4L0CA

Crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
b'MKGYNVYANGIRQHIIHFPGTGSPLLLIPGITSPAVTWGFVAERLAKYFDVHVVDVRGRGLSESGDLDYSLDAMADDLVALAQRMEGVVVLGHAMGARIAIRAARKDSQVFSRLILVDPPVSGPGRRPYPAKWSWYAESIRLAQRGCTAMEMRSYCPTWTDEQIELRAEWLHTCQYTAVKTAFDGFHTDDIHTDLAQLTLPIQLVVAGGAEVIQPDDIAEIISLAPQTTTYVVEEAGHMIPWDNLEGFITAVSNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deformylase
publication title Crystal structure of the N-Fopmylmaleamic acid deformylase Nfo from Pseudomonas putida S16
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 83
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0cA00
1CIJA 1IVYA 3I6YA 1R88A 4UBJA 1MTZA 3NWOA 3QPCA 4OB6A 5ALMA 2HFKA 2XDWA 2J4CA 4UBIA 5ALWA 1LPAB 5K3FB 4BC0A 4JUIA 4AB1A 2I03A 4QEKA 4HXFB 4B9AA 4ZXFA 2WILA 3OTQA 4KE8A 4EY7A 2XLCA 1X2EA 3QMWA 5ALNA 1QIIA 3IA2A 1ACJA 3OPMA 1XQYA 3TGLA 1EHYA 2ZJ7A 2JEZA 1R9MA 3IB3A 4KR0A 3BJRA 3Q0TA 4OYYA 4Q3OA 4F21A 5D6OA 2I3DA 5LZ8A 3S8YA 5LZ5A 2ONCA 2CEKA 4C4YA 4KAFA 4JYPA 3VJMA 3DOIA 4IO0A 5JD5A 1TAHA 3H19A 1AURA 3RK4A 1W4LA 4H18A 4AMYA 2XT0A 4FBLA 3H2JA 1MAAA 1VZ2A 3CXUA 2XUIA 1H2YA 4QE3A 4OUKX 3HC7A 3EQ8A 1IUPA 3DDUA 3PI6A 5CH5A 3DL4A 1QTRA 4BAZA 4C4ZA 1QO7A 3B5EA 4NMWA 3OM8A 3NUZA 4YPVA 1E8NA 2DHCA 4GW3A 1VXOA 2JGEA 4UPDA 4HVTA 3AUKA 4OYLA 5AO9A 2DR0A 4W9RA 3STUA 2WSLA 1QOZA 1VE6A 3ANTA 1J1IA 5AI8A 1U4NA 4N8SA 3D3NA 2BFNA 2ES4A 2NW6A 4CG1A 2W22A 4AMZA 2Y6UA 3H1AA 3FLBA 3QMVA 1XZLA 2QT9A 1J06A 4FMPA 4OD0A 2XMBA 1WPXA 3WZMA 3SC2A 1FFCA 1NU8A 2XUOA 3C70A 3C45A 1EX9A 3ANSA 3G0CA 4LXHA 5HF5A 2XMRA 2ZYIA 1ZICA 2AJLI 2XQFA 2YH2A 5JIBA 1YS2X 2R11A 1HQDA 2D5LA 2GBGA 4B83A 2CJPA 1ZJ4A 5ALUA 2WUDA 3C6YA 5KWIA 3PFCA 2CB9A 2XQGA 5ALVA 1FFDA 4PSCA 1Y7IA 2I78A 1UK7A 1E8DA 1CPYA 1MO2A 3I1IA 3O0DA 4DSAA 1AGYA 1P0QA 4X7BA 2PUHA 3B3QA 3V48A 3BE8A 2ZSHA 1DX4A 4BZZA 1EK2A 1YASA 3JW8A 4EHBA 3HYSA 3D2CA 4BATA 1XZDA 3D2BA 1U65A 5C8VA 2XUKA 4FKBA 2GZRA 1XQWA 5CRIA 3WYDA 1MU0A 3N2ZB 1J2EA 3C5WP 5A7HA 4JEIA 1Z68A 2D0DA 5I7UA 4L72A 1XFDA 4DMKA 1CUBA 2Z8ZA 2R8BA 4BYMA 4Y2XA 5JADA 5KBYA 1ZI8A 5DWDA 4KACA 5A71A 4PSDA 4CIBA 3PF9A 5BOVA 4J0JA 2PSJA 4PV7A 5CW2A 1VA5A 5E4YA 3QMMA 4BDTA 4K5QA 5HKBA 3HXKA 3ICVA 1DWQA 5DLPA 3LLCA 4RPCA 2QOEA 4DLNA 2HA2A 4U2GA 4ITVA 3DNMA 1GGVA 4Q05A 2WFMA 1CUUA 5JARA 1JT2A 1WOMA 1TQHA 3WKBA 3FVRA 1DQYA 5AKGA 1UZAA 4Z49A 1WHSA 3A2NA 3C6BA 5HK8A 3M83A 3WIOA 1K5PA 3O4IA 2WUGA 4A5SA 3EBLA 4B82A 4ZI5A 5DYTA 1XZGA 4ZREA 1B6GA 5FDFA 4J0KA 2OGZA 4BTVA 3AJAA 2ACEA 5LKAA 3G0GA 3A70A 4MWSA 3EF3A 3D4LA 2HU7A 4J0DA 4LYEA 1MT3A 4KAAA 1HPLA 5LZ9A 4Y7DA 4XWGA 5AKJA 1BE0A 5EHZA 3IUMA 1A8UA 4ROTA 2HA7A 4BB0A 1S8OA 1A7UA 1TKRA 3G9XA 4DNOA 5ALYA 4INZA 1KU0A 2XQJA 3K6KA 4X90A 1DX6A 4BCCA 4A16A 3O4JA 5ALRA 4QDXA 1HKHA 3ESCA 4F5ZA 5AHXA 4EY8A 1EA5A 1JJBA 4M0FA 4OU5A 4UFPA 1ZI9A 3GELA 1T2NA 3WL7A 5JD6A 4KE6A 5ALQA 1JMKC 1XZAA 1KEZA 3PF8A 3GFFA 4H7KA 1A8QA 5LLSA 4CG2A 4NS4A 5FKJA 3U0VA 2JEYA 4UHDA 5AKZA 2VQ6A 3FSGA 4B9EA 1R50A 4YX9A 3BWXA 1CV2A 2V96A 1WB6A 2JGLA 3S2ZA 3WK8A 5LKRA 2CZQA 2ZYSA 4XVCA 2VEOA 4UHCA 1EH5A 4N8EA 4ZV7A 2ZVDA 4XIIA 4U2CA 5HF6A 4HXGA 1EB8A 4DNFA 2VSQA 4HAIA 2I3ZA 3OURA 4J0CA 4G9GA 3PUHA 3UUEA 1BRTA 2FX5A 4B6GA 5EFZA 3D7RA 1QIJA 3H2GA 3MGAA 4WY8A 1M33A 4H7FA 5JZ9A 2WHQA 3WMRA 1CUEA 4Y2RA 3W9UA 3JYHA 2WKWA 2VTVA 5BWCA 4J03A 1Q0ZA 2J3DA 4HZGA 2JGMA 5EIEA 1BROA 3W9BA 2XMDA 3TEJA 2XUAA 2XE4A 5JAOA 5AK3A 1CUGA 1ZI6A 3I28A 3IIIA 4TVKA 2C4HA 5ALTA 1MNQA 3HI4A 1PV1A 4BE4A 5AOAA 2FJ0A 2XQKA 3KSRA 3R3UA 2XUQA 3IBTA 2DSNA 3H18A 1YCDA 4QWWA 1JJIA 3ZLUA 1AKNA 2PVSA 1TCBA 1JJFA 4PF1A 5AI4A 4U2EA 1YAHA 2LIPA 1QIGA 1U8EA 1JU3A 3WA7A 5T4BA 2RONA 5LP1A 4QLOA 4FNMA 3STWA 4BVJA 3I1YA 1EDBA 1UKBA 4AO7A 4JYMA 4J0GA 4K6HA 3F9CA 1N5MA 5D7BA 2PSHA 1J07A 5LZ2A 4BCBA 5KREA 3DLTA 1KU6A 4OSEA 1QIDA 3A6ZA 5YASA 4C6HA 5ALEA 1EDDA 2XLBA 1H2XA 4WJLA 4BVKA 1UK8A 3LIPA 5AICA 3WKCA 1T4MA 1NU6A 1IUOA 4IH9A 3HJUA 5ALDA 2XUFA 5JZBA 4C01A 1CUDA 1HDEA 4BAGA 3ED1A 1ZGCA 4I3FA 1QIMA 4B80A 2PU5A 2VAVA 3ZPXA 3MUNA 1XRQA 3RLIA 2WU4A 1UOPA 1XKTA 3QZUA 2BCEA 4XX1A 5AK6A 1LPSA 2XMSA 5JAUA 3STTA 4BDSA 1CUYA 1YA4A 4C89A 5D3ZA 3F67A 5ESRA 3VVMA 5CT4A 1YS1X 5I8PA 1MAHA 2PSFA 1IZ7A 3FBWA 3KWFA 2O7RA 2B61A 2Z5GA 3OC0A 3HLKA 4WFIA 5CTAA 3H2IA 3T52A 3AZPA 2BJHA 2HA5A 3I2KA 3BL8A 4X6YA 5AOCA 1LPNA 3M3DA 1THTA 5AM0A 5T4EA 5IVDA 3W2TA 4WDRA 1XZHA 3DYIA 1XRRA 1DINA 4M0MA 1CRLA 3WKAA 1C7JA 4G4JA 3ZLTA 4TPKA 1XRPA 2Z8XA 3C87A 4TGLA 3KD2A 1N5RA 2QVBA 3O4GA 5ALGA 2V9ZA 4G8CA 4MQLA 2G4LA 3DQZA 4X91A 4E46A 3WI7A 3GA7A 5AKHA 1MN6A 3QITA 3R0VA 5J3JA 4GLBA 2P8SA 3F98A 4M0EA 2X8BA 3I2IA 5AI5A 5ALLA 3T4UA 5D3KA 2VT6A 1X2BA 5CXUA 1DT5A 4D9JA 1LNSA 3FLEA 3C8HA 2WIJA 1OILA 1G5FA 2XMGA 4UFNA 1AZWA 2QMQA 1YB6A 2G63A 3IUJA 2PKYX 2RI6A 5ALZA 2O2IA 5EHQA 2WIKA 4EZIA 5FRDA 5EGNA 3WJ1A 2OAGA 1H2WA 1EVEA 1VLQA 3C5VA 5CT6A 3G9UA 4WCVA 5AKIA 1DQZA 3STYA 5DNWA 1QIFA 4U2DA 4O08A 1F0PA 1ZIYA 1CEXA 2VT7A 1R4ZA 5HF8A 4P93A 3WWEA 1ODSA 5F4ZA 2PSEA 1ORWA 2EDCA 3AZQA 3AINA 1W6RA 3R3WA 4Y2UA 3I6ZA 1NX9A 2WU3A 3AIKA 3Q8WA 4G9EA 4AO8A 4AZ3A 2YXPX 1XRLA 