4L0CA

Crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
MKGYNVYANGIRQHIIHFPGTGSPLLLIPGITSPAVTWGFVAERLAKYFDVHVVDVRGRGLSESGDLDYSLDAMADDLVALAQRMEGVVVLGHAMGARIAIRAARKDSQVFSRLILVDPPVSGPGRRPYPAKWSWYAESIRLAQRGCTAMEMRSYCPTWTDEQIELRAEWLHTCQYTAVKTAFDGFHTDDIHTDLAQLTLPIQLVVAGGAEVIQPDDIAEIISLAPQTTTYVVEEAGHMIPWDNLEGFITAVSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deformylase
publication title Crystal structure of the N-Fopmylmaleamic acid deformylase Nfo from Pseudomonas putida S16
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 83
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0cA00
2Y2UA 5AHXA 1AC5A 1FFCA 5AK3A 2RHWA 3TJMA 5AO9A 4ETWA 4X85A 1K8QA 2JEYA 2EDCA 2QOEA 1USWA 2RIPA 5K3FB 4QA9A 4AZ3A 4BE9A 3ZV7A 4B0PA 2JGIA 3D59A 1R50A 3EQ9A 1KU0A 3ESCA 1E66A 1N1MA 3G7NA 1QGED 5ALXA 1QE3A 2RONA 2XMGA 2WIJA 4H77A 4FNMA 4Y9SA 3E4DA 3ZLTA 4WY8A 5HFAA 2Y1KA 2HRQA 3QITA 1MT3A 5A7FA 4Y2XA 2OAEA 2VAXA 1EI9A 2Z8XA 1ZI8A 4TVKA 5ALOA 4DNFA 2HA4A 5JANA 4U2EA 4Q3LA 1QTIA 2WLSA 3B3QA 2W6CX 3F9CA 2PSFA 5DYWA 4OU4A 1E5TA 1F0NA 2V96A 3AIOA 2XMSA 3FVTA 2Z3WA 1ORVA 4BC0A 4P9NA 4K6KA 3ZWQA 2B4KA 4BE4A 4OB8A 5AKIA 1SC9A 4GEGA 1IUPA 3NWOA 4U2CA 4TPKA 3AIKA 5FPPA 3STWA 4DYHA 1CUYA 4MEAA 3WA7A 1GKLA 4FHZA 2H1IA 5CXXA 4QLAA 4X6XA 2ORYA 1ZICA 4KRYA 1YA4A 3I6MA 5AKLA 3O4IA 3AILA 2Y6VA 3D7RA 1ACLA 4BDTA 4Y2RA 3G0CA 3WWDA 3WWEA 2WIFA 3IB3A 3EQ7A 4M0MA 1R1DA 5AI5A 5LZ8A 1E8DA 1SCIA 5AI6A 3TEJA 4UUQA 1CUJA 4Q1VA 2XDWA 1DX4A 1XLWA 5CT6A 1EK2A 2OGSA 4GBGA 3I2HA 3R3UA 3WKAA 1CUEA 1CUHA 1XZJA 2WTMA 5JD6A 4X95A 4LYDA 2PU5A 2C4HA 1W76A 1A8SA 3A70A 4MYSA 1Q83A 5HK8A 1L7AA 4AB1A 2XI4A 2EEPA 4OSEA 3KWFA 3EIOA 3DKKA 2VJBA 2X76A 5AK4A 4EHBA 1AMNA 4AN1A 3L1IA 4KJXA 2QXTA 4PV7A 2OGTA 4F5ZA 2ACKA 1LZLA 5C81A 5ALFA 2QT9A 2V98A 4UHDA 3QMWA 3ESBA 1FFDA 2O2GA 4ZV7A 4X3CA 5K3AA 1EH5A 3LP5A 4QDUA 3DYVA 5IH7A 4BP8A 3X3HA 2O2HA 2XQFA 4UBJA 5AK5A 3QM1A 3G8YA 3IULA 2OGZA 1CQZA 5AKKA 4ZGBA 3A2MA 1XZFA 3OM8A 2HRRA 5IVIA 3JWEA 1JU4A 2XMRA 3V1NA 3GUUA 3ICWA 2OCLA 5HQ3A 5J3JA 1VA4A 1G5FA 3O4JA 2ZYSA 5JAHA 1CEXA 2CJPA 1BCRA 1UK7A 2PX6A 2ZJ6A 1BS9A 4G8CA 4X00A 2HFKA 2PVSA 1LBSA 2GYVA 1BU8A 4E15A 1P0IA 2G5TA 2RHTA 4B84A 4TGLA 2XUFA 1MN6A 3YASA 2XUOA 2DFPA 4UHCA 4C01A 1DX6A 5CBKA 4M0FA 4H7DA 2CBGA 3H1AA 3FCXA 1YA8A 4FBMA 4NZZA 1M33A 4BTVA 5AP9A 4C87A 2AXEA 2WHRA 1EDBA 3R41A 2PUJA 3VDXA 1UK6A 2HU5A 1XLVA 5HF8A 2CUTA 2K2QB 1VE7A 3WK4A 5JIBA 1K6EA 1T4MA 4G1FA 1YS2X 1F8UA 5ALKA 1XZMA 4BCDA 2IX9A 1TIBA 3W05A 4WJLA 3WYNA 4EY6A 4N8SA 2I3ZA 1W75A 5A2GA 3RM3A 3HZOA 4YASA 1DT3A 5AM3A 3SK0A 4MJ3A 4HRXA 5IVDA 5HF6A 2ACEA 3WWPA 5F4ZA 2ZYHA 4FFWA 3SX4A 1CUBA 4J7AA 4G5XA 1ZD2P 5KWJA 1VZ3A 1DT5A 1B41A 4B83A 5CH3A 4BZZA 4AX4A 4HZGA 4XJVA 5HKAA 4AN0A 3WKCA 2PUHA 2QVBA 2PSJA 4CG3A 2GZSA 3FSGA 2VA9A 5JZSA 1PFQA 4X6UA 1CUZA 1TCCA 1YB7A 4H7IA 4A23A 3WJ1A 2GZRA 3IVMA 2ZSIA 3QPAA 5ALLA 4FWBA 1MPXA 4FBLA 5FKJA 3WKBA 3FWHA 5HCUA 5ALMA 5AI8A 4G4GA 5CMLA 4EY8A 4Y2PA 2ZYRA 1QO7A 1VOTA 3WK8A 4XIIA 2WHPA 3MUNA 4F0JA 3HEAA 1JFRA 5K5EA 5BWCA 1QTRA 4X7BA 1IVYA 1O6FA 2QUAA 3A2NA 4QLOA 1ZI6A 4NVRA 2R8BA 5DJ5A 3O0DA 3FYTA 5FRDA 1QIGA 3O4HA 1ORWA 1J1IA 1XZLA 1TKRA 1CR6A 5LZ5A 1EDDA 4G4JA 1GZ7A 4J0CA 3R3ZA 2HA5A 3E3AA 1HLGA 4CFSA 4W1PA 1ZGCA 2DR0A 3GROA 4MYDA 5AKXA 4J03A 5ALGA 1CUDA 1E8MA 1TK3A 2CMFA 2PU7A 1DWPA 5LYYA 2WUDA 4EZIA 4UBNA 4YK7A 1EB8A 2DHDA 5CT4A 3ZI7A 2DSNA 2YXPX 2RGUA 3LIPA 2I3DA 3QMVA 4UPDA 1CFJA 4MQMA 4UBLA 5I9IA 1QIJA 3D2BA 1XLUA 4CG1A 5AM4A 1U8EA 3ZLVA 3WLAA 4QZVA 1CUFA 3PFCA 1XQYA 5BWBA 5D6OA 2OXEA 5LKRA 2OQIA 5AM2A 3GELA 3WIOA 3STTA 5LZ2A 3C6YA 4BRZA 4ROTA 1E89A 2WJ3A 4X93A 2H9YA 4EUSA 3WK6A 4UBIA 3QMMA 5LZ4A 1UKAA 2PSHA 3V1KA 5JAOA 4F60A 4BVJA 4B6GA 1LGYA 4QNNA 4PSDA 1UZAA 5AOAA 5K3CA 1DWOA 4U2BA 2AJBA 5DYTA 5JAUA 1L7RA 4MXDA 1W52X 4DM7A 2QS9A 1A8UA 4HAIA 5JYCA 5T4FA 1ZI9A 4J0JA 3WKEA 4D9JA 5ALNA 4BZWA 2XMCA 1CUXA 1DU4A 4JYMA 3ESAA 4FFVA 1H2ZA 4DLNA 3IA2A 3C6ZA 3H2JA 2JF0A 3DS8A 1UOOA 1EINA 1ZD4A 1RWQA 2GYWA 3EBLA 3P2MA 3VISA 4UHHA 3V48A 4J0GA 4H7HA 4B9AA 2NW6A 4DTCA 3HACA 4I4CA 5AI0A 1I6WA 3A2LA 2HDWA 4JH0A 3G0DA 4OB6A 5CT5A 1CIJA 5SYNA 2C0QA 4S0XA 4Y2UA 5ALZA 1DQYA 2HU8A 4UBOA 2OPHA 2JGLA 2W22A 4QDZA 5ALYA 1Q0RA 2JEZA 1UK9A 1H2XA 4BRSA 2GBIA 3KDAA 1Q84A 5FP0A 5LIPA 3PE6A 4IQ4A 3K2IA 5HFNA 3O9MA 4HTAA 4X97A 4DNPA 3C6XA 4ZI5A 7YASA 2XQGA 3VKFA 4X92A 1CVLA 4QE3A 3HRHA 4W63A 2VT7A 4N5IX 4BB0A 5D3KA 1JKMA 3WZMA 3HI4A 4N8EA 4KEAA 3G0GA 2ZJFA 1WCYA 5ESRA 1FSSA 3HYSA 4BVKA 1CUUA 1R3DA 4WDQA 1EHYA 1QLWA 2FJPA 3KD2A 5K3FA 5KREA 3W2TA 5FPQA 3T52A 4KE9A 4N5HX 2HU7A 2XMDA 3BE8A 3BJRA 5HF5A 4AO6A 2HA2A 2QMQA 1LBTA 4E46A 3ZLUA 4CCYB 2WKWA 1T2NA 5EHQA 4Y2SA 5A7GA 5FUMA 1IUNA 5ALQA 4ZWNA 5AKJA 5AI9A 2WUGA 2XUGA 1XZBA 4ZREA 3VJKA 4DMFA 3AIMA 2BUBA 2WTNA 4QEKA 3GZJA 2QXUA 3IUJA 1CUSA 2QKYA 2G63A 1AUOA 4GXNA 4DIUA 3KWJA 3IUQA 1QIEA 1XRQA 4DMHA 2WUFA 3QZUA 1TCBA 3C5WP 4LXGA 2B9VA 2JIDA 3WQHA 4XVCA 1XRPA 1ETHA 3V9AA 3I28A 1P0PA 4Y2VA 5K3EA 4XWGA 4Y2YA 3HC7A 3PUIA 1GT6A 2GBFA 3NUZA 4CG2A 1MX5A 1MJ5A 1ODCA 3WKDA 1MNAA 2P8SA 4FTWA 