3RRZA

H-ras in 70% glycerol: one of 10 in mscs set
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYEQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 61
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrzA00
1M74A 1YZLA 4C0LA 3EPKA 1JPJA 1PLLA 2CDNA 3KQNA 2AFIE 2OCBA 2QU8A 5GJVC 2WWHA 5JSZB 1M2OB 4IOJA 4EJSA 3QKRA 2BBOA 1UDWA 1N0UA 2WWGA 4I81A 5FTMA 1M7GA 1E96A 3KJHA 3T1TA 2V1UA 3UANA 1XD2A 3OFND 4Q7KA 2JEOA 3V00A 4PSVA 2AR7A 2IWHA 3FVQA 2QL6A 1GNPA 1UADA 1RRPA 3FE2A 2JLXA 1R6BX 2WJVA 3BFVA 3NHBA 4JBYA 5AUQA 3RC3A 3SJCA 2RGBA 4P3YA 5L3SB 1P61B 3LQRA 3TW8B 2DWQA 3D31A 2JJ2D 1W47A 2R6GA 1IY0A 1QBKC 1WXQA 4HB4A 2D62A 4O3MA 2BCGY 4P4SB 4A2WA 3K70C 2QEQA 4C2UA 2CCKA 2NO7A 4A0FA 1N0VC 4L9SA 3QKSA 2J45A 5LB4A 3BD9A 3U4QB 4K46A 2RGCA 5IK2D 2ZI6A 4DXAA 3QUSA 4V0NA 1KGDA 3NBFA 1Z8FA 5IT5A 3LV8A 3HJNA 4V0KA 4BZQA 1IQPA 2H16A 3BE4A 4PSAA 3ZIAD 1X8LA 1Z0FA 3DHWC 3VR2A 5HE9A 1OLOA 3GJ3A 2HLDA 2D7CA 1XCMA 2QP4A 2QE7A 1X86B 5DN6D 5L3SA 2O0KA 1DBSA 4HAVA 1CTQA 2G88A 5FR2A 5KOYA 2XOKD 3B85A 3ETLA 1E0KA 1N6RA 1IONA 621PA 1WA5A 1IY1A 4NYIR 3U7FB 3NIBA 3VHLB 1EG7A 4PO1A 4TT3A 2AK2A 1TQ2A 3BK7A 3RRZA 5JS7A 3H84A 2H1LA 6Q21A 3IDQA 1NIPA 4C0QC 1A2KC 3AVPA 2CL7X 4PZYA 1W46A 4UJ3A 5FI1B 1KAOA 2OE2A 2W00A 3VHXA 2GWHA 2VSOA 3V4RA 3R20A 3NBZC 3O8DA 2QTVB 4FCTA 3A58B 1J99A 2QRZA 3ICQB 2YJTD 3TSOA 4JL5A 2FSIA 1IXSB 1TNDA 1Z2CA 2CJWA 1DAMA 1G16A 2W6JD 4IVQA 2IS1A 1FPMA 2CEAA 3SS8A 2OG2A 2AK3A 1CXZA 4HAYA 2W6ID 4HAZA 5HTKA 2XTZA 4OHWA 2ZRHA 4LJ5A 4ZDJA 1R0XA 2Z4SA 2O0JA 1Q3HA 4OHYA 5EP2A 1NBME 1BKDR 1KI6A 3CH4B 2ZUDA 3F8TA 2ZSAA 3Q3JB 1ANKA 4KBGA 2DFTA 2V1XA 2QPOA 2XZPA 3M6AA 2ZJ2A 4KLNA 5B57C 2NTYC 2G0NA 1XD9A 4OI1A 3VKGA 1MT0A 2I4IA 2FJUA 3CW2A 3E5HA 5FOUA 3I92A 5CJPA 3GFPA 4F93B 1UF9A 1NJFA 2VP5A 3QF4B 2Z5FA 3SE0A 3C7KA 1VYUA 5G3ZA 4AK9A 2XZLA 1A7JA 3W9YA 1XPOA 4JVNA 5EXXA 1XJCA 1ZIPA 2GEDA 2W0MA 1YZQA 2HYDA 1H8ED 3Q85A 4Y0VA 2EFDB 4DB4A 4A36A 4LSGA 2HCBA 3VR6A 3K8YA 5G53C 1U9IC 4EPTA 3TLXA 4CEHA 2YOGA 5FPYA 4DUGD 2W2TA 5FTKA 5TXGA 1N6IA 1R5OA 1RJ9B 4MYHA 3W6PA 1W4BA 3KX2A 2VHUA 2WJHA 2AHOA 4IXNA 4ASUA 3NXSA 1M8PA 1E0AA 2BMFA 1P73A 2R6CA 1C4OA 4DWJA 5J4HA 5IDVA 2VBCA 3LW8A 3A1UA 1IXRC 3FMPB 3IGFA 3I5XA 4NL4H 4KITB 3L8ZA 1Z0KA 4HLUA 3TVTA 4C4PA 1HEIA 2GJKA 2E1RA 2ZANA 3U7GA 4B2PA 4HB0A 4DDUA 1XCPA 1FFHA 2C95A 3U3OA 2ANBA 2R9VA 1G17A 3I5YA 5J5CA 2IX3A 3VKHA 4R98A 1G8FA 1LTQA 1DS6A 2NPIA 4ZV4A 4RD3A 1KY3A 3TRFA 4EPWA 3OAAA 4V02A 3JZAA 4KBFA 4KJZA 2AD1A 1CRQA 5FOSA 5EUMA 1ZM7A 2OFXA 4DRZA 2F43A 2NGRA 4LBWA 5JJIA 3DKPA 2FSGA 1P3JA 1SVMA 2FX3A 3EARA 3LAWA 3PUVA 4JLBA 5H68A 1XNJA 2HT1A 5DYIA 1I4DD 2V7QD 2KJQA 4IXMA 4ZI2A 5JHHB 1TX4B 3KFVA 4PO8A 4BUJA 4EKDA 2J0QA 3ZVMA 2BKUA 3QKTA 3DVLA 3LBHA 2BMDA 4PQYA 3B1VA 2Q0HA 1QHGA 2D7DA 1J70A 4WOPA 4Q9JA 1SHZA 4AD8A 4MRVA 3DO6A 3L43A 2JA1A 4CEJB 2IYWA 1JJ7A 2L0XA 1MO4A 1SXJD 3D6TB 3QVVA 4DDTA 1IN8A 2O8CA 3B78A 1Y3AA 1W48A 4QHYA 1Q12A 4Q1DA 4R2IA 4NCHA 3KZ1E 3LFUA 3I62A 1OXUA 4RFSB 4TL6A 1OFIA 1V43A 1A82A 2AWNA 2GVZC 1IJFA 3DM5A 3U7HB 1HTWA 1S2MA 3P26A 2IT1A 3SYKA 1O87A 2JATA 4NZYA 3AKDA 4KVAA 2D06A 4DBLC 4MQBA 4A8JB 1MO3A 4MKHA 2ZR9A 2PLRA 1KSJA 1D9ZA 4US1R 2XGJA 3U44A 2V3CC 4HLUC 1NLFA 3I73A 3KL4A 2YWEA 2QT0A 2OO7A 5JRZA 2ASEA 4JJZA 4PC2A 5F3WB 2QBYA 4C0BA 1R10A 2BHRA 2RH5A 5A0FA 4NMMA 1GTVA 4YDHB 3R8CA 1YVDA 4JLKA 4URZR 3TR5A 3HP1A 1P4SA 1TPZA 2GVDC 2GXQA 2VO1A 4K81B 4KO8A 5JBQA 2DBYA 5J40A 3VX3A 3I4LA 5TVKA 3LX8A 2GCPA 1E9FA 3NH6A 1DG3A 4LHWA 3E2IA 3NBYC 3PR1A 4BZPA 3GJXC 1W5TA 3R8FA 4ABYA 3G0HA 1Z6AA 2VSFA 3OEEA 1NMYA 4XD7A 5KNBA 2RAPA 4QC2A 1T91A 5BN3A 1X3SA 5E7IA 4TLAA 3O47A 2ZR7A 3FOZA 4B3FX 5LBIA 3VMFA 3U2QA 1UAAA 4AKGA 2FFQA 4HI0E 4B2IA 4LHXA 1MH1A 3QF7A 4DSTA 4D6PA 4FD2A 5G40A 1G291 2JIZA 4PHFA 3W8RA 2WBLC 1XEXB 2ODEA 5BN4A 4OI4A 2AXNA 3BH0A 2QPAA 4RD2A 5A4JA 3K0SA 2QE7D 2AKYA 3Q5DA 4IFBA 1OH6A 1OFTA 2IHBA 2FZLA 3HU2A 3B5JA 2ZYUX 1G3IA 3RSOA 4D26A 3VNVA 3NWJA 2ZRMA 5LD2C 3IILA 2CLSA 3H4MA 2GXUA 4LRWA 2O8EA 3VQTA 4HATA 3REFA 4LHVA 2V55B 4ARZB 4YQFA 3ECCA 4QHTA 3U5ZB 1CJUC 4HYYA 4N0EA 4DHEA 1X8KA 3P32A 4WBSA 3WHKA 1PV4A 1AS3A 3RDPA 4AYTA 1NLYA 1BH2A 4UNPA 2O8DA 5EE0A 1KDRA 1AA9A 4EUNA 4V0OA 2OT3B 1FMJA 3OF5A 5SZKB 1Z0DA 1K6MA 3WMFA 3SBEA 3L2OB 4LGMA 4BZXA 5JWOA 3O8CA 3WXMA 4RD4A 4TYNA 3FHCB 3FKQA 4OQNA 2OHFA 3EX7C 2ONJA 5EP3A 1QRAA 3MWKA 3SDZA 1KJZA 2Q6TA 3I8SA 5TY0A 2HV8A 4M9XA 3X1YA 1Q0UA 4I1OA 1A1VA 2B7BA 1G19A 2KBFA 4B3BA 2F9LA 1DOAA 3MAAC 4RD0A 2IS4A 3UIEA 4GP6A 2VP0A 2NG1A 5JI2E 4JKIA 5TARA 1AM4D 3RWMB 1G8GA 1YR6A 2QMEA 2R6DA 4J0QA 4X8MA 1Z6YA 3TUJC 4DJTA 4ZCMA 4DCNA 1NY6A 2XX3A 4OHXA 4NYJR 1E3MA 3U44B 3NC1C 2CL6X 3Q72A 1NG9A 1KDOA 1SXJC 3DKVA 2REBA 4P32A 3KQHA 1T0HB 3C4JA 3N5CA 3ZDQA 3QEOA 4GL2A 1EFRA 3AUYA 2HUPA 5DIFA 2PL3A 1WBBA 1MO5A 4LYHA 2ZS9A 1J7KA 1VYTA 4HLCA 4QHSA 1RIFA 3CF2A 5G41A 2F1JA 5AJVB 1YZGA 1GRNA 1N6NA 2C78A 2OBNA 2WKRA 4ESHA 4PQRA 1II8A 1W36D 3C41J 1CJTC 5SZHB 4PPGA 2QZ4A 4FMBB 4B3CA 1U2RA 3FKSA 1RYHA 2EWWA 2OAP1 3AF0A 3CRVA 4G0NA 1NMZA 