1AN0A

Cdc42hs-gdp complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
189
structure length
189
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDC42HS-GDP
publication title The Structure Determination of Cdc42Hs and Gdp Complex
rcsb
source organism Homo sapiens
molecule tags Gtpase
total genus 58
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1an0A00
3NBXX 1TPZA 5FPYA 4ON9A 1U0LA 2UKDA 1LF0A 2FSGA 3FFAA 4M4SA 1UKVY 1JR3E 4LJ5A 4EPWA 3CF2A 4MKFA 3AF0A 1GAJA 2WWGA 2A30A 2QEQA 2IUTA 1QBKC 4IFBA 1U2RA 5BQ5A 3TW4A 2EWWA 2ZYTX 3H84A 3VAAA 3GLGE 3FB4A 4MDFA 2GCPA 5JJIA 1WP9A 1S96A 3KFXA 3B8HA 2EFHB 3IEVA 5F98A 5CM8B 4GSYA 3SEAA 1DELA 5JEEA 1IHUA 2HXSA 3VR3A 3Q7QA 2CL0X 2QP9X 3BK7A 4L9WA 5CYPA 5HE9A 2WWFA 2DCUA 2Z83A 3ETLA 4MKIA 5JLJA 2FZLA 1P3JA 5DI3A 1W0JD 4CT5A 1VG9B 5BXQC 5SZIA 1YZLA 4Y0VA 1E2MA 3HYRA 1XTJA 8OHMA 3K0AB 2B7BA 2ZRNA 2QBYB 4NP6A 4IVPA 4B44A 3MJHA 3C8UA 2GBLC 4DSTA 1TEVA 5EZ6B 4LJYA 3LFUA 2YKGA 4ASUD 1MKYA 3LNCA 2ZI6A 2VSXA 1G5RA 5KSOA 2ZSAA 1YZQA 5JJKA 4D81A 1L8QA 2X77A 1KHTA 2Z5FA 2EU8A 3THWA 1XCMA 3VNUA 1HQCA 1E9FA 2JDID 4AKGA 1XCGB 4ACAA 5M04A 2C03A 5AJYA 4AI6A 2P5TB 2KBEA 4CT4B 4B48A 3H1TA 4V03A 3SZRA 4DCNA 4JIMA 1JR3D 3SBDA 1UADA 1CU1A 4XWOA 4Q9HA 5EZ5A 1TAGA 1CLUA 3LXRA 3QKRA 3FHTA 1AZSC 2P2LA 1L4UA 4TSFD 5FBWB 4MDEA 2R6CA 1S0UA 4DUGD 3VKGA 1XEXA 4P4TA 721PA 5DISB 2HJGA 3I3SR 1WF3A 2ODWA 4KSCA 2PEYA 4QL3A 2G83A 4HLQB 2NOAA 3F0TA 5E95A 1I2MA 4LHWA 4TZ0A 2B92A 1N0VC 2CK3A 3IPXA 1T0HB 1OXUA 1ZD8A 3SI7A 2B6HA 5GVRA 3K70D 2VA8A 1KNXA 1XZQA 3LAWA 3E1SA 4V0OA 3AKCA 3ZZUA 2ZRGA 4KSBA 4HZUA 4F4CA 5JHGB 3LVRE 2G1JA 3EPJA 2BC9A 5HTKA 2R6FA 4HB4A 3WY9A 4OI0A 4AY2A 5JMTA 4M1SA 2D7DA 2ZJBA 1E69A 2RHMA 3CX6A 3A4NA 3AGQA 2LKDA 4TWZA 5FL3A 4V0MA 1YRBA 1P2TA 1CULC 1P62B 4EQ6B 2W0MA 2W0SA 4A0HA 2L0XA 5TY0A 4R2IA 2DPXA 5B57C 1AKYA 3FVQA 1KSFX 3CB4A 4RD4A 1XF9A 4TMTA 2MSDB 3TKLA 3J81k 1NMZA 1SVKA 2FA9A 1LS1A 3CPJB 3IQWA 5FOVA 1CTQA 1R0YA 3NG1A 2MSEB 5L3SA 4QNMA 5A5GA 2HDNB 3DHWC 4B33A 4NDZA 4EIWA 2IYZA 1TADA 3QE0A 2A5GA 1I2DA 1E98A 1UFQA 2J9RA 1GKYA 3KQNA 4Q7MB 4QC2A 5KUTA 3I8XA 2H1LA 2GHIA 1UM8A 4C7OA 1KYIA 4LK2A 4PAOA 5FOXA 1BS1A 1XP8A 1VHLA 1FTNA 4HLDA 421PA 1A2BA 1G1MA 3ZIAD 2O8FB 3ZS9A 2WJYA 1EFCA 1GRNA 4DWJA 2ZE5A 2OBNA 1E9BA 1ZNZA 2OZEA 3VFDA 4WZ6A 1TNDA 1ZMXA 2H92A 1OKKD 2BV3A 3IKJA 5FOTA 2MMCA 4RCZA 4BZQA 2NPFA 1VKJA 5GADl 5F3WB 4NYJQ 3RRMA 2ODBA 2O8DA 4B76A 1M6NA 5CJPA 2ZU6A 3SNHA 3ZQJA 3GLIA 2ONJA 1FMJA 3HP1A 3WXMA 3EPLA 2QY9A 1W49A 3ZJYA 4EFLA 4OQFA 2QRNA 2V1XA 2VHQA 2GXAA 1XDBA 2IHBA 3B1WA 1T3LA 4P4UA 1U90A 3TIFA 1LS6A 3ZVRA 4OK3A 1OIVA 3BXZA 4AC9A 2V4ZA 1E96A 1AS0A 2WVJA 2WM9B 2RGEA 3SJCA 2JLQA 2JIZA 1EX7A 3JVVA 5F2EA 3RC3A 4ZPXA 4ACBA 1XJQA 1NVWQ 2JLWA 4PO9A 1KSHA 3O8RA 4Q1EA 4XD7A 5JJLA 5DIFA 1P7CA 2IHYA 2XTZA 3KXKA 4OJQA 4PR0A 5CDFE 1X86B 3DO6A 2WTUA 2J41A 4PFSA 4OYHA 2ZREA 4I4LA 1T8TA 3IHWA 4ZIRA 4M2LA 4JT4A 1D2NA 1KK0A 1LW7A 2OUKA 3ZD6A 1MV5A 2H17A 4JSTA 4TMZA 2W6JA 4UQOA 2HLDA 1ESMA 1E1QD 4GZMA 1KZGB 1ZCBA 3CRRA 2Q6TA 4NCHA 2F1IA 5HE8A 4UNRA 1ZD9A 1M7GA 3HU3A 3QXSA 1XEWY 1UBFA 2Q3MA 4IDPA 4HSEA 2RKOA 4BLOA 3GLFB 3RSLA 2FFHA 2GK6A 2QRZA 4PC6A 5AUNB 1CP2A 2BVNA 1O3YA 3GEIA 1KI8A 2IF2A 3CNOA 2ZJZA 1IJFA 5KTYA 3KKOA 3UMRA 4ZCMA 4XSGA 3QKUA 2PT7A 1XTSA 1ZRHA 3KTAB 4LWZA 4TQ9A 1HA3A 1RJ9A 2HT6A 3O47A 2V9PA 3N70A 4HUQB 4WOPA 4MH0R 2XGJA 2CBZA 1GWNA 1E0AA 1M1YE 2RGCA 4TYQA 2ODEA 3X2SA 2QAGB 1DAIA 1J7KA 4IVRA 1NLZA 2B7CA 3TGPA 1GNPA 1XFAA 3PR1A 4DIEA 3AVTA 4KVGA 1IAQA 1YZNA 2ASEA 3QY0A 3K9GA 3U7FB 4OJKA 2DBYA 3QXJA 3PUWA 5EE3A 2VSFA 2YWGA 3OEHD 4D4KA 1QVAA 5HCNA 1P72A 1QG2A 1Z0DA 1KY3A 4B74A 1VMAA 1JPJA 4ZCLA 4DLZA 1NJFA 2BDTA 2JLSA 4EJSA 4IFEA 2ZI9A 4HYYA 3CH5A 4GOXA 4BE7B 3UPUA 1FNMA 3I92A 4PHTA 1SVWA 4L9SA 3QSYA 3LLMA 1HTWA 3IBGA 4TTPA 1HE8B 1RYHA 2GK7A 1Y63A 3TNFA 5EXTA 1OFIA 1G6OA 2GXUA 3GMTA 4C4PA 1E9AA 3CPHA 3LX8A 2VP9A 1NP6A 4DVGA 3TE6A 1E2IA 2BKUA 2ZYWX 1IONA 3KDSE 2V6IA 4QM6A 5P21A 5FPHA 2BEKA 2CE7A 5JCPA 2OCYC 2HCJB 1E2JA 4NKRA 1MRNA 1R5BA 3AUYA 3BORA 3KQLA 1Q20A 1G7CA 4AKIA 1IOZA 2O8BA 2AL7A 3CX8A 4BQSA 4L4UA 2QN6A 4L5BA 2C9YA 2W6ID 3Q85A 2D7CA 2FFBA 2FDCA 2QE7A 4KU4A 4ZDKA 1E1RA 2QL6A 5FL7A 2P6UA 1LV7A 3QENA 1NG1A 2ZAMA 5KSPA 4YXWD 2ZRFA 4HDOB 3THYB 1SVIA 4DLWA 3RAPR 4FI3C 2F9LA 3QKSB 4MKHA 4GZLA 4LGMA 2BCGY 1GL9B 3W5JA 5HKKD 4Z54A 3U6KA 2X1VA 5TB5A 1OW3B 3KUCA 1XD2A 3T5GA 2QGNA 3M1IA 4TLAA 3U7HB 4MITA 3THOA 2J7PD 4FCWA 2OILA 2CNWA 4MYTA 4AKEA 2IXFA 2IBMA 5CLQA 4CDGA 2JJ1D 3LDAA 1W36B 4FXPA 1RVDA 2ZRPA 1CBUA 4Q5IA 1N5JA 5TDHA 5LPNA 3H0KA 4UNQA 4DSOA 4M22A 5CM9C 4YMSA 3QNUA 1KOFA 2JLVA 4MQBA 3KXIA 3VHLB 2GCOA 1D5CA 2NO9A 1YZTA 3W5IA 5FPSA 2O0HA 3UMSA 2ERYA 1RPZA 3IBYA 3U44B 2F1RA 1SKYE 2CJWB 2QQEA 3NTUA 1TU4A 2F3RA 3PEVA 4Q4JB 1XTIA 1GKIA 1YVDA 2VP0A 2WHXA 4IW3B 2C9CA 2WOJA 2R6GA 3OAAD 4B2PA 1NIJA 3A1TA 5DH9A 4TTRA 1XXHB 4HZIA 5BWMA 5IF9A 1AK2A 2GZAA 2PLRA 2YOFA 4Q48A 5AUQA 3RS5A 1SXJE 3O8CA 4LZZA 4JYBA 1Z6XA 2CCJA 2KE5A 3FMFA 5KO2A 1SKQA 4V0ME 2XX3A 1Q0UA 2NTYC 3CNNA 5LBIA 