3RRZA

H-ras in 70% glycerol: one of 10 in mscs set
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
165
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYEQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrzA00
3SOPA 1W1WA 4O0MA 1Z8FA 3OE7D 2WKRA 3BH7A 4D6PA 1E2MA 4V02A 1X86B 5FTKA 4QRHA 4D81A 2BBOA 4FINA 3FOZA 4AI6A 3ZJYA 4Q7MB 1ZNXA 4LJ9A 1YRAA 1GKIA 3B5JA 1XTSA 4B71A 4PAQA 2P6UA 4TMXA 3FKSD 1A2KC 5FBVB 2J0VA 4RD4A 2DFLA 5EP4A 3MWJA 1XB2A 1TUEA 5EE1A 2OILA 3LVQE 2RGXA 2WICA 4F38A 1P73A 1YR9A 3DKPA 4FI3C 4PC3A 3FMIA 4AKGA 3PQCA 2AFHE 1OHHD 3MSXA 2ERYA 3QI2A 4O3MA 3ZDQA 4JYCA 1NVXQ 4JLOA 1HUQA 2XXAB 2QP9X 4URWR 4BLSA 2F6RA 1E2LA 1N6LA 2G88A 3OFND 5D3MA 1E94E 1N0VC 1Z08A 2DBYA 3BE4A 3B6EA 3PJRA 1UAAA 2V3CC 4A36A 2IW3A 1XEWX 2IK8A 2PZFA 3D3QA 5CM8B 2IYRA 4FWIB 3CPJB 2ECKA 5CK5A 3RYTC 3GMTA 2BOVA 1JQJC 2BKEA 2H16A 2ONKA 3NBFA 4LOAA 1MH1A 1JXMA 3CRRA 3V4RA 1TEVA 2IS6A 4JKIA 4AKEA 1XCGB 2Y8EA 2FFBA 2ZRFA 1ZNYA 3A1WA 3F3YA 3BWDD 3SE0A 3ICEA 1JQLB 2JJ8A 2QMHA 2RKOA 2ODNA 3DMNA 3SDZA 4PR0A 3RANA 1JJVA 2WM9B 3DHWC 4DT1A 3ZVNA 2KBFA 2MSCB 2DB3A 1O3YA 1ETUA 3H1TA 1TU4A 4OI1A 3VR5A 2GJ8A 1CJKC 4LZZA 1J70A 3CR8A 1KIMA 4A82A 2YJTD 1II0A 3AF1A 4IDOA 1TTTA 2GEUA 4JBWA 3CNOA 4MKIA 3RDPA 4TQUS 4E5UA 1ZU4A 1A82A 1E2DA 1GTVA 2BM0A 2QTFA 2XJ9A 1KI6A 2CNWD 5KSYA 1KK3A 2EQBA 1E0SA 3HR8A 4PXAA 3X1WA 2J0QA 1W46A 2WIAA 5LB4A 4XVRA 2ZXUA 2AN9A 2V1XA 2XOKD 3BD9A 4Q4LA 5TV2A 3SHFA 3KUDA 1J7KA 4PX9A 1P6XA 2CLCX 1HY3A 2GZHA 3GLHB 3VQTA 4B3GA 4NH0A 5KPJA 3U7HB 1F3OA 2CJWB 4X8OA 3WRXC 4KBFA 4NHOA 1N5LA 5CB8A 3GJ5A 3LA6A 2VBCA 1OH5A 1ZM7A 5G41A 1XD9A 3GEIA 4HDCA 2CCGA 3KXIA 4HAWA 3I92A 1BS1A 2X2FA 1DAKA 3Q7QA 3FHCB 1WRBA 4TQ9A 4PC6A 1EESA 2C9YA 2OBNA 4M22A 3ADKA 4DCVA 2QAGC 3LX8A 4DJTA 3TW8B 4BUJA 3AF2A 3LBIA 3IO5A 4OHXA 4Q1FA 2O8EA 3BB3A 3P20A 2J7PA 3WHKA 2GCPA 4Q00A 1S3SA 4QGFA 5A4JA 4JLJA 1CR0A 1XMVA 2JATA 4OI2A 2V7QD 2ZU0C 3HU3A 4IFEA 4LHZA 2W0SA 1SVWA 2C2HA 3TSZA 4ERNA 4BFSA 1W47A 3KB1A 1U81A 3QKRB 4TTRA 1KMHB 2FSHA 1FP7A 3NDBB 4TMZA 2LKDA 4JSTA 4F4CA 4GMXA 2OM2A 3B7GA 1W36B 4TT3A 5FBQB 3SR0A 2GJAA 3CF2A 1Q3TA 1GITA 2J45A 1NMYA 4JVNA 2IBMA 4TTQA 3S1AB 3NC1C 1C9KA 2KI5A 2D4HA 4RD6A 2Z6VA 1TUIA 3MCAA 4ABYA 2CL6X 5HZHA 4A8JA 1NLYA 2VA8A 4NYJQ 3H4MA 4B6FA 2CVFA 4LJ5A 1OYYA 4L4UA 3T5DA 2CMKA 2GF0A 1KSGA 3K0FA 2PMDA 4XWKA 2FF7A 3T35A 1SXJA 1XCMA 1HYQA 1G7RA 1TF2A 2J1LA 2K5UA 2HT1A 3ASZA 221PA 4LYAA 4HLQB 2IC5A 2O8CA 2JJ1A 4N0EA 1DARA 3U44A 1FUUA 5L3QA 1EFRD 1WBDA 2AFIE 1V43A 4ITRC 3Q7PA 4ESHA 2ORWA 3C5CA 3OESA 1Q3HA 3DOFA 4TLCA 4TYPA 5JHGB 4XH9B 4D0NA 3AUXA 2EWWA 4LC1A 5FPSA 4P4SA 5DNYB 5FR2A 5CLLA 3GLIA 4US0R 3R9XA 4D25A 2FGKA 2IF0A 2MSEB 4HATA 3MWKA 3MRSA 4PC2A 3GJ7A 1T3LA 1CR4A 2QGNA 1OH7A 1II8A 2GVDC 2VF8A 5KSOA 3UPUA 3KDSE 2SHKA 1KYIA 3TE6A 2AR7A 5DGXA 4WXRA 3N2IA 4GP6A 1OYWA 4TTPA 4C9BA 4DLRA 2QTVB 3M6AA 1XPUA 4PSAA 2HJGA 2ZS7A 2REOA 1NNEA 1KI7A 3CPEA 3ZIAD 5JJKA 1DAGA 2VEDA 4GSYA 2BMJA 5EZ6B 3WY9A 2G0TA 2OSBA 3CRVA 2J0UB 1ZM3A 3T1QA 3GJ0A 4P0TA 2GETA 5FUVA 1HTWA 4EKDA 4I1SA 5FL7A 2P2LA 4TLAA 5KDDA 3LDAA 1UBCA 5E7IA 4L16A 4YMTA 1Z0IA 3SN6A 3OIYA 2G3YA 1N6PA 1GNRA 3FTQA 1G17A 2WJHA 2NO9A 5DI9A 2BEJA 2QU8A 4BZXA 1JPJA 1Q1ZA 1Q1BA 1Z2CA 2H1LA 1W36D 4JLKA 2GZAA 3QPUA 1OJLA 1WE2A 3VU9B 3ZZUA 2F55A 4QGAA 4OL0A 4JT2A 3VFDA 2Z4SA 2JJ2D 2ZI9A 3ND9A 2CVHA 4DC9A 3U4QB 2W83A 5TVKA 3RABA 1VYUA 2JIZA 2I1QA 4ACBA 2C95A 4HZIA 4MUAA 4KBGA 2ZI4A 4V0ME 3WMEA 1JI0A 4B76A 1R5OA 1VHLA 4S2EA 1OKKD 621PA 4LYJA 4UXHA 1GG2A 3TVDA 4JYBA 1F2UA 1G21E 1XXHB 5KNCA 3AVWA 4NKRA 1UF9A 3LXXA 1M7GA 3L0OA 4NZYA 4A6PA 2YWHA 2HF9A 1MKYA 4TMVA 2RAPA 4XSHA 4DXAA 3AVXA 5G3ZA 1XF9A 2JDID 3B82A 4KODA 2JLQA 4LPKA 5JJIA 4AYWA 3NBZC 4YQFA 1DO2A 3PEWA 5FOVA 3IIMA 1E99A 3MAAC 4I1UA 4XD7A 4EJSB 1UKEA 2JAQA 4ZKDA 3FVQA 2CK3D 4IDQA 2C9CA 4WZAE 4LBWA 2ZRDA 4W7SA 5L3SB 4B47A 1KI8A 3M4YA 3TNFA 2OXRA 1OB5A 1H8EA 1YHNA 2B8WA 3CRQA 3ZD6A 5CYPA 5C1BA 4NMMA 3U6BA 3NIBA 3I8SA 3U2QA 4Q9LA 1CJTC 4M0LA 1UDWA 1J8YF 4UXIA 2CEAA 3CH5A 2QPTA 4MGIR 1W44A 2ATVA 4EPVA 2CHVA 4HUQB 2PX3A 1E0JA 2FSFA 1U8YA 1XDBA 2CL7X 5B30A 3PFIA 3DZ8A 2ZS9A 4KJZA 5SZKB 1FZQA 3KKOA 2NO0A 1M2OB 2R6CA 1R5NA 5CITA 2D2FA 3NHAA 4E22A 4QJ4A 1GNPA 4Q1CA 4RSGA 3DDCA 4G3XA 3EA0A 4BFVA 2RGCA 3OEEA 5FOSA 1JPNA 1P9WA 3CB4A 4YMVA 5CJPA 2XTNA 4R2IA 2QENA 1P72A 5BQ5A 2XNSA 2F43A 1ONBA 2DR3A 2J7KA 2NTYC 2X2EA 3I72A 4OJQA 4US1R 3ZVLA 5JCPA 4PO9A 1G8FA 1K6MA 3C7KA 1L4YA 1E9BA 3SHWA 4Q4JB 1Z6GA 1XTQA 1NL3A 4BZQA 4C7OA 3P4XA 1A1VA 2O8BB 5GADl 1T4GA 2D62A 3L2OB 2YYZA 3SJAA 4E07A 4EQ6B 2C04A 2FE4A 2EVWX 3NKVA 4MRRA 4DDUA 3U7FB 1J90A 3JZMA 4DLSA 1SHKA 3O8DA 4F92B 4XJXA 1XEWY 3QXCA 5BXQC 1RE0A 2YINC 3WBKA 2XX3A 4HZUB 2CHQA 2OAQ1 4BFYA 2ZVPX 2QP4A 1KO1A 1QRAA 3NHBA 5D3QA 4LJ7A 2PCJA 1FP6A 4A4DA 1XJCA 3WMFA 4AWXA 3MMPA 1AIPA 3IIJA 2AD5A 4M8NE 2ZI6A 1RVDA 4KLZA 5JLJA 2GAOA 3FYHA 2MSDB 4PZYA 4US2R 2DWOA 5JI2E 3ND8A 5KSPA 2JLVA 1CTQA 5JSZA 3L43A 3QF7A 4DLVA 1Q0UA 4BGDA 4MKFA 5A5GA 4A1FA 4IKEA 5TMPA 2QSZA 1TF5A 5C2JB 2PEZA 