4F38A

Crystal structure of geranylgeranylated rhoa in complex with rhogdi in its active gppnhp-bound form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
b'MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
molecule tags Cell cycle/chaperone
source organism Mus musculus
publication title Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
pubmed doi rcsb
total genus 56
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f38A00
1CR1A 1IY1A 2R6CA 3NTUA 2WWIA 3QOFA 1OH8A 1JNYA 2D06A 1P61B 5CJPA 1HQYE 3QKTA 4QBGB 2GJKA 4K46A 3PEWA 5B64A 2ZREA 1XTIA 4NL4H 3HPRA 3D3QA 1T0HB 3QBVA 4NCIA 2WJJA 3W6PA 1YJ5A 4MKIA 4OK5A 3UG7A 3Q85A 2ZUDA 2FFBA 1TNDA 1RW4A 4B74A 2Z4SA 1T8UA 4LHYA 4DBLC 1RE0A 1XJQA 1NMZA 3GJ4A 4TN1A 5CYOA 1EWQA 4L4UA 4KI0A 4JLAA 4V03A 5FPTA 1IONA 4E09A 3GLFA 5HE8A 1T91A 3VKGA 1F2TB 1G20E 2HLDD 1R6BX 2J59A 4GOKA 3LW7A 2VP5A 3DM5A 2V7QA 1XXHE 5CIQA 4C7OB 1AM4D 2ZE8A 1L4UA 3KTAA 1OH7A 4EIWA 1YRAA 2ZYUX 2IBMA 1S96A 3A36A 4B2IA 5K8TA 1YZUA 4QFMA 3QEJA 4KYIB 4Q4LA 1SXJE 3DVLA 4OI2A 1N5IA 3K0CA 3EIHA 3THOA 2ZROA 3A6PC 1US8A 1ZU4A 2R6GA 2PX3A 5K8LA 2FFAA 3EWAA 1VHTA 1J8MF 1OIWA 1H8HA 1KO8A 2Q9CA 4MITA 4IW3B 1BOFA 3SU8A 2UZIR 4US0R 2KBEA 5L3VA 3QG5A 3I1FA 4D4JA 1CTQA 3SYLA 4ZI3A 4LYFA 3TUJC 4EDHA 5AJYA 2CLDX 3U4QA 4LBVA 4IOLA 4EAQA 2JEOA 1D2EA 2BMEA 3CKLA 2EFCB 5CK5A 4IJMA 4YC7A 1XD2B 2F1RA 4HAWA 4NYIQ 4FWTA 3TSZA 3SBEA 1KI7A 1KO1A 4LV5B 1E9EA 4FXPA 3V00A 3AVXA 3LVQE 3FB4A 2JDID 2VHJA 4OI1A 4KSCA 1XPUA 3Q7PA 2RGNA 5EE5B 1HE8B 4URXR 4DJTA 2ZE5A 2FDCA 1XFAA 1XEXA 3T1OA 3AEZA 2YC2C 2D4HA 1YRBA 4HATA 5FPSA 2GK6A 1TEXA 1W2GA 4OQFA 1VTKA 4X8OA 4D4KA 2A5YB 5JRJA 3X1ZA 1UFQA 1KO5A 5EP3A 1Z2CA 3T1QA 5J40A 3PEYA 1VCMA 4RZ2A 2OSBA 1IJEA 2A5DA 3ASYA 2FN4A 3AP3A 2RCNA 2FSFA 1MH1A 1TQ2A 1YZTA 4R2HA 4C0AC 1HY3A 5L3SA 4MKGA 4RFSA 3PENA 2FEOA 2ZRBA 1H8ED 1X1SA 2VRWA 1FW6A 2P5SA 5FR2A 1WP9A 4O2LA 1MRSA 1F5NA 2GJ9A 3L0SA 2QM8A 4XOIA 2ORWA 4LY6A 1JJVA 1LS1A 1ZYUA 4JJKA 2XTMA 1ZCAA 3HPQA 2DR3A 3FFBA 1HE1C 3L0OA 4A8JA 2J7PA 1U0JA 5CLQA 3SFZA 4DDVA 1HQCA 1L2TA 1KJYA 2W2XA 4HAVA 2CDNA 4V0ME 1NL3A 2CNWA 4V0OA 2QE7D 2NO6A 1ZNWA 1Q1EA 4TSFA 4WW0A 3LBHA 3F8TA 3KXLA 3WMEA 2W83A 4OQMA 3SNHA 4XTRA 2IYYA 1DE0A 3ND9A 3BFKA 4QHYA 2NZ8A 4AYWA 3FOZA 4CGZA 2GVZC 3IBYA 1XXHA 1YZKA 4CEJB 3MJHA 5JJIA 4GNKA 3U4QB 4CIDA 3LAWA 1BS1A 4EFMA 2XZOA 1P75A 1Z22A 1SVLA 2C99A 2ZYVX 4DVGA 3Q5EA 3QXSA 2IYRA 4PQFA 4E03A 1J99A 4QC2A 4OI4A 4LJ8A 3WY9A 2QROA 1JAHA 4YLGA 2BBWA 3I32A 4QBIA 3OEED 1FX0A 4JYBA 3H2YA 3RWOA 1T5LA 4RD4A 2Z6VA 3TW8B 2H5EA 3QEOA 2H7VA 4D4LA 4M2LA 2B92A 1X6VA 3K0SA 4DHEA 4GL2A 1UBGA 1XDBA 1ZNXA 3C41J 4I1SA 3JZMA 1SQ5A 1I4LD 1HEIA 1KY2A 3QUSA 4FCVA 4MYUA 2J7KA 1GZSA 4YXWA 1YU9A 4BGDA 1OFIA 4F93B 1NBMD 4PO9A 2G3YA 1ZM4A 2RB4A 3DKVA 2HV8A 3THXB 2RKOA 2Q9AA 3U7HB 2GJAA 3EA0A 5EP1A 3BH0A 4PX9A 1LY1A 3BERA 4G0NA 4DLSA 1ZM3A 3KTAB 1EFUA 1CF4A 1A82A 1VECA 4V0NA 5LD2B 2FZLA 1ZD8A 2WKPA 4JLBA 5IT5A 1C4OA 4BFVA 4DUGD 3BJIC 1KK3A 3LX8A 4AWXA 4JL5A 2I1QA 4B34A 1IQPA 2PJRA 4Q4HA 1D5CA 1OT3A 5EQTA 3BGWA 1JPJA 1EFCA 4A92A 5IF9A 4A6PA 3NHBA 1GDDA 1OIVA 4PFSA 2CK3D 2XB2A 2O0JA 821PA 3N2IA 2FPMA 1XTKA 2XTNA 3BIFA 4Q00A 4RD1A 4UNNA 1LF5A 1TAGA 3Q7QA 4KO8A 2RHDA 3EWSA 5TXGA 2XOKD 3CNNA 4YMUA 3AB3A 4Q4HB 1NI3A 4Q03A 1ZMXA 4TYYA 4TMKA 5M04A 4CYMA 3I72A 3KJHA 2CL7X 5E4FA 1S2MA 1E79D 2ZRPA 1KSFX 2GZAA 2NOAA 2VBCA 3R20A 4Q4AB 4DSUA 3KKOA 2V4ZA 1N5JA 2I1VB 1ZW6A 1Z0JA 1XZQA 2J0VA 3MFYA 2P0EA 1SZPA 2IF2A 1W4AA 3CF6R 2QRZA 3BOSA 4QNRA 4LBZA 1J2JA 3LO5A 2VF8A 3GLHE 1EFHA 4DC9A 1Z0IA 1VCNA 4ACAA 4WOPA 4B73A 3B85A 4GZLA 4V0MA 3RSLA 1CKEA 2R65A 1CJTC 5KTYA 1Z2AA 4QGFA 4D82A 1RRPA 2B21A 4PXAA 3OEHA 2QTFA 4QM7A 2IYWA 4BASA 5A0FA 2BKUA 1R0WA 3THWB 3SOPA 3AV0B 2IYZA 3V4FA 4Q48A 4DLZA 1RRCA 3RS4A 1W36B 1ZRHA 2G83A 4PQRA 4F7WA 1EESA 3L0PA 2OCAA 3LDAA 4A0HA 2WJVA 3L8ZA 4KFTA 2ZR7A 2B7CA 1ZD9A 4DRZA 2WHXA 2F3TA 2GNOA 3CZPA 3NEJA 2QU8A 3HYTA 2PT7A 4NCKA 4FW9A 3SE0A 5TVKA 4BFXA 3IGFA 3MWYW 6Q21A 1IY2A 4BUJA 2A5GA 2ERYA 2IK8A 5FOWA 2V6JA 1MO6A 2VQSA 4AD8A 3RAPR 4RJLA 2D3WA 1JXOA 2BBOA 1C9KA 3A4NA 1Q1BA 1Y3AA 2Z0MA 5G40A 5CB6A 4FCWA 1F2TA 4A4DA 2G77B 2J9RA 3GLGE 1XMIA 3W8RA 5K8UA 2I3BA 2CHVA 1L4YA 3GPLA 1Z08A 3ND8A 3FHTA 3B1XA 5HZKA 1G5RA 1QHYA 1SVWA 1W1WA 2R6FA 3DPUA 4LJ5A 2ZVPX 5FPYA 4BFYA 4LBWA 4NYJR 4EPTA 5EJEA 1XB2A 4B44A 4D25A 4HSEA 3LW8A 3W5JA 4IVRA 2F1JA 3SYKA 3KJEA 2V7QD 4B3CA 2C5LA 1VKJA 5H1YA 1TMKA 4AC9A 1KDTA 2FSIA 5JJKA 5DLQC 4TYPA 4K81B 2J7PD 3D31A 4NPHA 4Q02A 4Q4AA 4URWR 3VR6A 3IEVA 4OK6A 1Z6YA 2QSZA 2OFWA 4PHGA 1PV4A 4LUCA 1PJRA 5H70A 3GP8A 4ZDJA 1D6JA 4WXRA 3CX8A 1Q1ZA 1Z3IX 2ZPTX 5L3SB 1UDXA 2R6DA 1KNQA 2RHMA 3QBTA 4ZO4A 1Q3TA 2ZRCA 2QPTA 3KL4A 4G5OA 2ECKA 4TMWA 2J0UA 3VNUA 4FIDA 5KSOA 1UKYA 1Z28A 1OXTA 3BH6A 3MMPA 3I5YA 2ZUBA 3AH8A 3P26A 2FZ4A 4DLYA 2NTYC 5KOYA 5HTKA 2AD5A 4I99A 3K0EA 2H57A 2QTVB 3E2IA 4JZKA 3C14C 3CRVA 1AKYA 3TAUA 1JJ7A 2REXB 2WSSA 3AVWA 3L43A 2DFLA 4DUGA 2PT5A 2F9MA 3EASA 4B6EA 2W2TA 5HZHA 2AFHE 4BE7B 3ADBA 1GKYA 2WWGA 3LLUA 4NCJA 2BBTA 2ZI4A 4EKDA 