3DS8A 4D9JA
chains in the Genus database with same CATH superfamily
2PX2A 3K94A 2FDRA 1WB4A 3DLIA 2MSDB 1ACLA 5KPDA 1A8QA 1KQ3A 5FP0A 2ZRPA 1GPNA 5LMNB 2I87A 1ZXLA 2Q0HA 4BIIA 2N47A 2VZLA 2CF5A 5LU9A 2GBLC 2QAGA 3IUPA 5CVVA 1JFLA 3E9RA 5FOWA 3TQRA 5A5EA 3K0CA 1YS1X 3UOGA 4RIFA 4DA4A 4RL4A 3Q3CA 4ZQHA 3F6BX 1NNSA 3JS5A 4NCAA 5B7GA 1QGZA 1N7HA 2JGAA 2OCAA 3DUWA 4JHLA 3KVOA 4JZYA 4OHYA 4FFWA 3FNFA 2QVCA 3EWNA 3LT0A 5LOVB 4UU1A 4YI5A 4DCUA 1J5EB 2OXEA 2UKDA 3N53A 3KPVA 1U2SA 4D6XA 3N59A 1P0MA 2QRQA 4JZKA 4FDMA 4C22A 3AB8A 4LOHA 1WXQA 4Y9DA 3TJMA 1NJ2A 1NUSA 3B6IA 4M1EA 1SVOA 3HUTA 4H7HA 4W63A 3BSFA 1YT5A 3CLVA 3GJ3A 4KFTA 3UA4A 4R3WA 4DMRA 4YAWA 3F97A 4Q02A 1TJ5A 1W30A 3M81A 3PRHA 4MW2A 1T25A 3OQHA 1FUIA 1T4CA 3PHIA 3A25A 1Y1RA 3TXXA 2FSFA 3FUVA 4F8EA 3GBPA 2DAPA 4F3RA 1EUDB 1HE1C 5B1IA 1R27A 3B48A 2O0LA 3DJFA 5DT9A 4J29A 3G0OA 1NW8A 1SXJC 3FGNA 3PFHA 4UNIA 2LV8A 4G5SA 2D5BA 1I7NA 4YV1A 1JLRA 2YCBA 1MVOA 2WI8A 3V4VB 1LRKA 1AM4D 4TS3A 3GVPA 3WAKA 2O14A 3HL0A 4JVMA 3BD8A 4AN1A 5L9AA 3DAGA 2KWIA 5CW1A 3UHFA 1ORHA 2WPDA 3UN1A 1VGRA 4LI3X 4N5HX 3ESRA 4XASA 1HUQA 1WDWB 4H7DA 4JLDA 3QVMA 4YVFA 3Q6NA 2CCJA 5KTKA 3U19A 3EXIB 1NN0A 1ONSA 1UF9A 2BCJQ 2VF5X 2EKZA 1BW9A 4N6NA 2ZCUA 4JOSA 3QM1A 4BPRA 5MN4A 2Y71A 1MPXA 1NMEA 1X8JA 3MFQA 2ZJFA 3UG6A 1LPAB 5JXHA 4H17A 1DAIA 5JRDS 1ABBA 2QLMA 4RZXA 5DM1A 1K06A 2EX4A 2LR0A 4U0KA 4AZWA 3EUAA 4L95C 1T1JA 1X6VA 2BFEB 2WE7A 5K0NA 4F5EA 2BT4A 3ZE8A 1YONA 4S1VA 2CFTA 4W82A 3EYAA 4KXXA 1K8XB 3QHAA 1B0UA 2JH9A 3X1ZA 1ID1A 2NVBA 2PAFA 2BEVB 3I2JA 3OOHA 3J81A 1RI5A 1E2FA 3OJEA 3QE2A 3V3TA 1Q83A 4JN6B 1FW6A 3NH9A 2NU6A 4G5HA 5J1TB 1EBUA 4JC5A 2PR2A 2JIBA 2DGDA 1KI6B 2FMXA 3TEJA 5TDHA 4D4MA 3OZVA 1RXWA 1WXHA 1RLTA 4Q3BA 2G7MC 4CMCA 1N1EA 5REQA 2Q1WA 1JPNA 3CSUA 4EJMA 2HNBA 2HTFA 3CMMA 5EI5A 4P36A 3DV0A 3HUEA 4IYRA 1NNI1 5KYYB 5C31A 1SVNA 3B89A 4KQGA 4ZQCB 2I9KA 1JR3D 2W98A 3H83A 4RA6B 4MUYA 4MZXA 1Q0HA 2QVXX 2GGSA 3MAGA 2RGGA 4FYJA 1DKUA 1GA4A 3F49S 3T38A 4DQUA 4JYBA 1NI5A 2ZREA 3GAMA 4I4TB 4J1TC 1XA4A 2C7GA 1JN0A 4PZEA 4V3BA 1QQ7A 3LUHA 2GBCA 3KHUA 4OMFG 4NSNA 1XD8A 2Q0QA 3W5UA 3WMRA 2VTKA 2DP4E 3T5MA 4D4GA 3D3JA 1T8SA 1Z4LA 4OL0A 4WEOA 4IH9A 2C5GA 2V7WA 3DNMA 1YBHA 2Q4EA 1KKUA 3EA5A 1SXJD 5AOBA 4JYMA 1OB2A 3H17A 1PF7E 2ABWA 2QN6A 3BC1A 4UM9D 4CM1A 5JCXA 1YB4A 2WABA 1UBKS 1U2TA 1VE3A 2HWKA 4DNQA 4U2BA 3U3XA 5L7TA 1W0KD 4YJFB 3WZLA 1FLVA 4O0LA 2FWJA 3Q7QA 4DHEA 1Q7BA 2K6GA 2V7XA 2IHTA 1DB3A 4E70A 1SELA 2ZJ2A 1F60A 4LMPA 2PQMA 5G3YA 5F3RA 1SUSA 2XQVA 1KTIA 3DZ8A 3FSGD 4NABA 2XHZA 3L84A 1NVAA 3VOSA 4LZPA 3VHLB 5JBQA 5A4DA 3PHJA 4I46A 4OY3A 3MPOA 5CT9A 3ST7A 2JF0A 3VKFA 2C99A 3T7EA 3IQWA 1G8AA 2WKQA 1LVHA 3FF1A 3WHKA 5A71A 5M04A 3C1TA 3IALA 2HNAA 5AKIA 5B37A 5JW6A 2PJDA 4JBWA 4P84A 1H2ZA 4MTCA 3SWWA 1PNRA 5E7QA 3CH4B 1P5FA 2DHQA 3DYVA 4DNPA 1OGJA 1PJ3A 1YBAA 3FHLA 1P2SA 1ZH2A 3HY3A 1WY5A 2VWGA 4EB8A 2C9ZA 5ER6A 4PHCA 2XXBA 5TS3A 2HDOA 3P0HA 1JA9A 4TSFD 1D8AA 4M76B 3UPDA 1ZXBA 1GFIA 1XMSA 1Z0AA 3DP9A 3BK1A 4ZT6A 5EFZA 4L15A 2GPBA 2IXTA 2ZJ3A 4GQBA 3ZCUA 2YKGA 1U90A 3UJ6A 3RS0A 3V4LA 1H4QA 1XG5A 3CN9A 3JAMA 3L0BA 2HV8A 3RUIA 1YRAA 2GB4A 3EF1A 3EIWA 3DDUA 4FDTA 4FUTA 4J9UE 3DQZA 4NLLA 5TC4A 2NUPB 5HM8A 3IO3A 3EZNA 1KARA 4JVLA 3HP1A 1WSDA 3Q10A 2FN9A 1Z13A 3G5LA 4N5LA 3PFGA 2XOKA 4KLAA 4QREA 4E21A 3UZUA 1A82A 1HE3A 1T5IA 3KCNA 2ETXA 2XD4A 3LU1A 1RM3A 1ISSA 1ZSYA 2ASVA 2HWWA 2I2WA 5DNVA 4DSNA 5LL6P 3CONA 1VYUA 2UXDB 2JIOA 3DT8A 1C7EA 3FGOA 1BSVA 3HN2A 1N8TA 3N6VA 3NORA 4H16A 5HA5A 4HAIA 3I92A 3HDGA 3B9RA 1K6IA 4FI3C 1TYCA 4CLRA 5CFZA 2E21A 4AKEA 2NZ8A 4DCCA 2QD1A 1Z6AA 4I5GA 3QOXA 4QATA 1KI1A 3WKAA 3X2SA 4RMIA 2DUWA 3CUYA 4CIVA 1FX0A 