1EG7A 1PJRA 4HI0E 3M6AA 5TV2A 3TQFA 4EPTA 4PPNA 4RD6A 4B3GA 3GPLA 1Z07A 1CJMA 2PCLA 2P67A 3TUIC 3RS3A 4QBGB 2P65A 1UBGA 3CKLA 1VYTA 2FPKA 3LD9A 1AM4D 3AH8A 4C0HA 3LY5A 2XXAA 4G5OA 1MOZA 1GTVA 3PUXA 3W90A 2R9VA 3PCRB 4LV8B 1JBKA 3QJYA 4CVNA 2I1VB 5CIWA 2RGGA 4YMWA 1X8JA 2R62A 3TR0A 4P31A 3W3AA 2XOKA 2REXB 3OIVA 4OI2A 4LJ7A 3I62A 3TMKA 1GITA 2OM2A 2QTHA 1XMJA 3UMFA 1ZCAA 2IYYA 2G3YA 1T4GA 1EFRA 1T9HA 1YKSA 3PUVA 4NMMA 4O2RA 4B32A 1YR7A 2DHRA 4A0FA 2J87A 4QJ5A 2E87A 3K09C 5HCIA 2ZRAA 2ANCA 3SJZA 5C46F 1KIMA 3VR6A 2SHKA 1NMXA 3NDPA 2C04A 1NSFA 4KVAA 4MRPA 5EE9A 1TX4B 2IYTA 3KX2A 1VDZA 3JZMA 3A8TA 4MGKR 3KKQA 4LUCA 3UXMA 4HAYA 1OSNA 2ZJYA 5JS7A 3MLEA 1HY3A 4CYMA 1LB1B 1SXJB 3R8CA 5DHAA 2WKPA 3WP0A 4AYWA 2VYFA 4UKDA 1R0WA 3GLIE 3EAQA 1G17A 4KYIB 4K46A 3AUXA 4EKDA 4LC0A 5KNCA 2FX3A 4QHYA 2C96A 2NGRA 1MABA 1SXJD 5BW8A 3I5XA 1Z0KA 2VF7A 1E2LA 3ZQ6A 4PQRA 2FU5C 2OXCA 3IEUA 1CR0A 5JWHA 1KI1A 1A82A 2QM8A 1ZM4A 3FPAA 3L82B 2IS1A 1G4AE 3T12A 1E2EA 3IDQA 2IYWA 4ARZB 1E9DA 1K6MA 3PITA 4YQFA 1KI9A 4CZ2A 1NN1A 4R2HA 1GG2A 4LRWA 1BIFA 5DSZA 4YONB 1ZNWA 2PX3A 4ESVA 5CIQA 3VR1A 2V1UA 2O8CB 5LB2A 1JQLB 4OI1A 3K9LA 1ZYUA 4H1VA 2QAGC 3QG1A 4HDQB 4GL2A 4A8JA 1OH8A 4Q4AB 3WHKA 4XWKA 4JLAA 4DLTA 3CRVA 1MRSA 1LFDB 4LOAA 4C2UA 1GIAA 1E94E 2WJVA 3DL0A 3O8BA 1UKYA 4UXJA 1KDPA 3A1UA 1NNEA 3W8NA 3ZVLA 5LB4A 4OL0A 4PANA 4RVCA 4TZ6A 1KK2A 1Z06A 2D2FA 3KKNA 2EW1A 4HDCA 2AKYA 3NC0C 4JBYA 4GT1A 4PSAA 4CGZA 5DHFA 1Z0JA 1KI6B 2J7KA 4QG7A 2BWJA 4C0QC 2RAPA 5CB6A 3U60B 1DAKA 1FMLA 2ERXA 4ITRC 3VU9A 5J4KA 4JL8A 4JLKA 1EESA 4LDJA 4L8GA 1JB1A 3TJZA 4LYFA 1II8A 1ODFA 4BLPA 1RZ3A 2CHVA 2DYKA 4HAXA 3ADKA 5BYKA 1G3IA 2WJIA 1XTQA 2C77A 5JCZA 3ND8A 4IDOA 4NPHA 1RW4A 4IEIA 3LBNA 1X3SA 3AF2A 2F43A 2JIZD 1A2KC 4TMKA 1KI2A 4U5XA 1R0ZA 2GZHA 1E9SA 5FUYA 4DEYA 1R2QA 4XD7D 4NYJR 1QDEA 1IY1A 4Q1CA 5FTKA 3CF0A 3U4QA 3MJRA 2ZS8A 3PXGA 2ATXA 4IOMA 2CHGA 1NSTA 4LY6A 2HT1A 1QG4A 4NYMR 1X6VA 3LO5A 4JS0A 2EFCB 1H8HA 3R7WB 1R8SA 3GJ7A 2VEDA 3VMFA 3T35A 1K5GA 2AD5A 1OXTA 3B13B 4JLNA 1S9DA 5DN6A 3TUZC 4D80A 4HB3A 2ZEJA 1Z47A 3QUSA 4TYPA 1J8YF 3MUFA 4G5GA 1E9RA 1US8A 2C8VA 2GNOA 3HDTA 3RS2A 3U3JA 1ONBA 2ZRBA 3AVOA 1W1WA 1W36C 3VNVA 2KI5A 2ZUCA 4M9SA 2WWIA 3AVXA 2P3SA 4Q1DA 5CYOA 2J0QA 1XJCA 2ZRMA 2Z43A 2J0UB 3GLHB 3T61A 2D2EA 2ZANA 1Z29A 3DM9B 2AFIE 1N0UA 1O87A 2ZSFA 1G16A 4FD2A 5LD2C 3K0CA 4URYR 1KDOA 4JJZA 3OZXA 4D4MA 1FX0A 3EWAA 2ZUBA 1D9XA 3EG5A 3NEYA 4H9GA 3L8YA 3CZQA 3W6NA 1DARA 1SVLA 4JT2A 2G1KA 2J46A 2ORWA 1KKLA 2ZI3A 1WB9A 1U0JA 1JXOA 2FSFA 3BS4A 3QVVA 1W4CA 2IW3A 4IXMA 1D9ZA 1JEDA 2Q3HA 2AN9A 4JMPA 5KSZA 4LV6A 4PSKA 2D3WA 1E0JA 3AGPA 4AURA 5CK5A 1G3MA 5TARA 2G77B 4CEHA 3FE2A 4IOKA 1KJWA 3N2IA 4Q02A 3U3KA 2H7VA 1ZP6A 2Q9CA 1WBBA 2W83A 1DAFA 4DT1B 1E9EA 1XTRA 1GDDA 3KB2A 3EA5A 1N5LA 3RHFA 3MWKA 2VQSA 3DVLA 2DB3A 3PVSA 3QXCA 1II0A 3U5ZB 4TMXA 2ZR0A 2D62A 521PA 1ZC4A 5AUPB 4URZR 4F92B 1GRQA 3GP8A 4DB4A 3UWKA 1I4TD 2FE4A 2E1RA 4DDWA 1MO6A 4TQUS 1F5NA 2HUPA 2QZ4A 1VECA 1G5TA 4FMDB 3FKSA 3FTQA 2QE7D 2QSZA 2WSSA 1E1RD 2JLRA 3OE7A 4MGIR 5FL7D 3LVQE 1J2JA 3SR0A 3TLXA 1L2TA 1Q1QA 5BYJA 3ZZ0A 5C4MA 1KSJA 2ZRCA 1HUQA 1KNQA 2QA5A 4KFSA 6Q21A 2GJAA 4B75A 1OHHA 4RZXA 4GMXA 1Z08A 1TQ2A 3REGA 3BB1A 5E3HA 4LX0A 2AR7A 5DYGA 4HAZA 3KJEA 4XTRA 4D0LB 2A5JA 2C98A 3GJ4A 1IXRC 3HU1A 2JA1A 4JBXA 1SXJC 1E0KA 1UPTA 4IJMA 3RYTC 4E07A 2O8EB 3U61B 1CJKC 3GJ0A 5DO9A 2GAOA 4UXHA 1J99A 3GLGB 1N6RA 3MG9A 4FIDA 2GCNA 5JSZA 2EFDB 3DOFA 1E2QA 2CNWD 4WBSA 3THXB 4Z1MA 5CB8A 1S1MA 2WWYA 1M7HA 1TUEA 2YOHA 1YZUA 3K0SA 3R9XA 2A5YB 1NKTA 3G82C 5FUXA 3Q5EA 3K70B 5DLQC 5K8UA 2ANBA 2I1QA 4M53A 5EE0A 4ZV4A 3EXAA 4G01B 2ZJ2A 1CR1A 2P5SA 3GFPA 4RY2A 4DLSA 2CCKA 5D3MA 1RRCA 2JCSA 1WQ1R 3A58B 3TAHA 1XNJA 4BLQA 2BBSA 4LHXA 5JWRA 4CEIB 5G3ZA 1JR6A 4E03A 1BO6A 1F6BA 4CW7A 5DI9A 2GBLA 3L43A 4HB2A 4E5UA 1KMQA 2VL7A 4S35A 3KQHA 2ZS7A 2CCGA 5FBRB 4MYCA 2UZIR 3SE0A 1NY5A 4Q18A 4URXR 1R0XA 3K9HA 1VIAA 4CIDA 3T1QA 2FH5B 3MGCA 4LJAA 3S1AB 4BRWA 4CEJA 3SYNA 4PXAA 2J5XA 3WYAA 1TMKA 4HAWA 2ZXUA 4X8HA 3FMOB 2PCJA 4M1WA 3B6EA 4C0LA 2QT1A 3A1VA 3JVUA 5K8TA 1Z83A 4QGAA 1UF9A 3LQQA 1V43A 2WPDD 4OQXA 2YHSA 2W2TA 1WDTA 2GEUA 4FWIB 2ZRJA 1E2PA 1T91A 3Q7PA 1VG0B 2HCBA 3K0FA 3RNLA 4M1YA 4I1SA 2O0JA 4P4SA 3D7MA 1DS6A 2J0SA 3FKQA 1D2MA 1DG1G 4DLYA 3AF3A 3B60A 3BFVA 1W4BA 4GNKA 4BFYA 1MH1A 3PJRA 2XEXA 2ZRLA 4A1FA 4FWTA 1ZUIA 4C0AC 5FPTA 5BN4A 2VPPA 2PEZA 4XWAA 3SYKA 2F7SA 4KFTA 3GJ3A 2GF0A 1M2OB 4TLBA 1KO7A 2XOKD 4ILEA 5C2JB 2GKSA 1HEIA 1IN8A 3MWLA 3X1DA 3H4MA 2FPLA 1NBME 4PO1A 1EGAA 4FMCB 4IKEA 1W5SA 2JJ8A 3RLFA 1EFRD 1Z63A 4GPTA 4NONA 3SQWA 2QENA 2FF7A 1OFUX 2DWQA 4URWR 3CR7A 4NYMQ 1G9XA 1XWIA 4A9AA 4OHYA 1E0SA 3W8RA 3G5UA 1PLLA 2AX4A 3EZ7A 3M0EA 4P33A 4LBZA 1CRPA 3AP3A 3B7GA 3RWMB 5G3YA 1KI4A 3W34A 1NMYA 4B6FA 4JLMA 4E22A 1Q57A 3LX5A 4Q01A 1N6IA 1XMIA 1F2UA 2REBA 4TL6A 4XVQA 1UKZA 1P2UA 4MYUA 2XNSA 2OAP1 3TW8B 2WOOA 1CJVC 2X2FA 4B34A 1KI7A 4S2EA 2VP2A 1F3OA 1UDWA 3EC2A 2WIAA 2OO7A 2H18A 4P32A 3TH5A 3NXSA 3QF4B 4Q4HB 4DLUA 2YVUA 4TT3A 4YLGA 3PQCA 