3RRZA

H-ras in 70% glycerol: one of 10 in mscs set
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYEQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrzA00
4BECA 4Y0AA 4CGZA 2CXXA 4OQNA 3AP1A 3EIHA 3K1JA 5ANRB 2DPXA 2ZRFA 1IY1A 3E70C 1E94E 1CJTC 1XD8A 4U02A 2G1KA 2ZRAA 2GCOB 2CBZA 4LZZA 1E32A 3FOZA 1W4CA 3NBFA 4F7WA 1OH7A 1X3SA 3OEHD 1G3IA 2NOAA 5DHFA 2IW3A 3C16C 2O8DB 4UXIA 5D3QA 1TQDA 4NBSA 4JVSB 1SXJE 2MMCA 1T9HA 1AIPA 1N6OA 1RE0A 3N70A 3THXB 1U2RA 2BMDA 1R4AA 1LTQA 1ZINA 2A2ZA 1C4OA 2GBLA 2ZYUX 3ZZUA 1VHTA 3KKOA 4P4TA 4RFVA 3AUYA 4F93B 2ZS7A 2OV2A 2DFNA 1ZNXA 1XEXB 4DC9A 1F2UA 4F4IA 3TUIC 1Z6AA 1UKEA 1G7TA 2CK3A 3PITA 3PCRB 1IN4A 1UEJA 4LJ8A 1BOFA 2CNWD 2I4IA 4U00A 3VR1A 5BYJA 3PR1A 2VP6A 4MA4A 4B71A 4AYXA 2HXYA 3BERA 1VECA 4NYJQ 3L43A 1OFIA 2QNRA 1NN0A 1EX7A 221PA 2EFDB 1R5BA 4D80A 5FUVA 2A5GA 1KI3A 4TMXA 4S35A 4EPWA 4AG6A 3HR7A 1ZNWA 1G3MA 1Z0KA 1E1QA 1N6RA 3QXCA 2HF8A 5KPDA 2CCKA 2VYFA 5TY0A 1T4GA 3SBDA 2XZLA 1RRPA 3Q5DA 5KTYA 1UAAA 1K6MA 1MO6A 1KI4A 4M1OA 1IQPA 2OG2A 2CCGA 3KJHA 4A2PA 4CT5A 3CPJB 4JLAA 4I1SA 4NCKA 3A1WA 3E1SA 5FPHA 2QMHA 3IEUA 1DAFA 1S1CA 1KZ7B 3ND9A 4HAYA 4FWTA 3MJHA 2WPDA 1DO2A 1Y63A 2B7BA 4J0QA 3WYAA 1RC8A 2ZU6A 4C30A 3QPVA 4DLWA 4Q5IA 2Z83A 3FHTA 4L8GA 5SZJA 3NWJA 1WDTA 4BRWA 1ZVQA 4TLBA 1M7GA 1N25A 2RCNA 2WWYA 4QG7A 5DHAA 3C15C 4BUJA 2VBCA 2N42A 1G6HA 1AQYA 4B3FX 2AKAB 3Q8XB 4P4SB 1KNXA 3Q9LA 5C46F 4C2TA 1FOEB 1G8FA 1VIYA 3SJAA 1KJYA 5KYKA 3R7WA 1ZU4A 2QQ0A 1JQLB 4IOMA 5HTKA 3NDBB 1S9DA 4ZO4A 3H0KA 1COWD 1E96A 3QXHA 5FI1B 3T12A 2GWHA 2OLJA 3SBEA 3GJXC 1E2HA 1AN0A 3QOFA 3ZZTA 3MCAA 2ZEJA 4MGIR 3CW2A 4RZ3A 2JIZA 1G1MA 3KJIA 2QTHA 1XP8A 4JL6A 2JJ2A 2O0KA 3IIJA 4URWR 3SN6A 1XCGB 1KNQA 2EYQA 5HPYB 1ZD1A 1WRBA 2FFBA 4KO8A 1G4AE 3CRMA 3OE7A 2BEJA 2VIIA 4M1TA 4B6EA 4KSBA 5JHHB 4EKDA 1W46A 1YR6A 3QPUA 4L5BA 3SJBA 1CJKC 5CK4A 5DO9A 1G5PA 5C4GB 2ZSDA 3KKPA 4FMDB 3IQWA 1T3LA 3OF5A 1RRGA 2PMKA 3QG1A 5G3YA 4ZV4A 1UADA 3K0SA 1DG1G 1XTJA 3QXXA 4WW0A 4GDFA 4MDEA 1IJFA 2NO9A 3ZD7A 1F2UB 1OB5A 3DM5A 1CJMA 2UZ3A 3ADKA 1IXSB 1GL7A 5K8IA 4DIEA 1G291 5TV2A 5KNBA 3PEWA 4HI0E 3LXRA 3OEHA 1LFDB 2F1HA 2X2FA 1G16A 3ADCA 4D82A 1RFLA 4BLQA 5FFMA 1SXJD 3AP2A 1TTTA 2RKOA 1II9A 1G8PA 1KI6A 4HAXA 4PO9A 1ZU5A 3RABA 4Z54A 721PA 2ZAMA 4I1OA 4XD7D 5J4KA 2ZYWX 4RZUA 2ZXUA 2H5EA 3FMPB 1KY3A 4V0LA 3BJIC 4E22A 4H1UA 5FL7A 4EPRA 1VTKA 1NIPA 5FPYA 2CLDX 1ZCAA 2G9NA 1IOZA 1OW3B 3GMTA 2YC2C 3PENA 4LC1A 3L8ZA 4D26A 4NTZA 3A4MA 3WRXC 1D2EA 4NYIR 4LUCA 3I4LA 1DAHA 3GJ6A 1MV5A 2ZJYA 3LW8A 3A58B 5BN3A 2JJ1A 3I73A 3Q7PA 3A1TA 3P20A 3NXSA 1CXZA 2B21A 2JATA 3AKEA 5EE3A 5J4YA 4KYUA 2CHVA 3CIOA 4TYQA 4US0R 4W9MC 2A78A 4WOPA 3L0PA 4MRNA 4WZ6A 2WMOB 2ZRJA 2H57A 3B1WA 2QAGA 4TYNA 2RGXA 2J7KA 3FVQA 1A1VA 2CL6X 1S3SA 4NYIQ 1RVDA 4HLDA 4LJYA 4XWKA 4EFNA 4A4DA 3EARA 3WP0A 2QM8A 1GM5A 1U9IA 1XB2A 2ZI4A 4CYMA 3NHAA 4RKFA 1D2NA 2FZ4A 2O52A 1EG7A 4D4LA 2E1RA 1T0HB 3BB4A 5J47A 1LB1B 2ZJ2A 3VMFA 1N5LA 2ZE8A 3THYA 5IRCD 3GFPA 2GHIA 2JDID 4ZDIA 3R7WB 2XAUA 2R6GA 1G18A 1HQCA 1SQ5A 3KUCA 4P3YA 2H18A 4PQYA 2AWNA 1QHHA 1N0WA 1Z6XA 3DHWC 5EXPA 1U9IC 1XU4A 2P2LA 4TMVA 5EJEA 2QGNA 1QHIA 1AZSC 4TMKA 5FUWA 2IWHA 3MWJA 3W9YA 1P6XA 4D0LB 3L0OA 3K9HA 3FKQA 5AJZA 2BM1A 3B13B 1J8YF 4B2IA 2FJUA 4C3ZA 2Z6VA 2ZSEA 1P7CA 2OCYC 5CK5A 2GAAA 4N1AA 3FHOA 4POAA 3UATA 4A82A 4B3GA 4LGMA 2XJ4A 4XSGA 4PSKA 2ONJA 3UXMA 1YR8A 1FUUA 4TLDA 4DT1B 2J7PA 5FPKA 1XTKA 3G82C 3A4NA 3FKSD 4TSFD 6Q21A 5JS7A 3QUSA 1WP9A 5J4LA 3GJ7A 1F60A 1ETUA 1GG2A 4Q7JB 5E3HA 2WSSD 3LNCA 3QI2A 1Z6YA 4TTRA 1P2UA 1FFHA 1DVRA 2VTKA 3JVUA 3RLFA 1QBKC 4BFXA 4JL8A 3UMSA 4B2PA 1G8GA 3GLHA 3ICEA 4KFSA 2DY1A 2EWWA 1N3BA 1NBMA 4MYHA 2H8KA 5C18A 3I92A 5AJXA 5FTNA 2ASEA 1KI6B 1JECA 2ZRKA 1IN8A 2NO0A 3LXXA 2WWWA 3QY0A 3A37A 4DLSA 4TLAA 3W8NA 1NLYA 4URXR 2JLYA 4QBIA 3NG1A 3VX3A 1IN7A 1TQ4A 3SYNA 2IYWA 1R7RA 2FF7A 3MG9A 5H68A 3GP8A 4PAMA 1KO1A 4JLKA 1NKSA 5UKDA 5ELXA 2GESA 1OXSC 4WIAA 1AM4D 4UQOA 4YMWA 1KDPA 2FPMA 3V4FA 4QL3A 1AJEA 1QG2A 2AKYA 2HDNB 3GLIE 2JAQA 3MWYW 1UBCA 3TRFA 1E99A 4DHEA 4LDJA 2DHRA 3DO6A 1T5IA 2QGZA 1SXJA 3NEYA 2GAOA 3AH8A 1DARA 1T8UA 4XD7A 1N0VC 2GZHA 3U5ZB 1U90A 1US8A 3HR8A 4JIMA 1T3HA 3RYTC 4BGDA 5HKKD 2IF0A 2CCJA 4TMZA 1ZW6A 5E7JA 1SVKA 5KSPA 4JVNA 3RRZA 1N6IA 1D6JA 1Y3AA 1OKKA 2P0EA 3KQHA 1EWRA 2QAGB 5KO2A 1HURA 4IDPA 2ZUCA 2ORVA 5FR2A 1Z6TA 4Q7LA 4DKXA 2IEYA 1EK0A 3RRMA 4V0NA 3TH5A 4M1MA 3CLVA 5DN6A 3QXJA 5FTJA 4BRUA 5LD2B 1SXJC 1G5TA 3QENA 4L4UA 3TLXA 3K0EA 2F7SA 2CLCX 1D9ZA 3M1IA 3ZQ6A 1Z83A 1ZUNB 4JBWA 4PC2A 4A8JC 1OXUA 1P9NA 1A4RA 1BYIA 3IPYA 2D2FA 2FOLA 1D9XA 3THYB 3WRYC 1G20E 1AKEA 2HLDD 3SU8A 4MRPA 5AK0A 2IX3A 2D62A 2J0SA 2WIBA 2FWRA 3KZ1E 2XJ9A 2B7CA 5CIWA 3KQUA 3ASZA 2HV8A 3D7MA 5JSZA 2H1LA 4PXAA 1QHHB 5DI9A 1CS4C 1KDOA 1RYFA 1E9AA 4JLMA 1RZ3A 2AD5A 4OHWA 3CRVA 1KMHA 4QBFA 4KLNA 1YZNA 5DLQC 4DDWA 1ZIOA 2QROA 4NCIA 2AXPA 1XD9A 2ZRLA 2O8CB 1HH4A 2W0SA 1Q21A 3E2IA 1FNNA 3SQXA 4LYAA 1W7AA 2JDIA 3LX5A 2GNOA 3PUZA 3LDAA 3KXIA 2F1JA 1ZUHA 3RWMB 1G6OA 2ZR9A 