1TCAA 4IHAA 1ETHA 4UBOA 4DMFA 1LBTA 4ETWA 2OCKA 1CQWA 5AI6A 3WWCA 3WL5A 2HFJA 5IVIA 3DEAA 4B81A 2C58A 3RKSA 1XZMA 3KWJA 2VATA 2JIDA 4Y2JA 5C81A 4X92A 2Z3WA 5IH7A 2WJ6A 4CI9A 1F6WA 4LKOA 3FYUC 2GYVA 1L7RA 4MYDA 1A8SA 1ZGBA 3MUOA 2GZSA 4DYHA 3WKEA 4BCDA 1QFMA 1TCCA 1XQXA 4Y9SA 4MQMA 1IZ8A 3WJ2A 1FFBA 4FTWA 1H23A 1EB9A 3VISA 1WCYA 3P2MA 3EQ7A 2FJPA 1UOQA 3VVLA 2GBCA 1UK6A 1QO9A 5ALFA 2EDAA 2BGNA 5AKKA 1VOTA 1E3QA 5ALSA 1GKKA 1CUZA 1VZ3A 3G7NA 3D5EA 3RM3A 4AO6A 4AN0A 4LIPD 2QUAA 2VA9A 4FNGA 3A2MA 3SWWA 3FYTA 1QGED 1ZD2P 1U2EA 2HRRA 1AX9A 2X5XA 5CBKA 1G66A 1DTEA 4QNNA 2WTNA 5HF9A 3HZOA 5FPQA 1SC9A 4K6GA 1MPXA 5K3EA 1R3DA 1WB4A 1ACLA 1B41A 4P9NA 1R1DA 2W6CX 1WHTA 4P92A 1EK1A 1QIEA 3LIIA 3SX4A 2QTBA 3WYNA 4DNQA 2WLSA 3TJMA 1LZLA 3CCCA 3O95A 4X6UA 2C0QA 3M82A 1VJ5A 4KRXA 1GQSA 1N8SA 3G8YA 2K2QB 2RGUA 1O6FA 2ROQA 5CH3A 5IKXA 1UWCA 1SCQA 2G5PA 3KOOA 5CURA 4OCZA 3BF7A 1USWA 4B85A 2WHPA 5EI5A 3O9VA 4FLMA 4BP9A 4QA9A 4I4CA 5ALIA 3WZLA 5FXMA 3WQHA 4BC1A 1DWPA 4A23A 3DJYA 2XQIA 2JBWA 2OQIA 2O2HA 1QONA 4PW0A 1QIKA 5AK5A 4P08A 4F60A 5JALA 3W05A 1DU4A 1ODTC 1P0IA 2PUJA 3N0TA 5JAHA 2UZ0A 4EBBA 4GBGA 3AZOA 1THGA 1H2ZA 4HTAA 3QVMA 5HK9A 2WUEA 3F97A 3W06A 4PSUA 1LPMA 5FUMA 4Y2TA 4Y2SA 4AX4A 5ALOA 1JMYA 5BV7A 1MX5A 4E14A 2QJWA 2WG1A 5I9IA 1ZOIA 5A7GA 2J4FA 2ZYRA 5KWJA 3M81A 4EA6A 3X3HA 1W76A 4GHWA 4X6XA 4LXIA 1XZEA 4BZWA 4EY5A 3H2KA 3L1JA 1H22A 4OU4A 4CFSA 2XUHA 3IDAA 3PICA 2HHAA 1D07A 2VJDA 5FLKA 3AIOA 1HL7A 3VJKA 1SCKA 2WFLB 2PPLA 3HRHA 1MNAA 1XZFA 3V1KA 2O7VA 4AN1A 2AJCA 4HRXA 2J3QA 1Y7HA 1SCIA 3HSSA 2BAGA 4IQ4A 2H9YA 3PFBA 3DL7A 4H35A 5SYMA 1YAJA 2C5GA 1UK9A 5AKEA 1K4YA 2HIHA 4BRZA 2PSDA 4QDZA 1GXSA 4G1FA 1RYYA 5AM2A 1WB5A 2ORYA 1DT3A 1K8QA 3V1LA 4FHZA 5T4FA 3QYJA 2H1IA 3E4DA 4U2BA 2HA0A 4YK7A 3WL6A 2OPHA 2WJ3A 3QPAA 2FUKA 4RE5A 4UHHA 1GPLA 4WFKA 5FV4A 1SFRA 4ZRDA 1CUVA 2GYUA 4UHFA 2JGKA 3WK6A 5CXXA 2WIDA 2XUJA 3R40A 5CT8A 1TIBA 3ILSA 2QKYA 3IULA 5CH8A 4C87A 5EHXA 1YSCA 1XZCA 1OCEA 4OPMA 3KXPA 1CUFA 4LHEA 2HU8A 2PM8A 2IIVA 4PO3X 2HADA 2B9VA 2RIPA 3ZWQA 1AC5A 5C8XA 1PJAA 2QZPA 2Y6VA 3WK4A 4FBMA 4G4IA 1CUCA 1K6EA 5HFAA 3D59A 3H0CA 4H77A 2OCIA 1QIHA 3FYUB 4GEGA 5A62A 3H1BA 2V97A 4KE9A 4MJ3A 1FJ2A 2DCMA 4GI1A 2WQZA 4FFWA 1DWOA 3WWOA 1UKCA 2WFLA 4X97A 1TK3A 3UUFA 3VJLA 4BE9A 1TRHA 3FWHA 1XQVA 3PDCA 5CMLA 3CN9A 1EVQA 3UMJA 3V1NA 3C6XA 2DQYA 1G4HA 4PNZA 4ZWNA 1UFOA 2DQZA 1EINA 5E4JA 3I2GA 3WKDA 4DGQA 3V1MA 3GZJA 2WG2A 3HABA 1VKHA 4UBMA 4DTCA 4Y2VA 4RE6A 2Q0XA 4X94A 1CUAA 3LCRA 4MEBA 3H04A 5JANA 2AXEA 4J0HA 1WM1A 1JU4A 4ARAA 5HQ3B 3BIXA 3IUQA 4CIAA 1G42A 4E11A 4GWLA 1GZ7A 3HACA 4ARBA 5CT9A 3E0XA 5JZSA 3IURA 5ALXA 1L7AA 1XRNA 3FOBA 4W1QA 4G5XA 4GDMA 2OG1A 5DYYA 4KE7A 3ZV7A 4N8DA 5A2GA 3G02A 2AJDA 3U1TA 2HA3A 5ISMA 2WTMA 2GBFA 4Y2PA 2CBGA 3FYUA 2QXTA 2OCLA 5AM1A 3DCNA 4EB0A 4DM7A 1XRMA 1BU8A 5HZGA 3AIMA 4V2IA 2XB6A 5EHNA 1BN7A 1UKAA 3PE6A 3FCYA 3LS2A 1LPPA 3I2JA 3R3ZA 3KDAA 4H7IA 2HA4A 3IVMA 3C8DA 5ALPA 1LLFA 3QPDA 4OB7A 4QLAA 4JH0A 2RHTA 2Y2VA 1CFJA 5AOBA 2QM0A 4B84A 4KAJA 2EEPA 1F8UA 3WA6A 1XLVA 4QDTA 3R3VA 2PX6A 5AM4A 4Q34A 3K2IA 2IX9A 5HCUA 1XZJA 3ESBA 1LPBB 5AJHA 5HFNA 4J3JA 2B20A 4G8BA 4L0CA 2G5TA 3DYVA 5HQ3A 2C7BA 1UT6A 2CKMA 3OG9A 3ESAA 4BTLA 1W52X 1XLUA 1GQRA 5K3BA 2BUCA 4I19A 3A2LA 3D2AA 4KEAA 4AXBA 2E3JA 2VJBA 1L7QA 1ZJ5A 4Q1VA 4AZ0A 3ICWA 5LYYA 1LPOA 2OCGA 2VAXA 4E15A 3HEAA 2WHRA 4B0PA 2ACKA 1BCRA 2YYSA 4C88A 5K3FA 1CUJA 5DTJA 2CUTA 5T4HA 1R9NA 3L1IA 2H7XA 4W1RA 4Q3LA 4FWBA 4IH4A 3CN7A 4DMHA 2JF0A 4Y2YA 4G4GA 5JASA 3I6MA 4ZGBA 3FCXA 2ECFA 5AI0A 1ISPA 4LYDA 4QDUA 2XMQA 1WPRA 4X85A 5E2IA 5LIPA 4H7HA 3BJMA 4AQDA 3GBSA 5ALKA 3VKFA 4BBZA 1QZ3A 5A6VA 5FOQA 5AI9A 2XI4A 3NGMA 3OOSA 4NVRA 5DYWA 1AQLA 3WK7A 2VJCA 1C4XA 3BDVA 5C7YA 5K5EA 1FSSA 1E66A 3QH4A 1UOOA 3C43A 2OGSA 5K3AA 5JAPA 5FP0A 3NOXA 4KJXA 2WHPB 2XMZA 5AKYA 1CLEA 1YB7A 2QR5A 4WY5A 4CCWA 1GKLA 4FFVA 3FVTA 1XZKA 5ALJA 1QTIA 2QJRA 2HA6A 1XLWA 3ZLVA 4XJVA 2XUPA 2OQVA 2V98A 3V9AA 3G9ZA 5AH0A 1ZIXA 4U2FA 5ALHA 1JKMA 3WWDA 5CT5A 1P0PA 4HXEB 1FFEA 5LZ4A 4UFOA 3R3XA 3YASA 1RP1A 4DSZA 1BN6A 3I2HA 4RGYA 4B0OA 4KRYA 1CVLA 5K3CA 5AIBA 4CCYB 4K2AA 1K63A 2WJ4A 4H7JA 1QFSA 3O9MA 2QRUA 2HDWA 2WIFA 3R41A 3BXPA 2XUGA 3SK0A 3R3YA 5A7FA 2HM7A 1CUSA 1W1IA 4W1PA 5JATA 2ZJ6A 3BF8A 2Y2UA 2WIGA 2IITA 1A88A 5JD4A 3STVA 5AKLA 1E89A 4K6KA 2X76A 2JGFA 5DNUA 3L1HA 5DNVA 1Q0RA 4PQEA 4N5HX 4X95A 4UBKA 4KYVA 1LGYA 3AFIA 3WL8A 5AM5A 2YASA 3IUNA 2HRQA 1ODCA 2CMFA 1AMNA 3VDXA 4GXNA 1VXRA 1XROA 3RARA 1ZD3A 3DS8A 4X93A 3EIOA 2VJAA 4QZVA 1JFRA 4MYSA 3EQ9A 2RHWA 3WK5A 3QBJA 2Y1KA 2XUDA 5DTIA 1O6GA 2WM2A 3GUUA 1BCSA 2OAEA 5AM3A 1X70A 2WUFA 1CUWA 4IH1A 1ZD5A 4DMCA 4QDOA 3W04A 4W1SA 4H7DA 1GPKA 3ZI7A 1SOMA 1VE7A 5E4TA 4J7AA 4B7ZA 1N1MA 2BUAA 5IVKA 3GROA 4YASA 4CG3A 1CQZA 4CCYA 5AIAA 5C8ZA 1CUHA 4QWMA 4FDMA 5AK4A 3FSGD 3LP5A 4WDQA 4BP8A 3DKRA 4DIUA 4UHEA 5K3DA 4N5IX 4W63A 2RAUA 4BVLA 1CUXA 3G9TA 1BEEA 2QS9A 3WLAA 1QLWA 4MXDA 5BWBA 1W75A 1JI3A 3E1GA 1AUOA 2VF2A 2DHEA 2DFPA 1Y37A 4X00A 2C5FA 4H7EA 1XZIA 4JNCA 2WG0A 6YASA 4J0IA 4FLFA 4UBNA 3G0IA 1YA8A 