5ALIA 4KAFA 4FKBA 3I2JA 2AJ8A 1E8NA 5E2IA 1R9NA 1LPBB 5CT8A 3HSSA 4DGQA 4KR0A 2Z8ZA 4C88A 4FLFA 5AIAA 4OD0A 4PW0A 1NU6A 1GQSA 4RE6A 1F6WA 2Y2VA 4I3FA 1GPNA 2PL5A 5ALTA 1GPLA 2OCGA 3C8HA 4K5QA 2ZSHA 1ZD5A 1JT2A 1VXRA 2J4CA 4HVTA 3H2GA 1OCEA 1O6GA 1CV2A 2WG1A 3ILSA 2GYUA 4BAUA 5I8PA 2R11A 4H35A 2PBLA 2JGJA 1THTA 2QUBA 2ROQA 3FSGD 3PICA 4EB0A 3HXKA 4ITVA 1A8QA 5A6VA 1BN6A 3WA6A 2XUKA 2UZ0A 3N0TA 4PNZA 4AMYA 4A5SA 3M82A 5IKXA 2VJDA 1ZIYA 1ODSA 1KEZA 1UOPA 2OCIA 4H7FA 2WHQA 4PSCA 4NMWA 1PV1A 3D4LA 3S2ZA 3PF9A 3F8SA 1ISPA 3R3VA 3LCRA 3VXKA 4Q34A 3DKRA 3QPDA 3B5EA 3PDCA 5EIHA 3KOOA 5IVKA 1KU6A 1XZKA 3FNBA 5E4TA 2E3JA 2QM0A 3PUHA 5JASA 3V1MA 1LPPA 5FOQA 5ALPA 2C0PA 1K63A 3R0VA 4IH1A 1MU0A 4Q05A 3G9XA 3C87A 4KYVA 4B85A 2WU4A 1VA5A 1AX9A 4XX1A 1CUVA 1JMYA 2HA0A 2HM7A 4CIAA 5I7UA 1FFEA 2IIVA 4UHEA 1G4HA 1ODTC 1YAJA 4BDSA 3UUEA 1U65A 4W9RA 5A62A 1XRMA 1GGVA 2WJ4A 4LHEA 1THGA 2ECFA 4HRYA 1IZ8A 3AZOA 1P0QA 1R4ZA 3DOHA 1XQWA 2CEKA 4WFKA 2D0DA 4ZV9A 2DQYA 3IURA 4UFNA 2XUAA 2X8BA 2JGMA 3WL8A 5T4HA 5EHXA 1QIIA 5EHZA 5BV7A 5JZBA 3HABA 1J2EA 1SCKA 5AKZA 1IMJA 1MAHA 1DINA 2OAGA 3IDAA 1GKKA 4BBZA 1E3QA 4GECA 3GA7A 4L9AA 4W1QA 1JJIA 4WDRA 1R9MA 3W06A 1YASA 3AJAA 4G8DA 1D07A 5JADA 1BROA 1C4XA 2AJCA 1K5PA 2O7RA 2C58A 1EB9A 1QIHA 5DYYA 3DL4A 4HXEB 2XMQA 2CZQA 2WUEA 3OURA 4QWWA 3O95A 2XB6A 5C7YA 3JW8A 2HA6A 3RK4A 3UUFA 1GXSA 4KAAA 5AJHA 1H2WA 2Q0XA 2QJWA 4QDOA 3IUMA 2WM2A 3T4UA 4RE5A 1TCAA 1EX9A 1VJ5A 4AMZA 3FYUB 2HIHA 5EHNA 3WI7A 1H22A 3B12A 3E1GA 5CW2A 3UMJA 4MWSA 1ZOIA 1LPNA 5C8XA 1WB6A 3BJMA 4JEIA 3R3YA 1BN7A 2CB9A 2DHEA 1XZIA 1EDEA 2WFZA 3DL7A 3DOIA 4PF1A 3H04A 5KBYA 1YCDA 1ZIXA 1TQHA 3HJUA 2GBCA 3OTQA 3ANSA 4N8DA 2HFJA 2CKMA 3H17A 1X2EA 5CH8A 1LPAB 1VE6A 4G9GA 3LS2A 1IZ7A 3M3DA 1XZCA 1QFMA 3BDIA 3DNMA 3VJMA 3NOXA 3DD5A 3H18A 3DDUA 4H7JA 3JYHA 4B82A 3BF8A 2OG1A 3PI6A 4H18A 4GDMA 2BKLA 5CH5A 4EA6A 1CUIA 5HF9A 3SWWA 4K6HA 3WL6A 1PJAA 1LPSA 4J0DA 5AKGA 4H7EA 4NS4A 2I78A 2G5PA 1VKHA 1J07A 2Z5GA 2WILA 4C4XA 4ARBA 3U0VA 2VATA 3H2IA 4X6YA 4KAJA 3OPMA 4AXBA 2PSEA 3NGMA 3V1LA 1TRHA 4FLMA 1HDEA 1S8OA 1P0MA 5FV4A 1B6GA 3O9VA 1J06A 2XQKA 3FCYA 4BAGA 4H7KA 3SC2A 2ZYIA 1F0PA 1XRRA 3G9ZA 4BP9A 2D5LA 1SOMA 1CUAA 3TGLA 2C5FA 1NX9A 4RGYA 4KE8A 3FLEA 1FJ2A 1FFBA 2BFNA 4RPCA 2EDAA 4FLEA 1QOZA 2VAVA 1Y7IA 1SCQA 3WL7A 4F21A 2BUCA 5ALSA 2WFLB 5T4BA 1BE0A 3RLIA 2WSLA 3I2GA 5HKBA 1EXWA 4AZ0A 3M81A 1XROA 4Q3KA 5AOBA 4MQLA 5EIAA 1LNSA 3FAKA 3BL8A 5K3DA 1QONA 5LLSA 4GHWA 3DJYA 1TAHA 4BATA 1XQXA 2PPLA 1CPYA 4QWMA 3DYIA 4ARAA 3M83A 4KACA 3QYJA 1MTZA 2XE4A 4O08A 4B80A 3R3XA 2VSQA 2B61A 4OYLA 3MGAA 3QPCA 1WHTA 2ES4A 1QIKA 2H7YA 2QR5A 5DLPA 2BJHA 1BRTA 5LZ9A 2V97A 4DSZA 2WIKA 3HLKA 2DHCA 4UFOA 5SYMA 4KE7A 3VVMA 2WFLA 1HL7A 1YR2A 4I19A 4LXIA 1HKHA 2H7CA 4C4YA 6YASA 2XT0A 4JYPA 3OG9A 5CXUA 4DMCA 4WFJA 4HXFB 2XUQA 3G9UA 1XKLA 5CT9A 4CIBA 1CRLA 4X91A 1CLEA 2YH2A 3WWOA 4EY5A 3F96A 1Z68A 4UBMA 3OOSA 4M0EA 5DTJA 1QIDA 2DCMA 1XZAA 3W04A 3QVMA 4DMKA 1MAAA 4GWLA 4U2GA 3VVLA 3I2FA 1AQLA 4FDMA 1AKNA 3F67A 2RI6A 2BAGA 1RP1A 5BOVA 5DNWA 3ANTA 3I1YA 4L72A 5IVHA 4PQEA 2XQIA 5LKAA 3D2AA 1EA5A 2WIDA 3FLBA 1XZDA 5AM0A 3D0KA 5K3BA 1ACJA 4L3WA 4C4ZA 3I2KA 4E11A 1YB6A 1CUCA 2O2IA 1X2BA 2YASA 4JNCA 2JBWA 1LPMA 1UOQA 3IIIA 2YYSA 3H0CA 3BWXA 5C8VA 4L0CA 2AJLI 2C5GA 1YAHA 2ONCA 1XFDA 5JATA 2WG2A 3H2KA 3L1HA 5DWDA 1Y7HA 2WJ6A 1LPOA 4YX9A 3BIWA 3F98A 2IITA 3U1TA 4KE6A 3L1JA 1QO9A 1SFRA 4K2AA 5FXMA 1A7UA 5ALJA 4EBBA 4H0CA 2WU3A 1ZGBA 2BCEA 3CXUA 2OQVA 4W1SA 4MEBA 4C89A 4CCYA 4OYYA 4Y7DA 1UXOA 1JMKC 2RAUA 5HQ3B 1UKBA 1WB4A 1IUOA 1N8SA 2XMZA 3STUA 5LZ7A 2XUIA 5EFZA 3R40A 3LIIA 3AZQA 3C5VA 2O7VA 3EQ8A 3I6ZA 2WFMA 4J0HA 1QFSA 1LLFA 5KWIA 3BXPA 2FX5A 2X5XA 2VQ6A 3QH4A 5CRIA 4J0KA 5DNUA 1GQRA 2GBGA 4BTLA 4UHBA 1UK8A 3STXA 4E14A 4EY7A 3ICVA 4OB7A 2Z3ZA 1ZJ5A 4INZA 3A6ZA 3WK7A 4IO0A 3WK5A 4IHAA 1UWCA 4P93A 2VTVA 2XLCA 1WHSA 5E4JA 1OILA 2HA7A 5ALHA 3CCBA 1XZGA 3GBSA 3H19A 5DTIA 1C7IA 3K6KA 1L7QA 4BYMA 2V9ZA 4AO7A 3AUKA 5EI5A 1EVQA 2HL6A 4P08A 3WK9A 1HPLA 3I2IA 2XUHA 5DNVA 4DNOA 1YS1X 4DSAA 5JARA 5AKEA 3WZLA 4OPMA 1ZD3A 3FLAA 1FFAA 2XQJA 1XRLA 1UFOA 1OXMA 5D3ZA 5EIEA 3FOBA 2WQZA 3STYA 3AINA 1JU3A 2JGEA 1VZ2A 3BIXA 4IH4A 1RYYA 2XUJA 4FNGA 3WMRA 3BDVA 1WPRA 4GLBA 5A71A 5LP1A 2XMBA 4X94A 5A7HA 2QTBA 3STVA 1MX1A 4G9EA 1Q0ZA 4IH9A 4U2FA 1WB5A 4Q3OA 3FBWA 4U2DA 2VF2A 4BVLA 3N2ZB 2PKYX 4EY4A 1HQDA 3DCNA 4V2IA 1YSCA 5AM5A 4OU5A 1H23A 2WG0A 5AICA 3E0XA 4Y2JA 3DEAA 5HZGA 3H1BA 2FUKA 1UKCA 4P92A 2Y6UA 4LKOA 5JALA 3DLTA 1BCSA 5JZ9A 3O4GA 2PM8A 3CN7A 4J0IA 1EK1A 4ZXFA 2LIPA 2FJ0A 5AIBA 5D7BA 1X70A 4C6HA 2HADA 3WJ2A 2B20A 3F97A 1U2EA 2HHAA 1WOMA 4AQDA 3WWCA 1XRNA 3ESDA 1MNQA 2VJAA 3C45A 3IUNA 4QDTA 4HS9A 1ZJ4A 5JD5A 5JD4A 5EGNA 3D5EA 2WHPB 4LXHA 4OUKX 1A88A 1H2YA 2OCKA 3AFIA 3Q8WA 1N5RA 1JI3A 4W1RA 1U4NA 3QBJA 4PSUA 4X90A 1BEZA 4FMPA 5AOCA 1WM1A 3CCCA 5JAPA 3G0BA 5ISMA 2BGNA 1UT6A 3G9TA 4Y2TA 3ZPXA 4GI1A 4B7ZA 4A16A 4Z49A 5FDFA 3W9BA 3KSRA 4LIPD 2WIGA 1W6RA 3Q0TA 3OC0A 4ZRDA 4UBKA 3LLCA 4QDXA 5AH0A 4BCCA 3S8YA 1MX9A 5ALVA 2BGRA 1G42A 4B0OA 