4F38A

Crystal structure of geranylgeranylated rhoa in complex with rhogdi in its active gppnhp-bound form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/chaperone
total genus 56
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f38A00
4LJ4A 1ZC4A 2ZVPX 2GXQA 1KO8A 2CLDX 1PUIA 4DLSA 4YMTA 1OT3A 1JAIA 1S2MA 3AVOA 1NVXQ 1A7JA 1CRQA 1VMAA 2AFHE 4FW9A 4YDSA 2W58A 1SVSA 3QSYA 3CRRA 1ZM9A 5TARA 1G7TA 2P6NA 2ZPTX 1PZNA 2F3TA 4XH9B 4DDWA 3A8TA 2ZJ5A 1YZUA 2C9YA 3I3SR 2OEPA 1E0JA 2NZ8A 2IF0A 2ZVQX 5JI3E 4YMWA 4A2QA 3RVBA 4PQYA 4BWYA 1QHHB 4HB4A 1EFTA 5DN6D 1OE0A 5HPYB 4XTRA 1NMZA 1ZBDA 5FPKA 5BN3A 3SU8A 1YZNA 2VSXA 3T06B 4YMVA 3W6OA 2BVNA 2AX4A 1JEDA 3THYB 3U3KA 2A30A 2FNAA 3PJRA 3BK7A 1RW4A 4I1VA 2WSSD 4DCNA 1MO6A 3LY5A 3OAAD 4L8GA 4NE2A 4GP7A 3RHFA 1I4TD 1YQTA 4B76A 2IEYA 3N2IA 3FHOA 4OQNA 4W5JA 1GKYA 4RZ3A 4G01B 3W3ZB 1X1RA 1L4UA 5FL7D 1HURA 3CX8A 2A5DA 1E9BA 4YMUA 2HT6A 1VHTA 2A5FA 2JASA 3AVTA 3CNNA 5EXXA 5P21A 4ZI2A 3WHLA 4QFMA 3OESA 4B2PA 2V7QA 3QKSB 1RJ9A 1AA9A 1NSTA 1OIWA 3QVUA 4O25A 4Y0AA 1OB5A 2JJ1A 3RSLA 1QHIA 2WWHA 4MDFA 3L8YA 4F4IA 3B13B 1CIPA 3HP1A 3KKQA 3WP0A 3ZZ0A 1KDPA 4CW7A 4OK6A 2HYIC 3X1YA 3JVVA 4PHGA 2QL6A 3FB4A 1ZMXA 2JLVA 1WP9A 2EQBA 2QENA 2RHMA 3ADDA 2ZE5A 1W49A 2QAGA 4AYXA 3RS3A 1SHKA 3CWZA 4JJKA 2OT3B 2ORIA 3K0FA 4CZ2A 2A3RA 5GADl 4IFEA 3BE4A 4FI3C 2ZE8A 2CLCX 2Z43A 2YYZA 5H1YA 3O47A 4TL7A 1YZGA 1II0A 1J8YF 1ZNZA 4Q7LA 4ARZB 2WIAA 4XVRA 4ACAA 2XZOA 2ZETA 4KODA 4H1VA 3KTAB 4AK9A 4PPQA 3B6EA 3EPKA 3IBGA 2AKYA 2A5JA 1UBFA 1VIYA 2ORWA 2FSIA 4N0DA 3TSZA 3PITA 2ZI7A 2QPOA 3LDAA 4MKIA 1ZRHA 5TXGA 2QGZA 3U60B 2QBYA 1CF4A 4V0OA 3QOFA 2FFHA 1JJVA 4C0BA 3QXHA 2I1QA 1VTKA 2Q9AA 2YOGA 3D31A 1T5LA 3AVUA 3FFBA 4LDJA 3TVDA 2G88A 1KNXA 1MOZA 3V00A 1Q3HA 4B3CA 2QM8A 5DYGA 3RNLA 1IBRA 1XD8A 3BIFA 3MJHA 4Q1AA 621PA 3QIAA 2YKGA 1XJCA 5BW8A 3PEYA 3WHKA 1KK2A 1Q3TA 3I5XA 1ZNWA 3WBKA 2FWRA 4LSGA 1XU4A 2IUSA 3TUJC 2F7SA 1E69A 2ZRLA 4QBIA 3K09C 1C1YA 2YWGA 1FP6A 3K09A 3QBVA 3WBJA 4PZYA 2XX3A 5KNBA 2O8FA 1ZCAA 4C3ZA 1DAFA 3GJ4A 5TMPA 3WNBA 1AGPA 4QNMA 3SNHA 1BYIA 4URWR 4C0SA 1UBGA 2ZU0C 4WOPA 2ZREA 4HATA 1IHUA 1NI3A 1VCIA 2VF8A 2ASEA 3LRPA 2RGCA 4U5XA 5A0FA 2ODEA 2R6CA 3VR1A 1CP2A 1RC8A 1YR6A 2CK3A 1U0HC 4BEJA 2CVFA 1CR2A 1GVNB 3FHCB 1TL7C 2OSBA 2EFDB 3FHTA 2RGEA 3IO5A 3W34A 4WXRA 1XEWX 4LC0A 4DRZA 2BMEA 1W4AA 1W0JD 1TU3A 5EQTA 4LV5B 2ZTSA 1Q44A 5SZIA 3VHXA 1KNQA 1PJRA 1H8HA 2FZLA 4DKXA 2QN6A 2OCYC 1S4QA 1XBTA 4KLZA 1UM8A 2QU8A 1ESMA 1T3SA 2QAJA 2REXB 1R8SA 3VTKA 1HEIA 1XCMA 5CLQA 2OESA 1RRCA 1QF9A 2IYYA 4LPSA 4EUNA 2RAPA 1KDRA 4RD3A 4MGYR 1AN0A 4US1R 1LB1B 4HYYA 3AP2A 3KQLA 1KJYA 2H57A 3EC2A 1X8JA 2GJAA 2J46A 4CGZA 1IQPA 1S0UA 3CPHA 2ZEJA 4RY2A 4BRWA 3QG1A 2ZUBA 2SHKA 2ZJYA 4LX0A 1DADA 3RLFA 1JQJC 4IKEA 1AKEA 2HYDA 4TLEA 5H8WA 4URZR 4M9XA 2FZ4A 3A1TA 2B21A 2ZJZA 1UAAA 1P2TA 2X2FA 1E79A 3GCGA 2FMXA 3K53A 4HUQB 1G9XA 5GJCA 3U3MA 5HCIA 3A4MA 1LV7A 4F4CA 1SQ5A 1CR0A 2IXGA 1U8YA 3LXXA 3R7WA 1HE8B 4Z1MD 3NBYC 5DSZA 1S9DA 3OF5A 2XXAA 2W6IA 5J4VA 3W6NA 3B78A 3SR0A 2WKRA 2GBLC 4LBWA 2GBLA 1N6NA 1Q1ZA 3LX8A 1JALA 3EARA 4A6XA 2HF9A 3PUWA 3GFPA 1G8FA 1ETUA 2ZSDA 1Z28A 3RS0A 1FPMA 3V4FA 2YJTD 4A8JA 1AQUA 2WWFA 2Q6TA 2GEUA 1KI3A 4U02A 3IGFA 5G53C 2IHYA 1VPLA 1GKIA 1GITA 4HDOB 4LOAA 2DYKA 4QHYA 2ANCA 3IILA 4JKYA 2PBRA 4QJ4A 4QJ5A 2PMDA 5SZKB 2ODWA 5CB8A 3QI2A 1M34E 3WYFA 4NYIR 1MABB 2JDIA 3ND8A 3Q5DA 1DS6A 4YC7A 2IEZA 3B2EA 1WXQA 3DM5A 4FMCB 4LC1A 4Q01A 2WSSA 5SZJA 3ZIAA 1Z0DA 4V0MA 4GNKA 3A58B 4I1OA 2ZR7A 2QT1A 4KI0A 2NO1A 4B3XA 2C78A 2ZRFA 1Z5ZA 1E2KA 3AVXA 1Q1BA 2YINC 2IT1A 2IHBA 3NHAA 4M1YA 3KJEA 2ZI4A 5IK2D 2BBOA 1F2TA 4EJSC 5AUOB 4TL8A 4EJSA 3EIEA 1HY3A 3HU2A 1W36D 4OI0A 3THXA 1IN4A 4Q4LA 5JJKA 3ZD7A 4URXR 4ZO4A 2VYFA 2GXAA 4PQRA 3QPWA 4D81A 3W8NA 1NP6A 3W9YA 5HZKA 1W44A 1XTSA 1FOEB 2B7CA 4QGFA 3OFND 2Q3HA 1P2UA 2WMOB 5JJLA 1EWQA 2UZIR 4URVR 2IYSA 2PMKA 3KJIA 3J81k 2WJHA 5EXTA 2FSFA 1IN6A 2V55B 4ZCMA 5UKDA 4CRWB 1DAEA 1P5ZB 1GG2A 5KDLA 1WB9A 2IA5A 4MYCA 1QRAA 3ZQJA 3NIBA 1WBBA 4Q1CA 3QF4A 3W5JA 3UATA 1OXUA 4WA7A 4YLGA 1Z08A 2YC2C 5AJWA 1TQ6A 3BORA 2IUUA 1N6PA 1OKKD 3THOA 3RS4A 1M7GA 4Q9HA 1JR3A 3MWYW 1N6RA 1R5BA 2J7PA 5AUNB 4IVQA 3SC3A 5JS8A 3AP1A 4GFDA 4BGDA 4BPBA 4FMBB 3LQRA 1I2MA 2PT7A 4PR0A 4G5GA 1N5LA 4P33A 2GETA 5CK5A 1DO2A 2BBTA 2HT1A 4AWXA 3PQCA 4B35A 1VIAA 3KZ1E 2J0UA 2X2EA 3D6TB 3N2EA 2WKPA 3IIKA 4KJZA 4RFVA 5KPJA 3UKDA 2W0MA 4E03A 4EPWA 3U4QB 3NBXX 1UKYA 2AXPA 4TN1A 1TEXA 4W9MC 3U7FB 2PX0A 2WJYA 2VHUA 4Q4AB 2D7CA 3SJBA 1T91A 1D2MA 1VCNA 2G77B 1GZSA 3TR5A 1OH6A 1E2QA 3F3YA 5HCNA 3S1AB 4EPVA 3IIMA 3DL0A 4GZMA 5CLLA 2ZRMA 5BXQC 4S35A 4TL6A 5JEEA 2FU5C 2CDNA 121PA 4UXIA 2CL0X 4AYTA 3QJYA 4RD2A 4G5OA 2BC9A 4F93B 4N3NA 2GJ8A 2FPKA 3CF0A 4JLOA 3UMRA 1X8KA 3RS7A 3U44B 5FPSA 3ZZTA 5DI9A 3KB1A 4OI4A 4DDVA 5BN4A 1R7RA 1KI6B 4NYMR 3SYKA 1PLLA 4PFSA 1YHNA 1CJTC 3LH5A 4DHEA 1U0LA 3OEHA 1S1CA 3AF3A 5E7IA 4EIWA 1NN5A 3GLFB 2V1UA 1VG1A 1BO6A 2NPFA 3CNLA 3VR5A 3TNFA 2VHTA 5KHOC 3HYTA 4J0QA 5L3SB 1QHHA 3EASA 