4L0CA

Crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
MKGYNVYANGIRQHIIHFPGTGSPLLLIPGITSPAVTWGFVAERLAKYFDVHVVDVRGRGLSESGDLDYSLDAMADDLVALAQRMEGVVVLGHAMGARIAIRAARKDSQVFSRLILVDPPVSGPGRRPYPAKWSWYAESIRLAQRGCTAMEMRSYCPTWTDEQIELRAEWLHTCQYTAVKTAFDGFHTDDIHTDLAQLTLPIQLVVAGGAEVIQPDDIAEIISLAPQTTTYVVEEAGHMIPWDNLEGFITAVSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deformylase
publication title Crystal structure of the N-Fopmylmaleamic acid deformylase Nfo from Pseudomonas putida S16
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 83
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0cA00
4G8CA 1CQZA 5FXMA 5AKGA 2UZ0A 4DGQA 4IH9A 2OLEA 1H23A 4OU5A 1THGA 1EDEA 5JAHA 4UBOA 4U2FA 5AKZA 4BAZA 4Y7DA 2PL5A 2QT9A 4X00A 3WYNA 3RLIA 3G02A 5T4BA 4EB0A 4XX1A 4KAFA 3PF8A 4HRXA 1PFQA 4Y2SA 3ZI7A 1B41A 5AM5A 3VVLA 2BGNA 5A7HA 4Y2UA 4JYPA 1U2EA 4AMZA 3DKRA 2WIJA 1QONA 3FAKA 4FDMA 3V1KA 4N8EA 4E46A 4N5IX 1ETHA 2JF0A 3EQ9A 5AJHA 1E3QA 4IH1A 3HABA 2OCLA 4QDXA 5CURA 2VJDA 4V2IA 1L7RA 4BZZA 5C7YA 4DMHA 3G0GA 3STVA 4Q3LA 4DNOA 1ORWA 2XUPA 3W9BA 5AI0A 5HK8A 3V1LA 4H7FA 5AKIA 4E15A 5AI4A 4PSDA 1AMNA 5AKLA 3TGLA 2XT0A 3O4GA 2XLBA 4UBIA 1WPRA 1EB8A 2H9YA 1XZEA 1XRMA 3QITA 1DT5A 3B3QA 4FFVA 3OPMA 1CUVA 3H2IA 3G0IA 1RP1A 5AM3A 3EQ7A 1YAJA 2PVSA 5CW2A 1LNSA 3BIXA 4C4ZA 4Y2YA 5JD4A 3DYIA 2AJ8A 5AI8A 5EIEA 3AIMA 4BYMA 2W22A 4MXDA 5AP9A 3BE8A 4DNPA 2XMSA 3AJAA 4RNCA 4BC0A 3DOHA 3VVMA 2C0QA 4JH0A 1DINA 1ISPA 5LZ8A 5HKAA 4N5HX 4GEGA 3MUNA 1QFMA 2Z8ZA 5EHZA 1EINA 2Z8XA 2VF2A 5ALIA 2YASA 1VZ2A 1MX5A 5EFZA 1BRTA 4X6YA 3C87A 5IH7A 3WKDA 4BC1A 5K3BA 3C45A 1U4NA 2GBFA 1U8EA 2CUTA 1YB7A 5AKKA 2XUKA 1JI3A 4L9AA 5AM4A 3H2HA 1N8SA 2WHRA 4S0XA 4HAIA 1VLQA 4FHZA 2VAVA 3JYHA 4DTCA 1X2BA 4LXIA 2X5XA 3WK9A 3G8YA 2HDWA 1Q0ZA 3EIOA 4BATA 5AOAA 2XLCA 1EB9A 4ITVA 4K6GA 3VXKA 2CMFA 1H2XA 4E14A 3QMMA 3I28A 2H7CA 5HCUA 4UUQA 1QIGA 1E5TA 3K6KA 4HVTA 5CTAA 3L1HA 4G5XA 3LIPA 1AGYA 4KAAA 1QJ4A 5CT4A 1RYYA 1QIEA 3STWA 1LPNA 3WIOA 2IITA 1KEZA 2HA3A 3WIBA 4EZIA 1XROA 3R0VA 3VJLA 5AIBA 3IULA 1LBTA 3HYSA 1FFEA 1OILA 5FOQA 2J3DA 1WB5A 3TEJA 1UFOA 4ARBA 3Q0TA 4G4IA 1EX9A 1H2YA 3IUJA 1ZIYA 2XMGA 3WA6A 5HQ3A 1RWQA 1HPLA 3A2NA 1K5PA 1SC9A 2CBGA 5CMLA 3B5EA 2GZSA 4LHEA 5EIAA 1TIBA 5IVIA 3WKEA 5JD5A 4INZA 5ESRA 2Z5GA 3KXPA 2Z3WA 2X8BA 3I2KA 3QZUA 4BVLA 2WIKA 3F98A 3D59A 3FVRA 4UFPA 5LP1A 5K3CA 1USWA 1YCDA 2VT6A 2FX5A 1MN6A 1EK1A 4H7KA 1FFAA 4J0CA 3UUEA 1XZFA 1HKHA 5K3AA 1LPOA 3BJMA 1VA5A 2WG1A 4N8SA 1TCAA 3OM8A 4C4XA 4BCBA 3W06A 1MAAA 3I2FA 5JAUA 1YB6A 4Y2JA 5ALTA 3D7RA 4A16A 1XRLA 2VJCA 1KU6A 4H7IA 3M3DA 1A8SA 4Y2TA 2EDCA 3S8YA 4GXNA 3AZQA 4B9AA 2DHEA 3I1IA 4DMKA 5JAOA 4Y2XA 2D5LA 1QIKA 4YASA 4UHHA 3WWCA 2V98A 3R3XA 1DU4A 3LCRA 5HF8A 4CIAA 3WZLA 2JGEA 5DLPA 2OQIA 1DWQA 4HTAA 4J0KA 1EVEA 3PFBA 2OAEA 2XUOA 4DNFA 3V9AA 2XB6A 3G9TA 4A23A 1XZKA 3M82A 1HQDA 5LKAA 1FFCA 1P0MA 2AJLI 5JAPA 5LZ7A 2RIPA 4LIPD 4LYDA 5I7UA 2ACKA 2OXEA 1J2EA 1SCIA 2WHPB 1J06A 5ALSA 4E11A 2WLSA 4F60A 3BDVA 1XRNA 1ODSA 1YS2X 5A7FA 2WHQA 2WTNA 1W4LA 4JUIA 3HSSA 4B6GA 2OG1A 3DLTA 2WKWA 4YX9A 5CH3A 3ANSA 1CV2A 2QM0A 3D2CA 1XLVA 4H7DA 4MEBA 3OOSA 4BRZA 5EHNA 3QMWA 2J3QA 2WIFA 2PSJA 3W2TA 1ZD3A 2PU7A 2GBGA 1Y7IA 4KR0A 3PF9A 2IX9A 1CUYA 1T2NA 5DYTA 5T4EA 3U0VA 1JMYA 5JANA 2HRRA 1UOPA 4H7HA 3IUQA 1JMKC 4WFKA 4AXBA 4QLOA 4ETWA 2R8BA 3JWEA 4J03A 1E89A 1FSSA 1ZD5A 3WK7A 2BUAA 1R1DA 1CUDA 3D0KA 5SYNA 3F96A 2C0PA 3ZV7A 5FRDA 4OCZA 3F67A 3KD2A 5H3HA 3STUA 3WKAA 3FNBA 5CT6A 1AURA 3WZMA 3DQZA 4UHCA 2O7VA 3ANTA 3I1YA 4BP9A 3QMVA 4EY8A 4LXGA 4GW3A 1VZ3A 3KSRA 3FVTA 3VDXA 4HZGA 3RKSA 3W9UA 1VJ5A 4M0FA 2WFLB 2WG2A 3DS8A 4CCYA 4QE3A 3QPDA 3P2MA 5D3ZA 5D7BA 4H7JA 3ZLTA 4KRYA 4AO8A 5DYYA 2PKYX 2VA9A 3GA7A 2ZJ7A 2QR5A 3IURA 1CRLA 1R50A 4X90A 4B81A 3EBLA 4UBMA 3H0CA 3F97A 5IKXA 3IDAA 1QIDA 1CQWA 1DWPA 2OCGA 3A6ZA 2H1IA 1ZIXA 4UHBA 1XZMA 4BE9A 1N5RA 1G5FA 1BCSA 3BWXA 1QTIA 1XRPA 4IQ4A 2OCIA 2JBWA 4MYSA 2VJBA 4BTVA 5K3EA 3AZPA 1MAHA 3LLCA 1CUAA 2HA7A 3I6ZA 2VSQA 1XKLA 2CJPA 1ODTC 4ZRDA 5AKXA 3V1MA 2PUJA 3EF3A 1HBJA 1J07A 1ZICA 5HF5A 1LZKA 2DSNA 5AK4A 4OB7A 1IMJA 2QOEA 4PSUA 1FJ2A 3BDIA 4EY6A 2ZYHA 3QM1A 1W76A 3AIOA 1E8NA 3WK6A 2XQJA 1UK8A 3WJ2A 3HC7A 3AILA 3FCYA 2XQKA 1GPLA 2JGMA 4ZREA 1MTZA 5ALPA 5I8PA 1A8UA 4WDQA 4PO3X 1N5MA 2PSHA 3W04A 1W1IA 5JIBA 2ZYRA 2YXPX 1NU6A 1XLUA 2ZYIA 4DNQA 5LZ4A 1MX9A 1LPAB 3M83A 4QZVA 1C4XA 2RHWA 2QUBA 1UOOA 4KE7A 2PSFA 3OTQA 3G7NA 4MQMA 2XMRA 3HZOA 5FDFA 2VQ6A 1MPXA 3QPAA 4WCVA 3SX4A 1CUHA 2ZYSA 1IZ7A 5CRIA 2PPLA 4UBKA 3R3WA 2DHDA 5AM0A 4AZ3A 2QJWA 5JD6A 2BJHA 5LZ2A 4GDMA 1JU4A 5A6VA 1AUOA 2HA4A 4DIUA 3DDUA 4GLBA 4W63A 4QDZA 3LP5A 3FCXA 4CG1A 3O4HA 4MWTA 1XZJA 4IHAA 4C01A 5HFNA 2HU8A 5E4TA 3VJMA 2XMZA 1CUUA 4UBJA 4PV7A 5ALUA 1T4MA 1L7QA 5FKJA 4PQEA 1GQSA 2NW6A 2V9ZA 4QLAA 5CXXA 1Y37A 1LLFA 4KYVA 1XZHA 1QE3A 2BUBA 5C8VA 1UZAA 1E8MA 2QXUA 4BTLA 3HI4A 3GROA 4BP8A 4EY7A 3LS2A 3C43A 3MGAA 1GKLA 3CN9A 1BE0A 4L72A 4XIIA 4ARAA 5KBYA 3D3NA 1CR6A 4Z49A 3IB3A 1ZGCA 2WUFA 4XVCA 1DX4A 3G0CA 1ZI8A 4MEAA 3BL8A 4P93A 5AI6A 3WA7A 3KWFA 3H2GA 