2SNIE

Structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN NOVO
publication title Structural comparison of two serine proteinase-protein inhibitor complexes: eglin-c-subtilisin Carlsberg and CI-2-subtilisin Novo.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (proteinase/inhibitor)
total genus 96
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1988-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sniE00
1P7VA 4M1ZA 1S2NA 2W2QA 1SBNE 1BFUA 3DE7X 1Y34E 2WV7A 5ARCA 4CFYA 1C9MA 1XF1A 2SECE 1GCIA 3SICE 3I2YX 1WMDA 3DE0X 2SBTA 1SBTA 3TI9A 3Q40A 3DE2X 2Z58A 1VSBA 2DUJA 3DDZX 1IAVA 1SUDA 3DE1X 1ST3A 1SCBA 1SUAA 5AMXA 5CW1A 4FONA 1TO2E 4J94A 1SCNE 3CNQS 1V6CA 4OMCA 1GTJ1 1PFGA 3LPAA 1C3LA 4DWWA 1SUBA 2IXTA 3BX1A 3DE3X 2HPZA 5B1DA 1YJBA 1SIOA 1OYVA 3ZXYA 3EDYA 4Z2AA 2DQKA 1EA7A 1T1EA 2P4EA 3EE6A 3VV3A 1GA6A 2W2MA 4NE7A 1GA4A 2Z2ZA 1YU6A 3DE6X 1ZVKA 1R64A 1GNVA 5JXGA 5AVJA 4C3VA 3F7OA 5AVKA 1DBIA 2X8JA 4BWGA 1NDQA 4GI3A 3VYVA 3WIVA 1SN7A 1Y9ZA 2PYZA 4ZOQI 1Y3FE 5B1EA 3VV2A 3QMPA 3I30X 1THMA 1Y3BE 1WMFA 1C9JA 4RYDA 1A2QA 1ZVJA 4DJ5X 4LVNA 2Z2YA 1MEEA 3DVQX 3CO0S 4CFZA 4OV6B 5ARBA 1S02A 4OMDA 5SICE 1GA1A 4HX2A 5K7SA 1AH2A 5AQEA 1AU9A 3DVRX 3I37X 1TM7E 1R6VA 2Z56A 2PQ2A 5JXIA 3LXUX 1IC6A 3LPDA 1WMEA 1TK2A 4JP8A 1NDUA 1KE1A 1WVMA 1SBIA 1TM3E 1SUCA 5JXJA 1Y33E 4C3UA 4AKTA 4CG0A 3T41A 1CNMA 2SICE 5JXHA 1SCAA 4WOBA 1TM4E 1SIBE 1SUEA 3H42B 3WQBA 4AKSA 2PWAA 2Z30A 3TECE 1DUIA 1AV7A 3LPCA 3WIUA 1Y4AE 1UBNA 1KDZA 3GT3A 1GT91 1AQNA 2SNIE 1HT3A 1GNSA 2B6NA 3SQOA 3I34X 4NE9A 2W2PA 4WOCA 1AK9A 1Q5PA 1YJAA 1Y4DE 3DVSX 3D9QX 2XRMA 3WHIA 2ID4A 1S01A 2Z57A 4H6VA 1SCDA 1MPTA 3DE4X 3A3PA 1TECE 3UNXA 3GCWA 3OSZA 1AF4A 3DE5X 3Q5GA 2E1PA 1P8JA 5FAXA 1T1GA 1SBCA 1SVNA 2ZWPA 5FFNA 1OYOA 1SH7A 1LW6E 3GT4A 1Y3CE 3DWEX 1GTL1 4HVLA 1TM5E 4H6WA 3QFHA 1SPBS 1R0RE 3F7MA 5ARDA 3HJRA 2W2NA 4ZARA 4I0WB 4NMXB 3VSBA 1BH6A 1KDVA 3DW1X 3P5BA 1BE6A 2GKOA 3BPSA 1NLUA 3PRKE 4KG7A 3VHQA 1YJCA 5JMOA 2WWTA 3BGOS 3D43A 1C9NA 1KE2A 1Y1KE 2PRKA 4MZDA 1Y3DE 2PMWB 3ZXXA 1BJRE 2ZRQA 2X8JB 4B5LA 5I9SA 2G4VA 3AFGA 4LVOA 1PJ8A 1KDYA 3L1KA 2PWBA 3F49S 1TM1E 