2D7DA

Structural insights into the cryptic dna dependent atp-ase activity of uvrb
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
Knots found
sequence length
652
structure length
621
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the cryptic DNA-dependent ATPase activity of UvrB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*T)-3'
total genus 228
structure length 621
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2d7dA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA01
1HV8A 3QVVA 1OIXA 3UMRA 2BIFA 2JJ2A 3RRMA 2GAAA 4A0GA 4R2IA 1E9FA 2X1VA 3RRNA 1E6CA 5FTJA 4KJZA 4LJ4A 1OT3A 3QNUA 1VG8A 3BB4A 1ZU4A 2TMKA 1KO5A 5F3WB 2REXB 4IVQA 4OQXA 3AF2A 4JL6A 4MRPA 4PPQA 4Q9HA 4IDNA 2QQ0A 1LV7A 3VR6A 4CGZA 5H70A 1E2KA 2OLKA 2VBCA 4DDWA 1VCMA 3T5GA 2ZRFA 1EGAA 5FPTA 1E69A 2JLUA 4NL4H 4P4SA 2G3YA 4CYMA 5E95A 2JLVA 1NY5A 2FA9A 2IXEA 1LY1A 4ZV4A 3FMIA 1NRJB 1V43A 2PMKA 4OI2A 4Q48A 3WNCA 1RRCA 4C0KA 1NVUQ 1U2RA 2I3BA 3BH6A 1XXHE 3THWB 2BKUA 3UKDA 2IHYA 3R9WA 3RS3A 5JJIA 3T06B 2DYKA 3H84A 4JLJA 4TTPA 1S8FA 2QROA 1T5LA 4PHHA 2IUUA 1XPOA 5CM8B 5SZJA 1EFUA 1YE8A 2GNOA 3KQNA 4QHYA 1TQ4A 1OXTA 2GJ8A 4OL0A 5KSZA 2AL7A 2F43A 3BBPA 1AA9A 1G7TA 4G5RA 4UJ3A 4C0HA 4ACBA 2WAXA 3HDTA 1G3MA 1EG7A 5FTKA 1T8TA 1M74A 3W6NA 3GLFB 3AP1A 4FCWA 3LQQA 1E99A 1N6KA 5BQ5A 3EAQA 3Q72A 4M53A 5JS7A 5JRZA 3R9XA 5B57C 2LKDA 3TAHA 1VKJA 2G1JA 3VKGA 1IAQA 1SVWA 3U3RA 3ZZ0A 1YZUA 3GLHE 1NLZA 3D8BA 4E07A 3ZVLA 1GFIA 4KHZA 1SXJE 4TT3A 1CJVC 3SI7A 4HI0E 4B74A 1DO0A 3B9PA 5B30A 5L3VA 3QIAA 1P61B 3QY0A 3QQ5A 5EZ6B 1W36B 1XD9A 1WB9A 3H86A 3LY5A 1YR8A 2F1RA 4EPTA 3QJYA 2XGJA 4HZUB 2J87A 2QU8A 1VIYA 2VP2A 5DISB 4AKGA 4MDFA 2WICA 3SJBA 4CT5A 1A1VA 2FSFA 1FQJA 4UNSA 1KO8A 5B64A 2CXXA 3R8CA 2AWNA 3THWA 1DAKA 1U8YA 1MT0A 2C96A 2V8OA 2ZVPX 4M9SA 4S2EA 4LBYA 3DKVA 3TR0A 2H5EA 2OT3B 4A92A 5C2JB 1JXMA 4F7WA 4DUGD 3OE7A 3O8DA 3THOA 1NLFA 1E0AA 5TDHA 2JIZD 4HUTA 4BWYA 3L0PA 3W34A 2JLRA 4LBVA 2ZRGA 1IN5A 2KE5A 3IEUA 2WSSA 4RZXA 5CYOA 5AR1A 5EXPA 1MABB 4MKGA 4V02A 2AXPA 4R71A 1B23P 4HB2A 4PC1A 2BC9A 3P32A 3VU9A 3RS2A 2FV8A 4O0MA 1G8HA 1CJKC 3B85A 4FMCF 4PANA 4YONB 1IY1A 1P60A 1W5TA 2IYLD 3W6PA 5TV2A 5IF9A 3A1TA 4OHWA 2D2FA 1P72A 1KOFA 4FWTA 1DELA 2CK3D 1OHHD 2R6FA 3ZVMA 4IKEA 1UBCA 5CM9C 4KFUA 5TB5A 2NPFA 3WBKA 2IS1A 3BIFA 1I4LD 1E9AA 2FSGA 3NTUA 3BH7A 2RGDA 4GNKA 1M34E 1XU4A 3Q3JB 3CZPA 1DPFA 2IF2A 3GJ5A 1KO1A 2LWIA 3GLGE 2ANBA 3UMSA 4TYYA 4A2QA 3AKEA 2FEOA 1XWIA 5HE8A 1TF2A 4DSUA 2GJ9A 3EIEA 5E7MA 4HAXA 1JALA 1OW3B 5AK0A 2B2NA 2E9SA 5B2ZA 4URZR 4CEJA 5CK4A 1ZM7A 1L4UA 4XWKA 2H92A 3I8XA 1GAJA 4G5GA 4BLTA 2HYIC 1IHUA 2C9CA 3CH4B 4C0LA 2WTUA 1RVDA 1KO7A 2XXAB 2VLIA 3DM9B 4IOMA 2Q6TA 1OXUA 4GBMA 4BEJA 3AQ4A 1JB1A 2GTPA 2BV3A 3WBJA 3I5XA 5AJVB 4D0LB 3TVTA 1I4DD 3BAFA 4NYJQ 4LJ5A 4TN1A 1SVMA 1E2HA 4DBLC 3HPRA 1F2TB 1TL7C 4Q1BA 1SULA 1RJ9B 4P31A 2BBSA 4B43A 3K0FA 4OQLA 1W0JA 5DN6D 2J0VA 2OE2A 4KBGA 1KJZA 2BM0A 3TH5A 1FUUA 3PJRA 2ZE8A 3P20A 5EUQB 4YDSA 2ATXA 3S1AB 1KAOA 2IYXA 5KU1A 2C8VA 2GCOB 3H1TA 2GK6A 4CW7A 2WM9B 5CDFA 2XEXA 3A1VA 1NN0A 2CLSA 1NL3A 1JPNA 2ZI9A 1RKBA 2W0SA 3WMGA 3RSLA 3A6PC 4TZ6A 3M6AA 3F8TA 2WKRA 4C30A 5L3SA 1QVRA 1KK3A 5DI3A 3N2EA 1RC8A 4FI3C 1RRGA 3FE2A 3AB3A 1T0HB 2XJ4A 3Q8XB 3EWSA 3ZQJA 1CLUA 1SHKA 2QPAA 4HUQA 4QRHA 5SZHB 1KI4A 4C0AC 1KSJA 4EJSB 2QGNA 2FDCA 1YQTA 3RRYA 5H68A 4JLAA 2FN4A 4J0QA 4LYHA 1N6IA 3KUDA 1QBKC 2Z4SA 3OEHD 1UKVY 2WWGA 3W9YA 1M6NA 2GCNA 4B35A 1Y3AA 1N6HA 4IW3B 2ZJYA 3GLGA 4HUQB 4JS0A 3TAUA 4MGKR 4MKIA 2CHQA 2Q3FA 4JT2A 2W6IA 4URWR 2QMEA 3UWKA 1PV4A 1Z6TA 2F1HA 2IYUA 3SFVA 3D3QA 2QMHA 4MYHA 1E96A 4HSEA 3RS7A 3VQTA 2ZRAA 3ZLJA 1Z06A 3NDBB 1Z6XA 4UXHA 4V0OA 5KNCA 1E1QD 4HZUA 1A82A 3CX8A 4Z51A 5J47A 4E09A 5HCNA 3PUZA 2PMDA 3WYGA 3W5JA 3A1SA 4A0RA 4X8LA 4KVGA 3QSYA 1C4OA 3AVYA 4RFVA 2AHOA 3REFA 1ZBDA 1E9CA 4GZMA 4HLUA 4KODA 1Z0AA 4M9ZA 3U4QB 4Q4HB 2RHMA 3E5HA 2DWOA 2ZRKA 1RJ9A 2RCNA 4Q19A 1XMSA 2BJVA 2LCFA 1OH6A 4LPSA 3MJHA 1M2OB 1TF5A 4WXPA 4P4SB 3L0IB 2QNRA 3B8HA 2ZIAA 4JT4A 2OCAA 3WXMA 3SDZA 4V0KA 1W7AA 2IYQA 1U94A 1D2EA 1U81A 2AWOA 1NNEA 4TT3D 3AVOA 1UDWA 2ZRBA 2F3TA 1WP9A 2ZAOA 2QP3A 2ZANA 3WY9A 1TEXA 2JJ1A 4LV8B 4JVMA 1FMLA 4JYBA 4LY6A 2O8FB 3TQFA 3RYTC 4AG5A 1E1RA 1LS1A 4OHVA 3NEJA 1CS4C 3SZRA 4F38A 2QP4A 2FPLA 2CHVA 5EXSA 3U6KA 2VHJA 3KTAA 1G7SA 1MABA 1R8QA 2UVQA 1FNMA 4XVRA 4GMDA 2C5LA 1XD2B 3FKQA 4IEEA 2CBZA 4HLDA 4CZ2A 4CEIA 2CCKA 5FOUA 1OF1A 1K5GA 1TADA 2ZUBA 1R5OA 1XJ0A 4LGMA 1BS1A 4URYR 1IN8A 3GLIB 3X1ZA 1OIWA 4GOKA 3RANA 2VQSA 3CBQA 1DO2A 1KHTA 3BFXA 4XWAA 2AKYA 4RD0A 3HYTA 2ZEJA 2FFAA 1NLYA 4DUGA 2O8DB 4MRRA 4QJ4A 1R8SA 1US8A 3U3OA 1LF5A 3ZVRA 1FOEB 2WPDA 1NP6A 2XTNA 1Z0IA 3VR4A 2D7DA 3QKRA 3X1WA 4DLWA 1Q20A 1XPUA 4B3XA 3R7WA 4NCNA 2J7PD 3THYB 2WSSD 2Z5FA 1TPZA 1XZPA 3ONWA 4M1SA 2WSMA 2GK7A 1G18A 3BJIC 4H1VA 4BLQA 1HY3A 1ZNWA 4ON9A 4YMTA 2X19A 2DFLA 4B3FX 2XSZD 1H8EA 1RYFA 1J8YF 4KLZA 4QBGB 1XXHB 4DXAA 1T91A 2HLDA 3FKSA 3QEOA 4IVPA 1NVWQ 3C16C 4YMWA 2IT1A 1FP6A 1K5DA 1U0HC 5UKDA 2ZI5A 4GP7A 5LB4A 1M7HA 3NC1C 