4F38A

Crystal structure of geranylgeranylated rhoa in complex with rhogdi in its active gppnhp-bound form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/chaperone
molecule keywords Transforming protein RhoA
total genus 56
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f38A00
5CK4A 3IGFA 3ECCA 3EZFA 4NMMA 2JLUA 4OBEA 2O8FA 2CVHA 2B6HA 1NY6A 2QI9C 4MDFA 1S9HA 3MSXA 2DFNA 4L8GA 4QGAA 1JI0A 2R6DA 1FX0B 3GJXC 3NXSA 3HP1A 4Q7JB 2REXB 1RZ3A 3HPQA 5AJXA 1D2NA 2Q9AA 1E4VA 3QOFA 4HAYA 1KO1A 3FGNA 2XJ4A 1W5SA 2J3EA 3BS4A 3FMOB 1KNQA 4LPSA 2F1HA 1ZUHA 2BMDA 1KTVA 2QT1A 2C2HA 5B2ZA 5AUQA 1Q20A 1KSHA 4LV5B 2GK7A 4LRWA 1NNEA 4TQAA 3QNUA 1SVWA 1ZBDA 1XD8A 4HAXA 3AVYA 4EDHA 3DMDA 4KODA 1E2LA 2O8BB 5JEEA 2AXNA 2WJYA 2WV9A 3IEVA 1ZM2A 3K53A 3DZDA 3OEHA 1ZJ6A 3D31A 1TEXA 4TL6A 3I3SR 3LVQE 1E2EA 1XWIA 2G77B 2ODEA 1JXMA 3AVUA 2JLWA 4KO8A 2XZLA 3DL0A 5G3ZA 1QF9A 4KBGA 2VHUA 3B5JA 1E9EA 4MRPA 3UPUA 4II7A 5F2EA 4M8NE 1G17A 1U9IC 3AVPA 1W44A 1T91A 2V55B 4Q1BA 2ZRMA 4JLBA 3W3ZB 4A6XA 1WBDA 2AKYA 3CUEF 3R9IA 1CR4A 2C9YA 2DYKA 3B60A 3QKSB 3CW2A 2XGJA 1GNRA 3P20A 3Q85A 4AD8A 3KXKA 1W36C 2YWFA 3U7GA 1CJVC 2QBYB 3GLFA 5EP3A 2QGZA 3ZYCA 4Z54A 2XTZA 2KB0A 2XOKA 1FTSA 4MKFA 3K09C 2EW1A 4BZPA 1KKLA 3UWOA 3C8UA 1NSFA 4IEEA 3JZMA 4DDWA 3FMIA 3U6BA 4ERNA 4QG7A 3X2SA 1X8KA 1GG2A 3SN6A 1UKYA 1F5NA 4ZV4A 2A5JA 4MYCA 3GLGE 5KSOA 3RS7A 2H1LA 2G88A 1E96A 2NTYC 4CT5A 3HYTA 5J47A 5GADl 4BFZA 3GEEA 2CJWB 4FWIB 4IOMA 3AVVA 4DDUA 3FFAA 2D3WA 2REBA 1KK1A 1RPZA 1XD2A 3GJ8A 1Z6YA 4A0GA 3U7FB 1WCV1 2X77A 1E2JA 3W8RA 3QF7A 2CEAA 2QE7A 1VHLA 3VU9A 3KZ1E 2RHDA 1X1SA 3SJBA 3SI7A 4DKXA 1AKYA 3BOSA 1G9XA 4PC2A 1W47A 1NVVR 3AP2A 1VPLA 4Q9HA 2VSXA 1CR0A 1J8YF 2OHFA 2VSFA 4NYMQ 1A4RA 4HB4A 3RNLA 2J0QA 2Z5FA 2OLJA 3SDZA 1G6OA 2BKUA 3KKOA 5DIFA 4LBVA 2JASA 1T3LA 2OBLA 4F4CA 1E2MA 4F4JA 2YJTD 1G8GA 5JSZB 2WPDD 3MWYW 2ZJ2A 3HU1A 4QBFA 1IAQA 3LQRA 4JLMA 4AC9A 2LCFA 2QPAA 2G1KA 4IFBA 2R6AA 2PZGA 3O47A 4YDHB 2G1JA 3PITA 4DSTA 1SVKA 3F3YA 4DT1A 1F2TB 3PUYA 3UATA 4PHHA 4FN5A 3CRVA 2WMNB 1NIPA 1U99A 4C0QC 5FR2A 3A1WA 1TQ4A 1JR3E 5EE5B 4Q1FA 4HB2A 3O8CA 2WM9B 5L3QA 3NDBB 4FXPA 3BE4A 5K8LA 4OK3A 3PEVA 1K8RA 3SBEA 5J4HA 3QXJA 1P4SA 2R65A 1YVDA 3DPUA 4C9BA 1OH5A 4TLEA 1SVMA 1OKKA 1ZINA 1NSTA 2W6IA 4J0QA 1CR1A 1TAGA 5JJKA 1PLLA 2FOLA 1P60A 1GITA 1Z0FA 2MSEB 2WWWA 2JLVA 2X19A 3FHCB 3LD9A 1Z22A 2B8WA 4M9ZA 3BRWD 1CR2A 1F6BA 2ZS7A 3QPVA 1VG1A 1K5GA 2FMXA 4JT4A 1GP2A 3A4MA 1N6LA 2IWRA 2PT7A 1Z3IX 3EZ2A 4JKYA 1YKSA 4XH9B 3K0SA 4RVCA 4NPHA 3T5DA 1NG9A 1F48A 2VP6A 2CE7A 1J70A 2JJ8A 2PX0A 1G19A 2ZM5A 2C5LA 4PPFA 1TL7C 2D4HA 1OKKD 2MSCB 2W6ID 4LC1A 4URZR 4NBSA 3U3MA 5HKKD 2OXCA 1AJEA 1YR6A 1G7SA 2FF7A 5M04A 1XZQA 3RWOA 4YDSA 3SYNA 1SZPA 4GNKA 4UNNA 4YQFA 2CK3D 5JHHB 2L0XA 5DLQC 4DSUA 5FPYA 1L2TA 4IW3B 3B8HA 1CTQA 1YZNA 4GZMA 2A9KA 5JI3E 3GLGA 5SZIA 1D6JA 1Q44A 4JVSB 1KSGA 5GJCA 1SXJB 2IYSA 3BIFA 5EQTA 2JDID 2P6UA 4TT3A 4V02A 1IN7A 1E9SA 4PPNA 3X1DA 2KBFA 3GLHE 3VHXA 1AZTA 4V0OA 1N5IA 3SS8A 3W9YA 4B76A 4Z8YA 1CXZA 1ZMXA 5TMPA 4B71A 2ZAMA 4JL8A 4C3ZA 1ZNWA 3RYTC 2PT5A 4EKDA 2E9SA 4KLNA 1XTRA 2FFAA 2O8FB 1OYWA 4A6PA 1U0HC 1VTKA 2B8TA 4GPTA 4QGFA 5AUOB 3MAAC 4WW0A 3PIRA 3EW9A 3THYB 4URYR 2QZ4A 1T5LA 4HLQB 4TSFA 4ARZA 3TSZA 4QGGA 5JZVA 1DADA 3FB4A 2WSSD 1AQYA 1WXQA 3X1ZA 4DSOA 1VCMA 1VG0B 3GEHA 2VBCA 3P4YA 1XBTA 1NKSA 2F1JA 2F3TA 2J0UA 3S1AA 2D7DA 2O8DB 4MGIR 3OAAD 4PZLA 5DHFA 4BFUA 3NWJA 1NN3A 3EZ6A 1FNMA 4TQUS 1RRPA 4NZYA 1RRCA 4V0ME 1JQLB 4TMXA 1W7AA 5FUWA 2RHMA 1AGPA 4OJKA 4LYAA 4PC7A 4TMTA 4L15A 3GCGA 3KDSE 2WJIA 1L7VC 1SULA 4ASUA 3UMSA 2I1VB 1IN5A 4C0JA 3HPRA 4POAA 4LYFA 3RSLA 4N0DA 5EXPA 4PQYA 2AD5A 2BVNA 2HCBA 2IS4A 3V9PA 3ZD6A 1TF7A 1AS2A 3Q72A 4OHXA 3W5IA 1WQ1R 3GJ7A 5D3MA 2IYLD 4TMWA 2HJGA 1UEJA 2VH5R 2VTKA 1ANKA 4Q7KA 4UKDA 2FJUA 5IK2A 1E2PA 4FD2A 4BLQA 4Q9KA 1H65A 4DXAA 5FTJA 4MRRA 4GP7A 1XMVA 2ZJOA 4RCYA 1QZXA 4GFDA 1TU3A 1UM8A 3OFND 1SKQA 2RB4A 4I99A 3CPHA 1EG7A 1ZNXA 2XTMA 2Q21A 4JSTA 4FCVA 4OHVA 2RGEA 4MYTA 5BN4A 4D6PA 3BC1A 1M7GA 1U2RA 2KI5A 3VFDA 5FUXA 2DHRA 2VO1A 2ZRBA 3THWB 2OILA 5K8TA 3OZXA 4M9XA 2KWIA 1TMKA 3NHBA 3PQCA 1GAJA 1TF2A 1NBMA 4EPXA 3BFVA 4F7WA 4NYJR 3E5HA 3SJAA 2IYRA 3EA5A 1ZCBA 3ADDA 3SBDA 1G4UR 3P32A 5KSZA 2AX4A 4PAMA 1E79A 2QPTA 4M53A 4ZKDA 4P3YA 4B2LA 1W2GA 4XVUA 4R7ZA 4NCJA 1TF5A 4IKEA 4NCNA 2FSFA 3U3JA 1R5OA 1ZP6A 5DGXA 1L8QA 4TLCA 4B6FA 1OFHA 1RFLA 2QU8A 2YZ2A 2GETA 4PQRA 4C30A 1N5KA 1XJ0A 2EFDB 4QL3A 4O0MA 3QPUA 2BM0A 2GJKA 4A4DA 2QT0A 4EIWA 4LZZA 1F2UA 4RD6A 2QP9X 2GKSA 1CJKC 4Q00A 4M1WA 3Q7PA 2G0NA 3A1UA 1PJRA 3RRMA 2WSMA 1YR8A 1J90A 1YZUA 3KJGA 4PO9A 1E2GA 1XD9A 1DAMA 4Q1AA 1L4UA 1UJ2A 3R7WB 2XJ9A 4HYYA 2ZJ5A 4C7OA 1CU1A 1XEWY 2BHRA 3T1OA 5AJZA 3M6AA 2EYQA 1EWRA 3ZZ0A 1J2JA 2WJJA 1W48A 3RS3A 3W3AA 2FG5A 2J7KA 2Q6TA 521PA 5K8UA 4RFSB 4RCZA 4N1AA 5JWRA 1ETUA 2F6RA 1U0JA 3K70D 1SHZA 1E9RA 1NVUQ 4NL4H 4R9UC 1S96A 1UDXA 5EZ6B 4AKEA 2HV8A 2GILA 4B74A 5G40A 4D4MA 5IHPA 3F5FA 3U61B 1KOFA 3BERA 4AWXA 4YMUA 4BRUA 2ZTSA 3DVLA 3OE7D 3SU8A 2ODWA 