3DYBA 1WSDA 2V8BA 2WUVA 1OT5A 2XTJA 4K8RB 3QTLA 2DP4E 3TI7A 2W2OA 2ID8A 3DW3X 3A3NA 4KPGA 2ZWOA 1SCJA 1BE8A 4DZTA 1AVTA 1SIUA 3AJ8A 1P7WA 1BFKA 2PKCA 1TO1E 1PEKE 1CSEE 4KB5A 1JEAA 1SUPA 1V5IA 1T1IA 5FBZA 2TECE 2Z2XA 1SBHA 2ST1A 4H6XA 1SELA 2WUWE 3VTAA 1EGQA 3AJ9A 4YN3A 1PTKA 2QTWB 3PTLA 1ST2A 2HD4A 3A3OA 3EIFA 1Y48E 3GCXA 2IY9A 1GTG1 1TMGE
chains in the Genus database with same CATH superfamily
2WKPA 2PX4A 2WWHA 3JASA 1ONNA 1ZKDA 1A50B 2IQIA 2GXUA 4FE3A 4BGEA 5HOEA 2Y66A 1WB4A 5KQGA 1S2NA 2PMDA 2QIPA 4JB0A 5EMNA 4HZIA 4JBYA 4UNSA 4FI3F 1XNGA 3J80A 3LYLA 3MMZA 3PI7A 1CX9B 1FB5A 1G2IA 2J5KA 4ZVPA 1E61A 5K09A 1WHSB 3LSTA 1RI2A 2JJ8A 2WTMA 2WV7A 2NU8A 3VPSA 4JS0A 2Y4NA 3LUBA 3ABOB 3GQBA 3A7DA 5EKDA 5BSHA 2H08A 2B1GA 3WYCA 4GT1A 4O29A 5FXMA 4L4UA 3HKCB 4ZQIA 3ZXSA 2CXXA 4BXOA 2C1EA 2G67A 4EGSA 3IV9A 4MKZA 1VL5A 2J9ZB 2UZ1B 1L0BA 3DOCA 3RKRA 2ZXFA 3DAGA 4PR0A 3W8EA 4C9BA 4DDMA 1V5FA 4MW2A 1CJUC 1AMUA 3K53A 1A9PA 2BKAA 4AKEA 2TSYB 4QGAA 4S12A 4C2AA 1REQB 4LE0A 3F6SA 4CKEA 1RBZA 5HJEA 3KQNA 3MWJA 3IXLA 2A78A 3ANTA 1KAHA 2ZIUB 4MV1A 3V1TC 3OPQA 1NVVQ 4WCDA 2MSEB 5F5LA 3RFXA 2EG5A 3EUFA 2WY2D 3OEYA 5IYZB 1YS1X 2Q1XA 3K31A 2OECA 2NPFA 1SD5A 1EXMA 3AC0A 3K3PA 3TW6A 1TQ2A 3IBYA 3NM5A 3QBVA 3CZMA 2FN4A 4WI1A 5CW1A 2EP5A 3H18A 3TGLA 1ECLA 3L92A 4A82A 3PJGA 4C0QC 3SEAA 2A9VA 2NNLD 3C85A 621PA 1SKBA 2P6MA 5BSUA 2AD5A 3NM4A 1TAQA 3QXHA 4OP3A 1LC3A 1J7KA 4UFOA 3TLKA 3W5JA 3O8BA 4YYZA 2IXAA 3TH5A 3PSHA 4V1CB 4Q6BA 4F8EA 1G4AE 2BZ1A 3TIIA 3ZWXA 2WWFA 4GNKA 4N0QA 3LUGA 3TPFA 3DXYA 2VUSA 1P62B 1X7DA 3GEPA 3LP8A 3OZSA 2X7JA 2HBYA 3DT9A 1ZL0A 1OLXA 1X77A 1VKOA 2DTDA 2PM8A 5IYZF 2A0YA 5DW3A 4DQKA 4EJMA 1E99A 3TQFA 1AN0A 2JEZA 5KNBH 1AUVA 4I81A 5EMJA 1QAQA 4LISA 3SE0A 2H6EA 1JHRA 2QI9F 5KJFA 3H5IA 2Q28A 4FD3A 4ND5A 1J2EA 4BWYA 2PH5A 1GNPA 5ADVA 2W37A 1GRNA 1WUKS 3KIPA 1XGKA 5CH8A 2WYVA 2Z8ZA 2OK8A 3W1WA 3QIVA 2B3TA 4OXRA 2Q62A 1L1QA 4LVUA 2I6XA 1M34B 1SVWA 4GL2A 1L7MA 4MRRA 3RD5A 1JIIA 4XDGA 5HKKD 2VPZA 3MTQA 1NN1A 1OBCA 4MMYB 4OKIA 3V1NA 3I5XA 3DC2A 1FU4A 3W5SA 3IQWA 3DNPA 5L9AA 5B3JC 1HYGA 4LVCA 1B26A 3DV0B 1GZ4A 3ZVKA 1IVSA 1ABFA 1RRFA 1VFNA 