4JZKA 4KODA 4URVR 2LKCA 3PEVA 2XSZA 3IIMA 4HUQB 2QSYA 4TLBA 1NN1A 4UNNA 1FMLA 4B74A 1C1YA 1SVKA 3DMDA 4JL8A 3L8YA 2ZEJA 3THYB 1E2NA 5DNYB 3K0CA 1R0ZA 2NMVA 1TQ4A 2YC2C 2PX0A 1O3YA 2AD5A 3EWSA 2F6RA 2KB0A 3B2EA 1FNNA 4Q1AA 4TTPA 1GG2A 1KNQA 1VYVA 2IYTA 2E9SA 4QGFA 4IKEA 3UXMA 2KBEA 4U02A 2QAJA 2FG5A 4D2IA 1ZNWA 3B1ZA 3WNDA 3VR4A 4LJ7A 4HB3A 2FSHA 5G3YA 5FL7A 1E9RA 3QBVA 1DO2A 4F4CA 2RMKA 3PEYA 3KQKA 4NCKA 1UBGA 5GVSA 4C0AC 1BO6A 2VHCA 2F1HA 2GEUA 5JZVA 4GFDA 2YKGA 5FTNA 2W2XA 5EZ5A 2Z4RA 3ZD7A 1KI4A 1VMAA 1E9BA 5DI3B 3R9IA 3RLFA 3MLEA 1AJEA 1U81A 2D3WA 4PAQA 1JI0A 2YC4C 1S96A 4LHZA 3IHWA 1ZU4A 3IHLA 4RZXA 1S0UA 2WM9B 1VKJA 1ZNYA 2FFHA 2UKDA 5SZJA 1E2KA 1G4AE 3P27A 1CJVC 1L2TA 2WMOB 3DZDA 2VH5R 4Q7JB 1E2DA 4XTRA 1GM5A 2FH5B 2C99A 3MD0A 1F2UB 4QBIA 2MSEB 2PT5A 1G8YA 1W1WA 2IUTA 4AKIA 3RAPR 3AF2A 4RSGA 1YQTA 4QJ3A 1LFDB 3CIOA 4PAOA 3F3YA 4OL0A 4Q02A 3AQ4A 4DT1B 4MRNA 2WKPA 5CDFA 4BECA 1ESMA 1US8B 1DO0A 1Z22A 3K9HA 5FUWA 1N6HA 3D3QA 4DLVA 1QHHA 5CB6A 1XXHE 3KTAA 2G0TA 2H8KA 3NG1A 5CIWA 2ZYTX 4CZ2A 5JHGB 2ZAMA 1UM8A 4NHOA 2IF2A 1EK0A 1U90A 4FWTA 1OB2A 2ZR0A 1U99A 1W5SA 4BFTA 3CF6R 2C5LA 3JVUA 2ZPTX 2QPTA 3HU1A 1G5PA 1M6NA 1AIPA 2NO9A 1Z5ZA 1F48A 3UATA 3WRYC 5JI3E 2JLVA 2ZE6A 1P72A 2N1BA 4E03A 1Q1EA 1PJRA 1YRAA 3QE0A 5DI9A 2BCJQ 4DCVA 3ZYCA 1GP2A 2FZ4A 3RS3A 4YC7A 3RRNA 3X1XA 5KDOA 5CB8A 2GAAA 1JQJC 1M1YE 1UKZA 1XBTA 3IIKA 4JLDA 3U6BA 4P4UA 1XFAA 3CPEA 1QG2A 1CS4C 1CF4A 1KZ7B 1Z6TA 3HR8A 4PZLA 4QL3A 2IEZA 1YZUA 1KDPA 1IN4A 2O8FB 3OAAD 1AGRA 1XEFA 4JLNA 1KI6B 3IPXA 4IDNA 4WXPA 1QG4A 4QGHA 4KYUA 2ZE7A 4Q1BA 1KTVA 3WBJA 3AVVA 1P60A 2R62A 4YONB 3NEJA 2WAYA 1DAFA 2B92A 4A82A 4C0KA 4TMKA 3MWLA 2YNMA 1H8HA 3CF0A 2OESA 2ZI9A 4M1TA 2V6IA 4Q48A 4CDGA 2J7KA 3FWYA 3OIYA 1PLJA 2K5UA 1DEKA 4GDFA 4RJLA 4DLXA 1E69A 1Q44A 2X2EA 2VP2A 4NYJQ 1OH7A 1TTTA 2GF0A 4GI7A 2QM8A 2RB4A 1WBDA 2ZYVX 4XWAA 3FPAA 4Q7LA 2EQBA 1Q3TA 1VTKA 3AF3A 2W6IA 2GRJA 4EPXA 4Q1CA 3MJRA 3FFAA 4O2RA 3LY5A 2O8FA 4RZ3A 2REOA 3PENA 1UKEA 3OEHA 2B8WA 4MKIA 5FOXA 1A4RA 3RHFA 3K0AA 3TUIC 1GKIA 3H1TA 2NZJA 3U6KA 1D9XA 4HSEA 2OZEA 4IDOA 2ZM5A 1Z0AA 3AGQA 4TQUS 1KSHA 2J59A 2GJAA 1CJMA 2PEYA 3ADKA 5CK4A 4AYWA 3GPLA 3RC8A 4D0NA 1TF5A 3QQ5A 2OLJA 5AUOB 4HB2A 5FOVA 5DYGA 2XTNA 5B2ZA 2PZEA 5FBLB 5LDDC 1E4VA 1YZTA 2CVFA 1XTQA 2CLCX 1ONBA 1M34E 3SN6A 1XTRA 2D4HA 3OIWA 1F2UA 2RHMA 1KOFA 5EXTA 4CT5A 3ZGXA 2JLZA 5FPSA 3QKUA 4HZUB 4MYTA 2IYYA 1FL9A 2X2FA 4BQSA 4OI0A 4Q19A 4D4MA 1XXHA 4AURA 1ZNXA 2GA8A 3B8HA 3AVQA 4JSYA 4DUGA 1CR2A 2OFOA 4E5UA 2FNAA 2G3YA 2ZROA 4Q4AA 4CEIB 3NC0C 4E09A 3LVRE 5F9HA 3OEED 2XEXA 1GL7A 4AKEA 1U8YA 4V0LA 4X8OA 3WBKA 2W2VA 1SXJE 1XJQA 4C3ZA 5JEDA 3EZFA 2WJYA 1UBCA 3TSZA 4XVUA 1F2TB 1E1QA 3TH5A 3I8XA 3B1XA 5BN5A 2B21A 2RGNC 3PV0A 4FINA 1AQYA 1JR3D 2GESA 3U7EB 1E9EA 2GDJA 1HV8A 4YLGA 3QG1A 4UNRA 5E95A 4TN1A 4ZO4A 2ZI4A 1NVVQ 5C1BA 5JJKA 1XD8A 1XWIA 4PQFA 3TKLA 4EFNA 3BAFA 4LJ6A 1FZQA 3CX8A 3RRYA 4HAXA 1GSIA 821PA 4D4LA 4LPKA 2ZRFA 2P6UA 4PC3A 3CM0A 1IAQA 1VHTA 1NKSA 1H8HD 5JRJA 1GFIA 3AF4A 5J4LA 2UZIR 5DO9A 2JJ8A 4HDCA 2A9KA 5F2EA 1EFCA 2HXSA 3HYRA 2CHVA 3KXIA 3LW7A 4FI3C 3CX6A 1YR9A 4MGKR 3CNLA 4TLEA 1HYQA 3PFIA 1PLKA 2GKSA 5CYPA 5EP1A 3FTQA 3UMSA 1RPZA 1CRPA 2B6HA 4BE7B 3DDCA 1EFHA 4PFSA 4EQ6A 3TBKA 4HDOB 4I1SA 3OEHD 3EPLA 5KSOA 4IHQA 3EWAA 4L15A 1W0JA 3LLMA 1G3RA 4Z51A 3J81k 1EWQA 3W3AA 1BIFA 3IO5A 5IK2A 4P4SA 4FCVA 4Q03A 4W5JA 3TQCA 2TMKA 3AM1A 1U0LA 2HT6A 2H92A 3ASYA 5DE3A 2QROA 5FTJA 3SQWA 5E7MA 1R8SA 1W2HA 5H70A 1U94A 2G1JA 5HZHA 2V54A 2O8BA 2ZRJA 1E0JA 3ND8A 3PITA 3A4MA 4D4JA 4MYCA 1KI9A 4LUCA 4BFXA 1XMIA 2FPLA 4L4UA 5DN6A 1DTSA 1OXVA 2CVHA 1WRBA 5L3QA 3K9LA 4Q9LA 4EQ6B 1G9XA 3L0OA 3GLIA 4ZKEA 4HZUA 4P0TA 4PHGA 4DB2A 3KUDA 4FW9A 2RGNA 4GMDA 4RVCA 4ACBA 4B6FA 3ZIAA 4TQ9A 2RGDA 1GRRA 5TV2A 3THXA 1TU3A 1RYFA 1PUIA 3LD9A 1N3BA 4L8GA 1S3SA 3O8BA 3U3MA 4C0JA 5GADl 1IOZA 3KKMA 1SKYE 1XZQA 1AKYA 1MRNA 3Q7QA 1JEEA 2B8TA 4G5RA 4G3XA 3CLVA 4I1UA 1EWRA 4EJSB 4TMZA 1KKMA 4MUAA 1XPRA 4M1MA 4A0GA 1L8QA 1XD2B 4AIIA 3SYLA 1WE2A 4M9SA 1QHNA 2ZJOA 2IYQA 5B58C 3QIAA 2QGZA 2GK6A 3QNUA 1QF9A 2CBZA 1B23P 4W5WA 3GJ8A 2X19A 3FDIA 1E1RA 5EE3A 2PBRA 1P2VA 5FBWB 1JBKA 5K8LA 4JBWA 2WMNB 4C7OA 1TU4A 2ZAOA 4WXRA 5KNCA 4S2EA 2ZRPA 4C2TA 3MJHA 5FOWA 4RD6A 1D8TA 1GKYA 4JVSB 3NVAA 3VNUA 4XSGA 2V9PA 2FF7A 2WPDD 4B3GA 5AJZA 2D2FA 4MGYR 1D2MA 2IBMA 2YZ2A 1WQ1R 2IYZA 2YWHA 4NYMQ 3VR5A 4MGZR 5FL7D 1CEEA 3MUFA 2ODBA 4NKRA 4KSBA 4NU0A 2DPXA 2ZRIA 1LS6A 1PVOA 4JYBA 1RVDA 2DWOA 4KSCA 2NO1A 5ELXA 2VLIA 2OEPA 4DEYA 5KNDA 5L3VA 1KK3A 2FGJA 2MMCA 1II0A 3U3JA 1Z83A 1IBRA 1KIMA 2F1RA 4ZI3A 1Z07A 2VHTA 3CKLA 4XOIA 1GAJA 5TDHA 3B6EA 2IUSA 2FEMA 2OCYC 2WSSD 4JSTA 1YE8A 3T34A 1E2HA 3VU9B 4C7OB 3T61A 2ZTSA 4W5HA 1FUKA 4YMWA 4A1FA 1ELOA 2NO6A 2IYLD 4EIWA 3MGCA 2BM0A 4LI0A 1NKTA 4RCZA 2R65A 4Q4AB 1UFQA 1Z0IA 2X8AA 4FIDA 4IJMA 4JLPA 2JCSA 4BLTA 3L0IB 3IO3A 4XSHA 5KU1A 1AZTA 1IXZA 1FX0A 4QBFA 1DAEA 4MKGA 4B34A 2CNWA 4URXR 3IIJA 1KYIA 1F2TA 4FMCB 3EAQA 1E2LA 2QNRA 3GLIE 5FBQB 1E2PA 2BIFA 5JJLA 