5JYCA 2PBLA 4BRSA 4F0JA 1Q83A 3WK9A 2ZSIA 1LBSA 3D0KA 2HU5A 3F96A 5SYNA 4WFJA 3PUIA 2XMCA 3F8SA 4H0CA 3O4HA 1HBJA 2AJBA 1OXMA 4NZZA 2H7CA 4HRYA 1EXWA 2OXEA 4UUQA 3DKKA 4FLEA 2QXUA 4RNCA 3JWEA 4MWTA 4Q3KA 4EUSA 2C0PA 5HKAA 1MJ5A 4OB8A 1XKLA 5IVHA 1FFAA 3STXA 1BEZA 4MEAA 2Z3ZA 3I2FA 5AP9A 4X71A 4L9AA 2GBIA 3G0BA 1EDEA 3DD5A 1HLGA 3WIBA 3VXKA 4HS9A 2JGIA 2BGRA 3H2HA 1I6WA 1CUIA 4FOLA 3C6ZA 4S0XA 1IMJA 4ZV9A 3DOHA 5FPPA 1QJ4A 2PU7A 1LZKA 4C4XA 3CCBA 4G8DA 1QE3A 2B4KA 3B12A 2PL5A 1E8MA 4L3WA 3MVEA 1Q84A 5EIHA 1GPNA 1YR2A 1C7IA 4UHBA 2QUBA 3G0DA 1UXOA 4DNPA 2OGTA 1BS9A 2ZJFA 5LZ7A 2BKLA 2JGJA 2ZYHA 3AILA 2AJ8A 3TRDA 4EY4A 1E5TA 5AKXA 1CR6A 2OLEA 3BDIA 3H17A 4X3CA 4EY6A 1GT6A 3E3AA 3ESDA 4LXGA 5EIAA 2BUBA 3FNBA 3QM1A 1MX9A 1ZD4A 2WFZA 1F0NA 3FLAA 4UBLA 7YASA 3K9BA 5H3HA 2H7YA 3FAKA 5DJ5A 1VA4A 2HL6A 1MX1A 4Q82A 1PFQA 2O2GA 3WWPA 3BIWA 4GECA 1XZBA 1ORVA 1P0MA 4BAUA 4Y2QA 2GYWA 2DHDA 1IUNA 1RWQA 1EI9A
chains in the Genus database with same CATH superfamily
3MPOA 1IVYA 2GR9A 5ADUS 1R88A 1RXVA 1E60A 1HKUA 1NBOA 4ZDIA 2IHUA 1O9BA 5UKDA 3SSAA 4MUYA 2R6FA 2O1WA 1MTZA 4CLHA 4F12A 3D6TB 2QX6A 1UM8A 3BD9A 1ZEMA 1RCUA 1YNOA 1Z63A 4H6VA 2ABWA 1NNI1 1XA4A 3TLMA 4Q7MB 1BX3A 3EPLA 2XB2A 3RU9A 2VH5R 1LF0A 1TM5E 4RCZA 3E7FA 3SQOA 2XD9A 5FPYA 4E5NA 5ALMA 2C8KA 1W5EA 2J4CA 3OTHA 5BSHA 4YDRA 1NN1A 4Z54A 1YONA 4N48A 4UBIA 1TA9A 5ALWA 2R1TA 3DE6X 3MA0A 1MO6A 4KV7A 4M86A 1QTQA 4O4IA 2IZ5A 1XKXA 5BY2A 3U0BA 1XG5A 1FS4A 1JDPA 2ANBA 2H4FA 4KXLA 5CA1F 4MVCA 1PR0A 4AB1A 2I03A 1U9IC 3C3YA 4ESHA 2QENA 3H9BA 2P3OA 4WBSA 3PHHA 4RNDB 1AQYA 2Q4RA 4BEBA 1SHLA 2CNDA 1EK6A 1GTMA 5HEKA 2BTEA 5T6BA 2ID9A 3OTQA 3ZY6A 4F4JA 2Q3DA 2BWJA 3QMWA 5ALNA 1A5BB 1QIIA 4BMXA 3H4VA 4YRTA 1XKQA 1ACJA 1Q74A 4RDCA 2FFJA 1MQ8B 1P8AA 3WGUA 5JRDS 4MKFA 1P17A 3HLYA 4YAGA 3A6EA 5KOHA 4I46A 1R9MA 2L42A 1T5DX 2VXOA 4KR0A 4MKHA 3G7UA 2M6RA 3EXEB 1P9OA 2I54A 3GLUA 3K0CA 1BWSA 2PH1A 4V3CA 2P69A 4JX8A 1C7EA 1OX4B 4GBED 4XDYA 3UW1A 3ZCVA 4C6TB 2FR0A 3IKJA 5LZ8A 3S8YA 1TT5A 2EVWX 2ONCA 4C4YA 2HHHB 3HCWA 4DXDA 1MX3A 1SWVA 4S1OA 3ADCA 1JBEA 4QATA 4BNVA 5CXQA 5BN4B 4QKQA 1VKNA 2WPDD 4JS0A 3CLUD 4C08A 2RGNC 4RWZA 1UJ2A 1X7YB 4A6EA 2NTJA 4RMIA 4FD2A 2QN1A 4GX2A 4IM7A 1WQ4A 3KKOA 3ZWNA 4BV9A 4DQDA 4H18A 1SIOA 4WT7A 3JQ7A 4XJTA 4AMYA 5K3OA 2VRCA 4LC9A 3TBFA 1FDTA 3VDQA 2VHTA 5B6JA 5JI3E 1YUMA 3HVRA 5BW4A 2IU6A 3L7YA 2FPKA 5K8CA 4WFQA 2XH8A 3Q3EA 1RT9A 3Q1KA 5CJ2A 2EJUA 5DSTA 3Q8LA 5DM1A 3LCVB 3AR7A 1PW7A 4C05A 1R5JA 1Y9EA 1UAAA 2F67A 2BGUA 2VNIA 4K9DA 4OJTA 1TZBA 3HR4A 1W8DA 2Q29A 5BXQC 5J4KA 4QE3A 3K6JA 4Q4AB 5FWXA 5KDLA 2KHZA 4HPXB 1VDMA 4JQSA 1OVMA 4MRVA 4TTRA 5DOZA 2QE6A 5EY5B 2PZGA 1KSJA 5TF4A 2BHNA 6ABPA 4GPZA 5B30A 3BSYA 3B51X 4RHFA 1COWD 4JK3A 3QU9A 4QLBA 1Q12A 5K0BA 4F2DA 1QTRA 5M5BA 5DFAA 4HUQB 3LG2A 4I4TB 4ZMRA 3MBKA 5IAEA 1E3LA 1Z6PA 5I7HA 4C4ZA 3PLNA 1PG5A 4V1CB 5F2EA 5KVCA 1FLAA 1W49A 4X84A 2HK8A 2J9GA 2W11A 3O8BA 3QKWA 4IV0A 3DLHA 1PQPA 1E4VA 4HQ0A 1I36A 3TUIC 4RHUA 1E8NA 3GLQA 3RRNA 4DJDC 3B2QA 3BMOB 1RAHA 4PANA 1VXOA 4TTJA 5FO0A 3ZYZA 1BWQA 1KR5A 3UXMA 1PT9A 3C39A 4L4SA 1NNSA 3BFJA 3EIQA 1NI4A 3QSYA 4I0WB 2CD7A 4QTYA 3N8NA 2GK7A 5IW8A 5C34B 5KNCD 1S4MA 1VE6A 1GTG1 5B2ZA 4GWKA 4JSTA 3DFZA 4NCIA 2PE5A 5AI8A 5IHPA 5K0CA 3RGGA 4N8SA 2ODQA 3BREA 5FPSA 4D9IA 1OBFO 2NW6A 1VP9A 2W22A 1JEJA 1CR4A 1CY4A 2G0TA 3PPIA 1A50B 3FWNA 3QUAA 4JD5A 2XT9A 1IOVA 1U80A 1ZPDA 4JJZA 3W8RA 4AMZA 1SKMA 2P5SA 3W1VA 5CXSA 2OXRA 2QY9A 4ND8A 4DIEA 5HOQA 3A9VA 3CURA 3P4XA 2QT9A 3RFVA 3R1IA 4G1MB 3ZK9A 1B2LA 4FMPA 1WPXA 4F4CA 3ICOA 3NAMA 1H4SA 2IDMA 3LCMA 1ZXXA 4JIGA 1KMMA 2LTAA 3OH8A 3R4VA 3H4MA 5TPZD 4XX0B 1DAEA 4R1LA 4PSKA 5KTTA 4HZIA 3S1LA 4OAPA 3BTUA 3D7SA 3JQ6A 2GK4A 4O02B 3QWHA 3HY6A 4CMHA 3TS1A 4A0SA 2XUOA 1W35A 3C45A 4DABA 2IPOA 3NORA 3LY5A 4IGFA 2OXIA 3WQBA 2QTZA 3K70B 1EX9A 1S2LA 1Z6ZA 3D0QA 4LJSA 3VR1A 3FUCA 4KITB 5HF5A 1OLXA 1CFZA 2XMRA 2VDVE 3AY6A 4YYZA 2I7CA 4RTLA 1G21A 1R6BX 1AMUA 5FL7A 1WKBA 4DREA 4HBZA 2JL1A 3I8SA 3ZY5A 1LSUA 3Q98A 5M3BA 1YA6A 4HDNB 1E96A 1G6HA 4EYKA 4D96A 3HDVA 2GTHA 3PD7A 4ZZ2A 1KK3A 2RGGA 4IQ0A 5TB5A 3AIIA 1I4OA 4B83A 2E82A 3M3PA 1WEKA 1F0KA 4D3FA 4WXMA 3CCFA 2XQVA 3FVQA 4NTZA 3TCXB 1XR3A 1XZ8A 2V58A 2XA9A 1IULA 3C6YA 3KL2A 3SZMA 4CIYA 1TTTA 3PFCA 3FTFA 1X92A 2HD4A 3OPYI 4UHJA 5FAKA 2BHLA 2XQGA 5A5EA 2RG1A 5KTNA 1MCZA 1K5DA 3D8BA 4DG5A 2AQKA 2I78A 4JKIA 3WRYC 3CMCO 1CPYA 3PXDA 3NM4A 3NO4A 3BT7A 2PUHA 3PGMA 1NF9A 3B3QA 4CQJA 4LGYA 4AI6A 2ZSHA 1V8DA 4L75A 4MV3A 4ZVLA 3WLTA 1O95C 4TLLB 5TGTA 2IV7A 3WAGA 3PEYA 1FNCA 3BMNB 1M8GA 3U7GA 3D2CA 3NHSA 1M73E 3PQ3A 4PSAA 2JBAA 1W30A 4NNPA 5TE9A 3T41A 3UMRA 1JSCA 1HFKA 4RMJA 1W4BA 4JBNA 2COKA 3F5MA 3PCRB 4M22A 3EGDB 4AZSA 1XD2B 4EBFA 3V1TC 2VOEA 4XQCA 1IIBA 4CV1A 5JH7F 1U2TA 4PZZA 1OI7A 2B30A 4A10A 1I2CA 3IP6A 2ZYGA 1XQWA 4TWJA 3DMTC 1JTEA 1YOVB 3DT8A 4EYOA 1FSZA 2QNRA 3WYDA 1ZVQA 3ACCA 1TQ4A 4RIHA 4CL2A 3W8NA 4R7TA 4ZARA 5CA1A 1ZK2A 2IP2A 3HSYA 1KZ4A 2JFGA 3FOAA 3G17A 3MQ4A 4KFSA 5A7HA 1J20A 1U9YA 3NHJA 4UNRA 2QD5A 1NMXA 2Q9AA 2YQ4A 5DTEA 2G6BA 1P5HA 4JB8A 