1AN0A

Cdc42hs-gdp complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
189
structure length
189
Chain Sequence
b'MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDC42HS-GDP
publication title The Structure Determination of Cdc42Hs and Gdp Complex
rcsb
source organism Homo sapiens
molecule tags Gtpase
total genus 58
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1an0A00
3PEYA 2ATXA 2ZI7A 3CM0A 5LPNA 1BIFA 1OIVA 1M1YE 1XD8A 2ZI3A 3W6PA 1PLKA 1TX4B 3H86A 1ZC3A 2R62A 4M9XA 2NMVA 3OIVA 2P0EA 1XWIA 4JLOA 1E9SA 2JLZA 4CEJA 4ITRC 1CJVC 1XP8A 4NKRA 4NZYA 3A4LA 1AKYA 4PZYA 2NQ2C 4D0LB 3RS4A 3THXA 4O25A 4B74A 3CIOA 3QBVA 3ZVMA 2CMKA 4JS0A 2WPDD 2AHOA 4PAOA 1PZNA 4I1OA 4F4IA 1E2KA 1KKLA 1N5IA 4A15A 4JLAA 1JQJC 3K9GA 3QQ5A 2CE2X 1DAGA 2QT1A 1KSJA 4ZI3A 1PJRA 1T3SA 2W0MA 1SZPA 4LOAA 2ZROA 2VO1A 3K0FB 5EP1A 4LJ6A 4JBWA 2A2ZA 1G9XA 3B5JA 3E5HA 4FCWA 1T5IA 1AS2A 2OLJA 4B2IA 5L3QA 4YXWA 2RGCA 4TQ9A 1I2DA 1I4LD 1WCV1 2WBLC 3CNOA 4PO8A 1ZINA 2D7DA 3HU3A 1E1QA 3AV0B 4ZCIA 2XOKD 5FOTA 3PUXA 2O0KA 3Q72A 3LY5A 2R6DA 3U3OA 2ZR7A 5DHAA 3AP3A 5FI0B 5JECA 2F1RA 4LWZA 2W83A 2DFLA 3EA0A 4G0NA 1E9RA 1GVNB 3CF2A 2VHQA 4NU0A 1IN8A 4ZIRA 2Q9CA 3KB2A 2DWOA 3TVDA 1T8UA 2V7QD 2W6ID 3KUDA 4FMCB 5FPHA 1JR3A 2KBEA 3HPRA 5KO2A 4CF7A 1G1MA 3CRQA 5TVKA 4FI3C 2IXFA 4URZR 1P2TA 3DVLA 1DAEA 3X1DA 1XJCA 1W49A 3LBNA 2NPFA 2IF0A 3L0OA 4TSFD 4BEJA 2OSBA 1TF2A 2DPXA 4M1WA 4U00A 2RGBA 3GLIB 2P6RA 2WMOB 3M0EA 2QTFA 3B1ZA 4KO8A 2W6JD 1KJZA 4RCYA 4OHXA 1EFTA 1YZGA 3EPKA 4D4MA 4CEIB 4Q48A 3VMFA 4EQ6A 3QG5A 3SNHA 1E32A 1UBEA 1YQTA 1L4UA 2ZSFA 4UNRA 4C2UA 3MWYW 2JJ8A 3CWQA 5JBQA 3JZMA 1OF1A 1SXJE 3LXRA 1JPJA 4AG5A 3SJAA 3PEWA 4PPNA 2QGZA 4N1AA 4Q4JA 1EFCA 5JEEA 4JSTA 1AGPA 1NVXQ 1OB5A 3NIBA 4A92A 2JEOA 2VSXA 4JT2A 2OCBA 2ERXA 4V0ME 4WZAE 5TARA 3O8CA 5L3VA 2CLCX 2WM9B 3BXZA 4XVUA 4MDFA 3FKQA 2O8BB 3U60B 3LFUA 1K6MA 4Z8XA 3U6KA 1NKSA 4UXIA 3ZIAA 1Z6YA 5JS7A 2Z6VA 1JR6A 2RGNC 2ZS9A 3QXCA 4UNQA 5FOXA 4HZUA 2GKSA 1KMQA 3SBEA 1ZUHA 2C95A 1GG2A 1LTQA 3EWSA 4JLJA 4HEJA 3SU8A 5CM9C 1HT2E 2D74A 2VP6A 3CX8A 3DMNA 4P31A 1XZQA 4YDHB 1OYWA 1S9DA 1Q20A 3OZXA 3PEUA 3RRMA 2WJYA 1ODFA 2J59A 4G5RA 3QY0A 5JHHB 1TNDA 2GBLC 2J45A 4HAVA 3QKTA 3B2EA 4IKEA 4PHGA 5DH9A 1QG2A 1E9CA 1XPRA 3QENA 3LRPA 3P20A 4HB3A 2ZRMA 3G82C 3HPQA 2XB4A 4AYXA 2ZSAA 1RYHA 4I99A 4IHQA 4C0LA 3NTUA 2QU8A 3DZ8A 1XEXB 5GADl 5KUTA 1DBSA 4QC2A 4XWAA 5HKKA 3PUYA 3QXHA 2FSIA 1RFLA 2FH5B 1SQ5A 2ZSBA 1KO5A 3E1SA 4NCIA 2Z43A 2VL7A 5JI3E 1RC8A 1E2QA 2LKDA 1N6OA 1US8A 3GJ5A 4TQUS 2VP5A 3DM9B 1KSFX 2FFBA 3AUYA 3NBZC 2YYZA 4LYHA 3KQLA 4EDHA 1FFHA 3A1TA 1W2HA 2GCOB 1MABA 2J0QA 1CULC 2GHIA 1S1MA 2BKUA 2F1IA 2X19A 1G5PA 5DLQC 1ESNA 1QG4A 4B6FA 4B6EA 4JBXA 1N25A 4PANA 5EP3A 2P5SA 2BC9A 3VKWA 2WWYA 1COWA 4URXR 4GP6A 3FVQA 3QEJA 4EPVA 1SXJC 4V02A 1QHGA 1P6XA 3FMIA 1LV7A 4JIMA 4ZDKA 1TQ6A 3ZS8A 1N6HA 5KDDA 3IBGA 4HUQA 3CH5A 4QOSA 5GJBA 5AJYA 4V03A 3E2IA 3GFOA 4LV5B 2PT5A 4D2IA 3MWLA 4DT1B 5K8TA 5TXGA 4KCGA 1DOAA 1FMJA 1HEIA 1FNNA 4H9GA 2KB0A 2JJ1A 4Q9HA 1HQYE 2AKAB 4Z54A 5KSYA 2HJGA 5EE3A 2VHCA 1MOZA 3PR1A 3T35A 1NF3A 1TEXA 1RRGA 2WJJA 3MRSA 2QBYA 1D9XA 2WAXA 1E9EA 2B8WA 2VP0A 1VKJA 1OV4A 3ZZTA 3M4YA 2NZJA 1KK1A 3RYTC 2OHFA 3VKGA 1XD2A 4URVR 4B43A 2QTVB 4L4UA 2WJGA 5BYKA 2YOFA 3TGPA 4C0SA 5L3SA 5EXPA 1RIFA 2XNDD 3EIEA 1TU4A 3BIFA 3TUZC 4V0LA 1W36D 3VKHA 2NG1A 3I4LA 3SE0A 2DFTA 4FCTA 4BRWA 3W6NA 3ECCA 2PZFA 3WNBA 3QXSA 3ASYA 3B1YA 1ANKA 2VPPA 2C96A 2WTUA 2EYUA 4XVQA 1RYFA 1HQCA 1NG1A 2V6JA 4DCSA 4OI0A 1GITA 3SQXA 4OI1A 3WBJA 5AJWA 4JVLA 2ANCA 4TMXA 1C4OA 4LYAA 3KX2A 1M7HA 2Q3FA 4DLUA 4OQLA 4RY2A 4DLXA 3BB1A 1OIWA 4ZKDA 3IILA 3VAAA 1E79D 1G5TA 3RVBA 1CIPA 1AS0A 1G7CA 1OHHA 2NGRA 4Q00A 3THYB 5EE1A 1WQ1R 2A9KA 3GLGB 2CVFA 1MRNA 2WMNB 2HLDD 4JT4A 4E07A 2PX3A 1AIPA 4PO1A 4NL4H 3FDIA 4B34A 3LX5A 1G3RA 2YWFA 4AYWA 3SEAA 3IIJA 2XB2A 4XH9B 1R0XA 3VX3A 4B33A 1TTTA 1XTQA 3CLVA 1U2RA 2YOGA 5E3HA 3ZYCA 1E6CA 4AWXA 2J0UB 5KOYA 5CITA 3JVUA 3SQWA 3OFNA 1N6KA 5F98A 1DO0A 3RLFA 3WMEA 1UKZA 1W4CA 3TAHA 2IYUA 1IY2A 3OESA 2IS4A 4JSYA 3T1OA 1Y63A 3VX4A 2JLVA 5EUMA 1UPTA 3KJIA 2QPTA 3RS2A 2PLRA 2JLXA 1RJ9A 3KKMA 5G3ZA 3UANA 1NBME 5G3YA 1TQ2A 1G8HA 1G4UR 4BFYA 2MSEB 3UMRA 2G6BA 3K0AB 3U7GA 1JB1A 3LW7A 2HXSA 2R8RA 3PUVA 4KYUA 5BWMA 2IYTA 1P2UA 4ZDJA 5FUYA 2C9CA 4D4JA 3GFTA 4OKSA 4LYJA 4IEEA 3LQQA 5JSZB 1AZSC 2KSQA 1A82A 2A78A 2ZJOA 5BN5A 1CXZA 4IOMA 4PC6A 4Q1BA 2B92A 2ZRNA 4QG7A 1WP9A 2J0VA 3W9YA 4LCBA 5C2JB 3QOFA 3V9PA 4RZ2A 1OH6A 3UXMA 4JLMA 4JVSB 2QN6A 1LFDB 1CJTC 4DCNA 5FTKA 4RZXA 1NIJA 2XZLA 3IDQA 1Z0AA 3FHTA 4ZCMA 3VHLB 4K8OA 5LD2C 5EZ6B 1CR1A 1BYUA 3IHWA 3N2EA 4RD4A 2VHUA 1CJUC 4WIAA 2ZYVX 3ND9A 4X8LA 2WICA 5FPSA 2VQSA 5BN4A 1Q1EA 1IN7A 3OIWA 4HAYA 5AUQA 4D0GA 4GL2A 1FUKA 3GJ8A 5SZIA 4QNMA 1ONBA 4DLWA 1XTSA 4N3NA 4TMVA 5J40A 5KDLA 1KI6B 1AA9A 1FUUA 5CK5A 2JJ2D 3AF2A 3K1JA 1XF9A 3LWNA 4EPYA 4QBHA 3ICQB 5FBQB 3TIFA 4A8JC 1VYUA 3REGA 2QAGA 4CW7A 1KI4A 1Z83A 4TTQA 2WKQA 2VHTA 1II9A 1UJ2A 2CNWD 3BJIC 2YJTD 2TMKA 1NRJB 2WWFA 1FP7A 3X1ZA 3PVSA 