4DZTA

Aqualysin i: the crystal structure of a serine protease from an extreme thermophile, thermus aquaticus yt-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
276
structure length
276
Chain Sequence
ATQSPAPWGLDRIDQRDLPLSNSYTYTATGRGVNVYVIDTGIRTTHREFGGRARVGYDALGGNGQDCNGHGTHVAGTIGGVTYGVAKAVNLYAVRVLDCNGSGSTSGVIAGVDWVTRNHRRPAVANMSLGGGVSTALDNAVKNSIAAGVVYAVAAGNDNANACNYSPARVAEALTVGATTSSDARASFSNYGSCVDLFAPGASIPSAWYTSDTATQTLNGTSMATPHVAGVAALYLEQNPSATPASVASAILNGATTGRLSGIGSGSPNRLLYSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aqualysin-1
publication title Aqualysin I: the crystal structure of a serine protease from an extreme thermophile, Thermus aquaticus YT-1
rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 97
structure length 276
sequence length 276
ec nomenclature ec 3.4.21.111: Aqualysin 1.
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4dztA00
5JXJA 1NDQA 3SICE 1Y1KE 2E1PA 1V5IA 1ST3A 1BJRE 2QTWB 1BH6A 1MEEA 1AU9A 5I9SA 4KG7A 1SCJA 1GTG1 2X8JB 3LPDA 1YJCA 3I34X 2Z58A 2W2OA 3BPSA 2ZWOA 4AKSA 1SCAA 1KDYA 2Z2ZA 4DJ5X 1SUPA 1EGQA 1IAVA 1GNVA 4CFYA 1GCIA 4K8RB 3T41A 1S01A 1SUDA 1WMDA 4LVNA 2V8BA 1KDZA 2IY9A 1BE6A 5AMXA 3DE0X 3P5BA 1GA1A 2PYZA 4NE7A 2WUVA 2Z2YA 1Y33E 4JP8A 3QTLA 1OYOA 3AJ8A 1YJAA 1PFGA 1Y4AE 4YN3A 3I37X 5K7SA 2GKOA 1SUEA 2SNIE 3LPCA 1TM1E 2ID4A 1YU6A 4DZTA 5ARBA 4B5LA 1GTJ1 1THMA 3VYVA 1S2NA 1AH2A 2PRKA 1GA4A 5SICE 3A3OA 4C3VA 1TM4E 3DE7X 1Y4DE 4H6WA 2ZWPA 3LXUX 4OMDA 3GCXA 1ZVKA 1JEAA 1R6VA 2ST1A 3TI7A 3WQBA 3Q40A 4I0WB 4CG0A 3BX1A 4KPGA 1R64A 4H6VA 3DWEX 1ZVJA 3GCWA 5AQEA 4Z2AA 1KE1A 1P7VA 4C3UA 1P7WA 3DW3X 1Y3FE 3EE6A 2P4EA 4HVLA 2TECE 1SH7A 1CNMA 1DUIA 4KB5A 1YJBA 1WMEA 3OSZA 1V6CA 2Z57A 2DQKA 1TM5E 1CSEE 2PMWB 1TM3E 3BGOS 1HT3A 2HD4A 3GT3A 1SELA 1WVMA 1Q5PA 5FBZA 3TI9A 3DVQX 1BFKA 2WWTA 4WOBA 1AVTA 5JMOA 3L1KA 2IXTA 3F49S 5JXGA 3DE4X 1SCNE 3SQOA 1P8JA 1XF1A 3D43A 2WV7A 5ARDA 1NDUA 1AK9A 3DE5X 1ST2A 1R0RE 4NE9A 2Z2XA 1AV7A 1Y48E 3WHIA 1TM7E 1TO1E 3H42B 5B1DA 1Y9ZA 2DP4E 1SBTA 4LVOA 4GI3A 2ID8A 1KDVA 1Y34E 4H6XA 2X8JA 1GT91 2G4VA 2DUJA 4WOCA 4OMCA 5ARCA 1SUBA 3Q5GA 1OYVA 1TK2A 2W2PA 1SUCA 2Z30A 3LPAA 3EDYA 1BFUA 1IC6A 3WIUA 1SCBA 1C9MA 1GNSA 3F7MA 5FAXA 2PWAA 1SIBE 2B6NA 4BWGA 4DWWA 1VSBA 2HPZA 5CW1A 3GT4A 1SPBS 3D9QX 1SN7A 3HJRA 1OT5A 3I2YX 1LW6E 2SECE 1SIUA 4ZARA 1TECE 3AFGA 2XRMA 4M1ZA 2W2NA 3PTLA 1GA6A 5AVKA 3DE2X 3CNQS 3DVRX 3VV3A 1SUAA 3I30X 1WMFA 4ZOQI 3VV2A 1TMGE 3ZXYA 1EA7A 2PQ2A 5B1EA 2SBTA 1AQNA 5FFNA 3QFHA 2PKCA 2W2MA 1A2QA 1C3LA 1MPTA 5JXIA 3DE3X 3DVSX 3A3NA 1UBNA 1SIOA 3DYBA 4MZDA 1SBCA 3UNXA 1AF4A 1C9JA 1WSDA 4AKTA 1SBNE 1GTL1 1PJ8A 4RYDA 2PWBA 1NLUA 3VTAA 3DW1X 1SBIA 1KE2A 3PRKE 1SBHA 2XTJA 3CO0S 4HX2A 2WUWE 1C9NA 1S02A 4NMXB 5AVJA 3AJ9A 1BE8A 1TO2E 1Y3DE 4OV6B 4J94A 3A3PA 3DE1X 3VSBA 1Y3BE 3WIVA 1DBIA 1T1EA 3QMPA 3ZXXA 2W2QA 3VHQA 1Y3CE 3DE6X 3F7OA 4FONA 2SICE 3TECE 1T1GA 3EIFA 4CFZA 5JXHA 1SVNA 2ZRQA 1PTKA 1PEKE 2Z56A 3DDZX 1SCDA 1T1IA
chains in the Genus database with same CATH superfamily
1Z0AA 3KYJB 2FLVA 3RGWS 2EGHA 3MWGA 5LB4A 4FEAA 3ZJTA 5DT2A 5JXJA 3R7SA 4PVCA 5KYWB 2ZQZA 1ISSA 4R3UC 3TAUA 3H0EA 2SHKA 5I48A 4LNUB 4XWWA 1XEFA 3WYBA 4M76B 1OB5A 1JHAA 2F62A 3UGQA 3PQDA 1Q0LA 3LD9A 3SICE 5C51B 4JJ7A 3T5DA 5AVSA 3RC2A 4KHZA 4WLOA 1QK5A 3GA7A 1ZMRA 4KXNA 3HBNA 5EHQA 1ST3A 3OEEA 3TDNA 2P35A 1AKNA 1ZZGA 1VSUA 2B6HA 3U1BA 4JR2A 4S1PA 2PU7A 2Q9AA 5BPHA 4S35A 4BCBA 1JDPA 2EIXA 2X2FA 3TSWA 4WBNF 1H1TA 1ZS9A 3SZUA 3W4JA 4WVFA 2EKQA 2JLCA 5D3MA 5FF9A 2HSEA 2SCUB 1OU0A 3GPLA 2Z6AA 5B1IA 3N2KA 1XNHA 3I1FA 4IEFB 4IIJB 3VZSA 4A2QA 1YOVA 1YI8A 4MB6A 1QPGA 4LF4B 3D6TB 5TE9A 4W5RA 3GEGA 2QRZA 4PYMA 3U3RA 3FTQA 4QXAA 2ZWVA 4P58A 2P65A 2QA5A 2A9FA 2XQKA 5IHPA 4ND6A 1ZISA 3R0ZA 1XKQA 2P9EA 1E2FA 2OGTA 5DASA 4OBWA 4IIFA 2FZEA 5EVCA 5C9ZA 2CXRA 2YASA 1EGQA 5AUNB 3VOBA 1THZA 1ZN2A 4NNJA 1AMOA 2HA3A 1YRAA 3AU8A 3FCCA 5J40A 4Q18A 4M1KA 2XADA 3UENA 4CEIB 1D4FA 3FGZA 5AXCA 2XVAA 3BBLA 4BO9A 1DRVA 2Z8XA 3LT0A 1T3TA 3NHJA 4HFMA 3T7TA 2NTVA 3HZZA 3LV8A 2EP7A 2IHTA 3HBMA 3KWMA 4YLEA 2ZJYA 3TEFA 5B3JA 1ZG3A 1RXEA 2HA6A 5KOIA 2ADMA 2PO5A 3U7HB 1G2PA 1UT8A 3FAZA 3LC2O 3LPNA 1PWHA 1L4HA 2FN9A 5BYBA 3O21A 2GGSA 3OMXA 4MS3B 4NG5A 1N6LA 2D3WA 2P0EA 1NBWB 1USGA 2NW6A 5CDUA 4FMDB 1LQUA 4ZV9A 1S7CA 3H87A 3K96A 4YRDA 4LKOA 3FDJA 1DQZA 1R50A 3FJ1A 1X7ZA 4RF3A 4AS3A 1NUSA 1KZYC 1Y33E 1F17A 4L5JA 1XLTC 3IKMB 5HDBB 5ES4B 1VIDA 1YJAA 5F2KA 2XOXA 3N70A 5TMDA 2IYOA 2P9FA 1W4RA 2VYFA 3HKDB 4TLAA 5IM4F 3MUOA 1M33A 3DL2A 2AV6A 3V1UA 4YN3A 2EFCB 4BVLA 3H5TA 1RWOA 3K0CC 2PVPA 4Q24A 1V43A 5K7SA 1JQDA 2GDJA 4FNOA 3GJ3A 3TIXB 3D3WB 1Q7TA 2VDOB 4P83A 4XYBA 5BQ3A 1Z4PX 1S9HA 1BMTA 4HNUA 2PZBA 1TJ5A 4IW3B 3THRA 1EI9A 3N9IA 3VDXA 4XA8A 3UYKA 1XL1A 2YH2A 4U9UA 2IH5A 2FMTA 2WFMA 4DA9A 1N2ZA 3FFXA 3U3JA 4ZIRB 4IAOA 1DHTA 1II8A 4YNBA 2C57A 3PF9A 3MMPA 4OKSA 2I2XB 4CU2A 1XPOA 3KKZA 5YASA 1FRVA 4IM7A 3K0BA 2FR8A 2XA1A 1GAXA 3ZWQA 1FNNA 1RMTA 4BUCA 4YJHB 4KE7A 1KVRA 4NL4H 4CL0A 4Y98A 1ZD2P 2YWJA 1Q0QA 2A33A 1ZUIA 2J67A 3E15A 1YVEI 4MTCA 5AHOA 5ANRB 2V0CA 2AOUA 2UYQA 3H1PA 4PRZA 3RF6A 