4UNRA 3WYFA 2WVJA 4KHZA 3WNDA 4C0KA 1T8UA 4R71A 1EX7A 1F2TB 1YZGA 2ZTSA 2GJSA 1S1MA 3KL4A 3JZAA 4FCWA 4GT1A 4PQYA 4TMTA 3UWKA 1XWIA 4C0QC 1UFQA 3Q8XB 2H92A 1XTKA 3ADDA 1MRNA 2ZAMA 1KJWA 521PA 4JS0A 4FMDB 5F9HA 3T34A 1W5SA 4HLDA 3MD0A 2IYUA 4F7WA 3TUJC 2ZYVX 4M1YA 4A0RA 1NVUQ 5EJEA 4LYHA 5EE0A 4BEJA 3EZ9A 2WAYA 4ASUA 1RIFA 4LJ8A 2BCJQ 1V5WA 4GBMA 1KI9A 1XD2B 3EARA 3RSLA 5ANRB 2ZRJA 3OAAA 4BFZA 4U00A 2RGEA 5IHPA 3SYNA 3EZFA 2IYSA 4QJ5A 4M9XA 3QXHA 1N6NA 1Q20A 1H8HA 1KNXA 1VDZA 3EAQA 2XSZA 1P4SA 2XGJA 1GRRA 2O5VA 4D82A 1E32A 5AK0A 1N0UA 1Z47A 1DAFA 3DVLA 2GXQA 3IGFA 1CJVC 1ZD9A 4EPYA 2ZRPA 1G5RA 4M21A 3QQ5A 3TK1A 5IT5A 4U7DA 1EWQA 1LB1B 4Q9HA 3THOA 4Z54A 1EGAA 4MGYR 4MGZR 4F4JA 3RLFA 2GJKA 1L4UA 1DPFA 4BFXA 4FCVA 4DDTA 1YZLA 2FFQA 2QEQA 1RYFA 3K8YA 3Q9LA 1RYHA 1E9AA 5ELXA 1Z0KA 2IL1A 4G5GA 2IYXA 1JR3D 1N0WA 2VP6A 3HPQA 3AB3A 3QEJA 4NCJA 5DH9A 1OIXA 5FBRB 1S0UA 4B3XA 2REXB 4CEIA 4KFUA 1DOAA 1N3BA 1LS6A 2QBYB 1KJYA 2WOJA 2C99A 1X3SA 4LWZA 2PL3A 2ZI7A 4R7ZA 3UWOA 5JZVA 2B92A 2H5EA 4KU4A 5E3HA 3SU8A 3SBDA 2ZRAA 3AF4A 2XTMA 2QMOA 2HYDA 2J5XA 1W4AA 1DEKA 2JA1A 3B1ZA 2J59A 5IK2D 1W0KD 4XVUA 1G4AE 2R8RA 2VYFA 3LXRA 3VKWA 1PLKA 3TAUA 1LFDB 2Z5FA 4JJKA 4LCBA 1FMLA 2IYTA 4D26A 4BLPA 2XB4A 5FTNA 1U0LA 5FI0B 1U0JA 2BCGY 2PJRA 1IQPA 1E2GA 4AC9A 4RFVA 2FX3A 1PUIA 4N0DA 4RD2A 1ZW6A 1ZRHA 3PUWA 1E1RA 1X8KA 3D7MA 5LD2B 4EPRA 4LHVA 4QC2A 3ICQB 4NL4H 4OHWA 5EZ5A 2GVZC 4BQSA 4KYIB 1GKYA 3FMPB 2FFHA 1HURA 3ONWA 2GZDA 4RCZA 2AWNA 4I81A 2R6AA 1C1YA 4TL6A 5FUYA 3FKQA 4ZIRA 4A0HA 1N6OA 2W2VA 1CJMA 3PIRA 5H1YA 4DBLC 4C0HA 3R7WA 1LVGA 1BKDR 2QUZA 4QHYA 2ZRHA 1I4LD 1S9HA 3VMFA 1OB2A 1VG0B 1G3IA 1NIJA 2G1KA 2VQSA 5CDFE 1M8PA 4I99A 1OPXA 2RGAA 4P3YA 3LV8A 4BASA 1GL7A 1OSNA 4BLRA 2QP3A 3RS5A 4QKQA 1E2IA 4BE7B 4CEJA 3L0IB 3W8RA 821PA 1SQ5A 1ZD1A 2NO1A 3E1SA 4DB2A 1SXJC 1IXRC 3FPAA 1E2QA 2RGBA 2DYKA 2OUKA 4OQFA 4LPSA 3WBJA 4LHWA 1DBSA 2CE2X 1FX0A 5FOWA 2ZE6A 2ZE7A 4RD0A 3I8XA 1XP8A 5J4KA 2I3BA 2ZJOA 3GLFB 1W49A 1CKEA 1E2PA 2XNDA 4RKEA 1OFTA 2IWRA 3QG1A 2QL6A 1IN6A 4TYQA 1WF3A 1Z0FA 1GIAA 2NZJA 1OE0A 3CR7A 2WJVA 2F1JA 1KZ7B 1XTIA 2W6IA 3GD7A 4EFNA 1Z07A 1N5KA 2PBRA 2QQ0A 3ZS8A 3HU2A 5DN6D 3GJXC 2WSSA 1GSIA 4JVLA 5GJCA 2X77A 1S2MA 4Q48A 1L2TA 4GDFA 1VYVA 2IXEA 3QKSB 1HQYE 2HV8A 2FH5B 1G7CA 1NMZA 3HP1A 1P60A 2OEPA 3AVQA 3PITA 1YR7A 3R8FA 4V0MA 3NH9A 3RRMA 1D2NA 3A58B 2C78A 2VP0A 1Q1QA 1IN5A 3QSYA 2ZAOA 1JALA 1KK0A 2D7CA 4W9MC 1YRBA 1YZUA 4DCSA 2QE7A 2OLKA 4HAXA 2B7BA 5JCZA 1E98A 2A9KA 1WP9A 3FHOA 1KI3A 2RCNA 5E7JA 1RW4A 1Z6XA 4KAXA 4UKDA 5FBLB 2ZJ2A 3OZXA 1J99A 5EXTA 1N5JA 1TU3A 2ZYUX 1G3UA 1G18A 3IIKA 5JWRA 1IM2A 4JZKA 1RKBA 2VIIA 3C16C 4BFTA 1RPZA 3VKHA 1E1QA 1XNJA 2O8EB 1WB9A 1KHTA 4D0GA 3TKLA 4F91B 2Q9BA 3OF5A 4I4LA 3ZZTA 4IXNA 4PQFA 4NCKA 2VP2A 2DWQA 1Q21A 1U94A 5CB6A 4TYWA 4JVSB 3U7EB 4LK2A 4A9AA 4LYFA 3RS4A 3R8CA 2A7QA 2GAAA 1IBRA 1FTSA 5DISB 5EQTA 2GDJA 3NTUA 4P4UA 3IEUA 3LH5A 4QOSA 4PPFA 4IEEA 3K09C 4NONA 4Q18A 3AF3A 3EZ2A 3UIEA 4OQLA 1UJ2A 3EIQA 3HR7A 1DAEA 1IJEA 3HYRA 4LV5B 4YXWA 2UZIR 3B1YA 1YKSA 2VHJA 4FIDA 3LLUA 4K46A 5K8UA 1IN8A 1SZPA 2ASEA 2QPOA 2KE5A 4HB4A 3WYGA 3KQUA 3V00A 2A5FA 3OE7A 4CRWB 4KI0A 1E9CA 1CP2A 1P7CA 2QN6A 5J4VA 4A8JB 1FOEB 1SVOA 3CZQA 4B3DA 3LVRE 4L9SA 3NH6A 4Q4AB 4MRSA 1NI3A 3KX2A 3K0FB 3K0CC 2WWHA 2HXYA 4BFWA 2VTKA 2WBLC 4BLQA 4IOMA 3EWSA 3A8TA 3CKLA 2ZYTX 2OO7A 3U44B 2PCLA 1Z22A 5IF9A 1OXXK 1NBMA 2GBLA 1NN0A 1GL9B 1SVMA 1XXHE 2MMCA 1LV7A 3RSOA 2P6RA 1OHHA 4PTLA 4AKHA 1AGRA 2DFNA 1B23P 2FV8A 4P4SB 1NF3A 4WXPA 3B2EA 4B74A 1SVKA 4KITB 3GLIB 1TL7C 2IEZA 3EXAA 4XSGA 1P61B 5J40A 4OI0A 3THYB 2EU8A 5FOTA 4C2TA 2R6FA 5JEEA 3A6PC 3C8UA 4LX0A 4AG6A 1BO6A 2QRZA 3MJRA 4WIAA 4B2IA 5BN5A 2IS4A 3A1TA 3GP8A 1G6HA 2B6HA 3DM9B 4Q7LA 2VO1A 1II9A 4MKHA 3U3RA 3BIFA 3BGWA 5EP3A 2G77B 5J4LA 3WHLA 2BMFA 2QZ4A 3W9YA 1VCIA 4JLNA 2NO6A 1KO5A 3U3MA 3CLVA 4QM6A 1T6NA 1XFAA 5GVRA 2FN4A 2RH5A 1OFIA 3LWNA 4OK3A 3ZZ0A 4AURA 3O8CA 4HYYA 2GXAA 2ZJ5A 3AVPA 4M9QA 2AK2A 2WZQA 3T15A 1PV4A 5HCNA 3CBQA 2XZLA 4XOIA 1Q44A 1EFUA 3GFTA 3NWJA 2V4ZA 2ZPTX 4N3NA 2BV3A 2ZYWX 2OFOA 2C5LA 1P62B 2OAP1 4PHGA 3SZRA 1E79A 2EFHB 3W90A 1VTKA 5DI3A 1OH6A 4TMWA 3NEYA 3TH5A 2ZSBA 1T9HA 2Q9CA 2ZUBA 3B1WA 1J8MF 2ZJBA 4ZKEA 3ZS9A 4C0JA 3SJZA 1KSHA 1OXTA 3W3AA 3W3ZB 3I61A 4NP6A 2CNWA 4WZ6A 2ZITA 3AUYA 4Q03A 3A4LA 4UQOA 2GKSA 3L8ZA 4B44A 1D8TA 2ORIA 2XOKA 3TW4A 3GJ4A 1NVVR 2OG2A 1NSTA 4IVQA 1N5IA 2JLSA 1AN0A 2H57A 1G8PA 4JL6A 4KSCA 3UKDA 2CBZA 4I1OA 1GL6A 4Q5IA 3BXZA 3KTAA 4B3CA 2UZ3A 3QPWA 2QPAA 1XEXB 1CJUC 4RZUA 4D0LB 3PENA 4LRWA 2NOAA 3Q5EA 3QVUA 4QM7A 2CLDX 3IQWA 4XIGS 3GQBA 2EW1A 4ZCLA 4C30A 4AIIA 2Q3FA 2FNAA 5F3WB 1Z0AA 5JHHB 3LQQA 3NDPA 1DO0A 5TXGA 3LNCA 2JLUA 2ANCA 3EZ6A 4GFDA 2QT1A 4QBIA 4NDZA 1KI4A 1JR3E 3BJIC 1W2GA 5EUMA 1VG8A 3TR0A 4FD2A 3KJIA 2XXAA 2F1HA 4C3ZA 3WXMA 3AVVA 4L9WA 4ZDJA 4GL2A 4UJ3A 4RZXA 2NO7A 2FU5C 3G82C 1NMXA 2Q3MA 5DIFA 1VCNA 1NKTA 2WKQA 4NYMR 2C77A 5G3YA 2J9RA 5GVSA 3TLXA 1P5ZB 2PMKA 2EFGA 5CIQA 3DO6A 2GK6A 3C5HA 5BYJA 1D9ZA 1N6HA 