1AN0A

Cdc42hs-gdp complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
189
structure length
189
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtpase
molecule keywords CDC42HS-GDP
publication title The Structure Determination of Cdc42Hs and Gdp Complex
rcsb
source organism Homo sapiens
total genus 58
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1an0A00
1KY3A 3W3ZB 4BFSA 3BS4A 1CS4C 4WZ6A 4NONA 5DLQC 3A1WA 3V4FA 2FSIA 2W58A 4PPGA 1US8B 1H8HD 1R0XA 3OEHA 3EIHA 4PZLA 3P32A 1L7VC 1ZNWA 2AX4A 4LY6A 2FFAA 3CH5A 2IS1A 4C0KA 5SZIA 4UJ5A 5KSPA 4WAUA 1M7BA 2OCBA 3D8BA 1UJ2A 4FINA 2G1KA 1ONBA 2VIIA 5F98A 3ICEA 1XD9A 2YC4C 1D8TA 3QG5A 2B7BA 4ZIRB 2XGJA 2MMGA 3EIEA 4L15A 5TB5A 2IWHA 1LTQA 3SZRA 2O8DB 3UK6A 3ZS8A 1E2IA 1CTQA 4ZDJA 3NC1C 4FWIB 3THYB 5EJEA 3PUZA 1E32A 2BMEA 1DG1G 2DB3A 5A0FA 3LXRA 2BC9A 2ORIA 1OSNA 2PL3A 4IVPA 4Q4HB 2ZU0C 4A6PA 2XZOA 1SVLA 1CR4A 1WBBA 1GAJA 2HUPA 1A4RA 3REFA 1K5DA 4KVGA 2G88A 4PO9A 3QBVA 4LHVA 2Q3HA 1EESA 4KVAA 2J0SA 1E79A 5F9FA 4N0EA 4PX9A 1LB1B 5KTYA 2V8OA 4PC1A 4ZDWA 2HLDA 3GEIA 3M1IA 3RRNA 3C15C 1T91A 1ZM7A 2V55B 4DKXA 5DN6D 2JLUA 3EZ7A 4CVNA 1Q1EA 4N1AA 2IBMA 2ZS9A 3CX6A 2JJ2A 3Q3JB 2OSBA 1KHTA 3VR6A 2J7KA 5JS8A 4LYAA 2IA5A 4IXMA 1K6MA 3LLUA 3K0AA 3Q8XB 2I1QA 1IJEA 4D0NA 4EPTA 4DEXA 2J87A 4QGAA 1W0KA 1G5PA 1FX0B 2LKCA 4M4SA 4QGFA 2A30A 1RFLA 121PA 4V0OA 4BRUA 4JMPA 4F93B 5JHHB 1COWA 3X1XA 3U7FB 4L5BA 4XVRA 1GRRA 4DCSA 1QHIA 3GEEA 3LVRE 4Q7MB 4JLJA 2F9MA 2BBTA 4QHSA 4OJQA 5C18A 4PC7A 2VQSA 5P21A 3UWOA 4ZPXA 3OAAA 3ZZTA 5AUOB 5FL3A 3VMFA 5JJLA 1M6NA 2JDID 1W36B 3DPUA 4NKRA 3IKJA 2JLSA 2WOJA 1W47A 2QE7D 2Z5FA 2J9RA 2QPTA 1J2JA 1GSIA 2WIAA 4LJ9A 1WXQA 2XTNA 1R0YA 3L2OB 1LY1A 3VX4A 2BIFA 2GJ9A 2REOA 2RGCA 1VPLA 1XEWY 5K8LA 1Z0DA 5DO9A 3CF6R 4AYWA 5FTNA 4V0MA 3ADCA 1TQ2A 1D6JA 3BGWA 1QHHA 1KGDA 1E2FA 4HB0A 3UIEA 4TSFD 5DIFA 1P9WA 2ZSEA 5BYJA 2Z4RA 5IT5A 1GRNA 2G6BA 4M9XA 2ZTSA 3ZIAD 5B64A 1E2EA 4QM6A 4RFSB 1M74A 4Q4LA 1KO7A 4Q1AA 4NYJR 4ERNA 4XVUA 4PHGA 1KI7A 3KJHA 2LWIA 1GUAA 3PEUA 4BLSA 1GP2A 2ZJYA 1AS3A 2OCYC 1AK2A 1F2TA 1IHUA 1MRSA 4JLPA 2ZAMA 2I4IA 3QXCA 1IXRC 1G7CA 3HYRA 4PO1A 1AQYA 1XEXA 3AKEA 5AJXA 3F5FA 4DLSA 5CIQA 4U5XA 1XD8A 4BRWA 1AQUA 2WPDD 4PR0A 5L3VA 4KFUA 4B76A 2MSDB 4TYNA 5H8WA 4YLGA 4TTPA 1YZLA 4IEIA 3I92A 2IF2A 4G5SA 4UXIA 1W4AA 3QKSB 4CEHA 1WDTA 2OBMA 4HLDA 4OK6A 4XIGS 3SS8A 3WYAA 4BQSA 4OYHA 2QORA 4EFMA 3AVXA 2FG5A 4L8GA 1OH7A 5JJIA 1BYIA 1B23P 1R5OA 3EWSA 4JLBA 1AKYA 1T8UA 2R6CA 4XVQA 2AK3A 1AZSC 2GILA 4B3XA 3A6PC 2JLWA 2QQ0A 3ZYCA 4IVQA 1XZPA 4NE2A 4URYR 3TR5A 2JLYA 5FBWB 3W6PA 1U2RA 1AZTA 1NKSA 1AA9A 4TL9A 1U8ZA 2ORWA 4LYHA 5J4KA 1WB9A 1WRBA 2JJ8A 1ZCBA 4LC1A 4NL4H 3RS2A 3GLIA 1T3LA 4JJZA 1M7GA 2ZITA 1J90A 2FEOA 2FA9A 2JLXA 4B3BA 3BIFA 5KDLA 1SGWA 3OEEA 221PA 4OK5A 2F1HA 3PCRB 5LB2A 3WHLA 5L3RA 4ARZA 5FPKA 4A9AA 1E1QD 1XD2A 4ASUD 1A82A 5DHAA 2GJ8A 4CGZA 1G7TA 3AF3A 3IDQA 1E0SA 1P5ZB 3VTKA 4BLQA 3ONWA 3EX7C 2IXEA 4GBMA 4MITA 1SXJD 1E9FA 2RGNC 3EA5A 1R6BX 3TIFA 4TLEA 4EPYA 4KLNA 1RJ9A 2ZYTX 4GZLA 1W48A 2BHRA 3OE7D 1GM5A 1UFQA 3K70D 3BH7A 2BBOA 4F7WA 3S1AA 1FQJA 1KJZA 2R6FA 3NH6A 4FMCB 1TNDA 2J5XA 5JWRA 1LFDB 3KB2A 4PHFA 3DM5A 2FGJA 4JT2A 4LPSA 3FHTA 1FMJA 4B3DA 4LZZA 2ANCA 4JLOA 5FTMA 1YR6A 5E7MA 1RE0A 2HV8A 4JLMA 3C5CA 2ZI4A 1G5RA 5DI9A 8OHMA 1J8YF 4FMCF 4LGMA 4R2HA 1NLYA 4URUR 2RGNA 1VYVA 1D2MA 5EXTA 5KSYA 2OUKA 2Q6TA 4NDZA 2XEXA 3LQRA 4A92A 2Q9AA 2B21A 3C14C 3OESA 3B78A 5CB6A 5DGXA 3DDCA 2FSFA 4HDOB 1BO6A 3VFDA 3EW9A 3THWB 3WY9A 2D2EA 3KQHA 1MO5A 1S4QA 3MSXA 3SFVA 2BOVA 4GRAA 2X77A 3L0PA 2BMJA 4Q03A 3CRW1 3U61B 5FOVA 4NTZA 1J99A 1IXZA 1P2VA 4MKFA 5HZHA 1GKIA 4F4IA 2ZJ8A 4U7DA 5DH9A 5JRJA 1ZCAA 2WWGA 2PH1A 1CRPA 3BFXA 1U90A 3TH5A 1P9NA 1OHHA 2FSHA 1RW4A 2JJ1D 3WYGA 3TUJC 5CDFA 3W5JA 3QSYA 3U6BA 2PLFA 1QHGA 3IEUA 4LV5B 3I73A 5SZHB 5KHOC 3OIWA 4KYIB 2OESA 1CJUC 1T3SA 3LY5A 2ODNA 2XJ4A 2ZM5A 2JLZA 2QAGB 2DCUA 2VP4A 1N6RA 3C16C 1OB2A 4HYYA 1TADA 5FL7D 3B9QA 2ZANA 3RS7A 3BWDD 1R5BA 4TYYA 1OFHA 2D62A 3SBEA 5C1BA 4TLBA 2ZRBA 4HI0E 4GP7A 3LX5A 3OFNA 1NF3A 2WJIA 4KXFB 3GJ6A 1QG4A 3T5DA 3ZJYA 3AVTA 4PC2A 1QHSA 3RC3A 3WMFA 1E9BA 3L0OA 2H57A 1CR0A 1I4LD 2FFQA 2NIPA 3DL0A 3BBPA 3IHLA 5GADl 1SKYB 3GLFB 3MWLA 3DMNA 4QJ5A 1JXOA 4NYMR 4DIDA 2OCPA 2CLCX 4IW3B 4CW7A 2WBLC 1M2OB 3B1WA 1OXXK 2F7SA 3RS4A 2FPMA 4A2WA 3MMPA 5JMTA 1W0JA 1ZJ6A 4LV8B 2XTZA 4B48A 3GFOA 2O0JA 2ZRFA 4HUTA 1VTKA 2G83A 1KOFA 1VCOA 5JECA 3BFVA 3IUYA 1YVDA 2GCNA 4LOAA 3EARA 2GXQA 4Q1BA 4XSHA 2CBZA 1KO8A 4PZYA 1DEKA 4XSGA 1E2DA 2J59A 6Q21A 4C0LA 4BLRA 2QP4A 2XSZA 4CT4B 2PX0A 2FV8A 2IS2A 3KX2A 1MABB 2I1VB 4DZZA 4JLAA 3NDPA 4PZZA 4H9GA 2QRZA 1HEIA 5DHFA 3ADBA 2A5JA 1GILA 2O0KA 1FMLA 4HZUA 4I1SA 3TAUA 3AGPA 2ZRIA 2ONKA 5DNYB 2QENA 4EIWA 1FP6A 1YZGA 3DM9B 1NN0A 2Y8EA 1E2GA 2ATXA 2HYIC 4Q47A 3AF1A 2V7QD 3UANA 2ZRGA 3E70C 4ZDKA 3LA6A 4XH9B 2EFEB 4IXNA 3QXSA 3FHCB 1LF0A 1EX7A 1ZUHA 3GFTA 4KBGA 1KIMA 2YNMA 2B92A 5JI2E 2CNWD 2JEOA 4Q7KA 1NMYA 4G5OA 2FZ4A 4Q66C 4TWZA 2BEKA 3GLHB 3DO6A 2NO1A 2VF7A 3B1VA 4IFBA 