1CUBA 2RGUA 4P08A 4JYMA 4ZXFA 1GKKA 3FWHA 4QEKA 2OPHA 3SC2A 5HFAA 1DT3A 5BOVA 2ECFA 4GI1A 5ALEA 2BUCA 2JGLA 2AXEA 4OU4A 4XJVA 4HS9A 4G1FA 3ESCA 2VEOA 3FLBA 5A62A 3DYVA 5DNUA 4RPCA 1D07A 4OYYA 3CN7A 4H7EA 2PBLA 2GBCA 3WL5A 3N2ZB 5A2GA 4G9EA 1UWCA 1O6GA 4ROTA 2XUQA 4H18A 1SOMA 4OB8A 4X92A 2C5FA 5A7GA 4K2AA 2VJAA 1N1MA 3O0DA 2XUIA 2HRQA 2BGRA 5DNWA 1CVLA 4BZWA 3AFIA 1NX9A 1IUPA 1Z68A 3H17A 4KEAA 3HEAA 4Q34A 5ALVA 5JZBA 2OAGA 3QPCA 4X93A 1BEZA 2I3DA 2RAUA 5DWDA 4Y2RA 3AZOA 2QS9A 5ALFA 1ACLA 1MNQA 4X94A 4UFNA 5J3JA 1JJFA 5KWIA 5ALDA 3WWOA 2R11A 4C89A 5C81A 4U2EA 1H2WA 5E4YA 4B82A 5FLKA 2WU4A 1QGED 2B9VA 1XZBA 4JEIA 5AKYA 1MX1A 4BVKA 4RGYA 3PICA 4FLEA 1LPMA 1QFSA 5ISMA 4CCWA 3CCCA 3ZWQA 2HM7A 2WUEA 4F5ZA 5LZ9A 3HJUA 4KE8A 1XZCA 3E1GA 3ICVA 1ZGBA 2G4LA 3WI7A 4NZZA 1AKNA 2ZJ6A 3G0DA 5AI5A 1VXRA 4BCDA 3W05A 2QUAA 3E0XA 1CUGA 1SFRA 3R3YA 4IO0A 1Q83A 1EK2A 2PM8A 4DLNA 4C88A 3T4UA 3D2AA 2QVBA 3FLAA 5YASA 1TK3A 1MT3A 1K63A 2VTVA 3UUFA 1QO7A 1X2EA 2J4CA 1QIJA 2O7RA 2WHPA 4BVJA 1MJ5A 2B4KA 4B84A 3WK4A 2DR0A 4Y2PA 3RARA 4I19A 4ZWNA 1CUZA 1XZLA 3WKCA 4EHBA 3GUUA 4B0OA 4C4YA 5EHQA 3HLKA 3CXUA 3BIWA 2V96A 1UKBA 3WK8A 3PE6A 5FPPA 4AO6A 4DMFA 1LBSA 1BEEA 3DCNA 1K4YA 3NGMA 3U1TA 5AKEA 5CT5A 3FSGD 4AX4A 3KDAA 1CUIA 2LIPA 4PW0A 2ES4A 1P0QA 2RHTA 2JGKA 1GPNA 4X7BA 5HKBA 2HA2A 3ESDA 2WTMA 2WIDA 4FFWA 4OYLA 1CLEA 3O95A 1GQRA 1DTEA 4Q05A 2G5PA 1WM1A 4L0CA 5DJ5A 3D2BA 5CT9A 4J3JA 3RM3A 2I78A 5K3DA 4QNNA 1UOQA 1EXWA 2Y2VA 4TPKA 1TQHA 5KWJA 5EHXA 1DWOA 1JFRA 1MNAA 5AHXA 3E3AA 4MYDA 3I2GA 4MQLA 1YSCA 2DHCA 2P8SA 3I6MA 5SYMA 2HIHA 3I2JA 4FNMA 4B85A 3K9BA 2H7XA 5AM2A 1U65A 2WQZA 1GXSA 4QA9A 2QZPA 3DD5A 2HL6A 2DCMA 4OPMA 4GWLA 4RE6A 1R9MA 2WFLA 1EH5A 3WYDA 3STTA 1SCQA 4FTWA 1YAHA 1CIJA 3ZLUA 5LIPA 4J0JA 2OGZA 2XMDA 4K6KA 2WG0A 3GBSA 2O2HA 3GFFA 2AJCA 1OCEA 1FFDA 4BDSA 3O4JA 3N0TA 3MUOA 2YH2A 5ALGA 4OD0A 4X6UA 2PX6A 4Q3KA 4QWMA 3X3HA 2XMBA 2PUHA 1YA8A 2QJRA 4DM7A 3C6BA 2D0DA 4L3WA 3NOXA 3QH4A 2BCEA 4GHWA 2XMCA 1EVQA 5CBKA 5BV7A 4YPVA 3WMRA 1C7JA 1LPPA 4KE6A 4ZI5A 1ZJ5A 3QVMA 2WUGA 5E4JA 5ALYA 3C5WP 3QBJA 4K5QA 4UBNA 5CH8A 1WHSA 4D9JA 4PF1A 5AO9A 4AN0A 1CUFA 3ESBA 3B12A 1E66A 2ZSHA 1R88A 7YASA 2AJBA 4B80A 3C6ZA 5BWBA 4QDUA 4OSEA 3E4DA 4J0DA 4OB6A 2I03A 3WL8A 1GGVA 4HXEB 2OGTA 3FYTA 3STXA 4DYHA 4C87A 4X85A 3AUKA 5K3FB 2JEZA 4UPDA 4X97A 1QLWA 2VT7A 2HU7A 3O9MA 4MJ3A 4X3CA 3C6XA 5LKRA 1QO9A 5JARA 2DQZA 1BS9A 4W9RA 1QIFA 4FKBA 4X91A 3BF8A 4LKOA 2WJ3A 3WWEA 2Z3ZA 1XZAA 4FLMA 1G4HA 2HFJA 4U2CA 3HRHA 1FFBA 5ALQA 5EGNA 2PSDA 4XWGA 4AQDA 4X95A 4QDOA 4C6HA 5K5EA 2WUDA 5JATA 5AK5A 1S8OA 3BXPA 1XQWA 1ZI6A 2AJDA 4W1PA 3H1AA 4Q3OA 5AOCA 1JJIA 3AIKA 1W6RA 5ALXA 2GYUA 2FUKA 3T52A 1YA4A 4F21A 1CUXA 5ALLA 5CXUA 1ZD2P 5CH5A 2HA6A 4KRXA 2RONA 4G9GA 5HZGA 5DTIA 5HK9A 5KREA 4TVKA 2B20A 3WWDA 4O08A 1YR2A 5AOBA 1OXMA 1M33A 1VE7A 1LZLA 2HU5A 3PUHA 3BF7A 5HF6A 3LIIA 5D6OA 2GYVA 2WSLA 4FBLA 3R3UA 5ALNA 2V97A 4AB1A 1EDDA 4AN1A 2WM2A 4CI9A 1A88A 3V1NA 1XZDA 4BE4A 3GZJA 5I9IA 4LXHA 4HXGA 3NUZA 3H2KA 3SWWA 1WB6A 2B61A 4BRSA 2J4FA 4AZ0A 3WJ1A 5DNVA 2GZRA 3I6YA 2FJ0A 1SCKA 5ALRA 2XI4A 3G9ZA 5JALA 5FV4A 1QIMA 3WQHA 1P0PA 3STYA 1IZ8A 2XUJA 2OGSA 5ALOA 1HLGA 3O9VA 2HFKA 2K2QB 4FBMA 4EY5A 4KE9A 5IVDA 1QZ3A 3WKBA 2JGJA 2XE4A 1AZWA 5AH0A 1XZGA 4YK7A 2YYSA 2WJ6A 2PU5A 2WJ4A 5DTJA 2QKYA 2Y1KA 4ZGBA 1R9NA 3WWPA 3C6YA 3PUIA 2EEPA 4H77A 1UKAA 4FWBA 4B9EA 1ACJA 5JASA 1XFDA 1C7IA 5D3KA 1ZOIA 1BU8A 2PSEA 2G63A 2WFZA 2XDWA 3HACA 4UHDA 3IUMA 3DNMA 2BAGA 4UHEA 5A71A 3TRDA 1IVYA 3C8HA 3M81A 4ZV9A 1E8DA 1JKMA 2Y2UA 3WL6A 1B6GA 3IUNA 4CG3A 6YASA 1CUWA 1EA5A 5DYWA 1KU0A 3H1BA 2IIVA 2HHAA 3D4LA 1XQXA 3SK0A 1ODCA 4KAJA 3VKFA 5AIAA 4ZV7A 2XMQA 3WLAA 4HRYA 1EHYA 3I2HA 2XUFA 1W52X 4DSZA 4WY8A 4UHFA 5AICA 5EI5A 1XRRA 2ROQA 5IVKA 4G4GA 4JNCA 4W1RA 1ZD4A 2WFMA 2WIGA 4BAGA 4B7ZA 3EQ8A 3DL4A 4LYEA 4PNZA 3QYJA 3WK5A 3YASA 1A7UA 5AM1A 4WDRA 1BCRA 2Y6UA 2JEYA 1LPBB 1QTRA 3IVMA 4QWWA 1QOZA 2QMQA 1THTA 1BN7A 5JADA 1VE6A 3F8SA 4FOLA 4WY5A 2WU3A 5ALWA 1GZ7A 3FSGA 3H18A 5HQ3B 1DQZA 3FYUC 4UFOA 1IUNA 3VISA 4OUKX 3IA2A 1O6FA 1XLWA 3PDCA 2OCKA 2XUAA 2C5GA 1F0NA 2VAXA 3HXKA 4BAUA 2XUHA 3IIIA 5FPQA 1JJBA 3C70A 5ALKA 5LLSA 4X71A 1XQYA 2GBIA 4UBLA 1VKHA 1EDBA 4WFIA 3S2ZA 3ESAA 1UKCA 1CUEA 1H2ZA 1YASA 3RK4A 1CEXA 5T4HA 1R3DA 1MU0A 5AKHA 4FMPA 2WILA 3NWOA 4BB0A 4CFSA 2HA0A 3G9XA 5EIHA 3H2JA 4I4CA 2XQGA 3ED1A 1CPYA 4GBGA 1WB4A 2HADA 3BJRA 4EA6A 3MVEA 1UK7A 5T4FA 5AKJA 2QXTA 1GPKA 5ALMA 2ONCA 1I6WA 1WPXA 5BWCA 5ALZA 3L1JA 3G0BA 2XQFA 2G5TA 3R41A 1ZJ4A 2JGFA 4EUSA 4DMCA 4P92A 5AI9A 2ZSIA 4M0MA 2CKMA 1TRHA 2RI6A 1WCYA 2JIDA 3O4IA 4U2GA 3R3ZA 1AX9A 1VOTA 1QIHA 3UMJA 1CUJA 1QIIA 1F8UA 3K2IA 4PSCA 3KWJA 4CIBA 1WOMA 4P9NA 3Q8WA 4J0HA 5C8XA 5C8ZA 4KACA 4G4JA 1EI9A 3VJKA 1PJAA 1R4ZA 2EDAA 2QTBA 4BDTA 1CFJA 3G9UA 1TCCA 1DX6A 4CG2A 4NS4A 3H19A 1HL7A 4J0GA 2FJPA 4RE5A 4IH4A 3FYUA 5FUMA 5F4ZA 4EBBA 4F0JA 4N8DA 3FYUB 5CT8A 5LYYA 5ALJA 2C7BA 1L7AA 4HXFB 2BKLA 5AK6A 2XQIA 4W1SA 2JGIA 3DJYA 2ACEA 4QDTA 2HA5A 3OC0A 1J1IA 3DOIA 5HF9A 4AMYA 2GYWA 1AQLA 2BFNA 1UXOA 5ALHA 