4L0CA

Crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
MKGYNVYANGIRQHIIHFPGTGSPLLLIPGITSPAVTWGFVAERLAKYFDVHVVDVRGRGLSESGDLDYSLDAMADDLVALAQRMEGVVVLGHAMGARIAIRAARKDSQVFSRLILVDPPVSGPGRRPYPAKWSWYAESIRLAQRGCTAMEMRSYCPTWTDEQIELRAEWLHTCQYTAVKTAFDGFHTDDIHTDLAQLTLPIQLVVAGGAEVIQPDDIAEIISLAPQTTTYVVEEAGHMIPWDNLEGFITAVSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-Fopmylmaleamic acid deformylase Nfo from Pseudomonas putida S16
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Deformylase
total genus 83
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0cA00
4Q3LA 1THGA 1ZGBA 1YA4A 1XZMA 3RM3A 5DNWA 1HKHA 4IO0A 1XZDA 1ZJ5A 4WFKA 2XMCA 3EQ8A 5CT9A 5A62A 3TEJA 1E5TA 1SCQA 3E3AA 4B0PA 4A23A 1XZKA 3K6KA 1XZJA 4W1RA 1Y7HA 2JEZA 2WG2A 1SFRA 3WKAA 5DTIA 1LNSA 3GZJA 3JWEA 4LYDA 5K3BA 2JEYA 2HFKA 3MVEA 3H2IA 2BGRA 4EZIA 1MX9A 3D3NA 1ORVA 2PL5A 1SCKA 5IVDA 4ZRDA 4HAIA 1MNAA 4E15A 1H2YA 1YSCA 5IVKA 2QR5A 2OXEA 3DL7A 3IA2A 3TGLA 5AJHA 4PNZA 2OPHA 3WK5A 1H23A 3IUNA 1R9NA 2B20A 1MT3A 2YXPX 1DWPA 1C7IA 4EB0A 1ACLA 4U2BA 2BUAA 1EXWA 5KBYA 1PV1A 3R3XA 1B41A 3AZQA 4G1FA 5AH0A 4OB8A 2EDCA 1N1MA 2XMQA 3WLAA 1EA5A 1LZKA 3IURA 5AKGA 2WIJA 2DHDA 4MYSA 1XRPA 5CBKA 3C6BA 2ZJFA 2XMGA 5AOCA 1CVLA 3V9AA 2H7YA 2XUHA 1R4ZA 1OCEA 5JADA 4XVCA 2HL6A 2J4CA 3V1MA 2D5LA 4M0MA 5AIAA 3RKSA 4BVJA 3FWHA 1TK3A 1VXRA 5ESRA 3ZWQA 1YA8A 4IQ4A 4KR0A 4BAZA 4FTWA 3DDUA 5IKXA 4CCWA 2X5XA 1QZ3A 2AJCA 1K5PA 4Q3KA 4N8DA 2HFJA 3DS8A 2XUIA 4UFNA 2O2HA 4XJVA 3O4GA 4QLAA 4AN0A 5ALUA 1JJIA 2ZYSA 2CMFA 3O9VA 3A2LA 2WIGA 1TRHA 3R3WA 4B81A 3VJLA 4DMKA 3AIKA 3EF3A 5AI5A 5LP1A 4C87A 1IMJA 3R3UA 2H7CA 1QIHA 3FYUB 2OGTA 2ZSIA 4BZZA 4YX9A 1KEZA 1QLWA 2VJBA 3DNMA 5CT6A 3HI4A 4AZ0A 4X90A 4Y2YA 5C8VA 5SYMA 2PPLA 5HK8A 5EFZA 2GYUA 3DKRA 3HZOA 3HC7A 1E89A 4GECA 3TJMA 4G9EA 1JKMA 1LBSA 5CT8A 5A6VA 4KRYA 1G66A 4BE4A 1EB8A 2PSFA 1L7RA 5H3HA 3MUOA 3LIIA 3I2GA 1CUSA 2JGKA 4S0XA 3BJMA 2HA4A 5K3FA 1QO9A 3G0BA 2XLCA 4B9EA 5LZ4A 3ZLVA 2WU3A 1XLVA 1XZHA 3OTQA 2BUCA 5CXXA 5CT4A 3VVMA 2CJPA 2VT7A 3B5EA 5LLSA 3O4HA 1MJ5A 5D3KA 5A71A 3B3QA 5HF6A 1LPBB 2XB6A 5A2GA 3AUKA 1JMKC 3N0TA 3QM1A 4N5IX 3C5VA 2C0QA 4CFSA 3G0GA 4KACA 2RHTA 1BEEA 4FFWA 4JH0A 3WWEA 2FJPA 5EI5A 3ZLUA 1TCAA 4J0DA 3M3DA 1G42A 4B82A 1YS2X 1CUIA 4U2CA 1ZD2P 1ZIYA 3ZLTA 5I9IA 3FNBA 1R88A 2WFLB 2WJ4A 4L3WA 2DR0A 2WFZA 4CG1A 3IIIA 2QKYA 2Z5GA 2WTMA 5K5EA 3D2AA 4ZI5A 2QRUA 2VAXA 3I2HA 2WFMA 3FBWA 3DYVA 1H2ZA 2I3DA 3FLEA 3VJKA 2XUAA 4BZWA 3E1GA 4JUIA 4X94A 4HXEB 2ZYRA 1VKHA 4KYVA 4NVRA 1ZD3A 4BTLA 3L1HA 4B6GA 1GQSA 1DTEA 3E4DA 3FVRA 4H7HA 4UBMA 2BUBA 3DCNA 4J0GA 1EI9A 2ONCA 2PSJA 3C6YA 5AI0A 1W76A 5ALIA 4DNOA 3H18A 3GA7A 3I2KA 5ALSA 5FV4A 2FJ0A 1EINA 1XLWA 3KOOA 1Y37A 3KSRA 2HDWA 5KWIA 4RE6A 1DX6A 3A2MA 4I3FA 1TKRA 7YASA 4X00A 1YAHA 4J0HA 1XZIA 3OM8A 5FXMA 1QE3A 4LXHA 2WQZA 1LPOA 3DLTA 2BAGA 3STWA 3PE6A 5ALXA 2HHAA 1EDDA 1GXSA 1XKTA 3EQ7A 5A7GA 4NMWA 5DTJA 4Y2PA 1BU8A 3H1AA 3A6ZA 3H1BA 4QEKA 4UUQA 2VF2A 1VA5A 3NOXA 2Z8XA 4H7IA 1BCSA 1F0NA 2QVBA 1CUEA 4RPCA 4HRYA 3PUHA 3LS2A 2H9YA 3AJAA 2PM8A 1Q83A 2RAUA 4GEGA 4H35A 2V97A 2V9ZA 4KE7A 1WB4A 2GBGA 2QUAA 3DD5A 1DU4A 5AK3A 3GUUA 3ESDA 3EQ9A 4BTVA 4FFVA 2B61A 2ECFA 3G9TA 3Q0TA 3IDAA 4GI1A 1FFCA 3CN9A 4Q1VA 4QLOA 5E2IA 1XQYA 1J1IA 5YASA 1TAHA 3C45A 4RNCA 3W06A 3RK4A 5SYNA 1ETHA 1GKLA 1EB9A 4ZWNA 1VE6A 2DHCA 5HQ3B 1UWCA 4QDTA 4EBBA 2J3QA 1CRLA 2XE4A 4UHFA 5FOQA 1EHYA 5IVHA 4LHEA 1CQZA 1UXOA 2CKMA 2OCKA 4KJXA 4ARBA 4UBJA 3LCRA 1P0QA 1N5RA 1NU6A 4J0JA 1AC5A 5HFAA 3PICA 2O7VA 3NWOA 5E4TA 2WILA 3R3ZA 1L7AA 1H22A 3CN7A 1HQDA 1VLQA 1UKBA 3ILSA 2HA0A 4UBNA 1CUYA 3HEAA 2WUEA 5T4BA 3DYIA 1UKAA 5EGNA 2JGMA 5EHNA 1ZGCA 4GLBA 4BC0A 4B85A 2VA9A 3HXKA 4P9NA 4LIPD 4AO7A 1KU0A 1TQHA 5CRIA 3I1IA 1XZCA 2Y2VA 2JGLA 2I03A 4N8EA 3H17A 4M0EA 1F6WA 2PUHA 3WK6A 5HZGA 2Y6UA 5HFNA 4U2EA 3QPCA 2Y2UA 1CUAA 2HIHA 1RWQA 2B9VA 1VXOA 5ALPA 4X6UA 5AI9A 4J0KA 4QWMA 3HLKA 5JIBA 4UHDA 1CFJA 2I3ZA 5A7FA 1EX9A 4FLMA 4JNCA 2FX5A 4EY5A 4BATA 3JW8A 5JAHA 1TCBA 2JBWA 3G9XA 3AILA 4QDUA 1BS9A 1UK6A 2VJCA 5FDFA 1E66A 4H77A 2BJHA 1A8SA 5EIAA 4DLNA 1LPAB 3IUMA 4HVTA 5K3AA 4EA6A 4MEBA 1CUJA 3LIPA 1UKCA 2ZJ6A 1EVEA 3W04A 2X8BA 5JALA 2WSLA 5EHQA 2AJDA 4ROTA 3FLBA 3F97A 3HRHA 5DYTA 1MNQA 4BRSA 2QUBA 1TCCA 1GGVA 3KD2A 1A88A 3FOBA 1D07A 4CCYA 1XRQA 1GQRA 4Q34A 5T4HA 1GPKA 3GBSA 3HSSA 2G5PA 3C87A 2PUJA 3H2JA 4G5XA 5DYYA 5C8ZA 4FBMA 4Y9SA 3WL8A 5AIBA 2XQJA 3AINA 2FUKA 3BE8A 3R3VA 1CUDA 4ITVA 1ZI8A 1C4XA 4KRXA 2ROQA 4BE9A 4WY8A 4ZREA 3FYUA 1CUCA 4FHZA 3K9BA 1LGYA 2HRRA 3WIOA 3YASA 3D0KA 1HDEA 3L1IA 3DKKA 5T4EA 3OOSA 4Y7DA 4DIUA 1CUVA 3R40A 4Y2XA 4C6HA 2DSNA 5D6OA 1ZJ4A 2XUFA 1YR2A 2XUDA 4K6HA 1MAHA 4BP8A 2AXEA 3H2GA 5AM2A 2QT9A 4INZA 2OQVA 5CW2A 4JEIA 4WJLA 5LIPA 1DQZA 5HF5A 2Y6VA 4CIAA 1LPMA 5AHXA 1BROA 4EY7A 3STTA 3DQZA 2HM7A 2XUGA 1Q84A 2WHQA 1ZI6A 1QIEA 5LKRA 1YCDA 2OQIA 1ISPA 1XZEA 4K5QA 3I6MA 1QOZA 1CEXA 1SCIA 4X71A 1ODCA 3WL6A 2RHWA 2WG0A 3QBJA 4G9GA 1YS1X 4H7FA 1AGYA 2XQKA 1EK2A 1WB5A 2QJRA 3SWWA 3FYUC 1J07A 2BGNA 1F8UA 3OURA 3HYSA 3FAKA 5D3ZA 1R1DA 