4L0CA

Crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
MKGYNVYANGIRQHIIHFPGTGSPLLLIPGITSPAVTWGFVAERLAKYFDVHVVDVRGRGLSESGDLDYSLDAMADDLVALAQRMEGVVVLGHAMGARIAIRAARKDSQVFSRLILVDPPVSGPGRRPYPAKWSWYAESIRLAQRGCTAMEMRSYCPTWTDEQIELRAEWLHTCQYTAVKTAFDGFHTDDIHTDLAQLTLPIQLVVAGGAEVIQPDDIAEIISLAPQTTTYVVEEAGHMIPWDNLEGFITAVSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Deformylase
publication title Crystal structure of the N-Fopmylmaleamic acid deformylase Nfo from Pseudomonas putida S16
rcsb
source organism Pseudomonas putida
total genus 83
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0cA00
3L1HA 2FUKA 2WU4A 4AMZA 4J3JA 1OILA 3GBSA 4G4IA 3N0TA 4LYDA 3T52A 4QWMA 3WYNA 5JAHA 2V9ZA 4ETWA 2OAGA 3ICWA 3VVMA 1AUOA 1F6WA 4DSZA 3D3NA 1WM1A 3CCCA 3NUZA 4Q1VA 5DWDA 5JASA 3R3VA 5A62A 2HA5A 1U65A 2XMQA 2QRUA 3STYA 3PUHA 3H2KA 5FOQA 1T2NA 1CEXA 3DL4A 5JIBA 4K5QA 2XQKA 4NMWA 5LLSA 2RONA 2QVBA 4J7AA 4QNNA 4XJVA 4FNGA 4JH0A 2WUGA 1FJ2A 1XROA 1CUDA 3BDVA 3TGLA 4CIBA 2VF2A 5ALGA 1C7IA 3ANSA 3F67A 4JUIA 4NVRA 3QYJA 4ZREA 3OURA 5JZBA 1LLFA 4AMYA 3G02A 4BRZA 4J03A 4GBGA 5ALVA 3DNMA 1THGA 5F4ZA 5AJHA 4B85A 5CXXA 2CBGA 1VXRA 4QDUA 3STXA 1TCAA 4LYEA 3DD5A 4YPVA 2C4HA 1JFRA 1WOMA 5YASA 5HCUA 4YX9A 2JGLA 4F60A 1PV1A 2BGNA 2DR0A 5JD6A 1JJFA 3IIIA 4GDMA 2J4CA 5AK4A 4ITVA 3CN7A 3IB3A 3E4DA 3M82A 6YASA 2C58A 3I2IA 5ESRA 5CT6A 1GKKA 5T4EA 3FYUB 3I1IA 3QPCA 5A7HA 1BRTA 1VZ3A 3I28A 4KAFA 4KJXA 2XQJA 1BS9A 3DLTA 1JMKC 3R41A 2HHAA 1UOOA 1MAHA 1XRMA 3O4HA 4FNMA 1J1IA 2Z3ZA 2ZJFA 2QXTA 2ZJ6A 1LNSA 4XWGA 4X3CA 2ZYRA 5AP9A 1VA4A 5AKJA 2B20A 3HZOA 1QE3A 3FVTA 3WWPA 4DNPA 5DNWA 4DM7A 1A8SA 4BE9A 1UFOA 3VVLA 5LZ5A 4G8BA 2BUBA 2ACKA 1Q0ZA 2C0QA 2Z8ZA 5DYWA 1QIIA 1LPNA 1YAHA 2RAUA 2HDWA 4B9AA 1TCCA 3DOHA 4GEGA 1CRLA 3H0CA 4H7FA 1ZJ5A 1DT5A 4RE5A 3ZLTA 4X95A 3OPMA 3WKDA 1CV2A 2OCKA 3W05A 3KXPA 1EI9A 5AH0A 4JNCA 1XRPA 4Y2XA 5CT8A 3W06A 1H23A 3WZMA 3A6ZA 3WL8A 1MX1A 4YK7A 2I03A 3H1AA 1QONA 2OCIA 4G8CA 2JGMA 3AILA 2XUJA 2JGJA 1XRNA 5AM0A 3BJMA 2H7YA 4MEAA 5E4YA 3SWWA 2WLSA 4GI1A 2WG2A 1EDDA 4L0CA 4QEKA 4QDOA 2C5FA 4W1RA 5T4FA 3HACA 1R9NA 2OGTA 3IDAA 5CRIA 5KBYA 4DLNA 4W63A 5AKZA 1NX9A 3DKRA 1GQSA 2WIKA 3PICA 4BE4A 4BAGA 1QIJA 3KOOA 2Y6VA 4Q3LA 2V97A 4KE8A 2IIVA 5ALSA 2CB9A 1YAJA 1W75A 1J2EA 2PBLA 4HTAA 1BCSA 4PF1A 4BC1A 1TAHA 1CFJA 2IX9A 1L7AA 1UK7A 1EB8A 2AJCA 2I3DA 4F0JA 3RLIA 5ALEA 1UK9A 4H7DA 1JMYA 4G9EA 5FLKA 1H2WA 1O6FA 2WIGA 3A2LA 5CTAA 5AKYA 5ALOA 1GKLA 4LKOA 3K6KA 1QOZA 1ZI6A 1YSCA 2NW6A 3QBJA 3V1MA 2O7RA 3FVRA 5D7BA 4BAUA 3WZLA 3A2NA 5AKEA 2BJHA 4KAJA 1WCYA 4C01A 2I78A 4MYDA 2HA7A 4BDTA 3F8SA 2WFMA 4TVKA 3D2CA 4IH4A 4ARAA 5LZ4A 4FMPA 3LCRA 2GYVA 1NU8A 1BN7A 1CUBA 5ALDA 1M33A 2OGSA 3LIPA 2J3QA 5CW2A 1XQXA 3MUNA 5ALIA 3WWDA 1GT6A 1R3DA 2JGIA 4G4JA 2XT0A 2XQFA 3D7RA 5ALLA 3B12A 4B83A 4OUKX 3O9VA 1XRRA 4QA9A 4UBIA 2YYSA 4H7HA 3CN9A 5LKAA 1DWQA 5FKJA 1UOPA 5HZGA 1KEZA 3FCYA 3LIIA 3D59A 1CUJA 4N8DA 4RGYA 1CUCA 3HI4A 3PE6A 4OPMA 4ZRDA 3E3AA 5HK9A 5JD5A 1WHSA 1Y37A 3V9AA 1TCBA 5A2GA 1ACLA 3DYIA 1E5TA 1EVQA 3JWEA 2ZYHA 3Q0TA 1YASA 1AX9A 2XUOA 2QMQA 5CH8A 1B6GA 2EEPA 3HC7A 4AN0A 4DMFA 5C8ZA 1EB9A 2X5XA 1UKBA 4X92A 2Y6UA 3IULA 4FTWA 4OB6A 1R9MA 7YASA 1MAAA 4B6GA 5EIEA 5DLPA 3UUFA 4Y2PA 3KD2A 3CCBA 1DQYA 1HKHA 4KRYA 3X3HA 2ORYA 1OCEA 1UT6A 5AK6A 4FDMA 3QMVA 4G8DA 1P0IA 2XLBA 1QGED 1HLGA 5LYYA 2H1IA 3ANTA 1JU3A 1WB5A 4IO0A 4QE3A 4CCWA 2PUJA 1CR6A 4OSEA 3AFIA 4AN1A 2ZJ7A 2XMSA 3BIXA 5EIHA 1JU4A 4PV7A 1ZI8A 4Q3KA 5A71A 1X2EA 4N5IX 4QWWA 4D9JA 4P9NA 4OD0A 3H2HA 3WI7A 4K6GA 4CCYB 4FLEA 1LPAB 1JI3A 4L9AA 3C8DA 1QZ3A 4ZGBA 3PDCA 4H7IA 2PL5A 4J0IA 4KE7A 3IUMA 4L72A 2VA9A 1ZD4A 3WLAA 3F9CA 1K4YA 5JARA 5AOCA 3C87A 3NOXA 3KWJA 1VE6A 5K3FA 4C4XA 3SX4A 5I9IA 1MNQA 3VJKA 2JGFA 3OC0A 5H3HA 3FNBA 4UHFA 4M0EA 3WQHA 1QLWA 1QFSA 5EHXA 2HADA 3IUNA 4UFOA 2EDCA 5KWIA 1BE0A 4X91A 1KU0A 3D2BA 4ZWNA 2VT6A 4EZIA 2C5GA 3E0XA 4W1SA 4F21A 4EY8A 4JYPA 1W4LA 2GYWA 4DSAA 2PSHA 4W9RA 1WPRA 2ZSIA 4BP8A 5IH7A 4WY5A 4UFPA 5C7YA 1ZJ4A 1E89A 5J3JA 2WKWA 3SK0A 4KR0A 5CMLA 3WK8A 5JAUA 3DL7A 1DU4A 3UMJA 3NWOA 3IURA 2R11A 4FLFA 4GWLA 5CT4A 3HYSA 1YB7A 1VKHA 4V2IA 5E4TA 1LPPA 3O4JA 1EX9A 1FFEA 1MX5A 2HA3A 3RKSA 5T4BA 4B82A 4ZV9A 5C8XA 2XMCA 4B7ZA 4KEAA 4UHHA 4DTCA 1ZGBA 2RHTA 2WFLA 2BGRA 2WIJA 3Q8WA 1AGYA 5BWCA 3O4IA 4Y2JA 5T4HA 4XVCA 1UZAA 2LIPA 1VJ5A 2OCGA 1QIFA 5EIAA 5FP0A 4UBJA 2XUPA 4OU5A 4U2CA 2GZRA 2HA4A 3FLEA 4EY5A 4WDRA 1XRLA 4K6KA 4K2AA 3PF9A 1XZAA 3W9BA 3H2IA 3PI6A 1UXOA 4A16A 2X76A 3I6MA 1N1MA 4MWSA 4S0XA 4EBBA 1AKNA 1Q0RA 1C4XA 2OGZA 2RGUA 1E8MA 1BEZA 3GROA 3FOBA 3P2MA 4CI9A 5SYNA 2Y2UA 1DWPA 4BTLA 1LGYA 5IKXA 1ISPA 5C81A 3I2FA 2X8BA 1ORWA 2D5LA 5JADA 1XZCA 2WHPA 4FHZA 4WY8A 1XKTA 3RM3A 2XDWA 3WKAA 3FYTA 1ODCA 1CUXA 5EI5A 4J0KA 2ZYIA 2XMDA 4Y2YA 5HF9A 3WWOA 1CUAA 3C43A 5LZ8A 4Y2RA 3O0DA 5DNVA 4N8SA 3T4UA 1CUGA 3H04A 4DMCA 2ES4A 4AZ3A 3H17A 1CUSA 2HFJA 4KE6A 1HQDA 4WFIA 3F96A 1XRQA 4RPCA 1CUZA 3UUEA 3EQ9A 1K6EA 3EQ8A 4UHBA 5A7FA 2V96A 1W76A 2AXEA 1AZWA 3WKEA 1S8OA 1QO9A 4W1PA 5EGNA 1SCQA 2QJWA 4U2GA 2HA6A 2WILA 