3II6X

Structure of human xrcc4 in complex with the tandem brct domains of dna ligaseiv.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
258
structure length
256
Chain Sequence
KISNIFEDVEFCVMSGTQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional interaction between the human DNA repair proteins DNA ligase IV and XRCC4
pubmed rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
molecule keywords DNA repair protein XRCC4
total genus 67
structure length 256
sequence length 258
chains with identical sequence Y
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
X PF11411 DNA_ligase_IV DNA ligase IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ii6X01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ii6X03
2EBWA 3AL2A 2EBUA 2K7FA 4JLUA 4XQ0A 1WF6A 1T2VA 3PXBA 2ETXA 3EF1A 2VXCA 3SHTA 3KTFA 3UENA 4BMDA 4OFBA 2WT8A 4IGKA 2LE0A 1T2UA 4U4AA 3T7IA 1CDZA 3K0KA 3COJA 2DUNA 2COUA 3K0HA 3L46A 2AZMA 3PD7A 1Y98A 2INGX 1Z56C 2XNKA 2JW5A 2D8MA 3UEOA 4ID3A 3QVGB 3L41A 2ADOA 3K15A 2COEA 4N40A 2M2IA 4Y2GA 3K16A 2VXBA 3QVGA 3K05A 3EF0A 1GZHB 3T7JA 2K6GA 3PC8C 4BU0A 2XNHA 3JVEA 3PXAA 3PXEA 1L7BA 1IN1A 3II6X 1OQAA 1IMOA 3PXCX 3T1NA 3U3ZA 3PC7A 4Y18A 3HUFA 1T29A 3HUEA 3I0NA 2EP8A 3I0MA 3PA6A 3FA2A 2E2WA 3L40A 5ECGC 4BU1A 1KZYC 1T15A 2NTEA 4XPZA 4BMCA 3PC6A 1JNXX 1L0BA 3PC8A 3SZMA 3SQDA 3AL3A 4IFIA 1N5OX 3SHVA 2R1ZA 3T7KA 2HTFA 2L42A 3OLCX 3PXDA 2COKA
chains in the Genus database with same CATH superfamily
5B3AA 1ABEA 2J3DA 1I7PA 3OZUA 1Q77A 4DYHA 3AM1A 3GV0A 4O2RA 4CN8A 1IL0A 1THGA 1DL5A 1E7QA 4L5JA 4U6QA 4ETNA 4WADA 3C6KA 3E05A 3IYLW 3ZWQA 3LOQA 3LQQA 3LDUA 5EIBD 3F2VA 2RKBA 3NW9A 4QEZA 1DG9A 3K92A 3AUYA 3ST7A 3OQPA 4GEGA 1BS1A 1JDVA 3OIWA 3IHWA 1P2UA 5HA5A 2YWEA 3H1TA 4QFCA 5JTUA 4JGBA 2HA0A 2ZJYA 5KHOC 3LQYA 3MW8A 3G2HA 4CEJB 3ZWVA 3M4YA 5LCXA 1ZUD1 1W25A 4DDVA 1HDYA 4LDNA 4MPPA 4RK4A 5HUHA 3COJA 1LBEA 1PWZA 3O3CA 2YVQA 2O1XA 2P69A 1JYEA 2C29D 4NCAA 4A15A 1TQHA 1XVVA 2Q4TA 2VUIB 3IBTA 1PJRA 1QWSA 3HZOA 3VI3B 2X8JB 4KWTA 4DNXA 4UTVA 2M6SA 3RQIA 2Q1YA 2DQZA 4G0XA 4JBIA 4JQZA 4LZOA 5EP3A 4BZZA 5CX1B 1U9ZA 2EKBA 5AR1A 3BA1A 5H1YA 4YJ2F 4A8TA 3A7EA 3FMPB 1L1RA 5DGXA 2D74A 2DCMA 3PNLA 4R68A 4WZAB 3MGCA 1UKCA 4ZAZA 4D74A 1MV8A 1FXUA 1OWPA 1P2SA 3U1BA 3O8LA 3L41A 2IT1A 2Q62A 4RL4A 3NHUA 3VZRA 3L6DA 4Y2PA 1SA0B 2GZ1A 4I4NA 4E0BA 4YRBA 3NXSA 4ZCRA 3T4PA 3RAJA 5E7QA 2FZGA 2G36A 2V6IA 3CZQA 4PTYA 4QXQA 5BO5A 3NTOA 4DC9A 2B4RO 3HWSA 3DLHA 4P53A 2N9UA 1PQWA 1FFDA 1UAGA 3RYCA 1BD4A 4J43A 1G9XA 3BXOA 1H93A 1ZZEA 2AUTA 4HQ0A 5ADVA 2A30A 4FE3A 5E7MA 1NLUA 2BI4A 3DOJA 3CW8X 3HEBA 4IQFA 1GG2A 4TTPA 5BURA 5U1PA 4N7BA 4TPKA 4FBGA 3O26A 4Q18A 2HNBA 2VSOA 5IH3A 1JHZA 4KU4A 4ALLA 3UT5B 2V45A 3I9V1 1PJZA 1VM6A 2FW7A 2GTPA 3NVMB 1CERA 4YP6A 1JE1A 2UYYA 3WYEA 3KSUA 1GAJA 1CJTC 1TM7E 4DIMA 3BG5A 1WHSA 1KVQA 1V6CA 2RB4A 2VRWA 3H04A 1R6BX 3HXPA 2NACA 3Q88A 3U3ZA 3CWQA 3OE7D 3SQWA 3KHKA 1G6Q1 2VH2A 4EZEA 3L02A 1H3NA 1WOMA 5JBQA 3UV7A 3E9YA 5DULA 3SDSA 2GBGA 3G9TA 3NAMA 3TL3A 1N2XA 1EX9A 1OREA 1WZNA 1HH4A 3HBJA 4AS1A 3WBJA 4MA5A 2PLAA 4PHCA 3V2IA 4JBYA 1Z6PA 2HSEA 3F3YA 4HNVA 4DYVA 4D45A 5IF9A 3S1AB 4IZOA 3CVVA 4D3FA 1U2QA 1B16A 4POOA 3IOEA 1MW8X 3ILXA 5C53B 2C77A 1VE3A 5J63A 2J31A 1YJAA 3DFIA 5C1BA 3FSJX 4XQGA 5ARDA 5CLIA 5AKJA 3TSAA 1ONOA 1F8GA 1U9IA 5A7HA 4CI9A 4RUKA 4MQEB 4PHFA 3FPCA 5JV5A 3FGOA 1SO8A 2EBUA 4KFUA 2RBEA 4EY5A 1YZUA 4XQ0A 5H68A 2H1FA 2WINI 5I7SA 5EJMA 2GK4A 4Q1DA 1ZQ9A 3U31A 1OCEA 2RK6A 2OV6A 3O7MA 4LBYA 4C14A 4DCGA 1RE0A 3IP6A 1X86B 3AR6A 3IJ5A 4MH0R 1US8A 5EP4A 1GL6A 3RV4A 2O7VA 1KP2A 2JASA 2NO1A 1DRUA 2XCRB 1XRRA 1JG2A 1ESZA 1NW7A 1II0A 3ZDCA 1L9KA 1Y4UA 2AFIB 3HCOA 5CFZA 1U65A 3OU7A 3M4ZA 2QTHA 3H7IA 4WHMA 3BN3A 3EODA 1KXZA 3MWEA 3QXGA 2A5DA 4ZT6A 4RXTA 3UUFA 5IULC 3VJRA 3LXUX 4N9WA 4EPRA 1QYRA 5BT9A 3FUCA 1XTVA 2C8KA 3U62A 2DPMA 4EG7A 1GFIA 5AOAA 2YZGA 4LBVA 1KMCA 2VCYA 4CQMA 2WF8A 1XZGA 2QLMA 3DVSX 4RHEA 4FDTA 2YN0A 1IOZA 3LYAA 5KVVA 2I4LA 1QIEA 3OAAD 1HYQA 1XP8A 2WJWA 1K97A 2YVLA 1OGJA 4RJ2A 3IE1A 1NUAA 5CA1F 2GGSA 2VK1A 3PYXA 4RETA 3CZ5A 4FFLA 4WL0A 5TF0A 1CUGA 4E1BA 1RPZA 1UWCA 2B0JA 4FGZA 4P0TA 2QM7A 1ZU4A 2XT0A 3A3YA 4XH9B 5AOVA 2PKWA 2IEIA 2P9HA 2XYGA 5A2QA 2BN4A 1JEDA 2AN5A 2GWHA 2DYKA 1XXLA 3K15A 4CMHA 2XTZA 1ZD3A 3BOSA 3ECSA 4UREA 4B3DA 1PR1A 1EFHA 1QUFA 1TEHA 2WZBA 3GPDG 1CY0A 3ANYB 1HNXB 2MR6A 4NYJR 3RHZA 4XRGA 4O4IA 3OOHA 4HVTA 5FI0B 3WNBA 4NARA 1TEXA 1IVNA 1QFJA 1HDCA 1JPVA 1OXMA 1PR2A 2IY7A 4DLTA 4ZYTA 5LIPA 1G9TA 1K3UB 4BIMA 3UGKA 1MO5A 4DV0B 4UE2A 1Z6XA 2Q5HA 3OPXA 4FIDA 4WK4B 5JC1A 1YZFA 2LDBA 1II8A 2WJVA 4AJLA 5JQWA 1M5RA 4LZZA 1CF4A 1BDHA 3VTFA 1GFSA 2ORIA 4FYIA 2AJ8A 1O58A 3SJZA 3V7YA 4A10A 3DDWA 4BQIA 5BV2P 4G0ZA 1CDOA 3ET5A 4HPJB 4CEIB 1X0XA 5KVAA 3B1VA 3HJTA 4INAA 4C5BA 2IS2A 1U02A 4TSFA 2H9YA 3DOHA 1PTKA 3I6ZA 1EE1A 3ZHTA 3BD9A 4G2NA 4UUBA 4R1MA 4CKZA 4GF5A 4OGKA 1GNQA 4GM1A 4PW0A 4BFLA 5F9FA 2J1LA 4MWBA 2K7FA 2HXSA 2EQBA 4OF4A 4KCGA 5JRZA 4WA7A 4I1PA 4BMCA 1G20B 1XNQB 3FMIA 5HPYB 1NJFA 2LIVA 3L8DA 3R7BA 2P9BA 5IXJA 4Q9NA 2X1HA 5DHFA 4DCPA 