2D7DA

Structural insights into the cryptic dna dependent atp-ase activity of uvrb
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
Knots found
sequence length
652
structure length
621
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*T)-3'
publication title Structural insights into the cryptic DNA-dependent ATPase activity of UvrB
pubmed doi rcsb
source organism Bacillus subtilis
total genus 228
structure length 621
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2d7dA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA01
1A5TA 4HZUB 1Z0AA 4X8MA 4DIDA 2AXNA 3JVVA 4E22A 2QORA 2JLZA 1PZNA 2ZR7A 3P27A 3PEVA 4B33A 3FMOB 3K1JA 3OIWA 5FR1A 2QBYA 1BMFD 4LC1A 2IXFA 4HSEA 4B34A 2FSHA 3A8TA 1VYVA 4Q4HA 2ODWA 3SHWA 3QXSA 2OXCA 1Z2CA 2UZIR 1COWD 1JNYA 3KUDA 2P6NA 5EE5B 3A4MA 5FOTA 1T3SA 4EPVA 2GEDA 4XWAA 2G83A 3KUCA 4JLOA 5KNCA 2D3WA 4BUJA 4DCNA 4V02A 2NO7A 4YMWA 3IBGA 2FA9A 3E5HA 4HB2A 1ANKA 3ETLA 3AF1A 2WJHA 4QGHA 4Q7KA 4UNSA 5CK4A 2GA8A 2MSEB 3THYA 2R6AA 5F9FA 1US8B 1U9IC 1BYUA 1NVWQ 2W83A 2CLSA 3BOSA 1UBGA 3B1WA 5SZHB 2EFCB 4QRHA 4TZ0A 1N5JA 2KSQA 3OIUA 2QPTA 2ZS7A 4CVNA 1E94E 8OHMA 2IYRA 1YR6A 3RS5A 3SJBA 5L3SA 1F2UA 3K9LA 2H18A 3CX7A 2ODNA 2YNMA 4RJLA 5D3MB 2JJ2A 3C5HA 2C9YA 3GFOA 3V00A 1R0ZA 2REOA 4F4JA 1VCIA 3AVUA 1II0A 1NVXQ 1I2DA 1Q0UA 1UJ2A 3T35A 4DC9A 2JLUA 1DTSA 2D62A 1XTIA 4JLJA 2XZOA 4JLMA 2ZRKA 3KL4A 1M34E 1XU4A 2V7QD 1G9XA 1TQ2A 4PC6A 5FPTA 1XPUA 4FXPA 1IOZA 3W8NA 4HLQB 5SZIA 5BN5A 1VMAA 2V6IA 5DHFA 3OIYA 3OAAD 1SZPA 4TL8A 4URVR 3GLHB 3OEHD 1F5NA 3ASZA 1ZYUA 4GRAA 4I81A 2JLQA 1E1QD 1UPTA 3RWMB 2IYVA 121PA 4KXFB 5EXXA 3EPHA 2G0NA 3KX2A 5FBQB 2JLVA 5J4VA 2WTUA 1HEIA 1XCPA 3PUVA 3AGQA 1FX0B 2BHRA 4QKQA 3GFTA 3VR5A 5CM8B 3AKYA 2YHSA 2IW3A 1KDRA 3FOZA 1Z29A 1GL9B 2WICA 3FDIA 1Z47A 3EIEA 3IHWA 4WW0A 4X8HA 3SZRA 4OQLA 4M1YA 2ASEA 4M1WA 4H9GA 3NEYA 1G16A 3FHTA 3B78A 3AV0B 1P5ZB 4HAYA 1KJWA 5J40A 4C7OA 2GWHA 2JJ1A 1U0JA 5HR5A 4DT1B 4B76A 4QJ5A 2QGZA 4V0NA 4OHVA 4B3GA 2BBWA 3LO5A 4R2HA 3FWLA 1ZCBA 2FOLA 4PHHA 4RD6A 4BE7B 5BYJA 5IT5A 5KSOA 3EAQA 2JGNA 4OJQA 4D0GA 1TU3A 2OLKA 4C0AC 421PA 1G6OA 3TW8B 4JT4A 1E2EA 3CONA 2ZJOA 4AIIA 3AVTA 1KI8A 5FTJA 3ZJYA 3TE6A 3GLGA 3T5DA 1Z6YA 4X8LA 1X1RA 4EDHA 1D6JA 1AKYA 3UWKA 5FUVA 2WOOA 4JBWA 1NN0A 3BB4A 4NMMA 4JLAA 4H1UA 4ARZB 1KKLA 3E1SA 2ZVQX 2ZYVX 4JIMA 3BFVA 4LJYA 2BCJQ 2MMCA 5JS7A 1LW7A 3ECCA 2DY1A 1E9DA 4QHYA 1Q20A 1R8SA 1LF0A 4PC7A 3AGPA 3FKSA 4C4PA 5E7IA 1J8YF 3VR4A 3C8UA 3CZPA 2G3YA 3WMFA 4A2QA 3WMEA 3W90A 3DKPA 3QY0A 4XSHA 4URZR 1DARA 4AD8A 3NXSA 5TMPA 1VHTA 2P65A 4MYUA 2IYYA 4KFRA 1JR3A 1XPRA 4CF7A 2J9RA 1JAHA 2ZRLA 3CH4B 2GRJA 3CNOA 4RZ3A 2R2AA 4KCGA 4A15A 2D7CA 2JJ2D 3AKEA 4OJKA 1X86B 2BJWA 3WBKA 3D7MA 4OHZA 1I4DD 4ESVA 3QI2A 2FH5B 2EQBA 1U8YA 4LHZA 5AR1A 4G5GA 3KJHA 1HE1C 3QKSA 3IIMA 3AUYA 2CL7X 3WNDA 5BYKA 1Z0KA 4UJ5A 3IHLA 4MGKR 4CIDA 1G8YA 1NIJA 4IDPA 3IBYA 2BMDA 1OJLA 4LJAA 5FPHA 1NIPA 1YZTA 4NONA 1OH8A 4FMBB 1Z22A 4ZCIA 1AKEA 1UBEA 4ZDWA 2DCUA 1FW6A 1LS1A 4A82A 3V4FA 1GRNA 1WBBA 3R8CA 2Q3FA 1AS3A 3CM0A 4Q9KA 5HCIA 1IJFA 4B3FX 1T9HA 5GVSA 2IXGA 5ANRB 3X1DA 1L8QA 2WBLC 2OCAA 1Z6GA 3T61A 4A92A 3K9NA 2IYLD 4JJZA 1Z0JA 4DB4A 4IOMA 1WP9A 2JDIA 1ZNWA 4PAMA 1DAKA 1OH5A 1ZM4A 3EG5A 2W6JD 3MFYA 4DCTA 5JBQA 1FTNA 2AFHE 2O8FA 1VG8A 3EZ6A 3ADDA 3TUIC 4PAQA 3T5GA 2PCJA 4ILEA 2YWHA 2R6CA 4BLQA 1HYQA 3REFA 5C1BA 1E69A 2Q6TA 1AJEA 3JZAA 1PJRA 1G1MA 2H7VA 3H84A 4TLBA 2ZE6A 4MKHA 4LSGA 1GNPA 1S2MA 4EPXA 2W6IA 4D81A 4OK6A 1VYTA 3GLIA 1W36C 2FFQA 3B9QA 4YQFA 4DCUA 2IYUA 4D25A 2OESA 3NG1A 5CLLA 3N2IA 1ZUHA 5F98A 2O52A 4M21A 3GLGE 2P3SA 2QY9A 2QMOA 3AH8A 5FBWB 2QE7A 3VKHA 2RGGA 4NYJR 2GK6A 1RVDA 3GMTA 3QQ5A 3IQXA 3BFKA 4RD3A 1Q12A 1QHSA 1GIAA 4UKDA 4UNRA 5FBVB 2A5FA 4RY2A 3HU2A 3UWOA 4PSVA 1RYFA 1UKVY 3I1FA 4QGFA 4UXHA 1G3IA 2BEKA 4Z1MA 1KSJA 1ELOA 2JEOA 1CP2A 4MUAA 4AYWA 4N1AA 4TYYA 1GRQA 1SXJD 4Q66C 3I8XA 4M0LA 2KJQA 2ZRFA 4HLUA 4B2LA 3FMIA 4XTRA 3LXRA 2FE4A 1JR3E 3QF4A 1K8RA 1JR3D 3UG7A 4URYR 1OFHA 4TQ9A 2CHQA 3QEJA 3AVYA 5BN3A 2V6JA 4R98A 2ZRMA 4MDFA 4L4UA 2YVUA 1QHXA 1WBDA 3WRXC 4D6PA 3QEOA 2QSYA 4K81B 3B1YA 4M9SA 1IN6A 1W49A 4LHYA 4G5RA 4A1FA 3CH5A 1F2TA 3MJRA 5J4KA 1E9BA 3OZXA 3WHKA 4LJ5A 2O8DB 1W36B 4KHZA 2QGNA 1AGRA 3B1ZA 3SJCA 2Q3HA 5HE8A 4Q7MB 4ZO4A 1W4BA 4W5HA 3SFVA 1XTRA 3DOFA 4TL9A 5DLQC 5J5CA 4A2WA 1W1WA 5EJEA 1SVKA 1CJKC 5TARA 3FMFA 3NTUA 2CXXA 2JLXA 3Q9LA 3C15C 2HF9A 3C7KA 1P73A 3ZS9A 3LQQA 2WKQA 2GDJA 5B57C 2VEDA 3FWYA 3FHCB 3AF4A 4HEJA 1G291 4PR0A 4DKXA 1KZ7B 5UKDA 1QF9A 2O5VA 4GP6A 5AJXA 5JCPA 3TAHA 1T0HB 1BKDR 1T8UA 2O0JA 4NKRA 5G53C 3AVXA 4B6FA 4QNRA 3B8HA 4QNMA 5EP4A 2VF8A 2C98A 1S1MA 2AD5A 2ZRNA 2K5UA 2UKDA 4AG5A 1US8A 4LBWA 1W48A 3RYTC 3BWDD 3GEIA 3PJRA 3L8YA 1IHUA 1TU4A 2WWGA 1OIXA 4JVNA 4XH9B 2P6RA 2ERXA 2JLYA 1ZRHA 4IXNA 5K8TA 1IBRA 4JL6A 1Y3AA 4TYPA 1E9EA 1ZBDA 1IXRC 6Q21A 3BBPA 4BFWA 4TMWA 5B58C 1OXVA 5D3MA 3TQFA 1DVRA 4B74A 4M2LA 1CJTC 3GLIE 4F4CA 3E70C 1ZD9A 4GZLA 4BFTA 2ZROA 1KO4A 2IL1A 2ZI9A 5HKKA 4Q48A 1CLUA 2EFEB 4Q4LA 3VR3A 3LW8A 2ZITA 2ATVA 