3F0TA 3AKDA 4NE2A 5EP1A 2BEKA 3DM9B 2CLSA 4M21A 4ZIRB 2IHBA 2X1VA 2YNMA 4P32A 2KE5A 3I61A 2ZPTX 2ZRKA 4KBFA 2P5SA 1N0UA 2BBSA 3LXXA 2ONJA 4LBZA 2BDTA 1E99A 3ND9A 5GVRA 1ESMA 3CWZA 4MRNA 3WNCA 5K8IA 2GJAA 4JIMA 2V3CC 8OHMA 3BB3A 3FWYA 4ACAA 4B33A 3B1YA 2FH5B 2QM8A 5D3QA 1M2OB 2ZRFA 4JL5A 3EASA 1DAHA 1M74A 3KQNA 2R2AA 4G5QA 2B7CA 5L3SB 1KSFX 5TVKA 1EGAA 4RD4A 4D25A 4X8MA 1E2HA 3BGWA 5TXGA 4A8JB 1H8ED 4OHZA 3CX8A 3KL4A 2FZLA 1MH1A 1W0JA 3C5CA 1UF9A 3UANA 5FOTA 1GM5A 1W4RA 1FOEB 1ZNYA 3BJIC 2XOKD 1GDDA 3FHTA 1IBRA 4DLXA 1EX7A 1RKBA 4EAQA 1OH6A 3UK6A 1ZIOA 2VF8A 5JS7A 2K5UA 1II9A 1VHTA 2EFEB 5JCZA 3U3RA 1LF5A 1HTWA 1OPXA 4LC0A 3NTUA 1I2MA 5KSPA 1M8PA 1XJCA 1Z8FA 5DN6A 1HQYE 1I4LD 2HDNB 4Q7LA 4QKQA 3TUIC 4JLOA 2YKGA 4MDEA 2O8BA 4TYYA 4XWOA 4RSGA 4MGZR 2BMJA 1OB2A 4DCVA 2GF9A 1Z5ZA 1XEXB 1US8A 4PAQA 1ZUIA 3TIFA 3HWSA 3IEUA 1H8EA 2W2TA 4MH0R 3DMNA 1JALA 4IDNA 3UMFA 1TUEA 4RY2A 2FV8A 4DB4A 4MKIA 4URWR 1KI9A 1KO5A 1T0HB 2WOOA 1P9NA 3L82B 2I3BA 2WWFA 3C4JA 4Q4LA 1AA9A 3VKWA 4ABYA 4CEHA 3QPWA 5FOSA 5DH9A 3KJEA 1EFHA 4NU0A 1XXHA 1Q3HA 4JBXA 4HUQA 2NPFA 1MKYA 4U02A 4TSFD 4DIDA 2PBRA 1XRJA 1UBFA 1AGRA 1LS6A 1NJGA 4GMXA 3A1VA 4JBWA 2GBLC 4ZDWA 1Z06A 1G64A 3AH8A 4Q9IA 3I62A 3FKSD 2EVWX 1LFDB 3TVTA 5FPTA 2QMHA 4Q9JA 4M1MA 2GCOA 2PLRA 3ETLA 2KSQA 3C15C 4C0HA 5EP2A 3K09A 4QNRA 1UBGA 3K0AB 1JJVA 1OHHD 1XXHE 4PX9A 4TTRA 1JPNA 1KI3A 3ZS9A 2O0JA 4Z1MD 1DG1G 5FBVB 3QUSA 2RGCA 1T3SA 1DTSA 2XNDD 2TMKA 3B13B 4PZYA 5A4JA 2CVFA 2CBZA 1IOZA 3B82A 1VYVA 1N6IA 4GOXA 4DLUA 1R6BX 3JVVA 3NIBA 3EC2A 2IF2A 4I1VA 1ELOA 3RRYA 3N2EA 4GP6A 2QAGC 4LOAA 2H57A 4DCTA 3GFPA 3HU2A 4LJAA 3KTAA 2QUZA 1CJMA 3K0EA 4OL0A 2DFKB 1S2MA 1JBKA 4D4LA 1PVOA 5TDHA 3T12A 4LWZA 3TW8B 4DCNA 4CYMA 2ZIAA 3AF2A 4A0FA 3RLFA 4A2PA 1DAEA 1OW3B 3ADBA 2GZHA 2CXXA 2ZI4A 4G5SA 4LJ4A 5C4MA 3U4QA 1U9IA 5KOYA 3HR8A 1BIFA 2PZEA 3RRNA 1Y63A 4LJ8A 2PCJA 1OFTA 4ACBA 4CEIA 1IHUA 1XTQA 1C4OA 3LBHA 4DC9A 3T35A 1N3BA 1XJQA 1O3YA 3EC1A 1PLJA 5B30A 4P0TA 3IILA 4B2IA 5HR5A 4ARZB 2ZRNA 1E9DA 1ZCAA 4Q4HA 4BFSA 3FTQA 1NBMD 2REOA 4XIGS 2UVQA 3FKSA 2QSZA 3EZ7A 3KQLA 4BPBA 2R6GA 3VX4A 1XCGB 2FN4A 4YONB 3WRYC 4A0HA 3KUDA 1KAGA 1VDZA 421PA 5E3HA 3K9HA 3QENA 3MCAA 1T9HA 1Z6TA 1E9AA 2W2XA 2PJZA 2ZI5A 5KDOA 3ZVNA 3WMEA 1XF9A 3ZJYA 2BM1A 3WP1B 5JLJA 1JR3D 2HXYA 2WICA 1OXVA 4JJZA 1AM4D 3DOEA 3IQXA 2IF0A 1G3UA 1GFIA 1ZC3A 1HUQA 1ZRHA 3R8CA 4CDGA 5E7MA 4B44A 3CZQA 4KAXA 3KFVA 2OZEA 5F9HA 3K0AA 2OAP1 4R2IA 4RZ2A 2O8EA 2ZE5A 4HB3A 2OE2A 3K0FB 4HDCA 4RKFA 3ASYA 2E87A 2F9LA 3BORA 5AJYA 1E32A 4W5JA 1WP9A 1XTJA 5FBRB 5L3RA 3VR5A 1OH7A 1HURA 5CLQA 4BZQA 1G4AE 3THXB 3UWKA 1DBSA 1RRGA 2CCJA 4A8JA 3EG5A 4TYPA 3PUXA 5DI3B 1YZTA 2N46A 3B9PA 4WIAA 3UIEA 5J4LA 1UPTA 2I4IA 4AYTA 4B32A 1GKUB 2IC5A 3S1AB 2C96A 3K0CA 2HUPA 5E4FA 1BOFA 1DAFA 2XNSA 4PR0A 2VQSA 3RABA 4B3GA 2ANBA 5DISB 3TVDA 1BYUA 1KO7A 4CT4B 1NMZA 2WKPA 2V9PA 2CL0X 2JLQA 3UG6A 3FMFA 4PC1A 2C03A 2CL7X 5G3YA 4EQ6A 2OT3B 2RH5A 2ZE8A 3LVRE 5AR1A 2A3RA 1XTKA 5C18A 2D62A 4KSCA 1ZC4A 4BFTA 3VAAA 5KTYA 2EFCB 4P4SB 4LSGA 2ZYWX 121PA 1FMJA 2W00A 3LFUA 2AFHE 1XP8A 2ZI3A 3CNLA 4OI1A 4BLPA 2GXSA 3SOPA 2GXQA 2NGRA 2ZI6A 4DVGA 1M7HA 1X6VA 1XMSA 2MMGA 1E1RD 3KB2A 2V7QA 4UJ5A 1YJ5A 5EUMA 4HUTA 3KB1A 4LHZA 2A78A 2EQBA 4AKGA 4G0NA 1PLKA 4M1KA 1V43A 2W83A 4EFMA 1KDRA 4XD7D 2Z43A 2XITA 3NG1A 1VCNA 2NZJA 5IK2D 2IUUA 4U7DA 4P4UA 2DFLA 1JAHA 2HXSA 4A2QA 2PMKA 1P73A 3HU3A 2G83A 1XPOA 1IY2A 1V5WA 1VYTA 2Z4SA 3PR1A 4IDOA 4DEYA 3AKYA 1P75A 2ZUDA 5CIQA 3T1QA 2P5TB 1Q21A 1T8UA 3B7GA 2FPLA 3SQWA 2AKAB 1U8ZA 1UFQA 2QNRA 4JT2A 3B85A 3WNBA 3J81k 1DPFA 3ZS8A 5KNBA 3CH4B 1IONA 4LK2A 2XZOA 3Q3JB 2QAJA 2CCKA 4KFTA 4V0KA 1Q1EA 4MRSA 4QBHA 3U44B 2BJVA 4NYJQ 5LBIA 3A36A 3IO5A 1DAGA 4PHFA 2ZVPX 4H1VA 4EPYA 3LW7A 4YMSA 2FPKA 3BB4A 2WMOB 3IHWA 2JA1A 5BN3A 4DLVA 2OFOA 2CMKA 4IXMA 1E0AA 3NHAA 3QEJA 2P0EA 2P6RA 5BQ5A 4Q03A 2GRJA 1G7CA 4OI0A 5JECA 3EPKA 2ZI7A 5LB4A 3BAFA 1Q0UA 4KVAA 3C7KA 3K0CC 1JR6A 3GLIB 2VRWA 3QF4B 3UG7A 2ODNA 2VP9A 5CK5A 3AF1A 4MYUA 2GEVA 4JZKA 4HZIA 4YXWD 3G82C 2NO0A 4MA4A 4PHGA 1H8HA 1IJEA 2DY1A 4B34A 2JLXA 3GLHB 1JNYA 4M1YA 5KO2A 1LY1A 4EFNA 2ZROA 2PH1A 2ZE7A 2ZE6A 3TKLA 3FDIA 2O5VA 3A1TA 2PLFA 2RGBA 1AK2A 2ORVA 2IYYA 1P2UA 4F4IA 1QBKC 4CRWB 3VNUA 1NP6A 1TADA 1OF1A 4V0MA 2FEOA 2IYXA 3QKRA 4EPVA 1G1MA 4AK9A 1TUIA 1U81A 4JLPA 1NLYA 4Q21A 2RAPA 1DOAA 1XTIA 3CZPA 1WF3A 4DHEA 4O2LA 1YRAA 3BH0A 4TL8A 2BEJA 5DN6D 2XXAB 1E2FA 2VP0A 4JLAA 1GUAA 4PHTA 3LW8A 2XB4A 1QHGA 3RVBA 3GP8A 3NEJA 2BJWA 2BIFA 4WZAE 4Q4AB 1HV8A 2OFWA 2QTHA 2P65A 4GMDA 4BASA 3EIQA 4CVNA 2NOAA 1II8A 2W0SA 1GL6A 4DDVA 2GBLA 2HEIA 4Q01A 4FCTA 1IXSB 1Z28A 5DHAA 4F91B 3U6KA 4MKHA 1W46A 3RS2A 4BLSA 1YZKA 5KNCA 4L16A 2ZU6A 2OM2A 2NO7A 2YV5A 4IOKA 3IIKA 1JB1A 2J0SA 1R5BA 1KZ7B 1MABA 5CM9C 2OBNA 2WIAA 4QHYA 4BWYA 2FX3A 5E7JA 2J45A 1WMSA 1CEEA 2HYIC 2ZJ8A 1MO5A 2FE4A 1PZNA 4PC6A 4M9SA 1QVRA 2ORWA 4V0NA 5FI1B 2V1UA 2PEZA 1RYFA 5UKDA 4BFYA 2H92A 3QVVA 3R20A 4UXJA 3AP3A 3Q7QA 3RSOA 2BV3A 1I4DD 1I4TD 4QBIA 2XB2A 4M0LA 1IQPA 3VU9B 