4F38A

Crystal structure of geranylgeranylated rhoa in complex with rhogdi in its active gppnhp-bound form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/chaperone
molecule keywords Transforming protein RhoA
publication title Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f38A00
2F43B 3BERA 3OIUA 5KPDA 1US8B 1ZM2A 5CB8A 3TAHA 4A92A 4FMBB 4CT4B 1S2MA 5FOVA 3PITA 4AY2A 4GMDA 1QHNA 2CLCX 2Y8EA 2JLWA 1J8YF 3LVQE 4B44A 5KO2A 1FX0B 1TQDA 4F38A 2QN6A 4LHVA 4OI0A 3R9WA 1TMKA 1GKUB 2BBSA 4Y0AA 4ZIRA 5DYIA 3CNOA 5BYKA 5ELXA 4OQMA 3HPRA 2AWNA 2XZOA 5JHGB 2IXGA 2ECKA 1OXUA 2H8KA 1J90A 2B92A 1OB2A 4HB3A 2GZAA 2FZ4A 3QG5A 4LJ5A 1R10A 1WBBA 1A1VA 1A4RA 1FTSA 5B2ZA 1UKZA 2UZ3A 1NVUQ 1OKKA 1EWQA 2WKRA 5EE1A 3W5JA 3DHWC 2ZJ8A 3FTQA 3GFPA 1Z08A 4ZIRB 2RGXA 2F6RA 3FHTA 1EGAA 2FF7A 5DO9A 2IYTA 2V6IA 3AUXA 4P33A 1UJ2A 2FEMA 5JCPA 4FWTA 2ATVA 4IDQA 1JXMA 4WW0A 3VMFA 4PR0A 1I4TD 4F7WA 1SVWA 1ZUIA 3MCAA 1KY3A 1T5IA 3RANA 4OK3A 1WCV1 1VYUA 2GBLC 2H92A 3W6NA 4W9MC 1YVDA 3CF6R 4KYUA 2DWQA 4R2IA 1NL3A 4D4KA 2VSXA 4JYBA 3BJIC 2ZITA 1FNMA 2RHDA 1HEIA 4JMPA 2RGAA 4KLZA 3U61B 1SKQA 4FCVA 3MMPA 3E70C 1NMZA 4Q7KA 1E9AA 1TAGA 1W0JD 4ESHA 3MWJA 4NYJQ 3K09A 2ANBA 5CK4A 5GJCA 1W44A 4DSUA 1WXQA 2BDTA 1CJUC 4ZDIA 4DDTA 1E9DA 3QF7A 2A5JA 1VCIA 2D74A 4V0KA 5C2JB 4A36A 1J99A 3ZGXA 3PQCA 4LHXA 1Z0KA 2ZYUX 2G0NA 2CXXA 1M7HA 1AS3A 1RJ9B 2QMEA 2BIFA 4JSTA 2JJ1D 4ZCIA 2XTNA 3TMKA 2GEUA 3RS7A 4TL7A 2QORA 3NG1A 2A7QA 4TZ6A 2AKAB 3TR0A 4D2IA 3KJIA 2HEIA 3SHWA 1XTRA 1KSGA 1W5SA 3RSOA 1G3MA 2GTPA 2ORVA 4OK6A 5JWRA 2NO1A 2IF0A 3E2IA 4URWR 2WWHA 3OEHD 1P9WA 4C4PA 1DO2A 4D82A 3CPJB 1N5JA 4CEJA 3FKSD 1E32A 1IN8A 5CB6A 1FMLA 3L0PA 1UKEA 1JJVA 2WJVA 3QVUA 4ITRC 2IYZA 3D7MA 2ZRDA 1WE2A 5FTJA 4DCNA 2IF2A 2CCGA 3VR3A 2GXUA 1N6RA 1U81A 2HYIC 5CYPA 1Q57A 3GJ3A 3VHLB 4FCWA 4YDSA 4CEJB 3I72A 4MKHA 1VCMA 5KDLA 3ZZUA 1Z6AA 1KI6B 4KYIB 3KXKA 4QKQA 5D3QA 2W2VA 2X19A 5KOYA 1TADA 2F1HA 2IXEA 4M1YA 4C30A 2I1VB 2LKDA 4BPBA 4I1SA 3U2QA 2C04A 4II7A 3C16C 2FEOA 2WM9B 3BOSA 3QKUA 3TUZC 4C7OA 1CR1A 2ZJBA 4AIIA 4K46A 2Z43A 2MSDB 4PHGA 4GNKA 4CDGA 4IW3B 5AWFC 1EG7A 3I4LA 2QI9C 1GM5A 3R7WA 1E9FA 5LB2A 1ZP6A 2AD1A 4WAUA 2NIPA 3WNDA 2O0KA 3ND8A 3CRW1 2ZSEA 2WTUA 4UNNA 4N0DA 1C9KA 2JJ8A 1XU4A 2JLQA 2QPOA 2BBWA 2VP0A 3FFBA 4PC2A 1KK3A 4S2EA 3RS4A 5JLJA 1GWNA 3WYAA 1VYTA 4BQSA 4URVR 2AD5A 3FOZA 1RRFA 1ZM9A 1ELOA 2HJGA 4AG6A 4DEYA 3X1YA 4PAQA 1G291 4Q00A 1E2LA 2CK3A 4UQOA 4LV8B 2NPFA 1IHUA 4BUJA 2FE4A 1G64A 3CW2A 4FD2A 1W4RA 3SYLA 2ONKA 5GJVC 4ASUD 1TF7A 2NTYC 4QM6A 3AF0A 2NPIA 1OIXA 5DGXA 4O2LA 2O52A 3PEYA 4I4LA 3HYRA 1KI1A 1OH7A 2C96A 2OEPA 4B71A 3C14C 1XX6A 3VR5A 4D4MA 4Q4LA 1COWA 1DPFA 1MOZA 1ZD9A 2W0SA 4TLAA 3FB4A 1DE0A 4EPRA 4MGYR 3LDAA 3FMOB 2QGZA 2GKSA 2ZXUA 3IKJA 1XEWY 4UKDA 2XTZA 4F91B 4B32A 1XEXA 3Q5EA 1VPLA 4MKIA 4N0EA 2SHKA 1SVLA 4FMDF 1P2VA 4Q48A 3UG7A 1AGRA 4FWIB 2ZRNA 2ZS7A 4LJ7A 3N2EA 4TTQA 3CR8A 1W36D 4YLGA 2IT1A 3CH4B 3DM5A 4J0QA 2BMEA 4DC9A 3QNUA 3OIVA 1G8YA 2QT1A 4Q1FA 2JA1A 3EX7C 4C2TA 3LRPA 4M9SA 2CHQA 4JLJA 1XEXB 2IUSA 5K8LA 4US2R 3SNHA 4NCJA 2OAP1 3AP2A 2QAGA 2QA5A 3KB2A 3PUVA 1W36C 2J41A 1CEEA 3AF2A 1NLFA 3Q5DA 5DSZA 4LI0A 2XSZA 4DLXA 5EE3A 2R44A 4QJ4A 1OT3A 1M74A 3A1VA 4EFMA 1RFLA 4URZR 1K5DA 2GWHA 5A0FA 4ZKEA 2JLXA 2D2EA 2V7QA 2ZR0A 3FFAA 4YONB 1VCOA 2WSSD 4LYAA 1OFHA 2W6ID 4M21A 3W90A 1E6CA 2NO6A 2RGBA 2QAGB 3AVQA 5KNCA 3BFVA 3QF4A 2ODBA 1P7CA 2P0EA 2JIZD 5AJYA 4B6FA 3FYHA 2GF9A 3IIJA 4DCSA 4N3NA 2IYXA 1O87A 1JPNA 1NJFA 1QG4A 1SKYE 2Q3MA 3EG5A 3NBXX 4FMDB 3UK6A 4Z51A 4IEEA 3D8BA 4EFNA 5FPSA 1MO4A 1NBMD 1C4OA 2KB0A 5FL7D 5FI1B 4B73A 4CRWB 3LLMA 1Q20A 3QF4B 2CL6X 3AVVA 4PQFA 3TNFA 3AP3A 2MSCB 1SXJD 5E4FA 2YC4C 1E69A 4A6XA 3OEEA 3CLVA 3BFKA 4KLNA 1SKYB 5IRCD 1J70A 5L3SA 1SZPA 2NO9A 5ANRB 2XNSA 1NVXQ 1E2DA 2ZVQX 2OAQ1 3TQCA 1G5RA 2FH5B 3KTAA 3U3RA 3RRYA 1ZC4A 3AVYA 1ZAKA 2BBOA 2EFHB 2QTVB 2FOLA 4M0LA 1SXJC 2HDNB 4KHZA 4MRRA 4ON9A 3NC0C 1ZU5A 2OO7A 2WHXA 1E2HA 1DADA 4JBXA 4URUR 1Z06A 2YOFA 4C0LA 2ZS9A 1OXTA 1SHZA 1W47A 1QVAA 2QQ0A 3AVTA 1JEEA 1MABA 2BEJA 4HZUA 8OHMA 3KX2A 1T6NA 2A5GA 4BZXA 2J7PD 2ZSAA 3UIEA 2VHQA 1AN0A 1CULC 1JBKA 5EP4A 5FUYA 1F2TA 2ZUDA 3TAUA 4Q1AA 1CS4C 3ZLJA 1VIAA 4HLUC 2QRZA 1N6LA 2CE2X 1G5TA 3OE7D 3U7EB 1FL9A 1YR8A 3CZQA 1R0WA 4NYIQ 3MWYW 1O3YA 1XJCA 1KJZA 2FSIA 2WSSA 3DZDA 2ZJ2A 4DSNA 4JLNA 3SQXA 2PZEA 2VQSA 3HU3A 4P0TA 1Z6XA 2QP3A 4IKEA 4PHFA 4XOIA 5KPJA 1XCPA 4OK5A 2P6UA 4OQLA 4JZKA 2R65A 5EE0A 2C78A 1P9RA 3RSLA 1WRBA 1ZINA 2N1BA 1GL6A 2ZRJA 2ZJAA 3L0IB 2W0MA 3DMNA 2P2LA 3GD7A 5JWHA 2JDID 5JSZA 1E79A 4Q1DA 1JQLB 3FWYA 4H1VA 1NSTA 3PXGA 2WWIA 4LDJA 4M1OA 3CX6A 2WJJA 2JJ2A 2GRJA 2GF0A 2ZROA 3IBYA 1N6KA 2AN9A 3LVRE 4DUGA 621PA 1UEIA 1PVOA 5EE9A 3QKRB 5EXTA 2VTKA 4TL9A 3ADKA 1DEKA 3P26A 4G5QA 4Q7JB 5F9HA 4MGKR 4HAUA 1XEFA 2JAQA 2IUUA 4G5OA 5JSZB 2YC2C 3C5CA 4IRUB 1PLKA 4QXAA 4RZUA 1LTQA 1W4CA 3NHAA 2GXAA 3SQWA 1I2DA 1KO5A 1MKYA 1N6IA 3QEJA 4EPTA 4D25A 4R7ZA 3GQBA 1OF1A 1OSNA 1NMXA 1ZJ6A 2V9PA 5BW8A 2NMVA 3QVVA 2IWRA 3ZVRA 2HLDA 2J87A 