3RRZA

H-ras in 70% glycerol: one of 10 in mscs set
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
165
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYEQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrzA00
2DPXA 3NDBB 3I1FA 1GIAA 3KKNA 4PC3A 4G5OA 2QGNA 2XX3A 1RW4A 3A1UA 5JSZB 3SR0A 4DKXA 4P4UA 2VBCA 3T12A 1KI8A 4C0BA 1G21E 2CL0X 1Z6AA 4C0KA 1U0JA 5FI0B 3SQWA 1Q3TA 3CLVA 2IYWA 2W00A 3ZZTA 1ZBDA 3KKMA 2R2AA 2AXPA 3KJGA 2ZS8A 2NMVA 1TF5A 2WWHA 1EFRD 3ZH9B 2GKSA 3A6PC 3A1WA 4B2PA 2VF7A 4IVPA 3B6EA 3ZZ0A 2ZJZA 4BFSA 3THXB 4LBVA 3X1WA 2O0HA 4ASUD 4CVNA 2GILA 3IQXA 3THWB 1OT3A 4WVFA 1NIJA 1E2FA 1XZQA 2E9SA 4KBFA 3DOFA 3ZVRA 1DAFA 5EP2A 3WP1B 1H8EA 4PAOA 1UBCA 5AJVB 1G3UA 4K8OA 4WA7A 1C1YA 1CTQA 2WOJA 4URVR 2ZSDA 3IPYA 4GFDA 1KO7A 2PJZA 2X2EA 3HU1A 1UEJA 821PA 1KHTA 2AN9A 3REGA 1GTVA 1NJFA 1J70A 3PUXA 3T1TA 3MJHA 3CPEA 1SVMA 2L0XA 3VTKA 2WKPA 4KFRA 3P4XA 1KY2A 2OBNA 3GLHB 1N5JA 2VHCA 3RS2A 3OEHA 1GKUB 4EPWA 1TTTA 2BKUA 3HDTA 1A1VA 4OHZA 1DO2A 1ZAKA 2MMGA 2P2LA 2GAAA 5FUVA 1M34E 2DFLA 3M1IA 1VG1A 2FMXA 2WJVA 4UXIA 1OIWA 4IDHA 2O52A 4D80A 5CYOA 3K8YA 5JS7A 3ZVMA 3Q85A 4KFUA 1IY2A 2H8KA 1HQYE 5J40A 4DIEA 1PVOA 4IOKA 4AWXA 4HATA 1WBBA 2D62A 3K0FA 4IOMA 4RFVA 4ESVA 4IDOA 1RYFA 1E2DA 3THWA 3NHBA 4BGDA 5DYGA 2CVHA 1OYWA 3GD7A 4JIMA 2RGBA 4R98A 3DDCA 4JLBA 4OKSA 2GF9A 5CIQA 1ZUIA 5DI3B 4YQFA 3FPAA 2J7PA 1TU3A 3RRYA 3KTAA 3BFXA 2KSQA 4W7SA 3VR5A 1ESMA 4Q4HB 1IOZA 2VEDA 1G291 4LZZA 5GVSA 1BIFA 1AM4D 1NRJB 3B9QA 4R7ZA 2YKGA 5DHAA 3OEHD 4N0EA 3VQTA 5FFMA 5UKDA 1Z0DA 4HUTA 4IDPA 3U61B 3N2EA 4AK9A 1R0YA 1JEEA 1ZMXA 1I2MA 2WWGA 3KJIA 3QVVA 4Q21A 3RSOA 4EQ6A 1HY3A 1N5KA 3C14C 3LBNA 4CEIB 2YV5A 1MT0A 1OW3B 4RD0A 4Q9LA 2YWGA 1ZNWA 2V9PA 2B8TA 2VO1A 1FQKA 2J5XA 2Q9AA 2Z83A 3TBKA 2REXB 2OAQ1 2FNAA 3TRFA 1II8A 2P65A 2ZVQX 3C41J 5DYIA 4OK3A 4C0HA 4HDQB 4P31A 1KO8A 3UMSA 4M4SA 4CIDA 4AIIA 4I1UA 2WTUA 4A0RA 2A5GA 3MCAA 2QM8A 1NNEA 5EXTA 1KI3A 5FTMA 3QF4B 5KDOA 3WMFA 1ZNYA 3QF7A 1QHNA 2G0TA 221PA 4BZXA 1ZU5A 1IBRA 4AKIA 2GCNA 1E2GA 2VPPA 1Q44A 1KZGB 1E0SA 2IWRA 1GOTA 1S0UA 5AWFC 3V00A 4B71A 2QENA 3K70B 1Y63A 4XTCS 1EGAA 3ADCA 1Z5ZA 2ZM5A 5TB5A 2FZ4A 1AGRA 4W9MC 4ZCLA 3WMEA 1E98A 2IX3A 1OFHA 1VYVA 2IBMA 2PLRA 3ADDA 3KJHA 1JBKA 2NIPA 2X2FA 4BLPA 3QXSA 2F55A 4DLYA 1OE0A 1XCPA 1CXZA 3VNUA 4XWAA 1HUQA 3THYB 2V1UA 3DPUA 2BOVA 2GJ9A 1K5GA 2WPDA 2ZRAA 3AGQA 1JQJC 2BDTA 4IEEA 3U6BA 1NMXA 2HUPA 1DAKA 2ZRBA 3SOPA 4BLTA 3BFKA 4EUNA 5KPDA 1KI2A 3T06B 1E2MA 1ZJ6A 4V03A 2OESA 1FUUA 2OCYC 4NYMR 2ATVA 4O3MA 1HTWA 3B82A 1R6BX 3RDPA 3NC0C 1EXMA 3GFPA 4RSGA 4PPQA 1QHHA 2OXCA 2ZUDA 3ZS8A 2IYQA 2R6CA 3FHCB 2ECKA 4ARZA 1KSFX 1A4RA 1ZUNB 4JBWA 4Q4LA 1OJLA 3WNDA 3CRVA 1PZNA 2FG5A 2JJ8A 1E32A 2FDCA 1IQPA 2C8VA 5L8VA 4M0LA 2BHRA 1F5NA 4A2WA 4LC0A 3CF6R 2NO7A 2H92A 4FD2A 2PH1A 1BS1A 3ZD6A 4BPBA 2BMDA 4HZUB 3X1XA 2XEXA 5HPYB 1G8FA 4JLAA 1Z0IA 1E2JA 3K9LA 2XSZA 2IYLD 3JZMA 2W0SA 2OAP1 2WPDD 3IO5A 3U44B 3DM9B 3CR7A 3GEIA 4ZCMA 5AUOB 1IN7A 1KSGA 2NO1A 2HF8A 1W4AA 1XMJA 1XZPA 5K8UA 4A6PA 1U9IC 4BZQA 4MRPA 2CL7X 5LPNA 4Q19A 4TSFA 4A36A 4RD3A 5KNDA 3SFVA 3PG5A 4CEJA 2ZS9A 2B7BA 5JI2E 3MJRA 3BH0A 1DAIA 1MABA 1R5NA 3RVBA 5CJPA 2GDJA 1JNYA 1CR2A 3I92A 2ORVA 1BKDR 1Z6YA 3MD0A 5FUXA 5FTNA 3U3JA 3C7KA 1W46A 3QQ5A 1JALA 1N6NA 1P2VA 2J3EA 3BC1A 1SHKA 4D81A 3L0OA 1E4YA 2W58A 3AF2A 1W4CA 1DTSA 2R6GA 3W5JA 3LW8A 1UKZA 2RH5A 3FMIA 3DKPA 3GJ4A 3SNHA 3KQUA 3I32A 3I4LA 2XSZD 3EZFA 2ODEA 2DWQA 1EFHA 1VG8A 3E2IA 1HYQA 1VYUA 3EARA 2DYKA 2OBMA 1A2BA 1L7VC 4HLDA 4PSAA 4LRWA 1KMQA 3LLUA 4LV8B 4TSFD 2BM1A 2RHMA 4JKYA 1E2NA 1TF2A 5G3ZA 2IS2A 3ND9A 3CPHA 3TR5A 2PZEA 4RZXA 4IXMA 1XBTA 1XRJA 1W2GA 4B75A 4HZIA 4NYIR 2GZAA 4F92B 2HXYA 4XSGA 4EJSC 4C0JA 3A1SA 1E0AA 4MKFA 1XB2A 1NSFA 3FMOB 2ZRFA 5CDFA 2MSDB 3CWZA 4Q7JB 5SZKB 1RZ3A 2YC2C 2ZI5A 4TL6A 3KQLA 2FF7A 4LV6A 3V4RA 3EXAA 1P3JA 4GBMA 4NCNA 3WHLA 1SULA 1VG9B 4B6FA 1WB9A 5F9FA 2IS6A 1T3HA 2O8BB 3Q72A 4DLZA 2P5SA 1IXZA 1FP6A 4MYCA 2ORIA 1DAEA 2JIZA 1II9A 3SYLA 3PXGA 1XPUA 1E2KA 3GEEA 3GLFE 3U5ZB 1Z47A 4HSEA 1X1SA 3EZ2A 4WZAE 3GP8A 4LGMA 4D4MA 5D3MA 3VKWA 3EPLA 5BN4A 2GCOA 3FKQA 3LBHA 4UJ3A 2ZSEA 2O8FB 4PPGA 3DHWC 1LB1B 3B7GA 3UXMA 3VR4A 4ZO4A 3VAAA 3E70C 5DIFA 4ZDIA 2FPLA 3LVRE 1DBSA 5F2EA 1SVIA 3LX5A 5E4FA 3X1YA 2GK6A 2X8AA 1GKYA 3QKSB 5FPKA 1MO3A 3QKRB 4UNNA 1L4UA 3CUEF 4RD4A 4LJ9A 1B23P 3PQCA 2N42A 1JPNA 3L8ZA 2I3BA 1ZC3A 2AKYA 3BH6A 4BLSA 4DCTA 2NGRA 1KO5A 3OE7A 1HT1E 1X8LA 3FKSA 3PENA 2CHQA 3AF0A 3CRW1 3LQQA 1US8B 1YZGA 1ZW6A 2IYVA 3CNOA 4KSCA 2HYIC 2P0EA 4KBGA 1VPLA 3SJBA 3W6OA 4RKFA 4C0LA 2JIZD 1KMHA 1S9HA 2AWNA 5CYPA 5HTKA 1I2DA 2EFHB 5KSOA 1CRPA 2ZQ5A 2BWJA 4C0SA 4TL9A 1SVWA 4DCUA 4LPKA 4MDEA 1XFAA 1VYTA 2IS1A 3R9IA 2ZI4A 2QT1A 3GLGB 2WWIA 1SVLA 1AS2A 2F1RA 4Q47A 3C15C 1RC8A 4YC7A 1SXJA 3K9HA 3QOFA 4TN1A 2OLKA 3SBEA 1Q57A 1COWA 5HCNA 3TLXA 3GJ7A 4HI0E 2CE7A 2IUUA 5ELXA 2A5JA 3K70C 3U4QB 4QHSA 4NKRA 3D3QA 3P1JA 5EE9A 1TU4A 1J8YF 2QMOA 3I61A 3OE7D 4LDJA 3RANA 3G82C 4MGYR 1FFHA 4P33A 1AIPA 4C9BA 2ZRLA 1XPRA 