4AKEA 5TY0A 1OH6A 2O8DB 4TT3D 3PV0A 2FGKA 1E2IA 3PQCA 3T06B 3T61A 2B8WA 1IM2A 2G0TA 4HB4A 4PO8A 4ZKDA 1S9HA 1AGPA 1W0JA 2MSEB 5FOVA 1Z47A 1OV4A 2JAQA 2OE2A 1IN4A 1P5ZB 4OHVA 1JEEA 2ZI7A 4MRRA 1KSJA 2WPDA 4JSYA 3NC1C 4MUAA 1NNEA 1E2DA 3H86A 4KXFB 5EE9A 1ZINA 4F4JA 1G3RA 3K0CC 3KJGA 4HAUA 3BBPA 4NCNA 4POAA 3DEFA 4LDJA 4ZPXA 2CCGA 2O52A 1KK2A 2XITA 3NC0C 2VHCA 2CLCX 4NBSA 4L16A 2QI9C 1Z6XA 5KU1A 3AKYA 3K9NA 2QL6A 4D0NA 1FP6A 5CM9C 2FX3A 3O47A 1E2PA 3L8YA 3B13B 4H9GA 4MGZR 4A8JC 2WMOB 4P4SA 5C46F 2FU5C 2AL7A 3G0HA 1G5PA 3WHLA 5BYJA 4FI3C 4DZZA 4PAOA 4CT5A 2LWIA 2IS4A 1WDTA 4TSFD 2ONKA 2FFHA 5BQ5A 1K5GA 4AKIA 3OZXA 1ZUNB 2NQ2C 3CM0A 3F3YA 1RYHA 3CR8A 2H1LA 3C4JA 3CWQA 2HDNB 2FSHA 3KQLA 2IUTA 5HCIA 1AZSC 2J87A 5DISB 3QPVA 4DEXA 4JLDA 5JLJA 3LWNA 2WICA 2AHOA 5KHOC 3NDBB 4MGYR 3I62A 3AVQA 2BM1A 4TYWA 4W5WA 2YC4C 5E7JA 2AK2A 1AK2A 4PZLA 1EFRA 3WRYC 2ZSAA 3HU3A 4B76A 5DHAA 3GLIE 1E4VA 4Z1MD 5DSZA 2QY9A 2YWGA 3AM1A 2QE7A 1W46A 5EP4A 4LZZA 4ZCMA 2I4IA 3M4YA 4PPGA 5HKKA 5EE0A 2PJZA 2A9KA 3HDTA 5FOXA 1XZPA 3QKSA 2F1IA 1G4UR 2OCPA 4GOXA 4WAUA 1ZUIA 2XB4A 3AKDA 3B7GA 3EZ6A 4JVNA 2IUSA 4ILEA 1UBFA 1ZUHA 3BK7A 3EG5A 3M6AA 5D3MA 1ZNZA 1QBKC 2FG5A 1R8QA 4N1AA 1Z0KA 1R8SA 5GJVC 3B5JA 4WZBE 4OQNA 3TAHA 3P20A 4OQXA 3RRMA 3FE2A 1LTQA 4MYTA 1S3SA 3B1VA 2YWEA 2VEDA 1ODFA 3ZIAA 3CPHA 2VO1A 2ATXA 4D4MA 3A1UA 5F3WB 1H8HD 1XX6A 2BMJA 3W6NA 1AKEA 3K09A 1M8PA 3HP1A 5G41A 2PLFA 2WWHA 4MRNA 3IEUA 4C0KA 2GBLA 1P9NA 4R7ZA 1XPRA 1OHHD 4KJZA 4DDTA 1GILA 1TX4B 3ZVMA 4TLBA 1GKIA 1VG9B 4Q19A 4ARZA 2WKQA 4Q7LA 4CEJA 2H18A 4TMVA 2MMGA 2CBZA 1FQJA 1T8TA 4KLNA 1FFHA 4II7A 3WNDA 1N3BA 2QORA 4IHQA 4PSVA 4UJ5A 4DDWA 3ADDA 4LV6A 1NVUQ 1XCMA 4QOSA 4A1FA 4DDUA 1E9CA 4L9WA 1R5BA 3SEAA 3IPYA 3IUYA 5FTNA 1GUAA 1II0A 1VYVA 4PC7A 2REBA 3UWOA 5TARA 2RGDA 3AUXA 1JAIA 5J4VA 5G53C 4AYTA 3KXKA 2F1HA 4YONB 3L0IB 3T5GA 3PUZA 2XGJA 2BEKA 1JR6A 1X8JA 2FMXA 2RAPA 3MD0A 3W9YA 4CT4B 3SJAA 1T9HA 2NO0A 1XMJA 4IEIA 1DVRA 1ZD1A 3TVTA 3V4RA 2ANCA 1NMYA 2QAGB 4I1OA 3WP0A 1DAMA 3TKLA 1HT2E 3VR2A 2YHSA 4V0LA 1OXXK 4URZR 5E7MA 4JLVA 4RY2A 2R62A 4DCVA 1PUJA 3QNUA 3I61A 5J4YA 3PCRB 1QDEA 3A4LA 4WA7A 5CDFA 4MKFA 5EUMA 4D2IA 3H4MA 3MSXA 3TH5A 1NBME 5J47A 2O8EB 4Z51A 2ZVQX 2WPDD 1F6BA 4E5UA 3A1WA 1HV8A 5HCNA 4M1KA 2VTKA 3ZS8A 3A37A 1B23P 1R0XA 4TLEA 5CITA 2EYQA 4L15A 1TF7A 4WZAE 2DCUA 4YDSA 1G4AE 2BJVA 3CUEF 2IXEA 4QGHA 3M1IA 1T3SA 2QAGC 2VYFA 3GFOA 4XTCS 2AD1A 5F9FA 621PA 1JB1A 4OHYA 4Q9LA 2WWWA 4B75A 4WBSA 4JSTA 4X8MA 1G41A 4JS0A 1QRAA 5JSZA 1XU4A 1E2NA 2NO1A 5FOTA 2QMEA 4LPKA 1GOTA 1OH5A 2ZEJA 1N6OA 2GEDA 4JL6A 1U0LA 3QXHA 1AS3A 4C2UA 2KE5A 5AUOB 3CH5A 1U8YA 3LV8A 2OM2A 4X8HA 4EJSB 3U7EB 2WVJA 4Q1CA 3GCGA 3P1JA 1JI0A 5IK2A 2GWHA 4CW7A 1OPXA 3E5HA 1G6OA 2ODBA 4P4TA 1VMAA 4JMPA 4A0RA 2OAQ1 5AJWA 4IVPA 4BFSA 2ZRNA 4M22A 4TQ9A 4HB2A 3RHFA 1GL9B 1X86B 3NVAA 3DZDA 3ZGXA 1XEWY 1N5KA 2KJQA 1ZU5A 4NDZA 1FUKA 4UKDA 2OLKA 3UMSA 3SYNA 2XZLA 4MUBA 4PPQA 4LC1A 3EC2A 3Q3JB 4B3DA 1UPTA 2QP9X 3I5XA 1SVSA 4Q66C 5H8WA 2DFTA 3QKSB 2X8AA 3DM9B 4GP7A 1XJCA 3NDPA 1D9ZA 1DG1G 1WXQA 3VKWA 2A5FA 2C98A 3P4YA 1LF0A 4PZYA 1R10A 2GESA 1KI9A 3QF4B 4MDEA 1KMHA 1TTTA 2D7DA 2CJWA 4ASUD 4NP6A 1FTNA 2ZSEA 4XVRA 1X8LA 4DB4A 3UPUA 3R9WA 1XTQA 1IN6A 5HE9A 3IIKA 3LD9A 1QG4A 1VPLA 2AXPA 3GJ8A 2FF7A 4ZKEA 3IHWA 1ZNYA 1OFTA 4IFEA 1XD2A 1TF5A 5LB4A 3BORA 4L5BA 4Q7MB 1SHZA 4PQYA 2CJWB 4EPXA 3KQKA 1CR4A 1OJLA 1Z6AA 2UKDA 2O8DA 2NG1A 1J7KA 3LRPA 4RFSB 2EWWA 2YOFA 3SZRA 2ZITA 5C18A 2ZRFA 3W5IA 1IBRA 4KODA 2GXQA 1G7TA 4BLSA 3LQRA 4FN5A 4URVR 1Q12A 2J0UB 2PCLA 1CRQA 4OHZA 3NBYC 1XEXB 3O8DA 1M74A 1QG2A 5EP2A 1G64A 1NBMA 1P2TA 2YOHA 5J4LA 2BJWA 3BXZA 3TLXA 5FBVB 4LJ6A 4CEIA 4OL0A 5LB2A 3I3SR 5AUNB 4KHZA 2VP4A 4W5JA 5DI3B 3VR4A 3TUZC 2WWXA 2V54A 2LKCA 3FMFA 3ICQB 1J8YF 1KYIA 4B3GA 5TMPA 1DAGA 5CJ2A 3BWDD 2P6NA 1Q3HA 2W0SA 5JEEA 3GLHA 4JKIA 3FTQA 5GVSA 1YZGA 2XNDA 2BM0A 2J0SA 1PLLA 2O8FB 2Q6TA 1G7CA 5KDDA 1XF9A 1SVMA 4OYHA 3PXGA 2IT1A 1CR2A 1TQ6A 2A2ZA 3L2OB 1MABB 4HB3A 1G16A 4LHZA 4ON9A 2D62A 3D7MA 4DXAA 3I92A 3GJ6A 2Y8EA 2AWOA 1AZTA 5DE3A 2RGNC 1F48A 4URUR 1X1RA 3FMIA 1VHLA 1G5TA 3X2SA 2JLZA 1ZIPA 3LQQA 1WMSA 1KKMA 3A1SA 3UG6A 3B82A 2RMKA 4LJ7A 1NN5A 2JJ1A 4HLUA 5GJCA 2CHGA 1IXSB 2VP6A 4HZUA 1T6NA 3GFPA 4ABYA 1SVKA 2ZSFA 1I4TD 4TZ6A 4KFRA 4DSOA 3ZZTA 2V1XA 2VHQA 3ZVRA 2QBYA 1HA3A 2ZRDA 2C9YA 1CP2A 4M1WA 4NCHA 3VR1A 4NONA 2JLRA 3VFDA 1P3JA 2V9PA 1PUIA 2JCSA 1LV7A 3NH9A 3FMOB 3LA6A 3W90A 1Z83A 3HR8A 3RS3A 4MDFA 2GETA 3T5DA 1K5DA 3GEHA 3X1WA 4QL3A 4CF7A 3LLMA 2IL1A 5A5GA 2ZI3A 4C0HA 4DKXA 1UM8A 4N0DA 3PVSA 5DNYB 5JI2E 1Z6GA 2BWJA 1OYWA 2PMKA 3SJZA 2D7CA 5KYKA 2DB3A 4AG6A 3RSOA 4QJ5A 4CDGA 2SHKA 1JECA 4O0MA 4CEIB 1UBCA 3THWA 2XXAA 1UBEA 2KB0A 4W7SA 1KHTA 1YHNA 1GRQA 4HI0E 1KAOA 1VCIA 2EW1A 2YYZA 4CZ2A 4LCBA 5HKKD 2W0MA 1AS0A 1G1MA 2QEQA 5L3QA 1NRJB 4LHXA 5H68A 1IN5A 2G9NA 3W3ZB 1W4RA 3MLEA 4UXJA 5L3RA 2BOVA 3QKUA 2GZDA 1KO7A 1LNZA 4JVMA 1U9IC 1UF9A 4D80A 3R8FA 3F5FA 2NO9A 1II8A 1AS2A 2FPKA 2CCJA 521PA 2ZJBA 4URYR 5BN4A 1JQJC 2RGAA 4HUTA 4OQLA 1E69A 4EPWA 