5G3YA 3K0EA 3Q7QA 3UXMA 2ZPTX 2EFGA 3CNLA 4PX9A 3CZPA 1GAJA 4DBLC 4ERNA 4YMUA 2GJAA 5SZHB 1OPXA 1A5TA 3NWJA 3D3QA 2XNDD 4URXR 1PV4A 2A2ZA 4CIDA 1OW3B 3SR0A 3VQTA 4UNRA 5KSYA 4F93B 1NG9A 4MYUA 3OE7A 1FOEB 5C1BA 3B85A 5CLQA 2FFHA 4RJLA 2PT7A 3IQWA 3A8TA 1GG2A 3O8DA 4L5BA 1VG8A 4HSEA 1NN3A 5E95A 4A0RA 5GADl 4A1FA 2DR3A 4GZLA 4BZPA 1DELA 1L2TA 2KSQA 4A9AA 4EPVA 1NI3A 2WOJA 2W58A 3FMPB 4G1UC 1Z63A 4HATA 4IOLA 5F2EA 3U3KA 2WPDD 3DKVA 4LK2A 4C9BA 5DH9A 1P60A 4JIMA 2JDIA 3AKYA 4JVSB 5KUTA 4M1TA 2GK7A 4QNRA 4D6PA 5HE9A 1E2NA 3RRNA 2QP9X 4BFWA 2IYSA 5GVSA 2ZRBA 3RS5A 2E9SA 4LBVA 4FW9A 2VP5A 1R6BX 3UWKA 5F98A 1U2RA 2GJ8A 2R6CA 4PO9A 2QU8A 4KI0A 3IHWA 4B75A 4IEIA 5EP3A 5FR2A 3MSXA 1VCNA 2GEVA 1T3HA 4KCGA 3BH7A 3HP1A 3CNNA 1G41A 2O5VA 1TEVA 4JVMA 3NDPA 1KI8A 5JI3E 3T1OA 1X1RA 3FHCB 4IXMA 3ETLA 3JVVA 5IK2A 2QEQA 2JLVA 1RC8A 4KFSA 3E5HA 5FL3A 4Q19A 4LBYA 5B64A 3EA5A 4M4SA 3WNCA 2J0SA 2OILA 1N6HA 4TL6A 3LLUA 5FUVA 1E1QD 2VHCA 1IY0A 4L8GA 4NBSA 3DMDA 5BN4A 5F3WB 2D2FA 4IOKA 1JR6A 4RZ3A 1QHGA 2QENA 3G0HA 4US0R 1GUAA 3QY0A 3MWLA 4LX0A 3AF3A 3WYGA 4A2PA 2G83A 4DCVA 1NIJA 4JJKA 4Q7LA 1DS6A 5CYOA 2WZQA 3L0SA 2QMHA 3FPAA 4DSOA 5M04A 2C98A 1RKBA 1KSJA 1LS1A 1PZNA 2F1RA 2B21A 2GNOA 3PUXA 1NKSA 2B8TA 3OFNA 3QQ5A 1GTVA 5E7MA 3MG9A 4RFSA 1D2MA 2RKOA 1MO6A 4NMMA 2WV9A 1RZ3A 1R8QA 2J0UA 3Q3JB 4P4TA 3UMSA 1LNZA 1S1MA 4NCNA 3TUIC 2JLRA 3K0AA 1CBUA 1CRQA 4LBZA 3PVSA 1T3LA 2FG5A 4CEIA 3AVOA 4WOPA 1SGWA 1N5IA 2WAYA 2A5FA 2F3TA 3DOEA 3H4MA 3RWOA 1WF3A 3B82A 1U9IA 1EFHA 5FOWA 2DBYA 3OF5A 3ZZ0A 3G5UA 2YWHA 4P3YA 3B60A 4WXPA 1R5NA 1Y63A 4PQRA 3HR7A 4BFUA 3X1XA 1B0UA 2VHJA 5KSPA 2QPAA 3K0AB 1P2UA 1S1CA 2JLYA 2QMOA 4TZ0A 3LQQA 2BC9A 3KZ1E 1XF9A 3L43A 1KI4A 3THWA 4HLDA 4NHOA 1Q1ZA 2VP9A 1X6VA 2GAOA 2PCJA 2V54A 4TSFD 3KKQA 5JI2E 3PCRB 2WWYA 4M2LA 3IGFA 2F1IA 1XTQA 3RC3A 1F3OA 1A2KC 2AK2A 4G5GA 2ZRCA 3C8UA 2E87A 2G77B 3P32A 4I99A 4JLKA 2OFXA 4OJKA 4YDHB 5E7JA 3V9PA 421PA 3BB4A 2VPPA 1ZUNB 1UBEA 4PO1A 2I3BA 4O3MA 4NE2A 1SQ5A 2HXYA 4HEJA 4DJTA 3THWB 5GVRA 3PEUA 3SC3A 2XTMA 1NF3A 1DO0A 4Q9IA 2C03A 4I81A 4O25A 5KNBA 4GP7A 2C95A 3A4NA 4V0MA 2F1JA 4V0ME 1XD2A 2AXPA 4GZMA 2XB2A 4DLRA 6Q21A 1EXMA 2F43A 4V03A 4ZDKA 1RYHA 5AUNB 2FMXA 4NP6A 2VO1A 1I2MA 1R0XA 4TMZA 2GETA 1IAQA 2J7KA 1R5BA 5JHHB 3EPKA 2AL7A 2QSYA 2J45A 4LGMA 3QPWA 2RGCA 3RS0A 4Z8XA 1FZQA 4L15A 1XD2B 4XTRA 1KGDA 3M6AA 4C0KA 1AZTA 1RE0A 4TQUS 5L3QB 4WVFA 2ZRPA 1UBFA 5KTYA 4GOXA 4HAVA 1NG1A 1SVIA 2ANCA 3I61A 5HZKA 4RSGA 2ZE6A 3T5DA 3E1SA 3Q8XB 1AA9A 3KQHA 2QPTA 4X8OA 4LY6A 3P20A 3BXZA 4EFLA 1FP6A 3LW7A 4A0HA 4JLVA 4QRHA 4OHZA 1OIWA 1M2OB 3BH0A 1VMAA 2ZE8A 1N0WA 5D3MA 5FUXA 5CLLA 1IONA 1QHSA 4TSFA 2FN4A 2X2EA 4RD0A 2GDJA 1H8ED 3I32A 2D3WA 2NQ2C 1MV5A 4JKIA 1OH5A 3VNVA 1T91A 221PA 2YVUA 3N2IA 2XOKD 2QL6A 1HY3A 1ZRHA 2DB3A 2ZRIA 2FX3A 2H17A 1D9XA 2P6NA 5CDFA 5TARA 4HUTA 5CDFE 3ZD7A 4F92B 3MJRA 4OI2A 2GJ9A 1E9SA 1YZKA 2AKYA 4JT4A 5D3MB 3SE0A 2ATXA 4A6PA 4JLAA 4HAXA 1KZ7B 4KJZA 4B35A 4GP6A 1ZM4A 5IDVA 3SHFA 4BFYA 3FGNA 3L0OA 1Z83A 2RH5A 2FSHA 3AH8A 5LD2B 2GCNA 4WA7A 5FPTA 4EQ6A 1LF5A 1E98A 5LDDC 3BFXA 3NH6A 4JBWA 4P4SB 3GJ7A 3AV0B 3EIHA 4HB2A 2KE5A 3KXIA 3CIOA 3KJEA 4TMXA 3BRWD 4DB4A 1ZUHA 4LJAA 4WZAE 3A1WA 1OYWA 4UNQA 3WHLA 3N70A 1RJ9A 2CHGA 2W6JD 4F4CA 4KFRA 4TT3D 2GILA 1E2KA 2FA9A 1EESA 3CX7A 1BMFA 4EQ6B 3K0SA 1P2TA 1OIVA 4MITA 3AVXA 4BLSA 4QBHA 4BFVA 1ZNWA 2NOAA 2JLUA 3I62A 2JGNA 3QUSA 1OB5A 2R2AA 4NZYA 1II9A 3U6KA 3AB3A 1T5LA 2IYWA 4IDPA 5TVKA 1S8FA 3ADCA 1GRQA 4DT1B 3C15C 5C4MA 1KSFX 3AVWA 1CF4A 3HDTA 1N0UA 4LJ8A 4EKDA 1LW7A 3W5IA 3VNUA 2UZIR 2Z0MA 2VP6A 4HB0A 3RAPR 5EXXA 2B8WA 4BLRA 1E0AA 2PZFA 1DARA 1G8HA 3RVBA 4PZYA 1UDWA 1JR3D 4DDUA 1XWIA 1W46A 4C3ZA 2EFEB 1E2PA 1KI6A 3KDSE 2GA8A 1HE1C 2XOKA 3RC8A 4OJQA 2VYFA 3VU9B 1SHKA 2EYQA 2DFNA 2GBLA 3SFZA 5EE5B 2GVZC 3WMGA 1E99A 1XTSA 4LV6A 2QM8A 4TMKA 2D7CA 3QJYA 5AUOB 2JCSA 2BMFA 4PSAA 4UXHA 1SULA 4LYFA 1MO3A 2OG2A 1WP9A 1Z0IA 3PUZA 2IYUA 4F4IA 3LV8A 1HH4A 5HTKA 4ACBA 2JLZA 3TIFA 3GLFA 3GLFE 3GEIA 3QOFA 3U44A 5IF9A 2Z83A 3ZYCA 1AGPA 5FOXA 2ZYVX 4HI0E 3T34A 5FH9A 2O8EA 2I4IA 2F55A 1KI2A 1BO6A 2ZE7A 1Q0UA 4QL3A 1BYUA 1MH1A 1Z22A 1IN5A 3KQNA 4TT3A 4IHQA 1W0JA 3QENA 2I1QA 3UANA 3ZQ6A 3ICQB 5KNDA 3GLFB 5J4YA 5CIWA 3CWZA 3WYFA 2W2TA 4ZKDA 4DRZA 3EZ6A 3U44B 1IXSB 4IVPA 2OXCA 1S3GA 3KUCA 2O8EB 1U0JA 1G16A 1XMSA 2CCJA 3PR1A 4FMCF 5J47A 4A4DA 1QHXA 4US1R 4LYHA 2IYLD 4BFXA 2J0VA 2JJ1A 1GZSA 1HURA 2LKCA 3EC1A 5KU1A 4C0SA 3W8RA 3PUYA 2YOHA 3W3AA 2CE7A 4AKGA 3IO5A 2ZI4A 1BIFA 4M9XA 1IM2A 2IS6A 3MAAC 4HDQB 4GI7A 2C77A 2W00A 3OEHA 3UMRA 3EA0A 3I5YA 3FKSA 5K8TA 4MQBA 3RNLA 1TX4B 3VR2A 5B58C 3TRFA 1K6MA 2EYUA 2IC5A 2ZANA 1RW4A 3A1TA 1YZUA 2VF7A 2CHVA 3K0CC 3AVPA 4K81B 1G19A 1NLYA 2FNAA 4CVNA 1YR6A 4MGZR 4Z8YA 4LZZA 4RD4A 1KO1A 3H2YA 1XTIA 5HZHA 3QBTA 2FGJA 1G3UA 1E9EA 1W2HA 1X8JA 3IUYA 2H18A 4IOJA 4MH0R 2PX0A 1MR3F 1M6NA 1M34E 1VDZA 3TE6A 3K9LA 4LV5B 4MYTA 2OCPA 2ZYWX 2REBA 5DNYB 2OT3B 1YE8A 2WAXA 4IDHA 2ZUBA 4OYHA 3O8RA 1M7GA 4Q9HA 3U3JA 2AX4A 2A30A 1R2QA 2ONJA 