3HCCA

Crystal structure of hpnmt in complex with anti-9-amino-5-(trifluromethyl) benzonorbornene and adohcy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
259
structure length
259
Chain Sequence
VASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 91
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hccA00
3RODA 3T7SA 2NNWB 2H00A 5T64A 5JR3A 1JG2A 5K0LA 4AUKA 4HC4A 2ZWVA 3I9FA 1INLA 2PX5A 2ZBQA 5GINE 4OX9Y 2YTZA 2PKWA 3DULA 2UZ4A 2BM8A 3LHDA 4ER0A 3AJDA 3KQQA 3FZGA 4RVDA 3JWHA 1KP9A 1YF3A 2NP6A 5FWDA 1DUSA 3IEIA 3C6MA 5DWQA 3PX2A 4YUXA 4NECA 4EMSA 4KIGA 5K0JA 4POOA 4F86A 5C0OE 2BZGA 4RVFA 5DRTA 1H1DA 2AOUB 1O9HA 2AVDA 5EZQA 3NVKI 3LCVB 3M33A 3UA4A 3HCFA 3KPVA 1JG1A 3FYCA 3HVHA 3PTAA 4GBED 2OXTA 1KXZA 2P7IA 3P2IA 4MHTA 3FTFA 2I7CA 3EVEA 1RJEA 2P3QA 3OFKA 4EK9A 5LQAA 5FTWA 1QANA 1RI4A 1IM8A 2YUIA 5GP1A 3MTEA 2E5WA 4YUVA 4M38A 1JTFA 2BR3A 1OR8A 5E2BA 3T7TA 3OCJA 1DL5A 3E8SA 5D1HA 2ZIGA 4B17A 3TQSA 4EVIA 3RIEA 1RI5A 2AOWA 1ZKDA 2PWYA 3REOA 3UA3A 4CKBA 4R05A 4XUCA 2Y1XA 5DM2A 1VP3A 4DZRA 3I64A 4E30A 2HNKA 2JHCA 3RW9A 2ZZNA 3NWBA 1NV9A 5DX0A 4CWAA 5DSTA 1X1BA 1P39A 1EAMA 2P40A 2ONYA 2P1DA 4M37A 4QPNA 3R9XB 4P7GA 3GCZA 5JUWA 2OO3A 1NW7A 3DTNA 5LQCA 4C4AA 5CD1A 3PX3A 5E9QA 4KRGA 4P7JA 4QVGA 3I58A 1VIDA 4AZWA 2C7QA 3FUVA 3MAGA 5EPEA 3UJ8A 3OZTA 3KPUA 5HZMA 4U7TB 4UOEA 3GU3A 1SUSA 4HSGA 5F2NA 5T67A 2ESRA 1O54A 3EVZA 5E1DA 1EJ6A 1U2ZA 3QOWA 4CXMA 2AVNA 4A6DA 4X60A 5ICCA 3BWMA 1RI2A 3GRVA 4OBWA 3LECA 4F85A 1D2CA 3KPWA 3OPNA 1VPTA 1PJZA 3B5IA 3Q87B 5LQJA 2GS9A 1G38A 3NTVA 3VC1A 3KQMA 4PIPA 2C7PA 4QTUB 4RTQA 3HCCA 3TM4A 3HVIA 1F3LA 1VP9A 5EZSA 2F8LA 3CKKA 5BW5A 3LDFA 3UJ7A 3PFGA 2EG5A 5E8RA 5E1OA 3CJTA 4YMGA 3O31A 1ZGAA 4YV2A 4YUWA 2XYRA 4A6EA 4DKJA 5EEHA 3ER9A 3L8DA 2QM3A 1X1CA 3A7DA 4OQDA 2PSSA 5GWXA 2YVLA 4HTFA 1R8XA 3KR2A 1T43A 4GQBA 4IV0A 4RTKA 3FTEA 5E2AA 3B7PA 3A27A 2FK8A 2I62A 5DX8A 2ZZMA 5EMMA 1YUBA 3G8AA 3TRKA 5CCBA 3R0QA 3SSNA 4PWYA 3E23A 4FP9A 1RJDA 3GNLA 5BXYA 2WA2A 3KR9A 3P71T 5F2KA 3EVFA 4EQZA 3KU1A 2AN4A 5KVAA 3UJ6A 2QYOA 1RJFA 3HVKA 2G72A 2ZW9A 5DRYA 1DCTA 1Y8CA 5K09A 2CL5A 2GAFA 2CWWA 3SXJA 2R6ZA 5CVJA 2NXCA 5GIOE 3B89A 1D2HA 2ADMA 4DQ0A 4XUDA 2VP3A 3NDJA 1M6YA 2UYCA 1WG8A 2G8NA 5EMLA 2B78A 2P7HA 4GOOD 1NW6A 2P3LA 4FSXA 1FP1D 1FPQA 2ORED 1P1CA 1EIZA 5E8JA 1R00A 2N47A 5EGSA 4PYQA 5DTRA 1N7IA 1Q0SA 3M6VA 3M4XA 4PYIA 4E2ZA 2IFTA 2IIPA 1G55A 3OE4A 4X61A 2R3SA 5CVUA 2C7RA 2Q41A 3GIWA 3F4KA 3ME5A 3A4TA 3GRYA 4X63A 4RTOA 3KHKA 2I6GA 2ZBRA 4QQKA 4IV8A 2QRVA 4K6MA 5FULA 3ELYA 5E9WA 4WXHA 2H1RA 1FBNA 2XYVA 3DXYA 2JH9A 2O05A 3HEMA 5FWAA 5M5BA 2HWKA 4DM3A 1AQJA 1WS6A 5DTMA 2AOTA 3TMAA 3VSEA 3OE5A 1EQAA 1JR4A 3K6RA 4YV1A 1PRYA 1R6AA 3ERCA 4RV9A 2OYRA 2XVAA 5DM1A 2V7EA 3FTDA 3UBTA 3UJAA 3P9CA 4LG1A 4DMGA 3E7PA 2AS0A 3KQYA 3G88A 5HOQA 4XUEA 1KYZA 5K0FA 4KDCA 1ORIA 4FT4A 2BH2A 4ATNA 3G2OA 1NT2A 3KPJA 3M6UA 1ZGJA 3CJRA 3IV6A 2P41A 5HIKA 3ER8A 1QAOA 2ERCA 1R74A 1P1BA 4KIFA 1NKVA 3M6XA 3B3JA 4LWPA 5FADA 4GOMD 1SQGA 2UYHA 3BGIA 1ZHFA 5H02A 1XXLA 2VDWA 2GB4A 2GLUA 4AX8A 3ORHA 1KHHA 2B9EA 2KW5A 4RTLA 5DPMA 4E2YA 2NP7A 4ER5A 3CGGA 1L1EA 4BP1A 1IXKA 3G2PA 3CC8A 8MHTA 3DR5A 3T7RA 3THRA 4RTPA 4L7VA 1QYRA 5E1BA 4RYLA 4PIMA 1X1DA 1I1NA 1L3BA 3HCBA 3BKWA 3PVCA 2Z6AA 4G56A 3UJ9A 2WK1A 2EX4A 1M0EA 2GA9A 2OBFA 3PT9A 1X1AA 4RSRA 2AZTA 3EVCA 5KQRA 4R8RA 5FQNA 4OA5A 3G2QA 1BKYA 5GIPE 3VYWA 2YXEA 4AZSA 3R24A 3A26A 2CMGA 1KPGA 1KPIA 3P2EA 5EHGA 2ZZKA 5ICGA 2BM9A 2Y1WA 4IWNA 5DT2A 4WVLA 1UIRA 5EIFA 1SVUA 5LQKA 3FTCA 3G89A 5EHIA 1JSXA 2G71A 2OPBA 2VDUE 2NXEA 3P9IA 3TFWA 3GRUA 1XJ5A 4IKPA 1UWVA 4M36A 4C03A 5C9ZA 4BP3A 3TM5A 2EJTA 4GUAA 4FSDA 2I9KA 5MHTA 2DPMA 3KQOA 5HILA 3LCUA 3BUSA 1BC5A 4E33A 3FUTA 3KQPA 2V74B 2OB2A 4RX1A 3SGLA 3G2MA 1F38A 4PYLA 1R18A 3WSTA 2NXNA 2ZIFA 1R8YA 2PT6A 4RTNA 5LR6A 4YMHA 2GPYA 2FYTA 4PCLA 3TR6A 3O7WA 4MIKA 3CCFA 4OBXA 4AZTA 2O07A 2ZLBA 4PONA 2Z6QA 4GC9A 3Q7EA 1WZNA 3JWIA 3VC2A 1YFLA 4MWZA 3G8BA 4BLUA 1Q0TA 2WA1A 2PXCA 3MERA 3UWPA 4BY9E 3JWJA 4QDJA 2IDKA 1WXWA 2DULA 3G7UA 1QZZA 3P9KA 5G02A 1VLMA 4HH4A 2PY6A 4CTKA 1X19A 2OZVA 3ELDA 2PBFA 2FRXA 3EMDA 3KPYA 5HEKA 1IY9A 1P91A 2CKDA 2IGTA 4LECA 4QTTB 3P2KA 3OZRA 2OKCA 3DMGA 1RI1A 3TLJA 2FHPA 3NDIA 3PB3A 3EEYA 4PYMA 4M7RA 3HA3A 1RI3A 5EVJA 3DP7A 1HNNA 1M6EX 3GO4A 5DXAA 5GOZA 4KDRA 1NW8A 4PGGA 2A14A 3BWCA 5GM2A 2G1PA 1AV6A 4X41A 3TPZA 3AY0A 1VQ1A 3DLCA 2YXDA 4RWZA 1VE3A 3EVAA 3CVOA 3FYDA 4R8SA 4XCXA 5DX1A 5B1SA 4CKEA 5KQSA 1EJ0A 3OU7A 5IKMA 3EPPA 4Z2YA 1FJXA 1O9GA 3LX6A 4RTMA 2FCAA 2JHAA 3KQSA 3B3FA 3MGGA 5CUQA 1ZQ9A 3C3PA 3HCDA 1D2GA 3MB5A 4FGZA 3BXOA 5FA5A 2AOXA 3CBGA 4KVZA 5EOVA 2ZIEA 2PJDA 5K0BA 1YB2A 2P35A 3SM3A 5FUBA 4P7KA 4E32A 3GRRA 4DCMA 2ZTHA 3KQWA 3X0DA 2Z6UA 2EFJA 2PV0A 2ZBPA 3DH0A 3FUUA 3EGIA 4MQ4A 3SR4A 4E2WA 3FPGA 4PGHA 4YV0A 2IH5A 4PYKA 2VS1A 5ICFA 2IP2A 2IDJA 5EQJB 5DM4A 5HIMA 2IPXA 2CMHA 3LDUA 4GOND 3KQTA 4OA8A 1JTEA 4MTLA 4BLVA 3SSMA 1BHJA 1RJGA 2UYOA 2ZWAA 3G5TA 3HM2A 5GM1A 5KS2A 1V39A 2O0LA 3EVGA 1QAQA 2QE6A 4QVKA 3P97A 2YX1A 