3RRXA 1E0AA 2X5KO 2NVUA 2QSUA 2YW2A 3BWYA 1PWYE 1QM5A 4DVGA 1WBJB 2FPUA 3R3XA 4Y7DA 3UJ7A 3IMEA 1U3DA 2ZWPA 3ZZUA 2OGZA 1E99A 4PG6A 5DN6D 1FXWF 1ADCA 2J59A 2JLYA 2UVPB 4JAVC 4HG2A 1IOVA 2GCPA 4Y9DA 5AIBA 1KIMA 4MVCA 2PLWA 1U0SY 4YMHA 1SHKA 3VTKA 3FYUB 4ZYYA 3ELBA 2OYCA 1JDSA 4Y1GA 4LY9A 1ZFNA 4TTVA 2QT1A 2P9TA 1QQ6A 3FWKA 2AE2A 3QNMA 4ZOCA 2Q3HA 4IY1A 2NZ2A 3MUNA 1D03A 1H3FA 1XKTA 5FH9A 3GNSA 4J6FA 3GCWA 1PLLA 1RM3A 2X1LA 4ZFNA 3PYMA 4WN3A 3JWGA 5ALEA 3LBHA 5B53A 1ZMOA 4YRRA 2FVYA 2Q4RA 4BVKA 5DM4A 4C88A 3H9UA 5EWLA 2QN6A 3P97A 1J1IA 1OX6A 3TLXA 1TC1A 4PSVA 3WQRA 1JLKA 2XKAA 5JVDA 4G0UA 3MRXA 2ZSBA 2JAPA 2RB5A 4RZQA 2WHPA 4GXQA 4EY8A 2TECE 3IKLA 4KQIA 2C54A 4GVLA 4LGCA 4P35A 5DTRA 1IRXA 1F06A 4TVOA 2ZDHA 1UL1X 4YCJA 5DI9A 3WQSB 5E7QA 4H0FA 5EMNA 5ERXA 1FUIA 2OAP1 4OGKA 3G68A 1M34A 2KMLA 3H86A 5JBIA 1CDDA 5KJCA 5LKRA 3HO8A 4ERNA 4ZKDA 3F4BA 3U62A 3RUCA 3G2LA 3T9FA 2O8CA 3E6AA 4YRQA 1PJQA 2LIVA 3WK7A 1RLUA 4L5BA 2H1OA 4DHWA 4RZSA 1RC0A 2YVKA 1ZXLA 2GA8A 3OOHA 1ZINA 4KFSA 2CCKA 3DZDA 3LK6A 3NJ8A 3GRZA 4GDMA 3ABQB 2Q0HA 4RH3A 1A98A 3M5PA 3R24A 1LDGA 5FA8A 5HFJA 3SG0A 3Q8MA 1YB7A 4HBGA 4L4ZA 3HJCA 1UWLA 4IX9A 4ZEVA 5T4EA 1AV6A 8ABPA 3W6UA 2ABWA 2NP7A 2VAPA 5JMOA 1NVTA 1RYZA 4F0JA 1VMIA 1VSQA 4YV1A 2ZYVX 4MULA 5CPFA 1FDUA 4IG9A 3WQQA 4MQMA 3N2YA 2XE6A 4L16A 5BUQA 3ICQB 4K87A 2VSOA 4D0LB 1MAUA 4O02B 4REOA 3TYXA 4FN5A 2B21A 3I23A 4MI9A 2R8OA 5TLSA 4R2XA 4QARA 4P86A 3I9OA 3V8BA 2I7VA 3O1IC 1NX9A 4XJVA 3BF7A 3KO8A 4HDNA 4YAJA 4LYYA 4ZVMA 3KT0A 4EGFA 4DCGA 4HQ0A 1L6IA 3GAFA 2VEOA 4I4IA 5LQAA 3L8CA 4EPRA 1IN4A 2NU7A 2GVDC 2G67A 1W59A 2WV7A 3RS9A 3NVKI 2QNRA 1S8FA 3EEFA 1K0FA 1SMKA 4JB8A 3NGMA 2I6XA 4KIGA 4ZT3A 5EJFA 2QNIA 2ES4A 3CISA 4I4TB 5BWBA 2ZBUA 1KFJB 4P33A 4PYRA 1D5WA 3FM9A 4LJAA 2QZPA 3CC8A 3DCIA 3U7QA 1E2BA 2J9XB 3QXHA 4OREX 4P6VF 3R74A 1R15A 1U8UA 4DUZB 1E3EA 3B6ZA 5FTNA 2DPGA 5KTNA 1TO1E 1Y5LA 5GONF 4LF7B 1QDUA 3HUUA 2DBZA 5DT9A 1E0KA 4PC3A 3F5SA 4OMFG 1CQZA 2ILTA 2ET6A 5A7GA 3PNVA 4KVFA 3S1SA 3AKCA 4ZYWA 5A5GA 4MR9A 1YA4A 3RABA 4AMGA 2YNMA 1H4TA 2ZE7A 2HJHA 1MRZA 4ZT2A 3VU9B 1Q95A 3TH5A 2EXXA 1GGVA 4HRVA 1FW6A 1EJBA 4KREA 2NSHA 1LTHR 3ABZA 5FBQB 2PNJA 2W70A 3NLLA 3TXAA 2FFRA 5EIEA 5KJ6A 3LTEA 2V98A 3WI7A 2Z3VA 5CA1B 4GWLA 2KJQA 4DLWA 2A86A 2DH5A 1OXSC 2UYHA 1LBSA 4JI2B 3EZLA 4B3RB 3PQ2A 3NTVA 3WGOA 2IZZA 2AMJA 4MROA 2AUMA 2GN9A 4FMPA 2BFBA 3D3JA 3L46A 4P3KA 4QU9A 4WNYA 2F9MA 4BVFA 5D87A 2YV5A 1KFBB 4O3MA 4EUEA 4OHFA 3B48A 3EPRA 2BJVA 3K09C 3Q7TA 4LDNA 4EUSA 5CPBA 1C9DB 3UMVA 4CHTA 2XV1A 3H7AA 4LC9A 5ICFA 1M6EX 3OCUA 3JQ7A 1P1IA 3OICA 5DXFA 4D97A 1TCUA 2PS0A 5JT1A 1C9MA 1DPGA 3IEKA 4ITRC 2JLVA 3BCUA 3N8KA 3OURA 1FX0B 1NUPA 1V8OA 3I09A 1LI5A 2YRFA 4UNPA 3RS5A 1T0JB 4LPKA 4KZPA 3TD2A 3VO1A 4C3OB 5LQNA 2G1KA 1N2OA 1PSWA 1SUFA 1Z5WA 2ODBA 2YRWA 3F3KA 3OKPA 3IERA 2OORC 4BAUA 1MRSA 2XLCA 4A73A 4OYYA 5JBNA 3OLXA 2B6NA 3IP7A 5F2EA 5A4DA 1BDIA 4BWGA 2ZG6A 3AY0A 4HGPA 1R66A 2KI5A 1SPBS 3GT7A 4OA5A 2AJLI 3PGJA 2ERYA 2J9FA 4QG7A 5KDDA 5THQA 1PEAA 1NR5A 4ENTA 2VRCD 3OFVA 4U7TB 2ZSFA 3AXTA 2QTFA 1J33A 2Y1OA 1FMLA 1TVKB 5LQSA 4TWIA 1AKWA 5H9VA 1WCV1 2FWNA 3L6DA 3O92A 3RE1A 1DFGA 3WLJA 3OWXA 1PFWA 2NO5A 3ZCRA 3MQFA 1FMFA 3AHFA 3SWWA 3CF6R 2C98A 4K1LA 2R97A 2VYQA 4DLYA 2HGSA 3P9CA 3RTCA 2Y68A 1GPJA 2BFEB 4J16A 4DA6A 3UF0A 4M0PA 1AG9A 4MYTA 3GN1A 1F6WA 1N57A 3I58A 1DLIA 4LY6A 4BO7A 4ENVA 1JXMA 3L06A 4GPIB 3SZMA 1ZONA 3WIBA 4DMUB 3IAAA 4LTDA 1VRWA 4BLWA 1Y80A 4MRNA 1XU7A 2C2HA 2L0XA 3AOEA 3QOYA 5COAA 3SDSA 1OREA 3ORFA 4RK5A 1CUEA 2NXNA 2WYOA 1NC3A 5JZSA 1B2LA 3HH8A 4GPAA 2FGKA 2ZIXB 1EA7A 3G0OA 1E0DA 1Y6ZA 4ZQCB 4ZDJA 4IGAA 3WIOA 2ERXA 3TOSA 2R86A 3IO3A 3GEMA 4RE6A 4RVSA 5LD2C 3T3OA 2IZ0A 3LE8A 1VGQA 2O2EA 4DLSA 3AR7A 2NZUG 2ZB4A 1ZD4A 3HRHA 2VHYA 4J49A 5KYXA 2IY7A 4DSTA 1IEWA 2J3IA 3AIIA 3M4JA 2O8EA 1GYPA 4UASA 2IYAA 1UBMS 4RQBA 5KYUA 2FLKA 2JJ2D 3DE3X 1XDZA 3DEFA 3RYFA 1M2JA 1MB9A 1MJ5A 3FPKA 1NURA 4XJSA 4Z0PA 2BKAA 3D6UA 2FZLA 2ZRDA 4ZVKA 3VR6A 2JB9A 2APJA 3N86A 2XGJA 4I8XA 1W2WB 4D8YA 4X1KA 3LYLA 1RLIA 1AO3A 4IFIA 1LBIA 3B1VA 4S0ZA 2AFIE 3ZHSA 1XQ6A 5BSVA 5ULLA 4WXEA 3RUFA 1A9XB 2YIJA 4A27A 4AECA 1IY9A 2JAOA 3AFMA 4AKTA 4QJ3A 3I5UA 2HPVA 5FAKA 2QL7A 1OLOA 3GWZA 4CTMA 2I66A 2AVDA 3EZ2A 2IEZA 1PJ8A 2OWEA 1G8KA 2ZSEA 3IIJA 3C6YA 3DGEC 2DY0A 3ZI4A 5CNKA 4ZAWA 1COWA 2P9CA 5FWYB 4GNRA 3R3VA 1UMKA 1PVVA 3D02A 3E61A 3EBPA 3KOUA 1RABA 5KTTA 3ME5A 5J23A 2WABA 4YUAA 1E94E 3ZJYA 1PJBA 2G9UA 2C5BA 5KTKA 1G63A 2RK3A 4O4JF 1ULSA 3PGMA 5JD4A 1X7YB 4JLAA 2P7HA 3C48A 3PUHA 4F3NA 3G2QA 2XWBF 3VPXA 4C7OB 2B35A 3AR3A 4D4LA 1QP0A 3EXIA 1WCYA 3TOVA 3H11B 3VZBA 1F4LA 5MDHA 4ZN6A 3NNNA 1VB3A 4NDNE 3IVAA 4YUXA 5CBKA 4MNTA 4EYQA 2FP3A 1V8ZA 4DNPA 4LXGA 2IS1A 2HYDA 3CU5A 1TUIA 2R84A 2VAVA 3OJLA 5JCJA 3CR7A 4L78A 2WIDA 1YFKA 2NYAA 2ZJ1A 1O0CA 2JHCA 5JDIA 1GTMA 4NZYA 2J3QA 2WDZA 4MVJE 1IPHA 2MSLA 4MIEA 4R1PA 1P3JA 3VR2D 3WK5A 1XZAA 3MLEA 4D8XA 4ZQIA 3TGPA 3DNMA 1X3SA 5JQGF 1HE4A 3AEQA 1T0HB 2QM7A 2OV3A 2ZUWA 4XQCA 2FLWA 5F77A 3L6UA 4MV0A 4D9IA 2RD2A 3CHYA 1J0XO 5KSPA 1Y3BE 4QYXA 5TJHA 3VVCA 4ENUA 2MWMA 3T35A 3ZLUA 3T7AA 