4X71A 4GW3A 1XKTA 4LYEA 4G4IA 5T4EA 4WFIA 1HBJA 1VLQA 2JGFA 2OLEA 4K6GA 4Y2QA 1CQWA 5AKYA 4MWTA 2VJCA 1JJBA 4OCZA 5CURA 1DWQA 1XZEA 5AKHA 1G66A 5AI4A 2DQZA 2XUPA 4BCBA 5ALRA 3IBTA 3PFBA 3PF8A 4Q82A 4CCWA 4WY5A 3DQZA 3WIBA 2QZPA 4UFPA 1C7JA 3C6BA 2BUAA 5ALWA 3FYUA 3R3WA 1R88A 3FVRA 4WCVA 3D2CA 4CI9A 1AURA 3K9BA 1K4YA 1NU8A 1W4LA 3KXPA 1QZ3A 1DTEA 5H3HA 1QIFA 3I6YA 4UHFA 5CTAA 4DNQA 1CUWA 2ZVDA 2H7XA 1GPKA 1BEEA 3C70A 1DQZA 2PSDA 3ED1A 4B81A 3FYUC 4RNCA 1LZKA 3H2HA 1WPXA 1N5MA 1W1IA 1XQVA 3TRDA 2XUDA 3I1IA 4JUIA 2I03A 2HA3A 3WYDA 4FOLA 2J3DA 5C8ZA 3BF7A 1JJFA 3WL5A 2QJRA 4BAZA 2J4FA 2XLBA 1XZHA 3CN9A 2AJDA 5FLKA 3GFFA 3AZPA 1Y37A 4YPVA 3D3NA 3EF3A 3W9UA 3RKSA 4B9EA 4HXGA 2VEOA 3C43A 2ZJ7A 5ALDA 5AM1A 1QJ4A 5ALUA 1AZWA 5ALEA 2QRUA 2G4LA 4G8BA 2C7BA 4AO8A 3VJLA 4BC1A 5AK6A 1AGYA 3G0IA 3MVEA 4KRXA 5E4YA 2JGKA 2VT6A 4PO3X 1VXOA 1CUGA 1EVEA 2J3QA 4J3JA 5HK9A 3RARA 1MO2A 1QIMA 3G02A 3C8DA 3MUOA 5YASA
chains in the Genus database with same CATH superfamily
1HSOA 2GFIA 2O2SA 1UMBA 4K86A 4ZHQA 2CSXA 2PVCA 5KTRA 1T0HB 5A0VA 1JR3D 1WVMA 2XB4A 4GX2A 1S6YA 3B38A 3Q5GA 3QBVA 4QBFA 3EEOA 3D3KA 4IM7A 2K6GA 2YWCA 3AEUA 3EGDA 2EDCA 4MPJA 3QWIA 4Z1MD 1UM9A 3LCJA 2PBRA 4MDEA 5BV1A 1U7WA 4CQMA 5FBRB 4FYMA 8MHTA 1DO8A 5K3FB 1YDEA 2H57A 1JQBA 3F3YA 4BE9A 2Q0SA 5GTDA 1I51A 1GADO 4TTJA 1BDJA 1MFPA 2Q5LA 2XNDD 3M9WA 3OMLA 3TXYA 4A2QA 1ONNA 1ULTA 1X1BA 2QI9F 2V7EA 4YJ2B 3D59A 3PX2A 5FWDA 5EJEA 3CZ4A 3PSAA 3UWOA 3JQ8B 1FBNA 3IQXA 4DIEA 7ABPA 1AKVA 5KYXB 2W83A 2C96A 1D4OA 3GLQA 3ZXYA 4F86A 5JQGA 3CSSA 3N9IA 1FZTA 1EDZA 4O0MA 3SC6A 5EE3A 1QGED 3VZPA 2WSSD 5DHSA 5ALXA 1K68A 1KR5A 3WGKA 5B4TA 5L3QB 1DO0A 2H4FA 2IYOA 4ZAWA 4DIUA 4MVJF 2ZQZA 4GLJA 4RLHA 4LYGA 2AOTA 5EWLB 1E64A 1I80A 1T2AA 1TCVA 2IW1A 4D4LA 2D8MA 1CCWA 1UBTS 4ZT5A 5NLLA 3TVDA 1VLLA 1ULSA 2QMHA 3IXMA 1QG6A 2O4CA 3IDFA 1MVOA 2V4UA 2Y1KA 3O94A 1HOTA 1MEJA 2F8TA 3E84A 5KQLA 2XADA 3AVVA 1YVUA 2W4IA 3KT0A 2QT0A 3AF2A 4NIMA 2Z8XA 5F73A 4I5IA 3WGLA 2QAGB 1NA5A 2RC6A 1CY6A 1YMUA 1ZI8A 3I9V1 2JI7A 4MUJA 4K1LA 4OL9A 4WESB 2AQIA 3H4IA 3UMGA 1TVCA 4NH0A 6ABPA 1QTIA 3B3QA 4DLWA 1TM3E 1AV7A 1CQIA 1H5QA 1E7SA 2V58A 3AG5A 5J1SB 1SHUX 1G7SA 3R7FA 1SCUB 4IVQA 4I55A 3SM3A 1R0LA 1HH4A 2BD0A 4LOKA 3TRHA 4L8WB 1DEAA 1VYUA 3NAZA 1T29A 1R3UA 4CDGA 1ZZEA 1RZVA 2AD1A 2J46A 1F4LA 5LQMA 1ZCFA 3IP1A 3M70A 4GD3Q 1F0NA 1Z37A 2V96A 3TLEA 4TVBA 2XMSA 4B3HA 3ND8A 2ZSAA 1GTG1 4GAEA 3TL2A 1ORVA 1L5HB 4FFLA 13PKA 4LNHA 3MLEA 1XJ0A 5GZ1A 2QMZA 4K6KA 2PZBA 4D3YA 1SUSA 2B4KA 4YCDA 3D7SA 4L85A 4QRDA 2BELA 1M2NA 1S2IA 2AI3A 2GKGA 3TMAA 1GTMA 4LZZA 2OZVA 3WLFA 4X1YB 4D0GA 5B2FA 5FTLA 1IUKA 3OLXA 3PDWA 1PUIA 1Z8NA 3FKSA 1ZW1A 1IUPA 1K06A 4MVJG 3TD6A 4AMUA 3V2UA 1JU9A 4O2LA 3UXEA 2ID9A 4XXHA 1Z06A 4NCJA 3ZOKA 2XZOA 4U2CA 4ZDKA 3R0XA 4TPKA 3UJPA 5BQPA 3FI0A 4CEIB 4BKQA 3W2HA 1UEJA 3AKYA 3L6CA 2ZE7A 5FPPA 4NV1A 4JENA 3WFJA 3QY0A 2I91A 1P31A 4OOEA 2H1IA 1F38A 2MYPA 3B85A 2A94A 5CIWA 4JI3B 1YQGA 3ZJTA 3NVKI 2JJ8A 2QTLA 1AUQA 4X6XA 1DKNA 2WY2D 1PCXA 2PYIA 2QBYA 4ON9A 1C80A 1E6WA 4KRYA 1RZRD 3IOYA 3PHJA 4U7PB 4UZFA 3G5LA 3I01A 5L3RA 2UVPA 3D7RA 2O5RA 2YRWA 4HX2A 5HIIA 2AC7A 2QSUA 5DB4A 5TV2A 4EQZA 2VDLB 3F6SA 1NW8A 3VNAA 2P4HX 4B3MB 2NOAA 2OVBA 4E31A 2Q2WA 4Y2RA 5T41A 1UANA 3MAJA 2CVZA 4N5NA 3VC2A 4C05A 4JGGA 3WWEA 4XDGA 4YUZA 4YRCA 2WWYA 1M74A 1OSNA 3R5SA 5EKXA 2WIFA 2SKEA 3V4VB 4W5RA 4M1TA 3EQ7A 1R5JA 1TFRA 4M0MA 3E53A 4U0KA 2EJBA 1FSFA 2HBQA 3BJEA 2B1JA 4MUIA 1E8DA 1M8KA 4O4JA 4P82A 4RFLA 5LZ8A 4B46A 2ORWA 1UBOS 5HKOA 2Q3EA 1S3SA 3IYLW 1NVVQ 1PLJA 1RPZA 1NHGA 2OBYA 3FVWA 3VPSA 4ERNA 1IG3A 1P72A 2RJNA 1DX4A 2YUIA 3BL6A 3DHVA 4GFDA 4I0WB 2QVXX 4WE3A 3T1NA 3VR5H 5KSZA 3PJFA 3RHSA 5I9LA 5BXQC 2H1LA 1CUEA 1U2SA 5SZKB 3ZXUB 2FN4A 1EUCB 2WTMA 1M76A 3MK31 4CUZA 4FI3F 2ISCA 3KYBA 4U7WA 3EWAA 1KWKA 2RGAA 1DGQA 2HUPA 2PTHA 2VPTA 4QPPA 3RYHB 3GT7A 5LQRA 3LWBA 3QQPA 2ILTA 1N5KA 1MO4A 4Z4HA 2FF5A 4L15A 2Q8QA 2GN9A 3E58A 1A8SA 3A70A 1IWBB 2YWHA 1Q83A 1FDIA 1KXJA 3ZY4A 1VRCA 2JAQA 3IELA 4NJMA 1H2AS 1L7AA 3TTYA 4JP3A 1BKSB 1E79D 1ES9A 1NATA 2GN6A 3B6KA 3NC0C 4K9QA 5CITA 5EZSA 2XI4A 4IF4A 1J0BA 3EK2A 1Y81A 4IIVA 4IV0A 2DQKA 2NM0A 2PX5A 2X76A 5AK4A 5IJZA 4XOUA 4R8MA 1HT0A 1JYEA 3HBLA 3ISVA 4U0JA 5LQDA 2GWHA 3AF3A 2QDKA 4FGLA 4NBVA 3UKDA 1XQ1A 2DUNA 4WBXC 1D9XA 2Q4EA 1FOEB 1K4MA 1C7ZA 4O59O 4NKRA 2D1TA 4XVRA 4LJ9A 3U44B 1RSZA 4BV2A 5KU7A 2V98A 1HTTA 4K9MA 1K3TA 4KU4A 3FCAA 3SXPA 2JZCA 3QMWA 4AKEA 3BH0A 4DR3B 3L0SA 2XDQB 4FIZA 1U4SA 2WC1A 2YMMA 1DKLA 4L27A 1GSIA 1BNCA 4C78A 1ONPA 4X3CA 3PDHA 3C1AA 4H6PA 4QOHA 2FSIA 4BO0A 3TQCA 3BVPA 2ECPA 4RA9B 3FUTA 2VPPA 1VB5A 3FSRA 4L5CA 2CSUA 3L4KA 4V1CA 3I72A 3SHWA 2V7TA 5ADWA 1C0LA 3QQ5A 2G4CA 1YACA 2MDTA 2ZR0A 1OZHA 1WW3A 2O2ZA 1PAUA 1SVKA 1JFFA 1TIKA 3A4TA 3LVBA 1I7NA 3OZFA 4XGNA 1XEWX 5JNWA 3G8YA 3UFBA 2B2CA 1KZYC 4EG6A 2XZDA 3QW4B 3HXOA 3QVOA 5JRJA 3FCEA 3I2YX 1IN7A 3L6UA 2WP0A 3NZEA 4KK4A 4M8SA 1Y4SA 4PLGA 4BS9A 4Z0TA 1XZFA 2P27A 2HRRA 3NFRA 4R3UC 4CBVA 3K32A 3KKQA 4IQGA 2CFTA 3SVZA 3VR6H 1Z13A 3TOVA 3GUUA 1SNYA 1ZM4A 3IDQA 3KOWA 