3W34A 3CWQA 3GEEA 4POAA 2YHSA 1TPZA 1YE8A 2FEMA 2ZEJA 2WJIA 2OCPA 3K0SA 2ZIAA 4MQBA 2QY9A 4ZI3A 4MDFA 5EXXA 4HI0E 3PCRB 1COWD 4YC7A 2BBTA 3MLEA 3OEHD 1E9EA 3CWZA 1MV5A 2FJUA 3FWYA 2PLFA 1YU9A 2HCJB 5FL7D 2Z4RA 2W2TA 2R44A 1BMFD 5CJ2A 3THWB 2BIFA 1IY1A 1XMJA 3I1FA 1X1SA 1MO5A 5KDOA 1IY0A 1TADA 1PVOA 3I73A 5FUXA 4A0GA 2A5YB 1YZTA 3DZDA 2KBEA 2FEOA 3DEFA 4Q1DA 2GF9A 2IX3A 3B1XA 2AXNA 2F43B 1ZC3A 4PSVA 3CX6A 4CEHB 4V0LA 4ZI2A 2J3EA 2BM1A 2Q3HA 4RD3A 4C7OB 4URVR 2BDTA 3TIFA 4TYYA 1WCV1 5M04A 3K53A 1I2MA 1KK2A 2JIZD 3R9IA 1CRPA 2Q9AA 1ODFA 1WMSA 1P2UA 2NG1A 2PT7A 3BH6A 4OHZA 4M4SA 1FL9A 1G8YA 4CIDA 2YV5A 3VX4A 1Q22A 3U5ZB 2XJ4A 3KJHA 4HLUC 2QAGB 2CJWA 2C98A 5FR1A 4B73A 1AM4D 3LD9A 2QA5A 3RS0A 3UANA 2PX0A 1R0ZA 5CDFA 3KQNA 2IEYA 4LV6A 1KO8A 5AWFC 1Y3AA 1HE8B 4MRNA 1M34E 2IYQA 1XTJA 4YONB 4RD1A 5K8IA 4Y0AA 1ZC4A 1DG1G 4FXPA 4R9UC 1G7TA 2ZETA 1SKQA 4HDOB 3E70C 4OI4A 4TLBA 5K8LA 4RFSA 4YMSA 1QHGA 1YZQA 4JIMA 4XD7D 3H84A 3Q3JB 4EDHA 3RRNA 1E4VA 4YDHB 4LJYA 3FFAA 4FWTA 5JSZB 5FPYA 1F60A 3K09A 3D6TB 2P5TB 2GTPA 4DLXA 4HB0A 1H8ED 4HAVA 4W5HA 4XWAA 2QQEA 4GOJA 2YNMA 3ECCA 3QKRA 1KMHA 4B43A 3CNNA 5FOUA 3P27A 5E95A 1D2MA 2GEVA 2V9PA 1G3RA 3NBYC 4DWJA 2A5GA 1SVLA 2PJZA 2IXFA 4G01B 4MDEA 1E2JA 2AKYA 2JJ2A 1U8AA 2GXSA 4HDQB 3K0CA 3PUZA 1ZNWA 3W8NA 3CW2A 5FH9A 4QHSA 1DG3A 3S1AA 3VAAA 3KFVA 5FPTA 3C41J 3B60A 4TL7A 2IWHA 3CO5A 2FG5A 2OFWA 3KKQA 2OBLA 5IRCD 1YQTA 3SQXA 3EPKA 2ZRGA 3LW8A 1M1YE 3UK6A 3AVYA 3QEOA 1OXVA 1BOFA 1OKKA 4B2PA 4O2LA 4DB4A 2QM8A 2ZQ5A 4TLEA 2IS2A 4BWYA 5SZJA 4E03A 1GILA 2J41A 2KSQA 3HJNA 3EC2A 1BH2A 4C0BA 2O8DA 1P2SA 4QGGA 1J2JA 4J0QA 2HLDD 2PZEA 4ZO4A 2P6NA 3BH0A 4IDHA 1XJ0A 4V0NA 1ZIOA 1OIVA 2JDIA 4Z51A 1QF9A 4K81B 2RGNC 1GOTA 1B0UA 3FB4A 1FNMA 2OBMA 2Z0MA 4IOJA 4LHYA 1KNQA 5FFMA 1W2HA 2B21A 5EE5B 1QHHA 2IYZA 2B7CA 4JLMA 5EE3A 4WOPA 2O52A 5KU1A 2IHBA 2N46A 3K9HA 1TX4B 5LBIA 4TL8A 4C0LA 2AK3A 1QG2A 2VHUA 421PA 3FMOB 2IUUA 4CVNA 2IYWA 1A7JA 3K70C 1OLOA 2W2XA 5G53C 2W6JD 3N2EA 5B58C 1ZUNB 1WXQA 4Q1AA 3BERA 5AUPB 8OHMA 1ZUHA 1AGPA 3QBVA 1W0JD 1SKYB 1NP6A 4YLGA 3VKGA 2XEXA 4JT4A 3GLFE 1GP2A 3WYAA 3AP3A 3CONA 4WW0A 2B8TA 3CNLA 4KFSA 4HSEA 4V0OA 2YKGA 4TL9A 1UBGA 1PLJA 3KZ1E 3U3OA 4CW7A 2WV9A 3QPVA 4TSFA 2VLIA 3TUZC 3QG5A 2HYIC 3Q72A 2LWIA 1ZMXA 2GCOA 1E6CA 3MWLA 3O8RA 4OBEA 3X1XA 4NYIR 2FDCA 3VU9A 2QNRA 2PLRA 5CM9C 3U7GA 3D31A 2FMXA 3K0AA 1MO3A 1XU4A 3IPXA 3X2SA 5C4MA 2FZ4A 3P32A 3ZH9B 4AY2A 2CL0X 2NZ8A 2W58A 5TB5A 1GVNB 1ANKA 2R9VA 1RJ9B 1QHYA 4M1MA 1KO7A 1M7HA 2ERXA 3OAAD 1LY1A 4A92A 1E3MA 3N5CA 5HE9A 1XXHA 3X1YA 3Q5DA 3W6NA 1F48A 1UKYA 2F1RA 4PZLA 3H2YA 1OH8A 1IXSB 2ZRBA 4KFTA 1NN3A 4V03A 3DL0A 3QY0A 3AKYA 3C4JA 5BYKA 4NCHA 2ZR0A 2ZRKA 4Q4HA 5KDLA 2DCUA 1K5GA 4FCTA 2IUSA 3NG1A 3C15C 3LX5A 4WA7A 1JNYA 5F2EA 5JBQA 4W5JA 5AJZA 4NCIA 4CEJB 4GI7A 4ARZB 1KZGB 2R62A 4EJSA 1N6KA 2WPDA 2W0MA 2HCBA 3QXSA 5HKKA 3REGA 1DE0A 1LF0A 1HH4A 2IYYA 1I4DD 2VF7A 3NEJA 5B2ZA 1AQYA 1HEIA 5L3SA 3K9LA 1R6BX 1LS1A 2NPFA 2ZU6A 3UMRA 4A15A 5DHFA 4H1VA 1S1CA 3W6OA 3ZVRA 3TBKA 4KLNA 2ZRLA 4C0SA 4IRUB 4YDSA 2O8FA 2GBLC 3P26A 1R7RA 1Z5ZA 2QSYA 1NLZA 1UEJA 2WJYA 2XTZA 4IVPA 5KHOC 3PUVA 1GUAA 1W4BA 3EPJA 2NQ2C 5UKDA 1DAMA 3LW7A 4NCNA 4Q1BA 4HUQA 3RS3A 4DUGA 5C18A 3GEHA 2ZRCA 3L82B 2EYUA 3GLGB 1G5PA 3AKCA 1L7VC 1US8B 2F9MA 1KOFA 4B48A 2QMEA 2A30A 4OK5A 4Q47A 3FDIA 1CRQA 3V9PA 2FOLA 3R20A 2IYLD 2IF2A 5DHAA 5EUQB 4DVGA 4TWZA 1VG9B 3BFXA 4URUR 5EP2A 4IW3B 4FMBB 3SC3A 1CIPA 1UDXA 4Q7JB 3W5JA 2ZS8A 2OCBA 1KO4A 4BECA 4FN5A 3QF4B 1FUKA 1VPLA 3F5FA 4NPHA 5F98A 2GILA 2ZUCA 4LY6A 4HLUA 4Q4JA 4JMPA 4RZ3A 1UPTA 2GHIA 4IDPA 4HUTA 1E1RD 1G8HA 4AYXA 3ZD7A 3F8TA 1FNNA 2OT3B 2N1BA 3BRWD 1OXSC 1FW6A 2IHYA 1TQ2A 1ZD8A 2IYVA 3VR1A 2Q6TA 3JVVA 2GCNA 2D74A 2EFDB 3KQLA 1LW7A 5JWOA 3NC0C 4D4MA 1A2BA 1ELOA 1G1MA 1T8TA 2PZGA 4HZUA 3B1VA 2V6IA 2BKUA 1JR3A 2JGNA 4R2HA 4URZR 4X8MA 4Z1MA 5GJWC 5P21A 4S35A 5TARA 3TVTA 5C46F 3MUFA 3K9NA 2E9SA 1A4RA 4LUCA 121PA 1SGWA 4BRUA 2FZLA 4O25A 5EXSA 3GLHE 1DVRA 1ZUIA 1VMAA 3AF0A 1T0JB 2KB0A 4AD8A 4PSKA 3I5XA 1XD8A 1G20E 1SHZA 3TGPA 1DS6A 5JRZA 2DHRA 3SFVA 5BW8A 3ZLJA 5JFGA 1K5DA 2WWWA 1M7BA 1YR8A 1Z29A 5IK2A 1W0KA 2R6DA 3A4MA 2YWGA 1C4OA 4CGZA 4DDWA 5D3MB 4DLTA 1F2TA 2XNDD 5G40A 4LGMA 1AJEA 3PR1A 2CE7A 2RB4A 3EA5A 4G5SA 3J81k 3AQ4A 4Q19A 4MYUA 1QHSA 3ETLA 3NVAA 4Q9KA 5HE8A 3BC1A 4DCTA 2QORA 2VSOA 4FMCB 3SNHA 3CF0A 2YVUA 3ZVMA 1NRJB 4KCGA 4WVFA 3DOEA 3L8YA 4XTRA 1YJ5A 1G7SA 1UBFA 4D4LA 1O87A 721PA 2ZE8A 1KSJA 2YOGA 4KV9A 4PFSA 1TQDA 3JVUA 1KKMA 1XTRA 3LFUA 2QAJA 4ON9A 1YZKA 4TN1A 3A36A 5GJBA 4BLTA 1XD2A 2KJQA 4R98A 1R4AA 1X8JA 4DHEA 1WA5A 3DKVA 5KOYA 4KSBA 2RGNA 3FGNA 4PC7A 4AYTA 2WWYA 3B8HA 2ZI5A 3X1DA 5KPDA 1AS2A 4DT1B 4B75A 2OZEA 2JCSA 2JASA 5AUNB 3P4YA 2G1JA 1U0HC 3LQRA 1DADA 3ZQ6A 2WHXA 2ZJ8A 4FW9A 3PXGA 1NG9A 3UG6A 5JJLA 2H7VA 1CR1A 1HA3A 2FSIA 4PQRA 4PPQA 1KI6B 2N42A 3QE0A 4OHYA 2O0HA 2VHQA 3B85A 2C03A 4QJ3A 3KQKA 3A4NA 1BYUA 1X6VA 4G1UC 3VNUA 1MRSA 4QBGB 1XX6A 1ZINA 2GWHA 1RZ3A 1RRFA 1IXZA 2DY1A 1GRNA 3PUYA 1U98A 