4F38A

Crystal structure of geranylgeranylated rhoa in complex with rhogdi in its active gppnhp-bound form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/chaperone
molecule keywords Transforming protein RhoA
total genus 56
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f38A00
2YV5A 3AP2A 1VG1A 4O2RA 1P4SA 1E2FA 1D2EA 2C96A 4YQFA 4EAQA 2NO1A 4G5QA 1WBDA 4UQOA 4JSYA 1EFRD 2ZS7A 3QBTA 1ZJ6A 4US0R 1P9NA 2PX3A 1VTKA 2PCLA 2YNMA 1OW3B 4D0NA 1FX0B 3CZQA 3QKRA 1J99A 1KMHA 3A1SA 4IDNA 1E1RA 5HCNA 5EJEA 1XMIA 3I92A 4TMZA 5KDLA 1ZCAA 2Q3HA 1E79D 2CCKA 2ZTSA 2IS2A 3VR1A 2EFEB 2RGDA 1RYFA 1DAHA 4OJQA 4Q9HA 3QXSA 1G8YA 3T34A 5JFGA 4M9SA 4F4IA 3FKSA 2YOFA 4TSFD 4QXAA 4OQNA 1Z06A 4LHVA 4KLZA 1CULC 1OFIA 4UXHA 2PJRA 2AHOA 2PMKA 3LW8A 4V02A 2GDJA 1G7CA 2NZ8A 2FE4A 1DPFA 2WM9B 4F38A 1W36C 3T1VA 1VECA 2X77A 1KDTA 2A5GA 2H17A 3SI7A 5FH9A 5JHHB 5DYIA 1HA3A 5DI9A 3X1WA 3U7GA 3RS5A 4D26A 2OCAA 3UWOA 4JLAA 1IM2A 5FUVA 2JJ2A 2GTPA 3GJ5A 5EE3A 1KIMA 3THXA 3HDTA 2IUSA 4FCVA 4L8GA 1MRNA 2ZJOA 3ND8A 3NKVA 2P3SA 4C2UA 2WWWA 5KPJA 1Z2CA 1P6XA 2W2VA 4MITA 5AK0A 4NKRA 3A1VA 4XJXA 2B8TA 2DYKA 1DBSA 2IA5A 4G3XA 2NMVA 3FTQA 2EU8A 5KNCA 1E0JA 1SVWA 3EZ7A 1ZW6A 3KJGA 1KMQA 4IDOA 4E22A 4UNRA 1N25A 4Z54A 1N5JA 1N5KA 5BN3A 4M22A 1NVXQ 3RYTC 1VG9B 3KQUA 1DE0A 4HAYA 3IDQA 3HYTA 2OFOA 4MKFA 3S1AA 1NY6A 3U3OA 1KGDA 3EPHA 1CP2A 3PUYA 4QL3A 2KWIA 3OEHD 4UXIA 1L2TA 1I2MA 2F3TA 2GCOB 4OQFA 5J5CA 4AD8A 4Q1EA 5CB6A 4XH9B 4DLYA 4GPTA 2NGRA 3CO5A 5JMTA 3X1DA 4BASA 2C9CA 2O0JA 3UMFA 2OHFA 1WBBA 1DVRA 1X8JA 3LLUA 4FW9A 2AKYA 3I73A 1W7AA 5FOXA 1WDTA 4OI1A 4Q1AA 4EDHA 4Z51A 4ESVA 3C4JA 4LYFA 1K5DA 4BFVA 4GP6A 2GJKA 3K0FA 4AKHA 2WOOA 5A4JA 4DUGD 1SXJC 4L5BA 1L4UA 3PUVA 5JWOA 2VP0A 2J0UB 5EXSA 4M53A 4EFLA 1ZM9A 4KBGA 1JAIA 5IK2D 1CRPA 1R7RA 1E1QD 2AXPA 2CHVA 2WJVA 3MFYA 1KSJA 4OQMA 3UMSA 1ZC3A 3L43A 3IGFA 1Z6XA 2IS1A 2W6ID 3K1JA 3B1YA 3IIKA 2ZYUX 3AKCA 4HAWA 1W4CA 1Q22A 1NBMD 1RIFA 1TF2A 3I4LA 4Q9JA 5FBWB 3RLFA 3LXRA 1KKMA 1IN8A 2WTUA 4LHWA 1RE0A 2XEXA 3OESA 1OHHD 1OHHA 5H8WA 1CJVC 1NLFA 3AP3A 3K9LA 1GILA 4XVRA 3Q85A 4TMWA 3FYHA 3FB4A 2FFHA 3MLEA 1AJEA 2NO0A 3MWLA 1BH2A 2ZEJA 2N42A 4Q66C 2AR7A 4DHEA 3GLFE 1P5ZB 3GP8A 5J47A 5SZJA 2WAYA 2QMOA 4RZUA 3EWSA 3Q7PA 4A6XA 3B85A 4LJ5A 2N1BA 4XD7A 1TQ6A 1W4BA 1KHTA 3IO5A 1NG9A 3KQLA 3QKSA 4DLSA 2OBNA 4KCGA 3CB4A 4RD2A 2BIFA 2FFBA 1AN0A 4KFSA 2XZLA 5AUPB 3SC3A 4JBXA 1EFRA 5JEDA 4C7OB 3U44A 1FMLA 3QKUA 1NN5A 4FWTA 3QG1A 1DEKA 5JRJA 1XEWY 4YXWA 5BXQC 2IEZA 1GL9B 2VF7A 1QG2A 3WXMA 4JL8A 5FL7D 4JL6A 4Q1FA 1YZTA 1H8HD 1NG1A 1S3SA 4Q00A 1FQKA 1GL7A 1F2TA 4W5WA 3I5YA 2VIIA 4HB2A 2GZAA 5FOTA 4D82A 4ZKEA 2ECKA 3K0EA 4PC3A 4Q4HB 4RSGA 1XCGB 4PO9A 4FXPA 3SE0A 4CT5A 2R9VA 3O47A 3QJYA 1LFDB 1ZU4A 4B3CA 2BWJA 2KI5A 2FFAA 2JJ1A 2WKPA 3W8RA 4NZYA 3O8DA 1JR3D 1RFLA 3UATA 2FPLA 2FPKA 1VCMA 2RHDA 1E9SA 4HZIA 1TU4A 3E1SA 3U61B 3OZXA 1KI4A 4B2LA 2GHIA 4ZDKA 1G17A 4N0EA 1E9AA 3B2EA 3H84A 4B35A 2Q9AA 5C4GB 4BEBA 1MR3F 3U7EB 3KB2A 1BYUA 3BH0A 3LY5A 4KLNA 4ARZA 1DARA 1Z6GA 3FFBA 5J4KA 4LGMA 2AKAB 4YDSA 3GLHB 3AKDA 5AJXA 1AA9A 1TADA 3K53A 4A1FA 3EC2A 4HUQB 2R6CA 3WY9A 2JLXA 3EA0A 2ZI3A 4HYYA 4DUGA 3RVBA 4TL9A 4BFSA 3F3YA 1E2MA 1P9WA 2XJ4A 1CR2A 1A2KC 5B64A 5CK5A 4JVLA 2ZI7A 4WIAA 2FEMA 2IYLD 2WWXA 2XTMA 2QY9A 4HDCA 1EWQA 3LO5A 5IHPA 2WMOB 3DOFA 2AX4A 1DO2A 3ZVMA 1GRNA 2J87A 1Q12A 2C99A 2ZE6A 5FBLB 5JJKA 3GLHE 3DZDA 4HB4A 4MH0R 4MGIR 3TAHA 1M7BA 2QAGC 3BERA 3QENA 1AS2A 2JLRA 2VSXA 2V9PA 1G5TA 2OFWA 3PEYA 2ZS8A 2ZE5A 1UBCA 3W34A 5DSZA 4P4UA 5JWHA 4MDEA 2ZE8A 1XJQA 3DVLA 1I4DD 3H2YA 4QFMA 4V0KA 1XTKA 4ZCMA 3B9QA 5L8VA 3AVQA 3ZQ6A 2CHQA 121PA 3RWOA 2I3BA 2HJGA 3MWKA 2CJWA 4C0HA 3PV0A 2CLSA 2DB3A 3T1QA 2NZJA 4ZIRB 1T3SA 3W90A 1F2TB 1G8HA 3MAAC 3AF0A 1TQ4A 3BIFA 2ORVA 1DOAA 1EX7A 4ACAA 4A15A 1BMFD 2WJIA 1Z08A 3VR3A 2NQ2C 4EPTA 4IOKA 2IEYA 3CPJB 1JPNA 3EIHA 1GP2A 3KTAB 5ELXA 1BS1A 2W6JD 3SOPA 4CEHB 1Q1EA 5FUYA 3TMKA 4B71A 1HE8B 3GJ6A 4B47A 2CL6X 3U3MA 1JXOA 1HQYE 1XWIA 4NYJQ 4A0HA 4IVPA 4BFYA 4QHTA 2ZI4A 2ZRFA 1T8UA 3T06B 1G1MA 1L8QA 4LBWA 4JJZA 1ZUHA 1UJ2A 1FNMA 2FDCA 4CZ2A 3OE7D 3ADDA 3LBNA 1D5CA 2G0TA 2BBTA 1HQCA 1OF1A 4L15A 3HR8A 1UDXA 4OI0A 4TSFA 3HPQA 5J4LA 4D2IA 1US8B 3NDPA 2WPDD 5BYJA 2FV8A 2JASA 5BQ5A 3KXIA 1XPOA 4LUCA 3QSYA 1CEEA 4I1OA 5AUQA 3ZLJA 2D7CA 5FUXA 1CJTC 2XTNA 3LNCA 1W46A 2HT6A 4AC9A 1P2UA 1XXHB 1R8QA 4HLUC 3VTKA 2G77B 3KKMA 2BVNA 2ZETA 1PLKA 3B13B 3SS8A 1FX0A 4HLCA 2GEUA 3CBQA 4QNRA 2KSQA 2RKOA 2FJUA 3N2EA 1XTRA 5FPSA 4NCKA 4GBMA 2JLYA 3QY0A 4C7OA 2BMFA 2PLFA 5KTYA 1OLOA 4DEYA 3LBIA 4R98A 2QEQA 5KPDA 4M1WA 2DWQA 2AD5A 2ZUDA 4HI0E 3CIOA 2C8VA 2IYUA 2AK3A 1XXHA 3CRMA 1EGAA 4JVMA 1UEIA 1T5IA 1YZKA 1RW4A 3GD7A 3R8CA 4QKQA 2ZSDA 4X8OA 2ZSFA 2GA8A 4O0MA 1OKKD 5LD2B 2IYRA 2P65A 3N2IA 3RRMA 1MABB 4Q02A 3I5XA 2FU5C 1X86B 1TEXA 2FFQA 4K8OA 2Q9CA 1BO6A 2QI9C 4Z8XA 3W6PA 4GZMA 5EE5B 3LV8A 3SZRA 1T4GA 3CNOA 1Z0FA 1OXSC 1TU3A 3KQHA 3MGCA 3ZZTA 1P7CA 1U0LA 2NTYC 3AEZA 2QTVB 1DG3A 3T5GA 1W36B 4URWR 1II0A 2WBLC 2EFCB 4MRPA 4A2WA 2QQ0A 