4DZTA

Aqualysin i: the crystal structure of a serine protease from an extreme thermophile, thermus aquaticus yt-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
276
structure length
276
Chain Sequence
ATQSPAPWGLDRIDQRDLPLSNSYTYTATGRGVNVYVIDTGIRTTHREFGGRARVGYDALGGNGQDCNGHGTHVAGTIGGVTYGVAKAVNLYAVRVLDCNGSGSTSGVIAGVDWVTRNHRRPAVANMSLGGGVSTALDNAVKNSIAAGVVYAVAAGNDNANACNYSPARVAEALTVGATTSSDARASFSNYGSCVDLFAPGASIPSAWYTSDTATQTLNGTSMATPHVAGVAALYLEQNPSATPASVASAILNGATTGRLSGIGSGSPNRLLYSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Aqualysin-1
publication title Aqualysin I: the crystal structure of a serine protease from an extreme thermophile, Thermus aquaticus YT-1
rcsb
total genus 97
structure length 276
sequence length 276
ec nomenclature ec 3.4.21.111: Aqualysin 1.
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4dztA00
2DUJA 1SELA 3LPCA 5AQEA 4KB5A 1YU6A 4FONA 2P4EA 1S2NA 1SCNE 1YJBA 2SBTA 1GTG1 1GTJ1 3I37X 3ZXYA 3QMPA 1WMEA 1NDQA 1SBIA 1T1EA 4NE9A 1AV7A 3VV3A 1TK2A 1P7VA 1Y3BE 3SICE 3ZXXA 1ZVKA 3F7OA 4M1ZA 2Z56A 3Q5GA 1SUPA 2PKCA 1SBHA 1SBNE 5FBZA 1C9NA 2PRKA 1TO1E 2W2PA 4C3VA 3BPSA 4NMXB 5JMOA 4CG0A 1ST3A 1BFKA 2PWAA 2QTWB 4H6VA 3DVRX 3Q40A 5FAXA 1GNSA 3DVQX 4KPGA 1TMGE 1HT3A 1Y3FE 3VV2A 3DE2X 3P5BA 2E1PA 1DUIA 2HD4A 5JXJA 2Z57A 1C3LA 1BE8A 1CNMA 3DE5X 2ZWOA 2GKOA 3LXUX 4YN3A 4K8RB 1C9JA 3AJ9A 3PTLA 2X8JB 3F7MA 4CFYA 2ST1A 2Z2YA 1AQNA 2IY9A 2WUWE 1R64A 1SUDA 3DVSX 3I30X 1SUCA 1GT91 1NDUA 3DE1X 1KDZA 2W2QA 1GCIA 1PJ8A 1SUEA 4AKSA 1WMFA 3F49S 4AKTA 4OMDA 4RYDA 2SICE 1S01A 1JEAA 2ZWPA 5B1DA 1TM5E 4C3UA 3I34X 5K7SA 1SIBE 1GTL1 1R0RE 3BX1A 3WQBA 4BWGA 1KE2A 1AVTA 4Z2AA 1Y34E 4CFZA 4ZARA 1P7WA 4NE7A 3T41A 1Y4DE 1TECE 1T1IA 1T1GA 2DQKA 1SIOA 4JP8A 1SBCA 5I9SA 2PWBA 1IAVA 2WWTA 3D9QX 1BFUA 5ARCA 4MZDA 1PEKE 1Y33E 3EE6A 3TI9A 1SH7A 1KDVA 3EIFA 1MEEA 4DZTA 1ST2A 4GI3A 1AK9A 4OMCA 1XF1A 4I0WB 5ARDA 3VSBA 3WIUA 5JXIA 4OV6B 1Q5PA 1TM3E 3AFGA 1SUBA 1SCDA 3DW1X 3A3PA 1WMDA 1WSDA 3LPDA 3DW3X 1CSEE 1SCJA 1BJRE 1MPTA 1AH2A 1AF4A 5FFNA 3GT3A 1EGQA 2HPZA 1PFGA 1OT5A 3BGOS 5AVKA 1UBNA 3D43A 4J94A 3VYVA 2DP4E 3GCWA 2ID4A 1TM1E 3OSZA 2W2NA 1KDYA 5AMXA 1NLUA 1SN7A 3VHQA 1GNVA 1TM7E 3HJRA 1PTKA 1SUAA 1Y3CE 1SVNA 1KE1A 1GA1A 1Y1KE 3PRKE 4B5LA 4DWWA 1C9MA 1YJAA 1LW6E 1BH6A 3DE3X 4H6XA 1SIUA 1GA6A 1VSBA 1R6VA 1TO2E 2Z58A 1P8JA 3TECE 3DE7X 1WVMA 2ID8A 1IC6A 4HVLA 2X8JA 1S02A 4LVOA 3DWEX 2WV7A 1THMA 2B6NA 2PMWB 2XRMA 3DE0X 2Z2ZA 3H42B 3CNQS 2WUVA 1OYVA 1GA4A 3DYBA 2G4VA 3LPAA 1BE6A 1AU9A 3DE6X 2Z2XA 5B1EA 3DDZX 3QFHA 1DBIA 3SQOA 1Y3DE 1Y9ZA 2W2MA 3AJ8A 2PYZA 2XTJA 1OYOA 2IXTA 1V6CA 5SICE 3TI7A 1SBTA 3GT4A 4KG7A 3A3NA 3GCXA 4LVNA 4DJ5X 3DE4X 1SCBA 4ZOQI 2Z30A 2SNIE 3UNXA 4H6WA 5AVJA 1V5IA 2SECE 1EA7A 5CW1A 5JXGA 2W2OA 5ARBA 3VTAA 4WOBA 3A3OA 1A2QA 3I2YX 1SPBS 2ZRQA 3L1KA 4HX2A 2PQ2A 1Y48E 1TM4E 1SCAA 5JXHA 2V8BA 4WOCA 1Y4AE 3QTLA 2TECE 3EDYA 3WHIA 1ZVJA 3WIVA 3CO0S 1YJCA
chains in the Genus database with same CATH superfamily
4FYKA 3WLHA 1N77A 1OVMA 2Q5JA 4FHEA 5HVNA 3LLMA 1SELA 5B2EA 2X13A 4PU0A 2GI4A 4ARZB 1L4UA 3UQZA 4EYSA 1UJ6A 3W9YA 3JWEA 2DPYA 2F2TA 2PGLA 1IZ7A 2O3SA 4FBGA 3R23A 1NM5C 4XPZA 4Y9RA 4J8PA 3I5AA 2M6KA 3SBXA 1P9LA 1I6MA 4X20A 2QD5A 5J2TF 4EJSA 4WV3A 2CLEB 1C9DB 2H5IA 5TGDA 3IT3A 3I37X 1ULHA 5FLKA 3BMNB 1GT6A 2AQ8A 3ZXYA 3QMPA 5LFAA 4JLWA 4PSUA 2IUSA 3GT0A 3GUZA 2DB3A 1T4CA 4EELA 1QIDA 5F5LA 4EF6A 1E9SA 4GPAA 3KNZA 4PIMA 3A4IA 1CZLA 5LPNA 3A9TA 4NBRA 2UUBB 2YQ4A 4GC5A 1FBNA 1ZGGA 3GROA 4JUCA 4C2BA 2XKKA 3WX0A 5FOUA 3AFMA 1BDIA 4GDFA 1MJGM 1TYAE 1W75A 4B71A 3JD0A 1V95A 1YR8A 5I8PA 4JGGA 4CKWA 3S28A 3TLBA 1YBAA 3KJXA 3KPYA 2YHIB 3OQBA 3O47A 2YNMA 4WZBA 3R6WA 3ZXXA 4U02A 3EH1A 4Y9DA 4J9VA 4UNRA 3F7OA 1PJ3A 2PMDA 1YJ8A 3G2HA 2C00A 4ZVKA 2GPWA 4BC0A 3GFFA 5KWJA 4GI7A 4D9GA 2P8SA 3WJ7A 2Z4TA 1JILA 2B1GA 3PGXA 4FOSA 4IHJF 3UUGA 4BNNA 1JYSA 2A8YA 4ZO4A 5LBUA 3ZY3A 4K9KA 5CEJA 3WO0A 5JMOA 2DQ4A 3OKAA 1X80A 1ILEA 1NYRA 2Q46A 3H9EO 1YKGA 3MZ0A 4XYBA 2X0DA 4JGIA 4RZSA 2XB2A 3L43A 1KVSA 4QU8A 4C01A 1QG6A 1AOXA 1CDZA 1SXJD 3NBAA 2QTWB 4PRKA 3RANA 4DLLA 2J9YB 3PE3A 1GZSA 3E15A 3HRHA 3O75A 5EYPA 5EIBC 3FYUC 4MUJA 2FETA 4MIEA 1ELOA 2B25A 2H52A 5FBVB 5FWYB 3P0IA 3SBOA 2BC9A 1FFAA 2YZ2A 3FWNA 4ZDIA 5THQA 3AX6A 4PV7A 1G5TA 1CEEA 2FVXA 4AROA 4OY3A 3EZLA 4XWYA 3NZEA 2V7TA 1NVFA 1TLTA 3VU9A 1WXQA 4F92B 3G68A 3WBBA 3NM4A 1QP8A 1JHQA 1QPGA 3H1TA 3NHKA 1CJUC 2H8GA 3D1JA 1DXOA 2W43A 3NHAA 1AKEA 1BGWA 1GKKA 4AG5A 2V6FA 2YRXA 3F7TA 3B9RA 1B8OA 1H0HA 4CF4A 1I2DA 3FCYA 4FGSA 4HDNA 1EINA 3L18A 1SZPA 5HK9A 1C3LA 9GPBA 1Q19A 3R09A 2CV1A 1DTWB 1EKXA 5BPFA 1KK1A 2ERXA 2H63A 3LBAA 1GQOA 3QEKA 3R3VA 2IGTA 4QHTA 4B3JA 1BO6A 4FVTA 1PL8A 2G88A 4Y6LA 5FR2A 1Q7TA 2HDWA 2PKQP 3OY2A 2X8JB 3A9VA 1NSYA 3HVRA 4OYHA 4U9UA 3SZRA 1OLSA 2AA3A 2C3MA 3Q6IA 4OXKA 1VJDA 3WYFA 3HSYA 3PHIA 3DBRA 4I5FA 4MWZA 1YB4A 3PKJA 4M9CA 1E0KA 1QH1B 2WFZA 2AIRA 3W2GA 1JZTA 3I30X 2QP9X 1RAGA 1IEQA 3OKPA 5IJXA 3DJYA 5HIIA 1YL7A 2VCYA 3FUTA 4EKNB 3LA6A 1U7DA 2QI9F 2VUUA 3DBLA 3H2GA 3ER9A 4TT3D 4ESEA 4ESVA 2EFEB 1PJ8A 1IB6A 1G8YA 3CRNA 1A71A 1J2RA 