2WOJA 2OXRA 5LPNA 5FOXA 4QM7A 3AM1A 4Q9LA 4Q1DA 1W4AA 2ZYVX 1S1MA 4BEBA 4QXAA 2HT1A 3CB4A 2I1QA 4G5RA 4OJQA 2ZRIA 1KI8A 1GRRA 2G6BA 4HLDA 2JJ2A 1OIWA 1G8YA 4FW9A 2ZJBA 3NBXX 3IO3A 4JBYA 2W58A 5AJVB 4TL7A 4M1OA 1QHIA 2WPDA 2ZSBA 4LHYA 2AN9A 3VR6A 1P5ZB 5FTLA 4B75A 4I1OA 4DT1B 4B3XA 1E2QA 2IBMA 4LX0A 4FCWA 4KFUA 1CJUC 1KK3A 2V6IA 3AUYA 3KFXA 3MLEA 5EXTA 1AN0A 2J0VA 4X8LA 3SJCA 1SXJD 4C0KA 2IXFA 4P33A 3VKHA 4AIIA 1NI3A 2BBTA 4QJ4A 1CULC 2P6NA 3DM5A 3QBTA 3KKQA 2WTUA 5GJBA 2GDJA 2J46A 2R44A 3LXRA 2OCPA 3NDPA 4Q19A 4NH0A 2H17A 2FGJA 3IBYA 1ZVQA 2GCOB 2VPPA 1XFAA 2ZREA 3QY0A 1HE8B 2QQEA 2OBMA 4G01B 1SXJE 4HZUB 3K9LA 4E07A 3RWMB 4BLOA 1MOZA 2BKEA 4JLDA 2HF8A 3SNHA 3U2QA 3GPLA 1EFUA 4NKRA 3Q5DA 2R9VA 3DO6A 4LYJA 5HE8A 1G21E 4HATA 4M2LA 3D3QA 3OE7A 4DLWA 3I5YA 5FTNA 721PA 4LHVA 1QG2A 2ZSFA 1G20E 2ZRLA 3CR8A 3CX6A 1OXXK 3ZZUA 1I2DA 4ZCIA 1KMHA 1WA5A 4M4SA 3T15A 1P2VA 1G18A 2Q9BA 3REFA 3OESA 2EWWA 1R10A 1S0UA 3WBJA 2VP2A 5CYOA 3TW4A 3QEOA 1BO6A 4B6EA 2ONKA 3MWLA 1WB9A 1Z29A 1KDTA 4JSYA 2ZETA 3I73A 1Q22A 4S35A 4XD7A 4C0LA 2WAYA 3N5CA 1OFIA 1GL9B 3T61A 2C04A 3VNVA 2QENA 3JZAA 3E70C 2X2FA 4FINA 3GJ0A 3AVOA 3TQCA 1Q1ZA 1VYUA 5FL7A 3PG5A 2VHTA 1ZU5A 4HAVA 4QC2A 1L4YA 1X86B 3JVUA 4QJ3A 4TMVA 2ZR7A 3PEWA 2IYZA 4KI0A 4ZI2A 1NIJA 1MO4A 4ITRC 1Z83A 2QP4A 4V0LA 2FEMA 2VA8A 3W5JA 2WWGA 1FP6A 2OV2A 4DBLC 5F3WB 4DCUA 1EXMA 3AB3A 2A5FA 4EFLA 4Q4JA 4Q02A 1CIPA 4L9WA 2RGAA 1RJ9A 2ZUBA 2IT1A 3BH6A 3VR4A 1ZNZA 3FVQA 2ZRJA 4TN1A 3X1XA 2IEZA 4K8OA 4C2TA 1Z0JA 2WKQA 1UKVY 5KU1A 4LUCA 2R62A 4IDHA 3IIJA 2JIZD 4OHYA 3PVSA 3PFIA 2WWYA 2OUKA 1KSJA 2QROA 2JIZA 1FUUA 1TQ2A 3C5HA 3RAPR 3OEEA 1FL9A 3KQUA 4Q7MB 2FSIA 3VR2A 2A7QA 2FZ4A 5B64A 4MUAA 3REGA 3W8NA 2QTFA 2RGDA 2Z0MA 3AV0B 3R7WA 2CL6X 2VEDA 2IXGA 4GOJA 4OI2A 4EJSA 4Q5IA 2RGNC 1JR3A 3GJ4A 1UAAA 2FFHA 1D2MA 3NVAA 3G0HA 2N1BA 3TR0A 4DWJA 4S2EA 1TQ6A 1HQCA 4HDQB 5B58C 3O8BA 2ODBA 5JBQA 1OV4A 3CLVA 1XZPA 2GJ8A 5FL7D 1KI6A 3GJ5A 4W5WA 4A36A 3VKGA 2H8KA 5EXSA 5KNDA 4CEJB 1GNPA 2ZR9A 1XDBA 3GLGB 4KFSA 3NC0C 821PA 1H8HD 2ZRDA 4B47A 2AFIE 3LA6A 5L3QB 2OESA 2AR7A 2F43B 1RYHA 4OQXA 4PPGA 2LWIA 1NKTA 2ZSDA 2IW3A 3F8TA 3FE2A 1BH2A 1XB2A 3QKUA 4Q4HB 5CJPA 3TMKA 1U8AA 2GTPA 1NRJB 4BFXA 1EFRA 3IUYA 3TBKA 1R5NA 3LBIA 5DYIA 5GJVC 4DLZA 1VCOA 3CF6R 3AKEA 2ZS9A 4N0EA 1Z0IA 2OSBA 3MWKA 4KYIB 5J4KA 1XCPA 1KJWA 4GT1A 1E1RA 4L9SA 1T3HA 4WAUA 3OIVA 4CZ2A 3W34A 2E1RA 1RC8A 3ICQB 4BECA 1OT3A 2CHQA 1P9WA 3G5UA 2VF7A 2XZPA 4US2R 1GKYA 3AF0A 1DS6A 4TMKA 3V4FA 1Z08A 1E6CA 3BXZA 1W49A 4P4TA 3LO5A 3SE0A 3ONWA 3KKPA 1OYYA 3UXMA 3WHLA 4QGHA 1XD2B 3GFTA 3OEHD 2OCYC 4B3BA 3VR3A 4KVGA 3SHWA 3WY9A 2IYVA 1OSNA 3GFOA 5C46F 4LI0A 1KJZA 4TLBA 1S9DA 3FKQA 4UNPA 4TYWA 2ANCA 2WKRA 1P2SA 2W2VA 2IS1A 1CKEA 3HR7A 4P31A 4A8JC 4NDZA 4F92B 2A5DA 1DO0A 1YZGA 4R71A 2JGNA 3T1TA 3WMGA 1OLOA 2CE2X 3GJ6A 3K1JA 4IEIA 4KFRA 4QNMA 5H68A 4Z1MA 1XTSA 1G3IA 3A58B 2QEQA 4Y0VA 2CDNA 1MR3F 2FFQA 1B0UA 1OHHA 3UKDA 3AQ4A 3WMFA 1DELA 4LCBA 1KMQA 5CB8A 1Z63A 4IVQA 2RGXA 2IX3A 4RZUA 2J7PA 2C95A 5JMTA 1KGDA 1S3GA 1LB1B 1M7BA 5AUNB 1QG4A 3FYHA 3WP0A 1LTQA 1IJFA 2RKOA 5HKKA 4A1FA 1JEDA 2O52A 2AXPA 3SYKA 3QBVA 3FMPB 3EXAA 1W0JD 4US1R 4HDOB 3U4QB 1N0WA 2BWJA 2EFGA 2V7QD 4LY6A 1J8MF 1F2TA 4BE7B 5EE0A 1XMJA 2GF0A 2YOHA 2WBLC 3LH5A 2ZJYA 3EWSA 1M6NA 2IEYA 3H84A 1OFUX 4ZKEA 3IPXA 1FFHA 4BEJA 4EPTA 1NVWQ 3CH5A 1Z2CA 1W4BA 2VLIA 3W90A 3CKLA 1NL3A 2EYUA 4RD0A 3WYGA 2XSZA 3SEAA 1TNDA 3D8BA 2XAUA 2OCAA 4Z51A 3HJNA 3THWA 1UDWA 2ASEA 4HLCA 1CRQA 2ZRHA 3BD9A 5H70A 1BKDR 1TX4B 5JHGB 4L4UA 2C77A 2MMCA 5CB6A 4QM6A 3AF3A 2WIBA 3LLMA 3NH6A 1D8TA 1R8SA 2PL3A 5JSZA 4Q48A 4B2PA 2YC4C 4I1UA 2HT6A 1N6OA 2IUTA 4B3DA 4B3CA 1P6XA 4Q4JB 5HE9A 4QJ5A 4PSVA 3Q9LA 1OE0A 4R2HA 4YXWA 1E0JA 2J1LA 3VQTA 4O3MA 4GL2A 2W0MA 1G5RA 1MRNA 2ZAOA 4NCKA 4KCGA 2QBYA 3R9WA 3TAUA 1YRBA 3A6PC 4UXHA 4A2WA 4EPWA 2PZFA 1E98A 4TYNA 3OIWA 2UKDA 1F2UB 3SHFA 1TTTA 3K0FA 2H18A 2OG2A 3NEYA 1W36B 3T34A 1HE1C 3ASZA 1GRNA 1N6HA 4GRAA 3AKCA 1EK0A 1ONBA 1MO6A 5FH9A 2QMOA 4PPQA 1X8JA 1U90A 3E1SA 1XXHB 1E2IA 3RDPA 5SZHB 4FMDF 3ZGXA 3AUXA 1NBME 4MRVA 3C16C 5J5CA 2VHJA 1LV7A 3MRSA 2FSHA 4TL9A 1UADA 1CRPA 1S3SA 2QRZA 1ZD9A 1GL7A 3RS0A 2MSDB 3AVTA 5JRZA 4IOLA 2R6FA 2WHXA 1NN1A 1OIVA 1U8YA 3H4MA 4D80A 1OXUA 3CRMA 3L43A 4A9AA 1Z0KA 1LS1A 1GNQA 2UZIR 3I8XA 3CNOA 3QG1A 5HCNA 3K9GA 3CNNA 2JAQA 5L8VA 4MGKR 4P4SA 1P7CA 2QRNA 2YWGA 3NKVA 2ZS8A 1G6HA 3QI2A 5GVSA 1EFCA 2XSZD 3RS4A 3WYAA 3BBPA 4FMCF 3NC1C 3V4RA 3TUJC 4RJLA 1CF4A 3PUZA 3P26A 2W6JA 3MJRA 1AS0A 1IN6A 2F7SA 2ZSAA 1GRQA 4LJYA 4YMTA 4AKHA 5EJEA 3A4NA 4AYWA 1G5PA 4KHZA 1NY5A 1UKZA 1FX0A 2FFBA 4M9QA 2JJ2D 4XTRA 4BUJA 3GLFB 5HZKA 3BK7A 1JJ7A 2HJVA 3VMFA 5LD2B 3TSOA 2EFHB 1ZIPA 4CEIB 1Q1QA 2J59A 3DZ8A 3EAQA 5L3SA 1AZSC 3GEIA 2WZQA 4PZZA 5SZJA 4NHOA 3H2YA 1YE8A 1ZD8A 4JJKA 4OQFA 5JS8A 1LVGA 2GCNA 3MWJA 4PO8A 1EFRD 2WVJA 1YQTA 4DLYA 4CW7A 3AVXA 1E3MA 4IVPA 2GNOA 2FPMA 3W6NA 1M1YE 1VIYA 5FR1A 4LJ9A 2ZU0C 4UXIA 4AKIA 5KDDA 4I1SA 4RZXA 4W5HA 1KDPA 2ZYTX 3RRZA 1Z0AA 3QXHA 4Q1CA 2FNAA 