4DZTA

Aqualysin i: the crystal structure of a serine protease from an extreme thermophile, thermus aquaticus yt-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
276
structure length
276
Chain Sequence
ATQSPAPWGLDRIDQRDLPLSNSYTYTATGRGVNVYVIDTGIRTTHREFGGRARVGYDALGGNGQDCNGHGTHVAGTIGGVTYGVAKAVNLYAVRVLDCNGSGSTSGVIAGVDWVTRNHRRPAVANMSLGGGVSTALDNAVKNSIAAGVVYAVAAGNDNANACNYSPARVAEALTVGATTSSDARASFSNYGSCVDLFAPGASIPSAWYTSDTATQTLNGTSMATPHVAGVAALYLEQNPSATPASVASAILNGATTGRLSGIGSGSPNRLLYSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aqualysin I: the crystal structure of a serine protease from an extreme thermophile, Thermus aquaticus YT-1
rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Aqualysin-1
total genus 97
structure length 276
sequence length 276
ec nomenclature ec 3.4.21.111: Aqualysin 1.
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4dztA00
1SBCA 1SIUA 3A3NA 2DUJA 3DVQX 4OMCA 2SBTA 1BFKA 2PRKA 3CNQS 3VTAA 3WIUA 3DDZX 1AH2A 3DYBA 3F49S 2QTWB 2SICE 2W2PA 1JEAA 1SCJA 1SVNA 3LXUX 1Y9ZA 2W2MA 5SICE 1KDVA 3VV2A 4OMDA 5FFNA 1GT91 3BGOS 1C9JA 1SPBS 2PWAA 5JMOA 1Y3BE 1SBNE 2X8JA 3A3OA 1T1EA 1Y4DE 1GA4A 2ID8A 1Q5PA 3DVRX 2W2OA 3DE0X 4H6WA 1VSBA 4WOBA 4YN3A 1KDZA 1BJRE 3DE2X 1AVTA 1KE2A 3EE6A 2W2QA 3DWEX 3LPCA 4I0WB 5AQEA 2ID4A 1TO2E 3AJ9A 1TECE 3LPDA 4CG0A 3DW3X 3QFHA 1Y3CE 3WQBA 1TM4E 5B1EA 1Y1KE 1GTG1 1R6VA 1SBHA 3I2YX 3A3PA 3GCXA 5AVKA 3D9QX 1SUAA 1IAVA 1AQNA 2Z58A 1Y34E 1SUEA 1SCAA 1TK2A 1GNVA 1OYVA 4H6VA 4WOCA 2PMWB 1BE8A 1T1GA 4DZTA 2GKOA 3SICE 1SUDA 2WV7A 4J94A 2P4EA 2IXTA 5FBZA 1WMDA 4AKTA 1PEKE 1ZVKA 4NMXB 1KE1A 3HJRA 1SUPA 3L1KA 3D43A 1IC6A 2V8BA 3WHIA 1SN7A 2ZWPA 3ZXYA 4ZARA 1Y3DE 3PTLA 5I9SA 5AMXA 3T41A 1TM5E 2DQKA 2ZWOA 1SCNE 4GI3A 1CSEE 1GTJ1 1PJ8A 4KG7A 1TM1E 1EGQA 4DWWA 5K7SA 1AF4A 1GA1A 1GCIA 1DBIA 1ST2A 1SUCA 1V5IA 2WWTA 5ARBA 1ST3A 4OV6B 1T1IA 1SH7A 1NDQA 3Q5GA 2Z30A 4NE7A 2HD4A 3CO0S 1TO1E 2Z2ZA 3DE5X 3VV3A 1BFUA 4K8RB 5AVJA 2HPZA 3QTLA 1CNMA 1SIBE 4KB5A 3VYVA 1P7WA 2Z56A 3H42B 3F7MA 3AFGA 1ZVJA 3DE4X 4HVLA 2WUWE 1OT5A 3QMPA 2Z57A 1AU9A 1GNSA 1Y33E 3ZXXA 3DW1X 4KPGA 4CFZA 4ZOQI 4H6XA 2PKCA 4M1ZA 1V6CA 1BE6A 1Y4AE 1YJAA 2X8JB 3LPAA 2B6NA 2E1PA 4LVNA 1THMA 1WMFA 1BH6A 2SNIE 2W2NA 1MPTA 1AK9A 5JXJA 1C3LA 1A2QA 1WMEA 3I37X 1AV7A 4JP8A 4C3UA 1HT3A 1YJBA 3DE7X 4FONA 3TI7A 3GT3A 5FAXA 1P8JA 1TM3E 2TECE 2WUVA 4AKSA 1GTL1 1DUIA 1EA7A 1SUBA 1Y3FE 2PWBA 3EDYA 4HX2A 3DE1X 2SECE 3OSZA 1GA6A 3SQOA 3GT4A 1P7VA 1MEEA 3BPSA 1SCBA 3PRKE 3WIVA 1WSDA 1YJCA 5ARCA 2Z2YA 1S02A 3I30X 3TI9A 3UNXA 4DJ5X 3GCWA 2G4VA 2ST1A 1Y48E 1LW6E 4RYDA 1PTKA 5JXIA 3DVSX 1PFGA 3P5BA 4MZDA 2PQ2A 1TMGE 1TM7E 2IY9A 5JXGA 4BWGA 1SIOA 1NDUA 5B1DA 1KDYA 1YU6A 2Z2XA 4B5LA 1S2NA 1C9MA 2DP4E 3BX1A 3EIFA 3Q40A 5ARDA 1SBTA 1OYOA 1SBIA 4C3VA 1UBNA 1WVMA 1R0RE 1C9NA 1SCDA 1XF1A 3DE6X 4NE9A 5JXHA 2XRMA 4Z2AA 1NLUA 3VSBA 3AJ8A 1S01A 3VHQA 5CW1A 1SELA 2XTJA 2PYZA 3F7OA 4LVOA 3DE3X 3I34X 1R64A 3TECE 2ZRQA 4CFYA
chains in the Genus database with same CATH superfamily
2XYPA 1L4KA 3EAQA 4ZMBA 2WJIA 1XTJA 1J0EA 1PJCA 3CLVA 2PVSA 3OIYA 4S1TA 4WW0A 1XLWA 3N7AA 4WVLA 3CRVA 4DV1B 1UKCA 2B1JA 2ZRFA 3E9RA 4XGIA 5SICE 1JIIA 2AN4A 3QITA 1N2IA 3NHRA 4JH0A 1JQLB 1YO6A 3CZMA 2B4TO 3FYCA 4MSUA 2FOXA 3TIVA 2Z1MA 3T1VA 2EJVA 2FETA 3ZU4A 1WP4A 3WGIA 4DV5B 3SN6A 4BLPA 3ZX5A 2JARA 1DSSG 1NOJA 1ZBQA 2NTJA 3FHCB 4IGAA 3RU2A 4CWAA 4GPD1 5K6RA 5GGYA 2P6MA 3CR8A 2WSSD 1WCWA 1NVKA 2A5FA 2V5AA 4YWJA 1JR3E 1E1RD 1E18A 4DR4B 4XCVA 2WVJA 3SJ7A 3GCXA 4KODA 1CFZA 1SUAA 3QV1A 2Z58A 5JISA 4JROA 3SS9X 1B74A 3UB3A 3BHNA 4OB7A 3ZDFA 1RVDA 2VSFA 3DFIA 5TMDA 1L1EA 5IDVA 2C88A 2QRMA 2NXWA 2QLFA 1KORA 1N25A 3AOEA 4K7JA 1IZ7A 3IIIA 1A88A 1Z6GA 5E3IA 2WVHA 3GC6A 2Q8PA 1I1OA 3EWSA 3TL2A 1I7QB 3V7FA 4R16A 5K3DA 4A0SA 2VAXA 3ZPXA 1CUGA 1U1GA 3OFSA 1U2DA 1QO9A 2IH4A 3B3JA 3EZ9A 4DJDC 4XB1A 1JNYA 2OUIA 1CJBA 5G0SA 2O8CA 3ROKA 2XGJA 1P75A 1Z6XA 1PFQA 3BIXA 4EUKA 3Q3GE 4QFCA 2ZS7A 3TKYA 3AHCA 4RTJA 3MA0A 3EC1A 3FNRA 4ZRDA 1ZUIA 4BFVA 4DLLA 3CJTA 2OBFA 3GUCA 3QXXA 3U81A 2IYOA 4LF8B 3ORYA 4DLXA 3AINA 4N03A 2F48A 1IVYA 3K1JA 3LGAA 3C98A 3CKLA 4J0QA 1UXJA 4AL4A 4YC7A 2PA0A 2VHJA 4JJ4A 3U7RA 3C3EA 4C1NA 1TYZA 1KI1A 3N0VA 1GFIA 1X7DA 4IS3A 4NCNA 4D9NA 1CZRA 4V0SA 4QYSA 3HXOA 3BMQA 2WFAA 1Y7HA 3VQTA 2PX5A 2G04A 1MMFB 2QVZX 2VL7A 3NC1C 4U7WA 2Y3IA 3ZWPA 3ITDA 3M83A 4PAMA 3W2GA 4EW1A 2QPOA 4BNDA 5TX7A 1OLOA 2OV8A 4P3XA 3OZDA 4ND6A 3AG5A 2PWBA 5TSDA 4X7MA 1ULSA 2A4MA 1JDBC 1DCKA 1ZGBA 3T1OA 1PF7E 1CF2O 3WJAA 1OQAA 3FSGD 2OVFA 4MVXA 1FY2A 1UMCB 3KEGA 3P2KA 1LW6E 1VIMA 1FYEA 1CEEA 5BQ3A 1ZHHA 4ND8B 4MIEA 4X3PA 1KDRA 2O2DA 1K6IA 3H9QA 3AVUA 1OBFO 4PGMA 4WEQA 5K3BA 4TMYA 4MVJD 4WXEA 1P2TA 1DAHA 2WSLA 3DUFB 2XHEA 4W99A 4M87A 1KEEA 2JDIA 4MVJP 2ZBVA 2BGGA 3L0DA 4KQ6A 4LQLA 5CR9A 1M0TA 3I2JA 5JSYA 2PMKA 1QANA 1NG1A 4BKQA 3LNTA 1E59A 4NPHA 4LY0A 3TECE 1NASA 3R0JA 4BZPA 1GSHA 1QORA 2BH9A 3E9EA 2PQMA 2NVOA 4ENSA 3W5HA 1J23A 3IQIX 3LC0A 4M1OA 4OSOA 4E1AA 4EFKA 4WKBA 4YROA 1N7JA 3U4GA 1ID8A 1UKVY 2YVKA 1RM0A 3IVMA 4FYWA 4KQGA 2RC6A 3RIYA 1AKEA 3G7UA 3QMVA 4PIMA 1UPBA 2GPNA 