4WW0A 2KJQA 1ZM3A 5CM8B 3T12A 2OHFA 4B3BA 1DAKA 2O0KA 4G1UC 5G3ZA 3P4YA 4GRAA 1OFUX 4CYMA 4QHSA 1L4YA 3O8BA 1RYHA 1E98A 3DOFA 3QKRB 5LBIA 1L7VC 1N5IA 2QROA 4BZXA 3TUZC 2ZSFA 1N0UA 1K6MA 1BMFD 4F7WA 3K0AA 1QHGA 3TGPA 3GLFE 1VECA 4I1SA 4CEIA 4KU4A 2QM7A 4IDOA 3THWA 4M1TA 4PAQA 4A0FA 2O8BB 1M74A 2I3BA 4UNRA 2F1HA 3TSWA 2F1IA 3I72A 2GRJA 3TVTA 1X3SA 1J8MF 2IS2A 1BS1A 3UK6A 2HEIA 4ZDWA 2A78A 4LRWA 5JEDA 4LY6A 3FGNA 3W6PA 3VU9A 1GRNA 1F48A 4Z1MA 1SGWA 4UJ5A 5FTJA 3W8RA 1D9ZA 1S3SA 2QPTA 3PCRB 1SVWA 3IQXA 1KI9A 3Q8XB 1YVDA 2IXEA 3U61B 4DVGA 4IXMA 1IY2A 5FI0B 3B8HA 1E2EA 3QG5A 3L82B 5KNCA 2DHRA 2E9SA 3KKMA 3I32A 2PLFA 3GJ5A 5CITA 3NXSA 4XVQA 2ZE6A 1Q20A 3NC1C 3NTUA 4A15A 1P9NA 2VLIA 2GK6A 4GMDA 1OXSC 4FINA 2EFEB 1FQJA 3EZ7A 2V7QD 2RGNA 2ERYA 2WJJA 3AF1A 4AI6A 4ARZA 4DSUA 2JJ1D 1NY6A 4GDFA 3BWDD 3KQHA 4NKRA 4C7OB 2Z4SA 4QBGB 3KTAA 4TYPA 5KSOA 1ZM2A 2ZS9A 2C96A 4MKHA 4EPTA 2O0HA 4TT3D 4LHYA 4QBFA 1D8TA 4DLUA 1N6HA 1US8B 2JLZA 3FWYA 2J0VA 5JJIA 2GJ9A 2JLRA 4MRSA 3KKNA 2FJUA 3OIYA 4MYUA 5LB4A 1XF9A 5JBQA 2FF7A 1X6VA 3A1SA 3R8FA 4PO1A 2JJ2A 4DSOA 1WMSA 4WXPA 3SYNA 3K70B 5IK2A 2XB2A 1G3QA 3HPQA 1SVIA 3U3OA 3MRSA 3E5HA 3EC1A 1W36C 2OLKA 3ZYCA 4DC9A 2A2ZA 1K5GA 3TUIC 4II7A 1NY5A 3ECCA 2P6RA 4A0RA 4A9AA 1DE0A 3KX2A 5K8IA 2V54A 4HUTA 1EFRD 1LFDB 4Z54A 3CLVA 3IEVA 3R20A 4V0LA 3QUSA 4DZZA 2GHIA 4LBYA 1W0KD 3OFNA 5EZ5A 1CJUC 2D62A 2GJKA 5DYIA 3VFDA 3AGQA 1G6HA 3ZS8A 4NBSA 5LPNA 2ZRJA 3BC1A 1XEFA 2FV8A 2H1LA 3EPJA 3LVRE 4KO8A 3AVQA 2DFNA 4DLVA 3TW8B 4DB2A 4OHXA 1Z0KA 3ICEA 4LV6A 5FUYA 1QZXA 2WWYA 1YZQA 4JVNA 3C15C 4XIGS 1E94E 2NO7A 1DOAA 4D0GA 2ZR0A 3ZLJA 1P60A 3H1TA 5JI2E 2REBA 2BOVA 2ZRHA 2OCAA 2W00A 2WJVA 1KZGB 3SBEA 1XNJA 4KFUA 2ZRGA 2GKSA 2V8OA 3CWQA 4TLBA 4FN5A 4BFSA 2ATXA 2PJZA 3VR3A 1II8A 3ADBA 1NLYA 3F8TA 4C0HA 1E4VA 4A4DA 2CK3D 1OH5A 1G8GA 1N6KA 1ZW6A 5B58C 1KK0A 3E70C 2FFBA 1EX7A 4O2RA 4BZQA 1R6BX 4NYJQ 3GLIB 3SQXA 3T1VA 1S96A 2XGJA 1G17A 3X1XA 5JCPA 2VIIA 2EU8A 1H8HD 2FG5A 2G1KA 4KAXA 2YHSA 3SYLA 2GF0A 4AIIA 2IS4A 4MH0R 5C18A 5FPYA 1AZSC 1FFHA 1ZD8A 1CR4A 1P61B 1JAHA 5FI1B 3OIUA 2Z83A 3FTQA 1E9CA 3LBHA 1KMQA 1AK2A 4KFSA 1XMVA 2FN4A 3TQCA 1DARA 1OB2A 1A1VA 4I99A 3CPEA 5G40A 2IX3A 1JJ7A 2P65A 3LO5A 4LBVA 4U00A 3H84A 2XAUA 1TEVA 1KKMA 1FW6A 2DWPA 3RWMB 1U9IC 4JKIA 4BFXA 2KBEA 4PHFA 1IXZA 1D6JA 1KAGA 2ZRBA 2JATA 2CCJA 1XXHB 2IYUA 3CX6A 3EW9A 1LTQA 2VP9A 4PAOA 4CIDA 4BZPA 1E79D 2GCPA 3FDIA 3CRMA 3K0EA 3C16C 4Q7MB 2R44A 1ZC3A 1LY1A 3RRZA 5BYJA 1TADA 2BBSA 2W0SA 1ODFA 2W6ID 1FX0A 1OPXA 1Z0JA 2CE7A 4QM6A 1KO5A 1MABA 2D7DA 4MKGA 1P9RA 1XXHE 5EE1A 1BMFA 3W5IA 3QVVA 4K8OA 3N70A 1JR6A 3NBFA 1NN3A 1N0WA 2ZQ5A 3L8ZA 1SKQA 4KLNA 4RFSB 3TIFA 5CYOA 5D3QA 1QG4A 2VP0A 1G3IA 3KUDA 3IUYA 4QHTA 2LKCA 1MH1A 1Z0IA 3L43A 4UNQA 1W1WA 3W3AA 1UADA 1PVOA 1G3UA 1GRQA 4Z8YA 3C5HA 4RD1A 2WAXA 1C4OA 3EXAA 5FBQB 1F5NA 4Q7JB 2QQ0A 2OAP1 1XZQA 2JDID 2ZU6A 3X2SA 5E95A 3ZIAD 4EDHA 2IW3A 2LWIA 3LXRA 5KSPA 1R0WA 2J45A 3SJZA 1VG9B 1G16A 3CX7A 2NGRA 3CRW1 4TLDA 2VP6A 5C1BA 2H17A 2HXSA 3ZDQA 3B82A 4E09A 1NKSA 1CKEA 5J4HA 4ZKEA 1WA5A 2W6JA 1TNDA 4TMZA 1HQYE 2C95A 4DSTA 5EE5B 3B9PA 1NJGA 1G41A 4HZUB 5HE8A 5JRJA 2AXNA 1NVVQ 1T0JB 1RKBA 4C4PA 4C30A 1IY1A 3FOZA 3KB2A 3L2OB 3TQFA 2NO0A 4URYR 1TTTA 2J87A 4TT3A 1VG0B 2QUZA 1IN5A 2IK8A 4US2R 4IEEA 4JMPA 1AS2A 2PCJA 3CW2A 4G5QA 2QAGC 4HI0E 5F9HA 1DBSA 2OV2A 2ZITA 1E2DA 2EWVA 2N1BA 4WBSA 4B33A 4UNNA 3F0TA 3F5FA 3LAWA 5SZHB 2GVDC 2O5VA 1GL9B 4X8MA 4H9GA 4Q4AA 1ZIPA 2Q3MA 5CDFE 2QP3A 1N6IA 4MRVA 4EAQA 3P20A 1G20E 2F3RA 3S1AA 1N0VC 1Z47A 4L5BA 2PLRA 1JR3D 3I8SA 1EFHA 1EFRA 2J7PD 4QOSA 2IL1A 1Z2AA 3DDCA 2CHQA 3DVLA 5DO9A 3UIEA 3VMFA 1W0KA 3LX5A 5KUTA 4JYBA 3CBQA 3TKLA 3MAAC 5LD2C 1ZNXA 1UKEA 3DHWC 3DO6A 5AR1A 2CXXA 1JI0A 2NO9A 2WBLC 4JLDA 4Q02A 3T1OA 2WWWA 4A2PA 3FVQA 2QSYA 4AC9A 1KI6A 1SKYB 4EFMA 1PV4A 2JLXA 2HUPA 1TPZA 4URUR 3QXSA 1AIPA 1U99A 1Z6AA 2WWGA 1TAGA 3GLFA 1ZIOA 2FGKA 4OHWA 4A92A 2D3WA 2GNOA 2R6GA 1RRFA 3OIVA 2UKDA 1WRBA 2V9PA 5L3SA 2B92A 2DR3A 1I4LD 4ILEA 2CHVA 4Q9LA 1A5TA 3FYHA 3SQWA 4PZZA 3A1UA 5GJBA 4L9WA 4QXAA 1XMJA 3ZJYA 1YE8A 1ZUHA 2ZRIA 4OQMA 4XSHA 1SKYE 1UJ2A 3D3QA 3QKRA 3GJ6A 4TMKA 3WXMA 4Q7KA 2AN9A 3FE2A 1M7BA 1U2RA 3KQKA 2XOKD 1T8TA 4LHWA 1UKZA 4TLCA 1FUKA 2C03A 4MRPA 4DCTA 1JQLB 4GOKA 3DMNA 2X19A 2TMKA 3OEHD 2YWHA 1SULA 2ZAOA 2PJRA 2G3YA 3I4LA 4RCYA 1P2SA 3EG5A 2VH5R 2O8BA 3CF6R 4L15A 5FOSA 1DAIA 4G3XA 1GNQA 3QXJA 4GMXA 4IJMA 1OIVA 4LK2A 4Q1FA 4QG7A 5FUXA 4Q1DA 2C8VA 1E96A 1ZM4A 2WMNB 4TSFA 5FBRB 4D4LA 3B1XA 4PSVA 4LJAA 5CJPA 2R6AA 5HR5A 4LJ7A 3U7EB 1S8FA 4BLQA 3D7MA 3B1WA 1G7RA 4A2WA 1OW3B 1XFAA 4LHZA 4B6EA 4B73A 4KYIB 4RJLA 4NZYA 5JCZA 1W47A 1Z6TA 2F1RA 3AB3A 2QMUA 3CF2A 2ZANA 4QRHA 3RWOA 1KI8A 3AUXA 1HA3A 4IDQA 4YQFA 3KQUA 2NIPA 2BCJQ 3EPHA 1AJEA 3MD0A 4IVPA 2G1JA 3BRWD 2O8DA 5JHGB 3TRFA 4OQFA 2BEKA 3LV8A 5L3VA 2Q3FA 2WZQA 1GWNA 1NBME 5EE9A 1XTKA 4N1AA 4NCJA 3T15A 4BRUA 4Q21A 3NEJA 4KSBA 4M1SA 2JLUA 2DB3A 2LKDA 4IFBA 1E2HA 4X8HA 4HLDA 4PHHA 3KJHA 3NG1A 2J1LA 3PEUA 2QE7A 4NU0A 5IT5A 