1SQFA 2UYQA 1G8SA 3UJDA 1VL5A 2K4MA 7MHTA 3EVDA 1TW3A 3FRIA 3GRZA 2QY6A 4H0NA 5K0GA 3HNRA 1SG9A 3V8VA 4HG2A 2IH4A 3HA5A 5KYGA 3S68A 5HFJA 1XCLA 5FCDA 2EJUA 4C06A 3AWIA 2GH1A 2HV9A 5E1MA 4FS8A 4P58A 3IYLW 5CM2Z 4PNEA 2PVCA 1XDZA 3T0IA 4C05A 5EC8A 3ELWA 2IBTA 2IBSA 2AN5A 3GXOA 4HRAA 4V0QA 5F2OA 2ZVJA 5FHRA 4YUZA 1VBFA 2C7OA 1AF7A 1NBHA 3G5LA 1ORHA 4FR0A 5CVDA 2AOTB 4EKIA 5LQUA 1EG2A 3HA7A 5T6BA 3PS9A 3EGVA 4YUYA 5EG5A 2JG3A 4C08A 1JG3A 2IH2A 2BR4A 3TKYA 2VDVE 5BP7A 3FPEA 3GJYA 10MHA 3HTXA 3PLAE 4KWCA 2ONZA 2P3OA 3E05A 1WXXA 3UJBA 3NMUF 1XVAA 3H2BA 1ZG3A 4PYNA 1TW2A 5K0EA 4CKCA 1YFJA 1G8AA 3FUXA 3M6WA 1JG4A 3A25A 3NWEA 5IH3A 5BW4A 2PLWA 3C0KA 3EVBA 2VZ9A 2PX4A 2FPOA 2PX2A 3FRHA 3GDHA 1HMYA 2AOVA 3OFJA 4RVGA 4X1OA 4LWOA 5EMKA 4CTJA 1MHTA 4ER7A 4P7FA 4PYJA 1WY7A 2ZCJA 3JWGA 1BOOA 4ER3A 4RTJA 3C3YA 5DTQA 2YXLA 3SVZA 5ICEA 3R3HA 2HR1A 5FHQA 1UFKA 2XBMA 1XDUA 2JHPA 3UZUA 4RTSA 3LKDA 3BGVA 1I4WA 3GGDA 1NW3A 2JJQA 3I5UA 2HTEA 2PXXA 4JXJA 4HTFB 3P9NA 4RVHA 3THSA 3K0BA 1G60A 1FP2A 4FZVA 3BZBA 4EKGA 5DXJA 2PT9A 5LSAA 2JH8A 4DA4A 5FQOA 4AZVA 2ZSUA 3FPFA 1KR5A 2PWPA 1NV8A 3ELUA 2PX8A 3DLIA 3EGEA 3LGAA 4RTRA 3TOSA 4GEKA 2P8JA 1I9GA 2YQZA 4R6XA 1SKMA 4GF5A 2O57A 4PYOA 2AR0A 4E31A 2YR0A 4F84A 2BR5A 5E9JA 4BLWA 5DSXA 2O06A 3U81A 5EMJA 3QOXA 2OB1A 1JQEA 3D2LA 3EMBA 3KR0A 5EEGA 2FK7A 3GWZA 3LBFA 3BKXA 4FT2A 5K0NA 4HGYA 1KIAA 5D1NA 3DOUA 3BT7A 3P8ZA 5EKXA 5CIYA 3KR1A 3LPMA 4Y30A 3FUWA 2B25A 1QAMA 1B42A 3LL7A 5K8VA 1KYWA 1NW5A 5P8WA 3HVJA 5DLYA 1JSZA 1YZHA 5FA8A 2XVMA 3BWYA 2H11A 5EIWA 4C04A 3FPHA 3DMFA 2PXAA 3MHTA 1XDSA 3MCTA 3BWBA 3EEOA 3LDGA 3NW9A 5LQNA 1N7JA 3A7EA 3KQVA 4R6WA 5ERGB 5K0CA 4PCAA 1AQIA 4KW7A 3ANXA 1N2XA 1NE2A 4QQNA 4QDKA 5EKUA 1L9KA 3SX0A 1YZ3A 4ZTBA 3QV2A 5HIJA 5DM0A 4DF3A 1NBIA 4U7PB 3V97A 2XYQA 3LKZA 3DXXA 3HP7A 1TPYA 4GC5A 4ER6A 3LCCA 4QPPA 2G70A 2LD4A 3DUWA 4OQEA 3OZSA 3SMQA 3AXSA 4Y2HA 3LBYA 2HMYB 2OY0A 4ISCA 3CJQA 2B3TA 3R6TA 2PGXA 3MCZA 3MQ2A 3TKAA 3OU2A 3M70A 3HCEA 2B2CA 1Z3CA 5CCXA 3AXTA 1SUIA 3FPJA 3DMHA 3HCAA 3I53A 4HGZA 3C6KA 5HIIA 4O29A 2NXJA 1JQDA 4PINA 3SSOA 4E70A 5K01A 3LSTA 4C07A 2AOUA 1MJFA 2AN3A 3MTIA 1JQ3A 1KPHA 4GOLD 4V0RA 5C1IA 2ZFUA 2ZULA 3IHTA 5CVVA 3OU6A 5K05A 9MHTA 5U4XA 1G6Q1 1L3CA 3NVMB 3PFHA 1L3IA 1XCJA 3UJCA 3KKZA 1XTPA 3BGDA 4E2XA 5K03A 3B3GA 3O4FA 4DCGA 5LQRA 5CVEA 3UFBA 3ID6C 3NJRA 2QRVB 3DXZA 2NYUA
chains in the Genus database with same CATH superfamily
2QU8A 5CBPB 4EB8A 3HBAA 3AY7A 4AUKA 2CJWB 3NOVA 1C9MA 1JKJB 1UK7A 1WUHS 2SKDA 4CU2A 2RD2A 2ST1A 4HXYA 2DHRA 3K9WA 5KX5B 3AF0A 4QAJA 3WDSA 1I33A 2Q3JA 3FROA 5ECGC 1GAXA 5DBGA 2WG0A 3RBZA 3CUYA 1HTBA 1NMZA 5DMHA 5EKSA 4UTXA 4A8TA 2IY7A 3WLOA 3K5WA 4YUXA 2BGIA 4JBGA 2BZGA 4O4LA 1OCEA 3FG9A 4JITA 2AVDA 1NVKA 3VR2D 2ZK7A 3YASA 3RVMA 5AOVA 4CYMA 2BEJA 1UDCA 3K0HA 4EW2A 5IMSA 1ORWA 1XMJA 1EX1A 7REQB 4F11A 3RABA 2B8TA 1BMQA 1YMQA 2GYUA 1WDTA 3JD3A 3U26A 4B6FA 5I01A 3F1LA 2PQ6A 2Q4RA 4B4UA 1WULS 1U2GC 2AN9A 3AC0A 5EJ9A 2AG8A 3PKZA 2G5TA 4E6EA 2RBGA 1WKBA 4K8OA 4LXQA 3UMMA 3OCJA 5F1YA 1NX6A 4G0MA 4MUJA 1W59A 3L6OO 2RGUA 3AGQA 4LS3A 1ILEA 4PXYA 4Q4JA 4X64B 1BKDR 4YRZA 2ORIA 3KEMA 2I6QA 3HUDA 3V4SA 5B6IA 2RB5A 4F91B 2MSDB 2ZZNA 1YBHA 2R6GA 4MYUA 1WCWA 4QSHA 2XECA 4RELA 5I48A 4MWCA 1P39A 1DDGA 2UU9B 1VIYA 5C8YB 4W4TA 3A1CA 3S2YA 5JHHB 2RHRA 2H7XA 3RAFC 3PJGA 3SMVA 2EJWA 2P68A 2C7QA 2F1JA 2IOHA 1CNEA 1HORA 2FPLA 2CVQA 1Y4UA 3OKPA 5B58T 1XD2A 3FDJA 1NJ1A 2BFOA 3BMOB 3NOQA 1O54A 1QE0A 3BIFA 1MEEA 1EJ6A 4MZXA 1T9AA 1S3GA 2CGEA 4JJ6A 2F9LA 4A6DA 2O54A 4O5OA 4PR3A 3EZ7A 3MLAA 1SHKA 1MX1A 3O8BA 4YASA 5EIBC 2ZJ8A 3UVEA 2O1EA 3I4CA 1CNMA 1YZLA 3PD7A 3Q8WA 5SZHB 3NYIA 1Y89A 4AK9A 3Q3HA 4WERA 4LJSA 1UEIA 4UKDA 4TXHA 4FUQA 4L27A 1KVQA 2I4IA 2PMDA 2WD8A 2WJZB 4NU0A 4CM9D 1Z6PA 4TLEA 3S7TA 2CFIA 2F8LA 3HBNA 1OGYA 3HFGA 1S1MA 5L6MB 1R16A 4YMGA 3O31A 4YV2A 2LV8A 1JKJA 2NYVA 4ZAWA 3ZDCA 3IMFA 1ZM2A 2ZYRA 2X4LA 4YAFA 5BURA 1QRUA 2F7SA 1GY8A 4HRYA 4JC8A 3ZY4A 1QK3A 1TA4A 1H9CA 1KI6A 2XR1A 3BSYA 1QBGA 4KUHA 4QJ5A 1XU7A 5G0TA 5T6MA 3R40A 3UK0A 2C7BA 3WDLA 1F2TB 2R48A 4OGKA 5BV7A 1EM8B 2CVZA 3BRSA 3VTKA 2VOEA 4GXQA 2IK8A 1EKXA 2N42A 3Q3VA 1R4ZA 3C3AA 2WA2A 1GR0A 4U39A 1M2OB 2ZSJA 3IS3A 4I1IA 2P2CA 4L08A 4MV7A 5AVTA 3DZJA 3DDZX 3TZBA 2XWSA 2I71A 4DLZA 5JD6A 1ML4A 4Q15A 2A9PA 4ABTA 4QOGA 4BTEA 4KZKA 4CMJA 2YZMA 3CO5A 2PO5A 1G59A 2SCUB 4WY8A 2G8NA 3EWAA 1OJ7A 1I3OA 5DYGA 4Z5XA 3VHLB 4GPAA 2PSDA 2WZDA 2VWQA 3AERB 3BH7A 3L7AA 3NV9A 4KMMA 4NFLA 4NZMA 2YXNA 3WOHA 4RFSA 3VISA 1IVSA 1HQKA 5EGSA 3D8RA 3UW3A 5C37A 4NXNB 1TJ4A 2J6CA 1T2NA 5EQFA 3Q10A 4F5ZA 2QSYA 5IT4A 1PJBA 2R3SA 3OUZA 4KQWA 3KAPA 5DMXA 4FFWA 4EG3A 3NONA 1TIKA 1ZRHA 2E7ZA 2J0UA 3A4TA 1U6KA 5I8ZA 2WFLB 1EE1A 3KZMA 2C94A 3E3NA 1HDYA 1MO2A 4K6MA 4MVJE 3ZE7A 3ZKWB 4FM9A 4EFDA 1IRXA 3HBMA 2XYVA 3ZBUA 2J46A 4MWDA 3TINA 4PG7A 4X44A 4MAAA 4LHZA 1XSEA 3K2IA 4NOJA 3E22B 4Q1AA 5KJCA 1JQJC 3IOCA 3VSEA 1QF7A 4ZA2A 3OE5A 3PYLA 1BDJA 2I7DA 1G4HA 4UD2A 3NHRA 1RJ9B 3TQRA 3PQEA 3OZWA 4B3CA 3ILVA 3MS4A 4IIVA 1KYZA 1U5AA 