4AO6A 5AKXA 2XMZA 2CKMA 3HABA 2C7BA 4H7EA 2WJ6A 1RYYA 1T4MA 2XUKA 5CBKA 1H22A 4J0GA 2FJ0A 2O7VA 4UBNA 5ALQA 1Y7IA 3WL6A 5D3KA 3VJLA 3WMRA 1GGVA 3GZJA 2XMGA 5AIAA 2Z3WA 3QITA 3G9UA 4QLAA 3I2KA 4FWBA 4MJ3A 1CUYA 5K3FB 3ESDA 2GBFA 1VOTA 1QIKA 3FSGA 4Y2TA 2WUDA 5BOVA 3V1KA 3DQZA 5AHXA 5A6VA 4QDTA 3I2GA 1XZIA 4HXFB 4LXIA 1YS1X 3WWEA 4U2DA 4EB0A 1ODTC 4HVTA 3YASA 4WJLA 1CLEA 1UOQA 3HJUA 2PUHA 3IA2A 4DNFA 5ALJA 1R1DA 4QZVA 5K3BA 3DS8A 1ETHA 2CEKA 1VE7A 1R50A 3ZWQA 4Q3OA 4B84A 1ZD5A 1GPNA 2OPHA 1CUFA 2O2GA 3RARA 1XQYA 2QT9A 2QS9A 4GW3A 4J0JA 2XUAA 2XUDA 1F0PA 5K3EA 4AO7A 3C6XA 1H2XA 1SC9A 3GUUA 4QLOA 3QMWA 4AXBA 1N8SA 3C45A 4DGQA 1SFRA 1E3QA 2ONCA 4DYHA 5AI4A 3QPAA 2WG0A 3H1BA 3DYVA 2XMRA 3QZUA 1JJIA 1CUIA 2B4KA 4F5ZA 3SC2A 2PSDA 2WFLB 1QJ4A 3MUOA 3G9XA 4FFVA 4X6UA 3VISA 1LBTA 1U8EA 3ED1A 1MX9A 2H7XA 4FBMA 3WJ1A 1W6RA 3MGAA 2O2IA 5EFZA 4U2EA 1DX4A 4FLMA 2J3DA 4BYMA 2JF0A 4HRXA 1EK2A 5JAOA 5AI9A 5K3AA 4H7JA 1DWOA 1ZD3A 2QOEA 3WK4A 1J07A 4EA6A 1MN6A 3G9TA 3IUJA 3AZQA 4X7BA 5AM5A 2XMBA 2JIDA 4BCBA 4FBLA 3U1TA 4OYLA 3GA7A 2DSNA 2BUCA 2VJDA 2PU7A 4MXDA 4AZ0A 3QVMA 5ISMA 1LPMA 1CPYA 5ALPA 4L3WA 4IHAA 5HK8A 1TQHA 2P8SA 5AK3A 2WHPB 4HAIA 1GZ7A 1WB4A 2VTVA 1HL7A 2G5PA 2Y1KA 5CURA 3H19A 2OG1A 1MJ5A 1Z68A 3BWXA 5HFNA 3TEJA 5CXUA 1TIBA 3VKFA 3ZLUA 4DMHA 2CUTA 2IITA 4DNQA 4CG1A 3D4LA 3VDXA 1UK6A 4LXHA 1XQVA 2QUAA 4P93A 2VAXA 2FJPA 1D07A 2WQZA 5AKGA 2XI4A 1MT3A 5AI0A 1EHYA 1JJBA 5FPQA 1DINA 1UKCA 1H2ZA 3VXKA 2JGKA 5I8PA 4PNZA 3R40A 4MYSA 1QIGA 3M83A 2I3ZA 3G8YA 3ESCA 2WG1A 4X6XA 5FV4A 1QTRA 5ALRA 2AJLI 1XZHA 2CZQA 4I19A 4RNCA 1A7UA 4X90A 5FDFA 3AUKA 3H2JA 1FFDA 3R0VA 4PSDA 1LPSA 5EHZA 3JYHA 3BXPA 2Y2VA 1XZBA 4HS9A 5AKKA 2XQIA 5AKIA 1UK8A 1ACJA 3R3YA 4BZZA 3L1JA 1MO2A 1P0PA 2WU3A 3DOIA 3ESBA 4KACA 3B3QA 1UWCA 1XZMA 4N8EA 2PSFA 2EDAA 1JT2A 4G5XA 5FXMA 4CG2A 1PFQA 3GELA 4Y7DA 1GPKA 4AO8A 3FYUA 4MWTA 4PSCA 1SCKA 4WFKA 5HF8A 4INZA 1AQLA 4EY7A 5LZ9A 3BJRA 1XZDA 5KWJA 5LIPA 5LZ7A 1ODSA 3WJ2A 1OXMA 2W6CX 3ZLVA 2XLCA 5HFAA 4BVLA 3IUQA 2RHWA 4A23A 4B0OA 1F0NA 2QKYA 1DTEA 2WJ4A 1LPBB 1XLWA 2XUQA 4OU4A 4E15A 4BATA 3O9MA 2XUHA 2WSLA 3U0VA 3EIOA 3IVMA 1VZ2A 2G4LA 3C70A 4GECA 5HF5A 3HEAA 4ZI5A 4UBLA 5FUMA 2WHRA 4G9GA 1IMJA 2YH2A 4WFJA 1QIEA 4Z49A 4NZZA 1GXSA 1U2EA 4X93A 3STVA 4XX1A 2H7CA 5AIBA 3K2IA 1MU0A 3DCNA 3WA7A 5HQ3A 4UHCA 3ILSA 3KWFA 5ALZA 3OM8A 2Q0XA 2AJBA 4WDQA 3AIMA 1HPLA 1EA5A 4PQEA 3G0CA 5JATA 4BCDA 4QDZA 2WHQA 3HLKA 2VJBA 5DYYA 2WUEA 4DNOA 5ALYA 3AINA 4AB1A 3ZV7A 1QIHA 3HRHA 4E46A 1CUEA 1K5PA 2QUBA 3FWHA 3WYDA 3B5EA 1ZOIA 2ACEA 3FSGD 1N5MA 4HRYA 1Q83A 4M0MA 2VEOA 1IUOA 5CT9A 1TRHA 3FBWA 1U4NA 1K63A 1XZEA 4FFWA 5IVHA 1AC5A 1CUWA 4UPDA 5AI5A 5BWBA 3WK7A 3AZPA 3AJAA 5K3CA 3TJMA 3R3ZA 4I3FA 2BFNA 4ARBA 4AX4A 3EBLA 3OG9A 2JBWA 2R8BA 4MQMA 1BEEA 3GFFA 4IQ4A 3FLBA 3E1GA 3V1NA 1R88A 5D3ZA 5HKBA 3JW8A 5JYCA 4LHEA 2YASA 4PO3X 1EDBA 2WIFA 3WK9A 4UBMA 5JZ9A 1A88A 3STWA 4A5SA 3FAKA 5LZ2A 2WM2A 3R3XA 3STUA 1N5RA 2DFPA 2PVSA 3CXUA 2HL6A 3H18A 4E14A 3V48A 4J0DA 3BIWA 4O08A 2QM0A 5DTIA 1XZFA 2BKLA 4P92A 4KYVA 3KSRA 3DEAA 3G0DA 1PJAA 5AKHA 4BBZA 4H35A 3C6YA 3F98A 2DCMA 1CIJA 2J4FA 2OAEA 5E2IA 3PFBA 3AZOA 1E8DA 1BU8A 4RE6A 1A8UA 1WB6A 2G63A 1F8UA 2E3JA 5DNUA 4TPKA 3HSSA 4J0CA 4UBOA 1X70A 4Y2QA 1WHTA 4UBKA 2PX6A 1CQZA 3WKBA 2BCEA 1ZGCA 4B81A 3KDAA 4CFSA 2CMFA 3I2JA 1DQZA 2HM7A 1FSSA 4ROTA 3G7NA 3G0BA 1RWQA 2JEZA 5K5EA 4MQLA 3G0GA 1IUNA 3PF8A 2GYUA 2PM8A 3WKCA 3HXKA 1YB6A 5CT5A 4HXGA 1XZLA 1Y7HA 4C4YA 5JD4A 1THTA 1G5FA 5ALWA 1AMNA 2XUGA 4UHDA 5HF6A 1JKMA 2BUAA 2O2HA 1L7RA 2K2QB 4BP9A 4BC0A 2OCLA 3O4GA 2WTNA 3ESAA 1QFMA 3M3DA 2Z8XA 3LLCA 1P0QA 3G9ZA 4J0HA 1LZKA 3D2AA 1K8QA 2DHCA 4K6HA 4NS4A 4PSUA 4H7KA 1EXWA 3A70A 4BCCA 1VA5A 2WIDA 3G0IA 4GXNA 4C88A 1XLVA 1DT3A 5AM2A 1BN6A 2FX5A 1LPOA 2DHDA 5ALNA 2G5TA 1QIMA 3C5WP 3WWCA 5HQ3B 3M81A 3WK6A 3DDUA 1B41A 3LP5A 4B80A 3C5VA 2QJRA 4KRXA 1HDEA 3FCXA 1IZ7A 3D0KA 4BRSA 1XLUA 3O95A 3S2ZA 3R3WA 4H0CA 4OB7A 4LXGA 1G4HA 1QIDA 1EINA 2D0DA 3EQ7A 4I4CA 5ALHA 2B61A 2DQYA 3DKKA 4H18A 5FPPA 2C0PA 3OOSA 4Q05A 3I1YA 5ALXA 3BE8A 5BV7A 4BVKA 4EY6A 1ZIXA 4CIAA 1NU6A 2XB6A 4X97A 1UKAA 3BL8A 3WIOA 5DTJA 3ZPXA 4FKBA 5JANA 4CCYA 5I7UA 2XE4A 2OQVA 4EHBA 1CUHA 2VT7A 5D6OA 3FLAA 4TGLA 2HRQA 1FFAA 2W22A 1AURA 3A2MA 3D5EA 4DMKA 2HU5A 1MNAA 1MPXA 2HA2A 2YXPX 2CJPA 4Y2SA 1RP1A 3FYUC 4X6YA 2AJDA 5LKRA 3F97A 3WL5A 4C87A 1SOMA 3K9BA 3R3UA 4DIUA 2XUFA 5ALUA 3C6ZA 1W1IA 3H2GA 5ALFA 5AI8A 2GBGA 4EY4A 4N5HX 4KAAA 4UUQA 1I6WA 1IZ8A 1ZI9A 2ROQA 5IVDA 5AKLA 2ZVDA 4Y2VA 1EK1A 1BROA 4PW0A 1ZD2P 1YCDA 3WA6A 5KREA 3AIKA 1SCIA 5AOAA 5JALA 5AM3A 3AIOA 3ZI7A 5JAPA 3C8HA 2QXUA 4B0PA 4X71A 2B9VA 2PU5A 4C89A 1GQRA 1CQWA 4G1FA 4UFNA 1L7QA 3WL7A 1EH5A 2WFZA 4ZXFA 4UHEA 1XZGA 5AK5A 1KU6A 1CUUA 5ALTA 4Y2UA 2PKYX 4BAZA 1LZLA 4OYYA 1XZJA 4EUSA 1H2YA 4U2FA 4BDSA 2OLEA 4ZV7A 1GPLA 4GLBA 1TK3A 3PFCA 2GZSA 5EHQA 1VXOA 3W9UA 4AQDA 4U2BA 3I2HA 3STTA 5JZSA 4E11A 5HKAA 4MEBA 1WPXA 1XZKA 4P08A 2HA0A 5K3DA 4JYMA 2HRRA 2ECFA 3BF8A 3EF3A 2XQGA 2GBIA 1W52X 5IVIA 2HU7A 4Q34A 5DJ5A 1G66A 1MTZA 3NGMA 3QM1A 