4O25A 3UWKA 2ZXUA 4EPRA 4NBSA 1E9CA 5EXSA 4Q4HB 1F3OA 4B33A 2LWIA 1MV5A 5GVRA 1DG1G 4Q47A 1IHUA 4Q66C 4R2HA 1Q21A 1T4GA 221PA 2ZJ8A 3FKSD 3C16C 1KMHA 2OUKA 4OQLA 4B3DA 1FW6A 2QBYB 2QAGC 4RD1A 4ESVA 2WKQA 1ZYUA 2WWFA 3O8RA 1EX6A 2R6AA 2ZJZA 3K09A 5C4MA 1JQLB 3QBTA 2QMOA 1GOTA 1XF9A 2PZGA 1R5BA 2GBLA 2BWJA 4TTQA 1YHNA 1G64A 2PZFA 5KTYA 2ZE8A 3HR7A 1CBUA 1ESNA 2GNOA 4F38A 4BGDA 2FMXA 4N1AA 5D3MB 5DH9A 3I61A 2ZI3A 4LYAA 4O0MA 3OFNA 2ODWA 3F0TA 5EP4A 4HAUA 5TB5A 3VTKA 4JMPA 2AN9A 4A2PA 5JMTA 2IXEA 4Q01A 3GLGA 1FOEB 4OI2A 1JXMA 2Q3MA 4M1YA 3KQLA 2CMKA 4I99A 3B1YA 5JLJA 5GJBA 1NN5A 2Q9BA 4BWYA 5JECA 4BLOA 3L82B 4D25A 1VIAA 5CDFE 4JIMA 4RZUA 4Q9HA 2O8EB 3IBYA 4OK5A 5KSPA 1DAHA 1HA3A 5AR1A 1VG1A 4BEJA 2ZRKA 3EA0A 4G01B 1SKYB 4JLJA 1NG1A 1ZM4A 3T35A 3DZ8A 3CRRA 3HPQA 1XP8A 4TMXA 3T1QA 3WMEA 4M22A 5AJWA 1A5TA 2OV2A 2XB4A 2O0HA 4CF7A 1XTIA 2B7CA 1E2QA 4Q5IA 2ZJBA 3AV0B 3M4YA 4OK3A 4WA7A 1Z06A 4L9WA 2GJ8A 5EE1A 4ARZA 1JR3A 3PJRA 4II7A 3W5IA 4UNSA 2J7PA 2O52A 1P6XA 4HAWA 4DCUA 4DDVA 4AY2A 1ZCBA 4JKYA 5J4VA 3AH8A 1UJ2A 1Z0JA 2EFEB 1UEJA 4GOKA 5HZKA 5KDDA 1OF1A 1YJ5A 2CE7A 5CLLA 3B60A 5KHOC 1S3GA 4Z54A 2BBWA 4ZIRA 2ZRCA 1Z08A 3I1FA 4GZLA 2WSSA 1I2MA 1Q20A 4AG5A 3PCRB 5KO2A 4DLSA 3BJIC 1G7CA 1NNEA 4MDEA 3K09C 2GILA 4XIGS 421PA 2FU5C 5AWFC 2WOJA 5D3QA 4DLZA 2QA5A 5FUVA 4YMUA 4ZDWA 2AXPA 4BFVA 3ZJYA 1Q1ZA 3LBIA 3K0CC 4KCGA 3RRMA 3FB4A 2Z43A 4BLSA 1D6JA 4TWZA 1OH8A 3VR3A 4Q4HA 2ZJAA 2C98A 4TQAA 3QF4A 2ANCA 3T15A 2ERYA 2YVUA 4OYHA 4Q4JB 5BQ5A 2G1KA 1E4YA 3RWOA 1D5CA 1KNXA 1SHKA 2Z83A 2JIZD 4NYIQ 1IN7A 2P67A 2H17A 1E79A 1ZU5A 3A8TA 3HDTA 3AVUA 5AUNB 3KJGA 3AGPA 4W7SA 1EX7A 2ZRBA 4GNKA 3HU3A 3P4XA 3A1TA 5CITA 2NIPA 1T5LA 2OBLA 4C9BA 2JLWA 3SHWA 1N25A 2RGGA 4L5BA 2ZUBA 3LDAA 2ZI7A 1N5JA 3U61B 3SI7A 2P0EA 2OXRA 2YINC 4LJYA 3BS4A 1XTSA 3SJBA 5LB2A 5B64A 1ZJ6A 4NTZA 1QZXA 3Q7PA 1T8UA 3KKPA 4IOMA 4UQOA 4HDQB 1Q1QA 4LK2A 3TMKA 1T9HA 4TL9A 4LHYA 2R2AA 5M04A 1X1RA 2WAXA 5CK5A 3THXB 2BMEA 3VR1A 3X1ZA 3BXZA 1W2GA 4HEJA 2EW1A 3QOFA 3QY0A 3A4NA 1SULA 3AEZA 1QVAA 2WWXA 3WMGA 4QKQA 1WB9A 4HUQA 3GJ6A 4MGIR 1SVWA 4JJKA 2FPMA 4LV8B 4PPFA 2CCGA 1KI8A 3THYA 1VIYA 5J4YA 1XDBA 3AUXA 1N6OA 1E9AA 2AX4A 1KI2A 2OAQ1 1DELA 5JEEA 1G1MA 4TLDA 3RNLA 1GNRA 3JZMA 2J3EA 1XZPA 3UG6A 3GFTA 5EXPA 3FYHA 2X1VA 2EVWX 1KO7A 1I4LD 1DPFA 1YKSA 4GOXA 4LV5B 2WOOA 1Z2AA 3PVSA 4BRWA 1EESA 4Q9IA 4NE2A 3GEHA 2A5JA 4B3XA 3B1WA 2IF0A 4F91B 3K9NA 4PX9A 1TQDA 4QGGA 2O8BB 2FGKA 3N70A 3MFYA 3WRXC 1KMHB 1E2EA 721PA 3GD7A 1OIVA 3GFOA 4LOAA 3EPJA 3QEJA 1RJ9A 1T5IA 2A7QA 4ACAA 4HZIA 3T1OA 4KAXA 1ZIOA 1KK0A 2ZREA 2QTHA 3GJ5A 4IDHA 1U8ZA 2Q3FA 2O8CB 3ZH9B 1G41A 4U00A 3PXGA 2MSCB 1XTJA 2EFCB 2VP9A 2DR3A 1DAIA 2CL0X 2LCFA 1Z28A 5FH9A 2ZU6A 3CWQA 3TAHA 1FQJA 3ADCA 4B71A 4XWKA 5P21A 1ZM3A 4DCSA 4PHTA 3KTAB 5L3RA 2FSFA 1NVWQ 3GJ0A 4TLCA 1K8RA 2J0UA 3BWDD 4MUBA 2XOKA 3T5GA 3TR0A 1GDDA 1OHHA 1ZD1A 4N3NA 4ZKDA 2IYVA 4BRUA 3GLGB 4Q4JA 1GL6A 2GF9A 2BJWA 2C04A 1TL7C 3SR0A 1OT3A 3T1VA 3V4FA 1KO8A 4QM7A 4M53A 3BERA 5H8WA 2CHQA 3S1AB 5JWHA 5K8IA 4RY2A 2XITA 1IN5A 2OFWA 2VYFA 2AFHE 2GJ9A 2EYQA 3IEUA 1R0YA 3BIFA 5FBVB 1PUJA 2PCLA 3PIRA 3DMNA 3BGWA 4US0R 5HPYB 2FFAA 2VEDA 1F5NA 2ZIAA 1KI1A 4YMTA 4Z1MA 1E1QD 2A5DA 2A30A 3GLHE 3G82C 2P65A 4U5XA 3EA5A 1E32A 5EZ6B 3THWB 1HT2E 3SFZA 1JAHA 1BOFA 4MKFA 4B6EA 1JAIA 3QPWA 2R8RA 1GWNA 1E98A 1HH4A 2OLKA 3EW9A 2JLRA 1NI3A 4RKFA 3VAAA 4B76A 3SJZA 1ZVQA 1P2UA 3FGNA 1WF3A 4QNRA 4DLYA 2G6BA 1S4QA 2QORA 3OESA 4TSFD 1KZGB 1W0JD 1VCMA 4KLZA 3PUZA 2QT1A 1DARA 2GCOA 2A2ZA 2ZRLA 4D4KA 4M4SA 2WTUA 4DIDA 1N0WA 2VTKA 2C2HA 1J8MF 4KV9A 4GSYA 4TT3D 2FN4A 1UBEA 4C30A 3VFDA 4EAQA 2W6JA 2IL1A 2EWVA 5EE5B 2Q21A 3TSWA 3NKVA 1SGWA 3RS7A 4Z8XA 3LXXA 2PH1A 2RGEA 2VP4A 5H1YA 5IHPA 4QM6A 2DFNA 1SVOA 2IW3A 2QQ0A 3QXHA 1AQUA 2GJSA 1HUQA 4CVNA 2WIAA 4JYCA 4DT1A 3ZVNA 1HQYE 3K0FB 4ZCIA 4GT1A 5BYKA 3GLFB 4LV6A 2W83A 2RHDA 1UPTA 4KXFB 1KJYA 2ODNA 1OYWA 2VPPA 4L16A 3TVDA 2VA8A 3EZ6A 3IQXA 4M0LA 5L8VA 3P20A 4EFLA 3BBPA 4U7DA 1N5IA 3WYAA 1BYUA 3VKWA 3VX4A 2YYZA 2WZQA 2C03A 4KU4A 4LPSA 2F9MA 3A37A 4CT4B 1DAGA 1P62B 1X6VA 5FL3A 1S8FA 2G9NA 2R44A 2J7PD 4KFUA 2JLUA 1FTSA 1E2IA 3C8UA 3KJIA 1PZNA 4M1KA 1N6KA 1VPLA 1OYYA 1ZBDA 2ZETA 1K5DA 3KKOA 3MSXA 4A0HA 1CU1A 2Z6VA 3CX7A 3ZZTA 1R2QA 2P5SA 2PCJA 3Q5EA 1JECA 3SQXA 2JGNA 2N42A 2HXYA 3FMOB 1VDZA 1CULC 3LLUA 5FR1A 2NPFA 3GEEA 2EFHB 1KI7A 3P4YA 5DI3A 4N0DA 3UMRA 1BS1A 2YOHA 4OQFA 1OKKA 5GJCA 2IK8A 1LNZA 4XWOA 2DWPA 4BFUA 4BPBA 3IEVA 3ZD6A 1NRJB 3B82A 1CLUA 1ZAKA 2HJVA 1NSFA 4DVGA 1LS1A 4LBYA 4FMDF 1N5KA 1H65A 4LBVA 1Q57A 1OFHA 4AI6A 1YZKA 4LYFA 1YZNA 2VHQA 3D7MA 1W44A 1G6HA 4D82A 4OQXA 4IOLA 4RCYA 3EIEA 2Q9CA 4IDQA 4M21A 3WYFA 2A3RA 5C46F 3A6PC 2REXB 5BYJA 2WSMA 2J1LA 2XTMA 5D3MA 3ASZA 5KSYA 1KSFX 5CIQA 3REGA 5IF9A 3OIVA 4DC9A 4JL6A 2R6FA 4UJ5A 2GXAA 5FUYA 3LX5A 4I4LA 3F5FA 1WMSA 3BB1A 2VRWA 1COWA 2GCOB 2GZDA 2GXSA 3K0AB 3AP3A 4G5GA 2KI5A 4P33A 2JASA 4WZAE 4A0RA 3RS5A 5JCPA 1UBFA 4CW7A 1P9NA 4M2LA 8OHMA 1SXJB 3SJAA 1EGAA 1D2NA 4BLRA 2FDCA 1P2TA 