2GVZC 1NMYA 1M8PA 3IO3A 4YMSA 1ESNA 2QGNA 2VSOA 5GJWC 2OILA 2J0QA 1XEXB 4M0LA 4Q9IA 5G3YA 2GCOB 3B1VA 3M6AA 1GRRA 2W83A 4LJYA 2XITA 1JPNA 5L3QA 1US8A 4DWJA 2NQ2C 4CDGA 4HDQB 5A5GA 2N46A 3V4RA 1FP7A 5C4GB 1BYUA 5EP3A 2JIZD 1P72A 2IYTA 4P4TA 3HR8A 4A8JC 3E2IA 1VYTA 1VKJA 3I61A 4ON9A 5LB2A 4EFLA 4B3FX 2FEOA 1NL3A 4M9ZA 2ZRKA 3MCAA 5A4JA 4WZBE 2W2TA 1QHNA 3RDPA 4LYAA 4OQXA 4OHZA 1ZP6A 3KXIA 1GNPA 3L0SA 3H2YA 2EYQA 1KY3A 1YRAA 4M21A 2FSHA 1OH7A 1UPTA 2ZYWX 2D2FA 3OE7A 1N3BA 2CBZA 2CL7X 4DLRA 1L2TA 1UEIA 3BB4A 4CEJB 2Z6VA 4MKFA 1HT1E 3BH7A 2OFXA 2RGAA 2J0SA 1XZPA 1HTWA 1YU9A 1BH2A 2ZE7A 2XJ9A 3DM9B 1YR7A 2IWRA 1KYIA 2JJ2D 3PUYA 4HB0A 1QHYA 5CYPA 4OYHA 3CM0A 4G0NA 3Q85A 4D4JA 4EPXA 1G5TA 1KTVA 3AKDA 1JEEA 4FXPA 3HDTA 1KI7A 2BJWA 1E2JA 4R2HA 2OLJA 2ODNA 2GDJA 3EZ2A 2KWIA 2ZRPA 4FCVA 4IDPA 4Q4HB 1KJWA 3SHFA 4LUCA 1MRNA 4O2LA 5JSZA 2JA1A 2IYLD 3ONWA 4D2IA 2OZEA 4Q66C 5FFMA 2OCBA 3ZVRA 3LBIA 3CIOA 5J40A 3B9QA 2RGBA 2X77A 1T8UA 1F6BA 2BHRA 1U98A 1R0YA 2E87A 4TQ9A 5H70A 2E1RA 4OKSA 3U7HB 1J7KA 3WYAA 1OXTA 4Q9KA 4ACBA 2AHOA 4A1FA 5AUQA 4LYHA 5JECA 1F3OA 4IVRA 5E7MA 3RABA 5FH9A 3TW4A 2VA8A 2FOLA 5KSZA 4B3GA 3Q72A 1XX6A 1MRSA 2R9VA 3BGWA 3QPUA 4GSYA 4PANA 5F98A 2WVJA 4UXHA 2EFHB 2O8EB 1DVRA 3QKUA 4TYWA 4DDTA 3WMGA 5IRCD 1MKYA 3UMFA 2NG1A 3B1YA 3KFXA 1OXXK 4HLUA 1G5RA 1UEJA 3Q7PA 1RRGA 4DCUA 3TJZA 3FKSD 3QEJA 4JS0A 4NYIQ 2QA5A 2QSZA 5FUVA 1KMHB 3PG5A 5FUWA 3I1FA 2FA9A 1YZKA 1KSJA 4M1OA 2AK2A 1JB1A 2ZSBA 4JBWA 1ZUNB 1EG7A 1EXMA 1T3LA 1CJKC 1Y63A 2ECKA 2MMCA 3OZXA 1NG9A 3FPAA 4B3DA 2BKUA 3C5CA 3O8DA 2QT0A 1T0HB 4TL9A 2QMOA 1X86B 3ZZUA 1A82A 1CLUA 3LNCA 2YVUA 4LCBA 4QM7A 4F91B 5B64A 1S1MA 2DWOA 4DLTA 3ZVNA 3VR4A 2REOA 4DIDA 4ZI3A 5K8LA 4D82A 2ZAMA 2HJGA 4LHXA 5JS7A 1TF2A 2VTKA 4YDHB 2JLSA 2OG2A 1XMSA 1HE1C 3IHWA 1Z2CA 4PZLA 3NVAA 1KKLA 5CB6A 3DOEA 3NHBA 5KTYA 1R4AA 3K0FB 5KSYA 3UANA 4ITRC 3GEEA 2ZS8A 3TAUA 2BWJA 5FTKA 1IONA 1NLFA 1GP2A 3AUYA 1OJLA 3VR2A 4EPRA 2GZHA 3B7GA 1G3RA 2H7VA 4DLZA 4RZUA 1TU4A 4TWZA 2WJIA 1HH4A 1SXJB 5DISB 4MQBA 2PL3A 2XOKA 1BIFA 4NP6A 3QF7A 1XCGB 2J9RA 3ZD6A 3LLUA 1DG3A 2Q9CA 1U94A 4IOJA 4HAVA 1XTQA 2Y8EA 4RFSA 3ASYA 1CU1A 2QBYB 2RCNA 1K8RA 5IHPA 2OBLA 4TMTA 5EP1A 2GZDA 4JLAA 5ELXA 2ZROA 3VNVA 1P62B 2FPLA 3WY9A 2NZJA 5FTLA 3KL4A 2C5LA 4CT4B 1C9KA 2AL7A 1SXJE 1W5SA 3GJXC 3M1IA 4EQ6B 3R9IA 4E07A 2PZGA 3K0CC 2ZJ8A 3THYA 3K0CA 2PT5A 2GZAA 3H4MA 1OXVA 4N0EA 3FKQA 2J41A 3GFTA 4LV8B 3B60A 1E9DA 1OFHA 3KKPA 4Q48A 1KHTA 2FSGA 4IOKA 4NPHA 5JRZA 1OSNA 3EIQA 2C9CA 2AR7A 3BERA 4ZDKA 2VP2A 4HLCA 1E2FA 2FGJA 4O0MA 4ZDJA 1E1QA 2QZ4A 2ZXUA 3CPJB 3K9GA 3RC3A 4LJ8A 3RRYA 1XTIA 4JLPA 2WM9B 4DSNA 2BDTA 4HZUA 3NC0C 5KDOA 1D2NA 1XD9A 1V43A 3QKSA 4A82A 1KO4A 3MLEA 1E2IA 1QHSA 4TTPA 2IYRA 2BJVA 1KO7A 1X1SA 2RHDA 4EKDA 4HAZA 1DEKA 1AS3A 2P6UA 4UKDA 3GJ3A 3DZDA 1OV4A 3MFYA 3CB4A 1COWA 4ERNA 2CMKA 1W2HA 4OQLA 4R2IA 2JLQA 3TBKA 2RH5A 2ONJA 3U5ZB 4BFYA 2QMEA 3Q9LA 4PXAA 1ZU4A 5IDVA 2GJSA 2W6JD 2JIZA 2HLDD 2IYXA 4NYMQ 4Q03A 2XJ4A 4ZPXA 2AD5A 4WAUA 1X8LA 1KSHA 3GMTA 2RGNC 3OIWA 4OBEA 3LWNA 4V0KA 1I4DD 2NO6A 5AWFC 3SN6A 1NNEA 3X1ZA 1Q12A 4B2IA 1W46A 4OK5A 2G83A 5DHFA 3NH6A 4D25A 3R8CA 5TV2A 1E2PA 4EPYA 2XNDA 1KIMA 1TX4B 2IUTA 1CXZA 1J2JA 2DBYA 2DPXA 3A4NA 2ZJBA 4M9SA 3AEZA 4B75A 3G5UA 4Y0VA 2RGDA 1QVAA 1N2CE 3QBTA 1D5CA 2IS1A 2DFTA 4B6FA 1WE2A 3ETLA 4NCKA 4HLQB 4JIMA 3R7WB 2JLYA 1E4YA 2KI5A 3WYGA 1G64A 1OFTA 2XTMA 1LS1A 2BM1A 4PSKA 4HB3A 3EZ6A 3MGCA 3X1WA 4XJXA 1FNMA 3ADKA 3ZH9B 3CZPA 4C0JA 5AJYA 1P2VA 1Z63A 4R71A 4DB4A 1P4SA 2PEYA 5TY0A 3FMFA 5F9FA 4TMWA 4RKFA 1B23P 1XWIA 4RD4A 5FOWA 2YWEA 5KPDA 3IPXA 3G0HA 1G291 4MUBA 1MO5A 3T1TA 1E2NA 1GDDA 1U81A 4NCHA 1AQYA 1Z6GA 4ESHA 1UBCA 1G21E 3IBYA 1W4BA 3PVSA 1SXJD 1GSIA 3ZVMA 4IHQA 2OO7A 2AFIE 1EFCA 4YXWA 3DKVA 4OHYA 3CH4B 1CS4C 2I4IA 2C9OA 4ASUA 4KFTA 2H8KA 2NMVA 2JAQA 3M4YA 4B32A 1P7CA 1WF3A 4KBFA 2RGGA 3REGA 1Z6XA 2FFAA 2IYWA 1G4AE 4JLBA 3AVPA 2B6HA 5DHAA 2C2HA 2PH1A 3IHLA 1XEWY 1NBMA 3FKSA 1HV8A 1XMIA 3HU1A 5JWRA 1OYYA 4L16A 1F2TB 1E9EA 2AK3A 2OFOA 1ZD1A 5J4YA 3VQTA 4C2UA 1E9FA 1BOFA 3KDSE 3TH5A 3WMEA 1P75A 3C7KA 3THXB 2IWHA 1AM4D 2P2LA 4OI1A 4GI7A 3E1SA 3SHWA 3NDBB 2EYUA 4V0ME 5EP2A 3FFAA 1LW7A 2BM0A 2R2AA 1J90A 4U7DA 3REFA 5KNDA 4AKHA 2FX3A 2N42A 4TSFD 2O52A 2DCUA 2ZSEA 4D0NA 1LVGA 1R5NA 5TDHA 2DFLA 1GL6A 1G8HA 2KSQA 4RSGA 2P5SA 4HUQA 3UG6A 1ZNYA 4ZCLA 2IF2A 3JVUA 2W2VA 4XWKA 1KZ7B 1V5WA 1IY0A 1PUJA 5JLJA 2F55A 3I62A 1GNRA 2IYVA 3GLIE 3TK1A 1RIFA 2GCOA 3NH9A 4UJ3A 1TQ4A 3IKJA 4NTZA 3EZFA 4M9QA 4LYJA 2Z5FA 3U2QA 2C77A 1GAJA 4DCSA 1EWRA 2CLSA 3QF4B 4MUAA 4LHVA 2XSZA 4HDCA 4PPGA 1QBKC 5EP4A 5AJXA 4IEIA 2V6JA 1R8QA 4I1UA 3P27A 4Q00A 1RVDA 1NLZA 2Z4RA 2EVWX 3K9LA 3MWKA 4MYHA 4S2EA 3VX3A 4B48A 4F92B 2QNRA 3ZQ6A 4CEHB 2R8RA 3CO5A 4C9BA 4Q5IA 2QE7D 3HPRA 4NDZA 3WRXC 2RGXA 3Q7QA 4KYUA 1TMKA 1RYFA 3SDZA 4RVCA 3IEUA 1ELOA 4QGGA 1DAMA 4JLVA 4M53A 3GLGB 2J0UB 3O8CA 3GJ7A 3QENA 3VKWA 4MGZR 5FR2A 4QC2A 3A6PC 2VSFA 4PPFA 4A36A 4DIEA 4CEJA 4F4JA 4JZKA 2WPDD 2BMJA 1U8AA 1D9XA 1NVVR 3T34A 4GL2A 