3EC2A 4CT4B 3AVQA 3IIKA 1SKYE 1XD9A 2ZI4A 3ZIAA 5DYGA 1Q1QA 1DO0A 1YR9A 2F9LA 2C5LA 2DR3A 3RS7A 4Q5IA 4DDWA 3GLHA 3W8RA 5KNBA 4FIDA 2JJ8A 2PZEA 4JLVA 3UMRA 4KYUA 1P2VA 5FUYA 5KUTA 5KTYA 4D4KA 5L3VA 4DSTA 3QG1A 3X1XA 4ZV4A 2WSMA 3MWYW 3BRWD 2VHUA 2DBYA 5DE3A 1KO5A 3KKPA 5TXGA 4FD2A 2XX3A 2XJ4A 3ZQJA 1RYHA 3KZ1E 3P32A 4D80A 4US1R 1QZXA 2DWOA 3KXIA 1S8FA 2A5JA 4R71A 2A2ZA 2B8TA 2NO9A 4IVRA 2DFKB 1ZM9A 3OE7A 4BECA 2CLDX 2H16A 1U9IA 3B1VA 1A1VA 1XRJA 2XB2A 1G8GA 1ZP6A 1SVMA 3A36A 5A4JA 3LXXA 4ITRC 1UDWA 1AK2A 1HQCA 5HZKA 1GILA 4DT1A 1WB9A 3M6AA 2V1UA 1R2QA 3IPYA 2FPMA 4HDOB 2PH1A 2TMKA 1E98A 4HLCA 4Q1EA 2LWIA 1FZQA 5DN6D 2QROA 1N6PA 3LBNA 2IYTA 2MSCB 4Q9IA 3EARA 3MJHA 2W0SA 4V0MA 1W4AA 2ZI7A 3LWNA 3GLFB 4XVUA 3VFDA 1LF5A 2NO1A 2X2FA 1X1SA 4EPYA 3C41J 2WSSD 5JWOA 3W3AA 2O8EB 4W5JA 3GFPA 1W5TA 3B1XA 3RLFA 2MSDB 3QVVA 1CJVC 1Z0DA 2QAJA 3IDQA 2WJVA 3F5FA 5F9HA 4GNKA 3KQKA 1N3BA 2ZUDA 3NVAA 1WE2A 3RS2A 4ARZA 3SYKA 4Q1FA 4M8NE 2IBMA 3CWZA 4MITA 1N5LA 3LX8A 4Q19A 2BOVA 2B7BA 2JA1A 4KAXA 3K0SA 5FPYA 1PLJA 4LBZA 4XVRA 2OFXA 3I62A 4LZZA 2PZFA 4LCBA 4M4SA 1M6NA 2FNAA 5JJKA 4QHTA 4HDQB 1HT2E 1YRAA 4S2EA 3BERA 4BEJA 2YOHA 3FPNB 5IK2A 4OHXA 3CNNA 1T3LA 2ZI3A 1DBSA 3KQHA 5TB5A 3V4RA 5JRJA 3F8TA 3SOPA 3EASA 5CIQA 1DPFA 1E32A 4EPWA 3EXAA 5JLJA 1ZNZA 3IPXA 1BYIA 3KFXA 1Z6AA 2KBFA 2WV9A 2WMNB 2CMKA 1TAGA 1J90A 4GPTA 2P0EA 1QDEA 3H0KA 4WA7A 2OM2A 3K9HA 5C4MA 1GM5A 5CB6A 1DELA 1J8MF 4OI1A 2FGKA 2ZJ2A 1MRSA 3CRQA 5JMTA 1FL9A 2V9PA 2R44A 3Q85A 4Q01A 4WAUA 2VP9A 3SDZA 3TRFA 2BMJA 4FMDB 1JQJC 1W47A 4B47A 1II9A 4F38A 2BKUA 1W0KD 3A1UA 1FOEB 3GJ3A 1Z08A 4EFLA 5EXTA 1TNDA 3W9YA 2ZRPA 3S1AB 3GLHE 3TR5A 3O47A 3TGPA 4EUNA 2D7DA 4BLTA 4DB2A 2GJ8A 2RGEA 2WHXA 4PANA 1XEWX 2HXSA 4KITB 3K70D 2VTKA 4B3CA 3TLXA 3LH5A 1VECA 4P0TA 2AFIE 2IYQA 1G8HA 1R0XA 3B7GA 3EPLA 4MGIR 2A30A 4GOJA 1IY2A 1TEVA 3MUFA 4PQRA 2F1HA 3AQ4A 4PSAA 4ZDIA 3BFXA 3IO5A 1FUKA 2CNWD 2BVNA 5G3ZA 4JVMA 2QNRA 2F7SA 5DGXA 1S3SA 1E9AA 4HLDA 2YC4C 4M1TA 2O0HA 3OE7D 2DB3A 1HUQA 2BWJA 4TL7A 1NJFA 4DLTA 4QXAA 4DDUA 3HU3A 2QP3A 1KO8A 1GRRA 2ZUCA 4TT3A 2GAOA 2ONKA 1MO3A 2XEXA 5GJVC 5GVRA 4B44A 2C8VA 4FWIB 4WXPA 2OBLA 1AS0A 2VSXA 4RD4A 3M0EA 4U02A 4DSOA 1QG4A 4KI0A 5DI3B 2QT1A 4ASUD 2WPDA 4V0ME 4GT1A 1CTQA 1NKSA 1G3UA 1U98A 3AKCA 4BZXA 1SVOA 1XMVA 1DAEA 2BDTA 2ORWA 4TL6A 1N6KA 2V1XA 1NVUQ 1JJ7A 2VO1A 1Q3HA 2CBZA 3P4YA 2NO0A 3VR6A 3LBHA 2Q9BA 2ZUBA 3Q5EA 3CPJB 1UEJA 3CO5A 1UF9A 2HLDD 1S9HA 1H8HA 2Z4SA 4NYMQ 3R9WA 3W6OA 1Z5ZA 3R9IA 2VLIA 4KBFA 5EUQB 1RRGA 3L8ZA 1LTQA 2V55B 3ZVNA 2EW1A 1XEXB 3BAFA 4NYJQ 5JI3E 1N6OA 3WYFA 4B35A 621PA 4PO1A 1IY0A 2AKAB 5KYKA 1D5CA 2CL6X 3EZFA 3I4LA 3I8SA 4QBGB 2CK3D 4BLRA 3BJIC 2F6RA 4KODA 1PLKA 3RHFA 2QL6A 3DDCA 2G77B 1UADA 3BGWA 4KLZA 1G3QA 5CB8A 2ZPTX 2IWRA 1EFCA 4L15A 2JIZA 3FMPB 3EPKA 1KI3A 1KO7A 3QBTA 2D06A 4LUCA 3NHAA 1AA9A 2F9MA 1YZGA 2Z4RA 1U8ZA 4RCZA 3QPVA 1U0HC 2IS2A 1S96A 2NPFA 2IEYA 1XCGB 5G40A 1RRPA 1LV7A 2AKYA 2WAYA 1L4YA 4B73A 2OHFA 3DHWC 1U94A 2GBLC 1E2PA 1XD8A 4Y0VA 4G3XA 1MO4A 2ZQ5A 3LW7A 3RRYA 3CIOA 4D82A 1E2IA 1N6LA 2H8KA 2O8DA 1KDTA 2CCKA 521PA 1JPJA 1KY2A 821PA 4KSCA 1GSIA 1XJQA 5TV2A 1KSFX 3REGA 5GJBA 1OXXK 3KQLA 5FTLA 1EX7A 4D4LA 5J4YA 3PR1A 2ODEA 1QVRA 3BH7A 4BPBA 3QSYA 4P4UA 1G5TA 1LFDB 2BM1A 3VR2A 1AN0A 2FMXA 2IF2A 1NN5A 5KDLA 1OH7A 3ZLJA 4B32A 1Z0FA 3W3ZB 4BEBA 1W5SA 5EE0A 4IOLA 2VF7A 2FZLA 4NL4H 2ANCA 1XX6A 3IEUA 4K46A 4URWR 3NDBB 1KI1A 2IF0A 3NC0C 5H8WA 1TEXA 3OFND 1XD2B 1VHLA 1E2MA 3CF6R 4UNQA 4ACAA 4G01B 4I1SA 4LWZA 5FL7A 2ANBA 4PSKA 1R4AA 3NEJA 1AIPA 3RABA 1CXZA 3PIRA 1ONBA 2P67A 1OHHD 1JEDA 2B2NA 1KGDA 1PUIA 1LS6A 2UVQA 5FPSA 1E1RA 1NKTA 3DO6A 5AUOB 5FI1B 5AUPB 1HQYE 3SR0A 1L4UA 1KSHA 1R10A 1JAIA 1BS1A 4TLEA 2WPDD 3CW2A 2O8CB 2PBRA 2BBSA 3KTAB 4KU4A 5DO9A 2GEVA 1F48A 5CLQA 5H1YA 1I2MA 4BLOA 1P2UA 1EFRD 3B85A 2XNSA 4HATA 1GNRA 5L3RA 1H8EA 1PV4A 1OH6A 5A0FA 3T34A 1T4GA 3VR1A 2EWWA 5CK5A 3N70A 4A0RA 5KO2A 5G41A 1XEWY 1DOAA 2XNDA 2A9KA 2F3RA 4V0KA 1R5OA 2GXUA 3RRZA 3C4JA 3LD9A 4WVFA 1DAIA 2ERYA 4PC2A 1N0UA 5EZ6B 4JJKA 1ZM2A 2UZ3A 4U00A 2C9CA 2FZ4A 2KBEA 3MLEA 3I32A 3EPJA 4AKIA 4HI0E 2QPOA 4DJTA 3AVVA 4E5UA 4OI4A 4TMTA 3ZZ0A 3GP8A 2FPKA 4GL2A 3T1OA 3AVWA 2RMKA 3MCAA 2RGBA 1YZKA 2ZVPX 4RKFA 2OUKA 4B3XA 2OFOA 4JVLA 1A2KC 1YHNA 1IN8A 1CRPA 3TVTA 2AL7A 2QAGC 4NCIA 2ZM5A 2Z83A 2ZSFA 4B3DA 3U44A 3G82C 3RC3A 1OKKA 5FUXA 3TNFA 2QRZA 1E79A 2AD1A 2J3EA 2XJ9A 2I1QA 3GPLA 2XSZA 1D9XA 3HJHA 3ND8A 3TSOA 1BO6A 2LKCA 3M1IA 4JKYA 3LVRE 2IK8A 4RD0A 2AK2A 1NG1A 3I5YA 3FHOA 3UK6A 1OPXA 1CJMA 3DVLA 5AK0A 1G19A 1M8PA 3HYRA 2WWWA 4OYHA 4KBGA 2H17A 5H70A 3KKNA 2C9OA 2O8EA 2X77A 4M9ZA 4LV5B 2KI5A 2QM7A 1N0VC 4ERNA 3IEVA 3SNHA 5KPJA 1KO1A 3B82A 3ZS8A 4NDZA 3KJEA 4NPHA 3U61B 2F43B 1HA3A 1E2HA 1U90A 2B6HA 2L0XA 4Q1BA 4TMXA 2Q9AA 3UIEA 4OQMA 1BOFA 4Q21A 1XFAA 3VHLB 3T1TA 2J46A 2ZE8A 1B23P 1RKBA 2QP4A 3A1WA 2OCBA 4URXR 3ASYA 4BGDA 4OHWA 1JJVA 1B0UA 3RS4A 2REBA 4DDTA 1RRFA 4C0JA 2QSZA 4C2TA 5EP2A 5FOUA 4NCHA 3HU1A 5FL7D 4FWTA 3LQRA 3LV8A 3H1TA 3ZDQA 1ZC4A 2LKDA 2ZS9A 2VHTA 