2JHFA 5I45A 2JLZA 1TM3E 2MSWA 1SRQA 2ZT7A 4D81A 2QQGA 5LFAA 3P5SA 3QKUA 3AF5A 5CVCA 3ECAA 3JU3A 4UW9A 2EX0A 1FYFA 1VRVA 4CQLB 1E9CA 1GHTA 2I7VA 2FSIA 3M4JA 4Q00A 4X20A 1WW2A 1RYYA 1Z07A 3K09A 1H2HA 4O2AA 5EHQA 4II7A 4KQIA 5BSFA 2QUJA 1Q0UA 4QASA 2V7EA 2G1JA 3O1IC 3SXJA 2VNIA 4ZMSA 2I3ZA 4NCJA 1CY0A 1P5JA 2G17A 3CUKA 4MCAA 1P4RA 1MEOA 1BWQA 2RBEA 4D7AA 7GPBA 2CK3A 4H7IA 4ESEA 4OI4A 1NZJA 3AVXA 5DO9A 2JBHA 3VDNB 1C30B 1CY2A 1GUBA 4U8GA 4MIYA 4ZYXA 4KNYA 4WXMA 2ZROA 4QTUB 1G8HA 2WPNA 3K8OE 3QTBA 5AW9A 3UMRA 3QY9A 1E1CB 2VRBA 1E3WB 2YBEA 4P3PA 1A72A 1VE9A 1LVGA 1EGAA 1OX4B 2EW2A 3FWZA 2Q3DA 3LXXA 4HBZA 1PQYA 1Y5NA 4MW4A 4FC6A 1GO2A 1ECJA 2EERA 1S2IA 2QQEA 2XGSA 3W0LB 5EQJB 2GWRA 4CUJA 1E2BA 1L4FA 1R0XA 4Q34A 2B5WA 1JDSA 4RC9A 2CCGA 4Y1RB 2O3SA 1GNQA 3CKYA 4FFOA 3LXMA 5KNBD 1W47A 1D1PA 1L7RA 2N9UA 4OYHA 5PNTA 2ZSAA 4AC9A 5KYXB 5D3ZA 3OZUA 2ATXA 1FMLA 2C2MA 4AYXA 4CODB 3HLKA 4DQVA 5CEJA 2PX8A 4RTOA 2CHFA 2G6BA 2GRAA 4K5QA 3EFOB 4BLRA 2JFZA 1Y6JA 4UBLA 1KTVA 3FZNA 3FKQA 2G28A 5U1PA 4Q15A 2IY7A 1SVSA 1NKSA 3LGXA 1ELOA 4OJNA 4ZQEA 3WO0A 1LB1B 1DX6A 2OEPA 2W6PA 3QRWA 4CL8A 1XROA 3KZMA 1MRZA 3BTSA 2Q21A 5FLYA 4OHVA 3X3HA 5IMSA 1PQWA 1X92A 3TOVA 1R8SA 3ZD7A 4OREX 2B8JA 2IYNA 2XVXA 3DC2A 4PG5A 4H1TA 4TYYA 1UFRA 3KPUA 3O3MB 3ICPA 1KE1A 5DBGA 1H66A 1QB7A 2B61A 1CF2O 1L4NA 4C01A 5EIOA 4ZDKA 4BRSA 4Y6SA 1S6YA 2IHYA 2P41A 2ARKA 4Z1OA 2WJAA 3FSRA 4TKUA 1YJAA 1YL5A 2OZVA 4A8TA 3EEIA 4PHTA 1SMKA 1O94C 3ONNA 5EXSA 2C9YA 3C7AA 4GX2A 1ATZA 4Q03A 1HMYA 1NZDA 16PKA 1T1EA 2HJRA 1D7OA 3Q88A 2JJ1A 3TIFA 3SF8B 1E4VA 3CZPA 1LNZA 5FJIA 4MW1A 1SKYE 1RAEA 2FMKA 1QJCA 3BGDA 4UXJA 3RRYA 5BQXA 1Z5VA 3VJMA 4B33A 1LGYA 5F2NA 2C8VA 3M5CA 1TA4A 1DRJA 3EXG1 1K6XA 2CFOA 1Z28A 2VUHB 3HCDA 2I1LA 2RJ3A 3DZBA 1GG2A 4TOIA 3PHBE 3G6KA 5FCDA 4TVSA 4UFOA 1VP3A 4DR1B 4JI4B 5IVDA 4KP7A 1TC1A 2W2QA 3T9CA 3JQ7B 2ZFUA 1U0EA 2A9QA 1Z2NX 1DBVO 2G9VA 3OTQA 4G1VA 3IAS1 5ALRA 5ULLA 5JSZB 4IHQA 5JCOA 5A3SA 3NBFA 4UHJA 4HAVA 3B2QA 2EZ8A 2FQQA 5J59A 5A4IS 1VIAA 1LPNA 2CZCA 3PCRB 4FZ5A 3F0TA 4PYKA 5DULA 5IANA 1EFVA 3WIVA 5EIFA 1EHCA 1DIAA 2DHEA 1K1EA 1QC5A 2IP4A 2ZBUA 5HCUA 3UTDA 4EPRA 4UCQA 5L3QB 1AS3A 4CLHA 2VP4A 3QX3A 1OFHA 4RF4A 4U6SA 3E03A 1P45A 1NWHA 1EDDA 3BFJA 2FPOA 3CNQS 2Y27A 4KBYA 4U1RA 4X7RA 2XKKA 3FMOB 2Y76A 4MQBA 4LZAA 1JHZA 1RJFA 4DMFA 4BY9E 2D59A 4KQEA 4MJXA 4KAAA 1GPBA 2W9XA 1C3LA 2BE7A 1Y6RA 5BSTA 2WNSA 3UYLA 4RETA 2ZRCA 5A6SB 3G7NA 4BIMA 1AOXA 1V8DA 3VU8A 1GGNA 3M1YA 1OFGA 5TSDA 5DASA 3UAWA 2ADMA 1PTJC 4MQFB 4X8LA 2RI6A 2VF8A 3DFUA 2D6FA 5DLQC 3AUSA 2AG8A 2PZFA 2QYTA 4HDRA 2Q50A 3GJXC 1VRCA 5CT5A 2QW0X 5IAGA 1XQ9A 2VEOA 1ZIYA 3F5SA 3TM5A 2ZPAA 2W2VA 4UASA 5DX1A 3EHDA 5AM5A 1TKAA 3COVA 2FWBA 1LDBA 3KYDA 4RMGA 1UM9A 3CH5A 3A3YA 1CFZA 3LSYA 5H4HA 2C2OA 3JYLA 5H16A 1Z82A 5AP9A 4RTPA 1UP6A 4HNTA 3DZIA 1W34A 3HYNA 2C5SA 1BE0A 2FKNA 3Q9SA 1W49A 1ZG3A 1QDUA 2YN2A 3HCOA 3IR6A 4IGIA 1WULS 4YV2A 2HN9A 5FUYA 4ZARA 4GZLA 5K3AA 1TMGE 5KDOA 3RRZA 4ZI7F 5DWVA 2VJQA 3KOZA 1LFDB 1TCBA 4WN9B 1X0VA 4EY7A 3Q11A 2IU0A 4NCIA 3PTLA 2X2EA 1JAHA 5JPIA 4BKOA 1W8DA 1JYSA 4RPIA 4ZXPA 3NTUA 4S1OA 1T2EA 4F4CA 4QE3A 3WHPA 3EQZA 4XGNA 1GTG1 3HADA 2V6IA 1EVEA 2ZBGA 4WT7A 4AJ9A 4Q3LA 2PFKA 3D3NA 1SOAA 3TSYA 5ABPA 2VSQA 1YE5A 1ESMA 2PMWB 1QB8A 3AHDA 3CBGA 4RM2A 2CUTA 4JT2A 1NVVQ 4R31A 1EGMB 2J07A 3DNPA 5DW3A 5JJCA 2H1SA 2UYQA 1N2CE 3WKEA 3NOVA 1P81A 5JAHA 4K88A 5FWDA 2O7NA 4H77A 4WJLA 2XCIA 3GRVA 3DDSA 5J43A 3EIQA 3RSZA 4LJ8A 4ZO6A 4DM4A 2JVKA 1G5QA 1XWFA 1ODCA 5ALIA 2Z95A 4XI9A 5M2QA 3FYCA 4PAGA 1V11A 1OR8A 3P9ZA 1FF9A 4AUNA 1IOWA 5EPOA 3JQ8A 3QKIA 3T41A 3CCBA 4IZOA 2IZ0A 1DAOA 5L95A 2V7QA 4FFMA 3AKCA 4MMXB 3REFA 1L7QA 