5HIKA 1Z25A 3JALA 3MINA 4RD1A 3QW2A 5FWNA 3D6NB 3ROZA 1SBNE 2XDWA 2I8LA 2GRAA 1FX0B 2ZUBA 3FI0A 3H83A 4Y3UA 1VJGA 1E58A 4BEJA 2IU4A 4L74A 3B48A 5FPPA 3UAGA 1KSGA 3PJRA 1V1MA 1L7PA 1H65A 3BTSA 4QYWA 1MW9X 5DX8A 2E5LB 1QQ6A 3TL3A 1IJKA 4CNBA 4ZYZA 2WIKA 2FU5C 5EJIA 1TZJA 2HT1A 3X1XA 1UWVA 3WQHA 4BB6A 1IY1A 5F4BA 1L3CA 1V7CA 2KMLA 2VNKA 4MW9A 2I2DA 2V4UA 1Y3HA 4E1BA 2IEDA 2HPHA 1ZSNA 2HJGA 2H7VA 4RORA 4BNXA 1PYDA 3L7NA 4ZEOA 1TJ3A 1TYBE 4M6WB 3MTEA 4OQDA 3PVZA 2D5IA 4P3NA 4QAQA 4QTTB 2UZ4A 3HWWA 3FNQA 4LW8A 1HKUA 1JU4A 1KZ6A 1FUUA 2I22A 3WLPA 1KL7A 3SF8B 5KQLA 4TSFD 5KWJA 2H63A 3EAFA 3EMBA 2DQSA 4XGNA 3UGQA 3ZU5A 4D9CA 2GZHA 3PGA1 2DFTA 2ZJBA 5F2OA 2VLIA 3UAXA 5KKAA 1BOFA 3FCEA 4FDLA 1IJBA 1E7WA 5HF9A 5BUSA 4ZT2A 3GLSA 1AMUA 3FHLA 3FPLA 1N7HA 3D5QA 2GJ8A 3H5WA 1FP4A 4I46A 4WBSA 1K5DA 1QWOA 3DBRB 3LX5A 3M1AA 4MRMB 5EGNA 2N1MA 1RM5A 1PNOA 1P18A 5JCOC 4WPGA 1XRLA 3P1JA 4WACA 3U9TA 1BW9A 1JGTA 4B6SA 3TZ6A 2A9KA 2ZAIA 3V8EA 1HG0A 4LXQA 5ELLA 1GIAA 4KQJA 1E7MA 1OV6A 1KEZA 5HTKA 1JR4A 2FHPA 4E5KA 1E6KA 2C20A 2HAEA 4UQLA 1O94A 3WSTA 3VO2A 1AJEA 1MA0A 1R4MA 2AFRA 3LT0A 4AY4A 2KPOA 1R8QA 3IPAA 4YJHA 3WGHA 5E2BA 3P27A 1NBEA 2BF4A 3K9QO 2K87A 3QPBA 4BNZA 4DABA 4DEYA 1MD9A 3BF8A 3NC0C 4CIDA 3G2OA 3QLTA 2G9QA 2F1RA 4JITA 3VPGA 5DRYA 3LQ4A 4O08A 2O8FA 1E94E 3EULA 1OZAA 3LXXA 2Y9MB 2G70A 2NIPA 2GILA 2AK3A 2WC1A 1YCHA 2X6TA 3HUDA 3DMTC 1AUOA 1A98A 4JYAB 1LRKA 2Q07A 3UEOA 1TF2A 1PNQA 1W19A 3NM6B 2GPBA 4O4HB 3HKDA 1YS1X 1O97C 4KJXA 3DOEA 1S2NA 3GGPA 4KFTA 3QEJA 3WKDA 3JCZA 1GG2A 1T4CB 1WVMA 3IUPA 4HEA1 4ZHQB 3TNJA 2FFBA 1RI4A 2J9ZB 4JBXA 5ECWA 2WFLA 1A82A 1EVEA 3FFXA 4QPCA 5IJAA 3VHQA 1Y1QA 4BPRA 2R65A 3DTNA 4GZ3A 4ZREA 4CKZA 1A9XA 2UZ0A 5BSFA 1EQUA 1A04A 4KPEC 1Y5LA 3D0RA 3GX1A 1QDUA 4RHXA 2ZUFA 5IJ9B 3GGDA 5G1NA 1N2EA 1VYHA 3WGOA 3FHTA 3WLTA 2WRZA 2O6LA 3CC8A 4LE0A 3KAQA 4BJ5A 3MJDA 4QQNA 4HQFA 5BYJA 4RD3A 2FF5A 2XKBA 2YN4A 2ZB3A 4YN3A 1WU7A 421PA 2W00A 5B3JA 5KKNB 4A6XA 1V45E 1BQEA 3HWSA 1QIGA 3HR7A 3PDIB 1FS6A 4FNOA 5DK4A 1UPUA 1LZKA 4MV7A 1NVXQ 1I9CA 3GLFB 2CSXA 2AOTB 2YV1A 4EG8A 2WMYA 4HTFB 1AGPA 1CDOA 4LEIA 3BH7A 3VC2A 1IYZA 2E0IA 3VTFA 5DI9A 1R9GA 4ZIRB 2G3YA 1GNPA 1SCUB 2O2ZA 3IIKA 3A11A 1YKGA 4FB4A 2O0HA 2BHTA 2WUGA 4LE2A 4D9KA 3KSBC 2GKSA 3HHEA 4R0VA 5JNVA 2H5IA 2YHSA 1MQ8B 1YGYA 3OQNA 4BFXA 2PE5A 1R0LA 5A71A 2N0SA 4WJZA 1C7EA 1OPRA 2CE7A 2GR9A 2K2QB 3NGMA 2E6UX 4ZJZA 5A4KA 3EXHB 2ZRAA 3KR1A 1JI3A 1JHVA 1SCIA 1E1NA 2NQ2C 2ZJFA 1Z4NA 2VF4X 2NU9A 1NIPA 3KZ1E 3ENNA 3R3UA 4RQUA 4X60A 2NYUA 2D2VA 1P1FA 4JYPA 1G21A 3TNFA 2L2QA 1CR1A 1XZKA 2QPTA 2UVPB 1PL6A 1E69A 1PD1A 4RDCA 3SGLA 5KOHA 2ANCA 5DSZA 1J39A 3ZWVA 2XVMA 2Z57A 1C1XA 2YIDA 4R1UA 4HFMA 1CD5A 1K63A 3AFNA 5E0KB 2OV3A 3QVGA 4HSEA 5REQB 1EFLA 9ATCA 3L7LA 1J1IA 2OD2A 3E8MA 3EUWA 4UPEA 3UICA 1G3IA 1TPYA 3C2QA 3L1IA 2C5HA 4WHMA 2AB0A 1FMTA 2JIMA 2XODA 1WD5A 4RFSB 3ZWBA 1E32A 1IOLA 1WHTB 3NJ8A 5LXTA 1GTL1 3A36A 3ELUA 1X42A 2D3TA 3DO5A 2AI1A 1KYQA 2EKBA 3B5JA 1HSZA 3IPRA 4I14A 4C2AA 2Z9CA 3GJXC 3C5CA 1GZVA 3WQQA 2GA8A 2XGOA 3NTRA 1B6SA 1W5TA 3AYXB 3PYMA 1YQQA 2D74A 5A4MS 5JRZA 3THWB 4JY7A 1QP0A 1TMGE 4EDFA 1OX5A 1QK3A 1RJ9B 5IDYA 1L5HB 5JCOA 2WT9A 2YXLA 4O1HA 2BRUA 5DULA 3D0KA 4J1TA 2RONA 1U5BB 1VSVA 4I8IA 4RLSA 3LE8A 2HDWA 3REOA 5DGTA 1M2FA 2D0IA 4K05A 1JSLA 3HY3A 2CJXA 3GFGA 3TTVA 5E7JA 4B33A 3E9QA 1AGRA 4MS4A 3OZSA 3E0QA 4GRAA 3KD2A 5A03A 3QFSA 4B4DA 2ZAOA 4IIVA 1YJQA 3GMIA 7REQB 1BWSA 2BFCA 1J90A 1QFYA 1V3UA 5F3RA 1WETA 2PGXA 2Z6VA 3MC1A 3NM5A 2QUBA 4CIAA 2DPHA 5A1TA 3R4VA 1YQGA 1EA5A 4FDAA 2EJTA 4D02A 1MO6A 2FQWA 1OVGA 5KMGA 1EUDB 1G3UA 1YS6A 1YRAA 4MGYR 4UPVA 1H66A 3BB3A 2ZBDA 4BFCA 2PUAA 2GM3A 4MS1A 4X1IB 5GJCA 5A5EA 4HR7A 3WYCA 2RDMA 1EM8B 1A1SA 5AJYA 2W43A 1KMIY 2AHOA 3FVVA 4P4TA 4Z8XA 4BKMA 3SHFA 5BUZA 4LF4B 3FDIA 3WGNA 2XYQA 4FC6A 4UDNA 3TG2A 1NVBA 4BP9A 2QJTA 3WV5A 4LRUA 6REQA 3PUXA 9ABPA 4Y6GB 2AJ8A 1O0CA 2WF9A 2ZGVA 3N70A 4TTQA 5CIQA 3A6EA 1RYHA 4CT0A 2ZE6A 3OF3A 3QVJA 4Y1GA 3DMHA 3R6LA 2P4SA 3A9RA 3HDHA 5ENDA 1U1DA 2FZ5A 2ZB4A 4ZN6A 1PT9A 1H2RS 1XVUA 4HEQA 1PUIA 4CR8A 3NYWA 4HMPA 1R8SA 4IJ5A 1JKXA 5BN3B 5IFKA 3I61A 2X8BA 1DDIA 4F71A 4PC3A 3OPVA 1GRQA 1Y5IA 2JGEA 2Q5JA 2YICA 3BQMB 3ILXA 1AD2A 2V7PA 4KVFA 4O4JF 4PVDA 1ZM3A 4EITA 1FDIA 5ITVA 5KTOA 2JGRA 3BWEA 3HLYA 1T5BA 4ISBA 1UADA 4U7HA 1KI7A 1LDGA 3G0BA 4QSMA 1PEAA 1ZRSA 3E7DA 1GHTA 1DIRA 5ARBA 4DPKA 1VHQA 4YJ3F 4I5EA 1Q0LA 2DH6A 4EWLA 5FBWB 3SPXA 5SZIA 5ETJA 2WD7A 1PR9A 1WEHA 3A1VA 4OHFA 2FUEA 3PHGA 3V1LA 2ORIA 3KQWA 1W76A 2W4IA 6YASA 4OKIA 4JLOA 2O2YA 4Q47A 3TZLA 3E5NA 1II8A 3HZRA 4MGHA 3SDBA 4BWYA 4N3BA 4FGLA 2Q4EA 4IQFA 3H4TA 2H1LA 2MIIA 2B4QA 4L08A 4D82A 5LZ4A 4RPLA 1KEKA 4KMSA 1J49A 3VOBA 5D85A 1TA9A 1T34A 3LPLA 3LRXA 2C94A 3L6UA 4OHRA 3BGDA 1G20A 3OTGA 4BP1A 5E8RA 1MAHA 3ZH9B 4MI9A 2W6OA 1H1DA 5AI9A 3KKLA 3V42A 4X1YB 3LGSA 2YN0A 3HFSA 4LFAB 4OI4A 4QNNA 4ZD6A 3CMCO 3RAEC 4ACBA 3ULKA 1PTJA 1VHDA 2MINB 2QZZA 1PWEA 4URXR 3GJQA 5DMXA 1V48A 1XLTA 1D2CA 3BVPA 4Q4AA 1LQTA 3KWMA 4ZWNA 1V37A 3H8VA 3K9GA 4O4JB 2IYFA 5ALRA 5LDHA 1L3IA 1KFBB 4RC9A 4DUZB 4W5QA 4WX2B 3K0AB 1L1FA 3TK1A 