4ACBA 4KBFA 5AWFC 3EA5A 1N5LA 2IYUA 1FQKA 2VIIA 2P65A 1DG3A 2ZU0C 1U8ZA 1NN0A 1W47A 1NLZA 1R5OA 2WAYA 2ZS7A 3K0AA 1MKYA 3NBXX 3EXAA 1A2KC 1BKDR 3G82C 3ADCA 3QF4A 2O8EA 1XPOA 2QGZA 1ONBA 1FMJA 3KUCA 1S1MA 2YJTD 4Q9IA 1NY5A 2DFKB 5KDLA 2GHIA 4HUQB 3CBQA 1V43A 3QSYA 1K6MA 3DMNA 4U5XA 1I4DD 1OSNA 4A2QA 5FTLA 2DFNA 5KPDA 1RPZA 4JLMA 3A1TA 2GJ8A 2ZR9A 1KOFA 1E2FA 5JSZB 2WSMA 3UMFA 5L8VA 2JJ8A 4Q9KA 5E7IA 4H1VA 1Z63A 3R9XA 2ZJAA 1E2KA 2DHRA 2WJHA 3UMRA 1Z5ZA 5EXTA 3FKQA 1U94A 1Z07A 3NEYA 4IVQA 1HURA 4JKYA 4I4LA 2QPOA 4LYAA 4Q1FA 4EFLA 4TMZA 3NBZC 1WBBA 4B48A 2UZ3A 1GVNB 2ZIAA 4EFNA 4NKRA 4IDHA 3MWKA 5DI3A 1GM5A 3B8HA 2HF9A 2F43B 1DAKA 2P3SA 2OUKA 4I81A 1FPMA 1MRNA 3FDIA 1A7JA 1IXZA 4DLVA 2ZYWX 2PLRA 4HLQB 2P67A 2YOGA 3ECCA 2IYVA 1DO0A 1OXVA 4BZQA 1COWD 3IHLA 2JJ1D 3VNVA 5EZ5A 4A15A 2NPFA 2IEZA 1R5NA 5DO9A 4V0KA 4DLUA 2QN6A 4EPVA 2VP9A 4GZMA 4RD2A 2YZ2A 1SXJD 2B8TA 3PR1A 4B2PA 4BZXA 4IDQA 4OJQA 5C4GB 4TL8A 3IO5A 2QP4A 5B2ZA 4C0SA 1NVWQ 1KI4A 1CR0A 5FOUA 4G5RA 3RC3A 3K0FA 1KGDA 4QXAA 1W36C 4IDPA 2JDIA 5B57C 1EFRD 1W4BA 4LV8B 5TB5A 3C7KA 4F4IA 3GJ5A 1U8AA 3ADKA 4CEHA 1VCOA 4F91B 4US1R 1QF9A 2ONJA 2ZI5A 2QNRA 2ORIA 3P27A 2ZJYA 4Q21A 4QBFA 3E1SA 1N6IA 4GMDA 2VSOA 2CNWD 4B71A 3IDQA 4A36A 2ZXUA 5FTJA 1E98A 4PZZA 5TDHA 3LY5A 3ZJYA 2CLSA 3KXIA 3AGPA 2N42A 2XNDD 4R98A 2OBMA 3WNCA 2C77A 4FCTA 5FTKA 5KNCA 5JBQA 2GEVA 2J3EA 3EARA 2EQBA 4O25A 2O8CA 2AWNA 2AX4A 5JS8A 4AKGA 2O0KA 1IAQA 4Q01A 3PITA 3NG1A 2GCPA 2YNMA 2WOOA 3QVVA 4X8LA 4LWZA 3GLIA 2BBSA 2ZTSA 2IXFA 3VMFA 2D2EA 2FA9A 3AVPA 4RZUA 3RABA 3AVVA 3QQ5A 4IOJA 221PA 4GPTA 1N6RA 3MAAC 4F4CA 4MH0R 2F43A 1G7SA 1F3OA 1JPNA 3ZS9A 2CE7A 1N25A 1DBSA 2QAGA 3VHXA 1SGWA 2ERXA 2C95A 2ODWA 3ASZA 4EPRA 5JI3E 2EFGA 2G0NA 4BFWA 3FGNA 3A1VA 3OAAA 4MQBA 2ZETA 3PUVA 3B9QA 1E1QA 1JEDA 4XIGS 2O8FA 2DWQA 3B78A 1E1QD 4B35A 2XNSA 1E9AA 4C9BA 4PAMA 5FL7D 5K8IA 4NYMQ 2OZEA 3T15A 2IYXA 2C04A 2CCKA 2AR7A 2BMDA 3WYAA 1TUEA 4KFSA 4LYHA 2FSGA 1BIFA 2BMFA 1G19A 1FTSA 2XXAB 4CVNA 3TK1A 1YZQA 2J5XA 1FNMA 1GAJA 2DWPA 3U2QA 3EPKA 3CZQA 2IYQA 4XD7D 3REGA 1ZC4A 1UADA 4LOAA 3RNLA 1M34E 2GAOA 3WXMA 2YV5A 2CXXA 1XCGB 3CH4B 3CRQA 3SC3A 3IO3A 1IY0A 3ZYCA 4C0LA 4DCUA 2FJUA 4IKEA 5FPKA 1DO2A 3K9HA 2ODEA 2BKEA 1GWNA 1DAEA 3U7GA 1FOEB 4Z1MA 1OE0A 2BC9A 3IQWA 3REFA 4FMCB 2WIAA 1I2MA 1KIMA 1T3LA 3G5UA 3QVUA 3WMFA 2YKGA 1HTWA 1KI1A 1U9IA 5G3ZA 3SS8A 3NWJA 1EX7A 2PX0A 4NU0A 4BRWA 3QE0A 2J0QA 4DIEA 3O8CA 1G3IA 3R9IA 1XRJA 3RLFA 2OBNA 2XJ4A 2C96A 1YVDA 2ZI9A 1CLUA 3X1YA 2VL7A 5FH9A 4XD7A 4LI0A 4BLTA 1OW3B 4QJ3A 5SZJA 1XXHB 2WOJA 4KFUA 3DDCA 4ZV4A 1KDRA 2AKAB 2QP3A 3EPHA 4PC2A 4Q1BA 1ESNA 1QHXA 2NIPA 4ZDWA 5SZKB 1TL7C 1N6KA 2NO7A 2VA8A 4TLAA 1E2JA 4MYCA 1U0HC 4G1UC 4HUQA 3RYTC 2WZQA 1R0YA 2XSZD 2Z5FA 3GLFB 2WV9A 3GJ0A 4HLDA 5FUXA 4BLPA 2QTHA 3CO5A 4DIDA 2EVWX 3D6TB 1ELOA 1NIJA 2ZE6A 2HXSA 3B1WA 4LJ4A 4U02A 3OFND 4RVCA 5EXSA 4B3XA 1OIXA 2PZGA 4JLJA 5CDFE 2QGNA 5F2EA 2VSXA 3QG1A 1COWA 4TQUS 1KSHA 5DN6A 4QJ4A 3GQBA 4LC0A 1KZGB 1IOZA 2A7QA 5FR1A 4BWYA 2RGGA 4DWJA 1R4AA 1MR3F 2ZU6A 1R0ZA 4JBXA 2HJVA 2OXRA 4IOMA 4RD6A 3WBJA 4D0LB 1II8B 1YZLA 1E0JA 2IC5A 4NE2A 3F0TA 3U7FB 1S8FA 4P3YA 3RS0A 1JR3A 1BO6A 4UNRA 3W8NA 3H0KA 1H8EA 2IWRA 2REOA 1GP2A 1P2VA 3K8YA 1KAGA 3ZQ6A 2WMNB 4JBWA 2RGXA 3NH6A 1W49A 2JLQA 2IHYA 3TW4A 4O3MA 1S4QA 1CBUA 1NJGA 1SXJA 2CVHA 2GK7A 721PA 3K70B 3OIVA 1RYFA 2G1JA 1E2HA 2O5VA 4BEBA 3MJRA 2O8BA 3RRZA 2KSQA 3TQCA 1RJ9A 4LHWA 1QHGA 1NLYA 4Q18A 1SKQA 1DPFA 4M0LA 1ZCBA 5LDDC 1YQTA 4P4SB 4FMBB 1E6CA 2H8KA 4GP6A 1G21E 3AQ4A 4DEYA 3EX7C 3B6EA 4KVGA 4BFUA 1YR6A 2ZS8A 5CIWA 3UATA 3JVUA 3EW9A 3CIOA 4M9SA 4BFZA 2IEYA 4YDHB 4S35A 2D74A 1HUQA 2DPXA 1AN0A 2F7SA 3IIJA 4Q5IA 1KJZA 1VIYA 2O8CB 4R2IA 5IK2D 4GOJA 1KI2A 5FPHA 3S1AA 2WKRA 5FUYA 2AXNA 2DY1A 1UEJA 4IDOA 2EFHB 4O2RA 1G8GA 1ZJ6A 3ZDQA 4IEEA 5JCZA 4GI7A 1Z06A 4HLCA 2C9CA 3OIUA 3K09C 2ZI6A 2GJSA 1SKYE 4XSGA 1XD8A 1N6LA 1GIAA 2ZRKA 4QHTA 2O0HA 3K0AB 4JBYA 3U61B 1BYUA 1TF2A 5KSPA 1A5TA 4DLRA 4JLPA 1Q21A 1US8B 2A78A 3IBGA 4XSHA 2KBFA 3CPEA 4LJ9A 3OE7D 1HYQA 4TWZA 2ODNA 2ZRLA 1KDOA 4ASUA 5JECA 3ZVNA 1UKEA 3EZ7A 4AIIA 4HAYA 1Y63A 1OB2A 4HEJA 1KNXA 5EZ6B 4HDCA 2AFIE 3U3KA 1ANKA 1E2MA 3TVDA 4R9UC 3CRRA 4GFDA 4KAXA 4TMTA 4LHVA 8OHMA 1GRNA 4RD0A 4AURA 4G01B 2HEIA 5KPJA 1GNPA 2X1VA 1CIPA 3DKPA 4B47A 4DLTA 5AR1A 3FKSD 4KITB 2F6RA 3TNFA 5D3MB 3W3AA 3AF1A 3WBKA 3C5HA 3MWJA 1IN8A 4XWOA 2N1BA 4RCZA 3NBFA 3KZ1E 4HYYA 5GJBA 1U90A 4B2LA 2XZPA 2ZRHA 1YKSA 1P9RA 4NYIR 1VYUA 3IILA 3NKVA 1Q44A 2BCGY 3U44A 4BFTA 1KTVA 3UWKA 2J1LA 3ZD6A 3BC1A 4FINA 5BN3A 1P6XA 1T5IA 4JT4A 4MGIR 4AKHA 3UIEA 5AJXA 3T34A 1E0AA 2V55B 2XTZA 4B3FX 1EG7A 1YR8A 3EZFA 3HR7A 1SXJB 2GAAA 2GILA 1G3MA 4NYMR 2FGJA 1N6HA 1MT0A 3WHKA 2W00A 5C4MA 3MGCA 3QY0A 4UXHA 1EXMA 4PHHA 1RZ3A 3EIEA 1JR3D 4LX0A 2GCOA 1FL9A 3OEEA 2GZHA 3LX5A 1IHUA 4LK2A 4UNSA 2JATA 2Q3HA 1EGAA 5DYIA 1TU4A 2PBRA 1FUUA 1NVVQ 3C8UA 3E70C 2QT0A 5DH9A 4CRWB 4HB0A 1NKTA 1XTRA 3AGQA 5CM8B 3UXMA 2WWYA 1A4RA 1PZNA 2QZ4A 3Q9LA 3JZAA 4EQ6B 1JQLB 5DI9A 4C2TA 4OI0A 1UJ2A 2ATVA 2R6AA 