3PEWA 1YKFA 2IYLD 2Y1FA 3M6VA 1VCIA 1T3TA 5HBGA 4JJGA 3CSDA 4UUMA 1A2BA 1KDVA 2X0IA 3GJ3A 2NZJA 5LQMA 1EQUA 3SKYA 2E48A 4BCDA 2V4MA 4DVGA 5AD1A 2Y68A 2Y9PB 2YZNA 4PZEA 4W5QA 3T7TA 1FYVA 4A26A 3IQHX 5BVHA 4A2WA 4BVFA 1OLSA 1QNFA 1TLLA 1AX9A 3PFCA 4NHEA 5TQVA 2EBWA 2BLNA 1X9HA 3LX4A 1YFJA 1XG5A 2PFKA 1E92A 3KHSA 4NZNA 5DWDA 2VDPB 2W2OA 1TAHA 1C7ZA 1CS0B 1A5AB 4R05A 4X63A 2C2YA 1UBSB 1ZW6A 4TKUB 5F1PA 3U1VA 4BV8A 4LPSA 3T7DA 1Q0QA 1RKQA 3P5SA 2H2IA 1AURA 4AG3A 3D3WB 4Y2TA 2WJGA 1EVLA 2BM9A 3F6CA 1S2DA 4OUDB 2OGTA 1HLDA 1UEIA 3DYIA 3CHYA 2X9GA 1A27A 5B4VA 4QXAA 4MPDA 4FDUA 2O3TA 9MHTA 1IY0A 3SYNA 1IB0A 3WL4A 3ZVNA 4UM9B 2JVJA 1YNSA 1IRIA 1W581 2XUDA 4HB0A 2ZS9A 3B7GA 1HXHA 1BJTA 1OIWA 1V47A 2QE7D 3BWCA 4DG9A 3DVLA 1E9CA 2W90A 3S5JA 1K66A 1Q20A 3BF7A 4CIWA 3PCTA 3PEFA 2HPAA 1DEOA 2YUIA 3QG1A 3PIRA 1ZK3A 2WF9A 4OHCA 5LQKA 1H2ZA 5EJGA 4JLOA 4MS1B 3KTAA 3UYLA 1P5HA 3EPRA 3U2QA 1ISHA 2JD2A 5EJ2A 4IRMA 2W70A 4MVJE 3FVQA 3H5VA 4ND4A 2HPVA 3F4KA 3T99A 2PBZA 5T8KA 3TWOA 3OO1A 1JDNA 3ECCA 2WM3A 2P4HX 2QX9A 3H87A 1KVTA 3AETB 4QL3A 1KC1A 1KU0A 4OQLA 5FI1B 2FSUA 1Y1QA 2FYTA 2CV0A 1VL0A 4HDCA 2VBGA 4CM5A 4LF7B 3G5UA 3LPAA 4ND7A 4ZHQA 5AUPB 4IBOA 5CJPA 2FE4A 1SUCA 3DV0B 1NNEA 3KWMA 5JZOA 1R9JA 4BMPB 4EO7A 2ZR9A 3GJ6A 2GDJA 1XMQB 4PO9A 3KDPA 4RHFA 2BFEA 3FYTA 4MS3A 2RH5A 1LDGA 1VJDA 3N2KB 4MUYA 3GUCA 4CLEA 2V7QA 2O1SA 2QTMA 3ANSA 2VZ8A 2YZMA 4IRUB 3NV7A 3MT8A 2ZM5A 1L1QA 1L4MA 2BE9A 2BHTA 4FEYA 1XTKA 4YV2A 1Q57A 4B6OA 4X93A 2Z6VA 4O63O 4F84A 4M0LA 3NBZC 3D3EA 1W94A 4B2PA 3LBHA 2Z98A 4YAOA 1W96A 1YB6A 1PR6A 1YZKA 5C34B 3RIHA 5ICFA 4FFBA 3VRHA 2FZCA 2PZMA 4HAZA 1KAOA 2IYEA 3A36A 4JJ8A 4M38A 4MB2A 1X3SA 1JR4A 1Y3CE 2JDID 1U9JA 1T8TA 4R2JA 3VZCA 3WBFA 5FWXB 3ZJVA 4B3RB 1RWVA 2NO9A 3WLSA 1ZMTA 1R0WA 3ORFA 1D0SA 2G82A 3GEPA 5JCPA 4ZEXA 1OH7A 1C8BA 1GU7A 2HRDA 2Q7OE 4ENTA 2X4GA 3AESA 3K0CC 4RNCA 4C0QC 4CE6A 5KYXA 3SZMA 1GCIA 3T1QA 1Q22A 3L0SA 2RSLA 2CLCX 4KVGA 3RRXA 3WMXA 4MWZA 3TIVA 2B20A 4HQRA 3WGTA 2IPLA 3FYUA 2BKVA 2ZBRA 2F4VB 5D3KA 1P2DA 5EYPB 3SFZA 3IRUA 1F8UA 2C3PA 3E0XA 3R74A 2ZG6A 3PF9A 3K1AA 4NZ9A 1LWOA 2G6TA 1MO4A 1MJNA 1KF0A 2PT7A 4HAOA 1G4UR 4UM5A 3SE7A 2WWFA 3UQYS 1QTIA 1QZXA 1G5RA 4CLDA 1T3SA 1ULBA 3FHJA 3HGTA 4YV1A 3NOVA 4ZCLA 1NMZA 4JEHA 4PAOA 1CVRA 1E0SA 2R86A 2WILA 3AQ4A 1LJLA 2JFBA 3GA0A 3RRMA 1F2DA 4EEKA 1GQ2A 1S4MA 1XMOB 3JR3A 1XPOA 3LPCA 3UJDA 2HK6A 4MHOA 3RSCA 3DE0X 4EBFA 3KYBA 4N8EA 4W9NA 1W4ZA 1Q44A 4EWLA 1XJCA 2HHJA 3N8IA 1XYYA 4IJMA 2BBWA 1YE3A 5EHQA 4J2OA 3FUXA 4WE3A 3R5XA 1P1IA 4ZZ0A 2GZ2A 1RYZA 2Q2QA 4B3HA 4QTXA 4U6SA 1R2QA 1RLJA 4JZYA 4BWYA 3AFGA 3LS2A 2V6BA 3JD3A 3RUPA 3UT5A 4M8KA 2BFWA 1DIRA 3DZFA 4F2GA 1F7VA 1W44A 2I4OA 2LBPA 3E18A 2O7SA 4REQB 2RBKA 3JY6A 3NKLA 4NCNA 4UE6A 1DC3A 3N3BC 1OSNA 3RRBA 4MRVA 4RELA 3QKIA 4WN9B 2R96A 2WWRA 5LZ8A 5U4XA 1N5DA 1SEVA 2MDTA 2EZ4A 3J7TA 1DC7A 4KB5A 5FT9A 1PWYE 1FYWA 2W5UA 2JI7A 4RVDA 3QQ5A 2VYND 1VHLA 2ZUUA 3IT3A 3QNUA 1SA0A 4QJ5A 5HFJA 3UWOA 4WZBB 4D0SA 5FX2A 2HA3A 2Q45A 4F5DA 1PNQA 3C5EA 4J16C 1TT5B 4L02A 3IBFA 5AJTA 3TLKA 3WRYC 1OC4A 1VYTA 6YASA 4BNGA 3IIJA 3C6MA 4XUDA 5E3HA 5KWSA 2YFHA 3EF0A 4MP6A 2P2GA 4DILA 1BROA 2HMWA 1QAOA 4DG5A 1ID1A 1L7RA 4IIUA 5K8LA 2GK6A 3V9PA 5JANA 2V9CA 2EARA 4H1HA 4O4LB 5JCOC 2O8BA 1BMQA 1BS2A 2FG6C 5CD9A 3R9WA 1E5TA 1LXCA 4Q03A 1XTQA 3R5TA 4KAFA 2TMGA 3DGFC 3AR7A 3CRMA 3IODA 4NP6A 3EN0A 4HZIA 4LSGA 4TS9A 4ZO7A 4EGSA 4FB4A 4DRZA 3JQ9A 1X1SA 2GEBA 2B1QA 1EVQA 2VKQA 2PUHA 2X1MA 2X0NA 4I1OA 4B7UA 4DRXA 1XD9A 1ISFA 2F1IA 1KIFA 4TLBA 5KPDA 5CIWA 5DM1A 1M72A 1GV0A 2VBCA 3OH8A 3QQPA 3MELA 3THRA 3JCZA 5FTJA 2ZJ1A 1YS4A 2GKGA 5J4HA 1IY8A 4B6FA 4PY2A 4R9RA 2IZZA 1XEXB 4G9BA 3LKBA 3B3FA 4YJFA 4LNAA 4NEHB 2REOA 3JQGA 4BMVA 5CCBA 3INNA 3U3DA 4N3AA 3SAJA 3F3SA 2EG9A 2BTQA 4R0VA 2QAIA 4W1PA 5EAIA 3HSSA 2M32A 1JQAA 3ZY4A 1WE2A 1U8EA 3K20A 1HRDA 3NH9A 5TT0A 1LSSA 2LD4A 2C95A 4YDQA 4YCBA 2PG3A 4XVCA 2QI9C 3U44A 1JKXA 3L7OA 1CRQA 1IWBB 1T6YA 1CZLA 2A0WA 2JZCA 1JJBA 1SB9A 1YDGA 2A0KA 2P6PA 4MV6A 1MEJA 4B43A 4HNUA 1UPAA 3NP9A 5FO1A 1WZIA 1NDHA 1FNMA 1VPWA 3IKTA 2Y27A 3RC3A 1EUDB 2FPWA 4MVJM 4RKWA 3M9WA 1LWNA 2WV9A 2GHQA 3EBLA 4A6DA 1GA1A 1QGED 1S8NA 5CB0A 1VB3A 5KJFA 4R5MA 1CFZA 2QSYA 3EXEA 3ENVA 3PS9A 2JRLA 2GSWA 3DV2A 3QHAA 4BB0A 3SWWA 5IUJC 3SBOA 5J9FA 3V33A 1GL7A 1X1QA 4OMDA 1P33A 1RWBA 3BE4A 1L7PA 1E4EB 5GZ1A 2HT1A 3D2BA 3L7BA 3BICA 5SY9A 3X1XA 4ZT7A 4NAHA 4BO6A 1X14A 1OFVA 1E6KA 3DFMA 1GQSA 1NUSA 1Z74A 3WIBA 5BSVA 2JCVA 2C9ZA 1R6DA 2AR0A 4D43A 2BFFA 2ZI5A 1XE3A 5KVSA 4NBUA 1PG2A 1P9RA 1RVV1 2I4TA 2VJKA 3KYDB 3D0RA 4MA4A 5COAA 5BYBA 1IEVA 3SM3A 5L7YA 3S99A 3A28A 3OEWA 1PR9A 2QRKA 5DCUA 4EYOA 1YFZA 2BKAA 3SQOA 1H05A 1GV1A 1WVMA 4OQYA 4FMPA 3HL0A 3VH4A 3HHPA 4YFYA 2QHXA 1WQ1R 4C0SA 2XXAB 1HOTA 4DFDA 5CYPA 2WTXA 4LJ6A 4MW4A 2TS1A 3KOYA 4U2CA 1MC4A 5JPIA 1XROA 3PNPA 1G3RA 1XOIA 2EIHA 5EJEA 1AMNA 3QBEA 1GN8A 1N2ZA 3GRKA 5H81A 3RVBA 3WO0A 3VSCA 3W06A 5A4KA 1G38A 2C2WA 3F6EX 5JD4A 2ZW9A 5LLTA 5LQNA 1FXWA 1U5BA 2DBQA 1KORA 1SU7A 2D7CA 4J91A 4XA8A 4F5YA 4JQOA 5EVJA 3BIJA 3FIJA 3WO1A 1XI2A 3GCXA 2QN6A 4LW8A 