4FFRA 4NQZA 2AJLI 1H6CA 1FLAA 2CLOB 2W2LD 3EZLA 3Q87B 3V8QA 3VZRA 1TK2A 4CKYA 1N2BA 5TMDA 3VX4A 4ENUA 2OSVA 3MHPA 3VYRB 3ZN2A 1CG6A 2IU4A 1ORRA 1J00A 1DS6A 4LF9B 4B34A 3WJAA 2XLCA 2HUPA 1MB2A 1M6YA 2NUTB 3IYLW 1QWOA 3L7CA 4K9MA 1U8FO 2Z5GA 3LNTA 4KVFA 1QXSA 3MRTA 2W43A 2YJ3A 2NTEA 4JUIA 2WMDA 3STUA 1Q11A 2BFCB 3FTQA 2BMFA 4MKFA 5FI3A 2P91A 3WA6A 3DBRA 5HIJA 2A8YA 1ZL0A 2NAPA 1P33A 2FPPB 1LUAA 1TU3A 3G8AA 1M72A 1R0ZA 5C3UA 2QRHA 3MWDB 3WNVA 4ITUA 1A77A 4WXHA 2NZXA 1V47A 3G2QA 2QPAA 4IO0A 4OXXA 5D3MB 4QJ3A 1Z18A 5I5EA 3IFSA 4HFMA 3FG9A 3REQA 4PG4A 1I8TA 4REMA 5TS2A 2Q6KA 2QG9A 4QUEA 4I8DA 2Z2KA 4QL3A 1CRLA 3IUNA 1EFDN 1MA0A 2I7XA 3JR3A 4B2PA 5I3CA 3LBYA 1NUUA 2IQIA 4RIGA 2YFKA 4YRJA 3RIYA 3T3OA 4IY1A 1PT8A 3C3WA 2R87A 3CZAA 3NLLA 4G9BA 4E2WA 1P2GA 1TU4A 2NIPA 2RGUA 3M6IA 3RC9A 3CCFA 4F8JA 1B4DA 4QRHA 3QU7A 1P8AA 3NEJA 2Q5QA 2H4HA 2OMEA 2RHLA 3B13B 2Y9PB 3K0FB 4G0MA 3MJEA 1OZAA 5BSUA 3U9LA 1XMXA 3ZV7A 1GM5A 1T6NA 3D7SA 2BR4A 4DA0A 1KRHA 1PR2A 2OECA 3IUJA 4LISA 3HKCB 2UXCB 3D6AA 2DETA 2XH8A 1JEYB 1BX1A 5MGBA 1DKPA 4J1QA 2FOLA 3FR7A 1NXXA 4QU8A 3TTWA 2B6HA 3EVTA 4LYDA 5IXSA 4AICA 4JLAA 1J0EA 4HY3A 3U0VA 4FT2A 1X1RA 4Q24A 5IJWA 4XKJA 4GWLA 5AOCA 1I5OA 1T4BA 2PPVA 2IE0A 1W76A 4NDZA 3ZXXA 1TD9A 1KQFA 2OCIA 4L51A 3G1TA 1FBTA 2AJ8A 3FRIA 5TEWA 1E9AA 2P6PA 2B4KA 3H2YA 5ENVA 4W9MC 1NTRA 2C3UA 2HXSA 1EE2A 4YROA 5J4LA 1Y3IA 3FHCB 3CLUC 3RHTA 3AILA 3FETA 3NAQA 2O1XA 5FQOA 5BV2P 2XCOA 2ZYTX 3WE7A 3C5HA 4EB3A 3RFCA 1GLGA 1KPGA 2CVOA 2O7SA 2O8CB 4G0WA 1M5RA 1LQ2A 4IPTA 1VOTA 4G2TA 2GWHA 3RLIA 1UPBA 4W1PA 3H5IA 2SKEA 3WICA 3NWJA 3BJIC 3CFYA 4B3GA 3EVCA 5LP1A 1DKNA 1JJIA 1XZIA 3GELA 1ZGCA 3KR1A 1G8GA 2ZAMA 2F17A 1FTSA 2B2XA 3PX7A 3BDAA 1RE0A 3EGCA 3LY9A 5CITA 3ETEA 1IVNA 1GZVA 2I3DA 1C50A 3GZNA 1KFEB 2VPZA 3IKLA 3V1KA 5EJ6A 1GYPA 1G6HA 5AM3A 5IARA 4G01B 2LD4A 4L2IB 3HA3A 3H11B 3D1JA 3C5WP 3S29A 4TS1A 3H8JA 5H80A 1SKYB 4LOIA 2I76A 1T4MA 4MQUA 5JDIC 3SS9X 2G67A 3QEOA 5KO2A 1DKQA 4EL0A 1P9OA 2WU0A 2EIXA 4WBSA 2F6RA 1SHKA 2TECE 2AN3A 4UUBA 5AM4A 3UHAA 1SC3A 4OFBA 4WBNF 4ZKDA 2R9VA 3UGQA 1WX1A 3MJDA 5J4VA 1O89A 2HJGA 2I78A 3MGAA 5LB4A 2SKDA 2QBYB 1ISJA 1GTMA 3F6YA 4FTWA 1ULAA 4L75A 3DV9A 2GKGA 1EM8A 2I1WA 3ZLTA 3DLBA 2D1YA 1LK0A 2XZOA 1T2NA 3TFWA 4D8TA 5JSQA 2X2OA 3M2PA 4BV9A 2XTZA 1DT5A 1WXGA 3AV0B 1G5TA 3SG0A 1KK3A 1PE0A 1NG1A 4G9GA 2O5VA 1H0HA 1RKBA 4RPGA 1UFOA 2CXSA 1E9VA 2P9QA 4OL9A 5ESDA 1HDGO 1Y7TA 2QSUA 1KS9A 4IUDS 3TJZA 1H2BA 5BP7A 1GNSA 4YRNA 2SNIE 4IWNA 4LMAA 4IW3B 2D0PB 3KZ1E 5JSUA 4HLNA 2ZIWB 4AMUA 1J0BA 3N6RA 4PBSA 1OIWA 3FPLA 2PDAA 1IB0A 3U4IA 1Y9AA 1V26A 1FFEA 3USCS 5C1BA 2QTVA 4KX5A 5LXTB 3AVWA 4RJ2A 1L5LA 1MABA 2JHGA 3SD7A 3WMXA 4AM8A 4DLSA 1C3OB 1MAWA 3FB1A 2GCPA 3K53A 1G5HA 4N0QA 1THMA 5D87A 4MDYA 4P54A 4FGKA 1OC4A 1X8XA 1OF1A 3O4VA 3QWBA 3CGGA 1GR1A 4LVOA 1PQPA 1M6HA 1PL8A 4NJOA 3T4UA 5KVSA 1FFHA 3V97A 2OCPA 1O1YA 2VYVD 4L0MA 3N05A 3NI2A 1JHMA 1FXUA 2WSSA 1HRKA 3LBHA 1SUDA 2QKYA 4UEOA 2QAGB 2ZIFA 3R9KA 1DBSA 3H16A 1GP2A 3KT0A 3FTNA 2KBFA 4K6GA 4MUBA 3WGLA 3PQ6A 1AK2A 1T10A 1W2GA 2XTNA 2PSEA 3BERA 3E9NA 1EDEA 4C4TA 4Z49A 1JGTA 3DEFA 4GOKA 2P75A 1KDZA 4EUEA 2Q0SA 1S4MA 5KTNA 2FEAA 4D3FA 3ZI0A 2VA9A 4DNFA 2ASEA 1U4SA 2W11A 3K9NA 1ISIA 2YH2A 1SCUA 3K15A 3MPUA 5E4JA 4JI7B 5DBEX 3BTOA 4RK1A 1P5HA 3T06B 4ZPJA 5KX5B 1U1CA 3WG9A 2W4IA 1G8JA 1NGSA 3ELUA 3KQMA 3QF4A 3R24A 4R4JA 2IHNA 3ERCA 3SFVA 5HZGA 1BDIA 4ARIA 1G2IA 4U2DA 4J3FA 4EG6A 5I7FA 1J0CA 4G2NA 2WWYA 3MK31 4YRPA 3HA2A 2JLXA 2OV6A 3BT7A 2Z3ZA 1RRGA 1VCMA 3GVCA 1NVDA 5TPWA 1S1CA 1IPFA 1RKUA 1UDBA 1KEPA 5DV9A 5E6RA 1OFVA 1OMOA 3VAYA 3QJ5A 3OZFA 2FK7A 4FS3A 1NFFA 4NCHA 5JEDA 2Y66A 3LUJA 4QVKA 3ZCXA 3PNBA 