5B57C 2IYSA 421PA 1ZD9A 4ASUD 1NLZA 3BERA 3K0EA 4UNPA 3C8UA 2E1RA 1N2CE 3VR5A 2O8EB 2ZR9A 3BOSA 1S2MA 4LC0A 3GLHB 3I32A 4DSUA 1E0AA 2QENA 5LB4A 4XD7A 3RSLA 1MT0A 4KITB 5JS8A 3R9XA 4BGDA 3OE7D 2P3SA 4MRVA 3WNCA 3OIYA 3V4RA 2ORIA 1E99A 1GSIA 1XMVA 1VG1A 1YR8A 1Z22A 3CNNA 4HAZA 3C5HA 1OJLA 4MYCA 4RFSB 2VA8A 4TMKA 1NLYA 3EZ2A 4M9SA 1E0SA 2UKDA 4MH0R 2MMGA 2ONKA 2ODBA 4QNRA 1YZTA 3I62A 2VF7A 4GOXA 3MD0A 2QEQA 2OFWA 2IYXA 2OV2A 3MMPA 3TSOA 821PA 2Z83A 4JKYA 2V6IA 5C18A 5FUVA 1MRSA 1VCIA 2ZRPA 3CPEA 4BQSA 2PT7A 2YWHA 4O2RA 2IBMA 4OK3A 3AGQA 3CRW1 2REXB 3B1VA 3NDPA 2JIZA 4E09A 4Q1DA 4LJ8A 1KO4A 2CBZA 5CM8B 5B2ZA 3U3KA 2FPKA 2J87A 3ZS9A 5KDOA 3SDZA 4LHXA 3RS7A 4MRNA 2QE7A 2GILA 1U8YA 1KSHA 4TWZA 2JCSA 2BMDA 2KJQA 1H8HD 1QHHB 5J4LA 3C16C 3QF4B 3SJCA 3AP2A 3MLEA 1G7SA 4LHZA 4Z1MD 2IYVA 3SS8A 3L43A 1XJ0A 3CNLA 3SFVA 4HAUA 4UJ3A 1VIAA 2XTNA 4PQRA 4WZBE 3RDPA 1F2TA 3AF1A 3KKNA 4B3DA 1ZD1A 2SHKA 2IYYA 3HDTA 5JHGB 2HDNB 2WWWA 1XJQA 4QRHA 1EFUA 3RRZA 4LJ7A 5CIQA 2C9YA 3VU9B 4OI4A 4BRUA 5BQ5A 3SJBA 1AK2A 1YZNA 2A5JA 4P0TA 2ZE6A 3UWKA 5JJLA 4NCHA 4HLQB 4P4UA 3KQHA 1VHLA 2ASEA 3M1IA 1QF9A 2WSSD 1KK3A 3I61A 3KZ1E 1GKYA 2CHGA 1CF4A 3BFKA 1VHTA 3NEJA 1L4YA 4KSBA 3RWOA 2PMDA 3K70C 2KBFA 3B7GA 3CRMA 1F6BA 1OXTA 3ADKA 3NHAA 4TMWA 1NBMA 3IQXA 2JLSA 2NOAA 4CIDA 3NWJA 5FH9A 4TYYA 3B1XA 2WJHA 3DHWC 2EFHB 2GCPA 3Q5DA 2QL6A 4BFTA 1E2MA 4PHTA 4EPTA 3SHWA 3MAAC 1SXJB 5KSPA 1P9WA 2F1JA 4G5OA 4YC7A 4D80A 2O0JA 3K09A 4FINA 1AS3A 4A0HA 1EG7A 3T34A 1CRQA 4BZQA 1KZGB 4DEYA 2I3BA 1WF3A 4CEHB 4GFDA 3RABA 3RRYA 2ZJZA 3IO5A 4QHTA 3GEHA 1NMZA 2XEXA 4GOKA 1Q21A 2W00A 4C30A 1FNMA 4I1VA 5K8UA 1ZM7A 1XEWY 3EAQA 3F8TA 4TL6A 5SZHB 4M2LA 4DLSA 4DUGD 4FMBB 1SVOA 1OH8A 4UXHA 1S3GA 4LBYA 1JR3E 4ZO4A 4JLKA 2R6GA 1XMSA 2AK2A 5TDHA 4DWJA 1J7KA 3KJGA 4IOJA 4DEXA 1CJKC 3KDSE 2D3WA 1FX0B 4HATA 4P4TA 1SHZA 4PO9A 4XVRA 2D7CA 4ARZA 4YMTA 4CT5A 3Q8XB 5DI3A 2C04A 1R7RA 1T0JB 4FMDB 2X77A 4JL5A 4RD2A 5LBIA 5EE9A 1R2QA 1A4RA 1M7GA 1BYIA 2O8DB 2ZR0A 1G8GA 3S1AA 1CKEA 1IM2A 4LV8B 4IOKA 1HY3A 2XAUA 1XXHE 1KY2A 2NIPA 3L8ZA 4TYNA 3LVQE 3U7EB 1XCGB 2F6RA 5JJKA 4JMPA 3GP8A 1I4TD 1P9RA 3KTAB 1B23P 3GJ4A 2DWPA 2JDIA 1LF5A 1GFIA 2AX4A 2UZ3A 1P7CA 3K9LA 2ZJYA 1FZQA 1GNRA 4P4SB 3TSZA 4BFWA 4U7DA 1C9KA 1SKQA 2QI9C 2ZREA 3AF3A 2FF7A 4Q21A 3H4MA 2I4IA 2F9LA 4ZKEA 1GAJA 3W8NA 1W0KD 3ZZUA 1UDWA 3K70D 4M9QA 2OLKA 3B9QA 3FOZA 4M9ZA 4N0EA 2BIFA 1CRPA 4K81B 3D7MA 4BFZA 2XXAB 2BEKA 1TUIA 2BJVA 2QM8A 4QM6A 2ZE8A 3R7WA 4WZ6A 2H57A 2V1XA 2ZSDA 2ZJ8A 3AF0A 3WYAA 1KO8A 3A8TA 3O8DA 1CBUA 1KSGA 4DLTA 4MDEA 2WVJA 4B73A 1PLLA 2HUPA 5IK2D 3GLFE 2A5YB 1Z0IA 2ZANA 3NVAA 4CT4B 3EPLA 4EPXA 1E1RA 4IW3B 2REBA 2WAYA 5P21A 1QHIA 4FMCF 4JLPA 3TSWA 3FB4A 2JA1A 5EXSA 2GZAA 5BYJA 3IIKA 5IRCD 4ZDWA 1GWNA 2RH5A 5L3RA 4URUR 2EQBA 5CYOA 2BHRA 1DO2A 4BLSA 4C0QC 4CVNA 1R5OA 2DR3A 3LNCA 2OAQ1 1KNXA 1XEXA 4A4DA 1GZSA 1ZVQA 2B6HA 1IY0A 1IBRA 2ZRJA 1KYIA 2PMKA 3PUWA 5GJCA 2J7KA 4F4JA 2R6FA 3LBHA 2F55A 4J0QA 1TU3A 5FOVA 1MO4A 3K53A 4G3XA 1EWQA 3W5IA 1SKYE 3PCRB 4QJ4A 4AG6A 4EFNA 2ZRAA 3AQ4A 2P6NA 1QHXA 2GCOA 2ZS8A 2XSZD 1XEFA 4KFRA 1AGRA 2FGKA 3QXJA 1WBBA 5LD2B 3U44A 1U9IC 2W58A 1EFRA 3U6BA 2XTZA 4LBVA 3IEVA 4ILEA 3N70A 1ZAKA 4LBWA 2LWIA 4M4SA 3GMTA 2C98A 2BM0A 1E2HA 4XWKA 3V4FA 621PA 1F60A 1VECA 2QT0A 3B8HA 1II8B 4W7SA 5FR2A 4Q4AB 3A4MA 4DCVA 5K8IA 4RD1A 2JLRA 3IEUA 1N6IA 4D25A 1IN5A 2R9VA 2ODNA 3AUXA 2C2HA 4A8JB 1OFTA 2ZQ5A 3QKRB 1OT3A 4KFTA 2IUUA 3T12A 3ZJYA 5G41A 1DAMA 1ZD8A 2FPLA 2RGAA 2VEDA 4LPKA 5CLQA 1P62B 2FFQA 3NC0C 3AVVA 4C7OA 3GJ3A 2Q6TA 4L16A 3TE6A 4B3BA 4F38A 2D2FA 1SHKA 1E1QD 5FBLB 3AVTA 1E96A 4XOIA 3C41J 1JI0A 3L2OB 3Q85A 4B3FX 3QBTA 2I1QA 2X8AA 4HB4A 1TF7A 1NI3A 1W4BA 1WBDA 3AB3A 4HLUA 1ETUA 3QXXA 1E9FA 1E98A 3OAAA 1Y3AA 4IVPA 2IS2A 1TEVA 2ZE7A 1DELA 2QMOA 5CLLA 2OE2A 4NMMA 5HTKA 1SVIA 5JMTA 1OXUA 4NYIR 2FFHA 2XOKA 1LY1A 3VQTA 1VG8A 4G5QA 2YWGA 4G5SA 2QP3A 3U61B 1NY5A 4M8NE 2AWNA 4OL0A 1G7TA 2N1BA 3KFXA 3RC8A 1XD9A 4LHWA 4AKIA 3PFIA 4KYIB 3THOA 1P2VA 3ZD6A 2RHDA 3BGWA 1XTIA 5HZKA 4CDGA 1U8ZA 3EIHA 4FD2A 4TN1A 2LKCA 3QUSA 2DCUA 4YMWA 1Z0JA 2QM7A 1L8QA 1W47A 2XJ9A 3AKEA 1KO1A 1ZNYA 2CCKA 1Z6TA 2W6IA 3U4QB 4RVCA 2ZETA 3CB4A 1R4AA 2GF0A 5EXXA 3EPJA 2GAAA 1KNQA 4Z8YA 5FI1B 1KDPA 1EWRA 3CR7A 4X8HA 5AUOB 1IXZA 3THWA 1XXHA 1OFHA 2BMJA 1KOFA 1GRRA 1XDBA 4DLRA 4MUBA 1N6LA 3I5YA 2V54A 4YMSA 2Z4SA 4PXAA 4KV9A 4LZZA 4G5GA 1WDTA 1Z3IX 4MRSA 4KBGA 5FOUA 2ZRCA 5E4FA 4GZMA 3LD9A 1ZU4A 4EKDA 3KJHA 4RZUA 5FPYA 1ZCBA 2N42A 4MKFA 4XTCS 1B0UA 3PG5A 1G7RA 1F5NA 4NYMR 1E2EA 2ZUCA 4O0MA 3NG1A 4FN5A 1T6NA 1N5LA 3EZ9A 3RANA 2EU8A 1A2BA 3SFZA 1GOTA 1KO7A 3ZIAD 3U7HB 2ODEA 4C4PA 4NYIQ 4LY6A 3WXMA 2Z4RA 1YZLA 3QEOA 4Q7KA 3A1WA 2IW3A 4DSOA 4F91B 1U0LA 1NY6A 4LPSA 2CLDX 2D4HA 1KI8A 4IDHA 3GLFA 3FE2A 3KJEA 1JAHA 1U94A 1FP6A 3A58B 2VH5R 3K70B 4Q03A 2V3CC 1J8MF 1U0HC 1T4GA 1L7VC 2J7PA 2GJ8A 2RAPA 1D6JA 5H70A 1T8TA 4F92B 3ZLJA 2ATVA 1SVMA 1Z2CA 2RGEA 5J5CA 1GRNA 4ZPXA 2PH1A 4FWIB 4LRWA 1G8PA 2QSYA 5F2EA 3HJNA 4GRAA 2DY1A 3TVTA 1NMYA 2A30A 3BD9A 4MGZR 