4HDKA 1B6RA 1ZNQO 1BYUA 2X7HA 4Y8VA 1B0AA 4KUEA 2ZIFA 4TT8A 5EJ5A 2H00A 4U63A 4ZI7F 1M9NA 2Z43A 3OWHA 3OX4A 1UH5A 4MUKA 3OC6A 1FLDA 4UPDA 1CUBA 2RGEA 4FXOA 1P5ZB 1XD2B 4K7JA 2D2VA 1NQAO 2AF3C 4NY1A 2D1TA 1L7BA 2FFQA 1ZBDA 2XOXA 3MJEA 1KYIA 1POWA 2JFHA 3ZJ5A 3NU1A 5TJ9A 4XXHA 2BHLA 2WYIA 3QX7A 3V9AA 4XYLA 1XHEA 3AUAA 3L8CA 5E6UB 3CLTD 5IAGA 3PRJA 4N0QA 3A6GA 1Z2OX 3FLMA 2GESA 3FDZA 3K4QA 4YYZA 1MNQA 3CUWA 1ECPA 1MVNA 1VKOA 1BD3A 1TVMA 4IG9A 5LXTB 3SLRA 4AJNA 1V8OA 2P9EA 4PV7A 1G7RA 1D7AA 1EP9A 2ZRJA 2H0QA 1F0KA 2CDAA 3O2JA 3C14C 4HXGA 4LKOA 2ZT7A 2X0DA 3IBYA 4BP3A 1O7JA 2H52A 1TM5E 2V58A 2W2TA 4XR4A 5DCLA 2I1LA 5TJHA 3ROMA 3OIYA 2XCSB 5K0FA 2V5UA 5KTMA 1Q0LA 4XCVA 5CLGA 2PLFA 5JEDA 2XDQA 4DARA 2QORA 3K1AB 1PKXA 2CEAA 1RQLA 4PZUA 1W75A 1JJ7A 2ZB7A 5HFAA 4OLHA 4LISA 5M34A 2B78A 1T3HA 3OO0A 4FFRA 1Z29A 1PJSA 4AQ7A 3THWB 2I62A 1J25A 3AUFA 4RCVA 1OLUA 4HXYA 3R6TA 4LVNA 3ZWKA 1SKBA 3NT2A 1QZ3A 4HNAB 4I4LA 4A5OA 1G5QA 2P68A 1A82A 1L5FA 1N7JA 2FLKA 2B92A 2Q9UA 3L06A 3MVEA 4BIIA 5LQRA 4NENA 3UAYA 3MS4A 4NNPA 2JB9A 4R8KA 4JYAB 4KGVA 4GOJA 1WXFA 1IC6A 3EQ2A 5CTJA 3TZHA 1O89A 3CIOA 2O9JA 4MEBA 1VMKA 3WGMA 4RY8A 1HT1E 3I04A 2J9RA 4R8MA 1GDTA 1IJKA 2VEOA 1O57A 2XBUA 3PDCA 4UU0A 5L4SA 1KK1A 3PE4A 1T24A 1NFFA 2P1ZA 1O8BA 1Y8QB 1A50B 1RLUA 5AVQA 3MWGA 4OJMX 2V6MA 3KQWA 2IS4A 3B3QA 3LY5A 4KXQA 1YDHA 2IOYA 2YXBA 3NHRA 2XQIA 3WFIA 1X7DA 2H4HA 1TK9A 3KLPX 3ZDZB 3LT5A 3G68A 4JR2A 1RLMA 1ADFA 1LK5A 3ANMA 3VVCA 4ESHA 2X0RA 5IPFA 5HG0A 1PJ4A 3PQ7A 4OQMA 1E18A 2BGIA 5DP2A 1UBOS 1ZQ1A 4DSUA 4EW2A 2DTDA 4EY7A 2CNDA 3EXEB 4A6PA 1CD5A 1E1RD 1F1JA 2JW5A 2W6PA 4MVWA 4TSFD 5DSTA 2ZR7A 2NUTB 3PX3A 3C7DB 3X2EA 1K5DA 1NQXA 5AKLA 4Y2QA 4HG2A 2HJ9A 5AW4A 5LLDA 2X22A 4HAVA 2ZJ5A 4CMEC 1RYBA 2JGEA 3L5KA 2XOKA 5JVDB 2XTAA 5AVUA 5HM8A 2VZLA 2XZLA 4B4KA 3BXFA 1M1NA 1V8BA 4AYWA 5ALUA 5EJ9A 1QH1B 2XR1A 2ZRCA 1L5NA 2MSNA 5IWAB 1MZVA 4BFWA 4L4SA 1YJ8A 1Y5NA 2JAWA 2ZRNA 4NPHA 5FOTA 3I8OA 1Y42X 1W5AA 1T6XA 2X8WA 3LKZA 1U0NA 5H7XA 5JR3A 2XSZD 1B76A 1AV6A 4IDEA 3D7NA 3HJCA 3Q2OA 4BY9E 4NCXA 3G1TA 1IG0A 4IIEA 3TB4A 4J1TA 5BVGB 3D5TA 3F1LA 3WKEA 1LBHA 1UQRA 5JZVA 1FE8A 4L76A 4DY4A 2MOKA 1EVKA 3EIHA 1O95D 4HX5A 3EDCA 1IN1A 1IN5A 2VAMA 4NFYA 1IWPB 1NKSA 2P4QA 1Q95A 1XR3A 2A5GA 4ML3A 2JLXA 3WGVA 1W0KA 4QRHA 3AFOA 4ENVA 2WM9B 2PT5A 4OHWA 3RU9A 2ONYA 3JQCA 3OZWA 2QTLA 1DC8A 3JD4A 3PF8A 1IY9A 3FAKA 2B1RA 3W2GA 1XDSA 3HKBA 1XQ9A 5HKLA 1DAKA 2O50A 2M6KA 2JIBA 1Y4ZA 3WBKA 5B53A 5JPDA 1QE3A 4G0PA 5KYUB 5IFKA 2C54A 1CZOA 2FOIA 1JWBB 3CRQA 3L7JA 1RRKA 1M2VA 1HEUA 1IU9A 1P29A 1UJBA 1PUIA 2AJTA 2OO7A 2RJOA 3MT7A 5FI5A 2ICAA 4MIYA 3LKDA 3O9ZA 1E32A 4MR9B 3PFWO 4NXMB 1K4YA 2YQZA 2ZITA 3AL3A 3JZDA 3LVFO 3PR3A 3R3JA 3DMTA 2R1ZA 5BSEA 1P6QA 5E2BA 1IBCA 3RYCB 4AO7A 1PFVA 3HEMA 4WOKA 3CWZA 5L3RA 1G9SA 1WUJS 4TV9B 3BJIC 4PG4A 3TG8A 4OOEA 2Q50A 1JH8A 4AMBA 4R9UC 3KOXA 5FNZA 5KWIA 2A5FA 4S1OA 2IYYA 4ISBA 1D4AA 1CJSA 3PHBE 2D0PB 4O4JB 1U8AA 2GM3A 1IM2A 3N0RA 4ND6A 3E70C 4TRMA 4GLBA 4TYQA 3K72B 4Q4LA 1KOLA 1WW3A 4WESB 2YTZA 3RTCA 3UATA 1UAYA 1TUEA 1E79D 2C2HA 3ESAA 4KQIA 2HH9A 2IYUA 3KSBC 1CU1A 2AE1A 2G04A 3A6LA 2V4UA 1Y7LA 4QEKA 4ARAA 4BJ6A 5F98A 2OXEA 3EZ6A 3PYMA 2BI7A 1XDUA 4KHPB 3SC4A 4XM2A 2H85A 1VBKA 1VLVA 5LM3A 4MICA 5JAMA 2CYBA 3T3DA 1O6GA 1RWWA 2PR7A 1GTJ1 1LVUA 2RGAA 4KVAA 4O5AA 4RY2A 5TMPA 3GNQA 5FLXA 1LI4A 1P74A 4PM4A 5D6NA 3MCUA 3X43A 3K6SA 4MPRA 1KRXA 1ZRHA 2B6NA 3B36A 2R5WA 4ALJA 2ANCA 3M49A 4JR1A 3IHLA 5HKKD 3G0BA 5KYNA 3O90A 1SCAA 2VXOA 5FLYA 2JARA 4B3IA 4FGLA 2QIPA 3SN6A 2Q5CA 2BSQA 2HK9A 3RB8A 4QWMA 2Z2JA 2WAAA 1RZVA 2F3RA 1YR1A 3NBAA 4JNKA 1VSQA 4DXHA 5L95A 1ICIA 1HQDA 4H6WA 3WGIA 7REQB 3TPZA 2IWHA 3OE7A 5FL7D 3ZHCA 1HM5A 3ASYA 2VTKA 2R1TA 1GT91 2ON6A 3B8HA 1XBTA 5LKAA 2VJAA 3NNDA 1ONSA 3DL0A 3BAZA 5CIQA 4CV0A 2CY0A 1MRZA 2VWQA 1VGVA 4EI8A 4EYEA 1E1CA 4HQFA 4JUDX 2NZ2A 4RK7A 5AJXA 1N0UA 1IQRA 3TJRA 2QF7A 3W9BA 4DCSA 4F38A 3M4NA 5JUWA 1GN9A 2QUHA 4BMXA 3GARA 5I5EA 5FL3A 1HDGO 4IVNA 3WMFA 4EKIA 1RE1A 3IAFA 3PE3A 4F92B 1VSBA 2UYOA 5HIKA 4CQNA 3LW7A 3MTEA 3PGMA 4MCJA 4NYJQ 5T4HA 3GZNA 1PR4A 2BR4A 1NLZA 3R0XA 5AFSA 3PEEA 4KMOA 4JYZA 3SYRA 1FYXA 2ZXUA 1QHHA 3UUEA 5HQ3B 2DCUA 3G59A 4RKYA 1KEVA 3T1VA 3BKWA 3I9NA 3TZBA 2XE7A 2B69A 4X41A 3VKHA 2AXNA 5DGIA 1MGOA 1QIGA 3D54D 4DZZA 3ZHRA 3ND8A 3BWXA 2BPOA 4ZAXA 3EXAA 1SKMA 3TQSA 1ZH4A 3P2KA 1IATA 1FFHA 1KJJA 1M6VA 1M54A 2DJ5A 3ZI4A 1VLZA 2HN9A 3NWPA 3TIXB 2CDBA 2PV0A 3WA7A 1OAKA 3EAQA 1L4NA 3I6BA 4X1YB 2IOHA 3ZE0B 4XPIA 4UEWA 5AUOB 4WK2B 3MQFA 1B23P 2DC1A 3K9BA 3GNTA 3ZH2A 1J9ZA 1TECE 1M34A 2JAXA 4MO9A 4UBMA 1X9GA 3DKRA 4L5IA 3WWZA 4B82A 4ZJUA 1JE0A 4D9FA 2FI1A 1CV2A 2CJYA 1SD2A 2OM2A 3EBOA 3SKXA 2H2HA 1CPYA 4KWEA 4LQ4A 4R3UC 4JCCA 4JLVA 4LE2A 1N75A 3TSOA 3D2CA 4A2CA 1Y4DE 5KNDH 1XLTC 1FNNA 5B58T 2RHCA 3AUUA 4WOBA 1QK4A 2VPQA 3R0QA 4MJ3A 4TYNA 4RHTA 5DLEA 5KMGA 3MK31 4H3HB 5J58A 5LA6F 1M8PA 1AS2A 1EIZA 4FNMA 1ORIA 1NE7A 3BD7A 3IDSA 3SJUA 3FXAA 4Y7CA 5EWLA 1D2CA 1KI8A 4QQFA 4QX6A 4MKGA 3EXHA 5FUYA 1H2YA 3M2PA 4MQFB 5AXDA 5I45A 2PWZA 3JWJA 4FONA 1R8SA 1NN1A 2E18A 1QB7A 4X1KA 3TOSA 