4TGLA 4BBZA 5AK3A 1TKRA 4M0EA 2ORYA 3C5VA 2O2GA 3GELA 1IUOA 1F6WA 3R3VA 2C58A 1A8QA 4G8DA 5FP0A 1P0IA 1CUSA 1PV1A 3IBTA 3PI6A 3FOBA 4EY4A 3ILSA 4W1QA 2ZJFA 2OQVA 4U2DA 1TAHA 2C4HA 1X70A 1K8QA 2XUDA 3A2LA 3L1IA 1TCBA 3ZPXA 2Y6VA 3DKKA 4KJXA 4J7AA 1ORVA 3AINA 2H7YA 1HDEA 1Q0RA 4I3FA 4A5SA 1NU8A 1K6EA 4Y9SA 3DL7A 1XRQA 4Y2VA 1UT6A 1H22A 2DFPA 4NMWA 3FBWA 3R40A 3DEAA 3H04A 1Y7HA 3TJMA 4H35A 1LGYA 4J0IA 5IVHA 4CCYB 1XZIA 1GT6A 2DQYA 5E2IA 1VA4A 4BCCA 1AC5A 3A2MA 4Q1VA 1BROA 4B0PA 4MWSA 4B83A 4FLFA 4GECA 2CB9A 4DSAA 1XQVA 2VATA 2X76A 2E3JA 1W75A 4U2BA 1JT2A 2QRUA 3CCBA 1LPSA 1Q84A 1ZI9A 3A70A 3KOOA 2I3ZA 3OG9A 2CZQA 1BN6A 1UK6A 3I2IA 3C8DA 3D5EA 5K3FA 2ZVDA 5JZSA 3PFCA 4Y2QA 4WJLA 3ICWA 1DQYA 3V48A 3OURA 4G8BA 3FLEA 5JZ9A 2W6CX 1JU3A 1XKTA 4FNGA 4H0CA 4NVRA 1WHTA 4AO7A 1F0PA 1CUCA 2CEKA 2O2IA 3WL7A 5JYCA 1VXOA 3F9CA 4X6XA 3JW8A 2Q0XA 1G66A 3ZLVA 1G42A 4Q82A 2XUGA 4WFJA 1MO2A 1UK9A 4K6HA 5LZ5A 1YS1X
chains in the Genus database with same CATH superfamily
4JKYA 4FZ3A 1GG8A 4FSDA 1CQZA 1MC4A 1NP6A 2ORWA 3P9ZA 4NFYA 2ZSDA 1F06A 3T35A 1GGHA 1PDOA 3RYIB 4WGFA 3TJRA 5JISA 1QLJA 4TQ9A 2I8AA 5AQEA 4DGQA 3SYNA 2Y1CA 2GXSA 2OLEA 2C4UA 5FTJA 4DY6A 6REQA 3IO5A 5EMLA 5KVSA 1E58A 3S1AB 1RJ9B 1X1QA 2X5JO 1QR2A 4Q37A 4EX6A 3RAFC 1XEFA 1NJ6A 1EJ6A 4O2BA 1C5KA 1PGJA 1T5OA 3DM9B 4Y7DA 3ZTYA 3JQ9A 4MHSA 3D6HA 5DBHX 3VPGA 3INGA 5EXEA 3WTBA 5T4BA 4E2ZA 4RVCA 3NATA 2BCJQ 1CP3A 3FNRA 4C43A 4Z7OB 1J8FA 3AV3A 3M5WA 3OT4A 3P9KA 4KAFA 3S44A 2A5GA 4HRXA 1LNZA 4P5PA 2FF5A 5JDIA 1PFQA 2G1UA 4JWKA 1CF2O 1GPWB 3VI3B 1EMDA 2XVYA 1EZ1A 2TYSB 5AJZA 4R1TA 2QX9A 4L5AA 3AV0B 1EK5A 4WN9B 3VVLA 3Q7PA 3JY6A 2XKAA 3I6IA 2O52A 3ISVA 4W7SA 4YRNA 3EIHA 3RVOA 4AMZA 4JJEA 3DKRA 4TQAA 4PICA 1E2IA 3IYLW 4CMGA 1OJLA 1OIXA 4XYMA 3V1KA 3HV2A 1Q50A 4GX2A 1XCJA 3KT0A 3K1JA 4JB8A 4L78A 3SS9X 2DHQA 4C30A 4POAA 3OIUA 3N6XA 5EJ6A 4X1KA 3HJHA 3E03A 3HCAA 1NVBA 1T4CA 3O3OB 2PK3A 2MIIA 4WK4B 1TF7A 2GPTA 3I6BA 1VECA 2C9YA 2NO5A 2GZ2A 3ROQA 4IH1A 1UBNA 4DUPA 4AKSA 4ABTA 1ELOA 3CZQA 3LQRA 4G63A 2P9CA 3UFXB 3WMFA 5JJIA 1HKUA 3T5TA 2VJNA 1S8FA 1TU3A 3H5WA 5C4IA 2JI6A 3DFMA 1H4TA 3FB1A 5G0SA 4AN4A 2VJDA 4MPJA 2GZDA 1XLTA 4ZYTA 5C7YA 3D6TB 1S1CA 2GEKA 2F4NA 3OY7A 3STVA 3TQFA 3D64A 4Q3LA 1CR4A 2PL3A 3CNNA 1ORWA 1AKTA 3HVJA 4DXAA 1GRQA 3W9BA 5KOIA 2OP0A 3S0JA 1KETA 1WXQA 1FU8A 4HNGA 4NENA 1JVSA 5IMBA 3S5UA 3SXUA 2MMGA 3OSZA 3QUAA 5KKAA 4B2PA 5AI4A 2VSYA 2PFKA 1ODFA 4HBZA 1OVGA 1B26A 3D6MA 2GVDC 3WR5A 3KAQA 2XNDD 3VH2A 3GLIB 2VUSA 1U8FO 4I9NA 1B76A 4NMMA 5JO9A 5HDBB 1KBQA 4QASA 3L01A 4NOKA 4YDSA 2YJNA 5L7YA 2X0DA 4WLNA 3ZZMA 5LSAA 5JS8A 1EB8A 1WUYA 3U5TA 4BLOA 3EXFB 4CIVA 1MORA 5EVCA 2RGEA 2GILA 2I6TA 4KQ9A 1M6EX 3Q4GA 4AMVA 1GQFA 3DBRA 3QUCA 1H8HA 1RWOA 2BHTA 4FFVA 5HRCA 2IELA 3PUZA 3Q15C 1ZK1A 1CQIB 3U7QA 1D2AA 4HLUC 1O97D 2W0MA 2Z08A 4I5IA 2G36A 3ZUPA 4B71A 1T5DX 1TCUA 1U0LA 3BVPA 3BWYA 3H2IA 3HB4X 1KDTA 3LY5A 2FN7A 3RVBA 3FPKA 3B51X 1RRCA 1Q7RA 1SC6A 4TWJA 5CW2A 5TQJA 4PZZA 5EG5A 1GYPA 4J91A 2RFLA 2QJOA 1NJGA 2AQHA 5B1DA 3AEQB 2YV1A 3MC1A 4E6EA 1YQQA 2VYCA 3Q9LA 3TOCA 5CDUA 3A4LA 1UCFA 2QL5A 1ZGHA 5EIEA 1AZSC 4LE2A 2OEPA 4MYHA 1AZLA 3IAXA 3ITNA 4TLLB 4QGFA 3VH4A 4BYMA 1GA1A 2BI4A 4NS1A 3DAOA 3KK0A 3JRXA 1JLRA 1NRWA 3U9SA 3U19A 2NO0A 1P2DA 3ABIA 2ATCA 2XMSA 4MO9A 3AJAA 4NG4A 3ZHVA 3PFIA 3CR8A 4OJQA 4BFUA 2GAAA 3I9V6 3I72A 2QRNA 5GOZA 3DO5A 1HH4A 4Q3AA 1TUBA 4BN4A 4F06A 5JXJA 1G8MA 1HV8A 2WHYA 4MV9A 4WERA 4B3HA 2R96A 5GJVC 2WJVA 5FQOA 1QFMA 1TPYA 2PX0A 2QPOA 2Z8ZA 5GVRA 1E5LA 1Z4JA 4IXDA 3QKTA 1Z35A 2C4TA 3ZCXA 1EINA 1KI9A 4F4DA 1YDEA 5JTTA 2RGNC 1K5HA 5ALIA 3UW1A 3NXSA 4R1SA 1ORDA 2RARA 1NWCA 2B83A 3L7DA 1AQIA 1MX5A 1G4UR 1KFBB 3OJOA 2VDUE 5HZKA 3RI3A 4EL5A 3FTPA 4X6YA 3C87A 3WKDA 5LQJA 1DQNA 3LT0A 3ZVKA 3WRVA 3BC1A 3EGEA 4MX8A 3IDFA 4R7GA 3AKZA 1EVZA 2PT6A 4REMA 2KLBA 4GRIA 1GPDG 2KJQA 2WHEA 2X5OA 3H5OA 3I9V1 4K9MA 4AS3A 1JU9A 2HJGA 4JVMA 2VWQA 1YRHA 4M22A 2JAQA 2UYYA 1NE2A 2XYRA 4WT7A 4EG0A 4MUEA 1JI3A 3BMNA 5AM4A 5KHOC 1YFLA 3NHMA 1CW2B 2H5JA 3ECSA 2FFHA 3OT5A 5I9TA 4LYFA 1E64A 2GCNA 4LRWA 2ZBDA 3DAFA 2ID8A 2BPOA 3PX3A 3ZIAD 2QD5A 4S0XA 1FDRA 4P81A 2IV2X 1M6HA 3R76A 4PGHA 2QM8A 2B92A 3JYHA 4DLAA 3TIIA 3CJQA 3FNGA 3ZZNA 4CIWA 4V0KA 1T2DA 6AT1A 2WMDA 1SOUA 1SKUA 1ST2A 5TIIA 5L3RA 1XWFA 2AMYA 4S2EA 5E3HA 4DCUA 1Q0ZA 4JLNA 5BN3B 2JJ8A 2SECE 3M9WA 3Q8MA 4QD3A 1EQ2A 5I3ZA 4EHLA 1SQFA 1V8PA 2CMFA 3AKEA 2FQXA 1ORTA 1ZHFA 1ZUNA 4MROA 2X15A 4PG4A 4LYGA 3F78A 3RS8A 4PCUA 3F9RA 3BHMA 3UO8B 3I28A 1RYNA 3VZBA 3FPCA 4DADA 1W88B 1W73A 4IZOA 3ZQUA 1BKYA 2CXPA 4KXFB 2XADA 4CKBA 1RM3A 1K4MA 4UUQA 5FWAA 3IKVA 1SRQA 5CTAA 3KCQA 1Y8RB 3GH3A 3L1HA 4G4SP 4ZT3A 2QU7A 4ZRMA 1AGYA 2WA1A 4L7VA 3BH6A 5HGJA 1Y8QB 1B3RA 4U7GA 1QJ4A 1ORIA 2OMKA 2VRBA 2ODWA 1OVMA 1RYYA 1ZLXA 2GSDA 2J9XB 3STWA 3HPQA 1NMYA 1BU5A 3ZTTA 3MJHA 3GFBA 2E1RA 2YV2A 2Z98A 4A9AA 2X3FA 2HA3A 4K9KA 4ZPXA 2QAGA 1DMRA 3MYYA 4ARCA 3JRWA 1FJGB 4DR5B 1XROA 2QIPA 5AIBA 3VJLA 2NZWA 3IULA 1QHIA 3WX0A 5SY9A 4FFNA 3AJ9A 3WGMA 1EVKA 1Z62A 3AM3A 3SSMA 4GBJA 2O8NA 3IP9A 2WNHA 5U1PA 