4US2R 4HUTA 1J90A 1RKBA 4IVQA 4CZ2A 3PQCA 3BAFA 4RD4A 4UNQA 1F2TA 3QBVA 2AFHE 1U8ZA 5K8LA 2H7VA 3ZYCA 5HCIA 2REXB 1QRAA 4KITB 3MSXA 2ZRCA 2R6FA 2ECKA 2Q9BA 3HU1A 2GTPA 2HYDA 4A0GA 5CB8A 3D6TB 3IO3A 2B92A 1JQJC 1YRBA 3MUFA 4ZDJA 4IDNA 1PZNA 1GKYA 1P61B 3FPAA 2OEPA 2BBSA 1YR9A 2QMUA 3GLHB 3FDIA 1Q3TA 4N0DA 3W6PA 1NI3A 3IIKA 2IS2A 5B2ZA 1GNPA 4HDCA 3KUDA 4TSFA 3NBYC 3C14C 1X86B 1EXMA 1Q1BA 3SJZA 1T5LA 3ZVNA 1G7SA 4EFMA 3F5FA 2ZJAA 3BOSA 3MAAC 4TQAA 2FFAA 2WHXA 5J5CA 4JVLA 1KSHA 4F4CA 3DZDA 2R6AA 5EP3A 4HZIA 1LS6A 4NU0A 1TL7C 2F9MA 2HYIC 3DEFA 2REOA 2ZYTX 1S9HA 1SKYB 5EE5B 3REGA 5FL3A 4RJLA 3BFKA 3BH7A 2B6HA 1GL6A 1E2KA 2IEZA 2XTNA 2DB3A 2QZ4A 1ZRHA 3EASA 2G0TA 4MGYR 4UJ5A 1US8B 3BB3A 1XZPA 2QSYA 3B1YA 3LBIA 4MRRA 4KVGA 3MGCA 3TBKA 3VR6A 2QE7A 4FCWA 2V8OA 2F55A 1D8TA 2NG1A 1ELOA 3LFUA 1WXQA 3PUVA 1BMFA 1P9WA 5AUPB 2FSGA 2ZJZA 1VG1A 4JYBA 4LV5B 3UK6A 2D4HA 4OHVA 3QEJA 3IBYA 1U0HC 1F5NA 1TUIA 2VA8A 1LVGA 1YQTA 2Q9CA 4W7SA 1NLZA 1KKLA 4UXJA 4WXRA 4AG5A 1CBUA 4PAOA 3V4RA 4ESVA 1GITA 1L2TA 4DUGA 3VKHA 1P75A 3X1WA 3SDZA 3FFAA 1HY3A 1CJUC 3SEAA 4TL7A 4H1VA 1BH2A 2CK3D 3MFYA 3OIWA 3EC1A 4LSGA 5DYIA 4R7ZA 4ZKEA 2QBYA 4DIDA 3B1ZA 2ZUDA 4BFZA 1OIVA 1MABB 5HKKA 3KKNA 2KWIA 3QSYA 1H8EA 4IRUB 4LBVA 4Q9HA 4EPVA 3QPWA 2NGRA 1JJ7A 4Q47A 1GNRA 4B43A 1U8AA 5FH9A 2J5XA 2JA1A 4ON9A 4DCSA 1NVVQ 1E9FA 2A5FA 2VHQA 1SHKA 2Z4SA 1XD2A 3AGPA 1GL9B 3T1OA 1KMHB 2IHBA 4NCJA 4EPTA 2VF8A 4FCTA 2W6JA 3N5CA 2OAP1 1XXHE 4QNRA 3R8FA 4MQBA 1OFUX 1AK2A 2NO1A 4CEJB 2ZI3A 3SYKA 3T5GA 1E1QD 4XIGS 4QGHA 1KO7A 1N6HA 4NKRA 4Q9JA 1FQJA 5J40A 1E9DA 5BYKA 2Y8EA 4C0HA 2VHTA 1TF2A 4JJKA 3OFNA 1KY2A 4A92A 2XSZD 2ZS9A 5FBWB 1NVWQ 3V00A 4IEIA 4Q1AA 2VHJA 5JHGB 1ONBA 2KBFA 4AWXA 1NMYA 3CPEA 1YU9A 2QT1A 3FGNA 1F2TB 2D7CA 3CZPA 4L9SA 5G40A 1WBDA 5JJIA 5M04A 3AB3A 4YLGA 3B82A 3QJYA 4XWAA 4JT2A 5D3MB 2WPDD 1NSFA 3RS0A 2P6RA 2XGJA 1PUIA 3GJ8A 4XVUA 3SZRA 2IHYA 3O8DA 1KDRA 4QXAA 5CYPA 1FNMA 4Q48A 1W4BA 5C4MA 1E4VA 1TEXA 4MH0R 2C78A 3QEOA 1OH8A 1Z0AA 2ATXA 2W2XA 3C4JA 2H17A 3PEVA 2PT7A 4M1KA 4CT4B 1DEKA 4Z1MA 1XPOA 3EIQA 4Q9LA 1W47A 3AVTA 2ZI5A 3UWOA 1YHNA 2MSCB 4R2IA 4WVFA 1NNEA 4HYYA 4EPXA 5DGXA 2BBTA 1VG0B 3D3QA 1J70A 4RCYA 4NCHA 3QQ5A 4B6FA 1VKJA 4FW9A 3U61B 4DEXA 3TR5A 4N3NA 2WMNB 1TPZA 2YC4C 1CR2A 1O3YA 5FBLB 1EFCA 3CZQA 4GZMA 1HTWA 4ASUA 2FV8A 1OJLA 2VSXA 3EC2A 1EWQA 2JJ2D 3OIYA 3CNOA 4Q00A 4QGGA 2V3CC 4A9AA 2YZ2A 1E3MA 4M2LA 5JZVA 1W4RA 2ZRNA 2DR3A 3OE7D 4JKYA 1L4UA 1GP2A 2VH5R 5SZKB 1KI2A 5L3VA 1NG9A 4GOJA 4BFYA 1LNZA 4KBFA 1FUKA 2C2HA 4TZ6A 4A0FA 1J2JA 5BWMA 1AS3A 3T35A 3X1XA 4RVCA 3THOA 3L0IB 1AS2A 1WBBA 1W36B 1E2NA 1KI1A 1M34E 1QVRA 1KHTA 1WF3A 2PX0A 2IWRA 3U44A 3WP1B 2A5YB 3T34A 5J4HA 1UEIA 5DISB 5BQ5A 2ONKA 4F92B 2F3RA 4DVGA 2QBYB 4LYFA 2OAQ1 2BCJQ 2H16A 3NH6A 1F6BA 3CX8A 4X8OA 3NHBA 1KSJA 1Q57A 1SKYE 1IJEA 1LF0A 2IA5A 2X2EA 3TMKA 1QVAA 1QHNA 3UANA 4PO1A 5KHOC 3SYLA 4ACAA 1KI7A 1TQ6A 2OHFA 4KHZA 1TUEA 1YZUA 2X1VA 3SFVA 4II7A 1XTRA 3P32A 3GLIA 5FL7D 2WJYA 4ZKDA 2F1RA 1XD2B 4R98A 4DZZA 3IHLA 2ZVPX 2BJWA 1CRQA 2CE7A 2FEMA 2IUSA 2XOKA 4P4UA 1UBFA 3EW9A 4KSCA 4QGFA 2CJWA 3PUXA 4GOXA 3VFDA 1OT3A 3RS7A 2VP0A 4LY6A 1JXOA 2Q9AA 3T61A 2ZJOA 2DFLA 4NMMA 4QM7A 1E2EA 2ZPTX 2YNMA 2GBLC 2JJ1D 4PC3A 1OV4A 1AS0A 2F6RA 3OEEA 4DDUA 1P9RA 1BS1A 4I4LA 3PUYA 4V0ME 3D8BA 1LW7A 5EXTA 4IKEA 4DSUA 5LB4A 2A5DA 2HCBA 1T6NA 3Q5EA 5IF9A 3DMDA 4AKEA 1DE0A 1ZM3A 4URVR 1GIAA 2P6NA 3AGQA 4LOAA 1XF9A 2C98A 2CDNA 5IK2A 2LCFA 1DAIA 2Z4RA 3L82B 3RWOA 3LD9A 2J46A 1VIAA 4W5WA 2IK8A 2XSZA 3K9NA 4Q4JA 2IBMA 1VCOA 5DIFA 3VR3A 521PA 1EFRA 4HLCA 2QPTA 3T06B 2ODNA 1GRRA 1OXXK 3RDPA 2IYLD 2RGEA 2WIAA 1R5OA 2WM9B 3GLFE 1KZGB 2ZU0C 2JLWA 3W5IA 4JLPA 5GJVC 4HDQB 1S3GA 3I5XA 1E1RD 3CNLA 3RC8A 4TQUS 5TXGA 3TVTA 3W34A 4IOLA 2ZANA 1GILA 1SVSA 4JMPA 3ECCA 3CPHA 1P62B 2GJKA 4JS0A 2Q21A 1GOTA 4NCNA 1JR6A 2GEDA 1VMAA 1G8YA 3SC3A 2J9RA 1KK2A 4IDQA 2KE5A 2O5VA 1XFAA 3AVOA 4LYHA 2LKCA 2V1UA 3EA0A 1E79A 2EVWX 2J7PD 2OCPA 2PCLA 5J4VA 4BASA 4CIDA 3Q3JB 3U3JA 4AC9A 3EAQA 4UKDA 5LBIA 2ATVA 2I1QA 4R2HA 2IS4A 2K5UA 4DLVA 4C4PA 4LBZA 3FMFA 5FUXA 1E2PA 3ZZ0A 4K46A 5AJWA 1OIXA 2D74A 3VHLB 5G41A 1NKTA 2BBOA 4WXPA 3U44B 2JLSA 2FGKA 1CJVC 3ONWA 4RFSA 4LCBA 3QKTA 1UBEA 3THWA 1RRCA 2C96A 1FL9A 1T8TA 3S1AA 1Z0FA 2R62A 3HPRA 2ZVQX 1NBMD 4G5SA 1IBRA 1Z29A 4DT1A 1KO5A 4JSYA 1R6BX 5JJLA 1AGPA 1FQKA 1T0JB 4B34A 3F0TA 4MGZR 5G3ZA 2A30A 2EU8A 5EE0A 4CEHA 3GLIB 4RCZA 2GA8A 2V6IA 4L15A 3KL4A 4FMCB 2QP9X 2WJVA 3EXAA 3A1UA 2JEOA 4AYTA 4D0NA 4AK9A 4I81A 4Q1BA 4C0KA 4YMSA 3X1YA 1N5IA 2CJWB 3CF0A 3AVQA 1BIFA 1G19A 3QE0A 2H92A 4U7DA 1G7RA 1QDEA 2D3WA 5JRJA 1M7HA 1S2MA 1UM8A 1N6NA 1VPLA 3PUWA 3FYHA 1TAGA 3BXZA 4TTPA 2QTFA 2KSQA 3AV0B 3QNUA 4HB4A 2RGAA 2SHKA 4FWIB 5AUOB 2GKSA 4DLXA 3TIFA 2Q0HA 2N1BA 1E4YA 1OKKD 1Z8FA 2QUZA 3ZS9A 4C9BA 4P32A 1DAEA 4ACBA 1C9KA 3VU9B 2QPAA 1IXZA 4EPYA 5DN6D 1CR1A 1Q20A 5JEEA 3IDQA 2GVDC 2OBLA 3NVAA 2FE4A 1OIWA 4XTRA 3J81k 4IW3B 3VX4A 2HCJB 2JLZA 3Q85A 3SHWA 1U0JA 4PC7A 4NYMR 4Q4JB 2J0UA 4A0RA 