3EC1A 2HL6A 3FGZA 2G4VA 3CKMA 4A73A 5LDDC 3UV7A 3L1UA 2ACKA 2H31A 1MXHA 2QMQA 2Y0EA 1WKBA 4N4AA 3K09C 1LLDA 5JO9A 2WDZA 3A6LA 3IP1A 2PZBA 2RHMA 2NGRA 4HDSB 1ZJZA 3OU2A 1Y8AA 3CNHA 4HEA6 3VR4H 3DCNA 1IBMB 2C3MA 3EVNA 2P30A 4FLEA 2F9FA 1BFDA 1UMCB 1ZICA 2O48X 4DMKA 2IKSA 3LFHA 3WK8A 1YZ3A 3M70A 4NXNB 3BRQA 4Q3DA 3CF4G 4EY3A 4I3HA 4IQGA 4O5AA 2QENA 3ZU5A 2WWIA 1Q1QA 3DONA 3TBHA 5LJLA 2DFPA 2PG3A 4MB2A 3O3OB 1KDOA 3KSRA 2HADA 3ES9A 3DDHA 4HYQA 3UQYS 4B85A 5DN6A 4PGFA 1SURA 2E18A 4MQFA 5ALHA 1ODTC 2I03A 1NNUA 2J5QA 1XUOA 2DY1A 3CG0A 5HG0A 5KNDH 5JHHB 4IVNA 5AXBA 4M1SA 1M2FA 2I5PO 4L85A 5GIOE 2CHGA 2R8OA 2RKOA 1U0FA 2XWPA 1DKOA 2ISQA 3RUCA 4WWHA 5CNMA 2QGFA 3AGQA 3BPSA 3QA3E 4M0PA 5IVIA 1WF3A 1VL6A 4GBMA 2Z3WA 4W8HA 4W1SA 5DEIA 2WQ7A 1T6YA 3PUYA 1MJGA 2IITA 1V43A 1ZI8A 3FRJA 4NJMA 3MUNA 2VPTA 4KSCA 5TLSA 4TQ9A 3VO1A 3OP4A 3RSGA 4R68A 2DPHA 1R18A 4YXWD 2GDZA 4KBGA 2P9TA 2Y1KA 1SZCA 4FGSA 1I3KA 5SZHB 3I3OA 5HZMA 4UFNA 1JLHA 3DL7A 4GH5A 4HSGA 4V39A 2QRPA 3R8CA 1RJDA 1E9FA 1N2IA 3S0JA 3G7UA 5K0BA 4MUFA 1J2TA 1YB2A 5AI8A 5MHTA 1U98A 2B8WA 4C7XA 1IN5A 1T9KA 1VL5A 2XIJA 3IMKA 4OLBA 1VMIA 1X7YA 5BSVA 2H85A 1FUUA 3A2KA 1MPTA 2DM6A 4FFDA 1FSFA 2NU6B 2FZ5A 3C97A 1OXMA 1I1HA 1RYMA 3CUSA 1E2NA 1NF2A 1H6BA 2CNOA 4P4UA 3RHFA 3WYBA 3THSA 2P9FA 3O4FA 4C2UA 1PBNA 1XRQA 3RI3A 4KQCA 4AURA 4F2PA 2CYBA 2I3BA 2RE8A 1MJGM 4EKDA 3FX2A 4JROA 1J21A 4HRVA 1EPUA 1PWXA 1I1QB 4JWTA 4DMLA 2GN6A 2PCLA 4CIAA 2GYWA 1L7BA 1UBUS 1U3FA 5F77A 1JQKA 4DREA 2NT3A 1F2TB 4D4LA 3OX1A 3M6WA 5K8TA 2EZTA 5IC5A 1EDOA 2G83A 1X38A 2J4DA 3WP1B 1ZCJA 1H2FA 1RR6A 2CYCA 2SCUA 2ZKLA 4X92A 4P53A 5DJ5A 5JBIA 3PQ4A 1JIXA 3UPUA 5B1EA 2VDUE 3TINA 2HMWA 4WDRA 3T7TA 1VI2A 4GOXA 2NPFA 1ZN2A 4CM8A 4W5JA 2LBPA 2CY0A 2IF0A 3CG4A 3NIWA 3LMKA 5IK2A 2B30A 1LY1A 3DEZA 4D80A 5F23A 2I1VB 2O5EA 2J45A 4HO1X 1NSYA 1RQ2A 3ADOA 2W8ZA 2FQ1A 5I01A 2FPXA 4F93B 2QTRA 3AG6A 2GK6A 3EFOA 1OYYA 1OV4A 1VIVA 2WWFA 2H11A 2V6BA 4H6XA 4EZIA 5AW1A 3U7EB 3EZYA 4DLZA 2Z83A 3MELA 4X1IA 4YCJA 5F7OA 4JCOA 4N40A 4V0NA 3CW2A 2FPSA 3CEJA 3HJNA 4UHBA 1VI5A 4M49A 2OHXA 1G8KA 2AN1A 4K9KA 3VVCA 3GUCA 4Q7MB 2LGJA 2BC9A 1FCJA 4UHCA 4B3IA 1Y81A 1QCZA 1CIJA 1ZD2P 4RH1A 5FO1A 4PEVA 3WQQA 2IKQA 4CEHB 2YIMA 4JKOA 4YDSA 1UR5A 1XZQA 1KGSA 3FWYA 2CE2X 4UAJA 3TAUA 5L4SA 2CKMA 2HK7A 3OCUA 2FW1A 2Y4NA 3IKMB 3SSOA 5CDSA 3BH0A 1NR7A 1PG2A 1UKEA 3LRXA 3AB3A 4OQYA 4DLUA 5BMVF 1K92A 1NVFA 2PJZA 1KO4A 2ZIZA 2AG1A 4ZEOA 1NP3A 5FNVF 3RTEA 4KN8A 4LS3A 3CYFA 5AXAA 5J4YA 5KOJA 2BMVA 2JGLA 1SHUX 2GBIA 2OO5A 3BGOS 4GX0A 1F1JA 3OMLA 4ZVPA 3TTVA 3ZOKA 1CYDA 5SYAA 3X1YA 4Z7JA 1U2RA 2AH5A 4HL6A 3WGKA 1ZVVA 1WUJS 4O8ZA 1C1DA 3DHNA 1FFAA 1LU9A 3KX2A 1NJ5A 1H0RA 2Z1NA 1IY1A 2VN8A 3JZDA 2IZ1A 2I7DA 4FYIA 3OQVA 5JAUA 5LQKA 1DKLA 1ECFA 2FRDA 2JRLA 4FE7A 1GSAA 3ZLUA 4E2XA 1FTGA 4AECA 1WY7A 1QCYA 4OYRA 1YA6A 3RAFC 4I55F 1LNQA 3E61A 3B1XA 2QK4A 4M21A 4QA9A 1PNTA 4MVJH 1GITA 2ZIGA 3LC7O 5IAJA 2W8BA 1KKMA 4PQGA 1LJLA 3GR6A 1UP7A 1XXHB 1UM8A 2QU8A 3QPWA 3AEQB 3M33A 3VZDA 2X23A 2XBLA 4RE6A 5K4GA 3DMNA 1K0UA 1ZJ5A 3PC2A 1HFJA 1E7RA 4QFCA 4RCYA 3F6RA 1U99A 2JFUA 2X0JA 3EIUA 5CFRA 3EMVA 4BPBA 4DEYA 2YXDA 4B6SA 4HR7A 1TMOA 4LE2A 5JADA 2V03A 4LDAA 4KGVA 1EI9A 1AKMA 4CGYA 4Z0TA 5HFAA 2ZSEA 4JFRA 3CLRD 2Q3BA 4ER3A 3D3QA 2QZZA 4M98A 3ZBTA 5MDHA 1N5KA 3K05A 3H5LA 5D3KA 1U7OA 4ZTZB 3EGDA 1IPEA 2B0CA 2RH4A 1RPJA 1TUGA 2R8ZA 1TJPB 4NU8X 1DKRA 2BHSA 4G1EB 4O4IA 4EB0A 1J4AA 3QBTA 4H6WA 1TK3A 3K1TA 3RGGA 1JBEA 2ZRQA 3EGXA 5L45A 4AQDA 1QO9A 4BBZA 3N6XA 1DCFA 4OI2A 1IHXA 1ZKDA 3C3BA 3G2PA 4E22A 5IJAA 4B3DA 2JW5A 4F0JA 3T5GA 4DBLE 3AHEA 3DLTA 3A6JA 2IOHA 2O2SA 2VQ3A 4MW6A 3SQOA 5I7VA 1TJNA 2YWCA 1SRRA 1W5AA 