2HRQA 1J2EA 3HACA 1BE0A 2V96A 3CCCA 4X91A 3UMJA 5EIHA 3ANTA 2WG1A 4GXNA 4X7BA 4FMPA 2BKLA 1QTIA 3I2JA 4Y2UA 4Z49A 3ESAA 3VJMA 3D2BA 1GT6A 1UFOA 3C5WP 3ESBA 5AKLA 1ORWA 2GZRA 4K2AA 1VJ5A 5JZ9A 4H7KA 1W75A 1MX1A 2J3DA 1Q0RA 3PI6A 1XQVA 2YYSA 2YH2A 4G8CA 1DT3A 5ALRA 5CH8A 4H0CA 4X97A 2XMDA 4B7ZA 4ARAA 2QOEA 4BVKA 4AQDA 3G8YA 4GDMA 4C01A 5C7YA 2QXUA 1L7QA 2H7XA 4E11A 5KWJA 1CUXA 3GFFA 5LZ9A 3W9UA 4BCCA 4FBLA 3IUQA 2RI6A 1FFBA 2E3JA 1QIKA 2QTBA 1CUGA 3BF8A 4OYLA 4U2GA 4UFOA 2O2IA 4BYMA 4LXIA 1H2XA 4DMHA 2EDAA 3C43A 4X92A 3OC0A 4IHAA 5LZ5A 1XKLA 2AJLI 1XLUA 1USWA 4MYDA 4P08A 3I2IA 1WHTA 1WM1A 3EBLA 3QYJA 4Y2RA 3DL4A 5AKXA 3ZPXA 3WJ1A 4G8DA 4AXBA 3FVTA 3IUJA 4EHBA 3WK7A 2ACEA 1XROA 3AIOA 4AMZA 1PFQA 1VZ2A 3PDCA 5DWDA 5AP9A 4W1QA 1S8OA 4TVKA 3E0XA 2WU4A 2OGSA 2WHRA 2ZJ7A 1LBTA 3G0CA 4C89A 1DT5A 1NX9A 2G63A 5JYCA 1GKKA 5AM4A 3TRDA 4X85A 5I8PA 2CBGA 4UBLA 1QFSA 5IH7A 2HA7A 3AZOA 5BWCA 3ICVA 2Y1KA 1BN7A 1AX9A 1QO7A 1BN6A 1W6RA 4ETWA 3O4IA 5I7UA 1SC9A 4KE9A 2DQZA 2WJ3A 3M82A 1XZLA 2O7RA 5K3EA 4G4JA 3L1JA 3WZLA 2ACKA 4FNMA 1XRNA 1MN6A 1A8UA 4UHBA 4DSAA 1LZLA 2VT6A 5HF8A 1X2BA 3BDIA 5CTAA 1DWOA 3BWXA 1EDBA 2GBCA 4DNPA 5AI8A 1LPSA 1QTRA 5FPQA 4HRXA 1O6FA 4FOLA 1HPLA 2C4HA 3QMVA 4FNGA 4CG3A 3WMRA 2XQIA 2XUOA 4F60A 2J4FA 4M0FA 5ALVA 3MGAA 1QIIA 4DYHA 1K63A 2VEOA 5ALHA 2JIDA 2I78A 3LP5A 1JJFA 1K8QA 5AM1A 4OD0A 5FPPA 3W05A 3W9BA 3PFCA 3GROA 3JYHA 1T4MA 4BB0A 2PSEA 5JAOA 4IH9A 4MQMA 4HS9A 4MQLA 1NU8A 3C8HA 4WFIA 1IUNA 4JYMA 3W2TA 5JAUA 1VE7A 2XUKA 4PF1A 3V1KA 1UOPA 2GBFA 1JFRA 5LZ8A 3RARA 4O08A 4X95A 1E3QA 4OU4A 1U65A 3QZUA 4DMCA 2HADA 3HABA 1R9MA 2H1IA 3NGMA 4Y2QA 4F0JA 2P8SA 5AO9A 1FFEA 3WWCA 2C58A 2UZ0A 4BRZA 1QIJA 4DNFA 4B84A 5AK5A 5ALNA 4AMYA 4AX4A 4P92A 4RE5A 1FJ2A 3C70A 3M83A 3WYNA 1AUOA 3AFIA 2Z3WA 4BAGA 2IIVA 3U0VA 2CEKA 4KE8A 2W22A 3N2ZB 1CV2A 4C4YA 1VA4A 4J3JA 1EVQA 4BVLA 1H2WA 2PBLA 3H04A 4UBIA 3BIWA 2XMZA 2PU7A 4QDOA 4B9AA 2IITA 1XRMA 1W52X 2XUQA 2VATA 1LLFA 3C6XA 4V2IA 1ZICA 1SOMA 4LXGA 3IULA 5CURA 5JZSA 2CUTA 2C5GA 3PUIA 2PKYX 1EDEA 1QJ4A 4XWGA 5CT5A 1MO2A 1K4YA 4YK7A 1P0MA 5E4YA 2VTVA 2O2GA 3DOHA 1WCYA 3WKBA 5JZBA 2XI4A 5AKJA 4G8BA 3WWPA 2XMSA 3H0CA 4J0CA 4B83A 2EEPA 4EY6A 4A5SA 4ZV7A 3A70A 3SX4A 4CCYB 4EY4A 4BCDA 5ALYA 1MAAA 3F9CA 5ALKA 1YAJA 1UK8A 1YB6A 3WK9A 3AZPA 1JU4A 4X93A 5BWBA 4PQEA 5AOAA 5ALGA 1IZ7A 4X6XA 3R3YA 2HU5A 5AKYA 1HL7A 1AZWA 3M81A 5BOVA 4PSCA 1WPXA 3BJRA 3NUZA 5EHZA 2ES4A 1QIFA 5AI6A 4AO8A 1WPRA 2JF0A 1IZ8A 1XZAA 2ZVDA 2IX9A 1XQWA 3STVA 2ORYA 3STUA 5AM5A 1VOTA 5D7BA 1ZD5A 2GYVA 2WTNA 2R8BA 4UPDA 1F0PA 5LYYA 5DLPA 3VISA 3I6ZA 2NW6A 1R50A 3MUNA 2OG1A 2CZQA 1W4LA 4CG2A 4W1PA 3WK8A 4NZZA 3QITA 3V1NA 4XIIA 3IB3A 1AURA 1JT2A 1LPPA 4ZXFA 5ALZA 5AM3A 3FSGD 3O4JA 1XRLA 5ALWA 5AICA 1GPLA 1N5MA 1CQWA 2OGZA 4WFJA 3K2IA 2WHPA 4BBZA 3AIMA 3BIXA 3X3HA 1AMNA 3FLAA 3GELA 2VAVA 4QA9A 3FSGA 1ZIXA 3T4UA 3VXKA 4GWLA 4OSEA 3O95A 4C4XA 4H18A 4H7DA 2PSHA 1G5FA 5C81A 4K6KA 4UHHA 6YASA 5JASA 2XQGA 4WCVA 3PF9A 5K3DA 1MPXA 3I2FA 1BCRA 3CXUA 1UZAA 2OAGA 3C6ZA 2V98A 4Y2TA 4L9AA 3DJYA 1LPNA 3WKDA 4HTAA 1FFDA 5ALEA 2RGUA 2XMBA 3STXA 4F21A 4RGYA 5ALOA 1YB7A 4N5HX 4MWSA 1VZ3A 1YASA 5CMLA 4G4IA 3H19A 3ZV7A 1EK1A 5KREA 2ZYHA 1XQXA 1CUFA 1CPYA 4U2FA 5AOBA 2WUFA 5BV7A 3A2NA 1ZOIA 1KU6A 5EIEA 5CH5A 1A7UA 1QIMA 5HKBA 2YASA 3H2HA 5ALJA 1MX5A 4NS4A 5ALDA 3ESCA 4HZGA 1QFMA 2AJBA 1CUBA 5JANA 4OYYA 4H7JA 2X76A 4EY8A 2C0PA 3HJUA 4X3CA 2VJAA 4PSUA 4QE3A 5C8XA 3D5EA 1Q0ZA 3OG9A 4WDRA 4Y2SA 1GZ7A 3QPAA 2DHEA 3H2KA 2JGFA 1WHSA 5JD6A 5LKAA 3WKCA 5JAPA 4WY5A 2QXTA 3PF8A 1FSSA 4UBKA 3WI7A 4BDTA 5ALTA 3WWOA 1WOMA 3G9ZA 2OCLA 5JD4A 3V1LA 4EUSA 4TGLA 2GZSA 4AB1A 1UK9A 4F5ZA 4FDMA 3SK0A 2RIPA 1RYYA 4KAJA 4QZVA 4Q05A 1E8NA 5FKJA 5ALLA 1C7JA 2QZPA 2HA5A 4QNNA 4W63A 3QVMA 1WB6A 4LYEA 3G9UA 4L0CA 5AKKA 5ALFA 4J03A 4E46A 1AKNA 4GHWA 4GBGA 1Z68A 2G4LA 1DQYA 4LKOA 1ODSA 3I1YA 2ZSHA 4GW3A 3SC2A 3U1TA 3UUFA 2PU5A 4Y2JA 4CI9A 1BRTA 5HKAA 1U4NA 1JJBA 4BDSA 3G0IA 1CUUA 1Y7IA 5AI4A 1R3DA 1OILA 4PO3X 4G4GA 3WYDA 3QMWA 3F67A 4BCBA 1P0PA 2OCGA 4MXDA 4P93A 3PFBA 4YPVA 5F4ZA 4W1SA 1HBJA 4N8SA 1XZFA 1N8SA 3B12A 1XFDA 3F8SA 5DNUA 4KAAA 1P0IA 5J3JA 2XDWA 3BL8A 2K2QB 4AN1A 1J06A 3DEAA 1BEZA 4C4ZA 4OB7A 3D7RA 1ODTC 5AM0A 4KE6A 4YASA 3QPDA 2C7BA 1PJAA 3WA7A 4DMFA 4Q3OA 5CH3A 1IVYA 5K3FB 2CB9A 4UBOA 1RP1A 4HXGA 2LIPA 4W9RA 3BF7A 4JYPA 4WDQA 1B6GA 3DOIA 3STYA 4L72A 1A8QA 1ZD4A 5AK6A 3WL7A 4OCZA 1IUOA 4Q82A 4B80A 5AKIA 1DWQA 3WWDA 4OU5A 1JU3A 3D59A 5AKEA 5A7HA 3WA6A 5DNVA 2VQ6A 1K6EA 1QIDA 1CR6A 2JGEA 1O6GA 3WKEA 3KXPA 3R41A 2WHPB 5JARA 2XUPA 4Y2VA 4DNQA 2XUJA 1JI3A 2WKWA 3WZMA 3ZI7A 2WJ6A 1M33A 1G4HA 5LZ7A 5DYWA 4QDXA 4XX1A 1CIJA 3F98A 4OPMA 2OCIA 3F96A 5ALMA 3QH4A 2XT0A 1QGED 4ZV9A 2W6CX 3WK4A 4A16A 2VSQA 2WUGA 2WFLA 2HA6A 2HU8A 5FRDA 4HXFB 4OUKX 2HA2A 1W1IA 2JGIA 1XRRA 3R0VA 2AJ8A 4QDZA 5HK9A 3WQHA 2BFNA 3V48A 5AKZA 4PV7A 1OXMA 3RLIA 2DQYA 1E8MA 4UHCA 3EIOA 5T4FA 3BDVA 2VJDA 5IVIA 2WLSA 1MTZA 2OAEA 1CUZA 3WIBA 4AO6A 4ZGBA 2QJWA 2GBIA 1DINA 3ANSA 4BP9A 4PSDA 3LLCA 3D2CA 1DX4A 4X6YA 3S8YA 4FLEA 1E8DA 