2J3DA 3A6LA 3QNUA 1DDGA 1K97A 3ZDRA 4ARBA 1KIMA 1I5EA 2G88A 4AX8A 3B9RA 4G4IA 1QZZA 5BN5A 3OEHD 2QRJA 1U2SA 3QPVA 1KZGB 1RWQA 2B7BA 3PUJA 4Y0AA 3QP9A 3F49S 4EPTA 7MHTA 1YBVA 3PX7A 3PUXA 2RH9B 1UAYA 1K8ZB 4KQ6A 1DPGA 3O73A 1DCFA 3GJ8A 3O6VA 3WFZA 1HETA 2QLTA 2GFQA 1MGPA 3NEAA 3CGWA 2CNBA 3L6RA 5F4BA 4QUHA 1TIBA 5BNWA 1TL7C 2YYYA 4Q15A 1N33B 2ZJOA 3BCUA 5C34B 3NC0C 3AY6A 1Z5OA 3LZDA 4QXMA 3V55A 1CJSA 4KQMA 5JD5A 1JLLA 2FPXA 3QYPA 3CIFA 4W9NA 2ZTHA 5FTNA 3L4SO 2X9NA 2Z5GA 1ZHHA 3CB2A 1E2MA 3I37X 4EUNA 2QLBA 1BJTA 3HSKA 2O57A 2B4TO 1IXKA 2ZW9A 2Y3IA 3EC1A 2IX3A 1YZYA 4X64B 2QU8A 5DVZA 3DJFA 5E1MA 4OY3A 2C07A 3D59A 1BH2A 4TXHA 4BVLA 3L1VA 2P7IA 2GN0A 4ER0A 2DKNA 1DXOA 2OAQ1 3HDJA 1TYZA 3UTCA 1KORA 1MFPA 4DCOA 2P2YA 3RC8A 1NSYA 2H54A 1USWA 2X5KO 1YCDA 3FTDA 4FT2A 4ZMSA 4UDYX 2FX5A 2ZR9A 4RV5A 1DO2A 1EK1A 4R16A 3B60A 3CUSA 4Z4HA 3HYCA 3AYZB 1X7GA 1L4FA 5K51A 3GGSA 3GEMA 3ZXIA 5AUPB 1TM4E 1IB6A 1HKHA 4RKWA 5K3AA 4IJMA 4ZI3A 5HP4A 1QO0D 1NNEA 3BJMA 4JYAB 3AUUA 1JQ3A 4ICIA 4XJTA 4F9EA 1V7CA 1AKYA 1PG0A 5FA5A 3KAKA 5J2UA 4KLAA 1C1HA 4N8SA 4C4XA 2DFTA 4KVZA 1V1MA 3BTVA 4BCBA 3COYA 3W06A 1W35A 3JD1A 4ZPJA 5JVDB 3T7TA 1XDSA 2I6SA 2ZSEA 4GOLD 4J94A 5ALTA 2JFHA 3VR5D 4ILEA 2PUTA 5EJEA 4JT4A 3ZK9A 2AB0A 3N6VA 3E7FA 4IUCS 4MZXA 3ZUGA 5ERYA 4DCMA 1U9CA 1E9CA 4I9UA 3S8YA 3TI9A 4Q7JB 1NYTA 4IQFA 3FNHA 4REQA 1YACA 3W3AD 4BMZA 5IUNC 4B9AA 2VP5A 3I1IA 5G4KA 2NYRA 4HD8A 3KJHA 4HH4A 2CNOA 1AA6A 2FR0A 2GNAA 2C0CA 5LA6F 5GZ3A 2ZXUA 5ED4A 2AA3A 1Y6RA 2P3SA 3HN6A 1KHTA 1QIKA 3S2IA 5CVVA 4RCZA 3CZAA 4ZO7A 4JT8A 4MR8A 4YASA 5HG0A 4FX5A 3LCVB 1EUQA 3EDYA 1DU4A 3AWIA 3ZHTA 1P1HA 2VFAA 3D6JA 3P9IA 4NZ9A 3WOHA 3LHDA 1L4NA 4U5XA 1G3QA 4YONB 3SZMA 3DE4X 3BULA 4J0KA 5I9MA 3RIXA 3KQHA 3I04A 5IC6A 3LA6A 3UGJA 3IGFA 2XUOA 4AKIA 3DF7A 2XB6A 4JBHA 1Y8AA 4JC4A 2VJMA 3EBPA 3ELUA 4TSKA 5BMVA 3E7XA 5BV2P 1N8TA 4G0MA 4AWXA 2AJLI 2YIJA 5JAPA 4QVGA 3ZS8A 1HZJA 3A6DA 4KNYA 4M83A 5LWHA 1PWHA 3OF5A 2GRAA 2RIPA 1AQUA 4MQ5A 5F78A 4B6FA 1KP3A 4DMRA 5BUCA 2FRXA 2D6FA 1B7GO 2IVFA 4IAOA 5ILGA 2J07A 2BP7A 4JKOA 1ZA2A 1YBAA 2OXEA 1Y6FA 2AN5A 3KYDB 3TO5A 5DOZA 1SCIA 4EHJA 2DFVA 1X1BA 4YAEA 3NTLA 2A7XA 1A04A 4F60A 4HNTA 3DNPA 2AZMA 1BEUB 1XRNA 1CHDA 3JSAA 3QNWA 4PHGA 3T6KA 1KY4A 4BQPA 1GNVA 3H99A 3KQPA 4O4IB 4A27A 3F71A 4AMUA 4PZEA 4MS1A 4GUDA 4CV0A 1GRVA 3IEPA 3WGJA 2Z09A 3AF4A 4TKLA 2JC3A 2WTNA 1B42A 2XJ9A 4EMUA 1IN1A 3ZE9A 1P7WA 2QVZX 4I0WB 4TXNA 1LSUA 3PNKA 4GBED 4M60A 1HORA 4XX0B 2VAWA 1XTBA 4NV0A 5F7ZA 3ZGZA 4B6GA 3EVZA 3FPBA 3GJSA 1OFGA 2GLTA 2MSEB 2PYIA 4RWZA 4C6TA 1JEDA 1Y5NA 3DEHA 2RK6A 1T8UA 2PR7A 3G2PA 2Q1WA 1NP3A 3QIVA 1GU7A 5TQ0B 1RC8A 4YX9A 1DIRA 4B73A 1A77A 2C77A 2PLRA 1WQ3A 3G7SA 4FFRA 5DEIA 4ZVKA 3RV3A 1CV2A 2WJAA 2Y66A 2Z56A 3TVYA 2DEUA 4JI7B 1E1YA 3BMOA 4ND7A 1ESNA 1KOFA 2OSVA 3ZC3A 1MQ9A 1Z8DA 2FZCA 3HV0A 4EDFA 1U8AA 3KHTA 1WW2A 4PSKA 5B4UA 4HN2A 3VI4B 2J3QA 4HWPA 5LL6P 2VTBB 2HF9A 2OZVA 3UJNA 4F2GA 3K96A 4ZEWA 3KWMA 4L3VA 2AF3C 2OXFA 4O1HA 5E8RA 3QVJA 3VH1A 1F9AA 4M6WA 1Y7IA 4WLVA 1BOOA 3DE1X 2FWBA 2H1VA 1YQEA 2IWRA 2PX4A 2XR1A 3RLFA 1QCYA 3TRIA 3HK2A 3GAFA 3A1DA 3ZHCA 5H7XA 2OLKA 5B1HA 2GUGA 1RPTA 3CLSD 1CUYA 2AFRA 3IR6A 3ZWCA 3OIDA 4TT8A 1TJ4A 1DQRA 2E4VA 3OPXA 2XKJE 5IJAA 2QK4A 3TZHA 1OREA 4QOHA 3U0VA 2WHXA 5CCBA 2R66A 2ODBA 1CVRA 2XHZA 3OCWA 3WYFA 5I51A 4IYRA 2ZAGA 1FRZA 1GGMA 1W0JA 1H5UA 2OZKA 3OPYA 1M2OB 1DC6A 4WFKA 4ARSA 2OK7A 4W5WA 1PGNA 2EX4A 4P7JA 4AXBA 3JS5A 1P5FA 2AW5A 3G13A 2RD2A 4CR8A 3M34A 1G4AE 2R8BA 4ZHSA 1Z6PA 2XNSA 5KX5A 1ZW6A 3EIFA 5HMMA 4MW0A 2WSYB 1U9JA 3DW3X 1MQSA 1N25A 3RSSA 1NUUA 2FW6A 3AEXA 4KUGA 1DZIA 3WK7A 1N2XA 2ZXFA 1OLSA 2BE7A 1R0RE 1W19A 2EGUA 3C3JA 3D0KA 3F96A 2FR1A 4QTZA 1SXHA 3RS3A 4ZZ0A 3HYTA 1YQUA 2X3UA 4V02A 4GPIB 1T2UA 1CBUA 3WKAA 5KYWA 2P9TA 3GJ0A 4QGHA 1JTFA 3RFXA 3W5HA 3WZMA 2HHHB 2WD9A 1D2GA 1KZ9A 2CJYA 3NLLA 2O7VA 4GUAA 1N77A 3F3MA 3VU3A 4A0FA 1LB1B 1GXSB 1VSQA 2DKOA 3LCCA 1MT0A 3QMVA 4EY8A 2WF8A 3OMXA 4BYGA 1B00A 1I14A 1CWUA 2ET6A 1CERA 3QIAA 4H31A 3EZGA 3GA0A 4HZGA 2NAFA 3Q6IA 2CD9A 2W0SA 6PFKA 4GD3Q 4M0FA 1RMQA 4Z4FA 3IOEA 3BXZA 3NHAA 4Y0VA 1OBVA 1EFRA 1JEEA 1TYBE 4RA6B 2QG9A 1H6BA 1KMHA 1ZKDA 2ST1A 1FTGA 4EHNA 3EGXA 1S2NA 4RV4A 1PJ3A 5HBRA 4FBGA 4XASA 3TNYA 2R2GA 3OLZA 1Z7GA 4EPWA 3G68A 3Q1LA 5AT1A 4C5CA 3QPDA 1SUEA 4W6ZA 5TMPA 3VKHA 2MYUA 2WM8A 3H5AA 2B0CA 3C7AA 4NDAA 3PXBA 2OFFA 3NAGA 2PGDA 2UUOA 2EW8A 4TS4A 4JUFA 3V1YA 2GS9A 5HHTA 3KYJB 5K03A 2WSSD 3G3EA 3IOMA 1Z8FA 4M89A 4JBLA 3U9TA 3TE6A 4UAUA 5CFPA 2Q4TA 3DOCA 3VOSA 2WTAA 1P60A 2QR5A 2Z04A 3A14A 4RPKA 4DPLA 2P35A 1L8XA 1XPJA 2XIJA 1YJXA 3TDMA 3U2QA 2D2VA 3WLFA 4EKYA 2AXNA 5BSEA 4D8XA 3GFRA 2XA9A 1BS2A 3PT5A 3CONA 3LUPA 2R44A 3FDJA 3IE0A 1W96A 4LE0A 4RW0A 2JCBA 5DZSA 3VYTB 4YT8A 5JSZA 4AY6A 2BD0A 3ZJTA 3LBNA 1B93A 1VSBA 3F74A 1KKMA 4DA7A 4S3MA 4MVJD 2VA8A 3D8UA 3REQA 3SQNA 2MHCA 1KQFA 3IDAA 2F9FA 1I3NA 5E6SA 4F6LA 4IX1A 1WY5A 2C92A 1P4RA 4MS3A 4QYWA 1PT7A 2ACWA 3HCOA 2FUG1 2OCGA 3HEBA 4EX7A 3L02A 3CVJA 4BASA 1RPAA 2JARA 2JCYA 2QMHA 1SVKA 1DRKA 4NQRA 1FYFA 1QNLA 2SCUA 1NN5A 2XZPA 