4JENA 2LCIA 4H7IA 3FF4A 4U6QA 4EAAA 4MTLA 2WHEA 4IIYA 2YV2A 4UTRA 5EKXA 2JCYA 3ONWA 3PJGA 4A82A 4NLLA 5EHZA 2YHIA 3EF0A 1BMTA 2JKVA 2WTAA 4AURA 3IQGX 3VNUA 1M2KA 2OORA 3D7LA 2AG6A 2GAFA 3TNLA 5PNTA 2IUSA 2B2XA 3L8CA 1YRHA 5F1KA 5TMBA 1T9AA 1VKHA 4K3UA 4NEHB 2WWWA 3B1WA 3W05A 4QATA 5AK3A 4HUJA 2O23A 1PDVA 2XBMA 1QH8B 2A0XA 1G0NA 2RAFA 5DBGA 3GZJA 2I3DA 4AG3A 4LX0A 5HIIA 2J9RA 2JKYA 4KU4A 4EABA 4DXDA 1E0JA 3FTPA 4YCDA 4L0MA 4NARA 4NS1A 1E2IA 2Q1WA 2IC5A 3NHAA 3QJYA 2D1TA 4RVGA 1HQKA 3SJZA 1OFHA 3C39A 3VNVA 3BN3A 1ZIXA 3HXPA 3H5LA 3RC9A 1AQJA 1QGOA 2CMGA 1PZFA 5IJWA 5E6RB 2DLCX 4HGRA 4B87A 4UAJA 3O3NB 3TB4A 1CUWA 2W2XA 1BXZA 1W0KD 2XCLA 4TMTA 5C8YB 4CXMA 4RYLA 3EIHA 1X1EA 3C3MA 2BFFA 3LRPA 1KZHA 3PFCA 4B82A 1BQ4A 3OEHD 1IAVA 1ODFA 4NH4A 5LLDA 4EZEA 4NULA 4A1FA 4LJ6A 2F3QA 2MYTA 2FWNA 1WAMA 3NRJA 3VAZA 2IH2A 3UMRA 2WTMA 1KBOA 4H60A 3F6SA 1O5OA 4HDMB 1E1KA 1RJEA 2WA2A 1JG6A 1OWMA 1GGEA 1SQGA 3A1DA 3JWPA 3OQPA 2F8MA 4TXMA 4UUMA 4PR0A 3PFBA 4BMZA 4KSCA 1M1UA 1P3DA 4MEJA 2GZ2A 2JCXA 3KLPX 4KG7A 3BWCA 5BXQC 2PAFA 2ZVQX 2WJWA 3VHXA 2FZCA 4BV2A 1FNCA 1NZFA 1P62B 4EGAA 5BRJA 1HEYA 1H9BA 1HOXA 4B8WA 4MS1B 4X1IA 4ARSA 1XO1A 1FTWA 4R2IA 1OTYA 3EEIA 3N2KB 4FB5A 4MVJG 3BMXA 4TTSA 1VKOA 1ZO8A 2ACEA 1RJGA 1CUCA 2BWJA 3KOMA 1ZUNB 4X7BA 5TR9A 2CXPA 1EFRA 3S2GA 4F2PA 1NW9B 1Q19A 1UZNA 4YRKA 2X8LA 3H1AA 2DTXA 4FBLA 2GASA 2IYRA 4M36A 4ZU6X 3IT1A 1FDVA 3I1IA 3V32A 4DPMA 1EK2A 4GLJA 1NN5A 4EEKA 2OR3A 2FJ0A 2X5NA 4NZ9A 3DDSA 2QIOA 3IP1A 5FEMA 5TPWA 1FLAA 4CQMD 3L6CA 1ZL2A 3P8ZA 4JB8A 1SZPA 1Z4PX 2O52A 3PQEA 4WDQA 4II2A 1W5SA 4WKGA 5BW5A 1PN3A 2JFPA 4ARUA 3PCRB 3ZCQA 1DJLA 1YZGA 1KMCA 3PD0A 1ZR4A 5LA6A 1H6BA 3FWPA 3OA0A 4Y2VA 5A6SB 4WKPA 1XPOA 5D3MA 3VR5A 3PJEA 2RG7A 2FLVA 1EGMB 2B0CA 4YIHA 5LZ9A 3TW8A 3OX2A 2JCBA 3P9RA 3OKFA 1A71A 1I14A 4IDAA 1Z7EA 4MA4A 1UOEA 1K8YB 1WV0A 3VOAA 3GEIA 2WTBA 1OYOA 1KQOA 4FCTA 2IKQA 3R5KA 1AN9A 4F8JA 3LGXA 5L7TA 5DNAA 4FN5A 3H5TA 2FWJA 1VPVA 1UK8A 2V7XA 2CHFA 1NA5A 2PFKA 4LJSA 2CYAA 2HV8A 3ROEA 4BWFB 1FFSA 3IEXA 4C1BA 3J7TA 4ZRNA 1E89A 2QGFA 1NMEA 1D1PA 1QMPA 2RHGB 3NUQA 3ND9A 5IC6A 4AJ1A 2ZB2A 1F2UA 5IBPA 2CLCX 1OI2A 2NZVG 5K1ZA 1YV9A 3GGJA 4PSDA 4R01A 3RPEA 2PKRA 1ELOA 1X0VA 1X3SA 1CR4A 3NBQA 4LJKA 2C9ZA 5FFNA 1Z07A 4WFIA 1AQYA 2H65A 4FHZA 4KUHA 3AJRA 4HQLA 2HLNA 2GXQA 3TLZA 3R76A 1PGNA 4WOBA 1Z3CA 3V6LA 1DIBA 2EERA 1RZUA 1W59A 5DIFA 4YCNA 1M73E 3QNMA 2UVQA 4URYR 2C7RA 3LKBA 1YK0A 1E4OA 4WN3A 3TLEA 1NXXA 1WUHS 2H5JA 3CUKA 2W42A 3RJMA 2J4DA 4I19A 1V43A 4G1CA 4KYUA 4TGLA 3OJEA 4C5CA 5HRAA 1AKVA 1Z9BA 4PNZA 2FPGB 4DNPA 5AW0A 3ELDA 4OATA 4JP2A 4YPVA 2NU6A 3S55A 2NTYC 4CL8A 5DHPA 5HBRA 3IUSA 2HBRA 2BTEA 4OH7A 2H1HA 2ZYAA 3N58A 4FOSA 3GT7A 2QW8A 3G9XA 4YRQA 1U63A 1T1RA 3KL4A 1ARZA 1N2ZA 3KUKA 4B3FX 1Q7BA 5LOVB 1IC6A 4MARA 5IWAB 3I6BA 4P98A 4JR1A 2B3TA 5FWAA 1BD4A 3JSXA 3A0RB 5FNVA 5L6LB 4OGLA 4EPXA 4XEHA 4N5NA 5LP6F 4HMQA 3MM4A 2IOFA 5ERYA 4XDHA 2EZ4A 2WWTA 4GXQA 1K97A 4ZZ0A 2BFEA 3EDMA 2AK2A 1ZMBA 2EYUA 4D9EA 4YRZA 3RS2A 3HI6A 3RAPR 4HKTA 3VV3A 1OX4A 1FUEA 4I2VA 3VKGA 1CNMA 1RNLA 1ZHFA 1C29B 1P7WA 3U44B 5LMUB 2IT1A 1U0HC 2VS1A 4P3KA 3SQDA 1R4AA 3CLTC 3C8DA 3GZNB 4R1MA 4HMOA 2Z95A 3SS8A 8ADHA 1N5MA 1LVGA 3LOUA 1G8HA 3RW9A 1H5NA 4GI1A 4HNAA 4AJ9A 4RTQA 1PLKA 1VJDA 3FZGA 1JEYB 5KJEA 2V7EA 4PAOA 1A9XB 5ADHA 1G8MA 5FXMA 2GZ3A 1Q1GA 2YS6A 1QXSA 3H8JA 3K2EA 2O8BB 3W8EA 1W46A 1YJBA 2YZGA 1E9CA 1PYOA 2WKPA 3WYBA 3LLSA 1VBMA 2DXIA 4KJZA 3P0IA 1Z82A 4LZPA 1R00A 4B3JA 1ZC3A 5ITZB 2GPJA 3PUYA 4W4TA 4BIIA 1C7QA 1C7RA 3ER8A 3HS3A 4EZBA 4BY9E 1OIWA 1VFPA 2FW9A 3AL3A 3S8EA 1K9SA 1E4EB 1JUDA 3QJGA 4S0XA 3STHA 4R71A 1NNI1 1WS6A 2D4AA 4ESVA 2O2SA 4QEDA 3CZRA 3UWOA 2NU7A 1XVAA 4N5MA 1NONA 4LHXA 4WLFA 2ZW9A 4YRLA 4CLRB 2FSHA 3FBTA 4CQLA 4MX8A 5LP6B 2QI9F 1EBUA 3F2IA 3FI9A 4JR2A 5CCDA 1FQOA 3E3OA 2G5GX 2GD6A 4F92B 1J9ZA 2F67A 5FL7A 4O2AF 2IZ6A 1XZNA 2IZ7A 2YWHA 1V25A 4OB6A 3PLNA 5L40A 3KTDA 2RHHA 3I76A 4PWYA 1KRWA 2HGZA 1JJFA 4LWQA 2AJTA 5G3ZA 5KYXA 1G8GA 4JJZA 1JVSA 2VQ6A 5E9JA 3T3IA 1H42A 1BEUB 3K1AB 4X93A 4C04A 4D3DA 4HNVA 2MSDB 1ZKDA 2AF4C 2ZYDA 3A6HA 4R2XA 3H5OA 1DKMA 4MQEA 4MQ5A 3WL7A 1TKBA 5FEUA 1L7MA 4CKCA 2BONA 2R97A 4AJNA 2GPSA 4MUKA 5JECA 1W75A 1K7SN 3FTEA 4EHNA 4KAXA 4HEA6 2WKRA 1TT5A 1FEZA 5C8XA 2EFEB 3IA7A 1FIUA 4BC0A 2OB1A 4F5ZA 2HA4A 3VR3A 3GPLA 1U2QA 3O4JA 4NCXA 1S4MA 2R751 4JI7B 1YMVA 4IXTA 2Y92A 1MTOA 4QELA 3NBUA 3UMBA 5C7LO 4K6KA 2V9ZA 2XTMA 3PXDA 3TLGA 4FMPA 1NBHA 5BOVA 4P5DA 4JP3A 3UJBA 3BD8A 3WISA 5EQDA 1GQRA 1EFPB 3M6UA 4KQXA 1JFFB 4YMIA 1YFLA 1LV7A 3COWA 2JJ2D 3OCXA 4I5FA 3RJ5A 1PT5A 2RAVA 3O8DA 1PLJA 2PJZA 3V4RA 4KC0A 1U90A 2BUAA 2WSBA 2SCUA 3OCJA 5EYPA 1OFGA 3IQEA 2XUDA 3JVVA 3LP5A 5D3ZA 1ZKMA 2XE7A 1YA8A 5FUVA 1RWQA 2PRJA 3AXSA 5AM4A 1J99A 3RBXA 4B44A 4UASA 3MS2A 1QE3A 3AEQA 1R5JA 2D2IA 5AW3A 1DE0A 1OSNA 1H9AA 4PNEA 2XKKA 3IDFA 4JA0A 3TSCA 4R83A 1UXKA 3H05A 1FX0A 4LDAA 4TVBA 3M33A 4MI6A 3NRCA 1FDOA 1ZD2P 1I0ZA 3AF1A 3ZOKA 2OM2A 4F11A 4M0CA 3A8TA 1CDZA 4L78A 2YZ7A 2WT8A 3HGTA 5KVSA 1E8MA 3RYHA 2HFJA 3VR6D 1EGAA 4CLEA 2XUHA 3CW9A 4JD5A 3E81A 2DLNA 3TB6A 4H6PA 5HZGA 