3EC1A 4GT1A 1V5WA 3HP1A 3WYGA 4EJSA 1RW4A 4PPQA 2ZIAA 3L8YA 4KBFA 3WMGA 1T0HB 1T3LA 5HKKD 4QJ3A 1W4RA 1U90A 4IJMA 5FTNA 1NVUQ 3EASA 5DN6D 2ZITA 1KAOA 1Q1ZA 1UEIA 2EYQA 3PENA 2R2AA 2AXPA 1D2NA 1S9HA 4B47A 5BW8A 1VMAA 4KI0A 1TQDA 4A2QA 2JGNA 1UBGA 4L8GA 2LCFA 5A5GA 4QBIA 3VNVA 1OIXA 1M8PA 2QPAA 4MKHA 4MUAA 4ESHA 2YKGA 2Q3MA 1Q0UA 2QRZA 1D9ZA 4AY2A 4NYMQ 3GEIA 2QMUA 3IIMA 1MO6A 1A1VA 2Q3HA 1GL6A 2PCJA 5E7JA 4C0HA 3UK6A 1O87A 2ZE5A 3WY9A 3IHLA 1GILA 1F2UA 4KAXA 4DB2A 5TMPA 2ZAOA 3Q5EA 2OUKA 3LV8A 2F1HA 1E2FA 1RRPA 1SVKA 1Z6XA 4QM7A 4CEJB 3VNUA 1T9HA 4EPWA 2H8KA 2WOJA 4XIGS 3SR0A 3THXB 2Y8EA 4CZ2A 3AVPA 3QVUA 1G41A 3QPUA 2WKRA 1MO5A 1MR3F 1I2MA 2BWJA 1S4QA 3QI2A 4Q4HA 1S8FA 3AKYA 1D5CA 3P27A 3IO3A 5J4KA 1V43A 1VG0B 4YQFA 1G3IA 3TR0A 1S0UA 3LA6A 4RZ3A 1Q1BA 5JEDA 3D3QA 2IHYA 4U02A 1FMLA 2ZVPX 3CRVA 4CYMA 1UM8A 2PX0A 2VP4A 3BFVA 5SZJA 3Q9LA 4BLPA 3HWSA 2PJRA 1WA5A 3NDBB 2CK3A 3U3RA 3LQRA 4S2EA 5L3QB 5M04A 2BV3A 1UDXA 4BEBA 1GNQA 4GBMA 1HYQA 2F7SA 2IC5A 3BK7A 4C3ZA 4IVQA 1R0YA 2OXRA 3DKPA 2G83A 2QY9A 3C4JA 1M6NA 4TT3D 4PZZA 1KAGA 4RCZA 3DEFA 1KKMA 3ZGXA 2G1KA 4TLBA 4MKIA 4BWYA 2H16A 3D31A 2BMEA 1DPFA 4XWOA 4H1VA 1GNPA 4W5WA 1PLJA 1W44A 2AD1A 3I8SA 1OHHD 1W48A 5DYIA 4M1KA 1Z08A 4LHVA 1UBCA 3VU9A 1WXQA 1X8JA 4ZIRB 4OQMA 1YJ5A 2QAGC 1XCPA 1X1RA 1ZW6A 1E79A 3KUCA 1Z5ZA 3SC3A 3T5DA 1NNEA 1KJWA 4AI6A 1SXJD 2HLDA 2UZIR 2ZYUX 3KQNA 5FTJA 4PSKA 2GXQA 4PSVA 1G19A 3CPHA 3SN6A 3A1VA 4DBLC 1YR9A 3TW8B 3OEEA 1P75A 4Q47A 3FHCB 2IYWA 1G64A 1TQ4A 2PL3A 4IDPA 4DLYA 2XZOA 2HXYA 2NO1A 4MGKR 1Z6GA 4EQ6B 1VCNA 1J70A 2VIIA 4IEIA 2REOA 3B85A 1GKUB 2OCYC 4NP6A 3OHMA 3AVQA 4M53A 3UWOA 4DZZA 1PVOA 2WIAA 3ADCA 1BS1A 2ZYTX 1Z0KA 2DHRA 5EE0A 5DISB 3RNLA 3U3MA 4B48A 5JZVA 3H2YA 4ABYA 2VP9A 4OHZA 4BZXA 2JLWA 4Q4JB 3W8RA 4LUCA 4KXFB 3VR2A 3EZFA 4LI0A 1T91A 4Q18A 5AUPB 3FPAA 1GRQA 1VCOA 3SZRA 4Q66C 1N3BA 1OB2A 2PJZA 1EGAA 1QZXA 3DOEA 5AUNB 1OKKD 2ONJA 1XPOA 1NVVR 4LJ5A 2ANBA 4OK6A 1YU9A 3B60A 1WE2A 4KFUA 1PV4A 5C1BA 3T15A 2OBLA 3NBYC 4HZUB 1FX0A 4PC2A 2J9RA 4LC1A 1F3OA 1XTKA 4TYQA 3TQCA 3DZDA 3JZAA 2HT1A 3GLIE 3U7FB 4HDQB 3QPWA 4L15A 1VDZA 1RVDA 4QKQA 3EA5A 4JVMA 1RRFA 1E4VA 2FPMA 1JJ7A 3QKSA 1NN1A 3CKLA 2YOHA 3P4YA 4AKGA 1EX6A 4X8OA 2BBSA 2GAOA 2OM2A 5AR1A 4UJ5A 1KZ7B 2JLUA 1OXSC 2ZRFA 4D81A 4MYHA 4ACAA 2ZAMA 2GNOA 1FL9A 2F9MA 5CJPA 5HR5A 3FMPB 1HTWA 1DE0A 4FW9A 2IT1A 3MCAA 4DDTA 2WIBA 1E2NA 1S1CA 5H1YA 3F0TA 2JJ2A 4JYCA 2O8CA 1VYTA 1ZM9A 2OXCA 3GCGA 4KLZA 4O2LA 2ERYA 1JECA 1JEDA 3EWAA 4UKDA 4XD7D 4HSEA 2IK8A 1YR7A 2CNWA 2QP9X 3A1UA 5SZKB 3F5FA 2XXAA 2OT3B 5D3MB 4JL6A 5C4MA 1H8ED 2KI5A 2J41A 3OF5A 2CJWA 4XJXA 4A0FA 3MJHA 4Z51A 1MKYA 4F4CA 4ASUA 4GDFA 1MABB 4AYTA 2QMEA 2QROA 5FFMA 4LHYA 1E2IA 4DDVA 3MGCA 1NVVQ 3CR8A 1ZU5A 3OE7A 1EK0A 4OK5A 1G3MA 4LYFA 3K09C 4IDOA 4AC9A 2FFAA 1HT1E 3KKPA 4BLQA 3U2QA 3W3AA 2HF8A 4PQYA 3NBXX 3N2IA 2WWXA 2YVUA 4GMXA 3EW9A 1NL3A 1YVDA 1KMHA 1G3UA 4NPHA 1NKTA 5F3WB 3I73A 2CLSA 3M6AA 4QGGA 1JEEA 1N6PA 3LO5A 1FQJA 3PITA 1K8RA 2FJUA 2QE7D 4IDQA 4ZDIA 1KI7A 3CBQA 3BC1A 4TLAA 5TY0A 1KHTA 3AH8A 4FMDF 3BORA 5FUWA 2BCGY 4Q1CA 1M7BA 5GVRA 1G3QA 3CF6R 3JVVA 1XD2B 2DB3A 3NXSA 5ANRB 4W5HA 3ND8A 2UVQA 5L3SB 1X86B 2VTKA 2YNMA 5JJIA 3DPUA 1GIAA 1KI9A 1S3SA 2BEJA 1Q3TA 4LJ9A 2F3TA 4ERNA 3CONA 3WP0A 3IBYA 4KVGA 3BB4A 2ZRLA 1G20E 2IUTA 2RGXA 1CS4C 1Z06A 5J47A 5HCNA 2EWVA 4Z1MA 2DYKA 1OE0A 3LVRE 1XU4A 2AXNA 4JKIA 4WVFA 2JASA 3AKCA 2QRNA 3K0FA 5EXTA 1UKVY 1VPLA 4YMUA 1E2DA 4D4KA 4B2LA 2XZPA 2ZRIA 1P72A 2JLYA 1BH2A 2WJIA 4R7ZA 2PEYA 3QKRA 3CWZA 5FL7D 2IA5A 3QNUA 4GOJA 4JLVA 4TL9A 3ZQ6A 1OFIA 1IJEA 5KTYA 4DKXA 1BKDR 1II0A 1TL7C 2GK7A 4EUNA 4QJ5A 1OYYA 2ZYWX 1GL7A 1G21E 5G53C 3OEHD 121PA 1CTQA 1P61B 3ADDA 2NO6A 2O8FB 1NN3A 2WSSA 1ZM2A 2FWRA 2BMFA 4G01B 3T1QA 3BB3A 2FV8A 4GI7A 5DSZA 2EFGA 4MKGA 4E03A 1W0JD 5FOWA 1AKEA 1E3MA 2FU5C 1E9DA 5HE8A 1Z29A 4C9BA 3FWYA 1ZP6A 2FEOA 3DOFA 1LNZA 3FHOA 3GD7A 2PZGA 4WXPA 2C9OA 4M1TA 5BXQC 1S96A 4JBYA 4OHYA 2W2VA 2JLQA 1E69A 3KKOA 4DB4A 2CL6X 2HYDA 4AURA 4BFSA 1GDDA 3Q7QA 1ZM4A 3AEZA 3O8RA 4LDJA 4B35A 3L82B 1OPXA 3FKSD 2O5VA 4HAWA 3GLIA 1P2SA 3R20A 4OI2A 2B21A 1IXRC 2B7CA 3TBKA 3VHXA 3I1FA 4HUTA 4Q4LA 2ZRGA 2XX3A 4CEIA 3K0CA 4BE7B 1RE0A 3FFAA 4B3GA 3FYHA 4DUGA 4IFEA 1QVAA 2ZPTX 4HDOB 4POAA 1KY3A 1N0UA 521PA 5HPYB 3MWKA 1OH5A 3U5ZB 3LBIA 1NSFA 2P6UA 2ZEJA 3SI7A 2ZU0C 1IXSB 2EVWX 4GP7A 4MA4A 4TTRA 1Q22A 5GVSA 3TRFA 2OILA 1R5BA 3VTKA 4EAQA 3E70C 5G40A 1VTKA 4HB2A 1NP6A 2PEZA 3SHFA 1MV5A 3X1XA 1W7AA 1G5RA 1DEKA 2J0SA 5BN3A 4PAQA 4MRPA 2BBWA 1P4SA 1I4DD 3KKQA 4W9MC 2QAJA 2O8BA 3C14C 5KNCA 4TYWA 1XMIA 1Q57A 1UAAA 2ZM5A 3WRYC 1KI3A 1OLOA 1X8LA 2AN9A 2QAGB 4NH0A 2GJKA 1JQLB 2XITA 4GMDA 4KSCA 5CK4A 5AK0A 5TB5A 1ZC4A 2A7QA 1E2GA 2ZSEA 3FGNA 3K9NA 2QA5A 1HUQA 1TAGA 2H7VA 3CX6A 4JJKA 1J2JA 2WKPA 2WV9A 5HZHA 4MYUA 3LX8A 4DXAA 1ZYUA 4L9SA 4DDWA 1NSTA 1EFHA 3ETLA 4JLNA 4P32A 2GTPA 3UATA 5JWOA 3C7KA 3NH9A 4K46A 4HLUC 4XSGA 1E1RD 2QQ0A 3CRRA 2AFHE 3RC3A 2G1JA 1G6HA 1M74A 5GJVC 3P26A 3REFA 1A5TA 4IDNA 4I1UA 4PHFA 1BMFD 1N5KA 3R8FA 1U8AA 