1YDFA 4MI9A 2C2ZA 1XT6A 5CM9C 3UHFA 4O6VA 1LC0A 3MJSA 3IR5A 4WN9B 3C3XA 4IXMA 3V8RA 1AQJA 4DMKA 1GA6A 3ES9A 1ZP6A 2OO3A 3R6TA 4O4LA 5JFTA 4KR7A 1QE0A 2FF7A 3AESB 4JB0A 1SXHA 5U4QA 4WINA 2AC4A 4NBSA 4BXOB 4Q7LA 5KBYA 2C5AA 2HSEA 4RVCA 1ZI8A 3DM9B 4PG4A 1ZONA 1CIPA 4KACA 4RD6A 5DWDA 4DW8A 1EP3B 4JN6B 5JJIA 2QTNA 5FPHA 4RF2A 1ZO8A 1A9ZA 2PS0A 3P9QA 3PJRA 1E3DA 4DSUA 3HCBA 4RWEA 1Q1GA 4UD2A 4BNXA 3ZD7A 1A9PA 4EEZA 5CDUA 1EWTA 4FHGA 2CXQA 1U3TA 1NR5A 3R23A 1Z3IX 1H4TA 1W0JA 1DJLA 1K75A 2HYDA 4GMDA 2YRFA 4KR6A 2LKDA 2YXDA 3HB5X 1PYOA 5DWQA 4BDTA 4K5QA 3B5IA 4G0WA 3ICVA 3PHLA 2LDBA 1JWAB 2OC9A 4HWSA 4ZGGA 2CSXA 1WUJS 3LLCA 2JARA 1AA6A 4AU1A 4U4AA 2QOEA 2BDEA 1RLIA 4ITVA 3UYKA 2FSIA 3C74A 4WVFA 5K6TA 4LBYA 3QF4A 2DFVA 4N49A 1CUUA 3IMKA 3Q5EA 2QQEA 4UM7A 2HSJA 2DUNA 1OE0A 2H4YA 3GC6A 4R1TA 3TG8A 1E9CA 2JCBA 2DYKA 4J4HA 4Y0NA 3CA8A 2IQIA 4LI3X 1WOMA 3U7IA 2WWWA 4AS2A 2PJUA 2OECA 2PL3A 3EH1A 2C03A 3F46A 1KAEA 2AG6A 4FE7A 5AKGA 4BFSA 1UZAA 5JNWA 3PJGA 1WB9A 1QLHA 3K0BA 3AY3A 2F55A 3CUTA 5HK8A 3U5TA 2C1ZA 1L4UA 3AK4A 3LPCA 4XD2A 1AV6A 3D6VA 4IZOA 4BGIA 3ML1A 3C0KA 3M83A 1D6NA 3UAWA 3P5SA 3EARA 3HJCA 1G98A 5TV2A 2F4NA 3RIEA 4K9MA 4DXAA 5K0FA 2WUGA 4XIJA 5CVCA 3KPVA 4QTTB 1CY2A 2IUTA 3BK2A 2JRLA 3TW6A 4BYGA 2HF9A 5HKOA 3P1JA 1RQRA 4F93B 1NKSA 5LQRA 4I1PA 2DF8A 4AKEA 1SEVA 3CX8A 2EP8A 5CVVA 4F8EA 4EG5A 2FUG1 4KUGA 2IY9A 3QVGB 5K1ZA 2B3TA 2M1XA 1C9JA 1B6GA 2A1UB 4BV3A 2ZBPA 3HM2A 1OV4A 3TOZA 2OBMA 4YQEA 3N2LA 3LYUA 1KJJA 3PKZA 5B1EA 4P3KA 1ZMRA 4I66A 4KCGA 4ZEVA 2ACEA 3U3OA 4P3NA 3TI7A 3A70A 1H9AA 4GZ5A 2YICA 2GEJA 3D4LA 3H4IA 1SU7A 4G2NA 4MGKR 1AZLA 1HE1C 3W2IA 2HU7A 4YCMA 1CSEE 1SURA 2MSEB 4LYEA 1MT3A 3DE1X 5IC6A 1KXZA 1G6KA 3Q3CA 1HPLA 4E3WA 4HGPA 3NVMB 3ISJA 1FXSA 3NBZC 1HEYA 1JX6A 1KEVA 2JZCA 2F1IA 3QKSB 4UEJA 2AFIA 3KYIB 4UCXA 4QOFA 4GOLD 3VU9B 2NU6B 1Y7PA 1DG3A 3D6AA 1E2FA 2HB6A 4P5PA 3M3HA 4DRYA 4IXWA 5AKJA 3TM5A 2IOHA 2HWUA 2FPWA 2XB4A 2JLYA 2QD1A 4L8VA 3ZBUA 3HA5A 3V8MA 4G0UA 2RJOA 4KK4A 4G63A 3I37X 2I87A 4O4JF 3GEEA 3FY4A 1T1JA 3GJ6A 4LZOA 1DZ3A 4B4DA 1XPJA 4QQ8A 4S1WA 6GPBA 2BEWB 2B4AA 5EP2A 2AMVA 2C04A 4EX6A 4BFCA 1B8VA 1SOUA 2CDBA 3AUXA 4IINA 1WUIS 1JIXA 4FNAA 4INZA 1SC4A 3K6KA 5FLYA 1QG2A 1CF2O 2X0FA 3TMAA 4BCCA 2RHHA 3ELWA 4MLZA 3RVOA 4A16A 4DGSA 3O4JA 4OSOA 5ARBA 3FTCA 4GNRA 4QDXA 4MJ7A 3HYTA 1A8PA 3ZHRA 5KNDD 1PD0A 1JEOA 3WHLA 4BOYA 3SJZA 4W99A 2AFIE 1T3LA 4N41A 1EA5A 1WSWA 2K6GA 4M0FA 3LRPA 3T3IA 1B3BA 5IZCC 1R18A 3OU7A 1ZI9A 2R4TA 1FRNA 4TS1A 4TMKA 4BB9A 2PKQO 1T2NA 3B1VA 2XNJA 2WF8A 3GLHE 5LB2A 3ROMA 3KZXA 4ZANA 4LRXA 3H7IA 2BVNA 1JHUA 1K98A 3MCZA 2ILVA 1DO2A 3TLKA 1N8KA 1OSNA 1CQXA 3K2BA 3G82C 4KBFA 4M1MA 3GFFA 3O6VA 1ZY2A 1R8YA 4AT1A 3ZJVA 1M1YA 1A8QA 2ASEA 3MMZA 4RGBA 1LQTA 3WGLA 3AR8A 4FGWA 4LRYA 5LLSA 4CG2A 2QTFA 5CLQA 5JH7A 4LF7B 5FKJA 1MJFA 5CJPA 1WDMA 2FWBA 1YFZA 2QYOA 1R8QA 4O5OA 5EE0A 4F9GA 5B37A 2JIRA 2QAGA 4LY0A 3C48A 4M88A 2VQ6A 2ZYUX 3VR0A 5AVYA 3AV3A 4JP8A 4F3KA 4PO1A 4YX9A 2GI4A 1QYWA 2QRVA 3BWXA 4C6RA 2V96A 1U1EA 3HCFA 1GAWA 3BE4A 3QEOA 4RDIA 3CZPA 1SOAA 4FDLA 4YP9A 2P6UA 1PFKA 2TYSB 3AUFA 3WK8A 5L40A 1BYIA 4ZQCB 3JZAA 4B3TB 4C9BA 4FBGA 3IUSA 4UHCA 3ELUA 3F1KA 1TADA 3O8RA 1ZMOA 2ZVDA 3ZWAA 4MUEA 3BFVA 4IW3B 1ZL0A 3FDJA 3RC9A 3DHNA 1R00A 5AESA 4NJEB 3GEPA 1TMYA 4F5WA 1GPMA 4IZ6A 1JHPA 1JJVA 1M1YE 4HXGA 4TSFA 3H75A 2NPFA 5KSOA 1KQNA 4DR5B 2IYUA 4ILKA 4DEXA 4ZZ1A 3AVUA 4P36A 1KH2A 2VSQA 4HAIA 3SZRA 3OURA 2OV3A 2CFCA 4RZHA 4MIKA 2ATXA 4Y98A 2PGIA 1VHWA 4NYMQ 1JBQA 2YN0A 3UUEA 2O2YA 3ZS8A 1QTNA 1HFWA 2VJNA 1D5CA 1SUFA 4DWOA 2H2DA 2FX5A 3CLHA 1Z0SA 3PNQA 3V4ZA 1XXHB 4F5YA 4F9TA 2VQEB 2G36A 1C4KA 1TEVA 3GD5A 4DOMA 2HT1A 1UJMA 4WUVA 1UEIA 4EM6A 3SDZA 3OEYA 3C3WA 3IEVA 3OZGA 2BY4A 4ZAFA 2FW0A 3GFQA 4WY8A 1M33A 4BPRA 1N9GA 4H7FA 4A91A 3WLJA 3EZ7A 4EYSA 1SCUA 1U9IA 1VRCA 1QH0A 4AJOA 3SEFA 2QPAA 4Y2RA 3W9UA 3DUFB 3JYHA 1GPH1 1R10A 4UDNA 1G20A 3HXTA 5AVZA 4S3MA 4DC0A 2VZEA 3QU4A 4FJ0A 1TQ2A 3OX3A 2A9KA 4LJYA 2JJMA 4J03A 4KQHA 3ZCUA 2HMSA 2HQRA 4HZGA 3K0FA 1JNXX 1VE9A 2V5VA 5EIEA 3DG9A 3GAFA 2HC9A 2P2LA 2XMDA 4Q4DA 4BNDA 3RRZA 1R6DA 5AHWA 3VTAA 3HWWA 4Y18A 3KQOA 3MIZA 2W2LA 2WJVA 4OQEA 3SS7X 1FVOA 2PUAA 4WW0A 3TL6A 3GCWA 4TVKA 3P94A 5F64A 2C4HA 5DHSA 3UK0A 3PEWA 1I4LD 3DE4X 5ALTA 2UXBB 3MLAA 1DWUA 3OZBA 3DLIA 2LZ0A 1Y63A 1VBMA 3C3JA 3JYQA 3GBPA 4BLTA 1TD9A 2TS1A 3I1JA 3LUHA 3IJRA 1HO3A 2FJ0A 3DAFA 3AU8A 1G20E 3DMYA 3NP7A 4FMDB 2QW0X 3OX2A 5AW5A 2XUQA 1HURA 3A05A 3IBTA 3H18A 1WJGA 5DLDA 3DVQX 3KXLA 3VVCA 4C4RA 5IUNC 2F3TA 1NSTA 3E5HA 1JJIA 3FKJA 4KQXA 1NFFA 1T9ZA 1AKNA 5G3ZA 3ZLUA 2NP7A 1CHDA 1PL0A 1U0JA 3U56A 2PRIA 3N7TA 4QTZA 4V0LA 1JFFA 1V9LA 2UZIR 2IZ1A 1EGAA 3MTJA 4PYRA 4PF1A 2ZETA 4AMGA 5C7LO 2BZ1A 1L6IA 4QSHA 3ESQA 3ZZ0A 1QPGA 4FFLA 2LIPA 4U1RA 2ZU0C 1GRVA 3SEZA 1V4BA 4EY3A 4E08A 4CEHA 5BSUA 4NCKA 2L82A 2Y92A 4DQXA 2D1FA 3PC4A 4G24A 4DR7B 4C0LA 1N0IA 3FBTA 4IUBS 3U4QA 2SNIE 3FF1A 1BE8A 4FNMA 3ZHUA 3V34A 1XV5A 1L5SA 2WU1A 4C22A 3SYKA 4TYMA 4FX2A 1RBYA 4AO7A 4JUCA 5FCDA 2OSVA 4B6OA 3IV7A 3H1PA 4KMRA 4WTOA 4JYMA 3BXFA 2PWYA 1Q50A 