1E1QD 1QG4A 4HB3A 2D3WA 4QXAA 2A2ZA 4QBFA 3UG7A 2EFEB 5KTYA 3SFZA 3U3KA 2C8VA 4CZ2A 2L0XA 4QG7A 2FPLA 4PAOA 2GA8A 3TQFA 3RRZA 1KSFX 3CRMA 2QBYA 1LF5A 2CCJA 4B3BA 2P5SA 1EFTA 3QVVA 1KAOA 2VSFA 4DIDA 5BWMA 2ZJZA 3IBYA 4CF7A 4BZPA 5DI3B 3G0HA 2RHMA 5DN6A 1FQJA 4Z8XA 3T5GA 4GP7A 2X19A 3MG9A 4YXWD 3BBPA 1GFIA 5KUTA 1OFHA 1YZNA 4NYJR 4D4JA 4EIWA 5EP1A 1ZVQA 2XB2A 4MUBA 4C2UA 3QOFA 4WZBE 3AV0B 3QBTA 1PJRA 1EWRA 2UKDA 1OT3A 2LCFA 5EE9A 4KXFB 1G16A 3GCGA 4M2LA 3KTAB 1BYIA 4P33A 5DYIA 5CIWA 4ZDWA 2KWIA 4UJ5A 3TRFA 3Q85A 2HXSA 4BFUA 5HR5A 1MABA 1SULA 2OESA 2FPMA 2P65A 4PAMA 1EFHA 1XRJA 3I62A 2ZSAA 1W36C 1NBMD 4HEJA 1TQ6A 4G5RA 4MYTA 4OQNA 2BMDA 2BVNA 5L8VA 1NN1A 1ESMA 1XZQA 4JBYA 1Z2AA 4DIEA 4E09A 2I4IA 6Q21A 4MYHA 4Q01A 5L3RA 4GRAA 1SXJB 4OQXA 3TAHA 1ZAKA 2AD1A 4QNMA 4HAUA 3RC8A 3FKSA 2F9LA 4QFMA 1L8QA 1MT0A 5FI1B 2OCAA 4IHQA 4LBVA 2BJVA 2O8CB 5SZHB 1BIFA 1R0WA 1D6JA 5L3QB 2YWEA 4QNRA 1P2TA 1Z28A 1GDDA 4DLWA 3QENA 3TR5A 2NMVA 3EG5A 4G5OA 2R65A 4X8HA 4YMWA 4DZZA 1IHUA 4XWOA 1AS0A 1P3JA 3KJGA 3T06B 1XEFA 2IT1A 3EW9A 3OFNA 1Q12A 1JAHA 3GLFA 4ZDIA 1II8B 2WKPA 4KVAA 1IONA 3U61B 2P0EA 2F3TA 1U9IA 4B3FX 3RVBA 2WWFA 4JL5A 1JEEA 3MGCA 4LDJA 4URYR 2ZRNA 2QTHA 5KYKA 3AKEA 3BFVA 2AHOA 2BJWA 2H8KA 1G8GA 3QXJA 5H68A 1E79D 3E5HA 4DLUA 3UXMA 2J7PD 2NPIA 2BC9A 2TMKA 4MGKR 5AJXA 3AGQA 3F0TA 3FMFA 3IUYA 1T5LA 3OIUA 3QKSA 3KUCA 4JJZA 1VIAA 2QRNA 4JVMA 5JS7A 4NU0A 3OIVA 3CUEF 1XBTA 1ZP6A 4IXMA 4GPTA 2A3RA 1S9DA 4MRVA 3KJEA 3CX7A 4O2RA 1GAJA 4DKXA 4QHTA 1XCPA 2JLYA 1S8FA 2ZUDA 3THXA 4TT3D 2BBSA 2ZR9A 4JSYA 3IHWA 4Q21A 4DDVA 3C14C 1OF1A 1HQCA 4ZCIA 1FMJA 4D2IA 3IBGA 1JEDA 1QVAA 4UNSA 2G9NA 2ZSFA 2WAXA 2AX4A 2AKAB 3UATA 1JB1A 3M1IA 4RFSB 4TZ6A 3AM1A 1SVSA 1Z6TA 4ZPXA 3OIWA 3QKUA 3K9GA 1F2UB 1RRPA 2WJJA 4P4TA 1LTQA 1ZYUA 2HF8A 4PC1A 4QL3A 1SXJD 1Z63A 4B35A 3AP1A 1AKYA 3GPLA 4V0KA 1ZNZA 3BB4A 4A2WA 1VECA 1DAIA 5JRJA 1QBKC 2JJ1D 2ZE5A 2FPKA 4LJ6A 1E9FA 1NY6A 4EPWA 1SKYE 2LKCA 3DMDA 3E2IA 3EX7C 3TJZA 2WMOB 1KDOA 3KFXA 2V8OA 2CCKA 3D8BA 2RGDA 5C4GB 1JECA 2XAUA 1CU1A 1I4TD 3ZQJA 5L3VA 3AVTA 4P32A 2V7QA 3KXLA 4LBZA 2IS1A 1WDTA 3IPYA 3PEVA 1E0AA 1A5TA 1ZIPA 5JS8A 2E1RA 2VSXA 2PH1A 3BK7A 2QROA 5H8WA 4EJSC 1CS4C 1CEEA 2X8AA 4YMUA 1PUJA 3SYKA 4Q4AA 1XZPA 3EASA 1U90A 4M53A 3B9QA 3CF6R 4UNQA 5KNBA 4DSOA 3OHMA 4ZDKA 5B57C 2O8DB 3TMKA 5HCIA 4OQMA 2J46A 1Z06A 3BAFA 3WRYC 5JECA 1R10A 3AVOA 2O0KA 3SI7A 5H70A 4OHVA 1Z6YA 1EG7A 1DELA 2ZANA 1WQ1R 2G83A 4MRPA 1E2FA 2FSGA 2BMEA 5B64A 4PZZA 3G5UA 3GJ3A 3QNUA 3VHLB 1G3MA 1R0YA 4CDGA 4DEXA 1QHHB 1R8QA 3SEAA 2ZI3A 1AK2A 3THYA 1HT1E 2EWVA 1R0XA 3WMGA 1T0HB 3LO5A 1NY5A 3U6KA 4U02A 1EFRA 2R2AA 2ZM5A 1G41A 3HWSA 4QGHA 2ODBA 3PVSA 5DSZA 4MITA 4BRWA 4ACAA 3RWMB 3AEZA 3BFKA 3EIHA 3GLHA 5DLQC 5AJYA 3NBXX 1CLUA 3RWOA 4A2PA 3ZYCA 2GK7A 1COWA 3KKPA 3V4FA 2VHCA 2VP4A 3OEHA 4PHTA 1AZSC 3WNCA 2VRWA 4L5BA 2XZPA 3IDQA 3QIAA 4PO8A 1RRGA 4Z8YA 3B9PA 5FBWB 1VYTA 1JXOA 3T61A 1BMFA 2MMGA 2YZ2A 4ILEA 5FPHA 4PPNA 3BORA 4EPTA 1OXUA 4BLOA 1UADA 3ZIAA 2FA9A 3RS2A 3GLGE 2Q21A 4A6XA 2YOHA 3CRW1 3ZGXA 5CLQA 1EX6A 2I1VB 4WAUA 4JL8A 5FTJA 2GCOB 1E2NA 2NGRA 1VCMA 2QT0A 4PHFA 4RCYA 4D4KA 4Q02A 4I1VA 2J0SA 4H9GA 4GOKA 5FUWA 1SVIA 1AQUA 5J4YA 3K0AB 3U60B 1M6NA 4BEBA 3A1SA 2QGZA 3K0EA 4DSTA 1JAIA 4B2LA 3WP0A 5BN3A 1G4UR 4M9SA 1H65A 4UNPA 3HU1A 1P9NA 4L15A 4EFLA 1T5IA 2F1IA 1QHXA 4RKFA 1EXMA 3SYLA 5JMTA 2D7DA 1E2EA 3SJCA 1VHTA 2VPPA 2CLSA 4FMDF 4LC0A 3VR6A 3LRPA 4GMDA 2C96A 1HE1C 1XPRA 5E7MA 1XEXA 2DWPA 4Q9IA 2D06A 2REBA 4A2QA 2Q0HA 2WOOA 2QG6A 3T1OA 2VHTA 5HPYB 1NIPA 3EC1A 4HAZA 2DFKB 2OV2A 2OE2A 4JKYA 5GJVC 5TY0A 4Q4HB 4BPBA 1D2EA 1R8SA 3BOSA 3KKNA 1NVVQ 3EPHA 3M0EA 2PT5A 5FPKA 2UVQA 3OEED 4RY2A 1RRCA 2OXCA 4TYNA 1TQ4A 3VNVA 4Q7KA 4IFBA 5HZKA 5IDVA 1KGDA 1G291 3RC3A 3BB1A 2EYQA 1ZM4A 5J47A 1KAGA 2HUPA 2V1UA 1ZBDA 1CBUA 2OHFA 3X1ZA 2HEIA 1KTVA 2H17A 4ZV4A 2R6GA 4IJMA 5LPNA 2BBWA 2O8FB 2JLWA 1RC8A 1IOZA 4DLYA 1RFLA 3CZPA 1N2CE 3KB2A 5KSZA 3CX8A 1G9XA 3GFPA 4L8GA 4M1TA 4CYMA 5CYOA 2ZVQX 3W5IA 2CK3A 4M1OA 1EFCA 4CT5A 1UKZA 2Z43A 3LBNA 2JLXA 1KKLA 1PZNA 1PLLA 3HYTA 3RHFA 5CK4A 2ODWA 2GNOA 2VP9A 5A0FA 1Z0DA 2W00A 2HJVA 4NYMQ 3THWA 4D80A 1VKJA 4CEIB 1G6OA 1U99A 3VR2A 3SS8A 1FPMA 4Q66C 1W4RA 2C9OA 2VH5R 3P1JA 4TSFD 2YC4C 1XJQA 1GWNA 2J0UA 2HLDA 3O47A 4PO1A 2ZSEA 3UMSA 1KJZA 4HAYA 4GZMA 1P75A 3PV0A 4QBHA 4W5WA 1W7AA 4CEHA 1QHIA 1WBBA 1GM5A 3FE2A 2QI9C 2GEDA 1GNQA 1KDPA 3AGPA 3EZ7A 1NBME 3PEYA 3R9WA 1NN5A 4C0AC 2ZRMA 1AA9A 2WWXA 5JEDA 1T91A 1VCOA 1DAHA 1P2VA 2PEYA 3W6PA 2ZJAA 2GJ9A 2QAGA 4LV8B 1Z0JA 4GNKA 3RS7A 1OV4A 3IKJA 3EPLA 2RGGA 1X1RA 2A5DA 2D2EA 4OJKA 4B32A 1G5TA 1S96A 4LSGA 1ZM2A 3U4QA 4PHHA 4M1KA 1XMSA 2AL7A 3IHLA 1E69A 4KFRA 2F3RA 4ASUD 4A0FA 4AG5A 3VR4A 2W6JA 4LJ4A 3TSOA 4IDNA 4ZIRB 1KI2A 3FHTA 1VIYA 1NSFA 1P9RA 1Z6AA 3R7WB 1KY2A 2ODEA 1E9DA 1N6IA 1I2DA 1W0JA 1UM8A 2G0NA 5LD2C 4OYHA 4KVGA 3AVUA 1YVDA 2WPDD 3LAWA 5HKKD 1R2QA 4KO8A 3PEUA 1H8HD 4DCNA 4Q9JA 4GOXA 4U5XA 3GJ8A 2XSZD 1FFHA 3T1VA 3L0PA 2V55B 5TDHA 2ORVA 1E9RA 1U2RA 1UBEA 4JBXA 