2ZVQX 3ZD7A 5IK2A 1IN6A 2YHSA 4B3CA 2H17A 4UNSA 2QSZA 2L0XA 2IS6A 1DAFA 1UBFA 4A36A 1EXMA 2C5LA 4Q7LA 1F48A 4F7WA 1E2JA 3MFYA 5AWFC 4MGYR 4B3XA 3TUIC 2OAP1 4PZLA 4PSAA 3DM5A 1CR2A 2OCAA 4ZV4A 3H1TA 2N46A 3ASZA 2IHBA 2FGJA 4FCVA 4YMVA 3ZVLA 3PQCA 5J4HA 2G77B 5KPDA 1E9AA 2XGJA 4ZI2A 3SYLA 4TZ6A 3EIQA 3QIAA 5B64A 5F9FA 2VLIA 2VYFA 3WHKA 2IXGA 1ZRHA 1CJMA 5DI9A 1FQKA 3GLHE 5DNYB 1GM5A 3P4XA 4QHSA 3EX7C 5F9HA 2VSFA 1W5SA 2XSZA 4QXAA 4DT1A 2QZ4A 1F2TB 2AL7A 1SVLA 2WPDA 4V0OA 1DS6A 2BCJQ 1ESMA 4ACBA 2RGDA 4YXWD 1FPMA 1C1YA 2KE5A 2ZJAA 2QGNA 5KSOA 4G1UC 3VFDA 4NDZA 2AD5A 1IJFA 2IEYA 3BBPA 2DWQA 4D0NA 4LJAA 3X1YA 2NPIA 3ADBA 1UADA 2CE7A 4L9WA 4LJYA 5JLJA 3OAAD 1QHNA 1ZIPA 2DFKB 4DSTA 3EC2A 2MSCB 3B9PA 5B58C 2GVZC 3P32A 2K5UA 4WW0A 1KK2A 2EFCB 4ON9A 4AIIA 3G5UA 1NJFA 4KLNA 2CCJA 4QGAA 1KGDA 4US0R 2GVDC 2CHVA 1JJVA 1JR3D 3MJRA 1DG1G 1JAIA 1PUIA 1Z0FA 3THYA 4EJSC 4CRWB 5K8LA 3BFXA 5IT5A 3GLGA 3LW8A 4TMTA 1Z07A 2GEVA 1NN5A 3B1WA 2X1VA 4DJTA 1P3JA 2GCNA 4KODA 2V7QA 3ZVNA 2BBOA 2ODWA 2H5EA 1X6VA 4NCJA 2JAQA 2B8TA 1D8TA 1IHUA 3NBFA 4OYHA 2J0UA 3VR4A 2QMHA 4TSFA 4XTRA 4Y0AA 4RKFA 3Q7PA 3TW4A 1H65A 2RHMA 2W6JA 3IPYA 3QSYA 3TLXA 4AKHA 1GTVA 4ARZB 3I8XA 8OHMA 5DI3B 4YDSA 4QL3A 3IKJA 2OCPA 3W3ZB 3AVXA 3TNFA 1U9IA 2GJAA 1W46A 1JNYA 1GL9B 2GESA 3K0AA 3MSXA 4IRUB 4OJQA 3S1AB 1E2LA 2OBNA 3DL0A 1N6RA 1OSNA 3GPLA 1SULA 4M1YA 5DYGA 2V55B 4NHOA 4R2IA 3AP1A 1HE1C 5JSZA 5AJVB 1ZNXA 5J4VA 4BFUA 1CP2A 4PX9A 4WA7A 5FBWB 3BH6A 4OJKA 3AVUA 1CU1A 2WWIA 4N0DA 3WYFA 1DTSA 1DG3A 5KNBA 5DIFA 3T1TA 1NVWQ 3GJ0A 4QHYA 4Q9IA 5JWHA 2MSDB 3CO5A 2A3RA 2W2XA 3BS4A 4RD6A 4TLDA 4A6XA 1RRCA 2X2EA 4PQFA 4A2WA 4BUJA 2ZXUA 4FIDA 4QBGB 3C15C 2J7PD 1D2EA 1VYVA 4HZIA 2YWEA 3VR1A 2F3RA 4B75A 2GF9A 4D4LA 1N0VC 2PCLA 1RZ3A 3CUEF 5EZ5A 3R7WB 4PPFA 4BPBA 2ZI9A 2GDJA 5CDFE 2QQEA 3HR7A 2BBTA 4MGIR 1G17A 2Q9AA 3BH0A 3T61A 2YZ2A 1QDEA 2Z5FA 4BASA 3GQBA 4M1OA 1IY1A 3SYNA 1W1WA 1W36C 1KI6A 3D8BA 3GJ7A 1A7JA 3B6EA 5A4JA 2QNRA 3QJYA 2IS1A 3I72A 4R71A 2ZJ2A 1KTVA 3W90A 3GFPA 3HU1A 4QFMA 4B32A 3RRNA 1BOFA 1Z0DA 4UQOA 2G3YA 4AKEA 4DRZA 4RD0A 5C4GB 5JFGA 2OBMA 1T5LA 1XEWX 3QVVA 4UXJA 2ZS7A 3HR8A 1YZUA 1ZNZA 2P65A 2V4ZA 2O8EA 3MWJA 4Q02A 5DN6A 1OW3B 3GLHA 2EFEB 2QORA 1N6NA 1COWD 2F43B 3B13B 2GXUA 4GSYA 1Q12A 3A36A 3GJ6A 1HV8A 4DCTA 4Q1EA 2J3EA 2QP4A 3BE4A 3HYTA 3A4NA 2VHJA 4FXPA 5D3MA 4E5UA 1CEEA 1E94E 4LGMA 2GZHA 1KDTA 4RFSA 2GK6A 4TQAA 2J1LA 2G0NA 2PBRA 1AN0A 3ICEA 3AGPA 2FSGA 1JBKA 3U44B 4IXNA 1R8SA 5KU1A 5CIWA 2JJ1D 3K9HA 4IVRA 4FWTA 4KFSA 1L2TA 1BO6A 4NTZA 4PAMA 2MMCA 3KFVA 5JRJA 1OFUX 3R9WA 3RWMB 2FNAA 3F3YA 1GKIA 5JCPA 1KDOA 5D3QA 3RS3A 1Z8FA 2GXAA 1HA3A 2ZUDA 3PJRA 3WNDA 2RB4A 2VSOA 2J5XA 1DAHA 2GZDA 4DVGA 4WAUA 4C2TA 2C8VA 4PFSA 2ZI5A 1PUJA 4JLBA 1Q1QA 2RGNA 1J8YF 3EZ6A 4M1MA 1A2KC 2FSFA 1Z63A 3LLUA 2CK3D 3RAPR 5FOSA 2HV8A 1FW6A 1G8FA 3LH5A 4QGFA 1QHHA 4C7OB 5GJWC 5J4YA 3QF4A 3DMDA 4DIDA 2CEAA 2XNDA 1Z47A 2R6CA 4JZKA 1M34E 2GWHA 4A82A 3RHFA 4I81A 2GBLA 3KQKA 1ZUNB 4PC7A 2CXXA 4LX0A 3AM1A 3NEYA 1IAQA 3D6TB 4US1R 4C0AC 4DHEA 2VP2A 3I92A 4R9UC 1XTRA 4TT3A 1XX6A 2YC4C 4PC3A 1VCMA 1W4AA 3NKVA 3H84A 1NJGA 3BH7A 2ZUBA 5DO9A 1Z6AA 2ZRDA 1SGWA 4BLOA 2O0HA 3G0HA 1ZIOA 2QTHA 2IXEA 5KNDA 3TAUA 2W0SA 3R8CA 2IYLD 3IGFA 4X8MA 3R9IA 5JWRA 4Q5IA 1W5TA 3UPUA 2FMXA 1AZTA 3HU2A 3OFND 5AJZA 4TZ0A 2ZJBA 4B71A 1XFAA 4PHHA 3X2SA 3OEED 2CL0X 3ZZ0A 3Q3JB 1IOZA 1UKEA 3LDAA 3TMKA 3UG7A 4Q9JA 3THWB 1XXHB 4PPGA 1CR4A 5FTLA 2O8FA 1SXJA 3ZDQA 2XNSA 1KI2A 2IF2A 3EARA 3GEEA 4ESVA 3BWDD 2OO7A 2A5DA 1NLFA 2G0TA 2WWGA 4MQBA 2IX3A 4CEHA 3WMFA 4V0MA 2B7BA 4U5XA 3NHBA 1ZMXA 4H1UA 4EPRA 4NCKA 1XMJA 2Q0HA 4C0BA 2ZRHA 2FA9A 1DAIA 4NBSA 2CVHA 4L5BA 1ZUIA 4Q19A 1LVGA 2ZU6A 5E7MA 4A6PA 5CB6A 4P33A 5UKDA 1RPZA 2IEZA 4QGHA 3PEVA 3WP1B 221PA 3EXAA 3MUFA 2IWHA 4EFLA 2DFNA 2BVNA 4A0RA 3C5CA 2C03A 1DAKA 2OG2A 3T1VA 1AJEA 1R0WA 1N0WA 1G8YA 1VG9B 3I5XA 5CDFA 4DSNA 1LS1A 1E2PA 4S35A 1TUEA 5FBVB 1X3SA 4A0GA 2FE4A 3W5JA 2GA8A 1LS6A 2GEDA 1K5DA 5FTMA 1ZBDA 4OQFA 3GLFB 1JXOA 4C0JA 1OKKA 1P5ZB 3PXGA 1M2OB 2H92A 3H0KA 4NE2A 4EIWA 2O8DA 4DLVA 4AD8A 5IDVA 3WRXC 4A1FA 3V00A 1YZQA 1DVRA 3CZPA 2GRJA 2ORVA 2G88A 2ORWA 1OXVA 1XCMA 2RCNA 3O47A 2FG5A 1QHSA 3KTAA 1KI1A 3MG9A 2ZI4A 4RD3A 1Z2AA 3W6OA 1VIYA 4HLDA 3UKDA 4TL8A 2QPOA 3L0PA 1P73A 4P4SA 4TYPA 1AQUA 1JALA 2OZEA 1XNJA 4EJSB 3NH6A 1IQPA 2IYRA 4M1SA 2ZRBA 5HCIA 1TMKA 4HAXA 1CLUA 4UNNA 3K8YA 2FSHA 1R5NA 2OEPA 3TK1A 4LSGA 1QVRA 3PUZA 2Q21A 2NO7A 1SKYB 1JXMA 2WOOA 5EJEA 2C78A 5DE3A 3ZH9B 2R6AA 3L0SA 1US8B 2GJSA 2G9NA 1KK0A 4BFVA 1J90A 3A37A 5B30A 1SVWA 2O52A 1XBTA 1WB9A 2C77A 4E22A 2E9SA 5KHOC 4Y0VA 4Q1FA 3SYKA 3VR6A 5IF9A 5FL3A 3AKDA 4HB0A 5IHPA 2A5FA 3CF0A 1FTSA 5FPTA 3FMOB 1WMSA 3AVYA 1NMXA 1SVSA 2OFOA 3A6PC 3ZQJA 1G16A 1K5GA 4Q01A 4HUQB 3AVWA 1G4AE 2BDTA 5C46F 1F2UB 1W2GA 1H8EA 1TADA 3QG1A 4TTPA 4MYTA 1KJYA 2JIZD 2VF8A 2D62A 4LK2A 1R10A 2FDCA 4PC1A 5A0FA 3QKUA 3UMSA 3FTQA 3SJZA 4V0NA 4B76A 3KL4A 1UF9A 3QE0A 3TH5A 2RMKA 1N5JA 4WBSA 2QBYB 3FFBA 3UG6A 2E87A 2I1VB 2WZQA 4Q4HB 2IUSA 5FUXA 4R98A 