1KK2A 2PQMA 5HZGA 2DPXA 3DEZA 1FRQA 5LZ8A 5JVDB 1G8SA 1J0AA 1NMYA 3QF4A 3CRRA 4YRTA 1N1EA 1MFZA 1RC8A 1KR5A 4NXNB 3N2GA 3AF5A 4V39A 4ENUA 3ND7A 2WJ6A 2ODEA 3UG6A 2QQ5A 1VRCA 4NZZA 1JEAA 3WLIA 5ITWA 2XKAA 4ZT6A 2IUTA 3BRSA 4MVJA 4BQFA 2X77A 5B1IA 2AG6A 5GAJA 1ULZA 2X9LA 3IQHX 2L82A 1PK8A 1ZH4A 4JBYA 4NX2A 5KJEA 4H31A 1GNQA 4RM2A 3IOBA 2JLZA 1GEGA 2O2CA 4XVQA 4FX2A 4OQEA 2CD9A 5IAOA 3JQGB 1BMDA 1UBTS 5KU1A 2DFPA 5C80A 3G2LA 1JXQA 3T7JA 5CDFE 3JZIA 4HB4A 2I62A 4H1WA 1MVLA 1U8AA 2XF2A 1A69A 2C2BA 2R7AA 4BMDA 3A31A 1HY3A 3MGAA 1CUWA 4DR5B 5JJLA 3PDIB 5FKJA 5AHKA 2NTNA 5C8YF 1G21A 3G0GA 5E4TA 2XITA 2HA2A 3KUCA 3MWJA 4G84A 1DADA 1NFFA 1CQJB 1TECE 2GJKA 5EY5B 3ZDEA 5D3MA 3GCDA 2PGAA 3NEYA 3ILVA 2CNLA 3GJ8A 1EUZA 3QE0A 3HYTA 3NBKA 1JR6A 1ZGHA 3DV0A 3P19A 4MVCA 2B34A 4HDSA 3STVA 3TJRA 4F3NA 2Z43A 4L22A 2Q27A 2A5JA 4HSEA 3D6VA 2K7FA 1NTOA 1W5BA 1XDWA 4BMOB 1ICIA 2PGNA 2KBEA 3OUZA 4R3NA 2VHVA 2XXBA 1ETHA 1A97A 3B78A 3IXLA 4KE7A 4EPTA 3DOEA 1JB9A 1O4VA 2OV2A 1LC3A 1V2HE 3KU1A 1SHKA 3O9MA 4P92A 5EZYB 4YP6A 5LMCA 4R8MA 1F7UA 5H59A 4REMA 4QNNA 1S8NA 4IJMA 3JYOA 1KDVA 4A8JC 1U99A 1KMCA 4L7QA 1NMXA 1OV6A 2VDWA 4LYEA 4W7IA 4MTCA 1WCIB 5C7IO 4TTTS 1GSOA 4ISCA 4BB0A 4LF6B 1DEXA 5KAPA 5JWRA 4TN1A 1M2VB 1O08A 3K9FC 1RJDA 2B9VA 2FV8A 2ZJFA 2VDPB 3PGMA 3QXJA 2GOYA 3B9PA 3K1ZA 3OOHA 4O4LA 4Z8YA 4YWJA 3SMQA 4AZSA 5LQDA 3AEYA 1P5ZB 3L8MA 5CFPA 3E6AA 3VAZA 5KYGA 2D13A 1IZ0A 1MIOA 1QONA 1PQ4A 5AJTA 5GY7A 2X0EA 3TM5A 4KTTE 3W34A 1ZCBA 4LHVA 3E8SA 4C4TA 2PU7A 1W2WB 1ZNWA 2L19A 3BDIA 3ZQUA 2HT1A 3E18A 1WHSB 1ZU5A 4JNCA 4DG5A 2EL7A 3CKYA 2H3EA 2NYAA 5FWDA 2HIAA 3PHJA 4UBMA 2CV2A 2GN0A 4TZ6A 1O95C 2NPIA 5D85A 3G0HA 2HI0A 5EN4A 3FFWA 1GG5A 2QU8A 2O8FB 4QIHA 1SUBA 3S3TA 5K01A 2R4QA 3ETJA 1V35A 3L40A 1L1EA 4FMDF 3ROZA 2BBTA 2Q9BA 1XU9A 2GBGA 2I6QA 5ADHA 1EH5A 2PZBA 3G8BA 4ITVA 4J3JA 4K81B 3S8EA 5A02A 1L7VC 3KZVA 3LPDA 1O03A 4S1VA 5DBIA 1VJ0A 1T1SA 2CUZA 2R48A 2X7HA 3G5AA 4WZZA 1K3TA 1SQ6A 2JJ8A 3MXOA 4JEHA 3U9LA 5U9CA 2GX6A 4B82A 2A59A 4CM8A 5C7LO 1V9SA 4YGYA 1COZA 1QQTA 1MJ5A 1COWA 3C70A 4IQ0A 4JHXA 1M1UA 1Z2NX 1SBQA 4CF5A 2REXB 4V0QA 1G0NA 1VM6A 5C8VA 4QPJC 1U8CB 4FSHA 1J33A 2AC4A 5D01A 1DRVA 2C4UA 3HJCA 5EKTA 4S24A 3RTCA 2HWKA 3QEMA 3CX8A 2ZYAA 1QG4A 3IO3A 2C5FA 3A6EA 1MX5A 3HBLA 3EYAA 1TIBA 1U5AA 5FDFA 5JOQA 4E5MA 5F2EA 5GGXA 4KGXA 4OUKX 5FJJA 2RE8A 3KX2A 1BE0A 3B6IA 4H1HA 4B6FA 3JCZA 2PZGA 1Z3CA 4O4IF 1AKUA 5FEMA 2P68A 1SVMA 2EATA 2P9YA 1DNPA 4F6CA 2NAFA 2P8JA 2RGXA 2XBLA 4PYNA 3V1KA 1ETUA 4KU4A 3LUPA 3QPCA 4HQKA 3K0HA 4WGFA 4XSGA 3ZU6A 2ID4A 4EVSA 4WJLA 5A03A 2WHPB 3LUDA 3NP7A 3O31A 1IATA 1X1RA 1X7GA 2JPDA 2LW7A 3JQBC 5DW0A 2RGWA 5DEIA 4BNMA 3H9QA 1XZJA 1HE4A 2GRUA 4HKTA 1DO2A 5DYNA 5JFGA 1C0PA 1FS6A 1RLMA 4DLVA 3E05A 3N7UA 5TSDA 1V8ZA 3WNVA 3U4QA 3K4QA 5LLSA 1FY2A 2ZBUA 3HZZA 4XWAA 1WX1A 2A0YA 3AOGA 3HJRA 4G8BA 2O8BB 1WHTA 3HLYA 3IUQA 4U2FA 1AZLA 4P4UA 1E4EB 4WKBA 1S96A 1Q83A 2AV6A 1DBVO 2A9PA 2GBFA 3BFJA 3GG9A 3LKZA 4WINA 5G4KB 5A7GA 2VDUE 4IJUA 5H5JA 1WWKA 1QX4A 1DC5A 2Q1SA 4UVEA 2HSWA 3TTSA 2B4YA 3W9SA 4HNAA 3E2PA 3ZWNA 2ZM6B 4ZT5A 3FGNA 1RWOA 1XIVA 1SA0A 1VI2A 4HWPA 2VNKA 1TX4B 3K1YA 5DULA 5ERGB 2HJHA 3R3HA 3RS9A 3TEFA 3BJEA 3MB5A 1KO8A 2JF0A 3PRHA 4YB8A 5AKKA 1UOOA 3FFXA 3CXUA 4KE6A 1PR0A 2K5UA 2HRQA 1ZJJA 2Z58A 3A06A 4RXTA 2O3JA 4LDAA 3BAZA 3H3FA 3KZOA 3QQPA 3WK9A 3O9VA 3LQ1A 4MQUA 3LZ6A 1FSSA 4NJMB 2EXXA 3K9BA 1HXHA 3ESZA 4I6JA 4CIXA 16PKA 1Z6GA 3NDIA 4GX1A 3H83A 1KP2A 2CDCA 4FR5A 3AR4A 2O0KA 1QYRA 2NXJA 4ZWNA 3U3RA 1IVYA 3FHCB 3H0CA 4F6RA 1QH0A 4UHCA 1WEHA 4AZVA 2PX4A 5M5BA 2G8NA 1E3WA 5L45A 4Y1RA 3REQA 3VSCA 2ZAOA 2QL6A 4O5AA 2B6NA 1CUJA 3DE0X 2OAP1 3HR4A 2V0NA 2SCUA 2PUDA 1DAGA 1QIMA 3VYWA 1VKJA 1WU7A 1B2RA 4HBGA 2VRCA 4UM9D 1OYVA 5FPHA 4CLOA 2LCQA 3N87A 2V9PA 1QH8B 1AUQA 3QH4A 2CMFA 3IQXA 3WWCA 3KKPA 1YVUA 4XPIB 5A05A 3ER8A 3CR8A 4AKIA 3AF2A 1O6GA 1XRJA 1A9ZA 2Z9CA 4QICA 3TL3A 5LQRA 2JLSA 2R1VA 2XWJI 2QTRA 3T8YA 3A6PC 5F1YA 1NJ5A 2I80A 3HO1A 4P5EA 5EE9A 2M6LA 1W6UA 4N9QA 5G0SA 3WMWA 3O84A 5CH8A 3TLXA 2XCSB 4WFQA 1PNVA 2ERYA 2X14A 3J7TA 3NTOA 3PNPA 4P22A 2GYWA 5ESDA 2ORWA 4Z0NA 5BW6B 5HBRA 4DJJA 4D81A 1BEEA 1DL5A 2O0MA 4UMDA 3R75A 5FOQA 3CZMA 3D6TB 1IRXA 1DBRA 4O3FA 5C1DA 5CXSA 3HCEA 4HZUB 2EYQA 4OH7A 1EWRA 3TKAA 3IOYA 1XQ6A 4K5QA 1ZCJA 4DLBA 3R24A 5LUBA 2YRFA 3DQZA 4KR3A 4ZZ1A 3QBJA 3QG5A 1O96B 1R6UA 2WSSA 2C58A 1GPBA 3O92A 1TZJA 1ZJYA 2P2GA 3OURA 1CZOA 4OP1A 2QLMA 5FOXA 1ML4A 5E6SB 4B79A 3F96A 5CM8B 1QG0A 4HDRB 1OTHA 2O1EA 3ETCA 3A6FA 3AU8A 3I5MA 1MB0A 3OQVA 2BGIA 4LDRA 4EUSA 4JS0A 5JIBA 4DW8A 1OB5A 2JD0A 3PNYA 1CVRA 2E4XA 2LZ0A 4K40A 3QSGA 1VP3A 1LZKA 4DMKA 1WD5A 1Z7BA 4CL0A 2RGEA 3OCXA 3QXCA 1M2WA 4WMLA 1WV1A 1ZOIA 2CCJA 2HLPA 2QN9A 1AIPA 4S1WA 4I2NA 1KYWA 4PF1A 1E8DA 1EFLA 1VMEA 4B33A 2X0RA 5ALJA 1GNPA 2WF8A 3DKRA 4AL4A 4IO1A 5L4LA 2H4JA 2GESA 2Z2IA 3IBFA 1NBHA 4DMFA 1G7TA 4WBNF 1K8QA 2A0XA 1N7GA 1GGHA 1GUAA 2WWIA 4MYUA 4FOPA 4RHUA 5LA6A 3T7DA 3UT6A 1YHYA 3GEBA 1PGPA 4G9EA 5GM2A 1H66A 4QGAA 1EVJA 1BMQA 2EP7A 2Q0QA 4JI0B 2YH2A 2HSGA 3X1KA 3T52A 2ZQZA 5K0BA 4IKOA 2GJ9A 5C51B 3DR3A 