5SZIA 5LDDC 4G0NA 2QMUA 2IXGA 4RJLA 3ADCA 4EPXA 1T3SA 2IUTA 1QZXA 1Z3IX 1Q1EA 4NE2A 1G64A 4FMCF 5J5CA 4M1WA 5DO9A 4DSUA 1E2HA 1S3GA 4N1AA 4DUGD 2O0JA 1CULC 3LY5A 3B13B 5FL3A 2WWIA 1FX0B 2YOFA 4M9ZA 3QKTA 4IVRA 3REFA 2EFCB 1OIWA 4HB2A 2FGJA 3LLMA 2RMKA 2BEKA 3GJ6A 4II7A 4F4IA 2A78A 3MWYW 1ZCAA 2GRJA 4GZLA 1DTSA 3CM0A 1U8ZA 3I5YA 4JLPA 1G19A 2CXXA 2CDNA 1U9IC 3VX3A 1W48A 3SBEA 2CHGA 3O8BA 3HPRA 1IJFA 1NJFA 1JJ7A 3MJHA 3QJYA 4IOKA 1M74A 4DSNA 4F93B 5AR1A 3AH8A 3K70B 3CH4B 4MH0R 1JBKA 1CXZA 4UNNA 1SXJE 1X8LA 4MKGA 2DFTA 1W5TA 2G6BA 4EUNA 3I32A 3AP2A 3CIOA 4JLAA 4TQAA 3RAPR 1LNZA 4TMKA 1E96A 1JR6A 1N25A 3T12A 2P67A 4MYCA 4Z1MD 5KNDA 4TZ0A 2IA5A 2O8BA 4DLZA 3L0SA 4EQ6A 2ATXA 1ZJ6A 1EK0A 5EXPA 4LJAA 1AS3A 1TF7A 2F7SA 3GLIE 2ZJYA 1XPOA 2X1VA 4NBSA 2P3SA 1IY2A 1KDTA 2ZROA 1NG1A 3QUSA 4H1UA 3UMFA 5BN4A 4UXJA 1NLFA 2ZSDA 2A5JA 2OFXA 2WMNB 4IOLA 2DPXA 4AK9A 1UKVY 2V54A 4DEYA 4RVCA 5FTMA 2OCYC 2XZOA 4JLDA 1F6BA 2GESA 4IEIA 3TQCA 1T3HA 2NIPA 2J87A 1OFUX 1QDEA 4ESVA 3HDTA 4P31A 2AWOA 2ZRIA 1CR2A 3VTKA 1YR6A 4KYUA 5F9FA 3AKDA 3MFYA 2GXUA 3ADBA 5HTKA 1FQKA 1E4YA 2ONJA 4NTZA 4HLCA 3KQHA 4MA4A 5DE3A 4DCUA 2OLJA 3VHXA 1UEIA 1RJ9A 1ZU5A 3DM5A 2QM7A 2RHDA 3K1JA 1N6RA 4URXR 3A37A 3KXKA 1MABB 4B6EA 5K8TA 2WTUA 1NVWQ 5JI3E 1E2KA 1MO4A 3B78A 2W6ID 3IILA 4Q1EA 4ZCMA 5AJVB 2XITA 1QVRA 4Y0VA 3SQWA 2FWRA 3TSWA 1IAQA 4XVQA 4NYIQ 5LB2A 1TAGA 1KI1A 2WSSD 4JLBA 4CT4B 1NJGA 2E87A 1D5CA 4XTCS 5AJWA 5AUQA 4EAQA 1GZSA 4AKIA 3SJBA 1GRQA 5J4HA 4B34A 2WSMA 4A8JC 4LI0A 1Z83A 4RZ2A 1HT2E 3TUIC 1F5NA 3A1UA 4ARZA 3I4LA 4EFMA 3EIEA 2BHRA 3K70D 2YWFA 1OW3B 1FTNA 1KMQA 1VG1A 2ZR7A 2WIBA 4OKSA 1XMIA 1R5BA 2BWJA 2QE7D 1E9SA 1TMKA 1W4CA 4PPGA 1Y63A 4PANA 5AUOB 1GKUB 1AZTA 2YC2C 3IEVA 1QHNA 1TNDA 2JLRA 2HT6A 1Q57A 1NKSA 4WBSA 1MR3F 1KDRA 2AXPA 2WWGA 3PUXA 3VR3A 1KK1A 3WNBA 4LHXA 3H86A 4TLDA 5KO2A 3GLGA 2V6JA 5DYGA 3CPHA 1US8A 3IQXA 1S4QA 3DPUA 2JLZA 4B33A 1IN7A 3WP1B 3QXXA 1D9XA 1MOZA 1TEXA 1MO6A 2Z83A 2ANBA 3H0KA 3PG5A 1KY3A 1AKEA 1ZM9A 3KKMA 3EWAA 2HDNB 4LBYA 4M1SA 2ZREA 3T1TA 2JEOA 2VP5A 3LBHA 1K8RA 1ZCBA 3BS4A 5E4FA 2FFAA 4K8OA 3GFOA 3QF4A 5FOXA 3N70A 3ASYA 2WJGA 1CF4A 3I3SR 3A1VA 4DRZA 2VL7A 2H18A 4X8LA 3RNLA 3U3JA 4C4PA 4JLVA 3RRYA 3THXB 5JWHA 3IO3A 3FFBA 3NXSA 1ESNA 1IN4A 5FTLA 4OK6A 4G5QA 1E0KA 1G3QA 1HV8A
chains in the Genus database with same CATH superfamily
1W1WA 1OILA 2WKRA 5JZMA 5GGYA 2JI4A 3DE1X 1ZJYA 1P8JA 1TVEA 4Y9RA 5GWXA 4QRHA 4BFYA 2Q5QA 1A7KA 3QYFA 1K8XB 4XB2A 1EKXA 1LGYA 1T8WA 2OO3A 2QUAA 2M6KA 3O4HA 3WZMA 3FOZA 1RXVA 2BTQA 3AHHA 3GJTA 4TV9F 4EL0A 2UVPB 5K3BA 3W77A 4V2UA 1GKIA 3DL4A 3LSTA 3WS7A 1T1IA 1VE7A 4PAQA 4DARA 4JI0B 2CXPA 2Q5EA 3KOUA 4FKZA 1ZXBA 2J0VA 4JB3A 4ZD6A 5EP4A 1CVLA 4X7MA 5EE1A 5CDHA 3D0RA 2WICA 5EJAA 1REQA 2CFCA 4NK4A 4FI3C 5DBOA 4PC3A 1RM5A 3FMIA 1IZ7A 3WLJA 1DKMA 1N2CA 4FNOA 4NV0A 3WRVA 2HA4A 4YP6A 5F4ZA 3V3KA 1C0LA 1NVXQ 2VQDA 2Y1XA 2I22A 2VQFB 2FWJA 2ZJ0A 2OO5A 3CGWA 1ZPDA 3PA6A 3PC6A 4FGJA 4HLNA 2QP9X 3E3LA 1UFRA 4OA8A 4RH1A 5ICFA 3UMVA 1ZITA 2F6RA 1N6LA 3HP7A 4JUBA 5D3MA 1E94E 3JALB 2PL9A 3GG9A 5TGTA 3W7BA 1P7YA 1A5BB 2VPZA 4WUTA 1KF0A 3ZTWA 4DCMA 5G0SA 4JQSA 4A36A 2JFYA 2FZ5A 2IW3A 2BZSA 3D3QA 4QGBA 1DZ3A 4TKMA 4Y18A 1QU2A 1QYRA 2CFSA 3RYTC 3KSMA 4O1IA 2RGUA 4BNWA 3IOEA 3JATB 2H16A 3WWPA 4LOAA 5LKRA 1QK5A 2NP7A 4CMAA 2LCIA 1TEVA 5JG7A 1AUQA 1PD1A 3V8QA 1JLLB 1NBWB 3IDSA 2XYQA 5D5HA 2FFBA 3GA5A 2JD2A 2JGDB 4WXMA 4AUNA 1SUBA 3BWDD 4RHEA 1VB3A 3NWPA 3TIXB 2AF4C 3DBHA 1RP1A 2ODNA 3GJRA 3DMNA 1CLEA 4G89A 4MQMA 3CX4A 3UUEA 5HCUA 4G4SO 5K51A 1FVOA 4OMDA 4RK0A 3VR5A 2ESRA 4XYBA 4P38A 3P2KA 5TPZA 3TF5A 2HB6A 2GNPA 2R7AA 3IJRA 4HWGA 1KIMA 5BR8B 4N8EA 2YJTD 2C83A 1Z12A 2WTEA 5GTDA 4AUEA 5CW2A 2R751 4HQFA 3WL8A 1IZ0A 3IAXA 1XRSB 1KDYA 2XJ9A 1BQ3A 2P5UA 3HO6A 3SXJA 3CZ5A 1KK3A 1D09A 3C98A 4PXAA 1QGDA 3A7EA 4NR0A 3TTXA 1W46A 2O2CA 3HBNA 3GLRA 1B1AA 2ZXUA 2V1XA 4PZPA 3EUEA 3N59A 4D0RA 4D1YA 4OXNA 3MS2A 2H65A 3KUDA 5B4TA 4FM9A 1VLQA 1KFBB 3KHUA 3N0VA 3NBKA 5BQFA 1VFPA 4BGEA 4CG0A 1F3OA 4TS9A 3CN9A 2CJWB 3UWSA 2EGHA 1I1QB 5JCJD 1JMVA 4NHOA 2FP3A 3KYBA 5IULC 4FKMA 1UQRA 1G20B 3UB2A 1ZH4A 4F1KA 3G2MA 1PL0A 1KOLA 4LWQA 3OE5A 2MSLA 1UWCA 2CCGA 4HAWA 5KYYB 1DAKA 3WRXA 2VHVA 5LA6A 3PFNA 4DC0A 4B5KA 1BXKA 2F4NA 2HU2A 2JJYA 2PUVA 1D5WA 1CQJA 1P2FA 2CJXA 2RJOA 3PLRA 3WZ2A 3UH0A 1JFRA 2I78A 2PXHA 3OETA 4DJTA 3TW8B 3AMVA 4QO7A 3M3PA 4ODIA 1MJGM 4OHXA 3TOZA 1DC6A 1O0CA 1NVKA 1GDTA 3WHKA 2COUA 3QLEA 1T29A 4RTQA 1QONA 3W5DA 1FTQA 3IAM1 5BWCA 1CR0A 2HA0A 5T67A 3DUWA 2ZU0C 3HU3A 4IFEA 1RP7A 5EHXA 2GHQA 2P9QA 4ZVVA 3R3JA 1WZEA 4ERNA 2O3SA 2GAJA 3GH3A 2XIQA 2V45A 3KB1A 4CNBA 4HC4A 4MO9A 1AF4A 3QKRB 2WHPB 4L0MA 4OF4A 4TTRA 4UEJA 2WE8A 3TLCA 3VU1A 4TMZA 3DFZA 4JSTA 4R01A 4F4CA 4QDJA 1MENA 1DBQA 2P40A 2OM2A 3L7MA 2WHRA 2QT9A 2H1VA 1H2FA 3B7GA 4AJ4A 3FYUA 2OD2A 5JC8A 4TT3A 3A1DA 1HXHA 2VJDA 4XWGA 1OXBB 5DLYA 2X58A 1XVUA 1Q3TA 2OHHA 1GITA 3BFPA 4CPDA 4W82A 1T8RA 2CBGA 2IBMA 4DM4A 3NC1C 3NPAA 5IKMA 3TRHA 3SWWA 1TKBA 2Z6VA 2X8LA 2R47A 