4OXQA 2IHKA 2AYXA 1X8KA 1PJTA 3HJBA 1WDMA 4H17A 5CA0F 5KIAA 1KMIY 1T1EA 4A5SA 4BQOA 1UOEA 1G7TA 2B1RA 2VXCA 1NN1A 3FNGA 3QHQA 5DWDA 3O84A 3P9NA 3INTA 4MYUA 5G0SA 3ZI0A 4MMYB 5LYYA 1MFZA 2JFFA 3B6KA 4PAMA 2V0GA 3SR0A 3VFDA 1BQ4A 1PG2A 4DCUA 2ZW9A 3QY0A 4J4BA 3A3KA 3TECE 1L3IA 1T1GA 1C14A 4QBFA 2JZNA 2QTNA 1IZ7A 1W76A 4OATA 1Z4JA 1NVMB 3ZV4A 2I1VB 5HK8A 4EGQA 2DUWA 1Y8RB 3GGCA 4BN0A 2XZOA 1YQ9A 2PS1A 1NPTO 1A8SA 3BFXA 3ZWKA 1KEWA 1ZD1A 4O8ZA 4J1SA 1PW7A 1F8GA 2JIOA 2F2TA 1RI1A 1EEHA 2DLCX 2F9FA 2ZR9A 4J6EA 3NRCA 5AXAA 5C5IA 1MIOA 1PBTA 1Q0SA 4QJIA 3TZBA 2P4SA 4J29A 6AT1A 4XLTA 3UPUA 3AHHA 4ZXFA 4GW3A 4A8JA 3VZDA 4Q1BA 4FYJA 3VC7A 1DXHA 4J7UA 2EV9A 2H2WA 4DCOA 1Q0HA 4AZ0B 4KL8S 1K9VF 5CDHA 5KVAA 2VSFA 5C8YB 1W30A 4LK2A 2GARA 5FBWB 3WFIA 3UEOA 3V97A 2CF5A 1P1CA 3X3HA 1CF9A 1OZGA 1HE8B 1B42A 1QB8A 1JXQA 2F48A 3INYA 3NCTA 3IPRA 2BH2A 1YZUA 1H2EA 4KUHA 1VFPA 1D09A 1N2JA 3S0JA 3LS2A 1LS6A 1MR3F 5AI8A 2PL1A 3ZIAD 1RM4A 5CHYA 2X2EA 3DZJA 2PXCA 1AU9A 1U8EA 1V3UA 1I10A 1MC5A 3BVPA 4UE3S 3OFNA 5D2CA 1E9RA 3NRJA 2IOFK 1A9RA 5CJJA 3V7NA 2CGEA 2EHDA 1PR4A 4FZJA 4EHKA 5KQRA 1N0UA 3N7AA 2ZSAA 3S2IA 4OJNA 3ADKA 4ZVRA 2A9KA 2NU8A 3UK7A 4KTVE 2GEVA 2YYYA 4WFIA 2GK7A 3V8EA 2ZJ5A 2NO4A 4Q3OA 4NBRA 4QYTA 3MSCA 4KRGA 5B3LA 5BWOA 2W6JA 4M1EA 3ZHTA 3CLKA 4FILA 4YB8A 4D8VA 1TO6A 2EWVA 2XNSA 3O3CA 4FHGA 4W1SA 3PU6A 3UQZA 3VDMA 1D4OA 3MOGA 3DBRB 4BNNA 1JHOA 3UOGA 2KS6A 4EKGA 2XCRB 1J8QA 1T8RA 2OBMA 4U7FA 1TUBB 2D00A 2ZAIA 4JR1A 2F1KA 1YOBA 1U5CA 4UTVA 4N5HX 5SY6A 4YMSA 4QODA 4FDTA 3TZQA 5TPWB 2YZKA 4GOXA 2H1LA 5CB4B 1KNXA 5E9WA 1H69A 3QNUA 3GLVA 1TYZA 4ZV4A 3OE4A 2C7QA 521PA 3UXMA 3NHUA 1BVHA 1QTRA 2I4TA 2JHGA 4MJ7A 1YE8A 1FXSA 1O8BA 1SVOA 3X1KA 2X1MA 2DWOA 4BQPA 3FUXA 5T4FA 1P4RA 3PSHA 1R4NA 4K9SA 1OOEA 4Q01A 3WDMA 1QH9A 4C21A 3ITNA 4L4XA 4RKEA 5I7AA 4B3FX 2Z4RA 1UMBB 5T4BA 3VJLA 2IPAB 5LCXA 3ZE7A 1SUEA 1RXVA 1R9NA 1N9KA 3P2JA 5CT5A 3R5XA 4WFKA 3FIUA 1I3KA 5LD2B 2HU5A 1JAXA 2PQ0A 4JP5A 2GYVA 2WJGA 4XGQA 2VTBA 2RGNA 5FNVB 2O1EA 3C3MA 1XE3A 5E6SB 1IXZA 4X61A 4TV9B 4A03A 2PH5A 5KPDA 1WXWA 4OHYA 1QGUA 3EN0A 4B5LA 4O1MA 1GTJ1 3JW8A 3M5DA 4NZZA 4B0PA 3BEDA 2P9BA 2VJNA 2O52A 1XEXA 4EAAA 5ADVA 5M7EA 2Q4EA 2FY8A 3NHZA 3KTOA 1I2ZA 1FTGA 2OSBA 3PZRA 5H4GA 2X9GA 5HOEA 1PQ4A 1OHHA 4HMPA 5FLEX 3I4CA 3AZOA 4C7VA 3UUEA 3FGNA 3NWPA 1KMQA 2JFZA 1P5ZB 2O1WA 3GJ8A 4Q9NA 1FY2A 1PZGA 1AK1A 4KV9A 4UTPA 1OZHA 1P9WA 1EDEA 4DL9A 4Z99A 3AR5A 4AZWA 1R74A 2X9NA 1Z5ZA 3RRYA 3IV7A 3AJRA 3REFA 2KLBA 2RGXA 1Q57A 1OLSA 1EAMA 621PA 5D6NA 4BKPA 4R9NA 2P6OA 3AM1A 5CX1A 3IEPA 4KGVA 3GP8A 1EBFA 3A1DA 3BMNA 4BLVA 1ZY2A 1T2UA 2W6MA 4IGFA 4MQ6A 4RD3A 1FA9A 1YGYA 2XUQA 3FOCA 3LF1A 1WXIA 4NH4A 5DBFA 5ADWA 1JVSA 3TI7A 1NF8A 3CJTA 3TKYA 3IGFA 2ISSD 3AV3A 1MTZA 2YWFA 5A5EA 1XRRA 3ZZNA 4CG0A 4NE2A 2CXXA 1IEQA 5TVKA 3UB3A 2GXAA 1XPUA 2WUGA 5FOXA 4CETA 1UZNA 5I8ZA 1X92A 2OCIA 4WLEA 2FNAA 1TB4A 4PNEA 5DE3A 1YFLA 2VO1A 2P0YA 3GQBB 2H7YA 5LYJA 1I3NA 2B25A 4DPMA 1V3QE 1JG6A 1ZA1A 3TL6A 4EDFA 1SXGA 1NXWA 3PQFA 4EG1A 1G5QA 4ZRDA 5IK2D 3NAZA 2O8FB 4MDHA 4B4WA 4Y2JA 4A2PA 2ZIZA 4HDCA 2AYYA 4GC9A 2GM3A 1CNMA 1XYYA 3BIXA 3TJZA 4FEEA 1HQDA 4MP3A 4O29A 2LE0A 3KSRA 4U1RA 3VH3A 4H7PA 1CQIA 5CR9A 1AKQA 4OXIA 2GAIA 4UBMA 1P2TA 3REQA 3RYHB 1VRCA 1NQVA 5E4FA 4OL9A 4QSMA 3E2PA 4JJGA 1VHJA 1PQYA 2C4NA 3WBJA 2PMWB 2WSYB 3CXUA 3DKRA 3RVMA 1BOOA 1XMJA 2QX8A 4UCQA 2QZ4A 1SB9A 4HQKA 5KTMA 1XOIA 3E1SA 4AYTA 1WVMA 1WP4A 3EGCA 5KKNB 3NALA 1G38A 1S8OA 1ZJ6A 4CLOB 4ZMRA 2H2DA 1EVIA 2FMFA 4HHEA 3U48A 4DN6A 3DAGA 1FDOA 3SVLA 4ME6A 5H0IA 4AJLA 4RDIA 1PV1A 1E2KA 3A1SA 2CNLA 5DHPA 3KKEA 1RJ9B 5FR2A 2P8SA 5CXQA 1HRDA 2C8VA 2F8MA 4GLLA 3VKFA 4Z1OA 4NARA 1P80A 1BXRB 1FSGA 2YDYA 2EBHX 1Q3HA 3B3FA 4BMZA 1UEIA 1FCJA 2FSVA 2WWXA 3OQPA 4R05A 3LM8A 2PRIA 1UDXA 1N78A 1UH5A 4QDOA 2BEWA 1JA0A 1PUIA 1Z4NA 2ON6A 1UPXA 1NJFA 2C99A 4ND5A 4FBMA 3PCXA 3UH1A 1EH5A 2P2LA 1X3LA 2YN4A 1X15A 1U0EA 3PR1A 2IU6A 1WB5A 4J7CA 4PPGA 1V1JA 4YFVA 3EOAI 4KFTA 2GPBA 4G0VA 4AWBA 2W8BA 3V1TC 3LNTA 4R51A 1T1RA 2BRUC 3W5HA 2N46A 3OPMA 2GZMA 1EXDA 2BIFA 5TJ9A 2H5IA 4JBIA 5IMBA 3DWIA 1OV6A 2EJTA 1L5SA 2HDWA 2Z2XA 3V9AA 5I3CA 1X1CA 3BMXA 3BXFA 4CM4A 2SKDA 2VF5X 3Q4GA 4L0MA 3UHFA 2C4VA 4FGLA 1WTAA 1NUAA 3BXHA 5C52B 2A1UB 1HDGO 4RTMA 1N0WA 1MORA 5AW1A 3BH6A 1EDBA 3VGJA 1V6AA 3IOCA 2GS9A 4KYTA 1LDBA 3K8QA 1IMOA 1X8JA 2X19A 4GPZA 2F17A 2FW7A 3TPCA 3WLMA 2BP7A 3GRYA 4HLUC 1Z2AA 2E37A 3A1TA 3CT6A 3PRJA 1FVOA 2O7SA 4G9EA 1RSZA 5KQPA 2XUOA 1K66A 3IAUA 1XZPA 2V5UA 3BYZA 3JQBA 4LQ4A 4LRXA 4LOKA 3CWQA 4WGFA 3ACCA 5T57A 1D7OA 4CHGA 1KL7A 3N5CA 1D04A 5BN5A 2NXCA 4WUVA 1AT1A 2VI5A 2ZCUA 3HG7A 4KUEA 4CI9A 3KKQA 1JJFA 3SZRA 2IVFA 2VJOA 2YKGA 4UU1A 2Z9BA 3PQEA 4N7JA 5E9AA 4ZRMA 4ZCQA 3DV0B 1H8EA 3OZXA 4IV8A 4MQFB 2M6KA 4I6JA 1CD5A 4ZD6A 3TMKA 5LZ9A 1PJLA 1IL0A 1NP6A 4B4OA 3EFOB 4CL2A 2PR7A 3FLBA 1VXRA 4HZUB 3CLVA 3W1EA 5EA2A 4A6DA 4XSGA 4BYMA 3B5EA 4TX1A 3B7PA 3G82C 3Q11A 1AE1A 3RWMB 3H8JA 1P44A 3RANA 3ET5A 4A8HA 3L49A 3CUEF 1FYVA 1OWNA 1PVDA 2BFDA 2GK3A 2GQ0A 4I6EA 4MW4A 2O8VA 4B6RA 2MINB 2JGDA 3HR4A 2PUVA 3F7MA 1J09A 4UAVA 1Y3IA 4CLRB 4F6RB 