4QUBA 1UBTS 4AYTA 5JT1A 2FKAA 1T4GA 2ZXFA 4J94A 3KPJA 4QJ3A 1PFYA 1ZGJA 3LGXA 3W2FA 1ORDA 2Z08A 3IR5A 4KX3A 1P6UA 1QAOA 4FEEA 3U3JA 4A1FA 3KJGA 4D8UA 3Q9LA 4BGDA 2ZRGA 2ZVPX 3RVBA 2NTYC 3ROFA 3KALA 1SC9A 3RSQA 3DCYA 3ML1A 2DYKA 3PEVA 4NBRA 3OO1A 4XFJA 1Z0DA 3STHA 5AVSA 1Z08A 2BUBA 1QKJA 3BCHA 4C0AC 3RYTC 3OM8A 2PA3A 2BHSA 2YOFA 3AVQA 1TPZA 1QIFA 3INNA 3TB6A 4FGUA 2Y9PB 3DVAB 1IN5A 1PUXA 3K9QO 2F3PA 4OFXA 3DR5A 3MSCA 4X3CA 3EQ8A 5DE3A 2B1GA 5F3DA 3T7RA 2J1LA 3STVA 2O5VA 4KQIA 2OHXA 4MS4B 4UNPA 4WINA 721PA 1F2VA 1I1QB 3IBFA 3ASZA 5EPUA 4OB8A 3CGWA 1H6CA 1UINA 2YWBA 3C48A 4EF5A 4CIBA 4CL8A 1R37A 4XWTA 1XRNA 3NWPA 4KGZA 1E3SA 2R2AA 3NP9A 5H16A 3G2IA 4CF7A 1OROA 3D7KA 5HKKA 2QZZA 4RH0A 3WLLA 2A9JA 2B5WA 5FNVA 2C8LA 3OQIB 1T9DA 2C2GA 4ZVTA 3OQNA 3GLTA 1GSIA 3LO5A 3KAKA 1B8PA 3PI6A 5CT4A 1LBIA 4DPMA 3DE2X 3ZXIA 4BQNA 1C3OA 1H2YA 5AJXA 3H6HA 3IUQA 1EUQA 2HJGA 3O3MB 1BGVA 1H2BA 1TJPB 5FYQA 2PE5A 1ESMA 2OQ2A 2C9OA 5KYTA 1WP9A 1T2AA 2V45A 3M4JA 2PYIA 2YFYA 3GBSA 4DV3B 1IB6A 5M3BA 3OPYI 3KZVA 2HRZA 1LH0A 2I91A 1CJSA 3PZRA 3KVRA 3ZY3A 1FZQA 4BKUA 4IOMA 4F96A 4KFTA 5EERA 4PWZA 3K9NA 5B7NA 4DBZA 4RIIA 3LHIA 2WSYB 2Y0EA 2R79A 4WUTA 4ZYLA 1AXGA 3D8HA 1KFEB 4EHAA 2EFYA 1S3FA 3WKDA 1SHZA 2XQFA 4X1IB 4DADA 4YDHB 3CCFA 5ALSA 3NAZA 1AS0A 1E9FA 4J1TC 4UVEA 1AIPA 5EAIA 1TE2A 3LK6A 3G2LA 3Q7EA 5E6SA 1J20A 1P17A 2KQUA 3OBBA 3K4PA 3QUSA 1UFRA 1THTA 2H9IA 5EJIA 3KOMA 3QU5A 3SQWA 2JEYA 4NARA 5SYMA 3W6NA 2DERA 1Z6XA 2AHOA 4LF6B 4AP5A 4Q9DA 3SHTA 1VFPA 2Z9CA 2MYPA 2VXBA 5KTYA 2C5SA 2WU8A 3E9EA 3T5AA 4ZOEA 3GEMA 3EASA 1LI7A 1OXSC 3I6YA 5KHOC 3AY6A 1IY9A 2WJVA 1MABA 4JJGA 4L0QA 1KAQA 3EXG1 1P7VA 2X8AA 3WLTA 1NURA 2QLJA 3K2BA 4MVJP 4L6IA 1PS9A 1MD9A 4RW0A 2UVPB 5JJLA 4QYMA 3IDAA 5I9TA 3QOFA 2CWDA 4IBOA 1PN3A 4KDRA 1RZ3A 1X7YB 5J4VA 1QO7A 3H8JA 4QEZA 1DCKA 1HF3A 1C1YA 3DL4A 1V9CA 5TMBA 4M0FA 2IHYA 3RRBA 3WWPA 4X65B 2VI5A 1UR5A 1NBME 1SCDA 1EXDA 1EVYA 3VC7A 3L6DA 3MXTA 1QIMA 4N3CA 3R0IA 5AJZA 2RHBA 1AOXA 1G16A 1XA0A 1L7XA 2PQ0A 3QVGA 5IXYA 4PX2A 1KU6A 2N46A 3DF9A 1BXZA 2DJ5A 4ZC1A 1HDOA 4ZI3A 1HE2A 4DBLC 3HP1A 4JT8A 1KEKA 3WGVA 3BXOA 3C7AA 4DQLA 3C3MA 3FCCA 3UUFA 1ZOPA 1RWBA 4HGRA 2FPGA 5K0BA 4NBTA 5A1TA 3WMEA 3PXAA 4Q34A 3AL2A 2RGRA 3EDQA 3JVDA 4GEGA 4FDUA 1UPAA 5EHXA 2Z6UA 3DH0A 4LSGA 2JJ8A 3FPGA 2NZUG 3HRIA 3FLAA 3IQWA 3V7FA 3LY8A 3PFBA 3BBLA 4DLXA 3NHAA 3WQSB 4RD4A 5AW0A 1CJKC 1ZVKA 4IIXA 7ADHA 2WTXA 3KQTA 1G0NA 1ZCFA 3G82C 1JWBB 3G5TA 1HNXB 1NN5A 4TKVA 4AY2A 4DV2B 3BH0A 2QE6A 3MUFA 1YRLA 2VYQA 3X44A 4B2LA 2VN8A 5EJ7A 1KDOA 4JEHA 5EIEA 4DV1B 3ROQA 5FEMA 1LJLA 2Y68A 3HKCA 4HH0A 4O3MA 3FRIA 2QZ9A 2PJRA 3ETEA 3AESB 2AA3A 3H16A 4H0NA 4I50F 1D2MA 1SKAA 3FFWA 1SVSA 3QZUA 2HCRA 5B2EA 1V37A 3AF2A 2OMKA 4HXGA 2FG5A 4ZO7A 5AXDA 4DA7A 4KI0A 4DT1B 3STTA 3PPYA 1CP3A 4V3CA 1W8IA 4Q03A 4ED9A 2AE2A 3N6RA 4FHCA 4JT9A 3CSSA 5CA0B 5EC8A 3ETGA 4BLRA 1PR3A 1Y4SA 2PKCA 3GXOA 4NCXA 4EYSA 2ZVJA 3GFGA 5FHRA 1H5NA 1QGZA 1GUBA 1GZDA 4DT1A 1WHTB 1GFWA 1RCFA 2P79A 2R6JA 4LJ5A 1JQKA 3OEEA 5CVDA 5D3MB 3ZJTA 3HPRA 1U8AA 1SOWA 3LX8A 4R98A 1VI5A 1EAYA 2H07A 3GRPA 4I9UA 4G97A 3JQAD 4KE9A 4ZZ1A 2FWAA 2FWIA 1X0XA 1LW7A 4MPTA 5IJWA 1KBQA 4AIRA 1Q0HA 1KKLA 3H9GA 1U7HA 3OIYA 1NF2A 2D7DA 1XZMA 2JF0A 4PPFA 2FW9A 1Q1GA 4IPTA 1JYSA 2QEQA 2ZUBA 3NBYC 4PR0A 4Q24A 3W79A 4LV6A 1G4UR 3FUXA 1G3RA 3QNMA 2X3UA 1SZDA 4XZ3A 4RVGA 4KNWA 3RVJA 3JRNA 3MPOA 5KCMA 5TRTA 5HCNA 1DBWA 1VZ3A 3O4HA 4MW7A 3F7TA 1EK0A 3T5DA 4V38A 2AK2A 1M0TA 5EESA 1L7QA 3U37A 4A3SA 4CM3A 1WW3A 2G9VA 3CT6A 3JQAB 5C46F 1QGOA 5KKCA 5DYNA 3OFVA 1IEWA 2DWQA 1L5MA 2H4HA 2C92A 2QRPA 4OXQA 2K5UA 4RPIA 4DSNA 4RTSA 1EUYA 1QCZA 1T0HB 1HT2E 2V9ZA 1M2NA 3AESA 5HQJA 2Q1YA 5EIHA 3U80A 1SIOA 2JBAB 4I9FA 1PGQA 1G2OA 2B0CA 4JIMA 4B6PA 4XB2A 4D3ZA 4UTNA 1NATA 2ZJ5A 1E6UA 1FP2A 1ZOLA 3OJEA 2O2EA 5B30A 4Z51A 3FPFA 2AYXA 3LY9A 4Q12A 5IHXA 3KV1A 1KEPA 2J59A 2XUAA 2BTQB 1A4IA 2YQZA 1OTHA 3L7KA 3ADPA 4FWBA 4TV8B 5KWJA 2YHAA 4JQSA 3UPDA 2OV2A 1QE3A 3TIIA 3H1AA 3ZD6A 3LCJA 4DW8A 3UAVA 4M9ZA 3LT1A 1CDZA 4NU8X 3ASVA 1BXKA 1DKQA 3KR0A 4P5DA 1TZMA 2OG2A 1FU8A 1E77A 1VE6A 1C3VA 2VBGA 1CY1A 1I2ZA 2CHQA 5BN4B 1U0RA 4HEQA 4HKTA 2C00A 4INJA 1W19A 4TL7A 3MQFA 1T3ZA 4BN5A 3GAFA 1HZJA 1DAMA 3I4LA 3TL6A 3TNLA 2C7VA 4M2LA 4Z4FA 5TQJA 1OX4B 1JSZA 1R5OA 2CXSA 5FA8A 1JBQA 4MCAA 4K81B 4RGQA 2OWDA 2PUBA 1XUOA 3LT2A 3G7SA 2I3BA 3K05A 1XCPA 4Y6QA 1BXRA 1J49A 3OCXA 2SKEA 3KRTA 3T3EA 2VTDA 4DGSA 3JARA 3RF7A 4JLAA 1NE2A 3W5JA 1ZC3A 4LY6A 1L9KA 2BUCA 1GEGA 5AVOA 3VVMA 2AGVA 1YZTA 1HFEL 3DA8A 3BWEA 1F6WA 1GQSA 1WBJB 3Q0TA 1EFTA 2RDMA 1DWQA 1R2QA 3OF5A 4JNKA 1MQ9A 4JEUA 3AL0C 1CR0A 3SZRA 3FOEC 5IG2A 4QM7A 4Q9IA 3CW2A 1FL9A 1BMDA 1XQ6A 4IM7A 2FN7A 3C7KA 1JF8A 1P2TA 3CJQA 3LFTA 2OHHA 3R6TA 4JN6B 4JLBA 5AW1A 2VSQA 1IN1A 4K9SA 2X1MA 2YVUA 4FR2A 1SUIA 3DMHA 3NBFA 3X2SA 5BPFA 1HSOA 1LKZA 1XPRA 2HSEA 3NIBA 3BERA 4JKYA 3DL2A 1IONA 1JILA 4TXLA 2AI2A 1OLXA 2ZULA 3FCXA 1CUWA 2Y9MB 3ST7A 1ZRMA 1G6Q1 1L3CA 4REOA 2BKVA 2YV4A 3QLUC 4C78A 3WIOA 4E2XA 1V3UA 2C1XA 4JJEA 4TUYF 2V58A 