2D62A 3RRNA 5FOWA 2ZRGA 1TF7A 4DLTA 2EFGA 5CIWA 1IN4A 1MO4A 1CTQA 3ASZA 3TQFA 3K9NA 1S2MA 2VH5R 2O8BA 1VCNA 3IIJA 3GCGA 1SVOA 4BLQA 3FGNA 1C9KA 2E1RA 2OSBA 1N3BA 4J0QA 3X1ZA 1P2SA 2ZRAA 4EKDA 1HV8A 2FSHA 4TZ6A 1A5TA 1ONBA 3AUYA 2DFNA 4W5JA 4C2TA 1NVVR 4RCZA 1L7VC 4TL7A 4TMKA 2PH1A 4BZXA 2VL7A 4WZ6A 2AFHE 3VU9B 2WJHA 2RGNA 2W6JA 5JCPA 3P4XA 4M8NE 1IBRA 2D2EA 4E5UA 1U98A 2NO6A 1E4VA 4JLNA 1OB2A 1SGWA 3UWKA 5G41A 1VCIA 2GEDA 1ETUA 5FPHA 2OO7A 4Q01A 4Q9LA 1NMYA 1K5GA 1COWA 1IXSB 3QPUA 2ZR9A 1KK2A 4XOIA 3TRFA 1WCV1 4GDFA 1OYWA 2V7QA 3AF1A 4US1R 5GJVC 1ZM7A 3PFIA 3B8HA 4DLWA 3KUCA 1RJ9A 5KO2A 1OIWA 1UBEA 2C98A 1OH7A 2G0NA 1BIFA 2FA9A 1H65A 2QSZA 3B60A 3U4QB 4OQXA 3CH5A 1GG2A 2XGJA 5EZ5A 3ZJYA 2XNDA 2WIAA 4Q4HA 1R5OA 4Q9KA 2DWPA 1SKQA 3CNLA 3OHMA 3CONA 4HDQB 4TLEA 3S1AB 1MABA 4YMTA 4Q1CA 3M1IA 2LWIA 3SN6A 5K8IA 2IX3A 4LC0A 1OB5A 1JECA 2ODEA 3WHLA 4IFBA 2HEIA 2J3EA 5EUMA 1EFCA 4EFMA 1VG8A 2WIBA 3OIWA 1N6HA 4Q4JB 2QPOA 4D25A 1Z83A 4G5OA 2ZRKA 5GJBA 1XB2A 4NL4H 2GJSA 1NKSA 1KDRA 4EQ6A 1XJCA 3LFUA 4NCNA 4UKDA 4PHTA 3CH4B 1NY5A 4NU0A 1FZQA 1VCOA 1ZU5A 1G7SA 4ESHA 5FR2A 4LV8B 5B30A 3U3JA 4XTRA 3TUJC 4PSVA 1GRQA 3VKHA 3L0IB 2GXAA 4YMSA 1IJFA 2DCUA 1YR8A 5JI3E 4I1SA 3BK7A 4QGAA 2YWGA 3BH6A 2PEYA 1O3YA 2PCJA 3EG5A 1JQLB 4YC7A 1J2JA 1ZIOA 5DI3B 2B7BA 4Q7MB 5B2ZA 5CB8A 3T1TA 3BOSA 2IL1A 2V3CC 4OI2A 3D7MA 3GJ3A 1ZIPA 1KOFA 1XMJA 3CX7A 3FE2A 3TLXA 1HUQA 3ZYCA 2MMGA 2PZEA 2KB0A 5L3VA 1Z47A 4L4UA 4DZZA 2OAP1 3GFTA 3IQWA 2IXGA 3EPJA 4NYIR 1AZSC 1PUIA 2VP4A 5HTKA 2RH5A 2HDNB 2ZR7A 1A2BA 3BAFA 3TSWA 4C0LA 3U6KA 4UNSA 4NTZA 5FBVB 2OLKA 2GXSA 3PUZA 1ZVQA 4BRWA 4EPXA 2AXNA 3BH7A 1GZSA 1VG0B 3U6BA 2GJ9A 1E0AA 3B82A 2CEAA 2JLQA 4PHHA 5CIQA 2JATA 3F8TA 3VR4A 1WP9A 1SXJE 3FMFA 1E69A 4PO8A 1SXJA 3MMPA 5KSPA 3X1XA 3RAPR 1W0KD 1W0KA 4TYQA 2ZE7A 1RKBA 1X8LA 2EWVA 2WV9A 3EZ2A 3I72A 5E7JA 3A1UA 4I1UA 3T35A 1RC8A 1H8ED 1H8EA 3AVPA 4OBEA 3ZS8A 1JNYA 2V6IA 4TMXA 2GF9A 2VSFA 1EFTA 1NN1A 4HAUA 4O2LA 2IYYA 2QMUA 5EE1A 3RHFA 2YYZA 2D06A 3A4MA 2GEVA 1JXMA 4JLPA 4ZDJA 2A30A 3A4NA 5GJWC 4MGYR 4D4KA 1NF3A 1E2KA 1R0WA 4M0LA 2QG6A 1UADA 1QHXA 2UKDA 4LJAA 4D80A 1XCPA 3KZ1E 2C77A 4YDHB 4IOMA 3V00A 2G88A 4C9BA 2GZHA 3CZPA 3CR7A 5B57C 3TJZA 4NYMR 2H57A 2R6AA 3FVQA 1MO3A 2HCBA 3CRW1 4V0OA 1DAEA 1E2QA 3KKPA 4ZPXA 5LB4A 5L3SA 2ZQ5A 3T1OA 1AKYA 3ZVNA 3IEUA 1S8FA 3GLHA 4G01B 1WA5A 4LYJA 3TVDA 3ZD6A 1S9DA 4B32A 3CR8A 2CNWA 2IHYA 3M4YA 1GRRA 1XBTA 4KHZA 3K0CA 4JL5A 2RGAA 1QVAA 4BFXA 3BFVA 2DFLA 4LI0A 4II7A 3U3KA 4AKEA 4JKYA 1SVIA 1R4AA 4ZIRA 5FUWA 5TARA 4CIDA 2JJ1D 4RKEA 4OJKA 3V9PA 3SQWA 2GVZC 4AKGA 3EZ9A 2QMEA 4AURA 3G0HA 4M9XA 1N6KA 3QXXA 3DKPA 1W5SA 4DT1A 2DR3A 2NO7A 5FTKA 4NYJR 4KAXA 5FPTA 3LVRE 4DBLC 2CE2X 4MRRA 5K8LA 1N6LA 2WPDA 2BV3A 3THYB 2RGGA 2G9NA 1US8A 1W4AA 2OE2A 4RY2A 1GKUB 1LF0A 1E4YA 1N6PA 1F2UB 2BCGY 4GOXA 3RS4A 1Z5ZA 1II8A 4G1UC 4DLXA 1GM5A 5C1BA 4HUTA 2HYIC 4JMPA 6Q21A 1KJZA 2R2AA 4ABYA 3BJIC 2Q6TA 1MH1A 4JLBA 3K0AB 3LX5A 4HDOB 1IY2A 4PPFA 4TT3D 5J40A 3ND9A 2F43A 1ZMXA 3NH9A 4LHXA 2F6RA 4PSAA 3WMFA 5AUOB 2JLVA 3CRVA 1R5BA 1XTIA 5HR5A 5AJVB 4NH0A 2KBEA 4OHWA 3LD9A 5KSZA 1P72A 4NDZA 4KXFB 2VBCA 4C0BA 4BRUA 2ZAMA 4C3ZA 4ZKDA 3K09C 1S1MA 3WYAA 2GJ8A 4AYWA 4E03A 2LKCA 3DM9B 1S3GA 2WSSD 4OK3A 621PA 1RRGA 1F3OA 2ZJ2A 3BFXA 3KX2A 4R2HA 1ELOA 1W49A 3NIBA 3SFVA 3AV0B 1E9FA 1XF9A 5KUTA 4E09A 1M1YE 1SVLA 4DSNA 2ZJBA 2AFIE 3QF4B 4GZLA 3VR5A 4B3FX 5FI1B 4M2LA 2V6JA 1XCMA 3BB4A 4MQBA 1TMKA 1R5NA 4IEEA 2D7DA 4DWJA 4PO1A 3TSZA 5IRCD 2O5VA 1KK0A 3GEEA 1XMVA 4DDVA 3OEEA 2X19A 4Q48A 1XFAA 5TB5A 4FCWA 1XTSA 2QAGA 1Z0KA 1EFHA 1XRJA 4RJLA 2GZDA 1G16A 1FTNA 3SYKA 1X1RA 4Y0VA 5AUNB 4DLUA 3QQ5A 2V8OA 1X3SA 1E9BA 1N6RA 1S96A 1LB1B 1E2JA 2OM2A 4BFWA 4EJSA 1SHZA 2QA5A 2OLJA 3AF3A 4BFZA 2ZITA 1OXVA 1PUJA 1YZLA 2V1UA 2PZFA 2BJVA 4WW0A 1P61B 1VYUA 2YJTD 2QROA 4EFNA 4A82A 3KFXA 2FNAA 4IRUB 4LRWA 2FEOA 1G3UA 3TH5A 3L0OA 3PENA 1XNJA 4QC2A 3C8UA 4F93B 2QE7D 1E0KA 1KI7A 1XD2B 5DHFA 4WOPA 3QXJA 2B21A 4QNMA 1SVMA 2K5UA 2VP9A 2QZ4A 2VYFA 2HUPA 3MRSA 4P33A 4DSOA 3ICEA 1CXZA 1E2GA 4H9GA 4LOAA 4B73A 3GLGB 3U7FB 2ZI5A 4IJMA 2IWHA 2ZJYA 4Q7JB 1G4UR 1G8GA 4LX0A 3DKVA 4IHQA 1NLZA 3VNUA 1LF5A 1HH4A 1T3LA 1KJYA 3M6AA 4R9UC 5DHAA 3LW7A 3RS0A 3QVVA 2HJVA 2VP2A 1JEDA 2EFDB 3T12A 3AVYA 1AS0A 1IQPA 2ZI9A 1K8RA 5FBRB 3LVQE 5FL3A 3ZVLA 1R0ZA 1OXUA 2FH5B 4AK9A 4US2R 1VHTA 2J45A 2XNSA 2P0EA 1K6MA 4IEIA 2ZRIA 3NHAA 3Q8XB 1W48A 4RZ3A 3V4FA 4CT4B 1NMXA 1YU9A 3C5CA 1Z63A 4P0TA 2ZRJA 3GEIA 1W4RA 1WF3A 5CM9C 2J9RA 3SFZA 1S1CA 4V0LA 1CF4A 4I81A 4TQ9A 4CRWB 2O52A 2G1JA 1CJKC 2PZGA 1GVNB 2XZOA 1FP6A 2J7KA 2DFTA 3W3AA 3CW2A 3UXMA 4HLDA 5HE8A 3RS7A 4AG6A 2BEJA 4B3BA 4R71A 4DEXA 1C1YA 3PUXA 4BWYA 1Z0DA 3D31A 4NBSA 2P5SA 1OE0A 3VAAA 1NP6A 2A5DA 3QVUA 1ZYUA 3KJEA 1OFTA 1YHNA 4IVRA 1N6NA 1D2NA 4KFTA 4D6PA 1QG4A 3IBGA 1OH5A 4BECA 721PA 2I1VB 3FHOA 1I4TD 2A78A 2C04A 3TE6A 4FN5A 1OJLA 4HEJA 3Q72A 1I4LD 4LCBA 4C4PA 2WOJA 3QI2A 2ZXUA 2XJ9A 2Q9BA 4RD0A 2HXYA 4ZDWA 2ZR0A 1NMZA 5BN4A 2BKUA 1QZXA 2ONJA 3P32A 4H1UA 3TIFA 