3HR4A 3Q5GA 1YI0A 4JOQA 4L73A 4QBFA 3O8OB 4UHBA 1GSAA 5JS6A 3UT5A 3DG9A 4QBTA 1NF8A 1Q0LA 3EXG1 1JPVA 4MKGA 1IFXA 1BCSA 3BWXA 4G9BA 3SJAA 3OY2A 1CY1A 1WHSB 4RH0A 1AV7A 2PZLA 4YREA 1KJWA 4N5MA 1WEHA 3L2OB 2CZCA 1YA6A 2DBVO 2QQFA 4MYSA 3ABOB 1KSHA 4EK9A 4YCSA 1GVHA 4PAGA 4RMJA 1VE9A 1A3CA 1U8XX 1N36B 1SR8A 3OE5A 5K3EA 1MAHA 2OZEA 3I6ZA 1U5CA 3IESA 4QOJA 3ADPA 1GQQA 5JNSA 1XKLA 4KOAA 1RKUA 1FFYA 1M34A 1FOEB 3T1NA 1Y5RA 3X1YA 1R66A 2Q4DA 1HEIA 3HBLA 3M5CA 3NYRA 4OMDA 3J81k 1HBJA 2KWIA 1EYZA 4YAUA 3RHZA 1RHKA 1XN4A 1G9SA 5DASA 1G8JA 2EJCA 4QATA 3EOBI 4FGZA 1P17A 1F2TA 1F60A 2DSNA 2J3LA 3DLAA 3RYCB 2V1UA 1F8XA 1DUSA 4F3CA 1EWRA 2PBFA 3G0HA 1EZZA 1FJ2A 3V5NA 1LBEA 1LLCA 2PFGA 3OA0A 1MOQA 3QM1A 5FWXA 1JFTA 2IPMA 3QEJA 3SS7X 1RZVA 2IEYA 3HA5A 3ND8A 4L1KA 4XCQA 3UAXA 3HKEB 5DM4A 2VYQA 5TVGA 4EKEA 1PUXA 2P2SA 3NAZA 4H4DA 2RKWA 4I55A 4LXXA 3AIOA 1ECLA 4CWAA 5AVOA 1E8NA 3GDGA 1SB8A 4UZEA 4IIGA 3E22A 4FNAA 5M04A 3H4VA 3QWIA 1VKJA 3PPXA 4DLUA 1U5AA 3WK6A 1BDHA 3TUIC 1T6YA 721PA 4J43A 1E2GA 4KVAA 2AN1A 3TRKA 1TKAA 2YS6A 3HC7A 4BKRA 2BFFB 2YMMA 4JWTA 4F2HA 1MUUA 2NLOA 4U7DA 2XQKA 1GPLA 2JGMA 4ZVOA 1DMSA 3QX8A 3DZBA 4ZREA 4BKMA 1JSXA 5EOVA 3HR7A 3DCJA 1WS6A 2HJWA 4B3GA 2UYOA 3TYXA 4BX2A 5I8PA 5H83A 9LDBA 4WDQA 1J20A 1N5MA 5F33A 5JZMA 1NGSA 2HPVA 2GI4A 2I7TA 1C9YA 2NXCA 3LYLA 3N2LA 3UMFA 3KQWA 1UM8A 2ZYRA 3RREA 1W2WB 1H42A 3ZNPA 1PTJA 4IHJF 1ZNYA 2XNJA 1DADA 1YV9A 4DNQA 5LZ4A 1OTYA 2Z2KA 3KKOA 1MX9A 3DUFA 3PVZA 2ECPA 4KBFA 4PPGA 1PSZA 2GN1A 2V7UA 4D8UA 4TLCA 5GGXA 3X1MA 5H8WA 4IXMA 5KSPA 1TPZA 5B53A 4W4TA 4YMIA 4KE7A 3GJTA 3QV1A 2PSFA 2QP4A 3OTQA 1KVUA 1QQ5A 2C9BA 4MQMA 1P7ZA 2VQ6A 3ZU4A 5KWVA 1MPXA 3P2IA 4PX9A 5J58A 4YWHA 5F7JA 1YHZA 1KY5A 3FCUB 3OCCA 5COAA 1QKJA 2AC4A 4TZ0A 3H1PA 2CSUA 1XFAA 1A4UA 2IXGA 2CVPA 5CRIA 2PPLA 4ID3A 3PTAA 1SXPA 3EB9A 2BSXA 5EWMA 2N75A 2GSWA 2W6NA 1XKQA 3BIOA 3MGCA 3MGKA 2YC2C 5HIIA 4EI2A 2ZSFA 1X7YB 2DHDA 1KI6A 3CSSA 2A86A 1WEKA 2OB1A 2GPJA 2OFOA 2WP0A 2X2FA 2X3YA 2ZKIA 2QJWA 2FZLA 2G77B 4M76B 2DF8A 4DKJA 1FP4A 2I9KA 2GEJA 3IV6A 5IU6A 3SJBA 1Q16A 3VVCA 3OWHA 4GDMA 4JGBA 4DLBA 4DIUA 1U1GA 3QXCA 4GLBA 1TTHA 4KK3A 4TMYA 4QDZA 3O90A 1VPDA 4DR2B 1C1XA 1CJUC 2L82A 2PIDA 3TPZA 5DM1A 4CG1A 1TB4A 5TT1A 5A0TA 3BG5A 1P77A 5KTYA 5LVAA 1YHNA 2O8CB 1VRCA 4AK9A 4DV3B 5BPHA 4Z9YA 4XYGA 4C01A 4D8WA 1KMIY 1E3LA 4WUVA 4EB6B 4Y9RA 3ZY5A 5JS2A 1R5BA 2JCSA 1NP7A 2FLKA 3N2GB 1O2DA 3N2KB 2XMZA 3TNLA 4LHWA 4ENRA 2P30A 4MMZB 1UP4A 1ZRSA 1TIKA 3A1TA 3PDHA 4HGNA 4Q1DA 3RQSA 3KQUA 1KTIA 3VHXB 3NHZA 4L4RA 4PV7A 3I32A 4BWGA 2X0EA 5ALUA 1L7QA 4D79A 5FKJA 3H1EA 1BNCA 3F2VA 3I73A 3OFSA 3WBKA 5FLXA 4K9QA 4B6PA 2NUAB 4B46A 4D0LB 4EHHA 2O8EB 4WBNF 3K94A 5EUBA 4CM6A 2RBEA 1NONA 2Q6IA 1M8JA 3E5RA 3ZE2B 1J0AA 3L79A 1P5HA 5BW5A 5C5IA 2CVHA 1SU4A 4C1BA 3ISJA 5TT0A 1SZCA 4WXYB 4O2BF 5KPDA 3TD9A 2ZB7A 1Y7LA 5CXXA 5DBGA 1NXXA 2YZ7A 2Q5QA 2P6UA 1ZPDA 3HWSA 4B4OA 4YCMA 1KJNA 4PQYA 2IYAA 2MMCA 3K16A 3DH0A 4LWQA 3P0JA 1K7SN 4MA5A 4G0ZA 4FZJA 2EQ5A 1P39A 2BUBA 2EZ9A 3KNZA 1IHUA 3R4CA 4I1OA 3UWSA 2ZBUA 4LQDA 5C8VA 4C7OA 4L0MA 5A9SA 3U7FB 4I6GA 3QG5A 1UZAA 4QUJA 3D8TA 2QXUA 3SOPA 4ZYZA 1O58A 2QTNA 5CUQA 1HNXB 2CJWA 2FSPA 1KZ1A 3GROA 3MFYA 4G5QA 4HFMA 4DGSA 1MJFA 2I8LA 4X20A 3MGAA 1C4OA 3OEHA 1BE0A 9ATCA 5K45A 1ZWKA 2QVXX 5J47A 3NORA 4R1LA 5A6SB 2QTHA 1GZ3A 4Z49A 4MCAA 4ARZB 1UQUA 3UK6A 3H1GA 1GZDA 3WHIA 4HSGA 4H17A 3ZE0B 1QF7A 2RGBA 3H84A 1OD6A 3PHLA 3E9EA 4F97A 1M0WA 4O4HF 3GBPA 2XXAA 1KMCA 5DXAA 3JD2A 1VYTA 1Y3BE 3L6OO 3QUSA 4JB0A 2C3OA 1JAZA 4NATA 2BIFA 4K46A 1J00A 3SY8A 5KO2A 4F86A 3HHEA 2GXUA 3MCZA 4G26A 1U7HA 3NNNA 4U7HA 3RC9A 2I3GA 5B3AA 1BDBA 3OTIA 5FQNA 2X0IA 5K6AA 4FJ1A 1WXFA 2ZVQX 1DTWA 1TCVA 4QDKA 1GKKA 5LJIA 5IULC 2IU3A 4QEKA 2OPHA 3SC2A 1Y48E 5I7AA 4QYXA 1ESEA 5DSTA 1SBNE 3F6EX 1S2DA 3O8DA 1N2SA 2WNSA 2C4MA 4CW7A 3LBHA 1DAKA 2CNWD 2HZ7A 1QO0A 3O8NA 3OSUA 4PWYA 4V0OA 4AS2A 4GI1A 4RA9B 4MGIR 1Y3FE 2CVZA 1U7DA 2JGLA 1TKCA 4OU4A 1EVYA 2IUSA 1KGDA 1C2TA 1FNSA 2H2GA 2NQTA 4G1FA 3RS5A 2R1ZA 3W78A 2DBZA 1NBWB 2QHXA 3K1ZA 2C2YA 4Q4LA 1M34E 2BGIA 4OEHA 3EFOB 2BF4A 4Y6RA 3VR5A 5KQMA 2F1OA 3ML1A 3CN7A 4EGAA 4H7EA 3VR2D 2PBLA 1QG0A 3LDHA 5J5AA 3SG0A 3UCXA 1O6CA 3ZZTA 5C80A 4GS5A 5IN4A 3ZU3A 1JDBC 3H9BA 3W3AA 1R0XA 2GX6A 4J6FA 5A2GA 2Q07A 3G2NA 5B58T 4FS3A 4BPBA 4PYJA 1RQ2A 1Z37A 3QU5A 4V38A 1NJ1A 4R9UC 2O2YA 2R1TB 1L4MA 2AOWA 1A97A 1S2MA 4BNJA 2XUQA 2VJOA 2BT4A 3NIWA 3FNQA 1Z73A 1Q1EA 3RK1A 3W8EA 3KLNA 2WVAA 3L0DA 2CW5A 2C5FA 2AUMA 4UMFA 5A7GA 2I2CA 4HDNB 1XMVA 2IEBA 3E35A 3EGCA 3L8EA 4L7QA 3HI6A 1L5ZA 3UC9A 3WG9A 5I7VA 4OXNA 1HNZB 4RTOA 3K32A 5ANRB 2V1XA 1D2EA 3LVRE 1EVLA 2OMEA 4X1IA 1YRAA 3QBTA 4OQ4A 2Q3LA 5TPWB 4C2BA 4YRAA 3C3MA 3LRTA 4KDRA 4OXIA 2WT4A 4EI8A 2NVBA 3OIYA 5AW4A 3IALA 1ENZA 4WI1A 2H85A 3GJ4A 1NT2A 2RC5A 1RWMA 3PDIA 3PQ8A 2MSDB 3CJTA 5IKPA 7REQB 2N0SA 1R5NA 2FSVC 4XIYA 3BDAA 2X19A 1Z68A 3HU1A 1H2AS 1TGYA 3DQPA 4JOCA 4R2WA 2AEMA 3KDPA 2X8LA 3IUSA 2I4MA 4WACA 4O5AA 4OP3A 1P2UA 4YB8A 4Q34A 1GZUA 3DZHA 1N2JA 5HS4A 2ZP1A 3GNTA 4BJ6A 4X93A 2EG9A 2V9CA 2I3DA 5AVSA 