1RP7A 1SBNE 2FPOA 4P80A 4YDHB 2H2WA 5DW3A 5CDTA 1USGA 3VU3A 5G0WA 2ZI6A 3TAUA 1VA4A 3JQ7B 1SKUA 3CLSC 5T64A 4CEJB 1D8TA 4L3OA 1UBNA 2PZKA 4HN4B 1BCRA 3UMCA 2AFHE 1E2MA 1PLLA 1FYXA 1XTUA 5AVXA 4KWTA 2FU5C 3HUFA 3FNHA 4RNDB 1LI5A 1X38A 3LNTA 3OTHA 4IKPA 4ZVVA 4HQLA 1T5HX 5B1HA 5J9FA 3SF0A 4BQQA 1VHWA 1IWPB 4X00A 3TL6A 3ESXA 1ESDA 2BI7A 1N9GA 2PVSA 2QTMA 5DLQC 5IDXA 4EMTA 5A0TA 2GYVA 3U60B 2F1OA 3LC2O 1H1LA 5G0TA 1TLTA 4DV6B 1AB6A 2W6ID 1Q20A 1UQRA 1VIYA 1U7DA 2FK7A 3C16C 3VOAA 4DZRA 3IV6A 5IRCD 3M6MD 3KVYA 2XSZD 3FBTA 4X54A 4ZVQA 2RHTA 3HYTA 4TGLA 1GRNA 5DU2A 5AXAA 4NXMB 1SBYA 3COJA 3BJZA 2CCKA 3V34A 2YHAA 5AQEA 3TJRA 4E7PA 4P35A 1EFLA 1L4GA 2GEUA 2ZIUB 3CKLA 1EU1A 1P81A 3QU2A 2BGLA 4KV7A 4O4IA 4YN3A 5J2TB 1TMOA 4RK1A 4I50A 3I4CA 3DDOA 3DWFA 5FI1B 2PR7A 4H7DA 1FXWF 1WTCA 4Y3UA 1PYOA 5BW6B 3LCCA 4NBUA 2AE1A 2OLJA 2W6PA 2CXNA 3FCXA 1WMFA 4BBJA 2W6OA 2WLTA 3G1TA 3R76A 3IMCA 1V95A 221PA 1K1EA 3GGGA 2GPTA 1M8FA 4FONA 4IY1A 4NZZA 4YJHB 1XD9A 2YHUA 4GYKA 3ZR4B 4Q4JA 4OUDA 3ELYA 4FZJA 4TKLA 3JQPA 1VBFA 4ZKDA 2AXEA 2RKBA 4US0R 5EINA 3SMVA 1EDBA 2DTDA 1EWRA 3OX4A 4PX5A 5BURA 4F91B 3ISTA 5IKEA 2PUJA 4CW7A 3ENNA 1BKYA 1IM8A 2QROA 4MA5A 3VUFA 4C1NA 1CVIA 2G25A 5LDDC 2B2NA 2Y0BA 3F3SA 3NBUA 4UOEA 4NBKA 1PZEA 1UBEA 2K2QB 3U5ZB 1X74A 4D3XA 5MFZA 4P31A 1DZIA 1JHRA 3OJ0A 2P3SA 3ORQA 1KI6A 4ZHSA 1CIVA 1ST3A 2ZUDA 4G1FA 5G1NA 1F8UA 2NO7A 1EP3B 1GKYA 2RHOA 1KTVA 2ZI9A 3EZ6A 3F9IA 1XZMA 5AJWA 4RGBA 1WMSA 5FHQA 4F96A 3C3PA 1CS0B 4RCZA 3HN7A 2IX9A 3SBDA 1ZO8A 3MPOA 4ZAYA 4RFVA 4YQZA 3EYAA 1DJMA 3HNRA 3SNKA 3SHVA 4QXRA 3NU1A 5FBWB 3C3AA 4EDFA 3LF1A 4Q9LA 1P18A 4M54A 2PIAA 4QIHA 4FEGA 4M8IA 4OJYA 4QFCA 3FDFA 3P94A 1X7GA 1I36A 3WHIA 3RM3A 2BTEA 1MGPA 2GTIA 1WZUA 4H7PA 4HO1X 4UVEA 3UAYA 1R74A 1T9GR 1Z36A 1MORA 5AM3A 1LBEA 2JAHA 3U7EB 1KE1A 1JEYA 5LA6A 1RM4A 3ZYCA 1D2AA 3HY3A 2MCFA 3SK0A 4HRXA 3UOWA 2IYNA 2XVAA 1I1QB 4NG4A 2QSJA 5HKLA 3JVUA 1U8CB 2JJMA 1JWBB 2Q5FA 2FV8A 3NAQA 4H4DA 4QNMA 3LT2A 1MQ8B 5HIMA 4BV9A 4DYVA 5HF6A 4F5EA 5CCXA 2J33A 5F4ZA 5CB4A 5EA2A 1RHQA 1UL1X 2TRSB 1SVIA 3IEKA 4OP2A 3CH6A 2PUEA 4BVHA 1BO6A 2FPMA 3V3TA 2YV1A 1PSWA 1KYTA 3Q6NA 1I3CA 4G26A 1II8B 2BEVB 5KHAA 5I51A 2ZBRA 5B12A 1U3DA 2BFFA 2FFAA 3HG7A 1H5NA 2ZR9A 2R00A 2PJRA 5JMPA 5IT9A 1P1CA 1XEAA 2I34A 4FDLA 1VZ3A 3ENZA 4CMHA 1K7FB 4Z4FA 3EDYA 1DT5A 4J43A 1J42A 4RESA 3M5CA 5GZ6A 3V2GA 1I4TD 1HXHA 2O3SA 2GGSA 2H2DA 3BN3A 2Z04A 4MVWA 2EL7A 1OZAA 5CLGA 5ARCA 2RB5A 2CYBA 2Q99A 4HZGA 3H3FA 1EWTA 1U28A 3MF4A 3Q9LA 4G8JA 4LUCA 4PHCA 3W2EA 2DFTA 2JIRA 3DHNA 1WQ4A 4IDAA 2H4YA 4M1SA 3WIVA 3GRFA 4PX9A 3VVBA 2PUHA 2BN4A 1G6OA 2QVBA 4WTOA 3EX7C 3LXUX 1TM1E 2GR9A 3NRBA 5GMOA 4BWGA 5LFAA 2ZB2A 1WSWA 1XWIA 2MSNA 2VA9A 3T3HA 5EJMA 4EKIA 5FWNA 1ENZA 1J8QA 2IDKA 4F6LA 1A8PA 4HEJA 1A71A 4LDJA 1DCMA 3UHAA 3Q1LA 1DJNA 1GO2A 1NMZA 4B87A 4DDVA 4BV3A 1CUZA 3A26A 3BD7A 3RO7A 5BMVB 5HRUA 4DV4B 2CF5A 3CX3A 4RQUA 5H70A 3AEQB 2B3TA 2VYCA 3KSMA 1SKYE 1Y80A 2OGWA 4K1XA 4XAQA 4ANFA 1YHYA 5E3HA 4EW1A 4YXFA 1Y3DE 4LZPA 5BT8A 2GZRA 2CB0A 1KR2A 3N2IA 4WA8A 1KSHA 3MT9A 4V0LA 3EDOA 2CLHB 5FHRA 3S99A 3IKMB 4RVOA 2A9QA 2EP5A 5F2KA 3OVMA 1T4BA 4ZRMA 1AT1A 4URXR 4I08A 4V03A 5FTKA 2G09A 1MJNA 2VDQB 2X3FA 2A1IA 3Q12A 1YIOA 2O8VA 4OY3A 3BHMA 4PAWA 3WKBA 5IZCA 5KYTA 1GA1A 3PQ4A 5HCUA 2OZLB 5ALMA 5KNBD 2A67A 1RI4A 4CCAA 2R60A 3QFFA 2PMCA 3THYB 1E6UA 2BKEA 5GADl 1Y5IA 4LDNA 1W5TA 1G20B 1ISIA 3GPIA 2H3HA 4PINA 4RX1A 4YLGA 1ZINA 3DVAB 5DM4A 3ENWA 1XTBA 3QNUA 1JEEA 2IY8A 3B1WA 4TT3A 1VKOA 2BGJA 2WHPA 4XWWA 1NVGA 2CXUA 4WL0A 4U2KA 1L9XA 3MUNA 1YB1A 4Y6LA 3ZVRA 4F0JA 5K6AC 1YTUA 1ORIA 4A8JA 4DWOA 2XB9A 3BE4A 4OGLA 5K5EA 5BWCA 5DGCA 1XNQB 1X3LA 4EZBA 2WTBA 1G5PA 3P2EA 4JC8A 5ER9A 4DC0A 3MFYA 3MELA 3X1JA 4K2HA 3T5BA 4H16A 3OU7A 4XQGA 3A2NA 3HKBB 1KH2A 1NNUA 2ESRA 3COPA 1B26A 2YWJA 3S1SA 2IYSA 4KIWA 2HWUA 5CVDA 4DXDA 1HLDA 3W78A 5BSWA 3KZKA 1EJ6A 1Z6YA 1YC5A 5BWOA 4B73A 3BTUA 1RBZA 1XZLA 1TKRA 4QAJA 3EVFA 4WLNA 1ZU5A 1NMXA 2AX3A 1KEEB 3ASYA 3FZEA 1B42A 1UJNA 1GZ7A 5C80A 3D7MA 2IDZA 3FPHA 2E4YA 3PFFA 3E3AA 4BWVA 5FWXB 3DMRA 3FWPA 2ZUFA 4C7XA 4MR8A 5F2NA 2MR5A 4G2TA 3EFOA 1FDUA 3QJYA 5KJFA 2FW9A 5IBCA 3QEMA 1PR9A 3UZUA 5K8TA 3D43A 4KW7A 1TGYA 1TLFA 2GVZC 2VH2A 3GROA 4QGFA 1CZOA 2OCYC 1Q1NA 1LJLA 4J03A 2E0IA 2BW0A 2IVZA 4R2MA 3DMTC 4J3NA 2NSDA 5DN6A 3WXBA 4MVXA 3WHKA 1CF4A 4J7CA 8OHMA 2DHQA 3GFGA 2WK1A 2EFEB 3M6AA 3OU6A 4K9RA 5EPUA 5JFGA 2AKEA 3VR4A 2B1IA 5CVJA 1JL3A 2WUDA 1HDZA 2FGJA 5T3UA 3ORRA 1EWVA 1WSBA 2C95A 4L16A 5EP4A 2D8AA 2IELA 2W8ZA 3OWHA 4ICIA 2FVYA 3BG5A 1H65A 1JXQA 2IX3A 1SXPA 3VVCA 2DG2A 3G6KA 4LZJA 1NXOA 2G70A 4E70A 2WQ7A 2IEAA 2B1GA 1T9KA 4YPOA 2NQ8A 1NMQA 4P7GA 4W5TA 2FG6C 1SKQA 4DV0B 3SFVA 4ZOQI 4PY2A 2RGUA 3A3YA 1JT9A 3QE0A 3Q11A 1Q6YA 4LG1A 3R75A 3TNDA 5I5EA 4C5CA 2BM9A 1P8AA 2ANBA 4HFRA 4AZ0B 4ND6A 3CZ5A 3HYCA 3U3DA 3PVZA 2P9GA 2K4MA 2VDPB 4KQ6A 3BFXA 1M2VA 1NQ5A 6NULA 4FMBB 1FPQA 1XL1A 3D2BA 4Z0HO 1FDWA 3SIPA 1B4DA 1E7RA 1TYBE 1IN5A 4YJDA 2YV4A 3F6BX 3AV0B 5AM4A 4G5OA 2ENWA 4TMVA 5ESDA 4Q12A 8AT1A 1W9HA 4NEHB 5FFNA 3GJ5A 3RVDA 4CKWB 