2VLIA 2XSZA 3FFAA 5JRZA 3RRYA 3PG5A 2KI5A 1KI6A 2PEZA 3CX6A 3ZZ0A 2GKSA 2MSCB 4FMDB 2HYIC 2IYTA 1NVXQ 4QGGA 4IXNA 4BRUA 2QQ0A 2ZE7A 4FD2A 3RDPA 2Q3MA 5FTMA 3CPJB 1VG0B 5J4KA 5ANRB 1S0UA 4C3ZA 3I8XA 5LBIA 1O87A 4JYCA 2W6JD 4JVSB 3LBIA 4BEJA 1G291 3FHOA 3CF0A 3OHMA 2R2AA 4L8GA 1VIAA 3GJ3A 3B2EA 5KNBA 3PUXA 1OLOA 1SHKA 2C9OA 5FL3A 5FOSA 3N70A 2PMDA 3IQXA 4M53A 5IDVA 1DOAA 421PA 2OT3B 3O8RA 1E2EA 1UKVY 4CEHB 3KX2A 2IHBA 2K5UA 2F9LA 4Q9JA 4LRWA 3GLHB 1E94E 1U98A 4PC1A 3ZD7A 1IJFA 4TL9A 2O8BB 1DAIA 3KDSE 4Z8XA 1T3HA 2OBLA 2OO7A 3RVBA 2JJ2A 4GSYA 4DSTA 2WTUA 2ZUCA 3SHWA 1KKLA 4A9AA 4ERNA 4XJXA 1W44A 2JLXA 1CULC 1CJKC 4KCGA 2P6UA 1UDWA 3ZQJA 1BMFA 1WF3A 2IA5A 4M1MA 1XMSA 3D8BA 1KK1A 3OF5A 1NLFA 2ZR0A 1KMQA 3EZ2A 3CNLA 3QI2A 4JL8A 3BB4A 1SXJC 1WQ1R 5FBRB 4N0EA 1SVOA 5C2JB 2HUPA 3A58B 2QBYB 2ZQ5A 1E0SA 1OKKD 1OXSC 4QBHA 4A8JB 1QHSA 1G8YA 2C03A 1AIPA 1LVGA 1W5SA 2JJ2D 4PHFA 1W36D 3AVUA 1E3MA 2RH5A 2HYDA 5TV2A 2XAUA 4M1OA 3U3MA 5DYGA 3FYHA 1GSIA 4BLRA 4ESHA 4GBMA 3ZIAD 4TLCA 3SR0A 4BZPA 4YMTA 2E1RA 2BHRA 3P4XA 2IW3A 3VR3A 3EIQA 1E9RA 4PSKA 3RS5A 1E9FA 2H16A 4GT1A 2PZEA 5DHFA 1P2SA 3CW2A 3EC1A 3MRSA 5GVRA 2CL0X 4E22A 1S9DA 5D3QA 1FP7A 3LFUA 4TYQA 4TTQA 4Z8YA 4RZXA 5BN5A 2HCBA 4ZDIA 1PLKA 2OAP1 3U3JA 3K53A 5LPNA 1UAAA 2ZRJA 2CEAA 3DL0A 1X3SA 3TR5A 2WWFA 3AP1A 4PPNA 2F55A 3K9LA 3ZVLA 2UVQA 3QKRB 2G88A 4NMMA 3EZ9A 1JR3E 1U99A 3BB1A 3TSWA 3J81k 3Q5DA 1N0VC 3KB1A 3TBKA 2JLWA 3B9PA 4QNMA 5J4HA 3CWZA 1Z0FA 4JT2A 4OBEA 4C0QC 1KZ7B 4IRUB 1EFTA 3R7WB 1ZAKA 4N3NA 5AJZA 4M1TA 2D2FA 2B7BA 1E1RA 5JWHA 3OFNA 1EK0A 3X1XA 3CB4A 2Z4RA 3LH5A 1SULA 1J70A 2W58A 3K70C 4HLUC 3TJZA 2V1UA 2ZJOA 2FWRA 2ASEA 1V5WA 1DADA 2ZJ2A 1KY3A 3ZZUA 5EXPA 2C78A 3U3RA 5AK0A 3K70D 2YWHA 4E07A 4M9ZA 3GJXC 4KU4A 5KDOA 1KK0A 2WJGA 4B33A 4WXPA 1Z29A 3NIBA 5DIFA 4R71A 1QVAA 4YMSA 4UQOA 5AUQA 4ZDKA 1P60A 4P31A 4LYJA 3U44B 1E9BA 2R8RA 1MO3A 2Z83A 3CNOA 3LXXA 5BYKA 1DARA 1XD9A 5JWOA 1OFHA 4S2EA 2QT1A 3RWMB 2OHFA 2QRNA 3RRNA 4Z54A 1M7BA 2FEMA 2GF0A 3SJBA 1WE2A 3NHAA 3RC8A 4FMDF 1Q0UA 1R2QA 4TT3A 3U6BA 2BVNA 2A30A 4DLWA 4I1UA 2GCNA 3KB2A 1D8TA 2PH1A 1MABA 2AKYA 4JLKA 3PFIA 3TMKA 1MO5A 3FHCB 3QXJA 4V02A 4Q4JB 4Q1AA 3FVQA 1XJ0A 1E96A 3TGPA 2HXYA 1T4GA 1XWIA 1PVOA 1KO4A 2Q3FA 5FFMA 1H65A 2AK3A 4P32A 5EE3A 5FUWA 1F2UA 2Q21A 4TMXA 4M9QA 3TRFA 2NMVA 2N46A 3AVOA 2TMKA 4NH0A 1ZBDA 4BLOA 2VHTA 4XWAA 4MRSA 4A2WA 2BDTA 4RD3A 2JLVA 3LNCA 3SDZA 1GKUB 2BCJQ 1ZIOA 4WZ6A 2C8VA 3SQWA 2F3RA 3DOEA 2XJ9A 3EAQA 2VP2A 3N2EA 1WB9A 1W0KD 3A4MA 5CYPA 1NKSA 2KWIA 3PIRA 4IDNA 3U3OA 4A82A 4EJSA 5CB8A 2E9SA 2A3RA 4KV9A 4PR0A 5JWRA 2ZJ5A 3WP1B 3CRMA 4HZIA 1L8QA 1XBTA 3MUFA 4OHWA 3VTKA 1RVDA 1S1CA 2EU8A 3ZLJA 4QKQA 1E4YA 1GG2A 4C0JA 1XP8A 4QGAA 1M1YE 1RRGA 4BLQA 2XOKA 3VQTA 2JLUA 1GNQA 2QUZA 2GTPA 4MYHA 2NPIA 1Q57A 2ZRGA 1JALA 3BFXA 1Q20A 1ZC3A 4XVQA 2HT6A 2YWFA 4K8OA 4OKSA 1YR7A 4A0FA 3H84A 1NP6A 4M21A 4NYJQ 1VG8A 2Z43A 1M7HA 4UXIA 2ZAMA 1JXMA 1RKBA 3KJIA 4Q47A 3R8CA 1NJFA 1P2UA 4U7DA 4D81A 4G5GA 3ICEA 2ZAOA 5AJVB 5AUPB 1OB5A 3PJRA 5KNDA 4JVLA 1G6HA 1KJWA 2BV3A 1G8FA 3ONWA 4ZCLA 5B30A 1KI6B 4HAXA 4C30A 4G3XA 2ZM5A 4G5QA 1UKZA 2QMOA 1G8PA 3VX3A 1R7RA 4GRAA 2OXCA 1ETUA 3GLGB 3FMPB 3U5ZB 1FZQA 1WCV1 3O8BA 3PUWA 5C1BA 1Z0DA 1FX0B 1I2DA 3BE4A 3IIMA 4WVFA 1CU1A 2VF7A 2Q9BA 1EX6A 2V8OA 2CE2X 5BW8A 1OF1A 4M1SA 3OEHD 3MG9A 4M1YA 5FI0B 1SKYB 1FNNA 2VHUA 3OIYA 4Q1DA 1QVRA 2ZANA 5FBWB 1DAHA 1J90A 3KKPA 3BB3A 3GLIB 4WIAA 1XNJA 1B0UA 3BRWD 3QF7A 2OFXA 1GFIA 3QJYA 3PUYA 3GD7A 3HJNA 4RCYA 2QMUA 4W5HA 2LKDA 3TR0A 3UK6A 3TUIC 4Y0VA 4MA4A 3K9GA 3RANA 1IN7A 3LXRA 2V6IA 1MV5A 2RGCA 2GRJA 1E2QA 3HU2A 4M4SA 1RC8A 4L9SA 4RKFA 5DN6D 4RKEA 4OJKA 1YZNA 2OESA 3CX7A 2FOLA 4W9MC 3P32A 2HLDA 2X19A 4KBGA 2R9VA 4Q7JB 4B43A 2BEJA 2GXUA 3GJ7A 4DCTA 1PLJA 4DB2A 1WRBA 5FBLB 3Q72A 5GADl 1N2CE 2J46A 2QENA 3M0EA 4HDOB 3T12A 4XVUA 1GITA 2ZJZA 4NZYA 3WYFA 3GFTA 1LB1B 1Q1QA 3DZ8A 3Q8XB 2PL3A 2WM9B 4A0GA 2DYKA 4D26A 4UNPA 3FKSA 1P4SA 2VPPA 2GCOB 1G17A 4I1VA 1QHIA 1QZXA 4LJAA 2J45A 2P2LA 2EFEB 1P62B 2IYLD 1RJ9B 1HT1E 3KQHA 5UKDA 3C5CA 4TYNA 1Z8FA 2OILA 5JHHB 4P33A 4Y0AA 3MCAA 1T0JB 1XCPA 3T1VA 4EQ6A 5L3QB 3EPJA 2EYUA 1XEWX 3VAAA 1LW7A 1W0KA 1Z0AA 1XEFA 2IXGA 2MMCA 2YINC 3B1ZA 3HYRA 1D9XA 2CL6X 4PAQA 1NSTA 2VP0A 1CS4C 2ZSBA 4LBYA 4YMWA 4AK9A 1TU3A 1EWRA 5JZVA 5HR5A 4GDFA 2IWHA 5JJLA 4AI6A 1X8KA 1M6NA 1KI3A 3KKQA 4QHSA 2OLJA 3TQFA 2QG6A 1W7AA 3I8SA 1ZVQA 1E9DA 4YQFA 2GVDC 4Q4JA 1NY6A 3CRW1 1O3YA 4ESVA 4ZIRB 1OFUX 3K1JA 5JCPA 4AY2A 3VKHA 2JA1A 1RIFA 5KSZA 4IOKA 3B60A 3N5CA 4QG7A 4TQAA 1DAFA 3X1DA 5P21A 1U2RA 3QKRA 3FPAA 3THYA 4LSGA 4PC6A 1F60A 2X2FA 1E2GA 1DTSA 3QXCA 2FV8A 4PO1A 4Q1EA 3AKCA 2IS6A 1YE8A 2QSYA 5CLLA 2Q0HA 2QMHA 2G1KA 4U00A 4UNQA 1P9WA 2HJGA 3JVVA 3PEVA 2FFQA 4J0QA 4DT1B 3IPXA 3ETLA 3GEEA 1AQYA 2WAXA 4KLZA 1NG1A 1NMXA 1E99A 3GMTA 4HDQB 5JMTA 3CR7A 4P4UA 2QQEA 1ZP6A 1MOZA 3L82B 4Q9HA 5JEDA 3BAFA 1M2OB 2CK3A 4C4PA 1Z6TA 4JIMA 3SQXA 3H1TA 3THYB 4IXMA 1QHHA 2ZS9A 3DO6A 2HT1A 1CXZA 4F92B 2PCJA 5F9HA 3A8TA 4XH9B 2JIZD 4DLXA 2YVUA 3RS7A 4F38A 2JLSA 