5FTKA 2P3SA 1X1RA 1JXOA 3L8ZA 1FQJA 4TLAA 3LV8A 1E79D 5B57C 1T8TA 1EWQA 2Q9CA 1JECA 1SKYB 2GVZC 4B73A 2G0TA 1KI6B 2JATA 2YYZA 3SC3A 1KIMA 4DLTA 4HAUA 4DDTA 1OXSC 3CONA 3B78A 3GQBA 5JI2E 2CHVA 1PUJA 3UMRA 4OI4A 2YOGA 1GVNB 2Y8EA 3WXMA 1RW4A 2LKDA 3QXSA 2O8DA 1MT0A 2HLDA 2OAQ1 1SVIA 4UNRA 4DLRA 2IYWA 2XEXA 4I81A 1XPRA 3L0OA 2HF9A 1E0KA 3CR7A 3EARA 3OIYA 1WBBA 1G291 2D2EA 1E2NA 1QHSA 4KU4A 1ODFA 4L5BA 4YC7A 4A82A 3NBYC 3K8YA 4C7OB 1KI7A 4C2UA 2FU5C 4TWZA 3NBZC 1UKEA 2DFTA 2VYFA 3QSYA 4B43A 5AUPB 1ZM7A 2V1XA 2QMEA 3QKTA 4G1UC 4A92A 2Q0HA 1Q3TA 1SHKA 2DBYA 1NN0A 2BMEA 4JLJA 4MITA 2ECKA 3KJIA 5EZ5A 3ADKA 2PCLA 4NYMR 4D0LB 1FQKA 1CBUA 1WRBA 2WAXA 3LNCA 2IS2A 4OKSA 1Z47A 4NP6A 4JVLA 1W0KA 5J4YA 5HCIA 2B7BA 2ZUCA 5D3MB 1FPMA 5C2JB 2CLDX 1EX6A 3DEFA 1FNNA 3L2OB 2CCGA 3SZRA 4ON9A 4TT3D 4X8OA 4XVRA 3T5GA 3ADCA 1KJYA 2QAGB 1VIAA 2NO6A 3LQQA 4TZ0A 3I1FA 2XXAA 2JEOA 3KKNA 2O0KA 4URVR 2BC9A 2D06A 2R8RA 3IPYA 3CM0A 2ORIA 1GOTA 4OHWA 3P27A 5BWMA 3WRXC 2N42A 4ESHA 1KY3A 3ICEA 2Q3FA 2JLSA 5H1YA 4D4KA 1IY1A 3NBFA 1W36D 3AEZA 3B1WA 2BBOA 5TB5A 1CLUA 2NPIA 3KTAB 3CPJB 1FZQA 3L8YA 3BFXA 2F1RA 2VIIA 5BYJA 3M1IA 4GSYA 1GSIA 1BS1A 1A2KC 1KK2A 4FMCB 4JLNA 4AG6A 4DZZA 2IUSA 3OEED 1VG8A 2ZJZA 4BFWA 1W4CA 3T06B 1XPUA 1N25A 1OB5A 1HA3A 5E7IA 2QY9A 4YMVA 2FSGA 2GHIA 4LV6A 1ZU4A 1FMLA 3ZQ6A 4TTPA 1R2QA 4ESVA 1J99A 2QGNA 5CJ2A 4WZBE 3TSWA 1CS4C 5JWOA 4OQNA 3PXGA 2H5EA 6Q21A 4A15A 1GTVA 1T6NA 3FOZA 3TE6A 4G5GA 3GJ3A 1SVOA 5CYPA 2ZRCA 2YOFA 3U5ZB 2VHCA 1SXJA 3QXXA 2PX3A 2DPXA 5IDVA 1S4QA 1R4AA 3SFZA 1Q57A 4WXRA 1ZM3A 4KV9A 2YVUA 3PCRB 1C1YA 3CPEA 4PTLA 1DAIA 1E94E 2ZR0A 5JWHA 3RANA 2GZDA 3IIMA 1DE0A 1A7JA 1Z6XA 4RZ3A 2X8AA 3VTKA 1NLZA 3QKSA 2BCJQ 5HPYB 3U7EB 1HT2E 1Q1BA 1Y3AA 3EZ9A 3ZVLA 1KKMA 4JYCA 4LBYA 1YU9A 1S8FA 4WZ6A 4ZO4A 3EIHA 1LNZA 3OF5A 2AD1A 1M34E 1VCIA 1P62B 1DG3A 2EU8A 5ELXA 2NMVA 3TUZC 3A4LA 4KXFB 4LDJA 4DJTA 4W9MC 3MD0A 4HI0E 2OFXA 5TV2A 5F9FA 1KHTA 2DR3A 2JJ1A 3L0IB 1Z0DA 3QIAA 4RKEA 1X8LA 5FOWA 2QAGA 3U60B 2C98A 3LLUA 3QF4A 2A2ZA 3M4YA 1T0JB 4JVMA 2UZ3A 4DUGA 2JLZA 2RCNA 5JRJA 5IF9A 1KI1A 1COWD 2CHGA 2GAAA 1N6RA 5FPHA 4W7SA 2Z6VA 3L0SA 1KAOA 4XWAA 3WBKA 5DI3A 3ZH9B 1N6KA 1E9BA 1N0VC 2CJWA 1OXTA 4IRUB 3CO5A 2KBEA 4QFMA 3TGPA 2CNWD 3DKPA 2DWPA 1XMIA 5FI0B 3TJZA 5FOUA 3KQKA 4NYIQ 1JQJC 1SGWA 1GZSA 2QSYA 4LV8B 5JFGA 3EA0A 4PSKA 4Q1EA 1R7RA 2NO9A 4FI3C 4OQLA 4WOPA 4DSNA 3D7MA 5EE3A 4JVNA 3TNFA 1NVXQ 4CIDA 4MUBA 3MMPA 3I5XA 3KUCA 1LW7A 3VX3A 1Z6GA 4EQ6B 1NN5A 4WVFA 2QM7A 2VP5A 4KYUA 4AY2A 4JKIA 3GLFE 5DO9A 5J40A 2GEDA 3CBQA 2ZXUA 5G53C 1G3QA 4US0R 5EXXA 3I72A 5HTKA 4HLUC 4YLGA 2O0HA 4AURA 2V4ZA 1R0YA 5AK0A 1D9ZA 4V03A 4NYIR 1EFTA 3IBGA 4TQ9A 1IN8A 4AI6A 2OCBA 2NG1A 1XX6A 3PV0A 1MV5A 3QJYA 2YC2C 1E9CA 3FFBA 5FL3A 3PENA 4JLVA 3ZD7A 4BZXA 2ZEJA 3CIOA 1G16A 4H1UA 1SXJC 2PEYA 5CDFE 3MG9A 5JCPA 4KLZA 5AWFC 3AVWA 1KYIA 2G3YA 3VR1A 2IL1A 4LJ7A 3WYFA 1G7TA 4M1SA 3QG5A 221PA 2O8CB 1DO2A 2P2LA 1KY2A 1W5TA 1XEFA 1ZW6A 4M22A 4C0SA 1N5JA 1OIXA 4A0RA 4EUNA 4ASUD 4UNSA 1SKYE 4ZDIA 3CRRA 3LRPA 1G8FA 1TPZA 1ZM9A 2ZITA 3K70B 1NJFA 3PUVA 4AYXA 2GXUA 3KJHA 1DAKA 2GJ9A 2VSOA 5KYKA 3U7HB 2QMUA 1RRFA 3OHMA 3EPJA 4FMDB 2JJ1D 4HLUA 1E4YA 1KNXA 4WBSA 4IVRA 1KZGB 1D2EA 2WSSA 4NCIA 4Q4AA 4JL6A 2CLCX 4B35A 2HCJB 4OYHA 1U94A 2WJGA 1HH4A 1NG1A 3ZIAA 1IY0A 1N5LA 3OFNA 4LHWA 2JLRA 3MUFA 4TMZA 4WXPA 5DNYB 3E2IA 1W1WA 2W6JD 3Q5EA 1II0A 5GJWC 2ZANA 2RMKA 2JLYA 1HY3A 4KJZA 1E1QA 3FHOA 3KX2A 4LHXA 5A0FA 1XNJA 1CP2A 3O8DA 4Q66C 5IT5A 5JJIA 1RIFA 4RFSA 1D9XA 3MGCA 3B9QA 3X1WA 1D5CA 4C4PA 4D0GA 4NONA 2VP4A 5CIWA 1VKJA 2XNDA 4XJXA 1AS3A 1SQ5A 5LDDC 3PEUA 5FPKA 4R98A 2BBWA 3M0EA 3IHLA 4RD1A 5G41A 1KO4A 3VHLB 1SVLA 1UBEA 1Z07A 5BYKA 3IQWA 4ZI3A 2F55A 3QVUA 1OJLA 1BMFD 4TYQA 4D82A 1W0KD 4JLKA 1G8PA 3GMTA 3WNDA 2C99A 3QKRB 4DLSA 1YZLA 4URUR 4Q18A 1BMFA 2F43A 4F93B 3ND8A 3RC8A 1T5IA 4U5XA 2IA5A 1N6PA 3B1VA 3KXLA 4NTZA 1JPJA 3K70C 4CEHB 1QHHB 2GZAA 3TH5A 3AGPA 4FMBB 4XTCS 2NZ8A 5TARA 5A5GA 3LBNA 4BLTA 4EJSC 1G3MA 4MQBA 4GOKA 1A5TA 2QPOA 2J87A 1JAIA 4DB2A 4MYHA 2A5YB 3X1YA 1AIPA 1XU4A 2ZYUX 4DIEA 1GKIA 2F3RA 3AF4A 3QQ5A 1ZUNB 2F9MA 2G9NA 5DE3A 2B21A 2XTNA 2Q3HA 1XCMA 1QHXA 5FUVA 2GESA 1G7RA 4U00A 5KUTA 1IM2A 4C0BA 4KITB 3EPLA 1E0SA 2AWOA 2VHQA 4KSBA 2QORA 1QDEA 4UNQA 3CF2A 3CRQA 3I4LA 5DI9A 2GAOA 3EIEA 2PJRA 2QL6A 2YWHA 1A1VA 1QHNA 3LX8A 4LJ5A 3ZQJA 4GZLA 4IFEA 3V00A 1K6MA 5KSYA 3THOA 1UEIA 2NIPA 4ZCLA 3LWNA 3W6OA 2AK2A 1MABB 4PQFA 2FA9A 1DEKA 1F3OA 5SZKB 4IHQA 5FBWB 4HSEA 2J9RA 3QXCA 5DYGA 1YZQA 3ZLJA 5FTMA 5CDFA 1T4GA 4XVQA 1SVSA 4FIDA 4IDPA 2X2EA 1COWA 2V6JA 4DEXA 3GLHA 5EUQB 1KO8A 1US8B 5LD2C 2FDCA 3TR5A 1FTNA 2QQ0A 1F60A 2QN6A 4UJ3A 2P67A 3N70A 2QTVB 2J41A 3QE0A 2BMFA 1KK0A 3R9XA 2IYQA 2WJVA 2ZQ5A 1X3SA 1QVAA 3U3OA 3ZVRA 5LB2A 4CGZA 5FOVA 4TZ6A 3IDQA 4YMWA 4PSAA 1S1CA 4G3XA 4NCHA 2ZJAA 1P2TA 1KMHB 4E22A 3KQHA 1KDOA 3TRFA 1AKEA 2R6CA 1E9FA 1C9KA 1E1QD 5FBLB 4N3NA 4JS0A 5HZHA 3D6TB 3IKJA 1G41A 2ZRAA 4PAOA 2D7CA 5IRCD 3MJHA 4EJSB 3H86A 3GLIA 2F1IA 5C4GB 3EPHA 4RD3A 2A5GA 