4M0FA 2HFKA 5AOBA 3ICVA 3BDIA 1J06A 3QPDA 2V98A 5CH3A 5AM4A 4C4ZA 2DHEA 3QMMA 5DYTA 1X2BA 4KE9A 4IH9A 1VLQA 2VQ6A 2VSQA 1A8QA 1YA8A 3W2TA 4OCZA 5FRDA 2HIHA 5AO9A 2QZPA 3V1LA 1Q84A 4OB8A 1G42A 1QO7A 1IVYA 2PSJA 2AJ8A 1BCRA 5C8VA 1YR2A 1TKRA 4XIIA 3LS2A 3QH4A 3L1IA 5ALMA 3W04A 2RI6A 2BAGA 5ALKA 5A7GA 1IUPA 3DJYA 4BZWA 2DQZA 2OQIA 1CVLA 1LBSA 4WCVA 3I6ZA 1YA4A 1EVEA 2VJCA 2HU8A 1XKLA 3N2ZB 4C6HA 5LP1A 1YS2X 4IH1A 3S8YA 2XUIA 5CH5A 4Q82A 1DX6A 1FFBA 1EDEA 2WJ3A 1HBJA 5AI6A 2VJAA 2GBCA 4GHWA 1C7JA 5EHNA 2Z5GA 1ORVA 2WUFA 4BTVA 1E8NA 2PPLA 2QR5A 2VAVA 2UZ0A 2OXEA 3WK5A 1P0MA 3MVEA 4G4GA 1FFCA 4Y9SA 4X94A 2WTMA 1ZIYA 2H9YA 2JGEA 3C6BA 5IVKA 2QTBA 1E66A 4H77A 1USWA 3RK4A 3IBTA 4BVJA 1CUVA 3I6YA 5SYMA 4X85A 4HXEB 2JEYA 1XFDA 4QDXA 3WIBA 4HZGA 1XQWA 5AM1A 4CG3A 5AICA 1QTIA 1ZICA 3PUIA 4YASA 5E4JA 2RIPA 4FOLA 2PSEA 4JEIA 4X00A 4BB0A 2ZSHA 4W1QA 2ZYSA 4B9EA 3VJMA 1R4ZA 3BF7A 3TRDA 3OTQA 2VATA 1O6GA 4LIPD
chains in the Genus database with same CATH superfamily
5ABPA 4ZOLA 5AW3A 3U44B 2IWRA 1JQ3A 4D79A 1IM5A 5DM60 2HCJB 3IQFA 5K0LA 2OP1A 1WG8A 3EPHA 1Z83A 2CHGA 4P31A 1RXWA 2QTTA 1KF0A 2G9QA 4QYXA 4TMYA 5HXAA 1VLJA 4FZ5A 4L57A 3GBSA 2X5KO 3N8IA 3DO6A 3NDPA 4G4IA 4IJWA 1YVRA 2W5UA 2P3QA 2SCUA 3NHJA 4KYIB 4UDNA 3D02A 3P97A 5H82A 5JMPA 4Z7NB 3IP9A 3UMFA 2XA9A 3HJRA 4IDEA 1P4SA 3SZGA 1K08A 1T24A 2ZIVB 3BRSA 1UMCA 3OAAD 2A0KA 4KN6A 1SCUA 1X1TA 2O3TA 1BX3A 2Y4OA 2XIJA 4EP1A 1W19A 2HPHA 4F97A 4RVHA 3DFIA 1WM1A 3I9V1 4MZDA 4Q1VA 2IPOA 2YWGA 3QXJA 4KYUA 2IS6A 2JAOA 1JWLA 4XSGA 5JASA 2AFHE 5JDCA 1L8QA 1MO4A 2HA5A 2VAMA 3CUKA 3KNZA 1GQOA 1T2UA 2AF3C 3H83A 2OFWA 4H59A 3OZGA 1A1VA 4HB3A 3FCOA 5TXGA 1NATA 2R1ZA 2GWRA 1HMPA 2H11A 3KAJA 4NBKA 1GYPA 1ARZA 2JG3A 1CEXA 1B6SA 3OPQA 2XQKA 4YV1A 1YIDA 5ELMA 3A1SA 3TBFA 5BV1A 2XVXA 3KJEA 4OMDA 4MDFA 3VR6H 5I01A 1YZVA 4KWTA 5C31A 2I67A 3Q9LA 5CDTA 2O8BA 3CWZA 2RONA 3H42B 4HDKA 4J7AA 2ODBA 2BEWB 1SB8A 1KHTA 1IZ9A 1H5NA 1T15A 2QWXA 3F5MA 3PCTA 3HB0A 4PBRA 4IHJB 4XJVA 1E99A 1JH8A 4FD3A 3COVA 1Z15A 1COZA 3S2EA 5DU2A 3OPXA 2ZJ2A 4I7EA 1DOZA 4PFJA 2MCFA 1GRRA 2QYSA 4E7OA 2A84A 3K70D 3NTLA 4F56A 3MG9A 2UYYA 3BDVA 3CH4B 4CIBA 3TZEA 3TGLA 3BPSA 2E5WA 3O8CA 4TOIA 3HSKA 3LY8A 4P4GA 5LQJA 1DAHA 2W2LD 1HA3A 3BX1A 1V6SA 3FPEA 2PEYA 3WDSA 4IZOA 2YWDA 3OURA 4KL8S 2YZ2A 5FOUA 1P0FA 1WX1A 2VYND 3MRVA 4TXLA 5JDIC 3TF5A 1LLFA 1Y6GA 4DW8A 1NG9A 4QARA 4TXJA 1WTAA 4D74A 3PD0A 3RJ9A 5EE3A 1ZXXA 3PIDA 4IMPA 4IZIA 2PUAA 5G41A 3AKYA 4YFYA 4KGVA 2JAPA 1EKXA 3T5CA 2E48A 5J47A 4ZAZA 2CBGA 1FLAA 1T2AA 4ZJZA 1R0BA 1VXRA 3WQBA 2J3IA 2OO3A 1WW3A 3IQGX 2GCOA 1DL5A 3UXEA 2EFGA 1ULTA 3F9IA 5B1EA 3HXMA 3BH6A 5J5CA 3STXA 2UAGA 4MWOA 5CHYA 3UB2A 1UH5A 4NBRA 1NR7A 3TH5A 1U0HC 3I62A 3NRBA 2CN1A 3BH7A 5IEBA 1JDBC 5DM4A 3PQCA 3OOHA 5G3YA 2ACWA 1WOMA 3HHPA 5YASA 3HJGA 4JSYA 4NNJA 4YRRA 4EI8A 1PV1A 3HWSA 4RM3A 2BGNA 3UA4A 5L6MB 5HTOA 1RW4A 4JUBA 2GKOA 1A2BA 1AKWA 1O5OA 3S1AA 2OXCA 3PUXA 2ACVA 5CD1A 4IIBA 1W34A 4ZVQA 1JL3A 4IRXA 1UBMS 1Z17A 4EF4A 3FDIA 2Z1MA 3WFJA 1JJFA 3CPHA 1CRWG 3RFTA 1ETUA 2PWZA 4ZKEA 3ZHZA 2BE9A 1QFJA 2Y1EA 3D54D 4HYQA 4QBIA 5KYUA 4ENTA 4I50F 3ZYZA 1DC4A 3CVOA 4CIXA 2YMMA 3M82A 3V2HA 1QHFA 3IBFA 4RY2A 3T4PA 4CLHA 3N53A 1GL7A 3ADKA 3QBDA 3UV6A 4YY3B 1Z2NX 3SXUA 4FNOA 1NNI1 3COPA 3F4KA 2C58A 3KFLA 3NS7A 1A71A 2VEDA 3OZEA 4XWWA 4NCBA 1GKKA 5BN3B 3AB8A 2ZPAA 4B76A 2ZYDA 2BVNA 2FFJA 3RUPA 2GVDC 3MWEB 3A4YA 5T4EA 4Z3KA 2JVIA 3ABIA 5HKKA 3LWDA 1BRTA 4KAFA 4IDBA 1KYWA 1GN8A 4XLTA 1Q22A 1Z0ZA 3OZXA 4F84A 5K0EA 1I3KA 3OCJA 4DMLA 2XQJA 2QV7A 1NVTA 3SNKA 3RYCA 2QAGB 3NXKA 1KSHA 4QJIA 1LK0A 1Q95A 3RVJA 1U02A 2PKCA 3DLTA 5JJCA 1F0YA 2KHZA 5I3CA 4PSAA 3CR7A 4CQMA 5DULA 1IN5A 2YNMA 4BP3A 1JMKC 3UTDA 2WC1A 3OTIA 3CRVA 5U4XA 1WMBA 2JLVA 3N86A 4NAVA 4RVDA 2IK8A 2VBCA 4N0EA 2VUTA 3AMVA 4MV7A 1MAHA 3G7SA 4NJEB 1GEGA 2AWOA 4NG4A 4B2IA 3DNPA 1W36B 4OK3A 2JFUA 3F7OA 3IALA 3LQ2A 1QRUA 4OBEA 4E5UA 3O4HA 4FNMA 1QVRA 1ZQ1A 2WZCA 2OESA 2RB4A 2Z3ZA 4AY6A 1P29A 2GN8A 4AU1A 2DR2A 3FSJX 3B1ZA 1E9FA 1D5WA 2WA1A 2HV8A 3A9WA 1NQ5A 1DI0A 3P0FA 4D9CA 1C14A 3ANNA 4TXNA 1M34B 5JWHA 4HPJB 4NDAA 4X3CA 4PLWA 4ALMA 2X8AA 3B13B 2QJOA 5AXBA 3U09A 1DC7A 4TLLB 3RNOA 2NSLA 5IM4F 1M6YA 1NBME 4IWXA 4DDWA 3AOEC 3BGOS 3E5MA 3GR6A 3R6LA 4QFDA 1P7YA 5T8KC 3ZTYA 3G0HA 3T12A 1TAUA 1PJSA 4A6DA 2BYTA 4DNPA 1TCUA 4QBKA 1FP1D 4UVGA 3JZMA 2A3NA 4FZVA 5DNWA 3G2LA 4YONB 4IV5A 3RYHA 4BNWA 4DM7A 7GPBA 5IHXA 1UFOA 2A33A 5KTMA 4HNHA 4K6MA 4MK4A 5HTKA 4P38A 4E5PA 5IAJA 3ADOA 4GPZA 1KAEA 3JAMA 4G8BA 3SYRA 5EMLA 3TSOA 4BJ6A 1Q0ZA 2OUIA 5FUBA 3FWZA 3HCBA 4KR6A 3KCQA 4X64B 1Y4UA 1IQ0A 2WSBA 5EINA 4RVNA 3KHSA 3C8UA 3NBZC 1LPNA 1YAHA 4JWKA 1HOTA 4EJ0A 3ZCPA 5JISA 1PGNA 1U2ZA 2Y0BA 3RRMA 1M2OB 2EIHA 1WU8A 2HQRA 3UM9A 1JE1A 2P90A 4I3GA 721PA 1JZQA 3D31A 4GU5A 4RU1A 4BU0A 1CRLA 3H0CA 3K9WA 4H7FA 4BJ1A 4M8NE 1XBTA 1GKIA 3HGQA 4WEQA 1WSDA 3C97A 1OWLA 5K0TA 5KMGA 4LJAA 4GBED 2PMBA 5DI3A 1AQNA 1EUCB 1SQ0A 1XNGA 2AK3A 3DVQX 3FPHA 3GQBA 4TL9A 4X95A 5KQRA 3UUWA 4D8VA 4V1CB 3VKHA 4E3WA 4YMIA 2AUMA 1EAYA 2Z2JA 3TRJA 4LHWA 3W05A 4JI0B 