1Q57A 2QI9C 4LGMA 4XWAA 5L3RA 2V1XA 3EAQA 1JECA 1CTQA 2BMFA 3RYTC 3U6BA 4E5UA 5BWMA 3K70D 3C4JA 3UMSA 4BE7B 2ZI3A 2ZM5A 4PX9A 4JT4A 3GLGE 3CRQA 4M4SA 2ZRCA 2GA8A 2IC5A 1II9A 1NIJA 1Q22A 4TMXA 4MGIR 1XD2B 2QP4A 4Q4HA 1E3MA 4TYYA 1IJEA 2CEAA 2DY1A 2QY9A 3LQQA 5EE3A 1OFIA 4PC3A 3OE7D 2CCKA 4IOMA 5DNYB 2CL6X 2CHGA 2JCSA 3DMDA 2OFWA 2MSEB 1DAHA 5DGXA 5FTMA 4AKIA 1AGRA 2D2EA 1M2OB 1YZLA 3EA5A 3RANA 2FFQA 3GD7A 1BKDR 2NOAA 3IDQA 3LD9A 1E9RA 4TZ0A 4IRUB 3K1JA 4C0KA 2GXUA 3AF4A 4X8OA 1TF5A 2GESA 2HLDA 1XPOA 1R2QA 5K8UA 4P4SB 3TLXA 1QDEA 3Q5EA 1ZCBA 4RZ2A 1VDZA 1Y3AA 1CBUA 1ZYUA 1SVMA 2BCGY 3HU3A 5BYKA 2BMDA 4R9UC 1E0AA 2O8EA 1G1MA 3K0AB 2D06A 1G8PA 3RRNA 4JSYA 5FBLB 4CEIB 1CEEA 2GWHA 3THWB 4Q4JB 2G0NA 2ZYTX 3H86A 3QEOA 3T5DA 2F43B 3U3RA 3RC8A 4KBGA 1FTSA 2IYQA 2P3SA 4BFVA 2XZLA 2O0JA 1L8QA 1W48A 2PZEA 5DI3B 521PA 2DWQA 1KMHA 4NMMA 1U90A 4PQFA 4F38A 2BKEA 3AKEA 1R10A 3AKYA 4JSTA 5AJZA 2ZI5A 2QEQA 2F9MA 5HKKA 2XTNA 1KI4A 1JPJA 4P0TA 3VU9B 1OH8A 1DO0A 3DPUA 2CNWA 3VNUA 5J47A 1NSFA 3U4QA 2WHXA 4JL8A 5JWHA 4X8LA 2BEJA 3VR6A 4B74A 1MO4A 3OHMA 5HE9A 1LS6A 3BS4A 2GAAA 1GFIA 4K46A 1KOFA 1CR1A 3UWOA 4FMDB 4JT2A 1EX6A 2AWNA 1KDOA 5EXPA 2KBFA 4L9SA 4M22A 1EK0A 1ZVQA 1AS0A 4NCIA 1T6NA 1F2UB 4FWTA 1I2DA 2JGNA 2VP5A 4TQAA 1IAQA 3SFVA 4GP6A 1EGAA 1Z0FA 1OLOA 4IDHA 5FPHA 3U44A 2ZYUX 4DLWA 1SXJC 3B5JA 4GOXA 3M0EA 1SXJA 3OEEA 4JLJA 3I5YA 4Z8XA 4P32A 4AYWA 4PC1A 1DPFA 2V3CC 2IS6A 4HAYA 1W4RA 1UBEA 4JYCA 4AG6A 2PX3A 1U8ZA 3HWSA 4ZCIA 3U6KA 2L0XA 1OIXA 3QY0A 5EE0A 3QPVA 4UQOA 4Q18A 4FD2A 2YOFA 3R9XA 1VCOA 4CT5A 4LYFA 4QGAA 2ZYVX 3AV0B 4QNRA 5C4MA 4EQ6A 2WICA 4TTRA 5IF9A 3A1WA 2YWFA 5BQ5A 4AKGA 3KQNA 2CJWB 1E9SA 1W36B 3PUVA 3RSOA 2A7QA 1LNZA 4XOIA 5KOYA 3EIHA 2OBMA 1E0KA 3TAHA 3GJ0A 4ZIRB 3P26A 2JLWA 2AD1A 3EPLA 1E9AA 1D2EA 4JBXA 4P31A 2JJ8A 4XSGA 2QTVB 1RPZA 1N25A 1HUQA 3BXZA 1KK3A 3TR0A 4AG5A 1S3GA 2ZI9A 5D3MB 3LW8A 2C99A 4DT1B 3AQ4A 5AJVB 2R6FA 1H65A 1W5TA 1YR8A 4Q9JA 4YONB 2GEVA 3P4XA 4D80A 3L0IB 4I81A 5DE3A 4GT1A 2WTUA 4GOJA 2B8TA 2VP4A 4PAMA 2FH5B 2QMHA 2ZJAA 1W2GA 3KKOA 1E1RA 1OHHA 5EUMA 4DUGA 5JFGA 1KSFX 1XRJA 3NEYA 4Q1EA 2H18A 2QTHA 1M7HA 1YZTA 2CE2X 1GIAA 3HYRA 2EFCB 2GTPA 5B30A 1E1QD 4JLNA 2KB0A 2A9KA 4DLXA 5GJVC 3VX4A 3UPUA 2QRZA 3PENA 5C46F 4BFTA 3PFIA 2OCPA 4PC2A 1FTNA 1SHZA 1G8YA 1QG2A 3GLHB 2O8CB 2QORA 3ICQB 1VG8A 1II8B 1Z22A 1IM2A 1AKYA 1IOZA 1T5IA 2HJVA 1NF3A 3B1ZA 4C7OA 2JEOA 1H8ED 1GKUB 3GEIA 3LLMA 4JVMA 4DLYA 3WNDA 4NCNA 4V03A 1UFQA 2CCGA 2XTZA 3U7GA 1COWD 2HDNB 3ASZA 2VBCA 4UNPA 3JZMA 2WPDA 1G19A 3GLHE 2H92A 4D4MA 2V6IA 5DIFA 1ZUIA 2EW1A 5C2JB 3KXKA 4FMDF 4TLAA 4FWIB 4V0NA 1VYUA 2RKOA 3PEVA 3AF2A 3A36A 2BV3A 2UVQA 5HTKA 4B71A 4TYQA 3AH8A 2FPMA 4H1UA 3K70C 3IPYA 1G6OA 1KAOA 4KHZA 2BIFA 2RB4A 3AGPA 1GTVA 4UXJA 6Q21A 2XEXA 4BFWA 2HF8A 3SBDA 4ZDIA 1J99A 5JWOA 5FL3A 3VHLB 4QKQA 1PLJA 1RE0A 2XB4A 1T4GA 2C04A 2XNDD 3CRVA 4MRNA 2IBMA 3BJIC 3TE6A 4DCVA 1A4RA 1N6OA 3KXLA 3I8XA 4KV9A 4WVFA 5DH9A 5CIWA 5E7JA 3T5GA 1GOTA 1JNYA 2F9LA 3UWKA 1CJMA 1XTRA 1VYVA 3U3JA 5DN6A 5GVSA 3CZQA 5HZHA 1IXRC 1DTSA 1T9HA 2ZRDA 3FMPB 4LJ6A 2GF9A 3MMPA 1SVLA 4MITA 3WP1B 5KYKA 1KI2A 3L0PA 1ONBA 1FX0B 2QQEA 3PUZA 1HYQA 2D4HA 2W2XA 3BD9A 4C2TA 4IOLA 1IN7A 4MDEA 3OAAA 1FUUA 3LA6A 3W90A 3KFVA 2G0TA 2J59A 3PR1A 4QL3A 4R7ZA 4G5RA 2FDCA 3EA0A 3DEFA 3BOSA 1IN8A 4HSEA 1U0JA 3LVQE 4A0HA 5FL7A 4OHVA 1RZ3A 1Q1QA 4LWZA 2XZPA 4KVAA 4NL4H 1KK1A 3TMKA 4QJ3A 5L8VA 3IQWA 3BH6A 4YXWD 2ZRAA 4ASUD 3PXGA 1B0UA 3NBZC 3C14C 1TUIA 3GQBA 4GZLA 3GLIA 1R0ZA 3I73A 3X1DA 4KCGA 1XCPA 3GFOA 1IXSB 2QG6A 4JJZA 2P67A 2PZFA 4PSAA 1FQKA 1NJFA 5ANRB 4HLUC 1XB2A 1A2BA 3CKLA 3A37A 4IDNA 4PPNA 1NBMD 2GEDA 5B57C 4XTCS 3C41J 2LCFA 3EWAA 1Z83A 1E0SA 1IJFA 4XWOA 3QKTA 1NKTA 4B44A 1SZPA 4ZV4A 1KSGA 1R5OA 3QXXA 4KSCA 1J70A 1LF0A 3MG9A 5FOTA 1RJ9B 1N6LA 1UDXA 1LF5A 2P0EA 421PA 3TSOA 2QP9X 3VAAA 4W5HA 4BUJA 3WRYC 3SJAA 2ORVA 2WWIA 3T61A 3QXCA 3RS2A 3SE0A 3FMIA 721PA 1DAGA 3AVWA 1FNNA 1XXHA 4NONA 4GPTA 3BAFA 2WOOA 2GAOA 1NVUQ 5FR1A 4CEHA 2QAGB 4DEXA 3CONA 3LFUA 4ESVA 4Q1BA 3PUXA 4XD7D 4QBHA 3PIRA 3PV0A 5K8TA 4D0LB 3KJGA 4WZ6A 4C0QC 3GLGA 4ABYA 5CM9C 5AUPB 1NG1A 3BH0A 1N5KA 2ZJ2A 1NN1A 3GEHA 1P6XA 3I92A 1MT0A 2XNSA 2XSZD 2ZR9A 3G82C 1Z06A 4P3YA 4TYNA 1ANKA 1GILA 1RFLA 2HV8A 3BFXA 1FZQA 2CVHA 2WWXA 4TTQA 5FOUA 1S9HA 3H0KA 3AVYA 3C8UA 4BLPA 3CNOA 2OXCA 3MWJA 1GM5A 3CH5A 5JZVA 1MV5A 1TQ2A 4M1WA 2WIBA 1E2MA 3AKCA 1OF1A 1XD2A 3Q3JB 3BFVA 1E2LA 5LD2B 1W7AA 2ZUDA 2ZIAA 4BLTA 1G4UR 4TQUS 1EESA 2OE2A 2VEDA 1NIPA 2AKAB 1PLKA 5M04A 2QPAA 5EJEA 1K5DA 3WMFA 4A6PA 4FMCF 1P3JA 3AM1A 2ZSAA 5JMTA 2VHJA 2YV5A 1W0JA 1G7SA 2D74A 1ZJ6A 4OI2A 1P73A 4JVLA 2O8FB 4RCZA 1GUAA 3B85A 2EWWA 4RKEA 2P5TB 4US0R 4MYTA 2HCJB 4DDUA 3VKGA 1HT2E 3K8YA 5CIQA 1Z29A 4P4SA 2ONKA 3D8BA 4BLOA 3BB3A 3RS5A 1CJVC 2I1VB 1XDBA 3R9WA 1KY2A 1NN0A 4BQSA 1W4CA 1JXOA 4WIAA 3SOPA 3WNCA 4D6PA 4D4KA 2G6BA 1XJ0A 2R65A 3GPLA 5TVKA 4MGKR 4QGHA 1SVKA 2C98A 2GILA 4Q4JA 4EFNA 1H8EA 2ANBA 1Q1EA 4IW3B 3ADCA 2F43A 3UG7A 3GJ8A 4KFRA 4RD0A 5KU1A 5E4FA 