4HAZA 1BYIA 3B1XA 3FPAA 2GJSA 2GXAA 1QRAA 1Z6AA 2Q3MA 2WWXA 1HT1E 2ZVQX 3A1SA 4GI7A 1II8B 1VMAA 5BXQC 2IS6A 2NQ2C 1VG9B 2YINC 4QHTA 2IYUA 3EWAA 2ERXA 5FUYA 1HEIA 1NF3A 5CM8B 3CRW1 4H9GA 1N6NA 3BH7A 3LDAA 3MFYA 3I8SA 2BCGY 3GLIE 4LJ6A 4GBMA 4XOIA 2O8CA 1GWNA 2AL7A 5E95A 1TU4A 5CITA 4HZUA 3PEYA 4K81B 2RGNA 3CX7A 4M1TA 5C1BA 3BFKA 3L0PA 3LY5A 3U3KA 621PA 4XSGA 1YHNA 4B3FX 2GVDC 2ZI9A 2C78A 4BRWA 5L3VA 4IJMA 4PFSA 2ERYA 3SQXA 1NVVQ 4HUQB 5J4VA 1K5DA 2D2FA 3H1TA 2O8EB 4JMPA 3CWQA 1G8HA 3ZZTA 3OIUA 1N2CE 1TQDA 4DUGD 3DKVA 1EESA 2Z4RA 1KI2A 4PC3A 1NMYA 4PANA 5AJWA 3K9NA 4HEJA 1WE2A 3THXA 3TQFA 1OH8A 1KI4A 1FP7A 1ZM4A 2DB3A 4C0AC 3LAWA 1R0XA 2YWEA 3DOFA 1R8QA 4PO1A 3RHFA 2IYTA 3I92A 4CF7A 2DCUA 2FWRA 1FW6A 4QOSA 2YHSA 1QHYA 1G3RA 3HYRA 2V54A 4D81A 2ATVA 4F38A 2HYDA 4QHSA 1DARA 3TLXA 3T1VA 4X8HA 2AWNA 2IWHA 2BOVA 5EE9A 3KKMA 3DHWC 3KXIA 4LBWA 4ZPXA 3B1ZA 4BGDA 2GEUA 2WWHA 3C41J 5EP4A 4BLRA 2DWQA 2QG6A 1NLFA 4D2IA 4G5OA 1AQUA 3DDCA 4MGYR 5TY0A 1A2BA 5ANRB 4ZCMA 2PMDA 4IDQA 4ZIRA 5BN5A 3OAAA 4CEJA 1NMXA 1YR9A 4WA7A 1E2KA 3H0KA 4XWKA 5EE1A 2C9CA 1IN4A 1IXZA 2ZRGA 2J5XA 4E5UA 4OQMA 2AHOA 1IXRC 1A82A 1PUIA 2GA8A 4UQOA 1ESNA 4IXNA 3THYA 2RGGA 4O2RA 3N2IA 1ZYUA 5F98A 5H8WA 4ZDJA 5BW8A 5JJLA 4D4JA 5KPJA 3Q8XB 2KJQA 1UBCA 3AVQA 4TTQA 4OK6A 4XSHA 2A30A 2VL7A 2J0UB 1O87A 2ZRPA 1E2DA 1CJTC 3I32A 4LYHA 4E09A 3GD7A 4DRZA 1R0WA 3ZIAD 4QRHA 2OEPA 2H16A 2IHYA 3AGQA 5KPDA 3P1JA 4DCSA 2C8VA 1E69A 1B23P 5KHOC 4HAWA 1U98A 4AG5A 4B48A 1DVRA 1FUKA 4PXAA 2NO1A 5JEDA 3AP1A 2B92A 1RVDA 4OK5A 4EPRA 1XEWX 2C9OA 3SJZA 3PUWA 4BFVA 3B6EA 1J7KA 2GK6A 3TAHA 3EX7C 3ZVMA 4O25A 4ZDKA 2OO7A 1GILA 1LF0A 3B2EA 4MKGA 1WDTA 4RFVA 4GDFA 2AK3A 1RE0A 3BB1A 2D74A 3P4XA 2Z83A 3PJRA 1XEXA 3HDTA 4FWTA 4QBGB 1P72A 2DWOA 4Z8XA 1ZD1A 1U0LA 4K46A 5FBQB 2OLKA 3C14C 1P61B 2ZSEA 3NH9A 4IOJA 1R0ZA 3RC3A 3R8FA 1YR7A 2V8OA 2FGKA 1RJ9B 1P3JA 1QHHA 4BQSA 2GWHA 4TLDA 1ZAKA 3RS5A 2IXEA 1MRSA 3A8TA 1JEEA 4RD2A 4URXR 2J7PD 2QP3A 4LGMA 1GIAA 3SR0A 4D0NA 4I4LA 1Q12A 1P9RA 2JDIA 2QE7D 4JYBA 1MO3A 3BWDD 3SYLA 2IK8A 3O8RA 2ATXA 2HLDD 1PV4A 4HB0A 2GCPA 5FFMA 1G5TA 2WWIA 4D26A 2EWVA 5DSZA 3TK1A 2XX3A 5CLLA 2CK3A 3W6PA 1Z2AA 3SFVA 5KDLA 1HYQA 4LPKA 2WJHA 3WHKA 1TEVA 3U44A 2LKCA 4Q47A 2QA5A 2JCSA 1VECA 2H7VA 3LX5A 5P21A 4ILEA 5FPSA 2SHKA 1W2HA 3CF0A 3ZDQA 4E03A 2CNWA 4Y0AA 3A37A
chains in the Genus database with same CATH superfamily
4YFVA 5DWVA 3VZSA 3IGFA 2VK2A 3ECCA 3EZFA 3A3PA 4NMMA 4OBEA 3CZAA 5PNTA 2JLUA 1MB3A 2D1SA 1RSZA 1NY6A 3F6PA 3LT4A 4PEVA 4RFLA 3FOAA 5H16A 4EHBA 4F3CA 4MDFA 1T4MA 5GY7A 3N07A 4QGAA 3RUCA 1YBFA 2XCOA 1GYQA 1N2ZA 3BMOA 4HWSA 3NHJA 3ZWYA 2ALJA 1VJRA 5AJXA 2V6BA 4GRIA 4FGWA 3CO0S 3F8WA 1V25A 4HAYA 2B4QA 3ZWOA 5C5IA 1P1JA 5LU8A 1QRUA 1SD5A 1XL1A 4GXQA 1ZMOA 2J3EA 1DKLA 2H48A 2F1HA 1VXRA 1PJZA 4REQA 2BMDA 1NW6A 1KTVA 3DMTA 4G0VA 2QT1A 5B2ZA 4MPPA 1NX9A 4BGIA 4P7GA 3BE6A 3EOBI 4LV5B 3UWSA 5AIAA 4LRWA 4GX5A 1B42A 1PZHA 1ZBDA 2QWXA 2WWVD 4KODA 1E2LA 2H51A 3O3MB 2ZJ1A 4BVFA 4F84A 3IEVA 4EKYA 2BZ0A 1V1JA 1ZM2A 4RX1A 1WZIA 1T8YA 2E48A 2JK1A 2ZLBA 2YNMC 1P19A 3FI0A 3D31A 2EJBA 1TEXA 2HJHA 4LRXA 4N5LA 4BJ3A 4GVPA 2A9JA 1NI4B 2GDZA 1DLIA 1JXMA 1U0GA 3PCTA 1OVMA 3ZU5A 1EEHA 3VR4H 4QDTA 4CKXA 2C4TA 1IZZA 3PQEA 2IY9A 1TK9A 3FD8A 2I65A 3B5JA 3FMVA 4LSZA 3UPUA 1X87A 2V96A 2PSDA 3COWA 1HDZA 2V4MA 4MAFA 2C61A 2XV1A 4BMOB 3W3ZB 2QHXA 3E9ZA 1GPH1 3QEMA 1WBDA 2VJQA 3CUEF 1RP1A 3ABQB 5I8WA 2HQBA 4MOWA 4ZOBA 2VP3A 1E7WA 5DVZA 4UFPA 1FSPA 4QRIA 2ACEA 2O2GA 6NULA 3CMCO 3P20A 4ATNA 3Q85A 1NHGA 1FU7A 2PPLA 3VU1A 3KXKA 2FLVA 3I1JA 2I76A 3HB5X 3FPKA 2IYAA 3A4IA 1QVWA 3GQVA 2QGZA 1IATA 5ED4A 5L9AA 3HHPA 2KB0A 3OM1A 3IKMB 1FTSA 3T7KA 1OI2A 1QOZA 1XDZA 3L01A 3L7JA 4L5JA 2OMEA 3ND6A 3G9XA 3UWOA 3JZMA 3ANYB 4ZA2A 3G0DA 5MFZA 1I4OA 1X8KA 2PUBA 3ESBA 5EZYB 2HFKA 1P74A 1UKYA 4ZVVA 3SX4A 4ZV4A 1Y3BE 2ZIEA 2W2KB 2A5JA 3GH1A 3PF8A 1O03A 4MYCA 2LR0A 2BMAA 2LBPA 2JIBA 5ALUA 3RS7A 4RLSA 5JZBA 1YB2A 2AFIB 1E96A 4CT5A 3IEXA 4WT7A 4CNQA 2AQHA 4EG3A 1ZRNA 2EZUA 4OBWA 4AY5A 3TRKA 1TM4E 2CJWB 5IARA 4O4HF 4EF5A 3AVVA 4DDUA 1O6ZA 3KAPA 4BFLA 2A0KA 2ZKLA 3GJ8A 1VP9A 1KJQA 3OJCA 3OD1A 3FFWA 4L0CA 1WCV1 3KLNA 1QNFA 3IC5A 3L6OO 3H2ZA 5K7SA 1E2JA 1O77A 1PR0A 3O84A 1QRRA 3QF7A 4DAEA 1OR8A 1QO0D 3TTTA 3VU9A 5J23A 2J07A 2RHDA 1X1SA 4N39A 3LZDA 1OXMA 1Y89A 1TOAA 3SI7A 1G9XA 4ALNA 5J5AA 1NBAA 5G1PA 4Q9HA 3WGJA 4PXYA 4LF5B 1W87A 1N0HA 2OHFA 1WUTA 1SQGA 2VSFA 1SELA 3LOPA 4HB4A 1GDHA 2JFOA 4Q34A 3RNLA 2VRCA 4M1QA 1XCJA 1YDEA 3MXOA 5DM1A 1G6OA 1FPQA 4M55A 5E1BA 5FAKA 4HJRA 5T3UA 5LXTA 2JASA 2FCAA 2XGMA 3DLAA 4I5GA 2Q5HA 2PBZA 2NU7A 1E2MA 2H0QA 3AR7A 1T0UA 2VAVA 4L8LA 4L8WB 3TM5A 2DQSA 3TEMA 1G8GA 4BNGA 3AL3A 3UJAA 4N3GA 3U4IA 4N40A 4AZTA 1RLJA 2ZJ2A 4F3NA 3EIUA 3PWSA 3HCDA 4XR4A 2ZUFA 3LQRA 4JLMA 3TLGB 1PR9A 2QPAA 2XUDA 3G2HA 4KXUA 4LNUB 4YDHB 4TT8A 2CFIA 3KALA 1I10A 1ODKA 3FPBA 3PITA 3V7FA 1MF7A 4DSTA 4EG4A 2ZSUA 3MAGA 5ARDA 3NONA 2C54A 4YYEA 2J3JA 4PQGA 4PHHA 2SKDA 3FCUB 4Q05A 2JANA 3REQB 3T7IA 2PA0A 3RSSA 2WMNB 4ZJYA 