4MKGA 2E9SA 3QPWA 5C2JB 2VSOA 4C0LA 4JLPA 4L5BA 4C3ZA 3WBJA 3MRSA 2C78A 1AZTA 1E1RD 2ZEJA 1TUIA 3HR8A 2QAGB 5ELXA 2OBMA 1JALA 4AC9A 1L7VC 4FW9A 4EPTA 3KFVA 3QENA 4LHXA 4F92B 1O3YA 4TMVA 3X1ZA 2I3BA 3H2YA 4FMCB 3UMFA 1S9DA 2FFHA 2QN6A 4EQ6B 1VCOA 2IXEA 3ZD7A 4US0R 3ONWA 4MYHA 2GHIA 2BC9A 1D8TA 1OFTA 5HZHA 2GZAA 1J7KA 3U7HB 3Q7QA 4Q9LA 1KI7A 3DPUA 3CKLA 1HE8B 1OYWA 2YZ2A 1NG9A 4JSTA 2XGJA 4N3NA 3S1AA 1E2FA 4F93B 5JRZA 2XITA 3U60B 2ZRGA 2Q0HA 4A6XA 4HAUA 2XNDD 2ZS8A 1IY1A 3G5UA 2GCOB 2RH5A 2P2LA 4LYJA 1MR3F 4PTLA 1OT3A 4TTPA 4L9WA 4L16A 4K8OA 4ABYA 3GJ7A 1W2GA 3V9PA 2GETA 2JJ1D 4EJSC 2OG2A 2R65A 2IA5A 1SGWA 2NO6A 1M1YE 3AF3A 1U0LA 3QKRB 1MABB 2GXQA 2J0UB 3RAPR 4WXRA 4RFSB 1KI9A 5EXPA 2ZU6A 4AYTA 4P4SB 4PPNA 3KQNA 1P75A 1HTWA 2VHQA 3OEEA 4AY2A 2W58A 2CE7A 1C9KA 1G5RA 1K5GA 3CRVA 3HJNA 4N0EA 4NYMR 1P72A 2N1BA 4PC1A 5L8VA 2DFTA 5CM9C 1JEEA 4LJ8A 4C9BA 1KJZA 2EYUA 4QGGA 1XF9A 2GKSA 1BH2A 3X1YA 2GJSA 2QM8A 4TQAA 4PPQA 4O3MA 2CVHA 5E95A 1HT1E 4JZKA 3X1WA 4Z54A 4DLRA 2F55A 3U3MA 4AURA 1E79D 3CX6A 5FTMA 1R8QA 1UEIA 5DI3A 2ORVA 2ZRIA 2X2EA 4FCWA 1MO6A 2HV8A 2B21A 4OKSA 1EFTA 1MO5A 2NIPA 1TQ6A 1W4RA 4Q7LA 2ZRDA 3ZQ6A 1KMHB 3FKSD 2BKEA 3BORA 3MWKA 1GP2A 2HXYA 1P7CA 2JAQA 4HB0A 5FOVA 3PEUA 1GG2A 3KKQA 3QNUA 1OLOA 1P3JA 3JZMA 3FE2A 1F6BA 4HAWA 2R6DA 3ZZTA 4G5SA 1PVOA 1E4VA 4OQXA 5F3WB 2NZ8A 5LPNA 3SFZA 1CULC 1II8B 1GOTA 3NH9A 4UJ3A 4PAOA 2RCNA 2GXAA 1XEXA 1DAHA 4LI0A 3ND9A 3A1TA 1VIYA 4JL8A 1QHHA 4NP6A 4JL5A 3T1QA 1G8FA 1TQ4A 4ZDKA 2BM0A 1D2EA 4IOJA 4E03A 1SVLA 1G4UR 2NOAA 2CL0X 2FSGA 4D2IA 3U4QB 4P31A 4B3BA 5IDVA 1Q1EA 1XB2A 3KQUA 1XXHB 3K0EA 1M2OB 4A6PA 4HZUA 3DOEA 4XJXA 3PUZA 1NMXA 1KZGB 2CLCX 4ZKDA 221PA 4LJ9A 1NRJB 3R7WB 1AQUA 4DHEA 3CWQA 3RANA 3NBZC 3NKVA 3VMAA 2ZR9A 4PHFA 5FUWA 4IFBA 3AKDA 4UXJA 1OXUA 2EFHB 3HYTA 5BXQC 2RHDA 3PITA 3CF2A 1IN7A 5JJIA 1JI0A 4FCVA 3NBYC 4JLNA 2GAAA 4HAZA 1K5DA 1ZNXA 4GSYA 5LBIA 2JDID 1Q3TA 4BWYA 1E4YA 3THYB 4IDQA 1Z28A 2W2TA 1VKJA 4AYXA 1Z63A 3RSLA 3SJZA 1ZJ6A 1D2MA 2J87A 3DL0A 2ZRJA 2FPLA 3EW9A 1T0JB 5DSZA 2QZ4A 1ZC3A 3B5JA 4YMUA 3RNLA 3HP1A 3CRMA 1MRNA 4E09A 2XAUA 1FMLA 4KFUA 1DAMA 1O87A 3QF7A 4H1VA 4PPFA 4IEEA 1NLFA 2R62A 4XWOA 4NTZA 2IEZA 2PL3A 2ZJAA 2V54A 2W6ID 3FFBA 1AZSC 2ZJZA 3H4MA 1UKZA 2FV8A 3OEED 2JLWA 1XD2A 4E07A 2YJTD 4NCNA 1P9NA 2WAXA 1CF4A 2OE2A 2DHRA 2WVJA 3QOFA 1CS4C 4US2R 4WZ6A 1KY3A 4L9SA 1G7RA 2QE7D 1R5NA 2C99A 2NPIA 4RKEA 2OCYC 4WOPA 1G5PA 3U5ZB 5FTNA 1YVDA 3Q3JB 5EUMA 3CRRA 2X1VA 4NBSA 2XZPA 3TUZC 4PFSA 2FX3A 3FVQA 4GDFA 2QI9C 3CR8A 3KTAA 2O8CA 4GBMA 4HDCA 4HAVA 4OK3A 1GTVA 1U8AA 2G1KA 2PZGA 1T91A 4Z1MD 2AK3A 1FX0A 2IUTA 1SXJC 2GVDC 1KJYA 2F1RA 2ONJA 5JHHB 2D4HA 1RJ9B 4MDEA 2YINC 2XTZA 4YDHB 3RDPA 2A5GA 4NH0A 1E2LA 4CZ2A 3I3SR 2P6UA 2GJ9A 1N6RA 4KVAA 2Z6VA 3HWSA 4CW7A 4PO8A 4O2LA 4LPKA 2J7PA 2W2XA 3EC1A 4JLDA 3NDPA 4MYCA 2IS6A 1ZIPA 4PQFA 3TH5A 1W4CA 1HV8A 5BN4A 3NWJA 2B8WA 2Y8EA 3A1SA 3RSOA 4DCSA 1KNQA 2NMVA 1WMSA 4Q18A 2ZYUX 5C18A 4BLSA 4U7DA 5L3QB 4DWJA 3VX3A 1AQYA 1KDPA 3GCGA 4QM7A 4CEHB 2B7CA 2CDNA 3CLVA 1JBKA 1E2JA 4Q9HA 3CBQA 3GLGB 1U81A 4NHOA 1ZU5A 5KSZA 2C04A 1S0UA 1CBUA 2JATA 2NTYC 4JT2A 1DEKA 2QEQA 1E3MA 4JLKA 2R6GA 1FP6A 4IDOA 4DLZA 2AX4A 2VP0A 2KWIA 3MMPA 3ZGXA 5CITA 3SJAA 3BIFA 4LX0A 1OSNA 4PHTA 4BZPA 3PFIA 3UPUA 2GCPA 1QHGA 4HB3A 1FNMA 2N42A 2RKOA 5IHPA 3WYGA 1KK3A 3BXZA 1IAQA 4IDHA 1X6VA 3Q8XB 4XD7A 2J7KA 1TTTA 2GJKA 1EESA 1GDDA 1SXJB 1YU9A 4Q4AB 1G7CA 4AG6A 1QBKC 5HPYB 2WIAA 1GKUB 2JLSA 3MGCA 2J59A 4TMZA 2HJVA 1NLZA 4R9UC 4RZXA 5FR2A 4Q00A 4DEXA 5CJ2A 2F43A 2XTMA 3AEZA 2J1LA 3LX5A 1KAOA 4Q9JA 3TIFA 4GOXA 5JI2E 4KO8A 3LVQE 4XIGS 5E7JA 4B6EA 2WKRA 3EZ2A 4TSFA 1M7HA 3TVDA 3LY5A 2ZSDA 4MQBA 2QRNA 2G9NA 2HCBA 1W0JA 2WWIA 3QVUA 4BFXA 5AUQA 5FOWA 1GAJA 3A4LA 1NN1A 2GEUA 1GKIA 5HKKD 5JS8A 1G41A 1KAGA 4CDGA 3LFUA 2ODBA 2ZR0A 4JMPA 4NCKA 4DLVA 4BZQA 4A0HA 2IYWA 1XNJA 2QTFA 4LGMA 3ZIAD 1C1YA 2RGNC 1EXMA 1ZCAA 4BFUA 1E0SA 2NZJA 4DLSA 4ZI3A 2QAGA 4B71A 2D74A 3ADBA 1BMFA 3K0AB 3EA5A 2QG6A 2WJYA 1T3HA 2HUPA 1GWNA 4YDSA 1COWA 5CJPA 3SHFA 1OYYA 4EQ6A 3U7EB 4O0MA 1E0JA 5AUNB 5DH9A 1X8JA 1N2CE 4PO9A 4J0QA 5JWHA 5BWMA 5DYIA 3SN6A 2EVWX 3CX8A 2YWEA 1YJ5A 4AI6A 1FMJA 4LJ7A 4ZCLA 2EYQA 2FFAA 3QXXA 2PEYA 2QPAA 4Q1DA 1G3MA 2GCOA 1KNXA 3U3KA 1VG0B 2G88A 1WDTA 3KDSE 4P33A 3W34A 2CCGA 4LBYA 2RGXA 2VP5A 2ZRBA 4V0LA 3RVBA 1IQPA 1LY1A 2WWHA 4AKEA 1EFUA 1MABA 2FSIA 2H92A 2J0UA 2OT3B 3QJYA 4MRSA 2OBNA 2WJGA 3FFAA 4DXAA 4RFSA 4P4SA 5FOXA 2XXAB 1JR6A 1Q22A 4AWXA 4MRVA 4JYBA 5EZ5A 2NQ2C 1P2TA 3BS4A 3SYLA 1FNNA 4QBIA 2V7QA 3P26A 3ZVRA 1E9RA 1KK2A 2P5TB 4TTRA 3SI7A 2J41A 2FWRA 1TMKA 1MKYA 2OXRA 2P5SA 2FFBA 1DE0A 2QUZA 3P4XA 3QXJA 3SEAA 5JEDA 2YKGA 4G5OA 4OK5A 3OAAA 3VHXA 1M7GA 1VDZA 2FF7A 5KNDA 1X8LA 3OEHA 3PCRB 1GITA 4IEIA 4M1OA 1Z2AA 2WM9B 1N6HA 2YC2C 3OF5A 1E1QA 3MSXA 4I1OA 2YV5A 1JECA 4GFDA 2EWVA 2HYIC 3L0SA 3NC1C 1XEFA 3CR7A 1ZM3A 4A0FA 1SQ5A 1AS2A 1GZSA 1E2QA 2QP9X 3KB1A 3L0OA 4II7A 4B2PA 3CB4A 1KMHA 3IILA 3IUYA 2C77A 3LAWA 3TKLA 1TL7C 3ZD6A 4TLCA 1IONA 2GXSA 3TUJC 1OV4A 2CJWB 1T6NA 2SHKA 3UATA 