2ZRBA 4LYAA 2JIZD 1HT2E 2H7VA 4Q47A 3THOA 2W0MA 4PHFA 4CEHA 1FUUA 1JB1A 3WP0A 2OT3B 1J90A 2WVJA 4MYTA 3TR0A 1IXZA 3HJNA 5C2JB 4A0RA 2PEZA 2GILA 4FMCB 3FPAA 1GFIA 3VFDA 2IUUA 3WBJA 1R2QA 4Y0AA 5IK2A 1Q21A 3NBYC 1E94E 3TNFA 4HUQA 1F5NA 4LBYA 4PR0A 1YRBA 3IIMA 5EP4A 1DAGA 5IF9A 3K0SA 1R6BX 1W0JD 3OFNA 4WXPA 3TW4A 2IYZA 4LY6A 2QPAA 1P73A 1YR9A 1DAFA 2ZYTX 4EJSC 4F92B 4QG7A 1MT0A 1KI3A 1IHUA 1Z0JA 5JSZB 1GWNA 2Q0HA 3EIQA 3LAWA 4URXR 4CEIA 2AD1A 3U60B 3GEHA 3CX6A 4S35A 1SKYB 1PVOA 3GJ7A 3EIEA 4RD4A 2FSIA 4LDJA 4QOSA 2XNDD 3EZ6A 4BFTA 5FTNA 4FMDB 4Z1MD 3PCRB 3SJAA 1IONA 4GT1A 4EPYA 3U5ZB 1HURA 3CPEA 3NC1C 1YQTA 1YZGA 5KSYA 3ZIAD 3ZIAA 2JJ2D 3I8XA 4JVSB 2GESA 4LWZA 4KV9A 4BZPA 4YLGA 5LDDC 4ZCLA 4O25A 4TYYA 4P4SB 4M1YA 4DSTA 1M74A 4GNKA 5SZKB 1RPZA 5KDDA 4V0ME 1G3MA 3DL0A 3ZZ0A 1E79A 4V0MA 2Q3FA 3QEOA 1H8HA 5P21A 4WZAE 3ASYA 2OXRA 1A4RA 2GJAA 1JQJC 3VKWA 1T0HB 3ONWA 3DZ8A 1P3JA 2IK8A 1VHLA 3UG7A 1OH6A 2G6BA 2H1LA 1OSNA 3FKSD 3B1VA 1N5IA 1Z22A 3KUDA 1JR3E 4ARZB 4EQ6B 3E70C 1DS6A 1G64A 2ERXA 3O8CA 1GOTA 4ILEA 2CVFA 3AGQA 4JIMA 4KVAA 3Q5EA 5CITA 3JVVA 4KO8A 3C41J 2IF0A 2ONKA 2OCBA 1HTWA 5CLLA 2QU8A 3QKSB 4TL6A 1A7JA 2C2HA 2O8DA 2IWRA 4QGGA 4BUJA 1JI0A 3WBKA 3C15C 2IYXA 2XSZD 5KYKA 3X2SA 1UBFA 2EYQA 2H92A 2FF7A 2F7SA 1CR0A 4TMVA 1KK1A 2GRJA 2NPIA 1QHSA 3W9YA 2YVUA 1S4QA 4KODA 2HT1A 1XPUA 2ZRLA 3LXXA 1O87A 2H5EA 1G9XA 3VMFA 4JLOA 1NSTA 4PAQA 3VHXA 4L9SA 2J7PA 1G6OA 1UM8A 221PA 1AGPA 3LBHA 2Z4SA 3EPLA 4ZV4A 1M8PA 4A92A 1MO6A 1AGRA 2IT1A 1Z29A 1N2CE 4KSBA 2HXSA 4P31A 3IILA 1RZ3A 1G5RA 2IHBA 2OUKA 3BFKA 3GFOA 4AYTA 1LV7A 3DMDA 1QHNA 2H8KA 2W6IA 3RSOA 1XZPA 2C9YA 3GMTA 1KI6B 4RD1A 4DCUA 3MJRA 2WWGA 2WJJA 2ZU0C 4PC6A 1EFUA 4NMMA 5FTMA 2ZRDA 3AVUA 1F2UA 2GVDC 4NHOA 3THWB 2J0QA 3IPYA 2CCGA 4A8JB 5H68A 1GITA 1X6VA 1U0HC 1OIXA 4WA7A 4F7WA 1NBME 5FOUA 2ZI6A 3TGPA 1IOZA 4BLPA 3P1JA 4BGDA 1KMHB 4YMWA 3K70C 4JLKA 5DLQC 4I1VA 4PC7A 4CGZA 1VMAA 4URVR 2SHKA 3NEYA 3H1TA 4BLSA 5J4YA 3KL4A 5TVKA 4FMCF 1JR6A 2VTKA 1P9RA 3UPUA 1UFQA 2QM7A 3IHLA 4DDUA 2I1QA 3I32A 3SHFA 1VIAA 1G41A 3ECCA 2XX3A 4FWIB 1ZD8A 4V0NA 1W2GA 2IYWA 2FZ4A 3I8SA 1Q0UA 3L0PA 1UKEA 3SJZA 4KI0A 4ACBA 4L9WA 2CMKA 2D4HA 1ZM3A 2HLDD 1NJFA 3QPVA 5GJCA 4DRZA 1P60A 1MKYA 1W0JA 4NP6A 3VU9A 1KI1A 2BMEA 2VA8A 4QBGB 1ZNZA 4LJ6A 3CF2A 2OCPA 5BW8A 3WMGA 3LDAA 4E07A 2CDNA 2ZSBA 3D3QA 3A1TA 1KAGA 3GLIE 1NVVQ 1ZAKA 1ZBDA 4PAOA 4V03A 3W8NA 4PPQA 3UMRA 3H86A 1N5LA 1XTQA 2F1RA 4M9QA 1Q20A 2ODNA 1U99A 3B9PA 3A1WA 3AB3A 4U00A 5FL7A 1U2RA 5H70A 1YE8A 5JS7A 3PEVA 2A7QA 1V5WA 2ZYWX 4FCTA 4PZYA 3EZFA 5HE9A 1ZC4A 4FD2A 3PIRA 1U9IA 1QHYA 4MUBA 1J8YF 3TKLA 1EESA 1Z8FA 1UDWA 1TUIA 1LW7A 1Z0IA 2WWHA 5A0FA 1TPZA 4DLZA 3C14C 5EXXA 2EWWA 4KYUA 2ZROA 4A36A 4TQUS 5CJ2A 3UANA 3I3SR 4NE2A 3BC1A 2C78A 3KQNA 3OIYA 5C4MA 1Q3TA 2VPPA 3K09A 4M9ZA 4AG5A 4XVUA 1TNDA 2OILA 1DAKA 1BKDR 4OHZA 421PA 2A5YB 1YZQA 1YZUA 4FMDF 1BOFA 1JEEA 1S0UA 1Z6TA 2BBSA 3SYNA 4P32A 3MCAA 4DDTA 3B78A 3ADKA 2WMNB 4YMVA 2PBRA 1G291 1KJWA 2G83A 3A4LA 1GNRA 1QVRA 5AR1A 4A2QA 1MOZA 2D74A 4XWAA 1P2TA 4B2IA 4C0QC 1GNPA 3OAAD 2ZPTX 2RHMA 1YRAA 3K9HA 1KI9A 1IJEA 1ZRHA 1EK0A 2GBLC 4PZLA 3FWYA 3OEHA 2FMXA 2BEKA 2ZYVX 2AK2A 4GRAA 2NO9A 3NH6A 4DLRA 4MUAA 2ZS9A 4C30A 2MSCB 1AKEA 2RGXA 2FX3A 4Q4AA 4ZO4A 2D3WA 2ZRPA 1LY1A 2A5FA 3NBZC 1JBKA 3LX8A 3NXSA 2IXEA 2VHQA 4HSEA 3EAQA 4AY2A 3D6TB 4LHZA 1BMFA 1VYTA 4FI3C 4K81B 3L82B 5D3QA 3O8BA 2YZ2A 1W36D 1U8AA 2F1IA 4R7ZA 4WBSA 3FHCB 3SBEA 4A6PA 3A37A 1XD2A 4PQYA 5JBQA 4LJYA 2VHJA 4TYNA 2NG1A 2VP5A 4L16A 3CRRA 3QBVA 4CYMA 1QHGA 2GWHA 2X2FA 3P20A 5FTLA 1YR6A 3TUIC 4HAVA 1YZNA 5J4HA 1CR1A 4XSHA 2ZSEA 4DJTA 4N3NA 3A58B 1G4AE 1FL9A 4NPHA 2QP9X 3TUZC 2X8AA 1B23P 3T15A 1D2MA 1M7GA 4LJ4A 1GKIA 3KDSE 2O8BB 4YMUA 3QPWA 1Q1ZA 2WICA 4P4SA 3GLFB 1NIJA 2UVQA 3B1ZA 2DWOA 4B6FA 4IVQA 2IYSA 2WWIA 2P2LA 4HB3A 4KBFA 1KNQA 4DCNA 2DHRA 2KBFA 3QXHA 4PPGA 1T9HA 1R0YA 2LCFA 2IW3A 1UKZA 2PJZA 3A8TA 3KB1A 3IUYA 4TTPA 3QG5A 3R8FA 1XXHE 1Q1QA 1KI8A 2BC9A 2IYTA 3B5JA 2V4ZA 1CIPA 1OYYA 4IKEA 1KO5A 3CNNA 1GUAA 2ANCA 2RGBA 4MRSA 4PZZA 4GOKA 4PANA 4Q1BA 5HPYB 4Q21A 3RRYA 4TLAA 5C18A 5AJZA 2Z6VA 1HEIA 2ZRHA 3GJ0A 4MGKR 2REBA 3FKQA 2BM0A 2GNOA 4LC1A 2XXAB 2XAUA 2HV8A 3Q5DA 1G20E 2Z43A 2ZRNA 2BJWA 4R2IA 2QP4A 2XITA 1CR4A 1JJ7A 2BDTA 1LS1A 2QN6A 2C5LA 2G3YA 3TR5A 4NCHA 3BD9A 3U3RA 1HE1C 1SKYE 1R8SA 1QHHB 3RDPA 4PXAA 1TF5A 1ZD1A 5F2EA 3K70D 5FR1A 4JYCA 1XEXA 2A2ZA 5L3QB 2V54A 3N70A 3W6NA 2A3RA 5KU1A 2ZUBA 4URZR 1XDBA 1FFHA 1KNXA 1LS6A 2CL7X 4YONB 5JECA 2NOAA 2CXXA 3KQKA 2GCPA 4TYWA 1G8FA 1BYIA 5KSOA 1E9EA 2RGNC 2FG5A 2KE5A 1DAMA 3NEJA 4LJ9A 2R62A 4Q18A 4JBWA 3ICQB 3EC1A 3HWSA 1YKSA 1Y3AA 3C16C 4AYXA 4Q7LA 3AQ4A 2EYUA 1M34E 2F55A 2WSSA 1GL6A 4JVNA 5IT5A 2FWRA 2QGNA 1OXTA 2P6NA 1W1WA 2BMDA 3GJ4A 4Z8YA 1F48A 1YR7A 4ZI2A 1PLLA 2AN9A 2W58A 4BZQA 4Q7KA 3OF5A 4CW7A 3RWMB 4HZUA 5JCZA 3MWYW 4RD6A 3FDIA 4TLDA 3I61A 5G3ZA 2ZANA 3OAAA 2QM8A 4UNPA 4XTCS 2J7PD 3QUSA 3SBDA 2IYQA 5C46F 3IKJA 3BORA 3TBKA 4GMDA 5L3QA 5DGXA 5DO9A 4JT2A 2VLIA 4GFDA 4D0LB 2B92A 