4XSVA 4HBGA 3ZWMA 2GBCA 1F7VA 4RKYA 5K3BA 1PWHA 3H5NA 1TI7A 5AVUA 5IULC 4ZOLB 4K7JA 1PV1A 2JLZA 1SELA 2XZDA 3CPEA 5TNXA 5JDCC 1KDYA 521PA 5ITVA 4Q5IA 4NABA 5EYPB 3TTUA 2WUWE 1NVVQ 4L50A 4PLFA 4Y2PA 1PFKA 3LLCA 3JWHA 4DV6B 2UDPA 4YJGA 1HO3A 3JQFA 2WIKA 2IVFA 3E9MA 1VLVA 3GHYA 3ADOA 3PX2A 5DF1A 3ITKA 2FCRA 4J6FA 4EB6B 4UXHA 4PIVA 1MC8A 4QDOA 3LC0A 3W5DA 3WXBA 1M1XB 1QS0B 4IJ6A 5D01A 4ENSA 1PYGA 1X6VA 2A1IA 4BEVA 4IKOA 1ESDA 1PJCA 2N1BA 2R8RA 4H59A 4ZP1A 4BYMA 4Q7JB 2G9QA 2X9LA 4DQVA 1GRRA 2VH1A 2X7JA 2YJNA 1XAJA 4DLKA 5FOUA 4V02A 4U2BA 2IZ5A 1WQ4A 2QWXA 3T7TA 1U0HC 5BNIA 4EHKA 1QHEA 1MB9A 1VYUA 4KLRA 2HF7A 3OP1A 4IAOA 5TS3A 4C3ZA 3L7OA 1XZ8A 2GCPA 4P4NA 4KKXB 1G1AA 3GWGA 2Z09A 3O3OB 4HZIA 1ECPA 3HEAA 4OSPA 4QBHA 4X90A 4IO1A 3TJRA 4HEHA 2FRDC 4YIKA 1JPVA 3FI9A 1P4JA 3IUNA 2A59A 2FZ5A 2JRLA 2OBLA 3IJ5A 4TLBA 4X7MA 4KXMA 2P1DA 4G9BA 1CUCA 3MT0A 5TV2A 3L4JA 3BIXA 1J24A 3C1OA 3DMNA 1LWNA 4MJ7A 1MAUA 1L7OA 3PX3A 4L15A 5HF8A 2C29D 2V1UA 4K9OA 2ONKA 2A0WA 4GYKA 6REQB 2ZIVB 4BLOA 1SUSA 2F9MA 1ZN2A 3KZOA 3ROXA 1P0QA 2TMKA 5JRDS 1EHYA 3OOHA 4ZZ3A 3TKLA 3IGFA 2BKEA 3D0RA 4MQLA 4REQB 3WGQA 4ARVA 4B76A 5B1YA 4PZDA 2OO5A 2BGNA 3R7DA 3BIWA 3AVUA 3RYFA 3MMSA 4F4FA 1BMTA 1BWPA 3LHSA 3DAGA 4RIFA 3AP1A 4S05A 2IL1A 1O97D 2P0AA 2QRZA 4N3BA 1JDSA 3PGJA 4P83A 5IKPA 4RKQA 5CT5A 1NRIA 4E1VA 3PDUA 2VH2A 1LW6E 5A4MS 1KFKB 1OBHA 2VYNA 1ZGAA 3JZDA 3JD2A 3O26A 5J40A 4WJKB 3BFPA 1PJSA 4K6FA 5CIQA 2IYZA 2OCXA 1PQUA 3AEXA 1W5BA 4BWVA 1MP0A 4OXKA 3S5UA 4B0OA 1OAOC 2RCNA 4HTFA 1CQIA 5H83A 4RSMA 1MXHA 4LPKA 3WYEA 2Z1NA 5I8PA 3W05A 3RU9A 1UM9A 1ZM7A 2BGUA 1T0IA 2GBGA 3LWNA 6ADHA 4N03A 4QATA 4CN8A 2C3UA 4PWYA 4YDSA 1FY2A 4ILEA 2HM7A 2O3TA 3V2IA 4TROA 3CSUA 5KYUA 5DT9A 1Y42X 2FUNB 3S1AB 3Q9UA 3L8CA 2L82A 2PGIA 3NHLA 2G72A 2KMLA 1Y1TA 1W52X 1Z4MA 2E4WA 4WLVA 2I3GA 3RBXA 3P19A 4BHTA 1CJMA 1Y8ZA 5LLSA 4UFOA 5A03A 5BOSB 5DNEA 3KWMA 3ZI7A 1G8JA 3AU8A 3N7AA 5TGDA 2NXCA 1FFBA 5GJCA 2PZKA 1MGPA 3KKPA 3OJ0A 4TWRA 3C3KA 5TC4A 2UYCA 4RD0A 1ZM9A 3PC4A 4JZKA 3ZCUA 1J99A 1Q21A 4V0LA 1T9HA 2QN8A 1O94C 1UP6A 1G5PA 2OAQ1 2V7PA 4FQ7A 4JUDX 4TM8A 1ORRA 2X8LA 2VTVA 3IP3A 5DSZA 3UFXA 1QR2A 5M29A 2C5AA 2D1RA 3CR8A 3NH9A 1CDEA 1U65A 3BHNA 3B8EA 1TQ8A 1W47A 1CXZA 3HV0A 3PU6A 3Q15C 5CVUA 3MYRA 4ZQHA 4F3CA 5C1DA 2A1UB 3UBMA 4IL5A 1TQ6A 3WQQA 5IH7A 1W36B 2IPMA 3O4VA 1H2XA 1UKAA 2O2GA 2PRIA 1N2CB 2WIAA 2WILA 5FULA 3E7FA 3SQOA 4HNUA 1FFCA 4RSGA 4CF6A 5CB4F 4G6ZA 1HMPA 1FMJA 1PR0A 3DTVD 3JYOA 2HWKA 4EYGA 3K8ZA 1AKVA 3WWOA 4W6QA 3L8ZA 4KQGA 2NPFA 3GA5A 3M2PA 4JLNA 1E5QA 4YALA 3ZZ0A 3IKMB 3LP5A 4NK4A 2CLFB 3H2JA 3OZCA 1D2NA 1V3TA 3OTGA 1GKIA 1RP1A 3P9CA 1E4VA 1KEWA 3E9CA 1GJRA 4LG1A 1GPNA 1IC6A 2J5XA 3GJ5A 3A3NA 4ZQBA 5LA6B 5CYGA 1UBRS 1T2EA 3MF4A 4UXJA 1FNMA 1ORIA 3CUSA 4EF4A 3N2KB 2NU6B 3MRVA 1IOVA 1GPUA 4N7MA 3S1AA 3TVYA 3IV6A 5KYUB 3ZY2A 2P41A 4KH1A 4Y0NA 5DIZA 3UV7A 1CQZA 1FUYB 2QYHA 5CW1A 2AW3A 3O95A 5AM4A 4F56A 1QH9A 1B8UA 1VB3A 1UKVY 5CNIA 5H02A 2IHVA 3PRJA 4JA2A 4E3ZA 3W4KA 3RM3A 2YV2A 4MIOA 1KBOA 4IEIA 1NQTA 1GYRA 1XTRA 3JQ7B 4MQ6A 1XG5A 4TZ0A 2XCTB 1XZAA 1Z16A 3EBLA 3EG9A 1K5GA 2JW5A 2BAGA 2F3QA 4OJKA 4XTCS 2VT3A 3MAJA 2BF7A 4NJEB 3M1LA 1RRFA 5B6PA 5JJ5A 1YBVA 1R4MB 4PO9A 3MGAA 4AKSA 1COWA 3IESA 4U2CA 2HIMA 3HCBA 1W8DA 5AVQA 4F4IA 3SYMA 2JLVA 1BIFA 1OGIA 3FKQA 2GTIA 3ZVLA 3EEQA 4URUR 4EPTA 5KNCA 5IM4A 1V11A 1G8PA 3EVCA 4DA6A 1TM7E 3P7MA 1SBTA 1UBJS 3N3AC 4TKUA 4WTOA 2V55B 1FYFA 5BR1A 2EBFX 2OHJA 1W4AA 2AC7A 2W8BA 2B5OA 3UUWA 4BRSA 3DJYA 4J0GA 3KYDA 3AHGA 3FDZB 2BM9A 1GTG1 5D7NA 3TLGB 4N3AA 3GI1A 1J39A 4HAVA 4DC9A 5JXWA 2DF8A 2EFDB 2VDUE 1PSZA 1QKKA 1QRDA 1L4BA 2Z4TA 4P1ZA 3CZPA 4B3TB 1Z7EA 2O2YA 1OBCA 3WKBA 2NPOA 1N2HA 4MYRA 4JXZA 3CVUA 1LNQA 1Z22A 3FCAA 2BYTA 2OVFA 4EEKA 2GFHA 4DCJA 4D98A 1K97A 2D2XA 3H75A 1HDCA 1HFJA 3N1UA 1EGAA 2DFKB 3QTBA 4MXDA 4PHCA 3P5SA 1THGA 4N76A 2Q49A 2WAXA 4S35A 4CE6A 2CMKA 3F78A 1L1FA 2DLCX 1Z17A 2EJVA 2G6BA 1JALA 1GUZA 2R8EA 4KE8A 2ZYAA 1NBMA 4KSYA 3BG5A 2ZI4A 3DLHA 1BYUA 3WDMA 3L0OA 4OJMX 1UWCA 1EB8A 1ZRSA 1NOKA 2QTTA 3WLJA 3F47A 3ZIAD 4TOIA 3P9RA 5AUQA 3QVSA 3VPHA 4IZ6A 1AS2A 3D9QX 1DQSA 2WPDD 1X8LA 1DUIA 5LDGA 3DMPA 2IYXA 4HMPA 4KYVA 3GJXC 3NM6B 5FPPA 2Q9AA 2XMZA 2PRKA 2YJGA 4AS2A 5MN5A 5H70A 2PXCA 3PFIA 3A6PC 1PJ2A 2W8ZA 4MVJH 1YZVA 1WIWA 2X8WA 4QXMA 1ML3A 3DLTA 1E3WA 2D8AA 4RK1A 4P38A 1LC3A 3AEUA 4LK2A 2YZGA 2H8GA 1U98A 3ELDA 3UT6A 1ZGHA 2H4YA 2VCYA 4QDTA 4BE9A 5CURA 1XQWA 4TVKA 4QTTB 1LPOA 2WUFA 2IU6A 1N2JA 1SBHA 3TEFA 1AGYA 2BH9A 3GQVA 5JXJA 1ENYA 1RI3A 4LZPA 1XNHA 3KHTA 1XCOA 2COKA 1QTIA 4PSAA 3PD1A 5EUQB 1D2RA 3UAYA 1CY2A 4QLBA 4C4YA 2V65A 3OAAA 3EGXB 2QVZX 3WNZA 1AGNA 1JA1A 1PT5A 5B1HA 5I7VA 2FN3A 1KVRA 1NL3A 2PEYA 5ALVA 5DI3B 4G85A 4Z99A 4OKSA 3PA8A 4RA9B 1EJ0A 3K09C 3OU7A 1YAHA 3U09A 1U0GA 4DEVA 4DIMA 5IKMA 3C5WP 1WB6A 2I2AA 2VYCA 3MGGA 4GLFA 4BRZA 2DPYA 4FDLA 3F1KA 4MVCA 3MB5A 3P27A 5TQ2A 1D4AA 4TUYB 1F4LA 2PJDA 3NT5A 2ZI6A 3GRRA 1VDMA 2CXHA 3W8DA 4FPXA 4XYEA 4AJNA 4MR8B 3MWEB 5JVDA 4W63A 3SR4A 3ODPA 4QU0A 4JI3B 5HK9A 