1P2VA 1T6XA 3WLAA 3PQDA 3TBKA 5IP5A 1CE8A 2ZR8A 2GERA 4LGCA 4AXXA 4YXWA 3GVIA 1LU9A 3A8TA 3RRYA 3ZGXA 2EFJA 3JYLA 4INOA 4K6MA 3K70D 3H99A 5G4KB 3IR7A 3VR1A 5DHRA 3GELA 3HR7A 4GGMX 3ZY3A 4JYZA 2D6FA 2YNMD 4ZJUA 1N2CA 3W8NA 5JWRA 1TVEA 2A92A 3K0SA 2GA9A 1G8KA 1V5GA 4QGHA 4EY3A 2MHCA 2VPIA 3CR3C 2PWAA 3N0RA 1A4XA 2NV2B 5FADA 5BN4B 5DYNA 5TQ0A 4MQ4A 4C7OA 2YZ7A 3R0ZA 4GXQA 2BEUA 5DBOA 2FPUA 1WHTB 1P2SA 1P5HA 1NVVR 3CZPA 3GFBA 3L7CA 3PWZA 4WZBB 5CPFA 5EZYA 5LZ4A 3QVGA 1J25A 3FIJA 3V1KA 3M89A 1TUBB 2NQ2C 3HB4X 4NOJA 4BVJA 1EX7A 2EYUA 1TT7A 3NAMA 4PE5B 3A1NA 5DTQA 3ID6C 3BBLA 1JHQA 1LGYA 2F3TA 1J0EA 4M7RA 4QNNA 2C4UA 2OM6A 3D64A 4C0WA 4PSDA 5BY2A 3KZOA 1H3NA 2IEBA 4AMGA 1U3WA 3O1JC 5E38A 3OQ6A 4BLVA 3T7AA 3PR3A 1O9BA 3ZU2A 1P75A 2VDNB 3MGBA 2AJBA 3QG5A 4R9SA 4F4JA 1QPBA 1N8KA 3USCS 1G55A 4QX6A 1TZKA 2OZKA 4EGJA 3OZXA 2B36A 3C4JA 1IPHA 3H1EA 4KAXA 1MC8A 2E85A 4HZUA 3OM1A 2R25B 5E1MA 4L0QA 2P9FA 3SJCA 3SSOA 1UJ4A 3VH4A 5T4FA 2PLWA 1ZI9A 5ERGB 3UAGA 1I01A 4J0JA 1XDBA 2Y0CA 5FL7A 4OAOA 2B21A 3T12A 1EFVA 3R7DA 2OENG 2A5FA 1MUUA 5HKKA 4L73A 5ALNA 2JFBA 1YU9A 4BZWA 2C5SA 1Q7BA 4O3MA 1OYVA 5FPKA 1NXTA 2O0HA 2GDZA 1JHVA 2QRVA 1P62B 1MRSA 2Z98A 3H2JA 1ZN8A 4RHUA 2M32A 4TMWA 3DS8A 3IEPA 3INNA 4P4GA 2Y92A 4NFHA 3M2TA 1C81A 5IDWA 1H6AA 1RWQA 3EBLA 5LMCA 4JI2B 3V48A 3ESZA 3QUCA 1PZGA 2EJWA 4J0GA 4JOCA 1GN8A 2NW6A 3TPZA 5A2QA 1OF1A 2FX2A 4M4SA 3T7CA 4CR7A 2VR1A 3NGXA 3HACA 3Q7IA 4P38A 1B0UA 4OFBA 2PRYA 1JQEA 2R86A 3AU9A 4KYIB 2Q9AA 2C03A 3QLTA 1HR0B 2HDWA 4Z3OA 4JH0A 3UFXA 1KNQA 3FNIA 5GAJA 3G0DA 4MWCA 2E5FA 3JYPA 2PCJA 4IFIA 5DCUA 4ZT4A 5DNYB 2WD7B 4AWXA 5DBEX 2LDBA 5SYNA 2R5WA 5CFRA 2AMJA 4P4UA 4B3FX 1TM2A 2Y1FA 4Y2UA 1PNOA 4YRRA 4HGNA 2RG1A 1DMSA 2FAXA 2HU8A 2A0YA 5E1BA 2HIGA 4DMRA 3MQ4A 2BR3A 4JOSA 4C6TB 5CEJA 3EH2A 4TWJA 5DFAA 2EBUA 3F4KA 3WLOA 5BOSA 2GEKA 4TKZA 2ODWA 3S5JA 3I0ZA 3C7KA 4F3KA 3T35A 2IHUA 2FWPA 1IZ9A 1H2XA 1SM4A 3SYNA 4RVDA 3ZCPA 1A7KA 3DBVO 1Q19A 3KDAA 4YT2A 5ARBA 4V0OA 1TDJA 2G9ZA 1MXFA 4NMXB 2CLFB 3HDYA 1FYDA 5HFNA 1TJYA 3M6VA 2HHLA 4LNAA 2P8JA 3LPCA 2W93A 2WZBA 3GJTA 2FUG6 3C6XA 3NIWA 4H2DA 4MQ5A 4U6NA 5DULA 4ZI5A 1JYFA 1ZNXA 5IC4A 3AF6A 3VKFA 2X2PA 3B1KA 4LBZA 3WY9A 2H0QA 2IYEA 1CVLA 2C5EA 4W63A 4PPGA 5KQRA 3TG2A 4KZKA 2Q62A 2FF7A 3O8OB 4N5IX 4URWR 3CUVA 4KKXB 4OV6B 1K6MA 2AG5A 2V8OA 1FP6A 3PNSA 1JIKA 5JCOA 2N1BA 5C31A 1JKMA 1L7DA 3P5SA 3HI4A 4N6GA 7MDHA 5EKDA 4UNQA 5KC9A 3G0GA 3PXUA 3V6MA 2BBOA 1WCYA 1ZJZA 2ZTSA 3THXB 4EJSB 5EXXA 3CW2A 4ZMBA 3HYSA 5F78A 3M5DA 2XTAA 1PR2A 1H0RA 3ZE6A 3OZBA 1QLWA 1DOAA 1Z5VA 2FJPA 4FHGA 2GETA 3QLUC 3UJHA 2DH6A 4HG2A 5BMOA 3I4LA 5K3FA 1TO2E 2IA5A 1YI8A 3VPAA 4HX9A 4U7DA 5JJLA 5FPQA 3R3HA 4KE9A 3RUPA 4TM7A 4YJ2A 1TLLA 2CDNA 2VP9A 4EIWA 3Q2KA 1N5OX 2XMDA 4JQCA 1KAOA 1RJFA 4IDBA 1NVDA 2JD2A 3GD7A 2QPAA 4JL5A 5KYXA 4TXMA 3WGOA 2AZXA 2ZAIA 4NCNA 5L3QA 1YDGA 3V4OA 5DIZA 4CCYB 1U8XX 1XDSA 3DE3X 1UMCB 1KMHB 1MX3A 4A2CA 5EWLA 2FUCA 3IQGX 4G5YA 3RHFA 1L3CA 2J7PD 3O7WA 1G3IA 3B1JA 5F1YA 3ZZTA 1LF0A 1VMIA 1WCXA 5FUMA 4DLAA 4MLZA 4JT8A 1IUNA 2W4QA 5FTNA 5BNTA 4YRFA 3WSWA 4WCFB 1VE3A 2P79A 4W7SA 3GH3A 2J5RA 2HBRA 2XUGA 3PPXA 5AKJA 5A05A 5AK0A 3I83A 2VHVA 3FFBA 2Q50A 2WZQA 2H1HA 1TU3A 1NAIA 5L3ZA 4DMFA 2BBTA 4JXXA 4QUDA 2AUNA 4IIUA 1DRJA 3M1AA 2PUGA 1NV8A 1TJ3A 1D03A 2OQRA 4R9RA 5JECA 3IS3A 5CUQA 2IUEA 2G63A 4X65B 1AUOA 1QTNA 1UMKA 2ONKA 4LRUA 4WESA 4Y9RA 5AJVB 2WOOA 3U4AA 3CJRA 3H86A 1V8FA 3ORHA 4GYYA 4CMIB 4AF6A 4YAIA 2YMQA 4XWOA 1QIEA 2FQXA 2PEZA 1SCUA 2EZUA 4XB6B 5LU9A 5AJTA 3VOTA 3T7TA 3MILA 2I7DA 4Z0NA 3F5MA 4EEXA 3GDOA 3QU9A 3VH3A 3C5WP 3P0IA 4ESHA 1U2GA 4IXMA 3VR2D 1BS2A 1QLJA 5KNCH 3ET4A 3VKUA 1W7AA 1XEWY 2WJZB 1KZ7B 2P7HA 1QKIA 1L5HA 3N0XA 4MPRA 4YY3B 1XRPA 1ETHA 2ZI4A 2OBLA 1P0PA 4N3BA 4Y2VA 5K3EA 3CU5A 1QHEA 2H2HA 1QUEA 4XWGA 3VO8A 2QAGC 2Y93A 4Y2YA 3HC7A 3GMDA 4OMFG 4X1YA 3JD0A 4RQTA 4XGQA 5CDYA 5HPYB 1FC0A 3BOSA 4HUJA 3ZZ0A 1UBKS 3KKKA 1Z7GA 1QZUA 2I3BA 5GONF 3C15C 3IOCA 1JDPA 2EIXA 4ENRA 3JCZA 4C7KA 3D7NA 2G1KA 1VFNA 2V7PA 2CJXA 4Q4LA 1OPXA 1R8JA 3G17A 5DNAA 3UPTA 3DGEC 2EIHA 3D3EA 4C4OA 4COOA 2C8JA 2Z2IA 3Q7EA 3DZDA 4TV9F 1ISGA 4FKBA 3DTVD 4HVAA 4UKDA 5E2IA 5CYGA 5LOVF 1R0XA 1ZNQO 3AOEC 5CT8A 4FZRA 1QGYA 2VTKA 5E3IA 3EB9A 3QVJA 5FORA 5CFQA 4PW0A 3DAPA 3DP7A 2XNDA 1GQSA 4RE6A 4XZ3A 5ED0A 2VK4A 1SBCA 5FX2A 1AHIA 1ZMTA 2GKSA 2FXIA 1FUYB 1SY7A 4OYHA 3F0TA 3AC0A 1JVBA 2Y4NA 4P3KA 1QYDA 4PBSA 5KTNA 2XVMA 1I7LA 2OCGA 4HGRA 4K5QA 3DE7X 3A9CA 4Y6QA 1BFUA 3HJGA 3RWMB 5BQ5A 1JT2A 5CK4A 1ZOLA 3EIQA 3VO9A 3CPJB 2VK1A 5IBRA 1RJDA 3OLCX 4HVTA 4AICA 4DA7A 1LDNA 4M49A 4TMTA 5FPHA 2QGFA 1HYQA 1OA0A 4D5EA 5DOZA 4CTMA 3OX2A 4IF6A 5H02A 4EG3A 1IN1A 2WG1A 2OD7A 2G9RA 1PP4A 3UAOA 1LD3A 3R6DA 3AVTA 3T38A 2Q8NA 2F64A 4UULA 1KY5A 4ZIRB 3H9GA 3PIDA 5FUVA 5GJVC 2P41A 3K0EA 1FQWA 2VXCA 3OETA 3OE1A 1EUCA 1SIUA 2JGJA 2QTNA 2E9SA 4FN4A 4WLOA 4ZVOA 4D9EA 5IS2A 2X86A 4HF7A 2F55A 4WBNF 3JARB 4K9NA 2BM8A 3MMPA 3PICA 4Q01A 2A4KA 2DFNA 2YXLA 3L9WA 3HXKA 4ITVA 4PC7A 1A8QA 4Q9DA 5EVCA 3UCXA 4BP3A 4KH1A 4E32A 4RDXA 1L4KA 1Y6ZA 5IARA 2IYPA 