2PANA 4ISBA 3F9CA 4O4JA 2IPXA 1G7TA 1MG5A 2O2ZA 2R8ZA 5CNKA 3QJYA 2PSHA 1KS2A 3EA5A 2IHTA 5DOVA 3E3MA 5J63A 3T95A 3MINB 5FB3A 4K6FA 3ZHBA 3DVLA 1P75A 2ET6A 2JD2A 3HDGA 4GG1A 3ZS9A 3ZWVA 1P6UA 4C7XA 2F1RA 5ALEA 2GERA 3JRNA 3X2SA 4ADSG 3DF9A 4HEJA 2FE4A 1W96A 1KDTA 2V7UA 5HPYB 2AYZA 3RV4A 5H81A 2Z2JA 4Z4QA 2BFPA 1UBSB 1Q3HA 3U7JA 2W48A 4G5GA 3BXZA 4KKXB 1O94A 2WD7A 4Q5IA 4UDOA 3CZAA 4XB2A 2BGKA 3B6KA 3LY7A 3JALA 4MUJA 1ZHFA 3FCUB 4N18A 4E33A 3ST7A 1ZUIA 1NVMB 4KDCA 1LTHR 5DISB 2I55A 3FGNA 3W8DA 4HI0E 3C7CB 2CHUA 1JG3A 1GEGA 1GG9A 1NVVR 3GARA 4ONEA 5TX7A 2FWRA 3IIEA 1ZJJA 3IP3A 5A4JA 3P32A 4B4OA 1QUEA 3EEOA 3HJUA 5HE9A 1YQGA 3HH8A 3NFRA 4HGQA 4C01A 5JSQA 1CUDA 5T3YA 3WSTA 4R7ZA 1VYTA 5LP6C 5TARA 5EOVA 1KGSA 1AK1A 4OGFA 4Y1FA 3QUQA 3OX4A 4QGHA 4BGVA 2R25B 2EQ5A 1FTGA 3NNDA 4TKVB 3GQVA 1RYDA 3TKYA 3KZKA 3MJDA 1XAGA 4B80A 2QN3A 3KZNA 1Y6RA 1PYDA 2YHAA 3P0HA 2NUTA 2R65A 3MUNA 3NVKI 2ZVQX 4K8OA 4Y6OA 1IH8A 4GAEA 3QFTA 3L77A 2Q6LA 2LCQA 2V6GA 4UOEA 3QOYA 2IHNA 2FRDC 5IJZA 4XX1A 4FT4A 1RQGA 3K4PA 2LUOA 3K09C 4L1KA 3HCNA 1Z5WA 1LPSA 5AK6A 1KFJB 1IN1A 4KGZA 1NKTA 5EP1A 1SY7A 1D03A 2VTDA 3BYZA 4C0BA 1H9BA 1U3CA 2GFIA 1UPTA 2Q4TA 3R3JA 1MTOA 3VR4H 2PKCA 3K1YA 1JR3A 4BDSA 4IVRA 1CUYA 3RS2A 1MXFA 1PJRA 5DYIA 3TM4A 4BKMA 5CB4B 3ECCA 4BNUA 3TCNA 1D1TA 4G09A 1K88A 4MR9A 2PG3A 1D1PA 3E1SA 4TRNA 5ESRA 1KBOA 1T9HA 2GCPA 4LC1A 3ZV4A 2QTLA 4MR7B 4CLOB 4XYMA 4EPTA 3NUGA 1O95A 1UT8A 1T24A 1VLVA 5CIWA 3UCEA 2PSFA 1USUA 2JLWA 3KYCB 3BSWA 9GPBA 5EEHA 1I2BA 2V4UA 3RJMA 2GPWA 1WDWB 1C2YA 2B61A 2GZ3A 1JDBB 3LOQA 4EHHA 4NZMA 1T0BA 2Z5GA 2ZYVX 1JN0A 3HLKA 1Z4LA 1W1UA 3SF0A 2KYRA 4YWJA 1PEKE 2V8BA 3UT5A 1RCTE 5JO0A 5PNTA 3DMTA 2BBOA 2V9CA 3JQAB 4TXMA 4EKEA 5CEJA 3S99A 3E7XA 1OGYA 2W6PA 5FUQA 3TW8A 3LC0A 2WA2A 3I2KA 1JR3E 3NC0C 4PAQA 5BOSA 1EVZA 5AOCA 5JSZB 2NU7B 4IRMA 5IUJC 1YU6A 4X45A 1THTA 5BNFA 3GRPA 4YJ2A 2J07A 3I9OA 4I9GA 2BMFA 4AUMA 3AM3A 2YYAA 5T4EA 2IQ5A 5C5DA 1XCJA 5IVDA 3W2TA 3WGYA 5F7OA 1YFJA 1QR6A 4OJNA 1P60A 2A9RA 2NZWA 4NNJA 3H4TA 4WDRA 5CLLA 4I1IA 4RIFA 4BMPB 1XRRA 5BP7A 1RHRA 4BPBA 1XTUA 2FEKA 2PRZA 4F11A 5E3HA 2QT1A 4E21A 2WAXA 1WOYA 4M0MA 4FGKA 1N7IA 3JQFC 3GMSA 5D1HA 4G4JA 1E7RA 2YJZA 3KV1A 4M9UA 4ZVTA 3FDIA 1YK0A 3ZQKA 3BHMA 4Z86A 2WU8A 2XXBA 3FW1A 4GX1A 4WH0A 2F1JA 3C87A 4E5VA 1TA0A 2B82A 1M1NB 4QU8A 3Q9UA 4HYYA 3FWPA 4PINA 5P8WA 3ITEA 3O4GA 1JH8A 1NVWQ 2J5KA 5EXEA 2IL1A 1MIHA 4BVFA 2CFTA 4DFDA 4G8CA 3AKYA 4PLVA 3L5KA 1J8VA 4LZLA 3RWBA 2YV3A 4QQKA 4I8IA 4E46A 3EEQA 3WI7A 2EXXA 5BSTA 2XKBA 3T7SA 5I7OA 4KWHA 2JNWA 1LDGA 1SVUA 1D3AA 1OBCA 1REQA 2C31A 5AKHA 1C9NA 4JJ6A 1D0SA 4LJ5A 2O3JA 4JOQA 4KV9A 5JHGB 5J3JA 3T6KA 2A5YB 1GY8A 1T3TA 3CIFA 1CULC 3AUTA 4FYMA 4XR4A 4Y30A 3QFCA 4CMAA 2WQ7A 4ENRA 5EMNA 2VPIA 3I9V6 1ESDA 1RM3A 4JJAA 3LNTA 1TMOA 2VT6A 4HQRA 3FD8A 4ZA2A 2BGWA 1N3YA 2O6HA 5D87A 5IN5A 2P1RA 2LPMA 3VO8A 3N0VA 1O8BA 4IICA 1TM7E 1LNSA 3GEIA 4N6GA 1YQ9A 4V0MA 4DCUA 2DR2A 2VSFA 5EUQB 4V39A 1MB4A 3FPFA 1Z6TA 4NE9A 4C04A 1QBGA 3QEAZ 4REQA 4N6NA 4BIMA 2O54A 1ZUWA 2LV8A 3VKVA 2DRIA 4I3HA 3GNTA 4JLOA 3QVTA 4R5MA 4V0QA 3OIGA 4MDFA 1G5FA 4P7KA 2QPOA 3FA2A 4X1IB 2IWHA 2WSSD 5LDDC 3MJEA 1M3SA 5BV8A 2IJGX 1KKMA 3C3EA 4K9RA 5GADl 1YB6A 1PWHA 3M6IA 5KPJA 3OMWA 4M8KA 2XTZA 4ZQBA 3GEDA 2E21A 3BL5A 5B4UA 5E95A 3HWRA 1LX6A 2IEDA 3A26A 3K5IA 4BVGA 3U6BA 4CT0A 1JRLA 4KXMA 3QKRA 2OQRA 3R7WA 1H3NA 4JBWA 2H0AA 4JL5A 4JOCA 4F4FA 5FRDA 2Z4RA 1JW9B 2RGAA 1M7GA 3BCHA 4OBEA 1BMFD 3FZYA 4MQUA 4V0ME 4F6CA 4YJHB 5A5DA 1ZU5A 2JI8A 2ZRGA 3T06B 3KKEA 5CT6A 1WV0A 4KR9A 4B32A 4RTQA 5C8YB 3FOZA 2F8TA 2OHJA 3G9UA 1XWIA 1KVRA 5FV7A 1FX0B 1DDGA 1R5OA 3ND6A 4IUDS 2JATA 3VR5A 3U7FB 2JCGA 1PR1A 3K8OE 2EFHB 3FPJA 5DNWA 1ULSA 1FJXA 4PPGA 1OWMA 3P7MA 2RFLA 3AFOA 1RCFA 2LGJA 3NPAA 4MO9A 4U2DA 1B4DA 4BMSA 4D5EA 4G1UC 2HLNA 4TKMA 1N6LA 5ELXA 1RI4A 1ZIYA 3PNLA 1PSDA 5DBFA 1Z39A 1CEXA 1QP4A 3EY9A 5J1SB 5HF8A 1SUPA 1JEYB 2YJNA 3A6HA 4JMPA 4EFKA 4G5YA 1ODSA 1Y7TA 1CDZA 2Z2XA 1GPBA 4EPVA 3PGA1 3ZWPA 5I4KA 4L8YA 2PMEA 2VSYA 5T8KC 4R2IA 2GPBA 1FNNA 2FPGA 3U3MA 4XAQA 3UTDA 3HNPA 3AZQA 3MJ4A 5KSYA 3J7TA 1PS8A 3PNPA 5T67A 3W6PA 1UPCA 1V71A 1K2WA 3U49A 3RIGA 3R3WA 4YFVA 4E51A 3AX6A 4BFVA 3M9XA 3Q8WA 4BKOA 1W36D 5ENVA 2VR1A 2GN4A 3CISA 4HAZA 4W7SA 1AHPA 5JU6A 1A8HA 1XRLA 1KBZA 4IS2A 2QRMA 2D2IA 4RH1A 3OF5A 1FQKA 1XMIA 2ZQZA 3UAVA 4DJEC 3ZU6A 1HE8B 2P11A 2ZBDA 3E9YA 4NIMA 2XZTA 4UBOA 2ZLBA 4YCLA 3KT3A 4PLYA 5F1PA 1SBZA 1ZR2A 4Q1FA 1JPUA 3FDXA 4ETWA 2H1RA 2WZBA 3AUAA 2OCKA 2O2DA 1P73A 1WHTB 4TSKA 3K7EA 3X1WA 2WJIA 3WV5A 4DJAA 4WK0B 1GYPA 5EJAA 3TW4A 2B7CA 1E2LA 4J0FA 4KHPB 3L49A 1MJGM 2HFJA 3GRYA 4N3NA 1R6AA 4BNIA 3DEAA 3UA4A 5IZCA 5K9ZA 3DT9A 3N39C 3OCZA 5EAIA 3AWIA 1P9NA 2NAPA 4ZYUA 4WXHA 3EZYA 2PV0A 3B9QA 5JXGA 1Y4ZA 2V3WA 3KWJA 4OO3A 1JA0A 1X1QA 2QP3A 3RVSA 2VATA 2X7HA 3IVCA 3SSNA 4ZHSA 2EIXA 1FRVA 2JIDA 3A0RB 2Z3WA 2B35A 2DFNA 2VDNB 3ABSB 4Y2JA 2WJ6A 4GF5A 5IH7A 2P65A 3OQIB 1UKEA 1IU9A 1FTQA 2ZSUA 2YFYA 1BKDR 3HJAA 4MWGA 2IZZA 4DLTA 3A58B 3V7FA 4EKIA 3GT0A 3FYUC 4WCDA 3OA0A 2O0LA 2QYTA 4A6DA 4HX9A 2PZFA 