4R0VA 5I6DA 2WMOB 3ROXA 3AZOA 4GSLA 2OM6A 2FSGA 3P0FA 3UXYA 5IFKA 1FP6A 1A95A 5ALFA 1JB9A 3JX9A 1UBRS 3Q7EA 2V7PA 2TS1A 1MNQA 2E89A 3GQBB 2ZB2A 3AF2A 2MINB 3AESB 1IY8A 4ND5A 3WDKA 1IHPA 1IJKA 4G4SO 4AKTA 4ZZ2A 1SNYA 2BMVA 4I4IA 3W5AA 3SKXA 4U02A 2CWDA 4Z3DA 1VFNA 1N9KA 1ZXXA 1EGAA 1SUPA 1WZEA 2H57A 4FCVA 2FPPA 3RTBA 1GHTA 1TEZA 1N0WA 1W30A 2C88A 2EFJA 1TTQB 3EWNA 1XCMA 2WIBA 3IE2A 4P4SB 1BCRB 3VZQA 2DTXA 2J5BA 1E3MA 5E4YA 5FLKA 4YI3A 4YT4A 2YICA 4KQFA 4RXUA 4Z2AA 5BSKA 1P9OA 2B9VA 2VZ9A 1JQBA 3ZQ4A 1M9NA 5KYXB 1UPCA 1U5BA 2QUZA 4PZ9A 4BVKA 2ZYDA 2AZTA 3PICA 2F1JA 5DO9A 1LPMA 3Q3JB 3LT4A 1OZFA 2IHJA 2O2XA 3QQPA 1ZQ1A 4F5ZA 1SUDA 3OQJA 3MWFA 3E1GA 3MMXA 4LCBA 4UEKA 5L8VA 2P6PA 1V2HE 1EJBA 5CNMA 2DMRA 2Y9PB 3FE2A 4PBSA 3T3PB 4YPOA 2YCLA 5DNAA 4GL2A 3OLCX 4UD2A 1AKNA 1CFZA 1XNGA 4JIMA 4MR9A 4DYDA 1ISJA 4PLTA 2P62A 3OWXA 3L06A 1B0ZA 3ZCRA 3F5FA 3G0DA 5AI5A 4ZOAA 4EJ6A 4BCDA 3CLRC 1RP7A 1PUJA 1XJWA 1WV1A 2QUAA 1Z2PX 3O4VA 4LMAA 3RTCA 2Z9DA 4MK4A 1OY1A 1PNVA 3AR5A 4KKXB 3T5BA 4KPYA 1JKJB 1OLUB 1E1RD 3JYPA 4IO0A 2Q5EA 2YDYA 1AQYA 2YBEA 3CEAA 2PY6A 1EK2A 3LFUA 2A1UB 4DLNA 1NMQA 2FMKA 2Y1EA 3I4CA 4J2HA 2VDPB 3GW8A 3KE9A 3MB5A 4TMVA 1M6VA 5EMMA 3RQIA 4C88A 3IEIA 3H3JA 2H52A 2C42A 1R0KA 5F3RA 3PTLA 1PLKA 4QGBA 1RBYA 2PX8A 3D2AA 3OI7A 2EL9A 3F2IA 1XD2A 2ZREA 3JQ6A 2Q1XA 3B6MA 5SZIA 3LKBA 4AKGA 1NAHA 4RPLA 3VZRA 3LXMA 3GZ4A 3GUCA 4QRDA 3FLAA 5K9ZA 1TW2A 4DV6B 1OAOA 1UBHS 1WAMA 1TK3A 3ZWDA 4EFDA 1V41E 4EENA 1SRRA 4HZUA 3TIFA 1RQ7A 4PNHA 3BA1A 2FI1A 1YT5A 4BNMA 5CTJA 4PX2A 5EXTA 3ADKA 1MO5A 1FXUA 4DLPA 1PQPA 5LXTF 1WDTA 2WHPA 1VE5A 3PQ4A 4M8IA 3RFFA 3SSAA 3VC2A 4Y6PA 1P45A 4EITA 5LQKA 3VSBA 3A9SA 4N41A 4DR1B 4ZT5A 4C0XA 3E81A 1Z56C 2JJQA 3H42B 2GGSA 3WK4A 3CVUA 2ZUFA 1O96B 2FR8C 2WFAA 3IVCA 4MUHA 4B2LA 3QUBA 4MKRA 1WCXA 1AXEA 1PN3A 4E7PA 1MP0A 3WKCA 1ZMTA 1XWWA 3M9LA 1V37A 4G5OA 4EHBA 4FZ5A 4LK2A 5TGTA 2J6IA 2P9QA 1KR2A 5JAMA 1V7ZA 4K6CA 4LJKA 3NPAA 3JQEA 1XF9A 2JFBA 4XQ0A 5P21A 3CXUA 3WNDA 3FHTA 4ZTUB 2W8BA 4KMMA 4L0QA 5TPZD 3ZWVA 1UKEA 1OHHD 1WVGA 2XYGA 3FPAA 3K5IA 4RY8A 1KDZA 5FPPA 4ZK6A 5KOJA 4AO6A 1VJ0A 2Q45A 1M1NA 2C97A 1LBSA 4UU0A 3BXEA 1P4JA 3W2EA 4NFLA 3ZCTA 4FYIA 4OXRA 4K8RB 1KI1A 4JFAA 1NKVA 4OM8A 5PGMA 1ZK2A 2B7LA 1K7XB 2NSDA 3OIFA 1CULC 1ORHA 3N7AA 1KJ8A 4AX4A 4LDQA 2PL9A 2VUTA 4KUEA 5LOVA 4OQPA 1P31A 3ZEAA 2AMLA 5J2UF 1CUIA 4C7KA 2WD8A 2CVQA 4HNSA 3TW8B 4XD2A 1XEWX 5JYBA 5KIAA 5GWXA 3QSGA 1W48A 1UM9A 2A1IA 1JA0A 2H1FA 3EZ2A 2ZWOA 3KR0A 4IUBS 3UYKA 4ETMA 3BAFA 3IUBA 3O91A 4IR7A 2F3PA 3LH5A 2GR9A 1Q3TA 3D0RA 3ESDA 4X7BA 2CL6X 3V8EA 2WKQA 3WADA 2JFFA 3HXOA 1QPZA 4XVRA 4MVJA 1YRQA 2KYRA 1O94D 3JD0A 4PVCA 1GU0A 2DHRA 4OYLA 4XXHA 1P4GA 3HPRA 5I4IA 1CLEA 1KAGA 2GK6A 3O95A 3GXBA 4HJXA 5B3JA 3L7BA 4P32A 2G5PA 2P91A 2HMAA 3CO5A 3RTAA 2TMGA 4L0CA 4L4SA 3PHGA 4HWSA 3DZFA 3TSZA 3U1VA 2WE7A 2H08A 4NBLA 2FEMA 1IL0A 2RJOA 4AY5A 4J3JA 3RM3A 2I78A 2J7PD 3HADA 4E22A 1UDRA 3NIFB 1V2GA 4NV1A 3WSWA 4ZZIA 1NF9A 1EXWA 5B2FA 4RMIA 1JR6A 3TGWA 2ONJA 3KVRA 2Z2JA 2Y2VA 3NV7A 1QNFA 3RFCA 3LGSA 1J8DA 3FJYA 4DF3A 4EW1A 4TPKA 1C30B 2QL6A 3RG8A 1Z26A 5B6IA 5KWJA 5EHXA 3ZDBA 1FSZA 3C5CA 3FJ1A 4F5WA 5CA1F 1SBYA 5IT5A 3I3SR 1V16A 2BBOA 3KUXA 1COWD 1MNAA 4LVCA 1TQ4A 3BZUA 3MT7A 5AHXA 3EXHA 3I2GA 3ZK8A 3GLFA 3IUYA 5BMVF 4CU2A 3I6MA 3NAQA 3AJEA 1DCTA 1P4SA 1SQSA 3K0KA 3IFSA 2ZJAA 4CM4B 4O29A 4GM1A 4RVUA 4LNUA 2QUIA 4DV4B 3B7GA 3M6WA 5AM2A 1U65A 1VI2A 5EP1A 3SOZA 5G0UA 4MR7A 4QA9A 5LWQA 5KHAA 5G4LA 1MX3A 5HBGA 3MRVA 3HBAA 1QE0A 2VRCD 3F1KA 5DX1A 1DL5A 1ND5A 2HL6A 1K27A 3DD5A 3EIUA 3OJ0A 2JVJA 3MJ4A 2DWPA 3MLEA 2D8AA 4QBHA 1E2QA 3OZUA 2QM7A 2X13A 4X8MA 4YFVA 4CEHA 1PFWA 1Z5VA 4DZZA 4ZJZA 2FSIA 2Y1DA 3EXEB 3I12A 3U4AA 3W1EA 2WFLA 4OHZA 4BNVA 5AQ1A 3STTA 1SB9A 1V95A 3LG2A 4C05A 4PYIA 2JFUA 1JZQA 1ZBQA 2WV7A 3IAUA 4RK7A 3IVXA 1N57A 1WDLA 3JQ7B 1JS1X 1OXVA 3OX3A 5DLYA 4JEUA 3UH0A 1IY9A 2X1MA 3G2HA 4PRYA 5IS2A 1G8PA 4E08A 3OZXA 4WEOA 4OP1A 4AJEA 2K4MA 4F56A 3UK7A 1REQA 1NDUA 3JARA 5L4SA 2WG0A 4TN1A 3RSFA 3QLUC 2HSGA 4MLZA 3IEVA 2HNAA 3GCWA 4WOKA 4OI0A 1MB2A 3UAGA 3K5HA 4CIYA 1OCEA 2P3LA 4M21A 4MQFB 1RRFA 5SZHB 1FFDA 4BU1A 2R8YA 4YUWA 3COJA 2YIMA 1ZGJA 2EIXA 1KI7A 2YH2A 5ALGA 1FRNA 1LBIA 1UJ6A 1ISMA 3CNEA 5HQTA 4OD0A 3AVWA 1F0KA 1YMVA 4EHFA 2FDCA 2XVMA 5KJ1A 2YZ2A 4QWMA 3W8NA 4EO4A 1YBFA 2A0KA 3DAHA 4KGZA 2FW0A 4GAEA 3UA3A 3C8ZA 1R0YA 2CFCA 2NQ8A 2IIQA 3IHTA 3L8GA 3VUEA 4C0WA 3TF5A 2WICA 1JT9A 4PLYA 2EVWX 2CZGA 3GMSA 1IN5A 4FOOA 3IERA 2QJRA 5CK5A 4B32A 4BVEA 2JFPA 2Z9BA 1Q0PA 3NOXA 1RT9A 2D7CA 3G7UA 4BJ1A 1RWKA 2QTMA 4XYEA 3VR6D 4DBLE 5CBKA 4HGQA 4OX9Y 5BV7A 3AB3A 1KI8A 4DA8A 3AR4A 2ZUTA 3NI2A 1NULA 4HTFB 1C7JA 2AQKA 4CODB 3GJ7A 2V59A 4ZI5A 4MKXA 2C83A 1ZJ5A 4LF7B 3VYSB 3ENWA 5JECA 5KTMA 3V6MA 3PYLA 4ZIRB 4ZT2A 3QFFA 2K5UA 2OTCA 4K5QA 1DE0A 3KQQA 4BNKA 1C3LA 4D0NA 1SVWA 1GCOA 1T4DA 1CUFA 2WT8A 2GBLC 3FI9A 3D8HA 3PDJA 3HP7A 3M6FA 3RJTA 3NTRA 2IZ0A 3ESBA 2ORVA 2J5RA 2R5WA 2AR7A 3DDNA 2Z43A 3DVAB 1F14A 4TWZA 1I3KA 2OGWA 3R1IA 3H8WA 4QJ5A 1FSGA 5THXA 3V97A 2EQAA 1AKWA 2YMQA 1R6TA 1BDMA 4JLBA 