1Q1BA 3RC9A 2H2AA 1K7FB 2ZT8A 2JFVA 4XSHA 5K0BA 4FMDF 1XD2A 4DBLC 2R8RA 3REFA 4FWIB 2VG8A 4FCVA 4LNUB 3U4HA 4X62B 2EQ5A 3CBQA 1ND5A 1XELA 2ZCUA 3I2IA 3IAM6 2LDXA 4G65A 5L3SA 2XGJA 1H1LA 1X80B 1H1DA 1A2OA 3F71A 4JL8A 3VMMA 1Q5PA 4OGWA 3ZUPA 1L7VC 1LZKA 1P4SA 1GZSA 4R8RA 5DHPA 2G9ZA 4P2GA 4NS1A 2HMYB 1YO6A 2DTEA 1IZZA 4D6YA 4BNTA 5AI0A 1T9BA 2E4UA 4S35A 3A1EA 4C4PA 4N40A 1TFRA 4EA9A 3ZJTA 2EQAA 1S2LA 4MUMA 1PJQA 1OLOA 4HO1X 3K9FC 4G0UA 2PGJA 3TDMA 3DBRA 1RP1A 4ILKA 4JHXA 2ODEA 1TQ8A 4XJXA 4CEHA 4KUHA 5K20A 1BWRA 1SC9A 1TTQB 4O4JF 3V7WA 3IMFA 4EB8A 3PC8C 1OILA 3KKMA 4WV3A 1QORA 3ZDRA 5JHGB 3FN4A 1Q83A 1QPBA 1ZWKA 3Q2IA 5ALYA 5F2OA 5J2UB 2OORC 3B6EA 3RDPA 1ULZA 4K2HA 3SFTA 2QJRA 4IHAA 1P5RA 4S05A 4YQEA 3IP7A 4BNZA 1U0JA 2QX7A 4L0CA 2WZDA 3N8GA 4DNPA 2Q07A 1UXKA 1W35A 2BTOA 1XTJA 3NCHA 3OECA 3VR5A 4UASA 2WYUA 5FFMA 2C3UA 2IEGA 3I1JA 5TMBA 2NQ2C 2G67A 5BV0A 5MFPA 3R20A 3ER9A 1KFKB 1NG9A 3GFVA 1W36D 2HIHA 2CFSA 5CYGA 2B5VA 2P7HA 3DCIA 1OY1A 3IHTA 1U0GA 2BELA 2HU5A 3LA8A 4UEQA 5H0IA 1C7FA 1X7ZB 4QDZA 3TBFA 4B48A 4D6XA 4RHUA 4YWHA 3SE0A 3ZCVA 3K09C 4NJEB 3PQ3A 2O0HA 2FRDA 4FFOA 1O6FA 5CAEA 2QQEA 3H2YA 1RQRA 3ZQJA 3NC4A 4HCJA 2ZZMA 4C7OB 3SVLA 2QTGA 4W8HA 4ZV9A 2L42A 4PEVA 2LV8A 3WMRA 3HJNA 4YCCA 3Q7QA 3HR4A 2J9FB 3ZKWA 1U5AA 1N5MA 2NO4A 1NW4A 2AQHA 3VI4B 1L3BA 2XBMA 3EGCA 1VA5A 5IVIA 1R00A 1DBQA 2CN1A 2DKNA 3BFKA 1RAAA 2DFLA 4OQDA 4RV4A 4AMGA 1VG1A 1XF1A 2XYPA 2Y8EA 1U1CA 1V5EA 2QZSA 4FOPA 4U1RA 3H5NA 2C9MA 1PYOA 4GC5A 4M22A 4Q4HB 2A1UB 3A4NA 3AZOA 5CAEB 2H0RA 2OLEA 1JEQB 2QXTA 3HZHA 1AQLA 3PXBA 5CVDA 3WYAA 1XUOA 3ZD9A 2HNAA 1Y34E 3DNFA 2J32A 3FY4A 3QVJA 4JFAA 4MPJA 2H48A 3PK0A 2QVGA 4U7GA 3IV6A 3W05A 4JX8A 3U09A 2W98A 4MS1A 4W5WA 4UARA 4ADSG 1C9YA 2QUZA 3CB2A 1T4BA 4MUNA 1D1QA 3EIWA 4I14A 1GPUA 3QKRB 4Q3NA 1VE5A 3GF4A 4HUQB 4ZD6A 5BR4A 5KKAA 1L7OA 4LSZA 3SHQA 2IUYA 2Z58A 3QV1A 3NO4A 4WASA 1FMTA 4Y1RA 1EK6A 2A5LA 2QP9X 3EUAA 5EXPA 3ZLJA 1EVYA 4QNMA 4YPVA 2XVAA 3ETJA 4F2PA 3TL6A 1FRVA 2UKDA 1Z73A 4F8JA 5HRCA 5L4NA 5K3FA 5IS2A 4W5TA 2DWQA 4QBKA 2FPGB 3RREA 3VNQA 1UMDA 1DMRA 3EG5A 4DIEA 1N2HA 3GEHA 5HJEA 2F8MA 2UYGA 1H3FA 4JR0A 1BOOA 2GS9A 2IDMA 2R25B 2XNCA 3QU5A 5BSMA 3TGWA 3LJKA 3I1FA 3W6OA 4BFXA 2H8KA 4XWWA 2ZR8A 1G6OA 2E4ZA 3VZSA 5I51A 121PA 1AXRA 2RCNA 1ZBQA 3EZ9A 3QW2A 4QOFA 3VUFA 1I80A 1AU9A 3WFZA 2QB5A 3BD6A 3FRIA 3D1LA 4U0JA 3FB1A 4QOIA 3PXXA 3TZEA 1KIMA 1E8DA 3F9CA 2BUBA 3W2IA 3QPDA 3GO4A 1Z3CA 2C03A 3LRPA 4Z99A 4JP2A 4XSVA 2Q6VA 4KR2A 5FA8A 1HDOA 2YJZA 3UGQA 1LDEA 3AHIA 4MR9A 5E38A 3RO7A 4D3XA 5JRJA 4OXXA 3LA6A 3CXUA 3L8ZA 4TVBA 4JXJA 3JTMA 1H6CA 2GI4A 2VJOA 2PV7A 3FFTA 3RYHA 3VSEA 1QGDA 2HYDA 3WLPA 3EIXA 4G37A 5CHYA 4NZYA 3NDBB 4KVZA 4AQDA 1X7XB 2IV2X 4X90A 5A0TA 4MVJA 2VJYA 3IT1A 1MUUA 2BMAA 4ZGGA 1CP2A 4UNPA 2FFAA 1E2PA 2GCOB 2FN9A 5E7JA 1R6VA 5AVYA 3WISA 2HAEA 1N2IA 3AC0A 2HK8A 2PUDA 4EJ6A 3HDTA 1O8CA 2EJWA 1SKYB 2C5FA 2IX3A 1G8FA 3W7AA 2XMCA 4NPAA 4BQEA 3T12A 3MWKA 2VHTA 2RHTA 2WAYA 2X8LA 3AUKA 4J75A 4LMPA 2XWQA 1HRKA 4O59O 4B35A 4TSKA 2AX4A 3PJDA 4OOFA 4H2DA 1T4MA 2QMQA 1VYUA 4PR3A 3TZKA 3ZDEA 2QNIA 3DYBA 4DY6A 4HWGA 4PG6A 2PRJA 1CEQA 1A9TA 1RFGE 2YHIB 3BMXA 2ZI9A 3GPCA 1FVHA 4WK6A 5CVVA 1HLFA 2PYZA 4X1IB 3O0DA 3UOGA 2ABWA 3C5WP 5LDHA 1W1WA 2IPXA 1MRSA 2PCLA 2R6AA 4BNJA 4BB5A 3CB4A 4TV9A 2DX7A 4EB0A 3URKA 3OFNA 2EERA 4PO8A 3MXOA 4NAUA 3ESYA 1CDEA 2NTYC 1HE1C 1DXHA 2BEKA 1Z4OA 5JNUA 2R7KA 3PGJA 1A5BB 5CEEA 1C80A 3TN7A 3AM5A 3CZMA 3K5IA 4G26A 1SBCA 2P9JA 1FSZA 2HM7A 1CQZA 3DR5A 4MW6A 3WGOA 5HCUA 1OD6A 4ES6A 5KYUA 3L92A 1I10A 2AFHE 5EERA 4MZXA 4CQMB 1Y3AA 2F1OA 2VA9A 3LU1A 3FF4A 4HGQA 1UCFA 1E2GA 2VWHA 2EU8A 1W2WB 3EIEA 2R4UA 3GUVA 3ACCA 4FSHA 4L73A 4YRZA 1PK9A 4FFBB 1IMJA 1SWWA 1NKTA 1A9YA 1K9VF 2QN1A 4B3JA 3IH5A 4ZMRA 2HMSA 1CS4C 2NIPA 4X92A 3MTAA 2O3RA 3WC4A 5F21A 4GXQA 3E81A 2PJDA 2PX4A 3EC1A 4PFSA 1ZSNA 3HU2A 5FV7A 2VUSA 4WA8A 3PFFA 1UBNA 3O4RA 2R48A 1L4GA 1U7DA 4J07A 4PTLA 5GM2A 3FWYA 1C3XA 1XSEA 4CHGA 3QXJA 2HZBA 1DAEA 3GRYA 4H1TA 3UN1A 5CFOA 4FCWA 1HT2E 1SBQA 2JPDA 4EJSB 4EL0A 2QE6A 3NJ4A 3N2EA 1JBQA 1RXUA 4EX6A 3U6BA 5KKCA 4ZYYA 5IJWA 4KNWA 3IBCA 4LOLA 4BNMA 1DQYA 1M7HA 2PWBA 4CL8A 4JDPA 3L6RA 1DAOA 4RVUA 3ZHZA 4E5VA 4EEZA 3DTVB 3R8CA 3I83A 5CCEA 5ED4A 4YP1A 1ONPA 3KNZA 2YDXA 3LRXA 4UVGA 2I6FA 4MRMB 2BFMA 4TL9A 1NR5A 3CJQA 3SU8A 1EKXA 2WQ7A 4LF4B 4NRDA 2PKCA 4L7QA 2I1VB 3NZEA 4BRZA 3OJEA 4YMUA 5KNCA 3V1NA 5CLQA 4JXZA 4R1SA 2R5NA 4R9VA 3T7CA 3TLMA 2QD5A 3G23A 2C94A 4F9FA 2B30A 1TVEA 3R1IA 4X65B 5E6UA 4OLJA 4GQAA 1PDOA 1UMKA 3K9WA 1JLSA 1GZ4A 1UJNA 2AEEA 2EF0A 2G0NA 2ZSUA 1KH3A 4IIBA 5DX8A 1SRQA 4G4JA 4MUJA 1FFXB 3PZBA 5LWHA 5FUBA 1L7EA 3CTMA 1E9SA 2KX7A 2G77B 4L4UA 3NOQA 1PGJA 3T52A 1W76A 1G8JA 3D4PA 3MTJA 2X42A 2BEUB 2Y3IA 4J29A 5F1KA 1KZHA 1C0EA 1W2GA 2CXXA 1UK6A 4KO1S 4IUCS 1CUSA 2HRQA 2W6IA 3BERA 2P8JA 2XVZA 2ATEA 3DEJA 2C2KA 2C59A 2VAVA 2VHUA 3D31A 4I0WB 4J7CA 4P3YA 3Q9UA 3ZBQA 4KPFC 2ZIVB 4G67A 5EP1A 2FFRA 2X15A 5EUQB 4D1YA 5EP2A 5CDSA 821PA 5JJKA 3OTOB 4Q9AA 2DKOA 2YH2A 5BPFA 3A1VA 3JPYA 4W5NA 2HC9A 4OL0A 3GU3A 4Q9KA 3DDOA 1QH8B 5G0VA 