4Z1MD 3WKDA 2PRZA 2I2WA 2OHGA 1LDYA 3BGSA 2PWAA 1Q19A 3K2EA 2ORYA 4V2IA 5FAXA 3HYCA 3D6FA 3FOWA 3S1AB 5HZKA 1JW9B 4QGFA 4PZYA 1JX6A 2E5FA 2C07A 2Y6UA 3I6IA 3PXDA 4QUAA 3DD5A 2AQHA 1DSSG 1MAAA 2HSWA 4TWBA 4F4HA 2XI4A 3PD1A 4I5EA 2AZDA 5LQKA 2J3HA 2F4NA 1WUIS 2R1TA 3E9DA 3Q88A 4XX1A 5AJXA 5FCDA 5FT9A 1AXRA 4EW1A 3WBBA 2PM8A 2IV3A 3BTVA 3HFRA 2BUCA 2JRLA 3PPWA 3WNQA 3T5AA 1L4KA 3BB1A 4L8FA 3GP5A 4G01B 3Q2IA 1KETA 1YS2X 1XQ9A 2IFTA 3LT2A 2Y0BA 3PRHA 2JVJA 2QQFA 4RWEA 5AP9A 4EFLA 5MN6A 3FHJA 5FPTA 1N2SA 2XRMA 3GJ4A 3IEXA 4HS9A 1IHDA 1L9KA 3ACDA 1MN6A 1UOPA 1BA3A 4AAYA 3T38A 5HQTA 1EUCA 2RH5A 4HI0E 4L6AA 4O4HA 1MDFA 3GXOA 5SV2A 5KWSA 3E3OA 1JDBC 4FYPA 3HP1A 3K0AA 2DWUA 4NAUA 3QWBA 2PLRA 3JQ8A 2VSQA 2PYIA 2CK3A 1ZC4A 5HIIA 1KQPA 2VP5A 4MUJA 3WQHA 5FUBA 3TIVA 4M1WA 4UTOA 1JG4A 2QPOA 3HB5X 2FG6C 3QEMA 1C8VB 3TM5A 5KYYB 2E6UX 1RI3A 3LGAA 4V0ME 1WVGA 3B1FA 5D8DA 5DX8A 2XUDA 4RHTA 3DMHA 4U4AA 4WD3A 2JGIA 4DIDA 1DKPA 1KVQA 1K6JA 3OT1A 3FJOA 3I52A 5T6MA 1PYOA 2JLBA 3K0FA 1NW8A 3WWPA 4AULA 2PS9A 2Q1SA 4D56A 2PKCA 1A7JA 1Z4KA 3ON5A 5ALPA 5AM1A 4E11A 4ZTZB 2O9JA 2ODQA 1GNPA 3O2QB 4OQXA 2WAMA 1A2QA 1A4RA 3PUXA 4A15A 1A5BB 1CZLA 2FPRA 3PUIA 3SHVA 4BNDA 3F5QA 4P54A 1KQNA 1MT0A 3KQNA 1K89A 2GCOA 2AOTA 4KI0A 5DWVA 1Z2OX 4BY9E 1XCLA 2PX8A 2XBLA 1YC2A 3HBJA 3S27A 2ADFA 1ETHA 2NAPA 4XTRA 3PDJA 3QU2A 1HY3A 5JTTA 1WNTA 3RUHA 3RT1A 3SI7A 1KDRA 1O9BA 3RASA 4YI5A 1OQAA 1JH9A 2L2QA 4R1UA 4YPFA 3I5AA 1B1CA 1E92A 3OZTA 4GLBA 3AZQA 2GTIA 4CF3A 1WNFA 1KAOA 2C04A 1C9JA 2HZBA 3FPJA 3DS8A 4B4UA 1I2AA 1OH7A 1KH3A 3MLBA 4XAQA 3Q8XB 4LMPA 1IWBB 3A9VA 3GGPA 5DGTA 4QU5A 4CL8A 5DGCA 5FLKA 3RUIA 3T1OA 1HL7A 1W5FA 4F46A 1OBFO 3HL0A 4PO9A 1KYTA 3HB9A 4Q3DA 4QUIA 3WDSA 1RQ7A 2GR9A 1UFOA 3PEVA 4FJ0A 4AKHA 3DW1X 5LN1A 1CJBA 1E2IA 2CDCA 3HB1A 1EWYA 4G0XA 1X14A 1WW3A 2R68A 1SBIA 1G5TA 4GQIA 4Y67A 1U8TA 3MINB 5HF6A 5SYNA 2OXTA 3TSOA 5FUWA 3ROEA 5C5CA 1ZHHA 2ZS7A 1O9GA 2D0PB 2W9XA 2FI1A 1RHKA 1Y5RA 1OX5A 3QVGB 4HJRA 1DI0A 3IC5A 4AN4A 2PZKA 2Z98A 1HE1C 1N5LA 4MVJD 5KHAA 1UUFA 4LQDA 3WL7A 2XDYA 4TWRA 1J7JA 2HOQA 2RK4A 4PCAA 1GY8A 4IIDA 2WJVA 1T2EA 2ZSKA 1KDOA 2H1CA 4COKA 2H18A 1NP7A 4N01A 5J47A 1F2UA 3KTDA 2WWYA 3CUVA 1HE2A 2QP3A 1ODLA 4NABA 3B7WA 2I4NA 5ADUS 3DFIA 4OP3A 3NNDA 2IS4A 3GJTA 5K0ZA 2QLJA 1V6SA 3DOEA 5IARA 2J7PD 4MV5A 5AJUA 3CLRC 2A1TR 3WIVA 1N5KA 4D4IA 2RH8A 3AO0B 1JYSA 1H2WA 5FJJA 3ZBPA 1EJ6A 3OVMA 1UPAA 5AKXA 1RWPA 1KKLA 3RTAA 3NBUA 2CXPA 4K0KB 1GCOA 3NDJA 4W63A 1MGPA 4G5XA 4HGYA 2W22A 3RADC 4LN1A 1QIKA 4K03A 1T9KA 3NHWA 4KFRA 5ICEA 1W52X 3EGIA 4D99A 2P9JA 1VYTA 3RO7A 3QUQA 3GVHA 2LCFA 2GBFA 3NYWA 3WGLA 1GFSA 5T3UA 4KWHA 3ZX4A 3IJ5A 3P0HA 1DBSA 1Q17A 1RQXA 3D2BA 2X8AA 4TMKA 4TRJA 4C6RA 2CLCX 2O23A 4CTKA 1FVFA 3CVYA 3RTDA 1HFJA 1IHOA 1NLFA 4FDUA 3CLRD 1I0LA 1KEUA 4I2NA 4EFNA 4EEKA 1U4OA 1F1JA 5JADA 2FMXA 4B5KA 4F1JA 1M6NA 3QWHA 3BMQB 1XDUA 2WJ3A 3LCUA 4JL6A 1GSOA 2R11A 4DQKA 3LY7A 5K3DA 1VLLA 4FYYA 1XTVA 3TZ6A 2YOHA 1CR2A 4G3XA 2PMFA 1SY7A 2Q99A 4U9HS 4G0NA 4XUEA 3SN6A 4GZ6A 4K6GA 3U37A 3DT6A 2F3QA 2P75A 3BMCA 3WYCA 2O48X 4ESOA 3ZJVA 1Z56C 3Q7EA 4P4GA 4X64B 3HYRA 4NENA 3ADDA 1MABA 1CK4A 4L9RA 5BSFA 3B9PA 5IVIA 5KINB 3A9CA 2NX2A 3GYBA 1KIAA 2JDID 1CF2O 2JPDA 3QXJA 1D2NA 4N41A 2HLDA 2CLKB 5HE8A 3CG0A 1NMZA 2AFHA 1GFWA 3ENWA 1FBNA 2ZPUA 3NHPA 4M36A 5JNWA 2ZKIA 3F6CA 3C85A 2BDTA 5IJAA 3VR1A 4YCCA 3N6XA 3R7LA 5EWJB 4ZT4A 3DPUA 5LXTB 1U9ZA 5K0LA 1Z26A 3BA6A 4XTCS 1T34A 3QJGA 2DB3A 4KAXA 1PVOA 2C2XA 4IJKA 2ZYRA 3S29A 4EGSA 2WSBA 1OWMA 2X7HA 3T9EA 3K1AB 1QOPB 1SCUB 2J0EA 3AEYA 2Z58A 5EZYF 1KOLA 3RS0A 3EQ2A 5CNJA 1G8PA 4QDZA 2E85A 5JZBA 4NBTA 3PNPA 4BCDA 4FMCF 4LOAA 5GMOA 3SS7X 2YW9A 5D1HA 1MOZA 1SUPA 3DB1A 2ZUVA 4IUYA 1B73A 4E31A 4WLUA 3DMGA 5KPJA 3S1LA 1EFVA 1YTLA 1HORA 2Q2QA 1LW7A 3R5JA 4KQXA 1G2IA 2DOKA 4CMIB 4EY5A 1X7HA 1E2GA 3GARA 1OVMA 4FW8A 4M0KA 3EBLA 2VOJA 4DM3A 4B3BA 2AC2A 1RRPA 4RH0A 1EQUA 4S3MA 4GYYA 5CNMA 4FYWA 3GJYA 1IOWA 3JQ9A 2H65A 3H13A 1U7PA 2XYPA 4X63A 1LK5A 2GAJA 2HJGA 3DTVA 2IU0A 5IYZA 5BURA 4Q47A 4ASUA 3OTGA 1JDBB 5GM2A 1J00A 2Q8QA 4O4LB 4O4IB 2FPGA 4NIMA 2CFTA 5DNVA 3RS2A 1VE6A 3PCTA 2BR3A 1G16A 4JP8A 1NBIA 1P1KA 4TLCA 2QMQA 5AHWA 2DWPA 2VYVA 3P2IA 4H7IA 4BMNA 4QOGA 4MWEA 2YVUA 3F3MA 4H2DA 1A2BA 3HDJA 3DZFA 1TW2A 3DKVA 3PFHA 4QBGB 4TSRA 3B85A 1ZK2A 1U2EA 1QF7A 3I37X 1HT0A 4C08A 3CUYA 3VHLB 1D1PA 5JLJA 4KAFA 3QHAA 4JVMA 3L4BA 5L95A 3C4VA 3I9KA 1YRHA 3TG8A 1PAUA 4XPIB 1CJVC 3VR6H 2J30A 1YBMA 4R8MA 5EGSA 5LC1A 3GNQA 3NZEA 1KK2A 4HDSB 4JWTA 7ABPA 2QY6A 2CDRA 4QDTA 1KY5A 3HZHA 1MKYA 2YJ5A 4FDMA 1S2DA 3PNBA 1U2QA 2NO6A 2GJ4A 3NEYA 5A7FA 1K7CA 3KOZA 2FK8A 5EP1A 1HC7A 1YJ5A 5AVRA 2CLDX 2AK3A 1AH2A 3JRWA 1NXOA 2QLTA 3O4HA 2NU9A 3G2NA 3UHPA 2RCYA 2FMIA 1ENYA 2V8OA 2FQYA 3DM5A 1KTVA 4Q02A 3JQAA 2XD4A 3JYHA 4YBZA 2CL5A 4EECA 2WWRA 3RFCA 2X0IA 2ZIAA 3D6JA 3KVOA 2ENUA 3HYTA 2FK7A 3MJFA 2YWHA 1EVZA 1BDHA 2VHQA 2GJ9A 3RS4A 1YVDA 5KOJB 4DPKA 1PX0A 3TQFA 2HAEA 3ZE8A 2YXNA 2GZ1A 5JJ5A 3CWCA 4YC7A 1EIZA 3MTIA 1G55A 2GNPA 4EO4A 3WYDA 3SC6A 4JSTA 1P4AA 1YU9A 5ICCA 3NTUA 5CLQA 1DEHA 5AOAA 2YXBA 1LVUA 2ST1A 4HRYA 4OJYA 