4P4SB 1ZNXA 5FOSA 4MRSA 3HWSA 1ZIPA 4C0QC 4HAUA 1T8TA 2FU5C 2QGZA 2QROA 1TAGA 1GL7A 1NY6A 5DI3B 3SU8A 4FCWA 2QBYB 4RD6A 4BLPA 2RGBA 3LX8A 1Q1QA 3BC1A 1F3OA 1Q0UA 4XTRA 3HR8A 3KZ1E 2BM1A 5L8VA 4AIIA 4B32A 1P60A 1UBFA 2ZRCA 1T4GA 4F38A 3A4NA 4KFRA 3ZZ0A 4US2R 2VA8A 2R9VA 3KKPA 4G5QA 1QF9A 4CZ2A 1QG2A 4OQNA 2IXFA 4NCJA 4DWJA 1HUQA 3KDSE 1KI6B 1N6HA 2F3RA 3T5GA 5KPJA 4LBWA 1IM2A 1P4SA 4BUJA 2LCFA 3X1ZA 4Q21A 4V02A 1MR3F 2QM8A 3CNNA 4AYTA 2RHMA 4OI0A 2RB4A 4TQ9A 2CHVA 3RYTC 1DADA 4JYBA 2V1UA 1M7HA 1KKMA 5H1YA 1HH4A 1G8FA 1GWNA 3ASYA 2NZJA 2OO7A 4A8JB 5JFGA 1BIFA 4JBXA 1OH6A 4BPBA 1ZM9A 4Q9IA 4BASA 2C8VA 2BDTA 1JAHA 3AH8A 4ILEA 4PO8A 1ZU5A 4JL5A 4MDFA 5KNCA 1GNPA 2ZE5A 3A8TA 3U5ZB 2AWOA 2RH5A 4Y0VA 3LNCA 3QI2A 2DFLA 4KLZA 3ZVRA 1D9ZA 3LVQE 3WP0A 3B1YA 3SR0A 4DJTA 1P2UA 2V4ZA 4LSGA 1EFHA 4XJXA 3DVLA 2GJAA 2Z6VA 1OXUA 1DAGA 2ODBA 4MRVA 2GVZC 2OXCA 5BW8A 2O8EB 3U7EB 2AXNA 3QJYA 4GZMA 2Q3FA 5CLQA 4A82A 3C7KA 3IO3A 3IQWA 4QJ3A 4AC9A 2IYUA 1RPZA 3AVVA 4KSBA 2AKYA 3K0FA 1WBDA 3QKRA 2CCKA 2PZEA 1QHNA 4DT1A 3GJ8A 1SXJE 1Z0IA 1OF1A 2XOKD 3SOPA 1P75A 2C9CA 1BOFA 1P9RA 1Z6AA 1T9HA 4Q9LA 1NIJA 1DO2A 3VR3A 2WAXA 2F43A 3K9LA 2ATVA 1FNNA 3CPJB 2DFTA 1XJCA 2G0NA 2GF9A 4TMVA 3FKSA 5KNDA 2ZRLA 3L8ZA 3NHBA 2XNSA 1KYIA 1DO0A 2IYLD 3X1DA 4EAQA 2OV2A 4BLTA 1O3YA 1TTTA 2FOLA 4BGDA 3SYLA 3CBQA 2REXB 1Z83A 2B8TA 4A0GA 2E9SA 3B60A 4LBYA 3HP1A 2DFKB 1YZQA 2P2LA 4W7SA 5SZKB 4C0JA 1NRJB 1W4BA 1E98A 2BMFA 4PAQA 4W5JA 3ZS9A 4DLRA 3RABA 1OH5A 3VKGA 4QNMA 2RKOA 3CRRA 2QMEA 4IRUB 1TF7A 2QG6A 1FL9A 1TQDA 2ZR9A 3LRPA 3BB4A 3CM0A 2UZIR 4Q1FA 3T35A 3EPJA 1JALA 1AS2A 2H5EA 2PMKA 4IVRA 4U00A 3H1TA 1UF9A 4PSKA 3MJRA 2OCAA 1UKYA 1JQLB 4QG7A 1BKDR 3B13B 5FFMA 1SHZA 3NVAA 2ZRHA 2WMOB 1E0KA 3IIMA 3KUCA 2C03A 2GBLC 3KKQA 4NYIR 3EC2A 1JPJA 2VP0A 5TV2A 3W8RA 3ADDA 1CF4A 2D2FA 2SHKA 3PQCA 4WXRA 3CX8A 2Q9CA 2ZQ5A 4M21A 4Z8YA 1DARA 5FUXA 3KL4A 5AWFC 2C9YA 1AGRA 2A5FA 1U0LA 3GJ0A 2H18A 2QEQA 1N6PA 5L3QB 4M22A 4QHYA 4RKFA 1SVWA 4M9ZA 4YONB 1ZMXA 4B2LA 1N6LA 4DBLC 4DSUA 1G4UR 2NOAA 3KQKA 4KFSA 3TE6A 4C7OA 2NO7A 2FN4A 721PA 4P33A 1Z5ZA 3VNUA 4MGZR 4URWR 2GBLA 1U8YA 2RAPA 3OF5A 3RS0A 3R7WB 4C3ZA 1W44A 2VH5R 4DB2A 4GOKA 5FUVA 1FUUA 2N42A 4D82A 5KUTA 1DTSA 3JVUA 5CM8B 3NIBA 1ODFA 1PLKA 1XJQA 2A5GA 4JVMA 2NTYC 3H2YA 2CL0X 5KU1A 5EP2A 4HSEA 3QF4A 5LD2C 1FW6A 3I62A 4P4UA 5KPDA 4TL6A 4R71A 1HT2E 4EPRA 3PITA 2BCJQ 4I4LA 2GTPA 1W2HA 2WICA 3VR2A 2GXAA 3EPKA 4NYJQ 1NVUQ 2TMKA 2N1BA 5EP1A 4HAYA 4KU4A 1CJMA 1GRQA 5K8IA 3AQ4A 4HAZA 3K9GA 3WNDA 1RZ3A 2JATA 4JLKA 4QJ4A 5AUPB 1SVOA 3LW8A 3BK7A 1PUJA 2X19A 1ETUA 3AB3A 4D2IA 2EU8A 4IDHA 3LD9A 2CHGA 5HKKD 3P4YA 3QBTA 3RANA 1G8YA 4P31A 5BQ5A 3UATA 2ZI3A 4AD8A 2CL7X 3B6EA 3HU2A 4G5GA 4J0QA 3THXA 4CEIA 3RC8A 2JLQA 3MWJA 5SZJA 3IO5A 1T5LA 2AR7A 2C5LA 1NBME 1NN3A 4UNPA 4YMUA 4L4UA 3CF0A 5JJKA 1OXTA 2WWIA 2XNDA 1XZQA 3D31A 2XX3A 4FN5A 4LJYA 4TYWA 5EP3A 1ZD1A 2WJVA 3ECCA 1US8A 2HF8A 2BV3A 3RLFA 1J70A 2G3YA 2QY9A 3MG9A 5FOUA 2WV9A 4AKEA 4CIDA 4D80A 5AUNB 4BZXA 2PJZA 1IQPA 2GRJA 1J7KA 2J46A 2KJQA 2VTKA 2WSSA 2ZS8A 1CP2A 4EPVA 1T0HB 2FPLA 1IN8A 1PZNA 2DR3A 5JLJA 5KYKA 4B71A 4B43A 4LK2A 4TT3A 3GJ7A 1YHNA 1SKYE 3T1VA 3U3RA 4CDGA 3GLFE 1EX6A 4ZIRA 5A4JA 5J47A 3VU9B 2O8DA 1QVRA 1E4VA 1DAIA 2OFWA 4OQLA 1KK1A 2W2XA 2VHCA 3BB3A 3THYA 1NSFA 3L0IB 4Q5IA 3V4RA 4N0DA 1Z47A 5B58C 1XU4A 3NBZC 3P20A 1JXMA 5HE8A 2KWIA 2IW3A 4Q4HA 5D3QA 2EW1A 3IPXA 5C2JB 1QHYA 4C9BA 1KK0A 4Z1MA 1DAEA 4Q7JB 4HB3A 1ESNA 2P3SA 2BJWA 4EJSB 2AN9A 4EKDA 1G17A 2NZ8A 5FPTA 1E94E 3BERA 4BFUA 3ZGXA 3PEYA 4EFNA 2ZJBA 2CMKA 4KV9A 3FVQA 1YZUA 3P4XA 5FR1A 3ZQ6A 3IBGA 1KKLA 1JR6A 2QUZA 1D9XA 4OHWA 3TQCA 1C9KA 1TL7C 4B34A 2ZUBA 5FBRB 4C0BA 2HXSA 4NH0A 3K09C 1V5WA 2O0HA 1XTQA 4TQAA 1OT3A 2ZJ5A 3OEHD 1Q57A 2YWHA 3QIAA 3PXGA 4QC2A 4KBFA 1W36C 2X2FA 5EE9A 2V9PA 4NZYA 1SZPA 3K53A 3NWJA 3QXHA 3WHKA 3KKOA 3GLHE 4Q1EA 1E9EA 3T1OA 2IYTA 1XTRA 3IHWA 2W6JA 5IK2A 2EFDB 1W7AA 1FX0A 2GJKA 2ANBA 3PV0A 4UNSA 2CJWB 4HLUC 4PXAA 1G5TA 3IIJA 4PHHA 4XWKA 1AJEA 4G1UC 3K09A 4AK9A 4GPTA 4KODA 2EQBA 3F0TA 5BYKA 4E09A 4BECA 3J81k 2VP6A 5TY0A 4DRZA 2W00A 2RGEA 4M1KA 5DYGA 1ZBDA 5JWOA 4RFVA 5JRZA 1VG0B 1YJ5A 1SHKA 2P5SA 3E1SA 3NG1A 4JLVA 3WRXC 2WOOA 5GJWC 3WXMA 1FPMA 1KO4A 2PJRA 4RVCA 5KDOA 5F3WB 1P2SA 3SYNA 1G20E 3A1TA 5EE3A 1CIPA 1JR3A 5CJPA 3O8BA 2VPPA 1ELOA 1E79D 1N0WA 3AP2A 4HLUA 4F4CA 1OW3B 1G64A 2HLDD 5FBVB 2ZUCA 3KXKA 1U8AA 1ZUNB 2QI9C 2FSGA 1GTVA 1OPXA 2F9LA 2QTFA 3OIUA 3I61A 4GDFA 2VBCA 1U9IC 3SBDA 2JJ2D 2CEAA 2YOGA 4RFSA 1KSFX 2OLJA 2ZEJA 1AS0A 2ZRAA 1SXJB 4NCHA 5CYOA 3RRYA 3T34A 4N3NA 4UNRA 3WMGA 3EZ9A 4O0MA 3B1XA 3NBYC 3T1QA 1KNXA 5UKDA 3AVUA 4LJ8A 3N2EA 4E07A 3K70B 1W0KD 3L82B 2GAOA 4WOPA 2CDNA 3HR7A 3CW2A 1G3MA 1WE2A 3KTAB 2FDCA 4GT1A 5F9HA 1COWD 5D3MB 4NYMQ 4PQRA 4Q4JB 4ESVA 1MKYA 2NQ2C 1JBKA 3L8YA 1VG1A 2A78A 1GL6A 4DVGA 1DAHA 1U9IA 2BEJA 3OHMA 3H84A 1LF5A 4MYHA 2GHIA 2WHXA 4UQOA 4D81A 5EE0A 4X8LA 2IEYA 2QP3A 3OAAD 2OILA 3QKSA 5J4YA 2ZROA 4TL8A 1R0ZA 1XXHE 5LBIA 3LBNA 3ZDQA 2GETA 5EXXA 2YYZA 2O8CB 3DHWC 4F4JA 