1OA1A 4O1IA 1D7OA 5FWYA 1A8SA 1ZGBA 2I4TA 5FA5A 4E30A 5L9AA 5LN1A 1H3EA 2BKUA 2GZSA 4P7BA 1S1CA 1OKKA 4EHDA 1GQFA 1ZNXA 5FUXA 2JLZA 4L5IA 4R9UC 1VIYA 1U0SY 1Y9JA 4GYJA 5GINE 2B1RA 3BC1A 2FOLA 3K92A 2HEIA 1TCCA 1TLFA 2GZHA 3KYDB 2WMOB 1DXHA 4I9UA 4M87A 3T3DA 2JVKA 3A6FA 4DA4A 4ZI7F 2V6JA 3G59A 3R6DA 5KYNA 4Y9SA 3L0BA 1OU4A 3VV2A 5L3RA 3PXCX 3MD0A 3EUFA 1H6CA 2PGLA 1H23A 3BCUA 1EB9A 4FTWA 4L7VA 4QFCA 2HX1A 3R2JA 1V6CA 4YXWD 2RHDA 3OPYB 3DTVB 2J33A 1QAOA 2JFZA 3GLKA 4RH3A 5E1DA 3PV0A 4WAUA 2J85A 3CSDA 2BR3A 1M2VA 4OP1A 3LY9A 5LXTB 1P5ZB 3UJNA 1QO9A 4PNHA 3WHPA 1EUQA 1FS5A 4IHJB 2OHIA 1C5KA 5A9SB 1BXGA 3AYXB 3LGAA 3OFNA 5ETJA 4QTUB 4YMLA 3A1UA 4GL2A 3TZKA 1G3MA 1KRHA 3RM3A 3UAYA 2Q2OA 2AZXA 1D2HA 4AN0A 2B7LA 4OQLA 3BZWA 3B1YA 3DNFA 2VP6A 4L08A 4J7UA 3SBEA 3VAYA 1RYBA 3ZK8A 1Z33A 4ZJYA 4LXYA 5LMZA 3C3CA 1MZVA 1P9RA 3FYTA 5FQOA 3V2HA 1QGED 2IOFK 1U3VA 1PFWA 2AG0A 2FP4B 1GRCA 2I76A 2Q5OA 3E7DA 3FI9A 4G0PA 4Q7JB 4Y9RA 3U37A 1SB9A 2XECA 4ZCPA 5LQJA 2E6KA 3VC7A 3U81A 3DMGA 3REGA 5HJ2A 1U2EA 4TV8B 2HRRA 3OQBA 2X5XA 2ILTA 4DA0A 4DY6A 2YN4A 5CBKA 3ROTA 3ET4A 1GIAA 1SXJB 3QWIA 3AY0A 2Y1FA 3SZ3A 2H3EA 1BVHA 1CZNA 3KSMA 3HK2A 4K6GA 1GV0A 1IHOA 4G1EB 4AG3A 1WB4A 4UCFA 5K6RA 2PTHA 2QL5A 3CNQS 3LL4A 4MIEA 2YVUA 3AVQA 1A5AB 3EXHA 3VH2A 4M9QA 4QODA 5SZIA 1YHNA 5DW0A 5TT0A 2IY7A 3K35A 1KDVA 3OLQA 1X39A 2HDOA 4IDHA 5LOVF 3PTAA 4O3FA 4KW7A 2AMFA 4EJ2A 1N7JA 3HP7A 4QASA 5KJ1A 2ZXUA 3RT7A 1Z28A 4P92A 1TXGA 1AU9A 1ZH0A 3OQPA 1XZNA 2XE6A 2ZUVA 4LNHA 4XWAA 3TIIA 2XRZA 1W94A 2V6BA 2WJWA 4TLEA 4NU8X 2HMUA 3LC2O 1SKYE 1Y5IA 3L6CA 4IXTA 3DHWC 4NU6A 4B44A 4E22A 2QTBA 1QHYA 1G2IA 1QFXA 3FZGA 4XLZA 4C0XA 1LLQA 1JAYA 2WLSA 1OFIA 2H17A 2OCXA 3CCCA 2P4UA 3VSAA 3O95A 1ZD1A 2VTEA 4FHFA 3M82A 4RY9A 2B8JA 1ESNA 1X7GA 4RA6B 5D6OA 5EZYA 1FNDA 3U19A 2CXUA 2PXHA 3ZE6A 4OOEA 1QRSA 2C5EA 3ZC3A 3WYEA 4TT3D 5L3QA 3S55A 4DNXA 5IX8A 3KJQA 2Y71A 1FW8A 2K2QB 2PQ6A 3EGEA 4H6PA 1DG1G 4TMWA 5D7NA 9LDBA 3QQ5A 2OHXA 2C83A 4P4GA 2W00A 3TD9A 1I1QB 1ADGA 5CH3A 2PLAA 2CXHA 2QTRA 4LQDA 3ZYCA 1PNVA 4GXRA 4EPWA 1RJ9B 1XCBA 2A3NA 2AD1A 2BFBB 3W5BA 1USWA 3KTAB 4AP9A 5L3SB 3X43A 1U7PA 3IBYA 1J0EA 3PNMA 5EESA 3RYCB 2WHPA 5C37A 3ZD9A 1Q7RA 3PX2A 3JQCA 1LW7A 3IMGA 5I7WA 1MORA 3OJ0A 2R9VA 5ALIA 3ER6A 4MR8B 3V2IA 5B7PA 1HT2E 1IHUA 1AKTA 2AA3A 1IEWA 3I6BA 3DLPX 2D0PB 3K2EA 3WQHA 5G40A 2V1XA 3QJGA 4N3BA 1GCIA 1XDGA 4UE6A 3NJRA 4A23A 2BH9A 3VZDA 3DJYA 2XQIA 4KN9S 3A9UA 1Y5MA 2X0KA 2XR1A 2E4XA 2NUBA 1B8OA 1GKIA 2IP4A 3A9SA 5CUQA 4TYQA 1PF7E 4C2BA 1DUIA 3NXSA 2G7ZA 1P0IA 1IY9A 1WW3A 3GLVA 2VAPA 1IQRA 1Y8QA 1Y8RA 2GN1A 5JAHA 3LBFA 3FFXA 5BWMA 1B74A 5F77A 2RGYA 4C3OB 1KIMA 3BAFA 4RAQA 4DADA 4EX7A 3FHTA 2O8EA 3KFVA 4OHYA 3HR8A 3L92A 3QVMA 4ZTBA 1GA4A 2RHCA 2WM8A 2AEMA 2ISSD 4PSUA 4ZIRA 9ABPA 2OT3B 3IAEA 3UXEA 2NAFA 1F48A 1X7HA 3AJEA 1DXQA 1KETA 2IS1A 3P45A 1XK7A 2FX2A 1ESCA 4HAVA 2WG1A 4MVJA 4YJGA 4RW0A 4ZCQA 5KSPA 1ZOIA 3WDSA 1VBFA 3FZNA 3PDWA 1C3OB 2I66A 4KN5A 2FQWA 2PMCA 3AR3A 1JYEA 2AOUA 5IJ0A 1KZ7B 3FM9A 1SG6A 1JSZA 1Z5GA 3IMEA 4HDSA 3X3HA 1V6AA 2G5GX 3GFPA 3PXAA 2O0KA 3QVXA 3O8QA 4BBAA 4JELA 1F2DA 3G89A 3KOYA 5JDIC 1VL5A 5JJCA 1EAMA 4JNKA 1PK8A 3DVAB 4PBRA 1X13A 4Z8XA 4EY5A 3I9FA 3O47A 1C1XB 2ZB7A 3X1DA 4B4UA 3U09A 5K2MA 1GZ5A 1H22A 4PCAA 1Z3CA 2FGKA 3VPHA 3FCOA 2L18A 2COEA 2XUHA 2A5LA 2A7QA 3R9WA 2BONA 3GRCA 3T3PB 1D07A 3ZKWA 4DMUB 1D6SA 2JJQA 3IBSA 1RZRA 4ZI7A 2FRDA 5F21A 3EVZA 1L7NA 1L5QA 1Y1RA 1CYDA 2AF3C 2DFLA 3H42B 4LSWA 5FLKA 3WLRA 5BRNA 3WP0A 1QZTA 2LVBA 3JVEA 1VSQA 3D3WA 4MVJE 2VZLA 2PPLA 5ICSA 1H2FA 1GAEO 2WMDA 3HRHA 1XZFA 3SEAA 1U2ZA 2HRBA 3V1KA 1QAMA 2O7VA 5KX5B 4PG5A 1I1NA 1J5EB 3SQLA 4R98A 2BAGA 1KYZA 1QQ5A 2H9YA 4I55B 4LN1A 5C1BA 4R54A 3K70C 1T10A 4PHFA 5SYMA 1KK0A 1RYNA 1YAJA 1NXWA 2R0QC 2JHAA 3K8QA 3COSA 3O75A 4ACBA 3H5NA 5I4BA 4DUPA 2GCEA 3BSSA 2FQYA 4X5OA 2YMQA 4BRZA 4FW9A 3DZ8A 4TMVA 4EI2A 4CXMA 2PRJA 3ABOB 4J9UE 4L8LA 4QPCA 3RS5A 3I5XA 2FXIA 2DPMA 4QDZA 5IM4F 5B53A 4LTMA 4GGOA 5AM2A 3AVWA 4EG6A 4GBMA 4UEOA 4P2BA 1DT3A 4FSDA 4JJKA 1AS0A 1QXSA 1BQ3A 4M1EA 1K8QA 1HRKA 1Q0LA 4IL5A 4RY2A 5FHRA 1XJQA 4KOAA 3V1LA 1E64A 5AVOA 1T8TA 3KVYA 5AW9A 1TMKA 3FHLA 3O3NB 2ZAOA 3E4DA 1Q6ZA 4MQFA 3RG8A 2RGWA 3TNDA 1EG7A 2FXVA 5LWQA 2HWWA 1K8RA 3KEGA 3SX2A 3WNDA 1R7RA 2IZOA 2EW8A 1W85B 2J1LA 3R7NA 2PJZA 5KU1A 4UTPA 2EWVA 3O1LA 5IF3A 5JW6A 2BFDB 4EENA 1Z6GA 5AQEA 4S12A 4WV3A 4IUYA 1M6VB 3QPAA 4OIMA 3PWSA 1XTKA 3V7YA 1U8AA 3JQFA 5BT8A 2FUKA 4D9HA 4UHHA 4IKEA 3OFSA 1G9TA 2ZW9A 2JLBA 4WFKA 1DEHA 1K68A 5IP5A 2OYCA 1LX7A 1CUVA 3IDZA 4RSMA 1ZLXA 2ZAMA 4MQ4A 3KOXA 4JCOA 4FVTA 2DVMA 4R0MA 2I4IA 1TU0A 1ZQ9A 4IJ6A 2ZCUA 2HLDA 4ND7A 2ZJBA 4RELA 4KGXA 5KAPA 5A1JA 1SXPA 4MW5A 2PHZA 1FQWA 3IULA 1U9CA 2B34A 2E2WA 2IU0A 2R48A 2IYPA 5ED4A 1JFTA 1Y1LA 5CH8A 1BRMA 1U0LA 1GUAA 1YQEA 1D7AA 1DO8A 4K9NA 2X1HA 2C3OA 3LQKA 5KVAA 1T6YA 3CNEA 3NBYC 4TUYF 3KXPA 4B7UA 2YWRA 1R74A 5AW4A 4DVGA 1OXSC 1UXKA 2WSYB 3CUYA 3GVIA 1UXIA 3VNBA 5H1YA 4QAQA 1SBNE 3CWQA 2OBBA 4UM8B 7ABPA 4QOSA 3VZPA 2C8JA 2EGUA 2XY4A 3GJZA 3KELA 4LF5B 4FOTA 4IIJA 3ROZA 1E2QA 