5DI3A 5FOVA 221PA 5DLQC 5CDFA 2VF7A 2X8AA 5JHHB 1DELA 2IXFA 2EFGA 1Z3IX 3MUFA 1YRBA 1XTJA 1FMJA 2WJGA 2ATVA 2ZJOA 4DJTA 4MA4A 2RMKA 1Z07A 1Z0AA 3QNUA 4TZ6A 2F1JA 4LBZA 4FCTA 4AD8A 2OXRA 2G9NA 3ZVLA 2A5GA 3N5CA 1VHLA 4C0AC 3HR7A 5GVRA 3SJCA 1CULC 3NWJA 4UNSA 2IYZA 4E22A 2WKQA 4BLRA 2MMGA 3K0SA 3MJRA 3L0OA 3V9PA 3SEAA 2VL7A 4OL0A 3P32A 4LZZA 1M1YE 2FEMA 3CR7A 4HZIA 4OJQA 2O8DB 1KO1A 2H16A 2VQSA 1GL7A 5FBVB 1ZU5A 1XPUA 2WAYA 4FCWA 4PO8A 1F2UA 1WQ1R 3NKVA 1ZD9A 3CUEF 5HKKD 4BECA 2MSCB 3MWLA 1TF7A 2HXYA 2VRWA 5FPTA 2PCLA 1O3YA 3AF0A 4JVSB 4JLKA 2OAQ1 4D26A 2CNWD 4PHTA 4R98A 3P1JA 1HQCA 4XVUA 2XXAB 3SZRA 2Q0HA 4HEJA 4NHOA 4CVNA 1EFUA 3BFKA 3HJNA 3AP3A 4DXAA 5L3QB 1E99A 5TB5A 4DEYA 4BASA 1E32A 1DG1G 4W5WA 4PC7A 2GK7A 3BB1A 5EUQB 5F3WB 3RAPR 3SI7A 2YOHA 4CF7A 5J4KA 2OBNA 4GBMA 4A8JB 4I4LA 3QQ5A 4A0GA 4NYJR 2VHQA 3AVVA 1R0XA 4JBYA 2X1VA 4LPKA 1JBKA 2ODBA 5FOXA 2OUKA 1RRPA 3A1VA 2PEZA 5EZ6B 1NVWQ 5F2EA 3EZ9A 3ND9A 4LJ5A 2QRNA 2CJWA 3SS8A 1UDWA 2KE5A 4LI0A 3OEED 2VHCA 4Z51A 4WZAE 4V02A 4PC6A 1XJQA 4G5SA 4B47A 4PTLA 5FBWB 2YNMA 4AKEA 1WCV1 1E2GA 1Z8FA 4ZIRA 1MR3F 2OM2A 4MRRA 1YJ5A 4Q19A 2DFKB 5D3MA 4JL6A 1WBDA 4OJKA 1SVOA 4W7SA 5H68A 1O87A 2FE4A 2Q21A 4JLMA 4DT1A 5G41A 4O3MA 3NDPA 5J5CA 4PO9A 2AWOA 2WV9A 4OK3A 1G18A 2HCBA 1XPRA 4EJSB 2H5EA 3UXMA 4P4UA 1FL9A 1T3HA 3K9HA 1KGDA 1YKSA 3IIJA 2GCNA 5FTNA 5KDDA 5JSZB 1ZINA 2NTYC 2WSMA 3ZGXA 4RD6A 4FIDA 4AURA 1CRPA 1G5PA 1G7CA 3QE0A 4POAA 4BLSA 1Z6YA 1AZTA 2J5XA 1OKKA 2ERXA 5AK0A 3FMOB 1FMLA 4M8NE 1N5JA 4KXFB 2Z0MA 2ZRNA 4AY2A 1QHXA 1WDTA 3RRMA 3O8RA 3GLHA 2J3EA 2O8CA 4BFUA 2BBWA 4HB2A 2R6DA 1P9WA 4IXNA 4RZXA 3LW7A 4B2LA 4M2LA 2WOJA 4XD7A 5EXSA 3T35A 1XEXA 4HAUA 3T1QA 1Q21A 1E1RD 2A5YB 2J7KA 1OHHD 1E6CA 1QVRA 1UKVY 3CR8A 4DUGD 3KUCA 5LDDC 1M6NA 4BEBA 4L4UA 4B34A 4HAWA 4C0LA 1F60A 1XP8A 1ZM7A 2GXSA 3JZAA 821PA 3SFZA 2R62A 5KO2A 3A4LA 4LJ9A 1VCMA 5J4LA 2NPIA 3EX7C 2VPPA 2Q9BA 2B8WA 3MSXA 2ZS7A 1JXMA 4B43A 1NRJB 1KJZA 3PEWA 4NH0A 5BN5A 4ZKDA 2VO1A 3BBPA 1KI1A 2YC4C 4M1MA 1A2KC 2UZ3A 2ZUCA 1NMXA 3GP8A 3LBNA 2F6RA 2QTFA 4K81B 4DBLC 2MSDB 4KVGA 5E3HA 4JL5A 2YZ2A 1OYWA 1ZAKA 1TUEA 2B7BA 3ZS9A 3VKHA 4BFZA 5B2ZA 1U9IA 2ZI6A 1TQDA 1G3MA 1KDTA 4M1KA 3DZ8A 5CJ2A 8OHMA 3K9NA 1JR3E 3DKPA 3EWSA 2K5UA 4HAXA 4TMVA 5CK4A 4Q47A 2V4ZA 1MO3A 1YR9A 1Q0UA 4KITB 1UF9A
chains in the Genus database with same CATH superfamily
1SD1A 4BY9E 1JEQB 2K7FA 1ZC4A 3GRCA 2ZVPX 1WZNA 1C1HA 4YQEA 1JTVA 1KO8A 4E21A 4FUTA 1PUIA 4DLSA 3M4ZA 1BVYF 4L85A 5I9LA 2LVBA 3MTBA 1JAIA 1EAYA 4MVJP 4V0SA 5CLJA 3AVOA 4FWBA 4U6NA 5REQB 1CRQA 1VMAA 2VFAA 1OBOA 1TIKA 4MOWA 1WS6A 4FW9A 1Z6ZA 2MCFA 3K35A 3AW9A 3LBFA 5HG0A 3QSYA 3WBBA 3IQGX 3OI7A 3D8SA 5F3DA 3D1LA 4IEFB 4RNCA 4BU0A 2QW8A 4QPZA 3AEQB 1HC7A 3RJTA 3K6SA 2F3TA 3PXEA 1TC1A 3IL2A 3LPDA 3A8TA 3AI1A 4ZODA 3TSAA 4KQ9A 4DARA 4F56A 4EG0A 1DDIA 1R9JA 3LY9A 1A9QA 2FZWA 3MOGA 4UFNA 2NZ8A 1N78A 3AI7A 3DBRB 3AR5A 1SC4A 3LT2A 1XF1A 5TJHA 4YMWA 1MQSA 1JDBB 1LPSA 4MRMA 4BWYA 1JZSA 4D57A 3LCRA 1MPTA 4EUFA 3QELB 2AQHA 2P69A 4MUJA 1ICIA 2OD9A 3O9ZA 1NMZA 1ZBDA 2HQOA 4MCHA 2NU8A 2YH2A 3HS3A 3VNQA 4Z0TA 2PQ0A 5FPKA 4HGZA 4NEQA 3SU8A 5BN3A 4J7UA 4U6QA 1HDOA 5EZYF 4DIUA 5EWMA 4YMVA 2BVNA 1FYFA 1ODTC 1R88A 2A30A 1SA0A 4X1YA 3BXFA 4A27A 4DCNA 1R8YA 1MO6A 3LQ2A 4EY7A 4NE2A 2ARKA 1DBWA 4BKMA 3NV9A 3AZPA 1RWQA 3O3CA 1VQ1A 2IEYA 3N2IA 4UUPA 4EECA 4W5JA 4MW9A 7YASA 4WCFC 1X9HA 4G01B 5EFZA 1UBUS 4WCFA 1X1RA 2RAVA 2PNFA 3VKHA 1HURA 2QZPA 2FQWA 5FYQA 3ZXIA 4NZMA 3ZCQA 1XVLA 1T24A 1VHTA 1UXHA 1EZ1A 2YQZA 4G1BA 3IKMB 4FQ8A 3CNNA 3MERA 1VMEA 5P21A 4M38A 3WHLA 3L6BA 4QFMA 2Q3JA 3OESA 1CIJA 3VC2A 3QMWA 4B2PA 2HJRA 2V7QA 3QKSB 4MW7A 3E7WA 5BSUA 1IVSA 1RJ9A 1NSTA 1K5HA 3QVUA 3ITDA 1EBBA 1X7WB 3CZ9A 4Q05A 3T4EA 1DB3A 1ZLXA 3RSLA 2PKXA 4JUCA 2EGUA 3FVVA 4TRRA 4CLHA 2PRIA 3B13B 3WP0A 3HP1A 3Q2KA 3GXBA 4IGAA 4PHGA 3PJFA 2QL6A 3CXRA 1Y82A 2E21A 3QEBZ 4W9NC 2EQBA 3O93A 1A9OA 4W9NA 4DY6A 2BFCB 4C3OB 1DC7A 1QM5A 2C2ZA 2QAGA 2RIRA 3ON5A 4AYXA 1SC1A 5CH3A 1RQNA 3CWZA 1H85A 2BF4A 2OT3B 4JJKA 3OBIA 3LWZA 3RAJA 2YDYA 3KOXA 3RREA 1FLDA 4FI3C 5DK6A 1UXKA 1YZFA 2J33A 3HSKA 3N74A 2C1ZA 5IJ0A 1PVVA 3O47A 1QFZA 3TTWA 1RAFA 3PTZA 2WIAA 4OYLA 4C4AA 3NBAA 2UV8A 4G4SP 4H1VA 4PPQA 1EM6A 2PQ2A 5TF4A 1XYVA 4LG1A 4MP8A 4XDGA 3EPKA 1VIYA 4HJRA 1TT5A 3CG4A 1VKZA 2I7DA 2XR1A 3PPXA 4D99A 1QC5B 1PFGA 2DF8A 1KEVA 2D1SA 2G04A 3PITA 4IDDA 4RDIA 1MDFA 1CF4A 1YA6A 2X6QA 1LFAA 3IAS1 3MZ0A 1L7XA 2GM9A 3C6ZA 3QU4A 4OCZA 1JJVA 3DBHA 3DO8A 4C22A 5B7QA 2I1QA 2R8XA 2Q9AA 4K6MA 1B2LA 3E9QA 5U4QA 3AVUA 4LDJA 1KNXA 1WVIA 4RZQA 1Q3HA 1XG5A 4NBTA 2QM8A 5DYGA 1IBRA 3BIFA 3MJHA 4C7BA 2GA9A 2AEEA 3IXMA 4LHEA 2HHHB 3T9FA 4U7HA 4FX5A 1YR2A 3VO8A 1H94A 2Q8QA 4YUYA 2FLWA 4B48A 2HY7A 2AYXA 2Q5FA 4LXIA 4Q3BA 2OQ2A 4RM2A 3ZBUA 3ZBTA 2QAIA 3ZW8A 3IKTA 1W94A 2TSYB 4UW9A 3SDSA 3QX3A 2F7SA 1GCIA 1V25A 1U1GA 2ZB4A 2HIHA 1XUOA 2ZRLA 4QULA 2YWGA 3ONEA 4ZYTA 1YL5A 4UTNA 5FV4A 4C3ZA 1QXSA 3GJ4A 3HL0A 4WK2B 3WNBA 1AGPA 2PS0A 3NJ8A 1FXWF 4CKYA 1FRQA 4WOPA 2ZU0C 