3MWJA 2H18A 4HLQB 4V0MA 3RS0A 2ZRGA 2VP6A 1P5ZB 4ILEA 4OQMA 2MMGA 4LJ8A 3K0EA 3W34A 1RC8A 1VCOA 4I1VA 2IHYA 3CRW1 2H57A 4WAUA 5BW8A 4JLMA 1P2SA 2F7SA 1OKKD 3ZVRA 1Y63A 1XU4A 3BB3A 3EC2A 2QQEA 4MITA 4POAA 4TYYA 2V8OA 5JCZA 4DSNA 2IA5A 1XB2A 3IBGA 4LC1A 3ZVLA 1W7AA 2DY1A 1G8PA 1OIXA 4CYMA 3KXKA 4BFWA 2BC9A 4F4JA 1RZ3A 3K0FA 3EZ9A 5CYOA 1JNYA 2IUUA 1MO6A 5JS8A 3FFBA 1XX6A 3GLFA 1LV7A 3IKJA 4M1SA 1OXSC 4S35A 2JJ1D 2SHKA 3BOSA 3UPUA 4P4TA 3L0PA 4TYPA 5AJXA 2RCNA 2GZAA 5JSZA 1JJVA 1X8JA 1RRGA 4ZCLA 1E94E 1SVIA 4M9QA 2J0VA 4Q18A 1T8TA 1D2EA 4TYQA 3NEYA 2CJWB 1NN0A 2LKDA 1US8A 3NDPA 2XNDD 1NSTA 2FV8A 1X1SA 1OFUX 3AP2A 2WWYA 2JLSA 1JALA 4DKXA 4MYUA 1TUEA 1C9KA 2WVJA 3LVQE 1KSGA 3GJ4A 5IRCD 1NVVR 1TF7A 5FBRB 1TMKA 2OM2A 4M1OA 2C9YA 4M8NE 3R7WB 2ZI5A 5C2JB 4BLPA 2BM1A 1QHIA 2FWRA 4Y0AA 1T0JB 1GRQA 3N2IA 4EPYA 3HPRA 2IYUA 1BMFA 1OXTA 1SQ5A 2AL7A 2VQSA 1T3LA 3CH5A 3CZQA 4GMXA 3T06B 3T5DA 3GP8A 1MRSA 3LBNA 3R9WA 5BWMA 4BLQA 4PSKA 3CRQA 3KXLA 1I2DA 3QG5A 4YMSA 3ZS8A 3KB1A 2Y8EA 2IYRA 1TAGA 2PMDA 4KYIB 1RRFA 3CR8A 1OW3B 4NCIA 5DHAA 5J4KA 1U98A 1ODFA 3LWNA 4F4IA 4FN5A 5AJYA 4TZ6A 1T3SA 3TE6A 1NF3A 1MOZA 3W6NA 3EZ2A 1NLZA 1SKQA 1OXXK 4ZPXA 1CP2A 3LRPA 4OHVA 4LBZA 1NP6A 4H1UA 1Z3IX 3AKCA 4AYXA 3DOEA 4RKEA 2DFKB 3TIFA 4EDHA 3EXAA 4IEIA 2IXGA 4QGAA 4GOJA 3HYTA 4ZIRB 3IUYA 4OK6A 4JLAA 3PEUA 4GBMA 4LWZA 4YDSA 1U0HC 3GLHA 1FQKA 4DLUA 2BEKA 4Q9KA 3LQQA 4V0ME 2PT7A 4DIEA 1YR7A 3C5HA 4NCJA 4RFSA 1ZMXA 5KPJA 2WICA 3SZRA 3SU8A 2CK3D 3BH6A 1G7TA 2GHIA 4G1UC 1KK1A 2ATXA 4DSUA 3CZPA 4B2LA 4R7ZA 1TEXA 3X2SA 2GCNA 5EE9A 3SYNA 3VU9A 4YXWD 2IS6A 2GTPA 4G5QA 1W4AA 2XAUA 1A2BA 2ERXA 5FI0B 4ASUD 4PAMA 4Q1FA 4MDFA 4HUTA 2VSXA 4JS0A 1G3MA 2QTFA 4TZ0A 1NBMA 2P6RA 1NVUQ 2GEVA 1AZSC 1Z6XA 3SHFA 3CNOA 4F7WA 2ZUCA 1S1CA 3BFKA 5K8UA 2BVNA 4JT2A 2I1VB 1DAKA 3ND9A 3CBQA 2PLFA 4OBEA 3SOPA 1ZUHA 3CPHA 4EPVA 4PC1A 2HJGA 4UKDA 1II9A 3RABA 2C96A 2E87A 2QI9C 3OZXA 5HE8A 2ZS7A 2HEIA 1RFLA 1W4RA 2BKEA 2RKOA 1GIAA 1G18A 4M1WA 3C5CA 4KFRA 5B30A 1VECA 2GAOA 4PXAA 2IYXA 2RGXA 3NH9A 1HQCA 4HLDA 1Q22A 1G6OA 1CR0A 3AP1A 1WCV1 2C77A 4D0GA 3PUWA 1KO1A 4PPQA 4ZDKA 1K5GA 3M0EA 4M9ZA 4Q00A 4WZBE 2GZHA 3WNCA 2BOVA 5KPDA 1W36B 3AVWA 1MABB 2KSQA 2BDTA 2BMJA 2BBTA 2VF8A 1XRJA 2ZVQX 4C0HA 2HCJB 3EZ7A 2ECKA 2QY9A 2OCAA 1JXOA 4LCBA 2CHGA 5DHFA 3QKRB 1Z6GA 2YHSA 5A5GA 3CWZA 2QG6A 5ANRB 3I72A 1JB1A 4FWIB 1HE1C 1SXJA 2F3RA 5LD2B 4NYMR 4FCWA 2FEOA 4PANA 1QHXA 1XEWX 1SVSA 5CM9C 1KI3A 3QXSA 3WHLA 5F98A 4TMWA 2CCJA 1GKUB 3GLIB 4LJ4A 1ETUA 3KQUA 2BEJA 4LDJA 4A9AA 4A8JC 2A5GA 2OXCA 1GITA 3FMIA 1G3QA 1Z47A 1VG0B 4YXWA 1KHTA 1NJGA 3AVXA 3HWSA 4AKHA 5K8TA 2I3BA 2ZS8A 4DSOA 5FTLA 5AK0A 2IWRA 3U4QA 3BB4A 3EIQA 1SVLA 1ZD8A 2JDID 2QAGA 4B32A 3B7GA 1JEDA 4NCNA 3NHAA 3QPUA 3RSLA 4US2R 1B0UA 2F43B 3W8NA 1IM2A 3IQWA 2PJZA 4QRHA 1ZRHA 4V03A 4A2QA 2OCPA 3IPYA 3X1DA 2W58A 4ITRC 3X1WA 2QM7A 4WIAA 1OHHD 2V7QA 1G3UA 1QVRA 1ZCAA 2BJVA 4UXJA 4TL8A 2A5YB 3CNNA 3KFXA 1R0WA 4K8OA 3U3KA 4B35A 5HR5A 2P2LA 1SZPA 1AGPA 1OIWA 1P9WA 1W0KD 4KVGA 4TMTA 2C9OA 5HKKA 1N6PA 3BFXA 3MCAA 3W3ZB 2Z0MA 2XJ9A 4Q4LA 1LY1A 1JR3E 2QMUA 4CGZA 2CNWD 2J0UB 4TMVA 2QGNA 3KKQA 4CRWB 2EYUA 5DISB 2YWGA 1XMVA 1E99A 1KAGA 1XEXA 1XMJA 4MRRA 1AKEA 2J87A 5DGXA 2Q3HA 2FPKA 2YWFA 5EQTA 4LC0A 3UK6A 2V6JA 4UXHA 2ZSFA 4D81A 2VIIA 5FPHA 3FHTA 4FXPA 1TUIA 4KFTA 1OV4A 1R7RA 1HURA 3DPUA 1P7CA 3L0SA 4JT4A 4NPHA 1E0SA 4RZ2A 2XNSA 3SC3A 4QOSA 5JWRA 3THOA 1OH5A 1M7HA 5EUQB 1Z29A 2PJRA 4PTLA 3WP0A 4W9MC 3RS2A 3ZS9A 5AUPB 1OSNA 2EU8A 2OSBA 4GP7A 2J46A 3OIUA 4UXIA 3P1JA 1EXMA 2N46A 3CR7A 3JVVA 1FP7A 3LA6A 1QHHB 3AF1A 3GEIA 1J2JA 3PQCA 3QKSB 4IW3B 3SBDA 4A8JA 5C18A 5CLQA 1I4TD 4KHZA 1J8YF 4MRSA 2D74A 4NONA 2WWWA 2ZRNA 3PUXA 4JLOA 2JLYA 4BEBA 1RRCA 1G20E 3OHMA 4OKSA 4URYR 5HCIA 5F9FA 4PHHA 4G5OA 1ZNZA 4WW0A 4MH0R 5CM8B 1GNQA 4QBGB 1NY5A 3K53A 3KB2A 2XJ4A 1JPNA 1ZP6A 4PZZA 1IJEA 1U9IA 3EG5A 4O2LA 1JR6A 4ERNA 1E2FA 2ZSBA 3E1SA 3CO5A 4X8HA 4DLWA 1AS2A 1OE0A 3G5UA 5KSZA 3ADBA 2ZSEA 4DZZA 3QXJA 1U0JA 1KDTA 2ATVA 1N5LA 3BH7A 4JVLA 4Q21A 1G7SA 1RKBA 4B44A 2DCUA 4D0LB 2DHRA 4LJAA 5UKDA 3UKDA 2H7VA 2AWOA 3TK1A 4BFZA 3PUYA 3KDSE 2CLDX 3I32A 1ZC4A 1W49A 1UEIA 1GZSA 2FFBA 1XJ0A 4MRPA 1AN0A 1G4UR 3QXXA 4B48A 4H1VA 4XH9B 3FMFA 4UNQA 1KKLA 4A6XA 4PR0A 4OJKA 3D8BA 3Q9LA 1GVNB 3A1WA 4WVFA 2QAGB 1OJLA 3CUEF 4BASA 4EJSC 4ON9A 1P9RA 5EJEA 2WJIA 2JDIA 1T3HA 1HT1E 2QUZA 4JLVA 1MR3F 1L4YA 4Q1EA 1E9DA 1II8B 3ZQJA 2JLQA 4LY6A 1GILA 2HDNB 1NIJA 3GCGA 1XTKA 3B13B 5SZIA 4KFSA 4TL7A 1KMQA 1EFRD 3I3SR 4TTRA 5E3HA 5DSZA 4DDWA 4A4DA 3QJYA 1KO4A 2IS2A 3AVOA 1ZW6A 1YR8A 4AG6A 1TQ6A 3BRWD 1Z63A 1DE0A 3DM9B 2HF8A 3DEFA 2A5FA 4LYJA 4DLRA 3B9QA 2ZSDA 1W0KA 2IEYA 3MRSA 5KYKA 2O8DB 2ORVA 4F92B 4A92A 2CK3A 1E9SA 2H5EA 2C8VA 1QHSA 3ZLJA 3BC1A 4MA4A 3PG5A 3MMPA 1EFTA 3V9PA 1P75A 2GETA 1VCNA 1WDTA 1RW4A 4NDZA 1J90A 3GLFE 2IXFA 2XSZD 2BBSA 2QMHA 2HLDD 4A6PA 3BORA 2XB2A 1FP6A 4XTCS 3TQFA 2ZRDA 2XZOA 1CR1A 1XPUA 3WP1B 4D80A 1FX0B 2GK7A 5KUTA 1UDXA 4E22A 3UMFA 3H86A 2G77B 3AKEA 1ZM9A 3C15C 2P3SA 