1WCV1 3THXB 5AJZA 3MWJA 5IK2D 1UDXA 1KOFA 2VA8A 1T5IA 1UAAA 2BCGY 3QF4B 2JCSA 5JJLA 3FB4A 4CEIB 4BLPA 2IHBA 2IUUA 1II8A 3ZYCA 4P4TA 3K0FB 1XDBA 2CVFA 4C2UA 2DFLA 4GP7A 5KDOA 1NSTA 5B2ZA 1ETUA 2R6FA 2OFWA 2OO7A 3AF2A 3CPHA 4FMDF 3AP2A 4TMKA 4ZKEA 4D4JA 1N6IA 3GEEA 3L2OB 3O8RA 5FOSA 1KSGA 4DZZA 2ZANA 2QMHA 3O8BA 4TQUS 4BFSA 3U4QA 4B2IA 1OB5A 4TWZA 1H65A 3BC1A 1XXHA 1OIWA 1YKSA 2IYXA 3SC3A 1E2DA 2OAQ1 2QA5A 1DO2A 1YZQA 2HT1A 4QBHA 3CNLA 4Q4JB 1E9CA 2VH5R 3B13B 1CU1A 1WF3A 2DPXA 3HDTA 4LC0A 1N5IA 3R7WA 3VU9B 1NNEA 3K70C 2VL7A 1FP7A 3EIQA 1R0YA 1EX6A 4DSNA 5FFMA 5JCZA 3WYAA 3TBKA 1MV5A 3BE4A 4IW3B 3T06B 1TF7A 3OIVA 4WZBE 4W9MC 4LK2A 4DBLC 3U6KA 4DIEA 1HH4A 4PZZA 5HCNA 2C96A 4EFMA 3QE0A 3BB3A 1GL6A 4LV8B 3NBFA 3W6PA 2EU8A 2GZHA 4M1MA 2WZQA 2Z0MA 1C4OA 4OI2A 3U44B 4YMTA 1KHTA 2IUSA 4PQYA 2PLFA 1TF2A 1VCNA 2ZJYA 2PCLA 1ZD1A 1OXSC 1IN5A 4TT3D 4TN1A 4XOIA 4ZCMA 1SVSA 1XPOA 3QKTA 1ESMA 3B60A 2PMDA 5JSZB 4GI7A 5A5GA 4TZ6A 1J70A 5G3YA 1VG1A 3O8CA 4Y0AA 1P6XA 2ZE7A 4IDNA 5CIWA 1Q57A 3H86A 1EWRA 4LOAA 1UKEA 1ZINA 2V8OA 4CT5A 1NP6A 4XVQA 3ZZUA 4DUGA 2VQSA 2RHMA 5KPDA 2IC5A 3DM5A 2HT6A 4PZYA 1P61B 4LDJA 4A8JC 2F1JA 4DDVA 1H8HD 1KK1A 4L8GA 3VQTA 4OI0A 1ZVQA 1E99A 2R9VA 4O2RA 4G5QA 4A2PA 4ESHA 4FCTA 3K70B 4RD2A 3AF0A 1DG3A 3CUEF 3IGFA 2QMUA 2FSFA 4A4DA 1UFQA 2HCJB 4KLNA 1Z6TA 1JB1A 1KI6B 2VIIA 2ZU0C 5K8UA 2XTNA 3T15A 2ZRCA 1ZUIA 4BQSA 4LPSA 1E9FA 1Q21A 5FTKA 1KDOA 1XZPA 2Q21A 1RJ9A 3OESA 1GL7A 3K09C 5B64A 4AKHA 4QOSA 2VSFA 3L0PA 3PEYA 3BD9A 1ESNA 2W6JA 2G1JA 4W5WA 1JQLB 2JIZD 3NH6A 3QBVA 1JXOA 1P2SA 4JBYA 1N5KA 1OW3B 3AB3A 1IM2A 1ZNYA 3QXCA 4JKIA 1XBTA 3RS0A 3SBDA 4C0KA 1V5WA 2A3RA 2ZAMA 1LVGA 3GEHA 2IHYA 1NY6A 4C0SA 1FUUA 2O0KA 4LBVA 3ICEA 2VP4A 1G17A 3LA6A 4X8OA 3DEFA 1A2BA 2PX0A 2REXB 2QU8A 1GNQA 1AGPA 2VPPA 5L3QA 4HYYA 4XTCS 4M1SA 3SQXA 2JASA 4CEHA 1VYUA 2Z5FA 1XXHE 4Q1CA 3EX7C 3G0HA 1E0KA 3JVUA 1W36D 1BIFA 2BIFA 5AWFC 5IF9A 3GLFA 1U99A 4FINA 1NVVQ 2BMEA 3I61A 5EE9A 4D0LB 1Z0IA 4UXIA 3SS8A 5KSYA 3BK7A 5KOYA 5GJCA 2J0QA 1G7SA 1P4SA 3CF0A 1RFLA 4A8JB 3F3YA 4MRPA 4PX9A 1TF5A 1W44A 1YE8A 4HUQB 1VG9B 3TAUA 3QG5A 3L0IB 1A4RA 2XOKA 3VAAA 2J0SA 4QHSA 2RB4A 3CZQA 4DRZA 1D2NA 1VIAA 1W2HA 4G1UC 3LLMA 3A1VA 3IO3A 3K0CC 1SXJA 4Q4AA 4DSUA 3B2EA 1E2NA 5K8IA 1D9ZA 4TLDA 1KI4A 4QM6A 2KB0A 3F0TA 4DEYA 3WP0A 4EIWA 1CIPA 1G18A 3WNCA 1NMZA 5HE9A 1Z3IX 1V43A 4ACBA 1KI2A 4KFTA 4TTQA 2VBCA 3PVSA 1PUJA 5EE3A 2QQEA 4RSGA 2H1LA 1TQDA 3Q5DA 5FBLB 3GJ8A 1ODFA 4V0OA 4QL3A 2H57A 2XZLA 2FU5C 2V3CC 1Q1ZA 1I4TD 2CHGA 1IJEA 2FGJA 3UMSA 4CGZA 1H8ED 2PEZA 1NI3A 3GJ4A 4DUGD 2GVZC 4NYIQ 3I72A 4I4LA 1OE0A 3KXLA 5BW8A 1G7TA 1T5LA 4YONB 2HJGA 2A5DA 3K0AA 3LBIA 4OHYA 5CYPA 3MD0A 4IXMA 3BH6A 2C2HA 3ZVMA 1G21E 3I92A 2ZSEA 4C0HA 5EXSA 4D4MA 4ZIRB 5B30A 2OLJA 5E7MA 5LD2C 1F60A 1OXTA 1UBCA 1N6NA 1OFUX 1SULA 3KJIA 1A82A 1DADA 4RZUA 2DYKA 4MYTA 4UQOA 4YC7A 4B75A 4I1VA 4LYFA 2OEPA 3ADKA 2E1RA 2BMFA 4CEJB 2NGRA 4GMXA 4U5XA 1S1CA 2IWHA 4XSGA 1CJUC 1VCMA 4EFNA 3AUXA 4POAA 3AM1A 5GADl 4W7SA 3THWB 2DFNA 1T8TA 4EPRA 3O8DA 2C95A 2I1VB 4A0GA 3SQWA 4QJ3A 3BH0A 4IVPA 4KVGA 1OKKD 3RRNA 1Z8FA 2XSZD 5CDFA 1Z07A 2IYZA 3BB1A 2OSBA 2BEJA 3EA0A 2XXAA 2ZTSA 4LYHA 1AM4D 5K8LA 1LB1B 1XMIA 4M22A 4JS0A 3GLFE 2O8BB 3VNVA 4JVSB 5JFGA 3Q72A 3W5IA 4P3YA 2WMOB 2PJZA 1E2KA 3A58B 3RS3A 3N2EA 4GOKA 4KFSA 5EP1A 4LHWA 3TSWA 4ZI2A 1XP8A 5LB2A 2ZI5A 4C30A 5H68A 5JEEA 2WOJA 1SKQA 5F2EA 1OB2A 2IS1A 1YRBA 1L2TA 3QPUA 2RGNA 4NZYA 1KTVA 2ZI6A 5JWRA 3KXKA 5SZKB 2BBTA 2XOKD 1WQ1R 5AJYA 3PXGA 2B92A 4EJSB 2CCJA 2WIBA 3EZ7A 1RIFA 2OV2A 3C14C 3MWLA 4I1UA 4RVCA 1YR7A 1P62B 1ZU4A 2JLRA 2GJAA 4NE2A 1SXJE 2XB4A 3SU8A 3WRYC 2WWYA 4LY6A 5LD2B 4GMDA 2NG1A 1OF1A 5JZVA 2CJWA 2EFDB 2LCFA 2AR7A 2AWNA 3LLUA 4JLBA 3THXA 2VP6A 2DWQA 4HB4A 4M9XA 5FI0B 2PT7A 3UG6A 4DFCA 1U2RA 1WXQA 2V4ZA 1XJCA 3FGNA 1W46A 1DS6A 2ATXA 4CEIA 2ECKA 2QMEA 3DZ8A 4FMCF 4N0DA 1Z83A 4KYIB 3K0FA 2GNOA 1QHNA 5DI9A 1CRQA 3TMKA 1SHKA 3E2IA 1MOZA 3KJGA 3EZ9A 2QBYB 1VPLA 1IXSB 1FQJA 5DN6A 2GCNA 4PC3A 3GJ0A 4Q4HB 4MRNA 1XWIA 1TADA 2GESA 3RRMA 2E87A 3LDAA 4CYMA 3THOA 2FG5A 2A5YB 4Q47A 3QKUA 4KV9A 4FN5A 4PPGA 3I5XA 2AWOA 2ZRAA 1F3OA 2AN9A 1SVIA 2BBOA 1DAGA 3DM9B 2GZDA 2WSSA 4MGZR 3U6BA 5TDHA 5M04A 1CR1A 1MH1A 4Q4JA 4MUBA 4URUR 1ZD8A 1PLLA 4M9QA 4JBXA 3A37A 3VU9A 3WHLA 1M7BA 5JHGB 1X3SA 3VX4A 2J45A 1R5BA 2IS4A 1XMSA 4QG7A 3EIHA 1NN3A 3GJXC 1J99A 1CR4A 4JYCA 4M1KA 1UKYA 2BV3A 5L3SB 2RGAA 3OHMA 2IT1A 1F2UB 2N46A 1YZNA 1ZUNB 3FKQA 5P21A 1E9SA 1NBMA 3PUXA 1CR0A 3QUSA 4M53A 5TVKA 1XTJA 3FYHA 1KKMA 5C4GB 2PMKA 3GD7A 3Q7PA 4Z8YA 3SE0A 5DNYB 1NSFA 3RC8A 1N0WA 2WKPA 1FTSA 1YR8A 1XTSA 1Z6XA 4YLGA 5CYOA 3P20A 3L82B 5KSPA 4C0BA 1E96A 4MA4A 2FDCA 1FPMA 2OCPA 2IYSA 4OQNA 3CRW1 1CR2A 4EAQA 2BJVA 3PEWA 1VTKA 1G6HA 1NLYA 1K6MA 3DMDA 1GVNB 4JSYA 1RE0A 4ON9A 4Q7JB 1EFHA 1ZAKA 1W7AA 1IN4A 5CDFE 2J0VA 1NL3A 1KYIA 2FJUA 3PQCA 5JSZA 5LB4A 1NJGA 4Q03A 2GBLA 4AKGA 3PUWA 4OBEA 3K53A 3NIBA 2ZXUA 1QRAA 4MKIA 1A7JA 2ZYWX 3RWOA 4YXWA 2RAPA 2ZJ8A 3B9PA 5E4FA 4A36A 1JXMA 1W0KA 2ZIAA 4G0NA 4IFEA 4BASA 2EFGA 4DVGA 