5KPDA 5JMTA 4B32A 1U9IC 3MWJA 4A36A 3K70D 2EQBA 2KWIA 1N6LA 2QPOA 4RSGA 5JCZA 3KKPA 1KJYA 4B48A 1T8UA 2BBWA 4DB4A 4ILEA 5FOVA 2NO0A 3MCAA 4FINA 4UKDA 4KFTA 1TMKA 1IN6A 3KQUA 2RGAA 1OH5A 2OESA 4BFSA 2D62A 1FFHA 4DDUA 4BFYA 1DAFA 3P1JA 2ZJBA 5KHOC 1N5JA 1OIVA 2VSOA 2DWPA 1N6NA 2ZE7A 3SYKA 1FMJA 2JLYA 2A2ZA 3C15C 1W0KD 1KYIA 5B58C 4OK6A 5D3MB 1SVLA 4AG6A 2J46A 2O8BA 3TR5A 1HH4A 1G19A 1QG4A 1G9XA 3GLIA 4M2LA 1YHNA 2EFCB 4Z8XA 2O52A 2V6IA 4CEHB 3ND9A 4B44A 1A5TA 3W3AA 4CEIB 3TJZA 3PUWA 4Q18A 5KOYA 4ZCLA 3U2QA 1NN3A 3TBKA 3GMTA 1EFRA 4P4UA 3DL0A 2PX3A 3VFDA 1W2GA 2FPKA 1Q3TA 1IONA 1KJWA 4OBEA 4B3DA 4EDHA 1NJFA 1QHIA 2EVWX 3DMDA 3FMFA 4PC2A 4AKIA 1VYVA 5KO2A 2VP4A 2XXAA 4ZKDA 2G1KA 2GCPA 4M1MA 2OUKA 1KO4A 4KYIB 3C41J 5CJ2A 1II8A 1E0KA 4URUR 1J90A 4LCBA 2ZITA 2YOGA 5JWHA 3ZD7A 5DNYB 4E22A 3FMOB 3A4LA 1NVXQ 5HCIA 3HR7A 3UATA 2G0TA 2SHKA 3PCRB 4PZYA 1KI6B 3AVUA 1KDRA 1VHTA 2J45A 5FL3A 2ZJAA 2LKCA 3IDQA 1W36D 4MUAA 2OILA 1T3SA 2CNWA 4ASUA 3PEVA 3ZS9A 1FX0A 4TLCA 1HURA 1NI3A 4A0FA 1Z5ZA 4IVRA 4ACAA 3ASYA 2FZLA 3I32A 3TK1A 3PVSA 3I61A 3TE6A 1G8YA 3VHLB 1UAAA 2UKDA 2F1IA 1G8PA 1S1CA 1XMVA 2Q9CA 1P3JA 4TLBA 1E2LA 1HA3A 3AGPA 2FPMA 3PUYA 3B78A 2OCPA 4Q9LA 2A5DA 4NYJR 1MO5A 1II0A 1P9RA 1NMZA 4QG7A 3CWQA 5JCPA 1UEIA 4GP6A 1XX6A 2AD5A 2QRNA 3GEEA 3WNBA 2L0XA 4ZDJA 5JEEA 3NHBA 3QUSA 2P67A 2WKQA 2GF9A 5HR5A 1UKEA 1Y63A 2BOVA 3WHKA 4B3GA 1Q57A 4Q01A 4ZO4A 4FCVA 1AS2A 2RGGA 2IEYA 1E4YA 3ZGXA 3IHLA 1E9SA 3KL4A 4TTRA 1TTTA 5D3QA 4EJSC 3FFAA 5J5CA 4NBSA 3KXKA 4JBXA 3ZVNA 2BBOA 3Q5EA 1YRAA 5EE9A 3RHFA 3LX8A 1XDBA 2ZPTX 1G6HA 4Q9KA 5FPSA 4OQNA 4D26A 4HAZA 4NYIR 2PX0A 1SXJA 1KSHA 3OHMA 2YYZA 3B1ZA 4M1KA 3QKRB 4Q7KA 5JEDA 1A2KC 3AKYA 4JJKA 3VR5A 2QPTA 1XEXA 1YZLA 2HF8A 2QTHA 3AKCA 2WJHA 2QSYA 3WMEA 1E1RD 2KB0A 2YINC 3ZS8A 3ZJYA 4IEIA 1G3QA 1CKEA 1T0JB 1LW7A 3NBYC 2A78A 5AJXA 2PZGA 3I4LA 5HKKD 4ZDKA 3IUYA 2IXFA 1VIAA 1Z6YA 1NKSA 2GXQA 3NDPA 2DCUA 5HZHA 1GILA 3D31A 2OO7A 4QGFA 2PL3A 3P4YA 3RS4A 1Z6GA 2DFTA 1IXRC 4BLPA 4HLCA 5AJWA 5FR1A 4Q9IA 1ZD1A 4Q7MB 1JNYA 4US2R 1Z22A 3SN6A 1W49A 3FHOA 4PHTA 2V55B 4QGAA 3C8UA 2WPDD 1GL6A 3C5HA 4DCVA 2A5JA 2OXCA 3MWYW 2NG1A 3Q7QA 1GIAA 1XTKA 1IN7A 1E0JA 1US8B 2J7PA 1D8TA 1CR4A 4NPHA 1N2CE 2V4ZA 1SHZA 4XJXA 3V4RA 3CWZA 2ZJOA 1Q12A 3I73A 4O25A 3TW8B 2IWRA 3GFTA 5BW8A 1VMAA 5DHAA 1S0UA 2H18A 3HU3A 4U02A 5DE3A 1H8ED 4TL6A 4NH0A 2D3WA 1FQKA 3U3KA 4GRAA 5AJYA 1GTVA 4B2LA 4DLXA 4QFMA 1LNZA 1MO3A 621PA 2MSEB 1IXSB 2EFGA 1D2MA 2AK3A 1DAMA 2Y8EA 4V0MA 4XSGA 1ZVQA 2QT0A 1E2GA 3HYRA 5G53C 2EYUA 1TQ2A 2WIAA 4OQMA 1MV5A 1S3GA 3BERA 4B76A 5F2EA 4S35A 5EQTA 3WNDA 3CUEF 4BEBA 4GT1A 2IS2A 1TU4A 4QJ5A 3CONA 3SQWA 1W44A 4C2UA 4DCUA 2GHIA 1Q21A 4IOKA 421PA 5CK5A 3ND8A 1A7JA 3QXXA 3GFOA 3I72A 3LXRA 1QG2A 2PT5A 4I99A 4W5HA 3A58B 4OK5A 1O3YA 3GJXC 2FOLA 1W0KA 1JR3E 3LO5A 4OQFA 2IYSA 1XCMA 3KZ1E 4TYWA 3O8BA 2G6BA 3AF1A 3VR3A 1S1MA 3OZXA 2CE2X 3AF3A 3VMFA 3ZYCA 4PO9A 4PSKA 4PC7A 1EFRD 2EWWA 3QPVA 4V03A 3DOEA 4PC3A 4Q00A 1ZM3A 5TARA 4E03A 3K09C 2REBA 2W6JD 2WJGA 3ZIAD 5CLQA 3FPAA 3RSOA 5AUOB 2NTYC 3LDAA 3WRXC 1R0WA 1RE0A 5ELXA 4C2TA 1PUJA 1LVGA 1NVVQ 4PZLA 4L16A 4BE7B 2XTZA 2I1QA 3QPUA 3R20A 4LYJA 1O87A 3LBIA 1HQCA 2AN9A 3W8RA 1G20E 2FGKA 3OEED 5KSPA 5GJWC 3Q85A 1ANKA 5LBIA 1AGRA 2BMJA 5ANRB 1XCPA 1E79D 3B13B 1P4SA 5EE5B 2R65A 1CJMA 3QXSA 3BB3A 5KSYA 5K8UA 3G0HA 3MD0A 1ZIOA 2C99A 4RD3A 5P21A 4O2RA 1AS3A 2WJJA 3FVQA 4QHTA 2YWHA 2ERXA 2ANCA 2GKSA 1ELOA 1F3OA 2WWIA 1YRBA 2ORVA 3T5DA 4C0SA 2HUPA 3EXAA 4LJ8A 2JATA 1KKMA 2IYWA 4ASUD 4DCNA 4W9MC 2ZXUA 2N46A 2WJYA 4UNQA 2VHUA 1OXSC 1XB2A 1AN0A 1CRQA 3TUJC 4ESHA 4ARZA 5FL7A 2H7VA 2RKOA 2WOOA 4G0NA 4UXJA 3U7GA 3IQXA 3CRMA 1F2UA 1F5NA 3LLMA 2R9VA 4LHYA 4LZZA 3GEIA 3B2EA 4JLOA 2VHQA 3HR8A 2ODEA 3LD9A 2A5FA 5FPKA 1RPZA 3U5ZB 5BWMA 3QI2A 5J4KA 1RRFA 4UJ5A 3N5CA 4PQYA 3TRFA 1XTSA 2ZR0A 1EFHA 1Z47A 3VHXA 2GJKA 2GWHA 4B3CA 3LBHA 4HDQB 1YR9A 4BLSA 4Q1CA 4Q4AA 2OHFA 5GJVC 1SQ5A 2PEYA 3O8CA 3AV0B 3REGA 2FU5C 5JSZA 1JEEA 4KFSA 3OIYA 3IO3A 2WIBA 1WMSA 1F48A 2FF7A 1U8ZA 4D81A 5JZVA 4FCTA 1AM4D 1COWA 2RB4A 4PSAA 3GLGB 4F92B 1P62B 2FX3A 3AGQA 4HEJA 2ZS9A 4LJYA 2R6AA 1OSNA 4LC1A 3IPYA 4C4PA 2G0NA 2ORIA 3NIBA 221PA 1BYUA 5AJZA 4ZI3A 2VP5A 2ZSDA 2QAGA 2O0KA 4XVUA 2KI5A 1QHYA 3T35A 1FPMA 4Q4HA 3VX4A 4PPNA 5G3YA 2D2EA 2YC4C 4DEYA 3UPUA 4O2LA 1MO6A 2C9YA 5IHPA 1ZM2A 1G1MA 4P32A 4QHSA 4A2PA 4TZ0A 1SKYB 3EPJA 1HQYE 3AVPA 4NYIQ 3SJZA 2VP0A 3A4MA 1GNPA 2GJSA 5FBQB 1ZP6A 2YNMA 4GOJA 4LJ6A 3RLFA 2H17A 3SBDA 3K70C 3CB4A 4MGIR 4XH9B 1XZQA 4TTQA 4JLMA 5C4MA 1DBSA 4OJKA 3FTQA 3QBVA 2VRWA 4Z1MD 4TQAA 5FTLA 2BVNA 4U5XA 121PA 4XVQA 3C14C 4MGYR 1WBDA 4DFCA 4EIWA 1XMJA 4V0ME 4I4LA 4TLAA 2Z83A 2HXYA 4Q1DA 3DOFA 1AQYA 4PR0A 1G64A 1Q0UA 1Q3HA 2QI9C 4ZCMA 1Z2CA 4NYMQ 4ABYA 2PZEA 4DIDA 3T61A 2EYQA 3WYFA 5IRCD 1NJGA 1MKYA 1SKYE 3ADBA 5EE3A 2V54A 5IK2A 1KI7A 2EW1A 2NO7A 1OE0A 2VPPA 3H0KA 4PO1A 2PH1A 1VYTA 2Q9BA 4DSOA 1CF4A 3NWJA 2FGJA 4LV5B 2J5XA 3QEJA 5FUYA 4L9SA 5DYIA 2WWHA 3EZFA 4W5JA 1IOZA 2YZ2A 4B33A 2ZSBA 4Y0VA 2DWQA 3CPJB 1P5ZB 3TGPA 