3II6X

Structure of human xrcc4 in complex with the tandem brct domains of dna ligaseiv.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
258
structure length
256
Chain Sequence
KISNIFEDVEFCVMSGTQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/dna binding protein
molecule keywords DNA repair protein XRCC4
publication title Structural and functional interaction between the human DNA repair proteins DNA ligase IV and XRCC4
pubmed rcsb
source organism Homo sapiens
total genus 67
structure length 256
sequence length 258
chains with identical sequence Y
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
X PF11411 DNA_ligase_IV DNA ligase IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ii6X01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ii6X03
4Y2GA 4OFBA 3QVGA 1T2UA 3I0NA 3PXDA 3PD7A 4JLUA 2K7FA 3PC6A 2INGX 3EF1A 3PXBA 1L7BA 2XNHA 3JVEA 3PXEA 2L42A 1T29A 1Z56C 4XQ0A 3U3ZA 3HUEA 2NTEA 2HTFA 3T1NA 4XPZA 1IMOA 4N40A 2DUNA 1T15A 4ID3A 3UENA 3PC8A 3UEOA 2D8MA 1L0BA 2E2WA 3I0MA 3SQDA 4Y18A 1KZYC 2ETXA 2LE0A 2R1ZA 4BU0A 4IGKA 3T7JA 3QVGB 3K0HA 4BU1A 1WF6A 3COJA 3OLCX 4U4AA 1CDZA 3AL3A 3PC8C 1OQAA 3EF0A 2M2IA 3L46A 3FA2A 3L41A 3PC7A 5ECGC 3PXAA 1IN1A 3K16A 3T7IA 2VXCA 2COEA 3T7KA 2COUA 3SZMA 2VXBA 3L40A 2EP8A 3SHTA 2EBWA 1JNXX 4IFIA 1N5OX 1GZHB 3SHVA 2EBUA 2COKA 2ADOA 1T2VA 4BMCA 3II6X 3AL2A 3K05A 3PXCX 3HUFA 2K6GA 3K15A 3K0KA 3PA6A 2AZMA 1Y98A 3KTFA 2WT8A 2XNKA 4BMDA 2JW5A
chains in the Genus database with same CATH superfamily
2DZDA 1XLTA 2ZJ2A 3VYRB 2X7JA 2WNHA 1C1XB 1SZPA 2O2CA 3DVLA 4MULA 3TDMA 1U63A 2CWDA 1EPUA 3F74A 4OAPA 5D5PA 3LRTA 2XB4A 4P7BA 4PBRA 3FG9A 3TWOA 4URWR 3Q9LA 3HYNA 3FYDA 4IIXA 3T3HA 1SCQA 3CRQA 3VTKA 2XW6A 4JB2A 1ID8A 1T2EA 1XZBA 3HB5X 1UDAA 1PTJA 1R0KA 1W2HA 2J09A 5BW6B 4N18A 2Q5FA 4C7KA 1T9HA 4GBED 3QNMA 2R8ZA 2EW2A 3KJEA 3CUUA 4NFYA 3OBBA 4O2BA 4E1BA 4L95C 2W6IA 4GZLA 1P61B 1NVTA 3CCCA 3JPYA 1OR8A 5KNCA 3NDIA 2HCBA 5DYYA 1EJ0A 1XEXA 4M4SA 3URMA 5E2IA 4X5OA 1TU4A 3QPWA 4UCXA 4US1R 4WH0A 4YLGA 4I9UA 1HGXA 2LUOA 4JHLA 4I4CA 2VHJA 1X80A 3DDSA 3L79A 3N2EA 4O25A 2W83A 1MG0A 4Y2QA 3ECCA 3LUPA 1TC2A 5D3MA 3JS5A 2AMLA 1IUPA 1YVEI 4ASUA 4DLKA 4B3RB 1Z9BA 1RLJA 4AAYA 3ZY6A 2W2PA 1M6VB 5JI3E 5AESA 5FI1B 4O3MA 4EHIA 1U90A 4OHCA 3LBYA 1KMHA 3BXFA 2DBVO 1BZYA 2R00A 5DBEX 1XNHA 2F1HA 4QGAA 1G19A 2UXDB 3LLMA 2GAAA 3UA3A 3M0EA 3RUEA 2NSJA 1PWEA 3BK2A 3Q9UA 4QFMA 5AM2A 2JLBA 2YNMC 4E70A 3AOEA 4BMSA 1G6OA 2Y4OA 4F0JA 1V11A 3D6TB 1Y1KE 1QU3A 2YMLA 5HM6A 2XCRB 1EVKA 3AB7A 4ZGWA 1G64A 2B1IA 3RTBA 2BGLA 3FTCA 1J33A 2B0CA 3KTAA 4A8HA 1TJ4A 4WCFC 5CD1A 4WUVA 5G02A 1GZUA 1KMNA 2RHTA 2V6GA 4B6JA 4DV1B 2DB3A 8ABPA 3C3DA 3NAZA 3IHTA 5JVDA 2VDKB 4ZU3A 4KWCA 4HDKA 1G4UR 4NWIA 3V46A 4E7OA 3ZHRA 1DFHA 1FJHA 4FD3A 1S2MA 1PLLA 4GICA 1KC1A 3QTBA 1MF7A 1DBWA 2ZRQA 3OECA 4PZPA 4YP5A 5IEBA 2D5IA 1EVIA 5BYAA 3ASZA 4DT1A 3L02A 2ZYVX 3H1FA 1EA7A 4UDOA 3A2MA 1L4FA 3QX8A 3UHFA 2I76A 3B5JA 4Q05A 4QLOA 2N9UA 1QP4A 5K3SA 1SCNE 4G5FA 3UMFA 2W6QA 4YDQA 1WXEA 1IBLB 1P91A 1DKLA 2IYXA 1QIDA 5IZ4A 1GL6A 4M6WA 2QEQA 2O0HA 3TTUA 3K15A 5T4HA 1GYRA 1NQAO 5AOCA 4S35A 1BN6A 2EFYA 1C0PA 3A6LA 3CSDA 3WV5A 1G8PA 1C3JA 4YIKA 1Y1LA 2WVHA 4DM7A 4EL5A 1GU7A 1RJWA 2OBNA 3N0VA 3W5JA 5DGTA 1OMOA 1W36C 3IP5A 3COWA 3V1MA 4BGDA 3VR4H 2JLWA 3HN7A 4JLBA 4ENQA 4KXNA 1ULTA 5I4KA 2DUMA 1A8PA 5KDLA 1NJ8A 3VM6A 3SFTA 1U8CB 4XGNA 3L8ZA 1Y5LA 1KZ1A 1U0FA 4CKBB 1SVUA 4OSOA 4W1SA 1C4WA 1L3BA 4CWAA 1IXYA 1WSWA 3DTNA 1EM8B 4FWTA 2JJQA 3FCEA 4DR1B 1LDMA 4H4CA 4S3MA 3RG8A 4CYMA 5F2KA 2A1TR 1NN3A 1PN3A 4UM8B 5ECDA 1XGKA 5CEEA 3E6AA 3LX4A 4PBSA 5FBZA 3ODGA 3O21A 4CLHA 5BVGB 2W8BB 5LA6B 3U3MA 3U3RA 5KQGA 3T1YB 4WVLA 3VZQA 2BGKA 2HOQA 3QMPA 5DX8A 1P72A 1A77A 4N3GA 5DASA 2TYSB 3WGZA 5L4NA 2CXQA 3MWDB 4KPUB 4C5CA 2J5RA 3HR8A 4MUJA 3KSRA 3LV8A 1IZ7A 3AQ4A 3OZFA 3RAJA 4HGNA 3DEHA 2W8ZA 3QBTA 4CV0A 1VHDA 3I39X 4KFRA 1M2OA 4MUIA 2GNOA 4OQXA 2W6JA 2ONYA 2XMCA 2XV1A 3F6EX 1UMCB 3TLGA 2HQ1A 3QITA 3ZUGA 2NXWA 3FIUA 1I2MA 3K9WA 3VDNB 4XOIA 3E4CA 2J33A 1CJBA 1Y4ZA 4Q1CA 3U7HB 4KLRA 5CXSA 2AXEA 3JZDA 3W90A 2Q2NA 3N28A 1F51E 1GPMA 1P5JA 1VBKA 1E0DA 4OF4A 5GONB 3P2KA 4GXTA 4L4YA 3T7JA 1WXIA 2VOEA 3K9HA 4RPCA 1DO2A 1GPJA 1K7CA 4F84A 5JYEA 2QP4A 3ZDCA 1V5IA 1XQ9A 2RGWA 1U81A 3KQNA 5T4FA 3OLCX 4ZK2A 1RZUA 4EKIA 5J58A 3QY9A 1KERA 4B3XA 1ONPA 1OQAA 1RHJA 2UVDA 2WV7A 4MPPA 4Q6BA 4UD6A 5EJ7A 2MSKA 3THWA 2I87A 2V0CA 4KKXB 1A98A 4Z86A 4JWKA 3REOA 4QD3A 3N2KB 4PX3A 4MVJP 4Q15A 3TJRA 4Y7DA 3IUBA 3QKRA 3FFBA 2X77A 4QGSA 4ZKDA 1Z8FA 2OSBA 2GERA 3DZHA 4IX1A 4P5EA 4TLDA 4Y2JA 4BE9A 2AW5A 4MKGA 4BQNA 2RHOA 4C6TB 2QQ5A 3ROGA 1NQVA 4DMUB 1FP4A 3PFFA 3PHBE 3GJZA 4EIWA 4UXHA 3ZEIA 2WM2A 2C9DA 1RBMA 3T9EA 1NG1A 2IWHA 1YR1A 5CVJA 1PS8A 3WRXC 4G1CA 4B32A 4ZJZA 5IBQA 3SPXA 2YXPX 5JH7A 1IATA 2VDPB 4TV9B 4H16A 3A0RB 3MTJA 4R2IA 3SAJA 2B1GA 4PAOA 3CO0S 2FNAA 1S3GA 4XW2A 3QLVC 5LB4A 4GIBA 2UXCB 3AGPA 4QFDA 4BLRA 1ACLA 5A4IS 1NNLA 1FYVA 2IY8A 3MQ4A 1BX0A 1W5TA 1CF9A 1B76A 3HTXA 2B8TA 1YE5A 2AFHE 2R1VA 2WTUA 3GPLA 2I67A 3CT6A 1B8UA 2QPOA 3TZHA 4AJOA 5HS4A 