5FI0B 1M7BA 3K8YA 4KAXA 1UF9A 5HKKD 3LW8A 1CTQA 1XTKA 3ZH9B 3HU1A 1R0YA 3KL4A 1WQ1R 1GRNA 3EWAA 1Z6YA 4Q18A 4XD7D 1KDRA 5FTMA 1AKEA 3UMFA 4E22A 5E7IA 2CNWD 1U0HC 2FWRA 2NZ8A 1UFQA 3DVLA 1JALA 2RGEA 4BFSA 2PJRA 4A0FA 4PO8A 4DIDA 3ZZTA 1NN1A 1NP6A 2FDCA 1E2GA 5AJWA 3CRQA 1W5TA 4OQFA 1KK0A 4ZCMA 5E3HA 1W4BA 4X8MA 2EWVA 3F8TA 2Q3HA 3VR6A 1E2JA 4Q4AA 3M0EA 5KDOA 4D81A 4GOKA 1N6NA 3DOFA 5BWMA 4QGGA 1LY1A 5BN3A 4OQNA 4X8HA 3IILA 3KB1A 4FI3C 4IFBA 2ZU0C 3VHXA 2C99A 5FBVB 4XWKA 5J4KA 1DAEA 2IYVA 1YZNA 2WWWA 2DY1A 2G1KA 3FDIA 1AZSC 1TF5A 4ASUA 2XEXA 1ZBDA 4Q4AB 4LHZA 4U7DA 4LUCA 1Q22A 4KV9A 2H5EA 5CJPA 5JJKA 1BH2A 1GP2A 4RD6A 1U98A 2J59A 4MYHA 2RGNC 3MFYA 1PUJA 2RMKA 4BLQA 1K5GA 3U6BA 4TLEA 1XPRA 4OHYA 2Z6VA 1FQKA 3GCGA 3WNBA 1E2QA 3EASA 5CM9C 3OIYA 2GCOA 3GEEA 4FIDA 4C0QC 3EIQA 3L82B 1KIMA 3TJZA 4HZIA 2W83A 1YR7A 1J8MF 3NBFA 3TK1A 2IW3A 3BGWA 3F0TA 4TWZA 5EJEA 3B78A 5GJBA 4P4UA 2EVWX 3OZXA 1HUQA 3SN6A 1F2UA 1QRAA 1Z6TA 2DFKB 2VP2A 4RCZA 4UNPA 5FTNA 1IN4A 1L4YA 4B3FX 1ZCAA 3B1XA 2IL1A 2Z4RA 1PLJA 3BWDD 3CM0A 4JSYA 3V4FA 3VAAA 4DLVA 1X86B 2MMGA 3V4RA 1OHHD 2BM1A 5FBQB 4W7SA 5KHOC 3ZVLA 3L8ZA 5AJZA 4Q9LA 3GLGA 2GCOB 1UKVY 3GLGE 2REXB 3I5XA 4HLQB 3SJZA 1U8YA 4ZDWA 4ZV4A 1DAIA 1VIYA 3DPUA 3QKSB 5CK5A 3EZ2A 4B3DA 5KSZA 3FVQA 3PIRA 2CVHA 5BYJA 2XX3A 1F2UB 5SZIA 1S4QA 2QROA 1W36B 1G9XA 2GZHA 3AEZA 2CLSA 2QM7A 2CEAA 3GJXC 1PJRA 4LJ6A 3I8XA 4GOJA 4KXFB 2BMJA 4KVAA 2HCBA 3CX8A 1ZIPA 3GLGB 4URYR 3KKOA 1Q3HA 3FMFA 4TMVA 3L8YA 3TW8B 2VHUA 2W6IA 3IIKA 5J4VA 4GRAA 3F5FA 1G17A 1S96A 4UXIA 2CBZA 5GJWC 3L2OB 4OI4A 1E9RA 3BBPA 1KZGB 4TQ9A 4AKHA 1EFRD 1NVVQ 2FZLA 2H7VA 2JIZA 1TF2A 1TUIA 3BAFA 1R5OA 4BLTA 3TSOA 5FPYA 1T0HB 3HJNA 3QPVA 5DLQC 4DEXA 4M22A 5G40A 2QBYB 3Q9LA 3QKRA 2A78A 1EFCA 2B7BA 4G01B 5FOSA 1KI7A 3AKDA 2RGGA 4HAZA 3LFUA 3LQRA 1NBMA 3EPLA 5FL7A 3VR1A 1NBME 1G1MA 1OXXK 1P75A 5JJLA 1UAAA 3TVTA 3O47A 3UATA 1CKEA 2AFIE 3NTUA 3AP1A 1SXJA 3ZVMA 1SXJE 3VR4A 4LOAA 4EUNA 1W48A 2IWHA 1KAOA 4NL4H 1ZU4A 3B8HA 1F60A 2GK6A 2QY9A 1JNYA 1Q1EA 3MUFA 1WBDA 4G0NA 5EZ6B 4BGDA 3GJ8A 4B3GA 3K70D 1KO7A 2VLIA 2ZRLA 3LBHA 1V43A 4RVCA 4DLWA 4GL2A 1C1YA 2ZEJA 2YV5A 1ZM3A 2QRNA 1T9HA 2NO7A 3EZFA 4Q1BA 1SXJB 1KJWA 1PUIA 1MO5A 4HLUA 5EP2A 4CT5A 5HE8A 3ASYA 3S1AB 1J7KA 1KNXA 1Y3AA 2IBMA 3GJ6A 3K70C 1Z0DA 5J5CA 1ZIOA 1YKSA 4WIAA 2J7PA 4JVNA 2Q0HA 3ZIAD 4NONA 4LCBA 2FU5C 3W8NA 4Z1MD 1XMIA 4V0NA 4WXRA 2YHSA 3SI7A 4V0LA 3IEUA 3OAAD 1UKYA 3T12A 4Q7MB 4TTRA 5DI9A 2ZJZA 1DG1G 1CU1A 2ZJOA 1EFUA 1Z3IX 3RDPA 5JBQA 3IEVA 2IEYA 4EAQA 5JS8A 5AUQA 2Q3FA 4YMWA 1EK0A 4QBIA 3D31A 4KSBA 4Q1EA 4L16A 2R6AA 3MJHA 1E1RD 2PL3A 3WMFA 4QFMA 2ZREA 2VF8A 1X3SA 4TYPA 5EXSA 1W2GA 1W0KD 4UNSA 3T35A 4FCTA 4QGAA 3T1VA 4ZPXA 1KSHA 2IYRA 1YZLA 2OFOA 1P61B 2Z4SA 1CLUA 4XH9B 3GP8A 3GLIA 3GLIE 4A8JC 3AGQA 2OBNA 3B9QA 1YZQA 4LJYA 4X8LA 2V1XA 4QBFA 1G6HA 4D26A 2XGJA 4CZ2A 2UKDA 1F5NA 3R8CA 3CPEA 5H8WA 3W3ZB 3CO5A 2OBMA 1Z07A 2BCGY 2ZRGA 4RZ2A 3PFIA 5BQ5A 4IDOA 1XEWX 2BWJA 3QEOA 4IVRA 2FSGA 3W6PA 721PA 3GLIB 2C2HA 1YU9A 3BS4A 2ZE5A 4E09A 4XSGA 2AHOA 2WIAA 3ADBA 2VA8A 1NN5A 4B33A 4QGHA 1E4YA 3T1TA 1Q1BA 1ZNXA 2BOVA 4B43A 3J81k 4HUQA 1G7CA 3SBEA 4DXAA 1D9ZA 1G3QA 4LSGA 4LPKA 1TUEA 2KJQA 4HAYA 5DHFA 3LXRA 4YQFA 3NDBB 2ORWA 3GEHA 4C0HA 1ZVQA 2VHTA 2JLSA 2ASEA 2BM0A 1VG1A 1HTWA 2WWXA 2QUZA 5AK0A 2ORIA 2GESA 1L7VC 1XMVA 3ZJYA 3AF1A 3C4JA 2A5DA 4POAA 4Z54A 1S3SA 4B74A 1FP7A 3NC1C 3KQKA 1E4VA 4HUQB 2G3YA 2ZAMA 3KQLA 2FPLA 2XNDA 2C9OA 4O2RA 2Q9BA 4AKEA 3K9GA 4LRWA 4PPFA 4YMTA 3C41J 1UBCA 1HA3A 3I8SA 5EQTA 4CF7A 4F4JA 2XZPA 3TR5A 3VFDA 4NDZA 3KXLA 4M1KA 4Q1CA 3TLXA 3TGPA 2IS4A 2CL7X 3QXCA 5HR5A 4DLUA 3KJHA 3VTKA 1G6OA 3B1WA 2XB4A 3W34A 1XTJA 2ZU6A 1G5PA 4A8JA 2DWPA 4ESVA 4YXWD 1HT1E 1GIAA 3I92A 2ZSBA 5DIFA 1AKYA 3CONA 3MD0A 2XZLA 5KSOA 3PENA 1Q44A 1W0KA 3M4YA 3B1ZA 3A1UA 4QJ3A 4JLBA 1Q21A 4Q03A 4AKIA 2R6GA 2FFAA 2WPDA 3QG1A 4W5JA 3CRMA 1CR2A 1LF0A 2ZRFA 4MUBA 1BOFA 4Q02A 4HLCA 3MRSA 4ARZB 1TQ2A 1S9DA 3BC1A 2O8BB 4KBFA 1G8GA 4A8JB 2QE7D 2FFBA 2V55B 3BORA 3ND9A 1Z8FA 3LO5A 1KAGA 1G4AE 2BVNA 2GJKA 4PANA 2J5XA 1IQPA 3K0FB 1ESNA 5J4LA 5JJIA 3UPUA 3JZMA 1TL7C 2X1VA 2PZGA 1GITA 1U0LA 4XJXA 4PSVA 2OCBA 1W7AA 3JVUA 1QZXA 5FTLA 1ZM7A 4DLYA 1D2NA 3R8FA 2GXSA 4JJZA 1M8PA 2ERXA 2WJGA 1GILA 4PC3A 3AUYA 1G8PA 3AKCA 3IQXA 1GRRA 5K8IA 5G41A 1RRCA 4IVQA 4BZQA 4DKXA 2HUPA 4NYMR 1DOAA 1KNQA 3NXSA 5KDDA 3GPLA 2NG1A 4I1UA 2MMCA 4FINA 4AYTA 4P32A 1P2SA 3DO6A 4DCTA 1E1QA 3TBKA 3OIWA 4G5SA 1OFIA 1KDPA 2QQEA 3LBNA 4EPYA 1II0A 2J9RA 4R98A 1TQ4A 3REGA 5JRJA 5JS7A 1FPMA 4U00A 2D62A 5L3QA 2UVQA 3W6OA 1Q1QA 4HAWA 4AYWA 4E03A 1E94E 3QE0A 4CW7A 1EFTA 3IPYA 1XCGB 3DM9B 2PMDA 5JRZA 2CLDX 2Q9AA 2ZI7A 3BD9A 3QKTA 2C9CA 4KBGA 5AJXA 1KO8A 1NIPA 3CF2A 3A6PC 2ZM5A 3VX3A 2X77A 1OH8A 4Q66C 2CMKA 4IDNA 3KFVA 4ILEA 4LC0A 3RABA 1E0JA 3OHMA 4KFUA 1R0ZA 2VEDA 3PEVA 2QE7A 3GFOA 4CEHA 3RWMB 2WSMA 1D5CA 4IJMA 1KOFA 3U4QB 4QBGB 1G21E 1W1WA 1V5WA 4TMTA 4R2HA 1D6JA 3CWQA 4GSYA 5EUMA 3HPQA 1CJTC 1CJMA 2C9YA 2A9KA 1PLLA 2QAJA 4HDCA 5SZKB 4DVGA 1XRJA 