1SKUA 5I9TA 4EA7A 4DKXA 5K0ZA 2AGVA 1BQ4A 1MH1A 3G2KA 4UAUA 2GXSA 3W5BA 2BTOA 3I8SA 1GTMA 3IAS1 1CIJA 3IV6A 4ZU3A 4CKBA 2ZM5A 2HRRA 5DHPA 3PC2A 4MIOA 4GOXA 4UDYX 1L5HA 3UN1A 4P5PA 4YJFB 1VLZA 4JEIA 1N5IA 2OG1A 2FSFA 3M1AA 3QTLA 1HLFA 3H9JA 2AFHB 4I99A 5FI0B 2G5CA 2F43B 2W6NA 2HW8A 2NU9B 4OSEA 2FW1A 2G9NA 3UVEA 1Z5GA 4BGIA 4M0LA 3F3KA 1JP7A 1XZKA 1E1CA 1FDOA 3OE5A 5FR1A 2A92A 3QXGA 5GIOE 3FCXA 1HSOA 2I7CA 4L15A 5CJPA 3GJYA 2PWYA 4FP9A 2ZJ1A 3LPCA 4Y98A 4GI1A 4NQRA 4AKEA 1P5HA 4BV8A 4US1R 4YIKA 4NJEA 4WNIA 2QSYA 1GAXA 5KOJA 3NHZA 1SCNE 5HZHA 2FPSA 3OE7D 4UBOA 3SVTA 2D62A 1I0ZA 4U9IS 1E89A 3DEYX 5IVDA 3RSFA 3RS5A 4EW1A 2C7PA 3TTWA 3GFVA 3T1VA 4B80A 3C45A 1WMEA 1X15A 2H65A 2ZRAA 1JLKA 1BRMA 3B8EA 5C35A 2O2YA 1QNFA 2XUQA 2HREA 4KPUA 3MTJA 4NK5A 1CS0B 1ZGZA 5CRIA 3WLNA 1BXKA 1RPTA 4EG6A 5DU2A 4LMAA 5KVCA 4LJ9A 1EWTA 4W6ZA 3TEJA 1NYLA 2Q4RA 1E9FA 3V2IA 5E7QA 1V48A 3DBHB 1R18A 4MB6A 3KQLA 2O19A 3VI4B 4IHJA 2WJ3A 4R2XA 3BGWA 1CNFA 2NZUG 3FH0A 2VT6A 3JVVA 4GH5A 4ZCIA 3ELBA 3LC7O 1Q1ZA 3HS3A 4TV8F 4D5EA 2P6PA 3PL1A 2VHXA 4C87A 2XYHA 3AM3A 1AK1A 4C76A 1X9GA 1VLJA 4KFRA 4UDOA 4X65B 1C9NA 1QRSA 1JR3A 4DUZB 1PNOA 4AQYB 5CLLA 1Z38A 3VH1A 3OWXA 1GR1A 4NKRA 1I7SB 5IVKA 1CZUA 1W96A 1XEAA 2H1HA 4NPHA 2VYND 4OBWA 2JIRA 4CG0A 2VWGA 4HXFB 5FBRB 1U8XX 4CV1A 3WHLA 2IWRA 2GH1A 3FB4A 4M76B 5E3IA 1V7QA 2FWAA 2BH2A 3UXYA 5F64A 2UAGA 2OMKA 2HSZA 5IXJA 5HKOA 1XZHA 4CVNA 1UKZA 2FG7C 2W6MA 2QX7A 3Q40A 3VNRA 4O63O 5A5VA 4G4SP 3IUYA 4HEQA 2EKQA 4XDYA 5CCDA 4ZV9A 2BFEA 2VLBA 5CG1A 2H9YA 2ATCA 5E6UB 3HY3A 5HF8A 3I62A 2JZNA 1R2QA 3FHOA 4C0AC 4JLPA 2X9NA 3EZXA 1KO4A 2CHEA 4URVR 1LBHA 4D9MA 1Y6RA 4PW0A 5FP0A 2ZBEA 1NVTA 1EK5A 1V37A 1UM9A 2F8SA 1QYIA 2GF0A 3BRCA 3OIFA 1BIFA 3PNVA 3RD5A 1Q7RA 1I4DD 5CK4A 2D4HA 3SJAA 3G0BA 4GE0A 1U4SA 3M4JA 1G17A 4FFPA 2D4AA 4HDKA 4RJKA 1B73A 4DZRA 1DKNA 3GVXA 4C7OB 5IJ0B 4RLFA 3B85A 5CGZA 2HV9A 2XMGA 3EBPA 3I76A 1SXPA 2OCXA 4RWEA 3OF3A 4H3HB 4C7VA 1DKLA 1NPYA 2OXCA 2JGIA 3CTPA 4UHJA 3V00A 3PT9A 1L7PA 1KOFA 1O97D 3MSXA 4YMSA 2BJVA 3H3JA 5LMZA 4G0UA 2C98A 3CLSD 5JYBA 3DMTA 3CX3A 4DG9A 5AW7A 1LPNA 2R6AA 1SU4A 1NGSA 1E58A 1VDMA 3NM6B 4QYTA 2HO5A 5E1OA 4BIIA 3PR1A 3QBTA 4UEWA 3V7NA 4JYZA 5B7QA 2J0UB 4FD2A 3HABA 2ZIZA 1X14A 4ZJPA 4W5HA 1SR8A 1YQDA 3MAJA 4B2LA 2R2AA 4TWIA 3N5CA 1Q1BA 2XZOA 4JENA 2FN8A 3L1UA 1MAVA 3U3OA 1NW8A 1G2QA 3DB1A 4KIWA 4L4YA 4XASA 3H17A 2B1IA 4JODA 1DOHA 3WBKA 2P79A 3QI7A 1C0IA 1EA5A 2GLTA 4KYUA 3RS3A 4AKSA 5I7UA 1YSCA 2IYZA 1TZ2A 2OD7A 2QRHA 3ZBTA 4YPVA 1YRWA 3Q4GA 2WJJA 3SEAA 1IOWA 1O6BA 2EAUA 2O2DA 3V8NA 5G1PA 3D3NA 3NWJA 3E3AA 1YA6A 2BF4A 5IMBA 1RBMA 4XGNA 5DISB 2J3HA 4N3BA 4ZVUA 2R6HA 2OECA 1SQ5A 3I72A 1OXMA 3INNA 3P4XA 4BQQA 3BXHA 4EGAA 3NJ4A 4RA9A 4TGLA 3RBVA 2NTVA 5DHQA 3ZCQA 3DQPA 4GZ6A 4QGFA 4ZPXA 3AW9A 4I4LA 1V5EA 2BGTA 4JLVA 2WTMA 4NJOA 5B1YA 2AEMA 5KWIA 5BQFA 1RIFA 3H13A 3H5AA 4D9JA 5KTOA 4GUAA 1CULC 1PWEA 2RBGA 4Y7CA 1TUGA 4W9MC 4DV0B 4Q7QA 1U3DA 1SUSA 2PGIA 1TCAA 3L05A 4BNWA 1E66A 3GEEA 4OJTA 3B3GA 3NWEA 5C8YA 1FS5A 2X9QA 3UJPA 4BWGA 2JAHA 3R5JA 1VSQA 5BSFA 2MYNA 4A1FA 3LDGA 4JLSA 1POXA 4WFJA 2ZYTX 1QIJA 3DT9A 2DE0X 1K98A 3JALA 2DG2A 3NBXX 1W0KD 4KREA 2B37A 2MIIA 2QUZA 4IP0A 1CBUA 3T3GA 5KPDA 4GZLA 1O57A 2G17A 3VKFA 2QRJA 1I1HA 1O0SA 1W52X 1ZOSA 3BGSA 1KDTA 3EQ2A 4JK3A 2GJSA 2E4VA 2DTEA 5ALEA 1IFXA 2VJYA 4YV7A 1MZVA 1F9EA 3AJDA 3KEOA 4TKVA 1K6JA 5EJ9A 2Q7XA 3F78A 3L7AA 4H1TA 2WWYA 1M0TA 2ZJ6A 1RXUA 2VH5R 4I36A 2IYNA 2ZWAA 3SPXA 3BD9A 2H5LA 1IDOA 1ZIOA 2I6UA 1EFCA 2E5WA 4EUFA 2QJRA 3V9PA 2UYCA 3ND6A 4XA8A 1BMFA 4I9FA 4PZ0A 4WESA 4CMIA 2D7JA 3VPHA 4F2WA 4FKBA 2CHVA 4JL5A 3EWIA 1OX4B 1H22A 2E4ZA 1PK7A 2L69A 4K6FA 4NG4A 3WV4A 3RYCB 1V7PC 2NU7B 3JWJA 3X1XA 1IZ8A 5KX5B 1XA0A 1XNRB 3C6MA 3OPVA 2F3UA 2GBPA 3D2BA 1S3GA 4U3JB 4XRRA 2VF8A 4R6XA 4AQ7A 2QUAA 3MSCA 1W0JD 3U17A 3IPXA 4FN4A 4BAUA 2XNDA 4JBNA 1MV8A 2PZJA 3BD7A 3QBVA 4TZKA 4E11A 3G6WA 5IYZB 4JUAA 3SVLA 1RQ2A 3HB9A 2EV9A 2ZS7A 4BRWA 4YV1A 5M29A 3IBCA 4H77A 3R41A 3I52A 2XVMA 1IWOA 1A9XB 2OCDA 3E35A 4KQEA 1L7XA 4FWBA 1FX1A 4J1TA 3IOEA 4TLLB 4XCVA 1ZCZA 1HL3A 1T5BA 2YOHA 3L7JA 2P2CA 5YASA 2Y1LA 1RQ7A 4Z1MD 3AHDA 3LNTA 3HU1A 3NTUA 4TX1A 3T1NA 4EPYA 2Y0DA 4IXWA 3UJCA 4JUBA 1U2DA 2X4LA 5FLYA 1U7UA 1KQPA 2X5XA 3QITA 4MO9A 5LVAA 1CZRA 2WNSA 3GY0A 2YXPX 3BTVA 3CX7A 4M9SA 4G65A 1BJKA 1E77A 2FUNB 4I1VA 1O0BA 3TR0A 2PUFA 2W58A 4N40A 1UT5A 2W70A 1XRRA 2H3HA 3N2NA 2VEDA 3SSAA 3EVGA 2VZ9A 1QV6A 2BKVA 4HQRA 3U7QA 1FNMA 2P65A 2FTKE 2A0UA 1GZ5A 4A5SA 4EFLA 2Y1FA 4TMZA 3SFTA 5JQGF 4LOHA 3IV7A 1DVRA 2A5GA 3DKPA 2JEZA 3CSUA 3AQIA 5H3HA 1YVPA 4CQMA 1Z5UA 3P9PA 4WY8A 1SXJA 3SX0A 3U13A 3FPEA 4TLAA 5E2AA 4BL5A 3WGJA 3RAJA 1G4HA 1H6CA 2H1SA 1BQEA 2FPGB 1Q14A 4GNKA 5EAIA 2LUOA 4C07A 3TUZC 2QN1A 3M1IA 2CE7A 2F3SA 4O2LA 4AU1A 2NADA 4RZ3A 3L4BC 2RFLA 2QG9A 1NJ6A 5KBYA 2FB9A 4H35A 2I6TA 1UBNA 4YROA 5CW2A 2YYAA 1RW4A 3C98A 3HM2A 4EKEA 5AJXA 4KNYA 1T6NA 3ZCPA 6LDHA 2H1CA 2IIQA 3FZGA 2RC5A 2J9FA 4M0DA 1RBZA 5DWDA 3VO8A 1E2KA 2OQ2A 5GIPE 3EPRA 4BB6A 1U2ZA 3FTPA 4ID3A 1YB1A 3P9RA 3NHFA 4MQ4A 4P7GA 5IBQA 3RASA 4FB5A 5CJJA 1J56A 1N25A 