1LF5A 2CLCX 1IY0A 4OL0A 2GZDA 1M6NA 2GXSA 4KVAA 3VHLB 1OXSC 1DPFA 4RVCA 5J4KA 3KX2A 4DSNA 1NJGA 2ZANA 5FI1B 1KI6B 2VHUA 3DZ8A 3EZ9A 3EIEA 2Z4RA 2QBYA 1T0HB 1KNQA 1NN5A 3Q5EA 4Q1FA 4DJTA 1ZD8A 1W36B 4DLUA 4PQYA 4DVGA 1HH4A 2ZU0C 1RIFA 2JJ1A 4ZCIA 1R5OA 2WWXA 1GDDA 1SXJD 5LB4A 2X1VA 1VIYA 2NO0A 1S3SA 1XP8A 5CB8A 1W0JA 3L0SA 2Q3MA 2XTMA 1COWD 4NYJQ 4W5HA 2F3TA 1KSHA 4IOLA 1LFDB 1L8QA 4LYHA 4R2HA 4DCNA 1Z0KA 4Q18A 4YLGA 1KO1A 2OCAA 3LNCA 2VSFA 4A8JB 3UKDA 4CT4B 4DLVA 1EFTA 1XTJA 1GWNA 3GLFA 3U4QA 3HPQA 1F2TA 2EFCB 4Q7MB 3RS4A 4M1KA 4Q1BA 4D4JA 2NOAA 3B8HA 3BS4A 4DWJA 3B1YA 1D2MA 3B1WA 3NXSA 3ZQJA 2HLDA 4DLXA 4NONA 2ZS7A 4C0AC 5DGXA 3TW8B 1K5DA 3J81k 2JGNA 2AFIE 3K09C 2J46A 1EESA 5JBQA 1OXTA 4LJAA 2ZRJA 3T15A 3WMGA 2FPMA 4RZUA 4FI3C 2OT3B 4RCZA 5G40A 4LJ6A 3C5HA 5CM9C 3KKQA 1OFTA 1IM2A 1KI6A 2AX4A 2ZRHA 1T5IA 2JJ1D 3SFZA 4EPYA 1CR1A 4B3GA 4PHHA 2W2XA 2G1KA 2QSZA 5FBVB 4II7A 1QVAA 3KQKA 1OV4A 2KE5A 1W0JD 2FPKA 2XZLA 2ZETA 2QA5A 1XPOA 2EW1A 1W4RA 5CIWA 5FTLA 2BBTA 5KHOC 1AKEA 4MKGA 5BWMA 3U2QA 5JCPA 5G53C 1ETUA 1G41A 4L15A 2ZRNA 4IDQA 3KXLA 3TW4A 1CULC 3A1VA 3DMNA 4U00A 2Y8EA 4TLEA 2D06A 1CRQA 3VU9A 5EUQB 5L3SB 3NEJA 2IK8A 2QAGC 3WHKA 5DNYB 3T1VA 1S96A 1JR6A 3QXCA 5KOYA 2HLDD 5AJXA 1OYYA 2YVUA 3TSWA 1A82A 4BZPA 2B92A 3PUVA 3L8YA 2ZAOA 3CZPA 3HR7A 3CF2A 4GOKA 3RABA 4TYQA 1D8TA 1E69A 4FMDB 5EJEA 4NCHA 1DELA 1OFUX 4FW9A 3BAFA 1C4OA 2SHKA 3L43A 3IBGA 3IUYA 2VP9A 4F7WA 4QG7A 1SVSA 1AGPA 2JATA 1MKYA 4POAA 4F4IA 1NLFA 1IAQA 2IYUA 1UBGA 4MRRA 4TMVA 3RLFA 3TR0A 2FFAA 3EPJA 2C95A 3AF3A 3AVTA 3RYTC 2C78A 2XJ9A 1B0UA 5EZ5A 5TMPA 5DH9A 4F4JA 5L3VA 4Q4JA 4ABYA 3CF0A 4N3NA 2V8OA 4B35A 3ZDQA 2GCPA 2WJHA 1XMSA 2FE4A 3IHLA 5FBWB 2JDIA 2ZE5A 3ZZUA 4D4KA 1UJ2A 5E7MA 4PC1A 4TYWA 1CJUC 2R9VA 4QGFA 2GESA 3ND8A 4QNMA 4JLDA 4Q1CA 3RC8A 1D5CA 2ODNA 3CIOA 2UZIR 5C4MA 5L3SA 1E2LA 3R8CA 2NQ2C 4GL2A 3RSLA 1D2EA 1KSJA 1CU1A 4BECA 3IEVA 3EG5A 4QM7A 1T9HA 5FR2A 4A0FA 1W47A 2X19A 1TMKA 4D6PA 4WW0A 4A9AA 1FOEB 2QTHA 3AUYA 3EIQA 4V02A 1QHGA 4CDGA 1AS0A 3EWSA 1WMSA 4MUBA 1YZQA 4RD2A 1OH5A 3BOSA 3PJRA 3K0SA 4PQFA 3HJNA 4A2QA 4Q5IA 2XNDA 4FCVA 1DO0A 1YR7A 5BXQC 1G8PA 4UNSA 2P6RA 3BD9A 2IXGA 1SKQA 1ODFA 1Z07A 2ZE7A 2VH5R 1S1MA 1E1QA 3H1TA 3QUSA 2OCPA 3WXMA 2C9CA 3QKUA 4X8HA 3WYAA 1HE1C 1KKLA 2JDID 1FX0A 1HURA 1HA3A 2A7QA 4M1YA 1E9AA 1N6RA 4IXNA 4AY2A 1P2TA 2AD5A 1N2CE 2PMKA 2ZXUA 1TQ4A 3P27A 4JLVA 4ZDJA 4G1UC 2D74A 1SVOA 3TAUA 2OE2A 4FN5A 3M4YA 3FHTA 3QPWA 1Z6XA 5HE9A 3H2YA 2ZU6A 3PV0A 3PVSA 4Q1AA 4BLOA 5H68A 3NBZC 3TAHA 3X2SA 1X8JA 2IYTA 1GRQA 2VA8A 2WVJA 1TNDA 2F1HA 1BH2A 4OQNA 5DHFA 3WRXC 4FMDF 1OH7A 4LOAA 3W8RA 1UBEA 4ON9A 2QRNA 2FA9A 1G7CA 1ZVQA 1YRBA 2GJ8A 4K46A 2A3RA 1YZLA 4DCSA 1WDTA 1G3IA 4QHYA 5AJWA 4MKHA 1G5TA 4FMBB 4LHVA 2XNDD 2QORA 3TSOA 5AR1A 4JKIA 5GJWC 1L4YA 3KB1A 2JEOA 1E1QD 1DG3A 2VHQA 4JVNA 4QGAA 4HLCA 1JR3E 5FOVA 2IYSA 4LY6A 2AK2A 3C5CA 2IXEA 1GKIA 2Q21A 2YOFA 4TLAA 5JHHB 1X86B 1EWQA 3IIMA 2CE2X 1GZSA 3K0FB 3RS7A 4LYJA 2PEYA 4DIDA 3MFYA 2GBLC 1TQ2A 2XAUA 3HPRA 5B64A 2XXAA 2CL6X 4JLKA 1Z3IX 3EW9A 1GP2A 1N0UA 2PT5A 4NBSA 4EPTA 4L16A 1T6NA 1YZTA 5JWHA 3PUYA 4PXAA 1AQUA 1G6HA 1OFIA 3KTAB 2FN4A 4Q1EA 3AV0B 3I72A 2WOOA 4S35A 4URYR 4B3CA 5E3HA 3PEYA 4XTRA 5AUPB 2VHJA 3CR8A 2A2ZA 2OSBA 3AKCA 2VP5A 2Z5FA 3B85A 4OHVA 4PPNA 3IHWA 3TMKA 3AKEA 2HCJB 1Q20A 1VCOA 2BIFA 1XX6A 2PZFA 3N5CA 1WE2A 4LSGA 3C8UA 3WYFA 4EFLA 1NF3A 3TH5A 3V4FA 4EQ6B 1E0KA 2O0JA 1R8SA 2PCJA 3SE0A 4TTRA 3EASA 5L3QB 4AYWA 1R4AA 2ZIAA 4A8JC 5KSYA 4OI2A 5CLQA 1U99A 4E07A 2EWWA 3O8CA 2ZRKA 1CF4A 4HAVA 4DUGA 2FX3A 5IK2A 2ERYA 4JJZA 3GQBA 2G88A 3HR8A 4XIGS 2W0MA 3A4LA 4DDVA 3TUZC 1NVUQ 1U9IA 2ZJ2A 3QKTA 2H57A 2W83A 1U2RA 4ZV4A 2ORWA 3WBJA 4B6EA 1II8B 1IJFA 2W2VA 1ZC4A 1YKSA 1M7BA 1GRNA 1Q1BA 1QBKC 1Z2CA 3CWQA 3LQRA 2Q6TA 1JXOA 1XF9A 4BFUA 1MH1A 1ZIOA 2CNWA 4GMDA 3TK1A 1H8HA 1TQ6A 4BFXA 3GJ3A 4UNRA 5JI3E 1I4DD 1G3QA 2KB0A 5FPYA 5E7JA 1G5RA 3BB3A 2GVDC 1CBUA 1KDTA 2CHVA 4TL7A 3EZ7A 1ZYUA 4DLWA 1YVDA 2GJSA 2BBSA 3QENA 3QEOA 5DN6A 3EX7C 4F93B 1XTIA 4X8OA 3G0HA 2QROA 1NI3A 3A4NA 4R2IA 3FB4A 4DUGD 4DEYA 5IK2D 3LO5A 5L3QA 4MITA 1YZNA 4P4SA 1XJ0A 5K8LA 1KTVA 4ZDKA 3FHOA 2JCSA 5AUNB 5LD2B 2J0VA 4C2TA 1Z2AA 2NO9A 4W5JA 1TAGA 1BOFA 4G3XA 4KYUA 3GFOA 1CKEA 2J59A 5FOUA 3B1ZA 4HYYA 4DB2A 1DAGA 2Q9CA 4JVSB 2O8DA 4RZ3A 4LI0A 2CNWD 3MUFA 1MO6A 1QHHB 1H8HD 4BEJA 4F38A 3AEZA 1J2JA 1RJ9A 2G3YA 4HEJA 5DE3A 4IFBA 2G9NA 3EA5A 4EJSA 2XOKA 3K9NA 4ARZB 4TYNA 1N3BA 4QJ5A 1JJVA 1JR3A 1W5TA 4NYJR 4DEXA 2D2EA 1ZU4A 4JYCA 5BN5A 2BC9A 3LAWA 2GJKA 2UVQA 2YWFA 1EK0A 1WQ1R 4FWIB 3GJ6A 2Q3HA 3AVXA 5DN6D 2WM9B 5TARA 1TL7C 3NBYC 2ZRPA 1Q1ZA 2FH5B 5TV2A 4L8GA 2F43A 2ZI6A 3MG9A 1TEXA 1AJEA 1Z08A 1KIMA 1UBFA 2QUZA 2QMHA 5CDFE 4QXAA 2RGNC 2WZQA 5K8IA 3A1TA 5IF9A 4MQBA 5A5GA 2WICA 2DR3A 6Q21A 5KPJA 1U98A 4CEJB 1JEDA 3BORA 1OB5A 4V0NA 3D6TB 1OB2A 1QHXA 1MABB 2W2TA 5JECA 4HAWA 1LY1A 1FPMA 4JJKA 5AK0A 4B3BA 2C77A 4Z1MA 2XOKD 5C4GB 4PSKA 1G1MA 5EE0A 1FNMA 1JR3D 1G9XA 2IF2A 1MOZA 4LJ5A 1ZD1A 2QI9C 2REOA 3H0KA 4D4LA 