4PYKA 5GJBA 3OZBA 3GGPA 1NU8A 2XUFA 2E49A 2W6IA 1KJWA 1KVTA 4MROA 2ZJFA 4OHCA 1C3JA 5JAHA 3L7CA 1ND5A 5JZOA 1G6HA 5ALWA 4EJSB 1QV9A 2WBLC 1BSVA 2FR8C 2OFFA 4F3RA 3FOWA 1O5TA 3WGKA 2HPVA 3T3HA 1M7BA 4ZEVA 2QUZA 1DQNA 2LVBA 3SS8A 1D4ZA 4DV5B 2PPLA 2QPLA 3EXEB 1NN1A 3RUIA 1TF2A 2WICA 4BO9A 3A3KA 1H4SA 2B94A 4E5PA 2J08A 5K0GA 3V8VA 1L5YA 2VJBA 1QLWA 1R0ZA 2GZ1A 3SXUB 1XCLA 4ZO4A 5FTMA 1LPNA 2PMCA 2NOAA 1RHRA 4C5CA 4BL5A 3TQQA 2H2AA 5L6LB 5B3KA 3KNZA 4LV8B 4ZREA 2FLVA 4X66B 5AJHA 2A5YB 1Z5WA 4G81A 2MMCA 2PVSA 3JD4A 4LZOA 4EPWA 4XA8A 1YVDA 2GZSA 5B12A 1GNTA 2PS9A 2AQHA 4XQGA 3IO3A 1JPNA 1RBZA 3DOIA 1UPFA 3NH6A 4J7CA 1YRQA 2OE2A 3E3LA 3ESRA 3CW8X 4EEXA 4WCFB 3I04M 3L05A 1KRHA 3OZUA 4BQSA 1Y7PA 4YTEA 5AVVA 1M2JA 1XP8A 10MHA 3GJYA 1J09A 3PXGA 3E0QA 1WO8A 4QLOA 4OBBA 5A5VA 1LBHA 3OKFA 1K86A 1PD0A 3S2UA 2UUAB 4JLVA 1IVNA 5EE5B 3JY6A 1DAOA 2O7NA 3RWOA 3AT1A 1G8AA 4UFPA 2E55A 5BW4A 1NXXA 2GN4A 3DXFA 3M3HA 4GZMA 4HP8A 4BFUA 2CVHA 5C4GB 5TSDA 1T29A 2QJWA 2I6XA 2IU3A 2FF5A 2NUBA 3JQ8A 3OTHA 2F43A 2JIQA 2OLEA 4L4YA 4W1QA 3PJDA 2ZYSA 3AJEA 1NVAA 4LHSA 2HU2A 1TFUA 2ZRQA 5HZHA 3PWTA 4UHJA 2V4UA 4PW0A 1ZIXA 1WCIA 4K9KA 4L5IA 4H15A 2DCMA 1NY6A 4FU0A 3VU3A 1K1EA 2FN9A 4FE4A 5DLQC 3EFOB 2BF4A 5B2FA 4WBNB 3P2OA 3MT8A 4HL6A 1JDTA 2BONA 2NTJA 3HXQA 2C57A 2P4EA 1UANA 1N3LA 2Q6VA 4AG3A 4EG8A 5H8WA 1FYXA 3LC7O 4K0RA 3ZEIA 4KPYA 3JQ7A 4NU6A 3HXMA 1NV8A 4ESEA 1A9TA 1E1QA 4XX0B 3I5XA 4B3HA 3VJRA 4DEYA 3ZCXA 4JNCA 4P4LA 2IYLD 5ICMA 1GRCA 3E53A 4HDNA 3FLBA 4X97A 5SY6A 1QYDA 1M6VA 3FFAA 5J5VA 1FQKA 1JHZA 3DF7A 3RVKA 1GHTA 3BD9A 1QG6A 3DE4X 1AXEA 4MS1B 2XF2A 1KTVA 3PF8A 2LCQA 4BIMA 1UZLA 3T7AA 4UM7A 1Q0ZA 1JR6A 4G5GA 5KDOA 4FC7A 3WK6A 4QAQA 1UBLS 3A4NA 3ZY6A 3ELBA 2WMDA 3V48A 3U48A 2QVGA 2PNFA 4QVIA 4O4LF 1SWVA 2RC5A 5K8VA 3RAPR 1SOAA 3HXKA 3KXLA 3H1FA 1K7EB 1JHYA 2HA0A 3B9RA 5IHPA 4JT4A 4RDHA 1GIAA 5KC9A 1ZMOA 1HT3A 3MCTA 3BWBA 4C87A 3WO0A 2XOEA 1SA0A 1YOVB 1CZNA 2YZ7A 1UJ5A 4N65A 2H4XA 3C3EA 3QY0A 4LF8B 3LSYA 1PDWA 1IEXA 1XRMA 3EGOA 4A0RA 4BKQA 4EQ6B 2DETA 2GARA 4IJWA 3WFZA 4AB1A 4NXMB 4YRQA 4HDQB 2L0XA 2DECA 2DY1A 4XB6B 3TMYA 3HP7A 3QH4A 5GONA 1GGEA 5JWRA 2Z8XA 5IFKA 5IVHA 1G7SA 2H6EA 2PN1A 1JPJA 4HJXA 4ZMSA 3FDFA 1RM5A 1TAHA 2TMGA 3GQBB 3TSCA 3WLIA 5LYJF 4XARA 3C85A 3LBYA 4ISCA 3WK7A 3PNYA 5KTNA 3IBCA 3TKAA 1IQPA 1VLQA 4LKOA 2Q21A 2HF9A 2XA2A 3EIFA 4HI0E 1XDWA 3QK7A 5AVRA 4JGGA 2ZAGA 2VK1A 3SHFA 3LSTA 1JFTA 4UE6A 4IHKA 1WCIB 4L28A 4MQ5A 4O1MA 2Q1SA 4OK6A 2A35A 4MUGA 3URMA 5C34B 1YQUA 4PQRA 2ZJ0A 3FH0A 5SYNA 4MW6A 1C29B 2ZAIA 3THYA 3TQOA 4LDPA 4R3WA 3OECA 1YI1A 1PJTA 1Z38A 1C3XA 2Q6KA 3W34A 5JW6A 2LBPA 2QA5A 1GKLA 4TRJA 5FFFA 1DKMA 1G21B 2YTZA 3HO8A 4TMWA 2UZ4A 1H2AS 1MOPA 3R2JA 5A7HA 1KXJA 2DFLA 5KNLA 2CV2A 3SKYA 1ABEA 4IIEA 3WLEA 1AKMA 3DHNA 1Y81A 4MCJA 3H6GA 4PZ0A 4OK5A 1JI0A 3ZZUA 2YWJA 3H9BA 1X1RA 2I5PO 1UF9A 3DZDA 1XL0A 3LUPA 4Z49A 3H84A 2EZ4A 2KHZA 1OI7A 3ZN2A 1LNSA 1IY8A 2XB4A 3VR3D 3PTAA 2V98A 5IFLA 1W4ZA 4MKRA 1ZPDA 2FZKA 1Y33E 2WVHA 4UASA 5A6SA 1Y3DE 4HDKA 1G5TA 3TI7A 1ONPA 3AJ8A 1KAHA 4DUYB 5AM2A 2DVMA 4WFIA 3JATB 4MO2A 4UREA 2G0TA 4YUVA 3D0KA 5E2BA 1U7UA 4CM4B 4DDMA 3OZDA 3P0JA 5LP6B 4B17A 1K2WA 4EVIA 1V5EA 3ZBQA 2CNWA 2E4VA 3HBLA 1EWQA 1PS0A 2AOWA 4HDRB 3RYHA 3UA3A 4MRMA 1C7QA 4EO4A 1NMSA 1DXQA 2OPHA 4ARZB 4RDXA 2Z2YA 4ZHQF 2V8OA 4RPKA 5AKZA 5DNCA 5JNSA 2JHCA 2A5DA 2TMYA 3RW9A 4EITA 3AUKA 3TOXA 1NFFA 4B5LA 1Q1QA 5CAEA 2P40A 5L8VA 2KE5A 3M6AA 3ZDBA 1NW7A 5C8YA 2CF5A 4IHAA 3LCMA 3RG2A 1L1QA 1VDZA 2OV8A 4YPOA 3OPMA 3FDXA 3PNPA 3GLGA 2GZHA 4ZGBA 3KPUA 3IQIX 3VR4A 4P33A 3BB3A 3TW4A 4H7PA 4EUFA 2ESRA 3RS8A 4YT2A 4JI8B 4U8GA 1CHNA 3L79A 4CXMA 1LCIA 2BD0A 1QVWA 2GVDC 2ISCA 3H19A 2QD2A 5H81A 1XYGA 1GWNA 5H5JA 4DVGA 2O3UA 5KX5F 5AESA 1AKEA 5ER6A 1MV8A 1U5CA 3WP1B 1PJZA 2XADA 1GPLA 5ETJA 3R8FA 3T5CA 2CXPA 3BL5A 4J0IA 4OHZA 1ABBA 3ZXUB 3P52A 4QTUB 2H3HA 2N1MA 3NKLA 2AFIA 2VCHA 3HVIA 1VP9A 3CKKA 1MXFA 3LDFA 3R9IA 3R3WA 1G17A 2W0SA 4HAUA 4E5MA 4GSLA 1Y5RA 1P8JA 4PZ9A 1DDOA 3JSXA 5IVDA 2XVZA 1EI9A 3OZAA 2YRFA 1E96A 2PZAA 3Q2OA 3T12A 3ZDFA 3VYVA 2VP9A 5L3VA 1TZJA 4UVDA 2PSSA 1W5AA 3DZBA 1MOQA 3N58A 1G5HA 3DEAA 2WW8A 4LQCA 4PZPA 3J80A 2PRJA 4KYUA 3K8OE 3GFVA 3MWJA 4I9GA 3WRVA 1Z56C 3MJCA 3EEBA 4Z8XA 4MGZR 3STYA 2QN6A 3SSNA 3ZW8A 1G21E 3E23A 2W6PA 4ZFNA 5A4KA 5BXYA 3OQJA 3P71T 4KUGA 2W4QA 2QY9A 4MH0R 4FXOA 4KBFA 4LBVA 4R7GA 5KVAA 2I22A 4BX0A 5AK0A 1Z47A 1L4NA 1OFIA 3RUCA 1Y8CA 5BWNA 2PUEA 4RH3A 4KJXA 4ZQIA 1U4NA 1N3YA 3PNVA 2P9BA 1ULAA 5E6RA 3WWEA 2FUEA 2R6ZA 2PLAA 4EG7A 1N9GB 2FSGA 1SZJG 3B89A 5KSPA 4LVNA 1GARA 2R4UA 4QUDA 3X1XA 4XRGA 5TGTA 2P7HA 2GK3A 2ZS7A 4GOOD 1KI4A 1P7ZA 3AQIA 2PTHA 4LZAA 2PUJA 3DBRA 2VQEB 4L0DA 2QUJA 1ZVJA 3RTGA 1ZMXA 3QLUA 1L7PA 2LZ0A 2B3DA 5FBLB 2C4VA 2ZYWX 5FNVF 1B6GA 4C30A 3NQ41 1EJ2A 4P2GA 4CM8A 4PYQA 3L82B 2O6LA 2AUNA 4GG1A 4X61A 2AMFA 1CIPA 3QNUA 1X14A 4W1PA 5TMDA 1EFCA 4X63A 4E46A 4EIWA 4GI2A 2PTGA 1JHXA 4CUJA 3AVWA 2HPAA 3VKGA 4KHPB 2AYZA 1ZH0A 2ZWPA 3E9NA 2YQ4A 1DAGA 4C7KA 1Y4DE 3ZTTA 1PBNA 4IWYA 1GN8A 