5E9JA 4AY2A 2AJBA 2G71A 2ZSKA 3L5KA 4OGGA 1IQUA 1GNRA 2HIGA 3C6ZA 4JR2A 4P84A 1IN4A 4IHJB 2H4XA 4YC7A 2A0UA 3SFTA 3DMTA 5ECDA 3RJ5A 3WL8A 4OKNA 4HXEB 1CQPA 121PA 1E2JA 1VKZA 2N9UA 2OK8A 2CF5A 3IP7A 3OQ1A 1Q15A 1CKEA 5LP6A 2A9KA 4L85A 4MLDA 4I1UA 5EERA 3Q98A 1VI5A 4JCOA 2YV5A 4KG7A 4URWR 4FJ2A 4CEJB 4BX8A 3AHJA 4GGOA 4DEXA 4DIBA 1U2PA 1HE2A 1TNDA 3AUKA 2DFDA 3B1KA 3DEZA 4P0TA 3REFA 4RPHA 2PUVA 4UPDA 4XEHA 3MFQA 1J9ZA 4CMIB 4QARA 5BQXA 5JCJA 1QLWA 1P19A 3NR2A 2NO6A 4FZVA 1S9DA 5JG7A 2VT7A 1NPTO 2HU7A 1TZJA 1UINA 3O9MA 4B2YA 4LJ9A 4MJ3A 4DLTA 6ABPA 3TBFA 3IT3A 4J1NA 4WKBA 2WKPA 2QV7A 4M0DA 5LKRA 2AK3A 1KK3A 4HFNA 3NS7A 4YEDA 4HRAA 1VMKA 2JIQA 3MLBA 4YAFA 1ID1A 4GG1A 4FKBA 4X91A 2G1PA 3QX7A 4EGCB 4NCNA 1QV6A 4LKOA 4W5OA 1DC8A 2JEOA 2WJ3A 4MW5A 4WECA 4F2WA 5I7EA 5I7HA 5TXGA 4K9LA 1WHTB 2BHNA 1DRVA 1Q0QA 3UT0A 1UMDB 3USCS 3RBVA 2QMYA 4ZT6A 3RAPR 2NU8A 5B7QA 2E18A 2XAAA 4J0QA 4R51A 2A9RA 5ALQA 4RACA 1BMFD 4V1CI 1W5SA 3QVXA 4WPGA 3E82A 4QXOA 4XWGA 4X95A 4C07A 2XCRB 2FQ1A 2GLXA 5JATA 4G1BA 4F9FA 4HMQA 1N6KA 2CGEA 1OFTA 3LTEA 3HMKA 4H08A 3SEQA 4EHDA 4F4IA 4AURA 3I0NA 4B6OA 5JI2E 1RDFA 4M53A 3A04A 4G0OA 2O7QA 2NU7A 4FI3C 3MERA 3LXXA 2PMFA 2R8RA 3BRWA 4RMGA 2FMXA 3KQTA 4YIKA 1M5RA 4Y9UA 2WF5A 2QRMA 5AOCA 2HWUA 3TN7A 4MGHA 5LQRA 1WSWA 2QM3A 2I1VB 4NECA 1LX6A 4NZNA 2VDJA 3ROGA 4WBNB 4JP1A 3DT8A 2MSKA 1PJSA 1N3IA 1C9NA 1XTVA 3T52A 3VU8A 1GAXA 1I1HA 1JKXA 2WNIA 1ATZA 4O2BB 3JAWB 4MVJE 3INRA 5CD1A 1CUXA 5EJ2A 4L95C 1YRYE 2HEGA 1TOAA 2QTFA 2LE0A 1F12A 2II6A 4DC0A 5CH5A 3V8VA 1TFRA 4RCVA 3GEEA 3IS3A 1FUUA 2YMPA 4G36A 2IS4A 2ZWPA 3AEUA 4LJAA 2RONA 4RLSA 1IWPB 4KXWA 3SYLA 3BIJA 1QZTA 3CCFA 5DTIA 5HK9A 3WAGA 2AFIE 4P22A 5KREA 2C9ZA 5T3YA 1NN3A 4KYTA 2B20A 3WWDA 4CDRA 2F8SA 4BIIA 5TSDA 1J7KA 4GIBA 2G70A 1IZYA 1GSOA 2VDQB 4HLCA 4UU8A 5EPEA 3H9JA 3I01A 2Q8PA 2YV3A 1E99A 5GIOE 4FMCF 3MWLA 2B3TA 5HF6A 3LIIA 3ZY3A 1Y4ZA 1I13A 1T1RA 2FK7A 2GHQA 2XCUA 4OL9A 3GGGA 4PGAA 1DHTA 4NU0A 4X1KB 4YWJA 3WMXA 4JR0A 3U3MA 4DQ0A 1T4CB 3I39X 4RM2A 2AUTA 5KC8A 2OV1A 2IPAB 1I0ZA 4ZDWA 3VSDA 1CDZA 1T3TA 1ZM4A 3BRSA 3UT6A 5JQGB 4LBWA 5KKNB 5FPKA 5ALNA 3O8QA 4AB1A 5C2JB 4R01A 1EDDA 4NZOA 5FUYA 3VR2A 4C0AC 2UAGA 1A88A 1G3UA 1ECJA 1WXWA 2W6MA 3CZ5A 3L8HA 3MTJA 4GWGA 5A0FA 1XF1A 4NZMA 3NRCA 4TLAA 5ICMA 2BE9A 4EJSA 4YXWA 2XPCA 3H2KA 1E92A 1W2HA 4QHYA 3B1JA 1LD3A 2ZEJA 4V3CA 3DE5X 1LKZA 4NENB 3JQFC 4RJKA 3SXUB 3UWKA 2FPKA 2J5XA 4G25A 4DM3A 2C57A 1KNQA 5B2ZA 4MDYA 3AKCA 4L8FA 2PS9A 3K35A 1WJGA 4S1WA 2IV3A 2GZRA 4CKXA 1ND6A 1QXSA 2FJ0A 2HQSA 5LNK1 2XI4A 3G9ZA 5JALA 1V9CA 1QIMA 2F4VB 4YRQA 4C20A 4O0MA 3GRRA 3KOZA 1N0UA 4G37A 1PKEA 4NBWA 2LCQA 521PA 5CG2A 5KSWB 3O2QB 3STYA 5HIKA 2VR1A 1IZ8A 5FL7D 5CM2Z 2H1CA 1GTJ1 2OGSA 4MQEA 4X65B 2BHSA 1O95D 2FAXA 3KE8A 3BMCA 3KJZA 4I14A 2KMLA 3GWZA 4WGGA 4WL0A 3SCZA 3ZGVA 4O4LA 3VR3D 4DLKA 5J4LA 2K2QB 3LI2A 3OU6A 2GJ9A 5LPNA 1I4TD 4TRRA 4EABA 3ETDA 4KE9A 1S7CA 1U8UA 1XVAA 5IVDA 4URVR 2H1LA 5AVYA 1GDTA 3WKBA 4CLEA 4UOZA 1N3YA 3OCVA 2JD2A 1U3TA 3W5DA 2I71A 4GXRA 3NDIA 5G1OA 1L7EA 1QFZA 1JA1A 1XZGA 4MMXB 2ZWMA 3VZPA 4HDCA 3ZBPA 1PLLA 2OYSA 1VHTA 2QEQA 1OA0A 3H4TA 3HQ4O 3KB2A 3VX4A 1QGAA 3D8BA 3EZ6A 2M6LA 5DTJA 1MJNA 2IXDA 3H65A 3EW9A 2HC9A 3EFEA 1I7QB 1T4BA 2NUBA 3IBFA 2VHUA 2V5AA 1QBKC 4MV8A 2ZIGA 2DBYA 3GRCA 1TM7E 3WWPA 3PFNA 4L8WB 1TZCA 1NOJA 4QQFA 4BV2A 3BM5A 4TTQA 4FFMA 2EYUA 3TCKA 5CB6A 4C78A 3C0KA 4FWBA 4ZVTA 1JH9A 1RAGA 3LO8A 4DT1B 4E1AA 1KRWA 5BV1A 4RM3A 3NWBA 4EBFA 4EVRA 4JS0A 3FHLA 1OTHA 1GEEA 1U9ZA 1TUBB 2PAAA 4DCGA 3L7MA 3VTFA 2FYTA 2JIRA 2EC5A 2VXCA 4HKTA 3GEBA 3PWZA 2J9ZB 3SHWA 3GRVA 3ETEA 3G9QA 2M6KA 1T35A 3BGWA 3CLTC 1IBKB 4K88A 4JLAA 1EUCA 3KG2A 1GNTA 1Z4OA 4O33A 3TXAA 3WQRA 1EAMA 3C3CA 4FGJA 2G63A 4LZZA 1UZMA 1KH2A 1EUYA 1PD1A 3HE3A 1RPJA 3BJZA 3DNMA 4C9BA 2AN4A 3D4OA 3ETCA 4NMXB 5JWHA 2BAGA 2QMOA 4XYLA 2VPZA 4ZO8A 3LX8A 2PKWA 5LUAA 4WINA 4HQOA 4ID9A 4UHEA 4QM7A 3ORSA 4I6JA 1N4DA 5DMHA 2DUJA 3ASUA 4UUOA 3FY4A 3TRDA 4A8PA 3T3OA 2Q4EA 2VF5X 3ASVA 2NT3A 1K6JA 1TJPB 1G18A 1OKKA 2JS7A 4RTSA 1JEYB 1L6IA 1FVFA 1UP7A 3WSVA 3RAEC 6GPBA 1E8DA 4E30A 1P3Y1 2NVUA 3OCZA 3O3CA 4JQCA 1JKMA 3U39A 3X1KA 3ZD9A 5ETJA 1XVTA 3NALA 2VH1A 3QFTA 3IUNA 3KLBA 3PQ5A 5AHRA 1T9GS 3TDKA 3ADDA 3UB2A 4K2HA 2B99A 1X15A 4CQLA 2AWNA 1PT9A 3UHPA 5GM1A 1DQPA 1NI3A 4CG3A 6YASA 1YJCA 4D97A 1O3YA 4YAKA 3AI2A 3K1YA 4ESHA 2ZBGA 2UV8A 4B43A 3KTAB 3D7NA 3SK0A 1ODCA 3WMWA 3UENA 2Q1UA 1PK9A 4Q39A 3KRTA 4WESA 2F48A 1I2MA 2QMEA 3HUEA 4CQNA 4JVOA 1N9ZA 1EKXA 3ETJA 5EZYA 1ZUNB 2HBRA 4HRYA 1EHYA 1Y9AA 2W6QA 2Q5LA 2ZSJA 3KZCA 1PS9A 3UGKA 3MTEA 4FVTA 1G5TA 4I5FA 3BREA 2CMHA 5CEEA 1CJTC 4H1TA 4WY8A 3IKLA 4CKBB 4DJEC 4F5DA 2O3SA 2BEUB 4M37A 3JZMA 4EHKA 1NYRA 2I76A 3A27A 3EQZA 1XRRA 1MV5A 3EA0A 2GKOA 4J9VA 2COKA 1YZFA 4GVLA 1DARA 2EATA 2JB9A 5DULA 4U7TB 5IVKA 2HREA 2IIPA 3RC1A 3EF0A 4BNFA 1FDVA 2RSLA 4B6EA 5K0BA 1VJTA 1RHJA 4W1RA 2YJ4A 3UY4A 3T7JA 3HH8A 1AMOA 2C98A 5FI0B 3U7GA 4BAGA 3E3OA 4EQ6A 1K2WA 1A9TA 3E3LA 1E6UA 3L7KA 2J31A 3ZE6A 2ASVA 1T8TA 4PNZA 3QYJA 3URMA 5CEJA 4LFBB 2GJ8A 4EF6A 5FUBA 