2Q3MA 3LNCA 4TLDA 3U3JA 4Z54A 3PV0A 5JFGA 2ZRMA 1VECA 1OLOA 2OBNA 4EFNA 2GCOA 4AD8A 5BN3A 4QXAA 1BMFD 1VCIA 5CB8A 5L3QA 1F6BA 2Z6VA 1NBMA 2OLJA 2ZYUX 4D6PA 3C5CA 4R98A 1Q1ZA 3BK7A 1XD8A 3OIVA 1XNJA 3M1IA 4IDOA 2YWEA 4OHZA 5KUTA 2IL1A 4MDEA 1FNNA 4QL3A 4FMBB 1OH8A 2JGNA 3QF4B 3AVWA 3IBYA 4LHXA 1OH7A 1N6PA 2JDID 5EP1A 2JJ8A 3SJCA 3ZZTA 3P26A 4IFBA 2QBYB 4V0NA 4YXWA 5CIQA 3NVAA 4B2IA 1X8KA 2RH5A 4CIDA 2OCBA 3WMFA 1G5RA 1G5PA 1UBGA 1OFIA 5BXQC 3QKUA 3HJNA 2QBYA 1UF9A 3GLHA 1FUKA 1KI1A 1QHNA 2QRZA 4HAYA 5CLLA 4B75A 4A9AA 4JJZA 3UG7A 3AKDA 2AD1A 4B47A 3B1WA 3THXB 1W36C 1AQUA 4ITRC 2G9NA 2GAOA 1AJEA 1G41A 3UIEA 4XWOA 4TMWA 2JEOA 5E4FA 1TNDA 3OAAA 1KK0A 5TXGA 5J40A 3IGFA 1J2JA 5EZ5A 1Q1EA 3VR2A 4TSFD 1IY2A 4MRNA 2PLRA 4TL7A 2O8BB 3G5UA 4I1SA 4M1TA 1JEDA 2VF7A 1GSIA 2VA8A 1FL9A 2G88A 2AK2A 2YKGA 2WMOB 4F4CA 1E2NA 5EJEA 3K0SA 3BFKA 5G3ZA 5FBLB 1JECA 1TQ6A 2CE7A 2ZSAA 3VNVA 1D2NA 4AC9A 4DRZA 4AURA 3DZ8A 5G41A 2V6JA 3ADKA 1YJ5A 3KKMA 4WA7A 5F98A 1G6OA 2ONJA 1D9ZA 4HB0A 3W8NA 4GI7A 1FW6A 3RC8A 4I81A 3MGCA 4DLZA 2NZ8A 1DS6A 4ZIRB 2ZYWX 2GDJA 1OKKA 3U7EB 1VYUA 4C0BA 4CDGA 1G4UR 1T3LA 1ZINA 4HB3A 2FG5A 4MYCA 3VTKA 4CF7A 3ZDQA 1ZM9A 3U4QA 4FW9A 2F55A 2D7CA 3TSWA 2ODBA 4MYTA 4KSBA 1MRSA 2YHSA 3NXSA 4BFWA 1DAIA 1X8LA 2I1VB 2BHRA 1NMYA 2PJZA 2W2XA 3P4XA 1RFLA 1F60A 2VIIA 2XOKD 2FNAA 4IDPA 2HJVA 3K0AB 3SEAA 3UANA 3V4FA 4CT4B 2C04A 1WF3A 1ONBA 2RGEA 4LC0A 1G8FA 1ZM4A 2CMKA 1CJUC 4DLYA 4JLKA 2ZREA 3K0AA 3TUZC 2ZRHA 2NOAA 4IJMA 4OKSA 4BFXA 3N2IA 5FI0B 2IWHA 4PO8A 2W58A 2XX3A 2YWFA 1JR3A 2ZJZA 4BUJA 2O8CB 2F9LA 1ETUA 1DAHA 1KIMA 3DHWC 4YC7A 1JR6A 1WA5A 3ICQB 3LXXA 2O5VA 2ZRPA 4D2IA 1KK1A 1U0JA 4B34A 3NKVA 3GQBA 2YWGA 2QAJA 5GJCA 1SKQA 4JBYA 3I8SA 1X6VA 2VH5R 1KDTA 2QM7A 3E1SA 3FHCB 3X1YA 2Z43A 3FFBA 4PAOA 3K9HA 4BFTA 4JBWA 3CX6A 4PAMA 1UM8A 3SYLA 1QRAA 3EA0A 4U00A 4BZQA 2O0JA 1YZGA 1N5KA 4MUBA 4IRUB 5L3SB 1JQJC 5AWFC 3QG5A 3RC3A 2HYDA 4NU0A 1W46A 2R62A 2A5YB 2XNSA 1SVSA 5HPYB 4FMCB 4HAWA 1UDXA 3FB4A 1UJ2A 1BH2A 4OK3A 4HLQB 4GOXA 1EXMA 3UWOA 1FP7A 4DLRA 4JIMA 5AUQA 2HCJB 4ZI2A 3PENA 1KI8A 3PFIA 5FTMA 2HXSA 1IJEA 2FZ4A 3OF5A 5CJPA 1MR3F 4Z1MA 3F5FA 1QHXA 3KJGA 1P9WA 1IBRA 1GKYA 4RD2A 4QNMA 1R2QA 3C4JA 2MSDB 1GZSA 2JLQA 2FE4A 1FZQA 1ZNZA 2XNDD 3B1YA 3SOPA 2NO6A 5KNDA 3MFYA 4ZKEA 4Q9JA 3LX5A 1HUQA 1XJCA 2WWFA 3L0SA 4ARZB 4F4JA 1YU9A 1I2DA 2H8KA 5KNBA 2YVUA 4EKDA 2F9MA 1MO4A 1KSFX 4C9BA 2WWYA 3KKNA 5FOSA 4ZCIA 4Q47A 1EX7A 2W83A 4MYUA 3L2OB 2GRJA 4M21A 3CO5A 2IS4A 4BZPA 3DZDA 3LW8A 4HATA 1N0VC 2Z0MA 3BRWD 1TX4B 3DDCA 4P4TA 1HE1C 2IX3A 3OE7D 4QM7A 4BZXA 1H8HA 4G5QA 3RNLA 2JA1A 1GVNB 1EK0A 3UMFA 4EUNA 2WMNB 4P33A 5LD2C 1P9NA 1QHHA 2OAQ1 1ZRHA 2VP9A 3D6TB 1EESA 3CNOA 3PEWA 2JCSA 4JVNA 2OFWA 5IT5A 4OI1A 2ZYTX 4M1WA 3CNLA 1YKSA 3AUXA 2GEDA 1GG2A 1JI0A 1UBFA 1BMFA 1MOZA 1N0UA 4I1OA 2QY9A 3WP1B 3PITA 1WRBA 1MH1A 2CDNA 3EZ7A 3SE0A 1ZNXA 4ESVA 2Q3HA 3T1QA 3LH5A 4I1VA 5FPHA 4B6FA 2JIZA 4OYHA 1R5NA 2CK3A 4QBFA 5FOTA 4Q21A 4FMDF 4LK2A 2O8EA 4LX0A 1VTKA 2W0MA 1E9RA 3TIFA 5FUWA 2GXSA 1TUEA 2VSXA 5L8VA 1CP2A 3EC2A 4QOSA 2JLZA 2ZAMA 1LF0A 2EU8A 2QMOA 2QA5A 3NC0C 4GL2A 5A0FA 1JAHA 1OHHA 2J0UB 2OFXA 1WBBA 2IEZA 2ZI6A 2J7KA 2ZTSA 2VTKA 3EW9A 4GSYA 1KMHB 3W90A 2BM1A 1L7VC 3PQCA 1Z8FA 3A36A 5FI1B 1NN1A 5HTKA 4A8JC 3KKQA 4LSGA 2FEMA 3NBXX 3NH9A 1NIJA 4AKHA 1ZUHA 4AWXA 4TSFA 3VKHA 3TMKA 3PR1A 4GZLA 2BBTA 3P27A 3EIQA 1CJTC 1ODFA 4II7A 3L43A 4Q66C 2NO9A 4N1AA 3M4YA 4X8MA 4WXRA 1S3SA 2O8EB 2UZ3A 2H1LA 5CDFE 5CITA 3GEHA 4LHZA 2X8AA 1HYQA 4A1FA 4MRVA 4URVR 2ZETA 1W0JD 1OPXA 2BMDA 5DIFA 2PT7A 2Z4RA 1NF3A 3CRVA 1S2MA 2OEPA 5FUVA 5LD2B 1XEFA 1SZPA 2D74A 4WZAE 3F3YA 3QKTA 3NHAA 1HTWA 5GVRA 2KBEA 2VSFA 1Z6AA 4RD6A 4Q02A 1DAEA 5DO9A 4XD7A 4PSVA 4W7SA 2IHBA 5DGXA 1ESNA 1CEEA 3B1XA 3CZQA 1JJVA 2GBLC 3SNHA 3ASZA 4UNNA 4DVGA 1EFCA 4RVCA 5DN6A 721PA 1VG0B 1G3RA 3EWAA 4BLRA 4DSNA 4H1UA 3I3SR 3QKSA 1R0YA 2QSZA 3TW4A 2ZYVX 2QQEA 5JECA 5JJLA 3DVLA 1Z63A 1CTQA 3QXJA 2ZUDA 2IK8A 3IEVA 3EC1A 3R7WB 1UPTA 1X1RA 2GILA 4NCIA 4EQ6B 1ZUNB 1GOTA 1Z2AA 4JL5A 1P73A 4A82A 2BEJA 3R9IA 3U44B 3QXCA 2MMGA 2DPXA 2O8DA 1DOAA 3OEHA 1CR2A 4N0EA 4EPXA 2ZM5A 2A7QA 2ZS7A 1YVDA 3QF7A 2IXGA 3IO5A 5JWOA 1ZC3A 3LW7A 4JSTA 4BFUA 1Z3IX 3K8YA 1JR3D 2P6NA 4IHQA 5K8TA 1BO6A 2W6ID 4BFVA 4AKEA 1QZXA 5F9HA 1N5IA 4QBHA 1ZU5A 1AZSC 1ZNYA 2ZRIA 3BGWA 3IQWA 5KDLA 4KVAA 4EFMA 1E1QA 2BDTA 4TMKA 5FOWA 1EFTA 1II8B 1W4AA 4DDVA 2ODNA 1KSGA 5FBWB 3ICEA 2AX4A 5DI9A 4LUCA 5BN5A 3GJ8A 4JKIA 3QXHA 4PC6A 4FWIB 2QMUA 3KB1A 4TMZA 3W5IA 4DC9A 2ZSEA 1OYWA 5EUMA 3MUFA 1AKEA 4HB4A 2NZJA 1SXJC 1P75A 1GRRA 1TU3A 1R6BX 1X86B 2B92A 4RFSB 4HAVA 2V1UA 1GKIA 1SVIA 3I1FA 1GL9B 1R5BA 1UEJA 3HWSA 3X1XA 3OIUA 3GJ6A 2C95A 4D4KA 2EWVA 821PA 1NMXA 3IKJA 2J0UA 1LB1B 4CEHA 2G77B 1XXHA 8OHMA 5EP3A 2OBMA 2DB3A 1PJRA 2IW3A 4Q7JB 1IXZA 3NH6A 1Q44A 1ZUIA 3JZMA 4YMVA 2O8CA 2CLDX 1R0ZA 4TYNA 3U6BA 1M7GA 1XRJA 1ZAKA 2WVJA 1NN5A 2DY1A 5DI3B 2HT1A 3KQKA 2XNDA 1PUIA 1U8AA 2C9OA 1Z29A 1E98A 1JQLB 2W00A 3THYA 5H1YA 3AEZA 1WQ1R 4FIDA 1E32A 5FH9A 4NP6A 3CNNA 2JJ1D 1IN4A 