1WSAA 4LXHA 1IBSA 5EHNA 5LQMA 4ABTA 3IL2A 2X8LA 2WZBA 5FL7A 2OGTA 3LIIA 4Z4EA 4BX0A 2XB4A 4OQEA 3EIHA 1FU7A 2RAFA 3LLSA 3UKJA 5ALKA 3VPFA 5IKXA 2IODA 4PZ0A 2X2PA 3U1TA 4UTVA 1QDLB 1JTVA 4W9RA 4AMUA 4KJXA 3IJEB 4KQXA 1G1AA 3DZFA 3LMKA 2BH9A 1CY1A 4AULA 1PWHA 4HT3B 3EE6A 5KQRA 4P0PB 1RAHA 1JHOA 2GHTA 1SBZA 4Q7EA 2JLBA 1NW6A 3X1JA 3V7UA 1C0EA 1KYWA 1H66A 3VSEA 2IX3A 2H54A 4UCFA 3CG4A 5JZMA 4B6FA 2MYUA 2C92A 1N2CB 3QITA 1CNEA 4FOSA 3H5OA 3W5AA 1P1BA 3D0RA 4EY7A 4HNTA 2RGRA 3AUJB 1NN5A 2CMHA 3TLAA 3GLSA 4MNTA 3K6SA 1BN7A 1D4OA 1VTKA 1V7PC 4QO8A 1Q1BA 1R64A 4D3ZA 4ZK2A 5TQVA 3BBPA 3VXKA 1H2ZA 1JQLB 3OX1A 4I9HA 3S2FA 3PPXA 2BUAA 4PNHA 2EL9A 4WESA 3C6ZA 3MJDA 1JPUA 3OIWA 4HH3C 5H0IA 1S4MA 1EJ6A 2O7RA 4I66A 4R2KA 1XQ6A 2QSZA 2ZJ5A 3GUZA 2R48A 3I5YA 1EDDA 2J3HA 5FEMA 3KTAB 4GI3A 5K3AA 1XZCA 5GINE 1CP3A 4XCXA 5TRTA 3NOQA 1RHRA 1CR6A 2QTFA 1APBA 1JG1A 1MGOA 1TYCA 4KXXA 1NLYA 3KWFA 3ZZMA 2YVAA 1ECJA 3L0IB 4JK3A 1HFWA 4NE2A 1KK3A 1NM5A 1O58A 3URKA 2PYZA 5IJ9A 4BBPA 4ZOQI 2ECFA 1EEXB 2C54A 2AYXA 5JRDS 3OURA 4RHTA 3VV2A 3WS7A 2F00A 1L9KA 4WZBB 5GOTA 3T0FA 1ZD5A 2I76A 3QVWA 1BX0A 2JIQA 2E6UX 2R66A 3MJTA 5A3JA 1XCMA 4RU1A 5IMSA 1OAOC 1AIPA 4BQFA 2HPHA 3NFYA 1QRTA 4WNYA 1OZFA 4HXYA 4DLVA 1AX9A 1BKDR 1WTCA 1YUNA 1U1IA 2G6BA 2EQBA 1ZVJA 2L2QA 2NYVA 4P5EA 1J0CA 1FFHA 2BEKA 4CEIB 1CUVA 2X9GA 4D80A 2WA2A 1B2RA 4RQTA 4ARZB 1FNNA 4MWGA 1XAJA 3CGGA 3OU7A 1LI4A 2C98A 2CFCA 4BO3A 2BMFA 4IPTA 1I7SB 3NXKA 1P1IA 3K70C 3ASZA 4L95C 2BFMA 1Z4LA 5IUKC 1V8BA 1O9BA 1BO6A 4X8OA 1JI0A 2XTAA 4LXTA 4HSEA 4K2HA 2IV2X 3W5BA 1W85A 2A6PA 1RM3A 1HMYA 1ZXLA 4MUKA 3A9WA 4OMDA 4AROA 2QRLA 1G5QA 1P9RA 4P4NA 1KEEA 2CHFA 4B17A 3U44A 3EH2A 3NTUA 4RV5A 4UNRA 2JFGA 1TPYA 2B37A 4R3NA 5AO9A 2AE2A 3WGUA 1J23A 2IU0A 4KPEC 3I37X 7GPBA 4ND1A 5CP8A 1RWKA 1L1RA 2VP6A 5KVVA 3OWHA 4BJ1A 4J6EA 4F9EA 1Z2AA 2VFAA 5P21A 3WI7A 1R0XA 2P40A 1V7CA 1XL1A 3O1JC 1X80A 4TL8A 4Q7MB 4OVKA 2Q6VA 3ESZA 1CY8A 5K2MA 3R9XA 3O9ZA 3KYDA 4YAEA 1IC6A 2QN1A 1D1TA 2X1MA 3OE7D 2OVBA 2H9IA 3BSYA 3IURA 1QFJA 5LR6A 2CHQA 1L6RA 3BTVA 3FSRA 1PAUA 1EDOA 4PSAA 4LGVA 2H1CA 2ZRDA 1CJCA 4FHZA 1BJTA 4RMNA 2WIJA 4OYLA 