4JLDA 1G291 4RFVA 1XZPA 1E4YA 1U0JA 2IYQA 2QG6A 2J46A 5LB2A 2WWHA 1EX7A 2QUZA 3RSOA 3K0CC 1JPNA 3N5CA 3O8BA 3U3JA 4LBZA 1H8HA 3QF7A 1UFQA 3T06B 5EUQB 1UKYA 4RSGA 1DADA 2DBYA 2W2TA 1J99A 1II8A 2XJ4A 4Q4AA 1ZJ6A 2AKYA 3BRWD 3WBKA 1YKSA 2ZTSA 5DGXA 4D82A 1W36B 2AFIE 4RKEA 2C99A 721PA 1XB2A 2Q9BA 5EP4A 3UMFA 4HI0E 2RGGA 2GEUA 4KU4A 3K0SA 1E0KA 4A8JA 2HJVA 5H8WA 3SOPA 1E0JA 4XSHA 1YE8A 5H68A 2EW1A 1E9BA 4DIEA 2GJ9A 4US2R 5KYKA 1Z28A 2FOLA 4IXMA 2ECKA 4IFBA 4W5JA 1YZKA 4D26A 3IUYA 3DKVA 2BM1A 3TUJC 2HT6A 3TR5A 4QBFA 2AR7A 4Q9KA 1QRAA 2D2EA 1NBMD 1XPUA 2CCGA 3J81k 1OH7A 4NCNA 4YLGA 2GETA 3ONWA 3WHLA 1YRAA 1XRJA 2CL7X 4OQXA 2EWWA 4P3YA 1X8KA 2BOVA 3GJXC 4LV6A 4URYR 1DARA 4O3MA 5AJXA 1Q3HA 1ZM3A 2NO9A 1HE8B 5FL7A 1KDRA 1R6BX 3LLMA 2ZJ5A 2V8OA 2V1UA 4JL8A 4B44A 2FZ4A 1RJ9B 3OEHA 3BAFA 2BKEA 2KWIA 1XTJA 5CJ2A 2FX3A 2P2LA 3KXIA 2D06A 1MO3A 4IOLA 4TL7A 4Q9LA 3VR3A 4EFMA 2FZLA 1U81A 3IPXA 3P1JA 1ELOA 1X1SA 2AK3A 1QHYA 2ZI6A 4MITA 4Q1AA 3KXLA 1NG9A 3IQWA 4II7A 1W0JA 4CGZA 2NTYC 4OBEA 1P9NA 1QBKC 3PV0A 1AQYA 4KVAA 2R44A 4NYJR 4BZPA 2HYIC 3SBDA 4I4LA 4Q7JB 4DC9A 3GLGE 3AVOA 3RS5A 1NIPA 4HYYA 1G18A 2WJVA 5LDDC 4HDCA 3TKLA 4GZLA 3U4QA 1U99A 4NONA 1AM4D 3CH4B 5HE9A 3L0IB 4Q7MB 4BFXA 3EZ7A 4MRRA 2HF9A 4WOPA 5E7IA 3LXXA 2VBCA 3W34A 2V9PA 4GPTA 2FEMA 1P60A 3CW2A 4F93B 2YINC 3HYRA 3FKSA 4HLCA 5TV2A 4BLRA 1MH1A 4DDUA 2WHXA 4JYBA 3DO6A 2P5TB 1LF0A 1TF5A 4RJLA 2AWOA 2RKOA 2JDID 5ELXA 1Q44A 4DLZA 1KIMA 4V0KA 5EP2A 1YRBA 4LJ4A 5JCZA 1GUAA 1CR0A 1LW7A 2IWRA 4BLTA 3EPHA 3I3SR 4C0KA 2YV5A 2IL1A 3T5GA 2IYZA 5JRZA 3LAWA 5DHFA 4D6PA 4PTLA 5EQTA 2HEIA 6Q21A 1IN4A 2EFDB 1YR6A 3RS0A 2X2FA 3QKSB 4PR0A 2PLFA 2HCJB 4WXRA 5L8VA 4OQNA 4URWR 4A9AA 3PIRA 2R65A 3B78A 1YHNA 1TPZA 2OESA 3B82A 4DCUA 2H1LA 2P67A 4BECA 2CDNA 1G6OA 2A5GA 2XTMA 2Z0MA 4KHZA 4ZCLA 1W0KA 1FOEB 2O8CB 4TMZA 1IONA 1U98A 2YC2C 1ZNWA 5CB8A 2NO0A 4TLEA 5EE5B 1LB1B 4NYJQ 2CHQA 3FMFA 1UEJA 5FBRB 1R0ZA 2OFXA 2BJWA 4YONB 3NC1C 3CZQA 1T3HA 3CPJB 4OHWA 3TJZA 2CJWB 3KXKA 4JVNA 4AK9A 2ZRKA 1EESA 2GXSA 3EG5A 1O3YA 3DDCA 4JJZA 4M22A 4B2PA 3CX7A 4M21A 2PZEA 2FN4A 3ZVRA 1HURA 1D2MA 1GP2A 1NN0A 3TQFA 5FR1A 3A1SA 1FTNA 1RKBA 2VRWA 1ZCAA 1WRBA 2JATA 1R8QA 4GNKA 1BMFA 1KMHB 4KJZA 4M0LA 2WSMA 4OHVA 5E95A 2H18A 2NZ8A 5JI2E 3OIUA 4R2HA 5CYPA 5FPKA 3UIEA 1OXXK 5KPJA 1HH4A 4I1SA 4TLCA 3KB1A 5KSZA 1EFRD 2HCBA 3KQUA 3QPVA 3AF4A 2F43A 4A2PA 3X1WA
chains in the Genus database with same CATH superfamily
2QYTA 4RAOA 3F6CA 1U9YA 5JATA 2ZI7A 3PEYA 2X6QA 3FSRA 1S2IA 1N75A 2C8JA 2K87A 2C9DA 2YVAA 2ZI3A 3LBYA 3NALA 1PLKA 3WNQA 4RTKA 1WUTA 4N6OA 4M9XA 3OIVA 2Q5FA 5C3MA 5EUBA 1IZZA 2JLZA 1SH7A 5B7QA 4NKRA 2O23A 3FNIA 3B9BA 3UFXA 4B74A 4TV9B 1AX9A 3F73A 3U56A 2CMKA 4QPDA 5HX7A 4CKYA 2WPDD 3ZVMA 4CHTA 1IDN1 4O4LA 4ZT3A 2HHAA 4F4IA 2Z1DA 4RTLA 5KVCA 3OQNA 1N5IA 4G8BA 3MMXA 2NXJA 4JLAA 4QE3A 3K9GA 3QOWA 3UAOA 4EP1A 2F4VB 2OV6A 3QQ5A 2CE2X 1ISHA 4CDNA 3O1HB 3ORSA 4GH5A 4U9HS 2EKBA 1MN6A 1NWHA 1DCKA 3VHQA 5CX1B 1SZPA 2BTQB 2ZROA 4YUYA 5EP1A 4ZTUB 2Q6VA 2DH6A 5G1PA 3KQSA 3WGHA 1V9SA 2Z9BA 4CCAA 2DLCX 3IDZA 4CTJA 4M46A 2IQ5A 2RGWA 2OLJA 4B2IA 4KTTE 3AR9A 3UHFA 3DZHA 1QIGA 4AJEA 3MT0A 5I51A 5ED4A 4TQ9A 1I4LD 2OHIA 2AN4A 3I1YA 1ZINA 2CD7A 3D7RA 2MTBA 3FVVA 2PKCA 3FAKA 3HHPA 4BNTA 1KDYA 4D7AA 2FLKA 2JI8A 1N5RA 2DVMA 2XOKD 4JUDX 3PUXA 4PZPA 2O0KA 3TGLA 3PS9A 4FFDA 4XCQA 3LY5A 3U3OA 1X2EA 2XVZA 2ZR7A 3KRTA 1QANA 3MTBA 3K1TA 4RH1A 3VDNB 2XDYA 3CEJA 3HJGA 4KGZA 4WPGA 4X41A 3VNRA 5FI0B 7ABPA 3EGWA 1B43A 1PQ4A 5D5HA 1UKCA 2GARA 2XDWA 3HZZA 4G0NA 1E9RA 3PNBA 4F2PA 3HB4X 1QH1A 1XRMA 3CUYA 2FG7C 2XBMA 1WL8A 3K2BA 3PDIA 2CZCA 4H6WA 4J0KA 4R9NA 3STVA 5DLPA 4YDQA 4HTFB 4G0VA 1IN8A 3BQNB 1P7PA 5DM1A 3TVDA 1RI1A 1T8UA 4FVTA 2V7QD 3IT1A 4A91A 4ALIA 2Z6UA 4LMPA 3TTUA 2I7CA 1C7EA 2Z57A 3D4BA 3QA3E 4JGGA 3PDJA 4RLHA 1D1TA 1XJ5A 3RAJA 3CRQA 2CNDA 2HRRA 2GYUA 3TFWA 4DDUA 5MGBA 2O8CA 1JHMA 3T1NA 1AMOA 2IXFA 3JXEA 1P2TA 4HEA1 1B93A 1XJCA 3L0OA 3I04M 4TSFD 2D5CA 2OSBA 2DPXA 1ODLA 1YR3A 4M1WA 3S2SA 2RGBA 4BMOB 3E35A 3KDPA 3M0EA 4DG9A 2BGRA 4S1OA 1EFTA 1YZGA 4WQMA 4EECA 3IDFA 4B83A 3EPKA 4CLRB 4XM0A 3EVEA 1OWLA 4EGAA 1ENZA 3VMFA 4MKRA 4Y6RA 1UBEA 3PNKA 1L4UA 2ZSFA 4MKZA 4UNRA 1GPDG 3OTIA 1WW8A 1EGHA 3R76A 4BNVA 1OF1A 3IQFA 1SXJE 5T6BA 3LXRA 2XGOA 3BGSA 5DMHA 4R5HA 4HGOA 1CR6A 3A9SA 3W5SA 1AGPA 1VLMA 3RADC 3KR2A 2NZXA 1OB5A 3NIBA 3TIVA 1NT4A 1ABFA 2D1TA 2I91A 1D03A 4JJ8A 3O8CA 2ZTMA 3N0XA 5L3VA 2CLCX 2WM9B 3BXZA 3ASUA 1E5QA 1EG2A 3LFTA 4ZT2A 2YWDA 3RS9A 3FKQA 5A1JA 5BN3B 1GQOA 5AQ1A 3TG8A 4MDFA 1UBRS 2A58A 4Q0MA 5DT9A 4D9JA 5BRNA 5KNBD 1V8DA 3RI3A 2QNIA 2TMDA 1EFAA 2QZSA 3RPEA 5HXAA 1Z88A 3FR7A 3N05A 1H23A 1Z6YA 3NAGA 3OHSX 4UXIA 1IB0A 4ITUA 5ALFA 3ZIAA 4D98A 2RGNC 3C3MA 2B37A 2P6OA 2ZS9A 3IP1A 2FFRA 1MNAA 3EHEA 5FOXA 3FGZA 4XDHA 4AJ2A 2HK8A 1QORA 3CRZA 3MCUA 4QYWA 4DQVA 4BO3A 4RJTA 4MTLA 3E7WA 3OJWA 3RTAA 1HT2E 1J5EB 2PSHA 5D5PA 3OZXA 1OWPA 3PEUA 3B3FA 3RRMA 2PZBA 1N57A 3VSCA 1SJ9A 4CQLB 2PHZA 1YB2A 3N58A 4RVOA 4G5RA 1P0FA 1TT5B 5ICFA 4C7MA 5LQNA 3GDOA 