4DA8A 1N6IA 2KMLA 3AUJB 1R4MA 1ONOA 1RQPA 5HMLA 1ZK3A 3MINA 4P86A 2CCKA 2DMRA 1KIMA 3DHNA 4QQ8A 1NLUA 3VHQA 4A16A 1U2EA 1TZCA 5LQCA 1RWXA 2CL5A 5IPFA 4QYXA 4D9KA 1AY0A 1TADA 3ROPA 1E6WA 2WYOA 1PTKA 4YFYA 2VG8A 2R4UA 1UPBA 1WXDA 1ZN7A 4QGSA 2C9ZA 1YL5A 2BBOA 3S5UA 1G6KA 1YK1A 2QTGA 4FHGA 2HPAA 4NMLA 3ZEAA 1A7JA 2X5JO 1Y1KE 2XBUA 4GYJA 2ZI9A 5G0VA 1WBDA 5CH3A 4H7DA 2P6UA 1ZVQA 5DHTA 1T34A 1VHJA 4E7OA 2H54A 1YCFA 1PNTA 4BFVA 3PC8C 2EJCA 5FWXB 1FMCA 1OR8A 1BH6A 1SVUA 3WGTA 3ZZ1A 1MQSA 3G2NA 1EG7A 5K03A 4ZHQF 5KJFA 1SHUX 2X0FA 4M86A 1T0JB 3C3AA 4L0CA 2PUAA 4CIAA 4URXR 3EFEA 4LJYA 2I3DA 3K6JA 3GJXC 1RLIA 4HWOA 1LRJA 4MS3A 4ZVQA 3OZGA 4NU8X 4P4SA 4D9CA 2R6FA 4MLDA 3I2GA 1OOEA 3C16C 4Y6GB 1F8YA 6Q21A 1CJMA 3PCRB 4NHEA 4MQBA 3KQTA 1ZA1A 4ZT7A 5E3HA 4YR9A 2VSXA 4TT3A 3L8GA 1EM6A 4LZOA 3URMA 4KZPA 1W2GA 1Q74A 1J2UA 3D6JA 4WXHA 4K3VA 3TGPA 1DHRA 5LUAA 3OJFA 5M3BA 3VMFA 3HRIA 3EHDA 3W04A 1ZNZA 3EA0A 2HIGA 4AJOA 5LP6A 1E7YA 1J6UA 2BH9A 5BN1A 5ADWA 1JDZA 2NIPA 5G1OA 3JQDA 2Z1MA 2PMBA 3GZ4A 4L3VA 1X1SA 1BVHA 2ZG6A 4KRXA 1GOTA 2WV7A 4RPIA 2PMWB 4Y0VA 9ABPA 2DPMA 4RCYA 4WKOA 4DSOA 2B92A 1QHYA 1M33A 3F6RA 3TW0A 3PI6A 8LDHA 4CIWA 1A1VA 4PLGA 2WUVA 2Z3WA 2OVFA 3K6KA 5T6MA 4FWTA 2I3ZA 3A6GA 4HEA6 4KV7A 3ZCVA 1U8EA 4MV7A 4RVCA 3EXHA 4INPA 4Y2HA 4CQLA 3GJ6A 4LF4B 3GXOA 1UJ5A 1XZGA 2BFBA 4XX1A 1OI2A 1YGYA 4C5CA 3R7AA 5B53A 2J6HA 3W3ZB 5DM0A 4UDNA 5K8UA 1Z0AA 3R7NA 4BX8A 3TEMA 4X85A 2PPVA 3NIBA 1QQAA 1FA9A 1CB0A 4IYJA 3T61A 4ZZIA 2HWWA 1USUA 1D6SA 1QWOA 3ITKA 2ATEA 3K0AB 3KWMA 4IICA 1DBIA 5BNTA 4DNXA 4HS4A 4U2KA 5ED0A 3LU1A 2GAOA 2ZAGA 2HTEA 3D6MA 3MT9A 4O4JB 5CYOA 2KYRA 3VGPA 3IUPA 4PAQA 4IDAA 4IG9A 4EL0A 1XPJA 221PA 2PKEA 4JR0A 1V6AA 1L4MA 2XE6A 4RF2A 4MINA 1CETA 4BQRA 1CRZA 3QWHA 1H05A 1D1PA 1UAGA 2DHRA 4DR4B 5HJ7A 5SICE 2F62A 2AN3A 1G63A 1U0LA 1PYGA 3FDXA 3ESBA 2JRLA 4KDCA 3CPJB 5BNWA 5E7JA 2BFFA 1O54A 4MVJG 2ZKIA 4LQLA 1M1YA 1G4UR 1PEYA 1PZXA 2GERA 3CUSA 4DCOA 1XRNA 3O4VA 3P9ZA 4P34A 3WKCA 4LE1A 3ZUPA 8ABPA 5KINB 2R87A 1JSCA 3OOEA 3V97A 4WBNA 4JKIA 1I4LD 3JZFA 3W1EA 4DDMA 2OGSA 5CK5A 4EY4A 4RTLA 1HRDA 1P1BA 3KOMA 4UCQA 3CLTD 3W8RA 1T25A 1GP2A 3UNXA 2XMPA 1NSTA 2V65A 2ZJZA 4IIYA 2Q49A 2B8NA 1T6BY 4YMGA 3PQ7A 2ARKA 5DM70 2OO3A 3IXMA 3E03A 2I4LA 3GHYA 2HSDA 5ETJA 5AJZA 1Z0SA 1OAAA 2Z6AA 1RYZA 2H31A 1T2NA 1J21A 5MGBA 1MVNA 4TV9B 1Z39A 5JY6A 1U0SY 4XQCA 2P77A 3EX7C 1YR9A 2GPTA 5CT4A 5L9AA 5K0TA 3AXSA 3PI7A 1ADYA 4LWZA 1NUAA 3QMWA 3P9QA 3TQIA 2WFLA 2R5NA 1JJVA 3H0EA 3HDHA 3E82A 4R69A 3RW9A 2Z9BA 3N8DA 5KNDH 5IBCA 4FXOA 4I6EA 4X6XA 4NDAA 2CVHA 1KI7A 5GWXA 1MJHA 5AM4A 1Y4AE 3PPYA 3LOPA 4ALMA 3K1AA 4QUHA 3R7BA 4BHTA 2IX9A 3AB8A 3Q15C 1MJNA 4UCWA 2R60A 2JAXA 2OCYC 3T34A 4R1QA 1GIAA 3WIVA 1W36B 4JLOA 4YQZA 4JB2A 1PVOA 4NMHA 4E4TA 1V9LA 2BMEA 2X3YA 1UDRA 4Q9KA 1F3OA 3O38A 4FOTA 4CMBA 4RADA 4HWTA 5HR5A 2CWDA 1G64A 4WERA 2D1TA 1YJBA 4I8IA 1A4RA 1W4AA 1K5GA 4O2RA 1M1NA 1JLLB 3GP5A 4QAJA 5MF6A 2O20A 3C0KA 2VUHB 1UBGA 4MR8B 2BY4A 3UJAA 4BO1A 1JV2B 2IKSA 1ZP6A 1X7YA 3H75A 2WD7B 1KAEA 2EX1A 3HXKA 4IS3A 2HOQA 4YRDA 5A0VA 1RNLA 2QMOA 3IMCA 4NWIA 4B7AA 3O21A 1M3SA 2Z8YM 3V55A 4OVKA 3I6ZA 1NDQA 3QLEA 3ZXIA 2G07A 1V8BA 3MELA 1XZAA 5HIKA 2O3TA 1I2ZA 2GPNA 1AV7A 4NE9A 4KR0A 1GYPA 5KMGB 2OK8A 1QV7A 1JR2A 4KBGA 1CLEA 3T7RA 3B12A 2O4CA 3MRTA 4V2UA 1OLUB 2QM3A 3HCOA 5FHQA 5BSUA 2Q6TA 3EC2A 2J0QA 5G0UA 3THWA 5LCXA 4ZV4A 2F8MA 4PYOA 4KSCA 3LYAA 4EECA 2XYQA 3FYCA 3P2OA 3NLLA 3AUTA 3T7SA 4M1ZA 3WMXA 1WG8A 3C8MA 1NXWA 1EUCA 1WJGA 1ZM4A 1TQHA 2J41A 2HMVA 3SC3A 4L07A 2ZATA 2ZGVA 4D4IA 4EPVA 3QXHA 3P4YA 3GRKA 1JAZA 2Q4BA 3O8BA 3KBBA 3LHFA 3IODA 4HATA 4Q1AA 1D2MA 1ENPA 1TW3A 2EZ9A 1QYXA 5CJ2A 3UFXA 4UFPA 4Y2YA 1ADGA 5LOVA 1KVTA 1NP6A 2IYWA 2X2EA 3ADKA 1K66A 2C2WA 2IYQA 4QBGB 5KOHB 5AVYA 1F38A 1XQVA 2Z6UA 3Q2OA 1UBEA 1FUEA 2I3GA 4KN6A 3DMRA 2HHCA 4BEBA 3KD3A 4MI1A 1P3DA 2JEYA 4JQOA 4DF3A 4LJSA 4K9SA 3TCXB 4CKBB 4CGYA 2QQGA 4MRMA 1FYVA 4LTDA 1L5QA 1T8RA 2V7WA 1MA0A 3DDCA 3H4MA 2A9VA 3MBOA 4KWEA 1JH9A 3KE8A 4K46A 3OE1A 4Q37A 1D3AA 1YACA 2ECFA 3ODGA 2BP7B 4EG4A 3HU2A 3VR4D 2C9DA 3DBVO 1YUNA 5JUWA 5KNBH 4RVFA 3R9IA 4HMQA 5DRYA 3KJFA 2NXNA 5J2TB 3A1EA 2G40A 1XZLA 1EDDA 1SEVA 4A73A 2AHOA 1H6AA 2I71A 2ZRDA 4JDUA 5I9BA 3ZDRA 3QVUA 4ZI2A 1KOGA 1V5FA 4KO4S 5CBPA 3QWIA 1FW6A 1K6XA 1KP3A 1FVOA 3G5MA 3HDYA 3V42A 3AT1A 3S8YA 3C48A 4XD7D 5LNK1 2CSXA 2A57A 1JAIA 1VCMA 1WCWA 3LVBA 2GKOA 3QHPA 4HN4B 4AY5A 3D02A 4YT8A 3DLHA 2RCYA 4KQ2A 2BEWB 1UKCA 1XKTA 2J3KA 1N2SA 1YB5A 2YV3A 3ETHA 3R7WA 2OXFA 3NHBA 3CR3C 3ROFA 2AG8A 1E9BA 2Q0HA 4GOND 5K6RA 5HW0A 1JAXA 1Q7CA 1TJYA 2XCQA 1UFQA 4A2QA 3T3OA 4OI2A 1W4BA 4BKRA 3HCPA 4UE2A 5EE1A 1WLSA 3OFVA 3PLNA 4ALLA 1OGJA 3L8HA 4O2BA 2WUWE 1M0SA 1TLLA 2VDMB 2JVKA 1DIRA 5GMOA 2FZCA 2V4UA 4FGZA 1SUDA 2WPNA 3ILXA 3R3XA 2ZUBA 3MTEA 2RGCA 3W2HA 1ZD1A 1EFDN 4I1PA 4IOKA 5KUTA 1FYEA 5F2NA 4UUOA 3AVYA 2RI0A 2MJLA 4BMXA 4CT5A 1DC3A 4FBMA 4Q6BA 4A2CA 1U3FA 3F2VA 4QDJA 4QU9A 4DE5A 2E6KA 5CVEA 4OI0A 3K35A 1N1GA 2YUTA 3KTFA 1YHZA 2HA3A 2QU7A 3QLUA 3QPWA 3PUHA 3EGXB 3S8MA 5REQB 3UGQA 5TMPA 5MGNA 3FSEA 4GGPA 3WL6A 3KJEA 3SQMA 3OLVA 