2E3JA 5C37A 2PBFA 1O0BA 2HQBA 3A26A 1QC5B 3B7WA 4GMHA 3RWBA 4BVGA 4EM6A 3G89A 5EWJA 5FADA 1ULTA 4IZIA 4ZC8A 4H0FA 2HLDA 3RABA 3T1NA 4F4DA 1PJLA 3UK2A 2G5CA 4M8IA 4IF6A 4XW2A 3FNEA 1HSZA 3OFKA 4ZCRA 2JGDA 4KUGA 4GMXA 3O8RA 3WC4A 1TAUA 3EMBA 2V7VA 2GEBA 4LPKA 4P3OA 3AG5A 4U6NA 4BYGA 1H2AS 1K4KA 3JQ9A 3SIXA 3SJCA 1DHRA 4A03A 3R4CA 1O5OA 2MYPA 1K9SA 1AGYA 3Q3VA 3NTLA 3KV3O 4P82A 3G49A 3R5TA 4G24A 1S2LA 1IZ9A 3OFNA 4RF3A 4ALJA 4A8JC 4PLFA 2DJ5A 3GVIA 1YZFA 2MINB 4NG5A 4DB2A 1GAJA 2GCOB 4IJKA 4LUCA 3O47A 4JI5B 4BZQA 5K3FA 3EXAA 1L5HB 1M76A 1XQ1A 5A7FA 3E81A 3KPJA 1PW5A 2QUBA 3F78A 5E6UA 4O2RA 3W5HA 4NKRA 3VJKA 1N3LA 4V0MA 1YFLA 1TAHA 5ECGC 3A14A 1WVMA 3BIXA 4P32A 1V4VA 1LLUA 2YINC 1BHSA 5KYVA 3IAHA 5TQVA 1V6SA 2JAWA 4Q7QA 5HSGA 4J3JA 5CR9A 1U2GC 1L7PA 3JARA 1YVEI 3QX7A 5JJ5A 1V25A 4HWRA 1KEVA 2YNMD 3LYAA 4I1OA 2GT1A 4P35A 1QHSA 1W52X 5BVGB 1MOPA 5FWNA 2C5AA 5LZ8A 4D8WA 2G82A 1RLJA 2XAAA 1I6KA 3FCSB 4EYQA 2RAUA 5B57C 1UKAA 2QTAA 3VO8A 1K86A 2A9RA 5JZMA 4MZDA 3L01A 5AHXA 4BYMA 2ERXA 1Q0PA 2X9QA 5DHTA 5FBLB 2GEFA 4RHFA 1H05A 3IA7A 2WVGA 4FJ1A 4JLKA 4NMMA 4PINA 1HE2A 1Y1QA 3WL6A 5AVVA 2AQ8A 4D99A 2RHCA 2ZWOA 3C85A 3NXKA 3SXPA 3HBMA 2FZCA 3AETA 4X95A 3VJLA 5K51A 4I14A 3MLBA 1L4GA 1YJXA 1CB7A 2KPOA 3HUDA 4MS1A 1SXQA 4EGFA 3GFTA 3NUGA 5KSOA 1IQUA 1GILA 4Y9SA 4ZAFA 1YZTA 4UM9B 4BVHA 3L43A 1Y1PA 1GEGA 5I4CA 1TEVA 3M9WA 3DBOB 2B0JA 3OA0A 3F5DA 1MTOA 2X0IA 3BHIA 5HTKA 5IJXA 1XQXA 2QLTA 3KEQA 3LUCA 4FNGA 2AHRA 5FA8A 3U2QA 3IDFA 4B0PA 4RW0A 2KX7A 3ZWQA 5BWBA 4YJHB 1Z2DA 4XLTA 2ZJ1A 2CJXA 4BFSA 3HY6A 4YX9A 4LE1A 1A9PA 2VT7A 4RHXA 1JLLA 3COYA 4EHAA 3EWAA 3FSJX 3ORSA 4UTVA 4EPXA 2CKDA 2IPXA 1NOJA 4KXNA 4QYSA 2HQ1A 5EMHA 3W3AH 4C7JA 3BWVA 2E6UX 3IV7A 3UMFA 4Y1EA 4WUTA 3AJ9A 4LXQA 4QKQA 1WQ1R 3LQYA 4HQ6A 3G0DA 2NO0A 2ZR9A 3SFTA 4FC7A 3EEQA 3LY7A 2H3HA 1T2UA 4E7OA 3FMVA 4N6OA 1ANKA 1DEKA 2GPAA 1JHAA 3GRUA 4ZANA 3CM0A 1ZR4A 1BS2A 3FDIA 1YQQA 1HDXA 3B8EA 3STTA 2ZPUA 3R74A 4U02A 2DLCX 5FHRA 4KQ1A 5KQSA 1USIA 2X0RA 4IFEA 5FLEX 3T3IA 3LCMA 4EP1A 1CZHA 4E46A 4LXXA 3W4KA 3DPSA 3ZHXA 4ZAYA 3RDPA 3ULKA 4B3TB 4DR7B 1NL3A 3NEPX 5B7QA 2OXRA 3H1EA 1PQ4A 3JWJA 1Q0SA 1T5HX 3P9PA 1ZNZA 2PT6A 3E2MA 4GYKA 2GESA 1KAOA 4F5WA 2ZVDA 3QMMA 4MQEA 4YRTA 2ZJ8A 1EQUA 3PUVA 4FHZA 3RVMA 3SS7X 1SUPA 4AJ1A 4F86A 2IYPA 1LPPA 3CSDA 4N8SA 4ZO7A 3I58A 4O4JA 3DM5A 5EMJA 3TRJA 4BNMA 2W83A 4RJIA 1ZU4A 4RZUA 3H2HA 5AKGA 4IQ0A 1DUIA 1N6IA 4WK6A 5D3QA 5J4KA 3HZZA 3ILHA 1VJ1A 1TB4A 5DRYA 3D6VA 4I8XA 3TZBA 5D84A 1I51A 3C45A 5FWXB 1X7HA 1ZGJA 3FVWA 1ESNA 1I2ZA 1GUAA 2YICA 2XB2A 5GQSA 3S55A 4UNPA 4IO1A 3TR6A 4ZOLA 2VNHA 2IYLD 3CZ9A 3R3SA 1AO3A 2PZAA 3BULA 3B7PA 4XR9A 1V1JA 3E0QA 2HPAA 3C8HA 3HXMA 5AJZA 1CUXA 2XMRA 3EDRA 2C2HA 4ALNA 2A3NA 3HB0A 3K7EA 4X93A 1D4FA 1OU4A 2QAJA 1W73A 1ZCZA 4WACA 1K6MA 4O3MA 3BMCB 3W9YA 4LY9A 3O5AA 3R0XA 4JL6A 4YP7A 5BN4A 4MV7A 1PFVA 3I9LA 4P7BA 4UBIA 2X1MA 2D2FA 4A6DA 5BV8A 4X66B 2J7PD 5FPPA 4HUTA 5HKAA 5FNVA 4OBEA 4GDFA 2OORC 4B1FA 5GADl 5KC9A 2ZPTX 2D1TA 2VTVA 5KNCD 4GLFA 4KIFA 4Y2HA 4GXTA 1UDAA 3QHQA 4PXYA 5GOTA 2WFLB 2EC5A 2BR5A 4MV3A 4U2GA 5LYJA 2FZGA 1F4VA 1UT8A 1E4EA 2F1HA 1YHZA 2BDEA 3PD0A 2AJDA 3VYTB 1XO1A 4AMBA 4HX9A 3RTAA 4YRQA 5HGXA 5HRAA 4DJDC 2WVJA 1IYZA 2QRJA 3IELA 2G1KA 4XWKA 1I4LD 5KNLA 2IBMA 1YQTA 2XE6A 3RVBA 1Z0FA 1XAJA 2BTQB 2UYYA 1ENOA 2X7HA 2Z58A 1RYDA 1N2JA 3P4XA 2XUHA 2WJYA 1E63A 5E95A 3ZZNA 1LI7A 4MYHA 1TTTA 1H22A 1XIVA 4UZSA 2I4TA 1RHRA 4NMLA 3RSSA 4GUDA 4Q1FA 2QTCA 3ONDA 3ZHUA 3SX0A 1I7DA 2FLWA 4PCUA 3FNGA 2AR9A 2PGJA 1ZN7A 4WY2A 2P62A 4R69A 5JC1A 4FSHA 1JQLB 4J07A 5HIAA 2C5EA 2Q6LA 2XITA 1DTWA 4NBRA 4DWVA 2EP7A 2PRJA 3X44A 1JNXX 1KETA 1N2EA 2BEJA 3O2QB 3R1IA 