2XXAB 3A4LA 3DL0A 2G83A 3OE7D 3R7WA 3K1JA 4R9UC 5FPTA 521PA 2ZRAA 3LO5A 2NO0A 5E4FA 3TNFA 1Q1BA 1V5WA 2ZJYA 3S1AA 2I1QA 1QDEA 2EFGA 1G5TA 2DFLA 2FA9A 2GBLC 2WV9A 4FMCF 3GJ7A 2J0SA 3AKYA 4CEHB 2ORWA 3C14C 2F55A 3K9GA 4ZDIA 1BYIA 1IY2A 1XMSA 4OHZA 4CIDA 1CKEA 4LX0A 3U3RA 2WWIA 4Z8YA 2OBMA 4KI0A 3TUZC 1S1MA 1NBMD 4QFMA 1LVGA 3A36A 1NL3A 3ADDA 1HE8B 3FHOA 4PPNA 3EPHA 3KJEA 2UVQA 4URUR 1KY2A 1FNMA 2X77A 4BFYA 3NTUA 2QP9X 2WJJA 3THWA 3MWYW 3K70D 3W6OA 1UKVY 3GLGE 3TJZA 1G21E 1M7BA 2ZJ5A 3ICEA 2QENA 1FTNA 2F3TA 1COWD 4Q7MB 1T6NA 4IVPA 3AVTA 4B47A 3CPJB 4WZ6A 3TW4A 1TADA 3SEAA 2KE5A 1ZUIA 3EASA 3ZZUA 4H9GA 2IC5A 1R4AA 3AB3A 3CB4A 3LXRA 3QENA 3W90A 4XJXA 4A15A 4QBHA 2AKAB 4TSFA 2PX3A 1U8AA 5BXQC 5C4GB 3R9XA 3GLHB 2JJ2A 1DVRA 2ZITA 1NVXQ 2O5VA 4QNMA 3SFVA 2HYIC 1FUUA 2FOLA 4FMDB 1WP9A 2Q9AA 1E2JA 3U60B 5FPKA 1OPXA 5GJWC 2WIBA 1VCIA 2YV5A 4AC9A 2QSZA 1VHLA 2BV3A 1L7VC 1TEVA 1LF5A 2DB3A 4NH0A 1W36C 4CEJA 3K70B 4JBXA 3CONA 3RYTC 1CR4A 4Z1MD 4IOKA 3Q8XB 4G5SA 4XD7D 5HCNA 3E70C 1XXHB 2J9RA 4TYWA 4URWR 2ORIA 3B9PA 3QI2A 1AK2A 1ZUNB 1QHYA 2MSDB 2QP3A 1G8HA 1TF2A 3TAUA 3NDBB 1E2MA 2VHJA 3A1SA 5L3QB 1S9DA 4XVQA 2WPDA 3EIHA 1E6CA 2QN6A 4PC6A 4QG7A 4C0SA 1S9HA 121PA 2IYSA 4IRUB 1XCGB 2ZYWX 5CJ2A 1ZINA 4IDPA 3T12A 5LPNA 2CXXA 1KJWA 2ONKA 2ZQ5A 3H0KA 4QJ4A 2ZVPX 1F6BA 5FOTA 1G5RA 2J41A 2KWIA 1RE0A 2WHXA 3ZZ0A 3KKNA 1GUAA 2YOFA 3NBXX 3SNHA 1XEWY 4IVRA 4JVMA 4B75A 3TGPA 2P5TB 2HF9A 5KDLA 4NP6A 1LW7A 3W5JA 1CIPA 4AWXA 4R71A 4YMVA 3QVUA 4RFVA 5JFGA 1OB5A 1CJKC 1LB1B 2V4ZA 4EFMA 4B43A 4DCTA 3PEWA 1KK2A 1VG8A 2ZE5A 1ZD9A 3M1IA 1E79D 1UKYA 1G7RA 4IEEA 3LH5A 4QXAA 2XNDA 1HY3A 4P31A 3WYGA 4IFEA 1BMFD 3RS4A 4E07A 2CE2X 1YU9A 3CRMA 3H2YA 1MKYA 1ZC3A 3UG7A 4B73A 2PEZA 5E7JA 2NZ8A 3LNCA 2F1IA 3QXCA 1NN3A 2DYKA 4DEXA 2JAQA 3MG9A 1E2GA 2D2EA 4QJ5A 2JJ1A 3A1VA 5HKKD 4XVRA 4LJ9A 3QPVA 3RVBA 1AS0A 1L4UA 1GL9B 1VG9B 3N2EA 1LF0A 1IN6A 3GMTA 3OE7A 1E1RD 3GQBA 4DLTA 4CEIA 2W0SA 3WNBA 2NOAA 5DLQC 4GRAA 1KO5A 3AVYA 2C9CA 2VF7A 5FUXA 4GPTA 1R5NA 1NMXA 3ONWA 5FFMA 1N2CE 4GZMA 4LZZA 1W4CA 5J47A 5TMPA 1H8EA 1YRBA 4X8LA 1EFUA 3EC1A 2J5XA 3QSYA 4OJQA 1ZM2A 3RANA 3UWOA 3KUCA 2QRNA 1DADA 2RGAA 1N6LA 2FE4A 2OILA 2PMKA 2XXAA 2ZU0C 1F60A 2WJGA 3WY9A 3DOFA 2VL7A 4PO9A 2A78A 2NQ2C 2UZ3A 4PC7A 1R8QA 4BFSA 3ZQ6A 2P6NA 1MABA
chains in the Genus database with same CATH superfamily
1WZEA 3KL2A 3ZI4A 2CHFA 1G98A 2XCUA 3GGDA 4FC7A 3V7YA 5LP1A 4YCLA 1I01A 2AFIE 3VC1A 4EATA 4ZK6A 2WWHA 1VXRA 4HXEB 1M2OB 2Q27A 4IOJA 4EJSA 4IUBS 4HJXA 2WWGA 5FTMA 1Y1PA 2BDUA 2NVOA 4M36A 3AO0B 3N59A 5JCOA 1U5BA 1T9KA 2NX2A 3KJHA 2IHUA 3LXUX 3W2GA 2M2IA 3UW3A 4QLOA 2JEOA 2CNDA 4OKNA 4F1KA 1DKQA 3BD6A 1OR8A 1WS6A 1EFDN 2Y77A 1GNPA 1S8NA 3M1LA 1L9KA 1RRPA 2LGJA 2P9GA 2ZUWA 3DMRA 2V7VA 1NV9A 3FE2A 3NHBA 3O2NA 4RLQA 4H1WA 3AR2A 1P61B 4XYGA 2DWQA 4Z86A 1RAGA 2E21A 2R47A 2A9OA 1ZGGA 3FTNA 1IHXA 1PIWA 4N47A 1NRWA 3PQ7A 4M8IA 4HY3A 1XZDA 2GERA 2QEQA 3ZZMA 2YY7A 3G2MA 3B6JA 1ZXBA 2FVYA 2X7HA 3DCJA 4S05A 2EGUA 4U9IS 4CKEB 1UPBA 4XYEA 5TF0A 4O33A 3JX9A 3WIDA 2HRCA 2FP4A 1Z8FA 3T7RA 6NULA 3F8WA 4JFRA 2FZGA 2OP0A 4V0KA 2AXQA 4PSAA 4I2NA 4GMKA 4YV0A 1X8LA 4PPYA 3EIWA 4OTZA 2XNHA 4GVLA 4GYYA 1BXGA 4XPIB 4G37A 2JFFA 2CWWA 1KEZA 4OHPA 3TYXA 2FRVA 4ETIA 1M6YA 1OLOA 4EKYA 5KINB 1ZXLA 3UMJA 2FRDC 4CQNA 2PA3A 4LWOA 3WDSA 1RAEA 2O0KA 2DT8A 2PE5A 1CTQA 2G88A 4PGGA 3AIMA 4QFBA 4CQMB 4GMHA 1E8MA 5AVQA 3SDBA 4S1WA 4E2ZA 1H1LA 1XR3A 4EMTA 4QYIB 2VH1A 4U2FA 1CUZA 1CZHA 1JXQA 1KAEA 1QZ3A 3I6YA 4Q6BA 5SY4A 4DZRA 3TECE 1IY1A 1SRQA 3G8CA 2AMFA 5AT1A 4UHJA 2AZTA 5AM0A 4K7JA 4CMHA 1GG5A 3OX3A 3VHLB 1EG7A 4TT3A 4MLPA 1TQ2A 3BK7A 1L7XA 1RYEA 3ILSA 3JQCA 4TZKA 2AUTA 5HRCA 3OQBA 1NVFA 2H1LA 1UPAA 3DDSA 4ZVKA 6Q21A 4C0QC 3AVPA 2CL7X 3PJDA 4A16A 2AEJA 2JA2A 2OHOA 4PZYA 4F2HA 1PEYA 5CAEA 3IOCA 2BELA 2GWHA 4OYYA 3TB4A 1D4ZA 2E4VA 2GLTA 2PAAA 2VSOA 2E4UA 4J3NA 3A70A 4FCTA 1JHDA 3A58B 4IEFB 1J99A 2G8LA 1LC3A 2QRZA 1FSGA 2W43A 3A1DA 5EKDA 3ICQB 4G23A 1YL7A 1EE1A 3ESDA 1K8ZB 3T0GA 1IXSB 1SM4A 1YA8A 4L73A 1TNDA 1Z2CA 5DCYA 3RSHA 2W6JD 2ZBFA 1UK8A 3H1AA 4NOLA 3SS8A 1GTSA 5ALKA 1EFVB 2PKWA 1C9EA 2JI8A 1HO3A 1AF4A 5AOVA 3KJFA 3KK0A 1XCJA 1ZR2A 3H2KA 3G2QA 1W6UA 2AG8A 2BKAA 3T9AA 4DY4A 1QF6A 2R87A 2GOYA 7GPBA 3IBSA 3X0DA 1DWPA 3L7DA 3CH4B 5F7JA 1IFXA 4K03A 2DFTA 4NU6A 3HI6A 2Y1KA 3U7QA 4FUTA 2QPOA 4HS4A 2RBKA 4KLNA 3ZWYA 4RTKA 3K1ZA 3QX8A 3VTAA 2DUNA 4DAEA 2NTYC 2G0NA 4ROTA 4BTEA 3VKGA 3T3GA 5DBIA 3DP7A 2I4IA 1Y7PA 1U0FA 3HGTA 3I92A 3IE0A 3S8YA 3PR2B 1VHJA 5AJTA 1QSGA 1I5RA 3C7KA 3KD2A 2PYDA 3LT1A 1MJGA 3PBKA 4YJGB 4CNBA 4F97A 1PTJA 2HA2A 3NFRA 1E77A 5KTNA 4A5SA 1X7YB 1R0SA 2IIQA 1XJCA 4TOIA 3IAUA 8ATCA 2GEDA 4FKZA 2HYDA 5H81A 4DMHA 5HGXA 5JFTA 3QM1A 4RJJA 1FQWA 1UM9A 5U4QA 2W6QA 1E5LA 3IEKA 4EPTA 2XVZA 2ZTVA 3NZEA 4UFOA 2XWJI 1YTUA 4LZPA 1DDGA 1VJGA 4WGGA 1Z75A 4FSXA 1Y8RB 3WFJA 1OWLA 2W2TA 5I7AA 4BB5A 3I04M 3K15A 3K2EA 1NURA 4L28A 5TXGA 3L6CA 1CD5A 1W4BA 4Y2TA 2WJHA 4ERXA 5I45A 4GOOD 1ESEA 1M8PA 1BDMA 4EMSA 3PPXA 2PRJA 5ECWA 