5IPFA 2P30A 3WQHA 3FG9A 3HY4A 4RSMA 4AJ1A 3O8QB 2YZMA 2Y27A 3E84A 5I51A 4RTOA 4KKXB 4QASA 2WM9B 4L5YA 3KVNA 3N2KA 4FU0A 4TVKA 4B7UA 3EEOA 4G2NA 3QXJA 1P4SA 3L49A 3P9SA 4C9BA 1VE9A 3NAGA 1D6SA 4J0QA 1OKKA 3S2YA 1AKWA 4J2OA 3QQPA 3EODA 2FOLA 1PJ3A 1P60A 3T1HB 2WWWA 3L8EA 2P6PA 2P1RA 3HC7A 4M9ZA 4V1CB 1CR2A 5K0NA 4AZWA 1F6BA 1RJGA 1K5GA 2YJGA 4JT4A 4Q9AA 4ND1A 4RTLA 3MYYA 3ZE1B 3LQKA 3BZUA 1N1DA 4GYJA 1YKSA 4P2GA 4XH9B 3K0SA 3QLEA 3EXEB 3TTUA 2B20A 3C7DB 3ODPA 1F48A 5FLEX 1DJQA 2AZDA 3O9VA 3RAJA 3N2NA 1JHPA 2YZKA 2GZ3A 2JJ8A 2PX0A 5CH3A 1A5AB 1I33A 3Q8MA 1NT2A 1QIMA 1DDGA 2QN8A 4X1IA 3Q3EA 2O07A 5I8PA 1TL7C 3UNXA 2Q2OA 3AOEC 3H11B 4HDNB 1PJLA 3PDIB 4URZR 2HHCA 2W6ID 1Y1LA 3HZHA 4LC1A 1UPBA 4MUGA 3U3MA 1BMTA 4Q4CA 1S6YA 2OXCA 1AJEA 2Q99A 2GTIA 1YR6A 4BKRA 1XZQA 4XA8A 1YVPA 1U0OC 5EWMA 3RWOA 3DWFA 4LQDA 4WXEA 4BQNA 1DRUA 4UQLA 1G21A 4EJ0A 3TSYA 4YJDA 1AKUA 3BWCA 4WSOA 1T36A 2C4KA 4DXHA 4QWMA 4YLEA 4CMEA 1QQ6A 3KD2A 2PGAA 4JU9A 4O63O 3MGKA 1L2TA 3K9WA 4L4ZA 1CTQA 1YZNA 2QRJA 5KX5B 1O1YA 4JU8A 5K3FA 5BSKA 2O0LA 2V7XA 2ZSIA 4JVSB 3DF7A 1KSGA 1KZYC 3NNDA 3SEFA 4E33A 3H8JA 3BIFA 3UXYA 4PPNA 4FEEA 1WU8A 5ADUS 4JOCA 1HI9A 3GLHE 5I7RA 1OLXA 5C1PA 3U16A 1GQSA 2QR5A 4F9FA 1GQQA 3HYCA 3A11A 4Z8YA 3PVCA 1N92A 3DB1A 3JS5A 4UM9D 3EUAA 5J2UB 5DBGA 4C3ZA 1ZNWA 2GJ4A 3IEMA 3IL2A 2C5AA 2PT5A 1ENZA 4EKDA 1YS1X 2X86A 3KEOA 1XTRA 3WLLA 2ESRA 3LL7A 5EKDA 3VVLA 4A6PA 1U0HC 2AGVA 1EKXA 2XWPA 4WGGA 3CX4A 4BCCA 3AX6A 2EDAA 4RIGA 3KS9A 1U4NA 2L18A 3FDJA 3MAAC 2I4NA 4L7QA 2QTAA 3PIRA 3EW9A 4X20B 4URYR 5KYVA 4DM3A 3THYB 4MWDA 5JZVA 1W25A 1RC1A 1WVIA 3QYFA 1GCOA 4BO3A 3X1ZA 4DSOA 3I2GA 1X7XB 3VISA 4YCSA 3OJ0A 2PX6A 1ZA1A 2VBCA 1FRFS 3JAWB 3P4YA 4NPCA 2OK8A 2F3TA 3PRJA 4YEDA 3RUFA 2D7DA 2O8DB 4MGIR 2NTNA 2W4IA 4K6OA 3ISVA 3NWJA 2UAGA 2GR9A 3BILA 1CUEA 1FNDA 3R24A 4UMDA 3MN1A 1DQZA 1YMQA 2EV9A 4NZPA 5BR7A 5DHSA 1RRCA 2PJDA 3O4FA 2ZDQA 1J39A 2RHMA 1AGPA 1XT6A 1XVTA 2R47A 2ZWMA 3ESYA 3OCXA 4H7IA 3L92A 4LYAA 2FMHA 5BV8A 4RHCA 2QW8A 3BHMA 3JQAB 3KPVA 1E2BA 1IZ7A 1CY7A 1IN5A 3WGNA 1T1EA 3HPRA 4D8VA 2YS7A 3GJRA 3RSLA 5AVQA 4N0DA 3GA7A 3Q3CA 3W2TA 3KHTA 2HRCA 3FOBA 5JY1A 2BVNA 2IS4A 1ZD4A 1H6AA 3AM4A 4MVCA 1MEOA 3PYXA 4OHXA 4X1IB 1V6AA 3ECSA 4ZZ1A 2W6MA 3FGZA 2XCQA 4N5DA 1ODTC 2HJGA 1QHEA 2YHIB 2VTKA 4UKDA 4H27A 5F52A 4CQMA 4RMHA 3ZG6A 1RHJA 4FD2A 1T35A 3RC2A 1V7ZA 1A1SA 3K8QA 2QN1A 2AC7A 2YWDA 4V0QA 5FTJA 4MRRA 2GM4A 4JP8A 1XMVA 4L8VA 4RCYA 2GM5A 3WGGA 3OFND 1U0SY 1E1MA 1F1JA 2RB4A 2WM3A 3AQIA 2AOVA 3KHSA 1CETA 3VUFA 2Q21A 3P9QA 4JSTA 4LOIA 4MRAA 4OHVA 4AU1A 4D6PA 1A69A 2FPIB 1EK1A 3VFDA 3KVVA 2EWMA 1JHOA 2V7EA 4K1LA 5A04A 5I45A 3PJEA 3THWB 5DBIA 4UNIA 5A4IS 3OZXA 3A32A 2PD4A 2HLPA 3PQCA 1GAJA 3QP9A 2VAWA 1A7AA 5DGDA 4F7WA 1QPBA 2OSVA 4JJAA 3SBDA 1PS9A 1LV8A 4RZSA 1ZS9A 2G63A 2E6KA 3RVKA 4EX6A 4G85A 5A3JA 2QPTA 4M53A 3ZKWA 4P3YA 1GAXA 4HYTA 2M32A 4G0YA 4K87A 2O19A 1ZH4A 3QPCA 3U4AA 3OECA 3JQ8B 2COEA 4NCNA 5GZ6A 1R5OA 2ZFUA 5LMNB 2EW8A 2O6LA 4LF6B 1RFLA 3ILXA 2ZIXB 4I9FA 1K9SA 4PQRA 1Q1AA 2GYWA 1XJ0A 1TZKA 1YL5A 2GH1A 2PKQO 3JRNA 3SLRA 3TCNA 2B69A 1EVZA 1GA4A 1KORA 1NXQA 2Q1WA 2Y1WA 4K1XA 4MUFA 3H99A 1ODLA 1Q92A 1X7XA 1MORA 2QT0A 4WNYA 3S28A 4RHFA 4DR2B 3V1UA 1FTYA 1BEUB 1EP9A 3NPMA 1CQIB 1QIFA 2GKSA 2GZMA 1JVSA 1Y8QB 2QP9X 2UZ1B 4QFBA 1T9BA 3VU3A 3WNZA 4PW0A 3A1UA 5HFAA 1L0BA 1E3SA 2WSMA 4UU8A 5L7YA 4BP9A 3KJGA 3SDSA 3GRAA 4PRLA 3DV0A 1E2GA 2WP8J 3OUTA 1E5DA 4E70A 4Z7QB 1Z6PA 2XJ9A 2B5WA 4TKUB 5E0OA 4IDGA 4CMGA 1I51A 3UHOA 3FPEA 2ZWPA 4IFIA 3A2NA 4OA8A 5K8UA 3RS3A 1VJDA 4YRPA 4NULA 5GIOE 4M6WB 3GLRA 1E6MA 3BQNB 1ETUA 5C9ZA 5CB4F 3NRCA 4MTLA 4RJJA 4NL4H 4UUBA 4R9UC 3ZCRA 3A14A 4B74A 3D4NA 4UEJA 4D4MA 4DG8A 1KOFA 4AWXA 1CYEA 3DG9A 4YYZA 2VRCD 2ZTSA 3D54D 1J56A 4CBVA 2YY6A 2GTHA 3S7TA 1X94A 4LQ4A 2ODWA 3DE0X 5D86A 4NBRA 3UPTA 3F0TA 1X1AA 1LJLA 2BEKA 4M7PA 1E7SA 2C00A 4DNQA 2XR1A 2XBMA 3BD7A 2IHBA 5H82A 4C4ZA 1A9XB 3EY9A 4DJJA 1HE5A 1G20A 1QO0A 2RIRA 4RY8A 1UMBB 2A9PA 2KE5A 5G2OA 5F4BA 1JRLA 1V5EA 3OZBA 4EVIA 3A6KA 4QFDA 2ONJA 2HI0A 1FFXA 1EUCB 1MP0A 2ISCA 4TUYB 9GPBA 3ND9A 4LTDA 1R6AA 3CWZA 5GVRA 2LCIA 3WNCA 4DMHA 1FDVA 2FEXA 3N3BC 3LK7A 4KMRA 3CNHA 4JIMA 5E6RA 4WACA 4D42A 3B1YA 1PHRA 2FH5B 5D3QA 3IQGX 2ZRFA 2P2NA 2ZWVA 3KQNA 5F35A 2PO5A 3ZBQA 1RAHA 4BU1A 5L3SB 1KSFX 1M10A 1IFXA 1D1TA 3VH1A 4L27A 4BUZA 3EGVA 3Q9UA 4EARA 3HP4A 4X8MA 1IPFA 1YI8A 1E2HA 3FBTA 3UT5B 1EFDN 1QB8A 4DNXA 3KL4A 3PE4A 3OQMA 1VL6A 2CMFA 4P81A 4HNTA 1A8QA 1R9GA 2YQ4A 6GPBA 3KKEA 4MV7A 3T6KA 2I91A 1ID1A 3HKEA 1IZ8A 1UAGA 2ZW9A 2PR7A 4UEOA 3LU1A 3KSDO 3W7BA 3ZCPA 3N1UA 2HK8A 2P1DA 2GERA 3U3RA 4YO7A 4EUEA 4TKVA 5AVRA 4QUHA 3DGFC 1G0OA 2AQ8A 4O4JF 1TM2A 1E2UA 1ESZA 2V6GA 4RHTA 4ZT4A 1FW8A 3F5MA 1QFMA 3VR4D 2OXTA 4QKQA 4A8HA 5LIRA 3QHAA 4B7AA 2IQ5A 1YR2A 1AMOA 1LDMA 2HRZA 1OB2A 2GF9A 1JHAA 1XEXB 1Z5ZA 1DCMA 1IHOA 2YW2A 1US8A 4IJ5A 5EQDA 4ENUA 2OZLB 3HWSA 3IEUA 5LKRA 1FTGA 1PL8A 1TKAA 2B1GA 3GD5A 1H8EA 1V0JA 3HSSA 3IQHX 3SF0A 2WM8A 4OB8A 5A03A 1DT3A 4WKGA 3RS8A 1N8KA 3MOSA 4MKIA 