5FBQB 2Q3HA 3LW7A 1FW6A 3LO5A 2RHDA 2XB4A 3Q7QA 3R20A 1YZQA 4OK3A 4OJKA 3SHFA 5KPJA 3DL0A 4D0GA 4OI4A 4GNKA 4UNPA 2J87A 2WVJA 3OZXA 1XXHA 1J99A 1XMIA 3RAPR 5AUNB 3KB2A 1ZC3A 3NC1C 3L8YA 3FE2A 2VEDA 2FSFA 1RJ9B 3WYFA 2YJTD 2BDTA 5IT5A 1FZQA 4W5JA 1E69A 2VP9A 3U3KA 4XH9B 5JJKA 3SQWA 3WMGA 3SR0A 5P21A 2XITA 4Q1FA 3EZ7A 5HE8A 4B3CA 1TF7A 1D2MA 1WMSA 1X8KA 2FU5C 2GJAA 4A0HA 3A6PC 4Q7MB 5DYGA 4Z8YA 2QENA 3HPQA 2QAGC 3GJ0A 2AX4A 4QNMA 2ODEA 1IN6A 1NY5A 3PVSA 2YV5A 2IXGA 4HAZA 5LD2C 4TZ0A 2R2AA 4NP6A 4BEBA 2FDCA 1E1RA 3A4LA 2R8RA 4IFBA 1RRFA 2QRNA 4MUAA 2QMEA 4IVRA 1R0YA 3BB1A 4TWZA 3C5CA 2DCUA 3GFTA 3WNBA 1Z5ZA 2IYXA 1OHHA 4AY2A 2QP3A 3LX8A 3ETLA 3O8RA 5FOWA 2JLXA 1XWIA 1R0WA 4JYCA 2RH5A 2O8CA 3NIBA 2GF9A 4HB2A 4YMVA 4G3XA 2ZSAA 5JWOA 3A1SA 4PPNA 3U3MA 1NLFA 4RFSB 3AM1A 3GJ3A 3THWB 3UIEA 4IEEA 1S1MA 4YC7A 1M74A 4E09A 3S1AB 4Q4LA 4MDFA 3KX2A 1X8JA 2IYSA 3M6AA 4Z8XA 1NVXQ 1HQYE 2ZRMA 4BQSA 1JR3E 5FOSA 2NTYC 2PT5A 2JJ8A 3R9IA 4CW7A 5A5GA 4FMBB 2IYVA 3QF7A 1K5DA 1GTVA 1TEVA 4GI7A 2EFGA 3WYGA 4CEHB 3EPJA 1CEEA 3NBXX 5KU1A 3SOPA 4URYR 3HJNA 1AA9A 3EX7C 1N5KA 1P60A 5TARA 4F38A 1ZMXA 2FSHA 4PHFA 2C9YA 2GVZC 3IPXA 2WTUA 2ZS8A 1X1SA 3U7HB 3LVRE 1YZTA 2W6IA 3CB4A 3TSWA 3AKDA 4B2LA 4DCTA 3PJRA 2YHSA 4PZYA 2O8BB 1W1WA 1ZD8A 2MSDB 4F4JA 3BRWD 4B44A 2ZQ5A 1E0JA 2BMJA 3BORA 3FB4A 4DDVA 4BWYA 1VCMA 3BIFA 3CH4B 5HZKA 3V9PA 4Y0VA 2QE7D 1PLKA 2RAPA 1KK1A 4PSVA 2QP4A 1BMFD 3LRPA 3BK7A 1QZXA 2QORA 4RZXA 4PZLA 4B3DA 2F43A 4ERNA 3WBKA 5AJYA 3U2QA 2B8WA 3AF4A 5K8TA 2QN6A 1IAQA 1RW4A 1EESA 2J59A 4DUGD 2Z5FA 2QG6A 2BWJA 4CDGA 1YKSA 4X8MA 2GZAA 3EZFA 5FR1A 1OYWA 3BFXA 2QY9A 1HYQA 1RIFA 1UKVY 4ZI3A 5L3QA 1BYUA 1KO4A 1Z3IX 3IBGA 4D4JA 4DBLC 4LWZA 1OH6A 2J0UB 3B1XA 4UJ3A 2AK3A 4JLOA 1G9XA 4QHSA 5JFGA 2ZTSA 3REFA 3AKYA 1J8MF 2WV9A 1H8ED 3QXSA 2OXRA 3W3AA 3B60A 2QT0A 3H2YA 1XPRA 5SZHB 5GVSA 2ZSBA 5JBQA 1UKYA 1XXHB 4B3XA 5JI3E 1OYYA 5EUMA 1ESMA 2VHUA 3JVVA 2ORWA 2EFCB 1N2CE 4LC0A 2ZJ5A 1NL3A 1KDTA 2IS1A 3CRRA 3EWSA 4Q03A 3GLGE 2W6JD 4DRZA 4YMUA 5HE9A 2ZAOA 4RD2A 4V0MA 2VQSA 3VKWA 1MABA 1IHUA 3VHXA 1W4AA 1Z2AA 1GSIA 1SULA 4D6PA 4PSAA 3OFND 3I5YA 4KBGA 3RSLA 1U99A 3C7KA 4HDOB 2C5LA 4B32A 1MOZA 3EPHA 4YQFA 2W00A 2BMEA 2ZSFA 4G01B 5FTMA 1Q1QA 4LHXA 3DMNA 4GFDA 2FH5B 3OAAA 2E87A 1ZP6A 4OK5A 4I1UA 4BLSA 4B33A 3B9PA 4CEJA 4RD6A 2EQBA 2ZJBA 3O47A 3TNFA 1W0KD 5TVKA 3JZMA 2W83A 3P1JA 5H70A 1YZGA 4D81A 4QJ3A 1ANKA 4FMDF 4UNRA 3GLFA 3K0FB 4OQXA 4Z1MD 3QKRB 4M1SA 1ZAKA 2J45A 4RD0A 4XJXA 3HYRA 3DOEA 1NG1A 1Z0IA 4QHTA 5GADl 4PX9A 3B6EA 1S0UA 3LBNA 1JEEA 3I8XA 4TTQA 1G17A 2R65A 4L16A 5D3MA 5EZ6B 2NO6A 3TW4A 4TYYA 4PHGA 1E9SA 1ODFA 2ZROA 4L9WA 2IXFA 1GRNA 5DNYB 1CU1A 3KB1A 3U60B 5B64A 4UNSA 1OF1A 2GK6A 4RKEA 2A3RA 1EX6A 4DWJA 3PV0A 4ASUD 2ZIAA 2XNDD 5BW8A 2JASA 4MKHA 2VSOA 2AWOA 3W8RA 4MYTA 1ZM9A 3NTUA 2V7QD 4QC2A 3B2EA 4PHHA 1W2GA 2R6DA 1GWNA 3QKUA 2WWGA 4Q9IA 2RGDA 3ZGXA 2V6JA 2HJVA 4K81B 1G3UA 1VHLA 3CR8A 1XRJA 4MKFA 4BLPA 3DPUA 1O87A 1JAIA 4JBXA 4LX0A 2OE2A 3VR4A 2YWEA 2GRJA 2QPOA 3MWKA 5KDLA 2C77A 2F43B 3I32A 1U0LA 1E0AA 4ZDKA 4D2IA 4DB4A 3QF4B 2ZETA 3CX6A 5E7IA 4Q21A 5JCPA 3BGWA 4MKIA 1PV4A 1OSNA 1SZPA 2FNAA 5A4JA 5L3QB 4AYWA 2WWXA 1K5GA 4KYIB 2PJRA 1L4YA 2OZEA 1NRJB 4HZUA 1C1YA 3CF6R 2CHGA 4XTCS 5KSOA 3P27A 4DLZA 4PTLA 4RY2A 4IFEA 1LY1A 1Q1ZA 4OI0A 4ARZB 1XCMA 1VG8A 4BZPA 3GEHA 4DCVA 4OJQA 5FOTA 1XBTA 4PQRA 1OFTA 2BBWA 4LPSA 621PA 1W2HA 3DDCA 4OHXA 5FUYA 4ZCIA 3FMIA 1KI9A 3W3ZB 4M53A 4R9UC 3UG6A 1UFQA 5A0FA 2XOKD 3IIMA 2FEOA 2UVQA 3DKPA 3FTQA 4LBWA 3R8CA 4AKGA 1E2FA 2ANCA 2GXUA 2ZRDA 4KFRA 3ZS8A 1K8RA 2WSMA 3UKDA 3U4QB 3ZLJA 2PMDA 3N2EA 3SNHA 5IDVA 4DCUA 3A8TA 1U81A 4M0LA 2W2TA 1OH5A 3OEED 1SVWA 1W36C 3K09A 1MO5A 5TMPA 3RRNA 2YWFA 3G0HA 2V4ZA 4NONA 1ZUIA 4WBSA 2F9LA 1U8YA 2ZREA 2PLFA 2VRWA 2EYUA 3ZVMA 1E2MA 1CRPA 5FI0B 2NO7A 2G1JA 3KFXA 3MLEA 1W48A 1E0SA 2ZM5A 2WICA 3CRW1 3R9WA 1E2GA 2NIPA 1JEDA 4F91B 3LLMA 4MITA 4HB3A 4FCVA 2D2EA 5IK2D 2Q6TA 4EJSB 3BE4A 3K09C 1JNYA 4M21A 4ZPXA 3AF3A 2CL7X 1JALA 3GLFB 4CF7A 4IDHA 4NHOA 2KB0A 4M8NE 4HATA 1T91A 5AR1A 1IXRC 1EFRD 1VYVA 4KXFB 4TYPA 3T5DA 5L3RA 4R71A 1RYHA 1YZLA 3IHWA 3UMRA 3ADDA 3I8SA 1ZBDA 4JKIA 1W5TA 2IYTA 1GZSA 3CO5A 1UJ2A 1XX6A 4M9XA 2RGCA 5CJPA 5GJWC 3AUXA 3TGPA 3CM0A 4OI2A 3IO5A 5CM9C 1W0KA 1G64A 4FI3C 4KV9A 4Q9KA 2V55B 2GJ8A 4OQLA 4G5RA 1FMJA 1IN5A 1FX0A 1PLLA 4GOKA 4X8HA 3SJCA 5JMTA 2OCAA 2VL7A 3HU3A 4JBYA 4PC6A 1V43A 2PEZA 3ZVLA 1CIPA 1DAMA 4XVRA 4MRVA 2YOHA 4OL0A 1WCV1 3LY5A 421PA 2G0NA 4S2EA 1N5JA 1KI8A 1L8QA 5KUTA 1E79D 1ZC4A 2FFQA 5KOYA 1Z6GA 1Z0JA 3LV8A 2IS6A 2OESA 2IYQA 1QHSA 1TU3A 2QSZA 4OKSA 3BS4A 2VSFA 4KJZA 1H65A 4BFVA 1SVIA 1ZM2A 3F3YA 4LJ6A 2QMOA 1EFTA 3AKCA 2C9CA 2GF0A 1XMSA 1KJWA 1KSGA 4GZLA 2XNDA 4C0BA 2QA5A 3P4XA 1TNDA 2C04A 1V5WA 4V03A 3GD7A 1W5SA 1XEWY 1IONA 1P2VA 2HT6A 1JR3A 2V7QA 3BFVA 1HEIA 3RSOA 4A2QA 4A6XA 5BN5A 2ZE6A 1MT0A 4DLYA 4HLQB 1JBKA 1NY6A 4D25A 3BH6A 4FINA 4HZUB 1KKMA 3WMFA 5EE1A 1CULC 2VP5A 3K70B 3CH5A 2WKRA 2OCBA 4DCNA 5F2EA 1A2BA 4B76A 5JEDA 5EZ5A 