4BVHA 2JLYA 1AKVA 2CFOA 5A6VA 3DHWC 4L9AA 4E31A 4N0PA 1L0BA 4KLZA 5DCYA 3HDGA 2VZ9A 3OOJA 5AVZA 4I5EA 4IG4A 3SS7X 5ALNA 3EG9B 2WHQA 5EHIA 1RWMA 4HDKB 4TMKA 1D09A 1N33B 2X0KA 1ZEMA 1C7IA 1PV2A 3P9SA 4TN1A 4M1EA 5ESDA 1Z6ZA 3LHDA 4CKBB 4RPKA 4MKXA 1JEYB 4GOOD 2R7MA 2WTMA 2YVKA 3FHCB 4D8XA 3K9GA 3G8DA 4QGAA 3LWZA 4W8OA 5CR9A 1LPBB 5E2AA 4Z7JA 1OFUA 2HUPA 3EEFA 1T6ZA 5D7BA 3P94A 3P97A 3H2SA 3SHFA 4NE9A 1C7EA 5CB8A 1G8HA 5CBPA 2CNBA 4YUAA 1A8UA 3LGAA 4OJTA 3TR0A 4C7JA 1ZJYA 3OZIA 5JSYA 3NV9A 1LW7A 3C8UA 2GYVA 2O7QA 3DMGA 3RROA 5DGCA 2FUKA 1ZPDA 1T36B 3QUBA 2OCKA 1LJUA 5F78A 4ICIA 5BQFA 4OFBA 4AX8A 2WT8A 1FPQA 2Z9BA 4INOA 1X8XA 5JAOA 4BQNA 4BO3A 2C00A 3T7AA 1AKEA 4EKNB 4F3KA 4F1WA 5BWOA 4QUHA 2BFFB 1RM5A 1VMAA 4YUWA 1V25A 2AIRA 2RHGB 3KX2A 1PWEA 1KI3A 3V4SA 1SVNA 1FSFA 2WU3A 4B17A 3Q7RA 4AN0A 3F74A 3STVA 4E5MA 1PG0A 1HSOA 1RHJA 1TKRA 5DYIA 4IIHA 2D1QA 2AMVA 5DCWA 3VC1A 3WLAA 1IN7A 1JAHA 1NF9A 3B1JA 4KN9S 1R3UA 2I76A 1YA8A 2EL7A 3ANXA 3OUZA 1CYDA 3AY7A 1XZMA 3HCRA 5AW0A 1X77A 3W5AA 1J8VA 4QHYA 1Q2UA 2IEYA 2HRZA 1YIOA 2QLFA 4K3VA 1GLGA 2H3EA 1CW2B 3B5JA 4IEIA 1GWNA 2RONA 4ZCSA 3U3RA 4CT5A 1PT7A 3NBYC 1KI4A 2PWAA 5JDCA 4R2LA 1U8TA 4D82A 3OT4A 1NYQA 4KZPA 3BFPA 4PNEA 2O2CA 1HR0B 1V2HE 4XTCS 3B1XA 2PGNA 3TE6A 1Q3TA 1OAOA 1U4NA 5CW1A 4JJ6A 1TTPB 4BVLA 4JROA 3UKOA 4UKDA 3D5QA 2C83A 3C5VA 1V95A 1J8DA 1DP4A 3MUFA 1RWXA 3PFIA 5B7QA 5CX4A 2O59A 3AR5A 2EKQA 2DT5A 1WXHA 1ZISA 3CGWA 1TKAA 2AOTB 3L0PA 1J70A 2ZWVA 4MUFA 2MSDB 1WV0A 4PX5A 3ROXA 1S89A 2IITA 3U3KA 1EE9A 3AP2A 3QTBA 4GLFA 3CX8A 3UOWA 4F7DA 5L53A 4MA0A 1C4WA 2HWKA 5FWXA 3FKSA 3DKVA 4S1PA 1E4OA 1JG7A 2YNMA 1NM5C 4G4GA 3JQ7A 1R0KA 2PMBA 3F7TA 5HFNA 2X4DA 3O91A 1SXJD 3LUKA 4RF3A 1Q91A 5E1BA 5BSTA 3TQTA 1KNXA 4JKYA 2Z2ZA 4GKJB 3L3BA 3LZCA 2FZKA 1KVSA 5EMHA 1EESA 4Y6RA 1RXWA 1T1IA 2QTRA 2VH5R 1U0EA 1W73A 3CCCA 1NIJA 3IJEB 2R1UA 3S1LA 2HSJA 4EHDA 3LPMA 3GFTA 1E59A 2Q8NA 2XUPA 3L4SO 3PNMA 2L18A 3LX5A 3UJBA 2CLFB 4L51A 1U28A 1LF0A 1WLYA 2HQ1A 3EYAA 2J09A 1OX6A 4CFZA 3GLGE 2ZREA 5K03A 4R98A 4YR7A 3LT4A 4AP5A 1E5QA 4IFIA 5SZJA 3LIPA 3QY0A 4TLEA 4Z9FA 3VU0A 4NMLA 3GD7A 5GAJA 4D8UA 4PIMA 1IM8A 5FTWA 2Z3VA 3OPVA 4WY5A 3VO9A 3VU1A 4EHKA 1UOEA 1GLNA 4UNRA 1RWOA 1GL3A 1ODKA 3SLGA 4M1WA 4M53A 4DMRA 2J9FA 1TMOA 5FBQB 4ZEWA 1BNCA 2VRBA 4HUTA 4MR8B 5CGZA 4UMDA 4CTOA 1Z2PX 1XP5A 3EGVA 4IEFB 3LHFA 3H5WA 2ONZA 1GAEO 2ZPTX 1CY8A 2XMPA 2A92A 4IYJA 2FPIB 2IC5A 5EOVA 3K9NA 2WSSA 1G5TA 1PUJA 1POXA 1TM3E 3NGLA 4DKXA 4F4CA 2YWHA 5KOHA 1ZMRA 3JQGB 2DPHA 1E60A 1I1OA 4ILEA 4WH0A 5ENDA 1JLKA 1B3BA 3PVZA 5HKBA 1PBTA 1ACLA 5FFFA 2GBLC 3QW4B 1MHPA 3A9CA 4HLNA 5KCZA 4GE0A 4LJ4A 2LRHA 1ZXBA 3U40A 2EZUA 3KUKA 4CM6A 3ONVA 9ABPA 4ZXPA 1Z5ZA 2ETVA 3NVDA 3SXJA 4IDNA 3GFSA 1YUNA 3IELA 4ND3A 5KJEA 4AX4A 5H9VA 4BVGA 1TLFA 2JFWA 4PWZA 4X1OA 3FYSA 5I47A 4LSWA 2FFBA 1IJBA 2HXGA 2WKWA 5BWMA 1Z8HA 2V3CC 2HI0A 1A7AA 2AD5A 4NG4A 1JQBA 4XZ3A 1E61A 1XXHA 3AEZA 3FH0A 2RH8A 3QOWA 4ZQGA 3VZQA 4E09A 1RI1A 3AERB 3ELWA 4M1OA 2VI5A 2XA2A 4JI1B 4ZDWA 3DBRB 1QF6A 1SUSA 2XTNA 1P3Y1 3F97A 2CYAA 1QQ7A 3CYFA 4I1YA 4MV8A 4RCZA 3IAUA 4YT2A 5A9TA 3F1KA 4WZBA 3RFXA 4BO4A 1JMYA 3U80A 4P35A 4A73A 1T1RA 1TF2A 1UMCB 1Y5MA 4MUBA 2XRZA 4CCYA 1LDBA 5DLPA 4GWGA 3B53X 4PLPA 5DXAA 2OPHA 4IWNA 3HCBA 4ZC8A 1JFFA 4KQFA 4WNAB 1MX9A 1Q15A 3AOEC 5C7IO 3GXBA 4ZA2A 1XNGA 2C3OA 2SNIE 3T0IA 3ZIUA 4HDOB 3ZE1B 2GPJA 2YIMA 4TXLA 1NA5A 4GP6A 1M2JA 4TN5A 2BH2A 3M8KA 5IUKC 2F3SA 1Z35A 1TYCA 5CB6A 3GLIE 2BZ0A 3PBKA 1JHPA 2ET6A 4X5OA 4DWVA 5J1SB 3RJMA 3KHTA 2D7JA 4U2DA 3LI2A 3FMOB 4R8LA 2AKAB 1U2EA 1CUZA 3OZAA 5LQAA 1ELOA 3HSKA 1RYYA 4PQYA 3O0TA 4A27A 3SM9A 2F8TA 3KC2A 1ZN9A 1QGAA 3A6ZA 2JAPA 2O3UA 5CB4B 3BH7A 1F3LA 4IWYA 3HACA 4D9MA 1EFRD 5E1DA 1DWUA 2MYUA 2Z5VA 4D4JA 3GZ4A 1R4MB 5EINA 3ZI7A 1GTSA 2FX2A 3EQ7A 4MVXA 3AY3A 3H4TA 4M9RA 2CT8A 5SV2A 1EP2B 5K4HA 3ROGA 3D5EA 4OU5A 3S29A 4QTYA 1VPTA 4TYMA 1FQJA 2YCBA 3UXHA 3AHFA 3QLEA 3IQEA 4Q34A 2G4CA 4CIDA 2OCPA 2DOKA 2FQXA 3W1WA 5K8VA 2BEJA 4N6OA 5P8WA 3ZGXA 4YQFA 1PWXA 1PFGA 4LQDA 1EBBA 2B9VA 1J8QA 1Y48E 2ENWA 4Z86A 3QV2A 2E0IA 2OV1A 2WHXA 1CUYA 2EOAA 1SG6A 4RD6A 3H1AA 2CSXA 1BEUB 2GPNA 2GYYA 5CXQA 4M37A 3SS8A 1N4DA 1NVAA 1Z5WA 3IDOA 4I4TF 3HZRA 3KIPA 1ZK0A 1GKYA 1RBQA 1RHMA 1WIWA 1BH6A 5ICGA 2ZT5A 4FYXA 5I7UA 4B4UA 3N8DA 2QRZA 2EJTA 3BHIA 4H7EA 5G02A 1WUKS 4IS3A 5LMZA 1D9ZA 4NXNB 2E6KA 3MQ4A 4RWZA 1WP9A 3UMJA 2ETXA 1JL3A 2IFTA 4B7XA 3O94A 4MW9A 4PX2A 1XRMA 4ME6A 2L82A 3AM3A 4YHBA 2ZRHA 2R00A 3DLAA 4XYEA 4ZPJA 3D2LA 3ESZA 4ZXFA 3TOVA 5A4DA 1GZ7A 1XMPA 4Y9TA 1P75A 2P79A 4U7WA 3RSLA 4CJXA 2BGMA 2LE0A 1M2OA 4AS3A 1NQVA 1DAIA 2FPSA 5DW3A 4Z4QA 3TPFA 1Q1NA 4LJKA 3FOCA 3AKCA 2COUA 5IN4A 4YCLA 5A3VA 2N0SA 4LI3X 3F4BA 5I9MA 1ZUIA 3ZDBA 1FFGA 1YCFA 1V48A 1V5WA 5AYVA 1FP4B 1T36A 2D4HA 1U3TA 4TXNA 2AG1A 1RCTE 4JXKA 4MMYB 4XB2A 2XWSA 3X2SA 2R8YA 4OK5A 1W8IA 2INGX 1EG7A 2CUZA 4Z4CA 3PUYA 3RRJA 1FJGB 3OFVA 3NUZA 1Q3KA 3H5AA 4R2KA 3UEOA 2Y0CA 4BX9A 3FOEC 1J7JA 4OQEA 4LX0A 4IHQA 5HK9A 1P3JA 5JZMA 3L8EA 1JU4A 1Q1ZA 4WKBA 1NU6A 4IDCA 3THOA 1MBZA 4CDRA 2O8FA 2YY6A 4HGZA 4GU5A 5E4JA 1G18A 