1H1LA 5DI3A 1JG7A 5EJEA 3AHFA 2P9JA 1WVMA 4OUDA 3SR3A 1RPJA 1SBIA 2CNKA 4J75A 3C48A 4H1HA 5HK8A 3GFRA 5JXJA 5LLSA 1I9CA 1EVEA 5C8ZA 3GWZA 5IVIA 4BCBA 2PT9A 5CFNA 4F45A 2P6NA 3AFMA 3R4VA 4L0QA 1DO8A 2QAGA 3BWYA 3GDOA 4LWZA 5FTWA 2VDJA 3VSAA 2JGKA 3KHKA 1T5HX 3MTEA 3NZEA 4ZJYA 3VPAA 2CY0A 1X42A 2YHIB 1MAVA 2MIIA 3B6ZA 4RK6A 1E1KA 1QOZA 3VPDA 5JAUA 3VPCA 3BG5A 5LZ7A 2GAIA 1HMPA 3SJUA 4HEA1 4HPJB 5ENDA 3V7NA 1CUGA 2DLCX 3TO5A 3WK6A 1JQKA 1WHSA 4QICA 3R7BA 2R6JA 4AKSA 3TECE 9MHTA 3AY3A 3HVHA 4KRYA 3BWEA 4GPEA 4HAWA 4MYDA 4RMHA 2GN0A 1GZVA 3HKCA 2WABA 3QW2A 4GM0A 1UKBA 4IBOA 4MVJE 5HE9A 2PMEA 3RYIB 3I73A 4B4WA 2UZ1A 2PUWA 3BB4A 4EG3A 1K4YA 2IP4A 2Q2OA 4G6ZA 4MLPA 1SD1A 2OGWA 4CCSA 1PS0A 1EIZA 1SWVA 1N5KA 4OLJA 2XT0A 1TYZA 3P9XA 2FI1A 4ZQBA 3UW3A 3WNBA 1ZWLA 1L5NA 2CWDA 1GFSA 1Y6JA 3CE6A 1REQA 4MEJA 3DHNA 2UYCA 1IB6A 1U9IC 1FLNA 2J7PD 2J0SA 1VL1A 2BYTA 1TCAA 3BMQB 4TT3D 1J25A 1T5LA 1ULZA 2O2YA 4O3MA 2I6FA 5JSHA 1VE6A 5KNCA 1XTSA 2WHEA 1ENPA 3NEAA 4K6MA 2AJBA 4RXUA 1DQSA 5IYZA 3CM0A 3KQOA 2G36A 2Q4BA 2YMMA 2OHIA 3OT4A 5IC4A 3OQMA 1BIFA 5JMWA 4RSMA 4IG9A 4OLAA 1GG9A 2X2OA 5KC8A 4BQSA 1RJGA 2IELA 2FNAA 2PV7A 3A37A 2XD9A 3G2MA 4FZVA 3WMFA 1YV9A 1QTIA 2WIGA 1GT6A 2JJ2A 1CVIA 2Y3IA 1DJOA 2HHCA 1YZHA 1MPTA 2EF0A 3FB1A 1BS1A 2ADOA 2G0NA 3LU1A 4YR9A 2UUAB 3AY7A 2EF1A 2R3SA 2VLIA 1TECE 3RS3A 1MLDA 3K6KA 3OSZA 3MMSA 4KPFC 3ZDXB 4CTOA 5CXUA 4V1CA 1O6GA 2CDRA 4JJIA 4PYNA 1BXRB 4LF6B 3NHZA 3GXBA 3F3MA 2M6RA 3P2JA 4Q3KA 1B6RA 5HGJA 3ORSA 1IZ9A 2D1SA 2I7DA 1NU8A 3IX7A 3DV2A 3EOZA 4DLLA 1JN0A 1OX4B 1W4CA 1YFKA 2TYSB 2FUG1 4PX3A 1J8VA 3EK2A 1Z7WA 2H0AA 1E3QA 1IY8A 4UCWA 3HUTA 3VI3B 2XNSA 4BY9E 3JQQA 3A14A 1YZLA 4KXUA 2GVNA 3ET5A 4EUNA 4YCBA 3GG2A 2VAVA 2PV0A 3ES9A 3OFJA 5FUBA 3CH6A 1FUKA 3BULA 4BNGA 2CCJA 1S7GA 2IU4A 3N8GA 1PTJC 3DS8A 3ONFA 5B58T 4YAIA 1M34A 5JADA 2HRDA 3KSAC 1BH6A 1IHPA 1QVRA 2PQMA 2ZZMA 2ATCA 4OHZA 1SXGA 4TUYB 2GBLC 2V54A 3GJ4A 3CKYA 1B93A 1WSWA 1VPLA 2W6ID 2HCRA 2H07A 3KDAA 5CXXA 2Q8NA 1ZWKA 2VDKB 2IF2A 2VF2A 3DV0A 3ONWA 1CJVC 3M8KA 5DYWA 1T3LA 2SKEA 2I1LA 1OREA 3AY6A 3CBGA 1P2FA 3PXUA 5F1OA 4DLPA 5IT4A 1GDHA 1ZX1A 3BE8A 