2HJGA 4V02A 3VAAA 4TMWA 2N46A 2FX3A 1R8QA 1QF9A 2A9KA 2L0XA 1CKEA 2GJ9A 1OFHA 4LBYA 1TMKA 1TF5A 4BE7B 5B58C 2YOFA 4M9QA 2QAJA 1QHGA 5GVRA 1CF4A 2DWOA 1NMXA 5CJ2A 3NDPA 1BO6A 1ZCBA 5JWRA 2EFHB 2ERYA 3LWNA 1XTSA 4PPGA 2HEIA 1R10A 2IYYA 2RGNA 3K0CA 5KNDA 3TSZA 2RGBA 3W90A 5B30A 2IT1A 2ZI7A 1DPFA 4O0MA 4QM6A 1XJ0A 3CUEF 1Q12A 3QKSA 4NH0A 4US1R 2W2VA 2Q3FA 3CF2A 2AFIE 4TL9A 1EFHA 2GETA 5EE9A 2JGNA 4JLVA 4RZ2A 1FMLA 3B9QA 4KAXA 4DSTA 2GEUA 2F3TA 4KVAA 3TKLA 2IUTA 2XTZA 4G5GA 4BFTA 5JI2E 4Q19A 4N0EA 2YYZA 4HLUA 4M1WA 3FFBA 1VDZA 2RGNC 3K0CC 2VLIA 3LBHA 1XJQA 5KDDA 4HEJA 3WHKA 5JWHA 1CP2A 3UG7A 4AI6A 4A15A 3I1FA 3GPLA 1GAJA 2R9VA 5AUQA 5EP2A 3B1VA 4NYJR 2KI5A 2NPFA 1Z47A 1XMJA 2CVHA 2WWHA 4ZCLA 3SI7A 1F48A 3QG5A 2YWHA 2OT3B 2PX3A 1E9CA 3T1VA 3TAUA 2OBNA 5KNCA 1G4UR 4HLUC 1DG3A 4KI0A 3GLGA 3U6KA 2C9OA 4O2LA 4GBMA 3VU9A 2VO1A 4O2RA 4XOIA 3E5HA 3KXLA 4KODA 1A7JA 1GFIA 2JCSA 1CR0A 1T3SA 1FX0B 1ZM7A 2NPIA 2EFEB 5EUQB 3MWLA 2QI9C 1GKIA 3TE6A 2ZE7A 1VG9B 1XCPA 3K9GA 3U6BA 1NSTA 1E2JA 2REBA 4KU4A 4M4SA 4MRSA 1N0UA 4BLRA 4XVQA 4OQMA 2WWFA 2XZOA 1II8A 2XB2A 1YR7A 3SS8A 1RJ9A 3GFOA 3L2OB 2IYUA 1MO4A 2B8TA 2Z0MA 2ZRPA 3NBZC 4G5OA 3WHLA 3KQLA 2WOJA 3B78A 4ESHA 2PCJA 1OHHD 1XNJA 3IGFA 3OHMA 3B8HA 2XTMA 4TYWA 1M8PA 2YVUA 1NIJA 5EXSA 4LJ4A 2P3SA 1E9RA 1Z28A 2WKQA 2RGGA 5K8UA 1D5CA 3ADBA 1P2SA 1VYTA 1I2MA 2XEXA 1MKYA 1NN1A 3QBTA 3KJGA 4MGKR 1G8HA 3W5JA 3Q72A 2FFHA 4DJTA 3WNCA 5F9FA 2PZEA 1UKZA 3VR2A 2AD1A 2O8EA 1KSFX 4D4KA 3WXMA 1U94A 4AKIA 2C99A 4OBEA 4BEJA 1H8HD 2ODWA 3L0SA 3RC3A 4E5UA 4B47A 4YXWD 4C7OA 4NPHA 3EIEA 4PPFA 1KK0A 2GK7A 4CRWB 3TUZC 3AVXA 2GDJA 3CX7A 3F8TA 1JJVA 2ZR0A 2ZR7A 2PEYA 2WOOA 5EP1A 2W6ID 3W6OA 2OILA 4BZQA 4PO8A 2LWIA 4P31A 2G77B 2HXSA 1YJ5A 2XNSA 3QKSB 4GP6A 4KFTA 5HZHA 4QBHA 1WB9A 4DSOA 1NJFA 4QBGB 4CVNA 3H86A 1Q1EA 3U7GA 1Q44A 1SGWA 1PLJA 2P65A 4LRWA 2P5SA 1RPZA 2PLRA 4O3MA 4BFSA 2GZDA 2EWVA 3CR7A 1QHXA 4U5XA 1UPTA 5C2JB 1DTSA 1G41A 2BIFA 3RS5A 3NKVA 3HYTA 4LJ7A 2IF2A 1OLOA 4LHZA 3NC0C 3LQRA 3GQBA 3W6NA 2GCPA 2O8BA 3I3SR 5JLJA 4JLBA 2C8VA 4EQ6A 1OXTA 3UMFA 3PG5A 4HAVA 4IVPA 4YMTA 1I2DA 3SE0A 2UKDA 1Z63A 4D4MA 4HAWA 3AF2A 2AXNA 2HUPA 5LB2A 2ERXA 3OIVA 2Q3MA 2QL6A 5CDFA 1EGAA 2R44A 1S96A 3IKJA 4HUQA 3TJZA 4LJ9A 1YE8A 3GLGB 4MUBA 5F98A 4JLDA 4QOSA 1E98A 3A1VA 2J3EA 4HAUA 4BZXA 4V0KA 4W5HA 1UDWA 2ZRIA 3KQKA 5KSZA 1OB2A 4I1VA 4ITRC 3EG5A 4AD8A 3GEEA 4V0OA 4GPTA 1TX4B 2DFKB 1GRQA 3DKVA 1DELA 4O25A 1N6LA 2P67A 4IHQA 2BHRA 1SVLA 3U3OA 1I4TD 4QJ5A 3TQCA 4YDHB 5KSYA 4I99A 2QTVB 2A5JA 3GEIA 3IUYA 4M22A 2DWPA 2OSBA 3X2SA 5EXXA 4JZKA 1UDXA 2GXSA 3K0AA 3DM9B 2X77A 1M7BA 1E2LA 2OBMA 2EW1A 3EZ9A 1Q3HA 1II8B 4G5QA 2D06A 1HT2E 2G3YA 3O8CA 3JZAA 4B75A 2CNWA 5JCZA 2VF7A 3OAAD 2P5TB 3MRSA 3NEJA 4PC1A 4PHTA 2CLSA 1PVOA 2OFOA 3VR5A 1DADA 5FPTA 3LH5A 1MH1A 4TQ9A 1X6VA 4NYMQ 2XXAA 1WE2A 1W44A 3RS2A 2VHCA 1ZNZA 5FBVB 1G3QA 4LPKA 4XSHA 4DXAA 1AKYA 1S4QA 4TLEA 2ZI6A 1J7KA 1P73A 1ZJ6A 3VNVA 3CNNA 4K8OA 1E0KA 4URUR 5JECA 2BCGY 1LS1A 2O8EB 3EZ2A 1Z06A 2AL7A 2E9SA 1G21E 2I3BA 2V54A 3MJRA 3B5JA 1HT1E 4C7OB 2PH1A 4M9ZA 2AHOA 4GRAA 4Q1DA 4LV6A 3RS3A 2CEAA 2ZRHA 3BC1A 5DSZA 2OM2A 1E9BA 1M1YE 2CE2X 2OXCA 3K0FA 5TDHA 1N6PA 2KJQA 2O0JA 3QKRA 1KAOA 2ZYVX 4MYCA 4UXHA 3AVWA 4Q4AA 3EA5A 3K53A 3ICQB 2Z43A 4PAQA 1X1RA 3PEUA 5EQTA 4DLTA 5HR5A 1EFUA 2BC9A 4QGAA 1S8FA 3MD0A 3WNDA 1LV7A 3TR0A 2VP4A 1IM2A 1H8HA 1SVMA 3IQXA 4PFSA 4YXWA 3RANA 5L3SA 3TQFA 1KJZA 4TLCA 3TK1A 4BPBA 2WJHA 3U3RA 4YONB 1JPNA 2ZJ8A 4TT3D 3RS4A 3C5HA 1COWA 3DVLA 2PJZA 1X8LA 1HE8B 4TL6A 2ORIA 1B0UA 3G5UA 3ZDQA 2ZRGA 4ZCMA 1YVDA 1KGDA 4EQ6B 4FN5A 4ZDWA 3KJEA 2C03A 4B3BA 4BFUA 1BKDR 4EFLA 2HT1A 4P0TA 3K70D 2OLKA 4YDSA 1N6KA 4AKHA 4HUQB 2BM0A 4TMTA 5LPNA 3AVVA 3C41J 1KO8A 2DYKA 4Q7KA 4QFMA 1ZM4A 3EZ6A 3KFVA 3QF4A 1W36D 3AEZA 1B23P 1FTNA 2BMFA 5C1BA 4LJ5A 4DSNA 4OHYA 3CKLA 5E4FA 1R0ZA 3KKQA 2QRZA 2AR7A 2FA9A 3N2IA 1VCNA 2G83A 1WA5A 4JLJA 4Q18A 3T1TA 4UNNA 3EPLA 1W0JD 1P3JA 1IY0A 4Q1EA 5LDDC 1DBSA 4ARZA 3K0AB 3VTKA 2ZE5A 4KLZA 4RD3A 2X8AA 3KDSE 5FBRB 3HP1A 3KTAA 3AQ4A 1NMZA 2QM7A 3U7FB 3OESA 1R8SA 1GDDA 4FIDA 1A2KC 2XX3A 2WAXA 3FHCB 2J0VA 4C0JA 4LI0A 1MRNA 2BJVA 3LQQA 4A8JA 4P33A 5G53C 3X1ZA 1NN3A 2XXAB 5CM8B 3CBQA 4IOKA 1Z07A 2WJGA 1P5ZB 3U4QA 2UZIR 4JJZA 3R9XA 3B7GA 1FTSA 1G3RA 4PPQA 3FMOB 5EP4A 3NH9A 4RD1A 2GILA 1KAGA 5HCNA 4JLNA 3GJ4A 1GNQA 2O8FA 4FXPA 4GMXA 1E9EA 4IOJA 1Z08A 2PZFA 5E95A 1ZD9A 2HF9A 2PZGA 3CWZA 3HDTA 4PQFA 4Z51A 1ZYUA 5DE3A 3AF0A 2JLUA 2J0QA 5FTKA 2LKDA 2ANBA 3M0EA 1G5RA 3QIAA 4C0AC 4WAUA 3A36A 1XMVA 1MR3F 3AP3A 3HWSA 1KMQA 4G1UC 5CB6A 3VKGA 4EJSA 3T15A 4IDOA 1NP6A 1TU4A 2ZUBA 5E7MA 1E2IA 4Q02A 2ZI9A 1SKQA 4DDTA 2CHQA 3BWDD 4BLTA 4Q4AB 1JB1A 2IL1A 3KKMA 1AZTA 2WAYA 4Q1CA 2ZITA 3ZIAD 4FMCF 3H4MA 3K8YA 4QHYA 4PANA 4CEIA 2JLVA 3TUJC 5CIQA 4MYUA 4IXMA 4DEYA 4ABYA 2NZJA 3IILA 2VP2A 4EIWA 4EJSC 5L3SB 5DI3A 1G7CA 2ODBA 4Q4HA 1M2OB 5DH9A 2I1VB 3AVYA 4KCGA 3EPKA 1E2DA 2PL3A 5FTLA 1SVOA 4KFUA 1FP7A 2MSEB 1R2QA 3DOFA 3MMPA 1JR3D 4B74A 3I61A 3QVVA 1JI0A 4NZYA 