5EXSA 4US0R 1OH7A 1D2EA 1OYWA 1DVRA 4RD1A 1QHHB 2I4IA 3WP1B 2CL6X 2Z4SA 1MR3F 1G7TA 2NZJA 4RFSA 4QBHA 1SHKA 4W7SA 4B2LA 4YDSA 4B3XA 4IVQA 4QBIA 4EPRA 4FCTA 3CW2A 1ZIPA 1AKEA 1IY0A 5AK0A 3TQCA 4A82A 5F9FA 1XPRA 2AHOA 1G64A 4JL6A 5JWOA 1IBRA 3EX7C 2VO1A 3KQKA 2GJSA 2HXYA 4M8NE 3AP1A 3LW7A 2VTKA 2GJKA 3OHMA 2BMJA 1E2GA 1TF2A 5FUWA 4TMWA 1IXZA 3NH9A 4B43A 4LJ4A 1G291 1N5KA 1TUIA 4DEXA 2FOLA 1NBMD 2GTPA 4JL5A 3KL4A 3N5CA 1E79A 2K5UA 1KDTA 2FN4A 1HURA 3AVYA 1P2VA 2XNDA 4R9UC 4M1TA 3T34A 1NN5A 4QJ3A 3WBJA 4EPVA 1EFTA 1KJYA 4Q9JA 5C18A 1IN5A 4RZ2A 5H8WA 2WAYA 1TF5A 2ZYUX 1FP6A 4AIIA 4XTCS 4M9QA 4DIDA 4BFUA 3D3QA 1HE1C 2IEZA 4II7A 1NLFA 3ZD7A 4KCGA 2BCJQ 4GMDA 1KMHB 4BEJA 1ZJ6A 2AKAB 3WNBA 3WMGA 3DMDA 1S9HA 4KLZA 3CIOA 4PSVA 4MKGA 2AFHE 4A36A 5KPJA 1DBSA 2PLFA 3FYHA 2ZIAA 2XITA 3K1JA 4DLXA 3DMNA 2IYQA 4JLVA 3PEYA 3BIFA 4OHZA 4JJKA 1R7RA 4OQMA 1U8ZA 1ZBDA 4MGYR 3DEFA 4BPBA 2CEAA 1UBEA 2GXQA 3A4MA 5G41A 5B30A 2ZSDA 3CONA 4FMDF 4BASA 2GILA 2ZAOA 4Q7KA 4RD2A 2VSOA 3BGWA 4IDNA 3BBPA 2VF8A 4XH9B 1GVNB 1RRGA 1E4YA 1F2TB 2ZVQX 4WW0A 4DB2A 2QAJA 3NDBB 4A0GA 4JVNA 1P75A 2GDJA 1OE0A 1YHNA 1FUUA 3QEOA 2ORVA 4M1OA 1G18A 2IWHA 4Q9LA 1H8HD 1X8KA 2B21A 4MGZR 3ZGXA 5J4HA 1Z2CA 1Z6YA 3A37A 3DZ8A 3LQRA 3N2EA 3OIWA 4NYIQ 3GEEA 2JATA 4P0TA 4ZO4A 1NN3A 3SFZA 2CVHA 2OESA 1ZU4A 3Q8XB 5FH9A 3K70C 1SZPA 5J4YA 2VHCA 4DRZA 5IK2A 2GESA 2PZEA 3RSOA 2P6RA 3ZH9B 4UNSA 3VTKA 2GZDA 5K8LA 2BBOA 2IEYA 2PH1A 2IF0A 5KPDA 5AJVB 5C4GB 3K0AA 5KDOA 4JLJA 1EXMA 2V6JA 4US2R 5BN5A 3EW9A 3QVUA 3B1XA 1UKEA 4PX9A 2BBTA 2QBYA 4GDFA 1ZU5A 4FN5A 1Q1ZA 3KJHA 4FINA 3LH5A 3BB3A 4RD0A 3B9QA 5B2ZA 4PHGA 3KKPA 3NH6A 5SZHB 1CJTC 1RKBA 4F4IA 4Q1FA 2ZU0C 3T1TA 4BFTA 2XTNA 4KFUA 2D4HA 3MSXA 1JXMA 2ZJAA 2X8AA 4PO8A 3EA0A 1N6KA 1N25A 5LD2B 4YMTA 1P5ZB 4TYWA 2NIPA 3OESA 2RB4A 1JECA 1R4AA 3PG5A 3KKMA 1KI3A 4NCIA 2G88A 2NQ2C 2EQBA 1E4VA 1L4YA 1W0KA 1G7RA 3E5HA 3QF7A 1QHGA 5DI3B 5FPKA 1FQKA 4KAXA 5TVKA 1TQ4A 2C2HA 4Q19A 1F60A 2GWHA 4OKSA 3L0PA 2AWNA 1MO3A 4UJ3A 3LV8A 2JLUA 1N2CE 5AR1A 3CRQA 4HB0A 2YZ2A 4W5WA 5CJ2A 5AWFC 3MFYA 4C0SA 1ZNXA 1UAAA 3ZYCA 4LHYA 2QGZA 2YWEA 3BH7A 3SBEA 1D6JA 4Q21A 3THWB 4FMCF 1D8TA 1WRBA 1IQPA 1TTTA 1OB5A 3FKSD 3PENA 4N3NA 2WSSD 4IOJA 3L0SA 3V4RA 4EQ6A 3FFBA 1ZD1A 3SHFA 2FFQA 3BJIC 3MWJA 3Q5DA 1BMFA 1PLJA 1Z22A 1CF4A 2XJ4A 3T1OA 2IYLD 1OHHD 3TBKA 4A0RA 2IYUA 2DWPA 4HUTA 3QKRB 1AS3A 4I1OA 1M8PA 4HEJA 4GI7A 5AJWA 2VHTA 3QG5A 4QHTA 1XEXB 1YQTA 4P3YA 2QMOA 3EPKA 3OEEA 2QQ0A 3R9WA 4Q00A 1NN0A 3CRW1 4PZLA 3OIYA 1SKYB 4G3XA 3A1WA 3UG7A 3TRFA 2ZE8A 3SN6A 3T1VA 1QVRA 4Q7LA 3ZIAA 4B2IA 3WMFA 1N6PA 4KHZA 2DY1A 3ASYA 4Z1MD 2CHQA 1JAIA 4TN1A 4DLRA 2ZUDA 1MO5A 4BWYA 2OXRA 2XSZA 3ADBA 5SZJA 4O3MA 4LBVA 4EFNA 2OBLA 2QU8A 4HZUB 4KJZA 4PTLA 1R6BX 4MRNA 2O8FA 2CK3D 2FSIA 1IN6A 1TEXA 3FMPB 4NBSA 4PHFA 1CXZA 1HT2E 2QTVB 1KY2A 821PA 1VG8A 1EX6A 4QRHA 5CITA 1FFHA 2OLJA 2ZSBA 4NHOA 5IHPA 3AF4A 4QGFA 4BFZA 1Q3TA 1ETUA 2P6NA 2LCFA 1S2MA 4N0DA 1U9IA 4B3FX 5EXPA 2C5LA 3DPUA 5DYIA 2F55A 1IY2A 4RZ3A 3CBQA 3B82A 5CK4A 4EPXA 5SZKB 2IXEA 5L3SB 3EC1A 3LBIA 2A5FA 3X1XA 4JLDA 5H70A 2GEDA 2NZ8A 2FFAA 3P4XA 4AD8A 5G40A 1NRJB 1YZGA 2TMKA 3RWOA 4C0KA 1E2FA 1QHYA 2WJHA 4NCJA 3RS7A 1VTKA 3H2YA 2B8TA 4JKIA 4C7OB 2OE2A 2RGAA 3GFOA 4XJXA 3K09A 1XX6A 1W2HA 2WKRA 3QXHA 2EYUA 2NO7A 4Q66C 1TF7A 4IRUB 4DHEA 5KYKA 4A92A 1ZW6A 1XMVA 2F3TA 5FBLB 1DAEA 4HLUC 4ABYA 4A2PA 3IUYA 4H1UA 3VX4A 2J59A 1LTQA 2FMXA 4JVLA 4KBFA 5B58C 1W4AA 1E2NA 1CEEA 2ZE7A 3I5YA 2ZITA 2O8DB 3EIHA 4W9MC 3WBKA 1I4DD 1G5PA 3CUEF 4BUJA 3GLIB 4ZDIA 2G9NA 4WXRA 4AK9A 4Q9IA 4BLRA 1CR4A 3GLFA 4Y0AA 4PZYA 3KFVA 4C9BA 2V8OA 3EIQA 4AYXA 5F9HA 3BC1A 3P1JA 1U8YA 4ZKEA 1T6NA 3I8SA 3EIEA 2VRWA 4JLBA 3CPEA 2Q9BA 1W47A 5HPYB 2NG1A 1NLYA 2YJTD 2WBLC 4XSHA 3OIUA 3DM5A 3KTAA 1AGPA 4HUQA 4DSNA 4G0NA 5KHOC 1COWA 1OFTA 2GVDC 3LXXA 5ELXA 1HH4A 3OEHA 3SS8A 2FNAA 2QAGA 4M0LA 3CR8A 1S8FA 3CNLA 4LJ6A 2NO0A 4ZIRB 4QBFA 1QHXA 5A0FA 4JLOA 3IIKA 3UIEA 1M74A 2FPMA 2KSQA 2ZS9A 1H8EA 4MA4A 1N6OA 3AVQA 3NHAA 1IJEA 1UJ2A 4D4LA 3SHWA 1RYFA 4EFMA 4FCVA 4N1AA 2OSBA 3EARA 3D31A 3RC8A 5FBQB 1ELOA 2W6JD 4WZAE 2HLDD 3TVDA 3UWOA 3L8ZA 1LNZA 3W3ZB 4B73A 2JGNA 2DFLA 2XB2A 2AK2A 1ZNYA 3RVBA 3QOFA 2RGNA 5FFMA 1KJZA 1Z5ZA 3QBVA 4JLPA 3GQBA 1W44A 4A2QA 1JNYA 1WCV1 2GJ9A 1J8MF 1JQJC 1Q21A 4DC9A 1RJ9B 3V4FA 2ECKA 3EASA 1ESNA 4TYYA 1U81A 3SFVA 1AJEA 2D74A 3RRZA 2A2ZA 4TLDA 4N0EA 1KO1A 2HJVA 4W5JA 3B85A 2XNDD 4A6XA 1GKUB 2GRJA 4JVSB 1VCMA 4M9XA 1OXXK 2AWOA 5FOWA 4AG5A 4B71A 4EJSB 1KO5A 3NEJA 2N1BA 2WMOB 3K9NA 5EE1A 5GJWC 3TSZA 1M7BA 3PEUA 3EZ9A 2RCNA 4GP7A 2IWRA 3SYLA 1IN4A 4AYTA 3A1SA 3KQUA 3SC3A 2LKCA 1P60A 3THYA 2BOVA 2PJRA 3AVVA 3P4YA 1AGRA 3F3YA 3QKSA 3U3OA 3PIRA 1EWRA 4LV5B 1ZM7A 2OCBA 2N46A 4LYJA 1GSIA 4KYUA 1FTSA 2BJWA 2JJ1A 4KODA 1OT3A 4NCKA 4BFXA 4X8LA 2H57A 1GFIA 2O0KA 5JEDA 3IHLA 1FUKA 2QI9C 2YNMA 1RFLA 4NH0A 2KBFA 1G19A 4QHSA 4XOIA 1FOEB 2CMKA 5K8IA 3AKEA 1QF9A 1N6NA 3HR8A 5AJXA 2PMDA 1ZIOA 1BKDR 4IOLA 5EE5B 2ODNA 3RS0A 1CRQA 2GJ8A 1NVUQ 2O8BB 2MMGA 5L3QB 1R8QA 4IHQA 1G20E 3ND9A 