4QXMA 5BO5A 2GBLC 5A5EA 3WGYA 1FXUA 1NOKA 1Q74A 5K4GA 1N3IA 3EWIA 2XE7A 4P86A 3VOTA 4YJKA 1QG2A 3G0CA 3GBPA 2R1VA 1VKZA 1XPRA 1P5RA 3HB7A 3LRPA 4HB3A 1U2EA 2ZRMA 2O5RA 2I8AA 3L8FA 3GPDG 3NT4A 4Y1RA 4OUKX 2NYVA 2XB4A 4UU7A 2PV7A 3QU4A 1XQXA 2QU8A 3NTUA 3FCYA 3ER9A 1KOLA 3P0RA 1XEXB 5GADl 4JYZA 1DBSA 4GLOA 2Q07A 4FGUA 3PPVA 3EGXA 4KXWA 2D0OB 4P2GA 4B4WA 1M2GA 1RIIA 1UAYA 4IIVA 3DLCA 1HWYA 4IJQA 3TX2A 4BQPA 5MN5A 4EUKA 3M70A 1MUUA 1WDLA 5JI3E 1AHNA 1PJ4A 3KYJB 1E2QA 2LKDA 1L5VA 3F6RA 1AZWA 1N6OA 4J03A 1US8A 3WGUA 3MEQA 5EHZA 1WLYA 4UATA 2FFBA 4B84A 4MWZA 3NBZC 4LYHA 3KQLA 2XYQA 4A8PA 5D5QA 4LXQA 4YRTA 1W2HA 2GCOB 2QZPA 3CGWA 3LP6A 1FUIA 3OD5A 2BKUA 4XUGB 3ZK8A 1ESNA 1P6QA 1QG4A 1XVUA 3PR3A 4L4RA 1N25A 2XUAA 4LJLA 1NVTA 2BC9A 3T5BA 3VKWA 2WWYA 1A2OA 3FVQA 3PR2B 3QEJA 1SXJC 3TZQA 2WYWA 1L7EA 4N82A 2O7RA 3ZY5A 1N6HA 5C5DA 2X86A 4OHRA 4DCOA 1TUBB 3JD1A 3CH5A 1U7ZA 3F6YA 4RMGA 5GJBA 1YR1A 3G8YA 4FDTA 3HJHA 2EF0A 3GFOA 1IG3A 2PGAA 1S2LA 3MWLA 4V1CA 2XOEA 4YRGA 1QGUB 5KTKA 1P3DA 1R6XA 4I9HA 1E3JA 4IMJB 1MU0A 2NU9A 1FMJA 1HL7A 1HEIA 2IY8A 3H4IA 2KB0A 2Q0XA 5DTJA 3R75A 5KSYA 1T4BA 3AEUB 2VHCA 3H19A 4G86A 4KC0A 5REQB 3RJZA 2ISQA 1RRGA 3VYTB 3MRSA 1LPPA 2ZBUA 2WAXA 2XUZA 1L7AA 2Y93A 3O8QB 3AEKB 2D5LA 4KRGA 2AKEA 1DTWA 4I1PA 3RYTC 1XUOA 1JQ5A 5DBGA 3VKGA 4URVR 1A96A 4B43A 2WJGA 4YJGB 2YOFA 4PLPA 2WG2A 2AC7A 1G5HA 3QHAA 1TU4A 2VC2B 3B2QA 3BIFA 4V0LA 2C88A 3VKHA 4BJ3A 2LE0A 3FYUC 4IUBS 4LDQA 3IMFA 4HH1A 3ASYA 1WULS 1ANKA 2ID8A 2BTOA 2BSAA 2EYUA 3D8HA 4ZO9A 4NJOA 2UUCB 4XVQA 3IRUA 1QQ7A 1Q11A 2YIDA 3DLHA 1NG1A 2W6QA 3DE6X 3F8SA 1UZLA 1QO9A 3GRKA 3MS2A 4RVFA 1BVUA 4XR4A 3L4BC 4OI1A 2EEZA 4QDXA 4EL5A 5HIKA 1ZA1A 4JVLA 4DJAA 1L5OA 1RC1A 4HC4A 4TMXA 1C4OA 1M7HA 3RBXA 1T29A 4PW0A 1ILWA 2EJWA 2QG9A 3FNHA 2FRVA 3VUFA 3IILA 2I33A 1E79D 4IIJF 4O2BF 4LRYA 1G7CA 4R8VA 5CHEA 4ZU3A 3RVBA 1O8CA 2NGRA 4DQXA 5JD3A 4KJXA 3HNOA 3WWCA 1TVMA 3TRIA 1TLLA 3D5TA 1PZFA 1MRNA 1MVOA 2PD3A 4E07A 4OLFA 1W88B 2WUVA 3NJ8A 1WOYA 3HEBA 3IIJA 4YJ2F 1E89A 3QW2A 5HIAA 5BQFA 5ADVA 1KY4A 4II2A 1SEVA 3TE7A 5A1TA 2VDMB 4AQDA 5IDQA 5KTSA 2OZLB 2IHUA 1ZJZA 4KXLA 1MW8X 1U2RA 5E3HA 2QJFA 3NDRA 2G1PA 1E6CA 3HCOA 4WGGA 3BKXA 1FXWA 3JVUA 3BSYA 3ORQA 1EA7A 1MLDA 4DWWA 1JLLA 1ZGHA 4U2BA 4PYOA 3WMEA 5F1YA 1W4CA 4E5DA 3FNGA 1N8TA 3PFHA 3KWFA 4W8HA 1Y63A 1TYBE 3O03A 4PG6A 3VX4A 4I4TA 3I2FA 2AFVA 2QPTA 3G5LA 3RS2A 1U6IA 4L76A 2OGTA 1L7NA 3KKMA 3ILXA 4ZEXA 3EG9B 1DIOB 1K7SN 2F3PA 1QIKA 5G3YA 3JQEA 2RHHA 1TQ2A 4KO2S 5HHTA 2LV8A 3FDJA 2FSPA 2K4MA 3KG2A 4R4JA 2G6BA 2C83A 3C4VA 3UMRA 5BSKA 1QHEA 1Z2PX 3IP8A 3BXFA 2HXSA 2R8RA 3PUVA 4KYUA 4OGWA 3RIYA 2IYTA 4D3SA 5BWMA 5I7HA 1ETHA 2C9CA 1SZDA 3AM3A 3SIPA 4FOOA 3GFTA 2JBWA 3C3YA 3MMSA 3FGPA 3SLKA 4DWVA 4OKSA 2XLBA 1JIVA 2OHXA 2HMSA 1DJQA 3TCKA 1X39A 3WGZA 3Q8LA 1AUQA 1XQ1A 1LD3A 2A78A 2JFHA 3TTYA 5BN5A 2VDRB 1UANA 5JNSA 2AR9A 1XAHA 3SC4A 1QJCA 3MCWA 4LCJA 1MIHA 2QN6A 2W4IA 2X0JA 1CJTC 3LYLA 2AOTB 4LDAA 4Q82A 5FTKA 1NIJA 3BRSA 3CTMA 1QPZA 4WMLA 2BFDB 2PMCA 4FFNA 2VDKB 3ZCUA 4D4GA 1AUXA 3UWPA 3ZNNA 3KCNA 3IQHX 4K8OA 2IH5A 5EZ6B 1CR1A 3N2EA 4RD4A 1QGAA 4YRDA 1P29A 3KR0A 1CJUC 2E0IA 1MQSA 4N5DA 4WIAA 4X8LA 3DWFA 5EOVA 4YWJA 5H59A 5BN4A 1JBEA 3CSSA 1Q1EA 5CBPA 1N1GA 1JHZA 1TK9A 5AUQA 4D9IA 5IDWA 2X1LA 4GL2A 5JCOA 3EC7A 1ONBA 4XJTA 1LPAB 3HLYA 4DLWA 4N3NA 2YUIA 4RF3A 2D0IA 1JVBA 1YI1A 3AF2A 3KSUA 1L1EA 1C9MA 3LYUA 4N49A 4IIJB 3UPDA 5IWCA 3WFIA 5KTTA 1U1FA 4KAFA 1KI4A 3GRFA 3JQAB 3DQQA 1U63A 4D1YA 1II9A 4Q3CA 3BJIC 4PTZA 2A14A 3O91A 4I50F 1AXRA 3RSGA 3VU8A 1T3ZA 4B8ZA 3RC7A 4G0MA 4K5QA 4YCLA 3JQ9A 4F45A 4YRIA 2PXXA 3HB9A 1DLIA 1UFRA 4U63A 421PA 4ASUD 4CR8A 1K68A 1RXSA 3EGVA 4GEKA 4JA2A 3KYDA 2E1RA 1N2CE 2NNLD 4XIJA 2ZR9A 3F3KA 5E9AA 2VNAA 3BOSA 4YAJA 1PEKE 3FYSA 1WV1A 3I32A 4MS3A 2J6BA 1C2TA 2VJMA 3R9XA 3OE7D 1NW6A 1R15A 4BKOA 3WWYA 2ZIFA 3WNCA 3OIYA 1VGRA 3HA5A 3V4RA 4IIYA 5AVTA 4M98A 2Q3DA 2VKQA 1JT9A 1K8ZB 1ZGAA 1QIFA 2QYHA 2ZWMA 4GI3A 4HAZA 2LPMA 4MV5A 1FYFA 4NCXA 3SF8B 3WLHA 1RKXA 1MX1A 6REQB 3EEFA 1VCHA 4P53A 1Y80A 2Q6IA 4FHCA 4ZC8A 1QRTA 2XYHA 2CJFA 3E9CA 3EXG2 4DLBA 3JVIA 4KHPB 4PYQA 4CUZA 4ENWA 4GOXA 1Y37A 1FRFS 3MD0A 4YUZA 1QH8A 3MMPA 4O4JA 1DSSG 4QAQA 4ZEMA 1J21A 2Z83A 3EVTA 4PVCA 3DYBA 3IDSA 4RF2A 5C18A 1PK9A 4EBFA 1R0KA 2Z9CA 4JD5A 1FRZA 2PT7A 2YWHA 4K6KA 4O2RA 5F12A 5IC6A 4N8SA 2IBMA 1T36B 2JAPA 4OK3A 4MPRA 5AVXA 1P18A 4LDZA 1BXKA 2A4KA 4GOOD 3SHQA 3UXYA 4E09A 1ZW1A 3A6JA 3DTTA 1HMYA 4Q1DA 4LWOA 1I7NA 5I4CA 1DL5A 4QWWA 2Y0EA 5B2ZA 1LU9A 3ZS9A 3LKBA 3IESA 3PJFA 1ZH4A 2FTKE 3D6FA 1JQKA 3M6LA 1LXCA 4UHCA 3LT5A 2GILA 4B46A 4X24A 4HJRA 1KSHA 4R2LA 2VLBA 2RSLA 2O07A 1H8HD 2EEPA 1WVGA 2JH3A 2WE7A 1QHHB 3UAZA 1IBMB 5D8DA 1ZR4A 1EZ4A 5KI6A 5LMNB 3H8WA 3QF4B 1DQNA 3SJCA 3AR5A 4NX2A 3JQ8A 3ZNPA 4Z9YA 4G65A 1JEAA 3CZAA 5EHGA 1OXBB 1TTHA 3K5HA 1XJ0A 3GAAA 3PDCA 1RQ7A 2XTNA 3GBVA 1KVUA 4PQRA 1Z74A 3DTYA 3O95A 3AF1A 1T1IA 3E9QA 3PUJA 3U4IA 4UEJA 1UWKA 3NOQA 3RTCA 2CXHA 3V34A 1C80A 4B3DA 1KDZA 1ZSYA 2HDNB 1MPTA 9LDBA 5JHGB 5BMVA 4IQ8A 1MV8A 4EOGA 5FBKA 