5KIAA 3LBAA 4JCCA 4P7BA 1QHYA 3VKVA 2ASEA 1QYXA 3DAFA 5JNSA 5KNCD 1V4BA 2G4CA 2GLTA 5EJGA 1RMTA 1J9GA 3DLTA 3EEOA 2WNHA 1T0IA 1EUQA 4ZVOA 1PSWA 4BV9A 2AKAB 4EBFA 1HORA 1OLSA 4YYEA 1H2XA 2V6BA 5DM0A 3LFUA 2ZREA 4US1R 4CMGA 3GRUA 4ND1A 3I3OA 2FKAA 3NCTA 2J6IA 2PH5A 3AW8A 3QBEA 1VOTA 2ISSD 5B30A 1LU9A 3ZXSA 2OXCA 1NW4A 2BGJA 1YQDA 2VPYA 1C1DB 2YC2C 1K0UA 3H5NA 1YHYA 4Y6LA 5AOBA 3AR8A 4OI0A 4TSFA 2VPTA 1G42A 1QLJA 1VMDA 3D81A 5H4HA 1M6EX 1HC7A 3EW9A 3IPXA 5FHQA 3C7CB 5K3FA 4F1KA 1Z5NA 1CE8B 4Z2YA 1N6IA 5K0ZA 2UZAA 3IJRA 2J85A 2WABA 3F8TA 1P73A 2HRRA 3KXLA 1EBBA 3ROQA 3TZBA 2RKBA 2C4NA 3GGCA 2R6ZA 4GOKA 3VYUB 1YDFA 1U7DA 2FMFA 5E6UA 4CEHA 4OMCA 3OY2A 4LJYA 1RQ7A 5IEBA 3F5MA 4TX1A 4MHOA 1EWVA 4HN2A 3PRJA 1S5PA 1JJ7A 4PC2A 4PXAA 5LDDC 5HGJA 3UG7A 5DSXA 4F56A 5ESWA 3IC5A 2JPDA 4B74A 2REXB 4NV3A 3VI3B 1QHHB 3MWYW 3GW8A 4LV6A 3OC0A 4BUZA 1YDMA 4IIHA 3RT7A 3RHSA 4AN1A 1Y4DE 2ODPA 2PGLA 1IN5A 1WZEA 3B6MA 3COYA 3HA5A 3T0FA 2AFHA 4UMEA 3L4JA 3T9BA 4MVJI 4NCIA 2X0JA 2CW5A 3OJFA 1QQTA 3NOXA 3VZQA 4DIEA 4B4UA 4Y2HA 5KYVA 3G5LA 5FTJA 2QE7D 3CE9A 5K2MA 2YYSA 1YH3A 5IYZF 4MS3B 3EGXB 4CT4B 3CVWA 5IVKA 2YL2A 5JROA 3HG7A 1XZPA 2PCJA 5CEJA 4CL0A 1GNVA 2JFHA 1M83A 2WTXA 1H1LA 1QBGA 2ORVA 3EOZA 2C2HA 3LWBA 1JAYA 3NIBA 2EQBA 2JI8A 3RS8A 4A10A 2XUJA 5IJZA 2O2GA 2PLAA 4P38A 1VXOA 2JEZA 3OPYA 3FOCA 1SR8A 1RPZA 3AT1A 1I5EA 2E85A 2I4LA 4G8DA 4UAVA 4DNFA 2P90A 1PR6A 4XB2A 2NZUG 2ZR0A 4IZOA 4HT3B 1I36A 3I9FA 1EAYA 2Q2QA 4QUDA 2EU8A 1PFUA 5GY7A 2ZUCA 4MYUA 4LV8B 2BAGA 4WXHA 2GF2A 1FFXA 2O59A 1E3WA 1URPA 1KTIA 2NYRA 2C92A 3Q9SA 4G9BA 3L92A 1YVPA 2BT4A 1PJAA 1XDDA 2JHCA 1XMJA 4X94A 4F85A 3U5ZB 5TDHA 1C9EA 1GG5A 1S2IA 2EZ8A 3RTAA 3WZ2A 4RHYA 4B48A 4MV4A 3WLEA 2N3ZA 4BQOA 4NBVA 1YVDA 3DCIA 4O2RA 1HRKA 2FZEA 4KAFA 2EW8A 3KKZA 2DR2A 3PQ3A 5M29A 4DLPA 1J7JA 1I2ZA 1T5IA 4ZC8A 7ADHA 1T4BA 2HBYA 3CYFA 5ER6A 3OX4A 2VTDA 3ET4A 1QR2A 1A8SA 5FWXB 3JARA 5K4HA 1NVDA 4OQZA 1TQDA 2OZVA 4RMGA 3OZUA 1OR8A 2X77A 2XT6A 4DCGA 4GLLA 1T2AA 1KDPA 4NU5A 4RZ2A 3WHPA 4EJFA 1KWKA 3TD9A 4LYEA 5LYJF 2I67A 2Q0QA 5EP1A 3LTEA 4A5OA 2BDEA 1I80A 2D5AA 2FRDA 4F3NA 2AL7A 3VU3A 1C4OA 1XKLA 2NO1A 2XGSA 2Y4OA 3EWNA 1Q77A 4FOOA 3QBJA 1H0SA 2I7CA 1ZR2A 1MNAA 1NHWA 4GOXA 4OF4A 3AYZB 1HGXA 4OM8A 3MJ4A 5ES4B 2BBWA 1YTLA 2VQ3A 1YRLA 3BXXA 4IZHA 4TKZA 4R1TA 5ED0A 1QQ5A 3K16A 1FTQA 2V54A 4P84A 1A4UA 3ZCRA 5JAOA 4MR8A 2I3AA 1SK9A 1DKOA 2VKTA 2ZE7A 2GCIA 3HDYA 3MXTA 1NRXA 4OJKA 4P6VF 4ZAWA 1TMOA 4CLOA 2IPLA 3EVNA 1BNCA 2DCMA 2WMDA 1QHEA 5CNIA 4QLOA 3AETB 1U28A 2RK4A 2VH1A 2X7JA 3OM0A 1DLIA 3P0JA 5HE9A 2Z8YA 2Y0DA 3T5GA 1JQKA 4RA9A 4P4SA 1A9YA 1DV1A 2R5FA 1JLRA 1PYGA 4WKNA 2I6UA 3N8NA 3DWFA 4M4SA 4YNBA 1IEVA 4U0KA 1VPTA 1YB6A 2XDQA 3WNCA 4F93B 2LVBA 2DWUA 3ZDBA 1WD7A 3ISVA 3HBJA 2ICAA 4B31A 1E6CA 4C7BA 3CPSA 2I87A 2VLBA 4IOJA 4LZJA 2PZFA 1EM6A 3KE8A 4NDAA 5BURA 5I3ZA 1YDGA 3R3XA 4QJ3A 2LE0A 4ZVVA 2I1QA 2JC3A 2SKDA 5CPBA 2JS7A 1KI6A 3WSWA 3PWSA 2O2CA 4FT4A 6NULA 3UYKA 1UT8A 1E1CB 2H3EA 4QZVA 1NI4B 3OKAA 1WNTA 1MJFA 1S3GA 2VNJA 1XJ0A 1B14A 2J09A 2YASA 5D1NA 2WNSA 2WM2A 5CEFA 1MJGM 4ISCA 1M34E 5KNBA 3OIDA 3X2EA 3K9WA 4R3WA 2GNPA 3OPMA 2OAQ1 5EXDA 3AMVA 1P4SA 4TKMA 1T9GS 3HY6A 3RFFA 3FNBA 1EVJA 3JQGA 3GOQA 2GEVA 3G9QA 3ONVA 1NRWA 5IN5A 3V8QA 3I4CA 1AS2A 2KE5A 2PL1A 2XNSA 4D46A 4FMBB 3UK6A 2YUIA 1ZNYA 4KITB 1S7GA 3SHVA 5SZHB 4BQQA 3ROGA 2PRIA 3HM2A 2GHTA 1ZSYA 1Y3DE 1AQLA 2A3NA 4WXYB 3HB9A 4LRTB 1XQVA 2E4UA 2P41A 1KDOA 3DOHA 4JLDA 1FW6A 3IO3A 2UYQA 2NQTA 3P9PA 3RUPA 2Y1FA 3HJHA 4DBLC 1E1YA 3BMCB 2DWCA 2H18A 2V0GA 1MFZA 1ZD4A 4WERA 1M1XB 2XOXA 1PS9A 1W94A 3DSRA 3KAKA 3LBYA 4FYIA 5DCUA 5J5AA 3V8RA 2XXBA 4R40A 3ZGYA 4DCPA 2BFPA 2BJWA 5IYZA 2WHPA 3U4IA 4L3VA 4IFEA 1LX7A 3CLUC 5HIMA 3JR7A 1UBKS 1A9OA 4M1ZA 5FI3A 4C2UA 1PE0A 3SJCA 5DLEA 3W6UA 1FMJA 3MEQA 3WLNA 4K0KB 5F7JA 4C0JA 1J8QA 2HB6A 5AW4A 4GMHA 3PEWA 2ECKA 2DPLA 4Y6SA 4RVNA 1BXGA 2IEZA 3TRHA 2OXTA 4CEJA 2HGSA 3BRWD 5HVNA 2WQZA 4BZQA 4JC4A 5C37A 2Y67A 4OQFA 1ZJ4A 2YYYA 4JQZA 2WUVA 4RWEA 5EMNA 4BDTA 1EVKA 4EY8A 4TYPA 2WD9A 2P3QA 1LLQA 5E1MA 2L0XA 5LU8A 2BMJA 3C3AA 4GOJA 2B35A 2Q1TA 3CFYA 2D62A 3D6JA 2VHZA 1R15A 1DXYA 2BFMA 4NZZA 4U5XA 1K4KA 2M32A 2JCSA 3IHTA 3UC5A 4D4GA 3T54A 5JXWA 2IV3A 2PXXA 3UK0A 1IN7A 1K7CA 4JLAA 4JLJA 4AJOA 3LOQA 3CBQA 1L7EA 3L04A 4KYIB 4MWTA 3TQOA 5IKMA 4DTCA 1DC5A 2QVBA 3D5TA 3H8WA 3MTGA 1JAZA 4UE2A 2B7LA 3EFOB 4X95A 4MMXB 3SIRA 3DR5A 2G9UA 5JC8A 1Y4ZA 3C1AA 4CF6A 4BQSA 4IGIA 2PPLA 3JWJA 3LBFA 2Q3DA 1G59A 2WINI 3NBKA 4QECA 4RZSA 4MA5A 3MUOA 1CQIB 1WDLA 3HNOA 1EDEA 2FUCA 4IV8A 2QLNA 3AM5A 3TKAA 3ADCA 3QKUA 2DERA 2VIIA 4RGYA 2ATVA 3OJLA 1KI9A 2PT5A 1MHPA 5LZ8A 4UEKA 3R6DA 4ARAA 1QZXA 1G5PA 3A25A 3INNA 4YXFA 1S2GA 4D96A 3MWEA 2EJBA 4DADA 1E0KA 3G0OA 1CR0A 2PT7A 2CC2A 4WKOA 4ZAVA 3SZLA 1BMFD 1WBBA 1N1EA 1ESMA 2I6XA 5H83A 4A8JA 2OBNA 1QRUA 1TO2E 4PLCA 821PA 2GXAA 5DHAA 4F21A 2B8EA 3OZFA 4YUVA 3ZBTA 4L4ZA 2ON6A 2Q50A 4ZZ1A 2LXNA 1TM4E 3SBOA 2OG1A 2WM9B 2WFZA 4BGEA 3FCCA 2FSSA 2R1VA 1Y5RA 1TMKA 2JGDA 2IF0A 1AK1A 1UBCA 1FFXB 4J1SA 4OREX 3T5TA 1JHZA 3V3KA 4Y2YA 4FFNA 3GVHA 1COWD 2C4MA 4JBGA 3HY4A 2AJBA 