1E2GA 3SYNA 3R9XA 1RW4A 2WWFA 4QC2A 2FEMA 3D31A 3WXMA 1G3RA 2VYFA 5KU1A 2ZRHA 3LRPA 1OFIA 4Q1AA 5EE1A 5E3HA 1DG1G 3HPRA 4Z51A 5JECA 1NY5A 3D8BA 4QBFA 4C7OB 5BQ5A 4YMSA 3WNBA 2VHCA 4OQFA 5DISB 3SBEA 1UBFA 3TK1A 1KIMA 1KI6A 3U3JA 4BFVA 1MT0A 4TYQA 1JPNA 3K9GA 2YOGA 1NVVR 1Q44A 3FTQA 2ZETA 2CNWA 1GKYA 5C46F 3NHBA 1RC8A 3A6PC 1Y63A 2G0TA 2GF0A 4QFMA 3B6EA 3HPQA 4BRUA 4CRWB 3NBXX 1ZMXA 2D2FA 4S35A 3ICQB 3VTKA 4Z8XA 5TY0A 1GUAA 5FPKA 2OAP1 3R8FA 1RZ3A 1R7RA 2F3TA 4PHGA 1IXZA 4KSBA 3IQWA 4UNPA 2HEIA 3N5CA 2G6BA 3I73A 2YWGA 2HYDA 3UANA 3GQBA 1YZUA 1R0WA 5J4LA 2PLRA 4MH0R 4PXAA 2YYZA 4ASUA 3QIAA 1KK0A 3KB2A 4D26A 1QVAA 2ZREA 3ADCA 2W00A 2Q9CA 1P60A 3AP3A 3D3QA 5EP3A 1RPZA 5KHOC 2ZYTX 4YMVA 4P32A 5IRCD 4BRWA 721PA 2OILA 4F7WA 4R2IA 1QHIA 5GJWC 5J47A 3WY9A 5FH9A 1G4AE 1DAFA 2HLDA 2VHJA 4HAXA 4QJ4A 1S3GA 1S4QA 3AP1A 2ORIA 4A8JA 3U2QA 4C0QC 5SZJA 1XCMA 1Q1BA 1YQTA 3J81k 3A4NA 4HUQA 3HR7A 2GILA 2H5EA 1FQKA 2YWFA 3R20A 5DHAA 2W2VA 3AVPA 1HY3A 2DWPA 2WJIA 1NBME 1TUEA 1QG2A 2ZJ5A 1NBMD 5J4HA 2IX3A 2CK3A 2A78A 2KE5A 3C16C 3ZVLA 1J2JA 2PT5A 4NYIR 3P1JA 1GFIA 4LV6A 4IJMA 3TJZA 3VMFA 1TPZA 3X2SA 3K09A 4D0NA 4HZIA 5FBRB 3QKSB 3PENA 4R7ZA 4QGAA 2I4IA 3CPEA 4RCYA 1R6BX 2X19A 4F4IA 1XTKA 2W0MA 2J5XA 3D6TB 3U7FB 1ZIOA 2AHOA 2CE2X 2CHVA 4RZ2A 1QHYA 1Z06A 1RRCA 4WIAA 3EWAA 3U7GA 3MAAC 4LJ4A 4DLXA 4TYWA 3K8YA 2F1IA 5HTKA 5LDDC 2WWXA 3TR0A 4EKDA 3W6NA 4TYNA 5DIFA 4BFYA 1E6CA 2YOFA 4YXWD 2GK7A 2R8RA 5KDDA 1XMJA 2VP2A 1WA5A 3U3OA 1EK0A 1N25A 2ZAOA 4HLUC 3AVOA 4IHQA 3VKGA 2RGCA 3PG5A 4DLYA 1I4LD 4IRUB 1ZM7A 3T12A 2ZE5A 1XZQA 2A7QA 2ZSAA 1G20E 2CEAA 2O8FB 2J7PD 1X8KA 1XJ0A 2RGDA 3T1VA 4TLAA 2HF8A 2Z43A 3GJ5A 4ZIRA 2PX3A 2VRWA 2GF9A 3QKRA 4DLWA 4LJ6A 4OL0A 2ZSBA 3OFNA 5D3QA 3GLIB 3IIJA 4AK9A 3K0CA 4A9AA 4RFVA 3VKWA 3GJ6A 2OZEA 2HDNB 4NU0A 1YZLA 4CEJA 4ZDJA 4LHVA 5FL3A 4F91B 3ZH9B 3KKMA 2C03A 1EGAA 1SKYB 5EQTA 4IKEA 3TSZA 3THWA 3FPAA 1OHHA 1LNZA 4FI3C 4IVQA 4NCJA 1KMQA 1XTQA 1HURA 4UNNA 3C5CA 2AXPA 1ZW6A 4WBSA 1UM8A 1SHZA 2FEOA 1EWQA 4LRWA 3LNCA 1E0AA 4WZAE 1OIVA 4DLUA 5AJWA 4Q02A 2O8BA 4XWKA 2QENA 4I99A 3QXHA 4B48A 4MGYR 3L43A 4XD7D 3MG9A 1EFRA 1SVWA 3VNUA 1NMYA 4MRRA 4ZPXA 4DCVA 2GTPA 2FN4A 4KJZA 3WP1B 2D2EA 2ZJBA 4IOKA 1FFHA 1EG7A 4O25A 3WMGA 3DMNA 4BFZA 1P9WA 5AJVB 4RD1A 3PUYA 1TX4B 1NF3A 2QT0A 1WRBA 3DKVA 3PV0A 2MMGA 3M4YA 1CKEA 4GZMA 4PZLA 1QHHB 3UKDA 2WJJA 3W5JA 4EJSA 4TSFD 1P9RA 2QTVB 3DZDA 4MKFA 3U3RA 2Q3MA 1M74A 1W0JD 4LYAA 3KKOA 1CEEA 2PJRA 2QTHA 1F2TB 4HUTA 3IKJA 3UXMA 2QQ0A 3EWSA 1G64A 3TQCA 4V03A 2X8AA 3TW4A 4B43A 1G8PA
chains in the Genus database with same CATH superfamily
3KLMX 1A5TA 4KMRA 3ILYA 3WB0A 4EW1A 2AXNA 5EZYB 2I2BA 1NUPA 2O1XA 4QVGA 3UB3A 2QORA 4NXMB 1AY0A 2C57A 2IODA 3RFFA 1PZNA 5C52B 2J67A 5KYUB 4C08A 4L6IA 3PEVA 4B33A 3OIWA 4LC1A 1VC2A 5AQEA 3AUTA 1G2IA 2FSHA 2PKEA 3A8TA 1PZHA 1COWD 2FPPB 5EE5B 1Z9BA 3A4MA 1Z39A 3GAZA 3SF8A 5CX1B 3WGNA 4AMZA 1AE1A 4HX9A 2D3WA 3DC7A 4MKXA 4BVGA 2AI3A 1JLRA 2HUNA 1PNOA 2Z2XA 2PL1A 4O33A 4HB2A 3E5HA 2PH3A 2CNOA 3SVTA 1XA3A 2WHRA 5JARA 2PKQO 1E62A 3GCZA 3WXBA 1P4AA 2GA8A 3AHHA 3MWDA 3TM4A 1E1NA 1MEOA 1NVWQ 1OBVA 3WI7A 2CLSA 2XKKA 1UBGA 3B1WA 4LEIA 3ESBA 3KEGA 1UC4B 3RU7A 3DLIA 1JHPA 3FNRA 3HR4A 3NGMA 5B37A 2QPTA 8OHMA 5DXAA 2GLUA 2YFKA 2C4HA 1AHHA 5DSTA 5LSAA 1E0DA 2BYTA 5I7UA 5L3SA 3DP7A 1F2UA 3O2QB 3SXJA 1X77A 1Y8RA 2H18A 2X8LA 3SM3A 4I3GA 3NIFB 1NUSA 1VRVA 4MYDA 4B3IA 2FR8A 2X0KA 3HZOA 1DCFA 3U80A 5KEIA 1NR1A 4NATA 2JLUA 2W4QA 4DC9A 4LZNA 4JJEA 3W4JA 1BRTA 1XTIA 1LW6E 4JLJA 4ZAFA 2XZOA 4IRXA 1E3TA 1M83A 3CLUD 3KUXA 3OEYA 1XU4A 2DUMA 4IO0A 4UBIA 4F9FA 3CE6A 4ZOAA 3L7IA 2MCFA 3MA0A 3QLJA 4M55A 4MS1B 1DDGA 3GFSA 4HQRA 1G8SA 4MWBA 3L3BA 2YFYA 2ST1A 5DHFA 1YS4A 1DV1A 3OIYA 3RODA 3WL3A 5A04A 1FXWF 4MUIA 5KBYA 4U7GA 1Y9AA 3GLHB 3OEHD 1NDHA 1DWUA 3BVPA 1UPXA 1W9MA 2BGJA 1DCMA 2BSAA 2C3UA 4I81A 5TQ2A 3QEMB 1NQXA 1UPTA 1HO3A 2NQTA 4KXFB 2W43A 3KX2A 1H9AA 3AT1A 2Y2VA 3J7AC 4AP5A 1HX7A 5C18A 1XCPA 3PUVA 1JDNA 3BHMA 1FX0B 2BHRA 1E7YA 5AW6A 3GCWA 2OVBA 4H27A 4EG5A 4NK4A 5F5LA 2IW3A 4ENUA 1KDRA 2XIQA 1TAHA 5HM6A 1GL9B 2A9RA 3FOZA 3LCUA 1Z47A 3EIEA 4H6PA 5ECWA 4YJKA 2QRQA 4J0GA 3V8MA 4DHWA 5HP4A 1A1SA 4BKPA 4J4BA 1VE3A 1P7WA 1G16A 2ZBQA 3NEYA 4H60A 3HRKA 1RMQA 3HO6A 4YI5A 4CDRA 5AW3A 3H5VA 3WYDA 4CKBA 1WKVA 4ZMBA 1N7GA 5AW8A 4HAYA 3ZV4A 1ISPA 5TX7A 1VKRA 2JJ1A 2YR0A 3ZDZB 2VYQA 3G2QA 2XCRB 2XYQA 3ZY5A 1ZOSA 4G4JA 1ZXLA 4QJ5A 4V0NA 2YXNA 4AXXA 2IVFA 1IHPA 3LO5A 3NANA 1TCAA 2IDZA 2Q29A 3G79A 1P0PA 4H6WA 4HBZA 4R2HA 2VUIB 4PHHA 4UREA 4RD6A 5AKEA 5BYJA 5IT5A 5TIIA 2GH1A 4HWOA 2XKJE 1KZ9A 3LVBA 4A26A 5AVJA 2JGNA 2RHJA 2ZUUA 5H7XA 1MCZA 1MOPA 1L7BA 3LC1O 3LS2A 1IDN1 5HBGA 3RGWS 1VHDA 3DJYA 1P18A 1FU4A 3QE4A 4QLAA 4C6RA 4FW8A 1PTJA 1U5CA 4U4AA 2ZJOA 3A3OA 2VJMB 5GIPE 1X87A 3T5DA 1YWGO 1ODJA 2YWJA 2FLKA 1YH3A 3C3MA 1L7RA 5JCXA 2W22A 3A4IA 4HGNA 2YZKA 5JDIA 2P6PA 4ZZ1A 3ZJ5A 4JBWA 1H9CA 3FVVA 4NMMA 4B6RA 2BE9A 1C0PA 2P4QA 2ZVQX 4XASA 3JR7A 2HXGA 1JHXA 4G8DA 5FA5A 4HN9A 4WTOA 3L7JA 1M33A 1HNNA 1U1CA 2GKOA 3C98A 4PC7A 