1XJQA 3D2CA 1ZOSA 1AZLA 4LFBB 1DCMA 1NV9A 4FEYA 4RDCA 4YLYA 1X1DA 2XF2A 2WTAA 3H2BA 2NUPA 5EFZA 3UWKA 3MB5A 2XTAA 1T9BA 1AQIA 2PKQO 3TXYA 2VAWA 1IC6A 3PC8C 1XL1A 4WLEA 1H2YA 5AVQA 1W0CA 4ANFA 4I50B 1AMNA 3M1IA 1GXSA 2CHGA 3DMTC 4LZOA 4ZXFA 2AF4C 2WHQA 2H65A 1L5YA 4LVCA 5FWAA 2PMDA 3ZGNA 4BGEA 5I4KA 1G63A 2KBFA 5KB3A 2QVCA 3K15A 4OQQA 4IBOA 4CIDA 2NOAA 4HNQA 5KX5A 4TYYA 3KVNA 1JFVA 1N3LA 3PQFA 2FUEA 4CKBA 4P4NA 4B3MB 3HYSA 3DHWC 4UMFA 1QZ3A 3BIJA 3DVRX 2QL6A 3P9IA 1E2MA 2D1RA 2PRIA 4D42A 4EPTA 3G79A 1DIAA 3CR3C 4FGSA 3A11A 4H4EA 4YC7A 4QGBA 2O0JA 3Q5GA 4MRMB 3UM9A 4BS9A 2BSQA 1AS3A 1R3UA 1CNFA 3QUQA 4A0HA 3N0RA 4Q15A 2XADA 5DT2A 3VU1A 1C1HA 4P34A 4CTMA 2I3BA 4RQAA 3F4BA 3KVYA 2CDCA 3U0VA 1TO2E 3I01M 2BGTA 3G8DA 3K31A 3DMFA 2ZJZA 3RABA 1LSJA 2FP4A 3IO5A 4QHTA 5HG0A 2W00A 3TLCA 4I1VA 5F7JA 4I4IA 1KR5A 1XEWY 1E5DA 4J0DA 4OXRA 2ECPA 2YMPA 4DUGD 5KIAA 4FMBB 1JR3E 4C0XA 4EI9A 3HKEA 4GUDA 3TXAA 4A10A 4F5ZA 5TF0A 3IIEA 4JJ4A 1JLKA 1KH1A 3PGXA 3RRJA 1J7KA 1XQ9A 2C4UA 3K2EA 1QWOA 3NUQA 2GPWA 4MWCA 1G5IA 1M2NA 4R7TA 5CVVA 4BVKA 1O5TA 5IJ9A 3I4FA 4YMTA 4G9BA 3Q8XB 3ABZA 4FNAA 3IP9A 3H2IA 1T0JB 1SZCA 4ZN6A 5D84A 3UK2A 5LBIA 3AMVA 1R2QA 1M7GA 3SMVA 5FAXA 4RF4A 1G8GA 3DTVA 2QM3A 1CKEA 1IM2A 4IV8A 4LV8B 1U9CA 4QO7A 2H5JA 2NAPA 4BNHA 2CLOB 2YMQA 5JJKA 1P81A 3SHVA 4PWZA 3BGOS 4JMPA 3GP8A 1I4TD 4BMYA 1R8JA 2VR1A 4GBED 1EDBA 2IEDA 3GJ4A 2IPNA 2JDIA 1LF5A 2AC4A 2ATCA 1EJ2A 3ZWNA 1RM5A 1FZQA 3EF1A 5AVRA 2SCUA 4U7DA 4BFWA 1KBOA 1C9KA 4U4AA 4NECA 5AKJA 2ZREA 4Y3UA 1VIVA 2IH2A 3CURA 4Q21A 3UO8B 1NW8A 3S1SA 3IKVA 5SY9A 3SWWA 3QYFA 2FMHA 2LP4Y 4ZKEA 5KMGB 1GAJA 4NU8X 3ZZUA 1UDWA 3K70D 2OLKA 5KKAA 2C5SA 3FF1A 3H9BA 4KAAA 2QLLA 2DHEA 2YUTA 5AJUA 4Y1GA 5JSFA 5DXFA 4FU0A 1EM8A 4K81B 5CP8A 1DKMA 1JFRA 3LUDA 1M10A 3E23A 4REQA 3LLCA 3SVLA 4RUKA 3FJOA 1L5HB 5K0NA 5AVWA 3CZ4A 4HX5A 1FDIA 1JR2A 4QOGA 1F0NA 1KVTA 2UZ0A 4P35A 2Z04A 3DD5A 4D9FA 4MDEA 1GFWA 5H83A 4W1RA 2ZDGA 1K3UB 1PLLA 2HUPA 3AWIA 3GV0A 1J6UA 4P3OA 5H0IA 4B73A 2A5YB 1E61A 4OXNA 4CT4B 4DLLA 3IP5A 2MYNA 5JZMA 1SA0B 2PUEA 2B5VA 2WAYA 1UT8A 5IP5A 1PZMA 3DBRB 4P3NA 2SECE 1MH9A 1LBEA 2WWVD 2IUFA 1U1DA 3FB4A 3GL9A 3NJRA 4QYSA 5EXSA 3VVCA 4EG7A 2GZAA 3Q7SA 1YJQA 5JYEA 4DR3B 1HNWB 1GWNA 1K8YB 3IAS6 3TTSA 2BKVA 3K9BA 2BMVA 4MMXB 1NR5A 3PC4A 1R5OA 2ZWOA 3LNCA 3SD7A 2X2PA 2RAFA 3FZYA 3JQRA 4GQIA 3IMCA 4WK4B 3ZLVA 4DWOA 2C1ZA 1ZVQA 2RBEA 4L4YA 1IBRA 4FW8A 2I6SA 2PMKA 4H0FA 5GJCA 2R6FA 2W2QA 1A9PA 2V7GA 1TU3A 3GGSA 3D6MA 3U3DA 1EWQA 1Z5OA 3LI2A 2OBBA 3GU3A 5T64A 4GYYA 4PIVA 3W5IA 2CNNA 3PCRB 1BN6A 3E0QA 4M9CA 2DECA 1KXJA 4O2AB 4RV9A 1SBYA 2Q2QA 3WIEA 4XWWA 1NQAO 4J43A 2BFBB 3UHJA 3NTQA 4X7BA 2D0DA 3L7IA 2AMYA 1WBBA 2ID7A 1KJNA 4RKWA 1G20A 3IEVA 2XTZA 1ADYA 3RU9A 1ZAKA 3ZWXA 3E7PA 3COVA 1NMQA 4M4SA 4UMVA 3W04A 3GMTA 1I6MA 4KGDA 2RHCA 1IPHA 1LRLA 1Q83A 4KZKA 1VECA 4FBLA 1KC1A 1H5NA 4W7SA 5H80A 2PUBA 3HBLA 4Q4AB 3FIJA 3A4MA 1ATZA 2BHSA 3JWEA 1P77A 3FI9A 4LGCA 3IEUA 2GFQA 1IN5A 4EYEA 2OGUA 1ITZA 2ODNA 4RMHA 3AUXA 4D6XA 2GM9A 1S5PA 4A8JB 1OFTA 2ZQ5A 2GYWA 1OT3A 3OUTA 1PYOA 1V16B 3C5VA 2VJDA 3GEMA 1USUA 2E37A 4ZP1A 2FPLA 3HKBB 1QC5B 2VEDA 3ANLA 4H60A 1JG6A 7MDHA 4JB2A 4LPKA 5CLQA 5AO9A 3PWTA 3K0HA 5FUQA 1AU9A 1OAAA 1RQPA 2JHPA 4L16A 4F38A 4UDOA 2D2FA 1SHKA 1T4CA 2FEWB 2R25B 2G7ZA 3JWPA 2DUWA 4K9PA 4B3FX 4LDRA 1NI3A 3Q9NA 1WBDA 2DLDA 2D7JA 2XNJA 4HLUA 1ZUNA 1ETUA 3BXEA 1E9FA 1NBWB 3VC3A 1OQAA 3TBFA 3DFIA 2AA3A 3QFSA 2QMOA 3BF8A 3BMNB 4ZZ0A 5IYZB 3L07A 5B6PA 4TTJA 1BX0A 2OE2A 4I36A 1I2ZA 4G97A 3RGGA 2P90A 1OXUA 3F3SA 2FFHA 2XOKA 1LY1A 5D6NA 4AF6A 3UMMA 1ZXLA 1P7ZA 2QP3A 3QEMA 3MPOA 3LPMA 3U61B 1MB0A 1O8BA 3GCWA 1G7TA 4R84A 3V4VB 1E92A 4AKIA 2PXHA 3PFIA 1P2VA 3V1LA 2QLNA 2HMYB 3F2IA 2LZ0A 4EVIA 5HZKA 1PAUA 3H2JA 3E3OA 2X15A 5LLDA 1AUPA 1U8ZA 1SC9A 1BWRA 2LKCA 2DCUA 2Q41A 2HF7A 2Y76A 4QFCA 3HQ4O 1YJ8A 3AKEA 4RJJA 5AK5A 2V0GA 1YDGA 2RK3A 3K16A 1ZNYA 2I2FA 2AIRA 2CCKA 2CZGA 3ESZA 3ZGVA 4RTNA 4NJEA 3U4QB 4HNAB 2QLTA 4RMNA 1ZFNA 1WSBA 2E4VA 2XQVA 3EPJA 1ORTA 5J5VA 1KNQA 4K1XA 1A4UA 3W79A 5AUOB 1R4MA 1TXGA 1QU2A 2BMJA 1KOFA 3OLVA 1UMDB 3W5UA 1V1RB 1QQ5A 4OGGA 1N6LA 4IR7A 3ZWQA 1GFZA 2GRAA 4RELA 1JXQA 2JBHA 2WIJA 4ZZ2A 2C5GA 4HGQA 3JARA 1Z3IX 2WFMA 1G2PA 4MRSA 4Y9DA 2XWQA 5FOUA 4DYVA 5BPFA 1NUQA 5TS3A 5DBFA 1U4NA 5FPYA 4MVJF 1ZCBA 5IM4A 3EHDA 1ONNA 2N42A 4MKFA 4BL5A 3HBAA 4IGFA 1P0CA 1UBJS 2QB5A 4FFBB 1ZN7A 5CVDA 2ZBRA 2AT1A 1HRKA 3CX4A 4O4LF 2YHIA 3I23A 3JQ6A 5JUWA 3GA0A 2OVBA 3NG1A 4FNGA 1RKQA 4PCVA 1DFIA 1T6NA 2QVGA 3JW8A 4FD3A 5TB5A 1T9GS 4X95A 2QI9F 3UFBA 3WDLA 4YDRA 3U19A 4ZJPA 2XKJE 4CODB 3U7HB 2QUBA 3AXSA 1VP9A 5CVCA 4AJKA 5BWNA 4F0JA 2QMZA 3G7UA 4OO3A 1O08A 2C59A 4J3JA 3OU2A 2AOXA 2FMFA 4YCAA 2RHWA 2W98A 1FFEA 3KJEA 1PP4A 3QVJA 4C7XA 1IOVA 3JRWA 5AKYA 1ZD2P 3A58B 1MG0A 2CMFA 2G67A 4Q03A 4PG8A 3ZQUA 1U0HC 3OA2A 4K88A 3R0VA 2GJ8A 4QRDA 2RAPA 1D6JA 3OSZA 3UEOA 4BQFA 4IQFA 1SD5A 4F92B 3H3XA 1NBHA 2ATVA 2AMVA 3DSRA 3I04A 2A59A 1U2DC 1Z2CA 3PC3A 1ZOPA 4NK4A 5I9TA 4ZPXA 4DA8A 2PH1A 4FWIB 4WUVA 5D51S 1FNDA 4F9GA 