1BKYA 2PG3A 2QGZA 4KR0A 1SB9A 1OAOC 3LYUA 2Z09A 2ONCA 3TLJA 2H4FA 2V8BA 3N2GA 1H6DA 1O95C 2DUUA 1JF8A 4IMPA 1MV8A 1E2NA 2NXEA 4R7ZA 1E3IA 1TM1E 1T2VA 4F0JA 4RU1A 1GZ4A 3NP9A 3LL4A 2JGMA 4H9GA 3MK31 2QRZA 2DBQA 4QDUA 5LR6A 2C4WA 4Z0TA 4Q3NA 4GZMA 3EH1A 4KE6A 4QT0A 4L95C 1C9KA 5A1JA 1VKZA 4HD8A 4EM6A 1M34B 1X86B 1Y89A 2FK7A 2XQJA 3EVZA 4CV2A 3T1TA 1ESEA 1LLUA 2AVDA 3ICCA 4URZR 1OH7A 2J6CA 3ZUGA 4KX5A 4X5OA 2JATA 5LU9A 1V6CA 3QOWA 5EHIA 4UAGA 2QN2A 4LVNA 1THMA 3H11B 3TTSA 4XIGS 2P5UA 4C5BA 3UN1A 5FBQB 3I37X 3DMRA 1D4FA 4JI3B 2JD2A 3U37A 2ZJ4A 3KVYA 5AHWA 4EVQA 2Z04A 1VM6A 2BZ0A 3KZXA 4PYNA 2ZT7A 1H22A 3QXGA 1RCUA 2XZLA 5DN6A 3VDRA 5LM3A 4F5WA 4B7CA 5BV1A 5DXAA 3A4IA 5ERGB 3IQWA 1EX9A 1N3IA 3JYLA 1F5NA 1LPSA 2UDPA 4RVUA 4TV9B 1QK5A 2KLHA 1NXTA 4Z7JA 3O3MB 1QTNA 1PJ4A 3MGCA 4HK4A 3OX3A 4C01A 2YZ2A 1NU6A 3D8UA 3G8YA 1NJ8A 5EIWA 4F5EA 3DHNA 2QYTA 2ZSIA 2IQ5A 1AKWA 4OU4A 3AVWA 2EVWX 4CMIB 3BA1A 4LK2A 1C14A 1YE5A 5FHRA 4DWJA 3B3QA 4YDQA 1NBIA 1ZW6A 1YS2X 3B3GA 3RYIB 3C3WA 1JXQA 3HKEA 1JE1A 2AGVA 3AGQA 2ZJ3A 1XP8A 3DA8A 4JVOA 3BE6A 4D9BA 1RXUA 1VBKA 4MVCA 4EW3A 1WKBA 1P6QA 4RJLA 5I4KA 3ORSA 2HCRA 4L8LA 4DUPA 2AX4A 5J4HA 4ZYYA 3DDNA 4G0WA 2PSHA 4N18A 3WGVA 3EWIA 2XD4A 4RLHA 1KH2A 2GBIA 2GERA 4IRMA 3ZKAA 4EA8A 3PENA 3WA7A 1WNFA 2YY5A 1KKMA 2DRIA 5SY4A 1NQWA 3JWGA 2AFIB 1HNNA 4J0HA 1QRDA 4Z3KA 2DTDA 1GXSA 1AK2A 1GYQA 2LDBA 2XLCA 1VBFA 1N6PA 2G36A 2R9VA 5M34A 4RVCA 5CT9A 2VPQA 3R7LA 1O5IA 4B43A 2FHSA 4UHJA 3RUEA 1NUPA 5A9TA 2OENG 1QNLA 3ABSB 2Y6UA 1K7XB 5JO9A 1XD8A 1K6MA 1LPOA 3L8GA 3GCDA 4B3GA 4E2WA 1SZCA 4FVTA 3ZJ5A 5L8VA 4BB0A 4ZU1X 2XSZD 3GK3A 3W0LB 1WUKS 4KXYA 1KPGA 1YB4A 4QHTA 1E66A 2UKDA 1M1NB 2JAWA 4ZDIA 1WPRA 3C14C 4QHSA 4EJSB 4UUBA 5HM6A 1IQUA 2UUPA 1FZQA 2WK1A 1GKUB 1O97D 2OZLA 3WK5A 1VPLA 4EBBA 3E3MA 4O5OA 2YJ3A 3NBFA 2HA6A 1NLFA 1ZGCA 3JZFA 1L7OA 1QTRA 3EEQA 3WNDA 1B4DA 1KVUA 1ISIA 1UXIA 5BQXA 1IQRA 1G2QA 1RQPA 3EIOA 4TQUS 2Q0HA 3V8VA 1YA6A 1I7DA 3PQDA 1KSHA 3ZY5A 3QI7A 4D43A 4ENUA 4B9AA 4BN0A 3TLGB 2PM8A 1BFUA 2HT6A 3PHIA 5C8ZA 2R8XA 4MAFA 4KFSA 2H5LA 3RR2A 1N6NA 4NYIQ 1NJSA 3I9V1 1E9EA 3ZZMA 3AJAA 1LC3A 1SWWA 1I5RA 4CV1A 3W5AA 3DMNA 5EMLA 3VR4D 4IXMA 4YJ2F 1S2MA 2C2YA 1E6LA 3FUUA 5C9ZA 1OAOA 1XNHA 1Y3AA 2W2NA 4PZLA 1KDTA 1GKKA 4WA7A 1G5QA 2GN1A 4MWSA 3OTQA 4XUDA 3TOSA 2IEYA 3BFJA 3AETA 1W88B 2BFNA 1M1ZA 1HE2A 5CBPB 5DEOA 4BJHB 5HM8A 1BKSB 1XMVA 2AYZA 3QK7A 5ALPA 5L45A 3TZHA 2PV0A 4L7QA 3FMPB 2ZQYA 4NRDA 1DAIA 4RD4A 1JB1A 1XRQA 1MO5A 1XFDA 2HO4A 4HSGA 3RWBA 4ALMA 3ETJA 2PLRA 4TUYB 2J9FB 2JJ1A 4G0OA 4P32A 4QOSA 1M6VA 1D2MA 1M8KA 1X7ZA 3HYLA 4YO7A 4YRPA 2H0AA 4ALJA 1TM7E 1E0AA 3TCXB 3K9NA 5AKYA 1SHZA 1TDJA 4TVOA 1J2UA 3CF2A 2HA2A 4D3ZA 5AM5A 1W4LA 5HCUA 1ETUA 3KKQA 4HGPA 4L6CA 4LXHA 4XLLA 5DGHA 5HKKA 3D1LA 4KN9S 1UBNA 1IBSA 1CZHA 2VA8A 4FFDA 4RNCA 4MLZA 2ZR9A 1V11B 5AVSA 3IL2A 3MJEA 1Q0TA 5DNVA 3U26A 1P61B 1ONBA 4OFWA 1IDOA 3OSUA 4WOCA 1QYRA 4LX8A 3SX2A 4RIGA 1W5EA 2PT9A 3KJZA 1USGA 3NHMA 3QEAZ 1QYCA 3E2MA 3H65A 2W2PA 3F7NA 1Q6ZA 4Q9AA 3T3DA 4EG6A 4QLBA 3RD5A 5KYTA 3BAZA 1M5TA 3CEPB 1R0BA 4EL5A 2R7AA 4TT3A 4WKCA 1KY4A 2ZUVA 2HUNA 2QVXX 2NT4A 1JEYA 3ZDAA 2C9OA 2CLDX 2IHVA 4M0PA 1LLCA 1PO7A 2ONJA 3FDZA 3SQXA 3VU1A 1EWKA 2PZ8A 4B3CA 3KLBA 4MWDA 1VPDA 4WUTA 2LW7A 2C58A 3TZQA 2P5YA 1PG5A 1T36B 1XTSA 1Z7WA 2L82A 5D2CA 3HKBB 5TQVA 2QVCA 3UTCA 5HJEA 1IBMB 2X4IA 4KE7A 2BMAA 2DHCA 1K3UB 1W96A 2UVDA 2HJSA 4KQ9A 3M34A 1ODTC 4TS1A 2V7QD 3LW8A 1WR8A 4XZ3A 4OBWA 3H0CA 1N2CA 1TU3A 3D2LA 4IMJB 4FSHA 4X66B 2YY6A 2WU0A 4O59O 3HB5X 5LOVA 1RXYA 2C0PA 3ZV3A 2J9YB 4FR0A 4QC2A 1THZA 4IJUA 2NGRA 1EUZA 1CEQA 1GGMA 4LOAA 3T35A 2YQ4A 4R1SA 1PCXA 3LJKA 1ECPA 4AYTA 1U02A 2J5XA 1J33A 3P97A 1Z0UA 2WWXA 2AW3A 2G40A 4G9GA 4MB0A 4ZQGA 3E82A 1Z73A 5IVPA 1KA9H 1MX3A 2Z5VA 1Q7EA 1SC1A 3OT1A 3PPWA 3EEFA 3QHQA 1OIXA 3BFXA 1WX1A 1GVHA 5BOSB 3AILA 5I8PA 3HPRA 2AUMA 3IJEB 1VPWA 1OT5A 2C00A 1R6UA 4QDXA 5FTNA 1IY0A 3ZQKA 4FFMA 4AKIA 5JNLA 2IL1A 4X41A 4G0YA 3CZQA 3BJIC 3MOIA 4NOJA 4BECA 1UBRS 3F47A 4FYKA 1O9BA 1P2UA 2A0KA 2CDNA 3QHPA 2P27A 4E5VA 3W5DA 5T64A 4CEHB 4A26A 3I9OA 4MUAA 3GLKA 1W4BA 3KVRA 4JLSA 5HF6A 4TZTA 3IP5A 2HQOA 4IUYA 4LUCA 1J2JA 2GYUA 4BHTA 4DARA 5EPOA 3Q11A 2DHRA 1UFOA 4NNJA 3ZVMA 1FRFS 2P3SA 5HBGA 1JZTA 3V55A 3KJEA 4FZRA 3O8BA 4Q93A 4EF4A 5KOIA 1JXMA 2Y8EA 3TZKA 2AVNA 1EPUA 3CXRA 3P2IA 1YVRA 2MDTA 2YNMC 3G49A 4J0CA 1XZMA 1T15A 3KOWA 1RFLA 4PZCA 1Y48E 2IKSA 2VA9A 1TIBA 2JLBA 4FEYA 2GWHA 4FR5A 4GP7A 4GE0A 5JXIA 1K6XA 3E4DA 1RLIA 2PQ2A 2Q2VA 5EIOA 5ESRA 4YRGA 1FYXA 2OMKA 4OP3A 4TTJA 2PNJA 3DZBA 3RBAA 3ANSA 1RKXA 2C3OA 1P0FA 4XKJA 4B3IA 1P0PA 4CDGA 3FBGA 2AD5A 2ZPUA 3AUSA 2G5PA 2QMQA 1JQDA 2PL9A 4NONA 1UXOA 4JVLA 3CWCA 3FZYA 3UOWA 3AFIA 3I01M 4Y8VA 3U40A 1CPYA 1NVAA 3K32A 1G8SA 1DADA 3CUUA 4MO2A 5C8VA 1GDTA 4LSGA 3U4DA 1R4NB 4HDRB 5AIAA 1RE0A 1ZJ5A 1P3JA 2VR1A 2X0IA 5E1OA 5G2OA 1DPGA 1ETHA 3RFXA 4DQUA 3CVYA 5GJBA 1KQ3A 2HLDA 3V4ZA 4BMXA 1N5LA 4WBNA 3K6SA 3SHOA 4WNAA 4TWZA 1CJMA 3GHHA 1EJ6A 1QG6A 2VI5A 3IKJA 1TEZA 3INTA 3A7EA 3M1LA 4TLAA 2QBYA 3I5XA 1Q0RA 2NVWA 2VYCA 1RRFA 2QRLA 3CBGA 3MXOA 5EPEA 1SUSA 