3B89A 3OY2A 3VAAA 3VZRA 4L02A 1Z2EA 3OZ7A 4KK3A 1QZTA 1XWIA 3GJTA 3IHLA 2YXLA 4JNCA 5IDYA 5KI6A 5JMOA 1QU2A 2OCYC 2ONZA 5EJFA 4DLVA 1NG1A 2HCFA 2OD2A 1H23A 3VNQA 1OPRA 5JDIA 2JFBA 3A6ZA 2E6KA 1IMOA 1K2WA 2IT1A 1H2AS 4EGCB 1MX1A 2HLNA 3ND6A 4OLFA 4F9GA 4KH1A 3WGHA 1GPUA 2CFRA 1SKMA 1QONA 5ERYA 3NAZA 2OCIA 2Q8QA 2V5AA 4FYPA 4KBYA 1W96A 4G8CA 4PYRA 1L8AA 1DBVO 4PZ0A 4PS1A 3KZCA 3H05A 5AM0A 2VDRB 5E2BA 2I8AA 2J3KA 2GESA 4IL5A 4R68A 5FOVA 1EFLA 3LHFA 1W8IA 1Z5GA 1UC8A 3EIEA 5E4YA 3SWWA 1KR2A 1KOLA 1NNSA 3AEZA 4PLVA 4YT5A 2G4CA 3FDZB 3MUEA 3U48A 5LM3A 1T0IA 4DILA 1ZN7A 3GRCA 1W0CA 4LF9B 2VDPB 3K1AB 5BYJA 3EIUA 1AQIA 5IAOA 4EJSC 4EKGA 4D9MA 4CTNA 3LRPA 5C7LO 4P81A 4FQ5A 3RQIA 1RJ9B 2AFIB 2BRUC 4QEKA 1NBOA 2PRKA 5HKOA 3TZHA 5LYJB 1FXWF 4BXOB 4FYYA 2YDYA 3NNDA 2WB2A 3I76A 3AONB 1BHO1 5I4IA 5T4FA 5TPZA 4B4WA 1S5PA 3R8FA 1E2IA 4U63A 4L4XA 3GAMA 3Q4GA 4A2QA 1BS2A 3COSA 2CEAA 2DWPA 4GSLA 4CM9A 1JSXA 4W8HA 1EIZA 1L7XA 1TVKB 1M1YA 4FC6A 2GK7A 1R4NB 1X38A 2A5DA 2JHCA 5AKZA 1XN4A 1NX9A 3DA8A 3KIPA 2QL7A 4I9FA 1I0LA 3LF2A 3NJRA 3PPXA 5HE8A 4BE4A 4IMIB 4EW3A 4IZHA 1IAQA 1XL0A 3GLRA 1JZSA 4OG2A 1Z22A 3KQVA 3VR5A 2VDMB 1BMDA 4DT1B 1PK8A 4MEJA 2ORED 4ZAFA 1DRJA 1LB1B 1Q11A 3QWBA 5JSQA 5ALSA 2UVPB 2JFXA 1YAJA 2QIPA 4YIHA 2YWEA 4XIFA 1I1NA 4Z99A 4FSHA 4LZOA 2D7CA 2QUIA 2WZDA 1E4EB 3A4NA 4C05A 5KOJB 1PWZA 4FKMA 3L92A 4BFLA 3UVEA 3BD6A 2QTLA 1CFJA 1ELOA 3T9DA 2BHRA 2O3QA 3SE0A 2O1SA 4HRVA 2EL9A 1UK7A 2MSDB 3IAS6 2IOHA 2AJCA 3F1LA 4G63A 5HKLA 1RBZA 5G0TA 4F0JA 4KXYA 3DM9B 3T9FA 2JHFA 2O4CA 4JIMA 3LW7A 2FWBA 5IJXA 3I83A 2X9NA 1TC1A 4QFMA 2YIDA 1GPDG 1DRKA 1OI3A 2GOYA 2VDOB 3SAJA 2YZGA 2WDZA 3ER6A 5T57A 4Q4JA 3L41A 4IGFA 3G5LA 4KWIA 1CCWA 2PQ2A 4Y3UA 1LTQA 2NMVA 1MB2A 4IV0A 6AT1A 3VPXA 4Q4DA 4LYHA 5TRTA 5BY2A 2N1MA 5AKYA 5ALOA 1DKNA 1C9KA 1EP2B 4BU1A 3UK7A 2DQ4A 3PFFA 5AUNB 2VL7A 4FONA 4ZO7A 1L3CA 4AKIA 3IHKA 3QLJA 2IW3A 3R5HA 3U3XA 2HCTA 4QUBA 2HMYB 3DMHA 5GGXA 1L0BA 1REQA 2R8XA 3NHPA 2PX5A 4I0WB 3WIVA 2NW6A 3QBJA 3UXYA 1LH0A 3V1MA 2O7RA 3FVRA 5D7BA 3SZRA 4D80A 2RGEA 1Z6TA 4I1IA 1J6UA 1ULHA 1S3GA 1U94A 1HE8B 5F1OA 4XIGS 3AOEA 2Q2OA 5T8KA 4OHKA 1XZNA 3UO8B 2BJHA 2QW8A 2ZRGA 4KAJA 3VU0A 1KVTA 5GJVC 2V6JA 2PJUA 3HJTA 4MYDA 5SY9A 3UBMA 2CUNA 1A69A 3LXXA 2EBUA 5AHWA 5B3KA 1VL6A 2O23A 1OLXB 4UREA 1E4VA 5AJUA 3OZUA 3U13A 4PXYA 1M5UA 2WSMA 1Z2PX 4GGPA 4XM0A 3D2CA 2WY2D 2QW0X 2OSBA 3I37X 1VRVA 2AYYA 1NONA 2P6OA 4ARAA 1Z2OX 1K3FA 1UJ4A 2BMVA 2V7WA 3DFMA 1I2BA 4JYAB 1BDMA 2H8GA 3K1ZA 5LMZA 1RWOA 3LU1A 3X1DA 1KEWA 1M33A 4N01A 3G13A 1OBHA 5CNMA 2QYHA 3DEJA 3MT7A 3V3KA 1NBIA 1XQXA 1YC5A 2ADFA 1K9VF 2FETA 2Z58A 4HS4A 5ALIA 2NYRA 3WWDA 1ZGGA 1IVSA 2OLJA 3LPLA 3SLGA 3ICQB 4WFQA 3WYBA 1NYRA 1R3DA 2WDPA 4RX1A 3E7PA 1WSAA 5BUZA 2EKPA 1FDOA 2JGIA 3O8OB 4TQUS 4EI9A 3PWSA 5KPJA 4NL4H 1V25A 1P7PA 2XT0A 2YV3A 2B36A 1PLLA 2BW0A 2HRBA 3GDWA 2ZUFA 3VH2A 5HGXA 1X0VA 3B12A 1U5CA 2X1VA 1KAQA 3R4VA 1Y6FA 4B83A 2ATCA 4OUKX 3HR4A 3O9VA 3P0RA 5FA6A 3G2NA 3NAMA 1HRDA 5EJAA 3AYZB 1I4LD 2Q07A 3ROZA 3KOMA 2ZS9A 4IJVA 2DETA 2Y1DA 3FGOA 3NZEA 4NE2A 4TV8A 3K9CA 4UTOA 2A1UA 5CFMA 1NJ2A 2YCLA 1VJGA 2YV2A 4JDPA 1NP7A 1SXHA 5HZGA 3LIIA 5JCXA 3QSYA 5CNJA 3L49A 1KP2A 3TLYA 1CUJA 4KIFA 5HNKA 3EK2A 4RGYA 4RMHA 4DCCA 5IUJC 1HE4A 1WKBA 2VPZA 2F43A 3ETEA 4BLRA 3DWEX 3S0JA 5L3QB 1XPJA 2PZGA 4DWVA 4G5RA 4C4AA 4AK9A 1V43A 2DWQA 5TPWB 2RGGA 2ZRKA 1R6VA 2W90A 5B2EA 4OFXA 1LKZA 1WHSA 3KUKA 3ZTWA 1CQIB 4EG1A 3V9AA 4DCVA 3NIDB 4DQXA 2YIMA 1H65A 2QZ9A 2YR0A 2V7QD 1QRSA 1ACLA 4HNSA 2V6FA 4P7FA 2WE7A 3DYIA 1EVQA 1KAOA 3UF0A 4C0WA 4URWR 5IZCC 4I81A 4EJSA 1C7ZA 1ZEJA 4PYOA 1HQYE 2QRHA 2WV7A 1WTCA 2XUOA 3SBEA 2BRUA 4H0NA 4JBNA 1B6GA 2I6QA 2AFHA 2RGWA 4M98A 1SD1A 3O47A 1OLSA 3AHCA 4R1NA 5CCXA 4LI0A 4DXAA 1MTOA 4QUJA 5L3SB 5FUQA 4XTRA 1DBWA 5IKMA 6ABPA 2Y6UA 2XT9A 3WYFA 4B6EA 7YASA 1BDJA 2DU8A 3ZW9A 1BHJA 1NJGA 1Y3FE 1ECCA 4DEVA 4B6GA 3DHVA 3G88A 5CHEA 3AGPA 5DLPA 1PL8A 5EIBD 3RVMA 5EIEA 3UUFA 4Y2PA 4S2EA 3C98A 3KD2A 2VWHA 3QYPA 4INPA 3ROGA 2J31A 5CA0F 2UYHA 2SICE 3PNKA 4A1OA 4HGYA 1KS9A 3CINA 2FP4B 1LV8A 1VKZA 2H06A 2ORYA 3HDTA 3I3SR 4JLJA 4MB0A 1B8VA 1FDWA 4JJ7A 2Y0PA 1SBTA 4FDMA 3E2IA 4TMXA 3TL6A 4XYGA 1U63A 3IP1A 5IDQA 5CU7A 5E8JA 3LCUA 1XD8A 3QU5A 1IZ0A 2ZYWX 4B75A 3JAKA 2RHLA 2VK4A 1QO0A 3NXSA 1C8BA 2VKTA 2HF7A 1MVNA 4ZVSA 4JYZA 2ZSEA 3GV0A 3SD7A 1RBQA 1JR4A 2C3MA 1WB5A 2QI9F 3FTDA 2OC9A 3OPYA 1YRQA 4Y6RA 1KBOA 4CCWA 3E5HA 1IRXA 4MDYA 5BV2P 1YJBA 4GX5A 4OSEA 2I0FA 2C29D 4F4CA 3TKYA 4A15A 3AG5A 3KZVA 4UULA 1V1RB 4JI7B 1C5KA 2W98A 3CA8A 1UOEA 2NT4A 2CVOA 2IZ0A 2XOXA 3H16A 1U0BB 3IHWA 4IDOA 1B7GO 1JVBA 3I34X 5E8RA 1NC1A 2Q5LA 4GGOA 2WHXA 3A6DA 2CHUA 4BQFA 4KI0A 2YRXA 4REOA 3GRFA 1J4AA 2MJLA 2ASVA 4HLQB 4YC7A 3IR6A 4GM4A 1IL0A 4RHFA 4FXPA 2AC7A 4N5IX 5LLDA 3IV9A 5C7IO 2GEKA 3N39C 5EEHA 3R9WA 2XGGA 4LF6B 3BC1A 5FNZA 4C7KA 4S2UA 3IAAA 4EPXA 3EF1A 2WEKA 2IL1A 3KKQA 2DQSA 1WV0A 1QKJA 4OY3A 4BX2A 3T3NA 4ZOCA 1JI3A 1QFXA 2BFAA 2PKQP 3LKDA 4MVJP 4K8RB 1XHEA 3OO1A 3GGJA 1C9DB 1E3WA 1M0TA 5A5FA 2WZBA 4OF4A 2JLWA 3U62A 3IQZA 1IY9A 4J0IA 4QRIA 