5DJ5A 5HCUA 1FFAA 1ACJA 5CXUA 3O9MA 3VVLA 2Z8ZA 1CLEA 5FUMA 4IH4A 4MJ3A 3D4LA 1THTA 2OLEA 2WUDA 2B4KA 4IH1A 2QS9A 4MEAA 4FKBA 4QWWA 5LZ2A 3ED1A 2ZYIA 3FYTA 4DTCA 4FWBA 1X2EA 4PW0A 1JMYA 5HF9A 4J7AA 4I19A 1AQLA 2RONA 3KWFA 4MWTA 3I6YA 4DGQA 1GPNA 3IBTA 2WIDA 1MU0A 2PVSA 1CUWA 2D0DA 3IVMA 4D9JA 1XZGA 5AKHA 1EH5A 2XQFA 2Z3ZA 3QMMA 3C8DA 4C88A 2DFPA 4J0IA 1TIBA 2XLBA 3ICWA 1U2EA 2WIKA 5EHXA 2R11A 5K3CA 1CUHA 1T2NA 3OPMA 4DM7A 2Q0XA 3UUEA 3Q8WA 3CCBA 4TPKA 3WJ2A 4UFPA 5E4JA 1ZI9A 3BXPA 2HU7A 1QIGA 4H7EA 4FLFA 1IUPA 3G7NA 1X70A 1HLGA 2JGJA 4B0OA 4K6GA 3P2MA 3G02A 1U8EA 3I28A 4UHEA 5ALQA 1UOOA 2BCEA 4OB6A 4DSZA 2QMQA 3FCXA 5JATA 5JD5A 3KDAA 5FLKA 3FCYA 3G0DA 3WL5A 2PSDA 5ISMA 5FP0A 3O0DA 1I6WA 2WM2A 2XMRA 1UOQA 4AZ3A 4CIBA 1UT6A 1QONA 3VKFA 2HA3A 4U2DA 5AK4A 4BC1A 2C5FA 4BAUA 3T52A 4KAFA 4I4CA 2GYWA 2PX6A 1UK7A 3VDXA 5HQ3A 2DCMA 4E14A 3S2ZA 2QM0A 1XZBA 2WIFA 4KEAA 3KWJA 2G5TA
chains in the Genus database with same CATH superfamily
3IR6A 1U28C 4QRIA 3GQBA 4K7JA 1W1WA 3EQZA 3II6X 3MMPA 1NI4B 1CZUA 2QZZA 3KEMA 4JJKA 3KTFA 3PP8A 4BFUA 1G5HA 2VH5R 4CLHA 4BXOA 1XWWA 2ZUDA 4YBZA 3ROPA 1JV2B 4NCXA 5LXTB 3K8ZA 3BXHA 3FUWA 4DBLE 3B53X 1ZJ5A 3COZA 2YJ4A 3S99A 4G81A 4MVJG 3MT7A 4LZLA 3BORA 3TEJA 1EK6A 3E3AA 5CEEA 1V39A 3FNGA 3ZVLA 1IOWA 4A23A 1ISGA 2MINA 2QPTA 4D9KA 5JNWA 3VO8A 2JEZA 3WG9A 1N2BA 3CSUA 3DFKA 2BJVA 3OIUA 1QZUA 3A25A 5JSUA 4WK6A 3WYAA 1CG6A 4BQPA 2R5NA 4S1WA 3WKAA 3GZJA 3LQQA 3VYWA 4LYDA 4DVGA 3OOWA 4F12A 1C9YA 1HDYA 2WKSA 2O8EB 2JEYA 4LGCA 5H5JA 1SR8A 3LGSA 3D7KA 5KDOA 1U1IA 3H2IA 2BGRA 4EZIA 3A9UA 5IBPA 1SURA 3P2IA 4LHZA 2IC5A 2PL5A 1A5AB 1SCKA 3E3OA 3GZ4A 3DHNA 3THOA 1A4RA 2NSHA 5J4YA 4DREA 1YU9A 3TLGA 4UAJA 3RYFB 2UV8A 1M6VB 2RKWA 1BFDA 4YRZA 4CT5A 2C5SA 3O94A 3HCNA 3SC3A 4L75A 1PCXA 1QF9A 1UEJA 2NGRA 2WSBA 3IUBA 2HMSA 4A8JA 4DR4B 2O8CA 3LW8A 1W4ZA 3ISVA 1V96A 5ADWA 3V4OA 2H18A 5AW7A 1YSCA 2GEDA 4PWYA 1GAJA 2Q1WA 3DL7A 3TGLA 1PSZA 1WCXA 2JDIA 3CH5A 1RRFA 2GR9A 2C9YA 3GUHA 3H6GA 4H60A 3VTFA 3MIIA 1J6UA 1IIBA 1KI6B 1Y89A 2RB4A 2TMKA 3OWXA 1HXHA 4PYRA 3SLKA 3N58A 1H23A 3WK5A 5HZMA 3AM3A 3TLYA 2BIFA 2X5OA 1B8OA 1ESCA 4WFQA 5H02A 4G67A 2H11A 1KFKB 1MJFA 4BNMA 2EWVA 4PVDA 2WRZA 3KG2A 1Z6YA 3MSCA 4QASA 1LF0A 4IFBA 1TUBB 4HLUA 2BFAA 3ZNPA 5JHHB 4M21A 1EGMB 5KBYA 4YJ2B 4DLKA 1B41A 3RUFA 5DYIA 4YROA 3UWPA 3MTBA 3AZQA 5AH0A 4A7PA 1ZMOA 2W48A 2O5RA 5FAKA 2GGSA 1N1MA 2QM7A 1Y3HA 3GYGA 4JLPA 4BPBA 4X94A 3UCFA 5DZSA 1THMA 4P35A 5HYVA 2X4IA 4QEDA 1JXAA 2AG0A 3NJ4A 3E05A 5HTKA 2A5YB 2CUNA 2DHDA 2YQZA 4RHCA 1G6KA 1YGYA 1HFJA 1VIVA 2P2NA 1OT3A 2W2NA 3DZGA 3V6MA 5CBKA 1O8BA 4PO8A 1RJ9A 3ZV6A 1ODFA 4DQVA 4GI2A 4JP1A 4RM2A 3CH7A 5KKCA 4C78A 3AY3A 4NAVA 4MWBA 1WVMA 2XMGA 2ZATA 3GY0A 1HDXA 5AOCA 5H7XA 3JRXA 1Q0LA 2FSIA 2OLJA 3UF0A 3LT0A 2N1MA 2H7YA 3IEXA 3OQVA 4KQ6A 3T3PB 1RJWA 4M6WB 1R4ZA 4S2UA 3ZJVA 5ANRB 2ZYAA 2WF8A 1RKVA 3NBAA 5C7IO 4GYJA 3DKPA 2IZ0A 5CG2A 4F1JA 4BLUA 3THXA 3QYAA 3ORRA 2XEDA 4OJKA 1N9GA 1ZGHA 2D5LA 3DBVO 4LC1A 2ZI9A 2FZ5A 5AIAA 1D09A 2BEVB 3BGIA 2FZGA 3QU5A 3RKSA 3QG1A 2QTWB 3V4SA 5BSHA 2P27A 4OK5A 4PGFA 1L1FA 2IU3A 5E4FA 5JJLA 5BSEA 4AURA 5ESRA 2XZDA 1S6YA 1MF7A 1J97A 7AT1A 1NTRA 4ZICA 2ZZMA 4HWGA 4RGVA 2H52A 4M87A 3D4OA 3GB9A 1W35A 2PJDA 3BZWA 4NCHA 1T8YA 4DUPA 5EKTA 4DIEA 3HEBA 2X4GA 2GEFA 4PICA 5IKXA 1T0JB 3IXLA 2C8LA 2BZ1A 2X5XA 4KR2A 2HZBA 2AJCA 1LK5A 4M0UA 3WMFA 2IHVA 1KPHA 4N8DA 1G1AA 1YVUA 1ZINA 4KPFC 2V4MA 1DADA 4KWIA 3DS8A 5A4DA 1NC1A 1FEZA 1FX0A 1WCIB 3A4LA 4A6PA 1Z5VA 1B76A 2IPMA 3BSYA 3ETHA 3K72B 2NLOA 3TMKA 4J9VA 4CKEA 4NCBA 1WMBA 5BOSB 3HUDA 4JWKA 4NPCA 1YNOA 3GRPA 1NVBA 1HSZA 4AN0A 2SHKA 1SY7A 4EHNA 3DGFC 4K8OA 2WJAA 3NH9A 3F1KA 2AHOA 3O7WA 4ZAZA 4MLCA 1KVRA 2HIGA 3V34A 2EW1A 3T5PA 1U11A 3UMBA 3R8FA 1GZ5A 2BFDA 3FI9A 3I9LA 2XYPA 3IR5A 5E6UA 3ND5A 1XJQA 4MI6A 5F3RA 5ED4A 2BYTA 1QWOA 1HDGO 4C08A 4KOEC 3GRCA 3VJLA 5A5GA 2ZYTX 3DULA 1BXZA 4KIJA 2FKNA 3OM0A 3P4YA 4R9SA 3MLBA 1ZUIA 1BW9A 4CMGA 1M34E 5KPJA 1P9WA 2H7CA 2XVAA 3FYUB 3K73O 2OGTA 4UNRA 1U9IC 5BMVA 1ZOOA 1DLJA 1MO5A 4PYOA 3ZWXA 4EMTA 3OICA 4AKEA 2V3WA 4AZ0A 2OV4A 1TYAE 1TADA 3H1TA 4V1CB 1PZGA 4CF5A 1CP2A 2PPLA 5LMNB 4O4LA 6CHYA 1N2HA 3ZD6A 2GYUA 2XUZA 2YY6A 4KSBA 1ZY2A 5BSTA 2GH1A 3ZOKA 2C5EA 3KQLA 3PNQA 4R6WA 2OBBA 1LBHA 4BZXA 4YLGA 4G9EA 1I2DA 2NV2B 1KI1A 1F48A 3DZJA 4PN3A 1JIXA 2VDWB 4PINA 4ARZB 3AR6A 2QRVA 2WBLC 4HDOB 3C6KA 4S1VA 1G66A 3C5HA 5E0OA 4I8IA 5DSXA 4KN6A 2NU7A 3GCDA 3GCGA 4WPGA 1JAHA 1JG6A 4EI2A 5B37A 5JR3A 3H0EA 3WSTA 3WTBA 4BL5A 2N47A 3P26A 2FSVC 5FORA 3UFXA 1FYXA 4BQFA 3COVA 4Z7JA 4HMQA 3QW4B 5C1DA 2ZBVA 1ZL2A 1QHEA 2XLCA 3FTFA 1P72A 3FAZA 1A1SA 1AO3A 2R86A 3LK7A 5BSWA 4ZQGA 5CB4B 3GAAA 1QHYA 1JF8A 1XZHA 3QI2A 4TKUB 1U8UA 4LDJA 3LFHA 1JVSA 3PNMA 2QG4A 5TPZA 3VVMA 1FXSA 2VYCA 3BWCA 2ZCJA 2CJPA 4EFLA 3FA2A 3PCRB 4HRVA 1XF9A 4MV1A 3D8TA 3PC4A 4UQPA 2JFPA 4FCCA 4KO1S 4HVAA 4U7WA 1AVTA 5LLSA 3WAGA 3LT5A 3CY6A 2V55B 5D3KA 1UPUA 1M0WA 3V8PA 1YR6A 4WBNA 4QARA 1ZZGA 4MRSA 1LF5A 5JAZA 5A71A 2XA1A 3AKEA 4D96A 4Q1EA 4TWZA 1P6UA 2ONZA 3AUKA 2VHWA 3PGLA 4WOPA 4Q03A 