5TJHA 4PBSA 2BM0A 4TMFA 3DTNA 5EPEA 2V4MA 2NV2B 2A5GA 4E07A 2WP0A 3T9FA 1JFRA 1OKKD 3EGXB 1YIAA 2RH9B 4FCVA 2HU5A 3BF8A 4OK5A 4AJ9A 3ZCUA 1MIOB 1N2CA 1CZHA 4KR2A 1Z0IA 3ORYA 4RUKA 3G9ZA 3RC2A 2I7CA 1D2GA 1T1JA 1U1FA 3PK0A 3T3HA 3OUTA 4G23A 3BD7A 2Q3LA 3NHFA 1JKXA 2Q7DA 2UU9B 1PGOA 3A32A 1SZCA 4N5NA 1ZD1A 1BDHA 4OX9Y 3BL6A 4IF6A 4UJ5A 4V2IA 5FX2A 3JQAB 3H0KA 3Q2OA 3LRTA 2R00C 4KGZA 2OCBA 2HBQA 1ZGHA 3U1VA 4D0GA 3KTAA 3IUJA 4RIEA 2O19A 4A1FA 4WECA 1FDSA 5IT0A 2BTEA 2AYZA 1H9CA 1J5EB 2BSXA 4FJ1A 5ED4A 1CJBA 3BQNB 1IM5A 1AGRA 2I55A 4I4LA 3TZEA 2W2OA 4NK5A 5JAIA 1SO8A 2A5FA 4Q3CA 1E59A 1D9XA 1U04A 1RSZA 5EXEA 4WZBA 3ZDDA 4TZ0A 4UCQA 3OQIB 4Q3LA 5AT1A 3EY9A 4E14A 2GLXA 1OJLA 1QRAA 1MFPA 1R5OA 5K8TA 1FTWA 1KJZA 5I7OA 3GLGB 3PR1A 4J16A 3DFKA 3NGXA 1J42A 2PXHA 1AQUA 1Q16A 1WW2A 2R1VB 3GGPA 1VL0A 4QT0A 4TQUS 4IHQA 5IEBA 3AF5A 2QN8A 5T8KA 4K9PA 4C21A 5L6MB 2PE5A 4KXYA 1BFKA 3L8YA 4ARZA 3LGAA 4D6XA 2NN3C 2A14A 3CN7A 4JYMA 5EP2A 5I9IA 1HZZC 5L4SA 3R3HA 1WOYA 2C8LA 1F8FA 5AKZA 2QZPA 3P9IA 1IN4A 3PGVA 5A5FA 3IOBA 1ETUA 4OGGA 3NW9A 2XT9A 1W0KD 4MQUA 1W7AA 3WDMA 1NJ5A 3PI6A 4OQLA 1SA0B 3TNYA 4DBVO 1B3BA 1VKJA 4PEVA 5LQUA 3KWJA 1V25A 5T67A 4KYVA 4NU5A 1SC9A 3HCDA 1C41A 3NJ8A 3FCAA 3NTOA 3JVVA 4N82A 4TWAA 1QDEA 1X0XA 1ZJ5A 3NRJA 4HDMB 1D2MA 4V3CA 1USWA 3KR2A 4YGYA 2J0QA 2QT1A 4E21A 1GWNA 5B30A 3VTAA 5KWEA 1XFDA 1PO7A 2ZFUA 4JWKA 5LP6B 2P69A 4RADA 4GOOD 1EGHA 4LS3A 5B1HA 1XWIA 1X7WA 1EE9A 2G8LA 2HOQA 3R0JA 2P1RA 4L57A 2QRQA 2XECA 3DF7A 1C1XA 1XZHA 4U7HA 4YDRA 5LQJA 3ZW9A 3F6YA 3VHRA 1BJKA 4BMCA 1RIIA 2GRUA 5E1BA 1T2UA 5J2UB 3LDGA 3PGKA 3IDQA 1NVAA 5EG5A 2I99A 5KU1A 3GCXA 4HLUA 2I2CA 3HU2A 3RRZA 1TMGE 2QN9A 1KTVA 4C3ZA 1V7ZA 2H48A 1Y5RA 2OK7A 2VJYA 1FLAA 4YJKA 4BVGA 2HLNA 5C4MA 1FVHA 1NVDA 1ECFA 1ZK3A 4PZPA 4LX8A 1T3ZA 1RR6A 1Y0BA 721PA 5HOQA 4ZAVA 1E62A 4W1SA 1Q17A 2V5VA 3H13A 4D3DA 1ZESA 1U11A 3KEOA 2ZRGA 3T99A 5LUAA 2PZKA 3IJPA 5ISMA 3FWZA 3N5CA 2ZXUA 1DHRA 4XM1A 4ZOEA 4ZAXA 4CFYA 2YHIA 3FNRA 2SECE 3R8FA 4DLZA 1P0PA 1B7GO 4IIXA 1VCMA 1PFYA 5DBOA 1Z6YA 3W5UA 2BGGA 2IITA 2JLQA 4LBVA 1A8IA 2VDWB 5IU6A 1Q0LA 1IWPB 1XZ8A 3LQRA 4KW7A 1XVIA 5AHXA 