1SUAA 2VBCA 3F67A 5I9IA 4PM4A 3EEBA 3OY2A 3RQSA 3NDRA 1J00A 4R0NA 4LDNA 1T1IA 4RDIA 4WD3A 4WUTA 1UJNA 4J16A 3IGFA 2EKLA 3MJFA 2AFIB 4H1HA 4BFLA 1A8QA 1M2HA 5DYWA 1JXAA 4HLUA 4LGYA 4C4PA 3KSDO 1Q84A 1R4MB 1TECE 5GIPE 3U4DA 1YMVA 3U7GA 1Q0PA 4B2PA 5AQ1A 2H5IA 2B30A 4CHTA 1Z26A 1FFHA 3VR2D 4FU0A 3U3OA 2PAFA 8GPBA 3BG5A 2BKLA 4PSCA 4WN9A 3WL4A 4F7DA 5LM3A 2JKYA 4HPWA 2IX3A 1O03A 4BMPB 2DKNA 2QD1A 4R9NA 4PN3A 4IWNA 1UKBA 4YRDA 1WB6A 5KTRA 2NPIA 1UJ4A 1M1YB 3H0EA 4KLCA 3B51X 1MQ8B 1VE7A 1WR8A 4QPJC 1JTVA 3JZAA 4XJTA 1ZMTA 3EUAA 5EUMA 2OFXA 4DRZA 2F43A 2NGRA 2QTBA 2VQ3A 4LBWA 4P08A 5KKAA 1VMIA 1PS8A 2EATA 1SVMA 3ISVA 4FDVA 5F52A 4JJ6A 4BBZA 1PQ4A 5KNDD 4KN9S 1JI3A 1G0NA 2R5FA 1PSDA 1DNPA 1CRWG 3QMMA 4KXXA 3KHKA 3O95A 5H68A 3FYSA 3WFIA 4IXMA 3W1EA 2AUNA 3W05A 4OQZA 1M67A 2QMYA 2Z56A 3NRBA 3OX2A 4ZO6A 2J0QA 4OL9A 3ZVMA 4MRMB 5JH7B 4K3UA 5ALSA 4L8WB 1PBTA 3UTDA 1VLZA 3J81A 5KAPA 2XOXA 1C7ZA 3R1IA 4QPPA 2Q0HA 4GI3A 2YY6A 4UUQA 5DNVA 4TV8A 2WYWA 2DF8A 2XUFA 1X1AA 5A5DA 3KU4A 1JFTA 3OY7A 1H2WA 3RTAA 2YQZA 4RH0A 4R1TA 2XUIA 5JJ5A 4HDSB 3NYRA 2W48A 2CDBA 3GZNA 4R1SA 1FNCA 1SXJD 5T5QA 1C50A 4IQFA 4KE9A 3ZDRA 1LA2A 2YJ4A 2H63A 1W48A 2QTWB 3IT0A 4CV2A 3CY6A 3SJ7A 5BSKA 4CL2A 2ZJ3A 3LFUA 3O4JA 1LDNA 4NQZA 4CKZA 2WU3A 1P2GA 1NF2A 1V43A 2ZB7A 2HM7A 4EGFA 1M83A 4W9RA 4MV5A 5JH7F 4M0EA 4XPIA 3SQLA 5CD1A 4I4CA 4NZYA 3AKDA 3EOAI 4MQBA 4DGQA 3FDZA 4AN0A 1MO3A 3EGXA 4HN9A 1FBTA 3AOEC 5JALA 1KSJA 2XGJA 1NUSA 4O4JB 4HLUC 4E7OA 1B8UA 1Z5OA 2QT0A 2YWEA 4Y2SA 3LRXA 1IHDA 5H4HA 3GUCA 3WL7A 1K98A 1V3TA 2AYYA 1GTVA 1TLFA 2MIIA 3EJ6A 1XZMA 4JT9A 2AC7A 3R8CA 3K0KA 1YVDA 2Y0CA 1YL5A 4AJHA 1IPHA 3HP1A 2GZ1A 1P4SA 3UB3A 2GVDC 1TKCA 2VO1A 4FYJA 1SB8A 2HHLA 4WZBB 5JBQA 5JZBA 2WYIA 2DBYA 3R6LA 4QASA 3DO8A 4BQRA 1NUTA 1SQSA 1RP7A 1T9DA 1YI0A 3HFSA 4CQJA 1G63A 3P2EA 3A6GA 2GCPA 4Z2AA 5JXJA 1XZFA 1XIVA 4LHWA 3E2IA 1TJNA 5K0BA 1QFXA 4ZAVA 2JGMA 2XCIA 1GQFA 2O2XA 4OATA 4X91A 4BZPA 1NA5A 4MUGA 5FB3A 1YA4A 2VSFA 2GZ2A 4CIWA 2RG7A 2AG5A 5CVVA 1GYRA 1OQAA 1AOXA 3BCRA 3B5IA 4F6CA 1WZCA 1M8KA 2ODQA 5E7IA 2GM9A 4L5CA 3L7LA 1DT5A 1K7XB 1RWXA 4YH1A 3VMFA 3KLBA 4TTSA 3U2QA 1Y8AA 1P1CA 2WJ6A 3A9TA 4LHXA 5JXHA 4WXMA 2XRZA 4JNKA 3QF7A 3ON5A 2XGGA 1P1KA 1F12A 4NK4A 4C08A 3SZ3A 3OZUA 1G20B 3BWYA 1Q7EA 3G0CA 2QD2A 4FD2A 3A9CA 4N8EA 4FOSA 4RZSA 5G40A 1G291 2JIZA 3WMFA 2P6OA 4M89A 2CEKA 5ES3A 1EUCB 2CLEB 2WBLC 2R7MA 4IDEA 1SG6A 5ITWA 3EZXA 3BH0A 4ZOLF 3DTVA 4TSKA 4EH1A 4BQIA 4IFBA 2IHBA 3O0DA 2Y2UA 5DX0A 5T57A 5DPMA 3WLFA 1QDLB 4JI6B 4D26A 2A14A 1K3UB 2CLSA 4LRWA 3GYBA 3ZHCA 1P33A 3JATA 3VQTA 4CL0A 4LHVA 1OGYA 4I4NA 4LWPA 4C07A 4ZHQB 3SQNA 3P32A 1JMKC 1AS3A 4A91A 2NXNA 1XZJA 1O8BA 5I9BA 5C1OA 1NLYA 3I83A 4BO0A 4AO6A 4UNPA 1R15A 1T2EA 3CVWA 2YXPX 5H83A 2DR0A 5CW1A 1LPPA 5EE0A 3GJRA 3VOBA 1KDRA 1AA9A 2J9FA 3GRKA 4UU1A 4KMMA 1Z0DA 1RXYA 2HA4A 4PAWA 3TXYA 3PTAA 4FB5A 3SBEA 3AESB 2VPYA 3WLRA 1FJGB 1UFKA 1X7ZA 1LSUA 1RI5A 1V6CA 1Z4OA 1C8VB 4PLYA 1K8XB 3GLRA 3WXMA 4RD4A 3TN7A 3O8CA 4OQNA 2BEVB 1YCDA 3AMVA 4WRRA 3EX7C 4E4RA 1RRKA 3HNRA 3MWKA 1QTQA 1SXHA 2GH1A 3DB1A 1ZOPA 3MWEA 1KJZA 4IV8A 2RKWA 1DP4A 1B6SA 1RHMA 2OHHA 3E05A 4OFXA 4QOJA 4M9XA 5TY0A 4N6GA 1A1VA 4M88A 4CNQA 2FN9A 1SURA 2B7BA 3ODPA 2QR3A 4F9GA 3UOAB 4OLBA 4YAIA 3RU3A 4K9MA 5EHZA 2NG1A 2IRWA 5JI2E 2O0LA 5TARA 5A06A 4EYSA 3IE1A 2QMEA 2R6DA 2SECE 3JPYA 1I0LA 3K20A 4J0QA 4CU2A 4YCSA 4FFVA 2Q3DA 3BK2A 3DZFA 1N8TA 3IRVA 4NYJR 2IYOA 1E3MA 2CL6X 2C5FA 3Q72A 3SAJA 1NG9A 2BGMA 4H18A 1SXJC 1ITZA 4HGYA 3SC2B 2H1WA 3KQHA 4LZAA 4GUAA 1EMDA 3ZDQA 1EFRA 1JF8A 1F2DA 4MLZA 5B36A 4B4DA 2PVSA 2O6LA 5B6PA 2F67A 3I37X 1J7KA 4NFYA 4Q3BA 3X1JA 4YJ3A 2ZJ4A 5AESA 4FI3F 1RIFA 4JLWA 3DB2A 3GJQA 4Y1GA 1IYZA 3Q0TA 3VSDA 4DS3A 1RXUA 2BP7A 3FX2A 5AJVB 1N6NA 2OBNA 4U2KA 4ESHA 4B45A 5JSUA 3VOSA 1CDZA 1T4CB 1W88A 3DOJA 4LE2A 1W36D 4PPGA 5AKJA 2NYUA 3N6VA 2WEKA 3FKSA 1RYHA 4XFJA 2WK1A 3SHTA 2OAP1 1NLMA 3AF0A 3DR3A 2WMDA 4JELA 4TXNA 1CNMA 2WFLA 2LKCA 3I09A 3KO8A 2ZDGA 4BNZA 1ZRNA 2H1VA 2WHRA 4KAFA 1ZVVA 4QX6A 3DTVD 4HUQB 3QITA 5F4BA 4NJOA 3HC7A 4Z0TA 4AN4A 1MO2A 5EQJB 5H3LA 5LMCA 5LXTA 1U4OA 1JHMA 2E7ZA 4ZT2A 4KP7A 4LDQA 3VPHA 3ZXYA 3JD0A 5CTAA 1SVKA 1Z7YA 2CXNA 1XHEA 2VZEA 3QU7A 4JL8A 2O7SA 3UVEA 3VMMA 3LLVA 5DNYB 1VLHA 1UK7A 1ZISA 2EGGA 2OZVA 4UBKA 1XMQB 2KMLA 2YC2C 2PX6A 4X97A 4ALJA 4C4XA 4NZNA 1J4AA 2O5CA 1KOLA 1F5SA 2HHJA 2QLNA 3DMPA 4LRUA 2KB0A 4PO3X 1FNNA 5IJ0A 3LXMA 4KGZA 1X9GA 1BN7A 3NBQA 4TTPA 4UC0A 5CLHA 2DTEA 2R60A 4AY5A 1KNQA 1OROA 4I1RA 3T3PB 4QPCA 1A5ZA 3ZV5A 4L2IA 1O0BA 1XNGA 1WV0A 3HHEA 1QYIA 3QWFA 1HDGO 1Y98A 2YWJA 4U02A 3E9CA 3RF6A 4LYEA 4B81A 1B8VA 1QQAA 1PK7A 3HLYA 4HB3A 4ZOBA 5DP1A 2VBFA 1QCYA 3QBVA 4K6GA 2IPMA 1WUTA 1DO2A 1JMVA 2Q41A 4XPZA 1WMFA 3CW8X 5DBGA 4YRJA 4UDYX 4Y6PA 3ZTYA 5AW9A 3CURA 4L0MA 2NP7A 3DYVA 1ISSA 2F1HA 2NO4A 3LHDA 4RIHA 4EMBA 1Q77A 4WOCA 2YKGA 3QP9A 1CQJA 3HCEA 5G0TA 1BS2A 1KI4A 3KXDA 1E9BA 4RDCA 3B7PA 3TM5A 1GUZA 1V7CA 5FBHA 3FSGA 1PWEA 1U2DA 2D3WA 3K8QA 2VF2A 1S96A 5A5EA 1T5DX 3MF4A 2GD1O 2D1SA 