2CHQA 3MFYA 5C4MA 1Z6TA 5KSZA 2IUSA 5KDDA 2FFHA 5H68A 5FTJA 3EPLA 2IYZA 4YXWA 3SJAA 1FOEB 1LVGA 3G5UA 1HV8A 3PEVA 3R9IA 1Z6GA 1UBGA 1X8KA 2HCBA 4YMTA 2DYKA 4OQFA 3PEWA 1RC8A 3NXSA 3PR1A 1FUKA 2A7QA 4WA7A 5DYIA 5JS7A 4GL2A 1P72A 3AP1A 1Z63A 5GJCA 1XMVA 3PUVA 3FHOA 3FOZA 2QRNA 3QKTA 1BMFA 1NLFA 4M1TA 4DUGA 1KY2A 1YZTA 3M6AA 3R8CA 2UKDA 5FUWA 2VHQA 4RZ2A 1X86B 3HPRA 4ZCIA 3MGCA 1IN5A 4AY2A 1E9CA 4ACAA 2ERYA 4CYMA 1R4AA 2BWJA 4I1VA 1M1YE 4OQXA 4CT5A 5B30A 5FI0B 5B57C 4PSVA 1FP7A 1JEEA 3CKLA 4WBSA 2EYQA 1W2GA 3EASA 1U0HC 4A1FA 4EQ6B 1NP6A 4AI6A 1A1VA 1TF2A 1P3JA 2VF8A 1E69A 1DBSA 1EFRA 1UEJA 2KB0A 2WJJA 1Q3HA 3SDZA 3TKLA 1FQKA 4PAOA 5J5CA 4JLNA 3W5IA 1NIPA 1HQYE 2OHFA 4YDHB 4JKIA 4O25A 2KBFA 1EGAA 2CK3A 1DAFA 2YV5A 3VR4A 5TARA 3SI7A 5FPHA 3OIYA 3K1JA 1D2NA 5E4FA 1X1RA 4LBVA 5CB8A 2H16A 4PPFA 4RCZA 5IF9A 4DLUA 2NO9A 2OFOA 3K9NA 2ZETA 3LBIA 3B5JA 1F48A 3E2IA 3QPVA 4PPNA 3PUXA 2C96A 1X8JA 3UWKA 3QY0A 4B44A 1SULA 1SVKA 1XF9A 1PV4A 1NMZA 2JLRA 2A9KA 5FR2A 1BH2A 1HE1C 2QT0A 2IT1A 4LBZA 4M0LA 3THWA 2MSEB 5G41A 1SVMA 3SN6A 2R44A 3GQBA 2GCOA 1N0VC 1GFIA 1S9DA 1XDBA 1XCMA 4B3FX 3GFPA 2EVWX 1XTSA 1P62B 1GKYA 2ZRPA 3OEED 3I5XA 4BEBA 1GL9B 5E7IA 3WNBA 2BVNA 1S96A 2ZE7A 2HT6A 4OI4A 1IN7A 3BXZA 5BXQC 2WWHA 3C41J 2HJGA 3LW7A 2IS6A 3D3QA 2NGRA 2QP9X 2R6AA 3K9HA 4JT4A 2WWWA 1JQJC 1KJWA 1FTNA 1Z0AA 4TTQA 1KZGB 5DE3A 1UBCA 1IY0A 3MD0A 2YWFA 4HAXA 4Q9KA 4DDUA 2OAP1 3N5CA 2ZRNA 1AM4D 1NBMA 2C04A 4LHWA 4ON9A 4JJKA 4US1R 2O8FB 2PCJA 1KI8A 1KO1A 4WW0A 4DXAA 4HEJA 1W5TA 1OKKA 3RRZA 2JAQA 3QQ5A 2WKQA 1XWIA 4MKHA 3ZD7A 1N5KA 3A1UA 3ZVLA 4R7ZA 2C78A 1DS6A 5ANRB 4KFTA 4DB4A 4LJ6A 3BD9A 4P32A 2WJYA 1KDPA 3MJHA 1OFTA 3CRMA 4DEYA 5HR5A 4HAWA 5FTKA 4LX0A 2IK8A 4UXJA 1GIAA 1UADA 5L3SB 3AF2A 5E95A 3GLFA 1Q3TA 2RGXA 4ZCMA 1C4OA 2BKUA 4ZI2A 1YE8A 3PUYA 1E2PA 1ZNYA 4LYFA 5EZ6B 3RS5A 1XPRA 4M1OA 2ZE6A 4FI3C 3U60B 3PENA 2P67A 4DLYA 4YDSA 2WIBA 3UG7A 3O47A 3KQLA 3FTQA 2YOHA 3AVWA 5DSZA 3THOA 3U4QB 1NL3A 1Z0JA 1U98A 4D4MA 3DKPA 1L2TA 3QXJA 1KK3A 3B85A 4MRPA 1E1RD 1OHHD 3H4MA 2R2AA 1Z0KA 5EUMA 2W6IA 2B8WA 2WAYA 1MABA 3B8HA 1KI4A 1P2TA 1KSGA 3FMPB 4TMTA 1UDXA 4DSTA 1S1CA 1E4YA 1MH1A 1N3BA 1UM8A 1E99A 3A4MA 5EUQB 2QQEA 3M4YA 2H8KA 3KJIA 4OHXA 3EC1A 4R9UC 2RMKA 3UMRA 2RGDA 5CK5A 1S1MA 3TNFA 2WTUA 1N2CE 1IY1A 1NN5A 1KI3A 3OFND 4NYIQ 2Z83A 4M9SA 1S8FA 3PIRA 4ITRC 4X8HA 5LPNA 2GK6A 3DOFA 5BN4A 5JBQA 3GLHA 1UAAA 2IYYA 2IYVA 3RRMA 1Z6YA 1HT1E 2LKDA 4P4SA 2GXSA 1II8B 1XTKA 1UBEA 1XRJA 2XITA 1OIVA 3KB1A 4I99A 4AG5A 1G3QA 2QM7A 4DDWA 1IN6A 3CR7A 1G18A 2ODEA 1W0JD 1XTIA 3QVUA 3O8DA 5DI3A 4A2PA 2J1LA 5K8UA 4FMDB 4GMXA 3BAFA 4DLWA 1F2UA 4WZAE 2QBYA 2CLDX 1R7RA 4MKGA 3VX3A 4G01B 4JS0A 1E6CA 4HATA 2J0UB 3KKMA 4A8JC 3ZQJA 4PANA 2XSZD 1GKUB 5CK4A 4Z54A 5LB4A 1JNYA 2ERXA 4CEJB 4KHZA 2NPIA 4QBFA 4TYPA 2GKSA 2QSYA 4FMDF 2ZIAA 3CZPA 2G0TA 2AHOA 1G16A 3T06B 1K5GA 3PVSA 3QPWA 1Q1BA 5FOWA 1KI6A 2F1RA 4DLTA 1G291 3UKDA 2OT3B 3SFZA 3VHXA 4LJAA 4M1SA 3VQTA 1XCPA 2ZREA 4Q4AB 3GP8A 1F60A 2H92A 1N5LA 3REGA 1VYTA 3GD7A 4AKGA 3TR0A 4A8JA 3A58B 5KOYA 3AV0B 5EXSA 2RGGA 4US0R 2B6HA 5J4LA 1H8EA 1D2EA 5LDDC 4FXPA 1CLUA 1GOTA 3EG5A 1DPFA 1VKJA 2JLVA 2K5UA 1VCMA 4ZKEA 3LDAA 2P0EA 2JIZA 2VO1A 3AKDA 4Q7LA 2CXXA 4DCUA 4QBGB 2ZSBA 1XXHB 3Q9LA 4UKDA 2OAQ1 3TUIC 4JL8A 3ZVNA 1Z06A 2W2VA 2IYXA 4MYTA 1NSTA 2ZAOA 1MO3A 4PFSA 2VHUA 1B0UA 2QU8A 2HEIA 1Z6XA 4TLCA 4Q9HA 4OHZA 2ZI6A 2O8EA 3BB1A 3TSZA 3WNCA 3I1FA 3L43A 4B3GA 1EWQA 4OBEA 1KDTA 3DOEA 3CUEF 4GSYA 1U81A 3CONA 4V0NA 3QE0A 2EFHB 1KI9A 4JLDA 5G3YA 3CRVA 1RRCA 4Q01A 4JVSB 3IBYA 1XNJA 3U44B 3KJEA 2GZDA 1JEDA 2FE4A 2V54A 3EA0A 5HCIA 1LS1A 4FW9A 1GITA 1W5SA 1OLOA 1OFIA 3CWZA 4HLQB 521PA 2BKEA 1DOAA 5JSZB 1E9RA 1N0UA 2WWFA 3HJNA 1ZM4A 4FIDA 4A6XA 5HZKA 4C4PA 4F91B 2RGAA 1G3IA 2O8BB 4Y0AA 3K0SA 2GK7A 1UEIA 3BFKA 5H70A 2GESA 4QRHA 3RHFA 4FD2A 1SVSA 4PTLA 4R2IA 3VAAA 1AGPA 2ZSFA 4IOJA 2JA1A 1Z29A 1VIYA 3FWYA 1N25A 1OXSC 1QRAA 1MRNA 2W0SA 4XD7A 1A2KC 3U3MA 2EFCB 2OBNA 2ZU6A 2XAUA 1PLJA 3NEJA 2GXUA 3AGQA 1R8QA 1NVVR 1NY5A 2VP2A 2Z4SA 3QF7A 4JBWA 4URZR 3T15A 4HLCA 2D3WA 3GLIE 2CL6X 2J7PA 1TQ4A 4JKYA 1YZKA 1RRGA 2MMCA 1Q21A 3BH0A 1PJRA 2VRWA 5EP4A 5CIWA 4MGKR 2E87A 1EFCA 5ELXA 4MYUA 5AR1A 1RVDA 1W4CA 1G7RA 1OYYA 2KE5A 3FFBA 3L0SA 4LRWA 1QVAA 4PC3A 3CNOA 4QBIA 3V00A 2XXAB 3Q7PA 4LJ5A 3SJZA 3FMIA 2CE7A 2FGKA 2GAAA 4NCNA 5HCNA 1VHLA 4ZI3A 1A5TA 4JVLA 2JASA 4V0KA 4JSTA 1H8HA 3GLGB 1XBTA 2B7CA 4XWAA 1IOZA 2CVFA 2GJSA 3NBXX 4MQBA 1KDRA 3ND9A 1FNMA 1FZQA 2PLRA 5EXPA 5G40A 2P6UA 3SJBA 3UMSA 1ZM3A 3ETLA 1AKEA 3NHAA 1DG3A 1Z08A 4LPKA 3VR5A 1JAIA 3FB4A 1OYWA 1VG8A 1DAMA 3FKSD 2V6IA 2YVUA 1UKZA 4A0FA 1HQCA 1ZC3A 1JJ7A 1XPOA 4LHXA 5L3QA 4HB2A 5JEDA 3TRFA 2BJVA 4OI1A 5FOTA 1G1MA 2ZRKA 2ZYWX 1OIWA 3CWQA 1ZNZA 2NPFA 3SHWA 4EDHA 2G9NA 2WMNB 3CF2A 4NPHA 4D4LA 5GVSA 1GNRA 1MOZA 2I3BA 3IQXA 4HDQB 1M8PA 3DZDA 1G3RA 4PAMA 4GI7A 3R7WA 5J4VA 3CX7A 4QL3A 1S0UA 4O3MA 2GEDA 4OKSA 4M8NE 3QXXA 1NKTA 3FE2A 3FFAA 2FPKA 4P3YA 621PA 2VHJA 4Z8XA 5JI3E 2ZRMA 4HUQB 3MRSA 4PHTA 3EPHA 1G6HA 3VKHA 1BS1A 