1VP9A 1KVQA 1LLDA 2FEMA 5ES3A 5BV2P 1IWOA 4DEYA 5JRDS 5IX8A 3ON5A 1YXMA 4LN1A 1E60A 4QXMA 4HDAA 3OF2A 4DOMA 1OYVA 1PEDA 1NJSA 2QVZX 3E0QA 2K7ZA 1K68A 4DR2B 1G66A 1WV0A 1UWCA 2M1ZA 1N2BA 4CMIA 2PKQP 3RV4A 1VHJA 1UWVA 3HCEA 5EAIA 4DC0A 3U6KA 1CUDA 3RTAA 5ERGB 1W5BA 1ZXBA 3DFMA 2JJ8A 4DLVA 1U1GA 4PLHA 4YFYA 3UUEA 5F9FA 3TVTA 3DLPX 4QQNA 5EEHA 2IUFA 4XUCA 4CNQA 3PDCA 4DSZA 4PLCA 3I2KA 3DDOA 3QFCA 4EZEA 4DDVA 3H87A 1QS0B 5BSTA 1C80A 1MA0A 1X3SA 1RSZA 4DUYB 3R9XB 4CMGA 3AI7A 3AVUA 1T15A 5IAGA 3B89A 2FJUA 2ZE6A 1W0JD 2Q5IA 4LSWA 2GTIA 3FYTA 2G71A 3D1JA 1ZD8A 3KWMA 4NU6A 2ZIFA 2P6UA 4JXJA 3ZBPA 2D00A 1UKBA 5CH3A 4P4TA 2G9NA 3A8TA 1BH6A 1D2NA 3HKEB 1AXEA 5A02A 4F5ZA 5IF9A 5ADWA 3RYCB 4B3BA 2CJPA 2Q3JA 3WMRA 1U0EA 4FQ7A 1JDZA 4WGGA 5AVTA 2QRLA 1KZGB 2E18A 5FTWA 4NJEA 4WXYB 3DVRX 3L1VA 2I1WA 2E4ZA 4RKFA 1UM9A 2UVPB 1Z22A 2X22A 2WE8A 2JLRA 3LPMA 3CVYA 2PXHA 1QH1B 1ZWKA 1KJZA 2E48A 2YWXA 3L82B 5E4FA 4E5NA 4ZO4A 5GINE 1E1KA 1K5GA 2HWKA 4IJVA 2XI4A 4F91B 5FLYA 1B41A 2EF1A 4YRLA 1YS2X 2PUGA 1QZ3A 3CX4A 5F51A 2YZKA 3K0FB 3FH0A 3AHIA 1T2CA 4Q4DA 2VXCA 3S8YA 5KWSA 1SD1A 3GD5A 3RF7A 3SZMA 3DAPA 1R3DA 3N6RA 1FRVA 2B5OA 2FRXA 4KDEA 4WXPA 4B2IA 1CF2O 4XYEA 4CF5A 2VZEA 1N6OA 3DBHB 4YUVA 1A9XA 2DM6A 1R0LA 3U7FB 4FMCB 3OY7A 2WAMA 1GR1A 2Q6VA 5B7QA 1N77A 1MEOA 1T36B 1IRXA 1ZUNA 1BFUA 1VJGA 2EBUA 3P20A 4KODA 5IK2D 5LR6A 3M49A 3BDIA 5IYZB 1F20A 5KSYA 1G17A 3PI7A 1WXFA 3TE6A 4CDNA 4P4NA 1UZAA 3MTBA 1G1AA 3GUUA 1L5VA 2R7MA 3FDXA 4PG7A 1NR7A 1VKNA 2ZS8A 3OTWA 1DHRA 1ODKA 4J16A 1KAOA 3K5IA 4HQRA 3M83A 3UPTA 4FCTA 3E1GA 3DO6A 4QLBA 4D0GA 5KPDA 3FTQA 5C2JB 3NHMA 2PZEA 1ES9A 1K3TA 4FHDA 3SF8B 1ZK1A 3SNHA 3VOTA 2PAAA 2Y66A 3QVGA 2VCEA 3ZDZB 5AVSA 1AQNA 1VKZA 4IUDS 4XASA 4E3ZA 1I0IA 2BJVA 1SOAA 2OZVA 2QT9A 5F2EA 1FUIA 2QP9X 2Q8PA 3ESDA 5H02A 4BNGA 4QPPA 4AC9A 5CA1F 1BDIA 3WGIA 2H4HA 2H57A 1X7ZA 3GZ4A 4OATA 4YH1A 1JH9A 4OTZA 4ZMSA 2A84A 2NTYC 4DA6A 3L8FA 3I05A 4KVGA 1WSBA 3SIXA 3TQRA 4YCCA 2V45A 1M0WA 4RD6A 1JXQA 1QSGA 2R6DA 2X0IA 5SYNA 2XQVA 5EJIA 3KD3A 4R1UA 1Z56C 2FZKA 3LPAA 3MSCA 3L5OA 1IVYA 5EZYB 4L2IA 3P9XA 4EKDA 4EHJA 1AQJA 1FNMA 1PHPA 1E1LA 1N3BA 1IZZA 3TAXA 1QK5A 3VNQA 4D3YA 4J2OA 1I13A 3THRA 2BR4A 2PGOA 2VYFA 4YROA 1HNWB 4Y2PA 1H8ED 3WIVA 1JLLB 2B6HA 1IUKA 3W2FA 1I36A 1RQXA 1WXDA 4X8HA 2QRPA 5EL0A 4L5YA 1M6WA 3S27A 1E2FA 4FN5A 5JNSA 2JDIA 4POAA 3KHSA 1HE1C 1TA0A 4KQKA 2R7KA 1IM8A 1VYVA 2PZ8A 2RGNC 2ZIXA 3JW8A 2IFTA 3RT9A 4BWYA 3UK0A 3KR2A 4H9GA 1NVFA 3HVRA 3MWEA 5G1OA 3AEQB 1FTQA 4C4ZA 1E5DA 4ZYZA 4X65B 2QKYA 1BMFA 1VKRA 1Z0ZA 3K92A 3ANYB 4YFVA 1ESEA 2Y6VA 2FW9A 3GDOA 4H7EA 3UYLA 2Z2JA 4OQQA 4A15A 4MSUA 1KH1A 3FB4A 2BFFB 4MDEA 1LW7A 1V7CA 3M9WA 1CRQA 1J7KA 1E7RA 1HYGA 2YOHA 4TWRA 4RZQA 1XALA 4UASA 3DLTA 1NP6A 4L78A 3U9SA 1AB5A 1UC9A 2JKYA 1O0SA 2E85A 5U4XA 4ILEA 2BM9A 4PIVA 2P30A 2GMWA 1SUIA 4KFTA 3B5EA 3LGXA 3RVBA 2OHIA 1P7ZA 2P62A 3O6VA 3IILA 4YJ3A 2C7PA 2BUAA 3FA2A 3JR7A 5EQJB 1G7RA 2IKSA 1X0XA 4OOEA 1GDTA 4DRZA 2BP7A 1BSVA 5FOSA 4KFCA 3SYNA 2J08A 3DDWA 2RH4A 4KVAA 1EZZA 1PAUA 1VLMA 1NP3A 1YBVA 3I6QA 1OAOA 3GRUA 3MCWA 4KOEC 4RVCA 1LS6A 1QRSA 3CGWA 1FFYA 2HK8A 3MINB 2Q4EA 3P4UA 5J2UB 4I6EA 4EQZA 3WLMA 5TQ0B 4IXDA 1VRVA 2IZZA 2ZB7A 3IT3A 4EY7A 4JB0A 1QM5A 5BVHA 3Q8KA 3KT6A 3I6BA 2G4VA 4DIEA 4F3CA 3CLVA 3X1MA 2Z08A 2VP0A 4G36A 2VDVE 1BC5A 4HSEA 1ML4A 4LTDA 3HXOA 4RSRA 4K0KB 1IHDA 3LQRA 3PFKA 3MUEA 1NUQA 3BSFA 3RYTC 3PXCX 2PH1A 3TGWA 1TJPB 2A5JA 1IQRA 1XZ8A 2IL1A 3K1TA 3GX1A 4YRKA 2BM0A 3LGAA 4DIBA 2ECQA 3D3KA 3OQJA 3B6JA 1D2EA 5DB4A 4BB0A 3KM0A 4BO7A 2D1YA 3A1DA 4RA6A 3FVVA 4EY5A 3TINA 5G40A 4CQNA 1DEOA 3KKNA 4OJKA 1FDRA 1NVAA 1D1PA 2BSXA 4LDQA 3S0JA 3OH8A 1EP3B 4BNKA 1VBNA 3O3CA 5DXAA 3SR0A 1VPWA 2C58A 3ERCA 5EUCA 3A6ZA 4L5IA 4ZJUA 2XT6A 5CA0F 3MT9A 5FTKA 3VO1A 3HJUA 3JQ8A 1G55A 1OJLA 2P2CA 3STYA 3E2MA 4E1VA 4B4UA 2BFCB 4K6HA 4UPEA 1QAOA 2W2KA 4L27A 3P2JA 2IPNA 4DZZA 4ZCIA 5FP0A 1W1UA 2WTAA 3G8YA 2RJ3A 3DBVO 3IHLA 1NE7A 1GADO 1KFEB 1NDUA 2X19A 3HL0A 3JAKA 5B1IA 3SZRA 1P3Y1 2RDMA 1LDYA 3DT9A 4EFMA 4D3FA 4B6PA 5LZ9A 4DB2A 1UBCA 1XQ6A 3LL4A 4TVKA 2A3NA 1N6HA 2ZB2A 3H5LA 2D5BA 4JLPA 4GGPA 1SOUA 2VQFB 1H42A 4AS3A 1UWLA 2H1VA 4YB8A 5KNDA 3PC8A 4B6QA 1YS7A 4D4HA 2FPPA 3EQ7A 5J47A 1WNTA 1JAXA 3CKLA 4M9CA 4BNYA 1GUZA 4Z0TA 4C4RA 2FEXA 2VUTA 3S55A 4TSRA 4L4ZA 2D5AA 3MGCA 5FBWB 2IGBA 1GR0A 5G2OA 5HVNA 3QX3A 5IJXA 1E3MA 1AIPA 4FR0A 1IULA 3UA4A 1G5QA 3SBOA 1T5SA 2H4XA 2VDRB 4A0GA 1JR3A 1Z6YA 4P86A 4BEJA 4G8DA 3OIVA 1EQAA 3KLPX 5L3SB 3HVUA 5ICEA 4FUQA 1KOLA 3VYUB 1XP5A 2EJUA 3G9TA 3GLGB 4G9GA 1SUWA 4X63A 3LXXA 3ETLA 1ECFA 1HSOA 2FLVA 2JEOA 3AHFA 3L7JA 4BQFA 3AMVA 1L5QA 3PU6A 3U7QB 1RWNA 2PTGA 2VH5R 5KYYA 4IO1A 4O4JF 5L95A 3T6KA 1WUIS 2I2XB 3KALA 4S2EA 3SZUA 4C0JA 4D5GA 1Q44A 2W71A 3E03A 2HJHA 3EQ9A 1Z08A 5LQRA 2G1JA 4X7BA 1QGDA 4NEHB 4MYHA 2JKZA 3BDVA 4MP8A 2JIQA 3VBEA 1XP8A 5F73A 3WKEA 1S2OA 1D7AA 1OIXA 2NZ2A 3PHHA 3UPDA 2JNWA 3EEOA 3HNOA 1SURA 4OXRA 1STOA 3KG2A 3KIPA 2PAFA 3LKDA 4RORA 4NJMB 1I7QB 1A4UA 1QP7A 3I6YA 4AN0A 2QRMA 3CZCA 5AM1A 4NSNA 2FSFA 3N0XA 2FWAA 3I9JA 2JLUA 3N2GA 4O2AF 3V4VB 4BV8A 3MCZA 