3ETLA 2DHRA 1K8RA 5JJKA 1YR6A 4BLOA 3K0FB 1D6JA 1PLJA 3IIMA 4LBWA 2V1XA 2V7QD 2IYZA 3EPLA 2DFNA 4Q4LA 4TQ9A 2J1LA 3FDIA 1UKYA 3AF4A 1CR0A 1TUIA 3JZAA 2OSBA 1IQPA 3QPWA 4H9GA 1H8HD 4RY2A 2BMFA 1QHHB 3WHLA 1XJQA 2FH5B 3QE0A 2VL7A 3OFND 2XITA 2G83A 3TLXA 1UKZA 4RD1A 3GLFA 4EPRA 3M0EA 2WBLC 3KXIA 4TL9A 4LYAA 3T1TA 4G5SA 2DR3A 1CXZA 2ECKA 2A5GA 1CULC 1JXOA 2ZI7A 4JSYA 4N3NA 2ZVQX 3LV8A 4BFZA 4RKEA 2YOHA 3U60B 3D7MA 4DT1B 1XCGB 5H8WA 2F1JA 3B7GA 4JZKA 4KCGA 1E2IA 4MRSA 1E2FA 1OB2A 4B2PA 1E3MA 2BWJA 1E2MA 5KSOA 1EWRA 5E3HA 1TQDA 4Q7LA 3SYNA 3DEFA 4CEJB 5JRJA 4BECA 1T5IA 2CEAA 4CVNA 1KNQA 4KV9A 3CIOA 1GL7A 2HF9A 3U7FB 1D9XA 2ASEA 1I2MA 5LDDC 3K70B 1N5LA 4X8HA 3FOZA 2B7BA 1L2TA 1XF9A 2XSZA 2GESA 1QVAA 1KDPA 4QBIA 1S4QA 2GJAA 5JBQA 4LBZA 5FUXA 1KI6A 1N3BA 2ONKA 1CU1A 1XD2A 3KQHA 3K9NA 5F9FA 3EZ2A 2HLDD 3FKSD 1GWNA 3RVBA 3KDSE 2XAUA 3VX3A 4XSHA 1PLLA 1G8GA 1PVOA 4KXFB 4NZYA 5C1BA 4D82A 5GJBA 4EAQA 3T34A 3EIHA 5FTNA 5LPNA 2P6RA 1W4RA 4JLPA 1G4AE 3QKSB 4JVSB 4ERNA 3K1JA 2J0QA 3BB1A 1GNQA 4KYUA 4AYTA 2Q0HA 5L3RA 2EFHB 4M9QA 3EX7C 2P5TB 4LPKA 5AUNB 3E2IA 4BASA 1XPRA 4IOLA 1KY3A 2ZJ2A 3EPKA 1U0LA 3QENA 2GZAA 2BCGY 3X2SA 3QF4A 2CL6X 2OCYC 1SGWA 3TSOA 2XJ9A 4CRWB 5GVSA 3N70A 3B5JA 1QDEA 2WAYA 4QGHA 4RZ2A 3KFVA 4X8OA 5L3QB 3I92A 4BGDA 2UZIR 4WIAA 1TEVA 4FMDB 4BRUA 1XEWY 2KJQA 4PQFA 3VR1A 5C4GB 3GJ4A 3L0OA 3FWYA 2BCJQ 1DE0A 4UXIA 4W5WA 4A4DA 3LFUA 4KSCA 5KPJA 3DM5A 1K6MA 1KNXA 4XD7D 4TMXA 4R9UC 1AGPA 1G291 2IUSA 2H16A 1WXQA 1YR7A 1SVOA 3SR0A 1DG3A 3KX2A 3Q5DA 4LDJA 1Z28A 4QKQA 4C0QC 521PA 4D4LA 1FTSA 1E2QA 3HP1A 4KI0A 1VDZA 1G7CA 4HDOB 1GP2A 2FMXA 2IYYA 2JLSA 5JHGB 3A1WA 2AKAB 2CVFA 3EPHA 4BQSA 4PPFA 2GXUA 2KBFA 3A4NA 5FOXA 1RRPA 5EP4A 4FD2A 2GXAA 1W5SA 1M1YE 4EJSA 3FPNB 4KFRA 3TQCA 1KTVA 3IIJA 3QOFA 4WZ6A 5A5GA 4WW0A 4P3YA 4TQUS 2ZUCA 4B71A 4M8NE 1DTSA 3OIWA 4PAQA 3KUCA 4RD4A 2YC2C 2HJGA 3WP0A 4AI6A 4OI0A 3VMAA 2GEVA 5IDVA 4GDFA 2CNWD 5G40A 1S9HA 4IDHA 3CRW1 3UXMA 5K8IA 3KJHA 3CF0A 4NCHA 3GCGA 4Q5IA 5JHHB 4LJAA 2XZOA 1RZ3A 1KZGB 4WBSA 2VP6A 1JAIA 4O3MA 2V3CC 2PLFA 1CR1A 2B8WA 4JL8A 2WKPA 2CCJA 2E87A 5EE1A 3J81k 4DCSA 2FSIA 2GVDC 1ZW6A 5EXXA 3AVXA 3MG9A 4EPYA 2QG6A 2ZR9A 1KAGA 1QF9A 2KSQA 1LS6A 4JLDA 3W3ZB 1KI9A 1W4CA 2RGCA 3RWOA 1P2UA 2P0EA 3LWNA 5C46F 3U44A 2DBYA 1P6XA 2GZHA 3ZQ6A 4EPVA 2VHCA 2WJIA 5A4JA 2D06A 2B6HA 1R7RA 2IS6A 4MQBA 4A8JA 3GP8A 2O8FA 1Z0FA 4NE2A 4G01B 5JSZB 1YZQA 1Z0DA 4JLBA 4ZDWA 3K0CC 1AS0A 4I1UA 3DO6A 4LV6A 3NEYA 5EE0A 3UG6A 2D4HA 3ZH9B 1SXJD 2ZR7A 4HYYA 1G5TA 1Q22A 4IXMA 4IOJA 1GKUB 4GPTA 4M1OA 3NBZC 4PPGA 3LVQE 1NG1A 3O47A 4K8OA 3TKLA 1G21E 2RGNC 3IPXA 3V00A 1MRNA 2ERYA 2NIPA 1GDDA 1G3UA 2ZE5A 2O0HA 2V7QA 3B6EA 3Q9LA 5HKKA 2CL0X 3MRSA 1N25A 1ZD9A 1EWQA 1ZC4A 3GPLA 3AH8A 1WCV1 1RW4A 3OFNA 4Q1FA 5CYPA 4QM6A 5DLQC 3SBEA 3RRZA 4D25A 4M1YA 2P3SA 5KTYA 2OAP1 4G5OA 2QT1A 3AVQA 2XB2A 5TVKA 4RCZA 1D5CA 1T4GA 5E7IA 5TY0A 1OFUX 4DT1A 2CJWA 5FPYA 4WZBE 1KKLA 1N6RA 2RGNA 3QG1A 3VKWA 1DVRA 4M22A 2OFOA 5DH9A 2YJTD 4NMMA 2FFHA 2GA8A 3FMPB 2ZROA 4L5BA 1OFHA 4A6PA 3CLVA 4HZIA 4WAUA 4C3ZA 4C0JA 1P2SA 4LJ9A 3SHFA 5DHFA 3MLEA 2BMEA 2X2EA 3FGNA 3OESA 1A4RA 2XB4A 2I4IA 2N42A 3CR7A 3LA6A 3LBNA 4TYPA 1Z08A 4POAA 1QHSA 4ZIRA 3PG5A 2JLWA 1P7CA 2FSHA 4OI4A 4D80A 2PCLA 2MSCB 2QENA 4EPWA 3F0TA 3CRQA 3TVDA 2OM2A 1KI2A 2A3RA 2PJRA 1NVVR 3KKOA 5JI3E 3DPUA 4HLUC 4AYWA 1OYYA 4Q1EA 5JLJA 3HJHA 1PLKA 2C2HA 1M7BA 3L8ZA 5K8LA 2E1RA 1U98A 2PCJA 1KZ7B 3BD9A 1XTIA 4E5UA 2Q21A 1W4BA 4M9XA 4MKFA 5BYJA 4L9WA 2B21A 2B7CA 1OXXK 5KDOA 3H2YA 1U90A 2OXRA 4GMXA 3DKPA 3SC3A 1I4TD 2R44A 1VG1A 2CVHA 1OJLA 1XBTA 2VYFA 2ZRDA 3AF0A 3CF6R 4DHEA 4DKXA 3KQLA 4L15A 3IBGA 3ZD6A 1AK2A 1IJFA 1A2BA 2VEDA 1ZYUA 1Z83A 1BOFA 3PEUA 5J4YA 3K9GA 2QZ4A 2QEQA 2QE7A 1PZNA 4D0NA 3RS5A 4M0LA 2AR7A 4YLGA 3EASA 5AUPB 2IYTA 2J41A 2W6JA 2HT6A 5JWRA 1HT2E 1RYHA 2RGBA 4Q03A 2QM8A 5GADl 3CW2A 2QN6A 1WDTA 5HE9A 4AK9A 3LQRA 4PHFA 2RHDA 1E9DA 3SJAA 2R6GA 2WZQA 1E2JA 2F43B 2NMVA 4TMTA 3E70C 1G17A 3TUIC 4KU4A 1X3SA 2X77A 1NIPA 1GNRA 2ZE6A 4LOAA 4TWZA 4YDHB 3K0CA 3ZIAA 2ATVA 4MKHA 4PX9A 1RIFA 3NG1A 4LHWA 5J4HA 3GJ7A 1E4VA 3AP3A 4NCKA 4V0LA 1GUAA 4NCJA 4FN5A 5EP2A 4B73A 2CCGA 3O8RA 2HCBA 4B6EA 3CPEA 2IBMA 1C1YA 2FWRA 4NTZA 1B0UA 3GLFE 4Q4JA 2QTVB 3EZ6A 3UK6A 2A9KA 1GRNA 3K09A 3OEEA 3GJ0A 4G3XA 1E2PA 1JPJA 3U3MA 3KJEA 2EFEB 2R6DA 5D3MA 1Z0KA 4TLEA 2QTFA 1BIFA 5EXTA 2PBRA 2IUTA 4AY2A 1KY2A 1E79A 3GLHB 2ZRLA 1JJ7A 4JKYA 4EQ6A 5FL7D 3AM1A 1ZJ6A 1SXJB 1WE2A 3HU2A 1NKTA 4MH0R 1R0XA 2FFQA 2YV5A 4KLNA 2W2TA 1OXVA 2N1BA 3LAWA 4C7OA 4OHYA 1E9EA 4RKFA 4A8JB 2IF0A 3BWDD 5TMPA 2REOA 1NG9A 1E2EA 3BH0A 4Q4AB 3KB2A 2F7SA 4DZZA 1Z07A 2AFIE 3K53A 5M04A 4PHGA 3SHWA 3AP2A 2A30A 4JMPA 4TMVA 2ZSFA 3MAAC 4ZDIA 1YZKA 3CM0A 2NQ2C 4F91B 2ODWA 2JASA 3T1OA 2WWXA 1CRPA 1M8PA 2OZEA 1VCNA 2GVZC 4TL8A 6Q21A 1ESMA 2AFHE 4RFSA 3SS8A 1ZCBA 2ZJ5A 4PXAA 2JJ2D 4A2WA 4IDQA 2H57A 2P65A 3FYHA 5JS8A 1P2VA 1DADA 1HE8B 2HEIA 4GFDA 2GBLA 5C18A 2C03A 1XTJA 4DCTA 4XTRA 1J8MF 4A6XA 3W6OA 3IILA 4LRWA 4K46A 5KYKA 5CB6A 4UNPA 4XTCS 2BJWA 3R8FA 3T15A 