1XTUA 2YMLA 3KV3O 3IAAA 4NIMA 1GAXA 3SX2A 1VKZA 4NI5A 3ORFA 3VC2A 3CEAA 5CB4A 2UKDA 2B1GA 1XVLA 4GMGA 4MTCA 4QGSA 1BXRA 1OMOA 3T7AA 2DECA 3IVGA 2R7AA 2WMOB 4DRXA 1Y1KE 1L3BA 1GM5A 3MD0A 3SHVA 4YAWA 4QUKA 2CV0A 2PT5A 3ABOB 1THTA 1W1WA 4I9GA 4PU0A 5FCDA 2QN9A 4AKIA 4RSGA 4QJ3A 1H3FA 4G65A 3H8SA 1EP1B 4OL0A 2JFVA 4Q02A 5DP2A 4H16A 3MVEA 3Q98A 3RGGA 1NZJA 4MR7B 3KZMA 1Q1AA 3EB9A 3K9HA 5FUWA 3AB8A 1B00A 5FADA 3UK7A 2GSDA 3VBEA 4ZAXA 1XCOA 4PLFA 1PK9A 4UU7A 4HGZA 4L7QA 3TIXB 2QTGA 2VK4A 4OP3A 1A7AA 1E5XA 4L07A 2ZAMA 1UM8A 2AOTB 2ODTX 4P7KA 3W3AH 5JANA 4XWWA 3FNHA 4FWTA 1IATA 4JK3A 4OM7A 2V7TA 4Z5XA 3PXDA 2P91A 1QJ4A 2H85A 3LKDA 4ZEOA 1FS5A 1E5TA 3ZXIA 1M6NA 2QWXA 4V2UA 4WOKA 3UATA 1F48A 3WRYC 1VZ2A 3H97A 3KBOA 5JASA 4YJ2B 5LZ2A 3CNBA 3U4HA 2ZZNA 4IZ6A 4O4IB 2N1BA 1DC5A 3T5TA 2VYQA 4M76B 2K7ZA 2OGZA 4FFOA 2W93A 5I5EA 4DCVA 1KEKA 3EEOA 1UJ6A 4YRZA 4XWYA 2FZ4A 4OMFG 1RWKA 2Q07A 3RRNA 3W2HA 1AZLA 1TVEA 4OA8A 3X1XA 5CB8A 4UVHA 2D5BA 4CU5A 1JQJC 3OPYI 2AI2A 5AK4A 4HDMB 1O54A 1XFAA 4LOHA 4P4UA 1T25A 5HM6A 1Z6TA 5KQPA 2OK7A 3N3BC 2VTBA 1L8XA 4PZLA 2FOXA 3MLAA 2OBBA 2Q5IA 3S8EA 4WXPA 1SRRA 3RVDA 2II6A 4QGHA 2BLLA 3KQQA 4Q1BA 3CNEA 4BNMA 3DT9A 4YPOA 2WYUA 1TW2A 1XF1A 4D8TA 4Y9DA 4DMFA 3CLTD 4A82A 4P6VF 1IB0A 4H08A 1SUBA 2WPNA 2WJPA 3AZOA 3OOWA 4C5BA 2OESA 2ZB3A 4M1TA 1WMEA 2V4UA 2ZYAA 3ZG6A 1TKAA 4KQCA 3C3YA 3LVFO 1TUGA 4R9RA 4DLXA 5LKRA 1E69A 1Q44A 3JWIA 3Q0EA 2VP2A 4CCYA 5J43A 2OFPA 2R11A 3KEOA 1N0IA 2QDXA 3HN6A 4CIAA 3B70A 1FU8A 1CNFA 2CFOA 2XRFA 3PHBE 3Q1KA 3KLNA 4R8MA 5HUJA 3DNPA 5JUWA 1LFAA 3RVLA 1RAHA 1Q3TA 2JI9A 4MUIA 1W5BA 3H9UA 5HRUA 4RM2A 4Q1CA 4EI2A 1ZZGA 3RPEA 3BA6A 4YFYA 5J58A 1KTIA 2FZ5A 2JI7A 4MKXA 4NJEB 1M1NB 1UKEA 3F4LA 3NQ41 3OEHA 3PENA 4NE9A 3K0AA 3T94A 5BN4B 3HUDA 2R6JA 4M0PA 3NHKA 1F4LA 1XDUA 2FJ0A 2NZJA 4EZBA 1BVYF 1J2EA 4HSEA 4OMUA 2EARA 2ZM5A 1LVHA 2ZAIA 4MP6A 1CJMA 3OT4A 3GPLA 2X4LA 3RSZA 1ATIA 4DR5B 4MR8A 1IAVA 5PNTA 4D0NA 5LN1A 1Y1LA 4LE0A 2WUFA 2OLJA 1IZ8A 3BK1A 5FOVA 2NUPB 5B2ZA 1TAUA 3PIIA 4BN0A 1WVIA 3OP4A 3RVJA 5KX5B 4I3FA 3DEAA 2BEWA 2H2WA 3EGVA 3FR8A 5IC4A 4IIXA 2GAIA 3R44A 3SN6A 4LWQA 5KBYA 3DNFA 1LSJA 1ZGBA 1KOFA 2PU7A 5FPSA 4B8YA 1I6KA 4OUDB 4ZAGA 1ST2A 4OEHA 2AJBA 1FL9A 3AFMA 4KQ9A 4HX2A 4OI0A 1ZH4A 4YFVA 4AJLA 1Y9DA 4FHCA 4DIOA 2XXBA 1XXHA 4TM8A 3B8HA 1N8KA 1QYVA 2ZWAA 1CR2A 3GELA 1B15A 3Q15C 4IXTA 4CUKA 3HA7A 3NC0C 1E4EA 5HFAA 2DWCA 3NEAA 4KE8A 5D5QA 5DM1A 3W8DA 1U8YA 3P5SA 3GUVA 4X8OA 1FUIA 4YRBA 1NQOA 1QYXA 1XJQA 4C3ZA 5C7LO 5IJXA 4PX3A 3EZFA 1IDN1 1L5HA 1EVKA 1YACA 1CZRA 3TSZA 2PZKA 2CF6A 2X2PA 4PZPA 5CT4A 1E64A 3PV0A 1TOAA 5JNUA 5IJZA 3ZHRA 1JR3D 4RK4A 2GESA 1E9EA 1YVUA 2C61A 2VSNA 3TAXA 4IV0A 4D9HA 2H59A 2PFSA 2HK6A 5C5EA 3F46A 1AG9A 1YAJA 3FGOA 2IS4A 1YASA 4HH0A 3RU7A 4ZHSA 3SVTA 1O97D 3OTGA 3WKAA 2GPTA 3F97A 5E2BA 2FR8C 2EZUA 2FCRA 4HXYA 5CTJA 4LJ6A 3ID6C 3IKTA 3RRYA 5LQNA 4D4LA 1E2BA 3IT1A 5H16A 3D6MA 2B35A 1PFGA 3GN1A 5JRJA 1JDSA 4WZAA 2NXCA 1RVV1 1KZ6A 1JQ3A 2C3OA 3ERCA 3OJEA 1P4RA 5F12A 2O48X 1NRIA 1XK6A 2QPLA 3X2EA 5J4LA 2PRSA 3ZWDA 1MW8X 2JJ8A 1CVRA 2DWUA 2A9KA 4DMMA 1Y9ZA 1VL2A 5F2EA 4H3KB 2CHVA 1KEVA 3ELWA 3DGFC 3LPDA 2GWRA 1P4AA 4RXMA 1BMDA 2D1YA 3PNYA 3CNLA 1QRRA 1HYQA 5CYPA 1PLKA 5CT5A 5EP1A 2F8MA 2QU7A 3CN7A 4BNIA 4YWJA 4B6JA 2M1ZA 4IIJA 2YBEA 4NHEA 4FOLA 3D0KA 2VK8A 4MQ5A 3HGMA 4PFSA 4DNOA 3C3EA 4DV5B 3GLGB 3KP1A 1X7HA 1SA0A 3FD8A 3OEHD 4Z4HA 2OO5A 1Z35A 4S1VA 2R0QC 3EWAA 1H2EA 3E3LA 1W9MA 4C4RA 2WD7B 3ZQ6A 1TTQB 4AP9A 1OLXA 3J81k 3X2FA 1K3FA 2A9VA 3IBFA 1U1EA 4M1EA 5AVOA 3JCZA 2X23A 3A6DA 3TQCA 3L4EA 4C5AA 1PP4A 3AM1A 1EJ0A 2C59A 4C5CA 4L95C 1WHSA 2H92A 5I8WA 3ASYA 2PUHA 3M33A 5ULLA 2QROA 4X41A 1R8SA 1SKMA 5H70A 2G1JA 3T7KA 3L01A 3FUVA 5HZHA 3DXZA 2N47A 4KUEA 2X9QA 1KC1A 3HXKA 2PVCA 2D0IA 1TYCA 4D4JA 3E27A 4BKOA 4LUCA 3E9RA 1L7OA 1XMIA 2BFFB 5CBKA 1PD0A 1OASA 1RZUA 1DTSA 1F8UA 2H1CA 3K4HA 4BB0A 3K9LA 2Q1WA 2Z2JA 4Q9LA 4EQ6B 1XMOB 3L0OA 1ZEJA 1HFJA 1PGNA 4UCFA 1W25A 3WGYA 3HV2A 3GWGA 4P0TA 4CM5A 1XHLA 5FV4A 4DB2A 3JR3A 1NP3A 2RGNA 4I4IA 4M7RA 4NJMB 3R3XA 4MB0A 4RVCA 5DX8A 4AUEA 4AUKA 1GUFA 2CMDA 1GRRA 1NW5A 3THXA 1XZCA 2HBZA 5BV1A 2HSJA 2EFJA 1PUIA 1O77A 3U3MA 3S70A 3OCVA 3O8BA 2JFUA 3A26A 3DF9A 4WGFA 4B5KA 2P9CA 4NMXB 5JCJD 4K9QA 4HDSA 2FR8A 5AI8A 3ZC3A 5CCBA 2PQ2A 3Q7QA 1JEEA 2XKBA 3CLVA 4I1UA 5B2FA 3I01M 1EWTA 4TMZA 1QYWA 4MUAA 2EFYA 1QPZA 4HVLA 4L22A 4XIIA 2NU7B 2VAMA 3L4SO 1CQIB 1Y4UA 3LCUA 1H4VB 4AG3A 1MHPA 1J2RA 1U1DA 2ORED 2FCAA 3C6KA 4DBVO 3HZRA 3QIAA 3DD1A 2GK6A 2ZUEA 2A1TR 4KR6A 4L02A 2LDXA 3WQQA 3ZE8A 1B23P 2Q6LA 1QE3A 5JQGF 3FMGA 1JG2A 1N2SA 1E1RA 4DYVA 4AQ7A 5EE3A 4TV8F 3TQIA 4IDAA 1AN9A 3MQ4A 4BZZA 1N8NA 1DXQA 5K8LA 2WMNB 4OQPA 1P1HA 4JQYA 3KTDA 2ZAOA 1N5RA 1EHIA 5LCXA 3ZV6A 4DJAA 5EHXA 1TRKA 2ZRPA 2IOQA 3MJHA 4BU0A 4MQ6A 3A2KA 3R7NA 1GKYA 1N1DA 1PGJA 1E3TA 5AVZA 4XSGA 2HDOA 4J7UA 3DDOA 3DZGA 5CHEA 5IDWA 5I7UA 3E61A 1JU3A 2JFPA 4KRXA 1RP1A 5AJZA 2OGTA 2Q6OA 1D2MA 4RTMA 4OFWA 3DCIA 3PE4A 5DM70 2NUAB 2G06A 3H6HA 4E0BA 4NKRA 4Q3CA 2P9ZA 