3TUJC 3QVVA 3VU3A 4R7GA 4HNRA 3WJAA 4CUJA 5FFNA 2ZI7A 1FUKA 4XDHA 4ZKDA 1JKFA 5K3AA 5KB3A 2YHIA 2YIDA 1NAIA 3WG9A 3GLHA 2WHRA 4UU7A 5A7FA 4HMPA 3BMNA 5BR8B 5ERYA 4DV1B 3IUMA 3O4IA 4G5YA 5F76A 3SOZA 2NPIA 3I1IA 1XWWA 1OYWA 2X3YA 2XUGA 5B12A 4UFNA 3TLZA 5JXJA 5EPOA 2NP6A 3ZLBA 2FWIA 2G1AA 5GIPE 3N0VA 1Z6YA 2WSSD 1YTLA 2ZQYA 1I2CA 2VAPA 4BX8A 5JDIC 2ZIWB 4FOLA 3KR0A 5IF3A 2PUWA 4CKEB 3H99A 3N3AC 4EI2A 5BSWA 3GA5A 2G72A 4JT8A 1E79A 3OX3A 1D1PA 4H7HA 4J3NA 4ZHQF 3S5UA 5TEVA 4J0IA 4R6WA 4B4OA 2OGUA 1M75A 1SVSA 3G79A 1Z0ZA 1J6UA 1ZD8A 4OEHA 2B1IA 2CE2X 4LMRA 4U7JA 4MV0A 1NN0A 3LFHA 5HF9A 1A0OA 4Y7DA 3AKZA 4F8EA 5K0GA 3WGKA 2PNFA 3HPRA 3IBGA 4NOLA 2CCGA 4Q1CA 1JX6A 1SIUA 2B25A 3LV8A 3RUIA 1IPHA 2AV6A 1L5OA 3FNQA 4QREA 4JX9A 2ASEA 1S7GA 4C21A 2HFKA 3LFUA 1I7SB 3ZTWA 4W1QA 4E4TA 1ACJA 3WNCA 5BV8A 1TO6A 1AQYA 1J99A 3R3YA 5AJVB 1OT3A 1CZRA 2CVHA 4EQ6B 1KFJB 1TZCA 2FWJA 4NC9A 4BHTA 4I81A 3WNZA 4G3XA 2PFGA 1SIOA 1W5TA 4FYHA 5HEKA 3W8NA 2BGRA 4BE4A 1L5RA 2HIGA 4EFMA 2WSIA 1NVMB 5BNWA 2UUCB 1SIWA 3NEYA 3RS4A 1G21A 1OAAA 2OCGA 2EFCB 2YXEA 4M49A 5TLSA 2C7QA 5JLJA 2TMYA 1VCOA 2C2XA 2PRZA 5I8PA 3KT8A 4P4UA 2AMLA 4G9EA 4AKHA 3CNBA 1KJQA 3LP6A 1VCMA 2X8JA 1TTTA 4DIKA 1NYTA 3ZU2A 1SCNE 2M6LA 2BE7A 4IGKA 2PGXA 4B6EA 2RG7A 4EELA 5IJ9B 1FW6A 2I3GA 1NTOA 4AWBA 5HQ3A 3LCJA 3RIXA 2V7PA 4W7SA 3RR2A 2PPVA 3QKRA 3R5KA 2ZIXA 1M1YE 4I4TB 1ZH8A 3W7BA 2G08A 5HTOA 3QHPA 1E9AA 5ALMA 2ONJA 1DBPA 1OWMA 2PKQO 4BB9A 3I0ZA 4Y2UA 3GG9A 4ARVA 5FOQA 1JV2B 1XFAA 4WAUA 4N03A 3E5RA 4BO1A 2ZB8A 5IANA 1O9HA 2GZAA 4L27A 4FGKA 4R8VA 4IF6A 3GAAA 4W8GA 4DTCA 2IY8A 2PZEA 1E99A 3AVPA 4UCQA 1FTNA 1E3WB 2A58A 2D8MA 3FJYA 3LVQE 4A91A 2E5FA 3V8NA 2H4WA 3A7DA 5FOSA 3NVKI 4URYR 1C30B 5DTQA 1MJHA 1ECFA 1G3MA 5TEWA 3K0AB 3NGXA 1M1NB 2JEZA 2K4MA 1KE2A 4HEJA 1SHKA 1A2QA 2R6ZA 4GBJA 5ALEA 5GJWC 1OHHA 2VF4X 4BATA 4C2AA 4DNOA 2VT3A 4QXRA 1DQZA 4W63A 1XA0A 1H0HA 3ETNA 4DEYA 4GKKB 1XXHE 2OXFA 3ABIA 1T1EA 1E3WA 1F5NA 1XEWX 3QI7A 3EGXB 4QFDA 1K6XA 1XZLA 4RHXA 5LQJA 1Z5UA 2V9ZA 5DSZA 3U48A 4B5KA 2W4QA 1Y1RA 1E1MA 4K6HA 4QYIB 2BF7A 5HX7A 4C07A 2HDHA 5ICEA 5ADWA 3UJHA 4KZKA 2F90A 3Q85A 2I78A 2Q6TA 3BMOA 3KJIA 3M83A 2HA5A 4GKAA 4GT1A 2CNOA 1FFWA 4FMBB 4UCXA 2IU0A 1MORA 3QGMA 3MOGA 2XMBA 2H5EA 1UZMA 1FU7A 3OLVA 1HDZA 4ZYZA 3AB3A 2K2QB 2HR1A 3N53A 3AO0B 1YK1A 2RKOA 4KMSA 4Q16A 3U39A 3GC6A 2HCTA 3IC5A 1X1EA 2JLBA 3KKEA 4G8DA 2NO5A 4H0FA 2FMTA 4NMXB 1KK2A 1EVJA 1GSIA 2ZBGA 3EUFA 5CW2A 4Z9BA 5ECGC 2W2LA 4Y3UA 2VDVE 4DBLE 5J2UA 1N77A 2WVAA 1QE0A 3OPYI 1AF7A 4L6IA 4MYRA 3SF0A 1G21B 4MDFA 4FFVA 5FCDA 2FMIA 1ZSYA 1UPUA 4C4ZA 1B6TA 2H9IA 3P0JA 4PINA 2DTXA 3W2FA 5JW6A 3DKKA 2ZSDA 1GAQA 2ZSHA 4FDAA 3C3JA 4GS5A 4HBZA 5KHAA 4BVKA 2H1IA 3BK2A 3I5XA 4C7MA 5JWRA 4EY8A 3F9RA 1GYQA 2WJIA 3ZCSA 3KELA 1LA2A 3B9RA 3QEMA 2OC9A 3GCGA 1XZFA 2O8FB 2C9YA 1VI6A 1DEHA 1BDJA 1U6KA 3DFZA 1ISGA 5ILQA 5SZIA 3KOOA 4Q6WA 3U9TA 2VNKA 2Z8YA 3OZFA 4Q3OA 1SCUA 4RTLA 3A32A 2PUJA 3TFQA 3VAZA 2YJ4A 4WXRA 2NLOA 4TV8F 4CL0A 3O1LA 1FDRA 3OJWA 1BXZA 4F04A 3U9SA 2X1VA 5AK3A 4O6VA 3JQAA 1XQWA 4DMHA 3TGPA 1O94C 2P1DA 4RD0A 5HILA 3JD0A 2CL7X 1IDN1 1J8FA 1ST2A 2VZEA 2VP0A 4EHNA 5LVAA 4BDTA 4C0KA 4JGGA 4UUOA 1RPAA 1O0BA 3OCVA 2QTFA 1D2GA 3QI2A 1JQ5A 5JC8A 4NAVA 4R31A 4C2BA 3R09A 4UDXX 4DUGA 1BA3A 1DZ3A 2PH1A 3V34A 4HV4A 1S96A 1XC7A 2ZIEA 3D1VA 4E32A 1XCMA 1M2HA 1L4YA 2C1EA 1FX1A 1WOYA 3CLUC 4PRKA 3G49A 4Z8XA 4ZRDA 4S04A 1WX1A 3GQBB 3EASA 3C16C 1HDIA 1EDDA 1JPNA 4KK4A 4P08A 2E7ZA 4JIMA 3PZRA 1WDTA 3O2NA 4GH5A 1E6WA 1Z0SA 3I6QA 1MG0A 4QQNA 3TM5A 1LF5A 1DE0A 5BRAA 8LDHA 1T0PA 4KAJA 2D6FA 2ZBDA 1EK0A 1MC8A 1SUWA 3ESCA 5DH9A 3UG7A 3V3TA 2OTCA 2JDIA 1QV9A 3AB8A 2IUTA 1EJ0A 3PUWA 4FNOA 1LBQA 2WW8A 3BSSA 1PZHA 2QPAA 3GOQA 3CEAA 1KU6A 3G2KA 5D84A 4JENA 2W43A 4LWOA 5DJ5A 4R1OA 1UT8A 3R5JA 1GKLA 3QFFA 1T10A 4BJ1A 2FW6A 3D6AA 1C1XB 4F7WA 3K0EA 1QU3A 3OY2A 4GMXA 3RS8A 1JR3A 1XRQA 1YB2A 2OWDA 3T0GA 1H2FA 1NXVA 3EK2A 3RFVA 1UC4B 4YQZA 4JA0A 1FMFA 4Q24A 2PU5A 3OCJA 3ZHXA 2P3QA 1D8AA 1S3GA 4AJOA 3AVWA 4P7BA 1SHZA 1K2WA 5JJLA 1N5RA 3CNHA 3G2JA 1MDFA 4UZSA 2D5LA 3O95A 4QUDA 3WWCA 4MDHA 4RKRA 1CEXA 4P31A 4QHTA 3E9NA 2DHEA 3EBPA 4DXAA 4E08A 1Z88A 4K1XA 1FQOA 2ZJ6A 4WLEA 3ZUGA 5HYVA 1QLJA 2P0YA 2LWIA 2VOEA 4R40A 1Q0TA 1UDBA 2ZU6A 3GHYA 1JEQA 3DLIA 2ZAGA 3I2FA 1LC0A 4TVOA 3EZ2A 3LNTA 5CT9A 4BKOA 4BWVA 3IUBA 5CM2Z 3GPBA 2C5GA 3QXSA 1BVRA 1DX6A 3DDHA 3OICA 4UW9A 3RU7A 1RXIA 3PHGA 4KO8A 4LC1A 4FIZA 2B21A 2ZS7A 3OQIB 1NV9A 1Z68A 4M8IA 4PG7A 2PWPA 4Z3DA 3CH5A 1JI3A 4JNCA 3SIPA 4JOBA 1NYLA 1P9LA 5E3IA 1YVRA 3GLFA 1BVYF 1IJFA 2C2ZA 5ICMA 2DUWA 4B76A 3SXUA 4TV8A 3HFJA 3RC1A 2EXXA 3D1JA 4MGZR 5CK4A 1SOAA 1PZEA 5L45A 3RBAA 5KYYA 3DOCA 3IAS1 4V3CA 4YAGA 4IDGA 3VJMA 5K8UA 4MVJD 1XNHA 3ANLA 4ECAA 4DSTA 3Q0IA 2JZNA 3LK6A 1X1TA 2FSGA 3L9XA 2HCFA 2HQRA 2JFNA 5HGJA 5T8KC 2KM1A 2P5SA 4EFLA 4M0EA 1TNDA 3EEIA 5JAIA 2QDKA 1TMGE 2W8BA 3P32A 5TS2A 1U81A 1TCVA 2H0AA 1GRRA 1P62B 3D9QX 3HCEA 3IP3A 4Q3EA 3OT1B 2W2VA 1D2EA 2H54A 2VCEA 2ZXEA 2AJLI 3DEYX 4LA4A 4WPGA 2HWYA 1P2TA 2VF7A 3K0BA 4HGOA 3MLEA 3RSQA 4RD2A 1NKVA 3Q5DA 3H5LA 1MX1A 