5FBLB 4C29A 3KXDA 4MUXA 1FU7A 3CF6R 4EW6A 4U0JA 5LWQA 1C0PA 4I50B 3C5VA 4O02B 2PZJA 4C3OB 4RKEA 3EX7C 1TD1A 1JTEA 4NENA 3F98A 2H92A 1CKEA 1GL3A 3BERA 3IVGA 2CB0A 3SZMA 4M55A 2R11A 4GPTA 2X9GA 2D1YA 1V4NA 4X92A 4Y2JA 1JV2B 1PK7A 2GJ9A 1SY7A 3DO6A 3RIHA 3SYNA 3K09A 4RVDA 4P4LA 5IAOA 3GVCA 1US8A 4NESA 1YIDA 3B9BA 4K40A 2F17A 5DM1A 2PZEA 3KUCA 3T41A 3ZIDA 4ZI3A 2QX8A 1GUZA 2ZXEA 4KAAA 3ZWOA 1IIRA 1UC8A 3P9SA 3C3DA 1ZM7A 2Q62A 4AD8A 4MWBA 3B1KA 4IKOA 3VU0A 3FCXA 2EL9A 4ZQBA 3WGUA 4YPOA 2QBYB 3EIXA 1Z16A 2FWIA 4AKGA 4LGVA 4MW2A 5DP1A 2BGWA 1TA0A 4CQNA 3IURA 2BGRA 1WW8A 4X1KB 1TAGA 5FLYA 4AG5A 1JR2A 1D0SA 1N9ZA 3K4QA 3TNDA 4AN0A 2XY4A 1J97A 1ENYA 1SEVA 1YZKA 4OLFA 3OQVA 3BWYA 3Q7PA 3WJ2A 6ABPA 1Z12A 3PGVA 3QLUA 4NOKA 4OY3A 1BQ3A 4KNWA 4E70A 4BMVA 4LCJA 1TFUA 5CDFA 2G72A 4A1OA 4XM1A 2BHSA 3BSYA 1OH6A 3C85A 3ZWWA 5A9SB 3G17A 2F1JA 5BPHA 1C3XA 1AHHA 4FGKA 4C08A 3LQYA 4CMJA 2V6FA 1Z6ZA 2E49A 3WGZA 2V98A 1JHAA 3RC3A 2GN4A 4E6EA 5IKOA 2AMFA 1E1RA 2QRVA 1QH8A 1OXKB 2WE7A 3PI7A 4TWJA 3AUXA 5C1IA 4AX4A 3IO5A 1C3OA 4LJRA 4EYEA 1LUAA 3DXYA 4QWWA 3CVOA 4MKXA 3H2JA 1OOEA 4O0LA 1NR1A 3FUXA 2ECFA 3ND8A 4BTLA 5AVXA 2FG5A 4TTTS 4HDQB 5A5FA 4JC8A 5EJEA 1KY2A 1W85B 1K06A 4MV3A 1P2SA 3WYGA 3DEYX 2FN8A 3P45A 4ZODA 2KJQA 2WLSA 1BE1A 2G0AA 3LU1A 2JIZD 1J42A 3HO6A 1E4EA 5BNIA 1U2GC 1ZH4A 2PWZA 3KXIA 1DWQA 1PR0A 2QXYA 3C5WP 3FYUA 5FYQA 1EQAA 1EZ1A 1ZXXA 3MMSA 4DIBA 2ZULA 4DRYA 3KQNA 1NJFA 5ITZA 3J80A 4L5AA 2XWQA 4MLPA 5K0FA 3JR3A 4TV9A 2I1VB 4Z3DA 4HLCA 3GJ5A 1YCDA 1QCCA 3OD1A 1LDMA 2JL1A 3BSSA 1S4QA 2PV7A 2VQEB 2H2HA 3MSCA 1XKTA 1FDWA 1UBTS 2OHOA 3DE3X 2BEUB 3GJ7A 3OPXA 4QYIB 4E5UA 2J3HA 4LF6B 2R7MA 4AY2A 4N0EA 3MW8A 3V9AA 2E89A 3AEUA 5DLYA 1M8FA 2O0MA 3L8DA 1KEUA 1M72A 4G0MA 3HWX1 3Q6IA 4TYQA 4I36A 3UV7A 3N6RA 1U11A 4YCJA 4BO4A 7GPBA 3N2EA 2WAOA 3NT2A 3OM9A 3IULA 5JAIA 3J7AC 3IYLW 4J4BA 2B5WA 5DW0A 4MUNA 2P1RA 1CVLA 3HYNA 4OAQA 4IQ8A 5AM1A 5EHGA 2ERYA 3DE0X 4EY6A 4A0GA 1U7HA 3LY7A 4D4MA 2BFEB 2ZAGA 2NVBA 3PC8A 4RO0A 1RLMA 3F3SA 2ENUA 2WU4A 3F7TA 5EKDA 1BVHA 2VF7A 1Z15A 4W82A 4R8MA 4ECAA 1Z35A 4DM4A 2ZB7A 3UHJA 3LQKA 1Y9EA 1E9RA 1E63A 3GV0A 4FQ7A 1EVZA 4MLDA 1I2BA 3EIQA 3GN1A 3TGWA 3W06A 2H0QA 1G60A 1T1GA 3TZEA 4HDNA 3U17A 2BGUA 3DJYA 3EY9A 3TAXA 2WB2A 3WS7A 3SFTA 4Z7OB 4BFYA 2W0MA 2NVUA 4LYDA 4DUGD 3C74A 4RIHA 2B2NA 1KJNA 3WHKA 1CY6A 1JN0A 2DPYA 2V0NA 1XNRB 3BEDA 2F00A 3HJCA 4R3NA 2NWQA 2HF8A 5GIPE 2OK7A 1XD9A 3DMPA 3EH2A 4RZHA 2E6KA 2EKLA 2A3RA 3G5MA 4QXMA 3TSYA 2BMFA 3ZWAA 2B5VA 4AMBA 2XXAA 1TZBA 1F3LA 2ZUSA 4PZPA 4HDKA 4G1MB 4G4GA 1IUNA 4HAUA 1NDQA 1YASA 1ES9A 2QTCA 3WQRA 2HD4A 1KJJA 1TZKA 3OT4A 5I9LA 2QG6A 4MIOA 1TO1E 4CRWB 4AQYB 1IHDA 3RT9A 3M5CA 4GRDA 1FNSA 2Z43A 3CRNA 1RM4A 1RVV1 4CCYB 1B1CA 2QTTA 3B1XA 1WPGA 5BW6B 4D45A 4DMFA 2IXDA 4OD0A 4UCQA 1QHNA 2R8ZA 4UHHA 2MJLA 1N2OA 4TTVA 4YECA 1PQYA 1YJAA 3MILA 4P9NA 4XIJA 3KB2A 5DNCA 1MIOA 4ER5A 1Z2CA 5FPKA 5EXXA 1MGOA 4HADA 2O5CA 4FUTA 1Q22A 4NF2A 3L0BA 3FNEA 1X39A 1ZWKA 4F84A 3KYBA 4HPWA 3WBJA 3RK1A 5I01A 3RT1A 4RM2A 3AKDA 3GA5A 1TM3E 1M0SA 4S1OA 3BFVA 4HB0A 1L4LA 3JXEA 3DE1X 3ASUA 4GBGA 4AI6A 1QRSA 5T7BA 2JLCA 5EZYF 1ECGA 2Y1XA 1DMSA 3I30X 4Y67A 3ABRB 5JLAA 1TIPA 2FPUA 1CY7A 1A9PA 1EXMA 1X7ZB 2ZSUA 4B85A 3HZOA 4IM7A 3I8XA 3NHFA 4G09A 2R6DA 4BMOB 3A1EA 3SHTA 3UVEA 1CJCA 5C5EA 2DWQA 1MZVA 1PR2A 3L0CA 3EYAA 3STTA 1JQ5A 3TBKA 4C4SA 1QP8A 3U7QB 3CF0A 1PHPA 4PHCA 5CBPA 1DIGA 5TPWB 2PZAA 3QEBZ 1ESCA 2IPNA 3RBVA 3ZDZB 3UA3A 1O2DA 2Q9BA 3ZWXA 1QGZA 3C3JA 1JNXX 4ZQIA 4BC1A 4EHJA 3VX3A 1A9QA 2MU1A 1R16A 2KS6A 2R60A 2QVGA 2XX3A 3DJFA 4OYRA 1DQYA 3BDIA 4DA4A 1N6KA 2Z8YM 4E09A 3UB4A 2VDMB 2LCFA 1JB9A 3PFHA 1NFFA 2KQUA 2WBLC 2MCFA 3OE4A 3DV0B 4EG5A 4X90A 1SBQA 1T6BY 3RREA 2J8ZA 3QKTA 5FA5A 4ZYUA 3QKIA 2ZU6A 2FDRA 2H54A 3N2KA 4M86A 1TGYA 1QYIA 1R50A 4ZAZA 2BEWA 1TQ8A 2RJNA 2WJYA 2X7XA 5CFMA 1TYEB 3PLAE 5HQTA 3BORA 3EXG1 3IAXA 3CX8A 1QC5B 4ROSA 1NMQA 4JR0A 4HAZA 2B20A 4JC5A 2PZBA 2VFAA 1OI7A 5ECGC 5AVKA 1NUSA 3ZGOA 4NICA 4NU6A 3V8PA 4CG2A 1L5RA 1VGRA 3NPAA 4B32A 3ZLVA 4K26A 4C0BA 5TGTA 4A6EA 1Z75A 1EFVB 4RCYA 4XX1A 3G8BA 3EZFA 3N7UA 3OU6A 1J07A 1K5HA 2GVNA 5DLQC 3ROTA 1WMDA 1WA5A 4BNYA 3L3BA 3TRFA 1RM3A 2OGTA 4MRRA 3ZK9A 2PFGA 5A2GA 1H2EA 1M9NA 4PZEA 3KJIA 5DT9A 1FXSA 2IBMA 1U2TA 3TSOA 1KPHA 4QEZA 4CV3A 1YQTA 1J24A 4ARIA 4DIKA 3F2VA 2Q1YA 1J7KA 1N5KA 3A7DA 2WG0A 1PG0A 3WYEA 2E55A 4JJIA 4EO9A 4JJEA 1P7ZA 4W5NA 1CX9B 3I1YA 4Z4GA 2FXIA 2VWGA 2FZGA 3AB7A 3NVMB 2Z0MA 3NOQA 4GR9A 3ZWYA 1OROA 3THOA 2QM3A 4BVGA 2FSVA 3G9ZA 5F9FA 4M8IA 2J0EA 4M8LA 1MNQA 1G2PA 4HH0A 1IZZA 4PCUA 2A0YA 3G1WA 4RPGA 1DHTA 4BVBA 4QG3A 4B4WA 1YS4A 1VL8A 5GONB 3T7TA 3TJZA 3WRYA 2BL4A 3N2NA 3AHFA 2HRZA 2NYVA 3E27A 4AIIA 1JPUA 8ATCA 2JKZA 3OLWA 4X45A 3AB3A 1YC5A 4KPGA 5F64A 2GARA 2DH5A 4OJQA 4WEOA 2GRJA 1XROA 1I8TA 2BLNA 3A14A 3BE4A 2ORED 3L8YA 3IA2A 2BJVA 2D5LA 5AR1A 1E9VA 4ZVUA 3TIXB 1FFCA 3LUFA 3TMAA 3MJSA 1KETA 3OH8A 1ODIA 1WDWB 2VUHB 5CLHA 5HK8A 4KDRA 3WDMA 3X1YA 4F8EA 4EPTA 4KR6A 2GN6A 1Z0IA 4MWZA 4PRLA 1MQSA 1QUFA 4TSRA 2YVUA 4L9SA 3SXJA 1Z0SA 4P4SB 4P34A 1JALA 5JADA 3QYJA 2Z3VA 4KTTE 4PYRA 1SD2A 