1FUYB 4PG8A 3EVCA 2Z3VA 4H7DA 3GLFB 3PGA1 3RYIA 2R751 1PWZA 4OIMA 1QV7A 4AN4A 2F9LA 1UK9A 3TR5A 2DUJA 5JEDA 1XOIA 4AYTA 3AKCA 2ZREA 1QFXA 1H2RS 3C3BA 4P4TA 3BHJA 1KNXA 1ZRHA 2Y1LA 2HWUA 3ACCA 3AEQA 3C4JA 3CBQA 3DDSA 3A9VA 4G56A 5AW4A 5JBIA 4GU5A 3OQ1A 5K3EA 5CT4A 4FBMA 2LKDA 3BMQA 2PUFA 3UPDA 3GWGA 4RZHA 4UATA 4CMCA 5COQA 4HNUA 2NYRA 1VLLA 3IHLA 4UZFA 2V6GA 3PRHA 4QLAA 4IX9A 2GGSA 1A5ZA 2C5HA 4A6DA 3HDQA 4FDVA 3C2QA 1GZHB 4GICA 4FGSA 4HVAA 4HNVA 1GEGA 2P2YA 4M98A 3UB3A 3M6AA 2CNWD 5C7OO 4XARA 1VJDA 4MUEA 3LUHA 2CLLB 4LK3A 1RCTE 5B2FA 5JY1A 4DUYB 5EEHA 4OY3A 2PQ6A 3H2BA 5E9WA 1CR2A 3K35A 4DC1A 3RREA 3G9QA 4UKDA 4LEIA 1K75A 2I8CA 1GKKA 3X0DA 2HDWA 3M9LA 4WEQA 4N9WA 4RQBA 3BREA 1IZ0A 2AEMA 3ML1A 3O03A 2J67A 4XSHA 4AY4A 4NCIA 1BXRA 2Z2IA 3ZDCA 1BDBA 4B6QA 3EVFA 3PE6A 2X9QA 4HDQB 4NU8X 3UJCA 2VTBB 4DRXB 1FW6A 1OX4A 4U9HS 1HG0A 3GFOA 3GDWA 1MX1A 4D8YA 3F78A 3TL6A 2EYUA 3HR7A 2QN6A 2FW6A 3RAEC 1VMAA 3IT1A 4PRLA 3NHSA 4ZAZA 3AR8A 5I47A 2WICA 1SOMA 2Q3JA 1JSRA 1RE0A 3AOEC 3WB0A 2Q46A 2YZ7A 3RIGA 4LBWA 4A0HA 2ZR9A 4ARVA 1ZW6A 2R8PA 4TX1A 2PBRA 3TEJA 1LPPA 2YN2A 2FFJA 3KAQA 2WTAA 5DM0A 3ZXYA 3WYEA 4TUYA 3F67A 2V45A 4WEOA 4RDXA 2E4VA 3BTUA 3NJ4A 4O5OA 5LSAA 4Z0TA 4B35A 3L7JA 3W9SA 1MXHA 2QB5A 4FKZA 1SUFA 2FZKA 2QAJA 3MRXA 2XDQB 3KCQA 1GAXA 2J3EA 4OXQA 3LGXA 6CHYA 2CGEA 1EUDA 1BRMA 2H7CA 5KNDA 2Z2ZA 3HBMA 2FGKA 3V9AA 3ABSB 3EIOA 4H0FA 5G41A 4TN5A 1ZVKA 2WHRA 3W6UA 2QQFA 1G8KA 3CO5A 3EGXA 5KPDA 1YL7A 1U0NA 2H8KA 5ICSA 4TTRA 1BMDA 2CUKA 1W76A 1L4UA 2QMEA 5JAMA 5JNRA 5E38A 4Y1GA 1MIOA 1WAMA 1PSZA 4QLBA 4LDAA 4AMGA 2OORC 2HBRA 1ND5A 1R6TA 2V6FA 1TQHA 2AUNA 4HXEB 1DG3A 4YXWA 3TWOA 3GLIE 2EBUA 4EG7A 4EQZA 5J4YA 4M7PA 3BC1A 1RQPA 5F64A 3AONB 3CH4B 3CUUA 1RWWA 5T3UA 2J32A 3C5WP 4ZQFA 3RQIA 4UOQA 2JGIA 3GXOA 1X1EA 1W5BA 2G1UA 3GIWA 4LOKA 4QQ8A 4BBAA 4QXQA 2Y1KA 3JQAA 4FKBA 1W8IA 2DKOA 1IQRA 5K1ZA 4J7XA 3WLKX 4L5CA 2WAAA 1H2EA 1Z2DA 2ZB3A 4MULA 2YOHA 2VOJA 3ST7A 4JJKA 1W0JA 4LUCA 5B1EA 3ZIAA 5JWHA 2HGSA 1GZ7A 3T1QA 1LDYA 2I33A 2QTTA 3KZ1E 4R4JA 2NV0A 4NFSA 1AF7A 2D7CA 1DFIA 3DCJA 3KZCA 1M7GA 1HDEA 3HXKA 3M4YA 3LY9A 3R7NA 2DWUA 4A91A 4JB8A 