2R7NA 1WE2A 3ANXA 1RBZA 3H5IA 1KYZA 2XUZA 2FZGA 2JEYA 4LDAA 2QJFA 3OE4A 3W2IA 1VPEA 4LV8B 5CGZA 4AMBA 4PC2A 1SC1A 2HXGA 3ZEIA 3T94A 1Q44A 1THTA 2QUHA 4DQVA 5HNKA 1SG0A 1GQOA 1I2CA 4MUIA 1A9ZA 3E48A 3FKJA 3T5GA 1ENPA 4KCGA 3GP3A 1SQ5A 4Q02A 4B3DA 4AU1A 3NT2A 3RUEA 4BY9E 1JR2A 2WU3A 2ZIUB 1GZ7A 1SCBA 3QBEA 4OH7A 5I5GA 2W4IA 4CLOA 1UDAA 3CRMA 1DQZA 1U2TA 5KNBD 4O0LA 4DMMA 3MB8A 4Y1RA 4U6NA 3FMPB 1PJZA 2J59A 2C1XA 4JC8A 1LEHA 1L9KA 4GE3A 2CFOA 3VISA 4A2PA 5IDQA 3WP0A 3IA2A 3MBKA 2R00C 3CLUC 3QVOA 3OMLA 4OATA 1FX1A 1O6FA 1ETUA 2R5FA 3Q1KA 4LC1A 4GR9A 2X9GA 4GZLA 4M87A 2E49A 3PDCA 1YWGO 4PFSA 1P7VA 2I29A 4X24A 3HGTA 1JNYA 4IDAA 3D0QA 4ZAYA 2XWQA 4L4YA 1ZZGA 3Q10A 4DY4A 1M7GA 1JLLB 2KX7A 4A26A 3QLTA 1P4AA 3IKJA 3G8DA 1SBHA 2XUHA 1RC0A 4WZAA 4XRRA 5JUWA 4I4TA 2IP2A 2QQEA 4JBYA 5DCUA 1X9HA 2X8JA 1NKTA 4AQYB 1CCWA 1OTXA 3UWMA 3S2UA 3E70C 3KPWA 3GFTA 2J7PA 4X71A 2GBIA 2HJSA 5BSRA 1VKHA 1P91A 2VC2B 4OP2A 4FD3A 1QVZA 2CYBA 4HX2A 3TEMA 3PU6A 4V03A 3KSMA 4Q3EA 5BW6B 4Z2YA 1D3AA 5CLFA 2HO4A 2R25B 5CIWA 3KOYA 4Z1MD 4FMPA 3NWOA 4L74A 4CFSA 2HA0A 4LSZA 2FMUA 2NO4A 4M9SA 5J2UB 4GZ5A 4R0MA 1P9LA 2PT5A 5EIHA 1OUMA 3PNMA 1V1MB 4G3XA 2NM0A 2WU0A 5JMOA 3QXJA 2HWXA 2HJVA 3FPSA 3OP1A 1HLPA 1W0KD 3CF0A 1H0RA 1WB4A 1EE9A 2HADA 3IJRA 3A1FA 4UM5A 2G7MC 1EVJA 1FU4A 5T4FA 3TAUA 1RXIA 2QXTA 5KTSA 5KYKA 4ON9A 5ALMA 3L0OA 2ONCA 1WUIS 4ZVSA 2VRCA 3ZDXB 1VCOA 4ZQEA 2IS1A 4REQB 2W58A 4BMSA 2GVNA 2I62A 2XQFA 3ONFA 1KJJA 2G5TA 5G4KB 1M8FA 4HDKB 2JD0A 3FCCA 3R41A 4IZIA 4NOJA 3FOEC 4RQBA 4EUSA 1KAEA 4RYLA 3ZCUA 5K4HA 4MB6A 1FU7A 1E0SA 1IWOA 4UNPA 5AI9A 2GZAA 2ZSIA 3H11A 4K9OA 3PHCA 2OCXA 4LXYA 4RZIA 5TJ9A 1V6SA 4M0MA 5K05A 3RTEA 4BO4A 3K70C 2ZYWX 1B74A 1UP6A 3LTNC 1DJPA 3VQTA 4C4SA 2ZUCA 4BQSA 2WJZB 1UBMS 2J48A 1M6NA 4DUGD 3MHPA 3R9IA 4MAAA 3H2YA 3ZWAA 1XV5A 2CXQA 5CA1B 1MEJA 1QOPB 1VOTA 2YXNA 2FXVA 2ZPTX 2WY2D 1UFRA 3WLEA 4M8LA 5MN6A 2DUWA 1ZNXA 4OHRA 4PSCA 2C8LA 5DSXA 3KWJA 4QAJA 3VPDA 4PNEA 5BMVB 2DU8A 3LVBA 5TC4A 3MWKA 4P9NA 3T5CA 5K0TA 3SVLA 2BEVB 1BX1A 3Q8WA 3CR3C 5CHEA 2G72A 3ZWBA 2O23A 4D45A 3TNFA 1E9FA 3T38A 1Y7TA 1TXGA 2NV2B 1NVVQ 4REOA 5K3SA 3FYHA 3C48A 4N0MA 4IV0A 1XO1A 1EI9A 5EVJA 5DGCA 2BP7B 3VJKA 3RT9A 4ESOA 2FOLA 5KNCH 1YU6A 3LJKA 1RWVA 2EDAA 4XKJA 4B31A 3AJ8A 1CFJA 4HS4A 3G9UA 1ZP6A 1DX6A 4QO8A 4DJAA 2QZZA 3R5XA 4CDNA 1VCMA 2H9IA 3H19A 1HL7A 1KYYA 2WTUA 4J0GA 3T4EA 5KYNA 1KEWA 1QHEA 3INNA 3KU4A 1K8YB 3I64A 4MS1B 4WXPA 3RSQA 3VR6A 1OC2A 1G17A 3N2IA 4TVBA 5F4ZA 3M5DA 3AETB 5ECYA 3L49A 5D6NA 3M6XA 2XBUA 5H59A 1DELA 4GE0A 4BXOB 4IL5A 5CLLA 4EBBA 1CE8B 1W1UA 4F0JA 1LC3A 3O1HB 2FSHA 3V6LA 5LYYA 1EDZA 1G21A 4CQMD 4IUYA 1NVWQ 4LJ8A 1Q3HA 1Z7WA 3EXIB 3IA7A 5K0GA 4KPUA 2IYEA 3GP5A 4C1NA 1L7AA 3PQDA 1LTKA 1Y1LA 4GNRA 4MRMA 2DPHA 5AK6A 1U1CA 4ZI2A 1NW7A 4D9HA 2JGIA 4G0VA 3DJYA 3BMOB 4QDTA 2NXWA 2Y9MB 4UPVA 4U4AA 3OC0A 1M5TA 3IP5A 5EJMA 2GH1A 1HX7A 3AR3A 3ZI0A 2GDJA 4GLOA 3VJRA 1VL1A 1BX3A 2G17A 2P68A 3JATB 1W4AA 2IXFA 1G20B 2ZE8A 1C14A 3LOPA 3IEKA 1AQLA 1R0WA 2QTZA 2W2LD 2A4MA 1XCBA 2FU5C 4EUFA 5JYDA 1L5KA 5AK3A 4H6XA 4M6WB 4M0EA 1BFDA 5J1SB 1R10A 3OEED 1A71A 2BRUA 3AI1A 1N5KA 3GELA 3MT9A 1JECA 1DJOA 3L8MA 421PA 3EZNA 2AR9A 4KIJA 2H07A 4TSRA 4IUDS 4EARA 1D6JA 3C7DB 3R3VA 2H5LA 4H4EA 3SICE 4YMLA 1TMYA 1JBEA 2IS6A 2GJAA 1P0IA 4DDVA 4KV9A 4DSAA 3IBTA 5E38A 1FLAA 3ICOA 1J0CA 3PI6A 4EY4A 5K6TA 2RK4A 3ILSA 3OQVA 4W1QA 3SLKA 3PHBE 1ZOPA 2OQVA 4JT9A 3I01M 3CUYA 1TAHA 2C4HA 2I7VA 4HNRA 5M29A 1QB7A 2EP7A 2NP6A 1M10A 1WW3A 2Q3BA 4JASB 3T06B 4D57A 4P53A 4YALA 3TTSA 1P6QA 3CZ9A 1Z28A 2W8ZA 6LDHA 1PUIA 2OV6A 1QJCA 2VZ0A 2XB9A 1OGIA 1P75A 3TX6A 3GT0A 5CNIA 1TCBA 4EEKA 5TY0A 3ZPXA 5CLHA 1FNDA 3VSEA 3CE6A 1U80A 4KJXA 3K1AA 4CKCA 1HUQA 1PX0A 2HMUA 2AC7A 1SOVA 4OHMA 1JFFA 4KOEC 4B09A 3GIWA 5JBQA 4LBVA 5AW0A 3GN1A 4CUKA 4ZV4A 3DVQX 4KX3A 1OLSB 1NU8A 4JT2A 3FPFA 2I5PO 2EF1A 4D0SA 4QUDA 3FPEA 1BMFA 1RS0A 4NAVA 1CEEA 4IQ0A 4Y9SA 4UM9D 1V4VA 4KNWA 4P3OA 1JG7A 1JMVA 3SMVA 4FHDA 1GUBA 2ZGVA 2BWJA 1XRQA 3J7TA 4GC9A 1IBMB 4ZO9A 1K6XA 4G1CA 1W4RA 5JLAA 4TL8A 4P38A 3EGOA 3GJXC 2P2GA 1YVDA 4BIMA 3AVXA 4HEHA 1Z0ZA 1QGDA 3FETA 4MPPA 4Y2VA 4X63A 4O2AA 2WR8A 1UT6A 1ZN9A 4WX2B 3I4FA 4D99A 2R1VA 4OXQA 3T1HB 4RH3A 1VPWA 2ZIAA 3KM0A 2CT8A 1U63A 3JQCA 3FBWA 1NVAA 4B4KA 3PEFA 1SXJD 2QL9A 5JCOA 1C8VB 1XG5A 2PR2A 3U44A 5KOHA 2PVPA 1Y7HA 3H04A 4S1TA 4TV8A 5D85A 5DGDA 1KO1A 3V4OA 4CF5A 4H35A 4H15A 1DIAA 2JIPA 4J0IA 3EGXB 5LQSA 1IJEA 2W7TA 1NI4B 2VS1A 2A3RA 3HO6A 1QHHA 3CNBA 5IVHA 2QZSA 3FG9A 1JDSA 4ML3A 5A4KA 1L5QA 3L4BC 4YMUA 1VHQA 3U31A 3H5TA 1XA0A 4FGSA 4DAOA 2DQYA 1ADGA 3ANYB 1NVFA 1FCJA 2ZPAA 4J4HA 3CVOA 4WZAE 5DKFA 2JLZA 3ICPA 4DE5A 1BOFA 1NW4A 3UMBA 2JRLA 1WZNA 2V0GA 3U4CA 3NHFA 3DCYA 4IIHA 1V5WA 1T9CA 4TUYA 3VZDA 1XYGA 3GOHA 4FLFA 1HYGA 2YHIA 2O50A 3CRNA 2B98A 3G2OA 2OHXA 4I6EA 1DBWA 5IJXA 2E3JA 1ODIA 1A7KA 2GDZA 3PDUA 1W75A 1Y1KE 1E1DA 3S8EA 2GO1A 2WTBA 2XNHA 1F1JA 3CCBA 4UCWA 5L3ZA 3HM9A 1QYIA 1ZI9A 2PJDA 3TMYA 1F8GA 2CV2A 2RGAA 3H4IA 4D9EA 4MS4A 5JSZB 4ENVA 1FFGA 3EGDA 3RRXA 3AR2A 2G40A 2JH8A 2MYTA 3D5EA 3M1LA