4NRDA 4E15A 1E18A 1ULUA 4DPLA 4UM7A 3U5ZB 2F9LA 3SM9A 1SIBE 3D0RA 1JDBC 4X64B 2CEKA 1AKEA 1T24A 1PJ2A 1OD6A 1NW5A 2Q7XA 3FKSA 1M2EA 3FSEA 3HU1A 4HQKA 3AM1A 1QVWA 1Z5UA 4LV6A 2IS2A 3WLAA 2CBGA 2C4TA 5AHWA 4CL0A 4HOYA 3T4XA 1FYVA 2F3QA 4N5MA 4NPAA 5T64A 3RFXA 2F2TA 2GILA 2J31A 4EHNA 2HO5A 1B43A 4J49A 4U7WA 4AIRA 1D07A 1S8NA 2NSJA 4D3YA 4LIPD 4N0MA 1ZRHA 4Y9RA 5IRCD 1D5WA 1EFKA 3A37A 5FBZA 4RFSA 5TE9A 5P21A 3C6BA 3M1AA 3NIGB 4ENQA 2VDKB 3PJGA 5A03A 3PUWA 1Y8ZA 1O2DA 1XQYA 3D0OA 1KHTA 2YY6A 4GLJA 4C1NA 1H2YA 2OORA 4YTEA 4CZ2A 8ADHA 1PYGA 5HUQA 5BSMA 3TVTA 4PCVA 2GAAA 5K0EA 1SC6A 4M0FA 4LGYA 2REXB 3SQNA 4LXTA 4WJZA 2FWMX 2AOTA 5C0OE 5KKAA 1KJQA 4WFIA 4KO3S 2JI6A 3EODA 1B23P 1GUZA 1NDUA 2JHAA 2QPOA 4YGYA 1W2WB 1TXGA 1Z39A 1E9SA 4X1OA 1Z0UA 4LX8A 4GYWA 5HILA 2NYUA 1ESCA 1HOTA 1Q44A 4PZAA 5GWXA 4B73A 4M1MA 3ZX5A 1UOQA 4H60A 1V3UA 1MZPA 3RBAA 1MXFA 1P73A 2VWQA 4HQFA 2GN9A 2QSYA 5KJ1A 5LZ4A 4P4SB 1KVUA 2C84A 2XYQA 4LXYA 3QLVC 3WJ1A 4DQKA 1DOHA 1G8PA 2J0QA 3KLMX 4BX0A 1XYGA 4LYJA 1L8XA 3ZS9A 3T9BA 4DC0A 4YY3B 2IXFA 5LA6A 4IOMA 2IEGA 3H6KA 2LDXA 4BATA 1V3QE 1DZ3A 4IMIB 2ZVPX 4RF2A 2PS3A 3FYUA 4PS1A 1H3EA 2XZPA 3I1IA 4X6LA 5HE9A 4NYJQ 1T34A 2H0AA 2ZR7A 1JLMA 1L4KA 3PDIB 1QTNA 4LZZA 4GZ3A 3QVJA 1DAEA 4IQFA 2PTHA 1FEZA 4WIAA 3V4FA 4P1ZA 2HZBA 2IX3A 4NESA 2JAUA 2I2DA 4NEGA 3EC7A 4PO9A 1JFFA 4MJ3A 2DF8A 4L9AA 5FIUA 3DM9B 3PEUA 4WZAE 4CR6A 1G20A 1G7SA 2C31A 2NX2A 4XUEA 4COKA 1UPTA 1G4HA 1ZRSA 2PZKA 3OQBA 4ZZ3A 1I36A 2ZYWX 1DJQA 3PF9A 1BX3A 2I8LA 2CVQA 4G0OA 3RNOA 2ZU0C 3KK0A 4N5DA 4YO7A 4YJ2F 1ORWA 4Z51A 3WSTA 2JFYA 3WFIA 2PUBA 4X3OA 2OR3A 2RK3A 1YTLA 2EDCA 2FW6A 4IXTA 4K6OA 3O7WA 4LKOA 1Y3CE 5AHKA 3LBFA 5FTWA 4BP8A 4EO4A 4LWOA 1TKCA 4B8WA 1ZEJA 2PSDA 5IVPA 3QYFA 1XMOB 2PSFA 3GJ8A 2OQVA 3LI2A 1Z4MA 5K0SA 4KIWA 3IOMA 1X1BA 1Y8QB 5G4LA 5ARCA 3TLKA 4BGDA 3L93A 4FU0A 3VC1A 4ZI5A 3NEYA 4DLKA 2IS4A 1Y4AE 5KZMB 5BORA 4BBAA 1JA0A 2H7CA 4G9EA 3OQMA 4G3XA 1UP4A 3RARA 1QGDA 1P44A 4JELA 3T0IA 3WXBA 4ZI2A 2BJVA 3I01A 2AFHE 3TD6A 3OFSA 5TJHA 3DWFA 4HNHA 2CLCX 1Z08A 1THZA 2C0PA 3KR2A 5CDGA 3H11A 1I2MA 1Q1ZA 4PLWA 5EKSA 1PHRA 2COEA 2I99A 3DMYA 3OMWA 2GBPA 1UJ5A 1H94A 3BSYA 1QONA 2CC2A 1T2VA 4U63A 1NI3A 1FS4A 3DW3X 1RCUA 3F4KA 5G41A 5BOVA 1U0GA 2NUAB 2NO9A 4IQ8A 4K2HA 4WOKA 3QXXA 3K1ZA 3E05A 1ZUD1 3M6AA 4M83A 2GCGA 1UBNA 2XX3A 4Q9JA 3SCZA 2JC3A 3LHKA 4YCMA 5REQB 2ALJA 2YWBA 5ADWA 2Q4OA 5CNKA 4HVCA 4EG7A 3AUJB 4I1IA 4XDZA 4QLOA 4RVHA 2EP5A 4ARAA 3VPCA 2HGZA 5EZYB 3TLGB 2V98A 4PICA 3TZLA 3ITNA 3Q9LA 4LK2A 4ZYWA 1W0JA 3JQRA 2WMNB 4F56A 5AJTA 1E5XA 3G5MA 4H35A 5EYPA 4ZGGA 1NE2A 5DU2A 4NP6A 4YCBA 1ZSVA 1SCNE 1UAYA 3AZPA 2FWIA 4DE5A 3TIXB 3K2EA 4RPCA 1IRXA 1YOVA 1X7YB 4JC0A 3UICA 4LF8B 2P5UA 4U7HA 3ESXA 2XKBA 1K75A 4C03A 2HRDA 3Q41A 4ZVMA 4YMVA 1RM4A 4GI3A 1N2HA 2FP3A 2SICE 2ZWPA 1NSTA 2HSEA 1XLTA 3FFBA 3C8ZA 4HK4A 5CXSA 1YB5A 3EDQA 2P2SA 2AEFA 2F64A 1Z4JA 1WCWA 4YR7A 3TG8A 1RAHA 4LHVA 4KPYA 2R25B 4I5FA 3OD5A 2F00A 4IHJF 5KCMA 4R2MA 5CH8A 4H7PA 1R0CA 4JXJA 4OUDA 3UV6A 1CV2A 3COSA 4TKZA 3JAWB 4OP3A 3QUCA 4C78A 4EDFA 1N0UA 1BXGB 1CZLA 2D2IA 1TJ3A 4DPMA 3IKJA 4JXXA 1WPQA 2HIGA 1OH5A 2EWVA 5BRJA 3QV2A 1VCNA 1P4AA 2DCUA 5FOSA 3AF1A 4I4CA 4OHKA 5HIIA 4BV2A 4TYNA 1G8MA 3R9XA 4XA8A 3W8NA 4R3NA 3RUHA 5D2CA 5LYYA 2HV9A 2B35A 4RLFA 2NZJA 4XOIA 2C88A 1JVSA 3PC8A 2XVMA 4INOA 4FDLA 3CR7A 5F33A 1TDJA 2L19A 3OQIA 4EOGA 5CBPA 1SWWA 3MB5A 1ETHA 5EMNA 2F1IA 4C7KA 5KNDA 3T95A 4RQAA 3NB0A 1VKZA 4C7OB 2GPYA 5AI9A 1QTQA 4URYR 5EOVA 3N39C 3DKKA 4JP5A 1T5DX 3HS3A 3NVDA 3I0ZA 3C3DA 2XUAA 4MYTA 4BMOB 4Z7NB 3F1KA 2YMPA 5L51A 4U7FA 1AXRA 3WB0A 5CEFA 4YMGA 2HBZA 3I0NA 4QLAA 3WDLA 5I4IA 3STWA 4DM3A 1XRNA 3G79A 