4DM3A 2FDRA 3DWEX 4S1PA 3VZRA 4B82A 1XEAA 4L02A 2Q6LA 1I4OA 4D8XA 1CZLA 2HCBA 4TN1A 4BGUA 1XD9A 3JQRA 5HX7A 1PRYA 4QNRA 5IBQA 3FSGD 4NESA 2QD3A 2OYRA 4PBSA 3TUIC 1P5RA 3O75A 4INAA 3RHSA 2NTEA 4WKBA 3AX6A 3G88A 2WB4A 2XY4A 1I4DD 2X13A 3K2QA 5SZIA 3U3RA 2PUVA 3HR4A 2J0VA 3DW1X 3HYCA 1V11B 1YWGO 3RVPA 1N25A 2FGJA 2ZR8A 3NRCA 3JXEA 1N34B 2QUKA 5L40A 1QUFA 3RJ5A 5LN1A 1CRPA 1SBQA 1B26A 1P1BA 1NKVA 3PNLA 5H3LA 3HCWA 3R0XA 1C9KA 4I1SA 5HBRA 3N8IA 3BGIA 5BV0A 5BSVA 4NVRA 1C0IA 4IXDA 3TL3A 3HUTA 2QLBA 2V0NA 3N6VA 4UXIA 2GLUA 5LMNB 3WQRA 1KHHA 2EERA 4RLSA 1PJLA 3ED5A 2R00C 3SJZA 1RC1A 4Y2VA 3L02A 3VU8A 4DANA 3RTDA 2LRHA 2GN9A 5G1OA 4AWBA 4ZJZA 4ZOQI 2NG1A 4KN9S 3ZQUA 4LJ8A 2YMQA 1XT6A 4C7XA 1RQRA 1OT3A 5B3JA 3RC7A 3ESZA 3UJ9A 1A1VA 2O3QA 4XQ0A 5K51A 5E3HA 2QYSA 3T54A 3HC7A 3NV7A 2O8NA 1EWYA 1U1EA 1UIMA 2IXTA 2R1UA 1NBEA 3NDPA 2WWHA 2OAP1 5J9FA 3KG2A 4IUCS 1YQWA 3R24A 5HRAA 3C6ZA 3OOSA 3P0EA 1LLCA 4DPKA 4GDFA 2HWYA 1CQWA 2MTBA 3O84A 1Q6YA 2PO7A 3LYHA 4R8MA 2X2FA 3MINB 5FLEX 3HRKA 4B44A 3F6PA 1QXSA 3TNFA 4QQ8A 5IKXA 2BCEA 3P9IA 1S4QA 2IYQA 4H6XA 4KX5A 3ICPA 4R83A 3CA8A 1SHJA 5EGNA 4MUNA 1D6MA 2OGSA 4E5YA 3UJNA 3Q1KA 3H5OA 2BBOA 3BUSA 4DYDA 2X4GA 3OIGA 1BC5A 1SCNE 4M98A 4GNKA 1DKOA 2H1LA 1C9NA 2NVUA 4HH3C 2FPMA 4LYHA 2RGXA 3GJ4A 2H1CA 3O82A 2CCGA 2Q7XA 1UJBA 3PUZA 5JO9A 2K6GA 5LR6A 1M66A 1T8TA 3G9UA 2KWIA 1FFSA 2QTRA 2W2OA 4C4RA 3K0KA 1DAFA 1OLOA 2CXQA 2ECQA 4HZUB 3SZ3A 5HZGA 3F8WA 2ZATA 1BXGB 3HL0A 3DZKA 4ZXPA 4I8IA 2I6SA 4X1IA 5A4FS 1TZCA 3L6BA 2O07A 4Q21A 4WHMA 3BK7A 4WVFA 1TZBA 4KAFA 4J1QA 3JQFC 2P2YA 3EXAA 4B7XA 1P0FA 4QGFA 1PG2A 4HQKA 1XMPA 4P4UA 2JK0A 2IXDA 2XB8A 5PNTA 1KEEB 1W1UA 5LZ9A 3LKBA 1YE5A 3UWPA 3E5MA 1AUVA 1TAQA 1DAPA 5EWJA 1N5OX 1LTKA 1XFDA 4TV9B 4G1UC 1EE9A 4BNTA 4Y0VA 3IIMA 1BA2A 3FVTA 3ZCPA 2F59A 4FMCF 4L22A 4AJEA 2EKDA 2LNDA 4CTKA 3LTNC 5IM5A 1EWRA 2IQ5A 2IPAB 1U90A 2JFXA 1JR3A 1NW4A 1RWQA 3HI6A 1YVEI 2X9QA 3LMKA 3TAUA 3TLJA 1K89A 3OP4A 4RL4A 1GZ4A 2R7MA 1XTBA 3R7NA 2OCPA 2O7VA 1AZTA 3N39C 1OWNA 1HNNA 3IEXA 4XWKA 1N5IA 3UH0A 3ONDA 2ZE5A 3HDJA 3CPSA 2CE2X 2QMQA 3FPLA 1DX9A 1M8FA 3GRCA 3Q5EA 4TLMB 3IBGA 5KMGB 4EUEA 4R8SA 4OHUA 4CKEA 4LXTA 4MQFB 3WL7A 5A1JA 4KFSA 2PYZA 3RNLA 2C4MA 3G8DA 1HQDA 1O9GA 4FTWA 4MEAA 1IOWA 3AV3A 4Q18A 3KJIA 4Y1FA 3ZNNA 4GPD1 3COWA 4QFMA 2Q5CA 5CFMA 1XTIA 3PGLA 2FMUA 4IFTA 3OHMA 2AOXA 4KO8A 4L1KA 5JHGB 1T8WA 3GPCA 3PQDA 5GONF 1YR2A 2ES4A 2P8SA 4HRVA 1MO5A 5FUBA 3SF8A 3ZGVA 2PUHA 3HSYA 3NNSA 2FZLA 2F1KA 1P44A 2JHGA 3AGPA 2Q3CA 3ZH2A 2XVXA 3OI7A 5AKIA 4ZVSA 4D41A 5JS8A 1U8CB 2G25A 4CLXA 1ATZA 5TDHA 1D9XA 4B3JA 5DEOA 5BN5B 1WJGA 3D3EA 1Q0LA 3GG2A 4PGFA 4WNCA 4N01A 4O8CA 2IT1A 4PE5B 4DDUA 1ZLYA 4TQUS 2CXNA 5AHXA 2ISSD 1DIOB 2EEPA 2MYTA 5AKXA 3EPRA 1C5KA 3A1FA 5B7QA 5KNBD 4A2QA 3BQNB 2PX0A 5C53B 1N8SA 1GGKA 2I7TA 2QAGB 2VF2A 4ADSG 3BT7A 1DPGA 2A9FA 1E6KA 5AH0A 1MENA 3NIFB 4PQGA 1JHQA 1PTKA 4FDMA 3EZGA 4MVJA 5E38A 2YCBA 3ZGLA 4M3NA 2J6HA 4M86A 2OXIA 1YONA 3VYTB 2YYZA 4RK4A 5CM2Z 5H9VA 4B3DA 2CVPA 2HQOA 3PGXA 5BWLA 5TVKA 1NUUA 2PGNA 4LY3A 4N47A 4I55B 1NOJA 3M49A 3LT5A 3P45A 5GIPE 2IEYA 4Z7QB 3QJYA 3RUFA 3DE0X 1A04A 4UCWA 3GLGE 2ZKIA 4CTOA 2JD1A 4JBNA 3UTDA 3ZGNA 3LIIA 4G1VA 4C4ZA 2IZ0A 3F0TA 5B2ZA 4C0QC 5JQGA 4R1TA 1BKSB 1VCNA 3IR6A 4IJQA 4WI1A 3VZQA 4L2IA 3A1VA 3IB3A 3SHQA 1SUFA 1UBUS 3DW3X 4GZ3A 4L4XA 5H7XA 3T1VA 3HN7A 2HZ7A 4A26A 4BQPA 3NMUF 4OXRA 1C9YA 1JEQA 2P2LA 4NEQA 4NONA 5FEUA 1OLUA 4TXJA 1HPLA 4PSVA 2COUA 3SK0A 3IUEA 3EVTA 1DAIA 5EJ2A 1YB7A 3H42B 1X13A 1XLVA 2VNHA 1FA9A 3D2BA 3UJHA 2C8VA 3M9LA 4BS9A 1VXRA 3D2CA 4K8RB 1YRBA 1PNOA 2WVAA 3KEOA 1H66A 1XRLA 5EZ6B 1GQQA 1IATA 3V46A 4EZBA 5LVAA 2C4UA 5A5DA 1FSSA 4IHQA 4ESHA 5KOIA 5JXGA 4JQZA 5F98A 4YRIA 2IYPA 3CURA 1XXHA 2DHQA 3BMNA 4JU9A 3KYIB 3AB3A 4E5VA 4FFBB 1JIIA 1T3LA 2ENUA 1DOHA 5I7SA 1J6UA 3VOAA 1G60A 2FW1A 2GRJA 2PT9A 3JQ9A 3WMGA 2NMVA 3PCRB 2WOJA 4MNTA 2ZSUA 1XL1A 5ISMA 5IDWA 3I05A 2EEZA 5T5QA 3VR2A 5KQPA 2PX8A 1KH2A 2UKDA 3G6WA 3H4MA 2J3EA 4KAXA 3FOZA 3Q7PA 3U0VA 4AIIA 4IDOA 1JVBA 4CRWB 5H1YA 5B7PA 4JV5B 2G4VA 2CHFA 1EFVA 3L7NA 2OG1A 5CP8A 5LKAA 5IP5A 3FNFA 1QP8A 2FLWA 3ZHOA 3B38A 1P29A 2NIPA 4HLDA 4JP5A 3K96A 3KBOA 1K8ZB 1QMGA 3GWZA 4R9SA 1T8UA 4M1MA 5TQ2B 1Z29A 3WYDA 1TZKA 5CFOA 3L77A 1E94E 1KZHA 3AERA 1WLSA 1H3FA 1QH1B 4RD3A 4WBSA 1DXOA 2Q3FA 2Z56A 4K9LA 1IIRA 1DJQA 5FLYA 1C2YA 4QUAA 1BX0A 4G1CA 1VL6A 3QPCA 1J0BA 4NQZA 1E2JA 3C8UA 2P4UA 4POAA 5JFGA 3DT9A 3TK1A 2QE7D 4W1SA 2JCVA 4YBZA 3HMKA 3OESA 4R2XA 2JASA 1U9CA 2LGJA 1G7RA 2O2DA 4MR7A 4PAGA 1OFVA 3FVQA 4CU5A 3NW9A 4Y67A 1GG8A 1FTWA 1ZWLA 2BGGA 1Y3FE 2PH5A 5IC5A 4WFJA 5ALDA 4C7MA 2WTAA 1AQIA 3RS0A 2Y67A 2H9AA 3SDSA 4B85A 5FL7D 3NHSA 1JT9A 2Y3IA 4HEA6 4XGNA 3KB8A 4N0MA 4PLZA 1WSDA 2VFAA 4EENA 5KEIA 2ZOSA 3LBIA 3N87A 2XGMA 3RHFA 4H1WA 2BMVA 3I73A 2ZRFA 4S3MA 1JJFA 4BO8A 2B4RO 4OFWA 3B53X 3ABIA 1N8KA 4K5QA 3ZCTA 4BO2A 4U7HA 4ZI2A 4S1NA 4WT7A 4ACBA 2OY0A 5EFOA 2CY0A 5JSYA 3BM5A 1QQBA 3LXUX 4NCHA 5CCBA 2D4HA 5JEDA 2EGHA 4IY1A 3WLSA 2PMKA 3HJRA 4XX1A 1O95D 4BNJA 