1G7RA 5DN6D 4AWXA 4BFZA 4CEHB 4PAOA 1OH6A 1IJFA 5AJVB 1RIFA 4W5HA 2O8FA 1VKJA 3K09C 4B6EA 4IXNA 2EWWA 3CKLA 4RD1A 2BEKA 2RAPA 3PEWA 1XD9A 3RS3A 1F48A 1R7RA 2B7CA 3I1FA 4P4SA 2D06A 5C46F 4FXPA 3WP1B 3ZVNA 4N1AA 3FE2A 5A4JA 1DAGA 1RRGA 2OSBA 3CUEF 3K53A 4PTLA 4DDWA 4CGZA 4D0NA 1YR9A 2IYYA 2VP4A 5FBRB 2VL7A 1ZYUA 1E0KA 1CIPA 1XXHA 2BMDA 3VX4A 2P5TB 1XXHE 2WJHA 4MUAA 5TY0A 2O8FB 3VKGA 4XIGS 1R8SA 3WRYC 1KYIA 2ODNA 5JZVA 2W2XA 3CPHA 1HYQA 1G4UR 2V6JA 5L3VA 2X2FA 4H1UA 4AD8A 4QHTA 3WBJA 1VHTA 4TYQA 1AS0A 3T61A 1BS1A 4TLBA 2ZJ5A 1XFAA 3QBVA 1TU4A 5FOTA 2G6BA 3SDZA 4AC9A 3CRVA 4PHHA 1XXHB 3CB4A 1XMJA 3EIEA 3WXMA 4DT1A 4XWOA 5JECA 4MRSA 1QHYA 4XSHA 2R6FA 1N6OA 5FBLB 4MDFA 3X1WA 2ZI9A 4R9UC 1F6BA 4DB2A 2DYKA 2O8DA 3HR8A 4NCHA 2CL0X 3DZ8A 4NCIA 2ZSFA 3TVDA 2AWOA 3U7GA 2QTHA 1ZMXA 2BBTA 3BK7A 2X8AA 3H86A 4ZCLA 3R9XA 3A1SA 2IS1A 1KO4A 2QNRA 3H0KA 2ZUCA 1E2IA 4RKFA 1EWRA 2ZRHA 2AK3A 3AGPA 3LA6A 1YZTA 3VU9A 4LC1A 2N42A 2Z5FA 4RY2A 4PZZA 5FFMA 1XCMA 2G9NA 1LS6A 1UM8A 2P3SA 4YC7A 5DI3A 2F7SA 2RHMA 2O8DB 1YHNA 1P73A 2LCFA 3WHKA 1FMJA 3FHOA 4TL8A 3SYNA 3U7FB 4UXJA 5DN6A 4Q01A 1H8EA 3LAWA 4QGFA 4M1WA 4U02A 2P5SA 1JPJA 1JEDA 2O0JA 2PEZA 1HE8B 2FGKA 2ZRMA 3I73A 5EP1A 5DISB 5LBIA 1KJYA 3NEJA 4M1MA 5H70A 1P9NA 2PLRA 4U5XA 5B57C 2WWFA 5DI3B 1FFHA 2YWGA 5TXGA 4OQXA 1NY5A 1Z5ZA 1NKTA 1FW6A 5JEEA 1KY2A 4AYXA 2CK3D 2QSZA 2R8RA 3ASZA 4WZBE 5AUPB 4RD3A 4B3BA 5EUQB 2ZYTX 1K8RA 4PPGA 1GFIA 1G18A 4NU0A 4Q9JA 3GMTA 2D4HA 1P72A 1LB1B 2KBEA 3B5JA 4D4LA 3CF0A 2H16A 2AR7A 3IHLA 4MRVA 5JEDA 5BXQC 1QVRA 2W6JA 3SEAA 3CBQA 4PHTA 4G5RA 2F9MA 4JLMA 3ZDQA 1J2JA 2O8CA 1Z2AA 3WBKA 1LFDB 1COWD 4D0LB 2IYQA 2R9VA 1NJGA 3EWSA 2YWEA 1ZD1A 3TKLA 5G3ZA 1D2EA 4DLTA 1SVOA 1KI3A 1W4AA 3LY5A 4EDHA 1X8KA 4LWZA 2FPMA 2ODWA 4NYJR 4TYYA 2IX3A 2JATA 3SYKA 4JS0A 2OFWA 4BE7B 3AVUA 1YJ5A 1S0UA 4MGIR 2K5UA 2ZVPX 2IEZA 4A15A 3SZRA 1N5KA 2O8CB 4QHYA 5HPYB 4RKEA 2YNMA 2ZSDA 1KDOA 4AK9A 1HT2E 4V0OA 4OHXA 2JEOA 2YJTD 4QG7A 2OHFA 2XITA 2AXNA 4PXAA 2WICA 3K9NA 3U3MA 3T15A 5UKDA 4KVGA 2HF9A 4C0AC 2PMKA 1B23P 1OFTA 2B6HA 4PPQA 2F9LA 4KU4A 5EZ5A 1CP2A 1IY1A 4AURA 2BKEA 3A4MA 4NKRA 3K1JA 1G3IA 2CVFA 3ADDA 3RLFA 1JR3A 3MGCA 5CJ2A 4C7OB 1JR3E 3H1TA 3BB1A 4XVRA 2H57A 4QJ5A 2R62A 1OJLA 2XSZD 2BV3A 2P67A 1NNEA 2WJYA 4NH0A 2YWFA 1AQYA 1KKLA 3LX8A 3GJ0A 1Z47A 1VHLA 4KO8A 1OLOA 3NKVA 2GEDA 4Q21A 2V7QD 3R7WB 4UJ5A 3NBYC 3Q72A 4ZO4A 2QAGC 1Q12A 1FUUA 2ZI3A 1HQYE 4BEJA 4PC7A 1IY2A 2OE2A 2XXAA 2RGDA 1NSFA 2NGRA 5FOUA 2CCKA 3WMEA 3TH5A 4PC6A 1G7TA 3WY9A 2NZJA 3ECCA 2DWOA 1U99A 3IBGA 2YYZA 4HYYA 4B3CA 4FMCB 5H1YA 1T3SA 1GVNB 3EPJA 1DAFA 2ZRAA 3U5ZB 3NVAA 1JQJC 2VRWA 3VKWA 3UG6A 1N0VC 4PZLA 3B2EA 1NY6A 4RFVA 4GDFA 2QZ4A 2XXAB 4M9QA 4M9ZA 1ZNZA 1A82A 3QXSA 3EXAA 1XPUA 1AJEA 4G3XA 1JI0A 4BLPA 3UWOA 2VSFA 2KI5A 3THYA 3C7KA 1SVMA 3OEED 4TLCA 1HQCA 1NVWQ 1T8UA 1P6XA 4DLZA 2PEYA 4Q9KA 1N3BA 4I1VA 4JLOA 1CR0A 4JLPA 4JYCA 4PPNA 4A82A 4DLSA 4WZ6A 2RCNA 4Q4JA 4QNMA 3QIAA 4A2WA 2EU8A 1H8HD 4EIWA 3THYB 4NPHA 1DAKA 2QG6A 821PA 3G82C 1G20E 1TQ6A 3KJGA 3K0CA 4M8NE 3V00A 2HCJB 3M1IA 2ZETA 4LPSA 4K8OA 5FBWB 1E9BA 2D7DA 4Q4JB 2V8OA 4XTCS 121PA 3PV0A 1A2BA 5CITA 1SVKA 5L3RA 1TTTA 5FPKA 1G7SA 4PQYA 1NMYA 3GLHA 4RCYA 1E9CA 3GLHE 2WOOA 3QXXA 3IPXA 1GNRA 1NN0A 2DHRA 3ICEA 4B47A 2ZAOA 1JJ7A 2V4ZA 4LBWA 2DFTA 3BE4A 5P21A 3AKEA 3FMIA 3CH5A 4LYJA 2Q21A 1II8A 1KKMA 1KTVA 1RRPA 2PJZA 3RRZA 3GLHB 1ZC3A 4YMVA 4QM7A 3QKSA 1BKDR 2IHYA 3KKMA 1BYIA 3HYTA 2IA5A 3QI2A 3SJCA 3X1DA 1FNNA 5HKKA 1E79D 1YRBA 1DAMA 2QTFA 4B2LA 2AFHE 4A0GA 1II8B 4XD7A 2JJ2D 2OZEA 2O0HA 2QMUA 3A4LA 1KK1A 2PH1A 4ABYA 1WB9A 3BH6A 1XBTA 2HXSA 3DEFA 2BJWA 4DUGD 4W5WA 2CNWA 2EW1A 1OV4A 3U3OA 3OESA 3B13B 4DWJA 3U7HB 3T06B 3LH5A 1H65A 4DSTA 3T1QA 4HDOB 2CJWA 2WJIA 5DYGA 3LXXA 5DE3A 4ZI3A 2GZDA 4L9SA 1LV7A 2P6RA 2VBCA 4JBYA 3MWKA 1H8HA 2Q9CA 2QBYA 521PA 1CJVC 5IT5A 1YZGA 4MKGA 2KWIA 2G1JA 5EXPA 2HYDA 3LBIA 3TW4A 5L3SB 1SVSA 4MRNA 4IFEA 1VYVA 1WDTA 2BHRA 4RZXA 3H84A 2HLDD 1CXZA 1ZD8A 4PSKA 3I3SR 1ETUA 2CJWB 4TMWA 3KTAB 1NRJB 3P27A 2RGNA 2ERYA 4EJSC 2C5LA 4E07A 3RRMA 3B7GA 3RS2A 3DKPA 4LJ9A 5FUWA 5KYKA 2R6DA 3LD9A 4DDVA 4DIEA 2DCUA 2J1LA 1VTKA 2QT0A 1XD8A 1FQJA 1U90A 1JAIA 3Q85A 1MABB 4H9GA 4FN5A 3CRRA 4HZUB 3ONWA 2OLKA 3IO3A 4MA4A 2PLFA 5B30A 1XPOA 2Q6TA 1RPZA 4JL5A 4C2UA 1GL9B 1AK2A 4ACAA 3A58B 1F2TB 3Q7PA 5FTKA 2J0QA 1HV8A 1GOTA 1XB2A 3DDCA 3KFXA 3S1AA 4TN1A 4B2IA 2GCPA 5TDHA 3REFA 1UDXA 3GJ5A 1N5LA 2GVDC 1P62B 2JASA 1N25A 2ZQ5A 5BN5A 3R9IA 2XJ4A 4LJ4A 4XVQA 4TYNA 1IBRA 2ZS8A 4M1SA 3QXJA 5LPNA 4ZDJA 4NCKA 4DCUA 4OL0A 5IHPA 2XJ9A 3AQ4A 1OHHA 5A5GA 1OFUX 1Z0FA 2YOGA 2J46A 4O0MA 3W9YA 2V3CC 2HT6A 1FTNA 3NIBA 4AG5A 5CIQA 4B2PA 1DBSA 4D0GA 3CR7A 1G8FA 2RB4A 2FFQA 5C18A 2L0XA 1FUKA 4KSCA 3U60B 4C0JA 1Z2CA 4OHWA 3P1JA 1AM4D 1VG9B 1GNQA 5CM8B 2GAAA 3NH9A 3EZ7A 3C5HA 2EFDB 4LHWA 4ZI2A 4EJSA 2OBLA 2TMKA 4BEBA 1UEJA 4BECA 3B6EA 2WMNB 3SS8A 2J3EA 3DL0A 4LHYA 2ODEA 1TU3A 5K8UA 3TSWA 4Q5IA 5IK2D 1XJ0A 4GMXA 4NYIR 4BASA 2FJUA 3PG5A 5L8VA 1ONBA 3EPHA 1EFRA 1KHTA 4OKSA 2A3RA 