3LZDA 4HDSB 4RZ3A 3RHSA 1M1XB 2DFDA 3ULKA 1XB2A 4BTVA 3H13A 1AO3A 1T2FA 4IIJB 1KYVA 5LIRA 2P62A 3DE5X 1MG5A 4P4LA 3R75A 3RF7A 1U2GA 3T15A 1SOVA 3ZTTA 4EKGA 2HHHB 4EVRA 1G5HA 4B79A 2QYHA 1UQTA 4V39A 4D98A 2JFOA 2CHVA 3KJNA 2ZLBA 1QZUA 1Y7PA 4KLNA 3SEQA 4PZLA 2H4YA 1EWYA 4A2QA 3GELA 4QGBA 1G3IA 2R68A 3QIVA 3Q7TA 5K51A 5ER9A 3SZRA 3WMEA 5CP8A 1TEZA 1PFUA 3LDAA 3UQZA 1YIDA 2IXEA 2VH1A 3K8ZA 3E9ZA 1PT6A 4P4TA 5CXUA 1OB5A 3CKKA 1FMJA 1MIOB 1EM8B 2C4TA 4JVMA 3PDUA 1RI2A 3LC7O 4G41A 4HP8A 4YIKA 3RVRA 3H4MA 4MYTA 3MSXA 5HMMA 2UYQA 3HU5A 1Y82A 2YN4A 4HNSA 4B6PA 3VO8A 4XI9A 1EVEA 1XAIA 2JAOA 4AF6A 3G5AA 2BVNA 3PHLA 3QPAA 4LJLA 1MT0A 1YKGA 1ZOSA 3O2QB 5F9HA 2WWTA 2O06A 1GZHB 5L3SB 3P9CA 2YMQA 1AVTA 2AOXA 4GQBA 2A7QA 4YXFA 1DB3A 2PKQP 2PYIA 3K53A 4G23A 4CHTA 4U7FA 1LS1A 1X87A 5AIBA 1G98A 2PR2A 1SHLA 2WQZA 4ZVKA 3RSGA 2QV7A 1F5SA 2P4EA 3C3WA 4LRSB 4K2AA 1P9NA 2Y4OA 5HE8A 2P2LA 4A23A 1M7BA 3VU8A 5ELXA 4ZIRB 2HA7A 2QLBA 1PT8A 3KU1A 221PA 5EZQA 4BKPA 3EGDB 1KI7A 2CZQA 2D5CA 4X3CA 2HHLA 3DYVA 1G21E 1G8YA 5D2CA 3WL3A 2ZCVA 2E2WA 4AZ3A 4TYYA 1V2GA 4WXHA 4H7DA 3TRIA 4AJ1A 4HQKA 3ZLTA 5LD2B 3O9VA 3WRXA 1T5SA 3QSGA 1YQGA 4Y0VA 2GT1A 4D8TA 4LWQA 2QVYX 2FPIA 1HYEA 4ZYXA 1APBA 3K9CA 3AINA 2DR3A 3T9EA 3FPAA 3WL7A 3GI1A 3ER6A 4H0CA 3SC2B 1EUDA 1WF3A 1I7NA 3GLSA 3ZW7A 5CA0F 2EVWX 6GPBA 2I7CA 3O8RA 2AKYA 2ZJ4A 1TJ4A 4MMZB 5EJAA 5JVDA 1VMDA 4E3ZA 4WVLA 4RQBA 5DN9A 2BHNA 1MU0A 1IRXA 2IHTA 1HWYA 2D2IA 1XMSA 3UH0A 1RQGA 2DMRA 3ZY6A 2VYFA 2H92A 4H7FA 1MAWA 2O3QA 2CHUA 2XBLA 4YACA 2IHUA 4LOKA 1N7IA 2QG9A 1L9XA 3PUZA 1ZD9A 3EA5A 3N1UA 4NJEA 4X8HA 4Y2JA 1W36C 1V8PA 3JQFC 4HPWA 1JJVA 1I0ZA 4G1UC 1GPAA 3D4OA 3IR6A 4Y67A 4K6FA 3OD1A 4DMGA 5KREA 5KQRA 1HE8B 4FZVA 5A04A 5JAHA 1X39A 4MXDA 2JD1A 4TTVA 2YY7A 2VHQA 4XVHA 3U60B 1TK3A 1WCXA 4QDJA 4CBVA 4H27A 5F33A 4BRWA 1EB8A 1RWQA 4HOYA 3F73A 5F9MA 3UTCA 2H2WA 2WU4A 3GCWA 3KALA 1L4EA 4I6EA 3I37X 1NVVR 3GAZA 1A4UA 5LBUA 3F47A 4TSRA 3T3PB 2FF7A 2GO7A 1E98A 3X2FA 3QBJA 4RJKA 5CTAA 5IASA 3MRXA 3C4VA 1EB9A 1JIUA 4Q15A 5TXGA 1NLFA 1JR3E 4HAIA 4MKRA 2OBNA 2ZUCA 1M0TA 3G2LA 3FPFA 1IZ9A 5FNVF 4L5CA 2ZYAA 5GY7A 1SXPA 2Y4NA 1UBJS 1ULHA 3NT5A 1E1DA 4CMCA 3ICCA 4PC3A 4YA6A 2D3WA 1PEYA 3QEMB 1QR2A 2NO0A 3IDAA 4HT3B 3NHFA 3VOBA 4WWHA 3DHYA 4MTCA 4QOJA 1XEFA 1NRJB 1WD7A 4DCCA 5LA6A 3CWCA 3N7TA 1PL6A 4NBKA 4D25A 1XX6A 1W52X 3IILA 5LZ2A 4WY2A 5DHTA 4HATA 3JU3A 1HL7A 3DOIA 4KRGA 4OBEA 3ZOZA 2EZ9A 2YS7A 3NIBA 2WMNB 3UJPA 3IAAA 4WFKA 1JQ3A 4A03A 3S1SA 3RGGA 4A36A 1IZ0A 3OD5A 2YYZA 2M1XA 3S28A 3V8QA 2X23A 1C3EA 3HXLA 3S2ZA 3IV9A 3O84A 2WYHA 3BL5A 3IOYA 4PR0A 4ZAYA 1FQKA 3VDRA 1WDWB 3WDLA 5KJCA 1L7NA 5CFMA 3DZJA 4X1KB 3R7SA 3VUEA 2BMDA 2CF5A 3MJHA 2FUNB 4N3CA 3K31A 3AYZB 3RKRA 3UWPA 4P3XA 5BY2A 4BE7B 2HL6A 1E3LA 3G88A 1H2BA 5CM9C 5AHWA 2SKDA 3SIWA 3RVJA 4DIOA 4BLOA 2W00A 1M2KA 3BXGA 1E1RA 3VU9A 1RYEA 4PSAA 1I32A 3CVOA 5KMGB 5A0VA 2WAOA 3RS2A 3C1OA 4JJKA 2PRKA 3R3WA 1XV5A 1D4OA 1Y4AE 4YRDA 4M55A 4QSMA 4UEKA 2QI9F 4GRDA 1EUQA 3OSZA 4DJAA 4KIGA 3QKWA 3ZBPA 1C0PA 1A9ZA 4OB7A 1KEPA 4X71A 4XQEA 2PAAA 4Y2HA 3VHXB 4A9AA 2QG6A 4JP5A 1KY2A 4YB8A 1WTCA 1RWKA 3V46A 4GVPA 5C80A 5I9IA 3E0QA 4NU6A 5MF6A 1SUBA 1YL7A 2NYUA 4W5JA 1JQLB 3AVUA 4DMCA 1CRLA 1LNSA 3ILYA 3KB2A 3CMMA 4EMBA 1Q7EA 2VP3A 3DFFA 4GW3A 2LKDA 1K08A 4AM8A 4B6QA 1XT6A 1VFPA 4GXTA 3N86A 5JZSA 4OFZA 1KP9A 1NU8A 3SX0A 1O9GA 1L7QA 3UANA 5FWDA 4LV6A 3TDNA 1D5WA 5B37A 2Y6UA 1LW6E 1Q0HA 1J2EA 2A9FA 2R4QA 3O73A 4LJ7A 1LH0A 1Y9DA 4JBNA 3DC2A 1XZ8A 4A0FA 4GFDA 2FR1A 5TMDA 2VTBA 4D99A 1QHHB 2ANBA 2BKEA 4UPVA 1XYVA 3D8TA 3KETA 1J0AA 1P4RA 3B5IA 3QPVA 4N5MA 4P33A 4UEJA 5A71A 1SOWA 4A0HA 3T3IA 1N2GA 1P2BA 4P7KA 5DLDA 4LRTB 4O4LF 2POQX 3HFRA 3ZZMA 1WO8A 2EBHX 3ZWCA 3AV0B 2JH3A 3LF2A 1LFDB 2H4JA 3RSFA 3BSYA 1AB5A 4RKFA 3MOIA 3I9OA 4LYAA 1X7YA 1R0SA 2VPYA 3KXPA 4PC7A 4DLYA 3GPIA 3NRCA 2AS0A 3HCCA 3I2YX 2BSAA 4K9OA 2ADMA 2IHYA 2QRUA 3AUTA 3H9JA 1U98A 4TTSA 4XM0A 2BFEB 4K9MA 3ZU4A 4QVIA 4YI5A 3FOZA 4YRAA 3H1EA 3KCNA 5IK2D 1OR8A 3RJ5A 2O8CA 1JA1A 1PG5A 3WSVA 5J4LA 2W2PA 4F6RA 3GAMA 1AHHA 4MDYA 4A82A 1GRQA 4H3KB 2Q0XA 3GLTA 4Q3CA 4OBXA 5HJ2A 1EXVA 3THWA 1C2TA 5JMPA 3JVUA 2FJ0A 1XZBA 2B6HA 1M67A 4GVLA 4NCBA 2XITA 4E88A 4ER7A 2CD7A 4D2IA 4C7OA 4FC6A 2I54A 3E4DA 3LQFA 1DELA 2RARA 1YIAA 5AHRA 4GI5A 3KSAC 1ABBA 5HF5A 2AFVA 4L2IB 1ZHFA 4JITA 1LTHR 1PS8A 3H6GA 3LCRA 1MOQA 3PNSA 4H15A 5F64A 5B7GA 3A4YA 3PC2A 1C1DB 4QBTA 4LI0A 1YQWA 4BYGA 1MC5A 5FBRB 2PH5A 2PXXA 5ILGA 3FBTA 3SJAA 3A10A 4RJJA 1DKRA 3DBVO 4D4IA 2YW2A 1NJ2A 2XWBF 5TQ2A 5FUMA 2BEVA 1F2TA 1JJIA 5TQ0B 3KPUA 3MHPA 4MNTA 1KO7A 5T6MA 1MAUA 1LS6A 1MABA 3COYA 2VOJA 2J33A 3I23A 4V24A 5BN4A 1IIBA 2WAXA 2O14A 4M7OA 2R11A 1T1SA 2NNLD 3MWJA 4KQKA 5LYJF 2FMKA 3AWIA 5U9CA 1RYNA 2YHAA 3IT2A 1E1NA 1WNFA 3TSCA 1KZYC 3OIUA 3CLUD 1YUMA 2L2QA 1E3JA 2WU1A 5AW1A 1DUVG 1FUEA 1UF9A 2QT0A 1S5PA 1WDLA 2WWGA 1M2WA 3NEJA 3O2SB 2B83A 4XWGA 5IM5A 2CL5A 2OV2A 3BZBA 3IAS6 1PR0A 3NOXA 3M1AA 4WJLA 4YJGB 1X1CA 2HLNA 2EFDB 1J56A 4AMYA 4MUXA 1TE2A 1YB7A 2PX2A 2Q3MA 4I4IA 2CKDA 5FJJA 2GRJA 1BAPA 2VJLA 3E15A 4IF4A 5B55A 6REQB 5ILOA 