1CJBA 3TBFA 3VZSA 3E1GA 3D2CA 3FBWA 3PKIA 3GD5A 4JJFA 1L4LA 4RKQA 3DDZX 3OZDA 5C5CA 3WTCA 4PXYA 4CM5A 1JFLA 1MOSA 4BUZA 3MWFA 4BWFB 5A5VA 3WMFA 3GPCA 3QEAZ 1Z35A 4HP8A 3T9AA 3WL4A 3W90A 4DYVA 3IAAA 3S7TA 5KX5F 3DKPA 1F7UA 5THQA 5JLAA 2QOEA 4XPZA 3ZTWA 1SHJA 3TW6A 3NXSA 5ARBA 4MVJH 2P65A 4MYUA 4NSNA 4DXHA 1RQGA 3FSGA 4KFRA 5AKHA 2OM6A 1T4DA 4EF6A 3OSZA 2RD2A 2EQ5A 4G2TA 1JAHA 1SCQA 2ZRLA 3CH4B 3HCNA 5K8JB 5LYJF 1C41A 4KCGA 1THGA 1MFPA 1I4WA 1J1ZA 1HI9A 1V7CA 3EVNA 3NJ8A 4GPAA 2R96A 5M29A 1R74A 3NT5A 2W8BA 1W19A 3AKEA 4UM8B 2XMSA 3D7MA 3EPRA 1JSRA 4OHZA 3WWCA 4RGVA 1I4DD 2JK1A 2PS1A 4OFWA 5KJEA 3TGLA 1VLLA 4LHZA 5E4TA 4OAOA 5AR1A 2REQA 1A27A 1CX9B 2AR0A 1T5OA 2XQIA 2IIVA 3KJHA 1HE1C 3M6FA 1TVEA 4X65B 3PDUA 4UAVA 2AZMA 4P6VF 3GRFA 1LQ2A 3WNDA 4ATNA 5BYKA 7AT1A 4AW9A 4UJ5A 5DBGA 4FJ2A 3ZDCA 4TM8A 5JFTA 2PUDA 3UTCA 2JFPA 4IDPA 5FPHA 5BO5A 2QR2A 4WOCA 2A0YA 3L92A 4NONA 5EMLA 3QELB 4S1OA 1Z22A 3W9UA 3OC6A 1AGYA 4MCJA 4ZCIA 3K72B 2Q4RA 1UBEA 4LOLA 4ZDWA 2BUBA 1FW6A 4RQBA 4MB6A 1ZZEA 4A82A 5M5BA 5D3ZA 3WA6A 4BU1A 1BXRB 2Q3FA 3A9TA 1ZA1A 1R27A 5HCIA 4ENQA 3EAGA 4V0QA 3DEHA 4B3FX 1WHSB 4BNIA 1PKXA 2Q41A 3M33A 1XC7A 3NBQA 1T5DX 3HY6A 1AKMA 2CXSA 3AUSA 3E9RA 3NTVA 4JJZA 1MC8A 1WP9A 1OH5A 1XFDA 5AVXA 5L6LB 2IZOA 3AVXA 3EG5A 4E6EA 1OTXA 1G66A 1JYEA 2G71A 1P4HA 3U19A 3EOAI 3OT1B 4WRRA 1SCKA 5BVGB 2QRVB 3ADDA 2GNPA 3L7YA 3TUIC 3ZCQA 4PAQA 1X2EA 3IQDB 2YWHA 3KQOA 3LO8A 4XLZA 2XUAA 3K73O 4IZ6A 1E69A 4O2AA 5C8XA 2OB1A 3EZGA 3JZAA 2YUIA 4TLBA 4IQ0A 2F48A 3X3HA 1I6MA 2PPVA 3Q2OA 2FN9A 3H5RA 4JC0A 3PHGA 3CLTD 4DJDC 3TLEA 3TIIA 3C3WA 2E4UA 1EHYA 1RTTA 3NCHA 4XJTA 5CGQB 1VYTA 2MT9A 4EH1A 2FFQA 1RSZA 1U1IA 3DZIA 3FYTA 1S6YA 3NG1A 3LL4A 1C3EA 1YCFA 1EK1A 1E6EA 1JFFA 2NV0A 2PUTA 3E3LA 4I50A 4UHEA 2RKWA 1B2LA 3IPLA 4JXKA 3M6XA 3QVLA 4WVLA 5FUMA 2EGHA 2WVAA 3GLGE 2P3SA 1AKNA 4WOBA 2XE6A 3VKHA 4M54A 3AK4A 3D3JA 4X44A 1VOTA 5BQXA 2VSNA 4LWQA 2O3JA 2FWAA 2XYPA 4MPDA 3FDZB 1YA8A 4JUIA 4ZVKA 1Q12A 4FFWA 3ENKA 4KQWA 4OD0A 5EJMA 4CKWA 3BMOA 1QV7A 3F46A 4BVFA 3Q11A 4XGRA 4WFQA 4JX9A 5IC6A 5KKCA 3HU2A 2XZTA 1I4OA 4N3AA 4IAOA 1Z8DA 1GEGA 2XH8A 3I1FA 1RKXA 1PKEA 4UPVA 4PYMA 1ZL0A 4QEZA 5B1EA 5DZSA 4G4SP 1JDBC 1CP2A 1GPYA 2AN4A 4MUAA 4O5OA 3HV2A 4HCJA 3MFQA 3GA7A 1SXJD 2H4HA 4WKOA 4BMNA 4CCYA 1RM3A 4ECEA 2OD7A 2DLCX 2VT7A 3CJQA 1DKOA 1W93A 2KJQA 3PHIA 4IFTA 4UAGA 1K9SA 1XZHA 3CW9A 1FIUA 3SJUA 1F0PA 3AFGA 2GD6A 1Z15A 5EYPA 2FE4A 4PBTA 2BFNA 1INLA 3IIEA 1M0SA 1RIIA 2I8AA 1OUMA 4TQ9A 4FHZA 1L5HA 4YRDA 3ZUPA 4AKTA 2BGWA 4WWHA 2DH5A 2V6JA 4MDFA 4HNGA 1U7WA 4ZA2A 2VK8A 4MJ3A 1NBIA 4FOOA 4KEAA 4P35A 3PEWA 4N54A 1M6WA 2YVUA 3STHA 2PBLA 2ZBRA 3WRXC 4D6PA 1WBDA 3VXKA 1MJNA 3PDWA 3EFBA 4AF7A 1W49A 2PWZA 4G5RA 4E5PA 3FOEC 2BTQB 3G9TA 4I1RA 5EPEA 1M2GA 1W36B 2IHKA 3OJOA 5JSQA 1CSEE 4Q7MB 1S2GA 4W5HA 5EZYA 4WKGA 3F2IA 5AHKA 4A2WA 4IS2A 3P0RA 4P3NA 4PNZA 1YOVB 5GTDA 1WV0A 2VDLB 1MGPA 3AEYA 3AR4A 3KKEA 1Y5LA 1N2JA 3QGMA 4J43A 2G17A 5GIOE 1VHWA 2H1OA 3Q9LA 4OH7A 1P7YA 3DHYA 5EIBC 4W82A 4J7CA 4XD2A 2NSLA 1A8HA 2GM9A 4X92A 3CZ5A 3FWYA 4U6SA 4HEJA 2FPPA 1XRMA 3CS3A 3DBOB 3ENQA 4PR0A 1YJAA 4TWAA 5DTIA 5JCOA 4AJKA 2GAFA 5CX1A 1TZMA 5EPUA 2GVNA 1AKWA 3VDQA 5KCZA 3TAHA 3OUUA 1ZITA 5CFMA 1ZEJA 1T0HB 1BKDR 1T8UA 2P30A 4EVQA 1PZMA 1H1DA 3GARA 3REQA 1V7QA 4AG5A 3CZCA 4GIBA 4UE2A 2QL9A 2QTRA 5MN6A 1GQRA 1XKLA 2A1TR 1F7VA 2R47A 3G2NA 3RYTC 3BWDD 5K0TA 1Y5NA 5MN4A 3E84A 2QLLA 2B25A 1VQ1A 2PUVA 3LHIA 4XH9B 4R3WA 4BQPA 1D6NA 1JQAA 5A4DA 4TYPA 3N2NA 4WN3A 5AW4A 1EB8A 1ZBDA 1IXRC 1IQRA 1E58A 2ZIWB 3WSVA 5B58C 4L78A 1C3JA 1N2EA 3PI6A 5LVAA 4CLHA 1PRYA 2UUOA 3OI7A 1G38A 3GLIE 1NNLA 2Q62A 8ABPA 2Z09A 3KOXA 3VJKA 4EGCB 3DDSA 4CLEA 1OLSB 3WLJA 4J7UA 2O6LA 3DE3X 1GZ4A 2XVAA 2ZI9A 3NTLA 4PR3A 3V8RA 1CLUA 4R3NA 4J0EA 1RHKA 3HG7A 4CLOB 1B8VA 4CT4B 1DC8A 1ZGAA 3C1OA 3WLRA 3DEKA 1JKFA 3QLVA 4G81A 1ORDA 3WGIA 4MS1A 3N3AC 4J1SA 3ZIAA 1XDZA 4B7XA 5DYGA 3QQPA 1DO0A 2F9LA 2DR3A 3IUNA 1BN6A 3FNHA 4LG1A 4GYJA 4PAWA 3GLHA 4Q5IA 3W8RA 4DDWA 2FFJA 1VI5A 1ECPA 3TQRA 4OQYA 1W94A 3RHTA 1ZD3A 2O3TA 3QEMA 4DNOA 1XN4A 4WX2B 3QFSA 4HL6A 1W29A 5L3VA 1L8AA 4DSTA 1V1JA 3X1XA 2I3DA 4PCUA 5HIAA 4HD8A 3LMKA 3UAOA 5A9SB 3MWYW 1W52X 1D4FA 1QFYA 3TQTA 1KO5A 2I78A 3DFIA 2ZT7A 2D5AA 3KKPA 4RPGA 2XUJA 3ZQJA 4D80A 4YCJA 1A8QA 3ONVA 3LBAA 2A5JA 1JZSA 2NZWA 1K4MA 1FFXB 2JIMA 4TZKA 1ZM9A 4K9PA 1YL7A 1GAQA 2F2TA 4BECA 4C1BA 1U9IA 4D9HA 5J2UF 1HR0B 1L8OA 4U6QA 1K7EB 2Y9MB 1FTQA 2WP8J 1IRIA 3FMGA 2YIDA 5AVRA 3HBNA 3N39C 1BJRE 1UDWA 2CY0A 1AK2A 3KZNA 4B4WA 4B9EA 2HPVA 1HQCA 2QZPA 4MVCA 4EWLA 1B1CA 3TMYA 4QLOA 4ZVOA 4YRBA 1WB9A 2FPOA 3EQ6A 1ISGA 3QOYA 3IPYA 2QN1A 2G4VA 1OAOC 1I01A 2SCUA 4Q1EA 4MUFA 2LWIA 3E18A 4KW7A 5JMPA 4DANA 1LQUA 1PEYA 2JBHA 3AL2A 3FAZA 3OU6A 3EDCA 1WLYA 4H7DA 2IYTA 3FB1A 2YTZA 2DGDA 4I46A 3EARA 2ZBVA 3ZH2A 2W0SA 4E30A 1Y34E 5G4LA 2FMTA 1FQWA 3PQ2A 1DHTA 3CVXA 1T9CA 2ZI7A 3MBOA 4PYLA 3GLFB 4AU1A 3W05A 3E1KA 3FH0A 4GSKA 1EJ2A 1LF5A 2WR8A 5JT1A 1X1SA 2VJMA 4UVEA 1RWWA 4W5JA 3C3YA 3DZCA 4U7JA 1AQIA 3WGLA 4ALIA 5M34A 1F2VA 2B0CA 