2GAAA 1OLOA 2HF9A 3PV0A 3TUJC 1RC8A 2CL7X 4DCTA 1WA5A 3U2QA 4DDUA 4E09A 2WICA 2D06A 2YC4C 3EPHA 3I61A 2WWHA 3OAAA 4OBEA 3U44A 3BWDD 1XPUA 1ZM9A 2CJWA 2R8RA 4W5HA 1Q3HA 3I4LA 5E7IA 4Q4JA 4JSYA 1E32A 3C5HA 3KB1A 3CZPA 3PUYA 3KJIA 1XRJA 1E2KA 1G21E 1KAOA 1KO4A 2VHJA 5FR2A 5IT5A 1DOAA 2G6BA 4MUAA 3ICQB 5JI2E 1XD2B 4LJ9A 1JJ7A 2O5VA 1XZPA 1XXHA 2A78A 5KNBA 4LC1A 3IILA 5IK2D 3C4JA 3HPRA 1FL9A 4YC7A 1YR6A 2CXXA 4OK5A 2FGJA 2WJJA 1Z6GA 3IO3A 3L0OA 3TAUA 2QM7A 5KU1A 2BEJA 4NZYA 3SJAA 2QORA 1Z6TA 2WIBA 1W2GA 1ZVQA 1RIFA 2B8WA 1OXSC 2R44A 2GETA 3C41J 1GNQA 1DADA 3QPUA 1E6CA 1EK0A 2GCOB 2ZRKA 4K8OA 2ZSEA 1J90A 2FSHA 4NYIR 3RS4A 3R8FA 3DZDA 2QMUA 4BECA 2IA5A 2JLZA 2FEOA 3BAFA 4JBWA 4TLEA 1T8UA 1E3MA 3P20A 4DCVA 4YMVA 1PUJA 1VIYA 1NVVQ 2IK8A 4TL9A 3O8DA 4IDHA 1B23P 2ZROA 3F5FA 5J40A 3WHLA 1Q22A 1KTVA 2IS6A 2WAXA 1G4UR 4ZI2A 4KFRA 2ZVPX 2PJZA 4G5SA 1WXQA 2OCAA 2OT3B 1X8LA 4RD3A 3UG6A 1S1CA 4I1VA 2I3BA 2JJ2A 4QKQA 4Q7JB 4AWXA 1W0KD 2V54A 1CR2A 1N6LA 1T5IA 4JYCA 4MYHA 4PZZA 2IT1A 5H68A 4DZZA 2YYZA 4B6EA 3C5CA 4M1KA 3TR5A 4RFVA 2QT0A 2ZR9A 4QGGA 2BIFA 1H65A 3L0IB 2A9KA 2XTMA 1XD8A 2QPAA 1U0HC 1SXJA 3AVWA 1UBCA 3C7KA 1XPOA 3FOZA 1BOFA 5EP4A 5EP2A 1R5OA 4YMUA 1N0WA 1VCIA 4QM7A 1ZINA 2PZFA 1G6HA 5E4FA 4I1UA 2VP6A 2A7QA 2XXAB 4R7ZA 5FTNA 1CS4C 4QXAA 3CX7A 1IN7A 2HEIA 3X1WA 4AG6A 3DKPA 1Z28A 5CLLA 3HYTA 4L15A 4MRSA 3K8YA 1DTSA 3MAAC 4G5RA 4POAA 4KXFB 1BMFD 3VR4A 3GFTA 3OFNA 5C1BA 1QHNA 4ARZA 2GA8A 2EYQA 2VIIA 4TMVA 3WNDA 1N5IA 3IPYA 1EFHA 4YDHB 1AQYA 3SDZA 3WYGA 1IM2A 2OAQ1 2O8CA 1G3UA 4DJTA 4PPQA 1NIPA 3VKHA 2KJQA 4MRVA 1TU3A 3AKYA 3OEED 5GJVC 2IS2A 4Q47A 1XJ0A 4C0JA 4Q4AA 5J5CA 3RDPA 3WRYC 3T5DA 4KLNA 2IUUA 1HQYE 1QRAA 1T3HA 1W4RA 4QGHA 4UXIA 1OV4A 1GP2A 5AJZA 3SU8A 4WAUA 2DFTA 3MMPA 1XBTA 2HYIC 2XSZD 1UDXA 1C9KA 5E7MA 2ZTSA 4F93B 1AZTA 2F1JA 2QMHA 5HZKA 5EUMA 3GLFE 1P9NA 3AV0B 1MABB 1OPXA 3I73A 2R6AA 2PX0A 4RZUA 1XEWX 2EVWX 3K0EA 1KI6A 2R2AA 3QXXA 2NMVA 3WNCA 1QHIA 1SHZA 3CF6R 2WV9A 5GJCA 3BRWD 3WYFA 4BFSA 3IGFA 2RGBA 4LCBA 1KK3A 3UATA 4BLTA 3X1ZA 4I99A 4IXNA 3A4LA 1HT1E 3CLVA 4B35A 1S3SA 4NCNA 3NBZC 1W5TA 2YWFA 2RH5A 1PZNA 1RRPA 3I32A 1PLKA 4J0QA 4LPSA 4Q1BA 1KDRA 4TL7A 1U99A 2W00A 1LY1A 3B1ZA 1SGWA 1VPLA 1W7AA 4A8JB 2H16A 2OLKA 4FMBB 2GEVA 4NTZA 2WJGA 4PC7A 4GOKA 3B2EA 2AK3A 1G41A 3GJXC 2ZYVX 3WRXC 4RJLA 4D0GA 1A5TA 3H86A 1TQ6A 3BFXA 2DFNA 3ASZA 2OFWA 1V5WA 4R71A 2XZLA 3B9PA 3EZ6A 3I72A 1YU9A 2DFKB 3U3RA 4EJSC 4DBLC 4TTQA 2OEPA 2FZ4A 3IQXA 4IDQA 1VCNA 5TMPA 3KZ1E 4O25A 4DCUA 1FW6A 2C99A 2RGXA 4I81A 4Q03A 4B3BA 3A36A 5JS8A 4PC1A 5KNDA 4PQFA 1OH5A 1NVXQ 4O0MA 1Z8FA 5HZHA 2BM1A 3VU9B 4KI0A 4U7DA 3DDCA 2IYSA 5FOSA 2RGDA 1II8B 5B64A 3KXLA 3HU2A 3R7WA 3AVUA 1NY6A 3EZFA 3TVTA 2WSMA 2ZPTX 1P2SA 3Q9LA 3QPVA 1MO4A 2O52A 2YC2C 2FG5A 1NL3A 5L3RA 3RRNA 1E2DA 4LHVA 4LSGA 1R10A 2CLSA 3I1FA 2RMKA 2QPTA 2IC5A 3U3MA 221PA 4EPYA 1OIXA 5TXGA 3ZS8A 2C9OA 3ZDQA 2V7QA 3GD7A 3EWSA 4GBMA 1P61B 4WVFA 1Q44A 2R65A 3ZVMA 4D26A 1G3QA 1G8PA 2F43B 1S3GA 2YOGA 3HJNA 1S4QA 4F91B 5JRZA 5IRCD 2BMDA 2ZI7A 2NO6A 3AEZA 5FUVA 3SOPA 1RE0A 5E7JA 1KZ7B 1N6HA 4EAQA 2J0UA 3GLHA 4JZKA 1COWD 4V0KA 3VR5A 3C15C 2J3EA 3VQTA 2WZQA 3AF1A 3P27A 2E9SA 3W9YA 4DKXA 3SQXA 1F48A 1NG9A 4HAUA 4PAQA 4X8MA 1HYQA 3U4QB 4NU0A 4KITB 1XB2A 4V0NA 4D0NA 3ZVNA 1G8YA 3LW8A 1H8ED 1XCPA 2BMEA 1Z3IX 2Z6VA 2V3CC 3QQ5A 3NHBA 1WMSA 3T15A 3E70C 1E99A 1GZSA 1NKSA 1OIWA 2YV5A 4R98A 5DGXA 1G7SA 4BZXA 5FTJA 1AS2A 1ANKA 4O2LA 2IS4A 2F1HA 1A7JA 4WZBE 1YZKA 2C95A 1DPFA 4LYHA 2ZJ5A 4US1R 4OQNA 4IEEA 1US8B 1GL7A 3V9PA 1PV4A 3B1VA 5DN6D 4A6PA 3P32A 3B78A 3B1YA 2ORIA 4DT1A 1W0JA 1JEEA 2VBCA 4CF7A 4DDVA 3BE4A 5KOYA 4OHXA 2WWXA 5HR5A 4D4JA 1U8AA 1ZAKA 4ZI3A 3PEWA 1QHSA 2PMKA 4URUR 3AQ4A 4G5QA 1OXVA 2W58A 1DE0A 5L3QA 2X19A 2ZRHA 3TSOA 2Z0MA 2A5DA 4K81B 3R9IA 1A1VA 4ASUA 1MT0A 4D2IA 1JAHA 2CDNA 2VP4A 2YWHA 3U6BA 1FX0B 3AM1A 4D25A 3RRYA 1GOTA 4HAVA 1AA9A 1UEJA 1HV8A 3CWZA 3D8BA 2XZPA 4OHWA 4ZDJA 3LRPA 2JDIA 2DWOA 3CRMA 5ANRB 1XXHE 1EWQA 1XD9A 1RRFA 3QEJA 2ATVA 3GEHA 1E9CA 3ICEA 2KWIA 1OYYA 2P0EA 3JZAA 1JR3A 1Z0IA 4BGDA 2ZE6A 1P6XA 3AKDA 4CEHB 3VHXA 4GOJA 4M21A 4TSFA 1YE8A 1YR9A 2AXPA 4V0LA 4Q9KA 4D82A 3LBHA 5UKDA 4A2WA 1ZM2A 1Z2AA 2NO1A 4DUGA 2F6RA 1FP7A 3KUDA 4LBYA 1W48A 4LHZA 2OFXA 1U98A 3C16C 3QI2A 4JVMA 2O8EA 2EFEB 3SJBA 1WE2A 1ZUHA 1CJUC 3GLGA 4XVUA 2KB0A 3UANA 5KDDA 4UJ5A 4C3ZA 1CIPA 2IYXA 1KAGA 3AB3A 3T06B 3THXA 1T5LA 3C14C 2PL3A 5EXXA 1W36D 5JFGA 5EUQB 1YRAA 1BYUA 1DG3A 1FZQA 2IYRA 2G0TA 2H8KA 4ESHA 4QFMA 3VKWA 3BERA 1BH2A 3PUZA 2Y8EA 2Z4RA 3IIMA 1GNRA 3Q72A 1OFHA 3VR2A 4MUBA 2QNRA 3MRSA 2ZI4A 5BN3A 3IIJA 2FV8A 4G1UC 3X1YA 2AD1A 1VHTA 4BEBA 3NWJA 4KO8A 4X8OA 4CEIA 4WIAA 3W6PA 1QZXA 3DKVA 4L16A 4LBWA 4CRWB 1IXSB 4PC3A 4BZPA 1P9RA 1AQUA 3RABA 2XAUA 1G8FA 4RKEA 2RHDA 1OF1A 3MWYW 3OE7D 1SVOA 4A15A 4UNPA 5FR1A 3HWSA 3LA6A 2ZJOA 4Z51A 4PAMA 5GVSA 3S1AA 1II9A 2IYVA 1A4RA 4B3DA 1J70A 2WPDA 2WWWA 3CO5A 5EP1A 2FJUA 5JSZB 1SVSA 3AP2A 5L8VA 1XMSA 3NBFA 4UNNA 1OB2A 2NPIA 1U9IC 2J0VA 3ADDA 3NIBA 2CLDX 2ONKA 2BMFA 4BRUA 2EFGA 