4MV9A 5C5CA 1U94A 2WA2A 3HO8A 1MN6A 2CHFA 2R47A 3EGIA 5IJ0B 4HY3A 2HSZA 1YUBA 9LDBA 3PGA1 1IEQA 4D9GA 1E2HA 3WAGA 3WB0A 1OAOC 2HLDD 1TC1A 1K8QA 3BGSA 1QFSA 1L7AA 1WPQA 1HTBA 1QK5A 3EVGA 4ZV7A 4EHBA 5IMSA 2Q2NA 3U16A 5DWVA 1ZG3A 4FHGA 4M6WB 4M9QA 2GN2A 3RRFA 3SOPA 3IXLA 2A35A 3MMZA 1ENYA 1KI2A 2MHCA 3HBNA 4F4FA 3A9TA 3LTNC 2C4HA 3OP4A 3ED5A 4L85A 3IXMA 1H8HD 2IYVA 3QUCA 4YCDA 4A8PA 4E3WA 4EK9A 2XMSA 5AW7A 3K2QA 3ZVKA 3HN2A 1ODCA 2G63A 2OO5C 4TOIA 2ZBFA 4UVHA 3VXKA 4TWZA 1PS0A 1JIXA 5JAUA 10MHA 4YN3A 2F17A 4ESVA 5K7SA 1DADA 3H2HA 2F2TA 3CCFA 4C30A 3L0CA 3WGZA 3S2EA 1YHYA 3F6SA 3IA7A 3PUXA 1QQBA 4LJYA 4IL5A 1SVWA 1YB5A 1DTSA 3C98A 4B87A 4B74A 4EGAA 2FMUA 2I29A 3KFLA 1PFKA 3EHDA 1MO2A 4LXTA 5EWMA 3DDZX 4J49A 4LFAB 3DZHA 5JZ9A 4KRXA 3IO3A 5K3BA 1J1ZA 2AHRA 5I9NA 3FPBA 1UPFA 2ZEJA 2HSDA 2PBLA 3KOUA 1AV7A 4L5BA 1QDEA 1ISPA 3EGXA 5HIMA 4FEAA 4QQRA 3SYLA 3Q7EA 3I64A 7YASA 3TD9A 3LWDA 2X6QA 2HF7A 2OT3B 1YZNA 2HIMA 5DIZA 1Q0ZA 4K03A 3NM6B 2HJGA 4FCTA 2Y9MB 1EIWA 2JBAA 4WRRA 5AM3A 1QGZA 3VPFA 1TTHA 1UFQA 3ICEA 5BQXA 4XYGA 1G1AA 5JFGA 4US0R 1P9OA 1I6MA 4OHXA 3HJBA 2A8YA 3LH5A 1OXTA 1W4RA 4RPGA 2C4WA 5K09A 4L28A 3BL6A 3GR6A 3FR8A 1NLYA 2WIBA 3RU2A 4RTQA 1EVZA 4DUYB 1EDEA 1KWKA 3GUHA 1H66A 4CG2A 2C7VA 3MAJA 3R9KA 4RJLA 5HKOA 1EEHA 1KMHB 2XJ9A 1TC2A 4FGUA 1FNDA 3KQKA 2FWRA 2FP3A 3GGOA 3E5MA 1X6VA 3C43A 3MMXA 1GZ5A 5DPMA 2CE7A 3RW9A 1NMQA 4C3UA 2J6IA 3KZNA 4X97A 3TMYA 2HDOA 3W3ZB 3ZK9A 5JFTA 3I62A 3C87A 1R16A 4EHAA 4TUYF 1B8NA 1CYEA 1ZR2A 1C1HA 2PIAA 4EB3A 4NHOA 2IYWA 4OHMA 2R751 2G9RA 3T3HA 1PR3A 2OCLA 5JASA 5AK4A 1H8EA 5HM6A 3V48A 2ZU0C 3KEFA 5KOIA 4CIAA 2G9VA 2O23A 1TA0A 4EUNA 4K9RA 1GCUA 3BMQB 1OASA 3TTXA 4MP8A 2LVBA 1KQGA 2KS6A 1VXRA 1KEWA 1TZKA 1F3OA 2MYNA 2PAFA 2I4RA 5KOJB 1TAGA 1WSDA 3AJ9A 1KPIA 3JYPA 5K01A 1RRVA 1XKQA 1N8SA 2P90A 2WJ6A 1KYQA 3HXQA 1R0RE 4X00A 2YMPA 4BB6A 4R01A 5LD2C 5HZMA 2UUPA 4LK3A 2NG1A 4N3BA 4TM8A 3WYDA 1IZYA 2WUWE 4IXDA 4YJ2A 4WOCA 1QM5A 3B82A 4CM4B 4R4JA 3NS7A 3GGGA 4I3GA 1N3IA 1Y6ZA 5CFPA 1XKTA 3GLIB 4Z3OA 3RVSA 4DWWA 4KQHA 4MQ5A 3Q7PA 4QIHA 4E5DA 2ZRDA 1ND6A 2PEYA 5I9TA 3CX4A 4JL6A 3HXKA 4C1BA 4N0MA 4IDOA 1HA3A 5AKXA 1I2BA 3DMHA 4IMPA 4ZCQA 5IKXA 3U5ZB 4UTPA 1Z7EA 2HHAA 1LSOA 2ZTMA 4C5CA 4UFPA 2VSNA 1AKMA 4FNGA 1FF9A 3H84A 4KQ9A 4UBLA 2VQDA 3WL8A 4ZWNA 3C6QA 3BRSA 3WGGA 2I99A 5JO9A 5CFLA 4G0VA 3AVTA 1DFHA 1P18A 3OIVA 1QDLB 1TADA 2X13A 4IV5A 2NUBA 2VFAA 4YCJA 3TAHA 3W5DA 2PUCA 3EEQA 3CU5A 3PD7A 4RV9A 4TV9F 5JCXA 2JI6A 1PW7A 3DULA 5CT8A 4WY8A 5BXYA 2SHKA 4DB4A 2F55A 5J23A 4D9EA 3D64A 3EZLA 5JNVA 3BGVA 3CSSA 3GMDA 3SHOA 2AEJA 1NLMA 3CZRA 1EFUA 3DZGA 2IL1A 1YJBA 4WBNF 1B3RA 3GDGA 1JN0A 3DT8A 3QVKA 4UMEA 4ZVQA 1KDZA 4HFJA 2YJ6A 3VFDA 1N0WA 2VEDA 2ZAYA 1M34B 2W9XA 3SEZA 4F06A 2GCNA 2Q5EA 4Q4DA 3UB3A 2ZATA 3L7NA 1VJ5A 2ZWIA 1K5GA 3NHMA 4XLLA 4YNBA 3ZNNA 4PICA 2YIVX 1QP8A 3QPUA 3L4BC 3QFRA 5A4MS 5HR5A 1FL9A 4MTLA 1FS5A 2DKFA 2E4AA 4PQRA 2EWWA 2H17A 4L78A 4WBSA 5GGXA 1QRTA 3QFCA 3KJZA 2UV8A 1AKUA 1MO6A 2BKUA 1DBRA 1S1CA 1OV6A 3ZY5A 2QBYA 3B6ZA 3OJCA 4W5HA 3PGVA 1Q19A 2FP4A 4U8GA 3TAUA 5EJ4A 2WEKA 2OPBA 3W79A 2DJIA 2OVBA 3QY9A 4I8IA 2ODWA 3LT1A 1U8ZA 4HDSA 4TKLA 4GSLA 5BN4B 4B9AA 1AN0A 5BQ3A 1R5NA 3C3EA 2X76A 1PNVA 2AZ4A 5HCNA 5E6RB 4N82A 5KNDD 4IMRA 1XAGA 4MINA 1VMEA 2DP4E 3DHNA 3ISVA 1N1GA 1ZCFA 1I8TA 1NOIA 2WBLC 2I6GA 1RT9A 3FDFA 1LNZA 3NBXX 1XU9A 1MEEA 4LFCB 4NCJA 5I7EA 3RADC 2GA9A 2GN0A 4D92A 3C8HA 1ISSA 1X7WA 1NVDA 4P3NA 1EP1B 4D9BA 4LHSA 4QPJC 1V1MA 3X1ZA 4QUIA 4EG0A 1A8HA 3IOBA 3AJDA 3MSCA 3BGDA 2E82A 3FCXA 2XHEA 3QX8A 4O8CA 1TJ3A 4W9NC 4DJJA 1T34A 2PLWA 5BOSB 5C8YB 2IOFK 4GOXA 5D3MA 2I65A 1GKIA 2OGSA 3OQNA 2ZSJA 5EJ6A 2I33A 1JFSA 4HN2A 2OFOA 2GVNA 1Z34A 4AN4A 2WTBA 1JU3A 4F2DA 2XE6A 1Q6ZA 2OENG 2Q1UA 3P9XA 4UD2A 5L4LA 1B1CA 1VYVA 3DKIA 2AJCA 2WNSA 2QGFA 3L8FA 3P2IA 3AEQA 1JYSA 1KJYA 2JLWA 1VPVA 1GYRA 4IMIB 3VGPA 4PWYA 1E1KA 1NBMA 2P27A 4QYWA 3L4EA 1LNQA 2YRFA 1H0KA 2W48A 1QJCA 6CHYA 5KSOA 1DQPA 2XMZA 4RTSA 1WZEA 3VVLA 3NHWA 1ZC4A 4DLVA 1T4CB 1FVFA 4WZ6A 3ZXUB 3HA2A 3UKJA 1IHOA 2CNWA 3NTLA 1F9AA 3IVXA 2ENUA 4EP1A 2BCEA 4KI0A 4N76A 1NVEA 4BJHB 1Y3BE 1Y5RA 4ZREA 5IWCA 3THYB 1EZ4A 3AF6A 3A31A 4EKDA 3QF4A 3GEIA 4HX9A 3V7FA 2D2FA 3RVDA 4XSGA 4E4RA 4WESA 4EF5A 4EDFA 2KW5A 2QUBA 1GSOA 4B4DA 4PIPA 4BLPA 2Q3FA 3BH0A 4MHSA 4PZ9A 3U1TA 4F2HA 2J4CA 2WVJA 1V45E 1ZUHA 4F3RA 1D3AA 3I92A 1DBIA 1QO0D 4O2AF 3QVGB 1TT5A 3CVYA 2OYSA 1UDXA 3DL7A 4CM7A 5DN6A 2W2LD 4OI2A 1YA6A 4LDPA 3K1TA 4KBYA 4FHEA 4LEIA 3TIFA 1PKEA 1QGYA 2YINC 3HKEB 4K1LA 1H1TA 9GPBA 1E58A 1MIOA 4BNNA 2B8EA 3NAZA 4MRAA 4ZHQB 5I7FA 5J2UF 4BO0A 1FJXA 4RC9A 2AA3A 1REQB 5T64A 2QAJA 1RXCA 1N3YA 4V0LA 3NDIA 5JY6A 5AI8A 2BWJA 1EWQA 2PQMA 1W36B 2WIAA 1SHTX 2CJWB 3IUQA 3LBYA 2IHJA 4NZOA 4YDHB 4AB1A 4BJ3A 5I9LA 3EGOA 4AXBA 3WYNA 3V2HA 4GZ5A 3WYBA 3UCXA 2PL3A 4TQUS 1SPXA 1XWIA 3UVEA 3A6PC 2O2EA 2VTVA 3BMCB 5EY5B 1XL0A 4BV2A 4Q21A 1D6SA 1T29A 2YBDA 3EGWA 1KO5A 4N18A 4MGYR 4JLSA 5AKKA 5NLLA 3SZ3A 2CV2A 1TX4B 5HS6A 3WZLA 4B81A 4YTEA 5JNSA 1VMIA 3N2IA 4XE5A 1JKIA 1RI3A 3AK4A 3IPXA 5NULA 3VYUB 3ZX5A 2FEPA 1GQQA