2HT1A 3WP0A 1CRPA 1EX7A 2ZTSA 3F3YA 4TQAA 4EJSB 2WKPA 2ZR9A 1NVVR 1M1YE 2CDNA 1ODFA 2E1RA 2PCLA 4KFTA 3GFTA 3KKPA 1D8TA 1MRSA 2GJSA 2IXFA 4DHEA 4BLOA 1JECA 3A37A 4B48A 1GKIA 2ZIAA 4UJ3A 5FR1A 4Y0VA 4C0BA 1ANKA 4OBEA 1E0SA 2OCYC 4NTZA 1Z0AA 3R20A 3OFND 4MRPA 1MT0A 4GT1A 2HF8A 2C8VA 2ZR7A 3FKQA 1IN6A 1P4SA 1RVDA 3LWNA 2OCAA 3X1ZA 1OXSC 2LWIA 1UADA 1GDDA 4OI1A 2OLJA 3SFVA 3QXHA 5C4GB 3KKNA 4B76A 3SJBA 1I4DD 4DZZA 3NBZC 1QG2A 2WKQA 3ZD6A 4L9WA 1DVRA 1IXRC 5FPHA 2PX3A 2G0TA 1N2CE 1T4GA 1YQTA 1ZW6A 3EW9A 2P65A 3IDQA 1CJKC 2YKGA 2YINC 4JLDA 4I1OA 3SBDA 1EX6A 4L4UA 3T5GA 3B9PA 2OXRA 1E2FA 3AM1A 3K70B 4TYWA 2PT5A 1W49A 4E5UA 3ZIAA 5F9FA 2WWGA 3HWSA 3HU2A 4Z1MA 2BKUA 5JCZA 4CYMA 1ZCBA 3OAAA 1U9IC 2IK8A 4JT2A 4JVLA 5DHAA 4S35A 1AQUA 2FV8A 2NO0A 3O8CA 1A7JA 2G88A 1KMHA 4JL8A 2V1UA 4NYMQ 4GPTA 1QHIA 3O8BA 1DTSA 5TMPA 5JFGA 4ARZA 1UPTA 4D80A 1T0JB 2O8BA 2REOA 2WVJA 5HCIA 1LVGA 4EPXA 1E96A 2WMOB 4PAMA 1XZQA 4D4JA 1Z28A 1E1RA 1S9HA 3SU8A 1MRNA 1KMQA 1IJEA 1DAHA 3EARA 1WA5A 2BJVA 2ZJYA 1Z29A 3BB3A 1CR4A 3K0FA 1VECA 1YRAA 2MSEB 1XJQA 5TV2A 1AS2A 1KMHB 4M53A 2IHBA 2IUTA 3LX5A 2YZ2A 1E2MA 1QF9A 1RYFA 1E2EA 4MYCA 2FPKA 3RYTC 5LB4A 2DPXA 2ZI6A 1KI9A 3KQUA 2GHIA 3THXA 1DG3A 3GJ4A 1UBGA 4KITB 1AIPA 1OYYA 4BFTA 3THOA 4GFDA 1GKYA 3EC2A 3ZS9A 2XAUA 1XNJA 5TB5A 2WIBA 1Z0JA 5SZJA 1I4LD 2PBRA 4MKFA 1X8LA 1XDBA 3UKDA 3BIFA 1Z6GA 2OESA 3MLEA 3NHBA 2FSFA 1XP8A 3THXB 4A2QA 3QSYA 1U8AA 3A36A 1P3JA 1R4AA 1E3MA 2DFLA 3K9HA 1WMSA 1KK2A 1NLZA 2HJVA 4OHVA 4RFSB 4MDEA 3TUJC 1U8ZA 4R71A 2WBLC 4Q4HA 5JWOA 2J0UB 4IOMA 3D6TB 4TTPA 1L4UA 2BCJQ 2EFCB 3TSZA 3EZ9A 4AI6A 3EAQA 4PFSA 4GBMA 5HCNA 3KUDA 1QBKC 3SJAA 3PUWA 3P4YA 4B3XA 4BWYA 5J4HA 4CEIB 4YMSA 4XVUA 3B1VA 1OKKD 2VIIA 4JL6A 4WBSA 3VKHA 3IIMA 1X1SA 1ZNYA 3WRXC 2VH5R 2A5YB 4Q4HB 4RD2A 3ZQJA 1JXOA 1TNDA 2H1LA 2KBFA 1QDEA 1U94A 4QOSA 1OXVA 3N5CA 2QGNA 3NEYA 4EPWA 4BRUA 4QHSA 2N46A 2QP4A 1JAHA 2IS2A 4P31A 3QPUA 1TPZA 2OV2A 1GNPA 1IN7A 4YXWA 3PJRA 1QHHA 2F3RA 1L8QA 4HB4A 4V02A 1JB1A 1IXZA 5LD2C 3U4QA 4Q47A 4B34A 4TLDA 3AF4A 3JZAA 3P4XA 1Q3TA 5JMTA 2VSOA 5H68A 4PC1A 2HV8A 1US8A 4QC2A 3TQFA 5J40A 3LNCA 2OUKA 5G53C 3X2SA 1VG0B 1N6PA 1KDTA 1P5ZB 4KODA 1G3RA 1TEXA 1ESMA 1QHHB 3SOPA 1T8TA 2EQBA 4XWAA 5AR1A 1FX0A 1OE0A 1XZPA 2OM2A 4JKYA 2ZRKA 3ZS8A 4BRWA 3B1YA 1GL7A 3RHFA 1BMFD 1GSIA 2ZI5A 1IOZA 2GXQA
chains in the Genus database with same CATH superfamily
2F43B 5KPDA 2HX1A 1GT6A 2C82A 2P91A 3TAHA 3V8PA 1JFVA 1UPAA 3UCFA 2C94A 1JYEA 4L9RA 5ALZA 3GJYA 1QHNA 2Y8EA 3N58A 3LVQE 4RABA 5KO2A 1FX0B 2H0AA 4HGRA 1MQ8B 3EFBA 1GZDA 3X1KA 2QN6A 1OZFA 3DV9A 4LHVA 3UJ3X 1GKUB 4AMBA 4QOHA 5BYKA 1QAMA 1RJWA 4OQMA 2XZOA 2IFTA 3MILA 5JHGB 3OP4A 3I0MA 1XTVA 4BBZA 4IWNA 3NMUF 2ZBUA 5K7SA 4AJ9A 1OB2A 1OYOA 1W52X 2GZAA 3JQDA 4BN5A 4DV5B 3INNA 3IUMA 4U2CA 3G8BA 1I7DA 1C1HA 2P69A 1YO6A 4YIKA 3AINA 5I7OA 4DYHA 2FKAA 2WUGA 3V42A 2C0CA 1JDNA 4QTUB 2INGX 3MGBA 5C0OE 3BMOA 1UJ2A 2NTEA 4EBFA 2CUNA 4P5PA 3U39A 4I2VA 3A4VA 4X84A 4GC9A 1GSOA 4HDRB 5M3BA 3QU2A 3SHQA 3S2ZA 3RUPA 2CZQA 2Y4OA 4H27A 1U5BB 1DBIA 1HKUA 2O5EA 3A0RB 3UAGA 1KAEA 2EJCA 2O6HA 2H92A 4BB0A 4YRNA 1X42A 4KYUA 5J2UF 3L04A 4FLMA 1S3IA 5FKJA 1PFKA 4D4KA 3DXZA 4JYBA 2HJWA 2WSBA 5F2KA 1PNRA 2P2GA 2RGAA 3NCHA 5LOVA 3ZDRA 4CFYA 1USUA 1NMZA 4Q7KA 1E9AA 2RHBA 3OM9A 1TAGA 1W0JD 1ZSNA 4L0CA 4LMAA 2CVZA 4NYJQ 4DSUA 1QKJA 1P2DA 1SHTX 3M70A 4PX3A 4WFJA 1CJUC 3T3MB 2RHOA 3WQBA 4CV3A 5I3ZA 4B8ZA 4G41A 2BM8A 2CMGA 4A36A 2FRDC 1FSFA 1ZCZA 4EYSA 2ZYUX 3K94A 5DF1A 2QR5A 1RJ9B 5EHXA 2QMEA 3NHMA 3IEKA 4JSTA 1X7WB 2PWZA 2QORA 5BWOA 2CFCA 2AKAB 4PXYA 1Y7PA 3TR0A 2QXYA 5EQJB 3LOPA 4JBHA 3U3ZA 3W3AD 3RTEA 3ZXXA 3KJIA 2HEIA 4B31A 1XTRA 3WL8A 1WW8A 1YS2X 2HMWA 4MHOA 2G06A 4D44A 1G3MA 5AVVA 2H1WA 2H5LA 5D3KA 3VO9A 1Y7IA 5JWRA 5K0GA 4OHFA 4OFXA 1QGZA 1UC4B 1ZITA 5E2BA 2IF0A 4E12A 3AIKA 4LNAA 1YIOA 1P9WA 4D82A 2L17A 4CQMB 2ACKA 1NQAO 3CWCA 3T3EA 4EX7A 3EF1A 4CEJA 4WNAA 3R75A 1YB4A 2QQ5A 3JW8A 4YP7A 3MN1A 1TAQA 2VWQA 3PNMA 2XHZA 3VR2D 4GGPA 5CB6A 5I9LA 1QRSA 1L0BA 1RT9A 5DP1A 1BWQA 5FTJA 1WE2A 2X14A 5G1NA 3OETA 3RSCA 5CFMA 2HHLA 3VSBA 3VR3A 3WMFA 1YGPA 3BDVA 2HDHA 3OURA 2W8BA 3CE6A 3VPAA 3LPDA 5CYPA 3ZWMA 4GH5A 1QRUA 5ICMA 3A9VA 3QVOA 1U4NA 3I72A 5FB3A 3R7AA 4CL0A 4EABA 4FFMA 3ABOB 1ID1A 3DJFA 3KXKA 3VGJA 4KQKA 4QKQA 1IZZA 1C80A 4FMPA 2PX8A 3ZD8A 3SDSA 2F1HA 2H9IA 4M1YA 3HCFA 2I1VB 3EDRA 3P2JA 4UNIA 4YUZA 4MA5A 2ZYDA 1V8FA 4P3XA 1OZAA 3EFEA 2C04A 3LX4A 4II7A 3U4QA 3C16C 1CUCA 2CXUA 2MWMA 4NDAA 3QKUA 4QEKA 1UMDB 3ZE1B 3TTSA 4BV9A 1KVQA 1SBQA 4Q37A 4C7OA 5DMXA 3NTQA 4CPDA 4K6OA 1OFGA 2G80A 2FEPA 4U39A 2O2GA 4EG6A 2ZSJA 2DRIA 1PQPA 1CQIA 4DLBA 3L4KA 2MSDB 2AN5A 2UYHA 3MMZA 2G1PA 4UTOA 3BWXA 3EIFA 4BGEA 1V4VA 3GRKA 2PK3A 1TXGA 4JZYA 2QI9C 3HEBA 1E9FA 1L1FA 4X20A 1ZP6A 1K27A 1AHPA 1U1EA 2NIPA 3EQ7A 3ENQA 4DCOA 1N2SA 1CYEA 1GV1A 4UM7A 3TQOA 3ZZNA 4DNPA 4BLWA 2G9ZA 2Z9DA 3WZ2A 4G0VA 1Y8RA 3RYCB 1E62A 3RUEA 3DYBA 1NVKA 3E9RA 4PC2A 1HI9A 1KK3A 4LOLA 4JI8B 1GWNA 3BDAA 4E30A 3PVZA 4PIMA 1QUEA 1H22A 3K4QA 1DKLA 