3CKKA 4FX2A 5HXAA 3F6CA 2GUGA 2NO7A 3L6OO 2CZQA 2FW9A 1EJ2A 2X76A 5HDBB 2C20A 3EULA 3VBCA 5LVAA 5DNYB 1A2OA 1KO8A 3OQIA 4X6UA 2BHLA 4DGQA 1ZIYA 4NZPA 3RTCA 1DQPA 3R5SA 3OESA 5EZ6B 4DJFC 4CEJB 4LIPD 3U3OA 1J70A 4AB1A 2FX5A 1QQ5A 4OGWA 4Q9DA 1B8OA 1UBSB 1W96A 2G9ZA 3B2QA 4GC5A 3KHSA 4PLTA 8LDHA 3GLGA 2R1VA 1S02A 3HFGA 4JR2A 4L73A 1LNSA 2FG7C 3UFXA 1CDDA 1A4RA 2GFQA 3C3KA 3ZLUA 3WAGA 4PYRA 2WOJA 1E6MA 3EAFA 3OLXA 3UCEA 4EYKA 4MUFA 2XVYA 4O1HA 1UZAA 1P39A 4LTNA 1RWMA 4FFRA 1JSXA 1U2EA 4IQ8A 1AH2A 1SRQA 3CGWA 2G25A 3WL7A 4UTRA 1Q20A 3MSXA 1V2GA 1M8KA 4O02B 2AGVA 1U65A 2JAQA 2PQ2A 4JMLA 4RANA 4CZ2A 1MHPA 4KAFA 4PLCA 5IJAA 3PGLA 3L7KA 3P2IA 3TX6A 1SA0A 2KJQA 2OTCA 2QTBA 3KOYA 5GV8A 2QM0A 3LS2A 4G67A 4M0LA 3CCBA 5FQNA 4C3OB 4KN5A 4DA0A 1EBFA 1WUHS 1L5OA 4HDMA 2G7ZA 4JOQA 4CU5A 3KVRA 4E1VA 2HDHA 5LP6A 1E2KA 1YBMA 2VP0A 3BZUA 2I5PO 3ONDA 4YUXA 1AC5A 4H1TA 1E1QD 1JEQB 2GJKA 2UUOA 5REQB 4LQDA 5AI4A 3T6KA 1HOTA 2BGWA 3LIPA 5IBPA 2Z98A 3BORA 4QBHA 5G1NA 3AZPA 4E22A 3NDPA 5J2UA 1R4ZA 4DLAA 3ZDZB 4C3UA 1TKCA 3HA3A 5HS4A 1GPBA 4YASA 3U4MA 4YRQA 1YL6A 2XJ9A 5KYKA 2YZ2A 3GIDA 4JELA 1XEFA 1VKRA 4IKEA 4P81A 5JLAA 4BQOA 3VOAA 4OHVA 3VR0A 3RSFA 3VR4A 3ZV3A 4IHJB 1ESNA 3I9OA 4QM7A 2QE6A 2XNCA 1AA6A 1XTBA 1U2DA 3H42B 4HQRA 4XGIA 2X58A 4RPHA 2JEOA 2PWAA 5GTDA 3PC8A 1ZKMA 3GDHA 4JJGA 4MQLA 4WCVA 3RKSA 3TQQA 5H68A 3N87A 3QPVA 1TT5B 2ZKIA 4JNCA 2ZAIA 1E2FA 4P6VF 4R1PA 4WCFB 1PQUA 3WIUA 5LWQA 3K0FB 1UMDB 3L7AA 4OO3A 2BM1A 2QEQA 4MCHA 5CLLA 3FA2A 3OC6A 1ID1A 3HADA 3RRMA 3I62A 2I1WA 2VDWA 3NAMA 2NXWA 3D8NA 3LY5A 4PXYA 5KYUB 3DXXA 1ODKA 2Q27A 3M1AA 1EUQA 5EZSA 1E18A 1TUIA 2X22A 2ROQA 1SOVA 4MQBA 2X0IA 3I34X 5BNZA 3GLFA 2A0WA 2A33A 8ADHA 5AVTA 2VF8A 3M1IA 3V2IA 1XTUA 2Z6UA 3SLKA 2ECPA 2YS6A 4G65A 3A9UA 1LVHA 3NKVA 3ULKA 5KYYB 3RODA 1EZ1A 2N1MA 3L1HA 2XRMA 5CLHA 5HJ2A 3RBZA 3JYHA 3VAYA 1PYOA 3F6RA 3QLTA 3G9XA 1GN8A 3H5AA 1KXJA 2DECA 4FNOA 4J0FA 1U9JA 2ISSD 2Y1OA 1L8AA 1VC2A 5EESA 2WF5A 1YR9A 2IYAA 5IRCD 4BZXA 5EHXA 4R68A 1MEJA 1VIVA 2QHXA 3SE7A 2BZ0A 2VPXA 1NONA 3T7TA 1XHLA 4AMVA 5CBKA 3EEIA 4EA7A 3CZPA 1JQ3A 1S7CA 4EUSA 2ZE7A 4D45A 1HUQA 2BLLA 1ISHA 