3WBJA 4G0NA 1KIMA 4JL5A 4LHVA 3BBPA 3CWQA 3U7EB 3HU2A 4C0QC 1HE1C 1QG4A 4ZI2A 1R5NA 4PZZA 5JRZA 1DOAA 1HA3A 3PIRA 1DS6A 1KTVA 8OHMA 1OXVA 2BOVA 1CLUA 1CR4A 2PBRA 3FWYA 4OHZA 4B35A 3RRYA 1I4LD 3LVQE 2X19A 4TT3A 4A6PA 2NZ8A 4JT4A 2BV3A 3ND8A 4Q01A 3EWAA 5GJCA 3FKSA 1Q0UA 1KK3A 1LF5A 2DFTA 3AF1A 3UPUA 1OPXA 1YZKA 2W58A 2FZLA 2WSSA 5FOVA 4C2UA 1JPJA 2IXEA 4LHWA 3LA6A 1MRSA 3ZH9B 4ZIRA 1Z22A 2YKGA 1YRAA 1SHZA 1UF9A 3RNLA 1QHYA 4IJMA 1JXMA 2RMKA 4M1YA 5F3WB 3TW8B 2QU8A 5L8VA 3KTAB 5CITA 1AQUA 1XTQA 3P26A 2CMKA 1R0XA 4EAQA 5CDFE 1SXJB 2JLRA 3TAHA 1DAGA 3UWKA 1P2TA 5BXQC 2O0HA 4A1FA 2WWIA 2OUKA 2VPPA 4XWOA 5KDOA 3I72A 4A8JB 4A2WA 1XEFA 3K70C 3D31A 5AJVB 3CONA 1WQ1R 3ZJYA 3VNUA 3KXKA 4B48A 2NQ2C 3C8UA 3SFZA 1W0JA 2WBLC 2ZRBA 5CLQA 4H9GA 2J41A 4B73A 2QQEA 4WA7A 1CTQA 1E6CA 1NVVR 2AK2A 1F3OA 4GT1A 3KQNA 1KYIA 1XJCA 4TN1A 5FPSA 2O8FB 4LJAA 4AIIA 5CYOA 4DB2A 4M9SA 4E07A 2GCOA 4Q66C 2BVNA 2DBYA 1MO3A 1M6NA 2OFXA 4OQFA 4OYHA 2FSIA 3DZ8A 2R6CA 1HUQA 1XEWX 2FPKA 2JLQA 1NF3A 2D7DA 2O8DA 3PFIA 1IY2A 1A5TA 3THXA 2BKEA 4ILEA 3TVDA 4C0LA 5JSZB 1KOFA 5H1YA 1GKUB 4E03A 4AURA 4QJ4A 4LHYA 5FOXA 1XEXA 4DLUA 1NVUQ 4DLRA 3ZVRA 2G88A 2CVFA 1FPMA 4CEIB 3TSOA 1UBGA 1XTIA 4RSGA 4LYJA 3X1DA 3GJ5A 1ZNYA 2HLDA 3CRQA 5DI3B 4Q4HB 3RHFA 2OFWA 1Z2CA 4IXNA 4URZR 3P4YA 4WZBE 3O8BA 4TL8A 1A82A 2BEKA 2WJIA 4HSEA 2GJSA 1VYUA 1OE0A 2F1IA 2V9PA 2AN9A 2A7QA 2IC5A 1Z0DA 3K9LA 4NL4H 2J1LA 5CLLA 2P6UA 2KBEA 4LV8B 3ZIAA 1DO0A 1I4DD 2GXAA 1XPUA 5F9HA 3H84A 5TB5A 4BLOA 1GUAA 2BKUA 4QKQA 2MMGA 4HB0A 2WKPA 1PUJA 4FD2A 2RHMA 3RVBA 2CL0X 1HV8A 3B85A 3BD9A 4EUNA 4A36A 1W49A 2V1XA 5B57C 4NE2A 5H8WA 3AVPA 2YWGA 1GVNB 2W0MA 4OI1A 3ZQJA 2FGJA 2IUUA 4GL2A 2OO7A 2YOGA 3T1QA 2G6BA 2FMXA 1JAHA 2WZQA 1E2QA 1L7VC 4MKGA 2IYZA 4X8LA 5SZIA 1DAKA 5AWFC 1TADA 3GCGA 3LLUA 4LK2A 1P72A 4NDZA 4ZIRB 3ASYA 1PJRA 1U98A 2XZPA 3LAWA 5GJBA 3PXGA 2JIZD 1TQ2A 3BH0A 2GCNA 3WMEA 3I62A 1XZQA 1ZIPA 1AGRA 3PEYA 2GEVA 4QRHA 5FOUA 3IEVA 2FG5A 1XDBA 4P4SA 121PA 5JS8A 821PA 3M4YA 1P4SA 4OK6A 4PR0A 4C0SA 1NN5A 1Q22A 2WJJA 2DWQA 4EDHA 4GP7A 1FP6A 2FPLA 3QVUA 1ESNA 2TMKA 3VQTA 3GLHE 2IYRA 5IHPA 1NBME 4GSYA 5BN4A 3AVUA 2C95A 2NMVA 1II0A 2QEQA 4WZAE 4GMDA 2GXQA 2RB4A 4BFWA 2YINC 3ZD6A 3H1TA 1NJGA 2FN4A 3OIUA 3WY9A 1VCIA 4JSTA 4JVMA
chains in the Genus database with same CATH superfamily
4ZQIA 4Q9AA 2A0WA 5LYJF 3IUNA 2CXXA 2GAFA 3D7KA 2R00C 4A03A 1Q95A 5C37A 2H07A 1RKQA 4XB6B 5ANRB 1QGOA 4BV9A 1IY1A 5JAHA 5E1MA 1E94E 3Q0TA 3LFTA 4IAOA 4Z3OA 2G1KA 2PUGA 1RZVA 4C6HA 1SD2A 1V8DA 5FFFA 1JG2A 4KL8S 1H69A 3D6VA 4YYEA 2K7ZA 5I01A 1J6UA 2NOAA 5T8KC 1DXHA 3FOFC 5EMJA 1J0EA 1Y8CA 1L3BA 1TQDA 1K97A 3H6KA 2QE6A 2QTGA 1V1JA 5D3QA 4AT1A 3V2IA 4E1VA 1T9HA 2FPGB 2VNHA 4IGFA 2XYGA 1F8YA 1U2RA 4IINA 3GJRA 1TA4A 4N82A 2TSYB 1LTQA 3D54D 4Q4CA 2WVAA 4I9NA 2V6FA 4PX2A 2QTBA 4P4TA 2UZ0A 4IEFB 4IJWA 2ZWVA 5AI8A 1I24A 4BNJA 4Z4CA 3NNNA 4DC9A 4OOFA 3O21A 1MAVA 1UM9A 3HGTA 4LF7B 3K6RA 5JH7B 2CK3A 1INLA 2O0LA 3EQ8A 2B6NA 3EWNA 5JXJA 5K45A 4LJ8A 2X4GA 3PFNA 2B2NA 3LUCA 3MJ4A 2LPMA 3KD3A 4KUGA 1IG0A 2BUBA 2XB6A 1TLTA 4U00A 4KR9A 2HTEA 3FOCA 3VR1A 3WIEA 3ZBUA 3VR6H 3ZWAA 5BV0A 3GB9A 3KPJA 4KKVA 3BERA 4OHCA 2YIDA 3AINA 1T8PA 1ZGCA 4L1KA 4R54A 1FFCA 1NN0A 5AVQA 1EX7A 1HF3A 221PA 2EFDB 3BTUA 1R5BA 4KZKA 5JAIA 1L3CA 3CSDA 3JPWA 3ZW7A 1NUSA 2A5GA 4TMXA 4C3VA 4EVIA 4FR2A 5HTOA 4S35A 3AOEA 4LTNA 2CVQA 1O97D 4N49A 3AI7A 2X8JA 1J0CA 3UJCA 4LE2A 4QD3A 3FJ1A 5JXWA 1GUZA 3NM4A 3KE8A 3W7VA 3IVCA 3QXCA 5HXAA 5AHXA 2HF8A 1M2NA 3VC7A 5TY0A 2XZLA 1T4GA 5TE9A 5C8YF 1C3VA 3HDQA 1JXAA 4WUVA 3TINA 4QATA 4BHTA 1KI4A 1P2BA 3RTEA 4X1IA 2VOJA 2E89A 4O5OA 5EGNA 3Q3GE 5C1IA 2OCDA 3G0BA 1LDNA 4X6UA 5FRDA 4CT5A 1O5IA 3CPJB 1U0FA 3LLCA 2ZTLA 3KOUA 3QW4B 5CJJA 3A1WA 5HBRA 1FBTA 1CVIA 4H7JA 1K08A 2WU3A 4HAYA 1YSCA 3MJHA 1EVQA 1FYDA 5EIBD 1Y63A 4Y2GA 4CMIA 4EABA 1P1CA 4R6WA 5E8JA 1N8TA 1SUEA 1XZBA 3M4XA 4BBAA 2WTNA 3JQ6A 3M1LA 4Q5IA 1IOLA 4F3TA 1FQOA 3G2OA 1RTTA 3Q87B 1Q7EA 1YQEA 5AVVA 1Q74A 1JHMA 2ZAGA 1JDTA 5DHAA 3M89A 1BMDA 3P9IA 2N42A 4ZTUB 3O8NA 4BGEA 3R5JA 1IZ8A 3GT3A 1MJFA 1C2YA 4JXZA 4Z4IA 1VIYA 4IRMA 3DFFA 2XCSB 1ZJ5A 3R7WA 4XPIA 3KQYA 5L4LA 4IOMA 1C41A 2HH9A 3RU9A 4ZO4A 4MTCA 4ILKA 3F7OA 5EZQA 1IFXA 1COWD 4FFOA 4JEIA 5FA6A 3GCXA 3SBEA 1RYDA 1KETA 1X19A 2GBIA 2M1ZA 2F17A 5FTWA 1DEXA 3VU0A 5H3HA 4II3A 4JT8A 2ZEJA 3L0ZA 2XODA 1ZH6A 1G1MA 2DOKA 2GRAA 2I8AA 3JZFA 2IY9A 5J59A 5JZBA 1U7DA 2Z2IA 1YHZA 2PVPA 1TMYA 2O0KA 3HFGA 1RAFA 4MDHA 3V7FA 3V8BA 2IYEA 1KC1A 2EYQA 4CTKA 5HPYB 4QYXA 2IU0A 3DKRA 1Q7RA 2PNFA 4FYXA 4GX0A 5IUKC 3V1LA 4KO8A 3CRMA 4QEDA 2BEJA 2HO4A 4WPGA 1P31A 2DKFA 4O2BA 5CLJA 1YRWA 3TTTA 4X1YB 2PFSA 4ZU6X 1KAEA 3FCOA 1G5PA 5DO9A 5F73A 1JLSA 4C1NA 2OCLA 5B3LA 3IQWA 3FCYA 3TTYA 1STOA 1UIMA 1WSDA 3OO1A 4TMFA 3TTXA 2PMKA 4GKJB 2HHJA 5TR9A 1N0HA 2I2FA 3HKDA 3IAEA 3K0SA 1BVHA 2DT5A 4ZOLA 1XTJA 3QVJA 4V1CA 1U28A 2YIVX 4NFHA 4Y7CA 1SEVA 1SQGA 4BMXA 5E9WA 1SQSA 3HBMA 3DM5A 4ITVA 2BGGA 1CJMA 2UZ3A 4H6WA 3ADPA 2V7TA 4LNUA 4IG4A 4BNYA 2JFWA 