4Z53A 1LFAA 3RC1A 1QOQB 3MT7A 4EITA 1E9EA 2ZTSA 1DFGA 1IE3A 4EHKA 2CDRA 4J29A 1L8XA 2OP0A 5DYTA 4MVJM 5AOAA 5JCJA 4QM6A 1H2EA 3DV2A 3KEGA 2J0VA 4HPWA 1O4WA 1U4SA 3DOUA 3JASB 1K9VF 1LGYA 5FL7D 2F3RA 2A5FA 2QL7A 4JJGA 3WK8A 4TOIA 4G0NA 4O1IA 5JJIA 3L6CA 1ZHHA 2C54A 1DKRA 3LP8A 4P3PA 4RADA 4X45A 5IUNC 1J5EB 1MEJA 1XTVA 4XD7D 1SBIA 3K5WA 2W43A 4XSVA 4IAOA 5JSQA 1D9XA 3WHIA 4RK7A 4XFJA 1N2GA 9ATCA 4MICA 2OQVA 4XARA 4TM8A 3EODA 1U0JA 4Q3LA 1W76A 2BOVA 4GR5A 1YHZA 3E7XA 2P4HX 3CEPB 1Z63A 3Q8XB 4NQZA 1N1MA 2QJTA 4FYYA 2FG7C 3LPLA 4JP1A 1WMSA 1TQ4A 4OHYA 1G20B 5KZMB 2GJ8A 3LVRE 1Q7BA 2YNMD 1A7JA 1FP1D 2YN4A 1NU8A 1DG9A 2IHZA 3JRXA 4D92A 2F00A 1QVRA 2G83A 1DG3A 3HYCA 3OJWA 1MBZA 4V24A 2P68A 3DV0A 4LE0A 3TSYA 5BT8A 2XXBA 2QWXA 4QYIA 2A5YB 2R2GA 2CLEB 1EK0A 3KOMA 4FBMA 2ZRLA 1GG9A 2G80A 1NFFA 3G2NA 4UNQA 4D0LB 1VI5A 1P2GA 1YIDA 1SG6A 3RD5A 5CDFE 5BYKA 5B37A 1YHNA 3ILVA 3SHWA 1H85A 1D0IA 4PEVA 3PVZA 4KN9S 4TV8F 2X2EA 5BURA 3OD5A 1LQ2A 1YR3A 2BSAA 4JC0A 5C18A 1V1JA 1N5JA 2GEKA 4BWFB 2GPJA 4RGQA 4D3SA 4U7WA 3T7RA 2JJ2D 2GEUA 3BAZA 5HGJA 3SZOA 4M3NA 1N2EA 5IH3A 3RBVA 2F1OA 3AT1A 1RRFA 3LT4A 4IKPA 4RABA 4Z3DA 1JQJC 5GIPE 3HK2A 1SXJE 1YKFA 3TL2A 3U7RA 1Y8ZA 3GI1A 4HBZA 3RU2A 4DYHA 1AU9A 2IHTA 2HU8A 2HRDA 4ZALA 3ZGVA 2F43B 5AW9A 1Z8NA 4B6SA 3TEJA 3COSA 3CV3A 4KN6A 1H5NA 2Q7OE 3ZX4A 1AHHA 1H93A 4DLBA 4J7AA 5JSFA 2PZMA 5K0FA 3KAPA 1D09A 3Q2KA 1YQUA 2X4GA 1JJ7A 3LVFO 3ZU5A 1L1QA 5ITZA 4M9ZA 4PBTA 5CT5A 3O95A 4YCBA 3CPJB 4F96A 5JO0A 1SHKA 1IHUA 4R9VA 1NOJA 1DVRA 1OV4A 3A2LA 3QKIA 4MYDA 4A8JC 4EY6A 3U19A 2YVAA 2GVZC 4JBNA 3DCYA 4OX9B 1I14A 2LW7A 1ZIPA 1Q0PA 3TXYA 1RXWA 3GHHA 4OQNA 3VR4D 2AXQA 3B60A 1G5HA 3AJRA 4MGZR 3Q8WA 5E6UA 4Y9SA 3TNDA 2NU6A 1OC2A 2XUJA 3IT2A 2HLPA 2XMBA 3RGWS 4ND6A 4Y2HA 2I4RA 3TZLA 5K4AA 4W8HA 5LP6A 5K0GA 3GLHA 1M76A 4KAXA 1UC8A 2GRJA 2O4CA 3TG8A 2IGTA 1S3IA 3CEJA 1OFIA 1DKPA 1P2UA 4GNRA 5K3DA 1GU1A 3WGMA 2NYAA 2PO5A 1TT7A 3LPCA 3Q4GA 4FXOA 5KNBH 1ODJA 3NOVA 3QYJA 3ND8A 3G6WA 3TUIC 1WULS 3V1LA 4FMBB 3DHVA 3LQ2A 3PA6A 5A62A 1T0IA 5M2QA 2PGJA 1J09A 2H7CA 2VVTA 4AKTA 5JHHB 4TROA 2WKRA 6NULA 4WQMA 4KNWA 5A7FA 2L17A 1IZ0A 2G9ZA 2H16A 3KP1A 1RIFA 4RSMA 4H7HA 5BY2A 5JNLA 3QEMB 2JZOA 2Q0SA 3BIJA 3ZD9A 5JQGF 1TYCA 3PXGA 2UZ0A 1DTEA 1N25A 3ASYA 1GWNA 4BGVA 4UTVA 4R7GA 2HN9A 5C9ZA 1ZFNA 1CR2A 2WKWA 4ZV4A 5JSKA 2B21A 2CVZA 5DYWA 2HCFA 1ZM3A 3ZCTA 4RTRA 2YV5A 3W5SA 4Z4EA 3ZGLA 1P4HA 1MB2A 4BQRA 3LY5A 1Z37A 2QTVB 3AI1A 2Q3BA 3EPPA 2ROQA 3HRKA 2NV2B 3NAQA 5TQJA 4UAVA 5AJUA 1JHZA 1V7PC 3ZW8A 1ZGCA 4FEGA 4D5EA 3AINA 3P2EA 1RVDA 2FQQA 2ZSFA 3OTIA 5ES4B 1MB4A 3KYCA 3I5AA 3HWSA 3DB2A 4PX2A 4M36A 2H7XA 2EL7A 2Q3LA 2ZI3A 3U4GA 3WS7A 2PJUA 4UM9D 1XMJA 2PTHA 1ADGA 4R1LA 4N5MA 4O1HA 5FAXA 1PZHA 4WK0B 5AJYA 4B47A 2LZ0A 4ID3A 2B4TO 3HB7A 5ILOA 1OU0A 3E3AA 1G6HA 4UQPA 4Z49A 2C7QA 2XIJA 1CK4A 3QBDA 1T9KA 5JYDA 3CF6R 3D4IA 4N4AA 4BGEA 4YMHA 1SPBS 1DDIA 2GJKA 2QUZA 3FOAA 2CUKA 4DIFA 3AONB 2QVBA 2BPOA 5JBQA 3HABA 3IERA 4ZJPA 2E9SA 2WAAA 2A6PA 4W6QA 3X1YA 2P5YA 3TRHA 3K0HA 4UCFA 4WY8A 4IGIA 3VR5H 2EQBA 1IQ0A 3OFJA 3CVWA 2DT5A 5B2EA 3DMFA 1JVNA 1OYWA 1QIHA 3DXZA 1ETUA 3TW8B 4GBJA 3T38A 4D02A 2VWPA 3QSYA 3O4HA 2J9RA 1GG5A 1ZOOA 3ZC3A 4U8HA 1N5MA 3NV7A 1TO6A 1K5HA 3QWAA 5E1OA 1ZC3A 4GMFA 4HWSA 1SIOA 2H5EA 4M9XA 1O8CA 3EIQA 1EK1A 3DO8A 3PA8A 3LC2O 1NPDA 1R88A 3Q10A 1QB8A 4LI0A 4L16A 1XEWY 2XYVA 3BXGA 1LS1A 2NN3C 2DFKB 5U1PA 5AD1A 1VJRA 4X00A 1Q19A 2AC2A 2O6LA 3JZMA 1ZU5A 2NZXA 3EZYA 1ZY2A 2PBFA 1QIGA 2XAUA 1J39A 2HHJA 5FUXA 1WDWB 3TJMA 3N05A 2CNDA 1ZM4A 4EI9A 6YASA 1YH3A 1PQ4A 3ELDA 2NO9A 5DX1A 3VPHA 5JAIA 1VXOA 2FX3A 2VSXA 1L5LA 2XSZD 3RF6A 1WHTA 4DLXA 2IPLA 3FNFA 1Z0SA 3HDVA 4F71A 3U60B 2F1KA 1EFLA 1HL7A 2FPUA 5EHNA 3VV2A 4YRMA 1PFVA 5ICSA 1K88A 1XTRA 1U8XX 3WQSB 2EFDB 2DR3A 5D51S 4XYLA 1AV7A 1YZNA 4Y1EA 3ZE9A 2EC5A 5HIIA 4NCXA 4O4LB 4RF3A 4TS4A 4OGGA 2I8AA 4BCCA 3NC1C 4RFVA 2BEUB 2TMYA 3LSYA 3MF4A 3IA7A 1IONA 3BULA 5FB3A 3ZK8A 4AUEA 1T91A 2X9QA 1VE9A 4TWBA 2Z9BA 3Q7RA 2WWXA 3EIEA 3I1IA 4B83A 1GGHA 4RCZA 3O4VA 3G9UA 1ANKA 2J9GA 3PUVA 3BTVA 4J0GA 4D8WA 4DANA 3ICCA 3ET4A 4E5KA 1BU5A 5IUKC 4DAEA 4URVR 1NVGA 1ONSA 2IHBA 2VJOA 3FVWA 2GVNA 4IJ6A 4Y0NA 3ZIUA 4D3XA 2D54A 5CDTA 4BKMA 1BX3A 2GBIA 1J24A 4KN5A 3TRIA 2ATEA 2OO5A 4FJ0A 2BW0A 5TRTA 4OYLA 4A1OA 5LQNA 3HXMA 1IJFA 3EXIB 4KDCA 1X77A 2QGNA 1FU8A 2Y9PB 4WCFB 1VECA 1YVRA 5KOYA 3WV4A 1BXRB 3WYGA 4G0UA 3B1ZA 5AJVB 4CTOA 5C3UA 4P0QB 1S8FA 4GM4A 5E1BA 2I1VB 4N1AA 1BX1A 4WA7A 1V7QA 1SCUA 3FCOA 4BNXA 4ZYXA 1ZHOA 1UMDB 2V74B 3KSDO 1KEUA 2GKGA 4X0EA 1RXYA 4WE3A 3ZJTA 3GUHA 4BVFA 2BHTA 3GGOA 2WIJA 3WL4A 1VSUA 2KBFA 3OX3A 4URHA 3O8LA 4WK6A 4EUHA 2PUEA 1QC5B 3D64A 3TQFA 2WJ4A 4PZCA 4LKOA 2OZKA 3J81A 2XZOA 2FX5A 1GIAA 1ONNA 1CNMA 4LJRA 1OSNA 1YDEA 4BVLA 1RXVA 4JBHA 3LUJA 1P1BA 3SMVA 1T3TA 1P75A 3KXDA 2JVKA 3D1LA 2J3QA 3R6WA 4X85A 1P62B 3IQIX 2F48A 4MWCA 2JAUA 2UU9B 4AKEA 4DUGD 1GPKA 3BGSA 1OXVA 4KPYA 3TIVA 1IBSA 4CKWA 4CEJB 3FX2A 3C3MA 1YZTA 1KYTA 3ZHBA 1T1IA 1UDRA 3A1FA 1E20A 2D06A 3KVVA 4LHXA 4LRQA 4O5OA 3UTCA 4F93B 2ZU6A 4PAGA 1JXMA 1FY2A 3ZE8A 5KDOA 1W36B 2JGRA 