2P9BA 2VJLA 1AXRA 4LRQA 3HXOA 4L73A 3UO8B 4KR9A 1GZHB 3CKMA 3ILXA 1E3EA 2QAJA 4G5XA 2IU0A 5I8PA 2Y0EA 4QE3A 1OV6A 1V4VA 3F5FA 3ZCPA 1XCLA 3ZE8A 3PDIB 3TMAA 1U80A 5F9HA 4CGYA 4IJQA 3IODA 4BIMA 2IOHA 4Q19A 3UUEA 4NX2A 2JA1A 4KAXA 3K0SA 3A2KA 1SZDA 3GUHA 4V3BA 3V55A 4E32A 1KIFA 5FPYA 4LBZA 1J7JA 5JD3A 5IUNC 2J9GA 2O3QA 4JLSA 5JJKA 3V46A 3EIUA 1FVFA 2QVYX 1HT2E 2A57A 2V7UA 1NGSA 3CNQS 4HDQB 5HZMA 1RMYA 4LX8A 3ZNNA 4ENTA 5IWCA 3BL8A 2ILTA 1X39A 5IK2A 3H2JA 3CNNA 1T3LA 1W5FA 2HB6A 2UVDA 4EO9A 5C1OA 3I9LA 4UASA 2P7IA 5IDQA 3SIXA 1DPFA 2IHZA 4DWWA 1B2RA 1H2HA 1B41A 1QRDA 4QTZA 4PFQA 4R16A 2WFMA 3KFXA 2YWCA 5DCYA 4WA7A 1YAHA 1J90A 2IUFA 2P0EA 3CN9A 3FLAA 4FYWA 4RLFA 5JZBA 4FZRA 1U8XX 1GPWB 3OWHA 1F14A 1DELA 4OEHA 4OI1A 2FGKA 2ZJ2A 3H1FA 1KE1A 1OZFA 1FBTA 4CIBA 1B76A 1NWCA 1IE3A 4MGEA 3HUFA 3LLSA 2R44A 1DUSA 4JOCA 4WAUA 4V0RA 2BSQA 2OQIA 4NBKA 2VRCD 4FMDB 1IEVA 4M8LA 4MV3A 5D8DA 1TCVA 3BM5A 1WUIS 2BKUA 2BGMA 1C7FA 1AXEA 5AJHA 1OTHA 5DNEA 4ZANA 4DQVA 4H7HA 4CIYA 1D1QA 4EFLA 1DXHA 5F1OA 1TNDA 2R7AA 3A7DA 3TLCA 3RNOA 2ATIA 4RZIA 3OURA 4IG9A 4FFPA 3O47A 3IE0A 4G5FA 3OJLA 4JH0A 2D7DA 4ZO6A 4BAZA 1RRKA 4BLTA 3QELA 2RGEA 4EUNA 2O20A 3D4PA 1I3LA 3IOCA 1XEWX 2X5KO 3L1IA 5K0GA 2VTKA 3TLXA 5BOSA 1UM9B 7GPBA 1BXRA 1G8HA 1R0XA 2A30A 1SWWA 5H3LA 4EY8A 1WHSA 3CPSA 2F1HA 4GM1A 4D0SA 5LQSA 4BOYA 2C92A 3G88A 3HDYA 3KAJA 3G6WA 2WINI 3PHBE 3TTYA 2BVNA 4NAVA 4Y1RB 4ZOLB 3ZGZA 5CXSA 1U3CA 3F5DA 1RLJA 1E9AA 4Z0NA 2YC4C 3LUHA 2IBSA 2HRBA 1R6DA 3HO1A 1HUQA 4DLTA 3LG2A 2QRVA 2E4ZA 3LP8A 4X63A 5J1TB 3WDLA 1KO8A 5EUCA 3WIVA 2YY5A 3VH3A 1H93A 3ZTTA 2GKGA 2XEXA 3H18A 4X60A 5DM4A 2LGJA 5GVRA 4B44A 5JQGF 2DVMA 4RM2A 5DOVA 3S81A 3R09A 1KMMA 4RD4A 4RACA 4HDAA 4DSOA 5CA0B 1ORWA 2C2OA 2QT1A 5HQTA 2H54A 3BD8A 4GT1A 3OPXA 4GSLA 2AJBA 1Y5MA 1NKSA 1G3UA 1OQAA 3IP9A 1XMVA 1J5PA 4E7PA 4M0KA 1C2YA 4OB7A 5JANA 1JJ7A 1Q3HA 1GCIA 2CBZA 3G5AA 3UMVA 3UK0A 4CL8A 3LBHA 3IAHA 3A2LA 2ZUBA 1ZJWA 1YDHA 2R6HA 3RBXA 1UEJA 2Q2VA 4IQGA 1S9HA 4UHHA 3FDZA 2AVDA 1J2TA 2W2KB 3HLYA 3MJFA 1RTKA 4MPJA 4QA9A 4DRYA 5SYMA 5CG1A 3NATA 3D8RA 3D7KA 3TI9A 4LF8B 1NFQA 4TKMA 2BF7A 1MXHA 1XEXB 1ONOA 5HBRA 3WYFA 2GWRA 3NTRA 5F23A 1E1DA 2AKAB 3I4LA 3BJIC 4OXRA 3EWNA 1PLKA 2BAGA 3E9EA 3OFJA 1XIVA 1VP3A 2CSUA 2JGDB 2Q0XA 2X9VA 3ESXA 4D97A 2J3LA 1ZGHA 1LRLA 4Z7QB 4M7PA 2G4LA 3F73A 4N12A 1KYWA 2JBWA 2Z9CA 3INRA 4EMUA 3BUSA 3IV9A 3L4SO 5TGDA 1WUTA 4I14A 4Q3LA 3ZKAA 1IXYA 3NHAA 5EI5A 1GQFA 3RKUA 2F9MA 3RLIA 1GTRA 1YZGA 3COSA 4RSRA 4HADA 2PO5A 2IS2A 2OGSA 1F6DA 3RC2A 1XCGB 3NT4A 3P71T 1K68A 2AKYA 4QASA 3RIXA 3C4QA 3NHFA 2AZTA 1J1IA 3F9IA 4QUBA 1VHJA 3ICVA 3L1UA 3OA2A 1J2UA 1XD8A 1EAMA 4G3XA 3T1YB 4U7TB 1X70A 2BTQA 4PM4A 1E2IA 2VJDA 4IKPA 4HZGA 5FBZA 2CFIA 2COKA 3BQ9A 521PA 5CD9A 3EVBA 2H4FA 1JPJA 1YIOA 4RJ2A 3CKKA 1XVLA 821PA 3CG4A 3ZJTA 3KZOA 3HVIA 2PKQP 1YJQA 5GJBA 3KQLA 3V97A 1EX7A 3ORRA 4D4LA 5J4YA 1YOVA 1YHYA 3PR1A 4LE1A 3OT5A 5KJFA 1UT6A 2R66A 1PZXA 4HNQA 3OKCA 2O7RA 5HJ2A 2QK4A 4ZJZA 2GLXA 1W25A 4HQ0A 5L7TA 1G5TA 2ZJ7A 1G0OA 1V3QE 2ZQYA 3L9WA 3OSUA 1I7NA 3D4NA 3RS8A 2FMXA 1KBQA 3ROFA 2XA1A 2IF2A 5KDLA 2OXTA 3HABA 3OCUA 1RI5A 1Z0FA 4IIGA 4OM8A 5AM4A 5B1DA 4BEBA 2WSLA 2BKAA 1W5SA 2DHCA 2VF7A 4IOLA 2PTGA 4P83A 3BHIA 4M0MA 2EX1A 1X74A 3FOAA 1K7YA 1QLWA 3SFTA 5IMSA 4LVNA 4RTKA 1YMVA 2BMAA 1THTA 4TOIA 2E85A 3W2EA 1IZZA 3A6JA 4UNQA 3F1KA 4G01B 3RM3A 3RBZA 1TKCA 1DX9A 3DDOA 3I05A 4LRXA 5IYZF 5FWAA 2GPWA 5KNDH 3DDNA 4EG4A 2F3UA 2ZCUA 3QVOA 1LH0A 1CXZA 2DTXA 4KQJA 3AWDA 2AJCA 2G72A 4INPA 5A4MS 2AQKA 1JEDA 5FPSA 2BFOA 4CN8A 1KEPA 3NNDA 4ZWNA 1HQYE 4EUEA 4B8WA 5BUCA 1YE3A 1C0LA 4XSVA 1BQEA 1SCBA 4DIOA 3C6BA 2QS9A 1BS1A 1ZKMA 1DKRA 1U3GA 2WPDD 1HRDA 3CW2A 4TLEA 2I71A 3M9LA 3R6GA 3B6JA 4ETMA 4XJSA 3QVKA 2E55A 5CLQA 2RH8A 4BLOA 2C00A 1GGNA 1P2UA 1EFRD 2YJZA 4OHBA 1WUYA 1GNRA 1VPEA 1ZH6A 2BZ0A 3NORA 5EHIA 1T4GA 1UJNA 3DCIA 1E1LA 2EWWA 3IP6A 4LIPD 3TKYA 5C3MA 3N70A 1Q7EA 4PYNA 3G5LA 2Q49A 4JJIA 3DWFA 4U9HS 3G8BA 3G9UA 1DOAA 4GDMA 5CH3A 1A9OA 2VCHA 3VNAA 4V0KA 1R5OA 2MYNA 5L45A 1N77A 1YUNA 2YVLA 1LA2A 3C4JA 4Y6LA 5JAQA 1QP7A 3OG9A 1DAIA 1BMQA 1H4TA 3KFLA 3LP6A 4U2KA 1RNLA 1CY1A 3FOWA 4FIZA 1GGHA 2O2SA 1B73A 3M7IA 4QOIA 5A9SA 1ZR4A 3N8IA 3HK2A 2X0IA 2G36A 2BMWA 3EK2A 4MI6A 4MR8B 1RC1A 3WB2A 4KWTA 4U00A 4AKIA 2E18A 4F6CA 4MR7A 2Y0BA 3WGOA 3WX0A 4XE5A 2FPKA 2VPWA 1TA9A 4RVGA 4UHDA 3ZV6A 1FFXA 4XX0B 1KBZA 3HDQA 3EEOA 4K0KB 2QZJA 4MWZA 3ER9A 5ARCA 2RGBA 3FUVA 2ZVPX 3EG9A 5DGHA 2BRUA 2OFOA 5JH7B 1A2KC 2JS7A 4TS1A 5DIZA 3DE6X 3EXHC 3SQNA 4EY7A 2R85A 3OQ6A 1XPJA 3IS3A 4DA7A 1YAJA 2Z83A 2ZSFA 4U7HA 5JJBA 1BD3A 2WF5A 2R8ZA 3SSOA 2QRZA 1E79A 2AD1A 2XJ9A 2VWGA 3DCNA 3M83A 3TTTA 4DLLA 3I39X 1D9XA 4BVJA 1T13A 1ZJJA 1K6JA 4X66B 4FFLA 2Z6QA 2IK8A 4K5QA 3RSCA 1RCFA 2Q1XA 2AN1A 2XZDA 2ZPAA 3CKYA 3BEDA 3I0MA 3NM6B 4HRVA 4I4NA 3LT4A 5K3SA 5KNCD 2HNBA 1EFAA 1KYXA 1CJMA 5CLHA 2V7PA 1A7UA 2WWWA 3HE3A 1H05A 3Q6IA 1ZI6A 1P77A 3GLRA 1R0KA 3KKNA 1PHRA 1K06A 4AJEA 2X77A 4A73A 3SKXA 2XBLA 2AF4C 3I09A 3DLHA 2KI5A 3MIZA 4HVTA 3ZXUB 3GH3A 5KKNB 5CDYA 