4DIEA 2JFVA 5TQ0B 2FW1A 4HWSA 1QIFA 2OHOA 3JWPA 4X66B 3OEHA 4KDRA 1TU0A 1QH0A 1G16A 1KORA 3BCRA 2UXBB 1TUBB 1SXJD 1IK6A 2ETVA 3AP2A 1MA3A 4JGGA 1H23A 2DQZA 1CY4A 3QLJA 3RABA 3UHFA 4Z54A 5ALVA 1YVRA 2OO5C 4I1OA 4J0IA 4XD7D 4RZUA 2ZXUA 5JO9A 2FTKE 4JHXA 4GKVA 4NRDA 3LG2A 4CBVA 4EJ6A 3KYCB 3DT6A 5EEGA 1IZ9A 1RWMA 4H1UA 3UMMA 3SF8B 1B3BA 5EKDA 1QMPA 3ZWWA 1NONA 3GMTA 1QK5A 1QH1A 3IRVA 3QU4A 3TOXA 4EHLA 4D26A 4QTXA 4BJ5A 4KACA 2KQUA 3GRRA 4LOKA 3RUEA 4LIPD 1I4WA 3E9MA 1XTPA 3I4LA 1MVLA 4W7HA 3CLSC 1NF9A 2XVZA 4WJLA 3BWVA 3GLVA 5BN3A 3L18A 2AQKA 3TL2A 3I73A 3Q7PA 3A1TA 1JA0A 1FRQA 3K9BA 3URKA 3AKEA 1P4RA 4JJAA 5DRYA 2GUGA 3WWPA 4LNAA 4KYUA 4O4JB 1AF4A 2DFDA 1BHJA 2BGNA 3P5BA 4AWAA 3CIOA 4YT4A 3O7WA 4I4NA 4RMHA 5B6JA 1JEAA 3GCZA 3L0PA 4MRNA 4QDUA 5ITVA 2AI2A 1NYLA 2ZRJA 4CL2A 1HETA 3V3KA 1BAPA 1VKZA 3G89A 1BRMA 4F46A 4NYIQ 1ZHHA 1R74A 3OCJA 3PUHA 5CURA 1P91A 2AHRA 2VPTA 4AMUA 1W6RA 1FSZA 3PC7A 5K1ZA 2FPRA 5ARBA 1V1MA 4R2LA 4D43A 4ENRA 1FMFA 2WTBA 4RSHA 4QIHA 2QM8A 3A9WA 3KLNA 4DNFA 4RVHA 1GM5A 1U9IA 3MUEA 4CYMA 3NHAA 3OEWA 3JQAA 3ZWDA 2O52A 2ABWA 4D4LA 5CFRA 2HNBA 2E1RA 1T0HB 1TJ3A 2FRVA 3R40A 3BB4A 3WBFA 1SBTA 2YZ7A 3EXFB 5A7FA 3THYA 2WWTA 1R37A 5KNCH 3JSAA 2I5PO 2R6GA 2RH9B 3OOHA 4GOLD 4DOMA 3B51X 5MFZA 2L19A 4P3YA 2IY7A 2AF3C 4P38A 3WGGA 4W8OA 4MR9A 1ZL0A 1Z6XA 8ADHA 3VHQA 3UAZA 2BT4A 3WAJA 3WB1A 1T6BY 2QGNA 4TMKA 1AZSC 2FUG1 1PV1A 5FUWA 4AJ1A 1C0IA 5BMVF 3EOAI 3MWJA 4D0LB 4WECA 1KXZA 3ND7A 2VG8A 1A1SA 3B13B 1J8YF 2A57A 4B2IA 5CVEA 2Z6VA 5EKSA 3UATA 4HNAB 2GAAA 4POAA 4A82A 4DTIA 3L1HA 4KMMA 3SK0A 2XJ4A 5AVTA 5KTNA 3AJEA 3KT6A 1U2SA 2RC6A 4FI3F 4DQKA 1J4AA 1L5NA 4BFLA 1SVUA 4NATA 3ZZMA 1KTIA 4KR0A 1PDOA 3EQ7A 1Y7HA 1YUNA 5F12A 1PV2A 4WCVA 1EFPB 3A4NA 1KJIA 1RMYA 3BXFA 3FKSD 5TS3A 3EYWA 3U7QA 2PIDA 3OX3A 2OD9A 2IYFA 1KAQA 1DWPA 4Q7JB 4NBTA 1QTQA 2R6HA 4K9OA 2WSSD 3QI2A 3GGJA 2QQGA 1BHO1 4PZUA 3HL4A 4TTRA 4UDXX 4UHBA 2AIRA 4BC0A 4Y6SA 3U4DA 2EZTA 1H1LB 1ZK2A 2I55A 1KEPA 4JKOA 3RLFA 4ZVLA 1QBKC 2COUA 2HY7A 4CM3A 2I6SA 2C5GA 4MAAA 2OCKA 3EIWA 5KOHA 5A2GA 2H2WA 4N5DA 2EBHX 4D8VA 4LSMA 3GLHA 4MAFA 3C6KA 4GXRA 4B4DA 1R0LA 3I92A 5HZMA 3PX3A 3QHQA 5FTNA 1KI6B 3TLZA 3AJAA 3VOAA 4CV1A 5DNUA 3R6TA 2Y1CA 4CV0A 3LXXA 3CSUA 1NPTO 2WWWA 2XZTA 3QY0A 4JUIA 4OFWA 4OB6A 4XWYA 4DLSA 4URXR 5JBIA 4IQGA 3WXBA 3KSMA 4BB0A 4OLBA 1TQ4A 3F4KA 3C3WA 2VHYA 1PFYA 3WFJA 5K09A 1OX4B 2F48A 1OXSC 2J3LA 1AM4D 3TB6A 1DC6A 2E4WA 2NADA 4EARA 4EG3A 3E48A 4QL3A 1AJEA 1YB2A 2AKYA 2HDNB 3QPCA 2JAQA 3OTHA 1E6KA 2JVIA 1E99A 1W36C 4BNKA 4LDJA 3GYGA 2EJBA 1ZGGA 4HCJA 4MQFA 5DNVA 4AO7A 5T4FA 3OQPA 3THSA 1T8UA 3FDZA 3H0CA 5FBHA 4K03A 4ZXFA 3U5ZB 2XGMA 5F51A 1RLMA 1PW5A 2VNAA 3RYTC 1VBMA 2F1KA 4KVZA 2IH5A 1SVKA 1PT7A 5ALWA 3OOJA 1BJRE 2P0AA 2WILA 3KKEA 4FVTA 3WRYA 4EYGA 1JVSA 2DHCA 5KO2A 1HURA 4IDPA 2O2DA 5FR2A 2BTEA 1DX9A 2OV1A 5FBKA 4F85A 3TH5A 1HNXB 2RFLA 3GRUA 1G5TA 4L4UA 3TLXA 5TMBA 1S5PA 2A7XA 2E4VA 2F7SA 1WDKA 2WHYA 3ZQ6A 1SXIA 2VDPB 4B1FA 4CKEB 1ZUNB 4R8KA 3CY6A 1V3UA 4JBWA 5KIAA 1PJSA 5FEUA 1AV6A 3KNZA 2CV2A 1KFCB 1BYIA 3V8EA 1HLGA 1RWVA 3I2KA 4Z0PA 5JQGA 1XVTA 1RYZA 3BIWA 5L95A 2FKNA 1G20E 1TYBE 2HRZA 3GARA 4UM5A 2QSUA 4N41A 5JYDA 2IX3A 4TTJA 1TFUA 1SIUA 1V16A 2QKYA 3DOCA 3KZ1E 3P45A 4NBVA 2LD4A 1H0RA 3ASZA 2BELA 3QPDA 3D7MA 3KQUA 1WLYA 3INGA 1L5SA 4PXAA 1D7OA 4O2AA 1KU6A 3D4BA 1QG6A 1KDOA 2YDYA 4JLMA 1CB0A 1G5HA 1BXKA 2EKZA 3E81A 1O5OA 3EFHA 4KLNA 4QBFA 5E9JA 1YZNA 3F5SA 4DKJA 2FW6A 3ASVA 3R74A 2C00A 3DMRA 3O3MB 1ZIOA 4DDWA 1JFRA 2QROA 4HDMB 3NOXA 3QVKA 1LKZA 3CZ5A 1RCUA 4K26A 4NCIA 4PZEA 1O2DA 3UBMA 1G55A 3C3CA 1HQDA 4J0GA 3W4JA 4D5EA 2G9VA 2V98A 3ME5A 1M2WA 1DQSA 2JHPA 1W7AA 5AOCA 1YC2A 1GPUA 2PMWB 5JS6A 2EIHA 3DDSA 3D3WB 3LRXA 1JU9A 3PUZA 2HKIA 3F6BX 2F1JA 4WCFB 5CBPB 3NYQA 1KYVA 4QFBA 3UAXA 5HKOA 3TOZA 4TV8A 1E4OA 1V5GA 2H7XA 2VDNB 5JAUA 5C7IO 1SXHA 1I7SB 4G97A 2MYNA 2PSFA 4F45A 3CN9A 1JLMA 1QC5B 3TW0A 5K8LA 4DMFA 4QOHA 3L79A 5HCIA 2QTLA 1AN9A 1QRAA 3LYLA 3MSXA 5AOAA 1GPH1 5FAXA 5AD1A 5TLSA 5T6MA 2HYDA 3WVNA 1ZZGA 3AFNA 3GT7A 1Q14A 2Q4EA 4MX8A 2WU8A 3M33A 3KSRA 3K1YA 4YAJA 1V2GA 2B92A 3FVWA 4LXQA 4YV1A 2GO1A 2Q5OA 1KDYA 3WICA 1IWPB 1V3TA 3LUBA 5E1OA 3HRIA 2QMUA 3X44A 4GI2A 2OBBA 3HCOA 3USES 3RC2A 4EY5A 2IOFK 2GHRA 3KV3O 5B2ZA 4PZCA 4AJLA 3KSDO 4P1ZA 3TXXA 4IMIB 3PX7A 2O5CA 2QL9A 1NT2A 4HDCA 2QHXA 3E4DA 3KUDA 4TSFA 4L0DA 4O63O 3FPKA 4C14A 1YL5A 4MWEA 3K32A 4OXIA 5ALEA 4C4RA 1X86B 4R0NA 1ODJA 1QF7A 4UEQA 2MSKA 4XCXA 4JV5B 1IUNA 4BNLA 1TUGA 1Q1BA 1EDBA 3ZWXA 4GM4A 3ZVNA 3X1KA 4EFMA 3F5FA 4FOTA 1M2VB 2WUWE 3MAAC 2ODQA 3IBFA 1CLEA 3DZDA 2R6AA 5DNAA 1K27A 1W88A 5AVZA 2ZJ1A 3JAWA 4IS2A 1LS6A 4BIIA 4BLVA 1TL7C 5C8YB 2A67A 2R1ZA 4HAOA 2NU6B 3DF7A 2WUFA 3REGA 4G26A 1Y4UA 3BRWA 3MJFA 4RJLA 1TI7A 4XVHA 3BH7A 4ZVVA 5EWLB 5EIEA 1VB5A 4RLSA 2NU8B 3HJGA 2G9QA 4AY5A 5LN1A 1I14A 3EASA 3KSBC 4IHJB 2BF7A 1US8B 2OD2A 3KAJA 2QSYA 1ONSA 2CVOA 4OQ4A 1MORA 1NQWA 5EJGA 1L7OA 1K7XB 1XRNA 4H35A 4RXUA 1ELOA 1P9WA 2QLFA 1RLUA 2FSGA 2ZJZA 4JYBA 3OKFA 5IASA 