4LNUB 5DYNA 2CDCA 4IZHA 3S28A 1ENOA 1LPBB 3FFTA 3RWBA 1SFRA 3IP1A 2PPVA 3VGPA 1GTVA 2W2LD 4GWGA 1DRVA 3ZNNA 1XT6A 3EC2A 1DU4A 1P4RA 2GGSA 4JB8A 4RIHA 1P33A 1QTIA 5DNAA 3PC2A 4K2HA 3F1KA 4Q16A 3ZK9A 5J5AA 5ALTA 5BV0A 1X8LA 3TQTA 1W87A 4TMYA 4XTRA 2YJZA 5AIAA 5GGYA 4B31A 3NHAA 2UVQA 4YJ3F 3SN6A 1Q3KA 1Z2CA 4D9CA 1YR7A 4PPFA 3BJEA 2W9XA 5DX0A 4YV1A 2XGJA 1I3OA 1IPHA 4OB8A 2CEKA 4OFZA 4BMPB 4R6XA 1JG2A 3GLUA 1Y81A 2QJRA 1KYQA 1OLSB 4YBZA 1QYRA 2E1RA 1TAGA 4G5QA 1V5WA 3Q2OA 4LXQA 4MRVA 3U4AA 2J59A 4IOJA 5CIYA 4GSLA 3R1IA 3FAKA 4O4HA 1LX6A 2XZTA 4YJDA 5EP4A 1XOIA 1K6EA 1I3LA 3LT0A 1YR9A 3JQ6A 3SJAA 5FH9A 4GPEA 3O03A 5LMNB 4N6GA 1U0LA 4JT9A 3VDMA 4Z0NA 3K9QO 3G6KA 1QYIA 4RMGA 4IYJA 4MR8B 5IH7A 3T06B 5CVVA 1KH2A 4LWOA 1VJDA 3KT8A 3Q5GA 1Z39A 4L5JA 3C8MA 2X5KO 2YY5A 3DOOA 3HGQA 4PC7A 1DAFA 3T7AA 2FSPA 3O1JC 1N2ZA 1QF7A 1ZEJA 5BN5A 1QHGA 2V3VA 4CM6A 3FF1A 4H3SA 2RHMA 4AROA 4BLQA 1KOJA 1GN8A 4CI0B 4UM9B 2CMGA 1S2LA 1Q1AA 3QELA 1PU2A 5JDIC 2Y1WA 4CEHA 5E6SA 5JHGB 2IYTA 2D2XA 1NN0A 2C4UA 2OV8A 2P4UA 4DWWA 1QLHA 1BWPA 1MJGM 4IWYA 4XTCS 5DXJA 3WOHA 4DIMA 4EB8A 1C50A 1BMDA 1SVNA 2PS0A 3F4KA 1CWUA 2NU9A 4Q34A 4RFLA 1Z8DA 3PUJA 2PLNA 3KKLA 3QK7A 4NYIQ 3ROMA 3NBFA 4DCSA 2WICA 1GGEA 4ZK6A 2RI0A 2VPYA 4GXNA 1L5SA 4OH7A 1UT6A 3ESQA 1KSGA 1FSPA 1LTKA 1NYQA 2TRSB 3OCCA 3QV1A 5G3YA 3TLKA 3P45A 3V6MA 3MFYA 5EIWA 3WGYA 4QKQA 5I9IA 2AC7A 2GEJA 4GPZA 2YWEA 3BAFA 3BH7A 2XE8A 1PQYA 1U2ZA 3FNBA 3PT9A 1T1GA 3ORQA 3U81A 1B16A 2WJZB 3E82A 2C1XA 1CUCA 2FSSA 3MJHA 5FTJA 1TAHA 5BSHA 5AK5A 2BRUA 2WTEA 5K5EA 2KBEA 3M5CA 4YPFA 3GVHA 1J8YF 4U7HA 2WNSA 1B14A 1PL7A 3BWMA 1MEEA 4KXUA 3CURA 4F85A 4WSOA 1XN4A 3SYMA 1XHEA 3CIOA 3DEIA 3R3XA 3I09A 1P9NA 1HTTA 4KRGA 4BRZA 4CR8A 4XWOA 1LPSA 4TS1A 2ERCA 4O0LA 4R1MA 3AKEA 1O0BA 1UDCA 3ANMA 3UCEA 1DBVO 4KQIA 4AKSA 1NG9A 4DQLA 3Q7SA 3C3CA 5F12A 5EC8A 2I66A 4MI6A 1JHOA 1K8ZB 4PXYA 3IGFA 5EPOA 1JEJA 1LEHA 1EUCA 1VJTA 4PYIA 1TTTA 3U7JA 4RZSA 3E9YA 3HCRA 4TWAA 4XH9B 2JHPA 2GEBA 1NW9B 4KN8A 2GUGA 4D45A 5FI3A 4F3TA 2Q2OA 4B2LA 5KTYA 3PR2B 1RJGA 2ID7A 2JZCA 4BQOA 3T3IA 1H3NA 3I5MA 4UNIA 3UXYA 3RU3A 1AUOA 2QVCA 3MSXA 4P34A 5KOJB 5JJLA 3KJXA 2A92A 2QUBA 5K6AC 4D0NA 1F0YA 1EDBA 5B3JA 1D5CA 3IAS6 2PSDA 1ZIDA 1X9GA 2PJDA 3DEFA 1PF7E 2COUA 5A5DA 2OHOA 1NI5A 3AQIA 2XR1A 4WD3A 2Q6TA 1ECCA 1NXPA 2HL6A 4BN0A 4BNHA 3P9RA 1M6EX 4FOSA 2GAIA 3URKA 5I8ZA 3WIUA 2P9TA 5JZVA 1L4GA 3W05A 3M1LA 4MEBA 2JRCA 2N3ZA 3AXTA 2PX5A 2NZ8A 2IOFA 3F5MA 2ZTHA 5F3RA 1MX3A 2QT1A 3WIOA 2WFLA 1KYWA 1F12A 3QE4A 1WUJS 2OVBA 1D1TA 2J4DA 1MDFA 3G59A 3C6QA 3KUKA 3OPYA 4QO7A 1M5UA 4MCJA 4FQ5A 3DKRA 1XRQA 1FE8A 1JEOA 2Q9UA 3IC5A 4Y6SA 2PK3A 3IAXA 1GYPA 4Z6KA 2IC5A 2Z9DA 3HM2A 4YJFB 4EY4A 1G98A 2YWRA 5M3BA 1EKXA 4ND7A 1R50A 4JBIA 5C8YF 1U8ZA 4D9NA 5LU8A 1QVWA 4ZVLA 2UYCA 1XEWX 4EATA 1JDJA 1JKXA 2CF6A 4JSYA 1BVHA 1JSCA 4GU5A 1WMAA 4TTPA 1XTTA 3SDBA 3TCKA 2QXTA 4FR5A 1N0VC 1N6IA 1VE3A 2CMHA 2FFQA 2D2IA 4FKMA 4GX5A 3TYXA 3KJIA 4QYWA 3EW7A 3MMSA 4I5DA 4B8YA 3BMOB 4H35A 4E5MA 4FX2A 3KELA 1D2HA 3MLAA 4O4IA 5K3FB 2O8FA 4ALMA 3L07A 4UTXA 2GBLA 2YH2A 3Q9SA 3AJEA 4U6SA 1DWUA 3W4KA 4AK9A 4JY7A 4ZYYA 2J9XB 2JFXA 4GPAA 1NW7A 5LKAA 2L18A 2BR3A 5F1OA 1W36D 3QWHA 3TOSA 3V8NA 4CW7A 1DI0A 3REQA 3OBIA 2RIRA 1ZBQA 2DQSA 4YRPA 4XVCA 4TMWA 1XPRA 4RX1A 4YAEA 2RKWA 2ZYHA 3DJFA 4IVPA 1ZRNA 4E33A 4LFAB 1M1NB 2XMSA 4UEQA 3VI4B 3E3NA 5KYKA 3QEAZ 5AVQA 4RQUA 3GROA 5CBPA 5HJ7A 4L4RA 3V2GA 5IXSA 2O2ZA 1ZISA 2AQHA 4MA0A 4MR9B 4F5WA 3CZ5A 3FOWA 3RJMA 3NTUA 1CDOA 3B7WA 4RL4A 4ZI5A 3QXXA 2JFBA 2YCBA 4WY5A 1JU4A 1OWMA 4MWZA 4BB6A 3NVAA 4JYCA 5CXQA 2F3SA 1QGUB 3VNVA 2J9FA 5ANRB 3V34A 1ZVKA 1MOZA 1NKVA 1JRLA 1UMKA 2XAAA 1CJSA 3OZSA 2HSZA 4HX5A 5TEWA 5CDHA 1JR6A 4XD2A 1R9NA 4MVWA 4XI9A 4CLOA 2BTQA 2JZNA 3W34A 5AVWA 3TD9A 3ETEA 1JPVA 3U7EB 2X8JA 4YRIA 2V97A 1K7SN 4IS2A 1GITA 1MQSA 3V1NA 1Q3TA 3HBNA 4EVRA 4G1EB 1RZRD 5FEMA 3C8UA 1NHWA 2FW0A 2H7VA 5T3YA 3KV3O 2FWMX 2EVWX 4ZYWA 3KHTA 1FUKA 1IOLA 1OX4A 2XB9A 4Y1GA 3ZYCA 2B30A 1GPWB 1GQRA 2ADMA 4MRNA 3IAUA 4PZLA 3HXPA 3V2IA 4C4SA 4QHYA 2D5CA 1ZJ4A 1YDWA 1TF2A 1WQ4A 1DOAA 4J0HA 3I72A 1SPXA 4ZT4A 1G3IA 5KQLA 5GM1A 3PLNA 2ZP1A 4KXYA 1HZZA 1FTSA 4Z7OB 1P1CA 1DGQA 1B0ZA 3IUEA 4HLQB 2VF7A 3FKSA 3BFVA 3DHEA 1HDRA 2G04A 4QXOA 1LNSA 2C59A 2G28A 2R11A 4AJJA 1NYRA 2JANA 4A6DA 3FUTA 4IFIA 2OM2A 4NG5A 4MWGA 5A6VA 4BQIA 4TRMA 2OGWA 1YB5A 2PO7A 4WASA 2IVZA 1PV2A 2W4MA 3P9YA 3VDQA 2DWPA 2NUAA 4CDRA 3CSUA 3CZQA 3VH4A 3WLQA 4EHNA 2P2GA 1C0KA 4HAOA 1NJ5A 5F76A 3ER9A 1OV6A 5AM0A 4A2PA 4PLVA 1F8XA 3CJRA 3GA7A 4TN5A 4Q9LA 1XTZA 1HK7A 3K9CA 5HKKA 1JHVA 3CC8A 3LZDA 2ZGVA 3G02A 3GLTA 4REOA 5EEGA 1ABBA 5CM2Z 4HT3B 5CYOA 1E6MA 5BRAA 1A1SA 1GZ4A 1RM3A 3AVVA 1C7IA 2FHPA 3MBOA 3RWOA 3GVIA 1QFMA 2EEPA 2QM3A 3H2BA 4MEAA 2BMVA 4WOKA 1OFUA 5JROA 1JHQA 3SYKA 1OBVA 2ZCVA 4IXNA 3R7BA 4GI3A 1R0ZA 2JFFA 1TKCA 2O19A 1R9GA 4W9RA 2H18A 2PH5A 2V5UA 3DGEC 5F7ZA 2OXIA 5B57C 3K9NA 1DTWB 2P41A 4V38A 1RMQA 3HB9A 4OYYA 2IH2A 1ZW1A 5KX5F 4MVXA 1DAGA 1X8JA 3BMQA 2I3AA 4HGYA 5G4LA 1V4VA 3UBMA 2C8KA 2Z3ZA 1E6WA 1LJUA 1TUBB 2YHSA 3QFHA 4KMMA 1QGAA 1RC0A 2DCMA 