3LFUA 5HGXA 5MDHA 1PJAA 2CNKA 2VHJA 1EX7A 2QZPA 2VXCA 5DHAA 2Y6VA 2NVOA 5GGXA 1E6MA 8GPBA 1XMSA 4G4IA 5CLHA 2ZTVA 3IAM1 1LEHA 1CUCA 3OKFA 1CEQA 1OAOC 3C3MA 3IH5A 5BO5A 2IHKA 3NH9A 4RPHA 2OLKA 2OWEA 1P2VA 4NU0A 1XU9A 2WWGA 4LVUA 3FZQA 4WNAB 4F72A 2ZJ5A 1ZIDA 4NV0A 1OPRA 3WB1A 1P7WA 4ZOCA 1N5KA 3IMFA 4FZ5A 1Z74A 2RDMA 1RPAA 4HDKA 3WWOA 1UKCA 1U9ZA 4YI5A 1H85A 1KI4A 5B5SA 4LXTA 1VM6A 3L05A 1C4WA 2IZ7A 3E0QA 4MRAA 5DIZA 4YPOA 2BMEA 3T61A 1Y3HA 2PN1A 1GGJA 3DWFA 3UUFA 1L2TA 3VJLA 5K6AC 3WYFA 8LDHA 3WFZA 5JCJD 3OZIA 2PX3A 2I65A 1TAQA 1H69A 2ZTSA 1W1WA 1NDUA 3GRFA 4QBHA 4U6NA 4JVMA 3M4NA 1P7YA 2HNAA 3QVSA 4NXNB 2NPOA 3FRHA 4A7PA 3ACDA 2HXYA 2AG8A 4Q24A 3CM0A 4IJKA 1XCPA 4O4HA 2DWOA 2BL4A 5HUQA 4CM7A 1UFOA 1Z88A 3OKPA 5E4JA 4CM1A 5HRUA 3S3TA 2CLIB 3L4BC 1EVIA 3H13A 1DRVA 3IXMA 1WETA 4C3VA 1LBEA 4D82A 3GZJA 2WG2A 1SHTX 3AP1A 5ENZA 1RVV1 3SMVA 1KAMA 4LEIA 4XIGS 2JH8A 3VTKA 3OZEA 3OJLA 4K0KB 4UPVA 2CYCA 3Q41A 4W6QA 4M1QA 4MAFA 4R1SA 4DIBA 3LCRA 3I6QA 4G0NA 4RHYA 3V4VB 1VBKA 4R2LA 1M67A 3MWFA 3R6LA 3WWYA 5G1OA 4XVUA 4K9KA 4P84A 2PO7A 2NZYA 2PEZA 4TVBA 1KI6B 3C3PA 5F12A 5T8KA 3WL3A 4E09A 4YRKA 3NV9A 2QD4A 6CHYA 3QE9Y 3MGKA 1ZJWA 3E3NA 1E3EA 3E18A 3CVUA 7AT1A 1Y5NA 2PUWA 4M1WA 3ZCPA 1M2EA 1YGPA 1XN1A 4K8RB 5IAKA 1E1RA 5DZSA 5EIFA 1JE1A 1M8KA 1VFPA 2WUVA 3U7RA 1O57A 5HKKA 4QL3A 3IEIA 3K1ZA 2DKNA 2V7BA 4E11A 4R6WA 3NAGA 1GZ7A 3MJFA 2PT6A 5COQA 3I53A 3RANA 3HACA 3ZHSA 1B6TA 2ON6A 1Q1NA 2E5LB 4ZI3A 5DM60 2BD0A 2VKQA 3E0XA 4IP0A 5IXJA 1FFGA 3S27A 2Q21A 4HV4A 4HF7A 1F2TB 2FPLA 3E9MA 3R7LA 4JENA 2I2WA 3ZH9B 2JH3A 1Z8HA 1L7AA 3TIVA 3GLRA 1JALA 5JFOA 2R8EA 3WP1B 5EERA 1YC2A 2RHLA 2VNKA 3DNPA 3CV3A 3W2HA 4YV1A 1AKWA 3GZ4A 3T1QA 2XWQA 1P4GA 3OTIA 4RTRA 2QVLA 5LB4A 5DYYA 3TRKA 3RI3A 4ECAA 3TBKA 1IOZA 1HG1A 4N8DA 1NVVQ 2EJVA 2AJDA 3PHBE 4FDTA 1U7UA 4HJXA 4UZFA 5CU7A 4YREA 5KVQA 4E88A 1SXQA 3LP8A 7REQA 4KMOA 3BXHA 1WA5A 5B2EA 1UIMA 4RMNA 4ATNA 5ITVA 4W5NA 4HVCA 5JS8A 2CBGA 1GO2A 3FKSA 3FYUA 1G6Q1 1I7PA 4L6CA 5IM4A 1ZW6A 1HSZA 2RG7A 4YBZA 821PA 3F71A 4QJ3A 4RKQA 3R77A 3KR0A 5C1IA 4DM7A 4EB0A 5K8TA 1XTQA 5HZGA 1BX1A 1D1SA 2IE0A 4RZXA 1C41A 1W4ZA 2O3RA 5EHNA 3VX3A 1DC8A 1E63A 1X9HA 2P6NA 1ZMTA 3TPZA 5EJEA 1SK8A 1NXSA 3E22B 4FFPA 5IK2D 3T9CA 3O8LA 3RC1A 2BEVA 4KPUB 4IKOA 5D3QA 3DE5X 1FMFA 1T3GA 2B25A 3FCYA 3NHWA 3VOSA 4YV0A 1RHUA 5H83A 5A5GA 1J0BA 4MUHA 1YDGA 3R3ZA 4MHSA 4TLBA 3ZY2A 1TVKB 1GFZA 4AD8A 3CU5A 5HBRA 1XOIA 1ECLA 4Q37A 3C8DA 1OYWA 3AEYA 3GPLA 4OB7A 1GCUA 2WWRA 2CZCA 1BS1A 2POCA 3EVGA 3HVJA 3MUEA 4EW6A 3OJXA 2IYVA 1E1LA 3EW9A 4JH0A 5HTKA 3K9FC 1DARA 1MH1A 3RIHA 3WMFA 4CODB 3ZEAA 2QMZA 2PIDA 1SG9A 2BP7A 2ZIFA 2P9HA 3QIAA 1QLJA 1RAGA 3R0ZA 4LXUA 1PT7A 5KTMA 3I8OA 2ZB2A 3ESZA 2R8XA 4KAJA 3ASVA 3OEWA 4F84A 1XCOA 3E7PA 5J2UB 3VI3B 1POXA 1ZK4A 3IT0A 1F8UA 3FRIA 3T1OA 2V4MA 3WA6A 3H9JA 1IPFA 1OTYA 2Y1CA 3GDHA 1CY1A 3HKCB 3MWJA 1ZOLA 4KRGA 5IC5A 1WU8A 1XLVA 4PGAA 3QKIA 1DFIA 3JAKA 4TUYA 4N82A 3MWDB 1V8OA 1L4BA 2MMGA 2O14A 3EBOA 2YWHA 4RK4A 1M2OB 3ZDXB 4KTTE 3ZDFA 2F64A 4LZNA 1O87A 1XZJA 3I8XA 4F86A 4P81A 1IZZA 1LPBB 1MW9X 1P2BA 3EXFA 4KWCA 2B20A 3K15A 5FUVA 4E4RA 2VO1A 4G8BA 4HN9A 5BR4A 1XDSA 1UC4B 1NP7A 5EJMA 2QT0A 2OZLB 2JJ1D 2QL9A 1H65A 3N3BC 3WISA 2VH2A 1V96A 1QMGA 3H2ZA 1T9GR 4RLSA 4ZI2A 4QYXA 5EWJA 2QTGA 5JY1A 3A4TA 4QOJA 3BH7A 3FNFA 1A8IA 3ZHVA 5GVSA 1VJGA 4HDAA 2WHXA 4PZ9A 3KUKA 1JKJB 1XVIA 2OCDA 1I33A 1PV2A 3B70A 4R1NA 4DLRA 3AI1A 3LL7A 3MB5A 3SI7A 2GRJA 2I6TA 1O2DA 3JSAA 4KEAA 4XW2A 2E3JA 4AXBA 1KMIY 1S7CA 4MYRA 3MT8A 5TMBA 5C51B 1TUIA 2G72A 4B40A 3KSAC 4RV4A 1VJTA 5IKEA 4Q1VA 1ODLA 4AJ4A 4PZDA 3CR8A 4YO7A 3KNZA 5TGDA 3R9IA 2XBUA 1WUTA 4OQMA 1LPOA 2RHRA 2MYNA 2VT2A 1VCOA 4PIVA 2O8CB 4L5AA 5FUWA 2IVFA 5EUBA 2I9KA 1V7CA 3LW7A 4NYJR 2OVFA 2ACKA 2EZTA 3JARA 4K9LA 2IBTA 4DPMA 4B3CA 1C9KA 3DEFA 1UXGA 5IKOA 3RS0A 3JWPA 3R0JA 5BXYA 3B1FA 5CFOA 5G1NA 1TM3E 4Q0MA 4DCCA 1RI2A 1JG6A 1ISIA 4FW8A 3DZDA 3RBVA 4YRIA 4L2IB 5T4HA 4FYXA 1T4CA 2H08A 2XNDD 4TMYA 1V5WA 1QP8A 1EQAA 2VBGA 3DBHA 3QP9A 4RSHA 2OK8A 4BJ6A 3EPPA 2ZAGA 3L1IA 2FR8C 4RS4A 2JCYA 3E9ZA 3F6BX 4Z1MA 4HLCA 4EKDA 3KYJB 1Z4OA 2WYVA 2B2CA 3KRTA 4D6XA 3JPWA 4YECA 5FNZA 3MRSA 3B1XA 3IAFA 2JF0A 4GX5A 4AN4A 4DMHA 4HDMB 4HLUC 2Q5EA 4Y2YA 3VDNB 4G4GA 2SKEA 2OHFA 5JASA 4RTPA 2FQ1A 3AKDA 1NBMD 1SBTA 4K40A 3ESYA 3F3MA 4ZGBA 4TZ6A 1LVGA 2XCRB 1I5RA 1LWOA 4R0NA 3RSSA 4CKWB 3E3LA 1G8GA 1SWWA 2LNDA 4YCAA 5AI0A 4EA7A 2FUG6 5HS6A 1L1EA 4NEGA 4ZAWA 5LR6A 3RTDA 5BN4A 4FYKA 2JGRA 5FHQA 5H02A 1WPRA 2GM9A 2PT5A 2VYNA 2QNBA 4O33A 1U9JA 1X7YA 3OE7D 4YUZA 1PUXA 1DB3A 3GT3A 3A27A 3U40A 3ACBA 3EW7A 1GNQA 3GDWA 3VKFA 3ZE7A 3V4FA 2B92A 2Z30A 5KNBD 3SKXA 4BBZA 5E3JA 1C8LA 1KYYA 4OSPA 3SNKA 1KWGA 1NRXA 1FDVA 3CBQA 3CLRC 2FRVA 4HH3C 4OHPA 2DJIA 3KTOA 5FADA 4Z4FA 4JXZA 4MLDA 2ZUUA 4RPLA 1L8OA 5JLJA 3ZVNA 1GL9B 2J3MA 3L0IB 1R0KA 1ZM9A 1GAQA 2GFQA 4GSYA 4K7JA 1MVLA 2DFTA 2O7SA 4PM4A 5DYWA 3RAPR 3U26A 5E6RA 2JDIA 3B9PA 4RENA 4QBTA 4ZVUA 4RKYA 1C4XA 2NUPB 3AM4A 3L8YA 4B4KA 3PEFA 4B4WA 1OXBB 5E0KB 5E9QA 3G2JA 4C4OA 5C7YA 1KI2A 5K5EA 4ARCA 1FSSA 2EQBA 