2AMLA 3WOVA 3C3JA 2Y1EA 3RNOA 1GG9A 4WBXC 1F6BA 5BV1A 4YACA 4C14A 4HQ6A 3JATB 3TOZA 4KO8A 4FKMA 3UMRA 4EG0A 5K6AA 1UKYA 5JSUA 3ZK9A 3BWMA 3COZA 3FCOA 2C7VA 4ACAA 4IR7A 5EIEA 4KQIA 2A7XA 4QXMA 3FTDA 4H4EA 1NF9A 2HCJB 3BE4A 4QRHA 5DNVA 5E9QA 3N8GA 4CW7A 1HYEA 1VIMA 6REQA 1GDTA 5FTNA 5ENVA 4OU5A 5D7BA 3WGVA 4PC7A 5D2CA 1LBEA 1Q0HA 1SCIA 1HQKA 4MLCA 4QLAA 5AVRA 4ZO6A 5GJCA 4BP9A 2H16A 5DMHA 3IAM6 4K03A 1CY4A 3GBPA 3PYXA 3MPUA 2YJZA 3K20A 4D9EA 1HA3A 3OM8A 5LYJF 1Q0RA 2JL1A 1S4QA 5HF6A 4HNGA 1PDOA 2IVZA 3BJMA 3LOQA 3NCTA 1B6RA 3L0DA 2JEOA 2A5YB 2XWPA 3HXPA 4B8WA 4KR7A 3QUAA 2OGUA 2J08A 3EOZA 3E9YA 3FBGA 5CX4A 4LI3X 4LYAA 3WRVA 2CL6X 1Y4DE 4IFTA 2OCBA 1PWXA 4JBLA 3LCUA 5DNWA 2G9QA 2PH7A 4MIKA 1PEAA 1NYQA 1Z7YA 3AEQB 1X2EA 3ET4A 4WZBE 5HCIA 4C4XA 5EIBD 3ZQ6A 4J07A 3FNIA 4DARA 4RMGA 3SZOA 2PJRA 1WNTA 4L50A 1HNWB 4CMGA 4Z54A 3PFBA 5SZIA 1AG9A 5IABA 2XT6A 3PD7A 4MZDA 4R98A 2FPWA 4GMKA 4HP8A 3DONA 2DQSA 3N3AC 1XJ0A 1YAHA 1P91A 3WB9A 2HF2A 4MV6A 3DMYA 2ZWMA 2GJAA 3AKZA 2DPHA 1DZ3A 2OGTA 5TT1A 3FDZA 5EMNA 5KQMA 1W29A 3OIYA 4Q4LA 4S0ZA 1NVXQ 4CRWB 3OE7A 1E59A 4A7PA 1L7QA 1NHWA 1R8YA 3SZMA 5JD6A 4EEKA 1MNQA 5IK2A 2H11A 3X0DA 2EZTA 2ONCA 2NZXA 4YREA 3RVSA 5JO0A 2KS6A 1X8LA 3FTQA 4PYRA 1XZEA 3BDAA 4PNEA 3DBOB 4WN9B 3OZFA 2RHMA 1CDDA 3HBAA 2GDZA 2PJUA 2ZVDA 1H42A 1S2LA 3OF2A 5T8KA 3WIUA 4IHKA 1YZGA 3BK1A 3SYMA 3WAKA 3VPBA 2YXBA 3M9LA 3W79A 4XB6B 5TS3A 3CCCA 2J33A 4DYDA 4RGYA 2CFCA 1E3IA 2IPAB 5IJ9A 5JQGA 3NV7A 2CZQA 3C74A 4XCXA 3PEVA 3BXZA 1US8B 4FEYA 1SMKA 2BKUA 5EJIA 3NGLA 1WSDA 1H3EA 1R0WA 1BG6A 3W1WA 1ZITA 1NV9A 2FW9A 3V7YA 1PYDA 3NDBB 1NXVA 5AKEA 3R7SA 1I2BA 2VYNA 1SVWA 4U1RA 1XMOB 3AINA 3GU3A 3MMPA 5LWHA 2WSMA 3O94A 4X9XA 4BC1A 2NPFA 1EXDA 2QW1A 3DOHA 4EKIA 1OLXA 3EWAA 3VC7A 4KNVA 1V9CA 5KDLA 2RGNC 4F5WA 3EA4A 1ZRNA 4OQYA 2F55A 4KDFA 2YIJA 4R01A 3SYLA 4KVAA 4L16A 4A2PA 3AZOA 1ML3A 1NUUA 3CVYA 2EKDA 3ZJYA 1ZS9A 4F8EA 5CFLA 4DBVO 5CFOA 1F6DA 1R7RA 1UXKA 2WYIA 3IS3A 3CZQA 3K1JA 1N6KA 3W6PA 5EJ4A 1O8CA 3VZRA 1MJGA 4Y1GA 3Q72A 2QLBA 2IOFK 4KGVA 4PCAA 4WTOA 1Y8AA 3U7RA 2WPDD 4UBNA 2BCEA 1U2TA 2ASEA 3AM4A 3GCWA 3PNSA 4Q02A 4Q0MA 1XAHA 3PTZA 1E6UA 3G9ZA 5FA8A 1JTFA 3ICOA 5TARA 3JAKA 3O9ZA 4CLDA 1NJFA 2FZWA 4BKOA 4P84A 3NJRA 4BO8A 3NWPA 1YVDA 3AUSA 1FDRA 4ZN6A 5KPJA 1H5QA 3ZD8A 3W7VA 2OSBA 5EP2A 3D4NA 3RUFA 1HG1A 3D6HA 5K3FA 4M6WA 4NZMA 2YC2C 2PRYA 1DP4A 1JEQA 2A3RA 1UZUA 4MVJE 4AYTA 4DTIA 2PXXA 3R3UA 3AVWA 4LRUA 5AVQA 2JARA 3WWEA 3DM5A 2VXYA 1R66A 2YN0A 3GV0A 4OLFA 3SD7A 1LBSA 1UXIA 3E81A 1KOJA 1NU8A 1OSNA 2A7QA 4C2AA 4BS9A 1WVIA 4GXQA 5DM4A 5EIOA 4UBIA 5FXMA 4UOQA 4IJKA 1TYBE 4M0KA 4DCNA 4Z7QB 5J4LA 1F7VA 2PUJA 3BE5A 2G9UA 3TZLA 2JFXA 4O5OA 3AUUA 1LSUA 1V2GA 3WR5A 1E5LA 2NNLD 2X0KA 2X5KO 2XTMA 3WS7A 2ZB8A 4WH0A 2H0AA 2I1WA 1N8TA 4LDNA 3K15A 5L3QB 1HDZA 5J3JA 1UQUA 2PX2A 1YQXA 2I87A 1P4JA 1ZMXA 1P8JA 4LWOA 3QG1A 4L73A 4NYJQ 3RLIA 2NU8B 1B93A 3D2LA 5F3RA 3TSYA 3WGYA 3ZHOA 1ULUA 1SRQA 2AN9A 1J9GA 4L5JA 3U4CA 4E2ZA 4UOEA 1G21E 3KU4A 4K05A 2AJTA 4IDEA 2D74A 3T1YB 2Z4RA 1IL0A 1I7PA 3FW1A 3PFGA 2ID8A 3K0FB 4TROA 4EDHA 2PSEA 3FHLA 4KFTA 2Z1NA 5A3VA 3U37A 4Z6KA 1YS6A 3LLVA 5IS2A 4HVLA 5B3LA 2POQX 2DJIA 3I4LA 1HDXA 1L9XA 1ZNQO 4YRQA 2QZPA 3GP8A 4GKVA 4EMSA 1T5DX 1QP7A 1YDEA 4PHTA 2CLDX 3Q41A 4MO2A 3EPHA 1MUUA 1CF2O 1G9XA 4DRXB 4FGUA 2V58A 3S2UA 2JW5A 4ETNA 1IOVA 4O4IB 3F6YA 3LUCA 4IIHA 2XI4A 4RK7A 4TSKA 1CFZA 4CXMA 4E30A 4G36A 5FO0A 3EIQA 1UOPA 3H19A 1JKFA 821PA 3MJSA 2RGUA 1QO0D 4MGIR 3ER6A 4RPKA 1XELA 3THXB 2JGEA 4TUYF 1XVTA 1A9QA 4YC7A 2OBXA 4FUTA 3IMKA 2HHJA 3LQRA 5E6RB 2J46A 2QRKA 2OESA 3KYJB 1YS7A 1J4AA 1T2AA 2I76A 1NVVR 2PUWA 3LBHA 3AY6A 1U8UA 1YZYA 3CQ9A 3PUJA 3QFSA 1TOAA 1G59A 1L5OA 3NYQA 1O95D 4JAVC 3WDMA 3NUZA 1HZZA 3WLFA 4AMVA 5ITZA 1QVWA 2HZ7A 2NP7A 1YGPA 3AV0B 5D7NA 4C0WA 2QQFA 4TS1A 5HFJA 5ALKA 3MMXA 1WXHA 1VIVA 2HIHA 4WCVA 3E9DA 3SQOA 1W0KA 6ADHA 4GM1A 1WU8A 3DEKA 3VR5H 4MI9A 1OZGA 2XNCA 4RPLA 4AS2A 4FEAA 2HU7A 4TLMB 3RFUA 2PX3A 2OUKA 4OHBA 4U2CA 5LR6A 2GEFA 1BWRA 3HY6A 3TCNA 3ZK7A 4P4TA 2I33A 4LY3A 1I8TA 1RD4A 4ZEWA 4Z4IA 4B4DA 3EMBA 4X95A 3BFXA 3ED5A 4WNAB 3PHLA 2OMEA 4Q3BA 4RF4A 5E9JA 1DKUA 4F04A 4O3MA 1G19A 1GRQA 5A6SA 3IAHA 4P4GA 3FUXA 4NTZA 4RCZA 2B1JA 4JI2B 1IQUA 3TB6A 4C43A 4D6PA 2FR8C 3ZBQA 1JQDA 4I3GA 5IT9A 5FJIA 3LSTA 1V41E 3PNKA 1ZESA 4MPJA 1VHDA 1ADFA 1AKMA 2OYRA 1M8GA 1WW2A 1KJ9A 5T4BA 4PZEA 3UMFA 1CG6A 4A8PA 4DG8A 3RARA 1ZD3A 1W4RA 2D59A 1CLUA 3HR8A 3D31A 3BL5A 2OG2A 4OFWA 2Q6KA 3BXEA 3RJ9A 1WDLA 4FMCB 1LTHR 4BNGA 1GAWA 1W47A 3VOSA 3LMKA 4RTQA 4BYMA 2GXUA 4G0XA 3TZEA 3EDQA 1VXOA 1X8XA 3K05A 4NESA 5B6PA 1RHKA 2HWXA 4EY5A 5C4IA 1FP4B 4DNPA 4GFDA 2I78A 1U7OA 4PYQA 2V0CA 3SKVA 1OH6A 5TEVA 5CDUA 5KREA 3VPAA 1U31A 3L0PA 4UMEA 2ZITA 2PGDA 1KYTA 2PS3A 4NV0A 1OIWA 1JJIA 4X6YA 9LDTA 2AE1A 1AN0A 3PV0A 4KH0A 3L1IA 1Y9DA 4DBZA 4LHXA 4PGMA 4PCUA 1Z0ZA 3PZRA 3YASA 4G1VA 5K2OA 3EBOA 2HJSA 4WOBA 2ZE8A 3C6BA 1Z68A 3V8MA 5K0JA 3Q0EA 1FQOA 1NC1A 4E33A 4FFRA 4PLZA 1GCGA 2KBFA 2OQIA 4HX2A 1R5NA 1JBKA 1QMPA 1XMSA 2CNNA 3DVLA 4ER6A 5AESA 4ZOLF 4BKPA 3CH7A 2FEXA 3WNDA 5FUWA 5I7RA 2UYGA 4YJDA 