1C30B 4BQSA 2AD5A 1W5FA 3OE4A 1WUHS 5K1ZA 1IY8A 2RJOA 4ALJA 4BKQA 1BGWA 1O89A 4EMBA 1Z17A 2GRAA 2FSVA 3UAXA 2ZJ0A 3HMQA 4IDGA 4PAGA 3B1JA 3GLVA 2NPFA 5DHPA 3C7TA 4HTFA 5IMSA 1G64A 1BVUA 2QI9F 1IPHA 3B3FA 1W4RA 4HG2A 1GDHA 4PNPA 4PIVA 1IEQA 5ALDA 4E14A 2ONKA 4YACA 5LC1A 1AHNA 3DBOB 4B79A 1K4KA 1YH3A 2JHCA 1T26A 3BK2A 2NVBA 2WE7A 3LXMA 4O2LA 1SUDA 3CUTA 4ZVOA 5C1IA 5LQSA 1KP2A 1VIMA 3AY3A 5HQ3A 1T15A 4I7EA 1R0KA 1UPFA 4R8KA 3M83A 1IMOA 4D4MA 3VR5A 5L3ZA 2P11A 4JBGA 2C61A 2W0SA 1H1DA 4QVKA 4BNMA 2EARA 4TLAA 5FPPA 3FMOB 1R8YA 1AC5A 3F78A 1UBOS 3M33A 5DRTA 3S68A 1TKCA 1Z5WA 1LQUA 2ZXUA 3NHLA 5EFZA 4U0JA 5FJJA 4DRXA 3ZDZB 4OHCA 3E1KA 3W4IA 2XE8A 1P5JA 1TJPB 2EJUA 1GTJ1 2VAMA 3FI0A 3NUQA 2SHKA 3NW9A 3PDHA 4MKIA 3OCXA 4N0EA 4R6XA 1NP3A 1TZ2A 1ULHA 4B84A 1AGRA 1XMQB 4LJ7A 4FW8A 4BS9A 2KS6A 2QRLA 4D9FA 4YLGA 2IT1A 4URFA 2PKEA 1L7EA 4LXIA 4WZZA 5AW2A 3IXMA 2CNOA 2V6BA 1CQJA 1FFAA 4RPLA 5FUQA 4M1QA 4A5OA 5EJIA 1V1RB 2QN9A 2CHQA 4M9SA 1SHLA 3FCYA 1D4FA 1N7HA 4RIGA 1UK6A 5AM5A 5LXTF 2GOYA 3L3BA 3N7AA 2QAGA 4HZGA 4DPMA 5JNWA 1W36C 3TM5A 3GVPA 1NJ1A 1XA4A 1CEEA 2W2OA 3V1NA 2O2HA 4YRDA 1UQTA 4E3WA 1DI0A 4MR8A 1U0TA 1EM6A 3OZTA 2XSZA 1IPFA 3S0JA 3UPDA 1D4ZA 3WRWA 2Y1OA 2GPSA 1KC1A 2RHGB 3FROA 4URZR 3HCCA 1MEEA 4L4ZA 5REQA 5JYDA 2RJNA 1M83A 3QGMA 4ZKEA 5B2FA 3ER8A 2D1QA 3QFCA 1E60A 4JOCA 3HB9A 1AB5A 4H17A 4Y7CA 2W6ID 4AXXA 3FZNA 4CLOB 1U8TA 4ZVMA 1DCTA 3BFVA 3QF4A 4EHDA 3ZY5A 1EUZA 2WD9A 4S3MA 6REQA 3WWZA 2JGDB 1A8HA 3LBAA 2VNSA 1E4EB 3WYCA 1IATA 4NCBA 5A03A 4R16A 3KZOA 1NJFA 1SKYE 3EG5A 4IHJA 4PZUA 3P0IA 4TS9A 1KDYA 4YT5A 3CN7A 3ZG6A 4IUBS 1IEVA 4GD3Q 4IEEA 4LYYA 2Z9BA 4RHXA 5CX1B 5ALHA 5FPSA 4EFNA 3IUQA 1R0RE 1Y82A 4LTNA 5B3LA 1XZBA 4B73A 4HJRA 4CRWB 3IAM1 2CL6X 3ZBQA 4C7VA 1LRLA 1AKRA 3P9RA 2GI4A 2NXEA 2QDKA 3ESQA 3AU8A 3FBWA 4ZWNA 5LLTA 4YV1A 4JXZA 1NYLA 1EKXA 4L8YA 1KR2A 2YZKA 3E81A 3D4IA 5AICA 3WSTA 1RTTA 4K26A 2ODTX 4CGYA 4KNWA 4V1CI 3G89A 5K6AA 1CZKA 2RARA 3ND5A 1NVXQ 1E2DA 2V03A 1G5RA 2PSJA 3ZX4A 1WPQA 1GNTA 4PBTA 3CMCO 4XZ3A 5DK6A 3AVYA 3CH7A 4M0LA 5EG5A 1P5FA 1SXJC 4MVJI 4XAQA 3VNSA 3LWDA 2J3HA 1C81A 3UAOA 4MAFA 4C07A 3H8WA 1FMTA 1UC9A 4JBXA 1BJTA 4KN9S 2YOFA 4C0LA 5CFOA 2QTAA 5TT0A 2YQ4A 1ESDA 1Z7BA 2GR9A 1QVAA 3CQ9A 4IJWA 4G07A 5ALOA 1JEEA 1MXHA 3AVTA 1L8XA 1V1JA 2BEJA 3Q7IA 4KWHA 1JKXA 2IDKA 4PFKA 8OHMA 3KX2A 3KM0A 2A5GA 2ZSAA 5E9QA 2AS0A 3FDJA 2P35A 2VHQA 3BGOS 3A6EA 3M6XA 1TOAA 5LA6F 3T41A 3PQ7A 2ZUDA 4X3CA 5ERGB 3TAUA 1FVFA 4HLUC 4IV8A 4CNQA 1B1AA 3NWPA 3H11A 4I1RA 4FS3A 4AN0A 1G4HA 2BSAA 3T3PB 3B9BA 2IBTA 3I2IA 3MWYW 2D5IA 2FSIA 4U5QA 4RLQA 5CTJA 4JLNA 4ICIA 2O2XA 2R1VA 2ACWA 3WIBA 4A23A 4BMNA 3SQXA 2VQSA 3BCHA 2IPOA 1XCPA 3GRUA 5TS2A 3GRVA 1HYGA 2P6UA 4OQLA 4OJYA 4AK9A 2E89A 3V97A 2NP6A 1ZINA 3ZWBA 2IY7A 2N1BA 3KT0A 3L0BA 3DKIA 4MA0A 1RWXA 2VOJA 1E3WB 1WVMA 1I0LA 2ZJAA 2ZBGA 5F2OA 3L0IB 4DCGA 1YKGA 2FDRA 3DMNA 3ETHA 1FFXA 4RWZA 2AOTA 2P2LA 3GD7A 5ESXA 2EWMA 5GOTA 4BL5A 2CXOA 4BLUA 2XXJA 3C8DA 4Q1DA 2FOIA 5GP1A 4X7RA 3PXGA 1V8DA 4NY1A 1RQXA 5A6SB 1ACLA 3CX6A 3MJCA 2WJJA 3HGMA 3KJQA 4MUHA 2GRJA 5CT4A 5F5LA 3S1SA 3MM4A 4MOWA 3WBFA 5EE9A 1P4HA 1U9CA 1W9MA 5EXTA 4ZK2A 2VTKA 2QIOA 3GF4A 1B1CA 2W37A 4TL9A 4G81A 3JD0A 5CVCA 2EP8A 1DEKA 3A3YA 4FC7A 4G5QA 2ZWVA 1MZVA 3Q11A 1OWPA 2N1MA 3F96A 3L6EA 4HAUA 4MS3B 4QLBA 3SQMA 5K0SA 3KD2A 3BIJA 2YC2C 4OB7A 1JJBA 5EMMA 2MYUA 4HRVA 1X7YA 3E7WA 3ESYA 3GLTA 2OV6A 3D6FA 3I39X 3SE7A 3SGLA 4OGFA 3NHAA 1E6WA 2BTQB 4X1OA 4X5OA 1N6IA 3F67A 5HUHA 1NT4A 3EMVA 2PUTA 2CFRA 4EGFA 3MTGA 4EPTA 1GRVA 4R7ZA 1S7GA 1OSNA 1NMXA 2V9PA 3SOZA 1NPDA 3LIPA 1KZHA 4DMMA 2HLDA 2J87A 5G3YA 4UZSA 5H3HA 4RAQA 1DIAA 3DLIA 3UXMA 3K05A 3SF8A 2ZPTX 4WADA 1U2GA 3A10A 1O4VA 3A27A 4P3OA 4ERNA 1YVEI 1WULS 2ZYAA 1PJTA 3KPUA 3U1VA 3DPSA 5TX7A 4BX2A 1ZK3A 5SZHB 1VL0A 1SIBE 1BXGA 1YE5A 4PGHA 3VSCA 2JJMA 4QQRA 2A2ZA 2H08A 3WAGA 4UCQA 3SR0A 1LK5A 5KEIA 2WTAA 4KKXB 5KSYA 1NG9A 4MINA 3GQBB 5FNVF 5MN6A 3B85A 1GNLA 4IG4A 4FOSA 2XQIA 3H9GA 4X00A 4ROTA 2Y2VA 2Q0QA 4OREX 2XD4A 4M7PA 2AUNA 1PWXA 1UBSB 2GTHA 2HEGA 4XPIA 3TIVA 3UK0A 2OO3A 4EYQA 4EYOA 2YJ5A 5EOVA 1QH8A 2NV2B 4U2KA 2LDXA 3F7TA 5E95A 4A0RA 2P3QA 2B20A 4I9FA 1QC5B 2UXDB 1DELA 1L2TA 4IILA 1OLXA 5EZYA 4A9AA 1ZOPA 1EINA 2Q1SA 2W58A 4G1UC 4MIOA 4JH0A 5F2EA 2YUIA 3DKVA 3EEIA 3TRJA 5JROA 2CEKA 3UA4A 5DB4A 4F56A 4E6PA 1LQ2A 5DH9A 2HCRA 3VZPA 2OCIA 5IH7A 1Z74A 5HGJA 1ZKMA 1L4BA 4OJTA 3KSUA 2NUAA 3HH8A 3LBFA 5CYGA 3RVOA 1U3FA 5CXSA 3RRNA 4NBRA 1AK1A 3O7MA 2IYSA 3ROZA 1GFZA 1IK4A 3TS1A 4BC1A 3ZV5A 5HK8A 4ND6A 2OP0A 8AT1A 1QOZA 1R6BX 2M2IA 4Y3UA 1P39A 1BXRA 4EG5A 1PS8A 1TK2A 4DDKA 2ZBFA 3TTXA 5F98A 1LI5A 3WLNA 4OFBA 2OCXA 3GT7A 1IBLB 1SPXA 2I2FA 2B37A 1DEOA 4FXOA 1Q1GA 4YRLA 3S7ZA 4RW0A 1GSAA 3FNRA 1J8DA 1EUCB 4K9RA 3V2GA 3FGZA 2VUUA 4V24A 1GQ2A 3ACCA 4RKYA 4OGLA 2O5VA 1LJUA 1TEVA 3NZEA 2Y77A 4J0CA 4WH0A 4DR7B 2VVTA 3C1OA 4JUDX 3FLEA 2SKEA 3NDPA 3PCTA 2MU1A 3T7TA 4FR5A 5CEJA 2IKQA 1ZL2A 2ZKIA 4FFOA 3ETLA 1DQPA 1WWKA 5EL0A 5JCOC 4HXGA 4J2TA 4KPFC 2YIDA 5IK2A 2QEQA 1NNUA 