1GNRA 1GL7A 2GEDA 3BRWD 1GILA 2JAQA 4LX0A 2O8CA 1RYHA 2ZRDA 3QG5A 3BIFA 2OBLA 2CCJA 4O2RA 4FWTA 1IN5A 1Z83A 3BGWA 1Q12A 1UEIA 2O0KA 5LB2A 3I62A 1X6VA 1YE8A 3LFUA 1PUIA 4ZPXA 4PTLA 4V0KA 2DCUA 4MRSA 3O8BA 2A5YB 4CEHA 1Q1EA 3S1AB 4M1SA 5LDDC 2ZJ8A 2YNMA 3SBDA 1U81A 1Z22A 3AB3A 5CK4A 5KO2A 2WAXA 3U7EB 3JVUA 4AI6A 3P32A 3U7FB 4UKDA 4IVQA 4NHOA 4DT1A 1ZIPA 4BUJA 1KK1A 4BRUA 1WRBA 2OM2A 4Q7KA 3PIRA 1W44A 3ZIAA 1QRAA 3BBPA 2ASEA 4S2EA 3U6KA 5F98A 5C46F 1NMYA 4NCIA 3W6PA 3P20A 2BCJQ 5DISB 5LBIA 2OFXA 4Z1MD 4NTZA 4CT5A 4M1WA 5J4YA 3BERA 1T8TA 4LCBA 5EQTA 2ZRMA 1G7TA 3QG1A 3X1ZA 3O8RA 3KL4A 3TUJC 3PITA 3A36A 4B48A 1NG1A 4JL5A 1NSTA 4Y0VA 3UWOA 4L5BA 1SXJE 3KKPA 1NN0A 2ZREA 1IY1A 3A37A 3U3MA 1CEEA 1HE8B 1KI1A 4LYFA 1W49A 3K0AA 3BB1A 3LA6A 3OIWA 1I4TD 5HZKA 5EXPA 3FVQA 3SEAA 5D3MB 3AF4A 5G3YA 4A0GA 3U7HB 2AXNA 2GCOB 3LXRA 2V4ZA 2NTYC 4Q00A 3S1AA 3AUXA 2FZLA 1G4UR 2B21A 4JVMA 5KTYA 1G64A 1CLUA 5JEEA 1R0XA 3ZIAD 2F9MA 4PC2A 2QY9A 2C2HA 1LW7A 2DHRA 1XD9A 2I1VB 4DDTA 4OHXA 2AK3A 1W4BA 2FSGA 1AS3A 1KI4A 2ZUCA 1AK2A 3E5HA 4FXPA 3U3KA 4CZ2A 4QJ3A 2ZVPX 5KUTA 4A6XA 2ZYWX 1G7SA 2FFBA 1Z0AA 3AVUA 2EYUA 4D82A 3VR1A 4NDZA 1VCIA 2NO6A 4OQXA 4U02A 4DLSA 1R8QA 1U0LA 5DO9A 5CB6A 4GZMA 1G5PA 2DWPA 2ZRGA 3B13B 4Q9KA 2PT7A 3L82B 3WRYC 1MRSA 3RRZA 2CXXA 1KMHB 5AJYA 3QEJA 4HAXA 1UDXA 4UXHA 3AKDA 1UM8A 2ZE6A 3LW7A 2Z0MA 2WWYA 3SYNA 3MLEA 1QHYA 2ZR9A 4DDWA 1T5LA 3AP2A 3VNVA 2MSEB 2PMDA 2WIBA 3NIBA 4PO1A 3ZJYA 1W2HA 2AWOA 2IW3A 2HT6A 1EFCA 2CEAA 4KJZA 2REBA 4TYPA 3W6NA 2AD1A 1OF1A 4HAZA 2Q0HA 4NP6A 1SXJB 4PHGA 2OG2A 3Q7QA 2WIAA 2HV8A 1NVXQ 1HV8A 3GJ0A 4OYHA 4KVGA 2G6BA 2EVWX 1XEFA 5FL7A 3EA0A 3FYHA 2QM7A 3IPXA 4B3DA 2HJVA 2ZJ5A 3AP1A 4AKHA 2QG6A 3AVWA 3VMFA 3FGNA 2ERXA 2J0SA 1K8RA 2YC4C 4AG6A 4FMCB 4DDUA 2QAGA 4QM6A 1G17A 4DXAA 4XJXA 1VCMA 5EE5B 5TY0A 1Z6GA 3CX8A 3OHMA 4L9WA 1N0VC 2DB3A 4IVRA 1DG1G 2XTZA 1GITA 5J4LA 2I4IA 2OZEA 3LBIA 3EPHA 4PSVA 1E0JA 2NG1A 1G8HA 1KI9A 1VIAA 3I3SR 2Z43A 3OESA 2ZPTX 3SZRA 3DKVA 3SN6A 3VFDA 2XITA 4PZLA 3WYGA 2QBYB 1KAGA 2ODWA 4BLQA 2IL1A 4B32A 4MGIR 2RGEA 5EZ6B 1UAAA 4DBLC 4ZIRA 3QVUA 2YWHA 3BB4A 3TE6A 4HLQB 3SYKA 2GRJA 3LLMA 1ZP6A 3GCGA 2LKDA 4OQMA 1HQCA 1UFQA 1NN1A 3OZXA 4Q03A 3T35A 3HYRA 4V0OA 4C2UA 3OIYA 1YR8A 3AF1A 5FL7D 2EFGA 2ZR7A 2VHTA 4ZKDA 1BYIA 4B74A 3G5UA 1RKBA 3QSYA 1F2UA 3CX7A 3ZGXA 2ANBA 3NBXX 1OPXA 1V43A 1A5TA 3UMRA 3GLFB 4DSTA 5KNCA 1F2TB 1FL9A 4LBZA 2H16A 2RGDA 5HCIA 1U90A 1D2NA 2QNRA 1QG4A 2RGAA 3K0EA 3NTUA 4PAQA 4LJ4A 2JJ2D 4JLPA 3NC1C 2HXSA 4HDCA 2KBFA 1MR3F 4MA4A 3H4MA 1JQLB 3IKJA 5JMTA 4B47A 2OLJA 1XTKA 5K8TA 4C7OA 2WMOB 2CLSA 4D26A 3CM0A 4PHFA 2HT1A 2QP9X 2RB4A 1E79A 3P4YA 2VL7A 2K5UA 1RRFA 1XD2A 1JB1A 2WKQA 4DSUA 1IONA 1NL3A 5FOSA 4DC9A 3EZ6A 1XXHE 2OFOA 1AA9A 1KJZA 2XZPA 3LWNA 4EDHA 4KV9A 4B3XA 3CH5A 1WA5A 1R0WA 4LV5B 4TMXA 4TQUS 3IDQA 1N5IA 4B3FX 4OJQA 3UK6A 2R44A 3AVOA 4FCTA 2GK7A 3CKLA 1LTQA 2RGGA 4PFSA 1GRRA 1U8ZA 4CGZA 2QEQA 3CZQA 1F48A 1KGDA 3CONA 4GNKA 3LD9A 1NG9A 4G5GA 4PO8A 1NY6A 3VU9B 4FMCF 2LWIA 3W3AA 1CR0A 4GP6A 4D0NA 2QQ0A 1ZM3A 4ESHA 5JWOA 4PZZA 1AZSC 2QU8A 2WHXA 5GJVC 1UKVY 1W1WA 3D8BA 2PJRA 2J1LA 4M1OA 1GNPA 2VP6A 3A58B 4QBGB 3LRPA 2QGZA 2DBYA 3ZVNA 1WBDA 1U0HC 1Y3AA 3CNNA 4B43A 1BO6A 1E79D 1BYUA 2D7CA 4LHWA 4R9UC 1AQYA 4XD7A 1FMLA 2R6FA 4L4UA 2GF0A 4Z8XA 2G1JA 3R20A 2F9LA 3NWJA 2GHIA 2BEKA 4OBEA 2HDNB 1M2OB 2V6IA 2W6ID 4QBIA 4C4PA 2R6AA 3B1XA 5FPSA 1KK2A 1PUJA 2V6JA 3BXZA 5JFGA 2JLVA 3JVVA 2VYFA 1ONBA 4A4DA 4KFTA 1J90A 4Q4JB 4HLUC 4M1TA 3R9WA 1AZTA 3IEUA 2QZ4A 4NZYA 4B34A 3RS5A 4PQRA 1XWIA 4TT3A 2OFWA 1SZPA 4JSTA 4JSYA 4HB0A 1DADA 2GBLA 2ZROA 1T8UA 2V55B 2V7QA 1T0JB 3CW2A 3WY9A 1OXXK 4I1VA 4MYTA 1KDPA 5FOWA 2BJWA 3TIFA 5JS8A 1HEIA 2OCBA 1UKEA 3DZDA 5DLQC 1ZINA 4QOSA 4PANA 3ZVLA 1G4AE 3CRRA 1OSNA 4OJKA 2RAPA 1F3OA 1FMJA 3NDPA 3AKYA 1KJWA 3QJYA 4XVQA 4Q9JA 1CS4C 1CP2A 2Z4SA 3W5IA 2F1JA 1NN3A 4YMWA 3PR1A 1E9EA 4XD7D 3KFVA 4TLCA 5EE1A 1G8GA 3NH9A 4IJMA 2WJJA 2CK3A 3SHWA 1RFLA 1XJCA 2CMKA 2WV9A 3UG6A 4H1UA 4KYIB 2GXAA 2DY1A 2XJ4A 1N6OA 3BJIC 3LDAA 3LH5A 2A9KA 1TUIA 2BKEA 1IN4A 2BBOA 4B44A 4MDFA 4CYMA 1J99A 5DSZA 3TVTA 1TPZA 4NL4H 3LVQE 1N6LA 1T3LA 3QXJA 3A4MA 4PPFA 2GAOA 5C2JB 3TGPA 1SGWA 1FX0B 4IW3B 4LPSA 4TT3D 1T91A 4R71A 3ICEA 1G3RA 4XOIA 4RFSB 2V7QD 5SZJA 3B9PA 1TADA 4KO8A 4KXFB 4D2IA 1DE0A 4XVRA 3ZYCA 1FUKA 2VLIA 2ZRCA 5IRCD 3K0CC 5A0FA 2IYXA 2QT0A 3Q8XB 1OHHA 4W5WA 4JL6A 1XXHA 4IFEA 5TXGA 1W48A 2IEYA 4AYTA 4JLMA 1QDEA 5FOTA 4U5XA 4L9SA 4KODA 4I99A 4EPRA 4PC6A 1XEWY 1CJMA 2GEVA 2EWVA 2VF8A 2CK3D 2FGKA 2C5LA 1BMFA 1UKYA 2IWHA 3RWOA 3EPKA 2JLXA 5J47A 3HU3A 3BE4A 3IQWA 2P6UA 5ANRB 1U8YA 3WP0A 1J8MF 4EAQA 2YWEA 1F6BA 4KHZA 4NMMA 2JLWA 2R8RA 1LVGA 4BRWA 4MGKR 2ZJYA 4URWR 4U7DA 1E9SA 4PR0A 4G01B 2F6RA 4WIAA 2WSMA 3DM5A 1J7KA 1H65A 2GETA 2FSIA 1IJEA 3QPVA 1IXRC 4Q9IA 2XXAB 1KKMA 3F3YA 3KJEA 3MSXA 4RFSA 4MH0R 4KU4A 1ZUHA 3UWKA 2H5EA 3QE0A 1OHHD 3SS8A 3BK7A 3FE2A 3N70A 1DVRA 2R6DA 3MWJA 2V3CC 2WJGA 5H70A 1S9DA 2W6JD 2WJIA 2AR7A 3B5JA 2ANCA 4E22A 1BMFD 1E2HA 3X1DA 