2QL5A 3C3JA 4UUAA 4JXZA 1VCIA 2HRRA 4U5XA 2H2AA 2H2FA 4XFDA 2OPBA 1CP2A 3VR1A 1YR6A 5ABPA 2IY9A 4UMFA 2VJPA 1VGQA 5GM1A 3HUFA 1TL7C 1UJCA 4FTWA 2VN8A 2RGEA 3I05A 1IDN1 4D8UA 2HCTA 4WXRA 1WHSA 2JA2A 2O2XA 2BEWB 2BMEA 1AN9A 1W0JD 1TU3A 5EQTA 4JYZA 4DQLA 1C9NA 1Q44A 3BMQA 4TRNA 2P4UA 5IDXA 3O8QA 2HSZA 4NAUA 5WRFA 3L18A 5IS2A 3P96A 4UU8A 3Q7RA 4KO1S 3U1TA 4FC6A 4PPYA 2MU1A 3DF7A 1ZH2A 4DKXA 4U2FA 2QN6A 1WUTA 1UM8A 2I71A 3VTKA 4GKJB 4PGFA 2XMCA 2OESA 1ACLA 2IYYA 4YRSA 1H2YA 1H3NA 2XUPA 3HXLA 5C35A 4XFKA 3Q3CA 1AN0A 1N7HA 1F2DA 3E9MA 4IDAA 3F4BA 4JOSA 3KQLA 2H57A 2ZIUB 1XZJA 5MN4A 4JASB 2P9BA 2GVNA 4YDRA 3TFQA 3CPHA 4IXWA 1H3FA 2PR2A 2ZEJA 4OGWA 1QU3A 3V7WA 2B30A 4W63A 2GS9A 3FG9A 2SHKA 4OBXA 2H54A 1X3LA 4B5LA 5AVTA 1S2NA 1WW2A 5GGYA 5K6AC 1DADA 1DC6A 1JQJC 2ATCA 4QOJA 4AXXA 5K6AA 1P80A 2QX6A 2FZ4A 2B21A 2ZJZA 3DDWA 1Z34A 3UMMA 1CJBA 2X2FA 1E79A 1IEQA 3GCGA 1GGEA 2FMXA 2Q28A 3N2ZB 3U3MA 4ECEA 3WWPA 4C01A 3KJZA 2AA3A 1SQ5A 1CR0A 3LZ6A 3MFQA 3ZE2B 4KNYA 3CVVA 2B1QA 2UUCB 1QGOA 4MZXA 4O2BA 2NNLD 4NZPA 5J4VA 3W6NA 2WWRA 5AHOA 3Q1LA 3A6GA 3SD7A 3F6RA 2O7QA 1H05A 3T3GA 2YV2A 2AFIA 3LX8A 1I3OA 3EARA 1GPKA 1G8FA 3ZHTA 2ZSDA 4BUCA 3TNDA 3JQAD 2YJTD 4A8JA 4EUEA 1W85B 3IE2A 2GSWA 4LOKA 4OFZA 5BOSB 2GEUA 1P39A 2KLHA 1JN0A 2N47A 4RKYA 4EBBA 1PAUA 3C3WA 4CLOA 1ZMTA 3IDAA 3BF8A 5LFAA 1GITA 2FRXA 1UBHS 1FLAA 3D6MA 3I30X 4FFSA 3UWSA 1GSAA 5JTTA 3FN4A 1I7DA 5FCDA 1P81A 2EEZA 2O2CA 4QJ5A 5SZKB 5BNWA 4NMWA 5JO0A 2ODWA 1NYTA 1XT6A 3A6EA 1TA4A 1VMIA 3PHIA 1KFJB 3KT0A 1SUPA 3OT4A 4FE7A 1WMAA 4TXLA 3HNRA 1O6CA 4YC7A 1LBQA 3ZWWA 4LC1A 1WXQA 3C3MA 3LPNA 1PTJC 4K86A 3GC6A 1FRNA 4Q01A 4NATA 3ZIAA 4IS2A 2Q3DA 1OVGA 2ORYA 1JIXA 4MXDA 1KZ1A 4JI8B 2VA9A 2ZR7A 4AZ0B 2C78A 4KO2S 4K9DA 2Z8YA 4MW4A 1CP3A 5DW3A 2HO4A 2D1RA 3RKRA 5TEWA 1Z74A 2YINC 4HBZA 1KIAA 4Y2JA 1L9XA 3I1YA 3SVZA 3KJEA 3EEBA 2ZI4A 2O2JA 1F6WA 3BVPA 3EIOA 3K9CA 2E6UX 3Q3HA 3V8BA 5I5GA 1U9YA 4Y1GA 5AUOB 3JATA 3M6VA 3HZHA 1EXNA 1IQUA 1IN4A 1D7OA 2PZMA 2QXUA 4PO3X 4Q4LA 3TLGB 4AZTA 3THXA 3ZD7A 4GR9A 4S2UA 4J9UE 3MJSA 4P92A 1TZ2A 3JU3A 1XROA 4DDKA 1XTZA 4I5IA 1NDUA 2GXAA 2PG3A 1MA3A 4FGJA 4D81A 1XQ6A 4HNVA 3OX1A 4IIEA 3W9YA 4ZYZA 1B16A 4TXNA 3VYWA 5LA6B 4OHPA 3SS9X 3V97A 1NHGA 3KTFA 4C07A 1Y3IA 2BEVA 2GD2A 4FPXA 1T13A 2SKDA 1TXGA 4YV7A 3MWFA 1CHNA 6LDHA 3KJXA 5K45A 2UZIR 3I5MA 3KJIA 3GL9A 5B1EA 1PS9A 3AK4A 3PTAA 2ZB7A 3J81k 3CNBA 2Z58A 4YPVA 3AM3A 4L72A 3E0XA 2FSFA 2I4LA 3QLJA 4ZCMA 2CF6A 3I1IA 3QNMA 1ODIA 1P5ZB 4GGOA 1GG2A 1YMUA 2GBPA 1C0PA 1XQ9A 5KDLA 3W9UA 3AQIA 4DIMA 4AFNA 2H4ZA 1I5RA 3DVQX 1Z6QA 3EW7A 1W19A 4MV8A 4PZEA 3WDMA 5A3RA 3LQYA 1WBBA 3L1IA 1Y1PA 1WVGA 3K6RA 4FX2A 3R2JA 1Q0LA 5IYZB 2IGBA 2WYIA 5AJWA 3UY4A 1NQXA 3T5AA 4OQZA 1FLVA 5ES4B 3OEYA 4NHEA 2IUUA 1ILEA 3C3XA 3DTVD 3THOA 3F8SA 4OFBA 4YTEA 1M7GA 3RS4A 2JLCA 2ZFUA 1JILA 1RTTA 5ETJA 4MGHA 4WVLA 3PQ7A 1NE7A 3WLHA 2PVPA 4BVHA 2JVIA 2ZGVA 3S2GA 1Z2NX 1FW6A 1P77A 2A94A 2PT7A 5JO9A 1RM5A 4DJJA 2EQ5A 2GO7A 2R79A 3KOMA 2PMCA 3ZWYA 3UF0A 3ZHYA 2Z04A 1SRQA 2Q5LA 3GBSA 3PQCA 4MW5A 5CUQA 3QTBA 2QV0A 3TLJA 3TMAA 1OQAA 3B9RA 3F90A 4KJZA 2X2EA 5A9SA 3H7AA 1Y81A 1Z56C 1SY7A 3LLCA 1DAPA 5DNDA 1XTVA 2H51A 3C8DA 1ECPA 3KAKA 2DC1A 4Z3KA 3QK7A 3TB6A 1TEXA 1XV5A 2V03A 5IFKA 3U7FB 2WJYA 2VHUA 2D7CA 1B74A 3ABQB 3L6UA 1NJSA 2G77B 1OH6A 1E2QA 3WADA 4F8EA 3OMWA 3IDZA 5JQGF 4J0CA 3RT1A 4TL6A 3R7NA 2W98A 5JEEA 5JSQA 2C9DA 4ZWNA 121PA 1DEOA 3UEOA 4BO9A 2E4ZA 3ICPA 3HEMA 2OV4A 1B93A 2VJDA 4J29A 5L4NA 5IKOA 1GAEO 2F90A 3IR6A 4F93B 3GDFA 4N3NA 1ZCZA 3F6SA 1BWQA 1DBRA 1JQKA 6CHYA 3U44B 2A0KA 1PGQA 1TUGA 3A11A 4WN9A 1MXFA 3ZZTA 4CQLB 4DBZA 4EHFA 1A2OA 2L17A 3LC0A 1VDMA 1NVKA 1R7RA 2CLOB 2G76A 3BULA 3PPYA 3TLYA 4D9NA 3TQQA 4KGXA 1PLLA 3KQYA 1YHNA 5AM0A 1BDBA 1CDEA 3AF3A 4LW8A 2WT9A 3LSYA 3LUKA 1C8LA 3NDJA 2QVGA 5L9AA 1JWBB 4MVJG 3PFGA 3CNLA 5KHOC 1PL7A 5KNDH 4J0QA 2H31A 3BIXA 5KAPA 1T4BA 1AY0A 1GT91 2OUIA 2KJQA 1ZM3A 4ROTA 1X7DA 2ZULA 3E9CA 3KT3A 3T12A 3PC8C 3MYRA 1UJNA 3EB9A 3ZI4A 3D2AA 3IPRA 3H5VA 1DAKA 2O0KA 3CO0S 4P93A 5COQA 4MWSA 5G3ZA 3P4YA 1AU9A 4CYMA 3M3PA 2I7XA 1DAOA 1R64A 2K7ZA 4DBVO 4LOLA 5K09A 3QKRB 1RYHA 3TUZC 4I1IA 1X15A 3COPA 1VSBA 3JPYA 1N0UA 1W2WB 1H2FA 1K6MA 4KUHA 1SRRA 2C8JA 3K0AA 4C76A 1VECA 2FEWB 2NTNA 2J9FA 1OWMA 1PFVA 5EWJA 3RBAA 1HFJA 4DEVA 2ORED 4H1WA 3OWXA 3THWA 3N86A 1BJTA 2ASVA 3RI3A 5C9ZA 2Z2IA 3JRWA 1A0OA 1P7YA 1M74A 2MJLA 3P5BA 1QGUA 3DE2X 1A50B 1Z39A 2BHLA 2F1HA 3TSWA 4QFDA 3UT5A 3I72A 4JBNA 1WX1A 3NAQA 3UT6A 4AW9A 3UK6A 5IPFA 1EP1B 2HEIA 2FTKE 4O4IA 4DTIA 1GD1O 4ZDWA 2G9RA 3C1TA 4CG1A 3JQQA 5HKAA 2PO5A 2OTCA 3GZNA 4EYOA 3VU9A 4R40A 1CUXA 4I9GA 1DKPA 4ALKA 4PY2A 2H7XA 2G5CA 1S3SA 4D8VA 4EP1A 2YMMA 1SVWA 2QW1A 3PNVA 2ZUWA 3IQXA 4YN3A 1YD7A 1YVDA 1YIOA 2IXEA 5THQA 4MVJD 3U61B 3WIOA 2D1FA 1KKUA 3CKKA 5FI0B 4A5SA 4EEZA 5EIEA 3BXGA 3CW9A 2IEGA 3WMXA 5ILOA 3CPSA 4B4UA 1QKJA 4FU0A 1IUNA 5KU7A 1UIRA 1IWPB 1Y3BE 2W4QA 3EQZA 3GJ5A 3NM5A 2EGHA 3B2NA 3JCZA 5SV2A 3TCNA 5KVAA 1KYXA 3TCXB 4D45A 3EXG2 2VLIA 1GL3A 2HKIA 3DLTA 2FOIA 