3PKZA 4E2FA 5IFLA 3QKWA 1SUFA 4XFJA 5P21A 3OM8A 4R1PA 3QOXA 3OBIA 2QY6A 3RUHA 3AF4A 5BW8A 4I1UA 4UTNA 4RLQA 3SCZA 1T9HA 1M6WA 2QB5A 2TYSB 4GM1A 4OJTA 2TMYA 4Q4AB 3HSSA 4EGCB 3AZPA 3TD6A 2O5RA 4LGMA 5LWHA 5KDLA 2Z2XA 4ZCLA 3G5AA 1JAHA 4U3JB 3RUAA 4IV0A 3L1UA 3PWTA 2LTAA 4ZJYA 3C7TA 3BBPA 3LNCA 3A05A 3VZSA 1U1FA 4R8RA 2I2AA 1P80A 1Z0FA 4PBRA 1IHYA 5CA0A 3OQ6A 5T6BA 4BBPA 4DNXA 1BAPA 4EK9A 3I8SA 3BJRA 3DBHA 3HHPA 3L82B 4P5EA 1UINA 1K3TA 4OEHA 5EWJB 2BGNA 2QLMA 2WYHA 1IUOA 3BK2A 4JL6A 2QN1A 4JZKA 3RTGA 3D3NA 1XEFA 3KSDO 3HU1A 4ZTBA 1YI8A 1TVKB 5HIAA 5LXTF 2N46A 1PGPA 2ZZNA 2QQEA 5JPDA 4LOHA 4DGQA 2BE9A 1WZIA 4XYGA 3EPLA 1Z5PA 5JD6A 4QU0A 1AKTA 2VT7A 4QL3A 1MIOB 5EVJA 5BSHA 2JHGA 5B3LA 2UZ1B 4ABTA 1BN6A 1UAYA 3TGLA 4WN9B 4C4YA 4OAOA 2BUBA 1Z2AA 2ZSAA 2ZYGA 4PQYA 3VJKA 1X9IA 2RHOA 2DT8A 4G4SO 3IDQA 1B6RA 1B41A 1BMDA 1Q17A 4X20B 3RTDA 3B89A 2CMHA 5TQ0B 2YYZA 3H87A 4H35A 4CBVA 1K1EA 3K9LA 1VKNA 2Q1XA 2V8OA 3I04A 4D44A 4PSUA 5EHNA 1GZ6A 2FH5B 3DAGA 1Y8RB 3VPHA 1NZJA 1TCAA 2YNMD 2GVDC 2FR1A 3AHDA 2L18A 3CGGA 1JQ3A 3ZZ1A 2HK6A 3W7VA 4ND2A 1XVIA 5DYWA 3WLLA 5KTYA 4H59A 1RC8A 1N4DA 2EXXA 3ONNA 4UXJA 5EP2A 1XRSB 4BNUA 1EXDA 3MT7A 1ZHOA 1NW3A 4D0RA 4M7WA 1KO8A 3ZXYA 3ADOA 1FCJA 3B3FA 2NZXA 3L5OA 3II6X 3ZHQA 2G0NA 2MHCA 4WAUA 3V8BA 3CG0A 3OJ0A 4C22A 3PEEA 2XAUA 3VKUA 5LPNA 221PA 5IH7A 1DAPA 4HDNB 4OFZA 3SVLA 1ABFA 3FF1A 4FS8A 4KO8A 4PAQA 4TLCA 3T7RA 4CLDA 5I5EA 2X9QA 3FYHA 1F8XA 1X1CA 4R1QA 4CYMA 4IDGA 1GPNA 2ERXA 1NI3A 2IYWA 3JQAB 3A3KA 4FOPA 3RS4A 1NBWB 5BVGA 2WAXA 3Q8XB 4Z4QA 4D25A 4RW0A 1WKCA 3O2QB 3ROXA 2EV9A 2Q5QA 2VDJA 5C5DA 4BPBA 3KYDA 1PFKA 3PC2A 3K35A 4BCDA 2WHYA 3AP3A 4POOA 3ETCA 1KAMA 7REQA 2FDCA 1BE6A 1TB4A 1DVRA 4OXYA 5KYUA 3UC9A 3N9IA 3IFSA 3MINB 4MKZA 3BK7A 1E2PA 2AMLA 4RSHA 3M6MD 1D5CA 2J3JA 4PQRA 5B6IA 2A4KA 4OUKX 4CCSA 2BELA 5IT9A 1TUIA 1R0YA 3IQDB 3EQ7A 1P9RA 4PEVA 3MUEA 1YL7A 1YRQA 1MRNA 4OMFG 3EGDA 1EIZA 3NHWA 3RK4A 1M67A 3P9CA 5IVIA 1XELA 2QWXA 1TTPB 4RQTA 2ZBPA 3SHQA 3FUVA 1NTOA 1BX3A 2E37A 3G5UA 5TC4A 2WSMA 3HJAA 4Y6QA 4DG5A 1M2VA 2D2FA 2R0QC 3F9RA 4RTRA 4FJ1A 2GN0A 1NF3A 1AKUA 1WUIS 2HJRA 4XUCA 1Z17A 4OA5A 3V8MA 3BDVA 3THRA 3DL2A 1USIA 3C8UA 5TJ9A 1XZFA 5CIYA 4FEEA 2FQYA 1JJBA 5ALHA 4AJHA 3OE7A 4M8SA 5EE1A 5LIRA 5C1PA 4A3SA 4GR4A 3UGKA 4C7XA 3VO1A 1RCFA 2Y1GA 1OXTA 1ZNWA 1H0KA 5T3UA 1I3OA 5FOXA 5JT1A 3LUPA 5EERA 1SCDA 2YZNA 1C2YA 1SXJC 2FFJA 3Q9NA 4FDTA 4S2EA 4A8PA 3ZVRA 4D8YA 1UC5B 5B2EA 3M5DA 2M2IA 1SXIA 4RFSA 1XDWA 3VC3A 3K5WA 4Y2PA 2VQFB 2WYUA 2C5AA 3ZE7A 4X97A 1F12A 1DX9A 1I0LA 4JVNA 3I0ZA 1EE9A 3RU3A 4DPLA 1AHPA 1SZDA 5TIIA 3FZQA 3WIDA 4LJ7A 3QVGB 5MN5A 3B70A 2OV4A 3WRYC 3PE4A 5EA2A 5C4GB 5FI1B 1QS0A 2AV6A 4FS3A 3DGEC 3CSUA 4O8ZA 5FNVF 4WLOA 2NV0A 1HQDA 5IWCA 2OYSA 1IULA 2NACA 2ZR8A 1DARA 2DPMA 2HCBA 5F76A 5ENZA 2XTZA 4BV3A 3RYHB 2UVPA 1GGFA 5EIBD 1O94C 4LRYA 4NYIR 4ENPA 1BD3A 3CTPA 3EG9B 3EPHA 3S7TA 5ES3A 1XLTC 1U80A 2Z8XA 4GHWA 5AK6A 1TECE 4MKHA 4BO5A 4HZIA 4DKXA 1DKQA 2XEXA 2NUTB 4WNYA 3EFBA 4RKWA 1TA4A 2A14A 1UDBA 1GT6A 2WVGA 4W7HA 2QU8A 1T0UA 1V95A 2VRNA 3UK1A 3V4SA 2CDBA 3OU2A 5KJ1A 3P7MA 5AJHA 2IITA 2UYOA 4QYXA 4UFOA 4N76A 1AT1A 4AYWA 5IKPA 2XT0A 2WV7A 4LY6A 2X40A 1IL0A 4MDHA 2FZKA 2YJ4A 5DM60 1KI2A 3S2FA 1EJ0A 4DA7A 3AWIA 2D4HA 2GEDA 5K05A 5DCLA 2OPHA 4EGFA 4JT2A 4UZSA 2ZCJA 1HTBA 3KJHA 2O2IA 2YIVX 4K6CA 3DOCA 4KPYA 1Z2PX 2HU8A 1VSUA 3CMMA 3UCFA 5ALKA 5BNTA 4MKGA 3B53X 1DTSA 2CFTA 1KR2A 1ST2A 3F67A 3L7BA 4G1FA 4XPIA 4ZYWA 1MP0A 4EFDA 1ZN2A 3MAJA 4N1AA 1G5IA 1QHFA 1RJFA 5JS1A 2H1VA 3GDFA 1LDBA 1CRWG 4F4CA 2R8PA 3C3XA 3H99A 4MWOA 3UFXB 5KWVA 3ONDA 5AUNB 1Q84A 4O2LA 1R74A 1YTUA 2ZYSA 1OGIA 3IAAA 1A5BB 4EJMA 5JCXA 2IP1A 4J43A 3TMKA 5K6AA 1TYAE 3ESBA 1T3LA 3ADBA 1SQ5A 2CVFA 2I2CA 2JD1A 5HGXA 4F60A 1HNWB 1VG8A 1VHJA 1Y4UA 2P2LA 4DCSA 1TJPB 2JA2A 3AU8A 2LKDA 4CKCB 1J00A 2PFSA 2W6JA 3DL7A 1JG7A 1H2FA 3UMVA 3ZZNA 4Z4HA 1F9EA 2CHQA 2CD7A 1NW7A 3GLVA 3OZEA 3D8BA 3RM3A 5JALA 1CRPA 3CNNA 3DMDA 4KXWA 1Z18A 5E1DA 3FWYA 2XOKD 4B35A 2XYGA 3QF4A 2QSJA 2MSKA 4JP1A 2F1KA 3INGA 2E4YA 1ZN8A 2CT8A 3AIOA 3QE4A 1HEUA 3AM4A 4H0NA 4ZXPA 4NAUA 3TEJA 3IGFA 1GYRA 1M2EA 1RS0A 2BM0A 2PKYX 2VT2A 4HUQB 4PYIA 4R1NA 2FRDC 2ZDGA 1IXRC 13PKA 4WA8A 5F1OA 5HZMA 1W36D 2GNOA 2CDAA 3NAGA 5ESDA 1OY1A 1E8NA 1JLMA 1U9IA 4DMRA 2A9PA 2JFQA 5TRTA 1HE5A 5LQJA 3JASB 5I9TA 5B7QA 4MVJF 3U3ZA 1D07A 1R0RE 1NBMD 2FQQA 5FT9A 4BX8A 5G0TA 5CB4B 3KSZO 1Z5OA 3SM3A 3R6TA 4B75A 2EHJA 2KHZA 3G88A 5KVQA 3TKLA 2VHXA 2JIOA 2D13A 2O06A 3Q6MA 4ZCPA 1T4MA 4AQ7A 1MAAA 1KOLA 4ZEVA 5AWFC 4FNAA 3R9IA 4WMLA 3ZW9A 3U2QA 2KLBA 4JAVC 5IRCD 4XIIA 1JI0A 1Q7CA 3QU9A 3SQNA 1F8UA 4E2XA 2I4OA 4DEXA 2Q5OA 2IYNA 2VATA 5BO5A 3IV6A 1GR1A 4PIPA 4CM8B 1DT5A 1FP4B 1TCVA 1J8MF 1GQYA 3A6LA 3FY4A 1E5TA 4OBXA 1E3EA 3G2IA 3UV6A 2AI2A 1MLDA 3X1WA 4IXWA 3GZNA 4P3OA 5IUKC 1JG3A 1MR3F 3TRIA 5JASA 3FWNA 2EFHB 4IOKA 1Y6JA 4JJ8A 1EZ4A 1AUVA 1VLHA 2AOUA 2YUTA 4ZP1A 5EZYB 3RCBA 1Z88A 4O2BF 4MVWA 1YRYE 4TQAA 3OT1B 5EJMA 4BX2A 5J2UB 3K92A 1BCRB 2C2WA 4M49A 3VR2D 1A5ZA 1P2GA 5LUAA 1Y1SA 5KQPA 1FJHA 3W78A 2MWMA 1DIAA 3E5RA 2F90A 2I8CA 1VQ1A 2BFDA 4FJ2A 