1ZCAA 2GZDA 4G1UC 4YMSA 4QGGA 2YOFA 1II9A 3IHWA 1W47A 4LWZA 1S9DA 4MA4A 2XZLA 1W1WA 2R2AA 1G7RA 3AVTA 3T1VA 5CIWA 2CHGA 1C9KA 4Z8YA 1COWD 1ZIPA 2IA5A 1AZTA 1BYIA 2ZJ8A 1R4AA 4AIIA 2ZU6A 3AUYA 5SZIA 1AIPA 1X8JA 2IYVA 3KXLA 1XMIA 2RMKA 5FBVB 1L8QA 3QBTA 2J0SA 4B3BA 3MSXA 4BRWA 4QC2A 1W2HA 4K81B 2GEUA 1OV4A 3CKLA 2C77A 2P5SA 1XTQA 3GD7A 1BKDR 2F6RA 3CR8A 1ZMXA 2F3RA 4MITA 3RAPR 2OBLA 2VHTA 2NO1A 4DJTA 2VF8A 4C7OB 1Z0JA 2P6UA 4L4UA 1IY0A 3A37A 4M4SA 2X2FA 1XEXB 5BYKA 3EARA 1E9BA 3KJIA 1AKYA 1JBKA 1TF7A 2AXNA 2QL6A 1H65A 1U99A 1TAGA 4OHXA 3B1VA 2OV2A 2WWWA 3K9LA 1N6OA 2WOJA 4BPBA 4YMUA 2HV8A 3CX7A 2ZU0C 4JVLA 1NSTA 3RDPA 5E7JA 4DEXA 5BN4A 4PFSA 1ZD8A 3MJRA 1N0WA 3RABA 1KMQA 2WV9A 4Q4JB 3S1AA 1GM5A 3RS0A 4U7DA 5IK2D 4PTLA 2B8TA 1J7KA 2OG2A 4XOIA 4LYFA 1R10A 1NBME 3L8YA 4DB2A 2WHXA 4D4MA 1F2UB 3CF2A 1J99A 4LJ7A 2J3EA 4JLNA 3ADDA 4LI0A 4DDTA 2VO1A 4FXPA 3KTAB 4R7ZA 4NONA 4US0R 1Q1QA 3VAAA 2ZQ5A 1W48A 2NPIA 3NBFA 4EFLA 4N0DA 1GRQA 1YZTA 1UBEA 1DEKA 3X1DA 4AYXA 3VU9B 1E0SA 3GJ3A 3EZ9A 3BC1A 3LRPA 1OFTA 3MMPA 3PUXA 4RJLA 1DARA 1L4YA 2J9RA 3EA5A 3U61B 4F93B 4HAUA 3BE4A 5LB2A 2Q9AA 4NKRA 1G3IA 3V9PA 3WRYC 2C78A 3I5YA 3GLIE 2QP9X 2JDIA 4HDCA 4YQFA 4IFEA 5SZKB 2ZRNA 4QJ3A 4YXWD 3BS4A 1VCOA 4F4IA 4JYCA 1NBMD 2PZFA 3CPHA 2BKEA 4P0TA 4Y0AA 5J4VA 1LTQA 3A1UA 4TYQA 4DLVA 4PQRA 3FWLA 3B9QA 1P2TA 3K0EA 1CIPA 4KO8A 4NYMR 3U7HB 3SQXA 2QE7D 1E2DA 3SFZA 1YZNA 4NDZA 1FTNA 1HEIA 2GF0A 2R8RA 3ZZUA 2ZS8A 4XIGS 2JAQA 2WJVA 2C98A 4RZUA 1KGDA 5FBRB 4NHOA 4WOPA 3BORA 4MGZR 1X1SA 2QAGC 4DSTA 4JLVA 2DFKB 2QUZA 2FFBA 4QNRA 4UNRA 3RWMB 1KI3A 5JI2E 3PXGA 3T12A 4D4JA 3VNUA 5DYGA 3TNFA 1J70A 4IXNA 4KITB 5FFMA 3IIKA 1KMHA 4DIEA 2NGRA 2ZI3A 5J4LA 3PUVA 3JVVA 2EFDB 4A0HA 3BFVA 4OJQA 4US1R 1UADA 1XTRA 2W2VA 4LHVA 4WVFA 4D0GA 1LFDB 2K5UA 3AVVA 4DLUA 1G16A 4RZ3A 2RGXA 1IM2A 1T6NA 2RAPA 3ECCA 4Q1AA 1T3HA 3TSZA 4ZPXA 1XEWX 2IYRA 1E94E 2ZRCA 3SU8A 5HZKA 1T9HA 2HDNB 2V9PA 3MWKA 1U9IA 1VG9B 2XZPA 3OAAD 3Q7PA 3B60A 4R2HA 1VPLA 4URXR 3A8TA 2CJWB 1KDOA 2CLCX 3C7KA 1GITA 4RCYA 2CL7X 4KBFA 1NSFA 3G82C 5KDDA 1S96A 1EX6A 2BEKA 1XFAA 3JVUA 4L8GA 4UQOA 3I62A 2ZRJA 2JLXA 3LVRE 5FR2A 3ADCA 2QORA 2ZI4A 3QVUA 2P2LA 1XP8A 3PIRA 4PZZA 1HT1E 4DLTA 1VHLA 1SVKA 1CBUA 1OB5A 1UFQA 1FX0B 2IC5A 4KAXA 2XTMA 2PEZA 3BXZA 3WYAA 1NY6A 1DG1G 3BOSA 4DWJA 2GETA 3HPQA 1F2TA 2FJUA 4A15A 3L82B 2XOKA 1V5WA 3B82A 2MMCA 3KFXA 2QAGB 3PEYA 1OKKD 3LLUA 3FHTA 5DSZA 3CH5A 3THXA 2R6CA 1Q1BA 3MWLA 2J59A 2ORWA 1QHGA 3GFPA 3HU1A 3EG5A 3H4MA 1DAGA 2QGZA 4DLSA 3DMNA 3CRRA 1KK2A
chains in the Genus database with same CATH superfamily
1NKVA 5JY1A 1YTUA 2AZXA 1OIXA 3RFCA 3UMRA 1R3UA 4KN9S 3HUTA 1YKGA 4GH5A 2GAAA 2WU0A 4H35A 1E9FA 2HK7A 3DLIA 1ORVA 3RRMA 3RRNA 4DAOA 3I2IA 4LJ4A 4LYYA 5I8ZA 1UXOA 1IM8A 3L02A 4ID3A 4GC9A 4J7UA 1KH3A 1ZI6A 2XE7A 1Y1RA 4DABA 2REXB 4IVQA 4OQXA 3I2HA 1G38A 2C20A 4X1KB 2W2LA 3FZYA 3L7MA 4JL6A 4MRPA 4RCVA 4TTAA 3V8MA 4HWTA 5KTPA 1QU3A 4GX5A 4X63A 2OLKA 2VBCA 1GUDA 2Q2OA 2ZRFA 1XO1A 2ZLBA 4O1HA 3H6HA 4LKRA 1YFZA 2DWUA 2V5UA 4NL4H 5JAZA 3M2PA 1CPYA 4CYMA 4ZOCA 4E31A 2JLVA 2GPJA 3LXMA 4DG5A 5G0UA 1LY1A 2DRIA 3IDSA 1BE6A 4ZV4A 1EUDA 3F5QA 3FMIA 3P2OA 3M2TA 4B3TB 4QUEA 4EUKA 1VP9A 4GPZA 4EJ2A 3IOMA 3DG9A 4L8FA 3RS3A 2VXYA 5ALQA 2I3GA 2MYUA 3QNMA 1Z5PA 2PXXA 2A9VA 2PKWA 2QROA 1T5LA 3H7IA 4WSOA 1RXEA 2QN8A 3GCDA 3WWCA 5SZJA 4BKQA 1EFUA 2GNOA 3LCCA 4OL0A 4PYLA 4N3CA 4GW3A 1DIHA 1MV8A 4KW7A 3AZOA 4MK4A 1JXAA 1GQ2A 2WF8A 3S28A 1HFJA 2L17A 1EDOA 1FP1D 1I3KA 2IU4A 5HDQA 4XXHA 3CLTD 1G1AA 1T8PA 2NV0A 5HP4A 1G3MA 3HFRA 4G8CA 4R5MA 1EG7A 4UDOA 1YBHA 3HTXA 4YGXB 1LJLA 3GLFB 2AV6A 3ZE9A 3ZUGA 1HOXA 2BDEA 1G8KA 3DL7A 1XA3A 2GPWA 3LQQA 5BQ5A 1IATA 2VQEB 1Z33A 5JS7A 1EA5A 1ENZA 1EB8A 4NARA 4J0DA 3HDYA 4MQFB 1NLZA 1T2AA 3FWNA 1SRRA 3U9TA 3Q9UA 3PYXA 4BQQA 2CB9A 4FXOA 1CLEA 2AR0A 3ROZA 1UFOA 1M6HA 1YT5A 1AGXA 2RI0A 4HI0E 5EG5A 4X1IB 3VZPA 4RHFA 4C43A 4WBNB 1L3CA 5IM4A 3ILVA 3PK0A 1WHTA 4ALJA 5EJ7A 1XVVA 2OV1A 3CT6A 4QUIA 3QQ5A 2V03A 1TCCA 1DQYA 1AHHA 2ZJ3A 5CD9A 1CDEA 2BFEB 4X64B 1M9NA 1U8XX 2HWKA 2HIMA 3H86A 4QU0A 1V41E 2F1RA 2PGLA 1XQXA 4HX9A 4L4RA 3QJYA 3E61A 3ZDEA 2J87A 3U4CA 5EY5B 1NHGA 2IELA 3I4FA 5DISB 4BGIA 3HXLA 4DNFA 3H8WA 4MDFA 1A1VA 4CM3A 3T9AA 2XUQA 1Z5OA 3TEJA 2O1SA 4B17A 4B7XA 5AP9A 2CXXA 5FV7A 2AZDA 2OTCA 2AOUA 3HKDB 1MT0A 3N5KA 3KKLA 4M9SA 1E3EA 1WPGA 2DTEA 3KT8A 4KRXA 4TS1A 5I9IA 1RLJA 4G0QA 4CN8A 4UEQA 3AC0A 4A92A 1M6VB 2NN3C 2YJ6A 1C3LA 4F7WA 4G1FA 2PTHA 3I34X 4QXPA 3U7JA 3NYQA 1E3IA 1Z17A 2JK1A 3D8UA 1CQWA 3THOA 3HB0A 1NLFA 2WYHA 3KTOA 2I0FA 1EB9A 5TDHA 4Q4DA 4HUTA 4BWYA 2FRVA 2WY2D 4IJKA 2IUFA 4KQGA 4J07A 4N6NA 4WV3A 1EE1A 2NYAA 2VJDA 5CYOA 5GONF 3T3HA 4ZCTA 4BGUA 4MKGA 4ZAGA 3HBMA 3QP9A 4ZZ2A 2AXPA 3ROGA 4R71A 3IX7A 2ACWA 4FP9A 3TAXA 2VAVA 2JFUA 4Z9AA 1G8HA 4RDXA 1SBZA 2BFWA 4FMCF 5L45A 1IY1A 1P60A 2IYLD 5IF9A 4U7TB 4IUBS 4MIYA 4Z7JA 3A1TA 5KYTA 4UU7A 5BQ3A 5KVVA 4GLLA 2R8ZA 3AI7A 3DOHA 5BOSB 1LV8A 4FWTA 2R6FA 1OHHD 2PA3A 3GYBA 3PQEA 1JFFB 5CM9C 1E63A 3N28A 2OWEA 1P39A 1H05A 4NDNE 2GS9A 2JRLA 