1KK3A 3ZS9A 1JXMA 1LF0A 1Q0UA 4WZ6A 1L2TA 4H9GA 4DZZA 5HZHA 5B2ZA 1U94A 4ZI3A 4A82A 1OXUA 5GJBA 3U3OA 4QFMA 5FPTA 3R7WB 1E9FA 1JECA 3KKOA 4P3YA 5BQ5A 4HB2A 2EYQA 3GLHE 4JBXA 5EP1A 4DB4A 4Q4AB 4US0R 4IKEA 1SKYE 4UNPA 3SJAA 4MRNA 5SZHB 2RGNA 4YMUA 1E1RA 4DLRA 1V5WA 2P6NA 3JZAA 4A92A 5J4HA 3DOEA 1P9WA 3NEYA 4C0QC 2XZOA 5JCZA 3GLIE 3OIVA 1YR6A 1DAMA 2AHOA 3PUWA 2CHGA 5HE8A 2AL7A 2A5FA 2WAYA 4M9SA 4OI1A 1Z63A 1M8PA 3QI2A 2ZAMA 5IDVA 1FQJA 2D4HA 2ATXA 5B30A 1PLLA 2ZJOA 4I4LA 1W36C 4LWZA 2QL6A 1D9XA 4EFNA 1NVVQ 2WSSA 1UPTA 3L0PA 1G3MA 1S1CA 2VP0A 5E7IA 4US1R 4EIWA 4B73A 4I1OA 3T5DA 1P72A 1RVDA 4CW7A 3R7WA 2TMKA 5KSZA 3E1SA 1VTKA 5FH9A 4ILEA 4P0TA 1P73A 4P4SB 4AC9A 3ECCA 4ITRC 1E1RD 4Q4AA 1Z29A 1RE0A 2H7VA 2JLZA 3WNBA 2QMUA 4A15A 5CJ2A 2E1RA 1CJTC 4URZR 3CO5A 4QNRA 2O8DB 2BMEA 5JSZA 2O8EB 2CLDX 5J5CA 4BFZA 1P75A 1KNXA 3HU2A 4D25A 2FSFA 2C99A 1RJ9B 2Q3FA 1ZM7A 1EWRA 4EJSB 1SKYB 4ZKEA 2BM0A 4RY2A 2HYDA 2VQSA 3ASYA 3DMDA 3EC2A 4QHTA 2QTFA 3IILA 5D3QA 4WXRA 1N6KA 2C04A 2WSSD 3MAAC 1W0KA 3W90A 1EX6A 2F7SA 2RHDA 3GLIB 1IN8A 2GVZC 1KZ7B 4BE7B 1GSIA 4DHEA 4GP7A 1JPJA 4QJ4A 3THXA 2BMJA 4HAUA 1E94E 2OV2A 1E9CA 4XWKA 2WMNB 1T4GA 2GWHA 4TYYA 1KJYA 2FWRA 1Z6TA 4NU0A 4IHQA 2J0QA 2PLFA 3DL0A 4GOXA 2F43B 4JL8A 1H8ED 4US2R 2IUSA 1KY3A 2J45A 5KSPA 3FMFA 3AQ4A 1K6MA 2WWFA 4CRWB 1M7GA 2IS4A 2FFQA 1R10A 1R7RA 4XSHA 2NPIA 4TQAA 2XTNA 4M1MA 2ZE8A 1G8YA 2PX0A 3HYTA 1GM5A 1XU4A 4AKGA 2H1LA 2B7CA 4Q1DA 2JASA 2B8WA 3GJ8A 1GFIA 4JS0A 4WXPA 5DI9A 5JZVA 4YMTA 1E96A 2WWWA 1E99A 3U60B 3F5FA 5BYJA 4KSBA 1YRAA 2QAJA 1CJVC 4JZKA 2O8EA 2ZI9A 3VHXA 3FOZA 3FMPB 3GLHA 2PZGA 1FTNA 1VDZA 5JJIA 4G5RA 4M9QA 1GUAA 2DWOA 1YR9A 2YOGA 5FBQB 4E5UA 1TEVA 1W0KD 2R62A 4PHTA 1OIVA 4EKDA 2KJQA 2N1BA 2O8CB 1XTQA 3TNFA 4F4CA 3TKLA 1M1YE 2EQBA 1G19A 2JA1A 2ZYVX 4LUCA 2DFTA 2IYYA 3NKVA 4X8LA 2VP2A 3OF5A 2QE7A 3GLIA 3B60A 3AP3A 2BJVA 3LX8A 4CEHB 2J9RA 2LCFA 4MUAA 1YU9A 1ZRHA 3PEUA 2PEZA 4HAYA 2CVFA 2J7PD 1NKSA 3GEHA 3CPJB 2J87A 4DT1B 1IN6A 2VRWA 1Q3HA 5DI3A 1WXQA 4FIDA 3THOA 3AVPA 1ANKA 3IIKA 1E9RA 3ETLA 2VTKA 2IF0A 5HR5A 2C96A 3CNLA 1Q1QA 4Q4HA 5BW8A 1NBME 4LJ8A 2OEPA 4V0ME 4BASA 2CCKA 3N2IA 4PAMA 3R9XA 1II0A 4YXWA 2IYRA 2ZTSA 4F91B 2GEUA 4TTPA 2AFHE 4RKEA 3R8FA 4URXR 4TMWA 2IA5A 3W3ZB 1MRNA 2PL3A 1IXSB 4CEIA 4LK2A 2RMKA 2XB4A 1G20E 4KCGA 3M0EA 2QE7D 5C1BA 2PX3A 1OXVA 2J7KA 4HDOB 4OK6A 1CR4A 3K0AB 1LNZA 3WNCA 4KLZA 621PA 3W34A 1HT2E 4TLBA 3D31A 1CJKC 2E87A 4UQOA 4BWYA 5AUQA 3OEEA 1N25A 2QSYA 1E9BA 4M9ZA 3UANA 1JI0A 1VMAA 2O5VA 1A7JA 3I73A 4YMSA 1JAIA 2JLRA 3ADKA 1JAHA 3RNLA 4YMVA 4DLTA 1I4LD 1NLYA 2HCBA 4GRAA 2YOHA 4WOPA 1FNNA 1NLZA 4KFSA 4B76A 4D0LB 5CITA 4PO9A 3KUDA 1E2PA 2FEMA 5F9HA 1R5BA 2YHSA 3QF4A 4JT2A 4OQLA 1KO4A 1QHSA 3W9YA 3T34A 1JJ7A 1XD8A 4XWOA 2ZI7A 4WAUA 4URUR 1XMIA 3LV8A 1KAOA 2BEJA 1QG2A 3SJCA 2FSHA 1KDRA 4YXWD 4GI7A 2ZJAA 2RGCA 3L2OB 4A0HA 4P32A 4HUQB 521PA 4C3ZA 2IEZA 2FV8A 2JLSA 4IDNA 2UZ3A 1FW6A 1KDOA 1TUEA 3ZLJA 3NBFA 4GZLA 4RD1A 1G18A 1G16A 4UXJA 3U3RA 4BLRA 3GFTA 5KNBA 3MWKA 4LYAA 1P9NA 3KB2A 4G5QA 3THYA 4X8MA 1P4SA 4J0QA 3RRNA 1ZCBA 1TQDA 5P21A 3OEED 4GOJA 3AM1A 1VHTA 3QBTA 2A5DA 3RHFA 5BN3A 1X1RA 2KWIA 2FOLA 3OIUA 1UF9A 2XB2A 1Z06A 1Z0JA 3BWDD 3NH6A 2WJYA 4JVLA 4GDFA 3I5YA 2OHFA 5J4VA 3RAPR 3Q5DA 5FTKA 4OHWA 4QBHA 5SZIA 1KOFA 3RC3A 2G0NA 4JMPA 4Q01A 1VG0B 1ZNZA 2D3WA 3UIEA 3V9PA 3K70D 2CBZA 4PC7A 2QAGB 2FU5C 3CX6A 3SC3A 2ZJBA 3AVQA 2JLUA 1VECA 4B2IA 3T61A 1M7HA 3MWLA 2DFNA 2GA8A 5JEDA 3DO6A 4HUQA 4HZUA 3FWYA 3QY0A 3HWSA 3UG7A 4BEBA 2NZJA 1S2MA 4NCJA 2EFDB 1KK0A 3K9GA 3NHAA 1VKJA 4MYUA 3H84A 5TDHA 3U44A 3K09A 5L3RA 4Z54A 1NBMA 1QZXA 3Q7PA 3QXHA 3EWAA 4ZIRB 3GJ5A 3PUZA 1UDWA 4V0MA 5FBRB 5FOXA 1X3SA 1Z8FA 4C30A 4JLNA 2GXQA 4V0LA 4AG5A 2YZ2A 3IO3A 4TLDA 4MRVA 4I1SA 3I8XA 4RJLA 1XJQA 5EE3A 2A30A 1C9KA 5IT5A 3QXXA 1YZUA 4G5SA 1P2UA 1TF7A 1XMVA 4HLUA 4QBFA 1ZM2A 3VR2A 2BMFA 1XEWX 2FJUA 2IT1A 2J0UB 3GLGE 1EG7A 3KUCA 1F2UB 3BH7A 4Q7LA 2ONJA 2ZRIA 4G0NA 2GZHA 2BV3A 2V54A 1NP6A 3PEVA 5A4JA 4QKQA 2G83A 3D7MA 4BFYA 4QGHA 2Q9BA 5CK5A 2CDNA 3VX4A 1ELOA 3VR3A 5KDDA 2NPFA 4IEIA 1OH6A 2WBLC 4TWZA 2OXRA 2QN6A 4LHZA 3RS3A 3C16C 721PA 1WP9A 4C7OB 3O47A 2DFKB 3FDIA 4EFMA 2JJ2A 3EC1A 3CRQA 4RD6A 3REFA 1GG2A 5JWRA 1NBMD 1PLJA 2V1XA 5H1YA 2C03A 1ZCAA 1XD2B 4E03A 5LD2C 1LS1A 5EXSA 4QGGA 2F3RA 5EXXA 1R0ZA 5M04A 2ZR0A 3IIJA 1GAJA 1XNJA 2J41A 4KAXA 2OO7A 2YJTD 3CRMA 2FEOA 1YZKA 421PA 4TL8A 4M21A 1CIPA 1ZM9A 3T1QA 1QF9A 4OI4A 1NVVR 4Q02A 3ZQ6A 2WKRA 3KDSE 1LS6A 2P5TB 1LV7A 4N0DA 1SHZA 3TJZA 4LHYA 1NIPA 2KBEA 3TQCA 1XEXB 2J0UA 2JLQA 4LJ7A 1YHNA 3NVAA 2F1IA 1YJ5A 1FP7A 2D2FA 2ODBA 4GPTA 2H17A 4ZDWA 4DSOA 3K0CA 2O8BA 5AJZA 4AYXA 5GADl 3A8TA 2ZYUX 1PJRA 1A2KC 4DCVA 3UPUA 2PBRA 3MRSA 1E2QA 2N46A 1MO5A 4A2PA 3U7GA 1ZM4A 1ZD9A 2IXFA 2ZSAA 3UATA 1NKTA 2KI5A 2ONKA 5JJKA 2QPTA 2O8FA 2R65A 1RPZA 2BBWA 1AN0A 2QQEA 2QP4A 3SI7A 5KU1A 4XVUA 1E2EA 2P67A 1S8FA 4HB3A 5JHGB 1GVNB 2QMEA 2QRZA 1ZNXA 3KFXA 3VKGA 3TSZA 2A78A 3K53A 8OHMA 4IOJA 3NG1A 3OAAA 4EPXA 2W6IA 1Z28A 3MWYW 3FFBA 