2Q5HA 5KYVA 1AZSC 1G8SA 2B78A 4ZQHA 1JMKC 2FJUA 3WY9A 3PFNA 1ZEJA 3R7FA 1K6MA 1NLYA 2JAUA 3KQMA 4N5IX 1O03A 1XZ8A 4R1OA 5T3YA 2HYDA 2J3HA 3OF2A 1AXRA 4K9PA 5CLFA 5JY1A 3G0GA 5J5VA 1BEEA 3GLUA 1OWLA 4JH0A 2ZYWX 1NUQA 3FF4A 3M3PA 1JLLB 4OQZA 4V38A 2XZOA 3CG0A 3JQAA 4V0ME 4RY2A 3MJ4A 5K2MA 3C5CA 1GGHA 1P8AA 1YKGA 4H16A 3EGVA 4CZ2A 1Q7RA 4YRGA 3TW8B 2NVOA 2WVJA 3ZDXB 1JTEA 4OHCA 2F3QA 2Z1DA 2HO4A 4QJIA 3FHOA 3VSCA 1D1QA 4OAOA 4D5EA 5KVVA 2RH9B 3T4PA 3VSDA 5MFPA 3I72A 4I1VA 4J0DA 4KQXA 4B82A 2Q1UA 2VHTA 1O8CA 5EEGA 1N6NA 3EJ6A 1NMYA 3C8UA 4UVEA 5FX2A 3FTCA 1FS6A 3AF1A 4DLSA 2J67A 2MWMA 5BN5A 4ME6A 3I3OA 1YH3A 4KQKA 4ZMBA 1IHUA 1Y63A 1HG0A 2EF1A 3K35A 3OIDA 2WPDD 1HDOA 4HF7A 1NUPA 2C0CA 2OL4A 2YV2A 3OY2A 3ZY5A 3HU1A 4IMJB 2ZETA 4QTYA 2WFLB 1MKYA 5KYYA 3AR3A 2I9KA 3MHTA 3AETB 4Z4IA 2WJ4A 2JFZA 1P4RA 2NTEA 3GHHA 4L3WA 4MNTA 4YCLA 1Q7EA 2DR0A 3K96A 4E5PA 1E79D 2DM6A 1XWIA 3HVKA 2R8ZA 1XTKA 4X60A 4AKTA 1KK3A 3WX0A 3G6WA 5K5EA 2VKQA 1UBCA 5JSZB 5T64A 3MCWA 3VH2A 4BVHA 5T6MA 4A8TA 1SKYE 1K0FA 1MGPA 2QDXA 1UFKA 4DR7B 2A14A 2WJGA 4P5PA 3RNOA 4B6QA 1KH1A 1XRJA 2GCOB 2C7VA 2V45A 1YI8A 3FSJX 1CEQA 4FSDA 4KXVA 2WF7A 5JO9A 3ZE9A 4O4LF 4A0GA 4B31A 3R1IA 3W8FA 2Q1TA 1OU4A 2Z2KA 3HB0A 2OR3A 1I30A 1U7DA 4XOUA 1C8BA 4TL6A 3IP9A 2XUAA 1XYYA 3D02A 4DSUA 4GR5A 3NVKI 3EGCA 3H86A 5KOJB 3LX8A 5K8LA 4G0OA 4MVJA 1RR6A 1TVKA 2IP4A 1E7RA 4H08A 3QLTA 2DUWA 4JUIA 4KV9A 4X54A 3FDIA 1JRLA 1V11B 1X39A 4EL5A 1C0LA 2PUCA 3R0QA 4LDAA 2EFCB 1Y3AA 3MJTA 2DR3A 5EG5A 4Z4QA 3L1HA 2PA0A 2HQRA 3AR9A 3IPRA 4HNAB 4OHYA 4DCPA 4UMFA 3E4DA 1C30B 3GFPA 1GNVA 3IELA 1FU7A 3NP9A 5F1PA 1HT3A 3FVRA 4WINA 4DN6A 2PUAA 4DDMA 2ECOA 1JEJA 2YOHA 3ZU4A 2DXIA 2D5CA 3DONA 5F35A 1XWFA 1PJ4A 3IT2A 2IS2A 4IDGA 1OTXA 3A6EA 4D8WA 1P4GA 2PSJA 2DTXA 1W5SA 2BI7A 2PLAA 3KZMA 3OY7A 5JRDS 2E4XA 1RHQA 5FUWA 3T5TA 2JI8A 5KNDH 1PJRA 1C3VA 3A6JA 3CLTD 1IG3A 1JYFA 3KYCA 5ALIA 3TZCA 4DNOA 2ZJ4A 5CITA 1JDPA 1JIQA 1W85B 1XDBA 1P6XA 1DFHA 4KX3A 3WB2A 1IBCA 5ALSA 3EK2A 4HVCA 4LF5B 4LY3A 1VE3A 4BFSA 1II8A 2P4QA 4EI9A 1EINA 2HPZA 4CKCA 4KTVE 3EVCA 1M6VA 1YUBA 3RSOA 1R9JA 2I7CA 2J07A 3LCCA 5KWIA 2E5LB 1XCLA 4OXRA 4Q7EA 4YCJA 1JFSA 4CE6A 1TA4A 2FMFA 2H2FA 3RHSA 3UY4A 4H1HA 1LBQA 2JS7A 2GD1O 3DEHA 2VIIA 3BXEA 3S27A 5BMVF 7YASA 1YCFA 3H4VA 3V3TA 4EKEA 1YAHA 1QCDA 5F9HA 1KYXA 3DTVA 4K88A 4NCNA 1KI8A 1X92A 3TK1A 4XYGA 5K01A 3LTNC 4OKNA 3KU4A 1A50B 1VLZA 4GI5A 5KVSA 4UCQA 3TXAA 2SECE 2XGSA 3MJEA 1P9OA 2DFKB 3S2UA 1EWVA 3SYLA 3TDNA 1DAPA 2HK6A 3F49S 4AWBA 3P9XA 2B2NA 4YP7A 3IAFA 1KKLA 1X3LA 2FXVA 1TQ4A 1VGQA 2QT0A 1X42A 1X0XA 1CQPA 5KTSA 1E9CA 1GEGA 3QP9A 3T3NA 1LPOA 1PE0A 1U3WA 2V7UA 2D2VA 2IY8A 1C0IA 1P81A 2ZUTA 3VU8A 3IDOA 4YJ2A 2WEKA 3SYMA 2GDZA 3OZGA 2HK8A 4KQJA 1PIWA 4EAAA 1EDDA 3Q87B 3A36A 4RBNA 4RTOA 1L5ZA 4LJRA 3FUXA 3GPDG 1GXSA 1XKTA 3EQ7A 2W90A 4HDCA 2VK2A 4QYMA 2MMGA 4ZEVA 5DTJA 1BU8A 5IJWA 2WT8A 3JQRA 1A7KA 1CJVC 3H1BA 5IAKA 5AVXA 4NRDA 1V8OA 1LLUA 1W9HA 2Y0BA 2ZRHA 4KXWA 2PRYA 4ZQFA 4XWOA 1Q7BA 3HXQA 1SXJD 3NFYA 1NAHA 1B7GO 4JXXA 2QVBA 1RHRA 1YBMA 1MB3A 3W5IA 3AFMA 4HYYA 5DULA 1LLDA 2A3RA 4M0DA 5CBPA 2H9YA 2Y66A 4HLDA 2WSSD 3K53A 1RHMA 4R9NA 2ZWMA 1GUZA 4CDRA 4RXMA 2VP5A 1KVSA 2D5BA 4P82A 3FB4A 1IBRA 4AJPA 3URMA 1SRRA 3CW9A 3IMFA 3IYLW 4IIJF 4JT4A 2FRDC 3WLSA 4EZEA 1RACA 2X6QA 3IJ5A 2JB9A 3AERB 4B73A 4KE7A 1WB4A 3HZZA 4GUDA 3S5JA 4DHWA 4TYNA 1N9GB 2GBGA 3DVLA 1P8JA 3HS3A 3QBTA 2C59A 1Q2UA 2OQRA 4QX6A 3TSCA 5AJWA 3LUKA 1DU4A 4RVOA 4BQOA 4BEWA 3CVUA 1DBSA 3A58B 2IS1A 3ESDA 5FYDA 3W34A 2ZVJA 1V5WA 4YRLA 1XEWY 3REGA 2BTQA 1G1MA 1WAMA 4NBWA 4MGKR 2IGBA 2A0UA 3NM6B 3IHLA 3BK1A 3K32A 1ESEA 3AB8A 4GLLA 2RJOA 1FBTA 3RG2A 5AJUA 4R3UC 1M2HA 1GFSA 1BX1A 2GM3A 5CDTA 7MDHA 5K8JB 3O2SB 3UBTA 2H1RA 4DLTA 5B7QA 5ADUS 2ILVA 2P9FA 1QZZA 3FFWA 3RK4A 2KBFA 2PY6A 1PT6A 4HGNA 1IN5A 3OD1A 1GKLA 5IT4A 1XCOA 3ISTA 3ST7A 2RGNC 1G60A 3FZNA 3RV4A 5HQ3B 1UWCA 1ZSVA 4QDTA 2VSXA 1LI5A 4NLLA 1UBSB 3HBMA 1JSRA 1JIJA 2BGLA 3S2FA 4UHFA 1DAIA 5L95A 2ZCVA 3FRIA 3GV0A 3IOEA 3L4BC 5CVVA 4DWVA 5SZHB 1I3OA 2IVFA 3BXXA 4GQBA 4JGBA 4LHEA 4YJKA 1UXOA 1Y9AA 2XQVA 1UKVY 1U2RA 1N4AA 2OCKA 3RS5A 4QODA 2YJTD 3IPLA 3JAKA 1FA9A 2F4NA 4O2BA 1S9DA 4UBJA 1Q77A 1GPWB 1NRXA 3FHCB 4LX0A 4AT1A 3LA8A 1ZBDA 3U3MA 3UJ3X 3ORQA 1IEWA 1Q12A 5DVZA 2ORIA 2Q3DA 4NKRA 5TT1A 3RASA 4HGOA 5DEOA 5HFAA 3G2HA 3PICA 4EJ6A 2QRJA 3KB2A 2KI5A 4JI3B 4NFSA 2WILA 5BR4A 1XOIA 2BI8A 3KJIA 4TTAA 2PGDA 1RE0A 3CN7A 3LYUA 1BKDR 4G85A 4G86A 4EWLA 1S2GA 3M1AA 1KH2A 3LUFA 3ZQ6A 1SQFA 5I4KA 4DARA 4YHHB 2YX1A 3R6GA 3ZWVA 2YZKA 3K0KA 4JQOA 2A2ZA 4LI3X 3TN7A 3HEAA 4UJ5A 4B5LA 2FW9A 2WUEA 5I7HA 4N3GA 1JL3A 3GJSA 1ECFA 1E64A 4NOMA 2OM6A 3CR8A 4INPA 2AQ8A 1NASA 4MI3A 2JGMA 5JSFA 1RXUA 3G13A 4QO8A 1X1RA 2R65A 1FUUA 3NI2A 3QVVA 1ZGCA 2JHGA 3BULA 3LC1O 3MWEB 4K9LA 2QYSA 4B85A 2WJPA 2BLNA 1WL8A 1QHXA 3M9XA 2AN1A 3K8QA 4JSRA 3HCRA 1Q22A 1WULS 2BKXA 4P9NA 3SOZA 2GJKA 2BR5A 4JI2B 1M8KA 1Z6XA 4ZOAA 2LCIA 3VHXA 4HNSA 3FBGA 1XZCA 2D0IA 2Y2VA 4M1OA 4M3NA 1IQRA 4UPEA 1CY0A 4RQTA 2C2GA 2V7QD 4QQRA 3IRUA 5INTA 1ZM7A 3SQWA 3G5UA 