4ABYA 4ETMA 1XCOA 4ZCRA 2AQKA 4IWYA 1AV6A 1VSBA 2ECQA 4TKVA 2QJFA 3MLBA 3R3HA 5HMMA 5A04A 4UU7A 1ABBA 2CMKA 3C2QA 3T7AA 1SH7A 2W2PA 4A5SA 4EZBA 1KSGA 1V8BA 3C24A 3H19A 3IXLA 4P83A 5BSWA 2GWRA 1DHRA 3FLMA 1G7RA 3HMKA 4Z9BA 3QBDA 3PX3A 4Q6WA 3GGOA 4HAIA 1ZCJA 3EXHA 4MP6A 2NO4A 1Y3IA 3PE4A 2XUHA 4PS0A 2IC5A 1RXSA 3SDSA 5IVHA 1E77A 3FNEA 3RTEA 2RGRA 4N0EA 5BORA 4PYKA 4D43A 4B3JA 3ER9A 4MRAA 3TX2A 4O5AA 4ESHA 3FCUB 1NUSA 2ORWA 3F1LA 4ND8B 2IV2X 3WB2A 4F84A 2E18A 3HDYA 1LTHR 1UPCA 4PYQA 4R41A 3T99A 1Q0RA 3U4MA 4LC1A 2EWWA 5FPSA 2PUBA 2EV9A 3OOEA 4K26A 4YRLA 1U9ZA 1O4WA 5DB4A 3R9XA 4D25A 3N7AA 5IDXA 2C4WA 1VE1A 3OQNA 3IJPA 3KT8A 2WKSA 4PW0A 3KDSE 1U2ZA 5DGXA 3H5RA 1COZA 1GNVA 1N2ZA 2ORED 3AR8A 4GP6A 4MUEA 1AG9A 4IR7A 5FF9A 4DLRA 1IZ9A 3I34X 3M6AA 4MVJD 3L06A 1O94D 4PSAA 3V46A 1UC9A 2REOA 2ZS7A 2IYPA 2PA3A 3PQ2A 5JJKA 3OY2A 1WUKS 1LTKA 2GVNA 3OVMA 3WY9A 2H0AA 2OSBA 4DV4B 1XKXA 1VBFA 3GFSA 1ZM3A 3T1QA 2EKQA 2BH9A 4P0TA 1Y5IA 1VJDA 3HXPA 1R8XA 1U1DA 3AFIA 1VGVA 3NETA 4TLAA 5KDDA 5E7IA 4ZARA 3FN4A 2IYOA 2A9VA 2FWNA 4L16A 3SN6A 2G3YA 3SEZA 2BKAA 3AUTA 3OFKA 2VDNB 4DE5A 5L4SA 2M6RA 3CW9A 1QGED 2PUJA 1M2FA 4LRQA 2IH5A 3H8VA 1C4KA 5BNIA 4ZEMA 4RZSA 1Q1ZA 2X3UA 1NURA 2HUNA 5HFAA 3ZZUA 1YHYA 3ZW9A 1BC5A 3DJYA 2F55A 2G9RA 3W5AA 2Z4SA 2XB8A 3HBAA 3FOBA 3NGLA 2PBZA 3E9DA 1T36A 2P0AA 2JIZA 2X0RA 4ACBA 3STVA 3FJ1A 4MUAA 3TBHA 3COJA 2R7KA 3DBRA 1N5MA 2ZI4A 3O21A 3N9IA 3ZQKA 1P0QA 1RI3A 2CMDA 1CFJA 1I3CA 1FTWA 1UFVA 1VHLA 3DLIA 4LWOA 5EIXA 1KZYC 1AX9A 4JX8A 1GG2A 2V5AA 4JYBA 4MV9A 2YYSA 3AVWA 5GMOA 4NKRA 3KLOA 2P68A 2X3FA 3L0OA 4NZYA 4QQNA 4A6PA 2HF9A 3RIMA 4OQEA 3UJ3X 4BJHB 1ZLYA 5B4VA 1Z7YA 4TMVA 2RAPA 2GN9A 3QHQA 4KACA 4XSHA 4MHOA 4AQYB 4CL0A 3B82A 4PONA 5JJIA 4MRMB 3MWFA 4Z4FA 3HCEA 3PFKA 1DO2A 2H51A 2VTDA 3DONA 3PEWA 5FOVA 4K9NA 1LPBB 4C3VA 3HSSA 1B6TA 3JXEA 4RZIA 5HILA 2V9CA 3V7NA 5BWLA 2H8GA 2ZBPA 3ELUA 4UDYX 4P35A 2QTBA 3CLKA 4EKEA 2AOUA 4ZKDA 3IUMA 4FR0A 4IDQA 4WZAE 2ZRDA 4NBLA 5SY6A 4ZT7A 1NR5A 1QRRA 4L4RA 2OXRA 1O7JA 2FUEA 1YHNA 2B8WA 4YRBA 3CRQA 1RYYA 1BHQ1 4U4AA 1GR0A 4HPJB 4NMMA 3SBXA 3TRKA 4BMZA 4DMCA 4UVEA 3ZE2B 3U6BA 3QJGA 4Z2YA 1YMQA 3HB1A 3T95A 2FPUA 4QREA 3L1KA 3GROA 1KJQA 4K6MA 1QQBA 2BISA 4FX2A 1UDWA 5A9TA 1KFEB 2CEAA 1E4EA 1UH5A 5CYFA 1AKTA 1DDOA 1PYOA 1QSGA 1C0IA 2ATVA 5CA0A 4DMRA 2J67A 1JV2B 2PX3A 1YDWA 2WQ6A 3AOGA 1U8YA 4P5DA 1XDBA 2CL7X 5CGQB 1WHSA 3GA0A 1BMDA 4KJZA 4WY2A 3KKOA 3K1ZA 3GEPA 4DREA 5CITA 3FTPA 4Q1CA 3JRXA 2HQ1A 4IJQA 5DULA 2AE1A 3OEEA 2C2ZA 4FHCA 4LSWA 10MHA 1F8YA 3O3MB 2EF1A 3BWXA 2JRCA 5CJPA 4OXYA 3KOMA 4FUQA 5C7YA 3DV9A 5I5EA 5FT9A 5JD4A 1GU0A 1NMEA 3L49A 3H2IA 2BP7A 3IAFA 1MOQA 2QN9A 1G8FA 1K6MA 3C7KA 1NUPA 2YQ4A 3LQKA 3PU6A 4Q4JB 1THTA 4NESA 1ECCA 1Z6GA 1WVGA 3SHWA 1NL3A 3V6LA 3VDXA 1VJCA 1VPWA 3P97A 1A1VA 4GKJB 4AW9A 5LBUA 2QYSA 1ILWA 1T4GA 1FMFA 4N18A 3WV5A 4E07A 2PIAA 2C04A 1T13A 4HVLA 4UZEA 5GONB 5BW6B 1MHTA 2Y4NA 4JMLA 4YQYA 4AJHA 5AHXA 4RTJA 4KQ6A 1VIMA 2XBUA 2LZ0A 4ARIA 3CO0S 5I9BA 3VUFA 1SUSA 1RHUA 3B3FA 3QXCA 1GY8A 1C3OB 4HZUB 2O2SA 1HG1A 4CQMD 1SU7A 2PXCA 1NJSA 1B00A 2R3SA 3GK3A 2F3SA 2IOFA 2ZVPX 3AI3A 3GRCA 3HYLA 3PF8A 1QRAA 4XGQA 5JJ5A 1YV9A 2ZVJA 3NHBA 2BFFA 4N49A 5F5NA 5AHRA 3SIPA 1MOPA 4AZ3A 2B25A 4O2AA 1XZCA 4AWXA 1I1HA 1JX6A 1WMEA 3IIJA 4R16A 3P9NA 2HMTA 1O5OA 4ZVPA 4RGQA 1QB8A 1VXOA 2ZI6A 3S5JA 4RQBA 1HRKA 2PNFA 3FDZA 3F6RA 2GAOA 2A58A 3N7TA 5J59A 4DNXA 1CS0A 1ZY2A 1B0AA 4RA6A 3K4QA 3NNSA 4FYMA 3VO2A 3ZDCA 2MT9A 3PA8A 3F6BX 2JLVA 1M73E 5JSZA 4M8SA 4FGLA 4U2DA 3ZV3A 4DLVA 1B0PA 4N7JA 1SCUB 4OYRA 3S7TA 3UHOA 3G2LA 2AUNA 1J9EA 1JZTA 3CEJA 4G1MB 4UATA 5CJJA 4ALMA 2OZLB 3JD3A 3WYFA 1SRQA 4UTZA 1TD1A 3AFHA 4YHBA 3T9EA 1C3JA 3VHXB 2G63A 2O2GA 3FWZA 4I1RA 4R71A 3PHLA 1F2TB 3C3YA 1ZSYA 1OFUA 4E5DA 4FCWA 4JJ6A 1AQIA 4Q0MA 4X90A 3UWKA 5LZ4A 1MX1A 1M0WA 3CCBA 1Y6JA 4RL4A 4ZYWA 5JR3A 2H92A 3V97A 4EMUA 2FEAA 1P0PA 4MWGA 4PV7A 4YPOA 1ZH8A 3TTWA 1QRTA 4B87A 4JS0A 4FMDB 1WZIA 3T34A 5F9HA 3VJLA 1CVRA 1KYYA 2HBYA 1DNPA 2R97A 1DL5A 4QOJA 4F7WA 1NQOA 2FKAA 1RBMA 4D8XA 4M1YA 4KPEC 1FB5A 2BJHA 3HY6A 4JNCA 4LYHA 3EZ9A 2WAYA 5THQA 3RS4A 4RJ2A 3TX6A 3TPZA 1RIFA 2PFKA 3H8SA 2WJ6A 4GBMA 3EARA 4DC1A 4CKWB 4MI3A 2ZRJA 1YJAA 1KVRA 4DBLE 5IHPA 4YUYA 3K20A 3KPWA 3MTQA 3C7TA 1EBBA 2Z3VA 3R7LA 4FZJA 2PVCA 2NU8A 1JWLA 2Q5OA 1Q20A 3GXBA 1UM9B 4MEJA 1KXZA 3WQSB 4GQAA 2XSZA 3BVPA 5GAJA 3RHTA 3CGGA 3BTVA 1GRRA 2O5VA 1Z4OA 3UAOA 1CEXA 3V9AA 5KJFA 4M7PA 3KEOA 1DAFA 2Y3IA 2GXQA 2YMQA 1CJVC 3DVLA 3R3WA 4YRQA 4EVSA 5JUWA 1EWQA 2V4MA 5DYYA 1KZ4A 1EGVB 1LB1B 1DX9A 2H3HA 2I6TA 2JLAA 3PF9A 2NU7B 3THOA 4LYDA 1HE5A 3TZ6A 3HVJA 3RLFA 4Y3UA 1L4UA 1XVLA 4JD5A 4DV7B 2QM3A 4RJIA 1GZ4A 2IZZA 2PT6A 1PJQA 5CW1A 3RAGA 1NW7A 4ZQHA 4IQGA 5TF0A 4ALLA 1U7DA 2H2DA 4PZAA 3R7NA 4Y2RA 3EPPA 4XQ0A 5ADHA 3N7UA 4HJXA 4NAUA 2GBIA 3OKCA 3NBQA 1Z0KA 2IL1A 4GYKA 2DF8A 4X1YA 4QJBA 3MAGA 2OQIA 2C07A 3MA0A 4L74A 1OIXA 3DMFA 4JITA 4CEIA 1UBLS 4RESA 2EERA 2XR1A 1PD0A 1ZJ5A 3KWLA 4DIOA 2Q29A 4M9CA 2C5GA 4AF8A 1E3WB 4UU0A 1CP3A 1VI2A 