4ZOEA 4BRWA 3EXFB 4AJ4A 1OXUA 5JYDA 1RXEA 2BGMA 4ZVTA 4KQHA 4L72A 2A92A 2PUVA 3IV7A 2VA9A 4MGEA 5E7JA 3VTKA 4BNXA 1S9HA 2DWUA 1PSWA 3DZFA 1PT6A 5EWMB 1P7ZA 1ZD4A 3PA8A 3KPYA 1QRTA 3F9CA 2N3ZA 2QENA 4OJKA 1NBAA 1K4YA 4XA8A 5FJIA 1I5RA 1Z16A 1NUPA 2P2CA 4PYNA 1J8QA 3QF4B 3CLTC 3NOXA 2IVFA 1XCGB 1GLVA 4IOMA 4X7PA 3TTXA 1JDPA 1C1XA 1PUXA 3UHJA 1X87A 2RHHA 2JGFA 3BGIA 4NS1A 3EMKA 2XT6A 4GE3A 2Y4NA 4QYIA 4J7CA 3FNBA 3GEDA 3O91A 1IEQA 1Z75A 1QLWA 3HB5X 1QFSA 2QROA 3LUPA 1K8RA 3IUNA 3GEGA 1QVZA 1Y42X 5HJ2A 1D03A 1W5AA 3X0DA 4E70A 1C3OB 5ITWA 3NGLA 5IT5A 5C1IA 3COYA 1CDEA 3D2BA 1SD2A 3OZCA 3Q9SA 4IIXA 1XJQA 2R6HA 4IXWA 3T5MA 3KZ1E 2OHJA 4ZT2A 4X63A 1XA0A 1LRJA 3E0XA 4KIJA 3VH4A 2B5OA 1EJ0A 3EHDA 4QATA 4R2XA 1WVIA 2IYLD 2IS4A 3N0WA 4E4TA 3ZDDA 1KEUA 3EXIB 5LFAA 2PKQO 4DANA 1QK3A 2RI0A 1V11B 4F21A 2G9VA 3U9TA 1U8TA 4QDKA 4JELA 1PJ2A 2P79A 1DHTA 4RENA 4W9RA 4DSAA 1TM3E 4ZQEA 4XJTA 1CR0A 1L4NA 1NBMA 1YS9A 2GPJA 4L75A 2RD2A 4BP8A 4RM2A 4WY5A 2HHHB 2V65A 3EEBA 3TZ6A 4QQ8A 4CETA 1ZISA 1QSGA 3HJBA 2C84A 3W7AA 4M0LA 4QBGB 1V2GA 3IDQA 2COUA 2MOKA 2FPPB 3FTCA 2FVXA 3IGFA 4CNQA 5L40A 3COJA 3CMMA 3BFKA 2H4WA 2GHQA 4MDHA 1HGXA 1QKKA 5IAGA 1D1QA 3OUZA 5HUJA 2G70A 1JLSA 2R1TB 4KR0A 4XDGA 4AAYA 4AI6A 4OHFA 1OHHD 2ATVA 4XWYA 5JAUA 5IZCA 4WA8A 2CNWA 3SEAA 2B1IA 3KK0A 4YCBA 3W5IA 5B3JC 3KS9A 4RZSA 1HKUA 1N2HA 3B82A 1EYZA 2IC5A 2R11A 2FWPA 3U80A 1NWHA 1E1MA 3L4BC 2PR2A 4RAOA 4BX3A 3PHBE 3PG5A 1AS0A 3EE6A 1B3RA 3WIDA 4RQTA 1IPFA 3GJQA 5JC8A 4BEJA 3DZCA 5IU6A 1DXQA 5E4TA 1QP0A 2Z4SA 2GO7A 4C14A 1T1JA 3KALA 2GXAA 2QLNA 4IAOA 4LOKA 3P2JA 2WJJA 1L1EA 2WF7A 3T4XA 1MX5A 2FFQA 1M2EA 2CLHB 4WJKB 1K06A 2VNJA 3KXLA 4KFUA 1R5BA 2JKYA 3KHUA 4B7ZA 4MVCA 4EB6A 1BJKA 2XDYA 2C2XA 4LE1A 3IODA 3C24A 5LDHA 2C9BA 2FLVA 4PRZA 2V5VA 1K5HA 1JDTA 4RLSA 4LXYA 5CIWA 2W6ZA 2BGRA 1MVLA 2YVLA 2DHQA 1ISRA 4IQFA 3PNOA 5BW6B 1RHQA 3FG9A 2YHBA 3VV3A 3TFOA 3PPVA 1AGYA 1O7JA 3WADA 2FW7A 2H4XA 4DE5A 3O4IA 2EP8A 4L5JA 4MWGA 5BWCA 5K03A 2H2IA 4XVCA 3EEFA 2PLAA 4FFPA 1CZLA 3BWYA 2QXYA 2Q28A 4RJ2A 2YICA 3P4YA 2EGGA 4NULA 2XUPA 2CHVA 4I50A 1DEOA 1V5EA 2DUUA 2XQVA 4ROSA 1L7MA 2NAFA 3AWIA 3U9LA 2VDNB 5F1KA 3FLEA 1YBVA 1BFUA 1LI4A 4FGKA 4DLWA 1E3MA 1TFRA 4ZK6A 4IOJA 1C9NA 4WDRA 5FBWB 1UODA 5DHUA 2GPSA 3BGDA 5KPDA 1V5WA 4EKDA 3CM0A 1NFRA 1TX4B 2WSSA 3IH5A 4XR4A 4CEIB 2PRSA 3ONFA 4JLNA 3RU3A 2PZEA 4C6TA 3LBFA 3N8GA 3W9BA 4DR1B 1C0PA 1QYIA 3PI6A 4Z9BA 4HD8A 1UXOA 4YGXB 4F2WA 4ZYTA 1QWSA 2X76A 2F3SA 3I23A 4AG5A 4CFZA 1PK9A 1UKVY 5HFJA 1N1MA 2EJUA 4RQBA 4A0SA 4F85A 1TGVA 3TSAA 2V4MA 3WB1A 5EA2A 4TRMA 2AHRA 3AUFA 5TQVA 1EG7A 3D6AA 3GFSA 3UGTA 3WICA 3PNLA 4YMTA 3H5LA 3WP0A 1JQAA 2RGUA 4HEA1 3IIMA 1BEZA 4OQ4A 3GROA 3M8KA 3P2MA 3WIEA 1M5TA 1S1CA 4EG7A 4F7WA 2P8JA 3E3MA 4CI9A 4OEHA 2HCRA 5DHRA 5JFTA 1NSYA 4J0EA 1DWPA 2QP3A 1FNCA 1E5LA 2A2ZA 5GVRA 3GA5A 4E5VA 5BOSB 3TQFA 2CT8A 2QJTA 1ORWA 2D5LA 3X1YA 5FI0B 1XRSB 4HRAA 1N6LA 5K0ZA 1EFDN 3DTVD 3NBKA 1XKTA 4CF4A 1DARA 1HLPA 2XODA 2FE1A 1T9HA 3A25A 4KRGA 3IESA 2BP7B 3C41J 2YWCA 1FW8A 4MWCA 4RS4A 5DOZA 2DBRA 2BI8A 5EI5A 4XASA 4J0KA 5IM4A 1P2SA 3W5AA 2ZYIA 3C3KA 4QPDA 1Z47A 3EDCA 3HE3A 4LPSA 4GPTA 1F0KA 1T13A 3THWB 5BN5B 4YBRA 2QX6A 2YYYA 3C43A 2R6DA 3LKVA 1US8A 5C32A 4FFLA 1C1HA 4Q12A 2CJXA 4IGIA 2I4RA 1VI2A 4N8SA 4RIEA 2JFGA 2GXSA 3ZJ4A 1AUQA 3RHZA 3T4UA 1SKYE 4WIAA 3A27A 3L0SA 4LDAA 1MVOA 3IMKA 2ECOA 3T3DA 5G4KA 4RLHA 4MPTA 1CUSA 3RUIA 4L0QA 1HQDA 3DBRB 3OQIB 4FYJA 4TQGA 4KVFA 4WFIA 2R7LA 2REXB 4HQ6A 3RVBA 3F96A 1RBMA 4IX9A 2C7PA 1LX7A 1U3CA 1Q14A 1SHJA 4PTLA 3OE4A 4L9RA 5J63A 1XRQA 2GN0A 2RGNC 5LQDA 2Q9UA 1AIPA 4IIJB 2WYVA 1VMEA 3KP1A 2XNDD 1VB5A 1K6EA 3PGXA 4FPXA 4BNZA 3ZHVA 2G77B 3MCZA 1W76A 1SUWA 2AXEA 4C7VA 1D7OA 3K6SA 5K0SA 4E07A 3AH8A 4LYGA 4JJ4A 3A7DA 2WAYA 5TT1A 2QUHA 4XLZA 4QDJA 4U2GA 2HMVA 2BHLA 2MSEB 2WILA 2ZM6B 4F91B 1FVFA 1M1NA 3SNHA 2CKMA 3BRCA 2ZRQA 1DV1A 1B76A 1Z74A 2VSXA 3BE4A 4EJ2A 5E1MA 1QB7A 5FBZA 2ZTSA 1DKLA 1AKTA 4LWZA 1RYYA 2D1FA 2XUKA 4OSPA 3CRRA 4BMNA 4LBZA 5ILQA 1LQTA 3ZY2A 2FJ0A 4IIGA 2RH5A 1QYWA 4KQFA 1P1CA 5JLAA 4A5OA 2FZGA 4CLEA 1KZ9A 3HV0A 4M1ZA 1WF6A 4UBNA 5ALQA 3S28A 3WMRA 3H5AA 4HHEA 2DULA 4MW9A 5B3JA 3REQB 1DV2A 3L4BA 1R16A 3WR5A 5CITA 5LDDC 3CONA 2XIQA 3G9UA 3JASA 3G59A 3LC0A 4MMXB 4EHNA 3H5WA 1J5PA 5E0KB 4MAMA 3I2KA 1JZTA 2LV8A 4LNUB 2W4QA 4LRQA 5E9WA 3IE0A 1GWNA 2GS9A 3SBOA 1XP8A 3K9NA 1XMQB 1TTPB 3T3OA 8MHTA 5FYDA 5H70A 1D1PA 2OWDA 2J3MA 2YFHA 5EXTA 3TMYA 2AOUB 2VTKA 1MA3A 1R0KA 3PC2A 1DJPA 1Q20A 1Q15A 1J39A 3A6EA 4Y2TA 2WUDA 1Y1KE 3QVUA 2QTVA 2A58A 4YDSA 1MLDA 1ZJYA 5ER9A 1UMDB 2B4YA 1YHYA 4M38A 1EVJA 4TT8A 5EWLA 4FB4A 4ZQGA 5C8DA 4O2AB 1JT9A 1NMSA 2BZ0A 3C1OA 4QJ5A 4F3CA 3IMEA 5A06A 3GGPA 5C1BA 1SBHA 2JAUA 4X66B 2EFJA 1XZIA 5C5CA 3CWCA 1BC5A 2WI8A 3VOTA 1B42A 3KC2A 1DO0A 1V8ZA 1ABEA 1TJ3A 2ZS7A 4G86A 1KFKB 5B53A 3BK7A 1FFGA 5BR8B 3CF2A 1LDBA 1UINA 2SKEA 1E9CA 2Z8YM 1OV4A 3RFVA 4KX5A 2VSOA 4QQKA 4IRUB 5LJLA 4DIBA 4MQEA 4WGGA 1JN0A 1WRBA 2RHOA 3F7NA 4Q1EA 4BKUA 5JOQA 1UOQA 2VUUA 2E18A 4Q7KA 3RNLA 2PUHA 2RGRA 2PGXA 2FSPA 3A2KA 4DNFA 