1AVTA 2JLVA 4L4XA 1H2YA 3E5HA 2Y1DA 2A9FA 3PGVA 1RBZA 4P82A 5T41A 4EYEA 4C3VA 2R3SA 4JB2A 3WNCA 4XLZA 2JI7A 3IOCA 4OY3A 3V1UA 4KQCA 3ZU6A 4B7XA 5H7XA 4KUGA 1GLVA 2B3DA 2D2XA 2JK0A 3AL3A 4P2GA 4WVLA 4ZGBA 2C5GA 3QVGA 4REQB 3P0EA 3QY0A 4YFVA 3WYGA 5F21A 4A2PA 4DCVA 2G83A 4V1CB 3AM5A 3IX7A 2VYNA 3AESA 1EHYA 2DUMA 2F3QA 2C98A 3G2HA 4EF6A 3ZHXA 3EWNA 2GNOA 1PZNA 3CT6A 3PUXA 3QW4B 5ALTA 4YUYA 2H0QA 1FX1A 3LFHA 2I7XA 3HXMA 2BRUA 1NX9A 3AI3A 4INOA 4EHFA 1EZ1A 1JIQA 4IKOA 2QN1A 2RKOA 1MO6A 4NMMA 4YN3A 4AF7A 1MLDA 2WV9A 1A27A 1R8QA 4P4TA 1BWSA 1FY2A 3L7NA 4MPDA 3OMLA 1PWEA 2F62A 5AHKA 1UFVA 2JLRA 3EEQA 4FNGA 3TUIC 3GMIA 2QRGA 3EGOA 1CRQA 3RHSA 4QYIA 1IJBA 1H2BA 1T2FA 3PWZA 2FG5A 1CY6A 3GFBA 5EHNA 3JAMA 3NALA 1X1CA 4WOPA 5I7WA 1NBHA 2IXBA 3LQKA 1PFQA 1WB5A 2FW9A 2WAYA 2A5FA 2N0SA 2BSXA 3H4MA 3V4VB 1NE2A 3C48A 2R6R1 3RHZA 1OI7A 1EFHA 4DILA 5F78A 4FK8A 1YGYA 1T5SA 2VHEA 4P3YA 3I83A 2QLFA 4PQRA 3HR7A 1M2HA 3BD7A 3PQ4A 2QPAA 2DP4E 2IE0A 3LCUA 2JLYA 5LDGA 4XB6B 3VC7A 4GPAA 3KZ1E 4W8GA 4R1TA 5HG0A 1KI4A 1SU6A 2V74B 5LZ8A 1Q1ZA 2QX4A 1TGVA 2V54A 3KR1A 2ZB8A 1WXXA 3Q3GE 4H15A 4KO2S 4P4NA 3EDQA 2RKBA 3PCRB 3WGVA 3OUTA 2WYOA 1TZMA 4CTJA 3O26A 1A0OA 2X1HA 5K8VA 4KI7A 4NZMA 3SXUA 3RC3A 3PCXA 3E5NA 1BE1A 3K0BA 5KVVA 3TYXA 3FOZA 2ZRCA 1IY9A 1GFWA 1IUPA 2YICA 3P32A 4JLKA 2OFXA 4YDHB 4A73A 3R3XA 1IJKA 3TLBA 2W6NA 5JYBA 4N4AA 4RA9B 1E1NA 5KC8A 4F21A 1EJ0A 4AJHA 1P0FA 4O3MA 3OWXA 1SQ5A 2FMTA 4HEJA 2C5SA 2PL5A 3M6UA 1GQRA 3THWB 1TAUA 4BEWA 3RVSA 3JCZA 1B42A 2FX2A 2VSYA 3OJCA 4ETMA 4W7IA 3IBTA 1ZA2A 1DO0A 3EHEA 3LUFA 4PLFA 2C03A 1XDZA 1OBCA 4GIBA 4O25A 4Q9IA 1XRSB 1NUSA 5H3CA 2C95A 4J49A 1KPGA 3A4NA 3VAYA 4V0ME 4G85A 2AXPA 1SCNE 1PD0A 2Q0SA 5GQSA 4GZMA 1WKVA 2IJGX 1A5AB 1EXMA 1SZJG 3G8YA 2CLHB 2F43A 3FTPA 2JFOA 2WF6A 2YHBA 2VRNA 3CCFA 4Y2QA 3E4DA 2FMXA 3EXG2 4ZQEA 2VO1A 3LUAA 3TL2A 5JJ5A 1CS0A 3Q7TA 4R8VA 1P0IA 2J7KA 3LYUA 5AOVA 5LUBA 1SKMA 1WKBA 3HGTA 2BHLA 1M1ZA 3G5MA 4UM5A 3WWDA 2AJ8A 2PSFA 3F5SA 2RGCA 3MTAA 1WNFA 1PCXA 3H0CA 3M89A 5CHYA 1EG2A 4QXPA 3RS0A 2IW1A 4CLHA 1FZQA 3ZI7A 1XD2B 1U7PA 2AE1A 3F6BX 5CLGA 4E5PA 4GM0A 2L42A 4RQBA 2XDWA 1RE0A 1C2TA 5C32A 5KTYA 4GOXA 5EIAA 1LBHA 1WUIS 1U3GA 5IFLA 2DQ4A 1KWKA 3GRYA 1NG1A 1F8XA 2SBTA 4NDNE 4IM7A 1DC5A 4NFLA 1G63A 2D8AA 1B6RA 2ZE6A 3VI4B 3IOBA 4NK4A 3KQHA 3PFWO 1BWPA 4WXEA 3FJYA 3QBJA 4A0HA 2PFKA 1DZIA 3EJWA 4DBVO 4QRHA 5J2TB 1N9GB 4OHZA 1JG6A 3AOEC 1Y6RA 3A70A 2C9DA 2CBXA 1EEHA 4I3HA 4XQ0A 4X0EA 2Z4TA 3UMGA 2GDJA 2NQ2C 4G8JA 3JAWB 2O3UA 1OH5A 2JG3A 3B5IA 4P81A 2XOKD 3HUEA 4AO7A 5CA1F 2H4YA 1HY3A 1ZRHA 3D6UA 4M46A 5KYXA 2H17A 3S8MA 1KA9H 5CDFE 3UHOA 5THQA 4QU0A 3LT2A 5JS2A 3N2KB 1PF7E 3D81A 5LR6A 2H4HA 3FPCA 1YZKA 4MRAA 2AKYA 2CNLA 4JT4A 4UEWA 4KPEC 3DCNA 5D3MB 3SE0A 3QFHA 2EW2A 2R87A 3MWEA 4RU1A 5HIJA 4AQYB 3N2LA 2H1SA 4OAPA 1ZUWA 1KZ7B 2HTEA 4KJZA 1RTKA 1YUMA 4NG5A 1ZM4A 4RX1A 4EWLA 4L8LA 5BQ3A 2ADMA 4F6RA 1Z83A 2C83A 2FSHA 4EG8A 3AH8A 4UHJA 2G4LA 2DUWA 3D5EA 4EQ6A 4JC0A 1WO8A 1CUFA 4AUMA 3FIUA 2Y1XA 4JBWA 4P4SB 1OX5A 1XRPA 3AV0B 3JASB 1QV7A 4B45A 4WZAA 1BOOA 4G1MB 5IHXA 4LJAA 1YT5A 3A1WA 3GNTA 1DRJA 3WHLA 4CTOA 3A05A 4AULA 1RJ9A 3C74A 3GAZA 1I51A 5IAJA 2QLBA 1GTL1 2Q3JA 4ZVQA 2KX7A 2GILA 3PHCA 3RYHA 4EY8A 4O4JB 5LBTA 2B7LA 5HMLA 4ECAA 1P18A 1P2TA 3LQYA 5DEOA 2ZUWA 4JX9A 2YYAA 3LPLA 4JEMA 5DEIA 3SC4A 2J0SA 3ZGYA 1EFAA 2CYCA 1G42A 1K06A 3BRSA 4TT8A 4CQMA 2DE0X 2C2KA 1II9A 3UOWA 1T5LA 4IDPA 2Q4DA 1ESZA 3ADCA 1GRQA 2C4WA 1TM3E 3C15C 3CXRA 1KSFX 1YJAA 1KVSA 3G5TA 3AVWA 1CF4A 1Z88A 3HDTA 1R9GA 1AKWA 2COEA 4IGAA 2HY7A 3A2MA 3MB5A 3LI2A 3VNUA 1SG9A 2UZIR 5A7GA 3ES9A 1HQDA 3T3GA 1HYHA 4HB0A 4QTTB 3VKUA 4CR8A 1YZFA 2B8WA 1SIWA 1W6RA 3GOQA 1DARA 2D3TA 3RVBA 4RPHA 3JZDA 2YNMC 2BGUA 3TLKA 1INLA 2O2SA 3A7DA 3CEMA 1JR3D 2WIJA 3I9V1 4LNHA 1UC5B 4DDUA 1D07A 1VI6A 1XT6A 4KHPB 4RBNA 1XP5A 1THGA 3CEAA 1RRVA 3AB8A 4HPXB 3EXEB 4IDEA 4ZCRA 2BFFA 3VU9B 2DFNA 4QWMA 1K3FA 2GBLA 2WQZA 4HDKB 2MSWA 1Y3BE 4FYXA 5JS6A 1EDEA 2Q6VA 3BIXA 4NPAA 2VCEA 2D7CA 5KX5F 1ISFA 3QJYA 4GZ5A 4M88A 5AUOB 3HU5A 1YC2A 3LCCA 1EX9A 4MHSA 4TV8F 4XYMA 1CUJA 4DLLA 1F9AA 2BMFA 2Q8QA 2R8ZA 1SULA 4OQ4A 5IJZA 4LYFA 1UPUA 2NX2A 3HDQA 1UODA 2G5TA 1Z0IA 3PUZA 4HBZA 4QUIA 3UHPA 3ZQKA 1UBKS 1BMQA 1K8ZB 5HTKA 1KC3A 3OX3A 2DHEA 1WBJB 3JQQA 2W9XA 5KJCA 3U44A 5HIAA 1GPNA 4WEQA 3VUEA 2F3PA 2Q5HA 4C7MA 2R6JA 4CM8B 2I4IA 5I7FA 3STYA 2G7ZA 1BO6A 1Q0UA 2D0IA 1JR2A 1M6HA 1BYUA 1KVRA 2Q4EA 1LW6E 3PUKA 1VCHA 5ALRA 2PTGA 3QENA 3OIGA 3U81A 1PSDA 1R6AA 1CY1A 1XF1A 1U7DA 4HH0A 4B7ZA 5KNDA 3ICQB 4UDYX 1AXEA 1AU9A 1ZH8A 4IQ8A 3GLFB 3WYFA 2WWRA 4HD8A 3IVAA 1ZOIA 3D7LA 3JQAB 4ZOBA 5DIZA 2FW6A 1IXSB 4ITVA 3KVRA 4IVPA 4QYXA 1JLLA 4UUQA 1V11A 4K9QA 5F73A 4AY3A 3KETA 4Y9UA 1U0JA 1NM5A 2ABWA 1TIKA 2GHRA 2MYNA 1GQSA 1DIOB 4HXYA 4NENB 1UAGA 4US1R 2I33A 3B38A 4LYHA 4A4DA 5K20A 2XNCA 3V2UA 3SNHA 4AZWA 1I0IA 2QRMA 4MV3A 5BSHA 4J1SA 3CR3C 5CT9A 4P7GA 3KPYA 2YOHA 2CE7A 3FAKA 4JNCA 4AKGA 3H8SA 5ELMA 3IO5A 4TZTA 5HOQA 2P90A 2JRLA 4M9XA 4OV6B 2OOSA 3PYMA 1ZIXA 1JEQA 2CNNA 