5HFJA 5JRDS 4DB4A 4CLOA 4RMGA 4D57A 1KI9A 4QUGA 1T0HB 4CUKA 2P9JA 4CM8B 3L82B 2I3BA 2IITA 4Q4LA 5HJ2A 3W6ZA 1UXKA 1QAQA 3DC7A 1FYXA 4G63A 2ZTUA 1EI9A 4KO3S 5FI5A 1W30A 3O31A 2P7HA 3KJEA 2PYIA 4M54A 3PR3A 3PHBE 4O4LF 1OU4A 4QEZA 4V1CI 1TT5B 2IYNA 4N5MA 4TSFD 1IAVA 5HCNA 4N18A 3U13A 1CR6A 4N3CA 5F21A 4GQBA 1UBFA 1RJDA 2DQYA 1U1FA 2FOIA 5A5EA 5CU7A 4KPEC 4JBWA 5E8JA 4ZDWA 1Z06A 2GEJA 2PRYA 2SCUA 4YRCA 3UYKA 5JS2A 4BKPA 4EB8A 5AVTA 3M70A 4Q9IA 2JBAB 3I62A 4NENA 1CQPA 2EVWX 1Y1KE 4JI4B 3H7IA 2GCOA 2XGGA 3BM5A 1B8NA 2PT6A 2XWBF 3C15C 3DAOA 3L93A 4IG4A 3MUNA 2EG5A 1GGHA 3CRNA 3GCDA 3K09A 3K0AB 4L7VA 1A76A 1JJVA 1OHHD 5HCUA 1MAHA 2B0JA 5JNVA 4MRMB 5H83A 1VIMA 3F71A 3ZUGA 5K6TA 1K7CA 2Y93A 4I14A 4BRZA 4Z1MD 2BKXA 1DG1G 3OP1A 3QUSA 3LQFA 1DBQA 4RTJA 4K2AA 2WSYB 1BE0A 1CUUA 2XNDD 2BGUA 3LQYA 4XFKA 4R2KA 4FOOA 1EVQA 1Y7LA 4D9KA 2NUPA 2I7CA 3UJBA 4GOXA 5CB4A 2Q1YA 1NF9A 1DHTA 3E0QA 3EC2A 5CH8A 5CVVA 3GWZA 2X8JA 1IRXA 2BUCA 1WZ2A 4HT3B 3LDFA 1FFCA 4B3MB 2Z5LA 3LQ4A 4YMLA 3UMMA 2HMUA 5AOAA 1TTHA 3D5QA 3ZWBA 2G0AA 1ZK2A 5E1DA 4BAZA 2G04A 3F74A 3HO8A 4LJAA 3TM4A 3KJFA 4GGOA 1HL3A 2YXPX 5FP0A 1XYGA 3QBJA 1JBKA 3G2IA 5A6SB 5TDHA 7REQB 4LWZA 2BP7B 3AHFA 1WDLA 4O4IB 3VC7A 4FONA 4RTMA 4IJUA 3RLFA 1R37A 2EBHX 1DAEA 4GQAA 3L4EA 2ZBQA 3Q41A 4HGZA 5KKAA 1Z4QA 3B3GA 4G5SA 4URFA 3TSAA 4X60A 4F5ZA 5IKXA 4F9EA 2XOEA 2GN8A 3U4QA 4JJIA 2P4EA 1O5IA 3WIEA 3VDNB 4TGLA 3VU0A 1OI3A 3G5MA 4ZEWA 3WB9A 1K88A 1OFTA 1ORHA 1YQUA 3DOJA 1SCIA 5AVUA 5KQMA 4Q12A 4CEIA 1IHUA 1XTQA 1C4OA 3UMJA 3LBHA 4FHGA 3MVEA 4RVOA 4BO0A 1XJQA 1O3YA 2C59A 2FMFA 1PG5A 3G02A 3IUSA 1EK6A 4GPAA 4IS3A 5KWEA 5FDFA 4HNRA 2R0QC 4ALLA 4QIHA 2Z8ZA 4DIKA 1Q7RA 3TCXB 1F14A 4B2IA 1YBMA 4ARZB 4OPMA 2DFVA 3VJMA 3A06A 3IALA 4KQ2A 5K2OA 4WHMA 1KEZA 2DPHA 3JYLA 2Y4NA 4COKA 3KQLA 5E9JA 3JWEA 3EZ7A 3Q2IA 2WA2A 3OLYA 3VX4A 2KLBA 4A0GA 4RHEA 1RQLA 2Q5FA 4XW2A 2P9GA 3TZBA 4RVSA 3ZHUA 4PYLA 4RC9A 4N5NA 4TTVA 2FI1A 2DX7A 3MCAA 4U7TB 3PD7A 4I2VA 4ML3A 3RJ5A 3TSCA 2W2XA 2FQQA 2G5CA 5G0VA 4S1WA 4Y6PA 1ABFA 2VA9A 1EAYA 3WP1B 3TTVA 3K0KA 3NTOA 2HXYA 4EJ2A 4FGZA 3DOEA 2V03A 2PSFA 2J6BA 4W5NA 4XLZA 1ZC3A 1GAWA 1YAJA 4B44A 2C8KA 4YFYA 4DWWA 1M6YA 3K0AA 3CCBA 3AHDA 4UOEA 4LTNA 1KYXA 1ZK4A 2B34A 2J31A 3K0FB 4HDCA 4RKFA 2W2PA 3ASYA 4DXDA 2F9LA 2B4TO 3TD9A 2VJMA 1QC5B 1QZUA 1XLTA 2RGWA 1FNCA 3BXHA 5I6DA 4H3SA 5IULC 5JCOC 4BZQA 3GZTB 3ER6A 3TPCA 4QUAA 1GL3A 3PX3A 4ZQIA 3T9FA 3TQSA 3ZV6A 1RAGA 2JI8A 5HKAA 1ZGJA 3T95A 3GPIA 1QUEA 1RRGA 4A8JA 4TLMB 4KTVE 1YZTA 3EXHB 1UPTA 5I9NA 3E82A 3C8ZA 2QDXA 4GS5A 4IHAA 2XCIA 3GVPA 4J3FA 3SG0A 2A9RA 4AROA 3IBFA 4LGCA 3JWHA 2VQEB 3C4QA 4M7RA 1P91A 2XYPA 5JVDA 1TEHA 4B3GA 5JSQA 5DISB 2M6LA 5EJAA 3TVDA 4F8EA 3C5WP 3GGPA 4JB0A 5B6IA 3ER9A 1KGSA 2WKPA 2IDJA 2CL0X 2JLQA 1EXNA 3GRZA 4MCIA 4XM0A 5ALMA 1YFJA 2F1OA 2XDQB 2X9GA 4ZYVA 1EVEA 1TVKB 2CL7X 3SGLA 2OT3B 2NXWA 5I7FA 3HL0A 1MXFA 3LVRE 3OE5A 1ECJA 2FF5A 4R54A 2FW6A 2FN9A 3DDUA 3PNVA 2BAGA 2WUWE 1UP7A 3FPJA 5DK6A 5KTYA 3TAXA 1JHYA 1P81A 1QO7A 2PTHA 4EMBA 5AQ1A 1H9AA 2GPBA 1FMJA 1WW2A 2W00A 3LFUA 4B79A 2DERA 2ZI3A 3CNLA 3P0JA 1RYMA 4FFLA 4GOLD 2GXQA 2ZI6A 5AKIA 1DKMA 1ZISA 3SOPA 1J9ZA 4UJ5A 4DVGA 5HJ5A 2G9ZA 2V7QA 1NNUA 4HUTA 3WV5A 4F1JA 1B4DA 2A78A 1J2TA 1CZUA 2ZB4A 3HKBA 2JJMA 1BXRA 2ZB8A 4M83A 4LF4B 2WSBA 3TPZA 2Z43A 1WSAA 3GFRA 3PXAA 3Q3VA 4JIGA 4RIIA 4N6OA 1ENOA 2IUUA 1MNAA 4U7DA 2Y68A 4P4UA 4A2QA 5HIAA 1ID8A 1HFEL 2Z4SA 3OKCA 5F78A 1R18A 1K4MA 2C1ZA 3T1QA 3O4HA 1L4MA 2VNSA 3W0LB 4AG3A 1Q77A 4B6QA 4NJEA 3PGKA 5DOVA 4C4AA 4EHAA 3KLOA 1QYVA 3WK7A 3ZS8A 3IEKA 2GD0A 2M9MA 2YWBA 4NE9A 4UBJA 2HWYA 2JI4A 1RMYA 2GYUA 3DV2A 1IONA 4L0DA 3R3JA 2W2MA 5DYNA 3TQOA 3HI4A 2QAJA 3IE1A 3ZH2A 2CCKA 5C8DA 3ROFA 4KFTA 4D9MA 3VHRA 3UYLA 5BSFA 1Q1EA 2FX2A 3DHVA 2Q29A 4UOQA 1WP4A 5LJIA 5LQNA 3PXCX 4TTTS 3PSHA 1K7XB 1NBWB 1PQUA 4KC0A 4PHFA 1U1EA 2R00C 5GTDA 1OZFA 2FPKA 1YQ9A 5IUJC 3K9FC 3KOYA 1O6BA 4ZXFA 2G08A 3ZDZB 3PNPA 3CF4G 4JLUA 4CTKA 3GN2A 4UEQA 3S7ZA 2PWBA 5K01A 3ZU2A 2Q6LA 3V80A 3QEJA 5FNVF 1BGWA 3ANTA 3OOHA 1CDZA 2Z09A 1KQPA 5BQ5A 4AZ0B 1NVMB 4J7AA 5EGSA 2P4QA 3GG2A 3IOEA 2N3ZA 4P3XA 1ZD3A 1ULSA 1ZVVA 4YMGA 1W1UA 2V7BA 3HO6A 4GXRA 5IUKC 1S2DA 1Q19A 3EYAA 3QF4B 2A4MA 1JR2A 1GPJA 5BQ3A 1SFRA 1SC4A 1GZ6A 1UWVA 3FZYA 3P0HA 4K03A 1J7JA 3AF1A 4MYUA 4X7MA 4Z2AA 4FHFA 1DX9A 1KQOA 4ISCA 4YXWD 2A86A 2NO0A 4LY0A 1FRVA 2XNCA 3R2JA 4PHGA 1H8HA 3RGGA 4BO9A 5IEJA 1QNLA 4QLAA 3X43A 2O2JA 2WZCA 4M1YA 5KO2A 3FWKA 1Z34A 4G8CA 2ZBRA 3QWAA 2O1XA 3LPDA 2E4XA 1TLTA 1VHWA 4R41A 2DLDA 2ZE7A 3TKLA 3N53A 4ZI7A 3UJ6A 4HY3A 3D2LA 3T99A 2ORVA 1RRKA 2PBFA 3AEYA 4PO3X 4R2XA 4V0MA 1T34A 1T4BA 2IYXA 4XI9A 4EPVA 3AETB 4JI7B 1Q0TA 1G1MA 1QK4A 3USES 3TDMA 1TUIA 1U81A 2BFWA 4JLPA 5CVCA 1NLYA 2XH8A 4UUOA 1YMVA 5KWSA 1MT3A 2I3ZA 2BYTA 4GM0A 4NAUA 4O1IA 3AERA 5JSUA 1GTJ1 1WF3A 4DHEA 1XZHA 2AYZA 2GZ2A 1KJIA 2GLXA 2N1MA 3WGMA 3ELYA 4GKAA 4ZVMA 1LQ2A 5HNKA 4BNDB 3FVRA 3RVBA 5KSWB 3L0CA 1J20A 4R1UA 2BJWA 2GUWA 1HV8A 1ZA2A 5BRAA 4IKOA 2IU6A 4MP3A 3EEFA 3M3DA 4DA0A 4YBRA 1D4FA 