1Z0FA 3SNHA 1UDWA 2HDNB 2WJHA 2NMVA 1E9SA 1TEXA 3EAQA 2FZLA 2D06A 2H17A 1KMHB 3TJZA 2REBA 1VECA 1Z3IX 3A1SA 1MV5A 4QXAA 5DN6A 3T1TA 5JCZA 1E2KA 2F3TA 1YRBA 4B73A 4DHEA 4MRNA 1VDZA 4D26A 3CPEA 4G3XA 5DISB 4KCGA 2QN6A 3A4LA 4RKEA 4DCNA 3AF0A 1UKEA 3IILA 3R20A 4B2PA 4PPQA 4I81A 1A2BA 3LWNA 1GZSA 2EWVA 4OQMA 1X6VA 3VR1A 1E2LA 4AG6A 4KYUA 2AL7A 2MSCB 4MGYR 4R98A 3U3JA 3X1YA 3ZD6A 1Q44A 2O52A 1SQ5A 4WVFA 1UPTA 4IOKA 5KNBA 3I8SA 2JGNA 4TL7A 2ZJ2A 4GFDA 2CCGA 4MDEA 1BYUA 3TQFA 2KBEA 1IJFA 1ZD8A 3TK1A 2BM0A 1QDEA 2QPOA 1EWRA 4EJSC 2JDIA 4I1OA 4GP6A 3D7MA 4LWZA 4Q02A 2QMOA 2QE7A 3CNLA 4L9SA 5E7JA 3B7GA 3TBKA 3VU9A 1GG2A 1JJVA 5EQTA 2O5VA 1R0WA 1ZYUA 3RNLA 3SQWA 3ND8A 2RHDA 1P61B 2VHTA 3C8UA 5CJ2A 2AD5A 3MWKA 1HYQA 4QHTA 2ZPTX 3LXXA 2YINC 1ZINA 4CF7A 1H65A 1TUIA 1E2NA 3B82A 2AD1A 2QTVB 3NH9A 3LO5A 2YKGA 4XOIA 3ZH9B 2IYRA 1KNQA 4TSFA 1WP9A 5FBLB 3VNVA 4IKEA 2J41A 1KI1A 3AVPA 2C98A 2ORVA 4RD3A 3ZIAA 1OE0A 1ZW6A 4V0LA 4D0GA 3QG1A 4EJSA 2GCPA 4LYJA 1IONA 1W46A 2ZJZA 2DBYA 3AVOA 3C5HA 5CITA 3CIOA 3K0AB 3ZVMA 5J40A 5K8TA 1KAGA 1XCGB 2A5DA 4ZCLA 4BWYA 3V9PA 1I4DD 4H1UA 1RIFA 5FPSA 2Q0HA 4OHYA 4E5UA 3EXAA 1JPNA 3PG5A 4TTRA 1KTVA 2XNDD 5B2ZA 3SYKA 1GVNB 3AUXA 4S35A 3FMFA 2ZI7A 3RWMB 1XMIA 3RAPR 4DCTA 2WPDA 5FBQB 3P26A 4EFLA 3D6TB 5M04A 4A15A 1R5NA 1CBUA 2Q9BA 2ZI9A 1GDDA 2ZR7A 4M9QA 2WSSD 1KO5A 3HDTA 4HDCA 4GOJA 3X1WA 1WCV1 3KJGA 4KO8A 1P6XA 3EZ2A 4TT3D 1HY3A 3P1JA 1LS6A 1NJGA 2CJWA 1MO6A 3K8YA 3DMDA 1SVIA 3WRYC 1OJLA 2N46A 4I1UA 4HB4A 4BEJA 3W9YA 1VCIA 3PUWA 2FH5B 5FUYA 2WWXA 1IN4A 1CEEA 4GMDA 3MCAA 4LHZA 5GJBA 1QHHB 4ZV4A 4RD1A 3UG6A 4L9WA 2XB2A 4LCBA 5CM9C 2HXYA 5C46F 1WA5A 1SXJC 1QZXA 4TLAA 3LH5A 4Z1MD 3NKVA 3SHFA 2C95A 2NO6A 1XMJA 2ZI5A 3Q5DA 3K70C 1DAKA 2OEPA 2BCGY 5G53C 3KQNA 2IL1A 5KSOA 4IDNA 2VSXA 2Q3MA 4JSYA 4BZPA 1E0JA 1S2MA 4DCVA 2V3CC 4M1WA 1E2QA 1E1QA 2IYSA 4IJMA 4JZKA 1F2TB 5GJVC 4ASUA 3AKCA 1U99A 4FCVA 2XTMA 3Q5EA 3WP1B 1Y3AA 1G8PA 1G4AE 1XEXB 2HT1A 1SXJA 1KJYA 2Z43A 5HE9A 1XFAA 3QEOA 4IOLA 4ABYA 1TU3A 4TLDA 4PC6A 4QKQA 2VSOA 2OBLA 3F8TA 4GNKA 5FH9A 2PEZA 3OE7A 4DDVA 3BRWD 3FGNA 4IHQA 1E2JA 4O2RA 4Z51A 2WVJA 2IUTA 5AJWA 5JZVA 3NEYA 5FTLA 4CEHB 1XPUA 2DHRA 2W6JD 3QUSA 5IK2D 2X8AA 4DDTA 4A4DA 3TVDA 3PFIA 3KTAA 1X1SA 3LQQA 3AUYA 4RCYA 5TVKA 4KITB 4BFXA 5D3MA 3NDBB 2PT5A 2PZFA 5EE1A 4HZIA 4Q4JA 2IWRA 1YRAA 4UNNA 4G5RA 5IHPA 1P73A 1LNZA 4HAVA 5BWMA 4YQFA 4K8OA 3ZZUA 1OH8A 1W49A 4BFYA 5TDHA 1YR8A 2V1XA 4K81B 2F6RA 1X3SA 3QNUA 2ODWA 1CR2A 1VG9B 2FFBA 4U02A 1W36D 1DELA 3ZLJA 3BORA 1U0JA 5FPYA 4F92B 1G19A 1GNQA 5IDVA 2O8CA 1VHTA 3GLIB 2QL6A 3QKUA 3P27A 3A36A 4PQYA 2A5YB 1E2HA 1JR3D 2WJGA 2Z0MA 4QBHA 1FFHA 2OM2A 4NHOA 2FMXA 4L16A 3QPUA 4PSAA 5F2EA 3W6OA 4ARZB 1ZIOA 2IF0A 4QM7A 1QHXA 1XD2B 2XJ9A 2OE2A 3MLEA 2C77A 4AWXA 1NLZA 4AKHA 1TEVA 3R8FA 1N6IA 4RZ3A 2GNOA 2JJ1A 2PCLA 4TZ0A 4V03A 1ZAKA 4W5HA 4NCIA 4AKIA 1G7SA 1G8HA 4ZO4A 2YJTD 1XTJA 4RZUA 2P65A 4A36A 2HJVA 2XZPA 1J8MF 1RJ9B 2BMDA 1VCNA 4EUNA 3IGFA 1JECA 2YZ2A 3JZAA 3QOFA 5FL7A 3GPLA 3S1AB 3TSWA 2AXPA 1ZUIA 3CPHA 2VSFA 1G41A 2FF7A 2XB4A 3LFUA 4B6FA 4WIAA 5G3ZA 2ZYVX 3NTUA 4Q18A 3U7GA 5GVRA 2YWEA 4EQ6A 2IX3A 2E1RA 2HF9A 2F1JA 3OIVA 4OK3A 2QA5A 1UKVY 2EWWA 3HU1A 3JVVA 2WKRA 2ZS7A 4ZDIA 2RCNA 4BFZA 2ONJA 2D4HA 3RS3A 3SE0A 3G0HA 2D7CA 5TMPA 4D4KA 1DE0A 1RRPA 3F3YA 1I2DA 4D0LB 2G77B 4IDOA 3HYTA 2A3RA 2NG1A 2IS4A 5AUQA 1XEWX 1OV4A 2CE2X 4MH0R 2EYUA 3TW4A 4BFTA 5IRCD 4YXWD 3GLGE 3UPUA 4A0HA 5KO2A 2QAGC 3QVVA 4RY2A 4KI0A 4DSNA 1NVWQ 4D25A 1Y63A 3EZ6A 2ZE8A 1CRQA 4NCKA 2AFIE 2QPAA 4UNQA 1TMKA 3T61A 3AEZA 2GCOB 2VL7A 2YWGA 1AN0A 1BMFD 4B2IA 1TPZA 4DUGD 5A5GA 1JI0A 3CB4A 3LV8A 4TMKA 4FCTA 2WWYA 1HA3A 4BLOA 1N6KA 4A2QA 4OJKA 1XX6A 2W0MA 5E3HA 1E1RA 1TU4A 4FMBB 2P5TB 4RJLA 1E9AA 4C30A 1VIAA 2QAGA 3DKVA 2L0XA 3GJ4A 4WXPA 1DVRA 4RD4A 1CXZA 2V7QA 5EZ5A 4M1MA 3TUZC 2J45A 2P6RA 2CCJA 4FWTA 1NMXA 2PX3A 4B6EA 2W83A 2IXGA 5AJYA 5AJZA 4IEEA 1NG9A 1M34E 1KAOA 2ZRDA 2KI5A 2CNWA 2GEUA 1EFRD 3MWYW 3ADKA 4DIEA 3VHLB 2O8FA 1NG1A 3GJXC 3U6KA 1R10A 4RD0A 2IUUA 5JCPA 4Q1DA 1G6OA 2ZVQX 1R2QA 2F1IA 2CK3D 5BN5A 4C2UA 4JIMA 3TVTA 2DPXA 4MUBA 4DLZA 1ZRHA 2CLSA 1TQ6A 4OL0A 3EZFA 2P6NA 2R6DA 2GWHA 5JEEA 2FX3A 2QNRA 2R65A 3W90A 4C2TA 1NNEA 5HTKA 2D74A 3GCGA 3RSLA 3U3OA 3TGPA 4XTCS 1TX4B 1Z2AA 1PVOA 1PUIA 3DEFA 5L3SA 1CKEA 4OHVA 4LV6A 1TUEA 3BH6A 1KI2A 1G8GA 2ZR0A 3ASZA 1TF5A 2IEZA 2J0VA 1IBRA 4Q00A 1LV7A 5JWHA 3NC0C 1Z28A 421PA 1OB5A 4KAXA 4QNRA 4HZUB 3I4LA 1E3MA 2GF0A 3Q85A 1KK2A 4EPWA 3U4QA 2ZJAA 4DLVA 4LC0A 1U94A 1NVVQ 3AF4A 4BFWA 3U7HB 3FDIA 3K0CC 1I4TD 3A1VA 3BE4A 4E22A 2QSZA 3B2EA 1KSJA 1G21E 2A2ZA 3W3AA 1XJ0A 1XEFA 3X2SA 2GZAA 2UVQA 1QBKC 3I8XA 5HPYB 3TW8B 1N6NA 3KXLA 2AFHE 4YMWA 1MO4A 1S9HA 1NBMD 3RSOA 3H86A 1NN1A 1YZNA 4LJ7A 3BJIC 2OXRA 1KSHA 4MKIA 2R6GA 821PA 3WBJA 1A7JA 4B35A 1OKKD 1MT0A 1YU9A 3C4JA 4II7A 3W8NA 2GEVA 4P4TA 4KSCA 3LAWA 4TMZA 3W6NA 3LBHA 2PBRA 4YMVA 1YR9A 1CJKC 1N5JA 1S3GA 3K0CA 2VLIA 4M53A 2C9OA 4JVNA 3QEJA 1CJVC 4C0HA 1K8RA 4IDQA 3IEVA 3CH4B 3IIKA 3U2QA 4DLXA 2GVDC 3NBFA 4LDJA 1II8A 