3FFWA 1NUPA 1EFVB 2V7QD 5JXIA 1CUDA 2ERYA 1E1DA 3AF1A 2ESRA 5SICE 3VC3A 4PZAA 1TLFA 3ZEAA 5FAKA 1XDWA 4GDFA 4LHSA 2JB9A 4P80A 3Q5GA 3TZKA 5T4FA 4PLGA 3EEOA 3W5UA 2LDBA 1TEZA 1W73A 1D8TA 4N65A 3GRVA 2HCFA 1U3WA 1BWPA 1NOKA 3OZUA 1T5BA 2JLRA 2XVYA 3DAFA 4MR8A 5DXAA 1UAYA 5KYUA 3LT1A 5C81A 4KXVA 2NT4A 1T9GR 4J0HA 1KEEA 2VNHA 4L3WA 5BMVF 5I48A 5HILA 3GCZA 4WXPA 1EWVA 4RDXA 3W5VA 4MDYA 5IK2A 5MGBA 3IAM1 4N7MA 2FN8A 3P71T 4FFRA 4REOA 2H85A 4M6WB 4WACA 1V1RB 4NQZA 4AAYA 4KNVA 3QBDA 4LMAA 5EIFA 1E3WA 2A2ZA 3ZYCA 4DC9A 3U0VA 1JQDA 4YCAA 2NSDA 1RAAA 2YNMC 4IR7A 2AE1A 4A9AA 3G6WA 1TUBB 2HA6A 2JHAA 1DE0A 2D0PB 3GARA 4MJLA 4YRFA 4BCDA 4HUTA 3QVWA 5DNUA 1LFDB 3FDJA 3KUUA 3R20A 1LC3A 2GHRA 4Y6OA 3O83A 3QUSA 5EYPB 5E6SB 2Y77A 4Y2HA 1M2WA 1W0KD 4BNGA 4BO2A 2D62A 4KXLA 1WUIS 3OUZA 5DYIA 2XV1A 4BNZA 3PWSA 4KE6A 3BWCA 2IU0A 2VWQA 1T2CA 2ZRJA 4QLBA 2FV8A 2I1LA 1MTOA 4KWIA 8AT1A 5JAMA 2B35A 4DLVA 1B4DA 3DE4X 5C5CA 2O3UA 3N8HA 1A72A 2HLPA 2NP7A 1XPJA 2BJHA 1HDGO 5A7GA 2VHWA 1NMQA 2WWYA 5BRNA 1Z5OA 4GE3A 1YZQA 1V8ZA 2PUEA 2PJDA 1PD1A 2NO7A 1SBTA 1KTIA 4NCAA 4AF6A 3VHXA 3KZNA 1Q0HA 1DTEA 4MUMA 3PC4A 1BXGA 1U2QA 3O95A 5B3LA 2BOVA 2QRMA 2V74B 3ISVA 3P7MA 3V2GA 5LP6F 5DPMA 1GO2A 1HEYA 2XWQA 5C8VA 1Z4IA 1O5OA 2UVDA 1BMTA 2ZRGA 1QTIA 3CWQA 1XYGA 2AUMA 1J8QA 1PWXA 1YC5A 2JGIA 3EUAA 4FN5A 4NG5A 4XB6B 3EXFB 5CJJA 3BIWA 5HA5A 1QQTA 2YN4A 3SJUA 4CKCB 5JSUA 4W5NA 1SBHA 2PA3A 1OH5A 1K4YA 5B58C 3WLIA 3E70C 1NOJA 1X7YB 4KHPB 4GZ3A 4O2RA 4BZQA 1EP3B 1R6BX 3NEPX 1FNSA 2E6KA 1P31A 1TLLA 3ELYA 2I1WA 2AIRA 1G17A 3E82A 1ILWA 1E3TA 1RP7A 3C6KA 4NV1A 4RSMA 1PZFA 4XGQA 5TT0A 2VIIA 3PGKA 3R4CA 3L5KA 2EU8A 3ROKA 3ZTWA 4PNEA 2G9ZA 3D7KA 1LH0A 4DL9A 2H4JA 3M6UA 2IH2A 1TYAE 3GRKA 4W1SA 1UWLA 3KD3A 2NYAA 1DZ3A 4PLZA 3PGVA 1IHYA 3E9RA 2CF5A 1P61B 4PG4A 1JAHA 3STXA 3ZHXA 1DQRA 5JARA 3FTQA 1OLSA 2Y1XA 5EVJA 2VDLB 3JQ8A 3H18A 2WU3A 2B1GA 3LBHA 1KMQA 3GDGA 1BQEA 2FN4A 3TQCA 2IIVA 4CMKA 4ER0A 1S01A 3CPEA 5G40A 4IFIA 3TR6A 1JJ7A 4LBVA 4U00A 3OO1A 3H84A 5ES3A 2XAUA 2WMDA 4BLUA 5L53A 1KKMA 1UKBA 4E2ZA 4IV5A 3DOOA 3MWDA 5K3AA 1K7YA 2JATA 2CCJA 2IYUA 2OO5C 3EW9A 4IQFA 2V58A 5IJ9B 1BMQA 1J22A 3K0KA 3ITEA 4BZPA 1E79D 5DBIA 1K8XB 1T3TA 2GCPA 5CB4A 1NBAA 3CRMA 3CW8X 4I9HA 2G5TA 5KNLA 3NHJA 4Q7MB 2IIQA 3KEOA 1ZC3A 2XT6A 3UMRA 3EZNA 4AN0A 2ISCA 5B36A 1NQAO 1TADA 3TZEA 1UZNA 1C3OA 3AILA 3TKYA 3ETCA 5I7EA 3Q0IA 3WV4A 1Z0JA 1YZHA 5KQPA 5CXSA 1MABA 5DCUA 1KYYA 4R5MA 3BGSA 1BA2A 3L01A 5A1JA 1GXSA 4MKGA 3U4HA 6NULA 1XVAA 4L7QA 4H0FA 4D4GA 4MB2A 3WAJA 3PDWA 2BKAA 2OFPA 4K8OA 3WLSA 2B83A 3QIVA 4YWHA 3K96A 4YVFA 4F4DA 2H7YA 3PIIA 5IC6A 1XZ8A 4ND8B 2EBWA 5CYOA 3UWPA 4DMLA 4ZV7A 4F8JA 4DNQA 1ZK0A 1L6IA 4XJSA 5B2EA 1JIKA 3DE6X 1I51A 4CL2A 2W70A 5AFSA 3NP7A 1R5JA 3J7AC 1I0IA 1WSAA 1A5ZA 3BWXA 3DWGA 4UNQA 1G3UA 3PPVA 3I28A 5IARA 5TS3A 4Z8YA 3WSWA 1PF7E 3T1HB 2CUTA 1YI8A 2OCXA 2PRYA 1F5NA 5HS6A 4P38A 2BDUA 5LQKA 4Y18A 2YJ5A 3CH7A 4BP1A 4G26A 1OGYA 3NU1A 4GRIA 1Z2DA 3ZIAD 4A5OA 5ESXA 2IW3A 1B8UA 4MWOA 5FFFA 4AJ9A 3D3EA 1T43A 1C7FA 3KVVA 5KSPA 3S1SA 1M33A 4YP9A 3VPCA 4EL5A 1G16A 1W25A 1CQXA 4RJIA 3P9CA 1J49A 2VP6A 5C1BA 3VHQA 5ALWA 2H17A 3LQKA 5T57A 3V7UA 4H6WA 4EWLA 4CU2A 5CPFA 3GROA 5K4AA 2L69A 4ZKEA 2QZSA 2W6JA 2R4TA 1Z38A 4Y6GB 4E13A 3VBEA 3GCDA 3NHMA 4DSTA 1JFVA 4FYVA 4LCEA 1J8FA 3M1AA 1XU9A 5DBHX 2QN7A 5JRJA 5LYJB 4U3JB 1BWSA 2R7LA 3JAKB 2IDMA 2ZKLA 1Z36A 1R00A 3LUDA 2X4DA 1K66A 1GGKA 5CDUA 5G1NA 3GEGA 4ZQHA 3AUJB 3ZY2A 3TQFA 1VL2A 2BKLA 2IHUA 2J3DA 1YZYA 3NZEA 3A1EA 3DXFA 5T6MA 4F6LA 1IPHA 4L28A 4TT3A 1M1NA 2QUZA 1IN5A 1QIFA 4FGKA 1ZI8A 2GYVA 2UVPA 4PYRA 4JMPA 1XNRB 5ESWA 2RONA 1JEOA 2PCJA 2FUEA 3C2QA 3CW2A 3G7NA 1G20B 3ABRB 4WFJA 1DBSA 3BD8A 3FTDA 3I64A 1PEAA 2OV2A 3PFCA 2V7WA 5I4BA 2ES4A 2O1EA 2VNSA 4H1TA 5BNZA 3FWNA 5LMZA 3OT5A 2LNDA 3QPBA 2DPGA 4OHKA 2N1BA 4TV9B 3SXJA 5LQUA 3ETGA 4YJ3F 1JSXA 4UNNA 3KQWA 3F0TA 3S2UA 3ASUA 2WV7A 1VZ2A 2I67A 5SZHB 4A26A 4X8MA 2YXLA 4H9GA 2BGNA 2VNKA 4RFLA 1Y89A 1PN3A 4Q4AA 2H63A 1ZIPA 4XIYA 2Y4NA 1QRSA 1RQGA 2YMLA 5B4UA 1G20E 2JAWA 5JS1A 2QLLA 1MIOB 3NVDA 3P9IA 1N0VC 4XWTA 3HCEA 2PLRA 2JFVA 2ONCA 3FGZA 2XZDA 3TQOA 3QBJA 5JDIC 3OVMA 1Y6RA 4PYJA 5JDIA 2YN0A 4H7IA 3PEFA 2IL1A 1Z2AA 3DDCA 3S7TA 2CHQA 4JNKA 4HCJA 4Q82A 3UFBA 3MJFA 5DO9A 5L4LA 1JAXA 2LDXA 5KUTA 4JYBA 1ZOOA 6YASA 3CBQA 1ZONA 1OGJA 2VLBA 4HTFA 4ZJYA 1ABEA 3AHGA 5LD2C 1JEJA 1X0XA 2IOFA 1UKEA 5CX1A 3DHWC 3LUPA 4KQIA 3KLNA 3WNQA 4XVHA 2XDQA 4HFNA 4RPKA 4HZGA 2QSYA 1L5SA 3G2HA 4AN1A 4ZZ3A 2YWDA 1MF7A 1P4HA 1Q16A 3G13A 2JLXA 2HUPA 5JXWA 4WBNA 3CVOA 4WOJA 4BWVA 1AIPA 5EHZA 2Z2JA 3VR4D 1TAGA 1I24A 2HMUA 3RWMB 3GLFA 2W11A 4C0XA 1PR6A 3L4EA 4KXYA 1WRBA 2MHCA 1SURA 1AQLA 2OV1A 4N8SA 2GLUA 2DR3A 3K5PA 5JAPA 1T4CB 3OC0A 1Z13A 3K9BA 2BHTA 4FEYA 1U0TA 1HGXA 4JJGA 1DFIA 4L9WA 4PNHA 4QXAA 4Y1FA 1F06A 3VR2D 1Z73A 4OQMA 4WK0B 4XSHA 4ZVTA 3VYSB 1AMUA 1OFUA 1TK3A 2CZGA 5DSXA 3GJ6A 4TMKA 5F5XA 4WBXC 3DFUA 1OAOC 2AN9A 2UZ4A 1U2RA 4G1EB 1OAOA 3VOTA 3JAWB 3DMNA 2TMKA 2MDTA 4L6IA 3ZDYB 1FFXA 3FCYA 2G3YA 