1V11A 3P9IA 3I32A 1TLTA 4K86A 2OV2A 1RCUA 2VAXA 4IGIA 3S2ZA 4CKEB 3DH0A 2V1UA 2NT4A 5E7IA 4WNAB 5SZKB 5BOSA 1ZRMA 4YR9A 5E9JA 1JUDA 1QDEA 1RWQA 2B99A 2LCIA 3DZGA 4KC0A 3CX6A 3GGJA 3HC7A 3S8EA 3EPJA 3NV7A 1DOHA 1SR8A 2H48A 2MTBA 2I6GA 2OWDA 3JQQA 3ICOA 4JQOA 4PAWA 1A9YA 4G1VA 3FKSA 1W5AA 4PAQA 3JTEA 5G02A 4M87A 4I81A 3IJEB 5BW6B 2QKYA 1EFRD 1JDNA 2ZBGA 3EDQA 2BBWA 1HEIA 1W49A 2J6IA 2P4EA 1BS1A 3F1LA 2J7KA 2ZXFA 3HQ4O 5A0VA 4MA0A 2GEFA 3I72A 1Y82A 1XO1A 5I9TA 1XL0A 1RIFA 4A23A 1N33B 2VZEA 5IAKA 4TUYA 3UAZA 2XCSB 2WP0A 4PPQA 1E32A 1XV5A 3A2MA 3ND9A 4EB6A 4DMRA 3I12A 4R3NA 1TM5E 2VIIA 1X8LA 3Q3VA 4KQGA 1DIOB 1AKRA 4M38A 2WTNA 1LXCA 4N6NA 5TQVA 1L5KA 4LV6A 3OIDA 5FBRB 2FSIA 2GXUA 2AG5A 2XODA 5DYYA 5D5HA 3KYDB 4UVIA 5JSFA 1HT3A 1RCTE 2ZJFA 3LDAA 5KVSA 2I1LA 3TQRA 1BWRA 4GIBA 3T1HB 2HN9A 3HVUA 4BFXA 1W93A 1QFYA 1DKMA 4RXMA 2B7BA 1YTUA 3MRTA 1EIWA 3SYTA 2J32A 2I6SA 3RJTA 4TV8F 3T3IA 4OHZA 1ONNA 1YDMA 4WOBA 4IWNA 3RG2A 5EXXA 4QEKA 1A9QA 1CE8A 2HIGA 5EE1A 5JSYA 1AVTA 1GUBA 4AZTA 4MUKA 2CKMA 3ZDBA 3HABA 4EBFA 4WINA 4WZZA 3BBPA 4MPRA 4LZJA 3TM4A 1OJLA 2VK4A 4MINA 4Y9SA 1UAAA 1QO0A 2XUJA 3JCZA 2I2AA 3LRPA 3F49S 3JD3A 5EERA 4HYQA 3VSDA 2GO7A 2LKCA 3T9BA 1S4QA 1UZUA 3BIJA 1L1FA 5DEIA 1UANA 2DMRA 3T1TA 1HNWB 1A9SA 2BELA 4LIPD 3MQ2A 2VDMB 5K8CA 4NJMB 1N2GA 1IIBA 4MITA 1F2TB 1WQ4A 1CY7A 1M2EA 3ZW8A 5JH7F 2EFYA 2GAOA 2I0FA 3IQXA 5MF6A 2ZSHA 3PENA 1Q12A 1X6VA 9LDTA 4UDXX 4ZCIA 5FIUA 2JBHA 4QA9A 5LZ2A 1YKGA 2IL1A 1UKCA 1OB2A 3VU0A 1K08A 2JCYA 2HMAA 4HS4A 2CZGA 4UEWA 5DU2A 2VSXA 3RIMA 3W5UA 1KK3A 1TYCA 3CQ9A 3ONVA 4A6XA 4JIGA 4DJAA 3HEAA 5A5DA 1J0DA 2OC9A 1JTEA 2OQVA 3TB4A 1GADO 2XEXA 1XMQB 3AWDA 16PKA 1VKRA 3JYQA 5BSHA 2EZ8A 2JLQA 3TRHA 4AMYA 4G5QA 1KQGA 5B1DA 1EHYA 1DGQA 1V48A 4MUBA 1WKVA 3Q12A 2UZIR 2V9CA 1TF2A 3NC0C 4R01A 3KFLA 1VBKA 4J3FA 2YUTA 1H5QA 4DXDA 5SZHB 2V7EA 4UOQA 3AL3A 2PVSA 3R9KA 3MWFA 4C0JA 5ALMA 4FOPA 1M1YB 1L0BA 1XLWA 2CBGA 4H6XA 4ND8A 3GW8A 2VDPB 4IIYA 4QUDA 4WTOA 4DUGA 2ZRCA 3PFNA 4IUBS 2G4VA 2R44A 4G07A 1R6AA 2ZETA 4RKFA 6LDHA 2CF6A 1NONA 3F6PA 3QPVA 2ZJ3A 1K6XA 1DC5A 1W0JA 1BRMA 1EQ2A 5ENVA 1JLLB 4MI6A 2FAXA 3FMIA 3TLYA 2DPLA 2Q46A 3OX2A 4HZGA 5F2NA 2G7ZA 2OP1A 2B92A 3OAAD 4V3BA 4INPA 4DZZA 3PFWO 4PAOA 2FJ0A 3HDYA 3M81A 3QXSA 1IVNA 3JYOA 1UBTS 3IX7A 5DK6A 3DDSA 2I80A 4DSUA 1A69A 1QKKA 1IEVA 2I7TA 3DHVA 3QMMA 4U39A 4DJJA 3FJYA 4EMSA 4KVAA 1Y4UA 3NHLA 4AJPA 4RFVA 2GRAA 1U31A 3B3QA 3JR3A 3MTAA 4GKVA 4BPRA 4YACA 4TT3D 1PE0A 1BXZA 2G80A 2HPAA 3CE6A 1BEZA 4TL7A 2JGLA 1EINA 3INGA 4EFKA 4MS4A 5JCOA 1T2AA 5ECGC 1PJZA 3B78A 2E4UA 5EP2A 2X42A 4QJ4A 5L53A 4XFDA 5CM9C 1AF7A 3RC7A 2BGRA 5EIFA 1GPMA 1X80A 2FWAA 1T5OA 2JJMA 1FU4A 3KV1A 3ZNQA 3AVQA 4BO8A 1ZBQA 5HZGA 3OQNA 2BSQA 5LLTA 1VM6A 3CX4A 3SX0A 4E08A 5TMEA 4RZXA 4XI9A 4HNHA 4D4JA 4FOLA 4GX0A 1DG3A 4EB3A 3TLZA 3OIGA 2P3LA 4M0UA 1QWOA 2AE1A 2J45A 3BN3A 3L0DA 1F7VA 1BHO1 2WUFA 3GI1A 4NYIR 5I51A 1NQ5A 4EK9A 3H1BA 5KNBD 3T15A 3OE7A 4EH1A 4BMXA 1F4VA 1INLA 1YE3A 2MIIA 1H4SA 2Z4TA 2O14A 2UUCB 2Q0XA 3LY9A 2LWIA 1H2FA 5REQA 5AUOB 2Z6QA 4KNYA 1L7MA 3HKEB 4NV1A 3LAWA 5KWIA 1IVSA 4C4PA 4JI8B 4EEZA 4W5TA 1AQYA 4TPKA 3CSUA 1R9JA 5B3AA 4F86A 4XR4A 2V96A 5AVKA 3A6HA 3CNQS 4NV0A 1ADYA 1FS5A 1PNTA 3N74A 1IQRA 2R7MA 3ZV7A 1L7PA 1VPEA 1NN3A 5EKXA 3ZU5A 1B76A 1ZGCA 2AH5A 4ZOQI 3AIOA 4LE1A 3PE4A 4RX1A 2B4KA 2CXOA 4D9MA 1Q2UA 3Q7QA 3UPTA 3IURA 1HYEA 3HLYA 3P19A 3IFSA 4RFSA 2BZGA 4C4TA 1FFHA 3RSCA 1X70A 2JFBA 3F78A 5EC8A 3S81A 1O0BA 2WU4A 1P5FA 2SBTA 1J07A 1KKUA 3ZQUA 2R00A 2RBKA 3EDOA 4UXHA 3JVEA 1HZZA 1V0JA 3M34A 5EE3A 2JEOA 3U9SA 3WNVA 5C80A 3U3KA 4Y1FA 1DWUA 1U04A 1P0PA 4V3CA 5IHXA 2D2IA 4QIHA 2XOKA 5AVVA 4AMVA 1N3YA 3OT5A 2R1ZA 4LQLA 3L7NA 5IH3A 4XYLA 3M6UA 1ORDA 4RDCA 1VSTA 2XAUA 1MW9X 3JAWB 4DQ0A 5J2UF 1JMVA 2IUTA 2OVBA 2VWGA 3T7RA 3TE7A 1W4BA 4PQRA 1KFEB 5KQSA 2OV8A 3FUVA 4OFZA 3UYLA 1OI2A 2CMDA 4B6JA 3D0KA 4GR9A 4MZDA 3TOCA 1Y7LA 3WZMA 3PHLA 3KWJA 5C4GB 1RRGA 1NUHA 1SBNE 1SVUA 2ZRJA 4GBGA 1Y1LA 2AL7A 1WXQA 2ZWMA 5JZMA 1UBSB 4FM9A 3FPEA 4YJ3A 2D7JA 4BP1A 5IX8A 1ZGAA 2O59A 1NYRA 2EBFX 3K0HA 1D2RA 4FIDA 4E21A 2ZI9A 3H5RA 3H04A 3PITA 1GSIA 4CDMA 3H9QA 821PA 2IP4A 2WFLB 4B2LA 3TDMA 4NU5A 3KBOA 4ETIA 3LKZA 3PUWA 3DOFA 1JBQA 3ZCUA 2QD2A 4C06A 3G8YA 2BVNA 4YMUA 4NZPA 5L40A 3NYQA 3M4XA 5L7WA 1BAPA 3TTXA 2OCGA 3WADA 4V1CI 4JROA 3FSEA 1XVLA 4XYMA 3CNEA 1E2JA 4BV9A 2J33A 1Z5GA 1T24A 3MBOA 5CW2A 3GGGA 5F1KA 2P7IA 1UWKA 1Y3HA 2AR0A 2YOGA 1VJCA 2Z2KA 1XU9A 2HRRA 4MUXA 5B3JC 4EW6A 2KYRA 3AEZA 2RJ3A 3NEAA 4G24A 2ZANA 4E0BA 3EVTA 1FU8A 6YASA 3G2MA 1U63A 5JNSA 3ZE6A 1EP1B 1BXGB 2XIQA 4XWGA 1RRKA 4ILEA 1N36B 2PGNA 4B1FA 4DKJA 2ZRPA 2HMUA 4CEHA 1A97A 1POWA 3NIFB 1WV0A 3CRNA 5IZCA 2PA0A 2WAAA 3ORRA 2D5AA 2H7XA 3LLMA 1RACA 3JTMA 4EABA 2Z95A 1JPVA 5J43A 4IS2A 3ZZ0A 3K6SA 2X23A 1GQSA 3GJ0A 1RWVA 3B60A 1JLRA 2YIVX 4G81A 1M1NA 4WCFA 2WE8A 8OHMA 3BHJA 5J2TB 3I3OA 4DR4B 4KI7A 1XBTA 3OIFA 2R5NA 4P4UA 3ZD9A 1VDMA 1TPYA 3QMPA 2P6UA 4ZK6A 4E5UA 2W2QA 3GLFB 1AUQA 3LDFA 2Y0EA 3HKBA 4GNKA 1DTWA 1M76A 1P5HA 3MVEA 1Q15A 3AR6A 4IFTA 4IYRA 4N5NA 4OY3A 2CLMB 5BMVA 1ZK4A 3H5IA 4MR7B 1ZGZA 