4RD0A 5KDOA 5TLSA 2RB5A 1RQRA 1QU2A 3WLJA 4OPMA 1N6RA 1RBZA 2DVMA 3PQFA 5LZ2A 3K71B 4BX0A 4R9RA 1CJSA 2J59A 2RI6A 3C6KA 4M1WA 1PBTA 4P53A 2EX4A 4QOHA 3L6RA 4RQAA 2G4LA 5FNZA 1PP4A 1YKFA 2VTVA 1SVLA 1VA5A 4AY6A 4RPIA 1TZ2A 3OU7A 1UC4B 1G21E 4FYHA 4CTOA 3Q5GA 2ZSBA 4UFNA 1L4FA 3HKBA 3L6EA 1ITZA 1E5VA 1ICEA 2VYNA 3E0XA 4J75A 2A86A 2HDNB 3KD3A 4ZQFA 3K6RA 2HQBA 5TS3A 2VHWA 5C53B 2AYXA 1F1JA 4HAOA 3S81A 2YMMA 4QQKA 1EFHA 5JAPA 5IT0A 2GHIA 4JN6B 2APJA 2PRZA 2GCEA 2Z98A 3ANLA 1YE8A 3CUVA 3U1VA 3LUBA 3AEUB 3T0IA 3TOZA 2HHAA 2M9MA 2FPPA 1UMBA 5FKJA 3TCNA 1EHCA 1PJ3A 4JIGA 4WINA 1ZVMA 3F97A 3U61B 4WLNA 2CXQA 1IBCA 1W5AA 2E4XA 3ORFA 2ZUEA 4RTOA 3AVVA 3LV8A 1F8FA 1UJ5A 1GQOA 4WY2A 621PA 3P96A 2V55B 1EK1A 1RKQA 1GR0A 2VC2B 3D0OA 3QKSB 2VF2A 2FSIA 4TV8A 2POQX 5J58A 1ZJWA 2WWGA 1QO0A 5HK9A 4FQ5A 3AL0C 1OAAA 3DCJA 4NFYA 2PUFA 4M0EA 1ZK2A 3BIJA 1PVDA 5HTOA 1V2HE 1V8PA 3V1UA 2WYIA 3GGGA 2P62A 4D97A 3UWKA 4Z54A 5B58C 1N32B 5H4GA 3QUCA 5ECDA 1QVVA 3RUCA 4URFA 3VAYA 2IEGA 4BMSA 3HWRA 5ECYA 1XDZA 3KPUA 4GX0A 1Q1NA 1JP7A 1ZC4A 2O5EA 1DJMA 1M6VB 1R8XA 3DZJA 3NGLA 4ARBA 3SVTA 3HBNA 3ZK7A 5AKXA 4C4AA 4GW3A 3MWDA 2FJPA 2QRVB 5BMVA 3ZVLA 3FDXA 4BFZA 5CXUA 2Z4SA 3WGTA 3PJDA 3IOEA 1FRVA 1U3DA 2ZXUA 3JAKB 5M7EA 1T8RA 3FLBA 2ZI3A 3RK0A 4TL8A 1PEYA 1ZDMA 4KBGA 5AI4A 1XD2A 3W1VA 1W34A 2Q3JA 2QTVB 2XJ9A 3MYRA 3LA8A 5K20A 1RI2A 2NZ2A 4P31A 5NULA 1QRRA 5EUCA 4D3FA 2F8LA 1F4VA 1AO3A 2CCKA 1ZUHA 2ZJ7A 1TMYA 4DMLA 5E1BA 4E15A 3THYA 2Q46A 4UCWA 3HN6A 4ZOLF 2JLQA 4KLAA 1KERA 4IIJB 3U09A 5F2NA 1RLUA 5DFAA 2WJGA 1VIAA 5LA6F 3IQZA 1NP3A 4E0BA 3EE6A 3OUZA 4MKRA 5F2KA 1Y37A 1P0IA 4F2HA 5JEEA 5HS6A 1TU4A 1NYQA 3BFKA 5JAQA 2PUHA 3TAHA 1QYWA 2XB2A 3GQBB 4XD7A 4MQUA 2SCUB 2OGZA 4PE5B 1SOAA 1JIXA 4ED9A 1A2KC 1TUBB 3GLIB 1TUBA 4NMXB 1RKUA 2F1OA 3K0BA 5EIHA 1EFPA 3WKCA 2PSEA 3U4QB 2ZJ2A 1HLGA 3LY5A 3PKIA 1O5TA 5EQFA 4DHWA 4PQEA 5FBVB 1P0CA 5ADWA 5C1DA 4NENB 4JS0A 1ZCAA 3EFHA 4E2YA 4NY1A 3UJAA 5AKJA 3G3EA 1OE0A 4MP3A 1N9GB 3EGOA 5F73A 3TW4A 4GEGA 3Q1KA 1NQ5A 4KRXA 4B8YA 5EEHA 4TUYF 4K8RB 4POAA 1N1MA 4ND7A 4RF4A 2G83A 1HFJA 3ESZA 2YDYA 4JOCA 3F7MA 2A9RA 3EK2A 1BXRB 3CQ9A 1XTVA 3CGWA 1W49A 1PL0A 2G1JA 2VH2A 3ITEA 1GNSA 4P2GA 4QJ5A 4UCFA 4RVFA 1VL5A 3ZHVA 2IHBA 2NZWA 4QBTA 2JEYA 1R4NA 5KINB 5AQ1A 4UJ3A 5FUQA 1S2LA 1GKLA 3K7EA 2B3DA 4O4IA 3QWHA 2P1ZA 3TLXA 1Q1ZA 4I1SA 4A0QA 4V3BA 4YMHA 4YV7A 1NIJA 4ZYXA 4DSTA 1Z45A 1JECA 1LTHR 3JD2A 1KQFA 5FAXA 1OGYA 5C8YF 3PL1A 3NP7A 1QH1B 5EE0A 3CPHA 1YR6A 4LTMA 5FJIA 4N47A 4JJ6A 4PINA 1DU4A 1XNGA 3KDSE 4MPTA 2CMDA 1E61A 3SYKA 3O83A 2H1RA 3O7MA 3WGKA 1X1AA 4U63A 4OLAA 2EP8A 1W2HA 1WVGA 1PFGA 5BNWA 3LVQE 4YY3B 1Z4LA 2R25B 3WP1B 1PQWA 3IUMA 4GI2A 5H9WA 5CLLA 2P9HA 5ARDA 4TV8B 5JD3A 1ONPA 2VK8A 3E1GA 3STYA 2UUOA 1K4MA 2ODWA 2Y05A 4ZV9A 1KPIA 3SYTA 3AEXA 1X7XA 3HU5A 1PLLA 2EWWA 4PRKA 4ZO6A 3UQYS 3JQ7A 4DJEC 1XTKA 2X58A 4XVRA 2MINA 3I34X 1GAXA 2EW2A 3FVTA 4Y6PA 2JGKA 1AZSC 3B85A 1DXHA 5JEDA 3EGDB 1L5MA 1N8TA 1WF3A 3OHMA 4H0CA 4P58A 4HNAB 5D01A 1QGDA 4KPFC 2VOJA 3VI4B 2CL5A 3AF3A 3PA8A 1OZGA 1NQOA 4N8DA 5TQ2A 4MV6A 3RWMB 3LUAA 4ZJUA 5HOEA 3UJ8A 2GYVA 1GPH1 1NXVA 1O8BA 4MLCA 1DAKA 2CZQA 3KM0A 4Y9TA 4EYGA 4AZTA 2OVBA 4GLBA 3A6GA 1NF9A 2XCIA 3L1JA 4K9MA 5CNKA 3PLRA 5FQOA 5H0IA 4J6EA 4DCTA 4L73A 4BQFA 4LF9B 1G19A 3R8XA 4EKYA 1JLHA 3D02A 1GPWB 3DLPX 5JCPA 1X9HA 4ZDKA 2FR0A 2VRBA 2P5SA 4LG1A 2WJPA 3GAAA 1J9EA 1ADYA 4QHYA 3K5HA 1Y3CE 4JWKA 4U6SA 1UXHA 4Q3EA 3UUFA 4ESOA 4NZMA 3JQAA 2RI0A 4R1LA 4YRCA 4XM2A 5JSQA 5TPZA 1AKMA 2KM1A 4H3HB 1C9YA 4MEAA 1Y7TA 3AI1A 2EBFX 1WW2A 1WW3A 1WF6A 4J76A 2ZT5A 3DF7A 2P9QA 4Q6BA 4DDKA 2CF6A 3GEEA 4E46A 1EI9A 1GU1A 3LK6A 2HK9A 3KBBA 2XQVA 3IELA 1ZD1A 4CF4A 1G1AA 4HQKA 1U8XX 4UVGA 2NU6B 3HGQA 2PMCA 3W1WA 3PTLA 2GN2A 5E8JA 5J2UA 2D8AA 2FSGA 3PQ2A 1G5HA 4JBLA 1O95A 4TMWA 3RRNA 1QCYA 2XVAA 4UHKA 1L5FA 2AOUB 1NN1A 1Y98A 2IYEA 4BQIA 1QZZA 4GEKA 1VJ0A 4HRYA 4NZNA 3SLKA 4J3FA 3WRXA 5KCZA 4HWPA 4S12A 1E7SA 3MD0A 3R0VA 2PIAA 2DULA 1IY9A 1JG2A 3IDZA 4RTLA 2FX5A 2Z4TA 5JCZA 1RQ2A 3DBOB 1WP9A 1UBFA 3BWDD 2OD9A 2I1LA 2IV7A 1WB4A 2NAFA 3EXEB 3JVDA 3LPAA 4PO1A 2C5GA 4MO9A 4R81A 1POXA 5CVVA 3QWFA 2WJ3A 4HWKA 1A8QA 5CLGA 4ZDWA 4CDRA 4A2WA 3GDHA 3H9JA 1GNRA 3BM5A 3C4QA 2R8EA 1QB8A 2DU8A 4AY5A 4UNPA 3OZCA 2ZUWA 1CQIA 3F4LA 3H3JA 3W1EA 2V7UA 5B4TA 5IDQA 1YQXA 3OC6A 4K9PA 4MS4B 5TE9A 2BE7A 2PX2A 3QFCA 3HDGA 1W0JD 3DBHB 3N0WA 1KU0A 2MSEB 3DT8A 3LBNA 3QTBA 2AHRA 3KKMA 4ZC1A 4G4JA 4IRUB 4BO8A 1CUAA 4KHZA 1OXBB 1G4UR 1ZLXA 2BGKA 2GNAA 3NWBA 2JB9A 4RYDA 1DDOA 2XTNA 2FMUA 3NM4A 4Q7KA 2DJIA 2JAQA 3K0HA 3LX4A 4DXHA 5CLJA 4BWGA 1NDUA 4IF6A 1CLEA 1Q83A 4AZSA 2CVOA 1KDYA 3OOJA 4MVJM 3GR6A 1CR6A 1CQXA 1RJ9A 3C1TA 1OKKD 3ZVKA 3KWFA 4D79A 3F96A 1SBIA 4ZGWA 3TO5A 1E9FA 2Y6VA 2ZM6B 2W6IA 3WLQA 4BX3A 3BCSA 1TL7C 4GPEA 2A1TS 5I7HA 1JJIA 2NXNA 4UEJA 4H3SA 2MOKA 4K8OA 4J1QA 2HMVA 1RWBA 3MQ2A 3BQ9A 1HDGO 4HN9A 4QDTA 3KJGA 3VBEA 5I7VA 1AH2A 1CVRA 2ARKA 4UOQA 3COPA 4CEJB 2K6GA 3ZIAA 2JCGA 3IMCA 2PXCA 3OQIB 5J47A 2FR8A 4FWBA 5IJ0B 4Q1DA 4M38A 1G9XA 2N9UA 5L7YA 1PQUA 5JRDS 4RMNA 5FJJA 2SKEA 1YDWA 3LUKA 4PCVA 5BSRA 1O6CA 2ZUDA