3IIJA 3IP9A 4RK5A 3BCSA 4PYLA 3RANA 3C4VA 1YCFA 3VPBA 3N70A 3NWBA 3QW4B 4BZWA 1FU8A 1XAIA 2VZEA 3WLOA 2XB9A 1E5VA 2P78A 4QJ4A 3R9WA 4AK9A 1SB8A 5T6MA 1EA5A 5CGZA 1PJ4A 3JQCA 4KNVA 2LXNA 4UEQA 3KXDA 3B6JA 3LQQA 3GGOA 3E0XA 1VHDA 2PYZA 1XEWX 2QX7A 3WGMA 4V1CA 4JJGA 1FRFS 1ECLA 4U7TB 2GZ2A 3AM3A 2XCRB 2G0TA 2IH5A 2I6FA 4WN9A 4BL5A 4WLOA 1I33A 2AC4A 1TO2E 1UMCA 2JCYA 2Y1FA 4JGGA 2QS9A 2RHGB 4C5AA 3VBCA 4NNJA 1B76A 2W6JA 1KMMA 2WWXA 3BMOB 3K0EA 3SXUA 2VHQA 4WXPA 3AM4A 1NUAA 4JP8A 3PWTA 5CVTA 2D7DA 3G68A 3F73A 2BTEA 1ZD8A 1AE1A 3NQ41 4R0NA 3NHAA 5AIAA 1VLJA 2CXQA 2YJGA 4J0DA 2O0MA 4OAQA 5IXYA 1RRPA 2VPWA 5FDFA 3TGWA 2XE7A 4FYHA 4S35A 5BQFA 1OC2A 1Y9ZA 5IUJC 1A1VA 3S8EA 2EKLA 4PF1A 4UJ3A 2VRWA 2H9YA 4KQHA 4O2BF 4WV3A 5LLSA 4YMTA 3BQNB 3CSSA 4QIHA 4EO9A 4PO3X 5LZ2A 1KZ7B 1ND5A 3GWZA 3MTIA 5FAXA 4OU4A 2OHHA 2JA1A 1KKLA 2CNWA 1IHDA 3FNQA 4REQB 3FLMA 2H5JA 3A4YA 3KELA 4BOYA 4F8YA 1QH9A 2GN0A 2UUAB 2C83A 3SNHA 2JLCA 1VHTA 4DLWA 5K6RA 1XTZA 3GRKA 1ZGHA 3Q8KA 1Z22A 2X6QA 1XU4A 2ZETA 1D5CA 3DZHA 1QYXA 3FJ1A 2XNJA 4BLPA 2P1RA 4TKMA 2HA6A 1GU1A 3B1JA 4M86A 4XLZA 2ZBPA 1KL7A 4BLWA 4I6GA 3IL2A 3PXDA 4IGFA 4ZO9A 3D6JA 1KSGA 1VM6A 2FZ4A 1SCQA 2R5NA 1MX9A 1V5IA 3NIBA 2VDOB 4KHZA 4R9NA 2ZAOA 1D4OA 1GNRA 1L6IA 1MFZA 1UPFA 3RVKA 2CEAA 4XYGA 1C29B 3VSAA 4NV0A 3BXGA 2ONCA 3FBGA 4V0OA 1DC6A 3F7NA 2DWCA 3QELA 2IHJA 4GMFA 3HFSA 3RS4A 4NZOA 4LHXA 3GT7A 1WDMA 1RLMA 3OO0A 5JS6A 1EFRD 1H23A 5JZVA 3GAZA 1M8PA 3CINA 3QPUA 1J25A 1L6RA 2C95A 4J0EA 4B17A 4IIDA 4EFNA 4MUEA 5TQJA 1M34B 2WM3A 5LQDA 1ESZA 5LUBA 5T4EA 2Q5FA 4KN9S 1QIJA 2A0XA 1E2GA 3E70C 3R9IA 3VKVA 4V03A 2C42A 3TPFA 4GQIA 4I4IA 1N3YA 1JI3A 1JQ3A 2C4UA 2ZQ5A 3FLEA 5ANRB 3UW1A 1YVRA 2XCQA 4KWTA 4ZVNA 3D1VA 1A4UA 1X1AA 3HY4A 3IPAA 1N2GA 4TV9B 2PMFA 4EKNB 1NTOA 3SDBA 4XIYA 2H6EA 5F7JA 4KXYA 2ZAYA 4FIZA 3JQGB 2V65A 4EVIA 1GN9A 4DSAA 5IVKA 3BE5A 2XMBA 5KJ6A 2VP3A 2UV8A 3WK6A 1YDGA 5G53C 1M9NA 4L07A 2VK8A 4LHZA 4RYLA 3T3NA 1WSWA 1SVMA 4MR8B 3DLHA 1Z7BA 1PEAA 2BDUA 1QH1A 1YQWA 3AW9A 1TFRA 3N5KA 2O2IA 3PXXA 1A9XA 1T0HB 3AFHA 3BWBA 4I0WB 3DR5A 5HFJA 4M1YA 1ZLXA 3ZCRA 3P5BA 4M8LA 4U7PB 3MT0A 4X3CA 2MDTA 3AJEA 4KC0A 1M6EX 2ZANA 3HSKA 3IUMA 1OZ0A 2KE5A 3PKZA 3RWOA 3QLTA 3ZWMA 3CLSD 4EZEA 3Q5GA 4EHKA 2G76A 2ILVA 3RROA 2RH5A 5I7SA 2C3OA 1U9IA 4LZWA 2V3VA 3JD3A 3PQ3A 4JU9A 4Y7DA 1Q0TA 1JSCA 4ARBA 2YC4C 4D8UA 4MKXA 4Z99A 3UAZA 4P2BA 4ZI7A 5H02A 2ZATA 2IODA 2QM3A 2VPQA 3CHYA 3QEMA 3RQIA 4AJLA 1CUEA 3ZQ4A 4UUAA 1F8YA 5BOSA 3BQ9A 1T36B 3Q7PA 1Q0ZA 2CJWA 3E4DA 2H9IA 1GSHA 3RTCA 1K63A 4XX0B 2WLTA 3OPYI 2IIBA 4UTNA 3ZGVA 2GD0A 3PXUA 1XC7A 4JODA 1UUFA 4PNEA 2TS1A 3VFDA 4B5KA 1HO3A 3L7IA 2IVZA 4MCJA 3C7DB 4HD8A 3I6QA 2AC2A 4XE5A 2JKYA 1JEJA 2D62A 3ND5A 3OZEA 3WYDA 3NVKI 2IHKA 2GAIA 4MVJP 2BEVA 3JQPA 1ZNYA 1WUTA 1YDWA 3DMRA 4QZVA 4GKKB 4ERNA 2DKNA 3IO5A 7MHTA 1HQYE 1WD7A 4L1KA 3DE6X 1XOIA 3I9MA 1EWKA 3GFSA 4HGZA 4DR6B 1GTL1 2VQFB 4JR0A 1DQZA 3VDMA 1OLSA 1SFRA 2J32A 3R7DA 3BB3A 3RF7A 1QQAA 1V3TA 2PH7A 3KVNA 5IF3A 2BELA 2ZUUA 3N8HA 4DLXA 1NQUA 5BUQA 1U0RA 2PZGA 3RBZA 5BRAA 1Z5NA 1J39A 4K3VA 5CYGA 2OOKA 1ZPDA 4RD6A 1GGVA 3CEHA 2AGVA 4PPYA 2FN4A 2WZCA 3KM0A 1NW3A 1VSVA 3DEYX 3OFVA 2EYQA 3ON5A 1WD5A 2AZTA 2ZAGA 2H1OA 2Q5OA 1KZ9A 2ZI9A 3L4BC 4GQAA 3H1GA 5IT9A 3IOYA 3QZUA 4QYMA 1WW3A 1JWBB 4DUGA 3DQPA 2GZSA 2GHQA 2ID9A 5C80A 4P22A 3VHXB 4Y6LA 3ZU4A 3ANSA 3KR9A 5TJ9A 4L3OA 3M5DA 3SP1A 1CHNA 2H1CA 3T9AA 3WKCA 1ZZGA 2HDNB 3LT2A 4CL3A 1VG9B 5AI4A 2CLLB 3I6BA 2GF0A 4C4ZA 5G1PA 3ASVA 3DEHA 3M8KA 4GPTA 3IEMA 2E7ZA 2VI5A 3F9RA 4OJQA 3KZVA 4R5MA 2C04A 4GEKA 4DG5A 4WKCA 3KE8A 4V1CI 5AHRA 2XE8A 3U44B 2QN3A 1UEXC 3DBIA 2V58A 1LX6A 3DVAB 5JPDA 4I6EA 1NP7A 2PM8A 