5GADl 3DEFA 3EA5A 2QNRA 1J7KA 1FTSA 1WB9A 3R9IA 2V55B 4TTQA 5AWFC 1N0VC 4AIIA 4A2PA 3LWNA 5EUQB 3LQRA 4PSKA 5TXGA 1TTTA 3KTAA 1KY3A 3NVAA 4EJSB 3ZS9A 1CS4C 3AKEA 4KFUA 4C0KA 3W5JA 2J41A 2QSYA 3AGPA 1WQ1R 1QDEA 3CX8A 821PA 4GOJA 4M1SA 3BS4A 2ZSAA 4IDQA 1F6BA 2XOKD 1G3QA 1EG7A 1TX4B 1M7HA 3L8ZA 3QF4A 2GCOA 1E96A 4PAMA 1EXMA 4Z1MA 2CE7A 4JLJA 3EXAA 1UEJA 3Q7QA 5TY0A 3QXCA 4DLVA 1TQ2A 3ZZUA 5D3MA 1T0JB 3B1XA 5DNYB 4IOJA 2C9OA 2W2TA 1PV4A 1KSHA 5DIFA 3AVOA 2HLDA 2I4IA 2V7QD 3REFA 4EIWA 4QGFA 3F5FA 3LA6A 2X2EA 1IAQA 2MSDB 3IBYA 4HAZA 4BQSA 2ZU6A 4LPKA 1Q1BA 4DB2A 2O8FB 3QE0A 2O0HA 3CRQA 2B6HA 3IO3A 3RC8A 1M2OB 4QM6A 4PC1A 5EE9A 2XB2A 2JA1A 3CF6R 3NWJA 2ZREA 1G19A 3UIEA 3R7WA 3E2IA 4U02A 3VR6A 4MKHA 3K70B 1RRCA 5KOYA 4B43A 4MRVA 2H18A 2ZJAA 2CCJA 2HCJB 5JJIA 1A82A 3NDBB 4B33A 3UG6A 4LBVA 1ZINA 3BB1A 2WWYA 3FOZA 3PITA 4C0JA 3WRXC 4QBHA 4OYHA 1V43A 1XJ0A 3KJIA 3MUFA 3QKTA 1II8B 5EXPA 1SZPA 1E2LA 3FMIA 3HR7A 4UJ3A 4MYHA 5ANRB 3RS2A 4BFUA 4PX9A 1E1RD 2YC4C 5E7MA 5TDHA 2BOVA 2XB4A 2ORWA 1P75A 2QQEA 4XSGA 2Z4RA 2QORA 2EW1A 3DDCA 2ZJ5A 1KSFX 2KJQA 2OBLA 3KKNA 5BYKA 5LB2A 3EPKA 3GFPA 1Q3HA 3AP1A 2CLCX 4B75A 1NI3A 3PXGA 1J8MF 1FP7A 1TQDA 4YXWD 3HPRA 1N0WA 1NSFA 1E2HA 2IYVA 4RKFA 2QBYB 1E32A 2WKRA 4ZCIA 4S2EA 3EX7C 2CLDX 1FQJA 1RVDA 3VHLB 1JJVA 3QKRB 4AKIA 2JIZA 1Z07A 3T61A 4HATA 2P6UA 2O8DB 3TSOA 1IY0A 1XEXB 2XTZA 4DCTA 1QHIA 2RAPA 5EP3A 4B2PA 1A1VA 5JRZA 2O8CB 3PG5A 4QJ5A 4KITB 2YKGA 3REGA 2ATVA 3A6PC 3THXB 1D9ZA 2YOHA 2OG2A 4Q1DA 2LKDA 2R6GA 4LJ8A 3EWAA 4A0FA 4IW3B 1R0XA 2ZJ8A 1E1QA 1IN5A 3CUEF 3L0SA 3PR1A 2B8WA 2VRWA 3OIVA 1XU4A 1W47A 2IBMA 3TK1A 3WP1B 4DXAA 4PPNA 1TL7C 2WZQA 3B1WA 1U0JA 1T3HA 1N0UA 5DN6A 1FUKA 5DN6D 4NONA 5FOSA 5JEEA 3SEAA 3ZDQA 1AM4D 1VDZA 2OCYC 2YOGA 1E2PA 2J5XA 2O8CA 3QNUA 4TN1A 4GP7A 3W5IA 2XOKA 3I1FA 2BM1A 2YWHA 3DMNA 5DYGA 2OBMA 1TEVA 4B44A 2QAJA 4A4DA 4JKIA 4AWXA 1GIAA 4XWOA 4DC9A 1EWRA 4JJKA 4KJZA 4URUR 1KSGA 2EVWX 2H16A 2Q21A 2OESA 2QTHA 1NNEA 4Q4LA 3J81k 4XVQA 1G8PA 1E99A 1YVDA 3QEJA 3AVVA 4WVFA 4A8JA 3PJRA 1NKTA 2GAAA 1VIYA 4LZZA 1E2NA 1AIPA 2BKEA 5DISB 5AJYA 5K8UA 2J0UA 3P26A 5L3SB 3PVSA 4F4JA 2QE7A 1XZQA 1KKLA 1KO7A 3K9GA 4G5GA 4MRNA 3RANA 2CL0X 3UK6A 1E2IA 4HAXA 2J0VA 4IOLA 3HU2A 2ANBA 4P4TA 5H1YA 3Q9LA 1GDDA 2DPXA 4JS0A 3SJCA 1DELA 5A5GA 2YC2C 1KYIA 3PUWA 1ZUIA 3FMOB 3GJXC 3PEUA 3QOFA 3GPLA 4MYCA 2BHRA 2Z83A 2R44A 2FZLA 1WMSA 1IY1A 1XTJA 1CKEA 2FPMA 3LH5A 3K0FB 5M04A 1OPXA 3X1YA 4LPSA 1ZCBA 4GSYA 2XSZA 2C03A 4PFSA 4NCJA 4A0GA 2QBYA 4POAA 2F9MA 4RVCA 4EPWA 4CEJB 4IXNA 3C5HA 2GXQA 5JLJA 2DY1A 2GETA 4KU4A 1CJMA 2EFHB 2WHXA 2CNWD 1XX6A 2O8FA 4PQFA 3KJHA 2FOLA 1L4YA 4FIDA 1KDOA 3TAUA 3VQTA 3CWQA 1Z6AA 3RS3A 4OK5A 4NCIA 4U7DA 2VHTA 4M1MA 3HYRA 1RJ9B 2O8EA 1ZM2A 1OXXK 3CKLA 1PZNA 4ERNA 2VEDA 521PA 3ZH9B 4HLQB 4GL2A 4OHXA 4DKXA 1PLJA 1LNZA 2VHUA 4XD7D 2ERYA 2ORIA 1E6CA 4ZDIA 1KO8A 2PLRA 5JWRA 4TLCA 2WAXA 2QP3A 4X8HA 4LJ7A 1KO4A 3WRYC 4CDGA 1WXQA 3K0CC 2YWEA 4D0GA 1WRBA 4F4CA 2HF9A 2WJYA 2Z5FA 1QBKC 3BE4A 3VX3A 3WYFA 2W83A 3NBXX 2O0KA 2P5TB 5BN5A 1NL3A 1AQUA 2Q3MA 4N1AA 2O8EB 3VR2A 1E9RA 2BBOA 4I99A 4TTRA 1W5TA 3SYLA 2ZRMA 2CK3D 2CBZA 2E9SA 3Q3JB 3ADCA 1AZTA 1TAGA 4B3GA 2D2FA 2JGNA 2ZVQX 4EUNA 4D4LA 2OV2A 1Z0AA 3TQCA 1VKJA 1LVGA 3OEED 3AVWA 2IF2A 5HCIA 3JZMA 2JJ8A 1AK2A 4QHSA 5D3MB 1T5LA 1XD8A 2MMCA 2QMHA 1U9IC 2PT7A 5KHOC 2F9LA 2QAGB 4CEIB 1JAHA 1SQ5A 2GAOA 1G7RA 4BE7B 5HKKD 4G5RA 5JSZA 1N6IA 5EP1A 5FFMA 3EW9A 4Q03A 5SZHB 2JLWA 4D4JA 1D6JA 5LBIA 4EPVA 2QRNA 2AWOA 8OHMA 5FOVA 1OV4A 2HYDA 5JI2E 1X1SA 2NIPA 2ZJZA 1QRAA 2EQBA 4PQRA 4KSCA 2G1KA 2FGKA 3D8BA 2ODBA 4OL0A 2QGZA 5FPYA 1VPLA 2GK6A 5F9HA 3SNHA 2QENA 2YWFA 2R65A 2BCJQ 2JCSA 3BBPA 1U8ZA 3WNBA 4JLVA 5BWMA 4JSTA 4RZXA 1NIPA 1ZNWA 3V4RA 4NYMQ 5GVSA 2QUZA 3NHBA 2BMJA 1P62B 2W00A 3PEWA 3E5HA 4TMTA 1G21E 3CLVA 3AVTA 5F98A 2ZM5A 1HT1E 3NBFA 4DSUA 3OE7A 2R6FA 2GBLA 4B74A 2WKQA 5G53C 3QIAA 1ANKA 1PJRA 2AWNA 5E4FA 5EE0A 1FNNA 1XPRA 2DFKB 5CJPA 3AUXA 2ASEA 2J1LA 4H1VA 1UKYA 2JEOA 1II9A 1UKVY 2XXAA 4LSGA 4MDFA 4WAUA 5HZKA 1OFUX 1JALA 4JT4A 4ON9A 4W5HA 3GLIB 1UAAA 3ZGXA 3BB3A 1SVKA 3LLMA 4C0SA 4RD3A 3THYA 2QRZA 5AJWA 1G6HA 4FMBB 1D9XA 3CM0A 4Q9IA 5LPNA 1HY3A 1OFHA 1UF9A 4QHYA 3GLGE 1Y63A 3DO6A 3DPUA 1FOEB 1XD9A 3FFAA 4MKGA 4BLOA 1N6OA 3VNVA 5EZ6B 1GAJA 2QT1A 1FW6A 1ZNXA 4B6EA 3F0TA 4MGZR 4D4MA 4G0NA 1ZP6A 5FI0B 2R8RA 4X8LA 5DE3A 2CVHA 4DB4A 1W44A 4FINA 3R20A 4B48A 3GLFA 3L8YA 5FPKA 2WWFA 3WMEA 5L3RA 3T5DA 2N46A 3ZVRA 4HZUB 4OI4A 3U44B 2AL7A 3U7HB 1T91A 4TYPA 3HP1A 4HB0A 5FTJA 4LV5B 3AM1A 1T8TA 3IPXA 3SHWA 5CDFA 4M1KA 2OZEA 1CRQA 3TVTA 2VSOA 4DVGA 1IN7A 1LTQA 5UKDA 1KZ7B 4BLTA 5CDFE 3NC0C 3TW8B 2J46A 5KNDA 1GKYA 1EX6A 1KO1A 1TUEA 1KAOA 4JBYA 4JLMA 4PC2A 3WHKA 2R6DA 3OIUA 5F3WB 3W6OA 2OFXA 1GSIA 3MSXA 4BEJA 4C0AC 4QJ3A 3AVXA 3SQXA 2Y8EA 2FGJA 1MV5A 1RRPA 4TT3A 2REOA 4D81A 3GJ8A 4ITRC 5E7IA 1FMJA 4WZBE 2J59A 4M4SA 5K8TA 1X8KA 4RFSA 4LBZA 2QT0A 4K46A 4F91B 2A5JA 4IFEA 5JJLA 3ZD7A 1XEFA 3MG9A 4MKIA 4A9AA 5JS8A 4IDHA 4DIEA 2C95A 4UJ5A 4W7SA 1IN6A 1KZGB 