2QPOA 2WKQA 4TQAA 5J47A 4HLCA 2GF9A 3QBTA 4TL8A 2PZGA 2PBRA 2JEOA 4NL4H 5D3MB 1T3SA 4WA7A 4LYAA 4TLCA 4ZCIA 1OKKA 3BH0A 3A6PC 2VP5A 5FTLA 1SVMA 2VH5R 1KGDA 1JPNA 5FI1B 2VLIA 4URVR 1FNNA 3DOEA 1GL6A 4OQLA 4C0BA 2UZ3A 4C30A 3Q3JB 4A8JC 2G0NA 1YR8A 3KJGA 4BFWA 1X1RA 3LLUA 2JLYA 121PA 2FGKA 2BBWA 3FHCB 4A4DA 3MCAA 4CEJB 3NC1C 2CVFA 1Z6AA 3U7EB 2JJ2D 3BB4A 4FW9A 3AVPA 4OI4A 4OHVA 3GCGA 4EDHA 1ZC3A 2QTFA 2QG6A 1DO2A 2H5EA 2QROA 2ZQ5A 4PQYA 3MD0A 3OF5A 4ERNA 1DO0A 4ZKDA 5DNYB 1T0JB 1KSGA 1VYVA 4LJ8A 2JAQA 2ZI5A 4PPGA 2OCPA 2XB4A 2JLXA 2PT5A 4M9ZA 3HPQA 3K0FB 1ZM3A 2DR3A 2HYDA 4DLVA 1VG1A 4F38A 5J4LA 4P4SB 2REOA 2ZRDA 4QJ4A 3BFKA 1R5NA 1NVVR 2BHRA 1ZUNB 4RCYA 2HV8A 3EZ2A 3REFA 4BLSA 4Z8YA 1E1QA 4Q4LA 4D6PA 3B5JA 4PC2A 5FTMA 3QF4A 4Q4HA 1XU4A 4OK6A 4F7WA 1JALA 4TYNA 2UVQA 3ECCA 1KKMA 4JKYA 2GXSA 3TK1A 5LDDC 1PUIA 2IUSA 2V55B 1Q12A 3QKTA 1QHHA 4DCSA 2YINC 2BJVA 3OFND 3NKVA 3P26A 4EUNA 3GJ8A 3BH6A 4AKHA 4M1MA 3UKDA 2HF8A 1XTKA 1JI0A 2OG2A 4NE2A 2ZR7A 4HATA 2CE2X 1GILA 1G3RA 2ZRIA 4MRRA 1GUAA 4DDTA 1NBMA 4B47A 3UK6A 2F9MA 1JJVA 2OFOA 1VCOA 5D3QA 4LPKA 3ZLJA 3CWQA 1I4LD 4KBGA 4PHHA 1WBDA 5L3VA 1OJLA 5JZVA 3TSWA 5JBQA 3E2IA 1F2UB 1DAGA 1X1SA 1FQJA 5GJBA 1K8RA 2CLCX 2ZJ8A 2RGNC 1P73A 2FEMA 3FMIA 1KK1A 1P9WA 4DSUA 4U00A 2R6DA 5JECA 5A4JA 2AXNA 2MSCB 2Q0HA 1UEIA 3L2OB 1G8HA 2ZETA 1SQ5A 1B0UA 3BOSA 2C78A 2IL1A 1LF5A 1AN0A 1Q1BA 1BYIA 4QNRA 3GJ5A 4RKFA 5DE3A 2VHUA 4DXAA 5CDFA 5FBVB 4HLUA 3FDIA 4RFSB 2J45A 1SULA 4KV9A 1KMHA 3IO5A 3GLHE 4TT3D 621PA 2OV2A 5G53C 1M34E 3W6OA 1U94A 1GRRA 2OHFA 2QUZA 4BFVA 5KDLA 1KO8A 1LVGA 4B3CA 5EQTA 2XJ9A 3FHOA 1AIPA 4RSGA 1Q1EA 1Z0AA 2LWIA 3U7GA 3K53A 5IDVA 3K0CC 1K5DA 3PFIA 2Q21A 3CM0A 4XVRA 1L7VC 1TL7C 2N42A 5FI0B 3D6TB 1NF3A 2OBMA 3LWNA 4F4JA 1PVOA 5J4VA 3GJ6A 4U02A 2W2XA 4XIGS 3ZZTA 3NVAA 2IX3A 1N3BA 2W2VA 3CH4B 1F2TA 2IXGA 3RANA 2EWVA 4Q1AA 4ZDWA 1C1YA 2ZM5A 3M4YA 4WXPA 3G0HA 4PPFA 2W6IA 1NJGA 2BM0A 2GVZC 4LI0A 1E79D 4C2TA 2BKEA 1NI3A 1VYUA 1EFUA 1E2HA 1DEKA 1YJ5A 3FGNA 3FWYA 4GP6A 5JHHB 1G8GA 1GM5A 4GFDA 2JASA 2A3RA 4YXWA 2WMNB 5AUOB 2QMEA 1Z0FA 3QIAA 5JRJA 5H1YA 3NBYC 1CKEA 3HR7A 2QSYA 2QP3A 2J1LA 3F8TA 1XEFA 5HKKA 1P4SA 2Q9AA 3V00A 5EJEA 1TQDA 4V02A 2XZOA 5FOUA 2FWRA 3WMEA 3VX3A 4GRAA 2V7QD 1Y3AA 5EP3A 1FPMA 3ONWA 2J7PA 3ADCA 5KSYA 3BD9A 2X2EA 4QOSA 1OH6A 4Z8XA 5JI3E 2Q3FA 1W46A 2QP4A 3R20A 1C4OA 3QPWA 1DAMA 1DAHA
chains in the Genus database with same CATH superfamily
3LCMA 3G9XA 5FPYA 2JGDB 3PJDA 1U0LA 2UKDA 4JZYA 3VR5D 5BO5A 4J43A 4KXMA 1UKVY 4MP8A 4AG3A 2R00A 1JR3E 3PDJA 3CF2A 5KVVA 3IERA 4V0SA 4CKXA 5HFNA 2WWGA 3DAHA 2ZWPA 2A30A 4A0SA 3WKEA 2R97A 2Y67A 4G1BA 4JC0A 4HNQA 5TQVA 1CUGA 2R8XA 2ZUSA 3K6KA 3OKAA 3R7BA 2RI0A 4WDQA 1WV0A 2UUPA 5BQ5A 3P97A 2ADOA 1O4WA 3QW2A 4AB1A 2PJUA 1G60A 2X22A 2D1RA 1L7BA 4QECA 2IPLA 5FLYA 2BSAA 4GM1A 1Y1RA 2JI4A 4JXXA 1CUSA 1TPYA 4BB5A 2ID9A 3MEQA 4MA5A 2ECFA 3L8MA 2GCPA 1XL1A 5T4BA 1YB5A 1U2GC 3KFXA 5IKXA 3M70A 1A8PA 2C3YA 5F98A 4PNPA 5CM8B 2P40A 4GSYA 5J2UB 1J4AA 3ZUPA 4TV8B 1DELA 3CTMA 3PNQA 1R37A 1Q83A 3BHNA 1PV2A 2IY7A 3AHGA 4KKVA 1JBEA 1U1GA 2O3SA 2QP9X 4N6OA 5CYPA 5HE9A 1GDTA 4KSYA 3AL3A 1W0JD 3FIUA 4DR1B 1WS6A 4RUKA 5FORA 1Y34E 2PYDA 4BY9E 8OHMA 3K0AB 1BE6A 2Q4DA 1H9AA 4N54A 5JISA 2YBEA 2XMRA 5BN5B 2I99A 3EZXA 5BV0A 4FW8A 1FDOA 1MH9A 3NGMA 4KQIA 3W2TA 2VFAA 5TQ0A 4DW8A 2NYRA 3L04A 1IZ9A 4I8XA 1H6CA 1DKMA 5KSOA 2GHTA 2PGOA 2VDMB 3I39X 4JJ4A 2FRXA 2X77A 4M49A 5HG0A 2PGLA 2Z5FA 2M2IA 2O2EA 3A9CA 1XCMA 3DAPA 2HF7A 1HQCA 5E4JA 4HLNA 2V74B 2YHAA 1XCGB 4ACAA 2PMBA 3AW8A 5AJYA 2AOUB 1JFVA 1NW5A 2BHTA 3KT0A 4MW6A 4AI6A 2EGGA 5ESWA 3OX1A 1P0CA 3S44A 4CT4B 6NULA 3H1TA 4LNHA 5G0UA 1NJ8A 1RQLA 4C78A 5EKSA 1CU1A 1AA6A 3E3AA 5EZ5A 1NF2A 3DA8A 3LXRA 3TNYA 2PSEA 2JCXA 2P2LA 1BN7A 4MVJM 1U04A 4LXUA 2R6CA 4L9RA 1WZ2A 3VKGA 2GEKA 5BSFA 1OI3A 5DISB 2QQFA 5DKFA 5CDUA 2R5FA 4QSMA 3V4PB 5F1YA 4DCMA 5EWLA 1A8HA 1WF3A 2ODWA 2EWMA 2G83A 4HLQB 4PYIA 4QOHA 3RVNA 1I2MA 1GA1A 5BQOA 1WMEA 1T4DA 4YRLA 1ZD8A 4O08A 3SI7A 2UYCA 1VSQA 4R84A 4UBIA 4EUEA 1EUDB 1G21B 2C7OA 3ZBTA 1GNVA 2Q9UA 2VA8A 2OV8A 5DYWA 5BNFA 5B36A 1TZBA 4KE8A 5CRIA 4YRRA 4IJWA 3RHSA 3TTXA 3RH0A 4D1YA 2OK8A 4ZTZB 4CLRB 2CNBA 3GLVA 3SZMA 3HLKA 5IKPA 1WJGA 4PY2A 2IU3A 2OVBA 1ZI9A 2ZJBA 4MQEA 2BE7A 2GLTA 4PGGA 5FL3A 2NU9B 4FZVA 4EQ6B 1XZCA 2BFEB 1TZ2A 3BXFA 1I2BA 1UJBA 4R2IA 4TYMA 4LQ4A 3QLUC 3KT6A 1AKYA 1Z62A 1A9XB 1C81A 4ZHQF 2Y77A 4A26A 5HYVA 2VC2B 2W6PA 4M9CA 4EWLA 3J81k 3OUUA 4UTXA 4RLQA 3NG1A 5L3SA 1RJEA 1HT3A 2WTNA 1IWBB 4PFKA 5TT1A 3ZHBA 1DQYA 3DHWC 1P8JA 4NDZA 2I2BA 4RGVA 5H4GA 2AEFA 3QE0A 5KWVA 2MYNA 1WSBA 1I2DA 1E98A 1Y8AA 5BWOA 3K6SB 2TMGA 1FTYA 3W79A 2QRLA 1JLMA 1XEAA 3MT8A 4NFHA 5ALOA 3KQNA 2BMWA 3C6XA 5T4EA 2PGDA 5KUTA 2ECPA 3KRTA 4E2WA 2OCDA 3G2MA 2WLSA 3DEZA 3I9OA 4C7OA 1KYIA 4LK2A 5JZSA 3NTRA 2F00A 3VJMA 1FTNA 4G1MB 3ZIAD 1B14A 2WJYA 1EFCA 1GRNA 2HSDA 3JWGA 2OZEA 4IIUA 3VFDA 3AZQA 1ES9A 1JA0A 3G6WA 3MPOA 3E9QA 4JAVC 4DR4B 3PR2B 4S05A 4DUYB 1OKKD 1RPJA 4TRJA 1PP4A 1PSDA 1VDMA 1ZFNA 2ZWOA 1LD3A 3JPYA 