1K8XB 5JSKA 2O57A 3BIFA 3MMZA 3W5AA 3OH8A 1YI8A 1RRMA 3DCIA 3BH7A 1ZGBA 4GNKA 4QASA 4Q34A 3RYFA 3GNQA 1JPUA 4MI9A 2IF2A 1RM4A 4PF1A 1QIJA 2LWIA 3A3NA 3QGMA 1BS2A 4FNAA 1EI9A 3UMSA 1UBRS 3V1MA 3WQHA 3AKEA 1D0IA 5B3KA 2PZBA 2DQ4A 1GQQA 2PT6A 5JFTA 4DSUA 1YS2X 1EK2A 4ARVA 5KC8A 1YI0A 5EQFA 4MYDA 1BMDA 4KNVA 3HLKA 1L4UA 4GPEA 2E1PA 1PR6A 5A05A 1ORTA 2CXNA 2ZJ4A 1U0NA 1CF9A 1ONNA 2B0JA 1H2AS 3RTDA 4Q9DA 5I4IA 4IG9A 3KQSA 2YXBA 5KYXB 2FLKA 5JNVA 1E5VA 3O8QB 1LQUA 4GBMA 4IIDA 4UMVA 3VKFA 4BEJA 1ENYA 2NWQA 1GZ6A 1JB1A 2GTPA 4ZVLA 4PU0A 3WBJA 1B41A 3FWZA 3DVQX 1BRMA 3KYDB 3O5AA 5AJVB 3TVTA 5I3ZA 1EWTA 1JGTA 4ZEWA 1Z38A 4J16A 2W8BB 4DBLC 3PP8A 4Q1BA 3DWGA 4DLAA 4P31A 3SQNA 5CFQA 3SSMA 3S8MA 3DXZA 2XVMA 4A1OA 1FUUA 4KQWA 3C3EA 5EYPB 2AEEA 3F46A 3RRXA 3S1AB 3HRHA 5BWNA 2OVFA 5AM0A 5EHZA 1DX6A 1HDGO 4XX0B 5BN4B 1EXNA 1UDAA 2SNIE 3UJ8A 4ALKA 4CW7A 2WM9B 5CDFA 2XEXA 4BN0A 1ZUD1 4TN5A 3ZWNA 5KYYB 5FO0A 1RQPA 2VJCA 4NC9A 5FWYA 2JIPA 3WMGA 3FVTA 1VA5A 1G42A 2ZT7A 3M6AA 1G6KA 3F8TA 1JPVA 4EA7A 5L3SA 2Z8XA 2PKCA 1QVRA 1GTRA 1PBTA 4KXUA 5K2OA 4XA8A 2JJQA 3UJPA 4BV9A 3L7NA 4I46A 3F3KA 2M6RA 5SY6A 1RHRA 5J58A 3I2KA 2CC2A 3L6CA 5JG7A 5SZHB 1P5RA 1EFVB 1VC2A 3MXOA 2I29A 3PWZA 4PYJA 1QIEA 4M0DA 5HGXA 4ZT7A 3RRYA 3W05A 4JLAA 2NO5A 1RVV1 4J0QA 4UPEA 2V9CA 4RXTA 1JHYA 1Z2NX 3MCWA 5TR9A 2Z4SA 3ZDCA 3W3AH 3QV1A 4BX8A 1UKVY 2WWGA 2XUZA 1CUGA 1CQJB 5D1NA 3U49A 2XHEA 4B35A 3P0JA 1MPTA 2JL1A 2ZJYA 3GLGA 5H3CA 4KKVA 2Q41A 4JS0A 3RQSA 5D01A 4BNXA 1LC0A 1YZVA 5C53B 4E2WA 2EGUA 2XZDA 1L5YA 1R8XA 2BEWA 1YFJA 5DMHA 1U0BB 5CDTA 1ZI9A 2F1HA 4MYHA 1E96A 9GPBA 5DBHX 1FYVA 4Q6BA 4I4CA 3H13A 1P81A 3ZLJA 1Z06A 4MLDA 2FPGB 3I1IA 1X19A 4CLEA 3NDBB 3D6HA 4C20A 2X5XA 5D6OA 1B8OA 5DEIA 5M5BA 2BGRA 4REQB 1RQRA 2FPRA 3F3SA 3BCHA 3VPHA 3JQGB 4XI9A 2PMDA 1U3TA 3WYGA 3EUAA 1S02A 4A0RA 4QG3A 3MM4A 2O0MA 4DQXA 1EUDB 3RVKA 1J20A 3ZWOA 3SQMA 3CUWA 3OE4A 3RV3A 1V4VA 4GZMA 4HLUA 1Y48E 4XQEA 3PQFA 3WGMA 4M86A 3E5HA 2ZRKA 2FXVA 4Q19A 2V6BA 4CBVA 4E7PA 1JE0A 1PV1A 3BT7A 1OH6A 4KR6A 3D3WB 4LYEA 1TF5A 4WXPA 4BDSA 3LY7A 4MXDA 4GYJA 3B8HA 4JT4A 4CTKA 4EHJA 5JAPA 4JR1A 5T8KC 3ZWQA 1W7AA 4C5CA 5IT4A 2WM3A 3AVOA 3EGDA 1NRIA 4EELA 4I4TF 1FLAA 1UMKA 2ZAOA 2ZANA 3WY9A 1I10A 4ZYLA 5K0JA 3I04A 1H4VB 2AYYA 2JJ1A 2HBYA 3PHIA 3PPWA 2A0FA 4H18A 4LV8B 4OOEA 3GAMA 5IBQA 2O8FB 4AG5A 1THGA 3RFUA 4PV7A 3NEJA 5IH3A 2ZT8A 3NVDA 1KEKA 4XVHA 2FPLA 2CHVA 3KEOA 4BS9A 4JJ8A 4YRBA 4V0SA 2JI8A 1R18A 1BFDA 1G7SA 4R51A 3M34A 4BTEA 3PL1A 2FN9A 2RFLA 1A5AB 1UXKA 4XVRA 2J3QA 2W6MA 3EEYA 4GPAA 4WH0A 2DF8A 3HCEA 3QWAA 3FPFA 2QI9F 4XUDA 4IEEA 4MLZA 3KD2A 4CZ2A 2C88A 2GR9A 5LP6F 1HSOA 1OV6A 1K5GA 1N3IA 5CYFA 1UINA 3KVVA 5K0ZA 1PR4A 1GTMA 1R5OA 1ZGHA 4LGMA 3VI4B 2GYUA 1O5TA 3NYRA 4HAOA 1A5ZA 1IN8A 2HEGA 4GKJB 3UKOA 4GOKA 2C7BA 1DO2A 1KAMA 4B3MB 2QZZA 4RD0A 4UTXA 1JVNA 3WL3A 2P9JA 5IYZB 3H2BA 4LDRA 4GBED 5CCXA 3BIJA 1NLYA 1SM4A 1TZJA 2HRQA 3IXMA 4KRGA 1K9VF 1R8SA 3RUCA 1US8A 1L8AA 2OAGA 1H2BA 1XAHA 3C4VA 5EFZA 3EC7A 3ZVRA 4AZTA 4ZK2A 4PX5A 1GA6A 1CZRA 2UYGA 3QKRA 3X1WA 2KW5A 3A6LA 4FK8A 1XPUA 2VG8A 4HVAA 3OU2A 4NCNA 1Y7IA 4MWZA 5KYYA 3Q4GA 2QXUA 3MHPA 4RKYA 1QFXA 4M1SA 1XCJA 1Z4OA 2WSMA 5FWXA 1Q2XA 4L8WB 4EYGA 1UP4A 1HY3A 4FGLA 2CHFA 4CQLB 3IA2A 4W8OA 1ZNWA 5DLEA 3G7UA 3LYAA 5FUBA 2EDCA 3FY4A 1DEHA 1VKNA 4EGFA 1JQDA 1H8EA 2CDAA 1J8YF 3CV3A 3FCEA 4KLZA 1JXQA 1N2OA 4QBGB 2HW8A 4NXMB 1EX9A 2GFQA 3EVBA 4KAAA 1NVWQ 2PX4A 3G89A 1F8FA 2IT1A 1YRLA 2VDMB 4FZ3A 3JS5A 1PVVA 3PVZA 2VPXA 4N4AA 2C1ZA 2PZAA 3NC1C 5IMBA 3STVA 1C9MA 4KO3S 1G98A 1U9IC 2FFRA 3MWJA 1ES9A 3R9XB 4M1QA 3V1YA 4CQLA 3IVGA 1BJRE 1M73E 5AIAA 4XM0A 2O07A 3BWXA 4L0QA 2VHVA 3KKPA 1L1FA 5JS6A 4W5TA 2PUVA 3KKKA 5HJ7A 3IMKA 4FINA 1BCSB 4J7XA 4KFTA 1X7HA 4IP0A 5HBRA 1GLVA 4A0QA 1FVHA 1O58A 4DMMA 4Y7CA 3TOVA 1VPDA 4F46A 2JAOA 4MAMA 5HF5A 4BFYA 2QN3A 4P3XA 1KZ4A 1KAEA 4EHAA 3I9LA 3KOMA 2DWPA 3LP8A 4KSYA 1N6NA 4DM4A 1IZ7A 3EEOA 1FMJA 1XG5A 2A2ZA 4BMXA 4A7PA 1W0KD 5IBRA 1SVLA 5JQGF 2J46A 3SF8A 3NDRA 3TR5A 1G19A 4OGWA 4R9RA 5I01A 4Z8XA 1YBFA 4I50B 2OYCA 3SOZA 1IZZA 4CEIB 2XYGA 1KEWA 1J9ZA 3CNHA 3TDMA 2J6HA 3TJZA 1C1XA 3LHKA 1NN3A 3IUJA 2B34A 4XGQA 4P4UA 4JUBA 1FSGA 3GGPA 4P4LA 3C97A 4EDHA 2I62A 1NJFA 2GLUA 2DR2A 3T8YA 1OLUA 2W8ZA 1IPFA 1U31A 1P80A 2GQ0A 2H48A 3DVSX 4L5IA 5AW1A 1VLMA 2GCPA 2FOIA 4M1MA 2K7FA 4BNMA 1EVKA 1SIUA 4QULA 2ZBRA 3VYVA 2OA0A 3NMUF 4JUAA 3VOAA 2KPOA 2H2DA 1JIKA 1XMPA 3L8DA 5E1DA 1ECCA 1H6CA 1IXYA 3OICA 2Q3DA 4I1PA 1J90A 4U2GA 1GUYA 1C30A 3IXQA 5AFSA 2OWDA 4OP1A 1KHHA 3Q7EA 3SMQA 4YK7A 3UPTA 3C87A 1XZBA 2RHHA 3M6FA 5DXFA 3EJWA 2WE7A 5IEBA 4C4YA 3QFFA 4UQLA 1FU4A 3UATA 2SHKA 3BRCA 3V8QA 3CFYA 4YRFA 2OV3A 1KDRA 1VKRA 4Z3OA 1WMFA 1RBQA 5FL3A 3BG5A 4D9HA 3FNFA 5EEHA 1T3SA 2CWDA 3PEVA 1FX0A 1HURA 3GQVA 5BORA 5LZ4A 1XSEA 3H87A 3L40A 2YWRA 1M72A 2G63A 4Y6OA 1S6YA 3ZQKA 1QAOA 1R8JA 2A1TR 3ASYA 4DRXA 4R1NA 1CWUA 1E77A 1KZ1A 5KC9A 2AOXA 2UKDA 2GNAA 2PKEA 5TGZA 4PGFA 4RADA 4ZVPA 2Q9CA 5AK4A 4TLBA 1E2LA 3H9GA 3QH4A 2NZWA 4RTOA 4U39A 3B78A 1OGYA 3HV0A 1JZSA 1QQ6A 