3LWDA 1GRQA 3OCXA 4BNXA 1X0VA 1OKKA 1E5DA 2WMOB 5EIAA 1JXAA 3L8HA 1ISRA 1I9GA 4N5LA 5P8WA 3PHJA 4K9PA 2QVLA 2NQTA 3W9BA 3I04A 5C2JB 4E5SA 3IP1A 1T36A 2IEIA 3FTDA 4MW6A 3EJWA 4P93A 5A5VA 2ZRQA 3PNYA 1AGPA 1SUSA 4P7GA 4K7JA 4HDMB 1BE0A 1YUNA 3FFTA 2C4KA 4RELA 3ZHBA 1ZXBA 5EHGA 1RRFA 2HWXA 2O1SA 4FP9A 4RF2A 4XX0B 5CX4A 2AD1A 2B34A 3WC4A 1XTZA 2GASA 6NULA 3MW8A 1Z8HA 4NJEA 4Y1RA 1FYEA 1FQWA 4Y6GB 4COOA 3PJRA 4YRIA 1O95D 2ODWA 3UMRA 2HA5A 2P3SA 2C78A 3Q9UA 2IH4A 2AXNA 1ZOLA 1VIVA 2FPWA 5GIPE 4MQEA 1G3QA 3FUCA 4I4NA 1FUKA 1DL5A 4M0LA 1WXFA 1NRJB 1X1BA 1FK8A 1M2OA 2V3WA 3G0IA 1AOXA 2BV3A 3H75A 3NAMA 4FJ1A 4I55A 2OQIA 4WXMA 3ZZMA 2MYUA 5EP4A 5K99A 1DU4A 2Z5GA 2GWHA 2FMHA 4I2VA 1R0CA 4RAOA 1MEEA 1NLZA 5AJZA 4IHAA 3A9WA 3PEWA 1ZJ5A 5EJ8A 3E70C 2RI0A 3H5NA 5FQOA 3VHRA 3CONA 5TS3A 4P3XA 3NFYA 2JJQA 1R9GA 3VAAA 5IKEA 3PGKA 4NATA 4GBJA 3K2BA 3H9GA 1Z0JA 2FW6A 4R1TA 1KY4A 3WB1A 1X1SA 5FUXA 4WZBB 4PZAA 2WSSA 1QC5A 1SQFA 1NG9A 3WKBA 1YVUA 2RFLA 3EGXA 4FQ8A 4EHBA 2I2CA 2X3FA 1R5OA 3TLGA 4JYCA 2HL6A 3IMFA 3MCAA 5E6UB 3S2FA 4PQFA 2YBEA 4P84A 4RA9A 5E2IA 4I1UA 1DP4A 4UHJA 1A9TA 4G84A 4ZEXA 1U9JA 4XARA 1XXHB 4KO3S 4TTJA 1P4GA 1G66A 1JQJC 3HXPA 3KAJA 3TNLA 3W8EA 5DI3B 2ZIWB 4AS2A 3ER8A 3G0HA 1RAAA 2YCBA 1CS0B 2H4ZA 3W4KA 4JCOA 4Q1EA 2J46A 2VCHA 4EA6A 5ALGA 1QIHA 4LJRA 2GVNA 4RVCA 1BMFA 4YQYA 2Z9CA 3AI3A 3H05A 4H3SA 3TE6A 1H9CA 3C98A 1DT5A 5E4TA 3ZHUA 1WMBA 2J3DA 2VUIB 4QAJA 3Q8KA 4II2A 4NOJA 1T4CB 3KOMA 5BW4A 1H6BA 3D3NA 3SVTA 1CZNA 1QVRA 3ANMA 2QMEA 3GRCA 1YRLA 1IY2A 3DE0X 4UDNA 1V8PA 2WY2D 3FOEC 2EJWA 2D6FA 4MVXA 5H80A 3V3KA 4WERA 2QRLA 4HNQA 3A9RA 4HUTA 3PBKA 4LJ7A 3AUSA 2X4DA 3EAGA 4DBVO 1SKAA 1L4UA 2WZBA 4RZ3A 4CGYA 3A1FA 4P4TA 4R8KA 1H9BA 4BC0A 1GVNB 1U2GA 1ZI6A 4Y1EA 4CXMA 1VYUA 4D74A 2QWXA 2WTAA 3THYB 1TU0A 4UFOA 3ACBA 3BTUA 3GZ4A 4BB9A 1C2YA 1AIPA 2GILA 1FNCA 1H8HA 2A7XA 2CEAA 1A8QA 2DH6A 2XKBA 4HSEA 3TGLA 1WCIB 2IP1A 1EFHA 1ZUNA 2UVDA 2XKJE 4XWOA 5KX5A 4A9AA 2C3OA 3QPWA 3RSGA 3HUFA 4XJXA 5KYKA 3PI6A 2KBEA 1P74A 2QI9C 5EKDA 4LZLA 1SOMA 5K0FA 5IVKA 3V8VA 4QPPA 2NP6A 3OLYA 1DDOA 2F43A 4HGOA 4O4JB 4KNWA 4PSUA 2C4WA 1EB9A 1XMSA 3NJ4A 4IVNA 1JS1X 1SZPA 2ZJ0A 2LGJA 4XJTA 5I9BA 4JI1B 1ZWKA 1GRNA 1XP8A 3TRIA 3ZWAA 1PLKA 3DC7A 3O1LA 4IH9A 5MN5A 1ZOSA 2P8JA 1BKDR 1V9SA 4UPEA 2FW0A 1VDZA 2FHSA 2JAXA 2Y27A 5F52A 3IT3A 4LY3A 4EM6A 1JHRA 2PV7A 2B8EA 2FDXA 2V7QD 3QPDA 4HMOA 2CXHA 2IW3A 5PGMA 4EY6A 5K5EA 2IITA 2QL6A 3M2TA 3GFBA 3L5OA 1IHXA 5EJGA 1SA0B 3RHFA 2RC6A 4PVDA 2JFGA 2OD2A 3QV1A 5SY9A 4PHFA 3ZEIA 4AG5A 1OFVA 4PC6A 3TIFA 3N2KB 4J0DA 4V0SA 3K9CA 4JGIA 3FY4A 3BDVA 2DPMA 4PFSA 2MJLA 4QHYA 4IS3A 1NV8A 2GF2A 1PFKA 2FPLA 4MPPA 3L9WA 2Q4OA 3SU8A 3WB9A 2I2BA 5TT0A 1JLSA 3LDUA 1UIMA 1QG6A 3IQEA 4X00A 4BFVA 2VJMA 3BXPA 3W77A 4F85A 3EIXA 4GHWA 3LKVA 4G0PA 3N3AC 4JR0A 4RVNA 4BFYA 1QZ3A 1LB1B 3NU1A 5CA0B 3PI7A 4ZVTA 3WSVA 4FLFA 5LQMA 1E2MA 5U4QA 3QP9A 1KJNA 4OQPA 2X3UA 2I33A 1GZ6A 2PWYA 4IIGA 5AHRA 4EJSC 4QUHA 3JQGA 1WR8A 3W9YA 1WHSB 3HDHA 5H81A 2C59A 4YRMA 1ZPDA 3OFSA 1MA3A 1POXA 4UMFA 2XGOA 2FX5A 3ZOZA 2O5CA 1L5OA 1BVYF 1JQEA 4EF4A 2XSZD 5HS4A 4QZVA 3G85A 5JWRA 3W5AA 1NSFA 4EZBA 2OFOA 4ZZIA 1Q50A 4YP7A 4MRSA 5C46F 3DMTC 5C1IA 2QS9A 2V7WA 1E8MA 1MXHA 3B5IA 1LVHA 2WWWA 4R8SA 1P1HA 1Z7WA 1UKVY 4LZNA 3REGA 1WSBA 4XSHA 2XD9A 2GXQA 5KHLB 1E2PA 1SELA 1VA4A 1TLLA 3R3HA 4QREA 4BC1A 2WA1A 1Z2CA 2NXWA 2IDKA 5F23A 1JAYA 2C84A 4ZTBA 4LF9B 2BHNA 3IUPA 1UOQA 1LBQA 2Z08A 4M8SA 2VH5R 3TCNA 3GJRA 4EL0A 1QUFA 1OSNA 1SBYA 3RFVA 4HAUA 4HP8A 4PR0A 3HYNA 2IPLA 1CB7A 1JKFA 1CLUA 1E64A 1PJSA 2O50A 2PSSA 3G0BA 4LXTA 1T9DA 3L1KA 4FDLA 4PNPA 2CW5A 4HWPA 3URMA 4G1MB 5EAIA 2IY8A 2XMSA 1MO5A 2HT6A 1G5IA 3EFEA 4LAFA 4D0GA 3BRQA 1ODCA 2XJ9A 4ZI7F 1Y4ZA 4GICA 4HYEA 3LUCA 2XE4A 3AP2A 4P5EA 1G5PA 1I33A 1EZZA 4X94A 2XA2A 3N05A 2QN9A 1QNFA 5AUPB 5B3KA 2DVMA 3AOEC 3F73A 4ZAZA 2JIRA 4DTIA 3DHEA 5DZSA 2CEKA 4MCHA 3WV4A 2ZULA 1JDUA 2JL1A 3EASA 4X3CA 1VKOA 1NT2A 2BR4A 4TVKA 1WQ1R 1LSOA 1CETA 3NO4A 4F4CA 1Z7BA 3WNBA 3CF4G 4XIJA 3B2NA 3LX6A 3OY7A 1E7RA 1WVIA 3ETGA 3I9LA 4BFTA 4LG1A 2ZRHA 5ENZA 1CX9B 3DB2A 1QSGA 4BNUA 2VBIA 4CR6A 3Q3CA 1M1ZA 1B7GO 4UATA 3MERA 2ZT8A 1ZKDA 1YS4A 2D0OB 3KZNA 1Y9DA 3MIZA 4FUQA 5ALWA 1QK4A 5ALZA 3QLJA 1UC9A 4Y9TA 4MW7A 4QX6A 4JVLA 3M6MD 3NETA 3RV3A 3GJ5A 1Z45A 3IT1A 4A92A 3EOBI 1ULBA 3COSA 4E7PA 2OSVA 1J56A 4C1NA 3CZ5A 1KHHA 2FPIB 4IIJA 4XWYA 4YRPA 1SHLA 2YHAA 3GLHE 5FULA 2J6BA 5EJIA 5EWLB 4UM8B 1YT5A 2CVFA 2QXYA 1JQLB 2IZ7A 2XQIA 5EJ2A 5IT9A 1HI9A 1R7RA 5A4JA 1LI4A 4YAWA 4AU1A 1XTKA 2OUIA 3U3ZA 4FC6A 2G1PA 3EOZA 3BSWA 3MILA 4O2RA 3IQHX 4RMJA 3ZHQA 1ZH0A 3DO5A 4TS3A 1J99A 4ES6A 5K03A 1NNLA 1EM8B 1SHTX 2CJXA 4NK5A 1LD3A 2G77B 4CEIA 2Q0SA 2WZCA 3EZ7A 4JLVA 4QC2A 3EDYA 4DQXA 1IPFA 4H1UA 5LQCA 1W9MA 1OLXB 2WM3A 3G88A 4CF4A 5DSTA 2ZB2A 5U4XA 3LYHA 4BEBA 3ANXA 3AYXB 1ESMA 3HSKA 1PL8A 1RIIA 4ZC8A 3QKTA 4KVGA 4HVAA 1RM0A 1U9YA 3KXPA 8GPBA 1AGYA 3RLIA 1G9XA 3ZDYB 2QR2A 3ASVA 1ZIXA 4QBTA 4NCNA 2PJRA 3GFRA 2F3RA 2QQ5A 3OTQA 3I6QA 4M49A 2BEUB 2X4LA 1WUHS 4IG4A 2C1XA 4E2ZA 1AS2A 5K2OA 2FRDA 2Z8YA 1LTKA 3D9QX 2XUKA 3NH9A 3QVOA 3M3HA 1X2EA 