1C1HA 2UZ0A 3BRWA 1NF9A 2YUTA 3DVSX 1O1YA 2XMPA 4IMPA 4RF5A 1PG5A 4RV9A 4QICA 1P4SA 1O6BA 1YONA 4LF8B 4YAKA 3RVLA 4I9FA 5COAA 3ADOA 4I1OA 3EVDA 5KDOA 5FO0A 3TRKA 2F8MA 1KEZA 1PV4A 4XQEA 1UOPA 1F8FA 3K92A 3L04A 3A6KA 3VR3A 5FA6A 2CVHA 4LJSA 3FMGA 3H2ZA 2WHQA 4J4BA 4NMWA 5TEVA 3ZTYA 4BVEA 4IL5A 1R16A 3IHWA 1T1EA 1UPTA 2AW5A 4KWIA 1T1SA 2KPOA 3GYBA 2ISSD 3F8SA 3FPKA 1ISPA 5KUTA 3WV5A 2ZB4A 1D9ZA 4A0SA 2QD5A 5FUBA 3RRBA 1BGWA 1LDGA 5JASA 4GYJA 4HFNA 3ND5A 1NC3A 1MQSA 1GJRA 2NPOA 4BNTA 1E5DA 1Z18A 2XDQA 4FDTA 2NU8B 1XZKA 1SH7A 3Q5EA 5E4TA 4HAXA 4N7JA 2V5UA 5LXTF 2E3JA 2QM0A 2QQ5A 1XCGB 3HHPA 3MJ4A 1LI4A 3QUQA 2DFKB 2A9PA 3NUQA 4RA9A 1E9BA 2JCVA 2PS0A 3LUBA 4M1QA 4PYNA 5FJIA 5HIJA 5FOQA 2XCTB 4F46A 1UZNA 1JE0A 5JNUA 4Z4IA 2IHJA 5FD8A 2O0JA 3C3YA 1DIGA 3QF4B 4M60A 4B4KA 4B74A 5LP6B 2C4VA 1K63A 5FLEX 1RXVA 2LDXA 2OILA 2XA9A 4Q9NA 4RDCA 2R8OA 4XYMA 1RZRA 4R7ZA 2P6NA 3L8GA 1GZ3A 2LR0A 2PUFA 1NUUA 1KVTA 1OTXA 3C87A 4KYVA 1MVLA 4NFYA 4PZEA 4B85A 2PXHA 3P9KA 1DOZA 4GOJA 1PYGA 1AX9A 1XPJA 5JLJA 1HT1E 2NPIA 5LJLA 1RJ9B 1D4AA 3U3OA 2UZIR 5C5CA 2HA0A 2C2HA 1N3YA 3T4EA 3VDNB 2QN3A 2V6MA 4BVGA 1JTVA 3BFJA 4QTYA 1FSZA 4WACA 4CIAA 3RGWS 3JQ7A 1XDZA 4CEJA 3HJCA 4QM7A 2IHBA 2IIVA 2Y1EA 3T7IA 1FRNA 3PEUA 5SZIA 1XX6A 3OTWA 2UUPA 4UHEA 5G1OA 4Q0MA 2C7PA 2X0RA 4DWJA 1ZHHA 4BFCA 1W0KA 3BERA 1HDOA 2Z9DA 2HDNB 3L43A 4R1LA 3RU7A 4M38A 2A88A 3GLSA 1ZBQA 3TW6A 2J41A 1D09A 1I2CA 4PEVA 2WJ4A 1EGHA 2V7QD 4LHEA 5CW1A 5DTEA 3ESQA 1THZA 2YXBA 4HRYA 3JQCA 1IZ8A 2J3JA 1P0QA 1AQUA 3L5KA 2YWEA 4GI3A 2P2YA 4GRDA 3UG6A 4LOHA 1LSOA 1K8YB 2RBKA 1K88A 1KETA 2A5YB 2D0DA 2JPDA 2ZRQA 4OI2A 4ZV9A 3K71B 3E7PA 3IURA 3GLHB 2NVBA 2A0FA 1PF7E 3EDRA 3W6UA 2GPBA 4QSMA 3L0DA 4BLOA 3G49A 1VDMA 2JGMA 1AHHA 1XPOA 5J2TA 3DXXA 3WL8A 5T4HA 3KAQA 4JSYA 3C1OA 1FP7A 4ZAXA 1KJZA 4JEHA 1P1RA 3HCFA 1DKRA 2PAAA 3NHKA 4HWTA 5IM4F 2Q7XA 4DAOA 1RKQA 2NSJA 3FH0A 3K09C 4PYLA 3AY3A 2HZ7A 5BV7A 5JZBA 4ZO6A 5B4UA 3JAMA 2MIIA 5IN4A 4XGRA 2VHQA 3AESB 4X7PA 5AKZA 3VUEA 1IMJA 4YJHA 3T8YA 3F2VA 1DS6A 3TFOA 4DIOA 3ELWA 1U9ZA 1VYTA 5C7IO 4BBZA 1Q12A 1E3QA 4W1QA 1D1TA 1T8SA 1JFLA 1KKLA 2E87A 1DIOB 1K98A 2P40A 4FUQA 4L76A 4HRAA 2FQWA 3PDUA 1QGOA 3D7LA 3DAHA 2X7XA 3IAS6 2VQEB 1Q7RA 4D8VA 2ZRIA 1Q1ZA 1PGOA 3QTBA 5ICFA 2UUAB 3U4IA 1WU7A 3AHJA 5JADA 1BROA 1EPUA 3QYAA 2A33A 3MWLA 3X1DA 2LVBA 3C39A 3N2YA 1GUYA 1M0EA 4BKRA 2I1LA 4JT2A 1UIMA 4C4RA 5LQUA 2WAMA 2O54A 2FSPA 3NP7A 1QIHA 3FVQA 4NQRA 1W2WB 4ALKA 2KW5A 1XD8A 3ZK8A 1CS0A 2HXYA 1XVLA 3N76A 3ZGLA 2B34A 4AULA 4AWBA 2CZQA 1OXVA 3E8MA 4HPWA 2I9KA 1KEKA 4KLZA 3U7GA 5C7YA 2G06A 3ZDXB 3DV2A 3HWRA 3K6JA 4DR2B 4Q02A 5F7XA 3JW8A 2AKYA 2HA6A 3AJDA 1H4TA 2HHCA 4F3RA 1GFWA 2GZ3A 3A04A 5TJ9A 1U1CA 1Z4MA 1W47A 4KAAA 3OZEA 2POCA 1RKUA 3KOYA 5AJHA 4JC4A 3MXOA 3B51X 2QJWA 4JIGA 1SIBE 3HBFA 5D86A 5DCWA 2QTTA 1R0BA 2HUNA 2NO0A 4LJ7A 4F11A 3NRJA 2WM2A 1MDBA 1JG7A 3EVGA 2VYFA 3E9MA 1VJ5A 2WUVA 3V97A 1UWKA 4KWEA 3U49A 4E51A 3M33A 1HE2A 1GSAA 3BGSA 4LJ8A 5EHNA 3WI7A 4E03A 5CG1A 2Q3CA 4MOWA 4TWIA 1BOOA 4EMBA 2RCYA 1ZIOA 2YFQA 5KB3A 1II8A 4A03A 4EHDA 5LLDA 2H52A 1QSGA 1JLRA 2WIBA 5MF6A 3U7IA 4YCJA 5BYKA 4YS6A 4G56A 3WJAA 5GINE 3PLRA 3BJMA 1X1TA 1H0SA 2WHXA 4TS3A 3SM9A 4ISCA 2V9CA 3Q3EA 2CFSA 1MAWA 3NHUA 1L1FA 1YRLA 2VF4X 5J43A 1B8OA 1OWOA 7REQB 2WFZA 2O8EA 3T9BA 2JW5A 4MJLA 3G59A 1XZPA 3BB4A 4MRMB 5JNRA 2QYOA 3H04A 4ND5A 1IFXA 3EHDA 5E6RB 5KBYA 3SQWA 2M6LA 4FW9A 1SEPA 4L75A 4HT3B 1D7OA 3DFFA 4LX8A 5BSGA 1YB4A 1WS6A 3ANSA 4X3OA 5L40A 4C2UA 3X1YA 3OF5A 2HFJA 1Z0AA 2VEDA 3LQKA 3UJCA 3VDQA 3QIVA 3VYSB 3O75A 5BMVA 2VJOA 3ZN2A 4MIEA 2V3WA 1SPBS 3UKJA 3AEQA 4KXNA 2ZVPX 4G9GA 1IZ7A 4B1FA 1O8BA 1WSDA 3PGLA 1O87A 3L8DA 1E1CB 1FU8A 1Q1BA 2FDRA 2UUOA 2YN2A 4HAYA 4KXMA 1Z63A 1ID8A 1S2DA 2AMLA 4AY3A 1NW7A 4F9EA 4YBRA 4YGYA 2EFDB 4BU0A 3E7DA 4DSUA 5CM8B 2BGIA 5CIQA 3AF5A 4C03A 1YR7A 3BXFA 3CE6A 4KMMA 4E4YA 3DNMA 3KAKA 2BEKA 4BZXA 1M10A 3DDUA 2XBLA 4N18A 4QOIA 1B73A 4C14A 1T2FA 4H18A 4QPZA 1FDRA 1GU7A 4H3SA 4OQPA 4XB2A 2OZLA 1UC5B 1L7BA 4LBYA 4I4IA 4RXUA 4WZAB 5IF3A 3THYA 1R0ZA 2VHXA 4KG7A 1V3UA 4JCCA 1MB0A 4EBFA 1PJAA 3Q9SA 4YRLA 1DCFA 1LPSA 3P20A 1G20A 1TVKB 1T3HA 5HM6A 3DVAA 3ZU5A 3A6JA 5JS6A 4DV3B 1UZMA 1QV9A 2EATA 1EKXA 1WKBA 4WV3A 5I7EA 3U19A 4R71A 1IOLA 4ESEA 2G5PA 1VKHA 1GVNB 1L5QA 3T3NA 4C4XA 2X23A 1J9ZA 1TQ6A 1ZNYA 2BMJA 3C85A 3U0VA 4ARBA 2GQ0A 2J7KA 4AM8A 4KAJA 4KVGA 4A6XA 3ZDCA 3QELB 3IAM6 3OPMA 3JAWB 2IDJA 4D99A 1YFLA 2C5AA 3PQ7A 5IABA 2PSEA 2IP4A 3HKBA 1IYZA 1OLOA 3NGMA 5TPZD 4MV7A 2ZR7A 1IJBA 4DDKA 3OEHD 1OXSC 4LK2A 5HGJA 1XVTA 5T8KC 3S1AB 1S8OA 1P0MA 3SZ3A 5BV8A 3LC1O 1PG2A 3BICA 2W2LD 1Q0TA 2AX4A 1NM5A 3BFPA 1B6GA 3L8CA 4J07A 1P6UA 3NATA 1DHTA 2ZJBA 2BGKA 1KEEA 3E27A 3A1VA 1ZL2A 4HTFB 2A5DA 2PJZA 1E58A 5FWXA 5G40A 4KDCA 2AT1A 1IHYA 1V11B 5F1OA 1DQNA 3AF1A 2O3TA 4JS0A 1I14A 1F0PA 1Z4IA 1D2NA 4LJKA 4EGFA 3TTUA 1G60A 2F90A 1EFDN 4OLHA 1TZBA 3VH2A 3FZQA 3GLTA 4UUMA 3EUAA 1V2GA 4MRNA 5A6SB 1SXJC 3RAJA 3D8UA 4DB4A 5L6LB 3TGLA 2C5FA 4DL9A 2A6PA 3I58A 3NTOA 3CH4B 4KE8A 2HQOA 2R6DA 1X7WB 4ZOBA 2LZ0A 4EKNB 4I5GA 