1SCKA 3L92A 4GICA 1II0A 4YJKA 1P9RA 5H4HA 3V9AA 2FX2A 4AXXA 4W1RA 3OKCA 2HHHB 3RK1A 2RC6A 3ST7A 1RHMA 3CWQA 4DA6A 5JCPA 4HFNA 3L4SO 4B4UA 1PGPA 1XX6A 1D7AA 1QH8B 2AD5A 2QRNA 3GEEA 3PQ6A 4L57A 5HOQA 2J9XB 3QUSA 2WKQA 1SUBA 2GF9A 5KNCD 2OHJA 5IBCA 4YP0A 4FDLA 5CNIA 4Y9RA 3WHKA 3BSSA 9ABPA 1Q57A 4E5VA 3DTVD 3FBTA 3PFKA 2G72A 4FQ7A 1AS2A 1Z7GA 3DBLB 5T4BA 4ENQA 4WXEA 3NETA 1BDJA 2BFCB 3IHLA 3H8SA 1G21B 4HFRA 4TTRA 5E6UA 1DT5A 5D3QA 4DVJA 4A26A 1N2BA 1U4NA 4EJSC 4JBXA 3F4LA 3PNYA 3P9PA 3D7NA 2H52A 3G1WA 3QTLA 4K8RB 5EE9A 1DCMA 2OZLB 2HN9A 3OZUA 1B1CA 3NTXA 1U6IA 2VNKA 5L4LA 4GZ6A 5DHQA 2ZPTX 4UEWA 2OD7A 1G6HA 4OQNA 4X6LA 3MEQA 4D26A 4RYLA 4H6VA 4NYIR 2HH9A 2PX0A 4HXEB 4MR8A 5JYEA 2ZGVA 3BSWA 1L5ZA 4M1KA 2XE8A 4Y67A 3QKRB 4F2WA 4CIWA 3CIFA 2WUEA 1NMEA 4JJKA 4E88A 1I2BA 3AHDA 1R9JA 3KQPA 5EVCA 3VSBA 2WJHA 3ZWYA 4CI9A 1Z6ZA 3ZS8A 4B2YA 2HLHA 1SHJA 4IEIA 1B1AA 4HV4A 2IP2A 4A8PA 1NPYA 3FPHA 2PZGA 3GRYA 5IJ0B 1QORA 4ZO9A 5JJBA 2YJZA 3QWHA 2NSYA 2Z30A 1VIAA 1FS6A 3VH2A 3Q12A 1OTXA 1ZA2A 2XGOA 5HZHA 4LWQA 3DXYA 4PS0A 5SYAA 5DCYA 4W9NA 3KYDA 3BXFA 4LIPD 2XMBA 4INZA 4QGFA 4MWDA 3NHYA 2BW0A 1XF1A 3P4YA 5B37A 1FUIA 3H9QA 5T3YA 2DFTA 1ZEMA 4Y6LA 2ZPUA 3SKYA 4BLPA 2VFAA 3LQYA 5E8RA 1QE3A 1XZAA 4QA9A 1PTJA 2FJ0A 3GA7A 4E4RA 6NULA 1BROA 1HORA 3FHOA 3C8UA 5EC8A 1FFAA 2EZ4A 2OXCA 3MWYW 2NG1A 2PR2A 5A9SB 1PG2A 1XTKA 4LF4B 1IJKA 3LCUA 1D8TA 4GC5A 2QN9A 3BAZA 2V4ZA 3UWMA 1SHZA 4NULA 1GV1A 3GLTA 1M2WA 5GONA 2AGVA 2ZJOA 2UUPA 3H97A 2EXXA 5E6RA 2WDZA 4IKOA 2AF4C 5E2BA 2X8LA 1S0UA 2Z98A 3BMOA 4U02A 4EQZA 5AKLA 4PG6A 2XF2A 4BMPB 1GTVA 2GK3A 1YS1X 3LQFA 2XNHA 3PLRA 4G6ZA 4BJ6A 2OECA 3D6VA 621PA 3ICVA 2MSEB 3D5QA 1D07A 1MG0A 1D2MA 2AK3A 1DAMA 3S2ZA 1Y5NA 2HHLA 4GR4A 3A3OA 5EIOA 5DCUA 4BNNA 2OUIA 3GFRA 3RASA 4G8BA 4TLMB 1U0FA 3SXUB 5BSHA 1L5FA 5MN5A 1NJ5A 3EF0A 4MQEA 3HI4A 4P5PA 1MV5A 1S3GA 4Y98A 5ENZA 1CY2A 4DF3A 4N03A 5DHPA 3WNDA 5K3FB 4Z4GA 1VMDA 2UV8A 1VIDA 5JROA 1TU4A 4QJ5A 3B48A 3QZUA 2PA0A 4KMRA 4C2UA 4FFBA 1C8VB 5B1IA 5AVQA 1Q21A 2QS9A 2V7XA 4N5HX 5EJ8A 3GMIA 3GFOA 4MYSA 5EMHA 3LXRA 2OV8A 2FMKA 3A58B 1H66A 3GJXC 1QCDA 5JBNA 5D7NA 1TM4E 1X74A 3DUFB 4IINA 1JR3E 4EATA 2GTIA 3COJA 1XCMA 2VTVA 2OMEA 3KZ1E 4MVJI 1VKOA 4D9FA 5ADVA 1JDSA 2G6BA 3O8BA 1RHKA 4OHKA 1YV9A 3VPAA 4GPIB 4UFPA 4HDSA 2Q2WA 2Y77A 1RJDA 1U2TA 3GFFA 3GA5A 1UBNA 1UXGA 2BKVA 1PJLA 3LVBA 3JQGA 4TSKA 3VMFA 1JKJB 3A14A 1BQ4A 3CEJA 1VMKA 1ZM3A 4E03A 1F4VA 4I36A 2REBA 2WJGA 4I9HA 1LI4A 4PGMA 3LS2A 5DOZA 2NTYC 3OX4A 4LGCA 2R0QC 2J3HA 4C2TA 3N0VA 1G5FA 1PUJA 3BMCA 3F2VA 3IERA 1NVVQ 3JARB 5AJHA 3ZV4A 1JAXA 4AUNA 1RYBA 3E7FA 3W5UA 2WILA 5FA6A 1OCEA 3WFJA 2WD8A 1OVGA 1RYZA 2I1QA 3R20A 5B6JA 1T4CB 4U1RA 4V1CB 4EO9A 1HQCA 4ZAYA 2AN9A 3DMTA 3DZCA 2OXFA 3WGQA 2FGKA 3QU9A 2QLMA 3Q85A 1YMVA 1ANKA 4PQGA 4ZRNA 1AGRA 1AQLA 4W5RA 4YP5A 5CM2Z 4BFLA 1CUWA 1KYWA 5EE5B 3WMXA 2P6OA 3QXSA 1JEOA 3PB3A 3ZHCA 3CJTA 3MD0A 4PCLA 1M6VA 3ECSA 4LOIA 4ZCSA 2QL5A 1NBHA 1TZKA 1RC1A 2XMSA 3WI7A 3KZOA 1XXLA 3H19A 2IYOA 4WD3A 1LX6A 3HXKA 1Y5LA 4C0SA 3S81A 4L1KA 4DHWA 1N78A 2ADMA 2FW7A 1U7PA 1YIAA 1YOBA 4W9MC 1BD3A 1OXSC 1MJGM 1XB2A 3T9CA 3R41A 5L53A 1WPRA 1CRQA 4RIHA 4UUOA 2B83A 1CETA 2Y0CA 1E6WA 2H7VA 3K1AB 3KYJB 2VH1A 3ZE8A 1SCDA 2I66A 3Q7SA 2AQKA 4ER7A 2CF5A 5I51A 3BSFA 5EMJA 1H0HA 2GUGA 1JG4A 1PRYA 4XFJA 1IHYA 1B15A 3WLNA 3CO0S 1XQ1A 3X2EA 1BAPA 1JHZA 2R9VA 2HQOA 4LZZA 2DFDA 4PY2A 1L4MA 2VHQA 2WC1A 5FPKA 2C9BA 2A5FA 1RPZA 3AFMA 4B6GA 4Y2TA 5BWMA 2ZZNA 4RYDA 5ITVA 4C2BA 1GZUA 4O4IF 4PQYA 1XTSA 2DAPA 2ZR0A 1EFHA 2PGNA 3OETA 3R0QA 2VR1A 3VHXA 3DW3X 1NWCA 1RQ7A 4PFJA 4YROA 1SU8A 3FZNA 3LBHA 2WJWA 5B7PA 1CNFA 1QHFA 1DQSA 2PEYA 4MKZA 2WSBA 4OHCA 5EMMA 1QQAA 1AN9A 3AV0B 3AETA 3HSSA 4ZHQB 1CUJA 2YNMC 4NICA 3DZIA 5J2UF 4GS5A 3UJ7A 3WLRA 1ZH0A 1F48A 4DBLE 4E5DA 2XNCA 3T9BA 3QKWA 5AI5A 4YAOA 2GM5A 1AM4D 2P9CA 3N7TA 2AMVA 4RLSA 3FNHA 2EW8A 1IZ8A 2ZVDA 5I47A 4W5QA 3MHTA 1N2ZA 1USWA 3WGJA 3DAHA 4G4SP 5AH0A 1B7GO 3S5UA 4C4PA 3NIBA 5CW2A 5DB4A 5ER9A 221PA 1B0PA 3A9SA 2XCLA 1BYUA 3IAM1 1TKRA 1BQ3A 1VL1A 3FDZB 3R76A 4IDGA 3O82A 2GO7A 1DWQA 5KNDH 5DXAA 5I5EA 4PR3A 5BUCA 4Q4HA 3HVIA 2NNWB 3UC9A 4D9MA 4F2PA 1HYEA 1UZAA 1QB7A 3IT2A 1WKBA 2YC4C 5GONB 2HV9A 5IHXA 4DEYA 3UPUA 1N7JA 1Q0SA 1EM8A 3HN7A 5LC1A 4UHCA 1UEXC 4WE3A 3MMXA 5TPWB 4RMIA 3O9VA 1SKYB 5MN4A 3RE1A 1QIFA 1YVEI 2CKMA 4NYIQ 5FV4A 2F3QA 1GNPA 1OBCA 2I3DA 5FBQB 5IZCC 1MD9A 4NPCA 3RLFA 4J0IA 4P5DA 1C3OA 1Z4QA 3CB4A 2QTWB 3E9CA 3VJRA 2ZUUA 1XZQA 4AICA 4HJXA 1I13A 3QU4A 5C4MA 3GH1A 3KUUA 3MJ4A 3PRKE 1NHWA 1RLTA 3ES9A 2BVNA 4XVQA 4D9BA 3C14C 1AURA 1V39A 1GNLA 3Q9NA 3L7JA 3UEOA 3CE9A 2Z83A 1OPRA 3N87A 1CUDA 1VMIA 4ZOAA 4JH0A 4PR0A 1RQLA 2VHWA 2R1UA 5E2AA 1D4ZA 3H9JA 3DB2A 2JGLA 3OZAA 4P2GA 2EF0A 5EWJA 5GOTA 1ZD5A 2PZEA 3GCWA 3WYFA 3Q3HA 4EW2A 1HE3A 2HGSA 1K68A 1MN6A 3CG0A 5CVVA 4D79A 2EIHA 3PQ8A 2PH1A 1E66A 3LECA 1VYTA 4ZANA 4IZOA 2Q9BA 5GZ6A 3NWJA 4LF7B 2HRBA 2J5XA 3NNNA 1A7AA 4RFLA 4KL8S 2CJPA 4CR7A 3WL7A 4WN9B 4D4HA 4PQEA 1CUFA 3EZFA 3VU1A 2YZ2A 4B33A 4EY4A 2ZSBA 2IGBA 3CPJB 2JGRA 