3PUIA 4JYPA 1G2QA 4J0QA 2OGUA 1ZXXA 3UJHA 2JGDA 1B3BA 4AJ1A 2BFBA 3PR1A 5LNK1 3HCCA 4AX4A 1P1RA 3AB3A 3OMXA 2MYTA 3EVCA 4NH0A 3LX8A 1U5CA 4G0XA 2WU1A 5D3KA 3UUWA 1EWRA 3T95A 5KNDH 2GN9A 4C87A 1RYEA 1Z2DA 2HQOA 1FZTA 4PXSA 4UATA 1E5XA 3TLMA 2NIPA 2ZB4A 4PZZA 1PD0A 1Q6ZA 4O6VA 2A9JA 4BECA 3VHQA 1Q0TA 1RLIA 1U5BB 2VDWB 4GRIA 4YWJA 3ZTWA 2HWYA 1E79A 2J0SA 4JP2A 4KWHA 3UB4A 4RS3A 1G291 3MTQA 4TYMA 2ICAA 2QG6A 3FOCA 3PCXA 3PEFA 4M38A 2PUDA 2QZ4A 4R8MA 3DVQX 4JP5A 3ZDXB 2OD9A 4YP0A 1BKSB 1EHCA 2PNJA 5ARDA 4RNCA 1AX9A 5AM4A 5G0UA 3AUFA 3WGNA 3WWCA 3RV3A 2ZREA 2E4AA 3UV3A 3NEJA 3C14C 2PG3A 3H6HA 1XXLA 2I6UA 1VJ0A 3RW9A 2HXGA 1II8B 2IYFA 3V4FA 3QXSA 1YRQA 4L8GA 3U39A 3JRWA 4PIPA 5C5CA 4N9WA 5LMUB 3ZWOA 3T3DA 2DFNA 1NUUA 1N2HA 3USES 5KNBD 4J91A 1HYQA 1CEQA 4A23A 2BKLA 3UXEA 1HEUA 1E2LA 3QXHA 4OB6A 3TGLA 3YASA 3D3WA 1AF7A 1ZITA 2CDNA 2IOHA 5A71A 1HWYA 3MEQA 5K4GA 1Y5NA 3HCDA 4KEAA 3B3AA 1GUYA 4NZZA 5TIIA 1C3EA 4WZBA 2LPMA 1KVRA 1U7HA 4RJIA 3DOJA 4ID9A 3KEMA 4L02A 5D1HA 3ZV6A 5F23A 2YN2A 3AI3A 3LECA 4BN4A 5F33A 1Y8RB 4PY2A 3TBHA 3UHJA 4I46A 3UOWA 4YUYA 1CFJA 4BAGA 5HKBA 2DERA 1SUPA 2YDYA 3OE7D 1T5IA 4WFKA 3TM4A 4GD3Q 2VAPA 3WL8A 2BGRA 3K0AB 1NRIA 5AWFC 1OUMA 1CVIA 2QQEA 1VPVA 3O90A 2BELA 3N2ZB 3Q6IA 4C4XA 4EA8A 4XLLA 3TW6A 3OQNA 2AJ8A 1IOZA 5HZKA 4ZIRA 1GZVA 2GK3A 2IEGA 4B3GA 3PX2A 2PUJA 2W6ID 4WK2B 5E2AA 3NHBA 1JILA 1O87A 1TYAE 3BIFA 4MMXB 3V7UA 3WIEA 2PANA 2ZUEA 3SR3A 1TIKA 5J3JA 2JLSA 3HA7A 2C92A 2W6OA 3FI9A 1XCOA 3GXBA 1UMBA 2F6RA 3OG9A 4R9RA 5D84A 4ZRNA 4YT8A 1QK4A 5CLGA 1O8BA 1T5BA 2HMTA 5HA5A 1GG2A 1VJ1A 3TTWA 3F4BA 1DRKA 1TOAA 5FULA 1ZN7A 3QU7A 1IXRC 3BXZA 2NXEA 1H9BA 1KPGA 3IJPA 5CG2A 1KWGA 4TKLA 3CG4A 2FP4B 3ZHYA 4F3KA 1BWSA 1L7XA 3UJ7A 1F0NA 4Q9DA 4E22A 3GLFA 1C3XA 1PGPA 1VIDA 4ASUD 4CM8A 4HWOA 1QGOA 1ZCJA 2R6ZA 3Q3VA 4OHXA 4H6WA 4BO4A 4JBLA 5JAZA 2HIMA 1CX9B 2V7XA 3C5CA 4LFBB 2ZJ5A 3TTYA 4FNMA 4K0RA 2J3LA 3B6ZA 3Q7EA 4C0HA 3LUCA 1OGJA 1UIMA 1SQSA 1XZCA 2VNAA 2XNJA 3SHOA 3UO8B 3VR5D 5I4BA 3NRJA 3DFIA 3F5DA 4B6RA 5C5IA 3IDQA 2BMWA 4GAEA 4DRYA 3M5WA 4ZCRA 3K70C 2WILA 3NXKA 3VPGA 2PUFA 1XTSA 3WHLA 3DMPA 3JALB 1PO7A 3SKXA 1W49A 2PGNA 3U0BA 6PFKA 3AFIA 4BO2A 3KJQA 4NYJR 1N9GB 2JAHA 3G2JA 3NR2A 1N9KA 2D62A 3P0EA 3TLYA 4DJDC 3H2YA 2Z83A 3CW8X 4J0FA 1M5TA 3SGLA 3F9CA 3LFHA 3F2VA 3O8OA 1Q1ZA 2AX3A 4Q1FA 5FOWA 4R51A 2CLFB 2UYOA 3B1YA 1AKMA 1RYYA 2YHAA 1DE0A 1XD2A 4ZWNA 1EWTA 4NULA 4RETA 1Y8QA 1P5FA 1W5FA 2ZBEA 5AKZA 5K6TA 4GX0A 5JQWA 3PNSA 2GB4A 2XLCA 5A9SA 3GP8A 1FRFS 1ZMOA 1GJRA 1GNLA 1ULUA 2A5GA 2WYIA 2FEOA 4PWZA 3VC1A 1JHAA 1EFRA 1E2IA 4PQGA 1XFDA 2JGKA 3I2FA 1UBMS 3GLVA 2Y0EA 2IXGA 3GP3A 1VJ5A 3NIDB 3RAPR 4EHBA 1AURA 2OMKA 3L7LA 1Y3CE 1HNNA 1G2IA 1M2NA 3WGKA 1V1MA 2AFHA 3RLFA 3ZIDA 5HRUA 4Q03A 1KAMA 3I23A 5IDXA 3L46A 4A8PA 1EDDA 1QGYA 5TMBA 4LOLA 2IYZA 1II0A 4J03A 3QUTA 5KTRA 4GZ6A 5AHRA 1L7OA 5E4YA 4Q7QA 2W70A 2H2FA 4NKRA 2V9ZA 3I1YA 3EG9B 3UT6A 5IWCA 2FPMA 3F97A 3TMKA 4KVFA 2IXAA 4X6LA 13PKA 3KQMA 4EG0A 1K3FA 1NDQA 1HXHA 1OFVA 3C6BA 3QNUA 1JQDA 2WSYB 5EMKA 2I8LA 3DTVD 1HDXA 4JCOA 2QPAA 4S04A 1QRUA 1P7YA 5GV8A 3UVEA 2GN6A 1FNNA 3ZDFA 4BRWA 1U8FO 3KJHA 1DEHA 4WT7A 1JVBA 3CEHA 4ZVTA 3S1LA 2JRLA 2AOTB 4A6XA 1ZA2A 4JT2A 3VOAA 3ONFA 2BM8A 4CBVA 2WP0A 3K96A 3T3OA 4H27A 1F4PA 2FUKA 3KWFA 2E37A 1SUFA 2DTXA 4GLJA 2X15A 5ALGA 3FPBA 1M1YE 5AVOA 3G2IA 4DNQA 2WJAA 4DLWA 3HJHA 4O4HF 1NUTA 5AM5A 1N32B 2QN7A 1QANA 4ZAZA 2IHJA 3DEAA 5BNWA 1NBME 3EAFA 5AVYA 3SYRA 4OHOA 2VKTA 3BQ9A 4MUGA 2VZ8A 3BRWD 1QQ6A 2FZWA 2N47A 3G2LA 2JVJA 4M0KA 2JIZD 3X2SA 4OJQA 4MRMB 1FMFA 1AS3A 2WF9A 2WWFA 2H4JA 4XGIA 1DBPA 1HYHA 1CEYA 5HEKA 5EGSA 2IU3A 3VR0A 4DC1A 5JSYA 2W6JD 3PQDA 3CVJA 2OHVA 2NYRA 2OCDA 4TKMA 2F8MA 2WD7A 1NY5A 2JBWA 4CF3A 3FXAA 2F8LA 1G8KA 3NX4A 1T5OA 1NXSA 3LT2A 2KS6A 2Q5JA 3DPIA 2C4MA 2HV9A 2BFEB 3DR5A 4CF7A 1JG6A 3TOCA 1MTOA 1XQVA 4BLUA 3ZY3A 5LYJA 1FDUA 1RRGA 4N0QA 1CEEA 4QATA 2UUPA 3EGDB 1X7GA 3TECE 2XNHA 4A8JB 1FOEB 5ALOA 1BYIA 4DDKA 2NVUB 1OWPA 4G5HA 3H9QA 4QGHA 1YI8A 4MGEA 4BJ1A 5C1PA 4REMA 3RVQA 1EP9A 1QG4A 1XKLA 3U3ZA 2V7GA 3TM5A 3AEUB 3D4NA 4NLLA 4YMLA 1O6BA 4CCYB 5CIWA 3HJGA 3LL7A 1FS4A 1Q7EA 1UBJS 3O83A 3J80A 1NOIA 4QHSA 3EXEB 3S2ZA 2OGTA 5I7SA 5AVXA 4IH4A 3AR2A 4DDMA 2QUAA 3T0FA 4HYQA 1XNGA 1CJMA 1AE1A 1TJ3A 2RFLA 2P2YA 2ZBDA 2VDOB 1TM4E 4QEZA 1FDOA 5BWOA 5CFOA 4CL2A 1KAEA 1XZNA 3MCTA 1G3QA 1ISJA 3DP9A 3MXOA 2Y67A 3TX2A 4RPIA 1VMIA 1RACA 3OOWA 2CCJA 1W29A 3GAFA 4BAZA 2FFJA 3C8DA 3V4ZA 1C7QA 3HYSA 3CUVA 2AOWA 2O23A 3LKBA 3LX5A 3RS0A 4YJ2A 3R77A 4RPJA 5CA0B 2JGNA 4G86A 2WUDA 2G4CA 1IZYA 1TUGA 1JKIA 3LBFA 4Y2RA 3V80A 1JVSA 4OAQA 4UUMA 3CRRA 3TQCA 1UINA 3JYNA 1L5RA 1EUQA 4RVHA 3QKWA 4A7PA 3R6LA 1E3LA 4MHTA 1Y7HA 3QENA 5FDFA 1GFZA 6LDHA 1TYEB 4ZQIA 4XWAA 5HQTA 2XUOA 4DIDA 7REQA 1E6EA 3EVDA 4RDCA 1Z4OA 4EYEA 3WJ1A 5EPUA 1WKCA 4V0RA 3RS5A 1YDMA 2PKRA 3LYLA 4KL8S 4OHRA 5DCUA 2IEDA 1Y82A 2OV4A 3FPAA 3KNZA 4LJKA 5DLDA 1LKZA 1OBCA 4MW0A 1L7NA 2AZXA 5A05A 5CAEA 2P77A 3IL2A 3RJZA 3L4JA 3VKFA 4AYTA 1H6DA 2REOA 3IR6A 5IASA 1DKNA 3VPSA 1P2FA 2FR8C 4D81A 4EKGA 3RYHA 3X3HA 4R3UC 5DVZA 4L76A 3AG6A 