1KK0A 3KDAA 3F6RA 3TR6A 5KTRA 3HKDA 1MOPA 5BO5A 4UQLA 3ASZA 1JSLA 4K88A 4OQZA 1MB2A 2AEFA 3SY8A 2GX6A 2C03A 4DLAA 1ZNXA 4GOLD 2EW2A 4AY4A 2Q1TA 4FHFA 1ONSA 3T3HA 3D3WA 3IMGA 4W9NA 1QE5A 3VC1A 5BV2P 5JNLA 1TOAA 1TCCA 2PAFA 3TRFA 3R5TA 4A0RA 4ENWA 3W2HA 3IAM1 1X77A 3MTEA 3NIGB 2FPPB 1DJQA 2YWRA 4CDGA 3GJQA 1NAHA 2YXLA 5BY2A 421PA 2H51A 3CLHA 2IT1A 3WJ7A 3U4CA 5JCJD 4YR7A 3H5WA 3OSUA 4AMBA 2WYWA 1WU8A 1Z9BA 2PUAA 2MSKA 2NSYA 3ZE1B 3C6QA 2R5FA 5CURA 1NM5A 2BSXA 1C1YA 4YJHA 2IKQA 1KZ7B 4RS4A 1YIOA 1KP3A 1FRZA 2CHEA 4BUJA 3WL5A 4RADA 2GTHA 1OTYA 1G21B 2IYXA 4K2HA 2Q5FA 3PC7A 1VPTA 4X85A 2CJWA 4MR9B 4X93A 1OX4B 4EUNA 3RIEA 3I73A 3IA7A 5KOYA 3SOZA 4UU8A 4A6EA 1E3DA 1UK6A 1L7RA 1XWWA 1Z6QA 2NU6B 3UHOA 4M6WB 1TZCA 4A8JC 3FCAA 1H2HA 4WXRA 2UVPA 2GEJA 3S4YA 3WISA 1DNPA 4BQFA 4CR8A 7REQB 2VF7A 3NHYA 1X42A 3O38A 3FYUA 1VYVA 5F5NA 1E66A 2XXJA 3LZCA 4Y0NA 2HK9A 1QBGA 2Q6IA 1TA0A 4LECA 3OFJA 3N0TA 4FZ5A 4DANA 4K28A 2O8DB 1Z47A 2PV0A 5ITWA 2BFBB 3MSXA 4G4JA 1PZFA 1TI7A 1TL7C 1VE5A 3COYA 3NOVA 3PV0A 3IYLW 4GOOD 4KO8A 4P4LA 2C3PA 5DSXA 5TY0A 3UXEA 4AJEA 1S6YA 4MR8B 5EPOA 5JAZA 3EPPA 5B7QA 1JIQA 2W6ZA 1AQUA 3L1IA 4LJSA 4EJSB 2NVOA 1RMYA 3H83A 3AFNA 3JQ7B 3SE7A 4TVSA 5H68A 3U0BA 4UJ3A 2VJLA 2FEXA 2IWRA 1TIKA 4F8YA 3MUFA 5FO1A 2WQ7A 1ECPA 2MMCA 2P3OA 2ISCA 3IJPA 4BLUA 4FYIA 5DCUA 4B3IA 4DV1B 1NBME 4L9SA 3UZUA 2HHAA 5F7OA 3MJ4A 3O6VA 4IO1A 1YB6A 2AUNA 5LB2A 3A6FA 3TBFA 3I9NA 3WLIA 4BU1A 1B4DA 2R8PA 3AI1A 3GMTA 3R0IA 1LKZA 1UBKS 4NXMB 1JHYA 2HIHA 3PRKE 1EK5A 3LDHA 2JJ1D 2RBEA 4FOOA 4MH0R 4Q9JA 4B3XA 5JASA 4Q9LA 3FSJX 1FNSA 3KJEA 4BV2A 5CB6A 4U6SA 4DAOA 1TEHA 2F3TA 3O94A 3PEUA 2QJRA 2FOXA 3GRUA 2UXCB 2DCMA 1BA2A 1JSZA 3C3PA 3JQRA 4LWZA 4WOJA 2IK8A 1KAGA 5CVCA 1PEDA 1I2CA 4YLYA 1JR2A 1EK2A 4MO2A 2NAFA 2BZ1A 1AUOA 1IK4A 2Q1XA 2C0PA 3LYUA 4I7EA 1DIBA 3NFRA 5CVEA 1MJGA 1KP9A 1ZSVA 3BXZA 3KKLA 1TMKA 1XWIA 2OM2A 4UQOA 3FE2A 1BS2A 4IEIA 4JBLA 3LHDA 4HUQB 1JJ7A 4TSFD 4E5YA 1HNZB 2P5YA 3OP1A 4JELA 4PQYA 5DGIA 3PGXA 2PDAA 5B1HA 1T26A 1JR3E 1WABA 1K8RA 2ZQ5A 1EHIA 1FL9A 2MDTA 4FK8A 1N7GA 1O08A 1VMEA 4L4YA 4LXIA 1E4EA 1KXZA 4HNVA 4DB4A 1MF7A 1ZD5A 3IDOA 4PPNA 3RYTC 4BNHA 4IINA 1C0KA 2AZMA 2WTBA 3ZDAA 1DRJA 2F6RA 3L18A 5AVUA 1MIHA 4JC4A 5AHXA 4DQLA 2IU4A 4PLPA 1QVAA 4HH3C 1FTSA 4J0FA 4NQRA 3AF0A 5TX7A 1NXVA 5JEEA 1YRYE 1EX6A 3HSSA 3OMLA 3G2HA 2AN1A 2G4CA 4MV3A 2ZBVA 1JJAA 1O0SA 1MJNA 5DNEA 1OFUX 3TX2A 2VHXA 2G9RA 4CTNA 3R6LA 3L7CA 1C0EA 2WSIA 1NBEA 5FFFA 2QZZA 3TX6A 5FYQA 4LSZA 1T43A 1LJ8A 1T6BY 4CFZA 1UDBA 1L1QA 5KYXB 2J85A 4IJWA 1DXYA 2EGUA 1J8YF 1I5RA 4BE7B 1OBVA 5EEHA 4B71A 1HF3A 2J0VA 4Q19A 3N0RA 4JJAA 2B98A 4C78A 2HCJB 2Z56A 3DDZX 4F71A 5BQPA 9LDBA 3E84A 3CVWA 1VE3A 5AOCA 4ZOLF 2X0RA 4HMQA 5I45A 3B53X 2GCGA 1VE1A 1LBTA 1XD2B 1WS6A 3A7DA 4X1KB 3VU9A 1NYQA 2H2AA 1DJNA 2PBFA 4IDNA 3DCJA 4QYWA 3NUZA 1GZ4A 2VHZA 3E9YA 4BB6A 4LYEA 5J1TB 1SHZA 1W96A 1YCFA 3LUDA 3PXEA 2QPLA 3PXXA 1HDZA 4RVGA 1JFVA 3GLGA 1E1QD 4CQNA 1KSFX 1LPNA 2EVWX 1UFKA 1H5UA 1L4FA 1NX6A 4H08A 2EW8A 3CVOA 5CIWA 4GS5A 3FUWA 1IUOA 5CM8B 4BL5A 4YUYA 2WYVA 3EDMA 5DHQA 2CHQA 4PYNA 1NBHA 3T7CA 4HNAA 2C29D 3ZXUB 4RM2A 4F9FA 5IDXA 3BWDD 1XDGA 1DO8A 2G0TA 1HO3A 1C2TA 2I3DA 2H4WA 2NZWA 3EXIB 3IJRA 3WLRA 2X8JB 2QGFA 2LIPA 3BJEA 4B6OA 4D4KA 3CZPA 4BRUA 3RHZA 1P2FA 2W2OA 4LTNA 3OUZA 4JK3A 3JALA 1TQ6A 4K6MA 1J5PA 1FX0A 3UJNA 4X0EA 3TVYA 4I50F 5GV7A 1RLTA 3S99A 4KQWA 1N7HA 3L0IB 1CUGA 3C8ZA 1PD1A 2Z2ZA 2WP8J 3K5PA 1IUPA 5EE9A 4KV7A 5C34B 5IDYA 2YZGA 3GWGA 5ILQA 1XLTA 3I1YA 4QLAA 1GNVA 4GYJA 4NS1A 3ZDDA 1LF0A 4DNXA 721PA 1ZGJA 1WL8A 9ABPA 3FIJA 4JI3B 3T41A 3CSDA 1K6EA 1NMQA 4FFWA 3ZTWA 4YIHA 1EFAA 1MLDA 1RBZA 2G88A 3HR8A 1YNSA 2Q5LA 1F0YA 3IULA 2VJDA 4U8GA 1WMDA 2YQZA 3SDBA 5AUQA 4P4NA 3HDVA 2H1RA 5JZOA 3UT5A 3KZOA 3MS4A 4Z9AA 5HFAA 3STXA 5AVZA 5G4LA 3OOSA 4X41A 1U8YA 3IIMA 5DN6A 2B3DA 3CKYA 3T0IA 2PUHA 3QMWA 3V7FA 1JBKA 3I2GA 1QAQA 3LX8A 3QVKA 4H0CA 4Q3LA 5DHRA 4ZJZA 1VA5A 1IE3A 4HSGA 1FLVA 3B9RA 1YHYA 5F7ZA 1U1GA 4BIMA 4PINA 1PT8A 1VIAA 2QRHA 4TTIA 3PIDA 1B3BA 4JLDA 4RTPA 3AVTA 4UD6A 3I2HA 3TL3A 5INTA 4B82A 5CFOA 4QFBA 5HPYB 2EJUA 3OLVA 4GMDA 1R6XA 2OO3A 4C2AA 1AGRA 2XQFA 5ITZA 3P0EA 2JGFA 3LBIA 5AKKA 4D92A 1CZUA 1YK0A 1Y4AE 3CVUA 2OK8A 4D9GA 1GZSA 2JVIA 1BE1A 4MLPA 2Q2OA 1GGNA 2Y1GA 3FXAA 3JVVA 1GL9B 3DAOA 4GMKA 1D6SA 3DMYA 5L3QB 1ZXXA 4NHOA 1Z75A 1Y5IA 4N54A 2CVHA 4PEVA 4ARVA 1YU6A 1ZEMA 2PAAA 3CX3A 3EXHC 5HRAA 4A8JB 3FF4A 3H2KA 3PEEA 3UUFA 3ANLA 4NV3A 1A71A 5JHHB 3G7NA 2AFRA 3SZGA 1Z22A 2NYVA 2QTZA 4OSOA 2H5LA 2RAFA 1FTNA 1LVGA 4PX3A 1SPXA 1Y1TA 4N3GA 5JAMA 5TIIA 3RVPA 1W94A 1MO6A 3FGPA 2CVZA 3L8GA 2JS7A 5CMLA 4TZTA 1SUWA 4EFMA 4FR2A 4D9EA 4CIWA 4CIBA 1Y7IA 3H4MA 3VBCA 1G1MA 1C29B 1XHEA 2PGIA 4KK4A 4C3VA 3AB3A 4L2IB 3HO6A 3WYGA 3EQ7A 2GSWA 1P1JA 1XNJA 1B6RA 3EG9B 1H2BA 2XQJA 5FI1B 1H85A 3BTOA 2VNJA 3T4XA 4Z4GA 1GG5A 1W29A 2DZDA 2YV2A 3PUJA 5LZ5A 5LFAA 5DSZA 1G1AA 5CLFA 1EGAA 4OMDA 1J90A 3IAS6 2VDWA 1E7QA 4L02A 1CYDA 3WWYA 3ZE2B 3V4LA 3GH3A 4HXYA 1EEXB 1TRHA 3E48A 3QBJA 3WB2A 1G7RA 5CFQA 1Z8DA 2Q6TA 4FU0A 2QMZA 3JQBC 2UYOA 2X0KA 3Q40A 5CVVA 4YRFA 2IBSA 