4L3VA 3ESAA 2EGHA 3AFIA 4N4AA 2WHYA 1LX6A 2ODBA 5T8KC 6LDHA 2O8DA 2GHQA 4I50F 1VJ1A 1WY5A 2QTMA 2JIMA 1SCNE 4Z9FA 1DRVA 3IMEA 5CJPA 5JNRA 2I4LA 2JGLA 1SKMA 2RJ3A 3EPLA 3OKCA 1HKUA 4DUZB 4EFLA 2I6XA 3KQMA 2QRNA 2YV1A 5KAPA 2DULA 4W9NA 1VXOA 2WJZB 1Y5RA 2IHBA 1SIBE 2PK3A 1BE0A 3K2EA 3L46A 4UZEA 4Y6LA 2E0IA 1J9EA 4BZWA 4ZHQA 2O2JA 4DQDA 3HNPA 1LS6A 1FJHA 1J56A 1PRYA 4J1NA 4PCUA 4KH0A 2SKEA 4OJNA 1L7AA 3O8OB 4TS1A 2V4ZA 2WVJA 1AS0A 5CNJA 1GA6A 3ITNA 4ZEWA 2RGEA 5BT9A 3OPVA 3UTCA 3JVVA 5JPDA 4YQEA 1O6BA 2R1TA 4R1NA 5DTRA 1PT9A 3MWFA 4J0IA 1XVLA 2RCYA 3LT1A 2JEYA 4PO9A 3O8RA 1WEHA 4XD7A 1QIKA 3LVBA 4CMCA 5JVDF 5IM5A 5FX2A 3A2LA 4AF8A 2XTZA 3IEMA 4OJQA 4PR0A 1Y7LA 3KYDA 1Z2PX 3RU7A 2EV9A 4EHKA 2J67A 1ZH0A 1T8TA 3DBOB 5ALMA 2CNKA 5CXXA 5CX4A 3SS9X 1KK0A 4E6PA 1LW7A 7GPBA 1MV5A 1DC5A 4BP8A 4JSTA 4UQOA 2I2WA 5JY1A 1AKWA 1ESMA 2FUG1 4BU1A 2BKVA 3WAJA 4U4AA 2DFVA 3LRXA 4QEZA 2IEDA 1O8BA 2YS6A 3I6BA 5HE8A 4UNRA 1ZD9A 1E7WA 5CHYA 3SQOA 3TZBA 1NOJA 1WSWA 2ECQA 4IDPA 2RKOA 4W1PA 3E8SA 3GLFB 4J7CA 5IFKA 1SMKA 2Z30A 1ZY2A 3WK9A 2BVNA 2HU8A 2GPAA 3GEIA 3MTDA 4I0WB 3CNOA 1J06A 2ZJZA 1MIOB 1ZGJA 4JGGA 4BE9A 4K28A 2EJVA 1JGTA 3KKOA 2M9MA 4GPAA 3QUTA 5HRAA 4N12A 1I0LA 1PBNA 1WP4A 4YJFA 5KOIA 5JARA 4TQ9A 2Y1OA 1HA3A 2ZB3A 2HT6A 1N8NA 3FPJA 3O47A 3SS7X 4WOPA 1QO9A 4OPMA 3DO5A 3S55A 4IM7A 4L95C 2QU7A 1MEJA 2X4IA 3MYRA 1L5OA 4IVRA 4JGBA 3PVZA 1GNPA 4YUZA 5BSVA 4R9NA 1C0PA 3U7FB 3K9GA 1U0EA 3N39C 1O0SA 1ZISA 2DBYA 3QXJA 1RXSA 3PUWA 2CDRA 5EE3A 2VSFA 5D87A 5JVDA 1FP4A 2XUPA 3FNEA 3HQ4O 4MW1A 4I4TA 4D4KA 3AY6A 3PA6A 5K01A 5J2UF 4TV8F 5FT9A 1WPXA 2GK4A 5L4NA 4XCQA 3HYCA 1V41E 1GAWA 5G1PA 4EJSA 2NXWA 2YZMA 1ADFA 4PHTA 5M5BA 3E05A 1SVWA 1U0NA 1SUSA 2C3PA 3VU1A 1K3TA 1KAEA 1HTWA 3FVTA 3L7KA 2AC2A 3IBGA 3LLMA 3MWGA 2XVYA 3OQIB 1HE8B 1Z7BA 4NCXA 5DBIA 5K0NA 2WY2D 1A9YA 1TA9A 3IA2A 3JQAD 4QBKA 4ZAGA 3VNAA 2H1FA 2OD2A 1DNPA 1U65A 2CUZA 3GMTA 3OY2A 2HA0A 3QRWA 4C4PA 1CY1A 2H54A 3HV0A 3PU6A 4UZFA 1JKIA 2PWAA 2DPGA 2VOEA 5TQ2A 1Z6ZA 4PWZA 4U8HA 2Q50A 4D3XA 1Q16A 3ZE9A 2E4ZA 2WU3A 1E2IA 1CUFA 2ZYWX 1IONA 2HB6A 4TKMA 4UCXA 4QM6A 5P21A 2DKNA 1C0KA 2CE7A 1U7HA 3NHMA 3ZHTA 4ZI7B 1HDIA 3L8HA 3CE9A 3KQLA 3AUYA 1R5BA 2P62A 3BORA 4EITA 1CUYA 1Q20A 1K0UA 1QKIA 2JIPA 3LA8A 1TTHA 2MR6A 2X5XA 4QU0A 3TIIA 3Q7EA 2AL7A 1T5HX 3CVOA 3NHJA 3JRNA 4XZ3A 5K8JB 2EF1A 4BQSA 4L4UA 4FZJA 3OSUA 1DAPA 2W6ID 1Y4DE 2FFBA 2BTOA 4HADA 1ZMBA 2FDCA 4H77A 1EA7A 2QL6A 3M83A 1YRHA 1PVDA 4YVFA 5FL7A 3VYUB 1OPRA 2J5BA 4I14A 1F20A 5GIOE 1NXXA 4P98A 3QENA 1GL3A 5D5HA 5IMSA 1LQ2A 5EFZA 2OMEA 2Y0EA 1M5RA 2NVWA 2PZJA 1EG2A 1TEHA 2NUAA 2Q0QA 4FEYA 4K8RB 1DQSA 2DPMA 4BNLA 3T7TA 3ANLA 1P0PA 2WM2A 1C4WA 1ODSA 3N6XA 4MX8A 3OOJA 4FKMA 2I7XA 6GPBA 1HE5A 1QQ6A 1M76A 2BGKA 4G8BA 1QFXA 1IZYA 5FAXA 3TLGB 3V8PA 3A26A 1JWBB 4HTFA 1N8SA 3T5GA 1DZIA 1GLVA 2WW8A 4WADA 5KYWA 1MVLA 2OILA 4LJKA 4MYTA 1OYOA 3AEKA 3C3EA 3IOCA 2EQ5A 4R4JA 4R1OA 3G2PA 5JATA 4OAPA 4O6VA 1S3FA 3B48A 2JJ1D 4QYSA 1GCOA 4HAOA 2IGBA 4E70A 4HH4A 5EMNA 2IXTA 1BROA 2DY0A 3U26A 1LDMA 4PYOA 5LPNA 5JCXA 3H0KA 3T9FA 1R0LA 2O3RA 1TLLA 3C5EA 3UYKA 1KMMA 4YMSA 5JXIA 3QNUA 4R7GA 3UQZA 2QVBA 1IHDA 1EVYA 3IP9A 4POOA 3P0EA 1UXJA 3RIYA 4AWAA 5J3JA 5HKOA 4CG0A 2QG9A 2XCLA 3KR1A 3KXIA 4MYDA 4WH0A 2CXQA 1M75A 2I6GA 1Q7RA 2OCKA 1SG6A 1RPZA 3DAYA 4RF4A 1ADCA 1G0OA 3RLIA 4RJJA 1OGYA 4YEDA 1OLUA 2HX1A 2A0FA 3WLSA 5IXYA 4GI2A 1SKYE 3U44B 3DFIA 3K20A 2P91A 2FEKA 2NNWB 2XCQA 1EDEA 1KJ9A 1EPUA 4H7DA 1XZFA 1R4MB 4Q4JB 4CKWA 2E85A 2EG5A 2N3ZA 3MT7A 2VP0A 4IW3B 4ND8A 1WKBA 1WZUA 1OFUA 3OAAD 1ZD4A 2I1WA 3PD7A 4J1TA 2WWVD 5J1SB 3ROGA 5F52A 3HABA 4E4YA 1WVGA 1EWYA 3EHDA 4MEAA 1EEXB 5BWMA 1AK2A 2PLRA 2G25A 3HEBA 1TM5E 1DIGA 4FUTA 4Q48A 5AUQA 5FDFA 3GNSA 4V1CI 4IXDA 3BDVA 3PICA 1U2QA 4BYMA 2F3UA 2CCJA 2KE5A 1Y7HA 2V5VA 2BD0A 1EUDA 3LQ1A 1RE1A 3SLGA 4ARSA 1BOOA 3SWWA 4QICA 3U7JA 2VI5A 2PUGA 1QCYA 1Q0UA 2NTYC 3OQNA 1EG7A 3HUDA 3B8EA 3H5NA 3OUTA 5TV2A 4RGBA 3ZXSA 2IHUA 5IYZB 4PPNA 2JBAA 5U9CA 1KY5A 3H17A 2B1GA 1CJMA 5E1OA 3B3QA 5FULA 3RS3A 4MI3A 4KQ6A 1VYTA 1UQRA 2FPKA 3H2JA 1T34A 3AH8A 3EGWA 2C1XA 2J30A 3LD9A 4UFNA 3FZYA 1L5WA 3WWZA 2XXAA 4G5OA 1MOZA 1GTVA 2OCLA 4N9WA 5HEKA 2GCIA 2R9VA 2DT8A 3BGOS 3G9TA 3PCRB 5TEWA 5BORA 2B8EA 1IYZA 2G6TA 4GLLA 4D92A 5I7OA 2HAEA 2YIVX 3D5EA 3ZN2A 1ZR2A 4FGJA 1EVZA 4U2GA 2R62A 3K4PA 1E6UA 1XGKA 4P31A 4E21A 2PG3A 1AGYA 3I6IA 3R3YA 2GGSA 3OIVA 3MCTA 2HTFA 4RVFA 3FROA 3WWPA 5ETJA 2OM2A 1I7NA 3IKLA 1T4GA 1OJ7A 1ZCAA 1XDWA 2WE8A 3PUVA 3ZCUA 4YJ2F 1V5GA 1YR7A 1RHJA 1PS8A 1B2LA 2J87A 1XMPA 2E87A 3K09C 3KSDO 4KPUB 4QJ5A 5C46F 5IU6A 2ZUEA 1I0IA 3DWEX 2SHKA 4BAZA 1NMXA 2VKTA 2C04A 5JNUA 1LGYA 1NSFA 3HZRA 4MRPA 2QN8A 4R8RA 1TX4B 3N75A 3KE8A 1U0FA 1ZA2A 3KX2A 4X85A 5LR6A 4DZRA 4KE6A 4IICA 4U7TB 1JEYB 3MLEA 4N5IX 4CYMA 4DLAA 1LB1B 3JQDA 1EH5A 4QVKA 3WP0A 2R8OA 2EZUA 4F5WA 3K5WA 2DR0A 1CY8A 4UKDA 4OMCA 3IELA 3VUEA 3NBAA 3HVRA 1NC1A 2BDUA 4YMGA 3GLIE 5EVJA 3GH1A 1YBAA 2Z09A 3LUFA 4KYIB 2WSBA 4LC0A 4RAQA 4X1YA 8ADHA 3I5XA 1P31A 1SXJD 1U2DC 2F1OA 4ZV9A 4N39A 