2D4HA 1DIHA 2G5TA 2V0GA 3HK2A 3I52A 1GSAA 3CCCA 3CX3A 3QEJA 1U0HC 2IUFA 4EYQA 4F2DA 1F5NA 3PQ2A 4W7SA 3V4RA 1SPBS 1XDSA 3FIJA 1T8YA 1PYDA 4INJA 4ESVA 2VS1A 3ZWBA 4YAWA 1P75A 5F5NA 1XP5A 3CLRD 5K5EA 2EZ4A 3SDZA 3FFAA 2R11A 1U0SY 1ULTA 1ORVA 3FYUA 2CK3D 4RSMA 3MFYA 4Y30A 3EC1A 2BFFA 4LSGA 2WFMA 4R7ZA 4R68A 3PUKA 3GCWA 2VDVE 2D6FA 5JD6A 1MABB 1C3XA 3KKNA 5D6OA 2VJCA 2XCUA 3JQFA 3QSYA 4IRUB 4M0MA 4EPVA 1U8UA 1QS0B 3F46A 2OPHA 5A05A 1HFKA 3A14A 4MJXA 4YROA 3U1TA 3A1CA 3QTLA 2DWUA 4OXNA 4QUBA 1SXGA 1J97A 2FY8A 5J2TF 4B43A 2J5XA 1L4NA 1WKBA 2YJZA 2JA1A 1Z26A 4ON9A 5L7WA 5FCDA 1V39A 4GW3A 5CFMA 2Y4OA 3CVWA 2PAAA 4MSUA 1UAGA 1RD4A 2IZ0A 4NCJA 4EPTA 1JWLA 3ZDCA 3EH1A 3EGDB 2H6EA 5ALOA 1ONOA 2OAP1 3MLBA 4PAGA 3PXAA 4GC5A 4KW7A 4PIMA 4V2UA 3TIIA 3M6UA 4CEJB 3GU3A 3T5GA 3DE1X 4XIGS 3BFJA 4YCJA 3JYLA 1BH6A 4IMRA 5DJ5A 3RUHA 1P1BA 3TTWA 1SBZA 3KOZA 3OZFA 3PWSA 4DV6B 1ENZA 2IGBA 1TF2A 4XLLA 4DA8A 2LBPA 3OFNA 4D9JA 4F11A 1HMYA 5FBWB 4RYLA 3RUCA 1AC5A 3TECE 1PJAA 3R0JA 5DNCA 3CTPA 4U9IS 3PDHA 3Q6NA 5JHGB 1ONBA 1NMYA 3AW9A 2AQ8A 1QLHA 1UBNA 2D7CA 2A6PA 1X1QA 3CZPA 5KVQA 2J4DA 4NFLA 1ZN7A 5CPBA 4CF5A 5M04A 3R3YA 4MJLA 3B82A 3MQFA 4QQFA 3UA3A 4QPCA 2D1YA 3AKZA 3D3JA 2ENWA 1QCDA 2OGSA 2YXDA 1PUIA 4XVUA 3ZY5A 5ARDA 3E9RA 3TX6A 4TKMA 1FNMA 4WVLA 5C4MA 4DHWA 2WINI 5HJ7A 2WFLA 4BMSA 4CR8A 2W2XA 2W4QA 3ZGOA 2H17A 3NPAA 3RROA 4CT4B 2IZZA 1I5OA 4INZA 3EIQA 4YP7A 1W47A 4OQQA 5BV1A 2ZI5A 1UOOA 1RIIA 4BAUA 4EPXA 1V4VA 3U4CA 4EKNB 1MHPA 1PQ4A 3AF5A 3G9TA 4E3WA 4X3PA 3D3QA 4C03A 4RCYA 5EEHA 4NCHA 3QQ5A 4QVGA 5G02A 3O82A 4P9NA 1NW7A 3CHYA 4NZMA 4Y1EA 1OAAA 1ZJ4A 2YC4C 1CR2A 1RQPA 4MS4A 5G0VA 3L9XA 1C7ZA 3ZH2A 1G8JA 3Q98A 4QGGA 1NXXA 2IBSA 1E3MA 4QDOA 4GLFA 3FB1A 3R75A 1T5BA 4D9IA 1BG6A 2M2IA 2XQFA 1W4RA 3VZSA 3MT9A 1RWQA 2DR3A 1NOJA 2BKAA 1Y3DE 2W43A 4FOPA 1GP2A 3QBEA 3M5CA 4M1EA 3L05A 4WKBA 3T7DA 3VSAA 5LOVA 1QPGA 1O77A 4MHTA 1NJ1A 1XGKA 1SBHA 3HO1A 1JDSA 3L7DA 2C2HA 2PMCA 1T1SA 4DRXA 3X1XA 3BWBA 3D2AA 3AEQB 3FPLA 3H5LA 3G9QA 3Q5GA 3K71B 3NRJA 4UHDA 4LOHA 3L0IB 1WBBA 3U80A 1KI1A 1M34E 3AEXA 1YIOA 3I9LA 1QOPB 1ID1A 3GL9A 5IMBA 1V41E 4C21A 2IWRA 5F1PA 2QM3A 5KJFA 2W2MA 1ICIA 4D8XA 3G0GA 5F7XA 2A5YB 3T34A 2P2YA 1Z36A 4CM8A 2ONKA 2F3RA 5ALMA 4DVGA 2QBYB 2OAQ1 2BCJQ 2VTVA 3NH6A 4KPYA 1SWVA 1TEHA 4HEHA 2WVGA 1DQPA 1PL8A 3H04A 4IILA 1TZCA 4YK7A 4W6ZA 5FIUA 5KYUA 1IJEA 4N5HX 1LF0A 5TNXA 2IA5A 1BKYA 2X2EA 3QKWA 4Q3KA 4DSZA 2V59A 5FORA 3UANA 5KHOC 4RMIA 1KI7A 2OHFA 1CSEE 4ZT6A 5IULC 2Y0PA 1OFGA 5CH5A 1UOQA 3P32A 3UVEA 5C8ZA 2YICA 3FUUA 4QYIA 4IIVA 3U9TA 4AG3A 1XD2B 4ZKDA 1OH7A 2ICAA 1NBAA 3DCYA 4M9UA 3BCUA 2ZVPX 2BJWA 1CRQA 3DEJA 3RT7A 1QNLA 2FSUA 2IUSA 1UBFA 3AK4A 3UB3A 5EUCA 1D7AA 4XE5A 2YJ3A 3LPDA 2V8BA 3PEFA 4GOXA 1H0HA 1U2PA 4FN4A 3V1MA 3PC2A 2H1HA 4MVJF 1OT3A 4QARA 4J2TA 3T61A 2Q9AA 3V8MA 5AMXA 4DUPA 2GBLC 4PC3A 3FDJA 5AI9A 1N2OA 4Y9SA 4DDUA 2JFOA 3LUAA 1WW3A 3EB9A 4RK5A 4V0ME 2UYHA 1L6IA 4HNSA 3GJQA 1UWKA 1UAYA 1A77A 2A0YA 4IKEA 4LYEA 1C7RA 5AVUA 2O20A 3QLVC 4LRTB 1A9TA 3AUFA 3T7KA 5IF9A 2A5DA 1T6NA 4BCBA 4BX2A 5AKKA 2GZMA 2XWQA 3KQSA 1K0FA 3C8ZA 2V5AA 2VF5X 2GPAA 1ZM3A 2W2NA 3KV1A 2XQJA 4ZARA 3F7NA 3WLJA 2W90A 3H9GA 2DBRA 4DG8A 1N2XA 1SIBE 4FSDA 3H13A 1G20A 2EEZA 4JNCA 2IXBA 4LOAA 4ALLA 3JW8A 2JBHA 4YQEA 4G24A 4MUIA 1QK4A 2P40A 4EEKA 2C4HA 2UZ1A 2J46A 3CJRA 3LD9A 4KG7A 4PSDA 1T4CB 3BD8A 3JQAD 4HDAA 4TRMA 5F9MA 3W5BA 1L9KA 1XELA 4ZCRA 3KELA 5DIFA 4MCJA 1G0NA 2JH8A 2KLHA 1ICEA 1YOVB 1YFZA 4CFSA 3D2CA 1ZISA 4BCDA 1M66A 2CF6A 3OQ6A 2ZU0C 3QMWA 1DFHA 3S2EA 4P3XA 3W5IA 5ADVA 2JLWA 1MX1A 4M86A 1UQRA 3MMSA 4Q15A 4ABTA 3F8WA 1WHSB 3BF7A 1D1PA 3KEQA 5IJXA 4DRYA 5TXGA 3D59A 5EJFA 5GZ6A 5WRFA 4IOLA 5JARA 1I9CA 5K0SA 2QL7A 3MNFA 3N2KA 2PLAA 3LHFA 1PAUA 2GZ1A 2XVYA 4JS0A 2RI6A 5AJHA 5AFSA 4RTSA 1KZHA 1DT3A 1Z17A 4PCAA 3O9MA 4G1FA 3EQZA 2GEDA 5FV4A 3TPFA 2A33A 3CSSA 3H3JA 4IIXA 1NPDA 1KK2A 4ATNA 3QJ5A 4GLBA 2Q5FA 4LYHA 5A3QA 1L5HA 1WX1A 3LYUA 3DAOA 1Z2DA 3LYHA 5HFAA 1U3DA 5DLDA 1E79A 2NV0A 4RPJA 4X24A 1B76A 2I65A 2W8ZA 4JC4A 2XE6A 5BWLA 5I4KA 5J4VA 2FWIA 1BQEA 1B42A 3LZ6A 4CIDA 5K51A 3U3JA 1MFPA 5LBIA 1MX5A 2ATVA 3B8EA 3I2YX 4NVRA 5C35A 2IS4A 2JZNA 2ECFA 1IY8A 1ORDA 4ERXA 4UFPA 5JG7A 4B8YA 3FMFA 3OZWA 1E2PA 1F4VA 3JX9A 1QFJA 1DZ3A 4FFNA 3ZZ0A 1EXVA 5K8JB 1TTQB 2HRRA 3ER8A 4ETWA 5IKXA 2HJHA 4WH0A 3BZBA 2OAEA 4JQYA 4LE0A 1Y7PA 3O4JA 5DCUA 5TQ2A 3HXMA 4BDSA 5C4IA 1VSTA 5K99A 2FEKA 4LRYA 1CJVC 3HCRA 3THWA 5F2OA 1RRCA 2ZBDA 4RV9A 4GGPA 1T6ZA 3RODA 2C5AA 2E5FA 1K7CA 3ICCA 5KJ1A 1IBRA 4NS4A 1RMTA 3LF2A 3MJVA 4GR9A 3I2IA 3JQCA 4DT1A 5I9NA 1PS9A 1ZGBA 1C9DB 1R6BX 3BG5A 4FUTA 3IPAA 4RPLA 8AT1A 3IAS6 3V7WA 2J67A 4DCJA 1VSVA 3F0TA 4N54A 5G3ZA 4MLPA 1HKHA 2EU8A 4PQEA 2FCRA 2HREA 4CEHA 2W42A 3GLIB 1T8SA 1AB6A 2GA8A 5IFKA 1B8NA 3ID6C 4FMCB 2QP9X 4AYTA 5LYYA 1N8NA 4I81A 4C0KA 1GDHA 2CJWB 2JI4A 2PGXA 3P2OA 4PYRA 1Y1TA 2PSJA 1G19A 3AVQA 3QE0A 4WKNA 5ITZB 1QDEA 2H2AA 4TVOA 4I5FA 1M7HA 3FCCA 4G8DA 1DRJA 1VPLA 4MV1A 1D4ZA 1NVAA 5H0IA 4L2IA 3TDNA 4F4UA 