2YOFA 3UXMA 2R62A 4IOMA 3FPAA 4DSOA 4Q48A 3TAHA 4E03A 4TQUS 4NBSA 2ZYUX 2VP9A 1NI3A 1Z07A 2XOKA 2WSMA 2AWNA 2PZGA 3MUFA 1F2UB 5TXGA 4W9MC 1E2MA 2DFNA 1WMSA 1AIPA 4G0NA 3BOSA 1XMSA 2BBWA 4MUAA 3PJRA 4M2LA 3CLVA 1Z22A 3MAAC 1N5IA 4AYXA 2J0UA 2IYQA 2ZSDA 3WMEA 3TMKA 1G3UA 4CEJA 4GOXA 4AURA 2W6ID 4IFEA 2FEMA 4Q19A 4B75A 3SQXA 4RZXA 4LI0A 2F55A 2DWQA 3SJCA 4D4JA 2ASEA 1T0JB 4QGGA 5JHGB 1EFTA 1W1WA 5CLLA 3GJ3A 2VYFA 2QZ4A 3TLXA 3K0EA 4V0ME 4RD2A 2X1VA 3AP3A 1KDOA 3B9PA 2PT7A 1L4UA 4EPXA 4Q4AA 2BBSA 4Q1CA 3EWAA 1JR3E 3EIQA 1ESMA 4D6PA 3KUDA 1C1YA 3AVQA 4S2EA 4ESHA 4P0TA 1R8SA 2ECKA 1CU1A 2G1JA 1XP8A 1OXVA 1D5CA 3N70A 1E9DA 2W2TA 3Q72A 2OZEA 4K46A 2GA8A 1PLLA 4MYCA 1G9XA 1T5IA 4MGIR 3DZ8A 3W34A 2FNAA 2AK2A 3K0FB 3QKRB 2GZHA 1XXHA 4DT1B 5EE5B 4PQFA 4UJ3A 1E0AA 5BN3A 2FJUA 3T12A 3A37A 3FKQA 1ZVQA 1RRFA 2ZUDA 2WKPA 1CJTC 2Q21A 1P7CA 1WF3A 2IHYA 2X2EA 2F43B 2NO0A 2IHBA 1FTSA 1T6NA 1HTWA 3WYFA 1KMQA 1L4YA 1V43A 1ZD9A 4W5WA 3U3KA 2VP5A 5AK0A 2JCSA 5FI1B 2V6JA 1T3HA 1YKSA 2ZSAA 3H0KA 4JBYA 3KFVA 4JYCA 2H7VA 2HCJB 4BZQA 3U44A 2ZXUA 3CZQA 1OIXA 4YMSA 3Q7QA 4X8OA 3CRQA 5AJVB 3M0EA 3AM1A 1VYUA 1Q1ZA 3KXIA 1Z8FA 4TYQA 2UZ3A 5JSZA 1L8QA 4NP6A 3AKYA 2YC2C 3I3SR 2C99A 3I32A 2OLKA 3CR8A 1I2MA 3CO5A 4TMWA 1VMAA 3N2IA 3RWOA 2O8BA 1IY2A 4OI2A 4IDPA 2GDJA 1JB1A 2ZRJA 4RSGA 3VKWA 4WZBE 4B74A 1O87A 2WZQA 4DC9A 2QT1A 1F5NA 4CRWB 4KJZA 1X8LA 3KKNA 2QAJA 2IYWA 3E5HA 2DWOA 2PEYA 4TMXA 2H1LA 4ZKDA 2J0QA 1H8ED 1RYHA 4NMMA 1S3SA 2JIZD 2R8RA 1RKBA 2KSQA 5CYPA 3LLMA 4LHYA 3SEAA 3ICQB 1YQTA 1SKQA 2CVHA 4MRRA 3G82C 5HKKA 3FYHA 1Q22A 2AKAB 4B33A 3QENA 3I72A 3HPQA 1F6BA 4JL6A 3SC3A 1W4RA 2YHSA 3O8RA 1LW7A 3UMFA 4QGHA 2C2HA 1ZP6A 3RVBA 2XXAA 2DWPA 2ZVPX 3JZMA 5FOXA 2WM9B 1ZM2A 1XB2A 1ZU4A 4B47A 4C0AC 3R9XA 4B3CA 4C0SA 3GLGA 1EFUA 4C7OB 2ZJOA 3I5YA 3WBKA 4LUCA 1NJFA 5J4HA 1II0A 1HURA 4Q9JA 2FWRA 4X8MA 4LJ4A 2QTHA 3FMOB 1II9A 3RDPA 1WQ1R 4XWOA 4M1YA 4O2LA 4A0RA 4POAA 1Z2CA 1CULC 1RYFA 3GEHA 3QF4B 2OFXA 4XD7D 1YR7A 2J3EA 3IPYA 4TZ6A 4YC7A 2D7DA 2DY1A 3R9WA 3OZXA 4QFMA 2EFGA 3GMTA 4BFVA 1HE8B 2HYDA 4NU0A 1IXSB 1Q20A 1CR1A 2IC5A 3HU3A 1EXMA 1OFUX 1E96A 2XZLA 4URVR 1Q12A 4BE7B 1NVXQ 2J7PD 4URXR 3AVYA 4QOSA 4ACBA 4TN1A 3KQUA 1ZC4A 5CDFE 3O8CA 2QMUA 2QGNA 2QMHA 3GJ5A 4HUQA 3KFXA 2PMDA 2OG2A 1IAQA 1EK0A 3B1ZA 4UXHA 5C4GB 1EG7A 3TSOA 3THXB 1KZ7B 4CEIB 1ANKA 5LD2B 1KMHA 2VEDA 4H1VA 1N6OA 4MA4A
chains in the Genus database with same CATH superfamily
1GSHA 1KY3A 3PVCA 4NMXB 1Q0HA 2JK1A 4MVJF 1FXSA 3BS4A 2VT7A 3AZOA 5K8VA 4R68A 1GDTA 3R6LA 4E5MA 1R6AA 3IS3A 5A5EA 5ICGA 4FEGA 4PPGA 1K2WA 4REQA 1H8HD 1R0XA 3OEHA 2JA2A 3EIHA 5M3BA 3P45A 4PZLA 3QUQA 2GZ2A 1WU7A 5ALSA 2D00A 2Z04A 3EEIA 3CH5A 4UOEA 1E2BA 3GP5A 1WXHA 4YP5A 2WTAA 4WAUA 2OCBA 4JQOA 1CHDA 3KELA 1T1RA 3JYOA 3FNBA 5LZ5A 3JQGB 4IHAA 3V7NA 4LFAB 5LQMA 2I6UA 3Q41A 5DNDA 1KDYA 2XGJA 4LS3A 3WYBA 3RFVA 1GD1O 2K7FA 2IWHA 1LTQA 3HBJA 3RRFA 3UK6A 4RTNA 1BZYA 3ZBUA 3L79A 3TLKA 2OFFA 1BDHA 2OD2A 1UMCA 4FWIB 2BI7A 3LIIA 3THYB 3DEHA 3WJAA 5JH7B 4EW3A 3IODA 2J4CA 3PUZA 1KDZA 4XARA 1TMGE 2DHCA 4XKJA 4BC0A 4L76A 2AMFA 3DYVA 1H9AA 2BC9A 2ORIA 2PL3A 3SZ3A 4Q4HB 3VYWA 2XNKA 1NR1A 2PN1A 5HK8A 1HDXA 4DTCA 3QVTA 3AHEA 1CR4A 3GGJA 3HBLA 1GAJA 1ULAA 4Q9AA 5A04A 3ABOB 3ESQA 3VOAA 4LRUA 1K5DA 2GBPA 2IGTA 2Q99A 3G13A 2JHGA 2HIAA 1V3QE 2I1LA 3OPXA 5P8WA 5TQJA 5DM1A 3P0HA 1IUNA 1NJ8A 3FGPA 4N7RA 3GUVA 4IXWA 4U7TB 4MOWA 1B26A 5IDQA 2OAEA 2KYRA 1LB1B 4PX9A 2V8OA 5DRYA 1N0HA 3HY6A 1T91A 2X7JA 3H1GA 2V55B 3VU1A 3EZ7A 4CVNA 5JMOA 2AXEA 1MVNA 1JLKA 1Q1EA 2WV7A 3HHPA 3HY4A 2ZS9A 3CX6A 1AU9A 2E82A 1TOAA 2HA2A 2PKXA 2IXBA 4GQAA 2VF4X 1BMDA 3LLUA 4N6GA 3FDFA 3Q8XB 2I1QA 4RESA 4Z9XA 4E5DA 1Y6QA 2GFQA 4D0NA 1UXKA 1NE2A 4G36A 5K0BA 1GKKA 4NHEA 4UBLA 2Y2UA 4Z86A 2HRQA 4EPTA 3DLHA 3V8PA 4NAUA 4AL4A 4HRAA 3EGDB 2Q8PA 1OWOA 1G5PA 4B4UA 4BNIA 2G8LA 4IV5A 1ECJA 3L18A 4M4SA 4QGFA 4X63A 4UHJA 4XGRA 4JMPA 3CX3A 5EIBD 5ARCA 2H08A 3K9WA 3OF3A 1COWA 1CUZA 1QX3A 4WX2B 4L5BA 3X1XA 4AZ3B 4DCSA 2XTJA 1QHIA 3GELA 1CUHA 2VDOB 3OE1A 1KAEA 2P30A 3R7FA 2ADOA 1SD5A 4ZQIA 4PC7A 1NPYA 2Q3LA 3WGJA 2XF8A 2F48A 3X2EA 2Z2JA 5A4IS 5LXTF 4AMVA 3SICE 2BKXA 1T8YA 5AUOB 4P1ZA 5FL3A 3LOPA 1M6NA 2P6MA 2GA9A 2ZATA 3DPUA 3DYIA 1MC4A 1YCFA 3N7UA 1XKQA 2JLSA 3PGJA 4NKRA 1L5NA 4ZZ0A 3KQPA 3PVZA 1J2JA 2PMFA 3FTPA 4WINA 3HZRA 1X9GA 4MLCA 3I9MA 4K0RA 5TGTA 3W5SA 5JD4A 1GZ7A 1Z5NA 1E4OA 5CIYA 1BDIA 1EUQA 3F9CA 1I6KA 3STWA 3D3EA 4LXIA 5KYTA 3TSYA 1Z4LA 2GJ9A 4K6KA 3SZGA 1KZ9A 1PSWA 2WHRA 2NADA 3C39A 1S8AA 1S2DA 1PW5A 2WIJA 2ZBDA 3FSJX 3P5SA 1J25A 1D0SA 3IAS6 4JJEA 5CLHA 4AYWA 5BVGA 4V1CB 1KGDA 1U5BA 3AYZB 4REMA 3WXBA 3SEZA 2IH2A 3UIEA 4P4GA 3M49A 2JAUA 4TSFD 1E7SA 2I2WA 1P9WA 1U8UA 3HQ4O 4ME6A 1XTTA 5LP6B 1GRNA 4M9XA 3UJ7A 2ZTSA 1DC4A 2QN1A 2PH7A 1ORVA 2IDJA 2OCIA 2WSLA 4N0MA 4P5PA 4P81A 5B64A 1MU0A 1T34A 2CLMB 2QVZX 4Q4LA 1V1RB 2Q5OA 2BZ1A 2I29A 2W2LD 4ERNA 2FWMX 4Z2AA 4WT7A 4XVUA 3HJAA 3D6HA 1J09A 3L9WA 1MAVA 3F2IA 1V39A 3I0NA 2PX4A 1GP2A 3LCMA 2ZJYA 4M83A 1V47A 1A5AB 2H3HA 1AS3A 4Z2YA 2H1HA 