3QKSA 3QKRA 3QIAA 1S4QA 1WF3A 3FKSD 3I8SA 4WBSA 4AURA 1E4VA 2H18A 1E3MA 5JRJA 1E6CA 3KXKA 1S3GA 2RCNA 3PFIA 4M53A 4AD8A 4DRZA 3B1VA 2C9OA 2OILA 3KXIA 1Q21A 2GTPA 4Q48A 4M22A 1US8A 3I5XA 1XEXA 5FBLB 1O87A 4JYBA 4ACBA 3FFAA 2BVNA 1ESNA 5FR1A 1RRCA 1P9RA 3GPLA 3ZD7A 4O2LA 3W8NA 1PV4A 4HB4A 3PCRB 3MGCA 5FPHA 3IGFA 4WZBE 2P3SA 1MV5A 1FZQA 2CCGA 3GLGA 3ICQB 2ZI3A 2GXUA 1Q22A 1QVRA 3RRMA 1R2QA 4M8NE 3ONWA 2ZEJA 4NE2A 3WBKA 3BFVA 3EAQA 2VSOA 1P2SA 4JLOA 3Q9LA 1D9ZA 2EFEB 5EUMA 2HF9A 3Q3JB 1OLOA 1RRPA 1IHUA 3OAAD 4OK5A 5CLLA 5H8WA 3TQFA 2OUKA 1W7AA 4E09A 3VR6A 4BFVA 4Z51A 3F8TA 4CF7A 4XH9B 1WCV1 4OQFA 5F3WB 4BFWA 5FUWA 2JLYA 1PLKA 2ZSBA 5E95A 3ADBA 2X77A 3H86A 4LHXA 3T1OA 2AKAB 4TMZA 3LXXA 4BFTA 4M2LA 1OKKA 4GT1A 3RWMB 4MKIA 1XXHB 1G6OA 121PA 2VSXA 2I1QA 4Q66C 4QRHA 4NPHA 4A1FA 4NYMQ 2HJGA 4ZI2A 3SQXA 4PX9A 3GMTA 1Z0FA 1P5ZB 1VCNA 4LBYA 4O25A 3CH4B 2ZITA 4YDHB 4K81B 5GJCA 3P26A 5JLJA 2IUTA 4H1VA 3SHFA 2MSCB 3ASZA 3CBQA 3B78A 3OFNA 4NCKA 4ACAA 3O8DA 2PCLA 4MYHA 5CM8B 1P61B 2RKOA 1N6PA 4PZYA 1U8AA 3DEFA 4LJYA 2FGJA 4Q9HA 5GVRA 2QTVB 4QC2A 4OHYA 4AKEA 1SQ5A 4IRUB 3QBVA 3QPUA 3AVYA 2QPAA 4JT4A 4A8JA 4M9XA 4KITB 4P4TA 4TZ0A 1QHIA 2C98A 1EFUA 5FL3A 2FFHA 4KI0A 2QPOA 1N6IA 4RZ2A 2ZUBA 3FTQA 3RS0A 1GL6A 1N5LA 2XNSA 2CJWB 3C4JA 4LC1A 3KZ1E 1OKKD 3L0IB 4YONB 2YINC 1VHLA 3MMPA 4LBWA 1G7RA 2Z6VA 3AGPA 4EPVA 2XGJA 4GSYA 3GJXC 4I81A 5IHPA 1AKYA 4FINA 1W36D 3SDZA 1NY5A 1RRGA 4TQ9A 5B58C 4Y0AA 2W6JA 4B33A 1NMZA 1DEKA 3OFND 1XCGB 2YYZA 2HEIA 4BQSA 5HKKA 2C9YA 1N6HA 2LKCA 1SXJC 5FUYA 1SVKA 2D7DA 1T3SA 1XDBA 4TTQA 5B57C 4Z8YA 1OH8A 4MGZR 2RGXA 4UJ5A 1OIXA 4UNQA 3QNUA 5G41A 1DS6A 4KLNA 3LY5A 5C18A 3TVDA 1D6JA 4B2LA 3CB4A 4N1AA 3VKHA 1O3YA 1P60A 1MO4A 5FTJA 2IHBA 4TZ6A 2MMCA 4TMKA 3IBYA 4JBYA 1X8KA 1GNQA 2IHYA 1UADA 3VX3A 3AVVA 4OI0A 3F0TA 2GJAA 4JLJA 5EP4A 1XCMA 2CJWA 3AH8A 3TUIC 1KYIA 4GMXA 4O0MA 3KQHA 4NH0A 2QP3A 5EP3A 1DAHA 1E9DA 1F60A 4YDSA 2B6HA 1E2IA 1M74A 2EU8A 4NYIQ 1FTSA 5TVKA 5JJLA 1N0WA 5KDLA 3DVLA 3UMFA 4RCYA 3K1JA 5HKKD 1EFRA 3M6AA 5KYKA 2IC5A 1TX4B 2VP4A 1P6XA 1W5SA 1GL9B 4TMTA 5BYKA 3EIHA 2G77B 2ZSFA 1XTRA 1KI7A 3PEWA 2BCGY 1DOAA 1DARA 4ASUA 4D0GA 3HP1A 2VIIA 3SJZA 2ZYTX 1P7CA 3T5GA 3B2EA 3SU8A 1XTSA 1EX7A 1P62B 4QL3A 2IYZA 1YQTA 2NZ8A 2UKDA 4FCWA 3KQNA 5JRZA 4ERNA 2GNOA 1NVWQ
chains in the Genus database with same CATH superfamily
1AB5A 1WW8A 2DPXA 3M3DA 1ID1A 2D2XA 3HCRA 3R7DA 3RIXA 3IERA 2KQUA 3NGLA 4FFLA 2QGNA 2XX3A 1YDMA 4G5OA 5JSZB 1V8FA 1KRWA 4YACA 3SSAA 2VBCA 4G41A 4YV1A 3H18A 2IOQA 1ZISA 4G8JA 4OMCA 2OGUA 1Z6AA 4O8ZA 2XKKA 3LF2A 5JO0A 4Z9YA 2ZJ0A 1U0JA 1LSUA 4LTNA 4M36A 4CFZA 4IJKA 1RR6A 4QASA 1XZEA 3ZZTA 3I3OA 5AXDA 2O23A 1E3QA 3O8OA 2R2AA 5ITZB 2ZS8A 2NMVA 2DUNA 5TF0A 3VOAA 4NCAA 2WWHA 3RYHA 2X0KA 3ZH9B 1QB7A 3A6PC 1TO1E 4UFNA 2C7PA 1HK7A 1ORVA 3WE7A 4CCYB 4E1BA 5KHLB 1KORA 3B6EA 1PR0A 3OPQA 2ZJZA 2LD4A 1R66A 2AG5A 1AHHA 2OD9A 3OQPA 5HKBA 3THWB 2M2IA 3OQIB 1ZGCA 2H5JA 1RWPA 3DOFA 1GFWA 3EGVA 1DAFA 4HRAA 2WFAA 4JBGA 3AEQB 4CMGA 5T6MA 3HYLA 3TDNA 2OO5A 5CG1A 5JZMA 4LN1A 2NTVA 4OOEA 3LBYA 2XDQB 2VPQA 2B35A 1TUGA 3RIYA 3OLZA 5EZYB 3ICCA 4B82A 4WE3A 4XOUA 4GFDA 1ZNQO 2PJZA 2X2EA 2O2CA 1UEJA 4QSHA 821PA 2JAXA 3FSJX 1V9LA 2PGOA 2WUDA 3DT6A 2YVLA 5IXSA 2C9BA 3LTEA 1L0BA 1L7AA 3MJHA 1FDTA 5JMWA 3VTKA 1D4AA 1O1YA 4EZBA 3BCUA 5J2UB 2WVHA 3P4XA 2Z5VA 1JDZA 3LPDA 4V39A 3ZIUA 3N5KA 1LU9A 1YNOA 2KLBA 1HRKA 3E05A 4RDCA 1VLLA 2BKUA 2CXUA 3HDTA 3F98A 1GTSA 2I9KA 1A71A 2NZXA 3CCFA 4RTJA 4J94A 2G07A 1XZ8A 3GZNB 4L8FA 1L7QA 1MEJA 1NBAA 5CX4A 3KSMA 5FUVA 3HTXA 1QB8A 2BI7A 2FLKA 3ZGNA 1OIWA 3DHNA 4ODIA 4MQMA 4KACA 5JY6A 1QC5B 4KMRA 2H8KA 5J40A 2AJCA 5HIAA 1DQPA 1ZH2A 3L0BA 4IOMA 4RFVA 1U3GA 4IDOA 1E3WB 2R8BA 1A9RA 4OFZA 3NHBA 3EEBA 3B6KA 4Z2AA 5JXGA 2CVHA 3NIDB 2W37A 4JIMA 2QN3A 3DDCA 3T0GA 4R2LA 4FQ5A 2R0QC 2JI7A 2FP3A 2PJUA 3BCHA 3DLCA 2QS9A 3T4XA 3MD9A 3QWAA 3WWEA 1MTZA 4ZT7A 1DU4A 2GERA 2J7PA 5E6RA 1VSBA 2KSQA 4PZ9A 4QUIA 2LNDA 4W7SA 2VBGA 2XADA 5B7QA 1DFIA 3KIPA 4UHEA 2VEDA 4B6SA 5IVKA 4XFJA 5C1OA 5GVSA 1QRUA 4AZVA 4J2TA 3D54D 1ZITA 3RIEA 5AMXA 2OD2A 1OV6A 4R7ZA 5ITSA 3OEHD 4N0EA 2C7QA 2C2XA 5FFMA 1QYCA 4M7OA 3DT8A 1Z0DA 3R9XB 3DWEX 1REQB 3GA0A 4HUTA 2H1CA 5JBIA 1JEEA 1BGWA 1Z68A 5C4IA 4QECA 3BA6A 3DDHA 3LECA 3AHIA 1ZGHA 3KJIA 4RSMA 4YR7A 3EVCA 1N5KA 1KVTA 2IVZA 3LQYA 3MQ4A 3NBMA 1C3EA 2E2WA 4E30A 4GRIA 2DTDA 4JWKA 3H87A 3TW6A 1NQOA 1YFKA 3W4JA 4L08A 4EDFA 4NH4A 4Q3BA 3EGDB 4G9EA 4KEAA 4EHHA 2EF0A 5BR4A 4QBKA 4OQQA 5I8WA 3HVIA 4EFDA 1RM0A 3TBKA 1CNFA 2REXB 3M6FA 2X58A 4QDXA 1JDBC 1KYQA 2VQ3A 1II8A 2P65A 2ZVQX 4GICA 3U4GA 5AKGA 5EJFA 4WRRA 3FOEC 3W9SA 4HDQB 2PYZA 3UMSA 3N9IA 1DQNA 5F73A 2PUVA 4CIDA 4AIIA 3TSCA 1XZIA 2WTUA 2GEFA 4I55F 1V3VA 3MCAA 1SUDA 5EXTA 3AUUA 5FTMA 4HDRB 5KDOA 3QF7A 6ABPA 2BM9A 2FRDA 3LUKA 2IDZA 1HF3A 4ZMBA 3ZCVA 3OBIA 2YCLA 1J00A 1GAEO 1O08A 1KZGB 5U9CA 2GBFA 1N7GA 1S0UA 3QLUC 5IUJC 4Q6BA 1EGAA 4YRCA 4FBLA 5D84A 2ZM5A 3BRQA 4TKLA 3AXTA 3BGOS 3IURA 3UWSA 1DZIA 3NOOA 1AGRA 1ISPA 3QNMA 1RJEA 