3D6HA 2AJBA 4UHJA 1GPWB 3KVOA 4F4FA 3IXMA 1KQGA 2VF7A 3W6OA 3TKAA 4CN8A 2VQFB 4BNIA 5FUMA 1DT5A 4FFLA 3PDWA 4EG5A 1VPVA 1NATA 1LPBB 2CLFB 2IS1A 4EY3A 3FPAA 3W90A 4DADA 5LM3A 4YX9A 1RLIA 3HH8A 1XKXA 4UC0A 1E9DA 2C5EA 2WU0A 3PITA 1KI9A 1NNI1 2FWIA 1OWOA 5DSZA 1GG2A 3S6JA 1BIFA 4IKOA 4C7MA 3P52A 1V16A 4ESVA 3OM8A 2V1UA 2O8CB 4IDCA 2AZDA 4EF6A 4HG2A 2ZJ6A 1QWOA 1XA4A 4FYXA 1KL7A 1ZYUA 5HQJA 4HDQB 4JYAB 4A8JA 4MV8A 2NYAA 1PCXA 5KINB 3SM9A 4DLTA 5MN6A 2ZCUA 3CRVA 5IAJA 3ZLVA 4YJ2A 1LFDB 3GCWA 2EX1A 3U0BA 3L7OA 4C2UA 1HYGA 1EVLA 3OTIA 1N92A 4TWRA 1IUPA 2LP4Y 3MTAA 1TLFA 3DL0A 3DNMA 4NH4A 4TLLB 3KZCA 2XWJI 4UXJA 3R0QA 2UYOA 1TW3A 4WN3A 1IBKB 4G9EA 3MCUA 4RVCA 2HRBA 3WB9A 2FZ5A 3QZUA 4CE6A 1UQTA 3FB1A 3B3JA 2QY6A 3LYLA 2CXSA 4JBYA 3WKDA 1QFSA 3UO8B 5JG7A 1BX1A 4I5IA 2CHFA 4WNIA 2XNHA 3NWPA 3PC3A 2CFOA 2BWJA 3TBHA 3DQQA 4ITRC 3VU9A 3IQDB 4UU8A 4ZYZA 4JLKA 4BKOA 2HRDA 1RI5A 1JB1A 4XJVA 1GPKA 1II8A 3OX4A 3AI7A 1M3SA 4LYFA 2IV2X 4F56A 3C7TA 5L4SA 4D8YA 2FLVA 1L9KA 4BLPA 4E3WA 4YK7A 1R6TA 4KQFA 4Z4CA 1QK4A 3JSXA 2HO5A 4O33A 4ANFA 1M72A 1KFCB 2WJIA 2E55A 3OKFA 3S5UA 3ND8A 4ZT3A 4ZI7F 1U11A 3R2JA 3RRBA 3WXBA 3AESB 2RIPA 3JV7A 1MMFB 4CU5A 2WJ6A 2VT7A 3KU1A 1VIMA 1X94A 3O84A 1UCFA 1NVFA 4BGEA 4DV3B 5J5AA 2K2QB 3HNRA 2ZIEA 1RYMA 3AIMA 1B8VA 3R0IA 4RXMA 2OC9A 5LYYA 2DKFA 3EDCA 4TMKA 1YS7A 3EXFB 2O1XA 3TLJA 2GZHA 1TTQB 4DEYA 1H2FA 4JA0A 2J9FB 1JQDA 2ZXEA 3K16A 1EK1A 5BUZA 3V1NA 2O50A 4B46A 2G1PA 3CF0A 3U4QA 3TD2A 4YO7A 3MJRA 3ZGNA 3I9LA 4GR4A 3PGVA 3VTZA 1FMCA 2GH1A 2IYAA 2R7LA 3DGFC 4IOMA 5E6SB 4DWWA 2CHGA 1NSTA 2HMYB 1YK1A 3BMOA 3RK1A 2PL9A 1SBTA 1NAIA 1OI2A 3I83A 3PPIA 1U1FA 3FYDA 4U9HS 4BKQA 2VEDA 5AVYA 3T35A 1C7IA 2AD5A 3FPFA 3EYAA 1V1RA 1XYYA 3CSSA 4GBED 5ERXA 1E1CA 3TGWA 1S9DA 4X3OA 1X9GA 2FRDA 4MPJA 4AMYA 3RUFA 3HEAA 4IQGA 4D80A 3ZXYA 3T3EA 2YVQA 1J8YF 4RW0A 3U7IA 3X43A 2GNOA 1NUTA 1S7CA 1PTJA 2NZYA 1FY2A 1ONBA 3AVOA 1W1WA 3KLOA 4TXHA 4LJLA 3NCTA 1YKGA 2R66A 5TSDA 2VA9A 4I9GA 4X97A 2KI5A 5E1BA 1JKFA 3E5RA 2FPPA 4MA0A 4X6UA 2DHCA 3J7TA 4Z7JA 3A2MA 4I46A 1Z73A 1XJCA 1A7AA 3HVIA 4KO3S 2D4AA 1M6HA 1PHPA 4N8SA 4UVGA 4F04A 1DJOA 2GPBA 2Z43A 3T4XA 2ZUFA 1P4HA 1XAGA 2J0UB 3PFBA 4IUCS 3GN2A 4IWYA 4BL5A 4CMIA 2D2EA 3DOUA 4L6AA 1GN9A 2AFIE 3FTPA 1N0UA 1RHRA 3B1KA 4JITA 4BNKA 4FD2A 6AT1A 1ZXBA 4ML3A 1MV8A 1NOIA 3VR0A 1CIJA 3PWSA 3LSTA 1GNLA 3AERA 2V7BA 3OZXA 4XR4A 1FX0A 3EWAA 1WB6A 2B5OA 2PS9A 4HNHA 3DR5A 4H9GA 3BULA 5CX1A 1N8KA 1I14A 3NNNA 4DC0A 1U1EA 1R27A 2ZI3A 3F5SA 1WB9A 1H1TA 1PT5A 2FSFA 3RUCA 1D4AA 2O6LA 2GD1O 3GL9A 3UGTA 1W4CA 2IW3A 3EF1A 4NG4A 1UM9A 3NPAA 2Q3HA 4C0XA 2BFFB 3CB2A 4LV6A 1VSUA 1L8LA 5CPFA 1E0JA 1FLVA 4NBUA 4OQ4A 3VO9A 4D0SA 5JNSA 1X2BA 3DVAA 3R3VA 1OQAA 1LK0A 3BWMA 4FOSA 5TARA 1Y9EA 3TD9A 3MS4A 3G7SA 1NR5A 4IOKA 5INTA 1TK9A 3CQ9A 1G66A 1KJWA 3D8UA 3N2IA 4MZXA 4V0RA 4Q02A 2OC4A 2YASA 3U3KA 3WLKX 4B7CA 4QELA 1ZVVA 3BXXA 4DT1B 3VHQA 4MP3A 3KB2A 2P8JA 3PNMA 1N5LA 1YUBA 3LYUA 1C4XA 4JP1A 3DVLA 2DB3A 1DBWA 4S1TA 1NW6A 3KJZA 2O59A 5LFAA 4B4KA 2GPJA 4L8LA 4P38A 1II0A 3LBAA 1G9TA 3N7TA 4B2YA 3U5ZB 5AOCA 3U13A 1DHRA 3TINA 2PL5A 2D62A 2ZR0A 3DKKA 1XG5A 3WSVA 4BE4A 1OXBB 4ENVA 3G8DA 4QQFA 6REQA 2ODTX 1CHNA 4ZVVA 2YFYA 1GRQA 2RK3A 4ND6A 1P1JA 5LQRA 4DBZA 3IJ5A 5JFGA 1KVUA 4KIUA 1K2VN 3IEIA 2AFIB 4BQFA 2BGRA 4TQUS 1UBLS 1F5NA 2HUPA 3P96A 3FUWA 3HUFA 2J9XB 4FDVA 5JQGA 1NZDA 1F9EA 2QE7D 2WSSA 4M0EA 2JLRA 2C4MA 2GSDA 1YQWA 4GWGA 3A7EA 1L8OA 1Q1QA 5BYJA 4Q3NA 2WLTA 3ZZ0A 4C6TB 5C4MA 1OHHA 3LSYA 4GMXA 2KX7A 1SUEA 3DLCA 4FBGA 5EPUA 1UFRA 5HQTA 4TMFA 3BB1A 3CKMA 2FLKA 2ILVA 2L19A 4MR8A 4FFPA 4HAZA 2QIPA 2IZ5A 4WTOA 2A5JA 3HWX1 3WR5A 1ESDA 1IXRC 1FSSA 3PPYA 4DV5B 1F0KA 4MKXA 3V1MA 3WLIA 1RQ2A 3BHIA 4A03A 1M2KA 1G8AA 1MO2A 2YRXA 3A6HA 1JTEA 3U61B 5DO9A 1J99A 2VYND 4F06A 1NR1A 4PIVA 2GCNA 1A9PA 3DOFA 3LO8A 3HRHA 3ZG6A 2VN8A 4GICA 5LJLA 3FD8A 4LZOA 1X38A 1YZUA 2YOHA 1ZVMA 3WGLA 3PC2A 2W93A 3L05A 4JROA 4Q9DA 4EO9A 1U0BB 1MX3A 1NLMA 4RTNA 2ANBA 2I1QA 1VLJA 3F2IA 4J6EA 4M53A 2OXIA 4ZV4A 4G01B 2ZJ2A 3RVKA 1KVQA 2P5SA 5KYXA 1EFLA 4A7PA 4EY7A 1EXNA 1EXDA 2Z2KA 3S40A 4J0JA 5LXTA 1RRCA 1A1SA 1R66A 2PMFA 1FLNA 2JCSA 3TTYA 4G26A 3E5NA 3WYEA 3UFXA 2QZZA 4BLQA 1Q17A 2BBSA 2PUJA 1ARZA 3INGA 4LHXA 4DV0B 5JWRA 3V1UA 3WKCA 2XVZA 2H1SA 5G3ZA 5A7GA 3LDFA 4CEIB 1JR6A 1EMDA 1B3RA 4GLOA 2YN4A 5DLYA 2L82A 2XRMA 5E0KB 4AROA 1WULS 2BI8A 4ZYYA 5LQKA 2CY0A 4LXYA 3MN1A 4MVXA 5AOAA 5IN5A 4LF6B 2IIBA 1YS1X 1KJNA 5BSMA 2B4AA 3VOSA 4QO7A 1FDUA 4B0OA 1J8VA 5B3LA 4LOHA 4TVOA 4Q39A 4MNTA 4D41A 5HBGA 1H22A 2VT2A 4PXAA 1UOPA 3OURA 4HCJA 4FR5A 4KP7A 3ER9A 4JB0A 2Y66A 2ZXUA 2VZLA 1JR4A 4JYZA 2PL1A 1A2QA 3B6EA 2EBHX 5HJ2A 4XQ9A 3ELDA 1L5HB 4ZGWA 1XE3A 1O94A 1OZFA 1Z83A 2X8WA 4Y1FA 4CLOB 2EJWA 2PSFA 2ROQA 2XNCA 4BIIA 3LQQA 4ZVNA 1ZOIA 1V43A 2XODA 3HHPA 2YHSA 1UMCA 1WDTA 3GRKA 3HKDB 3ONVA 4LS3A 2GEUA 3WLTA 5AI6A 2ZRJA 4ZXPA 3QOYA 2HXGA 4NS1A 1WUHS 4I1SA 3PFCA 1X42A 1BXKA 3D7MA 3M4JA 1QANA 4U3JA 4D8TA 5LZ4A 4IMPA 4MR9A 1LNSA 3F74A 4FYVA 4JUFA 3FJYA 4CQMA 1W4BA 1GPUA 1RCFA 1BJRE 