3DOEA 2GF0A 1SXJB 3RNLA 2VO1A 4I4LA 4MYUA 2IC5A 3LRPA 1OIVA 3AKYA 4JLDA 4KFRA 3NG1A 2V1XA 1NVUQ 3KKOA 5JHGB 1E0SA 4IXMA 2W2XA 3DM5A 4RFVA 4LYHA 5KNBA 1G3IA 2HF8A 3BGWA 4OK6A 5CYPA 1ODFA 1COWD 1WE2A 5DH9A 4CVNA 3O8RA 1G18A 4U5XA 2CJWB 2JAQA 3EASA 1NBMA 3MJHA 2BBWA 4QM7A 1XMSA 5HKKA 3SR0A 3R7WB 2VF8A 3RSLA 1SULA 3OFND 2WSMA 4TLBA 5TV2A 3K0AA 2E87A 2RGCA 3IHWA 5JZVA 1SXJD 4OKSA 4UNQA 1CJUC 1R10A 4B3XA 3WNDA 1NVWQ 2W0SA 2ZVPX 2IUTA 4M1OA 1NRJB 4URYR 2L0XA 3ETLA 2ZIAA 3SJBA 3IEVA 1KI2A 5LD2C 3GLGA 2OXCA 4LK2A 1J70A 2PL3A 1NLYA 1E2DA 2UZ3A 1D8TA 4HLUA 2TMKA 3RC3A 1DTSA 5EXTA 2ZUCA 1ZNYA 1F60A 3FMPB 5G40A 4TZ0A 1VYVA 5CK4A 5SZIA 2RGEA 5CLQA 4MA4A 4DDWA 1KDPA 1RRFA 4DCSA 1E98A 3L2OB 2P6RA 1I2DA 1NN3A 3AF4A 4QGHA 4PTLA 4X8MA 4B34A 1W2HA 1Z28A 3EARA 4DIDA 2A9KA 4M21A 4WXRA 3PQCA 3ADBA 1Z3IX 2IXFA 4XIGS 3AH8A 4ASUD 1MO5A 1OH8A 1Q57A 1U94A 1QHHA 5CYOA 1KK3A 2UZIR 2VHCA 4RFSB 1AS3A 2J0SA 5GVRA 3CWZA 2F43B 1KY2A 4Q5IA 2GKSA 3HU3A 1AQYA 1E9CA 3U2QA 5E3HA 1DG1G 3H4MA 4ZI3A 2XZPA 3BRWD 2QTFA 3DHWC 3ZQJA 1GNQA 3I62A 1Z6YA 4LV6A 3NTUA 3MD0A 4M1TA 4ASUA 3R9WA 1QF9A 3GQBA 4OQLA 2JDID 5J4VA 2OAQ1 2PT5A 1ZM4A 3IQXA 4JYBA 3G5UA 3GLIA 5CM8B 2REXB 3KXKA 4JZKA 1G5PA 4GMXA 1ESNA 1T6NA 1E9DA 1B0UA 1M6NA 2MSEB 5KDOA 3U4QA 3B7GA 3JZAA 1CU1A 1U81A 5G3YA 4TQAA 4QBIA 3KFVA 5EP2A 4CEJA 3KXLA 1JR3A 2FSFA 4OHVA 2JDIA 4NYIQ 2DBYA 3WNCA 4O3MA 1ZD9A 2CK3A 4TL8A 2FN4A 1CBUA 3B6EA 2B7CA 4N0DA 1C4OA 1SVSA 2RB4A 2JLZA 3SDZA 3VKGA 5TMPA 3KKQA 2JLSA 3FHTA 3WYGA 2IS4A 1MRSA 2F1HA 4OHYA 5F9FA 4B3DA 2VP6A 3BWDD 4QBFA 3LQQA 2X1VA 3H0KA 4UNNA 4TWZA 4W9MC 1ESMA 4CF7A 2ZAOA 3HU1A 1G3RA 1RYHA 1OKKA 1HYQA 1Z2AA 5FBQB 3C7KA 3MWJA 4GI7A 4DT1B 2QPTA 4AI6A 2GCNA 4B76A 3CPHA 3A36A 1G7TA 3P4YA 3SU8A 3BXZA 4XWKA 1U8YA 2IS6A 5B58C 1IXRC 1XEWX 1UPTA 3R9XA 1E3MA 4QJ4A 2PX0A 1OT3A 4EPRA 2WJGA 4P3YA 2Z0MA 5DI3A 2JLUA 1GTVA 2FSGA 1UBGA 1DADA 2RMKA 2NPFA 5E95A 3CF0A 1Q44A 1NN0A 5IDVA 2GXUA 3RRZA 3W3ZB 2ZRCA 3RABA 1XP8A 1S9HA 2YHSA 3P27A 4PHGA 4Q4AB 2VQSA 1ZUNB 2RCNA 4IDPA 1FPMA 1JPJA 2GK7A 2CHGA 2F3RA 4UXJA 1DO0A 2QL6A 2P67A 5HZHA 3QF7A 1E2EA 4LHYA 2OEPA 1KTVA 2F1JA 1SHKA 4QRHA 3G82C 3K8YA 1YJ5A 1CLUA 2PMDA 4RZ2A 3M0EA 3AF2A 1KI6A 2YINC 4G5SA 1P2VA 5EQTA 4DCVA 1U90A 1DAIA 4KVGA 3THWA 1NJGA 3N5CA 4Q19A 4BLRA 4KYIB 4BPBA 4Q4JA 3JVUA 4A8JC 3UKDA 4RCYA 3VX4A 2ATXA 2ODWA
chains in the Genus database with same CATH superfamily
1OTYA 3JYPA 3DGFC 1FS5A 4GC9A 4EJFA 1P4SA 1D2EA 2PRZA 2SBTA 4IUBS 4MUJA 1K1EA 2C96A 2R48A 5AI5A 1N2OA 2R7KA 1I9CA 4UUMA 3M89A 4E3ZA 1RYYA 3QV2A 5I9IA 2WC1A 3O4JA 3WAKA 4FFRA 4US0R 1WMAA 4OQ4A 4EB6A 2WJ3A 1ZJJA 1Q0HA 2YNMA 3MXOA 5AVJA 1FYFA 1NXXA 4ZVLA 2QV7A 1VCHA 3QKRA 1A5BB 4BNUA 5DBGA 5EJEA 1XMOB 1BW9B 2E4YA 4B4WA 2FZKA 3L84A 2GAJA 4FVTA 3ZWXA 2EFEB 3ROFA 3REQA 5I9LA 2COEA 4CU5A 3CEJA 1YFZA 1NZDA 2R7NA 4RPCA 1G8YA 2ACVA 3T34A 2NVOA 4C7MA 4BMSA 2ZUEA 1GHTA 5JYEA 3B9RA 3UJ8A 3RVNA 1ZA1A 1ND6A 2VQ3A 2PJRA 2P2YA 2AHOA 1I1OA 4TXLA 4V02A 2WM9B 2C7RA 4PX2A 5ICFA 2H17A 1UXKA 3MPUA 2FWPA 3X1WA 5DI9A 1IWBB 1TVKA 1YT5A 3BXFA 5EWMB 4OAPA 2QMZA 2B6NA 5FWDA 1I0LA 2GTPA 1AQJA 5MHTA 2FQXA 2DGDA 3B6IA 2V03A 4BNIA 3ND8A 1SOMA 3NTOA 4NFLA 5CH3A 3HQ4O 1D1QA 4IP0A 4I19A 1T8SA 2C61A 3ABRB 2W2VA 4QYWA 3WLTA 3ZJUA 4HMQA 3Q7EA 4BYMA 2FPXA 4JROA 1DBSA 3CLSC 1BRTA 1WSWA 3A6ZA 1Q7BA 3T3MB 3HCCA 3KPVA 2OTCA 3EZ7A 3FPEA 4MS4B 1T24A 5I8WA 3WK7A 3IKLA 4YHHB 1LXCA 2W4IA 2Y1FA 5M34A 4YRJA 5ALMA 4UNRA 1E1LA 1N25A 3ME5A 2HWWA 4B6JA 5E4TA 4Z54A 5LP6F 4B0PA 3WIUA 3P96A 4D02A 1TCBA 4MR7A 1X9IA 2BISA 4X1YA 4WK2B 4BKMA 3CLTD 2E5WA 4M46A 4R1UA 4ND7A 2J0EA 1KGDA 3U3OA 1OLSA 1Q84A 5CB4B 5ECDA 4EGFA 2KWIA 1JLMA 1L2TA 2GCOB 4QUGA 3V2GA 1KVQA 4M0MA 4MVYA 4AD8A 2R1UA 3PHLA 1J7JA 1CNEA 2EEPA 4XH9B 5CB6A 4PSDA 4TTJA 1RCUA 1RXYA 4Q9AA 5JMTA 3FY4A 3H13A 4OXKA 2C9CA 2O0JA 3UMFA 2OHFA 4D9NA 1DVRA 3ESYA 5ITZB 1WBBA 4W99A 5LA6F 1W7AA 3NU1A 4ETNA 4CR6A 1QIEA 3O9ZA 4E70A 1T36A 3T0FA 4X64B 4UBIA 4YRIA 1K5DA 1T8RA 2FOXA 3D4BA 3FCUB 3MT7A 3VAYA 4L5JA 4PHCA 2CFIA 3R6DA 3E3AA 3WWZA 2ZZMA 3FFXA 1CV2A 4DUGD 1SXJC 4L5BA 3DULA 3T3NA 1EVZA 5JWOA 2A14A 2BTQA 3FR8A 1BN6A 2VP0A 1EGQA 2Y0DA 3LFTA 4B0OA 2X1HA 4BV9A 2POQX 1E1QD 2AXPA 4G8BA 2HSJA 2CF6A 2OXFA 3EMKA 3W9UA 1KFKB 1KSJA 3MTDA 1ZC3A 4NV3A 1L5YA 3UMSA 5CXUA 2FP3A 3TRDA 1IVNA 2BLLA 1UWKA 2A0KA 3B1YA 2FI1A 2ZYUX 3AKCA 3IIKA 5EJFA 3RAGA 1HOXA 1W4CA 4EENA 5K03A 4REQA 1J8FA 4Q9JA 4WNCA 2WTUA 3PE3A 2Q2QA 2XEXA 2EF0A 1JDPA 2A1UB 4HN9A 1OHHA 2JI9A 1IEWA 4HUJA 1AKVA 4NDAA 3RVLA 3NC4A 3FUVA 3KQPA 1DRWA 3K9LA 5DBIA 5F1YA 2W2PA 1G20A 4QDJA 2YZNA 2WU3A 3AB7A 4Q66C 3GLFE 1JDZA 1D4FA 5C1IA 2C4TA 2CDAA 2B5VA 4YUYA 2IPNA 4LE1A 2WAYA 5T8KC 1R3UA 1U0BB 3VDMA 4DDHA 2EZ9A 1NW8A 3EWSA 4CXMA 4LJ5A 4AZ3B 2NUAA 1PD1A 4XD7A 4F3YA 2CXRA 1B4DA 2VYCA 2CXUA 1KS2A 1KMNA 5A04A 1KHTA 4ROTA 3MQFA 5JO0A 4K9OA 4WLOA 2JK0A 4R9SA 2B7LA 3ETJA 2FFBA 4TGLA 5HDBB 3USES 5IS2A 1UJ6A 4KFSA 2WF8A 1X3LA 1LDYA 4JGGA 1EFRA 1UMKA 1ZK1A 5JEDA 3U44A 1T5DX 1Q3KA 5C34B 3T7SA 4IICA 3I12A 5E6UB 1I7SB 1RLJA 2G71A 5JRJA 