2QMYA 5C5EA 4OOFA 4U39A 4AICA 1VYVA 1XT6A 3ADDA 3P0RA 3KJHA 1AUQA 4V0RA 3UB2A 4YP7A 4BLPA 1U0BB 2C3UA 1AGNA 3UHJA 4AKTA 2F55A 2GT1A 3HY4A 3VNUA 1I0IA 1LLCA 4XWAA 1HUQA 1PCXA 1CUDA 4D8YA 3DPUA 2BOVA 4N3BA 3DFKA 3VO8A 2WPDA 4CV1A 4ZMSA 3B89A 4ETNA 2H9YA 1LNQA 1Y80A 1C0EA 2ZRBA 3B48A 5BN3B 2Z6AA 2W2PA 5KPDA 3V4PB 2P2YA 4V03A 4J3NA 4B80A 2OESA 4FDTA 4S1TA 3I05A 2OGZA 3ETDA 2OORA 3O8QA 4IQGA 4Q9AA 1EXMA 3CKMA 4PPQA 3TZKA 4REOA 1MOSA 1CQXA 1D4FA 3ZS8A 3H5IA 4A73A 5KWIA 3FHCB 5BSUA 2XF2A 1KSFX 1A4RA 1U0OC 5LQCA 3BN3A 1OJLA 4ZHQF 3CRVA 4OA5A 3RH0A 1PZNA 3DYBA 1PRYA 4CN9A 2C8VA 3EXIA 5L8VA 3WDMA 3I30X 4TZKA 1U9YA 5CXXA 3NNDA 2J67A 3BE5A 3K30A 3F9IA 4LC0A 5ALFA 5JH7B 4JOQA 4Q0MA 4DHWA 1WETA 4YCMA 2HK8A 1F9EA 2GPAA 1U7TA 4ZI7A 7ABPA 5IJ9A 5HPYB 4YJHB 3HZHA 1G8FA 2UVDA 3EGXB 4IIXA 1Z0IA 3V2UA 1M2VB 3ANNA 3JZMA 5ARBA 1L1QA 2V7WA 3FYUB 3IO5A 3D7SA 1MLDA 3CR7A 4BNKA 4PYIA 4YT4A 3NI2A 4ZCMA 5CFMA 1SC4A 3M5DA 2P2SA 4OL9A 1W4AA 1XMJA 1XZPA 5HS6A 1RCTE 3CNHA 3DT9A 4BZQA 1SG0A 4I50B 3MT0A 4TSFA 1KS9A 1BD3A 1NJ2A 3Q3IA 4RD3A 1XMPA 3PG5A 2B7BA 3OI7A 1IUPA 5JI2E 1Q6YA 3T3EA 5HIMA 1P5JA 3VR5H 1RI1A 5DF1A 2PRJA 3RVBA 3JQBA 5CJPA 2PUFA 1ZL0A 5EIOA 4TRMA 4LRQA 1CR2A 2O3JA 3ORHA 5CFZA 1SHUX 2ORVA 1G20B 3G5AA 3CH6A 3MD0A 5FUXA 3COSA 3H2HA 3TOZA 3ZWKA 1NUQA 3WBBA 1GJRA 1SR8A 4RQBA 2J3EA 3NKLA 3RBZA 4RTSA 4NU8X 4OQYA 1V96A 3D5QA 5JS2A 2VQEB 4WLVA 3BXXA 1P91A 4KLAA 1KJ9A 3W5JA 4MS4B 3ZWVA 3LW8A 3OY2A 4FX2A 2RH5A 3FMIA 4ZVQA 1OLUB 3KQUA 2IXBA 3SQLA 4DLKA 1OA0A 1PSDA 3B38A 3HYNA 2C31A 1U0SY 1PG5A 2Y1FA 1SZDA 3D4OA 3DR5A 4DR7B 2OBMA 2XRZA 1PTKA 3QPAA 1TUBA 5KVSA 3BPSA 4PWYA 4LV8B 5LP6F 1SUEA 4MUEA 1VMIA 2IHUA 4XM2A 4JKYA 4HDAA 5FA6A 4AJ2A 5IVIA 5BUZA 2C4VA 2IS2A 3ND9A 4O2BA 1RLMA 3WYEA 2X0NA 4KH1A 4D8WA 4JR2A 1KC1A 3FBWA 4J91A 3GCZA 2GMWA 3PFNA 5KI6A 4M0UA 3OZAA 4B75A 4NYIR 5JMOA 1NM5A 3ASVA 2GZAA 3HSKA 3OKAA 1JG7A 3NDRA 3LT5A 3ER6A 3KLPX 4MKFA 3SMQA 1Y81A 1J1IA 3CU5A 4DYHA 1ZOOA 1EVJA 1TKBA 1X0XA 3EXAA 1IC6A 4FYMA 4NCNA 4MVJE 2BFEB 1WB9A 3DTTA 2AYYA 3P5BA 4OKIA 4Y1RB 5I7EA 3GDWA 4B8YA 5J43A 1IBCA 1M76A 4L4ZA 3SOZA 3D1JA 4L22A 2J9YB 4HGZA 5FNVF 1V39A 4JI5B 1II9A 5FLYA 2IHZA 3JASA 4TROA 3GU3A 4HSEA 1X1SA 4OGGA 4AQDA 3GP8A 3HDQA 1KQPA 1QFMA 1G2OA 1A7UA 1CIJA 2B3TA 2WDPA 3I23A 4HF7A 5D3MA 3VKWA 5BN4A 2GCOA 1R64A 3DONA 3FKQA 3GVIA 1JYSA 3IUSA 2CYCA 3DHWC 3K4HA 1IG0A 1LB1B 1M1UA 3ESBA 4J4TA 1RWOA 4PRZA 3V8RA 3UHAA 3L1JA 4EUEA 4P53A 4X61A 1Y0BA 3WA6A 3I9FA 5CVDA 1I2AA 3E70C 1R6TA 3LVRE 2JD2A 2PD3A 3WLTA 1DBSA 2WLTA 2C61A 3KXDA 3R3HA 3SEFA 5C7IO 5E4FA 4UE6A 4AJEA 3C3YA 3R3SA 3WB2A 2FMKA 3MTBA 2W2LA 5JVDB 2DXIA 2Q4TA 1RD4A 3MLAA 4RD4A 4LJ9A 3M6XA 4OLHA 5H9VA 2N42A 1B23P 1EJ6A 1JPNA 3H2BA 1ZH8A 5JXJA 4K28A 2OPHA 2AKYA 4E5SA 2FE1A 3OE7A 4DWVA 4MUFA 2VPZA 5IMBA 1XCOA 2HIMA 2D8MA 1ESDA 1E64A 1FSSA 1MDBA 1C1XB 1QCCA 1YZGA 3WK4A 1CV2A 5CFPA 5LUBA 3PF8A 1DXYA 4EVRA 3F73A 5I7VA 1V4NA 1WMAA 3CZRA 1POWA 3F5MA 2JIZD 3JQ6A 3C6XA 2PPVA 3Q0TA 5IAAA 4TVBA 5CYPA 2WEKA 5HTKA 1I2DA 1D4ZA 1E18A 2J9ZB 5KSOA 1AC5A 1XKLA 1C0KA 2NZUG 4HFRA 5KTRA 1TJ5A 1WZIA 5ALJA 4C0SA 4F3NA 1FNDA 2IPLA 2BT4A 1NFQA 2ZP1A 3DE7X 4I1RA 4LPKA 4C3VA 4MDEA 1HFWA 2IS1A 1GQQA 2ZI4A 2QT1A 4BNTA 1CX9B 2WWIA 5I47A 3ID6C 3C15C 5EPOA 1I14A 3A10A 2GNPA 2POCA 4PGMA 5A9TA 3EY9A 1P18A 1WY5A 4LGCA 4N01A 4A0QA 3ZE6A 1JLHA 3L1IA 3V5NA 5KNLA 3ROZA 2NTJA 4J03A 5I48A 4DR1B 1SNYA 4MJLA 4CLXA 2BUCA 5ECGC 2CE7A 2XHZA 3IHKA 2IUUA 3I4CA 4MGHA 5FWAA 3U7QB 5ELXA 4AMUA 4GOMD 3TNYA 4NKRA 2G5GX 2CHUA 4IILA 1XN1A 2PKRA 3D3QA 5EE9A 4ZOEA 1TU4A 3F3KA 5DGIA 1OD6A 3PQ2A 2QMOA 4R40A 5I5GA 3WIVA 4FEGA 4E5YA 2XYGA 4EHFA 3G82C 5A06A 3AFMA 1RC1A 4WD3A 1XU7A 1UR5A 3R7LA 3Q3GE 1XPRA 2CZQA 2IP1A 3GNLA 3LXUX 5KTOA 3ITEA 1L5GB 1VM6A 4RTRA 3FSGA 1GSOA 4FU0A 4LY3A 3OJWA 2Y0DA 4EHLA 1LD3A 1XWFA 2GXSA 4XUGB 5JD5A 1OXSC 2RBEA 3FRIA 4RVCA 3O74A 2WFLB 2XOXA 2I6QA 3NBUA 4ZJYA 5ADVA 3G9ZA 2VHUA 3I01M 5BSKA 1SU6A 1O8CA 3KVRA 3P9XA 3TB6A 3WDKA 2QBYA 3IOCA 1T0HB 5BQOA 1KNQA 3Q5EA 5HRUA 4AXXA 1ZD8A 2FX5A 2ODPA 2JJ1A 1XRNA 3CURA 4KE8A 1R5OA 1GDDA 1OREA 1GZ3A 1SXJD 3CLRC 1IPEA 2I6GA 5FT9A 5LB4A 2I91A 3UTCA 3UT5B 1XXLA 3O3MB 1UAGA 2OD7A 4NYJQ 4OJMX 1UIMA 1HDOA 3R3VA 1C2YA 2WV7A 3PQFA 4IRMA 4UZEA 2A1TS 2Y1OA 4IOLA 4NR0A 2IU0A 2A33A 4PBSA 1DDOA 1CY0A 1QXSA 5K0TA 1EBBA 1WVGA 3IVAA 1VJ0A 1QLWA 3QBEA 4NV3A 3LNCA 5EKXA 1R0CA 3U9TA 3UKDA 5BV1A 1JH9A 2HSGA 4R41A 1V9SA 1FDUA 3U4QA 1PBNA 4HNGA 1F2TA 2EFCB 4IGIA 1YR3A 4W9RA 5EY5B 3RS4A 2QJFA 2W43A 3WJ2A 3BS4A 1C81A 4ZP1A 3E9DA 4DLXA 3FNEA 2OAEA 2ZS7A 2G63A 2GLUA 4EG7A 4ZAZA 2VH1A 3R0QA 4QPDA 3DEZA 1WIWA 2GI4A 5B3JC 3N0RA 1YGPA 1F4LA 2QD3A 2XCRB 2C20A 1EESA 1EXDA 1N1DA 3KOOA 2YFYA 3NHUA 4N3CA 3D59A 3Q2IA 4KLRA 4LJAA 4TV9A 4X95A 1TQ8A 3EOZA 1TPYA 3TJMA 4FI3C 4RKRA 5BY2A 4WA8A 2GKGA 1QUFA 3V7FA 3WKCA 1C3XA 2G1UA 5CM9C 4W8OA 3KKQA 3AUSA 2ZUTA 1OFTA 1IM2A 2OHHA 2ZYRA 2JL1A 3COVA 4OLJA 1MAAA 3GAZA 4PHHA 1ACJA 1K0UA 1XAJA 4WCFB 5LLTA 5DDIP 3KQKA 1KXJA 1Y6QA 2OGWA 3N05A 5TEVA 2OXEA 4BV8A 4F4FA 2J3QA 4WK4B 