1H9CA 3KQLA 3GJ0A 3PQDA 4BO2A 3DCYA 3LZCA 4QZVA 1ECFA 1W47A 3DS8A 4TWAA 4B43A 3UB4A 4BBJA 1EVYA 2WTEA 3IJEB 1A98A 3ZNOA 1MD9A 4F38A 1Q0PA 3FXAA 4BNYA 2QI9C 2G9ZA 4N48A 3VPBA 1ZONA 3KJIA 5DX0A 3KVVA 3LYUA 1SR8A 4M1MA 4A2WA 1G2PA 3WE7A 2OPHA 3VAYA 1NFFA 1F9AA 1K66A 2DJ5A 3H1FA 3QPBA 1Q0TA 1BFDA 1H66A 4QXAA 4TXMA 4GOOD 1DVRA 3U17A 1PS9A 1FSZA 2BFEB 5F3WB 2O2SA 2QMYA 3V00A 3Q5EA 1FOEB 3FVVA 3MT8A 1W4ZA 4J0JA 4RL6A 4RJJA 5P8WA 1ODFA 2H3HA 2ZU6A 1F0PA 3W79A 5K3EA 5HILA 3NALA 4AO7A 1H2XA 4GZ3A 1ZXBA 3JQPA 5ITZA 4V0SA 3MJHA 1JJ7A 3ZU3A 4B6QA 4CLDA 5B1SA 1GFIA 3C45A 3HBFA 3WBJA 3KPUA 3E3LA 4KQMA 3UJAA 3DBLB 2A9RA 1E3QA 2O7QA 2ONCA 4BIMA 2GKSA 4ZI2A 3UCFA 5U4QA 2QL6A 1FJGB 2VKQA 2R3SA 2OSVA 1GGJA 4FMCF 2XMRA 2NU9A 2JLSA 3NKLA 5LA6B 3EXHB 1E2LA 2YN4A 4HUQB 3NV7A 4L5IA 1CR1A 1TD1A 4IS3A 5DDIP 4F5ZA 5JXJA 1JB1A 4LDJA 3VHQA 3R9XA 2BSAA 3EVZA 1HQKA 2QLFA 4R40A 1JRLA 2PSDA 3L18A 1SXIA 1N2CB 3W8RA 1U2SA 4YJ2F 1VDMA 2QMOA 2E4AA 2W58A 4CT5A 4WY2A 3U4AA 3TXYA 2O0HA 3K72B 2F2TA 2G1UA 4G6ZA 4N0QA 4X6UA 1HSOA 2ZUWA 1GUFA 2QMHA 2QEQA 1E0SA 2XCLA 4NYJR 4OIMA 4OXXA 4RXUA 1PR5A 4OFZA 1E62A 4N39A 1EX6A 2H7XA 2M6SA 1C50A 1W6RA 2V1XA 4FDUA 1XHFA 1XJ5A 1P1RA 3K6RA 1MQ8B 2OWEA 2R68A 2VZ8A 1FFXB 1W0KD 4FLMA 4QTTB 2VSFA 4QXMA 2EF0A 2J3DA 1G20E 4PANA 2REQA 4UU1A 4HRXA 4AZWA 5LPNA 3FHTA 1B8UA 1SIOA 4M1SA 3EGEA 3MC1A 4J16C 1RPTA 2VDWA 4Q47A 1RPAA 1N3LA 1A9RA 4NZPA 3SHTA 1A4UA 1G21B 1Z34A 2X5NA 3N6XA 4K40A 4KVGA 4X24A 5A6SB 1X14A 4L22A 3WK4A 4B6OA 3O31A 4GBJA 4GX2A 1DAMA 4LHXA 4QGAA 5EMJA 1TMGE 3OF5A 3VKUA 2V7VA 5JPIA 1RIFA 4QICA 13PKA 1J7KA 4KH0A 3RWOA 4D41A 2XMBA 3ITKA 4LNHA 2WAXA 3U4GA 5ECGC 3TBKA 3KR1A 3MW8A 1DS6A 1JX6A 1RLUA 2ZR0A 1M3SA 2ZRFA 4OYLA 1J2UA 1FDTA 1NMXA 3BL5A 5JYBA 2BKUA 2PU7A 2PD6A 3FZGA 3R2JA 5DBEX 3FMVA 1O96A 5JR3A 4TTTS 1AN0A 1UBHS 3LYHA 4YP7A 2OFFA 1YI8A 1LPMA 3KVRA 3OZFA 3SOZA 5JMWA 5ISMA 3N2KB 3AW9A 1WXWA 3CEPB 2VFAA 1N6HA 1M8JA 1TW3A 2I22A 3R7AA 3NP7A 1CZOA 4A8HA 5ELLA 3K31A 3M3HA 1E3DA 5LQUA 1GGFA 1AA6A 3CVVA 3MWLA 1NI3A 5AK3A 4L4ZA 5EMKA 5FUYA 4P7BA 3VAZA 4DPLA 1V1MA 1DPGA 1WB4A 3NAQA 4YA6A 4BN4A 5A4KA 1ZHFA 2Y1KA 1HL7A 4AVYA 5BVHB 1A97A 3FYHA 4NYJQ 3EISA 4U7GA 1T5TA 3C39A 3NTUA 3NYRA 3M6VA 4GYJA 5CXQA 1G0NA 2AZ4A 4DLSA 4DLAA 2G76A 4IJQA 5CXUA 1UIMA 3RTGA 1VPWA 4HLCA 1AGPA 1OXXK 2BFOA 3JR3A 5DSZA 1ZM4A 3P9KA 2CUTA 2XCSB 1T26A 2EG9A 2IITA 2FRXA 3KRTA 1ZG3A 5EJGA 1M10A 2XGMA 3LQ4A 3X1KA 2IU3A 3VDXA 3UPUA 2C31A 1XQVA 2QUAA 2ADOA 4EGAA 4A2PA 2C8LA 3JZDA 4KR2A 4DPMA 3P20A 1UBKS 2XTJA 3TVTA 2VAXA 4E2XA 4M0PA 4PCLA 4C5CA 4FFRA 4YAGA 2BKXA 3PC8C 4BLVA 3L06A 2IUYA 3D8SA 1QE5A 1ZRHA 5FPHA 3THYB 3H11A 1MDFA 2JHAA 4BY9E 4QOSA 2EBWA 1X7XA 2WQZA 5HSGA 4TLEA 1KZHA 5B7PA 3UUGA 1MT3A 1WVMA 1XDGA 2I1QA 2JGRA 2QB5A 5CA0A 1JPUA 5J58A 1PV2A 4R2IA 3E5NA 2R1VA 3QFCA 4IIDA 2GERA 1JJBA 1PT9A 3TRHA 1HYQA 1IPEA 2WWWA 3G9QA 2NUPB 1JF8A 1NWCA 2JGKA 1GHTA 3C3BA 2MSLA 2RHJA 3BE6A 3R5KA 4GOKA 3S27A 5JFOA 4S1OA 1OX4A 3R40A 2UUAB 1OWNA 2HAEA 4DCUA 4YLEA 4MW7A 3G8YA 5E2AA 3Q3IA 4LXTA 4X6XA 1XEXB 5FV4A 5IAAA 4NV3A 5BYAA 1AXRA 3R0JA 1EQAA 3HMQA 3VV2A 2CE7A 2AJLI 2JATA 4I08A 4WGFA 4L6AA 3LM8A 3GRKA 2P2YA 3V7YA 4A0FA 4HVLA 2C2GA 1UXJA 2PZJA 2UVDA 3CKYA 4X90A 3PNPA 2D62A 4X65B 5KYXA 1PNTA 5B2FA 2O8FA 4MVXA 3WLMA 2X0FA 2I66A 1N5DA 1VHLA 3KYCB 5DN9A 3GVXA 2P5TB 4IHJF 1DKRA 3QUSA 4W99A 2GNAA 1XZBA 2O50A 2J6BA 3G1WA 3GP3A 3IEXA 2ZIZA 4RUKA 3CLHA 5CBPA 3IVXA 1Z5WA 4E88A 1I2ZA 2F3PA 4G09A 2RJ3A 3L1JA 4IJKA 4Q7JB 4YHHB 3KQHA 1JKJB 2DY1A 3RUFA 2CVQA 1ONNA 3HEMA 1PEAA 3E9NA 3OP1A 3K2EA 2WF9A 4LJ9A 4HNRA 3WNCA 4KACA 3B3QA 5EKDA 4BFCA 1U1DA 1ZWLA 2FE4A 1FDUA 3MS4A 5CYGA 1CG6A 3FROA 5FXMA 3O94A 3F5QA 4OYRA 2HIGA 3DO8A 1TOAA 2VOEA 2HJSA 3AV3A 1TT5B 4HNAA 1ZP6A 2JJ2A 2JCSA 1GPYA 3ADPA 3ZHXA 2RG1A 5K3OA 2ZJYA 1DMSA 4XOIA 3TL2A 2PXXA 1C7EA 2P1DA 4R8VA 1HSZA 3LBAA 1EHCA 1K0UA 3G8BA 3WLPA 5EL0A 3GT7A 1IK6A 3RUHA 1SCKA 4YV2A 5HF8A 2J6HA 4DQLA 5JFGA 4CMJA 3BJRA 3CUTA 4KSYA 5FTWA 3P9SA 1QLHA 1W88B 3PEUA 4DGSA 3A11A 1S2OA 1K8YB 3W5CA 2FVYA 3OMLA 3PDUA 3AJ8A 5BNFA 1B16A 2Q3LA 3VO2A 2JFPA 5KVVA 2QNBA 1H2HA 2YV4A 4J16A 4JY7A 3DSRA 3GYBA 4CL2A 3TINA 2RGBA 2XLCA 5HQJA 2PH3A 2ZT5A 3FUUA 4HZUB 4P4SB 1H2FA 4Z7OB 1BH6A 1E6WA 4ML3A 3DDNA 3IUQA 4ND5A 2RHWA 3HCOA 5FBRB 4Q4LA 3VR5H 2EX1A 4R0VA 5CCBA 2FWNA 4IOKA 1LW6E 4UZSA 4ZAGA 1NAIA 2QKYA 4I46A 1JAHA 1DTEA 2EFYA 2P68A 5CLJA 2WJ4A 4LC1A 4W4TA 3LY7A 1OC2A 1EFRD 1NI5A 2Y1FA 1PS0A 3X2FA 1N4AA 4X8LA 3ILHA 1B8PA 4KFRA 3RASA 4M1QA 4BQNA 5KUTA 3SZUA 3O9MA 1S3FA 2F6RA 2EC5A 1OXSC 4D3DA 2UYOA 1XEAA 4BFWA 2WSLA 4OQNA 4C2BA 3ZQKA 3QENA 2JLZA 4KMOA 3PVSA 4AUMA 4Z51A 2WAOA 3TW0A 4JLUA 3IVMA 4Z2AA 1FSPA 2WWVD 3WGZA 2HHCA 4GECA 5FT9A 2IV2X 2YWBA 4RDHA 3HEAA 4ZI5A 4UBLA 1EGHA 1E9SA 1Z6XA 4JKIA 5JE8A 1TAQA 2CJWB 4BO9A 4E2WA 5KJCA 5LD2B 3BGWA 1PDWA 2QNRA 1XTSA 3MK31 4JJKA 3A1NA 3L40A 3ULKA 2JBAB 2NTVA 5LNK1 4NZZA 2NUAA 4P3PA 2HB6A 2KMLA 4X93A 1L5HA 4F6RB 4N6OA 4XX1A 3FHOA 5A1JA 2WD9A 4EQZA 2P69A 1Z5OA 5AIBA 3K2IA 4IUYA 2ZAMA 1NMZA 3FPCA 4DG8A 5I6DA 3SC2B 1MU0A 3EULA 1TZKA 3BXOA 3DCNA 3K9FC 