2CNDA 1BGXT 1PWYE 1Q1AA 3ZS8A 1UJCA 4NDZA 1R6UA 2F90A 2PGXA 1MB0A 4PZPA 4QQRA 4ZI5A 2F43B 1M2HA 3PDIA 2XTJA 3LIIA 1DXQA 1E2HA 2R1ZA 4EAAA 4JOQA 2P68A 3L5OA 5FYDA 3WYBA 4RTMA 1QNLA 5BRNA 2CMGA 3DFUA 3T8YA 2C07A 1XFAA 1H2EA 3ORQA 7ADHA 2HA6A 2YNMD 2YS6A 3A3YA 1CUZA 1Z3CA 3RUPA 3UHPA 3M6MD 4J2TA 4S0XA 5JE8A 2QVBA 1OWNA 4C0XA 3OX3A 4FFNA 1GYQA 4DDTA 1P6QA 3A2MA 2QSZA 1ZN8A 3DTTA 3PWKA 5EP2A 1H0KA 5FL7D 3LT5A 3LQRA 3SQOA 1TK3A 3CSSA 3PHLA 3UK1A 3ZDQA 3KPVA 4LF4B 3E35A 2VHTA 4TX1A 4GZ6A 5C2JB 1OMOA 1OY1A 2VSOA 3EDQA 3MPUA 1WB4A 2PM8A 4JLPA 3MJSA 5IAGA 5IARA 3MRSA 5K05A 3JATB 1AZTA 5H59A 5J23A 2AIRA 1TUIA 5D84A 3UGQA 3HR8A 4CIVA 5ELXA 2OBMA 2VYND 4EB0A 4AP9A 2UXBB 1PL7A 4FMCB 4NV3A 3NM4A 4J49A 3T1NA 1BOOA 3UT0A 4AJ4A 1I6WA 1OZAA 3BX1A 5I8WA 3LOQA 1RS0A 2HO4A 3VR5D 3GH1A 1D8TA 1N1DA 2GZAA 1M2KA 3UNXA 1JSXA 2BFMA 2DRIA 3Q3VA 2INGX 2CNNA 2ZAIA 3DPUA 2JCVA 3CKLA 3JTEA 2O9JA 3T5MA 4E12A 1NG9A 1O9BA 2HW8A 4LMRA 1IK4A 1UK9A 2O1SA 4ZVMA 4F93B 2F8MA 2XITA 3U60B 3OY2A 2Q0HA 1IUNA 4HFRA 5F78A 4QTYA 2XNDD 3G5UA 2GCOB 3W1EA 2ECQA 2P2LA 2F8LA 1MR3F 4TTPA 1XQWA 4O5AA 4QOGA 4K8OA 3TZEA 2UYHA 4FFMA 4FHFA 5D7NA 1PD0A 1QH1B 2GETA 3WMRA 1UM9A 1SGWA 1ILWA 4QELA 1PFKA 4WH0A 3Q40A 3VPXA 5KOJB 1VL1A 4N03A 1U3VA 1J21A 5EIAA 3MUOA 3OQNA 1SXGA 4IFIA 3S29A 4N5DA 3V4PB 1KI9A 3DAOA 2IW1A 2ZU6A 4GMGA 2EIXA 3SSMA 2VHQA 2FZ5A 4Y1RA 3DL7A 1NJ8A 4ZOLA 4EQZA 2CE7A 2JIOA 1X7YB 4NYMR 1TM4E 4N0EA 4E21A 1YA6A 2N1BA 4ZO9A 4KX3A 2DFTA 4X95A 3OLZA 1JEEA 1BDMA 1XF9A 3DFFA 4AP6A 2GSWA 1F0KA 4W1QA 5GV8A 3ER8A 4G89A 2HWUA 3HMQA 1V3VA 3CNEA 2VEOA 1N8TA 5LUBA 1E3IA 5E95A 3A3KA 4MI3A 2V0NA 3JQQA 4B6QA 3CVVA 2VKTA 2F55A 3W8FA 1L4NA 1UPFA 1LI7A 1VSQA 3HI4A 1R8QA 5CA0A 1BCSB 1QVWA 4BGVA 2X2EA 3JCZA 4KWIA 2WUVA 4OKSA 3K1YA 3VAYA 1A9XB 4IYJA 1W4RA 4Q7LA 2CVPA 1KMHB 2YHBA 3PHJA 3RREA 2ZBPA 2D13A 4IIUA 4PLPA 1FQOA 1P7VA 1SVUA 4KXLA 4ZQEA 4ZOQI 3HYNA 2VDQB 1PEAA 4AICA 4RULA 3JQ9C 5DGTA 3RJZA 2AYYA 4D7AA 4A7PA 3EXEB 3T5AA 1NRIA 2C9ZA 5E1BA 2RHLA 4AJNA 3JZMA 1MT3A 2QRKA 3O1LA 2XNJA 2DR0A 1CNEA 2JEYA 2DUUA 1YR2A 3LX4A 5F3WB 2O7VA 2ZYSA 1SCIA 4E5DA 5LPNA 3SFZA 2JVIA 1YFLA 4KPUA 3D6JA 2GXAA 1XEXA 3B52X 2OGZA 1GUZA 2C7GA 2D1TA 2QQ5A 5E0KB 4LI0A 3AM4A 3A1TA 3ES9A 4XYEA 1UMKA 2QTVA 4ZDKA 3MT0A 1D2EA 2XYRA 3KQTA 3L0DA 4F4DA 1G4UR 1WY5A 2CL0X 2NOAA 4OY3A 1QORA 2AQIA 2FSGA 4RV9A 4D2IA 3U4QB 5DK4A 3I37X 4JDUA 5C7LO 2G07A 1ABFA 3KB6A 3MT7A 1N2SA 3AOEA 4JUFA 4Q9DA 3K0EA 3WK4A 4A6PA 2WWTA 2HGZA 4WHMA 1USVA 4HZUA 4Y9UA 1R0RE 1FYFA 1W581 2FX2A 4CM6A 1N2HA 2RG1A 1K5HA 1MJGM 4LJ9A 4LOIA 3A04A 1EXVA 1MW8X 1EDDA 5DBEX 2RIPA 3RKRA 2PGNA 4F2WA 4Y3UA 5ERGB 2WLTA 4XEHA 2EX0A 1Z38A 5KVSA 2W2QA 3AFOA 4S1VA 3AKDA 3GAMA 3MWEB 4IGIA 1LDEA 3ZE0B 4C4SA 3K8QA 2PXXA 3X1MA 5JJIA 4FFDA 5FJIA 1M72A 2AOUA 1JI0A 3VPBA 5LFAA 4QTUB 4L95C 3VVCA 4WK4B 1JEJA 2GAAA 4HAZA 3ZU5A 1XPOA 1SC3A 2JDID 2XGGA 3RVLA 4D6YA 5EJAA 3JD2A 2FAXA 2DPGA 1T8PA 1AQNA 4YS6A 4HNAB 2Z9BA 2J48A 3J7TA 3PC7A 1FDUA 3DL0A 1GZVA 4Z9AA 5GZ3A 3KETA 5DSZA 4XWWA 2NV2B 4GH5A 3HP1A 1AUOA 3P19A 1YK0A 3Q5GA 1QDUA 1FMLA 1HDCA 4DTIA 4E09A 2PD6A 4YRIA 1DAMA 2AC4A 5I7RA 5K6RA 3HC7A 5I7WA 5KTKA 1NLFA 4R7GA 4FWBA 4XWOA 1D1SA 4NTZA 1PYOA 1NFFA 5D01A 3USES 2HJHA 3AJAA 4MB2A 2W6ID 1QYVA 2ZJZA 3L8HA 1UKZA 2A9VA 3OEED 3OEWA 3WOVA 4IO1A 4F5YA 4QYXA 5CUQA 4NCNA 4G8JA 1PTJC 3OWOA 3ZDAA 3T41A 4KR0A 1SH7A 3KUKA 4GI5A 3S2EA 5FOQA 1B26A 5EGSA 1X13A 3EPPA 5I7VA 5GY7A 3ND5A 4JYPA 1OPRA 3V2IA 2XI4A 2NPIA 1UBKS 3Q3JB 3CRRA 1CIJA 1L7DA 2QX9A 3O1IC 5JDIC 4Z4CA 5BSVA 4M9UA 5K99A 1HYGA 3KEFA 4MV1A 3VI3B 4NBSA 4RFLA 5LQMA 1NXPA 3RI3A 2O8VA 2E6UX 1RPAA 4XPIB 3L77A 4EYKA 1CRWG 3C5VA 2QI9C 3CR8A 2IU4A 2PWAA 3G0OA 4GBMA 2AG8A 2C5AA 2JI8A 1J24A 4Z1MD 5HOQA 5ALSA 2Y66A 3N2KB 1HLGA 2EKQA 2EOAA 2GS9A 3O94A 4ID9A 2ONJA 2D4HA 3H1GA 4MDEA 2YINC 1DXYA 2DLDA 1S2IA 2VPXA 3H9GA 2Z95A 2KW5A 2ZB2A 3SDSA 3EMVA 5HEKA 4CZ2A 1N2XA 1FFGA 4QUIA 2GJ9A 2H1FA 1I3NA 2Z6VA 1EQ2A 4QU9A 3VC2A 4PO8A 2J7PA 4NR0A 2XYVA 3GNTA 2WT4A 4PSDA 1ECGA 3EC1A 2QG4A 5LBUA 4BN4A 5BSFA 3P7MA 5I47A 4MYCA 1JEAA 5HYVA 2IS6A 1CHNA 1ZIPA 3S2SA 3NWJA 1MQ8B 2B8WA 1K8YB 3HBFA 3RSOA 5HRCA 5AM1A 3VDNB 3W2IA 3QTLA 5K09A 2WT8A 2YX1A 4Q18A 3SCZA 4MR8A 2FLWA 2YIVX 4NBNA 2WYIA 2J6HA 1KDPA 4E4RA 2B37A 1VE7A 3GCGA 1S8OA 3BE5A 1ILEA 5CXUA 4IJ6A 2A59A 2B7CA 4KP7A 5D5HA 1MORA 1XN1A 5LLTA 4DA4A 4XX0A 2GZMA 1GTJ1 3CLVA 3PNYA 4F6RB 1RQNA 5IVIA 1BQ3A 3AB7A 2XGMA 3FWZA 5LLDA 3MCVA 3AC0A 5FI3A 3CBQA 3GLGB 1XDSA 3IQZA 3K9WA 4N5HX 5JH7A 1J49A 2RDMA 4KQEA 2BE7A 2PYDA 2CLHB 4G1VA 3MJCA 1TAQA 4ZOEA 3W5VA 1ZH0A 2X0RA 3CZRA 3WLEA 4BDTA 2OHGA 4QOEA 4G1CA 2QEQA 4LZJA 1P80A 4FNAA 1E6WA 4JLKA 3HCCA 1FP6A 1C3OB 4MV6A 1CF9A 2VP0A 3WB1A 1BGWA 1Z0UA 1LXCA 3ZGXA 1D1TA 3L4EA 1UC5B 1FS6A 4OHMA 4L28A 4JJ4A 1CT9A 4BZPA 1JIIA 3PS9A 3TPZA 3UPUA 2BDEA 3UUGA 3H16A 4PRZA 1FNMA 1QFSA 2N42A 3CF4A 2I03A 3DF9A 1KK3A 5FORA 3RT7A 5CDHA 3Q8XB 3EGXB 4XD7A 1VSTA 4HNSA 5CYFA 1XZDA 3BSWA 3COPA 4Q4AB 4AUEA 5ALQA 1QBKC 3ELBA 4ZVTA 3AFIA 1GKUB 1P33A 3CLHA 4IMIB 4AJOA 2OC9A 1YUMA 1TLTA 1U0RA 2WG2A 3GEGA