5JHGB 1BH2A 1TEVA 2WJYA 2VH5R 1NVVR 4PSAA 2QAJA 3HWSA 1E1RD 2GA8A 2P5TB 2NGRA 4NTZA 5SZIA 1TQDA 3IKJA 3I73A 2W6JA 5KSYA 2HCJB 4PC3A 5E3HA 2MSDB 3HU1A 5FI1B 1TADA 1P72A 2IYSA 5EE1A 4OHXA 2H17A 1LFDB 1OHHA 4D6PA 2R44A 4XWKA 1NF3A 1ESMA 4M9XA 1L7VC 1TUIA 4B6FA 4ZI2A 3AF2A 1WA5A 5JS7A 2QA5A 4TZ0A 4EPYA 2GBLC 1HH4A 4GMXA 4MRPA 4QRHA 1NG9A 1VDZA 2EWVA 2W6IA 2XEXA 2H92A 4MKHA 3S1AB 1KI8A 3KKNA 3BD9A 2IF0A 5FBQB 3U60B 2ZRIA 5KUTA 2B6HA 2ZYTX 1LS6A 5FUVA 5F98A 5J5CA 3CLVA 2IUUA 1ZM9A 3PEUA 1D2NA 1G7RA 4UJ3A 2QPAA 1GL6A 1M7GA 2ANBA 3W34A 1NN3A 2BIFA 1N0WA 4TTRA 4AYXA 1OYYA 2HF8A 3RS2A 3U6KA 1AA9A 2IS2A 4MGKR 3EPLA 1RRFA 1VYTA 1W48A 4A2PA 1BMFD 3BH7A 3VR5A 3ZH9B 1N6PA 3SFVA 4PANA 2ZJ8A 1OXUA 5HPYB 2AN9A 1GRRA 2RGBA 1C1YA 4Q7KA 3TIFA 2GDJA 4H1UA 2IX3A 4P0TA 3T1TA 3K0FB 5LD2C 2X2EA 3AP2A 1GL7A 5E95A 1E32A 3DMDA 3SBDA 1YR9A 2WSSD 4KSBA 1OKKA 1CRPA 3BFVA 1P73A 2A5JA 4TLDA 2PEYA 3VHLB 4ZIRA 3SHFA 2GEUA 5JFGA 1N6NA 1K8RA 3QPWA 4EJSC 3C16C 5ELXA 2ZRAA 4BECA 3DOFA 1QHNA 3OE7A 4C0BA 1AQUA 3AKEA 3UKDA 4HZUB 2EFDB 2JGNA 3QIAA 1W0JD 4D0GA 2J41A 4JLOA 3KQNA 1ZM7A 2C2HA 2CVFA 3AVYA 4FMCF 3OIWA 4DT1A 3FWYA 1JBKA 1N0UA 1CJMA 2PZFA 4ARZB 1G3QA 3GLGA 4JLNA 1II9A 3TE6A 1U81A 1XTSA 2JASA 2WIBA 1E2LA 2OV2A 5EUQB 1W4CA 1TPZA 4TL6A 1KSGA 5BXQC 5IRCD 2ORVA 3VU9B 1A2BA 2WBLC 3KUDA 121PA 4OK3A 1QHHB 2XX3A 5B58C 3AVTA 1CJUC 2E87A 2RGEA 4KVAA 2OFOA 4EUNA 4BQSA 2P6RA 3BS4A 4NHOA 4PHTA 1MO4A 2LCFA 5G3YA 3GLFE 5GJWC 4DCSA 2W2VA 4LJYA 4JJZA 4BPBA 1AGRA 3KFVA 1A1VA 3R7WA 3AF0A 1W5TA 3W6OA 5KO2A 3T35A 4PPFA 4QM6A 3UANA 1F2UB 3QENA 3DHWC 1GNRA 4C7OA 2QM7A 3OESA 4DCNA 3TSOA 4B32A 1ZM2A 2FE4A 3VU9A 1KMHB 1S3GA 3CF2A 2JIZA 4ITRC 3C15C 1D2MA 3KKMA 1E79A 1XMVA 2IS1A 2GXAA 2FPLA 3V9PA 1UEIA 1XTJA 2L0XA 2OCYC 3SI7A 1G9XA 4FWIB 2OG2A 5IHPA 3OAAD 3QPUA 3B1YA 1BYIA 4DSNA 4LGMA 2ZSDA 3AF3A 4TL7A 2JLYA 1DELA 4KYUA 2VSFA 3THXA 1VG1A 2OEPA 3WMGA 4B3BA 1G8HA 2ZRMA 1IXRC 4RSGA 3AUYA 1CJVC 2GF9A 5DGXA 2WJIA 1WBDA 4MRVA 2FH5B 3GEIA 4TTPA 5FL7A 1NIPA 1CEEA 3LVRE 3WNBA 4YMVA 1P7CA 2W6ID 1KDPA 2FNAA 4IFBA 2CHQA 2DBYA 4ZCIA 3I4LA 4M8NE 1G18A 1AJEA 1DEKA 1SVIA 3WRXC 4A6XA 2OCBA 3AF4A 2NZJA 3KQUA 5BWMA 3KFXA 4LPSA 1E9SA 3QXXA 1G3UA 3NXSA 5CK4A 2X77A 3VX4A 1TQ4A 1DS6A 1RFLA 4YXWD 1NN1A 4HAZA 5EXXA 1W2HA 1FMLA 2G6BA 5A4JA 3SJCA 4RZ3A 3LBNA 1Q22A 4PTLA 3MWLA 5SZHB 4RFVA 1E0KA 1NSFA 2CMKA 4US2R 4AG5A 2DWOA 2V3CC 3SN6A 3WYGA 4G5SA 1GTVA 2GXSA 3CONA
chains in the Genus database with same CATH superfamily
3DONA 1UQTA 4ENTA 1DCTA 4C5CA 2FW9A 2WWIA 1QP7A 3DWEX 3LGXA 1OH8A 1OZFA 1OXBB 1VRVA 2C4MA 2FRXA 4MR8B 2D06A 2QG4A 1PFYA 4KH0A 4YREA 1H66A 4OYRA 3NT2A 3CTPA 2QR5A 3QKTA 4K9PA 3C0KA 2LPMA 4ER0A 4TKVB 1KOGA 4FFRA 1DJMA 1QWSA 3R3ZA 4K46A 5E4YA 3PEWA 4BNVA 2GSDA 2GO1A 4UMDA 3RTGA 4PLFA 3AL2A 1K6XA 4EF5A 1RJDA 4H3HB 4MKIA 4QDJA 3M49A 3IV6A 4CLRA 4YAFA 1XAJA 2DTEA 2ZUDA 1OFUA 2FFBA 5E6RB 1I01A 1UBJS 3U1VA 1TNDA 4RA6A 2Z4SA 1IWOA 4MV8A 5I7EA 1V5EA 1U5BB 4NZZA 4X91A 4U2EA 1NUUA 3LDUA 5GONF 4E09A 1S4MA 1IONA 3NHZA 3PHGA 5FPTA 1NBWB 1T91A 2I87A 4CTMA 4JXXA 1J9ZA 2HLDD 2IUYA 2QLNA 4GOKA 2OV8A 3ZWOA 1W581 1UBMS 3LW7A 4UM9B 3KZNA 3L4SO 2PLNA 1NW9B 2NVWA 3RKRA 2ZE8A 2BFBA 4HNQA 1RQNA 4MVWA 1WOYA 4DC1A 4MYRA 1YRAA 2D59A 4GF5A 1O95A 1PGPA 2ZYUX 5A3SA 5TEVA 5IYZA 1PNRA 4WJLA 3ND7A 1ZH2A 3A36A 4B2IA 3ZY3A 5F7OA 1O0BA 1MJNA 1M1NA 3AZQA 4KYIB 4RJTA 3LPLA 3SQMA 3VC7A 1W30A 3NO4A 4NV0A 1NRWA 3DVLA 1OZAA 1FK8A 3K0CA 2NXEA 1BS9A 2OAGA 2ZROA 2ZWVA 4R0MA 4UDYX 1C1HA 4Y6LA 2ID9A 2DSTA 5K8LA 4FYMA 2VPTA 2XCUA 1VHTA 5DM1A 3D3JA 3UTDA 1T8YA 4TGLA 1BOFA 2C00A 1O6GA 3F71A 3LSYA 2Q07A 1E1MA 2UZIR 2AG1A 1ZVJA 1RCTE 2MINB 2B8JA 3DGFC 3OMXA 3I1FA 4L1KA 3HKBA 5BNIA 3L4KA 1RC1A 4RJ2A 3O8QB 2QTTA 3HGQA 3KWMA 4LYFA 1E66A 4KZPA 4EDHA 1BRMA 4FHDA 3U4QA 4LBVA 3VI4B 3DLBA 3EGDB 2SKCA 4R1LA 3W78A 2IV3A 2OZLA 1D2EA 1Q3KA 3C7AA 1YV9A 4HZGA 2FDXA 2EFCB 4N6OA 3ZHZA 5I5EA 3HYNA 1AG9A 1J7JA 3NHPA 1XD2B 1BU8A 2F1RA 4FWTA 5B1IA 2PA0A 1RWPA 3LYHA 4N4AA 1DFHA 1KO1A 3N2KA 4LV5B 3TLGA 1EXVA 1UJ6A 2DFVA 3JQFA 1BGVA 4YLEA 1V1RA 5FYDA 1IQUA 3DC7A 4B2YA 1WU7A 4CN9A 2Q0XA 3HJTA 3RVDA 1DL5A 4DJTA 1EFVB 3D7LA 1XEXA 3AEZA 3C6XA 5SY6A 3R3XA 1ZD3A 4X94A 3CYFA 1NZDA 2FPXA 1VIMA 4E5PA 4L85A 1PKEA 1C3OB 3GI1A 4UZEA 4O4IF 2XOEA 4YMIA 4YRJA 3FWPA 3KOMA 3N39C 3BHNA 4O5OA 3DWIA 5EP3A 2PKYX 5FWXB 1ML4A 3UBTA 3PC4A 1VCMA 4WUTA 3A3KA 5DFAA 5A7FA 2QTWB 3KVRA 3FUUA 3LHSA 3O83A 4L51A 1A5SB 4B7XA 5FX2A 1QFZA 4Q1VA 2YBDA 1YZTA 3V1MA 1MW8X 1HY3A 3DBVO 4MKGA 2W5UA 1Z37A 4AC9A 3PENA 2FEOA 4R6XA 3UJDA 1QOPB 4HUJA 3PD1A 2IXAA 3PQ4A 2E49A 2PXAA 3FW1A 4JQZA 2HBRA 1WP9A 3PI7A 3L7NA 3E23A 3X1MA 1EQUA 5FNVA 3DNPA 4CM9D 4HY3A 4MWGA 5BUSA 3B6ZA 3GEMA 2ORWA 5DX8A 1LS1A 1W52X 2GBPA 2RG1A 2XTMA 5I3ZA 2DR3A 3EYAA 1QO0D 1M2WA 3TWOA 2J7PA 3DOUA 3SFZA 1HQCA 1BWSA 3E0QA 5AQ1A 4FGUA 1AUXA 2QE7D 1NTOA 5AOBA 4ZC1A 1Q1EA 2JIQA 1R15A 2WU1A 3LBHA 3PUJA 5A4MS 5BWCA 4RPGA 2W83A 3WIDA 2GTHA 4XTRA 2IYYA 1DE0A 3BFKA 4IJQA 3BA1A 3EEQA 3DR3A 1CUBA 1OUMA 1ORDA 1Z8NA 2NSJA 2GVZC 3ITDA 4HGPA 4I8XA 4OLJA 4Q9NA 