1JXMA 3FWPA 3RSGA 2VCHA 2CJFA 1N7IA 3QX9A 2EATA 5HIMA 5ALZA 4CR6A 5IARA 4LZWA 3WMEA 3LA8A 2WNIA 3HSYA 4X20B 2BM0A 2ILTA 3JRNA 4HVAA 4MV8A 4PQEA 2GBLC 2Z95A 5LQKA 4WASA 4QGHA 3N5KA 1P17A 3PC8A 4FX5A 4GLJA 5EMHA 2ZKIA 4WXPA 5IBQA 5JATA 4ASUD 3ILVA 1NVKA 1CJKC 2WHQA 3HLKA 3VU3A 1TEXA 4GEKA 2E5FA 2IXDA 3L2OB 4WBXC 3S5UA 1QQ6A 1CY6A 1BGXT 1OIWA 1FUIA 2YVQA 3ZBUA 1T6BY 4B1FA 1FUUA 5BQPA 3ZXYA 1ZH8A 3KQNA 4K3UA 3OZIA 3M1IA 4KW7A 5ALYA 4CHGA 3ZVMA 2JCBA 2PUBA 4JODA 5MN5A 3QA3E 2ZWOA 2HWKA 4AKTA 4ALIA 4E46A 1X3LA 1HF3A 1JEYB 1G3IA 4WI1A 2QUBA 3HO6A 1Y1SA 4LF7B 2E0IA 3K0BA 4GR9A 3HKCB 3WGNA 5LXTB 3IP8A 3TPCA 3DUFB 5KMGB 2QYOA 3N3BC 2E4XA 8AT1A 1Z6AA 4QTYA 1JR6A 3FDXA 1GTSA 2OHIA 1X13A 5DCLA 4W5RA 2YOGA 5GJCA 1Q83A 3JARA 3KUCA 3SC3A 1D0IA 2XTAA 1ITZA 1GZVA 3ICPA 3ME5A 4B32A 3DE1X 5KNCD 1TQDA 1IQRA 1TRHA 3DL0A 4QSMA 2V3WA 3OF3A 1K63A 1O97C 3UN1A 3TUZC 2E87A 4AZ0B 1P3Y1 4FFWA 2DECA 3CMCO 3OLXA 2PT9A 1U1CA 4WOKA 4ZD6A 2BFMA 1EIWA 4P84A 1PUIA 2C78A 3IBGA 4FDVA 4C3OB 3JWPA 3RJMA 1ILEA 1GRVA 1JEQA 4UPDA 1TM4E 4CCAA 1UPUA 1A0OA 5H8WA 4R2LA 4JT8A 1QLJA 4MRMA 4PY2A 1K5GA 1GEEA 1VKRA 3MAGA 3BWBA 5KYYA 3E9MA 5F7XA 1HE1C 3KUUA 4JEUA 4PFQA 9LDBA 1Z2CA 3H6KA 3M4JA 4A8JC 3EGDA 1WY5A 3AJAA 1WMFA 3PE3A 4KDCA 2WM9B 3TJMA 3UAVA 5JCPA 1TK9A 2RKOA 1NY6A 4I3FA 1KY4A 1RRGA 1FQKA 1J09A 2BFNA 2I6TA 3N8NA 1GV1A 3UHFA 4O1MA 3ZIAD 1Z4LA 1T5BA 3CEHA 4HO1X 1WQ3A 4TKLA 2JBWA 3TW8A 1L3BA 2R8BA 1I7DA 4RY0A 4MQMA 3NC1C 1GTVA 4J90A 1PJLA 4G1BA 4HADA 1BWRA 1AA9A 1R8QA 5H02A 3WQQA 4AS2A 1X1QA 1TKBA 1D8AA 3PEFA 2ZWMA 1BEEA 3ZHYA 2HLPA 5CM8B 2F8MA 1AE1A 2GJKA 1Y9DA 4ER0A 1E5VA 3LD9A 2PT7A 5EXXA 1R88A 3F7TA 3V6MA 1XJ0A 3OZTA 5HKBA 5BP7A 1GDTA 3ICEA 3FKQA 2ZRNA 4J4HA 3I30X 1TMYA 4MS4B 4XX0B 3NBYC 5F9MA 5DGHA 5KTNA 1T5DX 2P9GA 3CX8A 3H5OA 5K8JB 4IBOA 1PSDA 2RHMA 3C7KA 5AJWA 1OB5A 5CB6A 5FPTA 3LVQE 2XXAB 4MTCA 5EMMA 4OMCA 2YIVX 3R7WA 3KU4A 5LYJF 1VMAA 4UE2A 3ZKWB 3A4LA 4N5NA 3ACCA 2V59A 5FR2A 3GLFE 4JQCA 2WM2A 3ZQUA 4FHGA 3S2FA 2D74A 3OQMA 3EIHA 3NOQA 2FPRA 1N5RA 3DTYA 1SWVA 1XWWA 4JHXA 4K3VA 4TT3A 3O38A 4QNMA 3O74A 1EK0A 1FNNA 4LJKA 4JLBA 3TTVA 2VXYA 1ZD8A 4BNDB 3ZHRA 2P30A 3V48A 3JV7A 4HG2A 1T2VA 2I1VB 4DJEC 2EFEB 1YBHA 2G6TA 3OIUA 1N9KA 3BIWA 3GUVA 4K6OA 4O08A 4UMDA 1KZ1A 4YWJA 2JKZA 2QM0A 3BUSA 4G9BA 1TIPA 4ARVA 2BKLA 4EMBA 4NE9A 4G07A 3M34A 4ZRNA 5IXJA 1RQ7A 4OM7A 2B94A 1WXXA 3S1SA 3KPJA 1PJAA 2JIOA 4RC9A 1WZNA 3H7IA 2ZRHA 4B6SA 2CCGA 2V0NA 1N7JA 3DPIA 5C80A 1U7TA 2Q7DA 3JQAB 4CL0A 1IB6A 5TDHA 3PFBA 1YNOA 3AZOA 3IBYA 3IMCA 1BU8A 1N0WA 4RGBA 3WIUA 3PT5A 5J9FA 3K53A 1J7JA 1F8UA 4MRAA 4BMOB 1DCFA 2ZVPX 3F3SA 2YV1A 3JWIA 3HKEB 4DRXA 4R1SA 2QZZA 4FHEA 2C2OA 4UBOA 2FTKE 2X0NA 3DVLA 4OHCA 3Q8LA 5KDDA 3L4JA 4H15A 1T6NA 1GZUA 4GOJA 2Q2QA 4PRYA 2KM1A 1DXYA 4ZU3A 4G85A 3HNPA 4KXWA 1NDHA 4HEHA 3HCFA 4Q48A 4BQRA 3AL3A 2YHAA 1HFJA 1OFTA 2BFFA 1ZGCA 1LVHA 1RWPA 3LZDA 1HYHA 1M2GA 4ID9A 4KQJA 4QGSA 4FYWA 5BQ3A 3Q12A 4GI3A 3NKFA 3GJYA 3HRIA 3AXSA 1OFIA 3G82C 4K1XA 5CLHA 4L0MA 3PDJA 3DMGA 3G7NA 3L0DA 4LFCB 3G0BA 3B78A 3CT4A 3AC0A 3EBOA 2DFLA 1G20A 1EJBA 3ZVLA 4C5AA 5K5EA 3AUUA 1P6UA 3E18A 3OBBA 4JGBA 2WR8A 2P6RA 2W2OA 2GBLA 3ZGZA 3T4EA 3JD3A 4QU5A 3LK6A 3J81A 4URUR 1C9EA 3PDIA 3EG9B 4X5OA 1PLKA 2VXOA 2PT6A 5CT5A 4ZO9A 2VHYA 3J80A 3FTFA 1O9GA 3DMPA 4HXGA 1U2DC 1RFGE 3IPCA 1UF9A 1G6OA 1YVUA 3U5TA 2VHUA 4YV0A 1N57A 3I73A 1Z39A 2GCEA 2IIPA 4PPYA 4G5YA 3WGJA 2A0YA 1SCJA 1V4VA 3GX1A 3FR7A 3HG7A 3INNA 1L5LA 1PL0A 5K2MA 1G3UA 1IHOA 1OTXA 2JAHA 2KYRA 3RRYA 2YOFA 3U49A 4UHDA 1JLLA 5LBIA 4BNVA 5HF6A 1RC0A 2C3PA 2PL9A 1JKMA 2ZTMA 2BUAA 1JDJA 1O87A 2O2HA 3EVNA 4HFNA 4IUDS 4UXHA 1Y4DE 3ZI4A 1HO3A 4UASA 3L8MA 4EVRA 2OCLA 1TIKA 2GMWA 3OCCA 1TTHA 3FM9A 4K9OA 3ESAA 4U9IS 2J0SA 4BZPA 5K0JA 3KSDO 5FJJA 1CJSA 1C0IA 2R85A 2EJTA 3GZNB 3D8NA 4KQEA 2B5WA 1LZKA 2VBFA 3D2AA 5C3MA 3NYIA 1NUAA 4O5AA 3B6JA 3D43A 2Z5FA 5F3DA 5EZSA 1VHJA 1DQPA 1K8QA 1TFUA 3K35A 4YQEA 3OFND 3ITNA 4NFHA 4YJGB 3MQFA 5H59A 3URKA 4HV4A 1DJMA 4WKCA 2WD7A 5MFZA 1FXSA 2X19A 1W85A 2NV2B 4H7KA 1QJCA 3PNYA 1EXWA 1DMRA 3FZEA 5L53A 4PHCA 4CWAA 2AFIE 3G5MA 1QTNA 1GGKA 3A70A 4BCCA 1Y4AE 2UVQA 4TKVB 4C88A 1XTRA 1FX0B 4DY6A 1DT3A 5AM2A 1TADA 1N36B 4XQ0A 4ERNA 2FX5A 3AHJA 3VI4B 4A8JA 5CEEA 1SELA 2WUWE 3O2NA 2NTYC 3F3YA 4RZ3A 3DXFA 4AULA 4ZYVA 1DAOA 1JHXA 4BIIA 2N46A 2WWGA 3QRWA 4Z2YA 3LDFA 3IUPA 4YRLA 2AZDA 3WLRA 1V39A 4UE6A 4D8XA 3L1KA 1AQ6A 3ZE2B 3T9BA 1U0LA 1VSUA 2QUJA 4LJ7A 5ULLA 4B8ZA 1U0EA 1CIPA 5C34B 4RTOA 3LP5A 3HWWA 2B30A 3CB4A 4BUJA 2RAPA 1U3FA 1IC6A 4YS6A 3Q8XB 3TX6A 3OJWA 3EGVA 1ESMA 3DZDA 1I1QB 5FI1B 3HR7A 5DBHX 4KKXB 2FWRA 2IBMA 3UV3A 1E0DA 2GZHA 2LDXA 4OATA 5DF1A 5F2EA 5ILOA 1Y5IA 3EWSA 4MCAA 2P4HX 1X9IA 4EHIA 4MCJA 4L4YA 3E7FA 4BRSA 1Z6QA 1E9VA 1KZ4A 1JJAA 1Z4PX 1TB4A 4S0XA 3OFJA 1W2GA 2W6JD 2HI0A 1XA3A 1ZU4A 2ANCA 2ZYAA 3GD5A 1QPBA 3R3WA 3PLRA 4H0CA 3RRXA 2FK7A 1EUZA 2YX1A 1GITA 5DWVA 3RVQA 3ZY3A 1RRVA 1QOPB 2CJYA 1QKIA 4H9GA 1PEDA 4XGIA 2D0DA 3G2IA 2G67A 4PO8A 2FF7A 1ENOA 3T61A 3GJ3A 2DQYA 4KLAA 3DKKA 3I72A 4TLCA 1QK5A 1XALA 5FPPA 3UT5A 3WWZA 1PWEA 