2OCYC 2RAVA 1F2TA 3IUJA 3O6VA 1FRQA 1MRSA 4J1TC 3VKFA 1IXRC 3GL9A 3BRSA 5LZ9A 3OZEA 4LDNA 3HYRA 5AQ1A 1AQYA 1I30A 4ZEWA 4HX2A 3PZBA 3A6EA 1ZN7A 3AKEA 5AJXA 1LK5A 5CIQA 2EBHX 4U5XA 4Q82A 3EEBA 4DDMA 4GKKB 1BJRE 3LGSA 1V8PA 1HLDA 4NBWA 3ZY5A 2GQ0A 4XFJA 3V8QA 4I6GA 1USGA 2IZ7A 4BLVA 1WULS 4G5SA 3PNQA 5H16A 3NGMA 3TXXA 1JQ3A 2HA3A 2HJHA 2WU3A 1T5TA 2YFKA 4YLYA 3E27A 4JJ4A 2MYPA 2PZBA 3B7PA 1Y82A 4L8GA 2IGBA 4GYWA 1Z5UA 5F4BA 1DRUA 5ED0A 3ZDEA 2LDXA 4R9SA 1KMIY 3A6LA 3LLVA 3N3BC 4TKMA 3RVDA 2X6QA 4EF4A 4J1TA 1AKYA 1VSUA 1PE0A 1T8UA 2R6CA 1L4GA 3R09A 4JOSA 4MCAA 4R6WA 5AMXA 4BB9A 3SGLA 5B3KA 4F2HA 2Z6UA 1GYPA 1IBMB 3A6PC 2JLWA 2Z98A 4BXOA 2AOUB 5HM8A 1WWKA 2ONYA 1P77A 4DABA 4J0JA 4IO0A 3OM8A 4KNYA 3B6KA 1E77A 4UD2A 2X5KO 1U2RA 3QVMA 2D3TA 1KAMA 1Q50A 2XVZA 4TL9A 2HRZA 1U8ZA 5AT1A 1E5XA 5J4KA 1WB9A 1L7NA 1U0OC 1U80A 2EAUA 4K2AA 3RS2A 2Q1WA 1W30A 3TTWA 4DJDC 1EK5A 1M7GA 2B1QA 3DG9A 2D1FA 4RVOA 4N12A 4WDRA 2GD1O 5AKHA 3VNAA 1YAHA 3MXOA 3E8MA 1Z25A 3RPEA 1RHKA 1SGWA 2RHLA 3I8OA 4OK5A 1C3OB 4YAEA 3WHLA 2F9FA 2VF5X 5L3RA 4YUVA 4F8YA 4Z4QA 5JNWA 4EH1A 1VQ1A 3QBEA 4FSHA 4IMRA 2QN3A 4IQFA 2HIMA 4XQEA 2O2GA 1RWXA 4O4JF 2VTDA 3ZHXA 3E3LA 3M6UA 3U0VA 3ZJTA 3AF3A 3CLHA 5INTA 1YL7A 1B43A 2XUIA 2IXEA 4PU0A 4UVEA 2IV3A 2YHBA 4NBUA 5HM6A 2CMHA 2Q5EA 2RGNC 1G0NA 3WBFA 4F56A 5BSGA 3TIFA 1RJ9A 1NQWA 2VDKB 3UA3A 1KEZA 3BXFA 4B84A 2YJNA 1U31A 5DU2A 3EGIA 4KXVA 4FVTA 1YRHA 2M6RA 1FDOA 2XRMA 3NH6A 4Y2SA 5DM0A 3SYRA 1OTXA 2BHSA 2HF7A 4ZICA 1MB2A 3TLYA 3A3PA 4M6WA 4G6ZA 4HEA1 3R6GA 4KNVA 1FMJA 1UP6A 4B8YA 5TLSA 3JALA 1PNQA 2ANCA 5FTMA 3RAEC 1C7RA 1YQQA 4LDQA 2O7VA 2RHBA 4RMJA 5E7MA 1FRNA 1T4CA 3UJBA 3C5CA 4RKWA 4OAQA 5KOHB 3HZZA 5DNUA 1WQ3A 4URUR 2RGNA 1DQNA 1LBTA 2M9MA 3PNVA 4KJXA 4NDZA 2OHXA 4HAIA 3IP1A 4B4DA 4WZZA 3Q7EA 2A9OA 4E5KA 3TRKA 3BRQA 1J23A 1BO6A 3THWB 2UXDB 1MQ9A 2NW6A 2WABA 3PFNA 4KH1A 3T95A 4G56A 3DZFA 4MEJA 1BG6A 3KQHA 5ALUA 2YVKA 1A8SA 1CW2B 3GQBB 4EB6B 2BOVA 3P8ZA 1DL5A 4HNAA 2A94A 3MPOA 4OYYA 4Q03A 4R2LA 5FOVA 3JAKB 5DTQA 1J99A 1TVCA 4MKFA 2X0DA 3N5KA 4CNBA 1L7QA 3C3PA 5DH9A 1G8SA 4BNGA 1ZCAA 2WM3A 2PH1A 1TJ5A 3USES 1MB3A 2DC1A 1U90A 4NY1A 1OHHA 4JJ7A 1UINA 1UWLA 2ZUVA 3TUJC 3K6RA 5J2TB 3U6BA 1FXUA 3C24A 4LV5B 4R1SA 3V4VB 3RVKA 4BCDA 2EX1A 3H9QA 2NM0A 1VRWA 4IZ6A 4D6XA 2VEOA 2PGNA 3U4DA 1JLLA 4RY0A 3FLBA 1T3SA 1JIUA 3LY5A 2ODNA 3OE4A 4FT2A 2ZM5A 4PQGA 6PFKA 5EVCA 2JLZA 1U02A 3LYUA 2L82A 7MDHA 3D02A 3C16C 2W2MA 5K7SA 1A4XA 3NX4A 4BTVA 1YIDA 1ZCFA 2EF1A 1TRHA 2R8EA 2ZANA 3BWDD 3NVMB 3S99A 3OU7A 3VR4D 4UHKA 3SBEA 1V6SA 5B53A 3O2JA 4OHRA 3UYLA 2ZRBA 2C1EA 2VWQA 5CTAA 4ZI7A 4BY9E 3LE8A 1XWFA 4NE7A 3LX5A 2AQHA 5AM5A 3TZCA 4AFNA 4DG5A 1SUCA 2WJIA 3ROTA 1EMDA 1WDMA 3GJ6A 1MAWA 1PJAA 1QG4A 3GZNB 2V5VA 1OYVA 3I9OA 4UMDA 5FT9A 4KQGA 3T5DA 1QHSA 3RC3A 5JZBA 5I7WA 1E9BA 2HWYA 5KVQA 1NUQA 1I4LD 5B7PA 5BMVA 2H7XA 3IHLA 4INZA 2Z1NA 3ZX4A 2ZRQA 3GLFB 3MWLA 1OZGA 1BGWA 1PJLA 2JARA 5JMWA 1GUYA 2OCPA 2WYUA 4IW3B 4JOCA 3R76A 3H6GA 1M2OB 3B1WA 2XUOA 1ST3A 1UP4A 1KAHA 5F7OA 1H4QA 2FPMA 1PJ2A 1H5UA 2CFIA 1XVIA 1ECCA 2K6GA 2ZRFA 3RVPA 1VTKA 1RFGE 1BX3A 2OVFA 2YW2A 3FETA 2WF8A 4NEHB 3SZMA 1VCOA 3TRJA 4ZEVA 5A4FS 3U4MA 2X5JO 3BFVA 1KZ1A 2G0AA 2B98A 2X9VA 3SR3A 1FLNA 4I9GA 1J2EA 1DBWA 2GCNA 4LOAA 2GXQA 1H2FA 1KO8A 1W5EA 1DEKA 1QFMA 4FFDA 4YUWA 4RTOA 1K68A 4KE9A 2XCTB 1SCNE 3CIFA 2D1QA 5JS2A 1RT9A 2A92A 3EXEA 3KX2A 1FUYB 2WD7B 4O8CA 1OC4A 5CT8A 4JLAA 4EGFA 4PZZA 4MWCA 4H9GA 7REQA 4UE6A 1WAMA 1KKUA 4KRGA 1GILA 3I83A 1TC1A 2O0KA 4WE3A 5FA5A 2Z6AA 1NF8A 1Y6ZA 1PEDA 2NZYA 3F1KA 1KFEB 4Y6OA 2P3OA 1P7ZA 2ONKA 5EQFA 5FWDA 5DNYB 1PFYA 2FN8A 3FNIA 4PLZA 3FTCA 3HU5A 1GQSA 2ATXA 3K30A 3QLUC 1RBZA 5HRUA 2HYIC 5EZYB 1C7ZA 2VH2A 5DBEX 1TJ3A 4MZXA 3O82A 3UANA 2ZRGA 4CTNA 4NI5A 2IHKA 2XWQA 3QXSA 2IKQA 3RODA 2WF7A 1O95D 2BGMA 2NXCA 3GFTA 3RTDA 2B92A 3CUTA 5AQEA 3QE9Y 4W9RA 3PDIA 4YV7A 3EUFA 2G5TA 2P91A 4R81A 2NTVA 5AW9A 2FZ4A 3QVKA 3RQIA 5KJ6A 4B81A 4F9GA 5BN4B 4HN9A 5F1YA 1DOZA 3IAM6 4H7PA 4D3FA 2VF7A 1ZMTA 3TI7A 2I2CA 3BXHA 4P4SB 2O0MA 3DT9A 3VZQA 4X3OA 5LLTA 1ZIPA 2WT8A 4HAUA 3TOXA 5FFNA 1YWGO 1I3CA 1PBNA 3JARA 4I9FA 5FRDA 3GHYA 3T8YA 4AJIA 4C0XA 2X8JA 3QLUA 1SUPA 1GRCA 2HK9A 1RM4A 4C6TA 1NY6A 1PR3A 5DI3B 3HNOA 3G1TA 1SUSA 1LTKA 1ZVKA 3L05A 3D6NB 2WM8A 3LX8A 4I5DA 1F3OA 1WUHS 2C5SA 5EUCA 5JXHA 3DNFA 3DYBA 1Q0UA 1TO6A 3H2JA 3MT9A 4CR7A 1XRSB 4UZEA 2V4UA 3O93A 4C88A 3CZRA 3GFQA 2CNOA 9GPBA 1QLHA 4ETWA 1ZD2P 1UBFA 2YJGA 2ZRCA 1JZQA 2WMDA 1RI1A 2WYVA 1G20B 1WU8A 4KUEA 2VNKA 4B6OA 4US2R 2BEWB 4JP8A 3DTYA 2GYUA 4CZ2A 4DJJA 4TUYB 2BHNA 1Z7WA 1A98A 4S1VA 3KO8A 4FYPA 3HXMA 2YJZA 1USIA 1N6HA 1WNTA 1G6Q1 2GD2A 3T5GA 1PJCA 4LBWA 4PRKA 3ANSA 4FONA 3P9ZA 4BUJA 3B48A 3D8NA 3X1ZA 3N7AA 2XHZA 1MNQA 1MR3F 1EUCB 1KR5A 2DUJA 2CHVA 3FGOA 4Y9TA 4JYBA 3RYTC 2RI1A 1M7HA 1KKMA 4CI0B 4CIAA 5JAUA 3NT5A 4DXHA 4GGMX 3K6JA 4YAWA 2OO7A 2GZMA 3KPWA 5JFGA 2OCDA 4JBXA 2HU2A 1NLUA 4DANA 5CFMA 3N05A 1P1KA 4EKGA 3C3CA 3RVLA 1RM5A 3T7IA 5IN4A 2VAMA 3OZBA 3EFBA 3Q11A 2QJRA 1D5WA 1VCHA 4L4YA 4WKPA 1M6HA 