2IS6A 2V3WA 2ZZKA 2X4DA 3U9TA 4GI7A 3UHAA 1SUIA 4S1TA 1FFWA 1MH9A 1ZJZA 1Y0BA 2W00A 3K8ZA 3LCRA 1ICIA 1Y4DE 2HUNA 3K5PA 3EA0A 3JQFC 3B36A 1MB0A 3G2MA 1ECGA 1JIUA 5K8TA 4BKPA 3MS4A 1TX4B 4ENVA 2VDMB 4IAOA 4RHYA 4TWBA 1QTNA 3JYPA 4LF4B 1M3SA 5CH5A 4MB2A 5BRAA 2NN3C 3SYTA 2YR0A 1K6MA 1LWNA 1XZJA 3EIOA 5K8JB 2J9ZB 1BE6A 2NTJA 3WK6A 1JA1A 3K0CC 4KDCA 3AVPA 4HH1A 1WZEA 2ZATA 3AR9A 4M1EA 2H2FA 2QV0A 5JS1A 4UHDA 4BY9E 1DAOA 1Y1PA 4LZZA 3H2YA 4WBXC 1D1SA 2P40A 5AM1A 4EFKA 4GQAA 3FETA 3ZI0A 3UK2A 2PX0A 4MJ7A 4N82A 3S40A 4IKPA 4QU5A 2DUUA 2YWCA 4MYTA 4LV5B 3TRDA 4CCSA 4ZICA 1HDRA 2ZYWX 3DVSX 5GZ1A 2BEUB 2FW1A 1JQ5A 4LXQA 1EVJA 4CKCB 4F3NA 4H1WA 7YASA 4WOJA 2A30A 4TV9B 2Y71A 2WG0A 4HDSB 1XN4A 5FI0B 1Y4UA 4KAXA 3HXQA 1BDBA 4W99A 4XUDA 4ZXFA 3LW8A 4XRGA 1CTQA 4RNDB 1XTKA 2X8WA 3OSZA 2OPHA 1KFBB 3KL4A 3ZH9B 4BTVA 4OOEA 1LPAB 3IBCA 1M34B 4XR9A 1O08A 2OFFA 1L7PA 1OWLA 5HVNA 1QO7A 3JZFA 5E4YA 3FHLA 3UMFA 1X14A 4JDPA 4RHFA 4Z6KA 5D00A 1NJSA 1UFQA 2OBXA 3DVLA 4RK7A 5HBRA 4CV2A 4KRGA 4JI4B 4DIDA 4F86A 3B2NA 1GG9A 4DR2B 2JGJA 1Q74A 3GGPA 5IVDA 1QK4A 1N1GA 1W5TA 3A6HA 1KK0A 3N76A 4OQFA 2JGDA 1W4BA 1C29B 1QMGA 1TM4E 3F8TA 4NE7A 2OQVA 4YHBA 1QH0A 1WKCA 1E2JA 5DN9A 4HR7A 4KQMA 4IJUA 5KDOA 4CCYB 1K4YA 3DOFA 4LDRA 3WL3A 4YBZA 3HA2A 5CX1A 1V2GA 1PGPA 1LLQA 2HBYA 2Y67A 3R0VA 5BN3A 4OQNA 4X8HA 3WI7A 3KB1A 1U3WA 5FHQA 4U7HA 1SBNE 2FY8A 2C99A 3TMYA 4D3FA 1DFIA 4JUAA 2DY1A 2G1KA 2I4TA 1I32A 1TF5A 3O9MA 3PQ5A 3VZDA 1VXOA 2XEXA 3DEIA 3ESRA 4IFTA 3C39A 4DVJA 4LUCA 3BE8A 4FJ1A 2FHPA 3HJUA 3Q40A 2EJBA 4KAAA 1G20B 1TVMA 2APJA 1BH2A 4LDAA 3P9XA 3OZEA 4MJ3A 4YJ3A 4RC9A 2B82A 4MQ6A 1AH2A 4K9DA 1SXHA 2RGNC 4ALLA 4GZ6A 3WJ2A 1TO6A 1KQOA 2VDWB 1ZXXA 6YASA 4RDIA 4OHYA 1QBGA 3GCGA 3L05A 3HK2A 3C45A 1YCGA 2FQXA 3A9UA 3E7PA 2GCOA 4Q3KA 1QV6A 3R7NA 3RKUA 4H7EA 4HZIA 4N49A 4EZEA 3F0TA 4TWZA 3SHVA 1ZK1A 5EJEA 4OL9A 1PJ2A 5GJBA 2EVWX 1SIOA 1VL6A 1LBIA 5FI3A 5JNSA 1HUQA 3H2ZA 3MVEA 7MHTA 4DWVA 2PANA 3FH0A 1N1EA 4F8JA 1ISGA 1U3UA 2QJWA 4FDLA 4RH0A 3U19A 1PLJA 2AOVA 4O4LF 1F7UA 1X86B 1YNOA 4N5LA 5FBQB 2HFJA 3L8ZA 2XUZA 3P2OA 5EKUA 5K09A 5LQAA 3EULA 3ZBUA 3GLGE 2Q5OA 5JZ9A 3WQQA 3SJZA 4M98A 2MHCA 1DAIA 1VIYA 2PYIA 1OUMA 4UEKA 3SFTA 3TCXB 1CF9A 3PIRA 1P9LA 5BYJA 5KTPA 4GVLA 2DETA 1YQUA 4CTMA 1D2GA 2FPPA 3DLHA 3EZYA 3LPMA 4B4WA 2WAAA 1BMDA 4ARBA 3I76A 1YFKA 1ZR4A 3CIFA 4DUYB 3FVTA 4ZARA 3ULKA 4KVAA 2HCBA 2PKYX 1Y6GA 3Q10A 3KKOA 3KYJB 1JAYA 4LNUA 4F46A 2BKXA 4FYVA 3TTTA 5IZCC 5J4VA 1ULAA 5IAEA 3F5FA 1KEZA 1S96A 2VH1A 1IU9A 1GKLA 2EEZA 3L2OB 1E9RA 1MG5A 2YX1A 5AK4A 2BEWA 3QI7A 1BVRA 5CDTA 2Y1FA 3IBFA 1NVVQ 1T0UA 2OZVA 4RPKA 4XLTA 1TUIA 2B9VA 5KHAA 2NTNA 2QGFA 2VRBA 3BAFA 1QGUA 4DIBA 5TIIA 4GICA 5DBOA 4JJ8A 2AOXA 4M22A 3BMNB 2GK3A 2WFLB 1AGNA 5DLQC 4BGIA 2QBYB 3I30X 1EFCA 1R9JA 2B7BA 3A32A 2JIDA 3MEQA 4G01B 1IOWA 4YEDA 5FOSA 2RGGA 4RFLA 3UY4A 4EVQA 3DAHA 1D2AA 3LFUA 1NBMA 1Q50A 5FL7A 2ZT6A 1HDGO 3TWOA 5KOJB 1XMPA 4F45A 2BFOA 4GKBA 2MSLA 4YRAA 2V7UA 3O47A 3UMCA 3OPYI 4PZAA 1DJQA 3NTUA 3AP1A 1AG9A 4MSUA 2FUG6 2P0YA 4PHCA 1SXJE 5KYUB 4DR1B 3ZVMA 1GGKA 2M6LA 1QE3A 2EFYA 4KH1A 2IWHA 2JCYA 1KAOA 1ZU4A 5TR9A 1O9GA 3DEKA 1JNYA 1OX4B 1ZGJA 1QR2A 3B1KA 1F06A 1GGEA 2I87A 3BGDA 2VWGA 3GFFA 3MUFA 3IRUA 1T2DA 4HGNA 1TTHA 2VZ8A 2YFYA 4R0MA 1ETHA 1SCAA 1WW2A 2WJ6A 2WUWE 4MR7B 2QZPA 3W5UA 2UU9B 4GL2A 2ZRLA 5IZ4A 5AXAA 4AJ1A 2EQ5A 5LJIA 1D1QA 1ZZEA 3NHSA 3R3VA 4BO4A 3QOWA 2AFIB 1EWTA 3EZFA 3IUEA 1LFAA 3TCKA 4HWKA 5FV7A 1MO5A 1EJ2A 4D74A 2XT9A 2IP1A 2CVQA 3Q8WA 4J4BA 4L4RA 3S1AB 2KLHA 3DTNA 4NF2A 3CX4A 2IBMA 3O3CA 3K70C 4BBAA 4F4FA 1Z0DA 5D5HA 3MLAA 4HEHA 4QARA 5BN5B 3VNAA 4U9IS 1YKSA 4WIAA 2J7PA 4JVNA 5B3JC 3C5EA 4AY6A 1H3EA 2GK4A 2QTZA 4NONA 4NFHA 2VTBB 1OAKA 1XMIA 1FP2A 1NATA 4WXRA 1ENPA 3GU3A 3NDJA 4V0LA 4DA8A 4PS1A 1UKYA 3N8NA 1R6TA 3I9LA 1A9PA 4Q7MB 3T12A 1QC5A 1C3JA 4UOQA 3OO0A 2ZJOA 1EFUA 3GOHA 2CNKA 4RLHA 2JFHA 3RDPA 2MDTA 2IEYA 3CKKA 4J0DA 1HTTA 5C9ZA 3UMBA 3DW1X 2O7RA 2BZGA 3DVAA 4EA8A 1OFUA 1BFDA 2PL3A 3T3IA 2VF8A 3L4BC 2Q5EA 1CIVA 2PX4A 3G7UA 3ZWKA 3OUZA 1WHSB 2NZUG 1YZLA 2Y05A 1QLWA 1B73A 4X91A 3RAGA 4KDEA 3GP8A 3DOIA 1TA0A 1X19A 4XWGA 4RTNA 3ZE8A 3BA1A 2I2WA 2OBNA 3B9QA 1TEZA 4IZ6A 1XOIA 1EUCA 2ODAA 1NAHA 4PLWA 1KYYA 4X8LA 3F49S 2IHUA 4QBFA 3AB7A 1ZH6A 2ZWMA 2WM8A 3U80A 1G59A 4HNVA 1T2AA 2R7KA 2XGJA 4Y6QA 1F5NA 5J1TB 2H3EA 2C2GA 4LWOA 1QIEA 3CO5A 1Z0SA 4ZO7A 3VPDA 4YR9A 2WD7A 3IE1A 5CAEB 2DBQA 1WV1A 2ZRGA 3QHPA 2NV0A 1RS0A 4WESA 1CUGA 5IABA 4IDOA 4AP9A 2Z2KA 9ABPA 3QEOA 1IWOA 3OQHA 2YIJA 4YO7A 2C2HA 1YU9A 3BS4A 3LC7O 5ITVA 3PNYA 2PX2A 1YUBA 2O0MA 1Z4NA 4ZQFA 5MFZA 3TG8A 2H1OA 5LZ7A 4GWKA 3H1EA 1JG1A 4B33A 1E4YA 1Q1BA 4EVRA 2G72A 1U0OC 2GRUA 3R0IA 4HUQA 1VGVA 1Z25A 4KN5A 5EKDA 1CLEA 3JWGA 3OFSA 1TUEA 2KJQA 5F3RA 3KZXA 4REQA 3D2AA 3G2KA 5LP1A 4IQGA 4M7WA 5FULA 4MW4A 2XYRA 4C0HA 1JS1X 1ZVQA 1LBTA 1RJDA 3Q7RA 1S7CA 4DG8A 1USGA 3LHSA 1XMVA 3ZJYA 2BKAA 4YJHA 1L1QA 3R3YA 4RL4A 5C8YA 1E6MA 1S3SA 1X74A 4OBBA 3KQKA 1JFTA 4G56A 4KXQA 4U7WA 2DKFA 4KR7A 2QF7A 2XNDA 1GUBA 4F1WA