4YALA 2JFXA 1BE0A 3RG2A 4F1WA 4YXWA 2CVPA 1O5IA 4G89A 1GL9B 2VF7A 3GB9A 1QG2A 3CW8X 1J0CA 3IUQA 3JQFC 5D3ZA 4BY9E 1FBNA 2MDTA 4WCVA 3GELA 4PGGA 5LZ4A 4RNCA 3RSSA 1T1SA 3OZWA 3ZTYA 4M6WA 4NBVA 3MGBA 4PYKA 1B3BA 1JIVA 3I5YA 2GZAA 4COOA 3K9QO 1XZCA 2ECKA 4GOND 4RESA 4QOHA 4LNUB 2GVNA 1USKA 2VQEB 3VR2D 1PU2A 3EB9A 1J20A 1N3YA 1QFXA 3KQYA 2FXIA 5EZQA 5KYUB 5C53B 4BMPB 3QJYA 4B3CA 4HQ0A 2D2IA 2WKPA 3IR5A 4JITA 4LAFA 2Y71A 3O8DA 3OT4A 1RFLA 2ZJFA 3FKJA 3N53A 3MGKA 4M76B 3UATA 1VCMA 2J6HA 1E9SA 3O0TA 3EGXB 3T41A 5CA0B 1P4JA 4OSEA 4ZDKA 1XRQA 1R0BA 3FCYA 3C97A 3H84A 4B35A 4G84A 1MR3F 1YK0A 4I4TF 3F5DA 4J7UA 1BYUA 5L45A 4ARZA 1NXQA 2JIDA 1XHFA 3T9EA 4P84A 1NBHA 4LGMA 5DZSA 3VO1A 5J4KA 1MPXA 4Q05A 2IEDA 2Q1SA 4BEWA 1AA9A 4DBLE 3U1VA 2FX2A 1U3DA 2VJBA 3K53A 3A70A 4IPTA 5HX7A 4A1FA 4ZVMA 4E4YA 5LDHA 2D2VA 4U6SA 3WY9A 4HYYA 1ISHA 2OKGA 3IULA 3RVBA 3WLKX 4ALKA 1TGVA 3HCWA 3HO6A 2AG5A 2OMKA 4G5XA 2Y27A 3F3YA 1L7QA 4YJHA 5B64A 2FK8A 3EF3A 5CK5A 2ZI7A 3LI2A 3NI2A 2NYRA 2Y2UA 5B4TA 3PC6A 2QY9A 4IZHA 1FP1D 3KHTA 1ZS9A 1Y6QA 3LO5A 2WMOB 1RDFA 3DLPX 1DO2A 3M6XA 4DYDA 3W5AA 4BNLA 1XJ5A 2A5LA 2RDMA 1TZCA 1O4VA 2C5EA 2WLTA 2ZE6A 3FSRA 5FBLB 2QRHA 3AU9A 2CV1A 3VPXA 1AKMA 4HQKA 4MH0R 5LQSA 2BHLA 3URMA 3ETEA 3BERA 4UHHA 1AS2A 1DWOA 2VSXA 1N2CA 5ESRA 2WPNA 4L4ZA 4EW1A 4YRZA 3PEYA 3H9EO 1HGXA 1OLXA 1UBCA 2V9ZA 3LOUA 4OL9A 4PZAA 3AR2A 5JWHA 4IJUA 4P7JA 1P5FA 3L05A 1C9DB 3DVLA 2AC7A 4UREA 4P83A 4QFMA 5IAEA 1BWPA 1ADGA 1XTTA 1NNLA 2TYSB 5FO0A 5BSHA 1XAHA 1NUSA 2OQIA 1KQGA 3MCTA 1TVCA 1D0IA 4N7JA 2B2CA 5A5DA 2V7WA 4IH1A 4Q39A 3HJFA 2JLBA 1T2FA 1SMKA 1N33B 1IC6A 1CWUA 1LC3A 2QR3A 2XCIA 2CLSA 2FK7A 4L57A 5AQEA 3T1QA 2DB3A 1XEAA 3U39A 1YOVB 5AKYA 5BR1A 1B93A 3DPIA 4C5CA 1PQUA 3HYLA 1TQ4A 4A15A 1P8AA 3G2HA 1BMFD 2FDXA 2WJIA 3NOVA 3IAXA 3P9XA 2B78A 3NYIA 4FJ2A 3GRYA 4N49A 4LFBB 1NI5A 4S3MA 3AVYA 1JPNA 4CLOA 1W4LA 1IQ0A 1RABA 5CUQA 1Q1EA 3EVZA 2WKSA 1O0BA 2CLMB 3TE7A 3A0RB 3COPA 4ROSA 4B3TB 3GI1A 3EAGA 3GJ6A 3KLBA 4B47A 2R4TA 3KR1A 3OU7A 3Q9NA 2O2SA 4UAJA 4QBTA 2JGDA 4HH4A 2ORYA 2CKDA 4ZXPA 1V7ZA 4DPKA 2HGZA 4NYJQ 4BFYA 4QHTA 2XGOA 1WW3A 2PSDA 3HN6A 2ZI4A 3P2OA 4UATA 1PO7A 1N5MA 2TECE 5DRTA 4DJ5X 1L8QA 3WZMA 3EDQA 4MMZB 3NVDA 4JJZA 3LHKA 5EKDA 4B1FA 2G8NA 1FNMA 1ES9A 4X7PA 4CZ2A 3O8NA 3TSAA 1YQDA 3ADDA 3F4LA 1A9QA 1D5CA 1M1ZA 2PU5A 4YCAA 5AK6A 4ETWA 1I3CA 1OBHA 1CUFA 1U7XA 3EGIA 1NHGA 4TSFA 3HPQA 4D2IA 1LWOA 2D5BA 3NDPA 1QO9A 2O1SA 3ZE2B 5FX2A 3UMVA 2I76A 4RYLA 3D1VA 4I1OA 2L42A 2WSIA 2Z56A 3NT4A 3H5TA 3LZ6A 4N39A 5AUQA 5FUXA 3ZLJA 1CJTC 4C1NA 2HT6A 4LISA 4K9RA 1BW9A 4PCVA 1DFGA 2G77B 3QK7A 4NENA 1RCTE 1FLVA 3ETCA 4AWBA 1VSQA 4HLCA 3K5IA 1YBMA 2RKOA 1E89A 3DTYA 2Q3DA 3N2EA 4FYHA 3VSEA 2UXCB 4NJEB 4BX2A 3JQ6A 4GBMA 2JLYA 4C7OA 2IY9A 2BMFA 1RLIA 5I4BA 3OHPA 1OLOA 4L8FA 2RG1A 3LBIA 5ALQA 4DEYA 5KTYA 1DCTA 2AH5A 3W2GA 1M0SA 1VQ1A 2V8BA 2NU6A 2ST1A 2PANA 2EQAA 2ADMA 4NOLA 2ZUDA 3A6JA 4EHHA 4HI0E 5CFQA 1A5AB 1U9ZA 2C8VA 2IYUA 2AK3A 1KBQA 3NATA 3PWZA 1YZKA 1T5IA 4KZKA 3FRIA 3DL7A 1U8FO 3K4PA 4G0XA 2ZSDA 1NBWB 4TYMA 2ZSFA 3RBAA 2JFZA 4O0MA 3RHTA 2IYRA 2FSSA 3RRMA 3WKCA 3TLYA 1MABB 5JCJD 1BGWA 4RGBA 4Z49A 5L4NA 2JCVA 3PPVA 4MINA 3WL6A 1W9HA 1L9KA 4BV3A 2IQ5A 1U2EA 3ILYA 4ML3A 1E3DA 2QRGA 4GZMA 4Y6GB 2YCBA 3T9CA 3CNOA 1F6WA 3RU3A 5LZ2A 3KJNA 1OXSC 1RMTA 1TU3A 3K4QA 3KQHA 3ZZTA 1XNRB 4U7GA 2FWMX 1O77A 1Y1QA 3GA7A 3M9LA 4WGGA 5ERYA 1C4XA 1JQBA 2E89A 1QAQA 2XHZA 3TJMA 1W36B 2VLBA 1SQGA 5K01A 4MHSA 4NDNE 3OTGA 4A2WA 2QQ0A 2R25B 1XA4A 5JCJA 1R6UA 2C29D 3EOZA 3FTPA 3H8WA 1M1NA 1TF7A 2R8BA 1KYVA 5L4SA 3ASZA 3S7ZA 1XA0A 3PR3A 4D98A 5HQTA 5AK4A 3GGGA 1ISSA 1BX1A 4UQPA 2W43A 1CUEA 3S55A 4U5QA 4CCYA 1E1DA 1Z34A 3D7RA 4N5LA 4WBNB 4ZGBA 5LCXA 3AHIA 5DOZA 3FGNA 1C9KA 1L7EA 3NTXA 3DJFA 4J0QA 1M0EA 1P2SA 1LDNA 4NOKA 1ONBA 4AAYA 4C2TA 1NVVR 5DFAA 1JKJA 4NAVA 3VPDA 2Q5LA 2VL7A 5IFLA 1I3LA 2FEAA 2EJVA 1L7PA 2RGNA 3OEWA 3ZV3A 1KH1A 1PR0A 3IPRA 3P4XA 3P9KA 4R3WA 5JH7B 3RVRA 1W35A 4YRDA 3L7MA 5CX4A 1NXWA 2X5NA 3LDHA 1PHRA 1I8TA 1SGWA 2CZQA 1TE2A 1QKKA 3H16A 1RAGA 3HR4A 1G8AA 1GPWB 1ZFNA 4Q9LA 3VJKA 1CY6A 1YD7A 3U26A 2QTGA 5BV7A 1K6EA 5JBNA 3WL4A 4XOIA 1SOVA 2HA7A 2FPUA 3E05A 1OYWA 1DC4A 4WI1A 5LZ7A 5HRAA 1Q15A 1YS7A 1ZM7A 3CLRC 3OF3A 3H11B 3AMVA 3WRWA 2YY6A 1L1QA 3TNDA 3H97A 4DLWA 2OY0A 3JR3A 3ZHXA 4QFCA 3PQ8A 4R01A 1Z0SA 3ITEA 4ENTA 2KS6A 4F5DA 1OH7A 3PFGA 3UAYA 2QSZA 2XZLA 1U1DA 4PZ0A 4B6RA 3FVWA 1HYBA 4OQXA 4ZRDA 2ILVA 1GG2A 3RUEA 3KAQA 1MA0A 3AJ8A 4H0CA 5DM60 5BUZA 5ENZA 1Y7HA 2BHSA 1C3VA 2HJSA 1K88A 2XNDA 5E6SA 3V1UA 4DQ0A 1R5OA 3QTTA 4KK3A 3QELB 4GVXA 4F5ZA 1WCWA 3PVZA 4Q9KA 2FX5A 3CONA 5E6RA 3EZXA 4LVUA 2DBRA 3L02A 5BN3B 2IU3A 4CTJA 4I50F 1DQYA 1Q0LA 4DANA 4GLBA 1OB5A 1JECA 1SU4A 4HSGA 4C3OB 2YVLA 2P9BA 2WYOA 3HCDA 2P35A 1V8FA 2YCLA 2JAWA 2WHYA 3ERCA 1W9MA 1O6GA 1G6Q1 1WY7A 3A14A 1SUDA 3HKBB 4WFJA 5EUMA 4YI5A 1JI3A 1I7QB 1EFCA 4HNHA 4CKBB 2WIBA 4HTFA 3OIWA 2Q5JA 2XBUA 3QMWA 1EP3B 3HC7A 5TQ0A 2C0PA 4H6WA 4BX8A 1DEXA 4ECEA 4OY3A 1Z83A 5ADHA 1XB2A 2HX1A 1KDRA 1HEYA 