4HXFB 3LLCA 2DPXA 2E82A 2XUOA 5IJ0B 3OZFA 4L6CA 2JVJA 5JNWA 4GICA 1PVOA 4E4TA 4H77A 1R4NB 3C48A 4KSCA 3V33A 4M1ZA 2BF4A 3HSYA 2BDEA 4ZOLB 2OEPA 4NZZA 1SZDA 1VBMA 3CZRA 4L9RA 2FZCA 2MMCA 5IFKA 1TCBA 5L3VA 5LQAA 1I3NA 1II0A 1Q95A 1Z83A 1GSHA 3P8ZA 3QSGA 2F1RA 3R3ZA 3V1KA 3ZWCA 4L50A 4ZI3A 5TDHA 2IUSA 2FEMA 3INRA 3P9RA 5ERYA 1YE8A 5JAPA 1PJ4A 1RJGA 3RU9A 2C4WA 2OC4A 3CIFA 4JGBA 1NVAA 3OM9A 4K2HA 4DR2B 1NUHA 3L8DA 3Q9NA 5ITZA 4RZHA 2QUIA 2YV1A 1N7GA 2IYLD 3K9WA 1GTRA 2B4KA 3MGCA 2BM0A 1C9DB 1DC7A 4PGFA 5EIXA 1UFQA 1Z0ZA 1UMBB 2ROQA 4BLTA 2HMYB 3ZY6A 2YN4A 1XQXA 1AZTA 3IKVA 4OSOA 4MKGA 4C4ZA 3I0NA 2PRKA 5CFRA 1UBSB 2WHEA 4EKGA 4E46A 5DU2A 4URXR 3IIJA 1OAAA 2PS1A 3UJHA 4FMCB 3A25A 4MW1A 3SZUA 1M0SA 4N01A 3GLIE 2QS9A 4UEWA 4TKUB 1AUVA 4KWTA 4O25A 4N03A 3AI2A 2PKCA 3C7DB 5K3SA 3RYFB 2Q3CA 1M6EX 4NBSA 2BE9A 1VYHA 2X5XA 3HCOA 4UDXX 1RXEA 5A3RA 5TIIA 3VR3D 5GVRA 2W2PA 4DG8A 1DG1G 2PR7A 1ECJA 4R2HA 5AI5A 5KS2A 4GM4A 1Q21A 1EZ1A 1I7NA 221PA 1NGSA 2XYGA 3K0HA 4RE6A 1V4BA 3FKSD 4QTUB 4YI5A 5DN9A 4UMEA 3ZWAA 4B3DA 1FW6A 4DHWA 4G63A 2WKQA 3A31A 2R6AA 5TPZD 3LQ2A 2IE8A 4RK7A 3QBTA 1VC2A 2QMOA 2SCUA 2HK7A 3A6LA 1WKVA 3A6KA 1XF9A 3OCUA 4RHTA 5DHTA 1O94D 2JBWA 1T8SA 2ZUFA 1GHTA 4KHPB 3WNVA 4TTQA 4OAQA 3L02A 3DLHA 3G7UA 1RYMA 1G64A 3A6ZA 1WW8A 4ICIA 1YULA 3AUSA 4OF4A 5LMNB 2ISCA 4YRTA 3ISTA 3RT1A 2R7KA 1AXGA 1YU6A 1T9GS 5DH9A 3I61A 1N3IA 3MWDA 3WK5A 1VRWA 2ZI3A 2ZIZA 4IXWA 2MSNA 5GGXA 4CI9A 5HK9A 4LFAB 1T3TA 3VR6D 3EQZA 2H4JA 3HU5A 2C94A 3EXG2 4GM0A 4TUYA 2RDMA 4G0ZA 5C1IA 3UH1A 4S0XA 2XNKA 1QC5A 3ENKA 3GCWA 4X61A 2P27A 2ZYGA 4BVKA 1VIMA 3GLGA 3PGVA 2GT1A 3TQHA 4OI2A 2NTEA 1F0NA 3LF1A 4AJEA 4M1YA 2CMKA 4JEHA 4I99A 3B1YA 4FVTA 4PLVA 1NN5A 2Q9BA 3BXGA 3C74A 5JC8A 4NXMB 3G0OA 2AYZA 3COYA 1NPTO 3CZAA 1BG6A 3O73A 4GXQA 3OJLA 5GONB 3UV6A 5CDFE 3LT2A 1W0CA 4HGNA 2O8EB 3IBYA 1HA3A 3FUWA 4PFQA 4Q16A 4E51A 3S44A 1FYVA 4Q24A 2IODA 3K2BA 2ZT5A 4BEJA 3EA0A 2L69A 3N7AA 1GNVA 2HIAA 1B3BA 3REOA 1N9GA 3CMMA 3RHSA 3DQZA 3BXPA 5J59A 1NG1A 1PQYA 3VU1A 3A2NA 3DZ8A 4PYOA 2CD7A 3ORYA 4RQUA 1SD1A 1XP8A 4H6WA 3UYLA 1FZTA 1XZAA 4HDNB 4P4NA 1A5TA 2OV2A 1J0XO 1I80A 2VNAA 3MNFA 3OT1B 4HGPA 2B7CA 2ZBUA 1Q83A 3H75A 4R1OA 3UJNA 1E61A 3M4YA 1YQGA 2R85A 4R0MA 5DEOA 1IWBB 1T1RA 3U31A 4AF7A 3TFOA 3PJRA 2CD9A 4ARAA 5ICCA 1FBNA 2KLBA 4JKYA 4ZJUA 1OAOC 1RPTA 2LE0A 1KHHA 2AJDA 2QVCA 3B6IA 2F48A 1YE3A 4UZEA 5HZKA 5KDDA 2BKXA 2EG5A 3WICA 4CG0A 4JXKA 4KPEC 4ZU6X 1KAHA 1MEEA 2AS0A 2BBWA 3ZWKA 4G97A 4AXBA 1Z08A 3ILVA 4NJEA 5A03A 1V71A 1FIUA 5KO2A 3WDMA 4DLSA 2I8CA 4HAIA 3RVMA 2C0QA 5A62A 3AESA 1REQB 4MUNA 2LZ0A 1SD2A 5GZ1A 3K09C 2FF5A 4XIGS 1GQSA 1DBQA 2AE2A 4C6HA 4EG7A 5K0TA 421PA 2FU5C 1BOOA 1XROA 2O3QA 3D4PA 5D3QA 2QA5A 1LC0A 3H5IA 1GZ4A 3L7CA 2AXPA 2OZPA 4ZDWA 4ZO8A 2A84A 3ZJYA 3LBIA 3K0CC 1KBZA 3RRMA 4BLSA 2Z43A 4FFPA 2PL1A 4NDNE 4ZVTA 4CCWA 3HA2A 4Q4HA 2VCEA 3OLCX 1QIHA 4LNUB 1NNUA 4TLLB 4HQFA 2JH3A 3RRXA 5G0WA 3T15A 3ZKWA 5JCXA 4FZJA 2OY0A 2I6XA 3I42A 1KWGA 1D5CA 3I6QA 2Q5JA 4L51A 3RYIB 1FDSA 4B3TB 5I3CA 1RM0A 3KJGA 2B34A 3AGPA 4W7SA 1EX1A 2PSJA 1EX7A 5EJ9A 5KNLA 4IMPA 1DEOA 1LVUA 4WX2B 2MINB 3A1TA 3H7IA 2OB1A 4KQMA 2A8YA 2NIPA 5CYGA 4V24A 1TK3A 2A0UA 2ZUBA 2HX1A 2ECFA 2COEA 1IB6A 3E9EA 5AVJA 4EHDA 3WK9A 2HQ1A 3U61B 1GKLA 3BSYA 1OZFA 3SI7A 3TEJA 5EC8A 1LLQA 1XTSA 5IZCA 2J30A 5LB2A 3SJBA 4DRXB 1ZJ6A 3CEPB 3H2JA 3WK7A 2QTVA 4NCAA 1C3OA 2FUG6 4UQOA 4XSVA 4MUEA 5FAXA 4YJHA 1Q1QA 3H9EO 5KYUA 3EMDA 1DQYA 2FMHA 1F51E 2P8JA 1LQUA 3H1EA 4LHYA 5A7HA 4JH0A 4XM1A 2JZCA 3GCXA 1X1RA 2WAXA 5D5HA 1XRMA 2ZWOA 1L7BA 5EINA 4NDAA 3TJRA 5BQXA 5HX7A 1CG6A 1RQPA 1BE1A 1V8PA 3ZGVA 1IOWA 1VE1A 3QOFA 5A3QA 4WKPA 3QY0A 1FS6A 1X80A 1X38A 3JU3A 5G1NA 4MUHA 4HUQA 1R12A 1NC3A 3ME5A 2VZ9A 3L77A 2PIAA 4JIGA 4HH1A 4E88A 2FUNB 3THYA 1OLSA 1VIYA 1QZUA 1WKBA 3PNKA 1FYXA 4FFMA 1XDBA 3KQWA 5CUQA 5AKIA 5TJHA 1B6RA 5REQB 2Z6AA 5F33A 5LZ4A 1VGRA 2B1IA 2Z9CA 1GLVA 4HNVA 4QYSA 1KI2A 2OAQ1 1O1YA 4K0RA 5LQJA 1J8DA 1U0BB 4R1UA 3PX7A 1GNRA 3VPSA 5CNIA 3EXFA 3WMWA 3L8CA 4AXXA 1QIFA 1I4WA 1QH8A 3OLYA 5T4BA 3GFTA 2BEUA 4WINA 1XOIA 3VU8A 4LTMA 2DUUA 1OZHA 4JR2A 4LV5B 3CVUA 4BJ6A 1ILEA 1QB8A 1QO9A 5I9MA 3C6MA 1EESA 4B6GA 2Y71A 2HR1A 1MJHA 2A5JA 1UXKA 3FRJA 4F91B 1T0BA 1XTZA 3K9NA 3M82A 3N76A 10MHA 1Z38A 2HU8A 4WY2A 1TQDA 4ED9A 1A69A 1VMEA 3WRXC 3N70A 1CVIA 3MFYA 3DW1X 3ABIA 3T0IA 1Z4MA 3GFOA 4LOAA 1R3UA 2C7OA 3HA3A 2PUBA 3FNGA 2CXQA 4EI9A 4RMJA 4U63A 1ZIOA 3RFFA 2QTHA 2Q3FA 4EHKA 2RK4A 5E3JA 3K6JA 5F7OA 2QRVA 3PXGA 2MSCB 1EB8A 4RTSA 4FFSA 2PUWA 4QAJA 1DAIA 1IQRA 5F3DA 1VJRA 4YECA 4HWOA 3DUFB 1AT1A 1A9TA 1F9EA 1KH3A 2IZ5A 2JPDA 3I9NA 4D9NA 2HDHA 1TYAE 2AOXA 3F1LA 4KDCA 4PHTA 5G4KB 3KTAB 4KXMA 4RFLA 5L3RA 3E3NA 4LF9B 1K8RA 3BWDD 1ZCZA 1NTOA 1YGYA 1ORTA 4KQGA 4RGQA 4UTVA 3UQZA 4ZKDA 2FPIB 1ODLA 4M9UA 3DA8A 4E15A 3M83A 5DTMA 3PLRA 4F9EA 1FVXA 1GL6A 4ENWA 2E4AA 3A28A 4EG8A 3T1VA 1FEZA 3QMWA 1KO8A 3SCZA 3UWPA 4QM7A 3P2YA 3BERA 1W75A 2VNJA 3S1AB 1VP3A 3KWMA 3NCTA 4ZMBA 5HSGA 1KIAA 1ML3A 2ATEA 2KYRA 5K8IA 4D9BA