1PR4A 1MRZA 1K6JA 3SM3A 4YYEA 1Z4QA 1SKBA 3R8XA 2VP6A 4LXGA 3G17A 2YWHA 3Q3GE 4KNVA 3RARA 5J2TA 3BTSA 4RKYA 4K6OA 4GI5A 1WNFA 2QUHA 1X80B 1L4NA 1CFZA 2GA9A 1LBEA 4P4SA 4DNOA 3MGGA 3FMVA 5TQVA 3GUVA 3JAWA 1U65A 1GPBA 5IN5A 3NT4A 2GXAA 3WYAA 2C97A 1WZNA 2MJLA 4KHZA 3NC4A 2JG3A 3L0DA 5IMSA 5MGBA 3TZBA 1UZLA 5KHLB 3QLUC 2PQ6A 5KIAA 4QVGA 1FMJA 1ODCA 3L8MA 3INTA 3HBFA 4X8MA 4O4JB 4ZAFA 4E15A 1XFAA 4C7VA 5AW2A 4XWWA 1RM0A 2ZWPA 2QR5A 1E1RA 4C0BA 2H8GA 2YX1A 4CKZA 1SUBA 1TAQA 3SEQA 4R0MA 1FP6A 1DQZA 4NCKA 5ESXA 5CB4A 1J49A 1C4KA 1Y63A 4JVMA 4W7IA 3BMNA 3R0JA 2PD6A 3OIUA 2VCHA 4MGYR 4NZNA 5JXHA 2WUVA 4ZANA 1PKEA 4NFLA 3UCFA 1MJNA 2P65A 2QE7A 3IDSA 4MR7B 4PG4A 1G7SA 1E2GA 1KYIA 2VJPA 3FCAA 3NHWA 3B48A 4CMEC 3ZDQA 1LBIA 4F7WA 1PVDA 2XJ4A 1SK8A 3RT7A 2NQTA 2FDCA 3A10A 4U7TB 3VC3A 3KU4A 3CH4B 4ZAWA 3GFFA 3IOMA 1YU6A 1N0HA 3VKWA 1GQ2A 2LKCA 2YIJA 3M4ZA 4HDNB 4O2AB 2PSJA 1L5ZA 1OJ7A 1L5NA 4A5SA 3E7DA 4AVYA 1RE0A 2Y4NA 4OYHA 3IMGA 3KKZA 5EZ6B 4BNIA 4BCBA 3I52A 4A16A 2VNKA 2H17A 3ND7A 4U2EA 1XD9A 3VZDA 5A3RA 2IP4A 5I5GA 4CCAA 3D3JA 2CB0A 2HLHA 5GMOA 2VCYA 4J0JA 4M9QA 1DWQA 2IUEA 3AY7A 1Q0HA 3OLYA 5DGIA 4RM3A 5LYYA 3SEAA 2FZ4A 2PYZA 2XADA 1N0IA 4C89A 4EJSA 1EWKA 3WWZA 4OV6B 2BMEA 2Q9CA 2GASA 3GEGA 4FE3A 4U5QA 3VO2A 3CLTC 4Y6OA 4FFLA 2QRNA 4ZAGA 2QORA 1UK8A 2XF8A 3GFQA 2V8BA 3KZ1E 3VC7A 2G1PA 5HDQA 1P2SA 3GH3A 4ZODA 3AR5A 3VOSA 3OEED 1IM5A 3Q6MA 4M1KA 1CHNA 2CXTA 2XNDA 2EOAA 2O0JA 3U4CA 1E5TA 2Z98A 1FSSA 3DTVB 1QQ5A 2TS1A 3D7LA 1Z88A 1JGTA 4TRRA 1MKYA 5COAA 1EIZA 4RTSA 2WKPA 3BE8A 3ZE7A 4C14A 3P96A 2J9ZB 1CQIB 3KKEA 5DFAA 2IY9A 4G9EA 3BB4A 4LJYA 5DMHA 2O5RA 5JJBA 2VSFA 4HRAA 1J25A 1LUAA 2GKOA 4G4SO 4OD0A 4R71A 4UQLA 3DONA 2UDPA 2G9QA 3IOEA 2Z6VA 3QVJA 3QVSA 2L82A 1D03A 5AJWA 2H1HA 1T4MA 5ELMA 3UG6A 1G38A 2X6QA 4DLUA 4C22A 2YDXA 2ZFUA 3OCJA 1HG0A 3L0CA 4FNOA 2QYSA 2ECPA 4XJTA 3RYFB 2OECA 3KKKA 2FZVA 5ALMA 4FFDA 4ZI2A 1QH8A 4X64B 3GWZA 3DZBA 3A11A 3MFQA 3L18A 4QOFA 3QU5A 4TV8B 5GJCA 3ZEAA 2VHCA 1F3LA 4NCNA 5EP1A 5SV2A 4ENPA 7MDHA 3GRKA 1OASA 4ME6A 4NMXB 4WACA 3OVMA 4OK3A 3W4IA 4EPYA 2OV2A 5G53C 2ZEJA 3DZDA 4Q4LA 3PYXA 4XQGA 4WLEA 2GPBA 1KI4A 2W2VA 4U9UA 2MIIA 4ZCQA 1NXQA 3G2QA 1KI1A 3MELA 4QBIA 2JGMA 2QR2A 3VR1A 4JJ7A 2FPLA 1Q1GA 4DV2B 1T10A 3CPSA 2ZCUA 3CKKA 3JYPA 3KQYA 5KOHB 3EXHC 2ODNA 3ZVMA 2ZRJA 3NWPA 4J7XA 1I6WA 4J9UE 5IT4A 3GLFE 4D9FA 3EIFA 1KK3A 2XUQA 3GEPA 4KX5A 2JDID 3FVTA 1Y9JA 1L7RA 1VL8A 3QLJA 3IPAA 4RH0A 2OV3A 3B8EA 4RJKA 4A1FA 4BMDA 4EB3A 4NBSA 3UZUA 3OPYI 5D7NA 4E31A 1W93A 4ZVVA 3DDZX 4FGUA 2HUPA 2QRQA 3DL7A 2P1DA 3DXFA 3MCAA 1U3WA 4PQEA 3B3GA 1IIBA 3OFKA 1XXHE 5H4HA 1WW2A 3IBTA 1ZHFA 3GNLA 1ZD4A 3C43A 4FVTA 1Y6JA 1S1CA 1U3UA 3LHKA 3IULA 3NANA 1T13A 2HK9A 5C34B 3QKRB 3WGHA 2F8SA 1O95A 1R15A 5ILQA 3UMJA 4J9VA 1PJAA 3HI6A 4PNEA 3G23A 1RI5A 4BKQA 1H0KA 1T26A 2J3KA 1ZH6A 4ZO6A 5EE1A 4EENA 2DWUA 2ZJ4A 4MZDA 4Q12A 3SZ3A 2POCA 3OI7A 3BIXA 1AQYA 1GQYA 1WZIA 3CKYA 3IUYA 3IUJA 4N0PA 5AHOA 3TDKA 4E3WA 5F3WB 4TVBA 1K7YA 1REQA 5KYGA 1T4CB 3OQVA 4DCJA 3IUQA 4G09A 4IHKA 2EKDA 1K4MA 4PF1A 3UKOA 1FVHA 2VN8A 3AW9A 3MILA 1SC4A 1HX7A 1GAEO 2XQIA 3WIBA 2EZ9A 4ER5A 3LW7A 3OFVA 1C1XA 1V43A 4OLAA 1Z5PA 2BCJQ 2QJOA 3EH1A 1FVXA 3U5ZB 2QVLA 4GBGA 2PVPA 3Q2IA 3MG9A 1D4FA 3OFSA 1E2UA 1XNQB 5JQGB 3ONVA 3UJDA 2FXVA 3AEKB 3KR9A 4M1SA 1JAZA 5EQDA 3HSSA 1F2DA 1R6TA 1QHEA 2J5QA 4QTZA 1NF9A 1NOKA 1A2OA 4ZT2A 3MWYW 3TK1A 1IB6A 2O5EA 3N0WA 4FYIA 4H7DA 1W52X 3CNEA 2YJGA 4DGQA 1TKBA 2HI0A 4EHHA 2JI4A 2WD8A 4RY8A 1IAQA 3NVMB 3B9QA 4LGVA 1NYLA 5TPWB 2VJYA 4CMIB 4DQUA 4HNTA 1XTKA 4CM9A 4KUHA 1XZJA 2G06A 1Y9EA 1S7GA 3V8VA 3ZU3A 2CZQA 2PR2A 3HHEA 1OB5A 3KB1A 3BREA 4IIBA 1I3NA 2PL3A 2YJ5A 4JASB 2Y8EA 5FBKA 3CNNA 3NJRA 2ALJA 2WQZA 4E1AA 4BBPA 1G9SA 4F56A 3MXTA 3T7IA 1GGVA 1MENA 4LV8B 1K86A 2QD3A 1TI7A 5BR7A 3EYAA 2NO5A 4GKKB 3AOGA 3N8KA 2G17A 4CPDA 5HYVA 2FF5A 1M6VA 5EHIA 1G5TA 1T25A 2V6JA 2X40A 2X58A 1FNSA 1R4MB 2XF2A 3I5UA 4FD2A 3Q5EA 2PLFA 3S3TA 1ODIA 4MEJA 1NMSA 3F8TA 4MQBA 2C3YA 2ZWIA 4HVCA 1FDWA 3F67A 4PS0A 1U8YA 1YR2A 5EKSA 4FZ3A 1NXOA 4M0UA 2DTDA 1X74A 4QOJA 3WL7A 1IDOA 1WCV1 2BMAA 3SWWA 3I4CA 1SUEA 2F8TA 1W6UA 4ETMA 1DXHA 1OLUB 2POQX 5AI6A 5DIZA 2ZRGA 1QDLB 3CH6A 5E4JA 1ENYA 5CG1A 5JATA 1H3FA 2YXDA 1SVSA 3AHEA 4MS1B 4ECEA 3ECSA 1JYEA 4GZMA 2J3EA 1ISRA 1NNUA 1DL5A 1X1CA 2RCYA 4L28A 3U17A 3ZNQA 1ONOA 5KNDD 4DJ5X 1FQKA 1K7FB 4TXJA 2V5VA 1VCNA 3EY9A 1XI2A 3KKQA 3LC7O 4JLSA 4RE5A 3STTA 4DDHA 4X66B 1EB9A 1J5PA 2H9AA 2IIBA 3NXSA 1O9HA 3PWTA 4MCHA 2MSLA 3IOYA 1CEXA 2RH9B 4PSKA 3VTZA 1J06A 5MGNA 3ZJUA 4EVQA 5L8VA 1F6DA 1W85B 1N6KA 2IEIA 2NU8B 3CLHA 5D7BA 2A9FA 3Q1LA 3KAQA 3CVXA 2P69A 2QTAA 4GDFA 1N92A 3TJZA 3UMBA 4F2PA 1SBTA 2I65A 3I2HA 1DRJA 3RE1A 1KYVA 2X13A 2VG8A 2X23A 3EMDA 3GGCA 4P0TA 4PZ0A 3MRXA 3OZDA 1A9PA 1NJGA 4J0DA 4NENA 5EWLB 1K8XB 3SC4A 1JFTA 1O54A 4DL9A 2R8OA 5IAKA 5CFRA 3NDPA 4GC5A 4JROA 3I6ZA 3E7FA 5CDUA 4MVJA 2H5JA 3M5PA 3FZGA 1JA1A 4BNFA 3RC7A 1ZUNB 2AEJA 3FWYA 4WLNA 1T6XA 4I8IA 5A3VA 3S68A 1Q50A 1DCMA 2GS9A 4WERA 1CE8B 1SWVA 4AQ7A 1DZ3A 3OT1B 4W5OA 2P3LA 1YJXA 3UM9A 1KMCA 2H1IA 3HZRA 1J90A 4ENRA 