3V1LA 2BBTA 3GLUA 4KL8S 4MKGA 2PKQP 3QE3A 2CLEB 1LPAB 1G41A 5F1YA 4K6KA 3OKPA 4JYMA 4IDQA 3BAZA 3GFBA 1ZWLA 3R9KA 3A1VA 3E9MA 3P2EA 3HXMA 4J1TA 3SBXA 2EKPA 2Y99A 5K0JA 4N65A 1G9SA 2ZOSA 3WADA 1KEEA 4B6RA 1UDBA 3KG2A 3WHKA 5L3SB 1IOWA 5DNYB 1FRZA 4L76A 4BIIA 5K3FA 4DNXA 3FOBA 3I9NA 3LWZA 4S2UA 3VZRA 2OHVA 4CM9D 1OYYA 2Z1NA 1AQIA 3DE1X 1A82A 4BMDA 1X1EA 5E2BA 1AF4A 5LXTB 5C8VA 3HR7A 3CF2A 1D8TA 1E69A 4FMDB 5EJEA 5F33A 1PW7A 3RCBA 2XQGA 2IJGX 1EM8A 2OV3A 5CAEA 4EJMA 3BAFA 1B0AA 3KBBA 1C4OA 3DOJA 5I9SA 3KBOA 2Z4TA 2PVSA 1CZKA 3L43A 1N33B 4BATA 2C7RA 4GPD1 1MUUA 4OSOA 1CYEA 2VP9A 4MDYA 1SVSA 2B4QA 3IEMA 1MKYA 4MQUA 3FYSA 2PD6A 3FPHA 2FQXA 4MRMB 5JPIA 1M8JA 1YS4A 4UUPA 1C9NA 2A94A 4TMVA 4NBWA 1W8DA 2A7XA 4MR9A 4M89A 3ONEA 3PA6A 1PHPA 5DW3A 2C95A 2I5PO 3ZY2A 2GKOA 4CU5A 4F6CA 1KWGA 1RZRA 1W6RA 1V3TA 3D3NA 5TMPA 3WRWA 3ZV4A 3CVWA 1U9JA 4MCHA 2X9LA 4QAJA 2Y1KA 2V8OA 1OXBB 1DV1A 2WJHA 4EHKA 3IHLA 3VC3A 1E3JA 3AETA 5CU7A 2O5EA 4D4KA 1PS8A 3OLYA 5E7MA 4DZRA 4E4TA 4IZIA 2ISSD 1CJUC 1VB3A 2GESA 4MJXA 3I0ZA 4F9EA 1QE0A 3FVVA 1YJXA 4D4GA 7REQA 2ECQA 1E2LA 2QVCA 3U9LA 1LRJA 2ETVA 2YQ4A 1XP5A 3HJBA 4BECA 3GLQA 2AQ8A 2W8ZA 5TEWA 2OQRA 4KYTA 1EJBA 3WV4A 1W47A 3V7UA 1FU7A 2L82A 3LDGA 1GPMA 2QMQA 2QTHA 3LX4A 4MB0A 3E27A 1JWLA 1B6RA 3F1KA 2UUPA 1AS0A 1Q2XA 3EWSA 1WMSA 4QVIA 4MUBA 1YZQA 4RD2A 2GN2A 3O8OB 4JA0A 4XVHA 4RH0A 3VO2A 3ZHXA 4X66B 4RGBA 3G6WA 3K0SA 4DR4B 4Q9DA 2I3ZA 3ZV5A 3HJNA 2C1XA 4DAOA 4A2QA 5E6SA 2XNDA 1YR7A 3OTQA 4UNSA 3E7WA 2VUUA 3EXG2 4QYSA 5JSFA 1SKQA 4WLOA 2ZE7A 4TMYA 4CN8A 3QUSA 1CHDA 1E1QA 3KNZA 1ZK4A 1EDDA 2ZQYA 2OV8A 4BVAA 1LDBA 3O21A 4GQAA 1EH5A 1XO1A 4XB2A 3WYAA 1HE1C 1KKLA 5LQRA 3BYZA 1RI4A 3GEGA 4M1YA 2AFIA 3AHGA 4E21A 1EZ4A 2BGWA 1U0FA 2XRFA 3EA4A 1ETHA 4RCVA 3O2SB 5DCYA 4I9FA 4Q16A 4G1UC 3WIDA 3ZK9A 4LSMA 3S8EA 1SVOA 2QHXA 1JTVA 3PC6A 3QKWA 1BA2A 1DTEA 3E9YA 5DBFA 1DRWA 2IZ6A 1T9KA 5HE9A 4YREA 5ULLA 4AWAA 2VF4X 4MV1A 2ZU6A 3PV0A 5DHPA 1Q0SA 2QRMA 1RAFA 1YI0A 2WVJA 2Z5GA 4MV6A 1TNDA 1M5RA 2HJHA 4KN5A 1CUXA 4BMXA 4EYKA 1RWKA 4UD6A 2RBKA 3L6RA 4KWTA 5B4TA 2QRNA 2AYZA 1N8KA 1G7CA 4XGQA 2GJ8A 4K46A 2GFQA 1WDTA 1E3SA 2PWBA 3QYAA 3C98A 3Q3VA 4HWGA 4MKHA 4QHYA 4GHWA 1P6QA 3PXXA 5E1DA 3PQ4A 3U9SA 3ZN2A 3IE2A 4FMBB 5ES4B 1JEYA 2PAAA 5AP9A 2QORA 2OAGA 2FUKA 3HMKA 5A6SA 4ZAGA 3F3SA 1OAKA 5EC8A 4TVSA 4L6CA 4NENA 5GJWC 2G5PA 3GGJA 5I01A 1DG3A 4JVNA 5HQ3A 5LMUB 3PQ8A 4HLCA 5CT8A 1NLMA 2XWJI 1H94A 4UU7A 3LG2A 4AB1A 3M2PA 5JHHB 4X7PA 4I9GA 4GLOA 1EWQA 3IE0A 1U2GA 2PUCA 1Z39A 2QJRA 2QU7A 1Z5WA 3C1TA 3L8FA 1RHMA 1B42A 2GBLC 3HPRA 4G6ZA 1YBFA 2GN1A 2NV6A 2EW8A 1LDEA 2ZWVA 1QHEA 4UAJA 1GP2A 2PT5A 3V32A 4EPTA 4QARA 3WGQA 1ENPA 2E4WA 3ESQA 3VKUA 2X0RA 2VKQA 1M66A 5E6RB 3PRYA 3E7FA 1DQZA 5CVEA 1TT5A 3LPNA 4NX2A 2R8PA 1ZMRA 1ML4A 1P2DA 1S7CA 3BWMA 3I72A 2WOOA 1O4VA 3OVMA 4QE3A 4XTRA 3VU0A 2VHJA 3CR8A 3H9EO 1DHTA 3FB1A 4H7HA 4J7UA 1B73A 1NJ1A 3MFQA 3ZHVA 2QV7A 3AKCA 3O95A 2VP5A 4DY4A 5C35A 3AZPA 3G2MA 4PPNA 3RYIA 4BKOA 3RBAA 4RQAA 3CSUA 4BX0A 4XA8A 3RYFA 4DUPA 5A2QA 5JWOA 5IT4A 1T5HX 4UDOA 3TH5A 4YJGA 1MHTA 1DKUA 4FFNA 1R8SA 3IVCA 4TOIA 4ADSG 4KKVA 4AQYB 1YTUA 1XLTA 1PV1A 1Y4UA 3TN7A 2V98A 2MCFA 1CY8A 1ZCFA 2FW0A 3Q87B 3KE8A 1NVKA 2I78A 4DUGA 3LI2A 3OTIA 4R81A 2VA9A 5IK2A 3TB4A 4C20A 1IBKB 2H59A 4DNPA 1TAUA 4QEZA 2BL4A 2G6TA 4R5MA 4XIGS 4DDVA 3TUZC 3QKTA 1OLSA 5F9MA 2W83A 3M5WA 1BHQ1 3HLTA 1II8B 1IJFA 1Y1RA 2DHCA 3V8NA 3MGKA 1ZC4A 2YWJA 1ZUWA 4LXYA 4G2NA 1FDIA 5IN4A 2DAPA 1Q1BA 1A8UA 3TI7A 4ALNA 4C08A 2TMGA 3CWQA 1Y42X 3LQRA 4KNVA 1XF9A 1UXJA 3C3BA 4JROA 1MH1A 1HX7A 1RKXA 1OAOC 1XTBA 2VNIA 4BFXA 3GJ3A 4E6PA 2NNLD 3B2QA 2KB0A 1OASA 2JIPA 5E7JA 3KT8A 1USKA 4M8IA 1RWNA 2ZSKA 1QTQA 4QLBA 1JVBA 1RLUA 3JRNA 4RPKA 2MR6A 1VBNA 2VAVA 2CHVA 4E70A 1C0LA 2VUTA 1LH0A 1ZYUA 4JEHA 1T36B 4NNOA 1R4MB 4J1NA 2BGNA 2QL9A 3MTGA 3N6XA 3QENA 5DN6A 2NXCA 3EX7C 1XTIA 5TT1A 5DPMA 4DV5B 1EB9A 5I7RA 4DUYB 1VPWA 2G09A 4BBAA 4R2IA 5D86A 1KYTA 3W5DA 1PZFA 2G1PA 5TRTA 1K6IA 1YZNA 5K8LA 1TM4E 2PWZA 4ZODA 4ZDKA 3FHOA 3PEEA 1T8YA 1T2DA 1WZUA 3CX3A 2J0VA 5B53A 4MUYA 2NO9A 5FULA 1H2EA 3TIXB 4W5JA 1TAGA 4QZVA 5LOVF 1EDBA 2WC1A 2HB6A 3LXMA 3PUJA 4G3XA 4MPJA 4BQIA 4IX9A 4PICA 2CLOB 1MXFA 4UM8B 2QBYB 3I5MA 2BUAA 3L5KA 4JVSB 1SVUA 2QUHA 1UBOS 4RZ3A 3O8QB 4ZYYA 3FCAA 1MBZA 1RXCA 3HADA 2HH9A 3MUFA 4UM5A 3H9GA 1PT7A 4F38A 1V5IA 2ZLBA 1J2JA 3TFOA 5LWHA 4QQ8A 4IFBA 1ZWKA 5F21A 1I7LA 1V8OA 3QBDA 1I36A 4DEXA 2OG1A 5MF6A 1ZU4A 3NAMA 5BN5A 4BO5A 1RQRA 3EXIB 3M89A 2BC9A 2IXDA 3FNQA 4KE7A 4S1NA 4YCDA 5HQTA 5HNKA 2P1ZA 2WILA 1EK0A 2ROQA 3BRWA 3EHEA 3T38A 3FGOA 5LBTA 4DM4A 5I4IA 4U0KA 4BNZA 1AA6A 2PZKA 3WL5A 1A98A 3BKWA 2QX8A 4ZI7B 3F74A 4B4UA 3G7SA 5IJ9B 2B4KA 3QEMA 3ETCA 3T3NA 4IPTA 3QEAZ 1A4XA 2FH5B 2Q9UA 4L5JA 3AIIA 4WL0A 4MVYA 4L28A 4O2AF 5B55A 4BQQA 1M2FA 1V26A 1OYOA 2Q5OA 4C5BA 4E2WA 3VYVA 3WMXA 1O9GA 1BE6A 6Q21A 5KPJA 1U98A 3I2GA 3BORA 4E7OA 3P45A 3S7ZA 5JPDA 4WLUA 1TIKA 1Z3CA 3HWRA 4K5QA 4O4HF 1HL7A 4E5PA 4KIJA 1RLOA 4PX3A 4H1TA 4R4JA 1YJAA 1X7HA 1DCMA 4Y0NA 