4ZZIA 5A9RA 4MR9B 1FE8A 5FBHA 1JQDA 3ZE1B 4K05A 4EA9A 2PUAA 2Z2IA 3UT5A 4GKAA 1IPFA 1VCHA 1YBAA 3JQAA 2Q07A 4TRNA 1EDDA 5KC8A 3G9TA 4M4SA 3GL9A 1U6JA 1UMBA 1UCFA 4XVHA 5I9LA 5LQRA 2JA1A 3UCFA 1JVSA 1K8XB 1LBTA 2QJOA 4ZO9A 1KGDA 1LVHA 5AJUA 2C98A 4TVOA 1AM4D 2JVJA 1QNLA 5JDIC 5JR3A 3AVVA 4EDFA 2JCBA 5AW8A 2REQB 3MJDA 4YRLA 4ZOLA 2YHIB 3D2AA 3F7OA 4G8JA 3W77A 4XEUA 1PUJA 1U0TA 1VHLA 1FW8A 2DSTA 3BX1A 5FXMA 2BFNA 1LEHA 2ZCUA 2X2OA 1AKYA 2OENG 5CA1A 3OD5A 4K6CA 1DBVO 3QBEA 2R8XA 4LF4B 4LHXA 2VWHA 3MVEA 3OO0A 3IEIA 1A2QA 2VZ8A 1V6CA 3L46A 2EQ5A 5BWOA 2YHIA 2DMRA 2VDOB 3DVLA 5C0OE 2HK6A 2O0KA 3MRXA 4RVFA 3PE6A 1S89A 5HRCA 4B83A 2P77A 4DUZB 4HAYA 3UA4A 1NXSA 3KTAA 2ON6A 2BSQA 1BFDA 3HBFA 2X19A 3QXHA 4Y1RB 4YAJA 3JQGB 2NT3A 3C2QA 2AMJA 1EGMB 4X8LA 1MO3A 2IUEA 4J7UA 4QBKA 2NU7A 3FZYA 1R64A 2G7ZA 1E3QA 4JSTA 2BFPA 4YMWA 5KNBA 4MB6A 3MTEA 2XGOA 1KDTA 2QMEA 3D54D 2BW0A 1I6LA 3DO5A 4FW9A 5ALTA 5JNRA 4JLOA 4H0FA 5D1HA 2AFHB 2I29A 3MA0A 3A1DA 2YVQA 1HK7A 2D74A 3A70A 1XX6A 2NN3C 2NZ2A 4II7A 1WSWA 4D79A 3C7CB 3RSZA 2HHLA 4JLMA 1G20B 3ODGA 4GZ6A 4U8HA 3R5TA 3WADA 1H23A 3I64A 3IJEB 4N6NA 2BEUB 3ZK8A 1PL0A 1NASA 2XEDA 5EQDA 4ETNA 4RHFA 1V6AA 4WOCA 3ZWYA 3RK0A 3NPMA 4RZQA 4DREA 1JU9A 2XXJA 1NYQA 5JJCA 5CNJA 2R8BA 2Q8QA 5GTDA 4TV8F 1VPWA 4J1NA 3ZHTA 3S1SA 3GT0A 1YASA 5JG7A 4ZAVA 3BSWA 4H2DA 1MG5A 3MAGA 4LI0A 4UCQA 5E95A 4GKBA 5HZMA 1TOAA 1XQ1A 2E3JA 2R47A 1N6IA 2XTZA 1R0RE 3K31A 4ZALA 2OWEA 3EXFB 3RRXA 2ZAOA 4HDRA 2AVNA 2I3AA 3I9JA 3RYHB 2AJTA 4QYSA 4TUYA 3CH5A 4MW9A 3UWSA 3FWYA 1D2CA 3H2IA 3NFRA 1P0CA 4GP9A 4LJKA 4WADA 4F85A 2X86A 1CJBA 4GXTA 1T9KA 1WXEA 3C98A 2O52A 4GI3A 1OLXB 1XK6A 3VC1A 4F6LA 1QK4A 1Q1AA 2G3YA 4L9SA 5JS7A 4CL2A 4WEQA 4HTAA 4PPNA 1GLNA 2P91A 4UQPA 4NZOA 1E5TA 1RHKA 2P6OA 3CRW1 4JFRA 4ESOA 5CA0F 1N5JA 3IP7A 4ZDWA 4R31A 4RJTA 3UGJA 1JJIA 4Y2UA 2ZE6A 1R15A 5JS6A 2WR8A 1YNSA 4X94A 2CNNA 1GU1A 1XZBA 1E2UA 1P0PA 1RMQA 1V95A 1W1WA 2AXQA 2X7HA 4J0HA 1H0SA 2EKLA 1CYEA 5ALPA 3FTEA 1T43A 1P2DA 8ATCA 2XDYA 4IGIA 5E2AA 5CFRA 3DLPX 3QYAA 2AG1A 4B3GA 1Q16A 2GERA 3GPDG 3HJUA 1UM9B 5DX8A 5F5XA 3N7TA 3KX2A 4CEHB 1DRVA 2ZRDA 4P31A 2QN9A 2ZQYA 1E3WB 1O96B 2E2WA 3DM9B 3O47A 4N8DA 3TOVA 4DJDC 3UY4A 3NJ4A 4NCIA 3IO5A 4JJKA 5FTJA 2WKSA 2ZUVA 4Z9FA 3UJ6A 1L5RA 1DEOA 3K94A 4CGYA 4G4IA 2QQ5A 3IX7A 4CI0B 4JT2A 4DG5A 5K09A 1V26A 3U6BA 3HJFA 3N2NA 3TTTA 3OHPA 1TQ2A 5IW8A 3QNWA 3SVLA 3KLMX 3NHMA 2XT9A 1Y6QA 3F7NA 3VM6A 1X7ZB 2DH6A 4D0SA 5EMLA 4ZHQA 1H85A 1Q19A 3ILYA 4DR6B 5GVSA 4IIBA 4N18A 4RABA 2QS9A 5DI3A 4BV9A 1AQYA 2DLDA 2DZDA 2W2QA 4TTVA 4YMVA 5A3JA 3FSEA 5EJFA 2D00A 2N47A 1AKRA 3GFQA 2V3CC 1CQJA 3SLRA 3W2IA 4FBLA 3T7EA 3H0CA 4UM9B 1G2QA 3OE4A 5CYFA 4Q3CA 3A6ZA 2VA8A 2H2HA 2JGRA 4KQ1A 1GCIA 3FZEA 3LRTA 4QREA 5G0UA 2FQQA 3CEAA 2GPJA 4WZ6A 2PD4A 2ZBRA 4QQKA 4F92B 3IA7A 4HATA 3W6UA 4LDQA 5L53A 2D4AA 1WHSB 3HYLA 4BO7A 4Q1FA 5DTMA 3WMRA 1NW9B 1RACA 1UBGA 3JZFA 3QRWA 2ZWOA 1MX3A 1PEKE 1N6LA 1NM5A 3HXLA 3IQFA 2QJTA 2AI1A 5BYJA 1U31A 2PUGA 2VK4A 2V7EA 3RUEA 5C1OA 3EQ2A 3LP8A 3OOWA 3KHUA 3V4OA 1TIBA 4REQA 5FJIA 1RXEA 4D9MA 3O3NB 1ZGGA 4M7OA 3KKMA 5DBHX 3UOWA 1SPXA 2HRCA 3JAWB 4DLTA 2PPVA 4OAOA 4OP3A 4K0KB 3W6PA 3FRJA 1O03A 4JH0A 4IIGA 1U0LA 2PUFA 1JJAA 1LSOA 1BNCA 1Q0RA 5EHQA 4IYRA 2F17A 4DR2B 3CRNA 2V4MA 3RO7A 8GPBA 2YYSA 3SE7A 4F04A 1T5IA 3S1LA 5GAJA 5C7IO 5GV8A 3NUGA 1LDYA 3E2MA 1A9SA 4RTLA 2QD5A 4V0MA 5ILQA 2CV0A 1P1RA 2ZSKA 1Z13A 2UZAA 4ZVOA 4JZYA 2BMWA 2HXYA 2XW6A 2W93A 1PWXA 1XTQA 3MT7A 2R2GA 3QVWA 1ULUA 4O1IA 4PS0A 5HDBB 1R0BA 4BB0A 5E1BA 3I0ZA 4EJ2A 3V7WA 1V71A 3GZNA 4P8RA 4TLAA 5IXJA 4EMUA 3H5RA 1XZJA 3KM0A 2ZUUA 3WL8A 2EX4A 4O2LA 5K8IA 5DZSA 3FVWA 1I6KA 4FNMA 4KPUB 3LG2A 3DVSX 3OEED 2VR1A 3Q9NA 4D9CA 5JAOA 4TMTA 4URFA 3PL5A 2VQ6A 4JAVC 1E7YA 5J2UA 1Y6ZA 4F97A 4J3FA 2XYPA 2IYEA 1G64A 3KD2A 2IXFA 4B6EA 1RADA 3EHEA 2VPPA 4FYKA 4BTVA 1SCKA 4HS4A 3PR2B 2R1VA 2F43B 3OPYB 4K86A 2PX3A 4OM7A 4TZTA 1ISHA 3VU1A 4KR7A 1EZZA 3E3MA 4TV9A 4KI7A 3PDIA 2A30A 4LMAA 3KQOA 1NVUQ 2JARA 4NOKA 4ZOLF 4ZOCA 2GAOA 1ULSA 2P2ZA 3HSSA 4OBEA 1LF0A 1HKUA 1OFUX 1EUDB 1WY5A 2G40A 1L5HA 2OB2A 4FMDB 4G0NA 5TXGA 3U13A 1LSUA 2WIFA 4NMMA 3AVXA 1B43A 1M2GA 4TTAA 4G0ZA 5AI9A 2NXNA 3NTOA 2YHUA 3OWHA 2FSVC 2YASA 2CHUA 1VJTA 5J4KA 2GASA 3DKIA 2BFBA 2HRQA 2CDNA 3GA7A 4R8VA 1EPUA 5ALKA 1QQTA 3G9XA 4NHEA 5E7QA 2FSVA 2I4RA 4QWWA 1RBYA 3N2IA 3GGGA 2HREA 4RMNA 1ILWA 4MVWA 2GZMA 5BUQA 4H7FA 3Q0EA 4CMCA 1Y1KE 2JVKA 3MWYW 3R0ZA 3NBZC 3NUZA 3F49S 1ZIYA 3HE3A 5KOHB 5MN4A 4Q4AB 1Q50A 2V3VA 3NYWA 3TRFA 5JMOA 4BY9E 1D8AA 3JWJA 2ZIXB 2I54A 1N3BA 1O08A 3QVGB 3F3SA 1ZN7A 4BWYA 3N86A 3CZCA 4M0LA 1VKHA 2HF8A 4IDPA 1WM1A 2ZBVA 1NIPA 4EY8A 4TMYA 3CX6A 1PYDA 4EHFA 3R5HA 3EMDA 3AEUB 3PQFA 2CKDA 5DCWA 1ZMTA 3CNEA 3P2KA 3O2SB 4ERXA 3MTBA 1VCOA 3GD5A 3OEWA 3PC8A 4IOJA 4B3IA 2X1HA 3H8VA 1NVFA 4A2CA 4PLPA 2J0QA 2ZBUA 3BWXA 4IIUA 1M6EX 2PBRA 1V48A 1QPBA 5DXAA 3DBVO 3FX2A 1WXIA 4B8ZA 1KAEA 2B4AA 1A5SB 1ZRNA 2G63A 2HMWA 2JEZA 2W71A 4KQ6A 4WAUA 3VX3A 4AECA 3HM9A 3GGJA 3TIXB 3CWCA 4CCAA 3A14A 3USES 