4QFDA 4B7XA 2M98A 4M7OA 3W8EA 3IUJA 4L9AA 4WNAB 4UKDA 3RW9A 1CR6A 3CH4B 3DAOA 4RJTA 4NU0A 1FZQA 1Y89A 1VCOA 3NJ8A 5K0NA 4XQEA 3IDOA 4ESHA 5FR2A 5K0TA 4G37A 2P3QA 4WKPA 3D8RA 2DCMA 2JIRA 3FCSB 3IERA 4CKYA 3OH8A 3DQQA 5D6NA 3EK2A 3WA6A 1MORA 1SVNA 4ER6A 1KL7A 3BH6A 2PEYA 2VHXA 3G23A 2FQ1A 3IEMA 4PLWA 1YL5A 3EG5A 3R9KA 3W7AA 4XYEA 4ZGGA 1R8JA 3EYAA 5DI3B 3D7LA 4K9PA 5CB8A 3PDWA 2UUCB 1SWVA 3BOSA 3FPFA 3L4KA 1L4EA 2V3CC 2VXYA 1C9EA 3GJ3A 1ZIPA 4RDXA 3PBKA 2VDRB 1IY8A 2C1XA 4XYMA 1NV8A 3ZY5A 5EUBA 3TLXA 1HUQA 1IPHA 2MMGA 2PZEA 1D4OA 2XPCA 3A6LA 3VVCA 4X60A 1H6CA 2KB0A 4DAOA 4TS4A 1R9MA 4J0KA 4N0QA 3WYBA 5B2FA 2Y0BA 5L3VA 5B7NA 4RE6A 3PPIA 4L4UA 5I7SA 1T0IA 4Y6SA 3GFTA 1U0GA 2VP3A 1IQUA 3RUFA 4OP2A 4NYIR 5HTKA 2VP4A 1X7WA 2PMBA 2R47A 1A2BA 1R15A 4MKZA 4C0LA 1Z5WA 1H23A 2EFYA 3NR2A 5I9BA 4RY8A 3DLTA 3Q12A 4ZQIA 5DP1A 1VDMA 2IZ6A 2DBVO 1YL6A 4XVHA 3BH7A 1GZSA 1DKOA 3ZDAA 1VG0B 5GMOA 1FDIA 1XN4A 1E0AA 2CEAA 3ZWYA 4PHHA 1ECLA 3VR4D 2O2DA 1OREA 3C5EA 5LU8A 5T7BA 1GRCA 5LXTF 1H05A 3V1KA 1XQYA 2I34A 4RS4A 5FCDA 1Y6FA 2MOKA 3LUHA 2J9YB 5KSPA 1CHDA 2RJOA 3VTZA 1RQGA 1T9AA 3X1XA 2QVXX 1W0KD 4TYQA 3C4QA 5CA1F 1NW3A 3C6MA 1QCCA 2AQ8A 3IJEB 4YB8A 5E7JA 2EWVA 3BE6A 3T35A 5FPPA 3ZZMA 1RC8A 1OBOA 2IQIA 3AVPA 2FFJA 4XKJA 5AHKA 5H4HA 2PBLA 1JNXX 3GMDA 3ZS8A 1DJMA 3NBQA 3NYWA 1P4AA 2VSFA 4I9FA 1EFTA 4N7BA 4J4TA 4K03A 3ZY2A 3P8ZA 4EVIA 2QMUA 2P9YA 2YYZA 1Z6PA 3DW1X 3UK7A 3K4HA 1GN8A 1SZDA 1ESEA 4E7PA 5BWLA 4DE5A 1J97A 2A30A 3ND6A 5DNUA 1E77A 5AH0A 1QCZA 4D26A 1UKBA 3SIRA 4MP6A 1JBEA 5EI5A 4F12A 2UKDA 4D80A 4G85A 3KZ1E 1TRKA 4MQMA 4UTZA 1E58A 1SUAA 1MFPA 4XB1A 4YDHB 2O7NA 2GZHA 1T1JA 4Z0NA 3CZPA 3CR7A 2HAEA 1FMTA 3EVGA 3ECAA 5KYXA 1O96B 2D13A 3G68A 3E1GA 4YO8A 1MO3A 2HCBA 2VYND 5LB4A 5L3SA 3L07A 4H18A 3GCZA 3A3NA 1WVGA 1A5SB 2VAVA 2ZBRA 3EXIB 3IEUA 3ZE7A 1S8FA 4AM8A 4D5EA 3ZVNA 4M83A 2B83A 1GQOA 3ENNA 4UEWA 5I7RA 3ZD6A 1S9DA 3CNBA 3CR8A 1GV0A 3PR2B 3N5KA 5LWQA 5IAKA 1MAAA 1JG7A 4MUGA 5H02A 1FXWA 2R97A 1NW5A 1CQJA 4JL5A 2Y1GA 1QVAA 6REQA 2DFLA 4LI0A 3BILA 3GXBA 1NPDA 4H1TA 3SQWA 3A9WA 4OJKA 3TOSA 1M75A 3AR4A 4HS9A 1U8CB 3HCEA 2HH9A 2P40A 4QAQA 2NO7A 5LP6A 1GPH1 4G0WA 3DP7A 4YRFA 4QU0A 1QNLA 2CLLB 2PFSA 3AL3A 3P4UA 4NECA 5KYWA 1PZHA 1GU1A 3KEGA 1N6LA 1UPBA 3GFFA 3NV9A 3QJ5A 3THYB 4NCBA 1W4AA 3C6BA 2PWBA 1N6PA 2AZTA 2QG4A 3PE6A 4TUYA 1SHJA 1Z5VA 2YUTA 5MN5A 1Z5ZA 5JQGA 2X9QA 4H7FA 1KOJA 3CY6A 4UM9B 1ZJ5A 3MMXA 4HUTA 3G5MA 4E32A 1SC9A 1N2CB 4PPFA 1MH1A 4LVNA 3CLUD 4R6XA 1IY2A 4TT3D 1XPUA 5JFOA 1EUDB 1PYGA 2MYPA 3DE5X 5FUQA 4OIFA 5IUNC 4OQQA 4LHXA 2F6RA 3PXDA 4PSAA 4C4YA 2Q8PA 3OM9A 2Z09A 1SU7A 3VPHA 1XTIA 1CHNA 5HR5A 1JMKC 4NH0A 4OHWA 4ETIA 4XUGB 5KSZA 4KB5A 4DPLA 4ABTA 2VBCA 3COVA 1NFQA 4U6NA 1E7YA 2XH8A 2ASVA 2JRLA 2GJ8A 4AYWA 3DM9B 1S3GA 2OD9A 4YI3A 3A3KA 3GRVA 3LU1A 1UK9A 2WSSD 5EIOA 2VZEA 4A8TA 3GJSA 1OYVA 3JXEA 4O0LA 1HNXB 1TW2A 3EHDA 3W9BA 5JR3A 1PEDA 5LOVA 1N9ZA 3S8YA 4R2HA 1W49A 3NIBA 4R83A 3DHYA 5LQUA 3DZJA 4GWLA 1E9FA 1MJNA 3VOBA 1QH8B 3OZDA 4OYLA 3FDZA 2V59A 4K3UA 1S01A 1WCXA 4GR9A 1YA8A 3LCCA 1K63A 3TZLA 2ZJBA 3LG2A 4KWCA 3F5QA 3NHYA 4OO3A 1AC5A 2V6JA 1R6TA 4G25A 1DI0A 3JD0A 1R5NA 1VIDA 3CVOA 2NW6A 3E9RA 2VOJA 3M49A 4H7HA 2A9FA 3RK0A 3TLMA 3AU8A 3TG8A 2O5VA 5J2UA 3H19A 1UC4B 4GPEA 4DDVA 5HQ3A 1RXWA 1RYDA 3BD8A 2HK7A 2H1CA 2X19A 4Q48A 2CUNA 3CKKA 2AOVA 3LUJA 4ZEVA 2NACA 2QAGA 3GDFA 2H1HA 2YN4A 1Y80A 3GUZA 1F9EA 1GRVA 2G7MC 2FLVA 3QHAA 1N5DA 4MRAA 3S99A 4RTQA 5A6SB 4FFMA 5FI5A 1R4NB 2IPAB 3SXUB 4OMFG 2XV1A 3CVYA 1LB1B 1E2JA 4JR2A 4BFWA 1LC0A 4BFZA 4W5QA 2FMTA 3FMVA 1YZLA 3LX6A 4KMOA 1H3NA 1TO2E 4UE3S 2C9BA 3ZIUA 1P61B 2O1WA 3NP9A 5FUBA 5DGIA 1R4MB 3EEFA 1WQ4A 4ZEMA 2BM9A 2WJPA 5E2AA 4ZJUA 4L4RA 5IH3A 1RWOA 4I46A 1XNJA 3WL3A 4CV0A 4QC2A 1U0OC 4ZVQA 6AT1A 4JYMA 2QE7D 1E0KA 3CGGA 3NHMA 4WOPA 3QX9A 3ZU2A 2R1TA 1TK3A 4MK4A 2C7VA 4TXMA 1FDOA 2VP9A 1GZ5A 4ODIA 4BOYA 3ICEA 1CXZA 1PUXA 4LOAA 2JGRA 3U7FB 1PBNA 1O03A 2BFDB 2Z2XA 3V4ZA 3VVBA 2Q5HA 3AW9A 1OR8A 1N75A 4MGEA 5JDCC 3ACDA 4I3GA 3WIOA 3DKVA 3V7FA 4HWRA 3VNUA 2EIXA 1E63A 2GZ2A 3M6AA 4PM4A 4GNRA 4H7EA 4LZPA 4UMEA 5CVDA 3H9QA 4KXWA 3DNFA 3QVVA 2VP2A 1H1TA 2RONA 2IXDA 3C70A 3OM0A 1N5OX 1G20B 1XGKA 2EWMA 2WU0A 3UY4A 2V7PA 4AZWA 4P0PB 4JX8A 2YHIB 2RJ3A 5FBRB 4AJ9A 3KSUA 4ZMRA 5FL3A 2FH5B 5KU7A 1IZZA 3NHPA 4PLYA 1P1CA 1RPJA 2J45A 3EVEA 1V71A 1A9XB 1RI5A 1K6MA 2P0EA 2XNSA 1I32A 4FFWA 4K9SA 4DCCA 3CN9A 3NHAA 1H9BA 3QYAA 3V5NA 4PTYA 4RFLA 4PU0A 5T5QA 4M49A 1Z63A 2Z58A 4JQSA 3LSTA 2A8YA 3WLNA 5I4CA 4UPDA 1WMFA 4TQ9A 1UWLA 5IG2A 2QAIA 2G1JA 1CJKC 2O3JA 4MJ3A 1GVNB 1J06A 1PWHA 3FWPA 1DX9A 3W3AA 2V3WA 3D6HA 2QOEA 4BEVA 5HE8A 5KTKA 3L4JA 4AG6A 4BHTA 3E84A 4R71A 4DEXA 4HX2A 3ZJ4A 5K0EA 5K8CA 3T3OA 3NQ41 4UHBA 4ONEA 4A16A 3ZWAA 1XRLA 4EF6A 2NN3C 3PUXA 3GCWA 4MCIA 3GFVA 3K6RA 4U8GA 3WIEA 1KEEB 3D8TA 1DJOA 3OLWA 4IV0A 4LYEA 2ZUUA 1T36B 3VAAA 5JS6A 1NP6A 3GVCA 5HF9A 5KJFA 3N8DA 4RMIA 1SOUA 2OXEA 4IVRA 2RI6A 1D2NA 3WRVA 1N7IA 1PZEA 4FQ5A 1OH5A 2DC1A 3CLRD 5ARDA 4I5FA 4BECA 4JFRA 3D5EA 3FZYA 