5CEEA 4KMOA 4FBGA 1M5UA 1QVZA 4HDAA 1ILEA 1R6UA 3PLNA 1X7YA 3RS7A 2P2NA 2Q6VA 4Y2TA 3L2OB 1DEXA 3AKYA 3ZU2A 3U7EB 1GPYA 1QUEA 2K2WA 3KEMA 3IUEA 3QYAA 1JIKA 4H1TA 4PHGA 4Y6OA 4YO8A 4FEGA 1AZSC 3D1LA 3H11A 4Q39A 3SZLA 3ZIDA 2VRNA 1O03A 4PYLA 3NOXA 1RE1A 4FGWA 5CHEA 1N77A 2K7ZA 2IYFA 4LC0A 4B3HA 1E6CA 4L51A 3TXXA 2PH3A 1VB5A 1ISGA 2C9YA 2NQ8A 4EEXA 1EX7A 3AM4A 1LDEA 3NOQA 4WOPA 1GQOA 4QE3A 5KTYA 4W7SA 2ECPA 3T9AA 2OBFA 5FPHA 1DUIA 3KSUA 5MFZA 3PL5A 1NJGA 2D2FA 2B8WA 2PSFA 2XYVA 3AHGA 4PHTA 5JYCA 4OMUA 5LZ4A 2GEDA 4CCAA 2Z57A 1TXGA 3D2CA 1YKFA 4J0CA 3M9LA 5UKDA 4DWVA 1THGA 1E3WB 3FFAA 1JDVA 1G6Q1 1TA4A 3WLHA 3RAGA 3AGPA 5FI3A 4TN1A 1TJ4A 3K7EA 1ZESA 3BFPA 2O54A 1GDTA 2AUTA 2R25B 4HGQA 1R4NB 3QUTA 1IFXA 1ZVVA 3PNLA 2VQDA 1AJEA 2IHUA 1XZCA 5TC4A 3KOYA 3LW8A 1QGDA 1CV2A 1P4HA 5DF1A 2DR0A 4PGAA 3EF0A 1P1FA 1QE0A 2CD9A 4M7OA 3JD4A 5CVUA 3KD2A 3AP3A 4YHBA 4BZZA 3R7FA 3K15A 5EHXA 4UNSA 5EE5B 1B41A 3IPCA 4E1VA 3O4VA 3SE0A 3L8YA 2AD5A 4QJ5A 3RLFA 1RM5A 4EYOA 4B4DA 1YIDA 4AQ7A 2JAHA 1Y8RA 5F2OA 7MDHA 4WK2B 1KMNA 1EK1A 2DYKA 4IRMA 4K6HA 4GGMX 5IC4A 2HV8A 2B4RO 4FHEA 1XN4A 1APBA 3M49A 2GN4A 3ER6A 2O3SA 5AI9A 3WRXC 5EEGA 4R81A 3EK2A 3DE4X 1NRIA 1V7ZA 2HTFA 3EPHA 4C4AA 4ZCLA 5A4IS 3RVJA 3JWPA 3SMVA 2B82A 2XYGA 1OIVA 2ZTLA 4CTJA 4PICA 1IJFA 1N5JA 4Q4DA 5AXDA 4DEXA 4TMWA 3REOA 5TGTA 5EZYB 4Q3CA 2QR3A 3ZV3A 2FZKA 4AZ0A 1W6RA 1W4LA 1J8DA 2FQQA 3R6TA 3LFTA 5C8YA 1OLSB 3ED5A 3IUJA 4Q1VA 4UHHA 3U40A 4ZJPA 1W2GA 5CX1B 3U7IA 1J2EA 5AH0A 4JEMA 5HQJA 4FMCB 5F1PA 3AVVA 1LPSA 1TM7E 3FR7A 3QEOA 5ERGB 3VPHA 3KETA 5K0SA 4AW9A 1H3EA 1FB5A 3LQKA 1BYUA 3GN2A 3SCZA 1UR5A 3F8SA 1ZJ4A 3L4SO 2VZ9A 5GJVC 3OZDA 1SBTA 1NY6A 2JJYA 4C5CA 3K09A 1OLUB 4MVYA 1PJ2A 1NDHA 4ZQEA 2VRCA 3KC2A 3H4VA 4JJ4A 2VTVA 2QM0A 2PRYA 2WI8A 2HHLA 7AT1A 2CXTA 3MLAA 1Z5NA 3WKEA 4LHZA 2JFYA 5GZ6A 1E0SA 4A6PA 1D2GA 3D7SA 3RKRA 4F93B 3AUXA 4PZEA 5I7FA 2PWZA 5LYJB 1FLNA 1J5EB 3E1KA 3FFBA 4O2AF 4TS9A 3HCBA 2FSSA 4X5OA 2D2EA 3LWNA 4FNMA 3UMBA 3BEOA 4UE2A 1GYQA 1W1UA 2OORA 4DVJA 4RIHA 5DX1A 4IXDA 2B0JA 3IT2A 3OZUA 4BMOB 1SUBA 2XQGA 1U6KA 2VSNA 1HG1A 3CINA 4M21A 4R7GA 4YP6A 3SBXA 5E4YA 1LK0A 1SKUA 4YWJA 4YT2A 1XCBA 2XA9A 1XSEA 4UNIA 1WAMA 1W8IA 3DBRA 4ZCRA 1BD3A 2IHJA 1UBGA 2PMDA 4N65A 2B4TO 3H18A 3JYLA 2OOKA 3UJ3X 1B0UA 1TZ2A 4UEQA 1O58A 4RHYA 5HX7A 5F4BA 5BWCA 1XMPA 1U2PA 5DN9A 5I5GA 5C1OA 2BGLA 2C5LA 3HMQA 2PT6A 2EJVA 2J9RA 3KB6A 4F9GA 3BC1A 5CB4A 4F2HA 3BXOA 3AY3A 3B6MA 4OTZA 4MWCA 3QK7A 4JYAB 4NCXA 1LLFA 5FADA 3AMVA 5JYEA 2JJ2A 4GM4A 1M2FA 1N6OA 4IMJB 4TT8A 1NF9A 2AVNA 3EBOA 4LISA 4YMWA 5A0FA 4U2BA 3K0SA 4RD2A 3KPYA 2P67A 1MNQA 3GDOA 5J5AA 1TAQA 1JAHA 1X7XB 4XM0A 2MSDB 3FMFA 1VZ2A 5COBA 3AF2A 1QVVA 1KS2A 2AXQA 2BEWB 1UMBA 3VTFA 4W82A 3FZYA 4LXYA 4CIYA 4PC7A 1F8XA 5BN4A 3HACA 3EEQA 1EE1A 1CUIA 3EXHB 4FCTA 4LYAA 4WLFA 2P2YA 5ALJA 1SKYE 1U7OA 2R62A 3ZUPA 3R6GA 5FNVA 4YAEA 5K45A 2W8BB 2P1RA 4K8OA 2XMBA 5AI6A 1QHSA 4LF6B 3WGYA 2YJ6A 1XELA 5CNIA 4IZ6A 2ATCA 3QU5A 2ARKA 2BHSA 4R8LA 1HT2E 1AMNA 3UT6A 5F7JA 1XR3A 1FSZA 2DECA 1NQOA 1IM5A 3DC2A 4EKIA 2QYOA 4DJEC 1QQAA 2IYYA 4TOIA 1A5TA 2B9VA 4CTOA 5SY4A 5FB3A 2QXUA 3PKIA 4US2R 4I19A 4RLHA 3TTVA 3SZOA 4RIFA 3RREA 3TLJA 4BNZA 2ZIGA 3E5HA 4RJIA 1XA3A 2WQ6A 3VNUA 1FDIA 2NO1A 1W8DA 4QXQA 2PMEA 3F4KA 4CMBA 2ORED 3QPBA 3KAQA 1UC5B 1WF6A 2Q5OA 1M8JA 2XB4A 2L69A 4L5YA 2BEJA 3ROPA 4E3WA 4TKZA 3X0DA 3WVNA 1EWVA 1G8JA 2QL9A 4MYSA 5K3SA 4BMDA 3ESDA 3VR2A 4HF7A 4F5YA 3NP9A 4L22A 5I4IA 3GNTA 3ADCA 5LMUB 2QZJA 1E1KA 4BE9A 5HCUA 2WJ6A 2QG6A 4H31A 1NY5A 3A9UA 4KN6A 4NBVA 4HQFA 4RAQA 1TKCA 2WSMA 3IAFA 4HXFB 4MYHA 1P5JA 4QXMA 1U9IC 4D8WA 1H1DA 2KHZA 2XMRA 1KHTA 1XTBA 3K6RA 3O8QA 1X1QA 2FRVA 3OCJA 5KQMA 2Y2UA 3FCYA 3JD2A 2O7QA 1AQ6A 1N6RA 1TD9A 1NBMD 1NUTA 1D6JA 3MJSA 4JGGA 1XYVA 4W5JA 4DSNA 4BJ5A 2AJBA 4DR2B 4OXRA 3LOPA 4QTTB 1USUA 1YJXA 1P73A 5BSKA 2OXCA 2FEAA 4AWXA 4E33A 1U4NA 4WFQA 4MA5A 2O5EA 3NDRA 5TQ2B 3SD7A 2O8FA 1GGKA 4QOEA 1LCIA 1RYNA 3OG9A 3BSYA 3BXXA 4QJBA 1PUXA 4RW0A 1QU2A 3PVZA 1UINA 2Y3IA 1PIWA 3NEJA 2JAQA 5G3ZA 4WBSA 4V0KA 3G9TA 1J1UA 2J0SA 2YBDA 3RYHA 3SIPA 1M34E 3HA5A 3RTGA 1RYMA 5H59A 4RM3A 4WECA 5EJEA 5IXYA 3ZKWB 2QZ9A 2OYSA 4AUEA 2IYTA 4I1OA 1G0OA 4C30A 1HT1E 3L04A 4RD1A 1V37A 3HCCA 4TL6A 4YX9A 5JAUA 2XBMA 1C9NA 4CLOA 2VYCA 1WUTA 2WU1A 4NMXB 4OAPA 5G1OA 2JC3A 4H59A 3WAKA 1XPRA 3LHKA 3GVIA 5CDGA 1JG2A 2RK6A 1B3RA 1G59A 2D1TA 5JJIA 1QR2A 2XXBA 3N2IA 4KYUA 1JR3D 3MRVA 1RJ9A 1YZQA 1OYWA 4ACBA 4ZU1X 1NN0A 4U02A 1T0UA 1BXRA 2C2YA 4XIIA 1MVOA 3F96A 2C77A 1EUCB 3R6DA 4O4HB 5CLLA 4B84A 2WOJA 2M1XA 2G40A 4R9RA 3WK9A 3K72B 4Y6PA 3K0AB 4DDVA 3JQ8B 3H9EO 3H65A 3GLHB 1IXSB 2PUJA 3FMGA 3ZIAA 1T5IA 2Q5IA 3E7XA 2UUAB 2GN1A 1Y8CA 3C14C 3NVAA 2JA1A 4UBIA 1AUXA 3A6LA 4DMMA 3R8FA 3SGLA 5AI0A 2NTJA 2XF8A 1R88A 1GTVA 4LF8B 4ETMA 3AF5A 4UTRA 4MW1A 2IEYA 3WGKA 3KTAA 2J8ZA 2ENWA 1QKIA 4PQEA 4TGLA 3EX7C 1REQB 3W78A 1M8GA 2E87A 1FMJA 2OOSA 2ZE5A 3CZMA 1YS6A 1RJDA 2GN2A 2HZ7A 3O4GA 4XVRA 4L76A 1ZM4A 5IM5A 1DC3A 4PQGA 1YQDA 3LKDA 4X54A 4GR4A 2QUBA 2ZBFA 1FUEA 1YNOA 1T6YA 1TEXA 3AJDA 3DTVD 2F9LA 2VQ6A 3L0YA 1V96A 4M0CA 4UDOA 4D5EA 5JXHA