4RPCA 2NZXA 1ZJ5A 2XJ4A 1G5FA 1PFUA 4H1HA 2H17A 1IH8A 1B16A 3PBKA 3FD8A 1E9EA 1C30B 1GGHA 4CG2A 2RJ3A 3OX4A 3KLPX 4YAWA 3LHKA 4BPBA 4DUGA 4EJMA 4K40A 2YBEA 1VG0B 5EIWA 1QZTA 4EYEA 1FMLA 4WNIA 5DTIA 4DNXA 2QTGA 4ITUA 3KQWA 3OA0A 2JGIA 1XTZA 1F4PA 2GK4A 2P6NA 3CIOA 5AK4A 3SF0A 1DDIA 1ACLA 1JA9A 4M0CA 2JJ2A 4OPMA 2HU7A 1XEWY 4ZI7B 4R81A 1EVZA 1SG0A 2IDJA 2IPLA 5ILOA 2GCGA 4N1AA 2IPXA 3Q40A 3GRAA 3R23A 4GT1A 3JD0A 3JQEA 4LYAA 5IWCA 2XA1A 4R9NA 3HM2A 3AIMA 3D4BA 3RSLA 2K2WA 4U1RA 2R00A 3E5NA 3L1VA 2X5KO 3HKEB 1H6AA 1US8A 3OH8A 2WV7A 4GUDA 3QVKA 3O8DA 3CR7A 4BFVA 2NUTB 2YIVX 5HUQA 1FLDA 3IAM6 4LHEA 4WZBA 3CVWA 1GL6A 7MHTA 3F8SA 3ZUPA 1TUIA 3WY9A 1R9GA 1RIIA 1RKXA 3EBOA 1L6RA 3JW8A 3T7CA 4JI0B 1SG9A 1RJ9A 1UT6A 1Y8QA 2HSWA 3A2LA 5BW8A 2IH4A 3R3ZA 5A4DA 1CY8A 3SFZA 1PEYA 4D82A 2R1ZA 1X9IA 2J33A 2YFHA 3AEZA 2GEFA 1RD4A 2ODNA 5AHWA 5E1MA 2GM5A 2P5YA 4UUNA 1VSUA 3PHJA 3QI2A 5CFLA 3AKEA 4KFUA 4UAUA 1QIHA 3D1LA 3STWA 2I99A 3PQCA 2Z5VA 2AIRA 4U0JA 3RANA 1QU2A 4IXMA 3KE8A 2GFIA 4FQ5A 1NR7A 1L4GA 4YUZA 3W3AD 4EL5A 5KJ1A 4N7BA 1BU5A 4ALIA 1ZM3A 2WKQA 2GBLA 2OC4A 3CV3A 1HOXA 1P81A 2GNPA 3HDQA 3LXXA 4M0KA 3G0CA 1U04A 2O8VA 3LBHA 3C6QA 3ASYA 3OJCA 4YUYA 1JG3A 1PAUA 1QTNA 1EFPA 4QUGA 1NNI1 4D0NA 3R9XA 5CG1A 1GPDG 1MG0A 2J4DA 2P3OA 4ALLA 4KO1S 1RQXA 5KVQA 4GSYA 1DC3A 3RTBA 3W9UA 3CF6R 1TUBA 4C2TA 4NFHA 1H1LB 2B9VA 4L51A 5BSMA 1JL3A 5LD2B 2OORC 2R7NA 3WDKA 4UARA 4BO3A 3SSOA 1U2RA 5HM8A 4YFVA 3FRHA 1OH8A 3UV3A 3BB1A 1VJDA 2VBFA 5CK5A 1IHYA 2Y99A 4LMRA 4FHDA 2RAPA 3HU2A 3ZJUA 3U7EB 3R41A 5J23A 3O4RA 5EWLA 3FTPA 3TZHA 1W581 2J9RA 3CIFA 2XBMA 2R85A 1FRZA 2GZ3A 2DHDA 3QJGA 5KWEA 1L4HA 4KR6A 1JEOA 2XYGA 2Y0BA 3IVAA 1UBMS 1YB1A 4RLQA 1KO8A 2HFKA 4DDHA 3A6GA 4JXJA 1XTVA 1YR8A 2ZTVA 3MRSA 5F78A 4ZOAA 1YQEA 4NBUA 1EP2B 2ZIZA 1WD7A 1U3WA 2W98A 1JS1X 2YMLA 3LUHA 4LOLA 2IV3A 2B98A 4Y2YA 4AMZA 5LSAA 3JWEA 1IZ9A 3A36A 1D2AA 2O4CA 3EUWA 2GI4A 4BNVA 1FXUA 3FWKA 2XOKA 3QVLA 1ZR4A 1YZUA 2H5JA 3MGKA 4GEKA 2HLDD 4R6XA 2FAXA 4ZVVA 1ODFA 1PVVA 1SMKA 1USIA 1JJBA 4GF5A 5IT9A 2YR0A 3ZJYA 3NBUA 2ZSFA 5DKFA 1YACA 6AT1A 2B4TO 5C35A 5FPTA 2JLXA 4P98A 4NE7A 3HLYA 2ZYIA 5CLGA 2ZITA 3THYB 2FK7A 2NZVG 3LBFA 2VQFB 3ZJVA 2IHKA 3HHPA 3P8ZA 3OZXA 4DSUA 1GG9A 3KR1A 4ZIRA 5DGXA 3LVRE 4G65A 1E9CA 4OHRA 4ALJA 4YXFA 5KNCH 4AVYA 1WSAA 2F4VB 3V7NA 3CZRA 4DB2A 1XVVA 2LR0A 3IAFA 4DS3A 4QKQA 1EGHA 2IU4A 4C1NA 1KSFX 4ITVA 2VNSA 5C8ZA 3D4PA 1JFFA 1NQWA 3AOEA 1LNZA 4KE7A 1KO5A 3THWB 2GWHA 3IIJA 1JLLB 4FFPA 4HVLA 4I5GA 3CVJA 4OHYA 1YVRA 1JV2B 1PX0A 2AN1A 1BHSA 2GN1A 4U7PB 5JCOC 4B40A 1XTJA 4IGEA 4NS4A 3UHFA 3PQ6A 3RS9A 5BNTA 1P9NA 1W5EA 4KEAA 2ROQA 2ERYA 4G1EB 2IYSA 1GQOA 4F45A 2PZGA 4MRMB 5DU2A 2FMTA 3CRMA 2IHBA 2FW0A 2Z1DA 1B2LA 2HMAA 3VYWA 3LYLA 5I5EA 3V2HA 5JSZA 5JS1A 1UC8A 3M6MD 3PGMA 3TQCA 3NP7A 4TYQA 3L4SO 4UVGA 2DPXA 3K32A 2A9VA 4V0RA 2JGEA 2X41A 4YH1A 5LYYA 1BW9A 1IBRA 3OG9A 3EOZA 2GJAA 3PTLA 5FNVB 4U9IS 3BORA 3MS7A 2ZSIA 2L18A 4XI9A 4DXHA 3V7UA 4R51A 1OI4A 1Q7EA 2SECE 5TEVA 5YASA 3I23A 1DI0A 1G9SA 1ZL0A 2CNWD 5AI4A 5K0LA 1C7EA 2HZBA 4O4JB 4QBGB 1WV1A 2ZBQA 5SZKB 4YJHB 1JZSA 2D3TA 4L4UA 3PRHA 4ZJYA 1XD8A 2YFKA 5JOQA 4AY5A 1JQAA 2Q5HA 1R27A 2HQRA 1I13A 2G9UA 2HNBA 2CLMB 3IJPA 3P9QA 4BKRA 4BFSA 2NP6A 3GMSA 1RYBA 4RVSA 2JGFA 1X3LA 1RNLA 4POOA 1WF3A 4UU0A 1DLIA 5GV7A 4F86A 4M1TA 4OKNA 2G28A 5DRTA 4I14A 3S5JA 3NVKI 5TLSA 3H2GA 4GXNA 4K26A 4YNBA 4YP7A 1N5MA 1C3EA 3HCOA 4KPUA 1KXZA 1FXWA 2P1ZA 1Z6YA 1Y1LA 1K3TA 1QO9A 1W0KA 2FEKA 1TRHA 3UKJA 4DARA 4NS1A 5CFPA 1Y1PA 2ID8A 1AMOA 2EL9A 1RI4A 2GTHA 2IYYA 1VMDA 3QF4B 1C1DA 3DDUA 4FOPA 1H5UA 1NXTA 2BI8A 2XDQB 4LDJA 5FOTA 3VSDA 4EF6A 2JJYA 4D6YA 5LA6A 1OBFO 1RI5A 1ELOA 1A8HA 4AP6A 3ADBA 4DNPA 3A3OA 3B7GA 2ODWA 1E5DA 3GJ7A 4FUTA 3VR6H 4DZRA 4M7WA 4ZZ0A 5LWHA 4R3UC 1C7JA 3LQYA 3PQ5A 1U3GA 1T4BA 1WMSA 1XVLA 1IN7A 1R0YA 1YKFA 1SU7A 2P65A 2W2LD 4ENVA 1QCCA 2XNDD 3U19A 1T0UA 3F97A 2VJAA 1Y82A 3OURA 2OBBA 3FSRA 1TO1E 4NZYA 2D2VA 4I6GA 4XPZA 5CPFA 4E12A 5C4IA 2JIDA 3L4BA 3HYNA 2P9GA 4D43A 3FUVA 4EGAA 2JLBA 2V8BA 3T3NA 2XGJA 1NPTO 2PRSA 1X0VA 1NJ8A 3G7NA 2DKNA 4JUAA 1KJIA 2VRCD 1PZNA 1MZVA 4GE0A 3G85A 3K1ZA 5H9WA 1R10A 2XDWA 4OBWA 3ASUA 2DBVO 5F64A 4EPRA 3O8QA 1POXA 1O8BA 4M9RA 2O3SA 3TD2A 3DWGA 2C7PA 2EWMA 2JKVA 4U2DA 3RUHA 3I6ZA 3TQHA 2BM0A 4QTZA 4ZIRB 3SR0A 2O4UX 3PJRA 3BREA 4OAQA 4C0SA 1CERA 5A0VA 3EARA 4YXWD 1RXIA 4TXMA 4YUWA 5AJVB 3Q5GA 4MWSA 2A6PA 4XR9A 3SI7A 1NPDA 5HQ3A 4DV7B 2E6KA 4G1BA 4ACAA 1BCSB 3IMKA 2PXHA 3U56A 1CQJB 4RTKA 3O92A 1JIJA 1GN9A 4YPFA 5BPHA 3KTOA 1CUVA 2ZSEA 3DEIA 4RD2A 2V7XA 3N70A 4ND2A 4A6XA 3WNDA 2O7SA 5F2KA 4Z3OA 3EYWA 3PNMA 4YAUA 2R9VA 1RJFA 2R6HA 1EX9A 5IVIA 4LJAA 3L1IA 4UEJA 5F1PA 2PMEA 1V4NA 1YR6A 2PS1A 3CXUA 3JR3A 4BO1A 5IZ4A 121PA 2D5BA 3L0BA 3QP9A 5I3ZA 1N2OA 1ISPA 1LBSA 1K3UB 2EIXA 3I30X 3IQXA 4J1TA 4OOEA 4P53A 5BN1A 9ABPA 1XZPA 1YK0A 3RYIA 1N2BA 3B1XA 1AHNA 1M6YA 4IYJA 4DDVA 1V7PC 3F3MA 4NDNE 3I2IA 1RZUA 2X3YA 3IJRA 1RAIA 4U3JA 4JYAB 3I83A 5BW6B 3RC8A 2H54A 4BLSA 3A4IA 3LLSA 3TH5A 2IFTA 4PXAA 2AB0A