2VQ3A 2P9BA 4QJIA 3FZEA 1K4MA 4IFBA 2VO1A 4E51A 1JFTA 3FM9A 2UUOA 3BB4A 2Q4OA 1U02A 2DTDA 2YMPA 3DMGA 2ADFA 1JHDA 3CO0S 2GNAA 2Z5GA 1DFHA 4Y2TA 2ZSUA 4DYHA 3M9XA 2D1QA 4PLVA 5EOVA 3VSDA 2PUCA 1VE1A 1PSDA 3GFOA 3H1AA 2GPBA 4NBUA 3VVCA 1YU6A 1KWKA 4GWKA 4TLDA 3HY4A 1DXQA 1K88A 1QIKA 2JBAB 2VSOA 1S2MA 5A9TA 3GLHA 1U0OC 4FEGA 2SBTA 2YWGA 1N6PA 1Y81A 3JQ6A 1TTPB 4ZVRA 2JJMA 3UO8B 3ZOZA 2JIPA 2BR5A 4NBSA 4IZIA 3PYLA 1BU8A 4KQHA 4MYHA 4P0TA 1QGED 2BFNA 2V9ZA 1PFYA 4GIBA 2PGOA 1NOIA 3AGQA 3Q9LA 5FNVB 5KDDA 1QYCA 2PKRA 3KYCA 3MJDA 3V46A 2JATA 2PJZA 3L0CA 1SBIA 3G7UA 5BORA 4B45A 2DEUA 4A8TA 2WVHA 3ZU4A 1C7FA 2D1RA 1WUYA 4CN9A 3Q88A 2GBCA 2PX5A 1ZIXA 3KUXA 3VYSB 5HZMA 4CKYA 3AHIA 3GF4A 3KWJA 1KS2A 5KWVA 1TL7C 1CKEA 4EB0A 3UM9A 5IUKC 3BHJA 2HQRA 1SKAA 2YVUA 2QV0A 4K6MA 4D46A 1KRWA 5CLGA 3RG8A 4I1RA 1KIAA 2AR9A 2AUMA 5JJ5A 2GYVA 3G0OA 3RK0A 2INGX 4YJGB 2FSVC 1WZUA 4M99A 2FMXA 5F77A 2OKCA 1BXRA 4IW3B 2F1IA 3GFTA 4L8LA 1U2RA 5BSRA 4Z4CA 3QU2A 1TE2A 1L4KA 1P18A 3NGXA 2FOLA 4HHEA 1U9YA 1DBWA 2ZYWX 1R0YA 4DIFA 5FUQA 5BSGA 3C4QA 3GDGA 4XVUA 3VYRB 3CWZA 4QFCA 1E60A 3X43A 2WAAA 1LRKA 1XA3A 4INOA 1SG9A 3PPVA 3VHRA 1AXRA 2D1FA 2BTQB 4QPDA 1CY6A 5JPDA 5B5SA 3RK4A 2GAIA 3T3MB 1MENA 3CPEA 2WFAA 3CB4A 2ZDGA 2JA2A 5GVSA 3QU9A 4Q1CA 1QVAA 3MTGA 2H1FA 1GM5A 4AN4A 4Z0HO 4QTXA 4WPGA 3VNBA 2IF0A 1FXUA 3QE9Y 1F2UA 1ORTA 3D8HA 4DTCA 3KAKA 4QODA 4Y1FA 1SWVA 4OIFA 1PAUA 3VA7A 4M7RA 4URYR 2Y1GA 1GILA 2BCJQ 4QLBA 1NJSA 1YQTA 3IKJA 4FDUA 1DX4A 1P0CA 5FO1A 3TLMA 4AC9A 2IIPA 4XE5A 4IMRA 3RBZA 2QMUA 1T1RA 2GPYA 4HRVA 2O6LA 4RPCA 4YXFA 3RIYA 3UKOA 2PFKA 1XVVA 2VHJA 3AWIA 4H0NA 3KQHA 2TS1A 3OJXA 2PH5A 4IIGA 4QOGA 3RVQA 3TOXA 3T4UA 1VGVA 2IY7A 4LZLA 1CR1A 3QVTA 4MQ5A 4CQNA 3BK2A 3RTDA 2IYYA 4AY2A 4TV8B 3FR8A 5JNTA 1WDWB 3EGDA 1LPBB 5H83A 1MKYA 1U0GA 4FDTA 4YFVA 5H70A 1WDKA 2NV0A 2FAXA 3TL2A 2VSNA 2I8CA 4IIDA 4LWQA 3GNSA 3BCRA 5AUQA 4EA8A 1WPXA 1Z13A 1O8BA 3DVSX 3TDKA 5AVXA 1JIKA 1NHGA 2Y8EA 3F6CA 3EA5A 1J0DA 4O1MA 1UANA 4MS4B 5T64A 5BYAA 1X7WA 3N8NA 1B8UA 1EWYA 4EAAA 4M1TA 4WKGA 4LRQA 1AXEA 2QRZA 2N3ZA 5ITVA 1XXLA 2IDZA 2WTUA 3RRNA 1B74A 1MOSA 3U48A 1DEKA 3VQTA 2NYRA 5BOSA 3GI1A 3LKDA 2JGJA 5EGSA 4GOKA 3RVOA 4E6PA 5B7PA 1NE7A 2NUTB 4XJXA 1EZZA 2PT5A 2R8XA 4JLNA 4US0R 4WIAA 4YP5A 3KXLA 2SICE 3O3CA 2A94A 1BDJA 4LE2A 5INTA 3OJCA 5A5DA 4PANA 1YZVA 1U3TA 1BA2A 3H4VA 3DWGA 1PT9A 4OG2A 4F4CA 3K5IA 3QFCA 2VTBB 5BQ5A 2ATXA 5BXQC 1GTZA 1K8ZB 1NW9B 3A11A 4FBLA 2V6IA 4HNHA 4CLRA 4C3UA 4GVPA 1E0DA 2XUIA 3NYIA 2JKZA 5AKGA 3NETA 2Y1OA 3M81A 5TVGA 2HR1A 5K45A 5J40A 4IOJA 1XMVA 3MIIA 3WQBA 1ICEA 2E87A 3D64A 3SLKA 4F1KA 4TKZA 5DYTA 3UWOA 4Q39A 3KOOA 4K3UA 3KYBA 3QOXA 1C7QA 2ZQYA 2HK8A 3H86A 1Y1LA 2IYXA 4UU0A 3TQHA 2GWRA 2ZIWB 3SJBA 3IT0A 1EEXB 1K86A 4C0XA 4LV8B 3DOJA 3AFIA 3QNWA 2PO5A 4DDUA 2ZQ5A 1CR2A 1ZK0A 2GN9A 3CURA 3ZX4A 4NFSA 3UMBA 4MQMA 4R9VA 3MRVA 2MT9A 1X74A 1YZUA 1UBLS 2Y93A 3I45A 5EMKA 4XWWA 1QFJA 3JASA 1XCMA 3P9CA 1BOFA 2B7CA 3N2KA 4W9NA 3SI7A 5EXDA 1U63A 1KZ7B 2BGLA 1JHZA 1I24A 2OEPA 1Y4SA 4YECA 5H1YA 4D9FA 4DR6B 1SBZA 2JFFA 2LXNA 3L6BA 5TPZD 1ZISA 1J8FA 3B1WA 5A4IS 1A88A 3B3JA 3SAJA 4Z4HA 1BFUA 4KP7A 3AF1A 3T38A 4Z7OB 1JR3E 2CD7A 2FPRA 1KR2A 1U81A 4FCWA 3WL3A 5JU6A 1PQYA 3GFGA 3L3BA 1GPWB 4MB2A 4Q12A 2FQWA 1N5LA 2PE5A 4FINA 1UODA 3MN1A 4QJ4A 2P2DA 3DOFA 4RSRA 3L4KA 4EEXA 1NBMD 1YUBA 2ZULA 3I0ZA 3SXPA 3S68A 2V6JA 2JAPA 2WT8A 4MV5A 4TWRA 1GNLA 1YS4A 3VDXA 2DU8A 3HV0A 3U7EB 4ZT4A 4E3WA 3N9IA 4GZ5A 3HFJA 3PEEA 3QWAA 4L5IA 4BLWA 1PVVA 3QELB 3S4YA 5CB4A 2OYCA 3K4HA 2WOOA 4WZAB 1U4OA 2J5BA 1U7WA 2FH5B 1LJLA 3L07A 3LK6A 2XUPA 1BS9A 4NY1A 2Q28A 3A1CA 3RS8A 1PI3A 1ZY2A 2Q8PA 2Y67A 1MT0A 3F5QA 5H02A 1XF1A 4OHYA 1FCJA 2G80A 2P90A 4IDGA 2GNPA 3OI7A 2C3UA 3VKGA 4DAOA 4Z86A 3NALA 1JDSA 2WAXA 1HR0B 2PT6A 3C6YA 4PAOA 1N34B 1L2TA 1M6YA 4HYYA 4IIJB 3AF4A 3RF6A 1VBFA 1VE5A 1X87A 3C14C 3JXEA 4ZGBA 1SCDA 4BNZA 4YMUA 1T6ZA 2GD0A 2GXQA 3GFBA 3ZE8A 1D1SA 4LMPA 2O14A 2AX4A 2HJ9A 2CUNA 3H5IA 2TMKA 2P9EA 3HI6A 3MTQA 4O02B 1HTTA 1II8A 3ZJVA 1WETA 1V1JA 4BQPA 1GDHA 4O4HF 4PQRA 2VQEB 3GLGA 2ZSBA 3A6KA 4UAJA 3ZQ4A 2IITA 3O8RA 2O8EB 4O8ZA 4OHVA 5ALDA 4MEBA 5K3AA 3UEOA 1BJRE 2VZLA 3FPAA 3NHYA 4OXIA 4JMLA 2V6MA 1AH2A 3O4RA 1O4WA 4OI1A 1XGKA 1RDFA 3AR7A 2R7LA 3KG2A 4M38A 5EUMA 1PFGA 5COQA 1J20A 4URUR 5CX1B 3KM0A 2ODQA 3RB8A 2WU8A 1T91A 3PDJA 2UDPA 3IULA 2MSCB 5HPYB 3KUKA 1EQ2A 4QEKA 4EO4A 3PB3A 3AO0B 1V16B 1O6CA 1FFYA 3H1GA 1TJ3A 4ZI7B 2IW1A 3VR4A 5B1SA 1C80A 1BN6A 2WG1A 1M7GA 2XYVA 4ND1A 1ZH8A 1G3MA 1W9MA 2XECA 5HDBB 2VAPA 3OSZA 3WOHA 4HUQA 4BPBA 1AUXA 4DMHA 3L7OA 2PT9A 4UQPA 3GAZA 4D25A 3H4TA 3UJ7A 2CVFA 2WKQA 3UAYA 1LVUA 2REQA 4INZA 3T7IA 4BB9A 3VKHA 2LGJA 5I7AA 2FN7A 4Y0AA 2JH9A 4LSZA 2CNWA 5A9SA 4EYEA 2VQSA 4PQGA 1M1XB 4M83A 2P6NA 5JCPA 2FF7A 1AUPA 5TNXA 3JQAD 1R9JA 2B78A 3Q87B 1GGMA 2XZDA 2NO7A 2Y0PA 3LUFA 3WLEA 1OAOC 3PRKE 4ESOA 1KI2A 1UJBA 2OO7A 4NBLA 4ABYA 1N1DA 5CMLA 3ZXSA 4LMBA 1NRWA 5J9FA 4I50A 3SQWA 2C07A 2FHSA 2NXEA 4AMZA 3DE3X 1F0KA 3EBLA 3T7EA 2MTBA 2YINC 4KFUA 4UNNA 4LDZA 4RM3A 1X94A 2C4HA 1RP1A 3BSYA 2XCRB 3F4LA 2BBWA 4PHGA 3TRDA 