1YTUA 1FXUA 3A9RA 1Z5GA 3H7AA 3KEOA 3MD9A 2RGYA 1S2OA 1VMKA 1JAXA 3MJHA 5K3FB 1NUTA 1YNSA 3WLPA 3U4QB 3OTQA 3U39A 1URPA 1QDLB 4B8WA 3U37A 5L95A 1Z18A 2IYRA 4PQFA 1IE3A 2EF1A 1J99A 3TQOA 4AECA 4QC2A 5B12A 4RESA 2ZB8A 4W7HA 4YRGA 2FW7A 4G85A 3ES9A 5ECGC 2VUTA 3COZA 3I32A 3UWDA 3Q6NA 3ESQA 4C20A 3T3OA 2A0XA 4ZEOA 1JNXX 1A5ZA 4ENUA 2VFAA 4RD4A 3GDGA 2DLNA 2NUPB 3GC6A 2QR2A 2B92A 3OQHA 5AKZA 4AS2A 1C7IA 1L7PA 1ST3A 1DXHA 3E7DA 3N8NA 4XYEA 4BB6A 4JGIA 4C29A 2PH7A 2JAOA 1LKZA 4FOPA 5DRTA 3HACA 1I4LD 4ND4A 3UGQA 2E6UX 3LC0A 4YPFA 3H3XA 1U6IA 2J7KA 4GP9A 3IDOA 1GZSA 2IY7A 4QLAA 1H3NA 2B1IA 3CN7A 2QIOA 1GZUA 1GGNA 4IINA 2QPLA 3AFNA 4FNMA 1JHYA 2VOJA 4MICA 4ZQEA 2GJAA 2C8KA 4K1LA 5EP1A 3WDMA 3SKVA 1THMA 4PX9A 4CIVA 5I45A 5T57A 1YAJA 2PGJA 5CLHA 4G0VA 3E22B 1R0CA 3KB6A 2ZBEA 1IMJA 2XNKA 3KKEA 3N2NA 1A82A 5NLLA 4V0NA 3B38A 2FZLA 3D5EA 3KT6A 1L5LA 4JLBA 2JI8A 2GPTA 4B6SA 4DUGD 1JHMA 3R7BA 3UMGA 1BQ3A 4FM9A 5EQTA 2W90A 3KYDB 3BGWA 5JZMA 4IIXA 1JSXA 5E9AA 2A0YA 1FTWA 1GG8A 2HU5A 2J9YB 3EMDA 1OIVA 5AHXA 4A6PA 4BNYA 3MJEA 3N3BC 1V11A 1D07A 2O0JA 2FK8A 2FPMA 1XTKA 2XTNA 3BIFA 3MWDA 4RD1A 1F4VA 3UFXA 2B5VA 4Y30A 4CXMA 3S8EA 4EB3A 2XGOA 1TAGA 3Q7QA 1X1BA 5EXDA 5TXGA 4H1HA 4PS1A 3CNNA 4YMUA 3AB3A 2VQ3A 2C1XA 4PYJA 3SM3A 4MUNA 1A9SA 4CYMA 3ZYZA 5F52A 1EUYA 1P7PA 4TTTS 4QYIB 2MIIA 4C4ZA 5CFNA 1KSFX 2YASA 3P2JA 2XE7A 5JZOA 3MFYA 2OOKA 4K9SA 3UWMA 5JNWA 1OAOC 1W4AA 3IUMA 3VSEA 4J3FA 3T52A 1PDWA 1U2GC 4TRRA 2VAWA 2PVSA 1J2JA 1L5OA 2NSHA 4KIWA 5F5NA 2Q3BA 1NVTA 2IE0A 1Z0IA 2C5BA 2GBCA 3B85A 4RVNA 2X9GA 2IBTA 1O77A 2XCRB 4BVLA 4G5FA 2EKLA 5KTYA 3PD7A 3EFOB 4QGFA 1RRPA 2B21A 2YXLA 3ETCA 4PXAA 4ZYLA 1QYCA 2VSYA 4OXIA 1ONNA 1WXEA 3PC8C 1XZMA 2NP7A 1BEZA 3EQ9A 1VIDA 4QDKA 1WW3A 1KHHA 2RB5A 2BKUA 4LXIA 2D1QA 5HFNA 4JR0A 1KZYC 2C2XA 1R0WA 1JP7A 2B1QA 4RF2A 3LIPA 5GM1A 3V4FA 4DLZA 2J31A 3GG2A 3RS4A 2RGRA 3IVMA 4R1MA 1G63A 4AO8A 1VKRA 5B3LA 1H0KA 3DZBA 3ZXXA 4AF7A 1ODJA 3L0PA 2WDZA 3PA8A 1CZNA 3LDAA 3CUKA 4CIYA 5AW6A 2ZR7A 3TTYA 4G0YA 1R64A 2VTBB 2XF8A 3CZPA 3OQVA 4H6PA 4A8TA 4YCSA 1YUNA 3SOZA 3CT4A 4LGCA 3HYTA 3OJFA 2QLJA 2V9CA 3FCOA 4FW9A 1Z4MA 5EJIA 5ENVA 3SHQA 3L0CA 1PV1A 2PO5A 1T9CA 3EOBI 5DF1A 3VH3A 1W4LA 5TVKA 3DV0B 3HCCA 4B0PA 3NM5A 4Y2UA 1T5HX 1EK5A 1G8MA 3MWYW 4GO1A 1L1QA 1JEYA 3CVVA 2NXNA 3DWGA 3TTVA 4HQ6A 4NFYA 3KUKA 4QELA 1TOAA 3IPRA 4FYJA 3PHIA 2Z08A 2V6JA 2QW8A 4TM8A 2JCYA 3IUEA 2JAHA 3S40A 2C3YA 2R7NA 1QMGA 2C2WA 1ECLA 1JXOA 1WCIA 2I54A 2JGJA 3CCCA 3PJDA 1OV6A 4EGFA 4ZK6A 5I01A 2BBOA 4UAVA 3SE7A 5K8CA 4E15A 3CW8X 2VTVA 3EFEA 1IVYA 3OPMA 5KKNB 5BSEA 3SSNA 2P6PA 3IP8A 4XA8A 1J2YA 1F2TA 2LZ0A 1DNPA 1PWHA 2YFYA 3GDFA 4FCWA 1D3AA 1EX9A 2G77B 2J9RA 2Y9MB 3IDSA 4F2DA 5KJ6A 2DLCX 1NPTO 1QIIA 1D4FA 1ZD2P 2FWAA 2O3UA 3EXG2 5C8YB 5HZKA 1G5RA 1B00A 4QOFA 1G0NA 4LWOA 2ZVPX 3OZIA 4NYJR 3SYMA 2ZAIA 3ISTA 2H4WA 1H2BA 5FQOA 4W4TA 3M6IA 2X9QA 3TD6A 3W5JA 2PKCA 2FWNA 3KJEA 4RF3A 2V7QD 4B3CA 2DHDA 3YASA 5H1YA 3HJRA 1T3ZA 3OO1A 4HS4A 3W5UA 1TT7A 5JJKA 1IL0A 5DLQC 2DXIA 4CCYA 3AM3A 3L93A 4Q02A 2HPHA 4Q4AA 2BGKA 3M83A 4DF3A 3FETA 5IANA 2G82A 4B3IA 1DJQA 4OK6A 2OFWA 3ZXSA 4AQDA 3FVRA 2IEIA 4ZVKA 4WV3A 5H70A 3PPWA 3GJTA 3TEFA 1QTRA 4IS3A 4KG7A 4WXRA 5HHTA 2ZPTX 5AW9A 4RETA 3U26A 1VL2A 2D1SA 5IDYA 3WYCA 4N5NA 4TMWA 1Y8AA 1S2DA 3H2GA 3PLNA 1RHKA 4FIDA 3N2GB 4K5QA 3RFFA 2X7HA 3FRHA 5GWXA 3TLEA 4YROA 3E9DA 5HTKA 1EJ0A 1E3TA 1RRKA 3G2HA 2AD5A 2ZW9A 5LR6A 2H57A 4R2KA 4OD0A 2F3UA 2PJUA 2REXB 2GN6A 3H0EA 3S1SA 4WZBB 1MOSA 2EL7A 3WWOA 4N41A 3ELUA 5DEOA 5JDIA 1ONSA 1M5TA 1SFRA 4ZZ0A 3EUFA 3O7MA 1NYRA 2W2TA 1DJLA 1JEYB 3FI9A 1XCLA 3DGEC 3O73A 3O4RA 1MAVA 4P3XA 4NCJA 4BP3A 4I08A 1ZN7A 4D98A 2QUJA 2XMDA 3PV0A 1KYTA 1LGYA 1R74A 2B8WA 3GGPA 3F4LA 2QJRA 2QW0X 4PO8A 4ZKDA 2AJBA 2WAMA 1XGKA 1Z2OX 5J1TB 5LZ5A 1N7HA 5I7VA 1TAUA 3RYHB 2D2VA 4H35A 4YRMA 2CYCA 2Z5LA 3HSSA 1OV4A 2JAQA 5E1MA 1GZ7A 1GTZA 2B0CA 2IGBA 2OE2A 1FS5A 1IN4A 4GYWA 1Y8RA 2ZZMA 3M1YA 4JU9A 4RH0A 1XRMA 1X7WA 3G7SA 4FFNA 3EXIB 3GT3A 1QDUA 2C42A 4DPKA 2Y1EA 3GAAA 3O91A 3TJRA 2XQKA 2I8CA 3BXEA 1XQ9A 4WVLA 3H86A 3H97A 4GAEA 4ZT2A 1IRXA 3AR5A 3N53A 2DHEA 3R0ZA 4KXFB 5EE9A 4UBJA 5BOVA 4F4JA 2ACVA 3K0CC 5FQNA 4JXZA 2YRWA 2YZNA 4B4UA 4PINA 3RODA 1GYQA 2CCGA 4PLYA 3VYRB 2C4VA 3ORYA 4BQEA 3II6X 4D9HA 3QVWA 3KB8A 2CLCX 2QI9C 1Z6XA 1I4WA 1OLXB 4A5OA 4R16A 4RK4A 4PWZA 1MU0A 4D0NA 1FP6A 1Y6ZA 3JYPA 3PQ7A 4ZAGA 3DP7A 4CQMD 1Z4NA 1GUFA 3TRDA 5ESXA 2WMOB 1R8XA 2CUNA 1JDJA 3C3PA 5GZ1A 3H1BA 5C46F 3VJRA 2FU5C 4YV2A 2AL7A 3G0HA 3TMYA 4GH5A 3L7MA 5BYJA 4DZZA 1EXWA 4YCLA 3S3TA 3G3EA 4BMVA 1M34B 4NZMA 4WK6A 1WDTA 4NXMB 2K87A 5IN4A 2FCRA 1KRHA 1DKLA 3F3YA 4MV3A 5IFKA 1SWVA 3CR8A 3C4JA 3CWQA 3IXQA 1U2SA 3NVDA 4MW1A 7MHTA 1DEHA 5LP6A 5HCIA 4F5DA 1O8BA 1AZSC 2NSDA 4L0CA 2RAUA 2NUAB 1FSSA 3NANA 1E7QA 1QR2A 1BXZA 4BNWA 3NDBB 4MGYR 1NBIA 3I62A 3AVQA 3TD9A 4I3GA 4MVXA 1LRJA 3C3MA 1T0IA 4WN9B 4N40A 4EYQA 4TMFA 2YC4C 3OPNA 5HRCA 5E7JA 4TYWA 1NVFA 1Q7TA 2H1SA 2D5BA 1TQHA 3BQNB 3DTVA 2NVOA 1EWVA 1ECBA 5KTRA 2E48A 4RFLA 1WDMA 4MJ7A 4YJKA 1SK9A 5A4FS 