3ZDEA 4KPEC 1JEOA 4RJTA 4IXNA 3ORFA 5HSGA 4N8EA 2QTNA 1QDLB 2GI4A 3GLHE 4IXDA 3ZV4A 2Z95A 1ZCBA 2EU8A 3LKZA 3WK6A 1NBMD 5L7TA 2HJ9A 2JFNA 4XM2A 2SNIE 1JFVA 2YFHA 1UBKS 3IESA 4RXTA 4WXEA 5G3YA 5HFNA 1GVHA 4E21A 2CJWA 1OH6A 3WQRA 3DVQX 3NTUA 3QPCA 1O0BA 3EOAI 5IAGA 8AT1A 4WZBA 1W46A 2GA8A 3I8SA 2R7LA 1PF7E 4RWZA 4XASA 4ZO4A 4C06A 4R9UC 5IZCA 4IAOA 1TXGA 2B4QA 1IDN1 5LP6A 1V45E 4UHDA 3BMQB 1CFJA 1UMCA 1LNQA 5FA6A 1H0SA 5DGCA 1EX9A 5A7FA 3NBQA 1FLNA 1JLLA 4C1BA 5TQJA 1ZM2A 2FX5A 3OO0A 2QBYA 2EL9A 4N65A 4XAQA 1DUIA 1N2IA 2E18A 3JW8A 3KYBA 3ZHVA 2DULA 2O6HA 1RRGA 3MRVA 3OHPA 3L0CA 3P32A 4K3VA 2FETA 2RD2A 3HMKA 1EM8A 3QFTA 1S02A 5TS2A 3VU3A 1SBNE 1GT91 2JK1A 4OP2A 1L7MA 2J0SA 1N5LA 1B0UA 4KREA 3OP1A 1IHOA 1YU6A 4OSPA 4BKPA 5BPHA 2Q45A 2VBFA 3WB1A 2JFWA 2D0OB 4H77A 2XCSB 2DKNA 4OHPA 1PYOA 1A8SA 5EIAA 4PVCA 5LQRA 3UMCA 4DLNA 3IUMA 1HT2E 3H9UA 4IIEA 4FBGA 3UJ9A 2ZYGA 2PAAA 3KR2A 4KL8S 4MEBA 1Z39A 4F3NA 5KYYB 2BVNA 2HZ7A 1SQ6A 3P20A 1WZIA 1FUIA 3I01A 2PK3A 5L4LA 3E6AA 1Z33A 4F91B 3BIFA 1EA7A 1JT9A 1DG1G 2X8BA 2JFYA 9LDBA 4GGPA 5JALA 2IYRA 3D31A 5EHQA 3A1NA 5DRTA 4JK3A 3GR6A 4PQFA 4ZEOA 1G19A 5ICMA 3JQ8B 5DK4A 4RELA 1U3CA 1Q0HA 2RH4A 3QYPA 4MLDA 4V0SA 4BNKA 1ZR2A 2B83A 3A6GA 2I7XA 3E82A 5DYTA 1ZJZA 2R00A 2VI5A 3UEOA 4C2BA 1WCWA 1F5SA 3B1JA 5CJ2A 1N34B 2QUBA 4OMCA 3HPQA 1F2TA 1X74A 2VCEA 1VYHA 2I4MA 2VJMB 4BNVA 1JG4A 4QVGA 1WOYA 2C2ZA 1HLPA 2NM0A 3U31A 3KD2A 2WQ6A 4MUBA 1FFYA 1EXNA 1J00A 1A88A 3VZCA 4EG5A 3SIPA 1OFTA 2IXFA 1Y9EA 2QX7A 1L7PA 5JQWA 1NV9A 3M5PA 4FQ7A 3HBFA 2AFRA 3QTLA 4LWOA 2PS9A 1Q3HA 4LRQA 5I4BA 2H1LA 2ZB7A 3GBSA 3OAAD 4KK3A 1PG5A 4GZ6A 4Z99A 3OZUA 3PG5A 1KEVA 2HUNA 3LDHA 4XVHA 4F92B 4Y9SA 3WL8A 1X9HA 5FWAA 2GTIA 3EVGA 4DMGA 4ZCPA 5BR1A 5C1OA 3UPTA 1F7UA 3WMWA 2QN6A 2XTZA 5BQ3A 1THZA 1KOLA 3NYIA 4OL9A 4TLEA 3ZU2A 2V65A 4W7HA 2WWVD 1JSLA 4CQLA 2ROQA 1L5QA 3AR7A 4I55A 1W0JA 4Q3DA 4D57A 1G17A 5ILOA 1YL6A 4HGQA 4AG5A 1RQPA 2W2OA 3K9BA 3IAXA 3VDMA 3KVOA 1UKYA 2VVTA 1SC1A 1Z8FA 3DDNA 2DFTA 3OMXA 2PFSA 1P3Y1 3WIOA 4Z4CA 3L6BA 1I7NA 3GCWA 3TIIA 4I4TB 4D4IA 1PUIA 2ECQA 3CZ9A 5IYZA 1Q1QA 3N39C 5KQPA 3DKKA 3A27A 1QQ5A 1VJDA 1HYEA 1IIRA 1YCGA 4LSMA 4DW8A 4EFMA 1ZVMA 3LC0A 1J8QA 1NNEA 3FPHA 4ENQA 3TRFA 3OEHA 5FWYA 3LVBA 4EF6A 5IT9A 1KAMA 1N32B 5GONA 2AQIA 4O6VA 2ZPAA 3OQPA 4RLSA 5HGJA 3AKYA 3RUDA 1WNFA 1N3LA 4E2XA 4MP6A 5D6OA 1V95A 2AFIB 3H0KA 1YIOA 2GCEA 4HN9A 4JJ8A 4MZXA 4B3IA 3KIPA 1ZJ4A 2QU8A 5TPZD 1E20A 4YJ3A 2YIDA 1A3CA 1XC7A 4G36A 4K6HA 4BFZA 5TX7A 4K2HA 1U1EA 2XE8A 5AM2A 2QT9A 1R4MB 5KC9A 1FMCA 5CW2A 3OPXA 3I0NA 5TF4A 2I66A 1G18A 1FRNA 3M6LA 1R8YA 4G0WA 3TW6A 1YQGA 3I05A 1RCUA 4N3BA 1P7PA 1FPQA 2I6UA 2YWEA 3GJ8A 2RKOA 3ICPA 4GE3A 4MWZA 4CIAA 4WAUA 1L5KA 1C14A 1U1FA 2VUHB 3GEHA 4C21A 5LMUB 1FMTA 1BROA 3AGQA 5A9SB 3UMSA 5KZMB 3VV2A 2IHZA 1ISSA 5JC8A 2HM7A 1J8FA 2G3YA 4E6PA 4EUKA 4RHXA 1U0LA 1R5BA 5DM1A 1X8LA 3ADPA 1P2BA 1T4DA 2JAPA 1ZH2A 4U0JA 2WJVA 2FN9A 4PLGA 5CA1A 3D43A 3OFVA 3ZWPA 4AJLA 1IDOA 1N3YA 1N9ZA 4A92A 3OX2A 4DJJA 4NPHA 1L8LA 4NE7A 1GZVA 1JLSA 3MC1A 1L4KA 1UXJA 3BXOA 3ITNA 1G8HA 4A5OA 1EFCA 5KHAA 4DJDC 4F2HA 1DQRA 1TTQB 2XWQA 1F4PA 1GG9A 3QBJA 4MUAA 4WERA 3FKSD 3C3JA 1PZNA 3CV3A 1WMEA 3FVWA 3KT8A 1YS1X 1K7XB 4G9GA 4IGEA 1XO1A 4L0MA 3DXZA 4OHKA 5AT1A 3CNOA 4H7FA 4TV8A 4L16A 1NP7A 4RA9B 2BN4A 1A2BA 3RR2A 4MR8B 1LSOA 1EK2A 3RU7A 2WPDA 1NULA 1WB5A 2QJRA 3EAFA 4HYQA 3ZK7A 1NXOA 1EXDA 1I3NA 5CFNA 4GQAA 3W8NA 2BGNA 4HYTA 1F8UA 4NWIA 1QQBA 1X3SA 1PJCA 3X2FA 3A1TA 5D3ZA 3JWPA 2WD8A 1X8XA 1RQGA 3BE4A 1FMJA 3FYDA 2W37A 2IYQA 4LEIA 1MC1A 5GM2A 1E2UA 2ZOSA 2WB2A 3JVDA 2HRQA 3OLZA 2RARA 3JD4A 4L27A 5CDUA 4L02A 1J20A 1NLUA 2V96A 4EJSB 5K99A 4I6JA 3UMJA 5F9MA 3ANTA 1UXKA 1Z17A 4BLOA 4ZQEA 1QOPB 1UDBA 2CDAA 1N5IA 3BXFA 1XZQA 2G36A 2WG1A 3H16A 5JNUA 3AUYA 3ZVNA 3THWB 3HKBB 1D8AA 1GTZA 1OLXA 4X7BA 4NXMB 2DE0X 2D6FA 3BA1A 1SIUA 4U5QA 1KO5A 4HADA 4EX6A 3H5RA 3OUUA 1AO0A 3DD1A 5KYXA 1DC4A 1QTIA 2Q4TA 2CXRA 3TQHA 3EULA 4Y2UA 2HRDA 4URXR 4S04A 1ZK3A 3ESAA 1VMAA 1XD2A 2AMJA 2GHTA 5EWJA 3OTHA 3D2BA 2X1LA 4BO9A 3L8EA 7ADHA 3IPXA 4I1PA 4KQ2A 4R1QA 3WLPA 3ESBA 4HAXA 3FTPA 4X7RA 1D2AA 1TC2A 1C4KA 4ND3A 4K2AA 4UDXX 2V1UA 1NATA 3TF5A 1T9ZA 2F3PA 3F6EX 1TO2E 4ZDKA 1MX1A 1K0UA 2ZYDA 3GWZA 2J3DA 3IT0A 2B1JA 4DQKA 4EB6B 4OQMA 1NMQA 2H00A 1Q0RA 4IDDA 2RHOA 2C2WA 4M8SA 1ST3A 2BMJA 1KYYA 2EZUA 2OLKA 2WJHA 2FP3A 3V1TC 2C9ZA 2JFOA 2ZAIA 3FPBA 4M37A 4NX2A 5ITZA 3IL2A 1O08A 5CH8A 4H0CA 1SCJA 4X97A 5LL6P 1GTL1 2J6IA 1PJQA 1OX5A 4DC9A 3F3KA 3QEAZ 5HX7A 5IASA 4WACA 1GUDA 2DJ5A 2WP8J 4AQDA 1KARA 4RTKA 5HUJA 1T0BA 3RAFC 3O8NA 3NNNA 4C01A 4CGYA 4EZBA 5CD9A 2JJYA 3GAZA 3RWOA 5FFMA 3UOAB 5FPKA 1S89A 2R7AA 3PNOA 4O8CA 4D6XA 5AHRA 1OYWA 2DQSA 1L7QA 2H7XA 5KWJA 1XA4A 1P73A 3GFFA 1E2IA 1EQUA 1I0ZA 1RKQA 1E3IA 3FMPB 4ER0A 4JCOA 1TMGE 4G07A 4A8JC 2L42A 3MWGA 1R64A 3V2UA 4FBLA 3ZGVA 5IABA 2XRZA 5B2EA 2EBHX 1FFBA 2HNBA 2ZU6A 2E3JA 1S3FA 3O38A 4ZEWA 3SFZA 3DE1X 3G3EA 2XXAA 4EJ2A 3I5MA 1CUGA 2RCNA 4UVIA 4D2IA 4UFOA 3S7TA 2O2IA 3HKEA 4BB9A 5ENZA 2G1AA 1A8HA 4DMHA 1GPMA 5GZ1A 5DYNA 4U9IS 