4H6PA 5ICCA 4N47A 4CUZA 3EQ6A 1WOYA 1QLJA 3B12A 1QO0A 2E2WA 4NS4A 1KETA 4E14A 1MOSA 4K7JA 4EG4A 4ZCTA 5LDDC 2CVFA 1YQGA 5SZHB 3GYGA 1EM8A 1JBQA 4AKGA 3HI4A 1AK1A 2II6A 2ZJOA 1QAQA 2HJRA 3WBBA 4DA0A 2WHEA 3MS7A 2CXXA 2IYPA 2VF5X 5BVGA 1C2YA 2W8BA 2WT4A 5LA6A 1AN0A 3NEAA 1DNPA 3QVGB 1OD6A 4UUPA 5KAMA 4MKZA 1VGVA 1V8PA 2KWIA 3PL5A 1FYEA 3QUBA 2PIAA 4MUFA 5LD2C 1F6WA 3MWDA 4KPUA 4W1PA 5JCJD 2BV3A 2M6RA 1MNQA 4MS3B 3UAVA 2VHYA 5AUOB 1NQOA 2XGOA 1K7EB 5I7VA 4GPIB 4CV2A 1ORHA 2OCLA 3D6JA 3DMYA 2VDJA 3RB8A 1UMCA 3G5UA 2ZYRA 1MXHA 1KMIY 5FX2A 1CNEA 5A9TA 3LQ4A 4L2IB 4JYZA 1FNDA 1N57A 4UZFA 3OUUA 3QX7A 2VXBA 2WG2A 3ZCUA 4BS9A 4B9EA 4I08A 1YFLA 4G4JA 3OQOA 3ZOZA 4KR2A 4KIGA 5IT9A 4PZDA 5GONA 1HLFA 2FR1A 4TMXA 1OY1A 4PSCA 2IXBA 4F3RA 3LFTA 1V26A 4PXAA 1WETA 2IZ5A 2BUCA 2R84A 4LHEA 2EARA 4X91A 2CLHB 4Y9RA 3BT7A 1XCLA 3AUXA 1MQ8B 4FYXA 2QZ9A 4L5BA 5REQB 3HFRA 2G63A 3FCYA 4PVDA 5HJEA 2YJ3A 3ZE2B 2VHTA 4R1NA 1G0NA 3IVXA 4LRWA 4DREA 3OTOB 2O5CA 2XOXA 2YJTD 3GJQA 4ROTA 5CT4A 5JIBA 4AN1A 2WTMA 3K70D 5JAPA 3HBMA 3N2KA 4PCLA 3RVMA 1KE2A 4DCOA 3K0KA 4C2UA 8GPBA 2PMEA 1NMQA 1RYDA 1U3DA 4IIJF 4AQYB 4FKZA 4YMUA 4RZUA 4DCUA 2EGUA 4C6TA 5AR1A 1U0OC 2P90A 1FXSA 1YAJA 3DKPA 5SY6A 5EMHA 5BUSA 1CZKA 1NPYA 2C95A 4M0EA 1XZIA 4KZPA 2GYYA 4AJHA 4Y2XA 4A36A 1MG5A 1WE2A 2I4NA 1K6XA 1KR2A 3B85A 1HT0A 1EQUA 3L0YA 1MA3A 1Q7GA 1IN7A 1NX9A 1MAUA 2A2ZA 2HU5A 2IZ7A 4IRMA 2W2TA 2I6XA 3HVJA 3KXIA 3ORYA 4TV9A 4DLNA 3R09A 2E0IA 3WLLA 4E4YA 1PVVA 4HZIA 2AEEA 3KQSA 4GI1A 4RZIA 1LBTA 3Q15C 5JT1A 3M89A 3FGNA 1UK6A 2A33A 4KQJA 1WB5A 4LJLA 5A3SA 3RSSA 4FOTA 3FMPB 2Q29A 3UHOA 4EG6A 1T4BA 1UEXC 1USKA 1SRQA 4KXQA 3RM3A 3V5NA 3ZDYB 3FLAA 4LSGA 4RLHA 5IVHA 1A76A 3CRNA 4URFA 5C4GB 1QG6A 1U1EA 4FGKA 4L3WA 4ND1A 1MVLA 1VA4A 4EF5A 2UZ1B 2YWFA 4S0XA 5CJ2A 1UL1X 3M6XA 4G26A 4N48A 4K03A 3IE0A 4EVSA 3ODPA 1N75A 4IQ4A 2G67A 4EYKA 1HG1A 3IALA 5CXUA 3TZEA 3O47A 1OPXA 4LJ4A 2ZUWA 4YRQA 4ZQEA 1VMDA 4IZ6A 4JNKA 3RFFA 4MQ5A 1QKJA 1V0JA 3F3KA 3QU4A 1X1TA 2X4DA 3R5JA 5EKDA 2B82A 3RVSA 3CY6A 3NP9A 4DEVA 1GQFA 4GNKA 3IIKA 3RYIA 2B8EA 5BN4B 1GFIA 2IDMA 1KEEB 4C4OA 1NSYA 5MFZA 2J7PA 1G2OA 1ZN9A 3WXMA 2AG5A 2D2VA 3P9ZA 1QS0A 1PI3A 4YJ2F 1QORA 3ER6A 4YS6A 1GP2A 3FNEA 5C1DA 1ORIA 1NY6A 1E7WA 4V2UA 4BYMA 3JQ8B 1G8JA 4F9GA 2DLCX 3PBKA 5C3MA 2YIVX 2P1ZA 4LSMA 3WB9A 4ALLA 1CDZA 4DIKA 4BXOB 2CN1A 2CL6X 3BJZA 1NR1A 4J1NA 3L6DA 2QD1A 4C30A 1NV8A 4D6XA 1XMSA 1TADA 3HFSA 1PS9A 1QR2A 5GAJA 3N53A 3RT1A 2VJDA 4NU0A 1HKHA 2Y99A 5UKDA 2IWRA 2AIRA 3GRAA 3HKEA 3A05A 4H6XA 3UHPA 2NSLA 4HWTA 4BE4A 1AA6A 1KJNA 4Q3DA 1S02A 3MPUA 4F9EA 4HF7A 1NATA 4ZYTA 4I6GA 3E22B 3FDJA 4JK3A 1NPTO 2GJ9A 4KSYA 5HJ5A 4EBBA 4PC6A 1RQGA 1E2EA 1W96A 1XK7A 2UVPA 3OPNA 1EVJA 1W1IA 3VR6A 4XGRA 3JVUA 4UQOA 1SU8A 2YRXA 1BJTA 3HA5A 3O4FA 1QH1A 1MOPA 1L8OA 1N33B 2OD2A 4CTMA 1JQKA 4ZTZB 4NCBA 1EGAA 2IYRA 3EIHA 5I4CA 1XKXA 4NBKA 3NV9A 4KB5A 3PUYA 3PUWA 2XWBF 3MC1A 3LTNC 1ZJZA 3IUSA 4RHCA 4Y9TA 2F17A 4MQFB 3BEOA 5FFNA 3KQWA 3RUCA 5A3JA 5FR1A 2PBRA 1WLSA 3N0RA 3NQ41 3R3ZA 4FIDA 1ZVQA 4HH4A 1RDFA 1VB5A 5EXEA 3K0FA 5KTSA 4AG3A 1H2RS 4QU0A 2PD4A 4MWTA 4DB4A 1ENZA 3C7CB 3DLIA 4TTQA 3JWEA 4E03A 4WEQA 2EFEB 1NFRA 1ZKMA 1WSDA 1GUFA 1Z36A 3ZH2A 4DE5A 1LZKA 4B1FA 2GEVA 4FDLA 4UBIA 5EESA 5G1NA 4BV9A 3DBHA 1J1UA 4HFRA 3C5VA 4M53A 1GN9A 5KYYB 1L7EA 1E1QA 1NR5A 1T9DA 2IYUA 3ICPA 1T36A 1JJBA 3UHAA 1PEYA 3WSVA 1RTKA 1XE3A 5IYZA 3KUXA 2EAUA 5CB4F 4ZPJA 3GZTB 3K5HA 4EHAA 3CZAA 1ZSYA 2D2FA 2IS6A 2CL5A 4B8WA 4CODB 4N03A 4LZPA 3WGJA 4EGSA 2IU6A 2ORIA 3ZWYA 4D4MA 3FE2A 3DMTC 3ESBA 4MNTA 1RXSA 1G8FA 2WYOA 3OEYA 2DBYA 1XN1A 4XIYA 4YQZA 5DK4A 4EO7A 3HEAA 2R86A 2A4MA 4D79A 3KO8A 1I1OA 2GYUA 1LSJA 3L8YA 3PHCA 3Q98A 2PT7A 4FHEA 3SF8A 5D6OA 3QP9A 5B1SA 3D3NA 2XMQA 2IYNA 3EASA 4WBNF 2C98A 1BD4A 3BH0A 3TFQA 2IW3A 4UNRA 5H9VA 4BDTA 5C8YB 3RHFA 1YO6A 3TFOA 2NZUG 3RS4A 1S2DA 1WP9A 5U4QA 1EINA 3UMCA 4V1CB 4JFRA 3U16A 3HNPA 1NUAA 3SE0A 2QAJA 1FQWA 3C5WP 4F1WA 1U7XA 2Y1FA 4P36A 2BH2A 1EK5A 5FWNA 1GQSA 1M7BA 2CVPA 3HB0A 4TMVA 3LP5A 2FN8A 1XK6A 2XBUA 3O92A 4XAQA 5AVVA 4WW0A 1GSOA 5ALQA 1SZJG 2D3WA 2WZCA 2ZBGA 3CZPA 1PJ2A 4LS3A 5EZYA 4EJ0A 3KWJA 5CLLA 1R16A 2ZI5A 2GN1A 3NKFA 3I92A 3ICWA 3LDGA 4LYEA 4CXMA 4PYNA 4JQSA 5B4UA 2BBWA 3DJYA 2FX2A 3QMVA 3Q3HA 3GNQA 5KWIA 1JLLA 4M99A 4XX1A 1XZLA 1UAGA 2B7CA 4LDZA 2HPVA 4ZO8A 2G9VA 3KZVA 4BO6A 4MARA 2VHUA 4DCVA 1UKZA 3ESZA 4HPXB 4IRXA 5C7OO 2YZ7A 5HIJA 1DAEA 3UK1A 3ZI4A 1KBOA 2R48A 2NO7A 4ZQBA 3CF0A 5JDCA 1C81A 1ZRHA 2FZEA 2UYQA 3AEQA 2AB0A 1MD9A 3GUZA 3F3MA 1S3SA 4N39A 4QJIA 4OLFA 4MI3A 5LQUA 3TRJA 5F9MA 2HA2A 3PB3A 3V6LA 3VSDA 3K70B 1YTUA 5LCXA 4ITUA 3DV0B 3SDSA 3IP6A 5IJWA 2BFFA 3FNRA 4D4LA 3QJYA 1F5NA 1YOVB 4II2A 2HMYB 2XYGA 1DO8A 3OY2A 4QL3A 2A0KA 1SCKA 2VP9A 2ZIUB 3WNCA 4OKSA 1A5TA 3QUCA 1QQAA 4Q24A 1T2VA 2H0QA 3I8XA 3DL2A 4QYMA 1Q11A 4XSHA 5T8KA 2HYIC 3R3JA 1NSFA 4QBHA 3X1WA 1XCPA 1M6YA 4DIUA 1S6YA 3F7TA 1EUDB 4V0QA 4YRTA 4LF5B 5BN3B 1HUQA 1Q20A 1AB6A 2FMKA 4U7DA 1VCHA 3A9RA 4RKEA 4ZEWA 1Q1EA 1VLZA 4Y6LA 2AKEA 1G7TA 5B1HA 4HGOA 2X1HA 3ADOA 3U3KA 4MUHA 3TVDA 3GBPA 1MV5A 1ZGBA 5IZCA 