4H17A 1DEOA 1W46A 4LZZA 3AEXA 1VA4A 3JCZA 1B7GO 2WNSA 4GKAA 4LDQA 5EKTA 2FZEA 3UGTA 3WLFA 3KKZA 1QTIA 1SR8A 1MIHA 4MLCA 3RUPA 2ZQZA 2GDZA 2L17A 4ZTBA 4OGLA 4L5AA 1KE1A 2AUTA 2R8ZA 3B7GA 3NIDB 1V7PC 4E21A 2IUSA 4P7FA 4D41A 1TA0A 4RH3A 1ZUHA 1D0IA 1JHOA 5AI4A 3RSCA 4YJDA 5EHZA 3Q8LA 1X13A 3GRZA 2DQ4A 4MQEB 2AJDA 3WRXA 3K31A 3M6AA 5HDQA 3RUDA 4K6CA 4Q3NA 1H2EA 1KC1A 1QBKC 1LPOA 3AYZB 3ESDA 4MS3A 3UO8B 3VZQA 3GWZA 1NC1A 3LG2A 1YK1A 3DCJA 3B5JA 3GVPA 4GGOA 4HTAA 3HDGA 4WZBE 5AKEA 3W3AH 4OQXA 4OLFA 3FE2A 1LTQA 4FFMA 1KAEA 3O2JA 3B1VA 1WW2A 4ZVPA 4RELA 1UWCA 1XZDA 2A9QA 4EUSA 2HU2A 4V2UA 4J49A 4CLDA 2BLNA 1FFWA 4WERA 1FBTA 1R4MA 2BMJA 3KAPA 3M1LA 4U1RA 4X41A 3K09A 4M99A 1YE3A 3HP1A 4Y9DA 3RYCB 1KU0A 1HFEL 4NNJA 2D1FA 3NTOA 4GKKB 3IEUA 1EDZA 1BVRA 4C0KA 2O1EA 2PG3A 1OHHD 4DDTA 3ZVMA 2KHZA 2W2PA 4RS4A 4TV9A 5I9MA 4ARZA 2OY0A 4G36A 3RT9A 2XVXA 1P2DA 4XSVA 4B7UA 1U2DC 4WFQA 2HM7A 2OKCA 3BT7A 1FQJA 1R4MB 1FFAA 4KLNA 1FFHA 2M6LA 3SDSA 2QORA 5GZ6A 3ADDA 4LV6A 3SSMA 4DN6A 3BYZA 4D92A 2NUAA 2ZWMA 3KPUA 4A1FA 4GMFA 4JN6B 2W37A 3SBOA 4G1CA 4FYHA 3DL4A 3IPYA 3IUYA 3ZWXA 5FTNA 4YI3A 5I7AA 1II0A 1VYVA 3MMZA 3E3AA 4MW4A 1O1YA 3UWOA 3F96A 3M9WA 4PVDA 1EUQA 2W2KA 4YV0A 4R01A 4OHUA 5M3BA 4IL5A 1TJ4A 4MI1A 4TUYF 3AUXA 1Y1SA 4ZO6A 3KPJA 1JAIA 2FUNB 4MVJP 4AYTA 5BV0A 5J4VA 2WD9A 2X8JB 2F1HA 1JR6A 2YYYA 3V7NA 3PUZA 2NLOA 2BEKA 4YDRA 3SJAA 1JIIA 1T9HA 1MIOB 3SBXA 1ZD1A 4C87A 4NQRA 4I1OA 3NYIA 3R6GA 3KJXA 4OP2A 2JPDA 2VCEA 4J90A 3L05A 2VPYA 4HGNA 2CNOA 1NYLA 5DBOA 5A4KA 1UMBB 3ED5A 4RY2A 4X1KB 4DCVA 1XTUA 5A62A 2J6HA 5COBA 3Q40A 3QNUA 3ZHSA 1PR9A 1RM5A 4CM6A 4ZMRA 4ALKA 5JDCC 3SAJA 4WA7A 1YBMA 3WGYA 2WM8A 3AOEC 1G2QA 1JPUA 1NBME 1MJ5A 2JVJA 3BSWA 4PV7A 2Y1CA 5HILA 5DJ5A 3VO1A 4RTPA 3LPAA 4Z51A 1KRWA 2ZVQX 3OM9A 4X7RA 2ON6A 3A1WA 3TMAA 2Y2UA 2AE2A 1CQJB 4FFSA 4P81A 3HB4X 3ZI0A 3ZS8A 5CIYA 2AOTA 2QXYA 1YMQA 2EDCA 2EYQA 3O21A 5TNXA 5TMEA 1XMXA 2AEFA 3I5AA 1EUCA 1K5PA 1TYBE 3EUAA 3CUEF 3UJ7A 4B4WA 3MTDA 1T3SA 1O6FA 4XTCS 3OTGA 1DUVG 4R8RA 5KNCH 3W5CA 4IIVA 3NR2A 5EEHA 5I4KA 1ODKA 4IV8A 3ACDA 3H2ZA 4L4SA 5L3ZA 5AM4A 3WB1A 1V2GA 1G41A 3ZDDA 1T6XA 4KE6A 1E4EA 3ZW9A 3I1IA 1E1YA 1E2NA 1Y5NA 1X92A 5DYNA 5GGXA 3NTXA 4LPKA 1E2UA 2VHYA 4V1CI 1ZH6A 1N6OA 2BRUA 2GEDA 4JL6A 1Y3CE 3ORHA 1L7NA 3G88A 3SEQA 1XQYA 4AG3A 2XCLA 1N8NA 2CXUA 3FD8A 4LXUA 3RJTA 3TIXB 1U7DA 1IBKB 2CVQA 1E63A 3TFWA 4NWIA 2BFFA 1YB5A 3EF3A 3EMKA 4LTNA 1FB5A 4BJ5A 4EJSB 3TLKA 2R47A 2VAVA 3GCGA 1ORHA 3P1JA 1JFLA 5F51A 2OGUA 5E7QA 2KM1A 1FFYA 4I5DA 2ODBA 4KMOA 3SMVA 2JI6A 5JLAA 1CK4A 2XMRA 2XUAA 2UV8A 1C14A 1QH8A 1EH5A 3DYIA 3QK7A 4G5YA 5AD1A 3PXCX 1TW2A 2OAQ1 1G9SA 3A1DA 3VM6A 4A0RA 4BFSA 5L4LA 3OE4A 3DBHB 3KLNA 4PLGA 1P4HA 4RNDB 1KC3A 4WEOA 1NR5A 2BGGA 3SC4A 4WQMA 2G70A 2GHRA 3U19A 1N5KA 2KJQA 4NDZA 2BGRA 3AL3A 5MGBA 5ECYA 1FUKA 4QDTA 1PQ4A 5TPZA 2YIVX 4IQ8A 2O59A 1Y82A 2Y67A 3JQAB 5JT1A 3EC2A 3CEJA 2QP9X 4Q66C 1DAOA 3QKSB 5ITWA 3Q7IA 3DM9B 2SNIE 1XJCA 3HJCA 4BJ1A 1D9ZA 4NU6A 3G5TA 1DG1G 4JZYA 3NT5A 4ONEA 1Y7HA 4RLFA 2PSFA 4IJ5A 3P4YA 4DMRA 1O6BA 1LF0A 1H0HA 1X42A 1RAAA 4C7MA 1KI9A 2X4GA 5EHGA 4MDEA 3VUEA 1IK4A 2EERA 2CFIA 4LOIA 3O7WA 3PU6A 1EQAA 1QGUB 2CXPA 2ZSEA 4NP6A 2P7HA 4GC9A 4DB4A 1T2AA 3IAEA 3GJ8A 3LA8A 2ECFA 4RTQA 3FHLA 2BM9A 2FVYA 3U7QB 4IFEA 5CX1B 1XD2A 1P1IA 5ERGB 2I71A 4D4HA 1SOMA 3TX6A 4FILA 4PQYA 1IJKA 2CHEA 4EPXA 4QOGA 3KQKA 2RJ3A 3ZGZA 1CR4A 1Z6AA 3IVGA 2O8DA 4HLNA 1T4BA 2PX6A 1L7OA 4HDMA 3QEMB 2XA2A 3NJ4A 3EBLA 4CR7A 1XVVA 2X41A 4P3OA 1G7TA 1UP7A 3D6FA 3LLCA 1GV0A 1DT3A 5CEFA 1A98A 4JDPA 1EUDA 2W22A 1B8UA 1CRQA 1NW8A 3EQ6A 4MUYA 1A71A 1C41A 1PNQA 3QNWA 3STHA 3P52A 1M74A 3H2SA 5EP2A 5EZYA 1NBMA 1W85B 1P2TA 4KQ6A 1SBHA 4DKJA 3AHFA 4OH7A 2A1UA 5FAKA 2BJWA 1KH2A 1RXEA 1YQDA 4MQFA 5FBVB 2CXSA 2ODQA 4BNGA 3L1JA 3OUTA 4DILA 4KHZA 2VP4A 1JE0A 2ZYSA 2HRQA 3VR4A 4ROTA 4TV8B 5D1HA 3ZLBA 2FSUA 4HX9A 2B34A 5JQGA 1J8YF 1JG3A 1UPAA 3GOHA 5ALLA 3GLTA 1DAGA 2PE5A 3K20A 2J9ZB 2P6NA 1NXOA 4INAA 3DT6A 3GLHA 5JEEA 3O6VA 1COZA 3A6DA 2BM0A 2TMGA 4G65A 5K2MA 3SZOA 2AZXA 3GMSA 4OYHA 4KAJA 4HL6A 1TQ6A 4K6KA 1I3MA 1H85A 3W1VA 1ZICA 3VZRA 1IRIA 1JJFA 1I0LA 1P4RA 2Y1KA 1FNBA 3D7MA 3DB2A 3QVLA 4M0FA 4RDIA 4UCWA 4KPGA 1CQWA 4YJ2F 2AWOA 4U4AA 4UARA 3L5KA 2RGNC 3ENNA 3UCEA 2V96A 4NESA 3ZKWA 4D0RA 1Z73A 1UPXA 2P2NA 3H5IA 4YUZA 1X1RA 3FMIA 4OX9Y 3ZU6A 1PR6A 2LNDA 4WJZA 3X2SA 1FTGA 5I4IA 1VGQA 4N5HX 3EVTA 1L7DA 3VHQA 3S5UA 3UG6A 2H0AA 1HPLA 4FPXA 4LJ7A 1NN5A 2JJ1A 3CLUC 1X87A 5GJCA 1FYFA 4QVIA 3FCCA 3W8EA 2ZATA 1A72A 3FOCA 2ZSFA 5A2GA 4YAKA 3RV4A 3DCIA 4G9GA 7GPBA 2JAUA 2ZRDA 1A7UA 3ZEAA 3VR1A 4NONA 3HNRA 2JLRA 3VFDA 5JAZA 4QU9A 2JCSA 4ZALA 1A77A 4C5AA 3NH9A 2GK3A 5FWAA 3SP1A 1Y8ZA 3RT1A 4TXLA 4U7GA 4R2LA 1NNSA 1TB4A 2PRIA 4X97A 3HR8A 3ZZMA 4KR7A 2QRHA 4I8DA 4JBGA 2EZ8A 2VNKA 5DTRA 3T5DA 3X1WA 1NVBA 3JATA 4KXWA 4RDCA 1OWLA 4EEXA 4BMDA 1RBMA 2RHRA 4F12A 1U31A 4N0DA 1D2RA 4RKYA 5HBRA 5ICFA 3VO2A 1QLJA 4HXYA 2C7OA 5KYKA 1OYWA 2PMKA 3EIUA 2D7CA 3HNPA 3N2YA 3O82A 3O3OB 4AG6A 2DB3A 2QYSA 2VH2A 2R11A 3G49A 5GAJA 2SHKA 4NECA 