2B1RA 2CHGA 4R2JA 1TM4E 3WGHA 4X92A 4ANFA 4D9NA 3OC0A 4MV5A 2AK3A 2WU0A 5F5NA 4DLBA 5I01A 3ORSA 4GMHA 1GQQA 2P69A 4IHAA 3CZ4A 4TT3D 1PR4A 1WXEA 1XQ6A 4AS2A 5SZKB 4B4WA 5C4MA 4LC0A 4DBLC 1RZRA 1IN1A 2AJLI 1RAFA 4Y6OA 2HXYA 5TNXA 1PL6A 3FJOA 1XTIA 1FDUA 1U9CA 3AHEA 1USWA 1E7SA 1ZOPA 1D4AA 3GDWA 4MYDA 4WXHA 5T57A 4EG7A 2AN9A 2O4UX 3H3JA 3RRFA 4G5SA 5LD2B 5AYVA 1WHTA 4HDQB 3VHXB 4FX2A 4MAAA 4C2TA 2P4SA 2DKOA 3D1LA 5BN1A 3WL4A 2DT5A 1M7BA 3IMCA 3PZRA 4II2A 5GWXA 4DLUA 3T5CA 5ES3A 1XK6A 1ZUD1 2JFBA 5TEVA 3OM1A 5KSOA 5TJ9A 4KLZA 3RFXA 3N5KA 4JYAB 5B7PA 2QLBA 4AXBA 3FVTA 2R97A 4KAXA 4F5EA 1P4HA 3HNOA 1AQJA 1Z0KA 2XVMA 2XZPA 5IF9A 1AUQA 4WA7A 2ZI6A 1XROA 2CJWB 3AI3A 3FDFA 2H4YA 3PNSA 1WPGA 3C98A 2P2GA 4HWTA 2YY5A 2AQKA 4KPGA 2WSSA 4PGHA 3ZYCA 4AF6A 5GADl 3BWDD 4AMZA 1PFQA 1ILWA 4M1MA 5AK0A 4ZAGA 3JQPA 2OP0A 3NATA 4FYHA 5DWDA 1JA9A 5AP9A 3KQWA 1YDGA 1XQ9A 2IYFA 3JZAA 4QRDA 5K0BA 4W1QA 3P0HA 2CHQA 3OFNA 1S8OA 3HDYA 3MGCA 3VNQA 4B3FX 1HEIA 2X22A 1MDBA 2ZDQA 1SUBA 2BE9A 1J2JA 1UMCB 4K40A 1JQKA 3DMGA 3F5MA 3LPNA 2Y27A 5H9WA 4LF7B 1BCSB 4L28A 4MWDA 3E0XA 5AW6A 2ZJ7A 2BKEA 4WKGA 3RAPR 1DNPA 1H3NA 1IXKA 1PS8A 1K7EB 3DO8A 1NX9A 4Q9HA 5JG7A 3CEAA 3TD2A 2IL1A 5AM4A 4IQFA 2ZJ0A 3CKLA 4M1QA 4D3YA 1IBMB 4J0FA 4KU4A 1ABBA 1AH2A 2FWIA 2UZ3A 2XKAA 3OE7D 1GTJ1 1E32A 1T4CB 4FHFA 2CBGA 2P2YA 4TWBA 3TL6A 5JJBA 2JHCA 4UMDA 1C8LA 1SA0A 2BGKA 1X80A 2R6R1 1N7GA 1YVDA 1XU7A 1C9MA 1OY1A 1WEKA 4IEIA 1JP7A 1WD7A 1GJRA 1ZIPA 4YAOA 1LVHA 5BWCA 4PYJA 4KFSA 3EF0A 1BN7A 1AX9A 1QO7A 2CVFA 1NYTA 3HXLA 1H42A 1UBEA 1NUTA 1YIAA 3G85A 3JYQA 4GVPA 5LQKA 1OD6A 1EJ6A 4TS9A 2ARKA 3WRWA 4JX8A 3HYRA 3IQGX 3HKCB 1R3UA 3PXCX 3FNEA 1JDSA 4TVSA 1RS0A 3CE9A 3F71A 4YV7A 5K3EA 3BMNA 1KP3A 3Q5DA 4A6EA 3WZLA 2ACKA 1Y8RB 4LJSA 1RNLA 4FNMA 3RIMA 2D2IA 1RHJA 2FNAA 5KVQA 1A8UA 1VPEA 3RUEA 4DM4A 4EJFA 2O7QA 5LPNA 3TNJA 2QR3A 4UAUA 4IF6A 5HF8A 2X15A 3U19A 4P3OA 3HB7A 5E3IA 3RHZA 1YKSA 3R6LA 3BWXA 4DNPA 4D0NA 4BFXA 4RTQA 1H8HD 1T5HX 5AFSA 1VJTA 4AKHA 3TOXA 2FLVA 4PC7A 1X1SA 3E7WA 4AG6A 4CI0B 3KFXA 4JUDX 10MHA 3PJRA 2HCFA 2PVCA 3DOOA 4HWSA 3AESB 1T3LA 2BM9A 4J8PA 4IMRA 3NO4A 4CEIA 1O6FA 2FP4A 3S0JA 1HPLA 2OD7A 1T29A 5THQA 3EPPA 5HIJA 5EIBC 1VG1A 5EJ2A 2DWUA 5ICFA 3ZDBA 2XUOA 1Z5ZA 3DL2A 5CLHA 4DIOA 3HU3A 4M99A 3DAPA 5ALVA 4PPFA 1RPZA 1RE1A 1FK8A 2R751 3HJBA 3N5CA 4HDRB 4NU5A 1ZEMA 1ZP6A 3B2EA 4XDGA 3RTGA 4DYHA 3AV3A 2G0AA 2W98A 1YZLA 2SKCA 5ALHA 2JIDA 1Z45A 4JBWA 3I62A 1YS6A 3E84A 4WOCA 5BT8A 1JJFA 3BGSA 5AM1A 1KZ1A 2ZAGA 4ZAWA 3KUUA 4FOSA 2TYSB 3W9BA 2FN3A 4AU1A 4ZCTA 2H07A 4I7EA 1MQAA 4HB2A 4LTMA 1C5KA 2ZIWB 1QH0A 2FMUA 2FWPA 3KTOA 4DLPA 1FXWA 5FBQB 3T9CA 1E1MA 1UAAA 2PSEA 3RC3A 2P67A 4L5AA 3BBLA 2W6MA 1GTG1 4A6XA 1FL9A 5F78A 2QHXA 4MQMA 4I1IA 5FWYB 3IVRA 1PJ3A 5H70A 4JMPA 4PHCA 4PPYA 1IPHA 2BGUA 4BX0A 1BFUA 2CLCX 2HBRA 3FB1A 4FEAA 1YMUA 2C7PA 3BMCA 2RHCA 1IUNA 2AFIA 4AFNA 5BNWA 2PDAA 1G5RA 3M89A 3H8SA 2CXHA 4PS0A 4UTNA 3ZDDA 1ZUNA 2IDJA 3GVCA 4YJ3B 2GD0A 4D9FA 1XU9A 1QQ6A 2V0GA 4KV7A 3RODA 5KMGA 3C3YA 4BKQA 1R4MA 2Z0MA 3CZRA 3M4XA 1P19A 2HR1A 2GBFA 5IJ0A 2FW7A 2JIZD 1LUAA 4JLKA 1U7OA 3T61A 2KHZA 4QYTA 2BR4A 2A78A 3ZCVA 3GLKA 2J3JA 4CDGA 1FYFA 1E3QA 2Z4TA 3TFOA 5FTJA 3N7AA 1G3MA 4CQNA 1M2OB 1I10A 5C4IA 5KIAA 1T10A 1GRRA 1TFUA 4XCXA 3IEMA 3JQGA 1O6BA 4PHTA 3A8TA 3NORA 3PITA 5FI0B 1D6JA 4KKXB 2AOWA 2ZT6A 2HADA 5KINB 4FK8A 2QWXA 1ONBA 2PGIA 2UYOA 3QX7A 3HYTA 5J2UF 4GWGA 4FOPA 5EZYB 2OUIA 4KQIA 4F0JA 1BE8A 5EQDA 1SVNA 3MTGA 1OZAA 4TS1A 4ZO8A 1Z74A 3OQOA 4MHOA 1QG4A 2GBLC 1ISIA 2C98A 2UZ0A 3OJWA 5NULA 3RFTA 4BRZA 4E1BA 3UHAA 2FTKE 4XSVA 4LWPA 5A6SA 4E4YA 1HE1C 4IXMA 5ALNA 4XR4A 1A9ZA 3EUWA 3CH4B 3ZWYA 4AX4A 1JX6A 2GUGA 4KGVA 3DGEC 1NVXQ 1QHFA 4JLJA 2VHVA 1FJ2A 1KY3A 3C70A 1M7GA 1P44A 3DEKA 3OOHA 2OESA 3NXSA 2QAJA 4D41A 1OPXA 3H42B 3T7JA 2RBGA 5B4TA 3X1MA 3CNBA 3BK7A 4S2EA 3WYNA 4E07A 3TW0A 1AUOA 3B6IA 2EZ9A 3FCOA 4RA9A 2Z3WA 2IIVA 2FPKA 1V48A 4KE8A 3GJ7A 1SG6A 1YT5A 2C4KA 5AJYA 1FP4B 3KLPX 1UZLA 3U7QA 4E1VA 4KB5A 4IGAA 5KAPA 2QTMA 1OU0A 4ZDJA 2YRFA 2YBEA 1F9EA 3FLMA 3JPWA 4CF3A 4J3JA 4ETNA 1KOGA 3JXEA 4EMUA 4OOFA 2JH9A 3WGZA 4BGVA 3ROGA 3H04A 2CNNA 2J6BA 3CRZA 3LKBA 4GZLA 1XCPA 1VE1A 4MUEA 5DHFA 3Q2IA 3NNSA 5JMPA 4KXUA 1SN7A 2H3EA 1P17A 4BMCA 1B4DA 2PV0A 3FPEA 1M2FA 1GL7A 1L5GB 3QA3E 1Z7BA 4MPTA 3U4DA 1E1YA 4O59O 1LLFA 3G7SA 2AXNA 5LYJB 4LXGA 1SQSA 1E60A 4PAWA 5GVSA 3THWA 4ARIA 1AHIA 1M2EA 1YACA 4Q3CA 2Z56A 4CDMA 9LDTA 5JQGA 1O3YA 4ZQIA 3EXHC 3MOIA 2QN3A 2C5GA 3MMNA 3BKWA 1O7JA 2PGJA 3PUIA 3DM5A 3RU3A 3UVEA 5MGNA 4RULA 2Q4DA 1JR3E 2FZEA 3CJRA 4IJWA 1XN4A 3PL5A 2HHJA 1V25A 3G8AA 5TQ2A 1OROA 2IZOA 4XWGA 3DA8A 3RU2A 1BE6A 1UBNA 2EHJA 1DKRA 4O2LA 2CKDA 1RJEA 1MO2A 1Z0AA 2QMYA 2BH9A 1FFGA 3F9IA 1QRAA 1M1XB 5FF9A 2WPNA 5AVUA 4KQCA 1L5WA 3DZ8A 2G76A 5E4YA 3QXJA 3RFFA 1WCYA 4LJ8A 2PUWA 2UVDA 4J2HA 3QXXA 4DDUA 3U7IA 5AQ1A 1EQ2A 1U0HC 1GZ3A 5AKJA 5JZBA 3FIUA 3I6IA 3WGJA 4TUYF 3UCXA 1O5OA 3GJ4A 2Y67A 4RPLA 3UJPA 4G84A 5D6NA 1RWVA 2VPZA 2XMSA 2XWPA 4CFZA 1QH8A 2GVNA 4B83A 4DEXA 5TGDA 1D4OA 3NHMA 4LG1A 2C00A 5DPMA 2EJWA 