3I4LA 4KQMA 4X3CA 2BZ1A 2O8BA 4L15A 5FOSA 5FWNA 3S0JA 4QG7A 3ZE8A 4GMXA 1OIVA 4F5EA 3ZJVA 5KWVA 4BYMA 2QR5A 1GQFA 5ULLA 4PSVA 2HSJA 2R6AA 2P11A 1MC8A 4LJ7A 2D0DA 1IIBA 3CLSD 3DH0A 3S99A 4BLQA 1WV1A 1Q7GA 2JD1A 2P0YA 3B1WA 1QRTA 3ED1A 1DKNA 4A2WA 1MCZA 5BW5A 4LHZA 1KJJA 4B6EA 4CCYB 1EXVA 3LRTA 5JCZA 3WJ2A 1Z6TA 3B38A 1J07A 4C88A 2VYQA 3PFNA 4KN9S 3RWOA 5LLDA 2PLNA 2GBGA 3AUXA 1HA3A 3INYA 4MROA 1CUFA 1NW7A 4YQFA 3KQUA 2H4HA 3Q3EA 3EPHA 1NYRA 1HDZA 4BZZA 3RSCA 3GPCA 3BRWD 1X7XB 4HQLA 5HRCA 4KR7A 3GDOA 1M8FA 2A4KA 3L0DA 3L4BA 3GLQA 1KXZA 3MLBA 4KIFA 4XLZA 1QU2A 2Q4RA 2WZQA 3L1KA 1NBME 4UBKA 2Y1DA 4N1AA 5EE9A 3T15A 1RQRA 2VPZA 2HDOA 4WLEA 1ESEA 5AD1A 4J8PA 3M6MD 2HZBA 4LN1A 4ZEXA 1WNTA 1E2HA 1FVOA 4X8HA 1Z17A 2W8ZA 3CISA 3ZXUB 1VI6A 1G6KA 2GVZC 4A91A 1NUQA 4GWGA 1XZGA 3AR4A 3OJCA 3IO3A 3PX3A 5IT0A 5HP4A 3NXKA 5DB4A 2OILA 3OU7A 3UMCA 1F4LA 4NOKA 1J9EA 1DJLA 1RHUA 1AHNA 2NUBA 5F12A 5L40A 2GCOB 3BGVA 5E4JA 2GMWA 1QFSA 5DLDA 1SJ9A 2QX8A 2FQ1A 2X13A 3WVNA 5BSKA 2W6ZA 1YA4A 4U4AA 3ZK9A 1KBZA 1QAOA 1QP8A 2CXUA 2DP4E 3GRPA 4AS2A 1KU6A 2ZWMA 3TQTA 2VRCD 1NNI1 1L4HA 3QLUC 5GWXA 3RJZA 3QLUA 1NV8A 2OK8A 1PFKA 1G2QA 2X86A 3HR8A 1H6CA 4YLYA 1VYTA 3I61A 1CZRA 2J3LA 3Q6MA 2QX4A 4HK4A 5E0KB 4B3FX 4NFYA 4EFLA 1WLYA 2FEOA 5I9IA 2ZXFA 2WKWA 1JDTA 4M9ZA 4OIMA 3RM3A 1LPMA 2W2TA 3AC0A 3FRIA 3CC8A 4RKWA 1ACMA 3OLWA 5J58A 4YCDA 1ZP6A 1NW3A 3RUDA 7ABPA 1YRAA 3LK6A 1QZZA 4W6QA 9ATCA 2VATA 5DHQA 5I3CA 5F76A 2FSHA 4BV3A 1OH7A 4UOEA 2ADOA 2D2FA 3H6GA 3WFIA 2CBZA 2CL7X 3EXHC 1UEIA 3BB4A 1U8EA 3EXHA 5GZ6A 3OPNA 2VZ8A 1HT1E 2D5LA 3LMKA 4HQFA 1RLOA 4BNDA 4MQ5A 2DHCA 3VPAA 1BH2A 1TFRA 2ZE7A 1PNRA 3CY6A 3ZIUA 1KYIA 4M7RA 4G1FA 4ZT2A 5CYPA 1W88A 2KHZA 1TAUA 3CM0A 4NJOA 4D4JA 4EPXA 1G5TA 3AKDA 1XCJA 1JEEA 1JHDA 5K3BA 1F4VA 1ZKDA 4YFVA 1I3LA 1KJ8A 1WUYA 2KWIA 1U7XA 4GGPA 3I6MA 2O9JA 1N8NA 4LTDA 1R16A 5KJEA 1MRNA 1RDFA 3ONWA 4D2IA 3OD1A 4ISCA 5EJAA 3ZWNA 4AWBA 1K2WA 4DRYA 3LL7A 2I6XA 4QOFA 2I3ZA 1M2HA 3CIOA 3RE1A 5HJ7A 1EZ4A 3KYCA 3QE3A 3HVIA 1UOQA 5H02A 1LBEA 3MGGA 1U98A 2E87A 3OPMA 2FPSA 4IM7A 1RR6A 1LLQA 3IB3A 4YEDA 4UTRA 4ZHQA 2XQGA 2E1RA 2GN9A 1Z45A 2X8LA 4CQJA 2NU8B 1OXTA 4ACBA 4JDUA 2EFYA 5AUQA 5JECA 1R18A 2LD4A 1WB4A 2W6NA 3RABA 3ESBA 3FETA 3URMA 1A8HA 1EM8B 1FJHA 2X8JB 4AZ3A 4K28A 3TW4A 4RXMA 5EWMB 5JBNA 3TIGA 3W5SA 3ANLA 1JIVA 4X1YB 4CIXA 2VDQB 4UXHA 4EG6A 2EFHB 3HB0A 3ENWA 4MUKA 1TT7A 1DVRA 1R8JA 1P4GA 1ATIA 3QKUA 4ZGGA 2H1CA 2EKLA 1PWEA 4YYZA 4TYWA 5IRCD 5EKSA 2A59A 3UMFA 2G36A 4CG0A 1WUJS 1XAJA 4UBMA 4HLUA 3SSNA 3MRTA 4EM6A 3Q7PA 2WG1A 1RRGA 2AW3A 4WCFB 3P0JA 1X0VA 1CUUA 2CNBA 3V33A 3VDXA 5FUVA 2EIHA 1UKCA 4H3SA 4CKEB 4XLTA 1UZLA 1HI9A 2FA9A 1YZKA 2HK9A 2QTTA 3GMSA 3LIIA 1W75A 3A6ZA 3PUJA 1AGNA 1L8AA 1NUUA 2R7KA 3ILXA 3O2SB 4KQCA 4RHFA 1Y63A 3OZXA 3CWCA 1ZW1A 2VDWB 3FPAA 4B3DA 5P8WA 4HDSA 4RA6B 3ROZA 1BGWA 1DXQA 3CSSA 4DG8A 3IOEA 1LA2A 3M6XA 1T0HB 3WRYA 2VP3A 2N9UA 5HW0A 4UQPA 1X86B 3PC2A 2AFHA 3VSAA 5JVDA 2PKRA 2YVUA 1S6YA 3EOBI 4IJWA 4G0PA 4GICA 1CSEE 4MAFA 3RGGA 3ZVNA 3DV0B 4WERA 2REOA 3G0OA 5K8LA 1GLGA 3IMCA 2C20A 3DCJA 4EL0A 1X87A 2Q7OE 4IHKA 3ETDA 5C8YA 1K7EB 1Z2CA 5JROA 1KMNA 3NVAA 1KKLA 4FFMA 4MTCA 3DOEA 5KSYA 3B1KA 3UANA 5JAHA 1QB8A 1U2GA 3Q7EA 1KYWA 4QLOA 1NLFA 4NBUA 1GP2A 2XW6A 1DCFA 3AUYA 4UUMA 1LRLA 1M72A 3B7GA 1EVKA 3KB8A 2W6PA 3BE8A 2R47A 5DISB 3K2EA 1QRDA 4DV3B 1BIFA 2WT8A 4NP6A 3V6LA 2G1UA 3U7JA 2R6JA 1G9TA 3EIFA 1EFAA 2Q9CA 4KVFA 5BNIA 5HF8A 4O4JB 2X5JO 3CFYA 1TCVA 3NEAA 5F7OA 3VU8A 1UP6A 1CU1A 3MINB 4I36A 1TVKA 5IHPA 5BWCA 2Q1XA 4DR4B 1D1PA 2GZDA 3KR0A 5LU8A 1DHTA 4HN2A 4BB5A 2PX4A 2X42A 3HE3A 5T4BA 3REOA 2I87A 5FTLA 4LF7B 1O0CA 4S0XA 3OE5A 3GJXC 5A5FA 2V3VA 2YS7A 5JS6A 3AYXB 4E07A 1OXBB 3MHPA 5C5DA 2TMGA 5FUQA 3QJGA 2PT5A 4PR3A 3VNSA 3UHPA 4C4ZA 3V55A 3TG8A 2AOWA 2WSLA 2DAPA 2JGMA 4GH5A 4WNCA 1JLLB 2IUEA 3SVTA 1T8YA 2F3QA 4LV8B 2JFOA 1OFHA 5IEBA 3KKPA 3B52X 3PX7A 2FSGA 4COOA 4IOKA 2DUJA 3EIQA 3EF0A 2C9CA 2AR7A 5D3ZA 4ZDKA 1DDGA 5A1TA 1SN7A 1YFKA 2PRKA 4O0MA 1CEQA 1EEHA 1E1QA 1T8RA 2RK3A 4TWAA 3T94A 3TQRA 3MELA 1NT2A 1VHQA 2VCEA 1XTIA 1C0LA 4CUKA 1M2VA 2ODQA 2P3OA 2PU7A 4X7PA 3MK31 3VKVA 1BMDA 5E1DA 1VIDA 3DE7X 3IURA 4DCJA 2XBUA 1HT0A 4RMIA 2A9PA 1XD9A 1V43A 3NFRA 1I5OA 1KO4A 1JSCA 3B51X 4RVNA 1C30A 4A82A 5DULA 3KSDO 4JIGA 4PLCA 2PIAA 5EJ8A 2ZIFA 4S12A 4J6FA 3O9MA 3ZE0B 3J7TA 4EKDA 1GUBA 1DEKA 3AERB 5KIAA 2GPNA 3F2VA 3DZFA 1OV4A 4NJMA 4EELA 1FQOA 4RHCA 1QF6A 4TTTS 4PCAA 1QORA 1COWA 4L0MA 4OQLA 4ERNA 4XFJA 4BXOA 2I76A 5C1DA 4QG3A 4YRAA 3TBKA 5LVAA 4OGFA 2QMEA 3SZOA 1ZU4A 2GSDA 2GJSA 2M1XA 2W6JD 3K8QA 2JIZA 4JB3A 1Q50A 2XMDA 2FUNB 2FWMX 4NYMQ 3COJA 1F7UA 1O2DA 4OGLA 1E4OA 1XHFA 2Y3IA 1DQPA 4XD2A 3V8MA 1T0BA 5AESA 1IUPA 2E1PA 1N2CB 3L8EA 3OIWA 4OBEA 5G0SA 4AECA 5LIRA 3LC1O 1I8TA 3MUEA 3P9ZA 1ULAA 2I7TA 2Z2ZA 5FB3A 4I2VA 5AW5A 2GPJA 4CKZA 2QXTA 2QN2A 4B2IA 1DT5A 4U9HS 1ORWA 5A3QA 4ZMBA 3RHSA 3E84A 3L84A 2PUTA 4DCOA 2D54A 1SUFA 5IC5A 1M0EA 5DN6D 3DEHA 4XM1A 1NX9A 1WXIA 2JD2A 3AEZA 3G5UA 1UFVA 4B1FA 1ADJA 1N2CE