4ECAA 1YL5A 2RH5A 4Y0VA 2OZLB 2ICAA 2DFLA 2YASA 1NLMA 3G79A 3PE6A 2JGAA 1D9ZA 3AY7A 3QTBA 3BICA 4L5CA 3G23A 4F6RA 2BFBA 1TYCA 3OFKA 4BJ3A 4J43A 3TTXA 2C2OA 4L78A 2A0KA 1OXUA 2PZKA 1KJJA 2QL5A 2ZP1A 2FDRA 3OTWA 5LDGA 3I0MA 4G2NA 2GVZC 3H8JA 3UUGA 1CUXA 2AXNA 2V45A 3IBFA 4Z9YA 3V48A 4A82A 4ZCRA 3C7KA 4HNVA 3OX1A 3DXYA 3EQ2A 4BVLA 4AC9A 2SBTA 4PCVA 2JVIA 4W6ZA 2H07A 5J1SB 4U7WA 3LHFA 4I8DA 5HQ3A 2PZEA 3R0XA 3BMQA 3GJ8A 1BE8A 1KETA 1A9OA 1OF1A 1C9NA 2DQZA 3E1KA 1C4KA 4QD3A 2IIBA 4LGVA 2XVXA 5HFJA 4GI3A 1Z4JA 1Z75A 2PIAA 2VI5A 3FF1A 3OQIB 2G63A 4IJVA 1BHJA 2CYBA 2F43A 2HHCA 3IAUA 4NMHA 4RU1A 4NJMA 5EHXA 4LOLA 5AI0A 5AVWA 1Z6ZA 3GCDA 2XXJA 3LTEA 4WL0A 2EDAA 1KTIA 2UZ1A 5KNDA 1RI4A 1OREA 4MWOA 1NYRA 1BXKA 2XNSA 4XDHA 2C1ZA 2QJFA 2PSEA 1DO0A 2IYLD 1FFYA 3KZXA 2MSNA 3CT6A 1CJBA 4REOA 1DAOA 1IM5A 2IOHA 5AVVA 1MIOA 3B3AA 4MNTA 3HVHA 3C3JA 1YR1A 1O3YA 4JODA 4ZOLB 4A7PA 1E6MA 3QWIA 4RHEA 3P9YA 1UOEA 1Z83A 2REXB 5D8DA 1AN9A 2E9SA 4CM9A 1KYVA 2G06A 1WOYA 2OY0A 3HSYA 4OFWA 4U2FA 4LBYA 4WOCA 3SHOA 1R9GA 3HP1A 3ZW7A 4YRFA 1U3DA 3DD1A 1YZQA 2Q8QA 2CUZA 4D8WA 1QP0A 2BH2A 2VK8A 5EMHA 3CTMA 2I6XA 2CMGA 4RZHA 3REOA 4A26A 3RVRA 2NTEA 4PAQA 4QAQA 4Y2HA 3RABA 3PQ4A 3I9V1 3QOYA 3T3PB 3VKGA 2RKOA 1X1DA 3CYFA 3O38A 1KP3A 3VHRA 1GGNA 3E18A 1UXOA 1KERA 4H3HB 2AA3A 3ASUA 2I2BA 4DCGA 1KYZA 3BTUA 2H5EA 2XLBA 4OF4A 5TQ2A 1ZKMA 1PDVA 1L6IA 1F14A 1KR2A 3IRUA 2G80A 3H1TA 1VSTA 2FLWA 5EHZA 2IVZA 5AM4A 2OCAA 2I2DA 5KYUA 5L4SA 5HCUA 1HT0A 3ILVA 2ZRHA 2OPHA 3IIMA 1RWWA 3KUCA 2V3VA 2VRCA 1JPJA 1DRVA 3IOYA 4MGEA 1JEOA 4DMKA 2CLLB 4Z9AA 4RTKA 1RNLA 3WRWA 3P9QA 1CE8B 2Q9CA 1FVOA 4CR6A 2ZQ5A 4M21A 2BJHA 4S2UA 4TXJA 2OMEA 1TVKA 1Z37A 2ZIXB 2QD1A 2YX1A 3ED1A 1P6UA 2FMKA 5AWFC 5T4FA 3FYTA 4F0JA 2K4MA 2C9YA 2D5CA 2H6EA 3WKAA 2H18A 3QLVC 2O1XA 5EG5A 1H4SA 4M22A 1SVWA 3DP9A 3KLBA 4D79A 1ZMXA 2PV0A 3ABZA 1H9BA 4KQJA 4YTEA 3KQKA 3OFVA 2R11A 5FUBA 1RQNA 1UIMA 2DKOA 4M3NA 3N3AC 3ICOA 3EVBA 1SK9A 1OMOA 2CJFA 3IKVA 1Z5ZA 3ZK8A 5MF6A 2GPTA 4GPEA 4JA0A 4MGZR 1B14A 1XQ1A 1CS0B 1EFVB 3DNPA 1VPTA 3OF5A 1VBKA 4XLTA 4NABA 2ZYDA 3HUUA 1U7TA 2IDZA 1W5FA 3UAXA 2IHZA 4V39A 3GMSA 3AJAA 3ZWMA 4NX2A 4MSUA 2JFGA 3N76A 5IABA 4C14A 1UC5B 2OC9A 4DR2B 1SC3A 2VJMB 1A9ZA 2A5GA 4ZOAA 3INTA 4MPRA 3H2YA 1BCRB 2BEVB 3QF4A 4TV8A 1PF7E 2OR3A 5LD2C 1T6YA 3QLVA 4P4UA 3ZCPA 1JNXX 1Y1KE 1D1PA 4I4LA 4ZTZB 1R4MA 2WICA 5ICCA 2GXAA 2GYVA 3DDOA 5C1IA 2TMKA 3EFOA 4N3AA 5EP1A 1T2AA 5I3CA 1PQ4A 5DMXA 4NENA 1TO1E 1NQTA 1XQVA 4KR9A 5K8IA 3T5AA 4QJ4A 1SVOA 3S44A 3UJ3X 3BK7A 3L46A 1ETUA 5F73A 1NMSA 1NI4A 4DXDA 3JQ8A 4MJ3A 4WBNB 5HKKD 3QBTA 1DWQA 2Q5HA 4PLTA 1G8AA 3GG2A 4F60A 5JCXA 1HFJA 3MJEA 1XZLA 4Y2UA 3SQDA 2X15A 1DIOB 2CL7X 3GZJA 4K86A 1L5KA 4CEIA 1BDMA 4CHGA 1NVKA 5SZJA 3IO5A 3DUWA 3K20A 2B8EA 3OZCA 4EHLA 1GTSA 3OPYI 1SIWA 3I37X 4UNPA 4W1RA 3UKJA 1HMYA 5DBIA 2XCOA 4L4UA 5JANA 1BC5A 1OXTA 3D31A 4YCDA 2W8ZA 4KAJA 4A27A 4TYWA 5EP3A 1ZD1A 4NU6A 1T0BA 3A4YA 1JSLA 3LDHA 3SY8A 4BX8A 4IKPA 2BV3A 3G0IA 4D80A 1J70A 2QY9A 3MG9A 1VE6A 3U4HA 4AKEA 4XEUA 5ICEA 5AUNB 1X7HA 2IHJA 1C0KA 3W2HA 4Z3KA 1AB5A 4CIWA 1J7KA 2H2HA 2WSSA 3L7MA 1CP2A 4ZVPA 1PZNA 1XAHA 1JJIA 2FPXA 2Q27A 3JZFA 3N8HA 3JQGA 1L3BA 2PIDA 2DKNA 3DS8A 1DT3A 5BQOA 2Z6QA 5AW1A 3OWHA 3VISA 3KZCA 4C4AA 4YRQA 5KC9A 1EX6A 1HL7A 5J47A 1T10A 3JQQA 3VU9B 4POOA 4FFBB 4I1PA 1VHQA 1QVRA 1UDAA 3B70A 1NOJA 1XRPA 4BVHA 1C5KA 1V0JA 1FFBA 1JRLA 1RYEA 2J48A 4QOFA 3UQYS 3ELYA 3THYA 4WGFA 4QAJA 1NSFA 5JH7A 3DNMA 3L6OO 4TN5A 4N0DA 1O5IA 3O7MA 1Z47A 2F3UA 2EJBA 2HO4A 3A27A 3CUUA 3P20A 1WZUA 3PC6A 1V6AA 3K16A 4IRXA 2C94A 4J8PA 2C2XA 3BF8A 3IPXA 3OA2A 4Q4HA 5D3QA 1YS4A 1KWGA 1L4BA 5AKIA 1PK7A 1QOQB 2OXFA 4HB3A 3HJFA 2P3SA 4MVJI 2GN2A 4FZVA 2AN9A 4PYLA 2B8JA 2GBFA 3PCXA 4XRRA 2NZ8A 3QU9A 1E94E 3BERA 4G65A 4O29A 1JFLA 1Q7TA 2EG9A 2FPWA 3HFRA 4NFYA 4YRPA 3SXUB 2CMKA 4KV9A 4X84A 5DBHX 4R40A 1OI7A 4RKRA 1YZHA 4U6SA 3WICA 3ILSA 2R96A 5CDHA 1R15A 3C45A 2ET6A 2ZUBA 2FWBA 5BWOA 1O03A 4IHJB 3TXAA 4DG9A 1NNEA 5K5EA 4R31A 2HXSA 2O3RA 4NH0A 1ZXLA 5CP8A 2JCVA 3VU8A 1V3VA 3HCWA 1V5WA 2ONCA 4C29A 5CVDA 3JD3A 1KVQA 3KT0A 3L84A 1T2VA 2ZJ5A 4BOYA 1KQ3A 1FA9A 1Q57A 2YXLA 3ER8A 3IV9A 3ROGA 2E7ZA 2WKWA 5KNBD 5HS6A 3OCWA 1GFZA 2G08A 3UAWA 3KYBA 3T9DA 2QVXX 1GVHA 1SZPA 3K53A 3NWJA 3WHKA 4BVFA 2ATEA 3E5RA 3ORYA 4WLNA 4DQ0A 2PKWA 1XTRA 3E61A 5FA8A 3EGDA 1EQUA 4UBJA 4X54A 2C5AA 3FNGA 4HVLA 1JI3A 1CUGA 3ZY3A 2CJWB 4ICIA 2WQ7A 5JNLA 4TVKA 3KJXA 2AZTA 4AZ3A 4AN1A 2QUJA 3EJ6A 1PQYA 3ENZA 1EIZA 4XWKA 4PHHA 1JSZA 5K51A 1IULA 2QUBA 1JX6A 5K6AC 3KLMX 4R3UC 4AK9A 4R9NA 2QB5A 4BV8A 2ES4A 4XFKA 5LP6C 3MWDA 2XOEA 2K2QB 4PNZA 1HLPA 1OXBB 5T5QA 5FHRA 2RGEA 3K4PA 4EHBA 2CWDA 3Q2KA 3MQFA 5C8XA 1YJ5A 2ERCA 3G88A 3NG1A 3WRXC 4DUPA 4EHAA 2WOOA 4JOBA 1Y7LA 1XAJA 1FPMA 1KO4A 1IU9A 2PJRA 1U2ZA 4CLDA 1YT5A 5F3WB 4I4IA 3KV1A 4N01A 3A1TA 5EFOA 4EM6A 3ZEAA 1DLIA 1QUFA 5HBGA 3GGDA 5JS1A 3EODA 5CJPA 2VPPA 2DPLA 1IWPB 3D0QA 5IDWA 1ORDA 1E79D 1N0WA 3U1TA 1ISGA 4V1CA 5E9AA 4JV5B 3T0GA 5K6AA 3FYCA 5JARA 1WSDA 4NC9A 5AH0A 1GU0A 1VIMA 3S8MA 