2A0KA 4U2KA 2BHTA 1AZLA 5DSZA 1N2CB 3OQHA 3A70A 1S9HA 1HE4A 1QC5A 1SM4A 2JJ1D 2O3UA 1EE2A 2RMKA 3KHKA 4HDMA 3OD5A 3ZX5A 4WZ6A 3W4KA 3R5KA 4JLUA 2V7GA 1WX1A 3CIOA 1FC0A 3WK9A 1U3UA 2GSWA 3AZPA 4CEJA 4UHJA 1GADO 2DTDA 3C0KA 5CA0F 3IHWA 3M70A 5DCUA 2JRCA 2XCOA 5LQCA 3O21A 4ON9A 5KJEA 4DY4A 1GKIA 2DP4E 1LTQA 3DBRB 2X7HA 3CZ5A 3IKVA 1IZ7A 4OAPA 4I1RA 3LM8A 3R3YA 4X6XA 4DILA 1NN3A 4Z7NB 5JBNA 3FRJA 1KI7A 3T5MA 4AL4A 5CGQB 4GG1A 5BOVA 2J5BA 2QE6A 4OX9Y 4GAEA 4H9GA 2G71A 4US0R 1T3SA 6ADHA 3ELDA 1U7TA 3V97A 1WZCA 5EHZA 3CPSA 3EXFB 3PKZA 3SYRA 2W4MA 3FRHA 1I80A 1SC4A 1ZWLA 2FPIB 3QELA 4LOAA 4WKBA 5EESA 2WR8A 3W5SA 4BX9A 4HZUA 4BQIA 2CLFB 5EWMB 2H85A 2H8KA 2JF0A 1MO3A 2V3VA 4XLZA 2YYAA 4JYZA 1QO0A 3ICCA 4JDPA 1T24A 1G3QA 3I04M 4N4AA 4OQEA 2BW0A 4OJNA 4DA4A 3KRTA 4C76A 4W8OA 3UHOA 3VHRA 3D4NA 2Q8PA 1QE0A 3W7VA 4R2XA 2XB2A 4B17A 1HX7A 3WLIA 2WSIA 1OTYA 4PWZA 2HMWA 2ZSAA 3NW9A 3D3WB 4P54A 1ZITA 2PG3A 3TUZC 2V9PA 1ZMBA 3STUA 2VPQA 3ET5A 3OQIB 2I6SA 3AHFA 5EC8A 3NV9A 3IBCA 3OC6A 5JZVA 3TFQA 2G06A 2IP2A 4NBKA 5IX8A 3THYB 3AI1A 4ZO7A 4F5WA 1FU4A 5ECDA 5FI5A 3P4XA 5H81A 4DSNA 1KR2A 3A0UA 3B70A 3TAXA 4ILEA 2R8BA 2ZKIA 2ZSDA 4UPDA 2WM9B 5LYYA 3ABSB 4NR0A 2YFQA 1H9CA 5CFQA 3F5QA 4HAWA 3VISA 3EWNA 3ONFA 2FYTA 3GEEA 4FNAA 3V4PB 3MUNA 4JBLA 1EVKA 4KI7A 3NONA 5FNVF 4GOXA 3UM9A 7REQA 2IQIA 2YINC 2ZB3A 3DLAA 3LP8A 3RT9A 3ANXA 2ZJ3A 1N25A 3O4FA 1VSTA 2HLDA 3WK8A 3L8ZA 2P2ZA 3QITA 4K6MA 1XN1A 3SSOA 3QX3A 4OGFA 1G64A 1Q1EA 1XXHE 3LE8A 3WLJA 3K0SA 1OGYA 1SUWA 4XIIA 1AURA 1XDSA 4XWWA 1DRVA 1ZS9A 3NWPA 4NYMR 2FK8A 2HRBA 5LDGA 5DWVA 4RJLA 1UJ6A 1UR5A 1IULA 1JLKA 4AD8A 4YUXA 2JZCA 4CCAA 1JH8A 2DY0A 1Z6TA 2Y99A 5KTKA 2GM9A 2FN8A 1CQWA 3I9FA 2NUAB 2IWRA 1QGDA 2PHZA 3K2IA 3BD7A 3QFFA 4RZQA 5JJIA 4E70A 4I5FA 5KUTA 4ZVOA 3TNYA 3ZWCA 3U4HA 3S5UA 3KJGA 5PNTA 1AMNA 4UZSA 2VR1A 3E81A 1ZGZA 2VAVA 2IVZA 3NV7A 1ZSYA 4R05A 4QA9A 1HY3A 1NSFA 3OJOA 4N0PA 4B6PA 3U7GA 4XYBA 4BQNA 2ODEA 3U60B 6REQB 3KOUA 1X0VA 1K8ZB 4YS6A 1KBZA 1B8NA 1PL0A 3AHHA 3KWMA 4ONEA 3VXKA 3VKUA 1WTCA 3A06A 4D25A 4TZTA 1Z06A 4R54A 5REQA 4DIMA 4ERXA 3U2QA 3RSZA 4Z9YA 4HQOA 2Q62A 3G49A 4XD2A 2G9QA 1BA3A 4MVJF 1QAOA 3M49A 4XQEA 4U9UA 4BLPA 1KEPA 2I3BA 1SUSA 3U3DA 4A36A 1PFGA 4Z3KA 1YBAA 1Z2CA 4UNQA 5C3UA 4AZ3B 1TZBA 3BWYA 3CUYA 3IJRA 2Q0SA 3OEYA 4Z4HA 1G5FA 4CQMA 2H8GA 3DHEA 2Z9BA 4G0YA 4K6KA 1HTBA 3PUWA 1R6UA 3GGPA 1EFPA 4Q3BA 4MR9B 3QKRA 4U39A 3K9FC 5EE9A 1KI3A 5GJBA 2BD0A 3KWLA 4G5OA 4JLOA 2WM8A 3KKEA 5DHQA 5C7OO 5AVZA 3DMFA 2LCFA 2Q3CA 4OQDA 4Q9KA 1DRJA 5AVTA 2JNWA 2UKDA 4JT9A 3JRWA 5I47A 1UKEA 2QF7A 2NXWA 2GXQA 1DOHA 4JLSA 3WO1A 4PAMA 2P9QA 1EEHA 4L5IA 4ARUA 4EGFA 1TYBE 2D3WA 4A91A 5K3DA 3VZQA 2Q1SA 4CLEA 2DBRA 1NXTA 3OP4A 4OEHA 5D3MB 1J90A 1UZAA 1ZIOA 2FGJA 3RS3A 2GPSA 1FTWA 1RQXA 3X1XA 1FDTA 1R0KA 3QHPA 3K09C 3RAJA 3RSLA 4RAOA 1W30A 4HTAA 1Z6PA 3CGGA 3H75A 1UDCA 5ALEA 3TUIC 4F21A 4HDRA 2VBIA 2C5LA 4JJ6A 2OYCA 4PR0A 1VTKA 3WV5A 4PC3A 2P4HX 4KGZA 3PUXA 2ZB2A 2NVWA 2F00A 5FPYA 3KV1A 4N5HX 5LD2C 1KNXA 5DCWA 4R2WA 4BJ6A 1YASA 2JLBA 2CYBA 5CVCA 5GPBA 4G4IA 1B14A 1JH9A 4K05A 3K4QA 4Y1FA 1U63A 1GL9B 4DKJA 1GG2A 1RZRD 1XI2A 5EHGA 3BH7A 4Y1EA 2DBZA 1XQXA 2JKVA 3B1WA 4PX2A 1RIFA 5DE3A 1MQ8B 5HCIA 2XKKA 4JJEA 3OT5A 1TM3E 3PXDA 5GP1A 1GL6A 2BFFA 4ZOLA 2Q9CA 2G1UA 1KPIA 4LUCA 1HNNA 4TWIA 1G5QA 2YNMD 3WYGA 1H4QA 1FYEA 2HGSA 1AQYA 1T1RA 2WUFA 3BMCB 4ZKEA 3TLGB 3ZGLA 5BV7A 1WETA 5ABPA 4PONA 3CWQA 1GZ6A 4DZRA 4BEJA 3CWZA 3WLNA 4IUYA 2BHRA 1KU6A 5TMBA 4MA5A 3K7EA 4OQYA 1VRVA 3A3PA 1DIOB 5JD3A 5CH5A 2GS9A 2I55A 4R8KA 1A7UA 4QU8A 3I76A 3L18A 3MCUA 2CFOA 1WZNA 2CJXA 3M6FA 5CNMA 4D4HA 3EVBA 2C7QA 3W3AA 4P5DA 1KMCA 2RFLA 3FD8A 4NHOA 4NS4A 5ALDA 3WRYC 3ESCA 2Q6OA 3ORHA 1GFWA 1HDZA 3VPHA 2GZ3A 1RLOA 3P27A 3CNLA 4Q3AA 4KNYA 4P3PA 1MZVA 1CTQA 3JQGB 4QFBA 2WIBA 2M9MA 5BSGA 1FU8A 4O5OA 1S8AA 4R2KA 3JVUA 1G38A 5JANA 3CF4G 4KNVA 3JWHA 1NZFA 3BB3A 1C1DA 3HCPA 3QNWA 4EY8A 3K9NA 3HJUA 5DXJA 1W87A 4UEOA 3SXPA 1UL1X 1EFTA 1TU0A 3A1DA 4CKBA 3D5EA 4PGGA 1QH9A 4TSRA 4XA8A 1F2DA 4AJ2A 5KVCA 1LQTA 4Y2SA 1FMFA 3ZBPA 1I7PA 3R6WA 4IIDA 3HJAA 1R0RE 4D9BA 1DMSA 1XIVA 2C94A 2PXXA 4N6GA 4MHSA 2JLAA 3T9FA 3OE7A 3LLMA 4HLCA 1EVIA 2WTUA 4J4HA 2CLOB 5HVNA 3F3SA 2I87A 1SHLA 4GPEA 5JD6A 5LKAA 4LMRA 5TEWA 3KKMA 2QXTA 5J58A 2PZMA 3C3PA 1F2UB 1KY5A 4WVFA 2E2WA 5CIQA 4PLZA 1OJLA 4TZKA 2REBA 4GOKA 1PNTA 3G17A 2J3KA 3VNAA 4U6SA 3BQ9A 1SQ5A 1IBSA 1WQ1R 3WWOA 5KB3A 1WOMA 5HS6A 4YP6A 1YR8A 1JECA 1MO4A 4CKWB 2HLNA 2R8OA 4R9RA 4U5XA 3UGQA 2JFXA 2E1PA 1U2GC 1W94A 5IP5A 3EQ2A 4LJ9A 1JFTA 3DFZA 1ZHOA 3FTNA 2GZSA 5EZYF 4F5ZA 3OPYA 1FNBA 3DE4X 4FDMA 1K8RA 4OYHA 4R98A 4I81A 4WVLA 4NJMB 3SK0A 4KAJA 4Q05A 1FNDA 2A3NA 4LHXA 1GKYA 2VRCD 3D1JA 3K31A 3OLCX 4HDSB 5ALLA 5BW4A 3CO5A 1ZU4A 2XB4A 4W63A 2FSFA 3V42A 1D2HA 3ZY2A 1WB6A 4L8WB 1Q1AA 3GUVA 3OKFA 1T1GA 5C8YA 4RFSB 2AI1A 1F1BA 4J03A 1DTWA 1H8HA 3QPBA 1ENOA 1JXOA 4AKGA 5LA6F 1Q20A 1ZK4A 4KXLA 5KOIA 1EQAA 1Z68A 2EV9A 1CJSA 1VI5A 2ZSEA 4FW9A 4GOND 4KQFA 1SBCA 3UZUA 1R6DA 2AH5A 1MR3F 3CZMA 1TEVA 2ZBEA 4LZAA 4LKOA 5C1BA 1G291 4D82A 5DIFA 