3F7OA 2IFTA 4IQ4A 3H42B 1SXQA 2PL3A 1XZHA 4K6FA 4JOSA 3KBBA 5HW0A 2B92A 2FR1A 1MF7A 1O96B 2O50A 4IRXA 4L5IA 4RMGA 4D9KA 4DAOA 3OF3A 5ALKA 3TNLA 2QMOA 2J5XA 4H7PA 5A03A 1ISIA 3RG2A 5EYPA 2JA1A 3HU5A 1XDSA 4R8LA 1ZQ9A 2J59A 4XVUA 2VYFA 4P3OA 2VXYA 1XZKA 3LXRA 2OOKA 3W6ZA 4HXYA 5E1OA 2HV9A 5K4HA 3FF4A 2ES4A 2CDCA 2VNIA 4F60A 2YFHA 3KZVA 1VL6A 2C4UA 3GVXA 1DEHA 2XB4A 5FTNA 2FQXA 3AR5A 2BCGY 4FZ5A 1MPTA 1M1YB 4I1YA 4NEHB 2AMVA 4EEZA 1E2GA 5LNK1 3QE9Y 2FX3A 3RW9A 1L3BA 3EDQA 3WSTA 1ZW6A 2BTQB 3H2JA 1ZRHA 1QM5A 3IVCA 1E1RA 4AAYA 4CIBA 1TTHA 1W5AA 1PP4A 1QKIA 3AIOA 5JSFA 2A0UA 4OHWA 2W42A 3ICQB 1EJ2A 2ACKA 1U2DA 4EHAA 2FFHA 4JXZA 4BZZA 1LRJA 2GZDA 2YS6A 1M66A 3HUDA 4RKRA 1H23A 3E1GA 4HDRA 1C1YA 1FSFA 4ICIA 4QBKA 3FKQA 2H4YA 5FUYA 3T7DA 3WGYA 1FLDA 1OI4A 5ERYA 1CJMA 4A0HA 4BCCA 4DBLC 5BQOA 4AY5A 3DV0B 1BKDR 2AG1A 2ZDGA 3TW0A 2P8JA 4DGQA 2VZ8A 1S01A 1HNWB 4UEKA 1HG0A 5LMNB 3R41A 1FF9A 4KMOA 1WUJS 3WIDA 3D7KA 3W5HA 3LZCA 1PNRA 4ZK2A 5AIBA 1GPLA 1Y3BE 3OCWA 4I99A 5JAOA 2EHJA 3GGSA 3NOXA 3TZCA 5A5EA 3LV8A 3PD1A 5K0EA 2R1UA 1LSJA 1U8UA 5B3LA 2QU7A 5AT1A 1E7YA 3BF8A 4MR7A 3VJKA 3FB1A 4PLZA 3ID6C 3M9LA 4HGYA 3RS5A 1E2IA 4EP1A 2AV6A 2ATEA 4ENQA 1Z13A 1SQ5A 1MXFA 1LPOA 1ZD1A 3GRKA 1ESZA 1DC4A 2ZXFA 3S40A 3A4IA 3OWXA 1BGVA 1XLUA 3O82A 5DHUA 5FLYA 3WGKA 4UHHA 1DJOA 1IATA 3H2GA 4HDNB 3ROGA 1O1YA 4EI2A 2DR2A 1DKOA 4OQFA 4FW8A 3R4VA 4MUGA 3WBJA 5L4LA 1JEJA 1FX0A 3MGGA 4Y1EA 3I8XA 3TGWA 2ZJOA 3V2HA 1W49A 1CKEA 1E2PA 4MZXA 4RKEA 1I51A 1OFTA 1Y4SA 2GPWA 3DTYA 4KQJA 2IWRA 2YJNA 3KQSA 1IN6A 2YL2A 4Q3LA 1Z0FA 1GIAA 2I7VA 2JLUA 4YRAA 3AL2A 1L5GB 2O59A 3CR7A 3GNLA 1GPJA 1KZ7B 2J9YB 2W6IA 2JFHA 3F5QA 5K0TA 1Z07A 1TFUA 1N5KA 3BSWA 1H0KA 4HG2A 4D41A 1ISRA 3HU2A 4NDAA 3QX8A 4BUZA 2CB9A 4Y2QA 5DN6D 1GSIA 6PFKA 1W35A 4KUEA 4ZQFA 5CEEA 1ZIDA 2IYEA 1A5ZA 4H7JA 4K6OA 4Q48A 5GJCA 4O4IF 4YUXA 3GLQA 4I9GA 4RVGA 3AR6A 2RI6A 5C32A 1WPXA 4QUEA 4ARSA 1K86A 5CTAA 1H2RS 5I9NA 2I2AA 2HV8A 4D46A 4YAKA 3TGLA 2FH5B 5LZ5A 4AJLA 1PG0A 2HO5A 1P60A 2OEPA 5JNRA 5I7OA 3PITA 4J16C 4EQZA 1M6HA 3VPSA 1XDZA 4FT4A 2QN2A 3RRMA 1P4RA 1D2NA 3OCJA 3P2IA 4XWYA 2AXEA 1IBKB 4JI4B 2YXBA 3VI4B 3INGA 4U7WA 1UZUA 1UJCA 2D7CA 2PGNA 3BM5A 3K96A 3OQ6A 3DLPX 2XE7A 4W9MC 2IY7A 1G21A 1UDRA 3NWEA 3E84A 3DHNA 4HAXA 1BS2A 4MS1A 4OP3A 1E98A 5CXUA 1DAOA 1B14A 5JCZA 1P2DA 5LZ2A 2O19A 1RW4A 2E3JA 1KYTA 2QV0A 2Z6QA 1FK8A 5FBLB 4JOCA 1QYVA 2ZJ2A 3OZXA 2PPVA 3CUVA 4XGRA 4MI6A 4GKBA 3KWFA 2ZYUX 3KAJA 3SF8B 2I76A 1RXWA 1G18A 1AHHA 2C3UA 2I4OA 2HU7A 3M6UA 1RPZA 2BE9A 2O2HA 3CURA 1E1QA 1XNJA 4IX1A 1WB9A 5BT9A 2PRIA 1D6MA 3IHTA 4A3SA 1M9NA 2GPBA 2WYVA 3H99A 4I4LA 4YRRA 4J0JA 4X0EA 2CLLB 2VP2A 4NAHA 1FP4B 4EKYA 2DWQA 3WYNA 4F8JA 1X3LA 2GPNA 2CUKA 2GZMA 3Q98A 3G13A 4PLWA 4ZOLB 3MGKA 5M3BA 4PNEA 3TQHA 2IPOA 1V2HE 3COVA 3PXBA 3DEJA 4FR5A 2A7QA 2AVDA 4LYFA 4L7QA 2GAAA 4A8TA 2P9FA 5JZBA 5EQTA 2WVGA 3ZG6A 3IEUA 2DLCX 1SHLA 1QKJA 2BLLA 3LH5A 3RAFC 1RR6A 1PZHA 3F4KA 4QJIA 4N8SA 1QIGA 1OPRA 4YYEA 5JTUA 1JDUA 1LV8A 1TUGA 3AF3A 1WV0A 4CR7A 4KR3A 3EIQA 3HR7A 4LV5B 1DAEA 3FYUB 4YXWA 2H1WA 3TN7A 2IE8A 5F9MA 4E5KA 3Q12A 3QBJA 3CG4A 1NDQA 2ZTLA 2Q99A 4KN6A 3V00A 2X9QA 4N39A 3L4KA 1YACA 1E9CA 5CT9A 4Z4HA 4GD3Q 7MDHA 5U9CA 1ECGA 4P5EA 4F5ZA 5ED4A 2X5OA 2DOKA 1SVOA 3CTMA 2H52A 3HB9A 4TKVB 4B3DA 5J3JA 3E7WA 1NVBA 5KYVA 4YJFA 1JXQA 4MRSA 1DT3A 1ZCFA 2WM8A 4BDSA 1RCFA 1U0GA 3KYDA 2FTKE 3K0CC 2JI7A 2Y1CA 2A9QA 4GPZA 1QQAA 2WBLC 1G2IA 3Q7EA 2HSDA 2CV0A 1RI2A 4IOMA 3EXHB 4WASA 2W2QA 3EWSA 4BLWA 2P9ZA 1USGA 2XWPA 1RJGA 3K92A 2XKKA 3ZJUA 3QPDA 5CDUA 4U2BA 2QG4A 1G1AA 1NBMA 2GBLA 3RJ5A 1L4LA 1K68A 1RMYA 1LV7A 1THZA 1WB5A 1PTKA 1YB2A 2JGFA 3DAHA 3TM4A 1SQFA 2DFNA 3I6YA 3BREA 4OQZA 5THXA 1AV7A 2FV8A 4CLOA 2AC7A 4RWZA 3K1YA 3B2EA 2I2BA 4WXPA 4P22A 4DV3B 5BPHA 5AHKA 3GT0A 1BEEA 1XZAA 2F62A 2IEZA 2R68A 1Q1AA 2WI8A 3EXAA 3NFRA 3DGEC 3O1HB 4OEHA 1PQUA 3PQ7A 4MJXA 3THYB 2PX8A 2R6FA 4PZ9A 1VDMA 4AMBA 4LX0A 4AG6A 3MN1A 4FFDA 2WP8J 3LZDA 4NMHA 3RYHA 3SNKA 4WJLA 2B6HA 3ZWBA 4L75A 2HCFA 5EXDA 4BX0A 4Q7LA 3LKBA 1ZMRA 1L6RA 2CV1A 3U3RA 4L5JA 2VVTA 3BGWA 5AJTA 4KGZA 4NBUA 2G77B 3FD8A 1E2UA 5DM2A 4DBVO 4YHHB 3UGJA 3ABSB 1K66A 3MJTA 2WC1A 3TRIA 3W9YA 4OJYA 3HDGA 1IWOA 3CLVA 3PC8C 1RPTA 3LWNA 2C54A 5C7LO 3ZZ0A 4DJEC 3GV0A 3O8CA 2W2MA 4E11A 1C3VA 3AVPA 4WQMA 3PFBA 1BA3A 2XDQA 3E4DA 1DOHA 1Z4PX 4OJTA 2WZQA 4O8CA 2O2ZA 4Q4CA 3GLKA 5HCNA 4BB5A 2OHOA 3NGXA 4M7RA 4PLTA 2OZKA 4EH1A 2V4ZA 3P9PA 2VYCA 2BV3A 1TRKA 2OFOA 4PHGA 1VTKA 3I58A 3NEYA 4YAWA 2J0EA 3TH5A 2SICE 1BQEA 1E5VA 2VHYA 2YR0A 2GFQA 3EQ9A 5TQ2A 3G0IA 3IT0A 3QXGA 2GBCA 3M81A 4YRZA 2FHSA 3PHIA 3LYLA 4P3NA 1IBSA 1ULBA 2ATIA 3CA8A 3DUFB 3BSFA 4YGYA 3I61A 2ZWOA 2W5UA 3BCHA 1QAMA 4RKQA 1EGMB 1HTTA 1JE1A 5JO9A 3AUYA 4BV8A 1CVIA 5TIIA 2ZB2A 1JZQA 1SC1A 5JDIA 5JQWA 3DWIA 2BGIA 2I66A 1EBUA 5GIPE 1E61A 3BT7A 3DBRB 5H4HA 4CTOA 3ROXA 2VUUA 2DM6A 1VRVA 1AN0A 4JL6A 4KSCA 6GPBA 4DIBA 1BX3A 1U3FA 3G1WA 1UIRA 3K72B 1FDIA 1GL6A 2I3GA 2JIRA 2YFQA 3FBTA 4CF3A 1RYNA 3CZCA 1SBNE 1OLSA 3BXZA 4NJEA 2G40A 