1QP7A 2OBBA 4OXIA 1U8AA 1CUCA 2P2CA 3OIUA 1H94A 5AJUA 3VR6H 5LP6A 3I61A 4R9RA 1U9IC 3SBDA 1EVJA 4RVDA 1G2OA 2QLNA 2LR0A 4F46A 1VJCA 1AS0A 1V1RA 2BW0A 2ZRAA 3OU6A 4GX1A 3VR6D 3WRXA 4KQ2A 1FDIA 2ID8A 4N3NA 4UNRA 1TK2A 2BL4A 1N8TA 3BREA 3NC4A 3LQ1A 5ILGA 4O0MA 3WMGA 3WGUA 2H00A 4BE9A 4S1NA 5UKDA 1HYGA 4HPJB 4ZQBA 4GKVA 4RIFA 4BX3A 2IYNA 4G81A 2V58A 2XMQA 2AJDA 2EKQA 3AY3A 4FZ5A 3L82B 3GEBA 4JBLA 2Z1DA 5F9HA 2Z5GA 1RYYA 4NYMQ 3EWIA 1T3TA 3PC2A 1ZH8A 2NQ2C 3L8YA 4AO7A 1LVUA 4MCIA 1O9HA 2PH3A 4MW9A 1U9IA 4GL4A 3DKKA 1VRVA 2WHXA 4TMYA 5CT9A 5EE0A 2SKEA 3WBBA 1E6EA 3FNRA 3WWCA 5J4YA 2BR3A 1W9MA 1XXHE 2W5UA 4MUIA 3MLAA 2EKBA 1K97A 1CLEA 2YYZA 4L8YA 4F4JA 2CHQA 3IOCA 4A5SA 5KSZA 5KZMB 2IUSA 1G8MA 3E8XA 4MV1A 5LQSA 4KN5A 5JSFA 5KDDA 3EPLA 2ZDGA 1P4JA 3JRXA 2IYZA 3SSNA 4YXWA 4KR2A 1FOEB 4RV4A 3BILA 3CLSC 1PT6A 1C8BA 1JKJB 2AYXA 3KWJA 3D64A 2CXRA 3GFFA 4OQFA 2AOUA 5DT2A 3IUQA 2ZCVA 1D0IA 2W2OA 4IILA 5DYIA 2FKNA 3REQB 3V80A 2A0YA 3G6WA 3IE2A 3I09A 2FAXA 3IFSA 1P72A 4YP1A 1QHFA 3A31A 5ERXA 5GJCA 5D01A 4AY3A 1SB9A 1XMVA 5IJAA 3LC2O 4E1BA 4UTRA 4Z7QB 3PUVA 3FHOA 4YVFA 5C37A 1O6GA 4JI0B 3QKTA 2O7RA 4RMHA 3H1AA 2DKFA 4UATA 4ZT2A 1RBYA 5I9BA 2B0JA 2P6PA 2C84A 3M6AA 3R8CA 4EYKA 1QYWA 3DDUA 4UU1A 1O97D 4RZ2A 1C3OA 3MGCA 4AY2A 1UBOS 4GRIA 1KU0A 1L8AA 2A14A 3PJGA 4BX2A 1M2EA 3H42B 4EY5A 5LWQA 1EXDA 1ISSA 1MFPA 4I1VA 1M1YE 4OQXA 3DR5A 4RLFA 4CT5A 4NECA 4HMQA 1OX6A 5HSGA 4KWIA 4L6IA 4N65A 3V6LA 3IC5A 4BKRA 3TE7A 3T99A 1MVLA 1FXWA 2OMKA 4OIFA 4ZHQF 1WY5A 1LH0A 3PX7A 2A0FA 3EYWA 4P2BA 1FSSA 1ZMBA 3MCUA 5FQNA 3RUHA 2CV2A 3UZUA 1FJXA 4I08A 4QXRA 1B8OA 1A1VA 2DETA 5AJTA 2VF8A 2KB0A 1EFRA 1P5FA 3AWIA 3AM3A 3GB9A 3TKLA 4QATA 3SDZA 3W78A 5B1EA 5ITWA 3I1YA 3L0YA 5AOAA 4O25A 2KBFA 2VH1A 1DAFA 5IP5A 4GM0A 1D2NA 5E4FA 1X1RA 1ZOSA 5CB8A 4RCZA 5IF9A 4DLUA 2VZ0A 3ZXXA 1YE3A 3IR7A 1C3LA 4CKBB 5HKAA 1X70A 2OECA 2QL9A 3PUXA 3ML1A 5KOHA 1ZJWA 4O6VA 3OQVA 1SVKA 2A67A 1XF9A 3FPKA 3KC2A 4PZEA 4BVKA 1DIHA 1AE1A 3O3OB 2JLRA 3U9SA 3OOWA 1BH2A 4FFWA 1CUIA 1ESCA 3KUXA 4GR4A 3THSA 1ABBA 3THWA 1TA9A 3OX2A 4NMWA 1MHTA 4DA0A 3E9MA 2R44A 1KYYA 2II6A 1NHWA 3GQBA 4FDVA 1N0VC 4EB6A 2E37A 1XCMA 3CVWA 1XTSA 2XB8A 2ZRPA 1EP3B 3V5NA 2NUTB 3JAKA 4ATNA 4JGBA 4BEBA 1X39A 2QTZA 3F6SA 4B9AA 2BVNA 2HDOA 2SECE 5ALIA 4QYWA 1AO0A 5I8WA 2BR4A 2GARA 3EVCA 2XQVA 3TVYA 3DV2A 1NI5A 1QFYA 2HJGA 5EA2A 5J2TA 1T9CA 1SWWA 4BCBA 2VYND 2ZBQA 1QRRA 5EEHA 2WWWA 1MRZA 1V8DA 2X0IA 1RQ7A 1SU4A 4HK4A 4QTXA 5A1JA 1N77A 4QICA 2YWBA 1KZGB 1UBCA 1IY0A 2OGZA 3A9VA 3BCSA 2NV2B 4HAXA 2XE8A 4YRAA 5JCJD 2W42A 2GMWA 2D5BA 5KQGA 2C04A 1ZOLA 3LKVA 1F6WA 4I50B 3FUXA 2C7RA 4YAOA 1QWSA 3A9SA 5EKDA 3KHTA 3T3EA 1AG9A 3LKDA 2NV6A 3MJDA 3BT7A 2FJ0A 4ZALA 3AYXB 4K1XA 1CERA 3A9TA 4JYMA 3OJEA 3BMXA 1XWIA 1I51A 4BU1A 1EDEA 1D0VA 3LT2A 4JC5A 4HPWA 2C78A 1DS6A 2B9VA 4MP8A 3WGTA 5J1TB 3GRFA 3BD9A 3QFHA 3TM5A 3Q3HA 3GZNA 5HR5A 4DEYA 1RXUA 4HAWA 1P1RA 2DQKA 2GEJA 2WF5A 2A4MA 4KO4S 1KIFA 2VPIA 2I1WA 1GIAA 5DNVA 1LBIA 1UADA 1XQ6A 5AM1A 4LFCB 3JRNA 1VLVA 3AF2A 4C5BA 1HDIA 2DUNA 3U1BA 3GLFA 2PUGA 4CV2A 3EGXB 4CCAA 1C4OA 4YB8A 2YIMA 5IBRA 2CN1A 4ZI2A 4JR0A 3AT1A 3FWZA 4E7PA 3NYIA 2HMVA 5D7NA 3C8HA 3PUYA 3EF0A 4YV0A 1W5AA 4H7KA 3RS5A 1XPRA 2BI4A 3QX8A 5CW2A 2ETXA 3H4IA 1ZR2A 2XUGA 1R18A 3WGHA 1WBJB 3NBAA 5K6RA 1B73A 2YOHA 3EVGA 5DM4A 1CY7A 1P0QA 5DSZA 4LJRA 3O8NA 1NL3A 3U7QB 1XMXA 2YTZA 4N41A 2EGUA 2VDLB 1U2TA 1F1BA 3QXJA 3CPSA 1Z45A 1E1RD 3MIZA 3N2NA 1RZRA 3FCOA 3AV3A 5EWMB 3EGEA 3DW1X 4W5NA 4V38A 2PUCA 2NQTA 3EB9A 2WD7A 3HRIA 2B4KA 2R4TA 4TMTA 4UVHA 4DQLA 4EHHA 2XPCA 2P41A 1B00A 4DSTA 1S1CA 2AJCA 1E4YA 1JU4A 1U9ZA 5CUQA 1E99A 1XCBA 5AK3A 2IHVA 4BO5A 1K1EA 3SG0A 4DIOA 3W8FA 2QQEA 2E89A 4EVQA 3M4YA 4RTSA 5BRAA 3EC1A 2FP4B 4FI3F 5D00A 4FNAA 1BJKA 4OQPA 5JQGB 4BWGA 3IUSA 5K0NA 1OI2A 2QY6A 3KSRA 3D1LA 3KT3A 4WKGA 5EPUA 4K8RB 5GP1A 3TBFA 2RGDA 4MZDA 1CG6A 2IPXA 1S1MA 1T6BY 1QO0D 4Y6SA 1N2CE 4XUCA 4YJFB 2BHLA 4JC8A 2EFYA 3UJCA 3FLAA 2QZ9A 2NVWA 4QDOA 2LNDA 2Z83A 4YP0A 5LPNA 1S8FA 3ABSB 1PL8A 2WUFA 1WXEA 3DF7A 3EVNA 1LK0A 1K8ZB 3WLEA 5BN4A 5JBQA 4TV9A 4KQ9A 1ZGZA 3RRMA 1EXWA 1FQOA 1Z6YA 3MPUA 4ZQEA 4MHOA 1JG3A 4P4SA 2GXSA 4U7PB 1II8B 2HBYA 4X6XA 1XRJA 1GPKA 1RWNA 3DOCA 1MJHA 2QLTA 3KB1A 4I99A 4IDBA 3KOYA 1PNRA 2QRMA 5CMLA 3BIOA 4HQ0A 1GTRA 3CR7A 1G18A 3RYFB 1W0JD 4EGCB 3O8DA 3CKKA 3HADA 3N0TA 3BWYA 4QUDA 4XASA 5DI3A 4HH4A 4UM7A 3GBPA 3SIPA 1Z4PX 3A3YA 1QS0B 1V8BA 3KOXA 2FF5A 4CFZA 1FMFA 3P0EA 3MQ2A 2QRGA 3VX3A 4G01B 2PTHA 2QSJA 2B25A 4L5YA 3WK4A 1RSZA 1QU3A 4K6CA 5AVQA 3IV6A 1NXXA 2E4UA 3I12A 4LWPA 4CEJB 5LB4A 2BDEA 4LKRA 3AIKA 2NPIA 1U3GA 1KQNA 1G20A 4YCLA 4TYPA 2BEWA 4FMDF 1XRQA 1M2KA 2B4AA 1S2GA 2I3ZA 4TUYA 2WIDA 3T06B 2DU8A 5LQJA 1K5GA 3PVSA 3QPWA 1GAQA 1Q1BA 3BGOS 1DJOA 5C32A 2FQWA 1ZO8A 4FU0A 4DR3B 2R87A 1KBZA 3ZU4A 4DZRA 5B6PA 3EDOA 4DQKA 4QUAA 3A1FA 4LJAA 3VQTA 2QYSA 3P2EA 3RH0A 1EUCA 4WFJA 1OH7A 1YO6A 2R5NA 3GP8A 2QRVB 1GGHA 5JU6A 4PY2A 3GD7A 2B3DA 4MW0A 4RJJA 1MNAA 1JHAA 3D5TA 1E5TA 2FEKA 1S7GA 3MB8A 1WUIS 4R3NA 2WTBA 3NVKI 3JD0A