1VJTA 2Z95A 4EEKA 4JUFA 4K3VA 2QG6A 4B4UA 3VKHA 4Q7KA 4CTNA 5C3MA 1OBVA 4CV2A 3PCTA 2CN1A 4AJNA 1UQUA 4RPCA 2FE4A 3ZUGA 3BJIC 5EE9A 5IT4A 3ONNA 1QOZA 2VAVA 4ACBA 5IEBA 3BQMB 3KXKA 3BQNB 4D56A 2EX1A 3K9GA 3RCBA 5ALSA 1LDEA 5JSZA 1B6TA 4G0QA 3THWA 2JD0A 3IA7A 3V3KA 3WXMA 1CY8A 2ZYGA 3DCJA 4G0ZA 4GE0A 1G6Q1 3WGYA 4PTZA 4CCSA 2WSLA 3I2GA 1ADJA 1ND6A 1SWWA 4UAGA 3RSSA 3TZQA 2HGSA 4II7A 1H8ED 2COEA 1EXWA 4Y98A 2B1QA 4AZ0A 2F3SA 4LW8A 5JS7A 4ZZ3A 2D74A 1DTSA 1V7CA 2O50A 1P6QA 1ZIPA 3U17A 3U1VA 1NVTA 1UKEA 4E33A 1J0XO 3D4NA 3FAKA 4LQCA 5KKCA 4ZHQF 2HXGA 1Y7PA 4CG0A 3HJRA 4ZAGA 1T6ZA 5KVAA 3WAJA 4CKWA 1ZVJA 3DJYA 1TAHA 2EW1A 2ZRHA 3B6EA 3HCAA 3SKVA 4EKDA 1OIWA 1G2IA 1SKBA 4DLUA 4ZOLF 3LTEA 2A58A 3REQB 2WBLC 1JHXA 4DRXB 3MS4A 3HR4A 2VZEA 5G4KA 3BPSA 2YDXA 4RU1A 2HJRA 4JP1A 4EO4A 4BX2A 1MW8X 4ES6A 4JV5B 1PFWA 4Q7MB 1M7HA 3U81A 1M83A 2PX2A 2Q21A 5KTSA 3PXAA 2FMUA 3R3XA 2H17A 5BN4A 3AHHA 3WS7A 4W5WA 4WJKB 2ZKIA 3FLMA 4D43A 1H3FA 1EP2B 2HF9A 3G8AA 4A26A 2WTUA 1WHTA 1BX1A 1US8A 3OZVA 2DP4E 2ES4A 3GJRA 4C3ZA 3MOIA 3ZEAA 1TUBA 3DMGA 3BCHA 1QIKA 3G2PA 3L4EA 4QYMA 1OBHA 2DX7A 4HYEA 1RQRA 1O0CA 4HWSA 1JUDA 3PL5A 1HZZA 5DLPA 2B0JA 2LV8A 1T8YA 5LZ9A 1H0KA 1QFZA 2NSLA 2R8RA 1MR3F 3SE7A 3HLKA 1HMPA 2H2IA 3D3WA 4F8EA 3VSCA 1H4QA 1FQKA 1OXKB 5SYMA 2F1IA 1LLCA 4TSRA 4KE7A 3NT2A 4Z9AA 2F1RA 3VMFA 4EFDA 4KQJA 3VNQA 1LSJA 2F3PA 2P5UA 4FEYA 3WDKA 1K0UA 2J9FB 4RVSA 4BP1A 1A9OA 1A5BB 4YWJA 5B58T 3N2EA 1YR2A 4MUGA 1KRXA 2Z5LA 2CNWD 6CHYA 5FPYA 3RS3A 1BFKA 1QVWA 4LTDA 3O21A 5JTUA 2I87A 2H7CA 4RJIA 1Z25A 2R84A 2J5KA 3DW1X 3PHGA 1HZJA 1N6KA 3ACDA 4CU2A 4CR8A 4FHDA 4TLLB 5DBIA 5FEUA 3C1TA 1J97A 2D54A 5CXUA 1D1PA 1U0JA 4F9FA 4TKMA 1BHQ1 3EGEA 4GMDA 1QHHB 4FMDF 2WPDD 3G9UA 5DPMA 4P5EA 5B37A 3JD3A 5CT9A 2Q7OE 4AKSA 4CIBA 1P4HA 2WWTA 3KOUA 4N7BA 2ZITA 4R2IA 5BQFA 1IPEA 4BNMA 5SZJA 1QWSA 1O95C 4LV8B 1XTSA 2I2CA 2VI5A 1GR1A 1CRLA 4ZQGA 3H05A 4D02A 1QS0A 3W34A 5IHXA 2FSVC 4R69A 4Z3DA 4DIKA 3RBVA 5BPFA 2OR3A 3D1LA 4X1OA 5HJ2A 3RS5A 4CU5A 4JJGA 3D8RA 4UJ3A 2IYRA 3OOSA 1DO2A 3CY6A 5DTJA 5G41A 1B8NA 2X14A 1I4DD 4ZN6A 5HZMA 3AF4A 3BCRA 5K0SA 3B2EA 1KDPA 1RM5A 1RPNA 1XZAA 2YJ3A 5ARDA 3UWPA 1YMQA 3IEMA 2PWZA 4DNXA 4PN7A 3LECA 2FLVA 4BRWA 1P5JA 3SJUA 4JDUA 3KD3A 4UEQA 1KO5A 3HBNA 2FR8A 3RC7A 4DQLA 1RHJA 3HPQA 5AW4A 3FPAA 2WD7A 1R7RA 3FNQA 4IWNA 5K0FA 1AKNA 3AFMA 2BMAA 4G2NA 2ZWMA 3F73A 1Y5NA 1RP1A 2BDTA 3S2UA 3D6MA 5F9HA 3ANTA 5TS3A 4DQ0A 2X2EA 3M5WA 1M1YB 2CMHA 3I64A 4MQUA 1U2PA 2YFHA 4L72A 4Z9YA 4RQAA 3H8SA 2UDPA 2H29A 4EG1A 4WZZA 4OGGA 4C6TA 2WIDA 4X8MA 5EIOA 4ZVPA 4EG8A 4WNIA 1XZDA 4BNIA 3ELBA 3O84A 1L4NA 5ECWA 4JUDX 1J21A 3D0KA 3ZVNA 1ACJA 3OE7D 1AO0A 2ASVA 3IQIX 4JQSA 4WD3A 4GKKB 1OXXK 1GYQA 2P5YA 4E11A 3CF2A 3L82B 4DA0A 3L4JA 5KTYA 3PV0A 1YB6A 2O5CA 4XIFA 2MWMA 1MJHA 4TSFD 5A3SA 4DUPA 2O2IA 1X2BA 1PL6A 4HDSA 4BO9A 1VSTA 2YASA 3SQOA 3TEMA 4H1WA 1H4VB 2QG4A 3ZW8A 3RADC 4WQMA 2IS1A 2JBWA 3MWGA 4NPHA 2Q0HA 2N3ZA 4TMYA 5J47A 3IBCA 4B6QA 3JQGB 4TS9A 4MLCA 2ODBA 2WKQA 3H83A 4K88A 4O4JF 2M9MA 5HILA 1HGXA 1ESZA 3OJCA 2HF2A 5C8VA 3MGGA 2B2XA 1V4NA 5AW5A 4L0CA 2GT1A 3AJRA 3CEAA 2BFBB 3IBYA 2QRZA 2M6RA 1Z33A 4F3TA 4JUBA 1L5MA 4FD2A 3OE4A 4UCWA 3THXA 3L1KA 3OQOA 3PP8A 3MYRA 1QYXA 4EJSA 3W5UA 1OV4A 4V02A 5ER6A 1NQTA 4R1TA 2WJ6A 2I2AA 2ZRBA 1LPOA 3DE4X 1VHDA 3R7BA 3AUXA 1Y5MA 2ADMA 3KVRA 1LS1A 3WLTA 1OXBB 2DLCX 1G3QA 1DAFA 4GM4A 2AUMA 4HVLA 5F2OA 2WVJA 4KE6A 4C7JA 1SFRA 2ZFUA 2PA0A 2D1RA 3F46A 2NO9A 4K7JA 4PG4A 1UADA 3AERB 3W6ZA 1A95A 4F9GA 5J4LA 1U63A 3V7FA 1A04A 2QT1A 4QUJA 5E0OA 4EBBA 1SIOA 3GFOA 1ZGBA 3L0BA 4RMIA 5FJJA 4CQJA 3EOZA 4XR4A 1AD2A 1P4RA 1ZOPA 1XIVA 5CVUA 1L7EA 3UC9A 4C89A 1IRIA 4CCYA 5HUJA 1UMCA 1KMHA 4OYYA 4WK0B 2IDMA 5B3AA 1WXDA 1L5FA 3JAKA 2CNNA 1NVWQ 4Z0PA 2PANA 1TMYA 5JAQA 1VGQA 2RAUA 3LT1A 5HQ3B 4Y9DA 3JATB 2O48X 5AXCA 3HA3A 1S01A 3LP6A 3STUA 4Y1EA 2BI4A 2C9YA 1GLVA 2FGKA 3OOWA 4WCFA 5IJ0A 3M6IA 3AY0A 5E6UB 2RHBA 2DT5A 2YV5A 4G1CA 4QPNA 5EFZA 3C3KA 3S0JA 3C5VA 1O97D 1JG4A 3FG9A 3GP5A 4ZVLA 1U31A 4AY5A 3I6BA 3U39A 5JZVA 4PLTA 2FZLA 4HOYA 4CRWB 1DAKA 1QJCA 2O7VA 3TL3A 3RUCA 3EQ8A 3TZHA 3ED5A 1JMVA 2AFVA 2BRUA 3VC3A 3A3OA 3W8RA 3DR3A 1J24A 4C6SA 3OZIA 2OWDA 4CKCB 5GQSA 5T7BA 1EBFA 3EPLA 4H6VA 1Z7YA 1G8AA 1KC1A 2CMKA 1YQ9A 2EG9A 1MC5A 2VJPA 2OV1A 3IUBA 5GM2A 4BNZA 1YRBA 1QRDA 2Z09A 3N8DA 4RFSB 3AQIA 1JI0A 2CLIB 3EA0A 2WV7A 4LMPA 2QLLA 4MMYB 4D98A 1QCYA 1RTKA 1YS7A 5CRIA 3ND9A 3WDMA 2RE8A 2QR3A 3RTGA 3AKCA 4J0KA 1YRHA 5AMXA 1VMKA 4TYQA 1NDQA 2GXAA 1M0WA 1RI1A 4WCFC 1CKEA 1M73E 3FX2A 4HWRA 2AS0A 4Z4GA 1IU9A 3P9XA 3DFIA 2D1YA 3BH7A 1E3JA 4FC7A 1EVYA 3KTDA 5DEOA 1HQYE 1N8TA 1SQ0A 1VHQA 4NOLA 3UGTA 3R1IA 3WX0A 4BTLA 2P3LA 4CUJA 4EY7A 2OXCA 3A1WA 3KYCB 7ADHA 3A1TA 3N2NA 4PICA 4B45A 1MAUA 2J59A 1T2CA 1ZJ5A 3A6ZA 5BSUA 3WK7A 3ILHA 4TSKA 1E2FA 4IO0A 2AG6A 2LWIA 4RKEA 4RL4A 2GRJA 2DKOA 3KETA 5FR2A 1JQJC 1V7PC 1JTFA 4P54A 1UWCA 2C2ZA 2FZKA 3E82A 2PUTA 3DG9A 3LBHA 4LJAA 1D0VA 1PYDA 5BRNA 5FOXA 1R4NB 3ZBTA 4ZTZB 4ZT7A 2DBZA 3TQOA 4PANA 2L42A 3COYA 3UMJA 2ZRJA 2FE1A 3VYUB 3IPXA 1IQUA 4N39A 