4MV9A 2UUOA 1WD7A 4ZMRA 1HKUA 1PR5A 4Z1MA 4PSKA 5C4GB 3RRBA 1QUEA 1A9OA 3FNRA 2NNWB 1G9XA 4L50A 4JYAB 1DRKA 1G5HA 4ZWNA 4EG4A 3GRYA 1GNRA 3I2KA 3IVXA 4OSEA 1EUCA 2GEDA 2F8LA 1GILA 3JYLA 4IGEA 4NCXA 2QTWB 4BVJA 1RYHA 2G7ZA 3EE6A 1SXHA 4OUDA 2OBLA 2ADFA 3R5FA 4O2RA 4TM8A 4FWTA 4K87A 1Q12A 1G63A 3BSSA 4LOLA 2UUAB 1D6NA 3LFUA 2XIJA 1PUIA 5CXSA 5DLYA 3TLEA 4V0KA 4XGRA 5H80A 3R4CA 4UZSA 4MRSA 5IZCA 4CEHA 4LDRA 1JHDA 3TTXA 1HOTA 4RTOA 4HVAA 4BTVA 1GA4A 2Q1UA 3W5AA 1BMTA 3GYBA 1PNVA 4AUEA 4Z99A 4TLMB 2VK1A 1Z22A 5KO2A 2FN9A 1TUBB 2WAXA 4LMPA 4X6YA 2W11A 1N8TA 3T3GA 1QGZA 4AJLA 5HHTA 4AI6A 2WIFA 2BKAA 1KYYA 4UKDA 4N0QA 3QU9A 2XE6A 4WASA 2MSNA 1WQ3A 1ZIPA 5CMLA 1J56A 1UJNA 4O2BB 2OM2A 1TCAA 2WF7A 1FFGA 1R8XA 1THZA 1G9TA 3FJYA 4RVNA 3BG5A 2MTBA 4KW7A 2DU8A 2XUIA 1NQTA 3CLSC 5E6UA 3GMDA 4QTXA 3W6PA 1A4IA 1QV7A 2NTNA 5A05A 5LBIA 1L5NA 2OFXA 5JJCA 1KQNA 4OJNA 1QX4A 2XT0A 3E84A 1W59A 4AP6A 1FFXA 4XEUA 2NLOA 1T8TA 3TRJA 4PZPA 1ECCA 5EQTA 2OVBA 1WEHA 2VZ9A 3M7IA 3X1ZA 4B8ZA 1RHUA 1KGSA 2YWCA 3KL4A 2ZT8A 3KHSA 4B17A 2ORED 1J8DA 4L4YA 1NG1A 4NMHA 4O1IA 5HZMA 3TTUA 4LCJA 4IDFA 4BC1A 3RT9A 4MLPA 4Y0VA 1RXIA 4ZT6A 1IM8A 2B83A 1NYRA 4AP5A 3A37A 4I14A 3E8SA 2Z3ZA 1CEEA 4LS3A 1AU9A 2PGXA 2I8AA 1JQBA 1MVOA 3BB1A 4TV8A 3OIWA 2YJ3A 1HLGA 3JASB 3ML1A 5LSAA 5FLXA 2EIXA 4LZLA 5FKJA 5HZKA 3T5BA 4N6NA 2YNMD 3FVQA 3SEAA 5KJFA 3D2CA 1XN4A 4HBZA 5D3MB 3ORQA 5I4BA 1V11A 2GCOB 3O9ZA 4X5OA 4UDNA 4HX9A 3AUXA 3BSYA 1U6IA 4DRXA 3GAMA 1WM1A 3CX4A 5CCDA 1J25A 1MX5A 1XMXA 2J3KA 2VJLA 3FPJA 1EDOA 1P44A 4JVMA 3GC6A 3T0FA 1R0XA 2MR5A 2EGUA 2F9MA 2YDYA 2QY9A 3F7TA 4P36A 3HCCA 5L7TA 1DWOA 1U2DC 3WDLA 3PEWA 2YHIA 4ZK2A 2AK3A 1GXSA 1W4BA 1Z37A 5DHQA 4CZ2A 1AK2A 4V0QA 2X0IA 2XQKA 3MEQA 1J42A 1VGQA 2ZVPX 5CLJA 4MXDA 1PDVA 4UTXA 3QOXA 4A6XA 3RRXA 4CIBA 4A8PA 2EYUA 3BFJA 3CA8A 3ENWA 3VR1A 1WQ4A 2VZLA 2Q0SA 1LA2A 2XUOA 4J16C 1X2BA 4A26A 4OQXA 1LI5A 1WPGA 1R8QA 2GWRA 5CB6A 3EEOA 1RCUA 1TM7E 3ZIDA 2ZRGA 1LNSA 4MV3A 1Y9EA 2LW7A 2PT7A 4EYQA 2CXXA 2J6CA 3KT6A 1Y8CA 3IAM6 4A5SA 4PX2A 4KMOA 5AJYA 1C9DB 3QEJA 4X0EA 2YXBA 1Z6PA 3Q5GA 3AKDA 1T9DA 3RROA 1C0PA 3PI7A 5JYCA 3HFJA 1GKLA 4MUJA 2FRXA 3B3JA 3DA8A 1WXDA 2QD1A 4F2GA 4DDWA 4KN6A 4YAIA 3I6ZA 2MSEB 4DMFA 4RLFA 2LIPA 3ZY4A 3HB1A 3PBKA 2IW3A 2XE8A 2FR0A 2BRUA 2HT6A 1D7AA 1ULTA 2VF2A 1UP7A 2Q0HA 5I7OA 3PPXA 3T7TA 1FXWA 2C4NA 3Q7QA 1WXWA 4OYHA 4XE5A 2ECFA 4OXQA 4DEVA 2RI0A 4KQMA 2IBTA 1ORTA 3EWIA 2HJVA 1SEVA 5THQA 2B9EA 5ENDA 3A2MA 2VP3A 3VMFA 1QVVA 4ALKA 5B12A 1B2LA 1Z2DA 1YL5A 4L73A 1PR3A 3WGZA 2Q2QA 3NWEA 4FMCB 4BCDA 5SYNA 3PZBA 1G17A 1GDTA 4XJXA 2BTOA 3HN7A 2Y4OA 2AMYA 5EE5B 5TY0A 4DMGA 1XE3A 4C5CA 2QTBA 2R85A 4ALMA 4EKEA 1GITA 4ARCA 3Q7SA 4Y6QA 4P84A 3II6X 2OZEA 3L7BA 4PSVA 2HU2A 1DJQA 1G8HA 4DDKA 1VIAA 3HB7A 4N8SA 4AY3A 2WG1A 1A8SA 3UJ9A 2YZNA 3KQVA 4HEHA 4P81A 1HG0A 2NT3A 1O58A 4Q7QA 4U6NA 2CNLA 1I6MA 1BGVA 1BJTA 2Z8YM 3B3FA 3DLAA 3OCXA 3VFDA 2ODWA 4UBLA 4EG5A 4MGIR 5BR8B 3K4QA 4TXLA 3UOAB 5EHXA 3OEYA 5I3ZA 5IWAB 1PAUA 5HF9A 2JI9A 3OMWA 4HLQB 3SYKA 2X3UA 3FIUA 1ZP6A 5DM4A 4OQMA 1UFQA 4KPGA 2QLBA 4I8XA 4Q03A 3FNGA 5H5JA 5B1HA 3OIYA 3H97A 5C51B 1YS2X 1ISGA 4Y9RA 5FL7D 4KHPB 4DE5A 2A3NA 2F8MA 1DO8A 1N77A 2WYWA 1UCFA 1OZHA 3AK4A 4B74A 5A62A 1AV7A 2ZKIA 4JIGA 5IKXA 1EXNA 3QSYA 2VYVA 3RVMA 5ILGA 4C4YA 1L7DA 1ZXBA 3CX7A 2NU8A 4Y2XA 3CJQA 2HWKA 1PG2A 1OPXA 1V43A 1JIVA 3ZBQA 4DSTA 1F2TB 1Z17A 4PZDA 4UCFA 4U3JA 4UULA 1MOPA 3DXXA 4UUOA 2RG7A 3WGJA 1N7IA 3QZUA 4NEQA 1XZBA 4M55A 3NTUA 4JODA 2C82A 4H7KA 4FDAA 4LJ4A 4Y1FA 4DNQA 2RJ3A 4CIAA 4HDCA 4Y2VA 2KBFA 2JAOA 4MA4A 3TLJA 2G72A 3IKJA 1JQLB 3N8KA 3WTBA 4EF6A 5KVQA 3UJ6A 5JMTA 1XTKA 1Y5IA 2WMOB 3KO8A 2YJ6A 3ZY3A 3CM0A 4PHFA 1FDOA 2IYPA 3AJEA 4TV9B 3M6IA 1YCFA 4LF6B 4GGPA 4BNLA 3P4YA 1T26A 1XAIA 2K5UA 3IIIA 1QE5A 4FR5A 2B4AA 1Y7TA 5K0SA 5A7GA 2BH2A 5HF8A 2EX4A 4JB3A 1TEHA 4L5YA 5CX1A 1E1CA 4Y30A 4CTMA 2OFOA 1AA9A 2VHWA 1F8GA 1BCSA 2XZPA 3FVRA 3NVDA 4HNAA 5PGMA 4EDHA 3M34A 4B3XA 1BEEA 1HDIA 3ABQB 2RH9B 5JQGF 4B0PA 4GXNA 3HY3A 3DLPX 2PHZA 2QTCA 4AJJA 3OM1A 2IPXA 5DLPA 4B3FX 4DIUA 1HDEA 1BXKA 5AOVA 1IB0A 3AVOA 2XUGA 2GK7A 2AXEA 1U8ZA 3RUHA 5BP7A 1BH6A 4LWOA 4PTZA 1F48A 3DYIA 4KR9A 3CWCA 1KEEB 4NSNA 3DAFA 4QGBA 3IFSA 5A6VA 4BNVA 1J23A 2WJZB 3OLCX 1SQ6A 5DGTA 4PZZA 3ODGA 4OO3A 5BSRA 4ZO8A 3STTA 2A4KA 1PEYA 4F3RA 1W1WA 3QLVA 4NPCA 2VP6A 4LA4A 4D8UA 3JAWA 2GYYA 2ZSHA 2QGZA 1ECJA 5CAEB 1EM8B 5CNIA 3A3YA 1RYMA 1T2VA 2Y0CA 1HGXA 3CNNA 3IX7A 3MTDA 4RPCA 3UFBA 4OH7A 4ZN6A 1VP9A 4R9UC 4EGQA 1AQYA 1FMLA 4EA9A 3DBRA 4Z8XA 3KSZO 3ED1A 3X2FA 3R20A 1RSZA 2F9LA 5IDQA 3C1AA 2W7TA 2BEKA 3PNQA 3WLOA 4F1WA 1KJ8A 3PWZA 4MR9B 5TX7A 4G36A 3RSZA 4H35A 2JLVA 2VYFA 4F3YA 4C88A 2Q2NA 1THGA 4HLUC 1H5NA 4BNUA 3IEUA 5C80A 2QZ4A 3GIDA 2GPSA 3RS5A 4Q6WA 2JIDA 3RVNA 2OCLA 3IB6A 4PYMA 4DNFA 4QYXA 3L79A 3AETB 4WZZA 6ADHA 1DZ3A 2A0UA 2WHQA 1E5DA 4HB0A 5KTNA 5HFAA 1E6KA 2V7QA 1T0JB 4I1VA 4JI2B 3FPSA 3MOIA 3TDMA 2BJWA 4IYJA 3TSAA 2V3VA 4OJTA 3ZCTA 3HB9A 3EQZA 3OUZA 4JJ4A 7REQB 2LCIA 4X45A 1ZINA 4QOSA 2R1ZA