5B6IA 4PC2A 1A5SB 3I1YA 1XTVA 2HSJA 3UT0A 4CBVA 1HR0B 1X8KA 3R0JA 4MR7B 4YJ3F 1LSUA 3CE6A 3SIXA 1GN8A 4ASUA 1I0IA 3GEPA 3GOHA 3AUJB 3SC2A 4CCSA 1AA6A 4LQLA 5DHTA 2PGOA 3UUFA 1F51E 2VWGA 2CCKA 4ZHQB 1Z0DA 3IJPA 1ZRMA 1O5TA 3L8CA 1V3TA 4JJFA 1DKLA 1BRTA 4HXYA 4M0LA 4BFLA 1AK9A 3ZCQA 5HMLA 4U7GA 1XMIA 4CVNA 3AU9A 1BSVA 1N2CA 1CIPA 1Y7IA 1QNLA 1KEEB 2NO6A 3FMOB 2Z1NA 3PNPA 4XXHA 3D1VA 4RUKA 1J39A 2O0KA 2DPGA 3CB4A 4AI6A 1NOJA 5KYUB 3BUSA 3CX6A 3NIDB 4MRAA 2PZJA 4NP6A 1JTFA 5CP8A 4B8ZA 2J09A 3DBRA 4CM3A 1SHTX 2DRIA 4OJMX 5CA0A 4Q5IA 3SJCA 4ARSA 3K5WA 3NBMA 4YRNA 1P0PA 2O57A 1PVVA 4YRFA 4YCAA 4AY6A 2Q4BA 3PFBA 2PFGA 5EJGA 2BTOA 2I8LA 4KN5A 4HL6A 3KCNA 4HEA6 5F4ZA 4TMFA 5A4KA 3I5YA 3AEQA 4W1SA 1P77A 2MINB 3DF9A 2CGEA 3W6UA 3SD7A 3WHLA 2QI9F 2J48A 2B21A 1PZFA 2RGWA 1MAUA 1V1MB 3DVAB 2RI0A 3L7BA 5E3JA 3QLEA 4J43A 4TUYA 3T7AA 4V1CA 3DE2X 1K98A 1KZ6A 2Q8QA 4N8SA 4NBNA 1N8SA 2CVPA 1XFDA 3B12A 3LUHA 4HZUB 3LGAA 2NO7A 3R9KA 3RV3A 1GNLA 1TO1E 3HUEA 2ESRA 2XDWA 1ISJA 1M74A 2GJ8A 4YGYA 2VQEB 1DBQA 4TSKA 3BL8A 2PMEA 3PQCA 4KIFA 5G53C 3H1EA 3SKYA 3KFVA 4R2HA 4Q0MA 3LDUA 4C4ZA 4YMUA 1IYZA 3K0FB 5F7ZA 1PFWA 1ODTC 3O03A 4O4IA 4IIHA 5DNEA 3UXMA 4YRAA 3QPDA 2PX5A 3A7EA 1KIFA 3OSUA 2DETA 1PJAA 3WA7A 1X7DA 3OLYA 4IMIB 1IHPA 2AW3A 4QOFA 4DFDA 3QVTA 2EFHB 4BJ5A 1U0SY 3NTXA 3WC4A 1HG1A 3KLOA 4GH5A 3RC9A 4XIJA 1IVYA 1JAYA 3HFJA 4UBOA 3DW3X 3GNSA 1RP1A 1L2TA 4HXGA 2LIPA 3VYRB 2PMBA 3O3MB 1ZGGA 3IEVA 3EC7A 5HILA 2LD4A 1AK2A 1ZNYA 2GFHA 4TL9A 1Q17A 3QK7A 1QYCA 3WYEA 1MB9A 1MVOA 1R6TA 3IV7A 3PNYA 3MBKA 2ZSBA 1WXHA 2ZBRA 3BB1A 1NKTA 3QUAA 4C07A 4ZTZB 1UC4B 4UASA 4TLCA 1PT9A 3HP7A 2BHNA 4W9MC 1RMYA 1EP3B 3UMYA 3H3XA 4L08A 4N12A 4YPOA 3DV0B 3Q40A 4AMVA 2ATEA 3WGTA 3N2YA 1KQ3A 1WXQA 2GZ2A 4H0FA 4FD3A 3UC5A 3PHHA 5TE9A 2XT9A 4HAZA 2VP2A 1KZ7B 1ODLA 4CIXA 3BICA 3GF4A 2AE1A 3C16C 1PR0A 5B1IA 4ZJYA 3U4QA 1AK1A 1FTQA 1NSTA 2HK7A 4B3CA 4C0BA 4DUYB 3CLUD 5DNVA 2XKJE 2ZBGA 3DUWA 3FIJA 4FGUA 3W8RA 2X9NA 3GA5A 2HCJB 1CR6A 4JR2A 1HEUA 1BMQA 4NK4A 3DJFA 3HA3A 1KJNA 2F1OA 3MUEA 3DPSA 3ZI0A 2ATXA 4ZC1A 4L76A 4OGKA 2FZ4A 1RRPA 3UC9A 1PBTA 1SXHA 1UPTA 1WMAA 1SWVA 1DAGA 2YV1A 3ONWA 1PEKE 4HLQB 4MS4B 4AXXA 3BFXA 2FWAA 5CB4F 1KQPA 1KGDA 2P3LA 2WKWA 4GX1A 2IE8A 3ZI7A 2WJ6A 4V0NA 2BR3A 5HP4A 1ODKA 2R68A 3D3KA 1SUPA 3MWDA 1S8FA 4M46A 5J2TB 3ZVMA 1BXKA 4MKZA 3DMHA 3CINA 4OPMA 3ZHOA 4H6XA 2NXNA 1MB2A 3F96A 3JD0A 4O63O 1VE9A 1R7RA 4EQZA 1EKXA 3C39A 2ZT8A 2ZUSA 3JZFA 3LUJA 4S35A 5E9WA 3GJZA 2OY0A 1QGED 1V37A 3QX9A 4I50F 5BN5B 2YOFA 4PX3A 2PJZA 2W6CX 1SKMA 2VSQA 4CLOB 3T7EA 1FLDA 4K86A 4IGIA 4F45A 3HCEA 4XJSA 3B1ZA 4G0QA 1XTRA 4OHZA 5FRDA 1EP1B 3JAWA 1RTKA 3GLHA 3ANMA 3B6ZA 4EOGA 4BX3A 1VBFA 1CQIB 5TRTA 3VNBA 2A9OA 1NIPA 1XRRA 2ZTUA 3C7TA 4W7IA 4QDZA 5HK9A 2UZIR 1KMIY 3QKRB 2NYUA 4DJTA 5AVYA 2V6JA 4XLTA 1TUEA 2QQFA 2BFNA 3IAEA 1KP9A 3QLVA 1BVUA 3V48A 4WZBE 1H2AS 1BKYA 4FGSA 2CY0A 1UP4A 3IPYA 2YFKA 3KOYA 4QUGA 5GONF 1ES9A 5K0LA 4ZYUA 1F3LA 2LE0A 3HJFA 4G6ZA 1T2UA 3G2JA 1OZFA 2G67A 1KJ9A 2W8ZA 1CP3A 1CZNA 4RSMA 5HEKA 4F6LA 2VJDA 3ESQA 3T7DA 1FIUA 1OLSA 3OIVA 3QQPA 4UM8B 1PJLA 4W6QA 4ZT4A 5IVIA 4PAQA 1Z6ZA 1MTZA 3RHFA 4WCDA 3WIBA 4CKEB 2QJWA 4BPRA 3FZGA 4J9UE 5DBOA 3N2NA 5FTLA 4BP9A 4RC9A 3RVRA 1OPRA 3E70C 2G5GX 1JKXA 2EWWA 3OPQA 4HT3B 4I9UA 4CMCA 2NO1A 3OZFA 1DX4A 3EFOB 5EE5B 4X6YA 5ERYA 2Y1DA 1OYYA 3NOQA 3WBJA 2NWQA 4RXUA 4HWOA 4YUAA 4YP9A 4LHVA 4JODA 5DJ5A 1KPGA 4M49A 3QUQA 2D5AA 4C7MA 4IRUB 1RT9A 1J9EA 5F1OA 3CPHA 2Z2ZA 3SVZA 5E3HA 4DUGA 1J24A 2B9EA 2JFQA 4KODA 2IV7A 3GJ5A 5K8UA 3OCUA 2GN9A 5KYWA 4U3JB 1ISHA 2YV5A 1T8UA 2R62A 2R87A 3AUFA 4MJ3A 4OLHA 4QD3A 4GZMA 2MSEB 5G02A 3IQFA 2FU5C 4YT8A 4BWGA 2G1JA 1U0BB 2OLEA 5BMVB 1BDBA 2WUDA 5ITWA 5HJ5A 4D9EA 3BMOA 3L6CA 4RANA 1DCFA 3ZZ0A 4DIKA 3AVQA 3M6XA 4U7HA 3BWMA 5EMKA 3C85A 4JC4A 3BWEA 3GRUA 4DNXA 4ZZIA 1FW8A 2C9CA 1COZA 1E2QA 2N1BA 2VQSA 3JQ9C 4G1UC 4BO2A 1QP0A 1T8TA 3M8KA 5F12A 1EFDN 3FYTA 2PR7A 2HQ1A 1BC5A 2OXFA 3ODGA 4XFJA 3UPDA 3L7CA 3LQ1A 4TL7A 3VHLB 1PR2A 2X6TA 3HFSA 5D7NA 1T8WA 4L8LA 4P81A 4MTLA 1XZPA 1YC2A 4N01A 2H9IA 3DUFB 3KETA 1O54A 2Q8NA 3NG1A 5GJCA 2ZBQA 1GCOA 2PIDA 4KVGA 4C7XA 2GBLA 1PLJA 4GZ5A 4MWTA 1JA1A 3K9QO 4DGQA 3OJ0A 1QYIA 3UJHA 2I6XA 4NBUA 1GPNA 2WIDA 5LJIA 4NQRA 1BS1A 4IGKA 1C81A 4M60A 1E98A 3TRJA 2VK8A 3U3JA 4N6OA 5IKEA 1KMHA 4IWNA 2NO0A 4WWHA 3FX2A 4QC2A 2EG5A 1X1TA 2PXAA 3GP5A 3MHPA 1WXWA 3HPRA 3EMKA 2W0MA 5TGTA 3WNBA 1XZGA 2JBAA 5AKHA 5CB4A 1FNMA 3TKLA 2BP7A 2EJVA 3RVQA 3NRBA 2ZTSA 4M9UA 4ICIA 4JDUA 4KXXA 2Z3ZA 3NHBA 5EP1A 4C88A 5AD1A 3EGEA 4CIVA 5K9ZA 4LY0A 1YQEA 4D9MA 1Q19A 4JLNA 5E6SB 5L3QB 2Q5OA 5ESDA 4QM7A 5DYGA 1LEHA 2VYVD 2R11A 4I6EA 4A0QA 1OAAA 4CHTA 5KYGA 1EP2B 3QI7A 3OH8A 1CUHA 3FMIA 1QLHA 1JS1X 3Q8WA 4D4MA 3P1JA 4ER5A 2X9GA 3RSQA 2NVBA 1UCFA 5E4JA 1ZI9A 2FRVA 4MV6A 2A6PA 1GM5A 5JRJA 1ZH6A 4GC9A 1I7LA 4GP9A 4A27A 2P9EA 1GV0A 3IP5A 1SB8A 4YFVA 4FZ5A 1T1EA 4ODIA 4C5CA 5JS8A 4FLFA 1IUPA 4KI0A 1RHKA 1RYHA 2VN8A 2P4UA 2ZWIA 3HXTA 2XWSA 4CMIB 5IJ9B 4LHYA 4E1AA 4B0OA 1NBHA 3MTQA 4K6GA 2XPCA 3KJHA 4L8FA 3GFBA 5SV2A 1J9G<