3TGPA 2Q3MA 2PANA 1BG6A 1EINA 2EFYA 5F51A 2OG1A 4X44A 2AFVA 2FW9A 1VJ5A 2ZRMA 3RUHA 3EUWA 5I9LA 2GCOA 4NFSA 2QUHA 4AD8A 3BBLA 4EG1A 3IMFA 2WMYA 1SUIA 2QRJA 3R77A 1YQQA 2WEKA 4ZJZA 2GX6A 1ZY2A 3QVGA 2Z6VA 5DOVA 4C6SA 1NBMA 5KWIA 2ZYUX 1ID8A 1H42A 3C5CA 4B46A 4ZI3A 3JQFA 1Q1ZA 4CKBA 2C4TA 1HM5A 4JI5B 4ARSA 1DXHA 4IDOA 5IN4A 1PL8A 3S7TA 1CUBA 3C45A 4KLAA 1UDCA 8LDHA 4M7OA 1FNNA 1OH8A 4R1QA 3AVWA 4L3OA 2GFIA 5CB0A 2ZAYA 4LHXA 1N6PA 3P96A 1OH7A 5EP1A 5DSXA 4OQDA 4X1KA 3TI9A 3ZZTA 2BKXA 1SUPA 2I2AA 3P26A 4HQ0A 1ZITA 2ILVA 4KLRA 4V0NA 3TO5A 4TKLA 4BNVA 4X00A 4B2IA 1GTL1 1X8KA 4ZEVA 2P1RA 2OCBA 1Q6YA 2PRZA 1Z4NA 3DKKA 5BXQC 2DUUA 4Q39A 1A8IA 3QKUA 2B8NA 3EUFA 4YIHA 3HJNA 3NAQA 3SBOA 3CUYA 1UF9A 2GSWA 2RAVA 2E6UX 2QB5A 2BMWA 2NNLD 3SQDA 4DPLA 1QHNA 4LXQA 5DNDA 1XLTA 4JENA 4QDTA 1YIOA 4GG1A 4R1LA 4BU1A 1ILEA 1EXDA 1KS2A 3B1WA 4ITRC 3PZBA 2GAOA 1AJEA 3OCJA 4ZEMA 2QD5A 2VLBA 2GEKA 1YR3A 3WDKA 3FOWA 4PYQA 4DG8A 2DH6A 5J40A 4B84A 4JBIA 4M36A 3QLJA 1Q1EA 3VR2A 3SC4A 1IY2A 4R69A 4IDFA 3I58A 5A03A 3EW7A 1W73A 2O8BB 3BWCA 3H1PA 3UNXA 1Y89A 1ORHA 4FLFA 1MIOA 4XIIA 4ZXPA 1F9AA 3P9IA 4BWFB 2XLBA 1PDWA 3R3UA 1V4NA 3B6KA 4IMPA 3MILA 5EZYA 4K0KB 3DFUA 4QUGA 2PUEA 2G88A 4WZBB 4CMJA 1OD6A 1W4LA 5DYWA 5IW8A 3UFBA 1T8WA 4F4CA 1E7QA 5E1OA 4U7JA 5COBA 5AD1A 5G3ZA 1PS8A 1RI4A 1BVHA 3T3MB 1TQ6A 5LJIA 3NFRA 5K3FA 5BY2A 3TQSA 1YOVB 3C70A 4DRZA 5CT6A 4AURA 2E49A 3CW8X 2JJYA 3ROTA 3ZOKA 1JEJA 1WZEA 2A0KA 1IULA 2BONA 3ADKA 5DVZA 3AHHA 5AI6A 1ZO8A 4FW8A 5E2IA 4FYPA 4HB0A 3W8NA 2V45A 1XALA 3LDGA 5F78A 1FW6A 3MGCA 4BOYA 4LZLA 4LS3A 5IUNC 1H9BA 4E12A 2ODPA 1XZDA 3H04A 1UBTS 2AS0A 1AH2A 5K6AC 4LDZA 4NG4A 3ZDQA 1ZM9A 3A1CA 1F0NA 4CFSA 8ADHA 3TSWA 1DHTA 5LP6C 1JVSA 2PO7A 4L0CA 4Y9UA 4MYTA 5B36A 2OM6A 5JT1A 2YHSA 4DIKA 3UKJA 1X8LA 4YRPA 1PWZA 2X6RA 4ZI7F 3P2MA 2PJZA 3WA7A 1RCTE 1T0PA 1WUTA 4PRLA 2OD9A 1F60A 3WGHA 2BR5A 5JANA 5CLFA 3GZNA 3QJ5A 4XGRA 2KM1A 2Y67A 3UANA 1N34B 2G9VA 5D86A 2FAXA 4B80A 2GB4A 4G1EB 3U40A 1WF3A 2HB6A 1ONBA 1ZGAA 1BKYA 2ID7A 1RMTA 4LC0A 4YB8A 2VYQA 2CMKA 3AF5A 4UVIA 5BQXA 3UT0A 5FD8A 2J6IA 1CB0A 3K0AA 3TUZC 2NOAA 3AIOA 4OKSA 5EXDA 3RF6A 3VU3A 4C7MA 4AJIA 5KREA 4MV4A 1ZG3A 4MHTA 1WHSB 1NVTA 4Z2YA 2CT8A 1MEJA 2O8CB 1F8GA 1MVNA 2ZBEA 3LCMA 1ETUA 2O20A 2WFAA 2CFOA 1DAHA 1UPUA 1V0JA 3RD5A 3LUBA 1NR7A 4TKVB 3ICQB 5JNSA 1RBMA 2RBEA 2ZRPA 3AU9A 3BDIA 3D0OA 3QFHA 1U80A 4FLMA 4B34A 3COZA 2PAAA 3GQBA 1PJTA 3SEFA 5TS2A 2B30A 1L8XA 2QAJA 4MS1A 4Z7QB 5IASA 3I8SA 5ICMA 5M7EA 2QD1A 3BEDA 3HS3A 4HQNA 2VH5R 2QM7A 1B00A 1O08A 3N2GB 4B4WA 1SCBA 3FFBA 4KAFA 3OCWA 4PAOA 5A4AA 1EFKA 3VTFA 3CX6A 4MIEA 1WHSA 4N5IX 3EA0A 1ONOA 1W25A 1OX4B 1UK6A 1KU6A 1VYHA 4IRUB 2ZSUA 3SP1A 1JQJC 1MAVA 2DKNA 4LNAA 2XT6A 4OXXA 1PL7A 4NU0A 2PBFA 4MEAA 2A5YB 3T7SA 1PGJA 1JLKA 4LTDA 2QRHA 4FMCB 4TROA 3AXTA 4MI3A 4NE9A 4UUNA 5HPYB 3QUCA 4GOXA 3ETGA 3LRXA 2J85A 4ZVVA 2H2IA 1XRSB 5F2NA 3F7MA 3KZXA 4G5XA 2ZB7A 4DLRA 1QX3A 5K0TA 1PJQA 4CTNA 1AKWA 4WKBA 4P54A 3PENA 4LFBB 1SHLA 1SEVA 2GM3A 1V25A 2Y0BA 3SYMA 5CJPA 3X44A 1YKFA 1TD9A 2O3QA 3GEPA 1RAEA 2DETA 4AW9A 1NP7A 2PZMA 1IBRA 2G1UA 3DMYA 4IGIA 2F1KA 2FRXA 5BSVA 4DCCA 2J3MA 5IANA 2MSDB 3PXCX 1PNRA 1T8RA 3UAXA 2FE4A 1HDOA 5AKEA 4D42A 2X42A 3IV6A 4PO3X 4URFA 1FXSA 4F4JA 1DAPA 4B8WA 2BD0A 3DGFC 5GV7A 4IS3A 2VNSA 1HGXA 3K20A 5LJLA 2WPNA 4R1OA 3BRSA 4FDVA 1V1MB 4C9BA 1UZMA 2WT4A 3OT1A 4EF4A 2C5AA 3U26A 4IGFA 1KS9A 3L6RA 1QH9A 1QO0D 4MYUA 3LTNC 2GRJA 3CO5A 4WKNA 2IS4A 1AX9A 2QTTA 1EEXB 1SQFA 1AD2A 2WDPA 4CM1A 4NAHA 4ARCA 1DRWA 3C6XA 3DDCA 1IUPA 2LGJA 3ZY4A 4WMLA 3QRWA 4BL5A 1EZ4A 3OE7D 2Y1CA 3U9SA 4IV0A 1GAWA 4M99A 1VB3A 1GU0A 3RNLA 4D43A 8GPBA 5I7UA 1I3NA 1O0BA 5H4GA 1NR1A 4DIUA 4EUNA 5A3JA 1IUOA 1QHHA 2Y93A 3FSJX 3SXPA 2Q5IA 1ZRHA 2ATIA 2JZOA 3D6TB 1HRKA 2WTNA 3CNOA 4GMFA 5IFKA 2Y1LA 2OFWA 5FXMA 1YUMA 5YASA 3SHVA 3DFZA 4OI1A 2IP4A 1GG2A 1GQYA 1MOZA 1MENA 3TQHA 4I1OA 4QWMA 1JUDA 3IVAA 1JIXA 5ULLA 1K3UB 3OQHA 1ECPA 4K05A 4KREA 2YZ7A 5BT8A 1MP0A 3D81A 3FYSA 2DM6A 3PITA 4ESVA 1V8ZA 1GXSA 2WT8A 2NX2A 2OPHA 2JNWA 3VPSA 1SCJA 2OHGA 1D2CA 5KQPA 1FVFA 2CK3A 5T41A 3JW8A 4QBFA 4TX1A 5FOTA 4JJAA 3VI3B 4YO8A 3N2NA 4RS3A 3ORFA 1JLSA 4NCBA 4M55A 5JQWA 3SSAA 1MQSA 4BNHA 3D0QA 1TUEA 3EGWA 2X9QA 3I1YA 3PFBA 4BMCA 3ZE0B 1UODA 1MHTA 2QMOA 2YDYA 3NC0C 5KIAA 5M2QA 2GBCA 4GAEA 3PRHA 4OOFA 5A0FA 1JAHA 1Y6GA 3HUFA 1WBBA 3HQ4O 4S1PA 4JC4A 3DDZX 3TLGB 5KTNA 2ZI6A 2ZTSA 4WECA 1KMHB 1RKXA 4F5WA 1X92A 4IL5A 1GRVA 2PRYA 4NY1A 4DYHA 1NW8A 2I1WA 1XLWA 5E9WA 5HTKA 1EP2B 3DA8A 3DE1X 4XWWA 1TYEB 2FEMA 5F1OA 2KLBA 1GEGA 2ODTX 4ND8A 4ZALA 5K0BA 3I6IA 4N0PA 4TSFA 4MJ7A 3NS7A 3ADPA 3QM1A 4RSHA 1T34A 6REQA 2QLBA 1FRVA 1QVZA 3P27A 4BUCA 1ADFA 3HE3A 4Q66C 4RMHA 1HKUA 2Z3ZA 2DHDA 3RJ5A 4AY4A 2O8EB 1K0UA 2VYND 1VL6A 3OLZA 1N7IA 1ZGJA 3IJ5A 1DCTA 1B93A 2X7XA 1KZYC 4LHZA 5NLLA 3GLIE 4AO7A 5ALIA 3R7NA 3PUJA 1O6CA 1EM8B 4EF6A 3EMKA 5K9ZA 4B7AA 4IXTA 5DIFA 4ND8B 3W8DA 4LHEA 1S7GA 3JWPA 3SVTA 3OCVA 2CLKB 3EH1A 4H08A 4L72A 3H3XA 3WZLA 3INYA 1KQNA 1UZLA 3F3YA 2ZYAA 3QKTA 4FC6A 3UK2A 1HTWA 1TZCA