5GY7A 3ZJTA 4WOPA 1UOEA 2Z08A 4MUMA 2J6IA 3UMYA 4KWIA 4UOEA 2VHWA 4Q9DA 3ML1A 1KWKA 1FOEB 1MHTA 1M2JA 4KH0A 1WRBA 5KOJB 3RUAA 3DH0A 4F21A 1SU6A 2XMZA 3QU9A 5DLPA 5JOQA 2QT9A 5JAQA 4UVEA 3KB2A 1YQGA 1BMFA 1MO2A 5G1OA 2Y93A 4ZAWA 1C8LA 2GVZC 4G8CA 4YNBA 5AVKA 4ARZB 2GF2A 1BX0A 4BJHB 4G86A 5A4AA 1WG8A 2AQKA 1RI4A 1IK4A 1KJYA 2IYZA 4PIPA 3OA2A 4BCDA 5DN9A 5CLJA 4A16A 4ZHQB 1OXBB 3MJFA 3HLTA 1XCLA 5HBGA 4BQQA 3HI6A 4F12A 3WRYA 1Y5MA 3GFOA 1NHGA 1UC5B 1LZLA 5I9NA 1P1CA 2NO1A 2BFBB 3IMFA 3CVWA 3O91A 5EIXA 2I33A 4OKSA 3ET4A 3DVSX 3AVYA 2A5LA 3LDUA 3TD9A 3LQ2A 3TECE 2WIFA 1A71A 1UMBB 4KFSA 4WCFA 3D5EA 4K9NA 2VCHA 1U65A 5AVJA 1DG1G 1L5VA 1EYZA 1RIFA 3CGWA 2JAXA 5IT4A 1AN9A 1YJ5A 3FTPA 1NZFA 4MVJD 4HKTA 2W6ID 4OUDB 1U8CB 1CWUA 3B12A 3GLHE 4OK3A 3UJCA 5KSYA 3R76A 4KHPB 2B9VA 3FB4A 1ODKA 1GL3A 2Y1GA 4BO5A 1A3CA 3BM5A 2Z1DA 9GPBA 4R2LA 5JJKA 1E0AA 1DSSG 1FFSA 3T5CA 3EF0A 1FMTA 2NACA 1HNWB 4FI3F 5TQ2B 4UMEA 1OB5A 2CSXA 2IDZA 4YLGA 1V1RB 3ABQB 3PUXA 5K05A 2PLWA 1C7RA 2WJ4A 4IDCA 4YP6A 2WKPA 1U3UA 2HR1A 2DKOA 1AV6A 3R75A 5CBPB 2BFWA 4YASA 4BNDA 1E3EA 1P61B 2BFFB 3DP7A 5BUCA 4GPEA 4UMFA 1F2TA 1M2WA 4MPPA 1NV9A 1TW2A 2MYNA 4UBJA 4HB0A 2A2ZA 1VCIA 2EU8A 4ENPA 2DTEA 3PGA1 2HU8A 1MZVA 1XEAA 3SM3A 2ERCA 1PEKE 2EHJA 3JSAA 4B6GA 3UJ3X 5EJ8A 4X45A 1ITZA 2IDJA 4KPGA 1A8IA 3VYSB 3WLTA 3GGGA 5EIWA 1UBJS 4IDDA 1SXHA 4UHEA 1P8JA 2PS9A 4AROA 4BFTA 1ZBDA 2B1GA 1SBNE 4UMVA 4YCDA 1Z6ZA 1QX4A 1W29A 3CKKA 3D7KA 2WM2A 3CRQA 1EE9A 1DIRA 1US8A 2FSHA 5A4FS 2GLXA 1NM5C 1KYXA 5FTKA 1R16A 1WQ3A 4IEFB 2HDHA 1RACA 3BCRA 3H5AA 3RVQA 4BWVA 4D4KA 4EB6A 1SUBA 2WSLA 3C3JA 4ZRNA 1D6MA 2J0SA 1PFQA 2ZK7A 4R98A 3VZQA 3GJSA 4Q7JB 4NFLA 1CS0A 3IDOA 3OLYA 3E27A 5CNIA 5E3IA 2ISCA 2PEZA 4MSUA 3E1SA 1SWVA 2JJMA 2PXAA 1GLNA 1OV6A 2QX4A 3P0FA 4G97A 4IYJA 3RK0A 1MQ9A 3BHJA 3O83A 5B6PA 5B58T 3F9CA 1VFPA 4HMQA 4CI0B 1FL9A 1XTTA 4NONA 4Q4AA 3JQAB 1X1CA 4US1R 4WNYA 4BQPA 1OTXA 3F7OA 1Z29A 4JJZA 1GLVA 3G2OA 3LW8A 3PE4A 4FW9A 2QN1A 1U1EA 3PCTA 5C4MA 4AX4A 2R8YA 4XYMA 2Y2UA 3GFFA 3GP3A 1U0TA 1P5RA 5KTRA 2QNRA 1YDEA 1M33A 3OI7A 4B47A 1SCBA 1NXQA 1PWHA 5ELMA 5JJLA 2XGGA 3MXOA 4LJLA 5EY5B 2W5UA 1RXSA 2WJHA 3BWMA 3KPWA 5AWFC 1IJBA 1SXGA 3OF3A 4J0CA 4Y18A 2FE4A 3UT5B 3W6NA 1IC6A 1KO7A 4EY4A 3P7MA 1P7ZA 3VR2A 1SHTX 2FEWB 4IUCS 2O8VA 3RE1A 2J4FA 3U4AA 2V8OA 3H4MA 4HQ0A 1SIOA 1G21A 4OQPA 2R1VB 1E61A 1LX7A 2BMEA 3BTUA 3F5QA 3ONFA 1MD9A 3FCAA 3O03A 4TM7A 5DFAA 4RV5A 3HK2A 1EXWA 1ODFA 3I53A 1OBFO 1OYWA 3TZKA 4CM6A 2XUDA 1G20B 2IW3A 2Y92A 2QRVB 2OHFA 3FSGA 5JH7B 4CIYA 3GZNB 3OTWA 1IZYA 4A5SA 1L7EA 5BN4B 4YUYA 4HJXA 3VA7A 3RYHB 5KSWB 2ZIVB 4PZUA 1KJNA 1GNTA 4C0HA 1QK4A 3OOJA 4F5DA 3IOEA 1UIRA 2GETA 3NNDA 4IRMA 3I5AA 4CN8A 2JFBA 5E4TA 3VX3A 4X60A 3TQCA 1G2PA 2CL0X 5ARDA 3C3XA 4ZI7B 2IELA 2FPGA 1EUCA 3HP7A 4PYQA 5ALLA 3VOAA 1JAZA 3ER9A 1YIAA 2NPIA 4Z9FA 4DW8A 4KAFA 5FBQB 1P6XA 2YYSA 2DE0X 1EE1A 3BORA 5EZ6B 4EDHA 1GD1O 2Q0XA 6CHYA 3A1VA 2VA8A 5CYFA 5C7OO 5A9TA 3O92A 2PUJA 3PQFA 1Y4SA 4HXEB 1JG7A 1MOQA 1TNDA 1QIHA 2XWSA 5P8WA 3ZHRA 2CHEA 4DLTA 2BDTA 3INGA 1OJ7A 3OZCA 1GU0A 2QMOA 2QUHA 4UTZA 5T4HA 4ACAA 2J9FA 1A8HA 1JIKA 2HJWA 2PO5A 1T4CB 3FLBA 4ZVRA 5ESWA 1Y3HA 4ER6A 3ELYA 4EJSB 4K9RA 5BSHA 3KJEA 2QPLA 4B4OA 2PXXA 3DKPA 3ZDXB 3A9UA 1AKNA 4WVFA 4TV9A 1DWPA 5LSAA 3KQKA 3CNOA 4OK5A 4NBUA 3BGVA 3I12A 4ARCA 2B25A 2HIHA 1N92A 3I1FA 4XPIA 1SCJA 1FYDA 3GBSA 4DUPA 5LKRA 1E5TA 3HCAA 3L46A 2D1RA 4HXYA 1OLXA 2H9AA 3ENWA 4JLJA 4XXHA 1JP7A 2X40A 4AJIA 4Q1CA 5JDCA 4DJFC 3PQCA 1KU0A 2W6CX 2JASA 1MRSA 2V4ZA 3F5MA 1GPMA 4O4JB 1TJYA 4LVCA 1CZRA 4ATNA 3ONEA 1G6Q1 4FPXA 4X1YB 1CU1A 2C5FA 3O21A 2RHRA 1E69A 3HKDB 2VHZA 1RLOA 4FGJA 3ZGLA 1OWMA 2IP1A 3V1UA