2E4YA 3BXZA 1QFXA 3I1JA 2YCBA 4AJNA 2BFCB 1P33A 2Z3WA 4RH0A 4I8DA 5DEIA 3RTBA 3DDWA 3UPTA 4EB6B 1GSOA 3EEYA 3N2ZB 3MTAA 4FGWA 4JBIA 4K7JA 3IFSA 4WLUA 2FPUA 2GS9A 1LXCA 1LTHR 1YULA 2NM0A 4FWIB 2GKSA 5ES3A 3TIFA 1J1UA 4N65A 1WHTA 2R7NA 2FETA 2QUZA 4G09A 4G5XA 4GC9A 4OIMA 4BNFA 1Z4JA 3PJGA 4P32A 4TUYA 9ABPA 1BX1A 1PWZA 2Q6OA 4HS9A 2QPAA 2PBZA 3DZBA 3KR2A 3QBDA 3LSTA 4RM2A 5JCXA 3IDQA 4MI1A 4XTRA 1OIWA 1NPYA 3BBLA 3IJEB 1LK5A 2HCJB 1EK6A 4BQPA 5JPDA 5KNDH 5G1PA 2IPLA 2XUDA 4KXLA 4DLKA 3K9FC 2FQXA 4IJ6A 4K9RA 1U0BB 3NXKA 3G1UA 4MV6A 2Z6UA 3IIEA 1FA9A 2RI1A 5I9IA 5FBQB 1I6KA 3LW7A 3VDQA 4DLAA 2H1OA 3Q7QA 3R20A 3UJ3X 4KBYA 1FQWA 4P84A 4M36A 3V8NA 3KXPA 3IBSA 1M8GA 2PQ6A 4KRXA 5HJEA 4WOJA 3Q88A 1OBVA 4POOA 5LUBA 1T2VA 4CCYA 1JL3A 4G0OA 1U3UA 3MD9A 1GGEA 1RJ9B 2DU8A 3V4ZA 3PL1A 3FGZA 4GVPA 4OB7A 1FZQA 1A7AA 1P2GA 3B3AA 2VP9A 5I6DA 3DCIA 2W9XA 4H4CA 3EZ7A 3DHEA 3BAZA 3UT0A 3WFIA 3AERB 1TF7A 3MCTA 2GJAA 2BJHA 3WK7A 3I8OA 1GQ2A 4FSHA 4L4RA 4BBJA 1EG2A 4RZHA 3UA4A 2EX4A 2A9VA 2QAGC 2UUOA 3MVEA 4QNMA 4UEKA 4E21A 3PVSA 4J1NA 3EIFA 3DKKA 1QGAA 2YV5A 4C2AA 1Y8RB 3STVA 1BWQA 4C6SA 4KDEA 4JUCA 5DYYA 1ACMA 2EBFX 3GZ4A 4QBKA 4OQEA 4HEA1 1EWKA 3A4LA 2PX2A 2EP7A 1X2BA 4XFJA 3UXEA 3MS7A 1E66A 1VL5A 1WQ4A 3LLSA 5K4AA 3C7AA 4ZVRA 3GFTA 4BUZA 4KUEA 2IYXA 5U4XA 4D97A 1OHHA 1AHPA 1NWCA 1U7UA 5FOWA 4HVLA 1L5WA 1Q0ZA 1XWIA 3KR1A 4JYCA 1B2LA 1FP1D 3BRCA 4ROSA 5JVDA 1MTOA 2GF9A 2XT6A 4WINA 4BL5A 3I09A 3L04A 3V32A 3U3MA 4RFSB 5AICA 2AG5A 3GJ3A 3QV1A 4P3OA 4IEEA 1QU3A 1S1MA 1UFRA 3BF8A 4RHUA 4YC7A 1NNUA 2GO7A 1J23A 3QOYA 5DV9A 4E09A 1N9ZA 3R5FA 3KX2A 4HQ6A 5CVDA 4YGYA 5HK8A 2IYOA 1R18A 1NVXQ 3V46A 4DF3A 2G1UA 5EJ5A 3DAYA 3GFRA 2BISA 2PT5A 3DZCA 3KK0A 2JJ8A 2OECA 3FPSA 2C4UA 3PHGA 4OEHA 3O3NB 4QDZA 3SC2A 4FMBB 5A5GA 2IYVA 3DJFA 1K5DA 4GI7A 4AWBA 3BSWA 3WYGA 3PZBA 3VSDA 4N5LA 4D3YA 3EEOA 1IQ0A 1IBCA 2P9ZA 1QCCA 3NBXX 2PX6A 1JFSA 1J8VA 5K3SA 1YAJA 2YDXA 5DLPA 3CLTD 3N07A 1E62A 1ZMXA 4KDCA 3ZV4A 3C87A 1P44A 1YMVA 2VAWA 2DJIA 1PL6A 2ZS8A 2Y1WA 1PWEA 2BR4A 3BHIA 4NENA 1YZTA 3CB4A 4DCTA 3DDNA 1Z73A 5A5FA 1W1WA 4YUXA 2MSDB 3F6SA 4AS1A 3BRWD 4WUTA 1H2RS 2RHHA 3LL4A 5ALHA 3KD2A 3Q40A 4LC9A 1E0JA 1TZKA 1PIWA 1P74A 1VCMA 5MFPA 3FI9A 4UOEA 2QW1A 5E6UA 4B4KA 5HZKA 5KBYA 1IHDA 5ALSA 1M34A 3I2JA 3WA6A 1N5DA 4Q12A 4Y6OA 2XKJE 2RAPA 1YS9A 2Y0EA 5ELMA 1Y6JA 1QVZA 2AV6A 2Q50A 2I0FA 2I6UA 4RZXA 4TTVA 3ZQKA 2RI0A 3NGMA 2VRCA 1H42A 3OLQA 4M3NA 4YAEA 3SIXA 3U17A 2B8WA 1IAQA 1RW4A 3UV3A 4RHEA 4XPZA 2Z5FA 2QG6A 2BWJA 4CDGA 4X71A 1YKSA 3GC6A 4MULA 4JJGA 1OYWA 1KMCA 4G36A 1KEZA 2WJAA 2DUWA 4R1TA 4AZ0B 3U9LA 3ESBA 5L3QA 4AXBA 1BGXT 4RWEA 3RJ9A 3WE7A 4D4JA 4DBLC 1BEUB 4UMEA 4UW9A 3PLRA 2AK3A 4JLOA 4C7BA 1DWOA 2BHSA 2ECPA 5B5SA 4BXOA 5SY9A 3W3AA 3LHSA 3B60A 4R9NA 3H2YA 1TCUA 4F9EA 2XT0A 5SZHB 4O1IA 5KMGB 4KLRA 4XUDA 2VJYA 4UUMA 2M1XA 4L76A 4B3XA 1OYYA 3NS7A 2BEUA 2ORWA 4B84A 2PLWA 4YR7A 2FUEA 2W2QA 3RI3A 4LC0A 3LT1A 5ECWA 5JC1A 4HQ0A 2NU9A 1UBRS 4KQKA 3CRRA 3EWSA 4KRGA 3BGVA 4XYLA 3JQPA 3GLGE 1G42A 4BVAA 4YMUA 1U7TA 1TA9A 1GNTA 3KVVA 5B7NA 1RT9A 4HTFB 2HRQA 2W6OA 4GU5A 2B1IA 4YJ3F 4F2WA 1JJAA 2O7VA 3AYZB 4V0MA 1BHSA 2AXEA 5EZSA 3VHXA 3OD1A 2GWRA 1PX0A 1W4AA 1SULA 3E8XA 1DDGA 2PKRA 3NGLA 4AZTA 2JFGA 3OFND 3I04A 4DV1B 4NXNB 1XNGA 1GPJA 1XC7A 2AC2A 4B32A 2GLUA 5KNBH 3UC9A 2G09A 3CT6A 2IEIA 2QUAA 1P5RA 4O4IF 1C0EA 1XHEA 2OM6A 1GZ6A 1D2HA 3UT5A 1AQLA 1Q0RA 4GFDA 2QTZA 2E87A 1ZP6A 3PYMA 1WZEA 5JSKA 4P6VF 4EA9A 3B9PA 5CLIA 3QEBZ 2JFHA 4MB2A 2B34A 3E7XA 2PA3A 1EA7A 2OVBA 3KUXA 5TVKA 3E7WA 4ES6A 3FOAA 4P4NA 1QFYA 3ZKAA 1YZGA 2C7GA 2MU1A 2XD9A 4AB1A 3RK1A 1DBWA 4CIYA 1A8PA 3MRTA 2HQOA 4KGVA 4Z9XA 5NLLA 2PUFA 2C1XA 1ZAKA 4UHJA 4BLWA 4DSAA 3FLEA 3A6FA 3DOEA 3HYRA 3INRA 5IARA 5K0ZA 5GADl 3HMKA 3EDOA 3NUQA 1UMDA 1Z4NA 3C0KA 4PX9A 4H1TA 2WFZA 3A6KA 1XN4A 2PQ0A 3I8XA 2R6JA 3HWX1 4HNGA 1WUKS 4L16A 2YIJA 2IXFA 1KYWA 3IRUA 4R1UA 1F20A 1CU1A 4FFPA 3VO1A 2X1LA 4UNSA 4L5CA 4WSOA 4WY8A 5B7PA 1YS1X 2GN4A 3AESA 2R87A 4G81A 2L42A 3CVJA 4Y2HA 4ME6A 4DWJA 3AUJB 4KHPB 3NLLA 4FB4A 4MKHA 5CDFE 3EVZA 1M72A 4KB5A 2AWOA 5IU6A 4MYTA 1ZM9A 1NQAO 2Y1FA 3F97A 1V9SA 5DIZA 1CY6A 4GKKB 1SCQA 1RZRD 3QKUA 4IIEA 4QUHA 1QOZA 1VGQA 2V6JA 4H18A 5HDQA 3KEFA 1HOXA 4WEQA 4XUCA 4K81B 3WHPA 1VHLA 4QTYA 4DV2B 1VJ1A 1A8SA 1XRJA 2OCIA 4BLPA 5HF6A 3DPUA 4JBXA 1BCRA 2P3LA 3L7KA 5LLSA 4GI3A 3SLGA 2AVDA 2CFSA 2QPOA 4X6YA 1CNFA 1RWXA 4KQMA 2C77A 5SICE 2F43B 1P6UA 1E0AA 1G4HA 3EZLA 1WV1A 3OJLA 4OVKA 3CN7A 1Y80A 3DP9A 3WQSB 4DPMA 1TM5E 2OORA 5D00A 1RXIA 3KHTA 3VHRA 4CG1A 3PNLA 2OZKA 3T5MA 4II2A 2GFHA 3U13A 4D8WA 2Z4TA 2C9ZA 4RKRA 1KVQA 2E21A 2W5UA 1ZJYA 1PR3A 2FNAA 4GE0A 4D7AA 3UPDA 5IN5A 1CZNA 5A4JA 1DAOA 8GPBA 4KYIB 4IVNA 1HDXA 3ZOKA 4NNJA 5D5HA 5KSOA 4XTCS 3TGLA 3BL8A 3A11A 3WQQA 2PWBA 4PTLA 4ZEVA 3M4ZA 4ZD6A 1L8LA 3PXDA 4J16C 4LXXA 4AN4A 3C4QA 1USGA 1TT5A 4WKPA 3WDSA 1X0VA 5FOTA 4PQRA 2X0JA 1S7CA 4GXTA 4LTMA 4XR4A 2AMFA 3G2PA 4RTRA 5AKYA 4P0PB 1KI9A 2G9RA 3GVIA 1TECE 4ZQEA 3UG6A 1XZAA 1N3YA 2DPMA 4RADA 5DB4A