1JECA 3MZ0A 2JFOA 3JPYA 3PRKE 1VL5A 2NUTB 3LWDA 1P81A 1TQ8A 1UBEA 2KB0A 3MMXA 4OBBA 1YHNA 1L5WA 1GRQA 1L1EA 2H5IA 2I4RA 1KAOA 1VCIA 2EW1A 4HWRA 4HJRA 4LCBA 4YJ3B 4CZ2A 3M33A 4YY3B 3S7ZA 1G1MA 1N2OA 2QEQA 3KALA 2IYPA 3P94A 1GCUA 3DHEA 4UZFA 1JLHA 1WVMA 1PZXA 1Z8DA 4MTLA 4D8VA 1ILEA 3HYCA 1YB1A 5REQA 4YPVA 2QL9A 3A70A 1V7QA 4FE7A 4MVJD 5AHWA 1CS0B 1WD5A 3ENWA 4IO1A 5JCXA 1FCJA 4O2AB 3RVNA 3I4CA 4GI5A 4BUCA 3GLRA 2VEOA 2NO9A 3I30X 4MVJE 5K05A 4L6CA 3R8FA 2CCJA 4NJEB 1ICEA 1DLIA 2ZJBA 1ISSA 4OATA 4URYR 2PVPA 4HUTA 5KAMA 1LDNA 3N76A 1E69A 4EPWA 1OT5A 3HZZA 1CUJA 1FJHA 1SUPA 4KBFA 4NCAA 3EVNA 3G85A 2IZ5A 3O1HB 1MFZA 1L8LA 3ZY6A 1WU8A 2VIIA 3ZV5A 5IMBA 2G07A 1CS0A 3OX4A 4QNNA 1Z36A 1FU8A 4J4HA 4UTOA 1I3NA 1R5OA 3K0AA 4UBKA 3NBXX 3VR4H 1QHEA 4NMXB 4D8XA 2FSVC 5CD1A 3C4VA 4DR5B 5ALWA 2EBHX 3G82C 1JHUA 2VJOA 2I6XA 3I2JA 3HVRA 1GQRA 1H2AS 4L73A 4PO3X 1FMJA 4WLVA 1IBSA 4BX0A 1OA0A 2VJBA 2PX8A 1J2RA 3WIVA 3CVWA 1NY5A 1O5OA 2OBBA 2DFKB 2Y1XA 4QFDA 2GHIA 3EBPA 4I9HA 5CH3A 3UC5A 3R9XB 1V43A 4GM1A 3QSYA 3DS8A 4RQBA 5G1OA 2BMAA 1DU4A 1I4DD 3D43A 1LDBA 2QD4A 1LNSA 2WF8A 2DFNA 5FTLA 1RPZA 4FOLA 1BXKA 1XR3A 2YJ6A 4X85A 3IJPA 5JSZB 3EGWA 2WSMA 1RYMA 5L8VA 4R2WA 5MFPA 3P9IA 4N48A 1JTVA 4KGZA 1HQKA 4Q9KA 3T0IA 2O54A 3EOZA 3W77A 4PX3A 5FB3A 3R9XA 2XUGA 2PVCA 1XL0A 3IIIA 4R3WA 2DHRA 4NFSA 4AFNA 2WJHA 1L9XA 4OGGA 2WVGA 3UMRA 4R9RA 2RHWA 4I5IA 4IVQA 3BIOA 3DOCA 3KSMA 4X95A 1J4AA 3DLCA 4K8OA 1C3JA 3GDOA 4DNXA 5BRAA 1V8BA 1ZAYA 3ZK8A 2ZZKA 1UT6A 4NKRA 3KQSA 4E1AA 4IDHA 1GT91 3HUEA 4FJ2A 2F43B 1U9YA 1H0RA 2OUKA 2P3SA 1A7JA 1IXZA 1DUSA 2VG8A 5CB4B 1XNHA 4CIXA 3UMYA 3DFIA 3ZX5A 4G8CA 3T7AA 4JJIA 1TMOA 5EFZA 4ARAA 1C3LA 1WKCA 3JSAA 4BAGA 4KWEA 2AVNA 1GTG1 2WIKA 1BDJA 4H16A 3R5TA 4BZQA 4LOLA 4QRIA 1CUGA 3RWBA 1ECPA 3Q88A 2A4MA 5EZ5A 4C43A 3OSUA 4A15A 3IOYA 5CDHA 1Q15A 1I9CA 2QT9A 1GDTA 2QYHA 4YP1A 4ZVUA 1J0BA 1P0IA 5BSMA 1R5NA 3FPEA 3KS9A 3WX0A 3DUFB 3R9KA 3C48A 2TRSB 2JZOA 1WZ2A 3A6EA 3LBFA 4YNBA 1X0XA 3GT4A 3PR1A 4EYOA 2KYRA 5C4GB 2QV7A 2WV7A 5AVOA 1X70A 3IO5A 1UFOA 4C0SA 1UZMA 3L4BC 2NYUA 3KLPX 3HRHA 4AP5A 4G5RA 5BXQC 4UM5A 1T2VA 4UQLA 1PR3A 3TD2A 2A9JA 2VLBA 3P0RA 4IDPA 5B57C 4FGWA 3C7KA 3GJ5A 1U8AA 1U9CA 3I76A 1P31A 4IUYA 3RTDA 2ZJ4A 1JGTA 1L5ZA 1WHSB 2C83A 3G9UA 2EX1A 2FX2A 5TE9A 3F7MA 1GZ6A 2P3QA 1XZBA 2I4NA 4Q21A 5HIJA 3TLAA 3ZEIA 9LDTA 3O84A 4O8ZA 1FFDA 3GAFA 2JJYA 3WSTA 5I4BA 1A8PA 2ZXUA 1L7AA 2LV8A 4XCQA 4RCVA 2HIHA 5DLYA 2VDWB 1SC1A 2N42A 3WHPA 2OBMA 5IAJA 1Y7TA 3R40A 2P30A 3FOBA 2C77A 1CC1S 5FTKA 1SHUX 4NOKA 5JBQA 5EMKA 3EARA 2Q2WA 1LC3A 3KU4A 4BY9E 1KVRA 1UDBA 1L5FA 4LZAA 2O0KA 3K2IA 2IOQA 3LXUX 1JXAA 3E61A 3K0KA 4H2DA 2WW8A 4YRRA 3B6KA 4LWZA 3ANLA 4LVCA 5EMHA 4PG5A 3GNTA 3PL1A 3HCNA 2BGUA 3U31A 3AJEA 4HVLA 1FS6A 4F5YA 2G7ZA 1I94B 3QQ5A 1UMBA 2CB9A 4D9BA 221PA 4GM0A 1YZVA 4GPTA 4JNCA 2DQZA 2F43A 3VSDA 2H2HA 4GSKA 3ZY2A 2BE9A 2CE7A 4O08A 4MROA 2R2GA 3A9VA 3MCZA 4LYYA 2HJSA 2QAGA 4PE5B 2PGOA 4X1IB 4D8TA 4N76A 2ZPAA 3ASZA 4MQLA 5JI3E 3ZDYB 3V5NA 2ZSJA 2G0NA 4GM4A 5EN4A 4KQWA 2QN9A 2NUPA 5LCXA 2HRDA 2GM9A 1TAQA 3MFQA 5BV2P 1CCWA 1C30A 2ZETA 4MIYA 5C5IA 2I6QA 3HV0A 4QXPA 3L7IA 1E1QA 4XIGS 3CCBA 3B78A 1JLSA 3DF9A 1E9AA 1JDPA 2H31A 3LPDA 5K8IA 3DQPA 4NYMQ 5B7QA 3AUAA 4W7IA 1RYEA 4YRDA 5AJTA 4Z7OB 3P5BA 3S7TA 2BKVA 1E2BA 3WYAA 1TUEA 2IZ0A 2FSGA 1GAQA 1BIFA 2BMFA 4L57A 3HCDA 2XGGA 1H2RS 4OMDA 2XQJA 3TK1A 3WSWA 4KOAA 4HRYA 3CZQA 3FBWA 3N59A 1EA7A 1MJHA 2X86A 1NQOA 1M34E 3BEOA 4BMNA 3OPXA 4DCUA 1H1LB 3RU9A 2FJUA 1K8QA 3KSZO 3KQYA 4E5MA 1Z75A 2EP5A 1BMQA 1FX1A 3KOWA 3EGDA 1B0PA 4LRYA 5C1IA 3U7GA 2E37A 2ZTHA 1OE0A 2PDAA 2PD3A 3IQWA 3I01M 3M8KA 4LMAA 5FUBA 5ILQA 4BMCA 4W9NC 3TLBA 4KRFA 2VDJA 1QV6A 1FYVA 3PNVA 5EHIA 4B79A 1U9IA 5G3ZA 1EJ2A 3EISA 1SH7A 3BAZA 3K5HA 4R1UA 4GBED 2JCXA 2WJAA 4NU0A 1NTRA 3GPCA 2YWRA 4UHFA 4DIEA 3O8CA 3RLFA 4C3VA 5DM2A 1YJAA 2OBNA 2W2NA 2XJ4A 1YVDA 3K1YA 2PD6A 3X1YA 1AK9A 2QOEA 3A9TA 3VVLA 3CR3C 2H9AA 4LI0A 4DUZB 1GV1A 1F8XA 4QJ3A 3BSSA 5SZJA 4ZYYA 5KNBD 5KQSA 3FNFA 4HQKA 4AF6A 1RU3A 1O95D 1NX9A 1KDRA 2AKAB 3P19A 4WD3A 3EPHA 1ZHFA 4PC2A 4Q1BA 5L7WA 2FRVA 4ZDWA 4LQCA 4UREA 1CZOA 1TL7C 1N6KA 1KBZA 4DCOA 1SPXA 2ONZA 3RH0A 5BR1A 4QTTB 3ZQKA 2HWWA 3P9CA 3A2MA 5E8RA 2O2SA 2HB6A 2WZQA 1PEDA 4QULA 1R0YA 5G4KB 4UHJA 3RFTA 3SEZA 1QIKA 3WK7A 3N0TA 4MWSA 5CA1F 3CO5A 1SO8A 1TJPB 3DZIA 4RZQA 1ELOA 1NIJA 2C29D 1XWWA 2ZE6A 4Y2XA 4TZKA 4A6EA 4LXTA 4BP9A 1GUBA 1PKXA 2YZKA 3GY0A 2CY0A 2PZGA 2WM2A 5EXSA 4JLJA 2QTLA 3V2UA 5F2EA 5DN6A 3LUBA 3QG1A 4MAMA 3AI7A 5FNVB 4WNAA 4ZREA 4ARSA 4D9MA 3ONFA 3OZGA 2RGGA 4D43A 4FDMA 3MBIA 4DWJA 1R4AA 1DWQA 1WXGA 4RS3A 2VJMB 2IC5A 4E2FA 3U7FB 1S8FA 3RS0A 1OBCA 4OMUA 5C31A 3TW4A 7MDHA 1VBFA 3P9QA 1PSZA 3ER9A 3W8NA 4JH0A 1YUMA 2GSWA 3H0KA 1TVEA 4K6FA 2IWRA 1GP2A 1P2VA 2PJDA 3GMIA 4DADA 1T5DX 3WC4A 1VJ1A 3H4TA 4UPEA 5BT8A 1H4SA 2ACWA 5EJ8A 1X7YB 1Z0UA 3LNTA 3WGHA 1SXJA 4K05A 4I1RA 4PLWA 3WK4A 2B25A 721PA 1SBNE 5I6DA 1P1HA 4HH3C 1FLVA 3U49A 1IVSA 4BEBA 2B1JA 3NETA 4MWOA 1XE3A 2A67A 3FUCA 1XKTA 1RJ9A 1Y1KE 3UPDA 4G1MB