5IJ0A 4YJ2A 2CFIA 1W7AA 1EGQA 3WJ7A 4D9NA 4TROA 4AS1A 2WJHA 3LTEA 1K6JA 4L8WB 3VNSA 1JUDA 3BE8A 4GIBA 1PE0A 1YVEI 1JHZA 4HX5A 4RABA 5K8LA 1UQRA 1KQOA 4BVKA 1KSGA 4CIAA 1L8XA 3LL7A 5JV5A 1NJ5A 2J85A 4PZLA 2XB6A 4WK0B 3OFSA 1MHPA 3BL8A 1VLMA 5KAMA 1EVLA 4U7DA 5JANA 5I7UA 3AGQA 3O8QB 3QBEA 5JBIA 1JFFB 1HDZA 1XG5A 5E7IA 2XE6A 3HP4A 5HS6A 3AFHA 1MO5A 2O52A 4KG7A 4CPDA 2O57A 1FRNA 1XV5A 1OROA 1Z9BA 2O3RA 4WECA 1FFAA 1VSBA 2G5GX 3DEIA 4FJ2A 3TL3A 3NTVA 1TEVA 4LTDA 4W5OA 3A2MA 1UP4A 4E5MA 4AJKA 1PFYA 1D0SA 2GAAA 2MSWA 4ONEA 4RSRA 4DIOA 3GRRA 2HU5A 3CXRA 4PGGA 1MNAA 2XKBA 4P3OA 2F55A 4R7ZA 4IWNA 2W83A 2B35A 2PH5A 2FK8A 2UZ1A 1VGVA 1SHLA 2I2AA 1GRQA 3DULA 5EP4A 1GTL1 2LE0A 4UC0A 5EUBA 4YCJA 3MUFA 2PMCA 4MNTA 4NMMA 2HK6A 5AVKA 5C8YB 2XVYA 3WFIA 5LWHA 3SYKA 1KPIA 1SXJD 4PQGA 4PPGA 3H2SA 1BOOA 2Y93A 2QAGC 3PXXA 1NMYA 1GUAA 2EQ5A 4ID3A 4M0KA 4DIUA 4UEJA 1TVMA 2XUFA 4QPPA 3VSDA 4RDCA 4K46A 3CNEA 4CLRA 4ENUA 1N0HA 1YCGA 2YV5A 5AMXA 4QUIA 2GBGA 4JK3A 4MV9A 4EY4A 1MXFA 2JI7A 4JROA 4KXQA 3K9QO 3NONA 5DGIA 3BK1A 4PSVA 1W36C 4BEVA 3E84A 4U3JB 3VYRB 1U2DA 4AYXA 2ADMA 4R81A 2GF9A 3LUHA 1XDUA 2ROQA 5IVDA 2Q4EA 4G23A 3I04A 4ZT4A 3U44A 1EK1A 2VRCD 3G8AA 1IHUA 4TL7A 3KELA 3A1VA 1I2AA 4QBHA 4X1YB 4ZCLA 4JCCA 3UMVA 2JASA 1RC1A 5AM3A 1OVMA 1XMXA 4OHYA 1GNPA 3GA0A 3ZI7A 5JAPA 1RXYA 3EMVA 4KFTA 1U9YA 4WVLA 1IWPB 4PWZA 4EL5A 4Z3DA 3UOAB 5KKNB 1UJMA 1SU7A 4B0PA 1B2LA 2AG6A 1XDDA 2C3UA 4X71A 3VC7A 3EHEA 5J23A 2X77A 2AOWA 1IONA 4NABA 2ZIXA 1H8ED 4G0YA 1GQRA 3NFYA 1CQWA 4OM8A 4RD2A 1FRQA 1L7QA 5C18A 3SVLA 4R1LA 1GSIA 2SKDA 5FQNA 1HDGO 2XTMA 1HE5A 4KO3S 4UCQA 5KCMA 3ZU2A 3ZY4A 4IFEA 1DUSA 8OHMA 2PE5A 1FRVA 2CW5A 4KQ2A 3ONNA 3LQQA 4ZXFA 3TNFA 4UHEA 1Y9ZA 2VP4A 2CSXA 4P86A 4PYIA 2R25B 3I53A 1JAXA 2C96A 5AK5A 3MXOA 2Q1XA 2VZLA 2BDEA 1KU6A 5DK4A 3CZ9A 1CUUA 3HYTA 4M8KA 4Y2UA 4DCOA 2QHXA 5K0BA 5TQ0B 3W2GA 4M1TA 4LOJA 1EBBA 4QUAA 4AG3A 1X6VA 1PKEA 2P78A 4HAZA 4D4IA 3NHAA 5AW5A 4EUSA 3OX1A 4Q9DA 3D6NB 2OV6A 1N0IA 1TA0A 3LC7O 3RYFB 1KGSA 1YOBA 1U8YA 2XY4A 3HXPA 4PG6A 4AUEA 1H6BA 2PQ6A 2VLBA 2XH8A 3R9IA 3UKOA 4LCEA 2AB0A 3NUQA 2K4MA 4CEHA 3U4QB 3AWDA 5IT4A 2PGLA 4M9RA 2CDNA 3OQNA 3B36A 2WT4A 2OCAA 2BEWA 2RAFA 3IT3A 1UP7A 4DJJA 2DJIA 4YT4A 5GV7A 4TLBA 4IHJA 2GI4A 5HP4A 1E3SA 2A9FA 1N33B 1WMDA 1P4AA 2K2WA 1WUKS 3LH5A 1J1ZA 3NX4A 4NKRA 2GNPA 4QG7A 5EUCA 5K0GA 4EDHA 4G5OA 3TQCA 4DF3A 2AW5A 3LMKA 1T9BA 1Z3IX 3EF3A 4A10A 1DIHA 5D84A 4C4TA 4O33A 3N5CA 4BO0A 4IVPA 3Q7IA 2GXUA 4PLFA 1L5GB 1PT5A 1BWPA 4NFLA 1JIXA 2X3FA 4LQ4A 4MKFA 2GH1A 3MWYW 2PDAA 1XZQA 1KIFA 3C4QA 4JYCA 2RBEA 1VCHA 1LBHA 2W48A 1G66A 3FUTA 3GF4A 3HVKA 3LUCA 3NGMA 4OOEA 4TRNA 3ELDA 4DV7B 3ICVA 3W8EA 2GTIA 2O0LA 3OQJA 2IY9A 4UNPA 3Q11A 3T1NA 3X1MA 4BGUA 2VNKA 3OPYI 4IYRA 1U8AA 1AZLA 1PQUA 4ISBA 5CH3A 2AQKA 3QI7A 3UEOA 3ZHQA 4C4ZA 4F3RA 5LN1A 2HO4A 3P2OA 3QMMA 5IZ4A 1X2BA 4ABYA 4KB5A 1OB2A 3RYIA 5SZHB 1KK2A 2F3TA 1SKAA 3A9CA 4IH9A 4D02A 2B83A 4Y0VA 1ULZA 1JGTA 5EIFA 1LI7A 3DZJA 3HPRA 1TNDA 4CM5A 1QHHB 1X9GA 4BFUA 3LT2A 4DEXA 1CRPA 1A9PA 1I7QB 4GPEA 3UK6A 4OCZA 4WT7A 4BX8A 2HIHA 4RD6A 1F2UB 5DN6D 4PAQA 3HYCA 1Q84A 2XYPA 2LCIA 1VPEA 4GMGA 2QMUA 1SQ6A 4IICA 4M9SA 1G42A 1TQ6A 2PSJA 4JZKA 2AJ8A 1X3SA 3EVCA 4Q9AA 1YBFA 3H2BA 3H8JA 5IWCA 1NSTA 2C57A 2Q8PA 2NP6A 4CF5A 1I4OA 4QBFA 3OCYA 1T3TA 1VDZA 2ZI4A 2CMKA 1Z5VA 2AN5A 3GJ8A 3ZHSA 5LJIA 4GMFA 4NFSA 5EIWA 3DXYA 4RELA 4X60A 1JG4A 3NHZA 421PA 2H4JA 3DPUA 3B1VA 3GMDA 5C1PA 1Z06A 3K1YA 3K8YA 4ZDIA 1NZJA 2PX4A 3TPFA 2WF8A 3F46A 1XTKA 4MW6A 4R84A 3TAUA 2ZSDA 3RS5A 1S2IA 2QTMA 1M74A 1QYXA 5EG5A 5BN3A 4FMDB 1DJLA 4IVNA 1IUPA 3MWEA 4PZCA 3FSEA 1RXSA 3DJYA 4BRUA 5THQA 1N9GA 2NSDA 1T1GA 3LLUA 3A6GA 2B0CA 5FTJA 3W3AH 2OQIA 3ZR4B 1QX3A 1QQBA 4GBMA 1U3DA 1T43A 2CLDX 4PGMA 5H68A 3OKFA 1J56A 1NQUA 2IXEA 3I6ZA 2L17A 1YA4A 3OA0A 4MKIA 3WZ2A 1EVEA 2QAGA 3MOSA 4UHJA 2P40A 1N2SA 1GCIA 1XKLA 3E2PA 2D1SA 2L82A 3N2ZB 3Q41A 1K7SN 3OTHA 5LP1A 2IRWA 2ZRBA 2F9LA 2W00A 3HUUA 3K0FB 1P1BA 4NU6A 1DX6A 4O4JB 2I8LA 3Q8KA 3RH0A 2WJ3A 1SXPA 1HBJA 2L19A 1Y8RB 2JRLA 2PJZA 1LCIA 4NYIR 3HQ4O 4RDXA 2DFVA 2C9CA 5CNIA 2OZLB 3B3GA 1X7HA 3DDWA 1D4FA 5ARDA 5F5NA 2IW1A 5ESWA 3DGEC 4D96A 1F60A 1WE2A 1RLMA 1JEEA 3ACDA 3IMFA 4EW6A 1V4BA 3NV9A 4II7A 4XGKA 1I10A 1ZLYA 4LRUA 2AW3A 3Q9NA 4J3FA 3VDMA 4CM1A 3BK2A 1ORVA 1YMUA 3K9LA 4BTVA 4LY6A 1CT9A 3K0KA 1NKVA 2AEJA 4NEHB 2Q6IA 1E8NA 4TSFA 3MT9A 3P0JA 4CV0A 3Q85A 4IP0A 3BAZA 3RSHA 3DG9A 3TQRA 1YZNA 4DG9A 3FPKA 3IKMB 1JV2B 3LKBA 2VAVA 3U4CA 3ZGXA 4CIWA 4EX6A 3GY0A 2JJ1A 4D9BA 2R5WA 1ISIA 3MVEA 1J5EB 1QDEA 4YAJA 3G68A 2CLSA 3T3MB 1KKLA 4KQIA 1Z35A 4MQ6A 5GOZA 5ILGA 1PFUA 1JQLB 3AVWA 3IAS1 4JEMA 1C0KA 1LDNA 1RAHA 1UC9A 3VSCA 3GVPA 4ICIA 1VJTA 2V8BA 2WTMA 1WF3A 4CNBA 1L4HA 1CY8A 1FNDA 2JGEA 2BGTA 2PWAA 3AEQB 4FFBB 2H16A 1SXGA 3LZ6A 5IVKA 1UIRA 1AKRA 5FIUA 1U28C 1Y34E 2DE0X 3IBTA 3JXEA 4ARZA 3I6YA 5FEUA 3TLGB 1OREA 2D5BA 1TYCA 4JLVA 3R6DA 4Q7LA 4AZVA 3JYNA 4IIJF 5DB4A 1PJ8A 5AHRA 5ED0A 1M2OA 5FUXA 4JVNA 3LVRE 3I9KA 4S3MA 1XFDA 1EZ1A 2NO0A 3N70A 1M7BA 4R2MA 1N8KA 3Q7EA 1EM8B 3ER8A 1GYQA 3R5XA 2NXCA