4GMFA 4HUJA 4JJEA 3ZGOA 3DW3X 3TLYA 3UO8B 1ZBDA 3C43A 3P19A 1U8CB 4HDRA 1M76A 1XA0A 2VAWA 4U2KA 3RAJA 1T34A 4NYIR 1DRWA 3BMOA 3QWBA 1BDJA 1QKKA 1Z0AA 2Y1OA 3FGZA 4I6GA 2PPVA 5DCUA 1TRKA 1T5HX 4I5GA 1N0WA 4G37A 3D81A 1SD1A 3VNUA 1EE1A 5HR5A 5KB3A 1MB3A 5JDIA 3JV7A 3IEPA 2VSXA 5TJ9A 1Z2OX 5FNVB 1NKVA 2P0EA 3U9LA 1XLWA 4BB5A 5JBNA 2HJGA 2IK8A 4DL9A 3NOQA 1HE4A 2XUPA 2V98A 1V1MA 2HCJB 2ODBA 3CF0A 4D42A 4G41A 1UPFA 1QO0A 2F17A 1K9VF 4QECA 4OHFA 5FL3A 1YRQA 1UKZA 2AFHA 1PKEA 4NFSA 2JZOA 4DSTA 4EQZA 1ZIXA 4CKEA 5CLFA 1JKMA 2YV1A 5HM8A 4S0ZA 4PRLA 3ZDQA 1LSJA 4M0UA 5AVTA 5AJYA 3BICA 4YGXB 4AYTA 4EAQA 3E23A 4KWTA 1P0PA 3PHCA 2J3IA 3DKIA 3CEJA 3RS7A 4B43A 1OZAA 3KYBA 4DA6A 3NHKA 3P2EA 4XWOA 3VC2A 4KO3S 1IWPB 3R3XA 4DUGA 5KEIA 1R3UA 2I71A 4CMBA 4Z1MD 3DEIA 1I1OA 2QZ4A 1PCXA 4BO3A 1GGKA 5K3CA 4YHHB 3PYLA 2X14A 3SC4A 1A71A 2P2NA 3EVCA 1OLSB 4UMDA 4BWFB 3KR2A 1VHTA 1K63A 3IIMA 1VB3A 4M83A 1CNMA 2WJ4A 4IXNA 2UUBB 4B3RB 3ZZUA 2DCUA 2VXBA 1LU9A 2MINA 1M6NA 3G6KA 1RWOA 4B79A 4C6SA 4EMTA 2HDWA 1N2HA 5ER9A 3R41A 4EKYA 5AVKA 2AFHE 2MOKA 2Z56A 1JFLA 5HGJA 2CUKA 2XUGA 2IBSA 1A76A 4KXUA 1X42A 4NAVA 5BYKA 2W6JA 3L8HA 4YP1A 4DR3B 1NF8A 4YR7A 1DCTA 3IHLA 2ZBRA 4PHCA 4BE7B 4HXYA 5A7FA 4NMMA 1G59A 1GL7A 1YE5A 4MGIR 4Q7QA 2KLHA 3M33A 2Q8QA 5A4FS 4QDJA 1FMJA 1ZM2A 3ON5A 3FAZA 4ZEOA 3ZGZA 1EX1A 3BF8A 1WZCA 1E4OA 2WIGA 1ZCAA 2VK8A 4JEMA 4FN4A 3KEQA 2JGDB 2M1ZA 4Q6WA 2ZJOA 3WAKA 5JD4A 2BHSA 1J49A 3AUJB 3S8MA 4EAAA 2FG5A 1ZD8A 1EP2B 1S01A 1UPXA 4HYQA 4MROA 3MS7A 3T5CA 5TQVA 1F5NA 4BFWA 5KYGA 1N25A 3DGFC 1OHHD 4H4CA 2RJ3A 3MD9A 3TR0A 3QYAA 3O1IC 3OEHD 5DNVA 2PX2A 1SOVA 4GXTA 3HVHA 3WYCA 1UMBB 3BMNA 4ROSA 1T4BA 5KPDA 4RL4A 3LGSA 2VC2B 4UTVA 4YMHA 4UBKA 3NM6B 3JQGA 3VOTA 3ZV5A 1Y6FA 3HXPA 1JDBC 1RFLA 1OBOA 2JCVA 4KYVA 1C0PA 1JPNA 1WY5A 1OIXA 4JC5A 1WVIA 3AH8A 2ATCA 1AE1A 2J0QA 3H7AA 2HRQA 2XZPA 2A9JA 1L4HA 2H92A 2UZ3A 2H1VA 1N9ZA 1YOVA 2ZRHA 4GWGA 1XFAA 4PCVA 3W34A 1X1RA 3KZ1E 5CM8B 3TAUA 3VDXA 5DT9A 3WIUA 1VXRA 1PNQA 1WTAA 1ZZEA 5E9JA 1NLFA 2B1GA 1JHVA 1I2MA 2QF7A 3TZCA 1ZD3A 4X93A 4CKCA 2Q50A 3EIOA 3Q2OA 1W46A 4LDQA 2Z58A 4MQEB 4QZVA 1JFRA 1P5JA 5F5LA 4MYSA 4ZC1A 4WN9A 5ADWA 1AZSC 4EP1A 3SJBA 1OT3A 2Y1GA 4AQ7A 1B8NA 4C7BA 1THMA 4FOSA 1HYEA 1U8UA 1C4OA 1LBHA 1OAOA 1UBFA 3FUWA 4IIHA 1D8TA 2ZK7A 4BXOA 2FHPA 4LDAA 1TX4B 1SVMA 3GPIA 4CQLB 2ZRIA 1YUNA 2EZ8A 1UZMA 1GZVA 4C7KA 4OQXA 3WLNA 1PP4A 5AM3A 5ITZB 1AB6A 1D4AA 1NIPA 1TUGA 1P62B 1E6UA 2HNBA 2P6OA 2WB4A 3BXGA 4YMVA 5CDYA 1U8XX 2J6HA 3JAWA 1AA9A 4FYYA 4JSYA 4MK4A 3QBEA 1KRWA 3OQOA 4YGYA 4PAMA 1AG9A 2AWOA 5BNWA 1ORIA 3ORSA 1C3XA 3QELB 4CMIB 3DBLA 2XV1A 5K6AA 1IAQA 3K0EA 2C5SA 3K72B 3KV3O 4RGQA 2XUZA 4KQKA 5J2TB 4CF4A 5E4TA 2ETXA 3K9LA 3GGCA 1T36A 1N1MA 5IKMA 3EE6A 5IVKA 2JIZA 4B4VA 3EAFA 4DV7B 3F8WA 2DWCA 3OAAA 1WPQA 3FETA 4OAOA 1GQOA 5L7WA 2ADFA 2BCGY 4FS8A 1KC1A 4P35A 4U7GA 2OCAA 2GX6A 2VRNA 4HFMA 3ZXUB 2OO5C 1B23P 3W77A 3JRWA 3BZUA 1GGMA 1N2CA 3ZBTA 1J42A 4WDQA 2UXDB 4KMSA 4DC9A 5CLJA 5DWVA 5K3DA 3ED5A 1Y5RA 3NJ8A 1NBWB 8OHMA 5JJKA 2P5YA 1T1RA 1XVAA 1XNJA 4E31A 3ZTYA 3OTGA 1N7GA 4UEWA 2J9YB 3RVMA 4PN3A 1UBRS 3G9TA 1CS0B 3EGCA 3PVCA 4XVRA 4PWYA 4IIVA 3WLAA 4XYLA 1LS6A 1RU3A 2ORVA 1Q1QA 1RHMA 1KVSA 2I99A 1NOIA 4OGLA 4NATA 3PR1A 1O97C 3WRXC 4YLGA 3FLMA 1I6KA 4MV0A 1YDEA 2A3RA 3KPJA 5FX2A 1VC2A 3CGWA 1XN4A 2CLHB 1V37A 1YBVA 2AR7A 3NATA 3ZOKA 3ZVKA 3RCBA 3PFHA 4ZP1A 1E1NA 3BRWD 1AUOA 3PC8C 3GBVA 1RXWA 5DI3B 4Q9LA 4JP3A 4BUCA 1YCFA 4PBTA 1FZQA 1PS0A 1E0SA 3CEPB 2BEUB 2ZUWA 2AUMA 2P6PA 3HB4X 4FUQA 4X41A 2C5FA 2X9QA 1N2CE 3IP5A 2ZTHA 1L7BA 3BJZA 3PC2A 2A1UA 3JQ8B 6YASA 3MMXA 1IE3A 4KYUA 5I3ZA 3I76A 3TOSA 4D98A 3QVKA 4RL6A 5F1OA 5T5QA 1BGWA 2B99A 3D5QA 4INAA 5JYCA 4NQZA 5E0OA 1UBTS 1NXTA 3L1UA 3EAQA 3ZZTA 1VLLA 5I9LA 5DHPA 3MRVA 3G85A 2R2AA 1A9OA 2JFFA 1BFDA 1LBSA 3QHPA 1YH3A 1QHFA 2FN3A 1ECCA 2HU5A 1PX0A 5IYZB 2FU5C 4WFJA 4N01A 4J1TA 1YJBA 4WKNA 3RPEA 2YIJA 5JUWA 3VPSA 4U3JB 4FQ8A 1YTUA 2ZROA 4DLSA 1FUUA 3O4HA 4D8WA 4NJMB 1I9GA 4UULA 5HILA 2C9ZA 5CHEA 3RABA 4DCSA 2FMFA 2OR3A 1ZW1A 4F04A 2X4LA 1BC5A 2HN9A 2BEJA 5I9SA 4TM8A 2H7CA 2PUGA 1ISHA 4HRYA 3CUKA 3ANNA 5JE8A 1G8KA 1DC7A 4YMGA 4D2IA 1W4RA 4DQVA 4LYFA 2VF7A 3JQDA 5EYPB 2WD8A 5GONB 2FFQA 2HLHA 4MIOA 3RSLA 3H8JA 1YZNA 3WIEA 4FLEA 1Z5ZA 1N36B 4LZAA 2P30A 3EDMA 3HVIA 3ROFA 4MJLA 2ZI9A 2C7OA 1DJMA 3P27A 1T5IA 3L5OA 3QE3A 4H3VA 4L4RA 4OB8A 3RU3A 421PA 1FFAA 3DFKA 3LDFA 1PZGA 4C29A 2ZIAA 1WZUA 2JVIA 1EQUA 4X1KB 2HBQA 1N34B 3DO8A 4GI3A 1SUDA 4WEOA 1E1DA 4MEAA 1QRDA 2Z3ZA 1EFRD 3HVUA 1ISJA 3I2FA 1R9GA 4R8LA 3O5AA 2AXPA 2CXSA 3GGGA 4Y6QA 3LO5A 3W6UA 4A2PA 2GBIA 5BYJA 1VECA 3GV0A 4B74A 3VO9A 1X7WB 3RODA 4D43A 3G5MA 4ASUD 4C4AA 2HJ9A 2A9VA 2GLXA 3VXKA 4IILA 2Q5LA 2ZULA 1E99A 3UUGA 2AUNA 4A0RA 1UKYA 2SICE 3U44B 4CDMA 1XYVA 4QAJA 3MHPA 3HGTA 1JVNA 2BGRA 2R1TB 3ITNA 3Q87B 3QFRA 3W5VA 1D2EA 2REBA 5F1YA 4O4IB 3B7PA 4OF4A 4WOPA 1HE3A 4FYPA 3IXQA 2XF2A 2J30A 4IFTA 4IQFA 4AF8A 5JEEA 1IMJA 2DX7A 2VSOA 3QX8A 5HJ5A 4ZV9A 1KKLA 4I4IA 4CM3A 3K6SA 5FPPA 1TVEA 4OHXA 5DEIA 1GZ6A 4WA8A 2XCOA 2PU7A 3CX3A <