2EQ5A 1QV6A 1DBWA 2IYXA 2EX4A 3IAEA 2BEJA 3I23A 1IHPA 3PNVA 1ISFA 3HUTA 3K6KA 5DTIA 1PEDA 3WLKX 4D0SA 3H2YA 2H8KA 1C0IA 2YIJA 3FPGA 4LRSB 1GEGA 4P08A 4YECA 4QJ3A 1LSSA 3QKWA 1DXYA 3LPAA 3I2IA 5KYWB 3LBNA 3MQFA 4DNOA 5CVVA 1YS1X 2JK0A 3B1YA 2WI8A 1TEZA 2QE7A 4MYCA 1RU3A 4WOPA 3CYFA 3SMQA 2GAOA 3WZLA 5BNFA 4LC9A 1PVDA 4G09A 4UVGA 2C42A 3LUDA 4LRTB 1SQGA 3DA8A 1ANKA 1TW3A 1NJFA 2P1DA 1QVAA 3IMEA 3STYA 2C61A 2Q1UA 5DP2A 3EF0A 1XTRA 1TJ4A 4PC6A 1X92A 3TDMA 2J6IA 1H2BA 4IH4A 4US2R 3CRMA 4OQ4A 1Z2DA 4HUQB 4OLAA 3IP3A 2FPPB 3ORFA 1U2TA 1QO0D 2E6KA 1X8LA 2JIOA 3A4IA 3BWVA 2PS9A 4ZIRA 3D0RA 3RUIA 3AL0C 3B3GA 4KIUA 3L77A 1I3KA 2CVQA 4RK7A 1QK4A 1JAHA 1JPVA 3EXHB 4N6OA 2EFGA 5A71A 1J8YF 5JSHA 1V8PA 2G7MC 5LP1A 3JARA 1ZD9A 3STVA 1ZEMA 1KZ6A 2JNWA 1P6XA 3L1UA 5BRAA 4G9EA 4BMXA 2PA3A 3SXUB 2AN9A 4QYTA 1VSBA 2APJA 2FOIA 3AFNA 1U94A 3AJ9A 4JBHA 4U2DA 2VDMB 1GQOA 1RLUA 1XK6A 3RYHA 1W581 3N2ZB 4B2YA 4IDPA 2PKYX 5BVGA 2PN1A 3F1KA 1M8PA 3MOSA 4LSWA 4D4HA 1DP4A 3TQHA 4DADA 5C37A 3A1SA 5JISA 2Z4TA 1WKVA 5H3LA 2C7RA 1HL3A 1VDZA 2WG0A 3GX1A 3N2GB 2H31A 2JHCA 2FEPA 3E0XA 3PC8A 3Q3VA 2BOVA 1H2RS 1H6BA 1YGPA 3UHJA 3CKKA 4B6OA 4LJ5A 4UREA 3HYLA 4RULA 4IOLA 3FUUA 4BNLA 1N0VC 1OI2A 1ZRMA 2ZBUA 1V1RB 4UARA 1IY8A 2G71A 4WZ6A 3ZHUA 3NHFA 3FDIA 4DSNA 3GNTA 3K9CA 1Q3KA 4OXIA 3DLTA 3FTCA 2RI1A 1D2MA 3G23A 1KVUA 2OBMA 5KVVA 2DGDA 4L9RA 1NNI1 1OU0A 1N5IA 1GGNA 1LTKA 4UASA 2AEJA 1GL7A 5LB2A 1YBVA 5BN5B 1UJ2A 4J29A 3WNQA 4YCAA 2FPKA 1T5IA 1J5EB 3QENA 5SY6A 3TGPA 2ZTLA 1X70A 2AN1A 3TTSA 2BJVA 3DUFB 3LAWA 2DYKA 2QEQA 1Z3IX 2VJKA 4YRTA 1LLDA 4R1QA 3QP9A 3AU8A 1V1JA 1RVDA 2C7OA 4XPZA 5LP6A 2DFVA 4ZK2A 4P81A 1KS9A 5CR9A 1A76A 3B6JA 3WWCA 5I4KA 1QFYA 2H07A 4RWEA 3JQFA 3QEOA 4NYIQ 1GEEA 1R12A 4F1JA 1Z4JA 4RS3A 3ESDA 1MNQA 4HHEA 3GEPA 4H08A 2VDVE 4EWLA 4LRYA 5EMKA 1RJ9A 5DVZA 4BQFA 2X9LA 4HS9A 1VKZA 4QDTA 5FTJA 4EHIA 4ER0A 4YUWA 4EA7A 3O8DA 4Z9XA 1MOSA 1PNTA 3A1EA 4UEOA 1XAJA 3D5EA 2D4AA 1UBUS 1M0TA 2OWEA 1IBMB 1SEVA 1K3FA 3CH5A 4YV7A 4BNFA 2FG5A 4LWZA 3U26A 4EPRA 1E5LA 1A88A 1TQ4A 3WMXA 2GO1A 4B6JA 3WLIA 2VPYA 1Y8ZA 2ZUTA 5AVSA 2F4VB 1FVOA 1V6CA 5J40A 1NJ1A 5A9SB 3VHXB 2OCKA 3TTWA 4RMGA 3F6YA 4DYDA 1SBIA 3LT0A 1N5RA 3TR5A 1UZUA 1G5RA 2Q2VA 3KLNA 4R40A 3L6EA 5DLDA 4BB6A 3O4VA 2OVFA 2MSDB 2UXDB 1UKVY 3DCYA 1Q3TA 4N47A 2QZ4A 1NP3A 1WAMA 4EGAA 1MBZA 4CF6A 3M3PA 3MWKA 3HBJA 2VN8A 1NUPA 1NUAA 1WM1A 2HB6A 3EAQA 1U3VA 3VOSA 1E3MA 1O9HA 2CEAA 3TVYA 1TM7E 2NU7B 3GLHA 2IUUA 2YOFA 5IEJA 2QYSA 1UT6A 4Y2TA 3NOVA 4FGZA 3ZPXA 2K5UA 2V3CC 2MR6A 1PN3A 1QX4A 4LS3A 1WDLA 4DR6B 1SCAA 3GFSA 4IG9A 4B7ZA 3DOUA 2BHTA 4OHVA 2DM6A 1Q2XA 5IAGA 3W9BA 1KMQA 1VPTA 2FP3A 4LIPD 3IVAA 4NECA 4OBXA 4QNRA 4F92B 3MNFA 4KDEA 1I7DA 1CIPA 3R0QA 5K6TA 1T9BA 1E59A 3AESA 3IMFA 3ITNA 2R87A 4WZBE 4CMGA 3S81A 2B4YA 4G67A 4UBKA 4ZV4A 4IV8A 1GFSA 1KOGA 3DZKA 4HAUA 2WT9A 2ZROA 2OD2A 3H4MA 3RS4A 1SAYA 4IQ8A 3TRJA 1N2GA 1HC7A 2H4HA 3V33A 1MX9A 3UCFA 1VECA 2GK4A 3Q72A 4LCBA 3OSZA 1ZPDA 2XW6A 4PG7A 2PGDA 1AXRA 3WLSA 3ZHVA 4ZI2A 3KB6A 3LY5A 4I3GA 4B0OA 4KO1S 1LSUA 3JQBA 3WA7A 2XTJA 3AB3A 1EVLA 4FYXA 2RGBA 1XKTA 2DKNA 4G4IA 4GW3A 4PLYA 3F8TA 1YJBA 4U3JA 2O8CA 1KOLA 1JXAA 4JA0A 2IHVA 1HBJA 5LQSA 4OO3A 3H9BA 4TMFA 3I04M 1LUAA 1Q14A 5DHFA 5HDBB 1JIQA 4G5SA 3OTIA 3A3PA 5JT1A 3F49S 2G1UA 2QWXA 4X7MA 1R66A 5DGXA 1T8UA 3KZNA 2R1TB 1JJBA 1VIMA 2C8KA 2YWGA 5ESXA 1ZJYA 1GP2A 1ZONA 1R6TA 1EP1B 1U0HC 2D0IA 4OCZA 3CNQS 5CGZA 2W6NA 3VX4A 1DWQA 4Q7LA 4PAOA 3RYFA 4J0FA 5U4QA 1Z2PX 1VRWA 1SA0B 4F1WA 2Y68A 1FL9A 2VP2A 1QYRA 2AG0A 4Z86A 3VI3B 1KQ3A 4WVFA 1XNHA 5E7IA 4P36A 1JIXA 1PQ4A 2O57A 4HQ0A 5GP1A 4ALLA 4F5YA 5L95A 4BO6A 2MSEB 2FW7A 3EFHA 5MGBA 3TD2A 1DRUA 1O94D 4MRRA 3LWDA 1T3ZA 4Q82A 2AQ8A 2C00A 1RFLA 4YMGA 3DQZA 1DRKA 2QZPA 2IP2A 3G0OA 3G8BA 4HEQA 3WOVA 4NX2A 1JG3A 3DPIA 1SCDA 2HWXA 4DVGA 3KL4A 4JYBA 2X19A 4YP1A 1IJFA 1R64A 1TTHA 3NHRA 4QT0A 4WCVA 4PLFA 1Z8DA 4M9ZA 4XCVA 3VA7A 1OAKA 5ICMA 1IZZA 1M9NA 3I45A 1PS9A 3ORSA 4KPUB 4INPA 5THKA 3AEKB 3SN6A 3U40A 4C3VA 3UB3A 3LV8A 2HXSA 1N57A 3QLJA 3C3DA 3LSTA 4HPXB 3ZDBA 4HDRB 1QZ3A 1MZVA 1HWYA 4XD7A 3PZBA 7REQA 1N6IA 2H6EA 3I6YA 4UHFA 5CTAA 3NVDA 4MRMA 4U02A 5P21A 2CL6X 4KK3A 1HI9A 2ZVDA 4ZOEA 3RRNA 3BS4A 3WBBA 2VWQA 5E6RA 2R2AA 1O89A 3CIOA 1GZ4A 4MW5A 3B60A 2EKLA 2VPQA 3ZCQA 1NBAA 5ELLA 5CLJA 2I3AA 2ZYTX 3U7RA 1Y4AE 3CCFA 5CK5A 4D25A 4B3TB 3EULA 5CDFA 4GUAA 1ADBA 1W1IA 3KLBA 3U9SA 1XQVA 4AJ9A 1TZMA 4DDHA 4JGBA 3COWA 2AXPA 1KRHA 4JUIA 3VSBA 4ALIA 4ECAA 4ZCMA 3GLFB 1XNRB 1JLSA 1WCIB 1N2SA 2I03A 2YVUA 2HQ1A 3MUFA 4Q1AA 1G5HA 3RVOA 3W79A 5K09A 2VFAA 4KR9A 3ADDA 1PRYA 3TO5A 3WYDA 1P8JA 1SVNA 2ZDGA 4FOLA 1E1CA 4GPTA 1G8YA 2IH5A 1IEWA 2J3DA 3GG2A 4X20B 3CISA 1U9YA 1O96B 2V7UA 3A32A 4I6JA 2C0CA 1GPDG 2C4KA 1JJFA 1LVHA 2QTHA 3ILYA 3UIEA 4E2YA 3WGIA 1XMSA 4OL0A 1H69A 3FNGA 2J4FA 3IC5A 4MB0A 5DDIP 5FV7A 3ROZA 1XWFA 5B1DA 9ABPA 4XRRA 3FOFC 1FFYA 1XF1A 4JR2A 2IGTA 3DPSA 4C9BA 1DG3A 3AZPA 2QV7A 5KX5F 3JZIA 3D3NA 2JI8A 5A5GA 1ZDMA 1SUDA 3SEFA 4JJ8A 4CNBA 4MRVA 4WADA 3ZD9A 2EP8A 3NBKA 2W6QA 4A8PA 2PKRA 3EF3A 2OHGA 1TVKA 4HXGA