5J2UA 2EBHX 1CTQA 4UTNA 5TQ0A 5D87A 1OIVA 1XROA 5KSZA 4MINA 4L6AA 2PUBA 1ISPA 4RYLA 1Z0UA 2ZUDA 3A9SA 3OCVA 2FDRA 3WQRA 1SOWA 4MGKR 1JZTA 2AEFA 3EVFA 4K8RB 4PPNA 3T61A 3IBYA 3LTEA 1K8QA 4JLAA 3DBOB 3QPDA 3H5VA 1KFBB 4YPVA 3OZUA 2GDJA 1V3VA 2X5XA 3N9IA 1EWQA 3IQFA 1KAQA 2QGFA 3TMAA 3ZVNA 1Y6FA 4UMFA 2GM3A 1MN6A 2ZQZA 1V47A 4KJZA 4M37A 1P3DA 3TSOA 3FCCA 5E6UB 1T1JA 3CHYA 1KU0A 1X1EA 4DLYA 2HO4A 1N7JA 4J4BA 1DC4A 2O7QA 1N5LA 3EZXA 3EYWA 2GSWA 1XTUA 3PQ5A 2R60A 3TTSA 1QV9A 2D5LA 2AK2A 4LECA 2W93A 3TNLA 3B3QA 4QWWA 5K0NA 3C1UA 4REQB 3MGAA 4DDTA 1AN9A 2NZVG 4NHOA 3LQQA 5IDWA 1AKWA 2V7PA 4KRXA 1KDPA 4JZYA 5FTMA 3LWNA 2FW7A 3R0VA 3ABRB 4CG2A 2YXBA 2A1UB 5KVAA 2JH8A 2WI8A 3D02A 3THSA 3ZZ0A 5JXGA 4RV5A 2HW8A 2IYLD 4EFKA 2RHDA 5EZQA 2AOVA 2VJMB 4P93A 4H17A 2H54A 1MJGA 2YXLA 4HTAA 1C9DB 1CUVA 1EVZA 1IHYA 5DM0A 3SI7A 2TSYB 1V9SA 2OV6A 3FMGA 3AK4A 4RZHA 5JZSA 1BCRB 5KX5B 4KIUA 3FKJA 4Q66C 5IDVA 1R0RE 1WXXA 3OTQA 1VE7A 4CUJA 5HKLA 4KGZA 4NMWA 3G0HA 4ENWA 4LRXA 2XLBA 4QG3A 3PXAA 4B6OA 2V1UA 1KIFA 1DXOA 1NRWA 1P73A 1U3GA 3H1TA 3MWGA 2P0EA 4KBGA 1EBFA 3BUSA 3DEYX 3V48A 1AMOA 3NMUF 1W9MA 3RQIA 2BONA 1T8SA 3OHMA 4OJNA 4B7UA 1H4QA 2ZSBA 2ZAGA 4EF4A 3MGKA 1QOZA 3HRIA 1YKSA 4L6CA 5EE0A 4UBOA 3LH5A 4ZDKA 2EF0A 2RB4A 4K1XA 1GRCA 3EHEA 3TB4A 3P0IA 4TLEA 4NFHA 1X39A 3VAZA 4YIHA 1K2WA 5L3SA 1GPDG 3LNCA 4KVZA 4Q48A 5HSGA 1USGA 4S12A 1ZD1A 2P2ZA 2IUUA 4X95A 3X1DA 4D41A 3GLGA 5JSUA 4Q7LA 3S2GA 1R27A 4S24A 3UAXA 1IQUA 1NSTA 1GNVA 1T2FA 2ZSDA 3GBVA 3U7QA 4HQOA 1GKYA 1VLJA 4WECA 1BQ3A 1JUDA 1B8PA 1C7ZA 2REBA 4MAMA 3WC4A 5AW0A 3L0BA 4NYMR 4OXQA 1M1UA 4KIWA 5KJEA 5LWQA 4ZOEA 3AW8A 3PJFA 4ISCA 4MIKA 2ZSAA 3AR3A 4HXYA 5AKYA 5C4MA 1A8IA 4B34A 2BGTA 1HR0B 4B81A 3VTAA 1DADA 2ACWA 2VJKA 4RFSA 1S2IA 3NJ8A 1H1TA 2EFHB 4K05A 4BO5A 2QSUA 1ZRSA 2RGEA 1U04A 1BVRA 3G0GA 3HKDB 3HR7A 3IOBA 3LCMA 3O5AA 1V39A 3PD1A 4ENSA 3BOSA 1EX7A 4B76A 5BORA 2EZ4A 3H13A 4L0CA 4NJMA 5DBHX 5IG2A 3LF1A 4XCVA 4W8GA 3ZZMA 3KL2A 3JVDA 3SX2A 3F6BX 3KZCA 1VA5A 5ALIA 5ILGA 3VKVA 4NXMB 4NYJQ 3EMVA 4EWLA 5IF3A 5IAOA 3P4XA 4MB6A 1ODSA 4XDZA 2YY7A 3PXEA 1ADYA 2P2NA 2O7NA 1O97C 5A4MS 5KVVA 5F21A 1NNSA 5DN6D 2Q3FA 4YVFA 5WRFA 4YAGA 2ASVA 4MW9A 4RY0A 3VC2A 5K20A 4Z9BA 1I5EA 4CLRB 1MC4A 5AVUA 1O57A 3F46A 3MN1A 4QULA 1I7NA 1LK5A 1V8ZA 2JH3A 3AO0B 3OC6A 4HDQB 4CTJA 4H1HA 4EW1A 1R8YA 4BUCA 1H8EA 1E3TA 5DN9A 4M87A 5LZ8A 3S1AB 1QHHB 1VCOA 3UV7A 1Z4MA 1AA9A 1A7AA 2DY0A 2J6CA 5CLIA 1URPA 4DYDA 1XMVA 4HS4A 5H59A 1KI3A 5LP1A 2MYPA 1VSVA 1T8TA 4LIPD 3BD6A 3KBBA 1TM2A 3FDIA 2EDCA 1RYNA 3I01M 2WEKA 4HLDA 3U3JA 1ZCFA 2DFVA 5I7WA 2ZROA 3JYOA 1G20A 3V1YA 4Z1OA 2VAXA 2Y1CA 4RV4A 3IKJA 1Q74A 4IJWA 1JFFB 1T9GR 3AR8A 1D8AA 3ZHXA 5A4DA 4AP5A 3AHGA 1ICEA 3NNSA 1TFRA 1ECBA 1WV1A 2WDZA 3D3QA 3ELBA 1YJQA 3SIWA 2XHZA 3PWZA 4YI5A 2ZQ5A 2PL5A 2WB4A 2QZZA 1U3FA 2PZKA 4R2MA 3RJ9A 1DAIA 2G9UA 5CH5A 2Q5CA 4BMNA 3WLNA 3P0JA 2R87A 3DV9A 3QW2A 3ONEA 4NATA 2ZRMA 4DZRA 1IN1A 3NH9A 2Z0MA 3U4QB 4LY6A 4CCWA 1Y4AE 3PGVA 2H6EA 2QXUA 4I19A 3TOZA 3NHUA 3G49A 3KK0A 4ZV9A 5KMGB 1GNQA 4CMJA 4ZVRA 4A2CA 2PRIA 1FEZA 1XQYA 1NLUA 4O3FA 2R8XA 1Z17A 1V8BA 3NBUA 4UMVA 1EU1A 3D0KA 3ZWNA 2W6MA 1LDBA 5KNLA 3PQ8A 3VRHA 5FLKA 2WJWA 5CEJA 3WGUA 5I7HA 1FTYA 3H3XA 2PZLA 3DO5A 1HDOA 1NN1A 4RZXA 4OHZA 3O2QB 2IEZA 3HXLA 1F0PA 3A1EA 5LOVF 3TKLA 4H1TA 5B53A 1XWFA 2F43A 4ZDWA 5A5GA 3JQQA 5E7QA 5LNK6 3IO3A 4NPHA 4QRDA 3ZGXA 5CX1B 1GCAA 2WWHA 1N7GA 3HXTA 3T7SA 2BDUA 2E3JA 4B6FA 3IP8A 3QY0A 5DM4A 1C8LA 2XQGA 2Q9BA 3D4BA 2OD7A 1FX1A 3IO5A 1OI7A 1W2GA 3VHRA 3OKCA 3C4VA 4ML3A 1U2GA 5I51A 3SY8A 2XQFA 1EGHA 1JYSA 1LWNA 1K4KA 4QO8A 5LIPA 1FPMA 1VSBA 2G5TA 4U8GA 2CHEA 4RMIA 4TXMA 4F8JA 2VUSA 1FUUA 3AG5A 3QZUA 3AL0C 3IMFA 3QOYA 3L6RA 1QE5A 5FWDA 1IK6A 4W99A 3KQHA 1MX9A 2J0UB 3CQ9A 4L51A 4TTVA 3MZ0A 1QIEA 1QPBA 3A4VA 4Y6GB 1I6KA 4KR9A 4HAWA 4IIVA 5DHFA 1DAPA 3NHSA 5BPFA 5EJFA 3PD7A 5EZ5A 5HX7A 4OHVA 3U3DA 4UHBA 2NVOA 1JKFA 4UEKA 1EFDN 3C5EA 1EWVA 1TD9A 5COQA 3ZOKA 1SWWA 3BRCA 3ZLTA 1GLVA 2Q46A 3NTOA 1GZ6A 2VZLA 3ROEA 2Z57A 3WIDA 421PA 1S8OA 3ER8A 3C3YA 3KPJA 3MRSA 3CNBA 4B43A 1ITZA 4IUCS 3T4XA 1OTYA 1J0BA 3ND9A 1Z6ZA 2Q4DA 3S7TA 1HDYA 5I45A 1SIUA 4URXR 3P0HA 4AJ9A 4Y2YA 4PHFA 3CRW1 1RP1A 5B2FA 2R68A 2O07A 2GZHA 2R4UA 3RSHA 4JI5B 2DX7A 3QEMA 4Q00A 2WJYA 4MKXA 5CK5A 1H2HA 2WVAA 5FI5A 5IDYA 4ZHQF 1M34B 3KQTA 2J3HA 1E59A 1H2AS 4YWHA 4S1PA 1LCIA 1N8SA 4S0ZA 2QGZA 4NNPA 3N8IA 4Q7MB 4YMIA 2XWSA 2IBSA 1MUUA 2GX6A 4HMQA 4N12A 2F4NA 2C2KA 3EQZA 4MVJI 4OQEA 3EXHB 3IAHA 3MD0A 2J3MA 4NAUA 2WA2A 1WAMA 3LY7A 4U1RA 1LH0A 1IEXA 1LVUA 3IPYA 3HXQA 2QTVA 1C41A 4X41A 4YTEA 4XVQA 5BN5B 2YWBA 3GGSA 4FW8A 1J23A 2MSNA 3DHWC 4J2HA 3BXEA 4HTFB 5THKA 1VYTA 2C2HA 2IITA 4YAWA 1DJLA 2QRGA 3FD8A 1NHGA 1HT2E 1OU4A 2IJGX 3F5FA 5TQ2B 2BI7A 5ER6A 1NVKA 3CNHA 4XQ9A 4XRGA 3GLIB 1VLLA 1AMNA 2WU3A 1EFPB 5B3AA 2J5KA 3N07A 1BG6A 5SY4A 3RRFA 1F9EA 3F2IA 2JGAA 4DEXA 3NM5A 3EXAA 4ZT7A 2YWDA 1XDBA 5LBUA 4V02A 3U4MA 3C74A 3WMXA 4GOND 2QUJA 4DMGA 2YXEA 5F77A 1HY3A 2AN3A 2SECE 4INZA 3VISA 1A9TA 3VYVA 3NUZA 3LU1A 4GH5A 5J40A 2B35A 5D6NA 1ECPA 1GL3A 2AZDA 4C7JA 2AFIE 3PQ3A