4R2WA 1O77A 2ZRLA 4AZ3B 5A04A 3TFOA 4KN6A 4C0AC 3PQ6A 4XUCA 3EEQA 4PF1A 3U5TA 1STOA 3VYRB 2QTLA 3I12A 4Q34A 5KOHB 3SX0A 1M2OB 3U1VA 3AFNA 4MQ4A 5B53A 3WBFA 2WI8A 5JAHA 2GKSA 1IN8A 1V95A 3X1DA 5BOSA 4RMHA 3FFXA 2OZLA 3NOOA 4FMCB 4IKEA 1EE1A 3CVJA 1RBYA 1Z63A 2AX3A 3GRYA 3GEDA 1OFUX 1T2EA 2NUPB 3AK4A 4RGQA 2H5IA 3VSDA 3EVTA 5HF8A 4U0JA 2YJ6A 4MEJA 1E0SA 3A6DA 3G5UA 2AX4A 2UU9B 5C7YA 1L7DA 1MEEA 1CRPA 1Y1SA 3TECE 4J4BA 4LY3A 4C0WA 4PG4A 4OFBA 4W5QA 1NASA 2VNIA 4CJXA 1NQUA 1U8CB 1KI4A 3I6MA 4OUDA 5BR7A 1OTYA 5AK3A 1HNZB 3KWFA 1N6IA 3Q8MA 1F2UA 3BQ9A 1FJGB 1GEEA 1UKZA 2IITA 4ND5A 4MYUA 5F7JA 4MAAA 2RGUA 2VT3A 5AO9A 1EA5A 1UOOA 4HDSA 1MXHA 4P7BA 4R2MA 3E81A 4RPCA 1PJ2A 5KNCD 4X66B 4D4IA 9LDBA 2L17A 1HR0B 4NNOA 1CE8B 4ZHSA 3D3KA 5I7RA 2WIAA 2OO7A 1NFRA 5FLEX 2VNAA 3NXSA 4YJDA 1X7ZA 4DLUA 2BTQA 2ZBRA 3H2GA 1GG9A 2BY4A 1Z5PA 1EB8A 3NATA 2W42A 3EGVA 4FE4A 1DVRA 3KOXA 2I4IA 5DASA 1B16A 3WP1B 3WLRA 2C0CA 4MI1A 1MR3F 3DBLA 4RFSA 4IV0A 3D6AA 4QBHA 4WCDA 1IFXA 5AJUA 1JXQA 1WEKA 2FG7C 1B76A 1NBEA 3DSRA 3NKFA 4B3XA 1J00A 3KVNA 1DKPA 1M0WA 4H0NA 4O4HA 4RQBA 5EJ4A 4YN3A 1MDFA 2P4UA 4LEIA 3S7ZA 1RWXA 3SXPA 3VZDA 2YWRA 4FCTA 3ZWOA 2WIDA 3K73O 1T26A 1YO6A 2NP7A 2FP4B 1JQKA 2VO1A 3HCAA 1TGVA 1JHPA 2W2LD 3F3KA 3H5IA 2GJKA 3OHMA 2AG6A 3PXBA 5FUWA 3R7FA 4RMIA 4GMFA 3BJZA 1KVTA 3NH9A 5B7GA 1YJCA 1P17A 2VTEA 4LJ4A 2WVHA 4MUJA 2FOLA 1A77A 4DEXA 1IRIA 1NBMD 1OC4A 2CBGA 5CH3A 5D51S 4IY1A 4QFCA 3N5CA 1KDTA 1UJMA 2JH8A 4YUWA 4EUHA 2I4TA 4QUBA 3AVYA 3VH1A 4ZOQI 1XRLA 3I2KA 2HA6A 2QTCA 1L1QA 3JQRA 3KOUA 4M1TA 4OFXA 1PG2A 1CF9A 3HZHA 3WBJA 4R9SA 3SICE 1NLUA 5H8WA 1WNTA 4R41A 1YS9A 4BGVA 1V96A 3JD4A 2P3OA 5BP7A 4EHNA 4XTCS 1T6ZA 4AP6A 4DIDA 4NJEA 1BDMA 5IWAB 3KV1A 1NLFA 4RKWA 2GTHA 1ZGHA 2NVUB 3RG8A 4PBTA 3ZW7A 3HSYA 1UC9A 4PYKA 3W7VA 1I5RA 3IEXA 3LCVB 5CFLA 1S9HA 5C4IA 1SCDA 4PSVA 2C94A 2Q7OE 4MKGA 2IYFA 4J4HA 2OO5A 5DEOA 4A36A 1FTGA 1DBSA 1L3BA 2PLFA 3A1EA 3FYHA 3IUSA 3K1JA 2XITA 2WIJA 4ND1A 4TKLA 5LQUA 1JEQA 1P6QA 1OX4B 4JLVA 3BIFA 4RWEA 4OHZA 3T7AA 3QVLA 5LVAA 4B3SB 4LF4B 3WL4A 2XF2A 4OQMA 4BOYA 1WDWB 3LKBA 1U8ZA 1ZBDA 3WBBA 1VL8A 4E31A 3JQ7B 3EFEA 2BGUA 1EAMA 3A7DA 1EUYA 1EZ1A 4KIGA 4MJLA 4LDPA 1MF7A 1D8AA 2ZAOA 1HEYA 3IV7A 2O1WA 4Q7KA 3ZBUA 3BGWA 5IH3A 5IASA 3HXQA 3BBPA 1H6AA 1RRGA 2XVAA 1Y5IA 2ZVQX 3KXPA 1XK7A 4YUAA 2QAJA 3VSCA 3RUIA 2P7HA 4JI4B 4JVNA 3RI3A 2GDJA 4F5EA 2PX6A 3CTPA 4YMHA 2R1UA 4AJIA 1FUUA 5YASA 3HEMA 2ORVA 4M1OA 1G18A 3L0YA 4CG1A 3MZ0A 1J2EA 1H8HD 1X8KA 3O2SB 4LN1A 4DJEC 4DLBA 3VU3A 1GSAA 1UXOA 3ZGXA 3DNPA 3NVKI 1SC1A 3Q2OA 2BFWA 2CMDA 5TPZD 2CDAA 1Z2CA 2QIOA 2VJMB 2WC1A 2WFZA 3DZ8A 3I2IA 3I9KA 2O2GA 3OIWA 3Q12A 1YGPA 4LRXA 4XCVA 5IAKA 1M6VB 1YMVA 3E9ZA 5MN4A 5HUHA 2DQSA 4EG6A 4FLMA 1PR0A 1GCIA 2YHIB 3NT5A 2CVHA 2OESA 5K4AA 4KXLA 3SFZA 1ZU4A 3Q8XB 1K7SN 1XVIA 2PWBA 2VHCA 4CQLA 2P6RA 5IJ9B 4UNSA 9GPBA 1GGJA 3SFTA 1UPFA 3OCXA 3F2VA 2IEYA 3QTLA 1GPYA 3MIZA 1SU4A 4NU8X 2DH5A 2A7XA 3W4IA 4AJLA 2QTGA 4YAIA 3I5MA 4JLJA 2V6JA 5KDOA 1CV2A 4R05A 4GVPA 3CUUA 5LLTA 3QVUA 3B1XA 4KTVE 4XYLA 1RHQA 5A5FA 2QBYA 3MAGA 1JH8A 1M6EX 2YXDA 4PLHA 3MMXA 4FN5A 1Q1ZA 4MK4A 5I51A 2WTMA 3P2MA 1JHXA 3N0TA 4FINA 4BB9A 4C4YA 3WDLA 2QHXA 5CA0A 1IB0A 2ZWAA 4EUFA 4UOEA 1LFAA 5J23A 3GRZA 1MJ5A 4D44A 5IG2A 1Z68A 3AILA 4WK4B 1NPTO 1UBUS 1NJ6A 2FUEA 5J59A 3ROPA 1XDDA 2D4HA 3M1LA 4YRNA 1IUKA 2ZJAA 3COSA 2X8AA 2Y1DA 5TX7A 2IPAB 1YB4A 2NT4A 4PO8A 5KNLA 3CVUA 2H0AA 1N25A 1ONSA 3V4ZA 3ITEA 3F47A 2FDRA 3VYVA 3OESA 4GMGA 2Y1FA 2W6MA 5SY6A 1RYZA 2FK8A 3RC9A 2EQBA 1OBHA 1L4YA 1L8XA 5I4KA 1G7RA 1Z5GA 5EOVA 5JH7B 1QHGA 5JAPA 5DI3B 5FPKA 1VJCA 1I01A 1FQKA 4S24A 1TQ4A 4MRAA 3GUZA 1Z74A 2OKGA 4UEQA 5CBPA 1T1GA 2GWHA 4BGIA 4UTZA 1MO3A 4UJ3A 4IILA 4WD3A 3JAWA 2CV0A 4I3FA 4CN9A 1EJBA 1XLUA 3ESXA 1M2VA 1JZQA 4RGYA 5B4TA 4UVIA 3F73A 5DM4A 2V6BA 4IYJA 4W5WA 2Z95A 3FSGA 3Q7RA 4EL0A 1FXUA 3K8OE 3QE2A 3MFYA 2PNFA 3F46A 4O02B 2G06A 2XT6A 3U7QA 5G0TA 4PNHA 1JIQA 2QGZA 2GEFA 1V1JA 2IOFA 4JXKA 3UJPA 4QFBA 4G0PA 4INPA 2VZ0A 4FMCF 2LDBA 4YALA 1OB5A 2CV2A 1IQPA 3A9RA 4DLNA 5CYFA 1GTG1 2OP1A 3RARA 2WTBA 4N3NA 3UKJA 3SHFA 4C0QC 3V1TC 2FFQA 3BJIC 3EW7A 4R81A 1BMFA 1GUYA 1PR3A 1Z56C 2FPIB 3E58A 4QTYA 1CF4A 4I2NA 3I30X 4FILA 4DV4B 1CEXA 1TVCA 3H3JA 1A9ZA 1I7LA 4R1QA 2PKCA 1Q14A 1AS3A 4GS5A 1M8PA 3A0RB 2J09A 3EXG2 3QG5A 3ZK8A 1XWWA 4AQ7A 2J5RA 1XEXB 1N7IA 1YQTA 4P3YA 2QMOA 2WHPB 2XCUA 1U0GA 3OEEA 4IPTA 4D42A 4DAEA 2B99A 2PZMA 3OJEA 1J9GA 3TQHA 4F3YA 1JQBA 3A27A 4E5PA 1YQEA 1U1IA 3SN6A 1VXRA 4NFLA 2EL9A 2IW1A 3WWCA 3D0RA 4Q7LA 2X7HA 3B6MA 1N6PA 3A14A 3KTFA 1N9ZA 2DY1A 1Z0SA 3OD1A 2CHQA 3PNBA 3SZLA 4QU8A 4GUDA 1J2UA 3LLVA 2I76A 2ZUDA 5H83A 3WYDA 4DLRA 4V1CA 3ADBA 5SZJA 2YXLA 4HEA6 4O3MA 3OC6A 3O92A 3H2ZA 1E4EB 2RHCA 5DMXA 4JVOA 4P4LA 3RC8A 2ZPAA 1R6BX 2VKQA 2XGSA 4ND3A 2CDBA 3T3PB 3ZBQA 3ZWKA 2W2OA 1ODIA 3HRIA 3ZCRA 1MW9X 2ZWVA 821PA 1KY2A 5HIIA 5A03A 5KMGA 1J8FA 3E9CA 4Q4DA 5AHOA 1FFHA 3REOA 5HUJA 2GZRA 3QTTA 2JH3A 2QYTA 2O05A 1ETUA 2P6NA 4EY6A 4N0DA 4IZOA 2ZTMA 5LNK6 4KR0A 4YRDA 4R9RA 3TEMA 1SCU