1ISRA 3BD9A 4A0QA 2CKDA 2ILVA 4MMYB 4YCDA 5HIIA 4B8YA 3HP1A 2X8JA 3AEQA 2DUMA 4EJSA 1L5NA 4HS9A 2H00A 2ZIAA 3I58A 4KBFA 2GZRA 2GS9A 4TMYA 3WMGA 5JAUA 1YTUA 1T3LA 3SZUA 4Q3BA 2PL9A 3LSTA 5HKKD 2MR6A 2D00A 2A8YA 1W4RA 4IJMA 5FTNA 5EYPA 4UMDA 1WPQA 2ZITA 3KAKA 1KAOA 1H0HA 1UEIA 1U3FA 2EYQA 2R2AA 2V0NA 3AFNA 2H51A 1DAOA 1E5XA 3AERA 4KI0A 4LC9A 5AM4A 4B47A 2UXBB 3UMJA 3V2UA 1I3MA 4DADA 2QRPA 2HA3A 3IMEA 4II3A 2QVBA 4LQLA 4DDHA 1M8PA 3SQXA 3VNQA 5EKUA 2QPAA 4RQBA 4D99A 7YASA 3D8RA 4CM6A 2GBGA 1Q0UA 2NT4A 4I55A 2RBGA 1X1CA 4C0WA 5FB3A 5ICMA 4TKMA 5AK3A 2XT6A 1FDRA 1E7YA 1Y5MA 1V6AA 4TSKA 5IJWA 4RESA 3HJAA 1ECGA 5CDYA 1GUDA 1RHUA 3P5BA 3PIDA 1URPA 4MP3A 3TPCA 3ZE0B 1GILA 1MDFA 3BWYA 1RMYA 2ZAOA 3KZMA 1DMRA 1XLWA 3LV8A 1E2FA 1Z6XA 4QM7A 1Z3CA 4P0QB 2C5AA 4GXQA 1HR0B 3BDAA 2PUDA 2H8KA 2WOJA 3A2NA 5AXDA 4P3XA 5BV7A 3UFXB 2HMAA 3HCBA 3UB2A 2XXJA 3NHFA 3QVUA 1LLFA 2GN2A 1VPTA 1MEJA 1JSLA 2DQ4A 1GCIA 3MTQA 3TPFA 5ADWA 2VNHA 5KQGA 4CV0A 4O4LB 4RNDB 1X14A 3ENVA 1I2MA 4XYGA 1S4QA 2NN3C 2XYRA 3A6HA 3HSYA 3LWDA 3ZWKA 3PTAA 2Z3WA 3P27A 2EG9A 5C7YA 2WKWA 2HGSA 5CH3A 1VG0B 1G3IA 3TR0A 4JB8A 5A0VA 1Q1BA 3D3QA 1R50A 4U02A 3UB3A 4DL9A 1JYFA 5AXBA 3WMWA 1YA8A 3VDRA 3HWSA 1IXKA 4MUJA 5KAPA 3NDBB 1OVMA 3LQRA 4NZZA 1L7BA 1ZOOA 3BWVA 1QZTA 5IMBA 4L0MA 3A9VA 4TRNA 1HYQA 5LYJA 4E2XA 3T5PA 1FIUA 2XRMA 1V8BA 2PAAA 3MQ2A 2G83A 4I6GA 5EIXA 4MEAA 3RUDA 3P9PA 4KLRA 5B5SA 4OLAA 4M9UA 3LT4A 3ILHA 2Q0QA 2ZBEA 3OSUA 4FGZA 3ZEIA 2WJ3A 4TLBA 2I3AA 1T5BA 3R3YA 3PL1A 2ARKA 1YS2X 4GSKA 4RVDA 5IUJC 1OBOA 2MDTA 3D31A 4I19A 4H1VA 1GNPA 3NYIA 3O4VA 4C7JA 3ZVKA 4LNUA 1XDDA 5B4VA 3IV6A 1XLVA 4FKMA 3VMMA 1OHHD 5I7FA 4GP9A 5KBYA 1TKBA 4FI3F 3M83A 2BFFA 5JDIA 1F0KA 1Z08A 3SS7X 1GZDA 1K6JA 1ZZEA 1NW5A 3K4HA 1WXQA 3VU9A 5LYYA 3D9QX 1NPTO 3ESBA 3I42A 2XCTB 2CV1A 2D1YA 4MW9A 5LIPA 1X1RA 3QKWA 3RUIA 1E79A 3T3MB 5K4AA 2J3QA 2I0FA 1KJWA 4AI6A 1SXJD 3PNYA 3GMIA 2UZIR 4U7JA 4WACA 3TIIA 3KQNA 3IMGA 4PSKA 4PSVA 1KEWA 4R40A 2OD7A 2PH5A 1DBQA 4B81A 3EVNA 1P75A 2Q6KA 3KM0A 4RZSA 4QD3A 2OB1A 1FBNA 2XVAA 1A4XA 1TQ4A 2H8GA 1LJLA 3W2FA 1X94A 1QCCA 4DLYA 2H11A 2C4HA 3SPXA 4AZVA 3L4KA 3I1IA 3G2KA 4KQMA 1LI4A 4WNAA 5TGZA 2PJDA 2BELA 4IEIA 3NUGA 3DFKA 1GPJA 4W9NC 1BFUA 4NBLA 2WP8J 1Q7BA 5LCXA 3NC4A 1ISIA 3EBOA 3RNLA 3ZXYA 3U3MA 3RFVA 1IVNA 1F9EA 3H2YA 1T4MA 1PK7A 4BKUA 2FRDC 4MJXA 4JX8A 4YN3A 3PUKA 1WLSA 4A3SA 5J1TB 4TPKA 5JBNA 3W8RA 3CLRD 2HKIA 2XA1A 3V7WA 3GN2A 1RJWA 3IPAA 3L46A 4G89A 2IE0A 4QUKA 4LI0A 4RJ2A 4C3UA 4IDFA 1GRQA 2RE8A 3T7SA 4RPGA 1ML4A 1PWZA 2WF8A 4GVPA 1H2WA 4JV5B 1QZXA 1SIOA 1NE2A 2OQRA 3PP8A 3QMMA 5LD2B 3UJAA 4LJ5A 3D0KA 1YL6A 3O2SB 1YU9A 3B60A 1WE2A 5ALXA 3AR3A 2Q8PA 4GR9A 4CIBA 4BJ1A 2VK8A 3PJEA 3NBYC 1FX0A 1Q6ZA 2OQ2A 2J9RA 3G5AA 1Y9ZA 1I3CA 1F3OA 1ZUD1 1OAOA 3TQCA 3JZAA 2CB0A 5CFQA 1CDZA 3U7FB 1WSAA 2CXSA 3CYFA 4DMRA 3I83A 3OJOA 1KPHA 1RVDA 1P7VA 3DE4X 4JVMA 4PNHA 2C0PA 4GW3A 1RRFA 2FETA 2YOHA 2NYRA 3B3GA 2Z56A 4GKBA 4D43A 1JDBB 2GAOA 4LY3A 4UJ5A 1KZ7B 3H42B 2ZRFA 4FJ0A 3PTZA 4LTNA 4Y1RB 3UK7A 2JJYA 3SX0A 4YHHB 1T2EA 4JBGA 5KYNA 2DUNA 1T0BA 2F9MA 3D1JA 5CJPA 4Z9XA 4WCVA 3FMPB 3ZUPA 5HR5A 4C5AA 1F2DA 1U8FO 1U11A 1N2SA 4FZ3A 1S1CA 4ZV7A 3EGXB 4JYCA 1SIUA 3CKYA 1ZM9A 2OXCA 2VQ6A 3O94A 3Q3VA 2CDAA 4UD6A 5JSHA 4NHEA 3E5NA 4DA9A 4H7EA 2EHJA 4P3PA 1IY9A 2ZSUA 1NZFA 5L7WA 4XD7D 5JD6A 4MUMA 1REQA 2C2YA 2IK8A 3DFUA 3A1UA 2QP9X 3EPRA 3N9IA 4KH0A 2YMLA 5SZKB 5K99A 2WU0A 2XHZA 5C4MA 5L4NA 2WU4A 2APJA 1CUIA 1TC1A 2KI5A 2Q5LA 2ZIZA 4CHGA 3Q2IA 1DT3A 1C5KA 2RG1A 3MJHA 4V2IA 4A0FA 4K9MA 4Z51A 1MKYA 2O14A 1E1KA 1OLSA 2VWQA 3FZEA 1H2EA 4ASUA 4C89A 5JR3A 2UU9B 2IP4A 1WKCA 3R5XA 2WC1A 2YZKA 4LHYA 1JIKA 3B5EA 4DDVA 5DBOA 3OMXA 4BEWA 4EH1A 2O3UA 1PCXA 4GI1A 3OE7A 2FG6C 1L7RA 5CB4A 5AYVA 3SXUA 3K09C 4EJ6A 5JRDS 3CE9A 1JU3A 1RMQA 3N6RA 3RK1A 3SICE 3O1JC 4YP7A 2YVUA 4GMXA 3UAWA 1NL3A 1YVDA 1G3UA 1ZMRA 1DXHA 4LF4B 5FTWA 6PFKA 2JZNA 2ZBFA 4O1IA 4V1CB 3EMKA 3I73A 3MCTA 2CLSA 2D3TA 2W6OA 4ZRNA 2NU9B 4EUFA 4H1WA 2H2WA 1PK8A 1VE7A 1ZICA 2XQIA 4YCMA 1FQJA 3PITA 3V7YA 1UPUA 2QE7D 2QF7A 3HP7A 3PGJA 4FGWA 4FR5A 1U2PA 3BC1A 4YTEA 5G0TA 1PGQA 3WYEA 5P8WA 5CFPA 3DOOA 4RJKA 2H9IA 3M7IA 4P5PA 5EPUA 5TY0A 3TPZA 4QULA 4XGQA 2R8ZA 3AHDA 5FUWA 1ECPA 2BCGY 1Z6ZA 1DTWB 3A0UA 4Z4HA 3G23A 1QYDA 3QE9Y 1N1DA 1VBKA 2PXAA 3W3AH 1ZHHA 1NW3A 4FGJA 4WKGA 1QYWA 3LDGA 3FPHA 3NM6B 5HDQA 5HP4A 3QU9A 4JOCA 2CXOA 4BVLA 1QFZA 4BNWA 3F3MA 4S1VA 4B85A 2CUZA 2ZUTA 3T52A 2F3TA 1NP3A 2NYAA 2I2CA 3G2OA 4OU4A 5LNK6 1EP2B 1SKUA 4XIFA 4F8EA 2FX5A 3BB4A 3S70A 4BO0A 1ZNQO 2IUTA 1CS4C 3FN4A 1YZYA 1HNZB 1NP7A 1KMMA 2AH5A 2EWVA 3FNEA 1X74A 4M36A 3VH2A 4DV0B 1OE0A 1XCOA 4RCVA 3M6MD 4U7PB 2MINA 2R6ZA 1G2OA 3SKXA 2WIFA 4M83A 5H7XA 2QRNA 3SYMA 4IFIA 2BZ0A 2YJ6A 1X7HA 1F6DA 4MVJP 3WGOA 4D4KA 1KWGA 1RWWA 1RXEA 4B2LA 1L5ZA 2JHCA 4Y6PA 2NV6A 2WJIA 3HGQA 5LKAA 3N76A 4Z0PA 4Q12A 2JFVA 1CZUA 2XLCA 3SZ3A 4TL9A 1CQJA 1KA9H 1ZL0A 4XGNA 3AHEA 3OJXA 4DLPA 2DBRA 5DGHA 3E48A 3M6VA 4KN6A 4NMLA 1II0A 3C1UA 1J09A 2A7XA 2GGSA 1GL7A 2Q9UA 4BC1A 3OLWA 1XZEA 2OV3A