3IAS6 4IIEA 4BASA 3EIQA 2A9VA 1N5DA 3KSRA 3D2BA 3S70A 4DYHA 2EP8A 1GL6A 3DF9A 2V5VA 3NATA 5EIXA 2HEIA 1BD4A 4Q01A 2JI6A 3LECA 4R8MA 5CMLA 1ECLA 3OQ6A 3NS7A 3CU5A 2JHGA 4RZQA 1IVSA 1P1FA 2XY4A 5LQSA 2OYRA 3IIKA 1RRVA 2J0SA 2J3KA 1MABA 4G89A 4BWYA 2TYSB 4PG8A 4KN9S 3ZU3A 4DQ0A 3G0OA 2PQMA 4IO0A 2FX3A 2J45A 1WMSA 2E5WA 4D9JA 4IIJF 2RC6A 3NHMA 3A26A 3MC1A 1PBTA 4QYTA 2CMDA 1MNQA 3SMVA 1FVHA 1PZNA 1OQAA 2RGYA 1H5UA 2O6HA 3O91A 1GV0A 3OZ7A 2RG1A 3Q0TA 3WK5A 1GUDA 3SOZA 3HFRA 4BFYA 4URHA 3RVJA 1TQ8A 1CJSA 4FE4A 4HNQA 1AGYA 2G7MC 2R8OA 2WOJA 3PC8C 4J3JA 1EZ4A 5KYGA 1RYEA 1O96B 1TTQB 3TL6A 4KDFA 4JBNA 3C6YA 2EG9A 3M1YA 2XKKA 4Q1DA 1W4AA 2XA9A 1S1MA 3VYTB 1C7RA 4HEHA 5CFRA 1EJ0A 1X70A 3OCYA 2I1QA 4G5RA 2Q07A 2G6BA 1E62A 4HLDA 2RE8A 1G8YA 1I8TA 4MS3B 4Y6QA 4EYOA 1BQ3A 2O0MA 3KQPA 5A4FS 2O2XA 2JEYA 2W58A 1JSZA 4TL7A 1HLDA 1MU0A 2WPDA 2ZSBA 2QB5A 1P5ZB 2DF8A 4ITVA 2HWXA 2IOHA 3PNMA 4GNRA 2AG1A 2YR0A 2D5AA 4I1OA 5F64A 3LPAA 5T4FA 1VMEA 4FCWA 4F72A 2V6IA 2EAUA 2VDQB 3KFXA 1GPNA 2QRUA 1AN0A 1UBRS 3M5DA 3O6VA 4P38A 5KJEA 1IMJA 4G4SO 4OP3A 1SXJD 4PFQA 3FDFA 2H7YA 4AMGA 4BE4A 5KOHB 1JHRA 2BBTA 4QJ4A 3D8HA 2WTUA 5GJBA 5EZYF 2ODPA 5FORA 4CHGA 2R44A 3GGGA 5H9VA 3HVUA 3DDSA 1T6YA 2H17A 3WRXA 4KH0A 3B9RA 2I3AA 5KTPA 2VPPA 3QLVA 3OJXA 4BB5A 3DVAA 1HE8B 4P4GA 4IPTA 3DCJA 2G1AA 2YXEA 4OP1A 2NSLA 2WUEA 4IDAA 1WCXA 2D0OB 1QYXA 3O4RA 3ZV5A 2B8NA 5CFOA 4E07A 4XQ9A 2DFDA 1YCDA 3SNHA 3Q2OA 4EKNB 4RPKA 3U2QA 3EVEA 5KWVA 1YDMA 1SA0B 5HE8A 5BOSA 1W52X 4QO7A 1PDWA 4U6NA 4YV0A 2C3UA 5KOJB 1A2QA 3F7NA 3EJWA 3A27A 1Z73A 2O7QA 4UZEA 5FTNA 1G42A 4DRYA 4E1AA 2ZSFA 5LL6P 5CBPA 5JAZA 3ZZUA 1I2DA 3UJPA 1KMHA 3T15A 2YYYA 4A23A 1P2VA 2HU5A 1ZGGA 3NC4A 2YRWA 4HN2A 3UJ7A 3WBJA 2VP2A 4H7KA 1Z4OA 3IA2A 5CYOA 3ZY6A 5JNRA 2JLAA 1MZPA 2OXFA 1CY0A 4L22A 4DV1B 3T5CA 3D0OA 3RK0A 1KDTA 2B61A 1WBJB 2XD4A 4OXNA 2X8BA 1MAVA 4EELA 2IV7A 1T10A 1OFIA 4PVCA 1H42A 1XYVA 2IH5A 3DKIA 2PUVA 2YUIA 1D2GA 3OBBA 2QENA 3JVIA 3JZAA 4KWHA 2X2FA 4CTMA 2IEGA 2GPWA 1PEAA 3AEQB 5P8WA 4HVTA 3GJ0A 3CFYA 3AVOA 4LNUA 1XYYA 2L69A 3EVBA 4RH3A 5FL7A 2VHTA 4EO9A 4QC2A 1L4YA 2OGUA 1UT6A 1H3NA 1QZ3A 3JVUA 3BXOA 3OMLA 5ELMA 3SC6A 3W5AA 3HDJA 3PEWA 5ITZB 1E5VA 4GM4A 3H5TA 5EA2A 4YPFA 4YRNA 4X65B 2HMVA 3BREA 2FEMA 4PRKA 3VPGA 1V95A 1P0IA 2WWGA 2P8SA 3G5AA 2AMYA 4WCFA 2DECA 3GFFA 5EIWA 5KI6A 3V6LA 5C53B 4DLKA 3M82A 2FZVA 4EFLA 1EXMA 3AB3A 4H7HA 4Q02A 4L9WA 5HKBA 2F8SA 2RGAA 1M2JA 1L5SA 1BN7A 1LBEA 2UV8A 5H02A 3CC8A 4MRMA 3LUKA 4M1EA 3GLQA 1I3NA 4K6GA 4CQMB 3X1XA 1DXQA 3E61A 3CHYA 3CEMA 4K8OA 1MQAA 1UKVY 1V8PA 2ENUA 4KGXA 2W42A 3V7WA 2R62A 4IDHA 1MX5A 3CMMA 3C6ZA 1MFZA 1MV8A 1M54A 2QUIA 4LISA 3FKJA 1IRIA 2WUFA 2NXEA 2RHOA 3OPXA 4HEQA 4JNCA 4LE1A 4MR9A 1Y6JA 4NABA 2I66A 2JIZA 2QRGA 2Q50A 2H07A 4FYWA 3P2JA 4X1KA 2X1HA 5T6MA 4WUVA 1YZYA 3UJHA 3VR2A 2A7QA 4KFCA 1D2CA 2J85A 4MUAA 4P3OA 4PNHA 3REGA 3MELA 4F5WA 2QTFA 2I29A 3CURA 2XYVA 3NAMA 4FUTA 4W1QA 4BV9A 4PRZA 3R7WA 3H6KA 3N8NA 1E6KA 4IJQA 4OY3A 5IDYA 4ZMBA 2JVJA 4YT4A 1XRPA 5ITSA 2FW0A 1P3Y1 2FPGB 2VEDA 2YVQA 4G5YA 4GOJA 4KWEA 4EJSA 3T5PA 3DZGA 1MHTA 1V5IA 4IIHA 1FDIA 1NJ6A 2PUEA 1UAAA 1NJ8A 4UVEA 1KZ4A 2XUPA 5JBIA 3FLAA 4J2TA 2ZM6B 1D2MA 4PGFA 1DEHA 3G0HA 2TMDA 1U3DA 1TDJA 1ZOIA 1ZX1A 3I37X 3W7VA 4Q3OA 4V0SA 2PL1A 5BW5A 3QHPA 3PX7A 5EQFA 4JKOA 1FUYB 5C8ZA 2IPNA 2NTJA 2HK9A 5IXSA 4R7TA 2AYXA 1OV4A 3S40A 3AU8A 1XZPA 5FL7D 3AM5A 1GAEO 2JIMA 3G7NA 2QRMA 4W5WA 1B93A 4NVRA 4INZA 3SR4A 1G5HA 3GCWA 1DRVA 4NARA 3LC0A 5DXFA 4XUDA 1TM1E 4TXHA 4B47A 2AFIE 5AP9A 3ILSA 1PL0A 2C7BA 2UZ1A 4G07A 4OQXA 4YJFB 4BKOA 3TVTA 3EXG1 1KY5A 1Y1TA 1U8AA 2GTPA 3MJEA 1PS0A 5HXAA 3NIGB 1OLXB 2FPPB 5IJ0A 5H0IA 2JFUA 4L02A 2W4QA 4M9UA 2H00A 1RWQA 1U1IA 4JBGA 5ALTA 3ZC3A 4DMFA 1OAAA 3UJDA 3VBEA 3INRA 3MCWA 3IUQA 5C1IA 1JIIA 1CZRA 1XCPA 1KJWA 5K03A 7MDHA 2AE2A 1ZG3A 4EL5A 1USKA 4W7IA 2FTKE 4IDDA 5BN4B 3OIVA 1RC8A 3HB4X 1AUXA 5LA6F 3W34A 1L4NA 4ZRDA 3W5HA 4B31A 1NV9A 1PT9A 4BECA 3FR7A 3Q11A 2XZPA 1YTLA 1ISGA 4R3UC 4R6WA 3KLBA 4BPRA 4CI0B 4US2R 2ZSKA 1ZZEA 4Q9DA 2VN8A 3GGDA 1EUDA 4OV6B 3V4FA 5KKNB 1TJ5A 3NHWA 1J07A 3WAKA 2YVAA 2ZDHA 1RWKA 3KKPA 1OYYA 4YTEA 3QPDA 5H59A 1ADCA 3GFTA 1Y9EA 3CW8X 3A9SA 1FSSA 3VR3A 4B3BA 4ND8B 5GM1A 3HCFA 3CVYA 3FRIA 4RDCA 3GFOA 4RMNA 4RETA 4LI0A 3P52A 1Y82A 1S9DA 3RVSA 5FV4A 1ABEA 3CTPA 1LDEA 4ESOA 5PGMA 2XUOA 3HR7A 4Z9YA 1KWGA 4MROA 2A5DA 2AJTA 2VPIA 1DO0A 3IBTA 1EA5A 1FK8A 4ZQEA 3S8MA 4R71A 2ARKA 3T1TA 1VI2A 3WMGA 1QKKA 4A6DA 4NX2A 5KNBD 2W4MA 3GJ6A 1LBSA 4OXQA 2QMQA 3A58B 2C5HA 2CDNA 1Z12A 2V4UA 4Q6BA 2VPQA 1U28A 1OHHA 3LX6A 4M76B 2I7XA 1DELA 4J16A 4WJZA 2NSYA 4PLZA 1MGOA 4YCDA 5AKXA 3W04A 2PUWA 2NU7B 1N9KA 1JQ3A 5CT9A 5C5DA 5B55A 4JJ4A 1M7BA 2IOQA 1GGFA 1YFZA 3FYHA 3NTQA 6ADHA 1LTQA 1IJFA 2RKOA 2OHGA 4KZPA 4A1FA 3G2KA 1H6BA 5EJ4A 2CV0A 2HQRA 4PTYA 2R7AA 3SYKA 1SOUA 4YAUA 1WHSA 3A3YA 3FMPB 3RAFC 3ENVA 3IOMA 4YROA 2BWJA 3T3GA 4ICIA 3GVCA 1WNTA 2YV3A 2ZIZA 3RJZA 2WFLA 3PTZA 4LDNA 3FNQA 3FRHA 2AN4A 3ENZA 4BEJA 4AJOA 4MI9A 4QTUB 5B7NA 5CCBA 3S55A 1F4PA