2SCUA 4B3CA 3UAWA 4Z99A 4CTKA 1YI0A 1AN9A 2CXSA 3C5VA 1E5LA 4CJXA 3NUGA 4M9RA 5LMCA 4QM7A 2NLOA 4XGIA 3IQWA 2ZB3A 3UJAA 3UN1A 1TKAA 1XA4A 3L6RA 2C59A 1MDBA 3LFHA 4CLDA 3GQBA 3S8YA 4AMZA 2Q3FA 2FNAA 3KUUA 1DMSA 1Z0AA 2NTJA 3TCKA 3PPWA 1LSSA 3X0DA 3LBFA 1WUIS 2K2QB 2QT1A 1E1CA 2Y27A 3DAYA 2RHHA 1W2GA 3DHVA 3IRVA 1SCAA 1ONOA 4KKVA 3KJIA 2F1HA 3H1EA 1C8LA 1P5JA 3T7KA 3ZHYA 1RWKA 3TE7A 1DHTA 4L02A 3TIVA 4ZDJA 5K5EA 5C8YA 2ECOA 3EH2A 3H5VA 5DIFA 1NKTA 3EG9A 4NYMR 1C1DB 2C77A 2ILTA 4H59A 2JEYA 3OUUA 4R2KA 4YECA 1GJRA 2J9RA 1QIFA 1R4NA 2EFGA 5CIQA 3C5HA 1LK7A 3W34A 1UBTS 1JI3A 3CWQA 5KNDH 5IP5A 5TPWA 1GT91 2FHPA 2ZEJA 2V5VA 2OCPA 3A31A 3TZBA 2ZIAA 1OGJA 2QY9A 3M4JA 4MQBA 5LQMA 4F5YA 1VIVA 5DGTA 2HRRA 1KU0A 4CQJA 1COWD 4YC7A 2WP0A 4YBZA 5BWNA 1NNUA 7AT1A 3CWZA 3DDZX 2FJUA 4R81A 1WHSB 5TEWA 4S0ZA 2D0IA 1OU0A 3E27A 2ZB8A 4G0QA 1GNSA 1CWUA 2W2TA 5LZ9A 3X1MA 1S6YA 1XO1A 1BMFD 3TNDA 4PG8A 5CJ2A 2RI1A 2KS6A 1XMJA 3R3SA 1CUUA 2GFIA 4CU5A 5KDOA 4EK9A 4Z3KA 4O29A 1AY0A 5AKGA 4YV1A 5FUXA 5J2TF 2A5YB 3X1JA 4Z6KA 1ZG3A 3VVCA 1JHRA 4HXGA 3KM0A 5COQA 3E9RA 3DEFA 4AICA 2CNOA 3T9AA 2BKLA 4JBGA 1RM3A 1VM6A 2DFPA 3LPMA 3EGDA 1WSAA 4V0LA 4C0WA 4ZI2A 2BM1A 3OCCA 2P9YA 4D44A 2BDTA 3TIFA 2Q49A 4BQNA 4QOFA 4CDRA 5M04A 3QX9A 3FNFA 3R9IA 1NZFA 1TVKB 2RDMA 3KSRA 5GONF 2PT7A 1IC6A 3BH6A 4OHZA 2WJ4A 3MJ4A 4DRXA 2R5FA 3CJQA 2LE0A 2HMAA 5EWJA 2QAGB 2WUEA 2ZWMA 4D8VA 2H1FA 3ITEA 3MINA 3ZCRA 2OTCA 4OHFA 3DLCA 1KEEA 2XQGA 2WF6A 3F4BA 3O8OB 3PL5A 4GSKA 4EHHA 5K0BA 3QFHA 2XKAA 5CDFA 3UANA 2XW6A 2A0KA 4Q05A 3GJQA 1DUVG 4R6XA 1EJ6A 5CUQA 5AWFC 2IH2A 3L7CA 1M34E 2AOXA 2OCLA 3AU9A 4H6VA 3EE6A 1XTJA 4OFWA 1OROA 4R9SA 2HCRA 4AZ3B 1SUEA 4JGIA 1DBVO 3TG8A 4LXHA 4O2AB 1O94A 3E70C 3TFQA 5FAKA 2PO5A 2GYVA 4J94A 1HORA 2BFBA 2X0EA 2OG1A 2PQ0A 3A04A 1YZQA 5EJGA 4CCWA 1WY7A 5H5JA 2A1TS 2GOYA 1TCVA 3N8GA 2PUEA 1CS0B 2XCQA 1QTQA 2OWDA 5CXSA 3FLEA 3Q3JB 4H7KA 3RRNA 2HNAA 3NUQA 2RHRA 3SKXA 4CFYA 1ARZA 4G1CA 5JSZB 2ZIFA 3EULA 4L6CA 5CRIA 2V6FA 2OP0A 3MXTA 1H8ED 3FOWA 3M9WA 3O1JC 3OZWA 2D1QA 4UE6A 1WHTA 2QQEA 3D8HA 3PRJA 2DTEA 4JA2A 5DWVA 3ECCA 4IBOA 2XQIA 3D9QX 2XRZA 4FDLA 3WA6A 4RTRA 1XTPA 2XB6A 1J5XA 2XUFA 5FOUA 2R0QC 1D2MA 1TFRA 5FDFA 3T4UA 1HETA 3MCWA 2VQ3A 3NBYC 5F2OA 4ZEVA 2C4TA 1B6GA 2BFEA 3PIIA 4S1WA 1KRXA 3NDRA 4XD2A 2B9VA 4G67A 4YTEA 2JFPA 3V6MA 1GTL1 1RT9A 2O7RA 3HWRA 2ONYA 1ZNWA 1RQRA 3IX7A 5FH9A 5I51A 3S81A 4WCDA 3S1AA 3VAAA 3KFVA 3C41J 1NMSA 3B60A 2IWHA 4ER7A 1GPDG 1LLDA 2A94A 3CO5A 3KKQA 2OBLA 4NBTA 1YQTA 3AZOA 5CD1A 3EPKA 1QF6A 4KDRA 3LW8A 1QDUA 1M1YE 3UK6A 5DNAA 4EO7A 3AVYA 4X24A 3W5UA 1YR1A 3LX4A 4E32A 1P4GA 3CXRA 2ZQ5A 2NAPA 4TLEA 2IS2A 4E7OA 2QX7A 1GILA 4GBED 2J41A 2NU8B 3EC2A 3LOPA 4QGGA 2A84A 4J0QA 3EHDA 2HLDD 2PZEA 4CG2A 4ZO4A 4S1OA 4CL3A 1T0UA 4F45A 1XMOB 2WZBA 1QFZA 5TT0A 3P9SA 5IBRA 3UQYS 5JJBA 4IZIA 4BX2A 1GOTA 4LQCA 1QLHA 5C9ZA 3M6IA 9ATCA 5IC4A 1CV2A 4X92A 3UJDA 4E0BA 4DG8A 1DZIA 3K4PA 2IU0A 5EE5B 1EQAA 2IYZA 3T3NA 1H66A 4K3VA 3RHSA 3KWMA 3A0RB 3NCHA 3N2NA 2O52A 1EDOA 1W9MA 5KU1A 1WMBA 3AFOA 1TX4B 5LBIA 4C0LA 4G41A 4UBOA 1CDZA 1KC1A 1PJSA 4FGWA 3FMOB 1SOWA 3UAVA 3NC4A 4O63O 1A7JA 3QITA 1T26A 1EP2B 2F3QA 1NBEA 1CJBA 4C4SA 1MJHA 2W6JD 3HKDA 4BMVA 1V1MB 1WXQA 1B2RA 2OGSA 2QRQA 3JASA 3M5WA 1AGPA 4Y1RA 2PKYX 3DVQX 3GNQA 2WJPA 1SKYB 1O6FA 1NP6A 4YLGA 2V6GA 3H3XA 4G8CA 4C78A 1GP2A 3GCDA 4ZYUA 1I5OA 5EIBD 2OZPA 3PHGA 5JLAA 5BN4B 1DEXA 4NFSA 4V0OA 1YS1X 3BWYA 2YKGA 3K8OE 2XDWA 4TL9A 4EA9A 3H75A 3ZHZA 1PLJA 3I45A 1HQKA 2YY6A 2JHFA 3FHJA 3VPCA 2JCBA 3ZLTA 2YRXA 1X13A 2FN8A 5IH7A 3V4LA 1E20A 1DAPA 2WDZA 2BFCA 3FPJA 3A3OA 1U3DA 1D0SA 4Y8VA 4EF6A 2HYIC 4NJMA 1AOXA 2JLBA 5SYMA 1S2LA 1RYZA 4HQNA 1N2EA 2P6MA 3JTEA 4YK7A 4P81A 3SG0A 2YBEA 3O8RA 4NYIR 3VU9A 5DSXA 1F38A 2DPYA 4XEUA 1ZN7A 2PLRA 3Q2KA 4IX9A 5A2GA 2FXIA 5A3JA 5EIWA 1OOEA 3EEBA 5TMBA 2BFNA 3E5RA 3K0AA 3EDMA 3U7QA 3UJBA 4DR2B 2ZCJA 2FCRA 1LCIA 5C4MA 5AO9A 1OWOA 2FZ4A 1ZGGA 3P32A 5FJJA 2W58A 4M1MA 1JIJA 4YRKA 2ERXA 3OAAD 3LOQA 4YMIA 4A92A 1UOOA 4F72A 1W8IA 4D8TA 3R6GA 2BUBA 5HE9A 3ZHOA 2PFSA 3ZV5A 4EI9A 1JDJA 4MR8B 3W6NA 4BQQA 2ZYDA 4PZLA 4CQMA 1PRYA 2P7HA 1IXSB 4YH1A 4BWVA 5BURA 3FOEC 3QY0A 3AKYA 2OFFA 1T2FA 4KP7A 3C4JA 5KVCA 1I4OA 2C4MA 4RULA 2ZRKA 1PR4A 1YFKA 2R4TA 2WWVD 3C15C 1YS7A 3L7JA 1V16B 3LX5A 4HF7A 4IIVA 4KEAA 2RONA 4MR7B 4WA7A 5F2EA 3A0UA 3VJMA 3JYNA 4ARZB 2D54A 2R62A 1EYZA 1N6KA 3C3DA 3CLUC 3K1AA 2HCBA 4TX1A 4C6RA 2QZPA 4C89A 3DOHA 5HKKA 1YVPA 1I4DD 3HZHA 3GRZA 5IHXA 1U31A 4OHKA 5L3SA 1R6BX 3EMVA 4GGOA 5JISA 1NKVA 1T15A 2I71A 4IIGA 4A15A 3T6KA 3HE3A 4DMKA 1S1CA 5JNLA 3TBKA 1NC3A 2BZ1A 4NNPA 4C0SA 4CMHA 3AZPA 5CIYA 3Q0TA 4I9HA 3IPAA 2CFOA 5AW9A 1WKCA 1NLZA 3U1VA 5KYUA 3SY8A 1L5WA 3K94A 2NU9A 3LCRA 4FFSA 3WB0A 1GTZA 5KHOC 1GUAA 1L7NA 1YC5A 3RUCA 3EPJA 1TZJA 2SKEA 4YV7A 4NCNA 3GDHA 4ZHSA 5IZ4A 5C31A 4Q1BA 4HUQA 3RS3A 3H13A 5LQKA 2GGSA 4FOSA 3GLGB 3L82B 3FDXA 1G5PA 3D2AA 5ICMA 2F48A 4JI2B 2F9MA 1OJ7A 4J49A 3IUEA 4B48A 2ACWA 4J0FA 1M2OA 3RVKA 3DZJA 3BCSA 1I33A 5IYZA 4FFMA 3FVVA