2Y71A 1U90A 1FFWA 1YRAA 4KMOA 2XOEA 3TECE 1W93A 2IL1A 3DE7X 1HYGA 5F78A 2ILVA 4EPXA 1LD3A 4XDZA 3NAQA 2H0QA 1D2HA 3A28A 4J2OA 1Y5MA 3UH0A 1DARA 5T3UA 4DLWA 1FDTA 4LGMA 2D0PB 3DC2A 3AQ4A 3A27A 3FMFA 3OFJA 4QD3A 1EP9A 3EK2A 1DQZA 5TQJA 3Q3CA 3VHLB 1OGIA 1W7AA 5B30A 3KQYA 4URZR 5DYGA 1AGXA 1NM5A 4HDOB 3E9RA 3GUVA 4ZAWA 1JYEA 3QJ5A 2QTMA 4N3GA 1Z0KA 3MRXA 3ZIUA 3ABSB 4EHNA 1HTWA 4GGOA 1OHHA 3NUQA 1JFFB 2ICAA 2P9ZA 3IPRA 4KXFB 4Q82A 5G0WA 5JD3A 3HDJA 4H1VA 3BXGA 1A8IA 3U09A 4TKMA 5H8WA 3AEKB 2PANA 5KQRA 2WSYB 2JIBA 4AIRA 3JW8A 1REQA 1W36C 3BGDA 1WPQA 3HMQA 5EQJB 4BO2A 3U26A 2CDRA 3OECA 1RJ9B 1KFKB 1RFGE 2AEFA 4GR4A 4PYJA 4QUGA 2V74B 4PR0A 4Y2RA 2OXIA 1E0JA 3PDWA 1AX9A 1Q6ZA 4KEAA 3H1FA 1MHTA 1PV2A 1I5OA 1UAYA 5DWQA 1JLSA 4JYBA 4KDEA 4MW9A 4UREA 2AR7A 1EUDA 4X1OA 5B58T 3ANNA 4R9UC 3VO1A 4A92A 2UYYA 3VKUA 4B75A 5C32A 4C4PA 2GSWA 1RHRA 5DM60 1ZRMA 4E03A 4ZHQB 5FEUA 1WTCA 3LT4A 4INAA 1OYOA 3D3KA 4N82A 3I0MA 4TSRA 4JJ8A 2FX5A 2IXTA 1I3MA 2JDID 2CB9A 1Z37A 1BXGB 2AK2A 3GQBB 3OTWA 3MFYA 1YBVA 3SC6A 5LN1A 2CXHA 2HCRA 2F3QA 4N03A 2WSIA 5GONB 1R4NA 3FYUA 3SVZA 3Q7EA 2OBYA 4LDPA 1Z29A 3RWMB 4B9EA 1VYVA 4BO5A 4J3FA 2V7BA 5E4YA 4WAUA 1PZMA 3L8DA 4JA2A 4U7HA 3WNQA 4QQFA 4DJ5X 1P7CA 4EJ6A 3PRJA 3QVJA 3JZMA 4QBTA 1O5OA 4PONA 2FEWB 3ZGLA 4I1UA 5DYWA 1YH3A 4J0HA 1OT3A 2ZJ5A 3MILA 3BD6A 4HAWA 4LPSA 5DK6A 5CB4F 3PXXA 3G59A 1YFJA 1SXJE 4Y2UA 4I3FA 1KKUA 5AKHA 4KR9A 2XB9A 3KRTA 1I5RA 1Y7PA 3UENA 2CLLB 3LDFA 4KV9A 2WKPA 3VSEA 4X45A 1KEPA 2FFRA 2HRZA 3H99A 4U0KA 1DSSG 1NW5A 4DNOA 2B4RO 2X4DA 3GB9A 2FGKA 4PAMA 2GBLC 2VK4A 5KKAA 3RROA 3PL5A 2HLDD 3QGMA 2V3CC 5HQJA 4NH0A 3LRTA 2GZ3A 4A2WA 1SGWA 1A4XA 5JNUA 3RYTC 3QUCA 1X13A 2AZDA 3NXKA 4UM7A 3E7WA 4Y9SA 1N1MA 3SCZA 1K63A 1VKZA 3K09C 5DHUA 1YR7A 2F3RA 4ZOLA 2DUNA 4L08A 5I9MA 2IEBA 2V3WA 2YQZA 4MPTA 3AGPA 3K0EA 3PSHA 4RY8A 4ER0A 1I7QB 3ISVA 1S89A 1DDOA 4C21A 3DUFA 2J7KA 4DLSA 1OC2A 1WSAA 4IJQA 3T1OA 7AT1A 5D51S 2GEKA 4Q19A 4RF5A 5E1MA 3RC9A 3O93A 4TMWA 1Z4OA 2FPIB 4MHSA 2V8BA 5JATA 3I1JA 3GMIA 2YIDA 1SJ9A 2KJQA 4BNXA 1XMPA 4CKXA 4IH4A 4DLAA 5AJUA 1WXEA 2V7QD 1PL6A 4TXLA 5AFSA 4G89A 1GHTA 5IUNC 3L0ZA 1NQUA 4C3VA 3PNQA 2VSYA 1UWCA 3C1UA 4BO7A 1Z5PA 3HCRA 1F2TB 3DEJA 3UB4A 3CEAA 1RYYA 5HIJA 4FONA 1V5WA 3AERB 3H2BA 3O7MA 4CF3A 3O95A 2C4NA 4XWTA 1IN6A 2ZCJA 3WZ2A 1DKPA 1Z6PA 1NVBA 1ZUNA 1QTRA 1Z82A 1LH0A 3RNLA 1PJZA 3HXMA 5CLJA 3TNFA 1CD5A 2MYTA 3NG1A 3GRCA 3EVFA 4PSVA 4CHTA 2IOFA 3CUUA 1WZ2A 4JEMA 4D7AA 1D6MA 1Z25A 3UPDA 5CXXA 1JG1A 2Y05A 621PA 5TT0A 3LX6A 1V8PA 5LYYA 2OP1A 5TQVA 2G82A 2Z98A 1GXSB 2HT6A 2V7GA 2WPDA 4HPXB 3K0CC 3RC2A 2HBRA 1FDWA 2FOIA 3O90A 5GOTA 3DJFA 1BW9B 1WZCA 1MR3F 1D8TA 1Y3BE 3I6BA 2ZI5A 1E2QA 4ZCLA 1GADO 1FJHA 3GJ4A 2O0HA 1LEHA 2FWJA 2W93A 4ON9A 4ZAGA 3AVPA 3T3DA 4D3XA 1ZGCA 2X7JA 2YFKA 4C08A 2A1UA 2NVWA 1PFVA 1Z4PX 4BV3A 4QEDA 5LDGA 2PDAA 2BGMA 2JCGA 1WR8A 4L72A 4R7ZA 5D8DA 2C20A 3KBOA 3TIGA 3ES9A 3BIJA 1PUXA 4CTNA 3L6OO 1M7BA 5C53B 2YXDA 2JG3A 3PGKA 1FU8A 1LVGA 2H1IA 3D1LA 3OTGA 2QW8A 2R68A 5JO9A 1Y6FA 4H4CA 2IS1A 3PGLA 4HUJA 1J00A 2HXGA 1DUVG 1MB9A 4YBZA 3H2HA 1NW4A 1SU7A 2IP4A 5K99A 1IG3A 5J1TB 1H1TA 3CN7A 5AR1A 1J1ZA 1G8FA 2GCEA 4BB5A 4ECAA 3H2SA 3WIBA 4YT4A 4BFLA 1P9WA 2ISCA 1YK0A 4FHZA 4TTVA 4AJIA 2QBYA 2QD1A 5BN5A 3U0VA 3I73A 3RYIA 3K2BA 2EP8A 2KX7A 1TQDA 4G5YA 3CW2A 1UBJS 2X1HA 4NYIR 2PSFA 2BFAA 2EZUA 1XCBA 3VV2A 2ISSD 1LPMA 1NFQA 4BNUA 1JQKA 4JGBA 3SHWA 2UZ1B 4R8VA 4XYMA 5F5NA 1GPAA 3K2IA 5EFZA 4A8JA 1DCKA 5C31A 2ESRA 1LSOA 2BR3A 3JQ8A 2WR8A 4ZU6X 3PGVA 1HORA 3LHIA 3WLLA 3TGLA 1QFXA 2JBWA 2Z57A 1DJLA 4FLFA 4N7JA 2CMDA 2UUPA 1TVMA 3BWDD 4JB8A 2EW1A 1HQCA 2FPOA 4DDWA 1JFSA 4X71A 1M1YE 3GFRA 5G1NA 1CK4A 1DAIA 3D7KA 1UMBB 2C3YA 3SJCA 2FPXA 1QO0A 1PGOA 1WDTA 2P1ZA 5CNIA 2GAAA 4DY6A 1CZNA 2O5VA 2B2NA 3D4BA 3M6AA 3NPMA 4JQYA 1WABA 4QATA 4XX0B 5JPIA 4BNVA 2Q5IA 2ST1A 1MAAA 1FW8A 1QQ7A 5A1TA 3ESCA 3F6SA 3X1WA 1PV4A 2ZI4A 4DRZA 4J3NA 3UJNA 3ZR4B 1T5OA 3BWCA 3G49A 1IQPA 1O95A 1XROA 3EDMA 5D3QA 3OZXA 3MLEA 1CVLA 2REBA 4LNHA 4UAVA 4UXHA 2C3OA 4N7MA 1U9JA 5AM0A 1X0XA 4EM6A 3FXAA 4JSTA 5I9NA 1PWHA 2G04A 5B55A 3AILA 1NP7A 2B83A 4MPDA 1RC1A 3K9NA 2VAMA 4G5FA 1FFDA 1PNRA 4F2PA 3ENZA 3A7EA 1G5HA 5G3ZA 1TMOA 2AX3A 3DL2A 3A1VA 5DIZA 5IAKA 1EXWA 1Z7GA 3DAGA 1TQ6A 2WY2D 1K4KA 1E5VA 1DIGA 1XZDA 1F2DA 1BD3A 2HEIA 3KO8A 3OFND 3TXXA 1S8OA 1S2GA 2P3QA 4D4KA 4N18A 4GNRA 4HAXA 2I4RA 4HLCA 1IPFA 4KQFA 3SNHA 1ZK1A 3IUMA 5JH7B 3W2IA 2PR2A 3UJHA 5MFZA 2MSNA 4CEIB 3S2YA 2R79A 4JBHA 3Q2IA 3OHSX 3C24A 3WLRA 1ZI6A 3JD1A 1SM4A 1QF7A 2PMKA 2ZTUA 3WL7A 2FMTA 3I5XA 2XMSA 1EVQA 3H8JA 4UC0A 2DQZA 3IUEA 5J2UF 1R10A 2DLCX 3CINA 4A9AA 4J16C 3SIRA 2CMKA 2DCUA 2XMBA 4L4XA 2HHHB 3SXUB 1BTOA 1R15A 4B44A 3FMGA 3SK0A 2Q6VA 3HJGA 1UDCA 4PHCA 3JQBA 1YBHA 4PC3A 1U0NA 4HQLA 4NATA 5BUQA 2MSDB 4K28A 1RXSA 2P2LA 3EZ2A 1Z26A 2CB0A 1LY1A 3EZ6A 2WUFA 4LEIA 5DLQC 1EWKA 2NUPB 2WJIA 2SHKA 4N54A 3HNOA 1P2FA 1PWZA 2J67A 3PC7A 5C5CA 3AFHA 3WI7A 4BVEA 3ANXA 3AHCA 1LGYA 4R31A 2DWQA 2WNIA 3M4ZA 1EHCA 1GG2A 4IG4A 4PLTA 3RRXA 4YIHA 3K6SA 4D3ZA 4HTFB 1PJQA 1WSWA 2Q9UA 3FE2A 4PRZA 5CYFA 5IDXA 3WY9A 