3TOVA 2ZWPA 2Q4RA 3CINA 1H66A 2XIJA 3E03A 3EJ6A 1KC1A 3Q72A 1I4LD 4ILKA 4JNCA 2CDCA 1S6YA 3QI2A 4YJ2B 2JCGA 3GO4A 5KX5B 5FXMA 1GZ4A 4FYXA 4JGIA 4ZDWA 1KEUA 1NMZA 1VLVA 5BN4A 2V96A 3RIHA 2H5LA 2FTKE 3AUAA 5ALWA 2GO7A 2FYTA 4K05A 2JIZD 3LUFA 3Q3EA 1A4XA 1JDSA 2VUTA 4XGIA 2F3SA 3THOA 3L92A 1NQUA 4PHFA 1DRVA 3KOUA 3HA5A 3LT0A 2OQ2A 4M60A 2OT3B 4F4UA 1B15A 1VBFA 1W8IA 5I7FA 1ONPA 4MYTA 3HJNA 5F21A 3PDIB 3TR0A 4A0RA 1QH9A 2PEZA 4CL0A 2PAFA 1QS0A 2Z4TA 1VGVA 3OA2A 5CXQA 3E3LA 1R2QA 4Y0AA 5BNFA 3CUSA 1ECGA 4ME6A 4R1PA 1FXUA 4HUQA 1EUYA 2XZDA 2CLEB 1DAGA 5BV8A 1CB7A 3LY7A 2H5IA 3H9UA 2NXEA 3OM1A 4QBKA 4EMUA 1NHWA 1W0JD 4F92B 2QPAA 5K0JA 1YR9A 1BN7A 4QG7A 3KYJB 2P62A 1BSVA 2RBEA 1KI3A 2LP4Y 1XZEA 4B4DA 5JSZB 4AZ0B 2EFJA 3IXLA 3LAWA 3I53A 4G5HA 2E3JA 2DHDA 2Q4EA 4UBJA 4B8ZA 4CEIA 3U60B 1N2SA 2WT9A 2C57A 1QP7A 4EA9A 4S35A 2Z1DA 1SKYB 1M54A 1PVOA 1BQEA 3HA7A 3L6BA 1EEHA 1ACLA 3OX3A 1P0IA 1N7HA 3IR6A 3EZ6A 4LXUA 4BFTA 5FTNA 5FUMA 1YMVA 1RAEA 2PE5A 2WIFA 3A9CA 1IONA 1SPXA 2GHRA 1TEHA 3IBCA 5JAZA 3NCTA 3VPSA 4DM4A 1IZYA 3JD2A 4OP3A 3KCQA 1JL3A 4UCWA 4JENA 2XODA 1L5LA 3MERA 2JJ2D 4JVSB 2EKBA 4LWZA 4POOA 4IXWA 3NETA 4ZCLA 1SUIA 4DJDC 3VOTA 1BGVA 4DSTA 1M74A 2WDZA 1PJAA 2FUG1 2Q5CA 2Z9CA 1E79A 1XYGA 3SXPA 1SUWA 2CF5A 3QEOA 3RVSA 2UU9B 1SURA 2H1OA 2ZRQA 1JQJC 1NDHA 3LZDA 4FNGA 4ITVA 1DKQA 2I3GA 1QK5A 2YYAA 3DZ8A 3E4CA 4MIYA 3HBJA 2C0CA 3MOIA 3FKSD 4ZARA 4E5DA 3PFKA 1ORVA 1Z22A 4EQ6B 3TBFA 1A69A 1C80A 1U3CA 2F00A 3E70C 3JAKA 3DUFB 1G64A 1U3GA 3ZHTA 2BDUA 2WR8A 5JAPA 3DLHA 3DP9A 4RF4A 2CVFA 2FEXA 1E92A 3AGQA 4AL4A 3Q5EA 2DZDA 4XRGA 3AUSA 2ZUTA 4NG5A 2OPHA 3HUUA 3IDZA 4IYRA 1TMOA 3JQ9C 1DAOA 4DYVA 2O8DA 3FROA 4FQ8A 1WDLA 4QGGA 5DLEA 4NU5A 2IDKA 2HDOA 4OKIA 4BUJA 5A0VA 1V0JA 4UBMA 5HIKA 3MCUA 4KR9A 2PSHA 5H7XA 4XWYA 1DZ3A 3FWZA 3H18A 4RTKA 1PDVA 3X2SA 1LBQA 4W4TA 2H92A 5HJEA 1QV9A 3I9OA 1XE3A 1GQYA 1K86A 2YXNA 1H6BA 4YECA 5GONB 5IU6A 4IF4A 2HF2A 1FE8A 2HD4A 1S4QA 4RH3A 4CMJA 5JNWA 2CZGA 1CY7A 2XYVA 2HU8A 2ZRLA 2Q3CA 3EPRA 2H5EA 4QQNA 1L5QA 1GGMA 3UKOA 4FYIA 4UASA 1CIJA 3U9TA 1NSTA 1SEVA 4RTRA 2DULA 4I3HA 5JSQA 2HSGA 1S5PA 4GMFA 2YBEA 3IESA 3LQ2A 3P45A 1M8PA 1MO6A 5CDYA 1AGRA 2XYQA 4TRJA 5C8XA 1FTYA 4P31A 5JG7A 1G5RA 2IHBA 2VT3A 3GFOA 1UT6A 1F2VA 1MVNA 2W71A 4LF5B 4AUMA 2RIRA 3DMDA 3KELA 4L3WA 1TI7A 4PVCA 4ZT4A 4R3NA 3OCWA 3RGWS 3HV0A 4DXHA 1SUSA 4NV1A 1P17A 4DCUA 4QU8A 4MVJE 4KWHA 5B3KA 3CZ9A 3HV2A 3MJRA 1ZZEA 3ILVA 2Y92A 3OE4A 4IHAA 5B3JA 2ZU0C 1VXOA 5CRIA 4NMMA 3V8VA 5BOSA 3A6DA 3S81A 3PFNA 4QATA 1HLGA 1C7RA 1FNSA 2GVDC 2P0AA 5HF6A 2J4CA 1P19A 1RJGA 2D7JA 3D7KA 4AFNA 5DSTA 1BFDA 2CCGA 4WWHA 4EHIA 5KVVA 3AL0C 2FPIB 1TT7A 3L0YA 5KWSA 3TXYA 3EQ9A 3MTJA 2ZWVA 3H1FA 2D0OB 2P2CA 4E1AA 1RZRD 3LPNA 1BS2A 1FFWA 1NBME 5DT2A 3TIIA 1THGA 2ZI6A 1QOZA 2VT6A 4MUHA 3DV2A 3AIIA 1Z17A 2PNJA 3TGPA 4UZFA 3SYMA 1OX6A 3WK6A 1BEZA 4YUVA 2I78A 4OQDA 3JX9A 1ONOA 3WK5A 4YV1A 4JLKA 3L0ZA 2OZLA 3R3UA 2Q8QA 4FMPA 2QPLA 2D0DA 2ZYDA 4AECA 3H1TA 4HDRB 2CXHA 3OZ7A 4BLSA 5J4YA 4OX9B 2PH3A 2VTKA 2YMMA 3EXG2 4PFQA 1RKVA 3UPUA 3TLEA 2CFSA 1UFQA 2PSEA 3IHLA 3AJAA 1GKLA 4FE4A 3PQ7A 2RFLA 2PYIA 1Z74A 2B1IA 1T9DA 2NT3A 1EB9A 4FWIB 4D9IA 2P2NA 3LUAA 4V0NA 1L3IA 4YNBA 2G63A 4E7OA 1Q0UA 3KEFA 4X3CA 3FBWA 4HD8A 3SJZA 2JJYA 3V6MA 4L9WA 2YFYA 3BIJA 1FFDA 2CMKA 3M6MD 2HLDD 1E7MA 3ER6A 3KC2A 4DRZA 5IBPA 2QTWB 1MKYA 4L50A 5D2CA 2BMEA 2OFPA 1FVOA 2HGSA 1U3VA 3R0ZA 4LJ6A 2OCPA 1FA9A 2X9GA 1SKAA 3WMGA 4E07A 2ZSBA 3IAHA 5K3SA 1QRRA 2BFCA 2X3YA 1KMIY 1V11B 3UCXA 4PAOA 1KOLA 4CF5A 2JGLA 3UMRA 3L7CA 3M34A 3NKLA 2BR3A 3D43A 4G86A 3FVRA 4M9QA 4EB0A 3BL5A 2HLPA 3VHXB 4AJLA 3FRHA 5FKJA 4L2IB 2IHJA 4ND6A 3TPFA 1V6CA 1YE8A 2XUQA 1RHUA 3IP5A 3DAGA 3B53X 2ZYWX 1V5WA 3PEVA 1CG6A 4FCTA 3HXTA 4PZYA 4R7GA 1NE2A 4C3VA 4E5NA 5I51A 3JZIA 3UTCA 5C9ZA 1M2VA 1TGYA 1SQ0A 1Z4MA 3AG5A 3ASVA 3H2KA 3V6LA 6CHYA 1QHFA 4B7ZA 4BVBA 4FE7A 4RA9B 1WAMA 3S40A 5T4FA 5CH5A 1PZGA 2GYYA 1V1RA 3OP4A 2VTBA 3NT2A 5EXXA 3NKFA 4OBBA 5ALJA 3D2CA 1H42A 3I3OA 3WX0A 5B1EA 4B6GA 2CUZA 3GZJA 3KQNA 1I5OA 3HJRA 4FSHA 3UEOA 3JVDA 3H11A 1Q3TA 1EI9A 1Y8QB 3DO5A 1TZBA 3CUTA 4Y2GA 3SVTA 1RWVA 1YZQA 1YZUA 3SC2B 2G17A 4FMDF 1QQTA 5LWHA 1YDFA 3QE9Y 4QPNA 2I87A 5JIBA 1UDAA 2F8MA 2NNWB 2ZJ7A 3SYNA 1VLJA 5DHQA 3UHPA 2AOTA 2H8GA 4G0VA 1VPTA 2JZOA 3ZI4A 1KRHA 1T0UA 1QVRA 3MYYA 4J43A 3A9RA 1HL3A 1I5RA 1MQ8B 1Q0RA 3QFCA 4JP2A 4K6FA 1Q7CA 2P9FA 4MWEA 4XWAA 3VI4B 4YK7A 3X2FA 4C0QC 1DB3A 2XRYA 4CKBA 1KP9A 4RM2A 2QTZA 4B4UA 5IT4A 2QRLA 3G5LA 1IH8A 1NQAO 2C88A 4C6TB 1IBMB 2GBLC 1NZFA 4PZLA 5KYYB 5EYPA 1YFJA 1Y5MA 4EO7A 3B52X 1DV2A 2XXBA 4GKVA 4OU5A 3HKEB 3GLKA 3HKCA 3AR5A 4J16A 4Y2PA 1GNSA 4C30A 5M2QA 2OYSA 1A2OA 2RKBA 5KTPA 4LMBA 1D1PA 2RGXA 4ALNA 1B14A 3VZBA 2I3DA 2D3WA 2M6KA 3S6JA 4CG1A 3OPQA 4MVCA 1ADFA 1JLLA 1YAHA 1X70A 3AEXA 3LOQA 4IIJB 4N5IX 4A0QA 4C7BA 1QF6A 4M9UA 4J1SA 5KQLA 4PQEA 4FI3C 1M1XB 3ITNA 2J48A 2YZ2A 3BSSA 3DOHA 4RXMA 1U8AA 3F46A 2F1IA 3SQOA 3SBEA 2R1TB 3EDOA 4V3BA 4FT2A 2EP7A 3VPBA 3C1OA 5JBQA 4LJYA 5DHTA 1TYBE 2VHJA 2Q07A