2W2KB 4CN8A 4BFCA 1NZFA 4TQGA 4YJ2A 5IW8A 1ISIA 2Q4EA 4OK3A 4OJKA 3U62A 1RI2A 2QSJA 1E64A 2X19A 2ZBVA 3UWPA 2A30A 5I7SA 4PYKA 2D3WA 2LR0A 3E9EA 3NHWA 5EHQA 1Q3TA 1KI1A 5I9SA 5BR8B 3OD5A 2YZGA 3NWBA 1Z12A 4RVSA 2WJPA 3OPYB 2IU0A 3U40A 3ZDQA 5KHOC 5HNKA 4RIHA 4G0OA 3DEAA 4UJ5A 1MX1A 4G5OA 3NRJA 4OQPA 3RBXA 3WGQA 2NW6A 2WUGA 1CEQA 2B6HA 5ARCA 1GCAA 1CYEA 5DSZA 4LHZA 3WISA 3ZYCA 2QMYA 1H2RS 4LECA 4A0GA 2CEKA 2NQ2C 4R16A 2FPKA 1BWPA 1NXXA 2H4HA 1YASA 1TF7A 5H4HA 4DB2A 4ZXFA 3AETB 2XQKA 2QXUA 4CMAA 2Q5FA 1JSRA 2ZB3A 4ZCPA 4ERNA 1U7ZA 1TGYA 2VXOA 7REQB 2ZXUA 4LRWA 1GNTA 4NNJA 5BR7A 1AHHA 2VP4A 5EVCA 5DRTA 4MQFA 1ZM2A 2F00A 2I2DA 3T3PB 4HO1X 3BHIA 5JXWA 1DJNA 4QWWA 1QQBA 4IFEA 1MXFA 521PA 4XGIA 2DBVO 3KUUA 4JCOA 4CWAA 1A9OA 1S8AA 5TPZA 2C7GA 1A8UA 2HDOA 2OV3A 1FOEB 1YS1X 2RHJA 3UAWA 1EM8A 1ZXBA 2SKEA 3PFHA 1NQVA 4QOFA 3NFRA 3OF5A 4MDFA 3C3BA 1L7NA 5L6LB 1KEZA 1W94A 4RD1A 4L85A 2Q62A 1E0SA 1W5AA 3OJWA 4MI3A 4N5MA 4QULA 4UFOA 3EXAA 1F3LA 4LGVA 4FFSA 1X1QA 5LYJB 2BFDA 1RADA 3I9KA 5JSKA 4ZHSA 3GJSA 1TM3E 4QYIB 3N1UA 3CVUA 3CS3A 4OHPA 1KAHA 4O4HA 3RKUA 3KAJA 1FTGA 3FNRA 5F4BA 1USGA 2DQYA 3PXDA 1FSFA 3UGTA 1IY2A 3DW1X 3T3NA 1YR6A 4W1SA 5TQ2B 2BEVA 3V4VB 4CG2A 4FHFA 4RHYA 2BN4A 1U0BB 1RWBA 2AOTB 2FG5A 4N5NA 3R40A 3ICPA 2O7QA 4CHGA 2R8PA 2YJ3A 4BFZA 4DCSA 1WB5A 1QOZA 3FPHA 1XVAA 3JSXA 1OI3A 4GMXA 5K5EA 2G6BA 3M4YA 5IWCA 1A5ZA 3QNMA 2ZRBA 3E22B 3UXEA 1NXSA 3OKCA 2ZBFA 4N0PA 2PV7A 3T9EA 5LXTF 4DY4A 1GVHA 2XVYA 2Z8YA 4ZRNA 4BV2A 4JI7B 1XTPA 3IILA 1QFYA 4ZT2A 1MBZA 3ITDA 3SZUA 5HEKA 4RACA 4O2AF 4W1RA 5JAPA 4LZZA 3H04A 3QENA 3IALA 1YS9A 2EQBA 3KT0A 4OA5A 3ILHA 4PFKA 3GARA 2IHTA 1XDUA 1ZONA 1VE3A 2NO9A 2EL9A 4XIJA 3UIEA 4B7CA 4K2HA 1DXHA 2EDAA 1JU4A 2Q0SA 2WJYA 4EL5A 3H5LA 2JJQA 5EWMB 4RFSB 5DBEX 4RABA 2W2NA 3T15A 4BP8A 2YKGA 2EWVA 3OJ0A 1VJCA 3Q7SA 4MW4A 1QJCA 3SR0A 1N6NA 2R6ZA 5IKXA 3MAAC 4GBJA 4LS3A 1CUFA 1E8MA 5IBRA 3UW1A 2PBRA 2Z5VA 4DRYA 2QZ9A 4IEEA 1N2CA 3RJ5A 4EF5A 1RZRD 1JEJA 1IN1A 3PFNA 1QTNA 1PUJA 5G0TA 4RY0A 4X60A 1L3CA 1N5MA 2OPBA 5KYKA 3O3MB 4FYPA 2WLSA 4MKHA 1QM5A 4IMIB 1AGNA 3WMEA 1ZUIA 2VWQA 2O8DA 3L8YA 1OV4A 4B3HA 3CKMA 3FVRA 4HLDA 3ZLBA 5JYEA 2OOSA 1ISSA 3EXEB 5KDOA 1H1DA 1LW6E 4HLQB 3FJOA 1PJ4A 4ATNA 4H6XA 3QKRB 3TW8B 1PGNA 1HO3A 2PEZA 4QXOA 3TIIA 3NO4A 4REOA 1B8VA 5J4HA 4H6PA 1P6XA 3UCXA 4OHMA 3PVSA 4R0VA 5SZHB 3VJKA 4XFJA 1Z6AA 4LAFA 5AW2A 1UMKA 4DDKA 2YCLA 5I9LA 2RAFA 1LDMA 2RD2A 4ZD6A 5LP6F 4GMDA 2AH5A 5CFNA 2PD3A 3KR0A 4UD2A 5CDFA 5K4HA 1W85A 1V3UA 2WM8A 3BQ9A 3SIWA 3ABZA 2JHFA 3HH8A 3JR7A 2H9IA 4NENA 4QTTB 3ZVRA 3LQ2A 1Q1GA 1F1BA 2AFIA 1BCRA 2Q5HA 3TLGA 2Z3VA 4JXJA 4CQJA 4DJFC 4F4HA 3FPGA 3ILSA 4LVOA 4UU8A 5AJVB 3KOUA 2EZ8A 5HUJA 1HUQA 1I13A 4ARSA 1TZBA 1KAOA 5BVGB 4HAOA 1MABB 3DSRA 1E4OA 1IH8A 4EJFA 5KYYB 1OH8A 2GZRA 3R1IA 4FTWA 1U3WA 2WKRA 4MP3A 3TAXA 4HXEB 4EB6B 1UEJA 2YHUA 1QG2A 4KN9S 3I42A 1U3GA 3NHLA 5G02A 1ZRHA 4MP6A 5L4SA 2ODPA 1TA9A 4KQMA 2NTJA 1JIVA 2OCLA 3JAWA 1UMCA 3IMEA 1U3CA 3RUCA 1C7ZA 1CUGA 3T4PA 3ENVA 4BWYA 3Q8XB 3ZCXA 3ASVA 3EQ7A 4NIMA 4EKGA 3AVXA 3EFOB 3MD0A 3ORSA 1E5XA 1FQJA 1V3VA 4ZODA 1IBLB 3ASUA 1T3ZA 1B8PA 3LPAA 1U0TA 2UVQA 4JB0A 3M5PA 4WDQA 2Q5CA 2I7TA 2IHVA 3FNQA 2VKTA 1PJCA 3JWPA 4JSRA 3UQYS 3DWIA 2J4CA 3WIDA 3DDZX 4PAGA 2CXPA 1NFRA 3IIEA 2QW0X 4BGUA 5LMUB 1MW8X 2NV6A 4ETWA 5ALNA 3ZY2A 2ZRGA 2HF9A 3DKIA 2PVCA 5ICFA 1ZD9A 5BRNA 1DMRA 1E98A 5JVDF 3BKXA 1L0BA 1EP2B 3N53A 3FNHA 2LIPA 1ZOPA 3B82A 3AL3A 3ZE9A 1Z4LA 1HMYA 3RU3A 2GM9A 2OORC 1M5RA 3G85A 1XRMA 3FVVA 4U2DA 2DH5A 4IQ4A 2ODNA 3TFOA 4F4DA 2X6RA 4NI5A 5F3WB 3PIRA 1HDIA 2VAWA 1QYDA 2G3YA 3VM6A 1XZCA 3ZQKA 2I99A 2NUBA 2XKBA 4JZYA 3NATA 2GJ8A 2PH1A 3GCXA 4R0NA 4RZHA 2AOUA 4YMIA 1QRTA 4OKSA 1FE8A 3KSBC 2H17A 1L7RA 2BUAA 2NO1A 4Q3KA 4CT4B 2IFTA 5LLDA 1CQIB 4JWTA 3I9NA 1QCZA 3RU2A 3R8FA 1M6VA 2B7BA 1Z2PX 1P7PA 2I67A 2R62A 3KTOA 3OZSA 2VQFB 4NONA 3UT5A 3A25A 1E1NA 4ADSG 5HE8A 4DV1B 1NBMA 1UOQA 1XNHA 2P9JA 2J48A 3NAZA 2F1OA 4NBTA 3DCNA 3UATA 1E3TA 3EASA 3N5KA 3ZJUA 1ACJA 4LV6A 1V11B 4TVOA 4PWZA 4CM1A 1C3EA 3CH5A 3E5RA 3ICVA 3OMXA 3VR6D 3U5TA 1ISMA 4MULA 3PE6A 2RHHA 2I1QA 4TUYB 1HFEL 2WOJA 1J7JA 4P33A 3RI3A 1E9EA 3RS7A 3KSMA 1E6MA 1IY8A 2PMCA 2Q3MA 1T29A 1T3LA 3V4FA 2BKXA 5FPYA 3A32A 3USZA 1I94B 5GOZA 4WADA 3EGVA 3KXDA 3CVJA 1K9SA 3DYVA 3R76A 2KB0A 1P44A 4KHZA 4DMCA 3KQMA 3EIEA 5FOWA 4A10A 1QVRA 4WCFC 2ZB7A 1AQIA 3C8DA 4FEEA 4K2AA 1KJZA 3L1KA 3M6WA 1L4EA 4ZDJA 3HEBA 5DBGA 5EZYF 1RQGA 1PR9A 1WQ4A 2FPPA 5ICGA 2K87A 4A5OA 5LWQA 2AJLI 3MOIA 1LS1A 1XVUA 1Y6ZA 1RRKA 1QX3A 1I1NA 1YE3A 2RI1A 3Q9UA 4HWRA 3GL9A 4W1QA 5UKDA 4D4LA 5KI6A 2O2HA 4M9XA 4YRIA 4MRVA 5JZ9A 4C1NA 4DCCA 4EOGA 4CODB 2C31A 3DVRX 3DZGA 4RVOA 3CHYA 2RGAA 2WJVA 3GFPA 4JVMA 5AQEA 1G2OA 4ALNA 5KO2A 2Q3FA 1C81A 3N86A 1YB2A 3UWSA 3U61B 4UBJA 1X3LA 3MGGA 4N3NA 1E7MA 2NUAB 1V1RB 1GTG1 2VHYA 3EQ8A 3NEAA 4TKUB 4D74A 2XOKD 4BMSA 1V4NA 1XDBA 1G8JA 4JLDA 1PT7A 3P9IA 1PR4A 2OZLA 3D3QA 4B17A 2QN8A 1BWQA 1YMQA 2XNJA 4B3BA 3PQCA 3GUYA 4NRDA 1ZKMA 4L2IB 1CW2B 1EGVB 3EF0A 4Q4AA 2E4AA 3PQEA 4R51A 1FRFS 1AHNA 1Y1PA 1QTIA 2KE5A 4N12A 1R4AA 2A3NA 1UPXA 3AUFA