3D6UA 3OJLA 5K2OA 2GN4A 3CMMA 2ADMA 5BRJA 2Z8YA 5EMMA 2EHDA 3L0PA 3K5HA 5ES4B 4OHFA 5TPWB 2IUSA 3VR1A 4K6HA 3L4JA 4DCMA 1J2TA 4QU9A 5A4KA 4F5ZA 1DINA 3OCXA 2QYSA 3AR3A 4IQFA 1PW5A 2RB5A 3LV8A 2IEAA 5DXFA 1Q0ZA 4NENB 2VJOA 2YY5A 2NSLA 3K30A 3OIDA 3PGMA 3WO1A 821PA 2Q6OA 3HZZA 4G4GA 2FSFA 4LPKA 3AW8A 1EUYA 2VTBA 2RHMA 3AEYA 2LD4A 2ZIWB 4W7HA 2DMRA 4DRXA 2GWRA 3HXQA 3OZUA 2PKQP 1AQIA 2V59A 1OXTA 4H7HA 1MA3A 3OJ0A 3PLRA 2D2EA 2L82A 3EG9B 3KV3O 3L6RA 3L8GA 4ND3A 4DIUA 2ECKA 2XKJE 1KZ7B 4L72A 2JI9A 4EB6B 4PZAA 1L4EA 2O7SA 5JISA 3DJFA 1LPOA 4IICA 3Q8KA 3L4BA 3B13B 4RS4A 5F76A 1K3FA 4NV0A 4KSBA 2ARKA 3Q3VA 4BMVA 1C7JA 4FK8A 1DO0A 1S2LA 3P9PA 1H65A 3DMRA 5H7XA 3UUGA 2E4WA 1KAGA 1BH2A 1O3YA 4EFLA 4F4JA 4UREA 3ZI0A 4DILA 5JQWA 3S81A 3P94A 3D31A 2JCBA 4N0DA 4ZV4A 3JAWB 4OX9B 2M1ZA 3SKYA 2Q7OE 1RWPA 2W70A 1RPTA 1ICIA 2EFYA 4EI8A 5F2NA 3RQSA 2IVFA 1E32A 2RGXA 2F67A 2PGNA 2XDQA 5E6UB 3ZQJA 3FRHA 3OTHA 1YRHA 5AK3A 4LAFA 5E4YA 4CNQA 3TLGB 3NNNA 1DWUA 2C2BA 2D8MA 2ZCVA 4FNGA 4M2LA 1GCUA 2VHVA 3PR2B 3VISA 2V55B 5LQSA 1P2VA 3FAZA 4KACA 4W8OA 1IK6A 2AXPA 4CCWA 2FWBA 1JFVA 2VTKA 3F5FA 5IK2A 1EBUA 3P0HA 4CBVA 4F11A 1PNRA 1E2EA 1EP2B 3PNMA 2P2GA 4LMBA 4B2PA 6YASA 1YTLA 2B82A 2VJPA 1JSZA 1L4FA 2Z9CA 2CXPA 2G5PA 2QZSA 1R5JA 3IXMA 4FEYA 1NDHA 1S2DA 1V8ZA 3UB2A 3AIKA 2OEPA 2V8BA 5TGZA 2IZOA 2VG8A 3LK7A 5EINA 1C80A 3O4JA 4ZDIA 2F55A 1UPTA 1FDTA 1FA9A 2JATA 3M7IA 3ROKA 5CK5A 2ZUCA 3DEHA 4DA8A 2KS6A 3NT5A 4U2BA 1I30A 1W87A 3G68A 2JLXA 2LP4Y 2K5UA 1K1EA 2B36A 1JYSA 2OSVA 3OFKA 3R7DA 4B2YA 3A3YA 4GMGA 2ODBA 3EWNA 4B3CA 3GFPA 4I3HA 4DV7B 3CW2A 3NYIA 2PUDA 3EIXA 4E94A 4HRAA 4W63A 1VECA 3SGLA 3IP7A 4OUKX 4UPEA 1S3FA 4MUMA 3NHRA 4FR2A 5F77A 1A9XB 1VI5A 4NHEA 4CEJA 1OHHA 2C2OA 3WGGA 1K8XB 2J33A 2IU3A 3ADPA 1QF7A 1TZMA 3EGEA 5TPZA 3KVNA 1QPZA 2C9DA 3FOAA 4LA4A 2WI8A 4JH0A 4IJMA 10MHA 1U0JA 1MENA 1T5TA 2IYWA 3A4LA 2CK3D 4HAYA 4R84A 1A0OA 5AW2A 2H5LA 4LSZA 4XVCA 5IJ0B 4F72A 2IEYA 3EGVA 3T1OA 4RJKA 4B3HA 5FOTA 5F3WB 1GQQA 4YTEA 1NR1A 1X1TA 3SLGA 3PNKA 4GGMX 1C0IA 1LS1A 3KRTA 5CNJA 4BLVA 3FVVA 4JXJA 3UXHA 3ZE1B 2V7UA 1MF7A 1R0BA 2EZ8A 4WD3A 4N7RA 4F5EA 1WZCA 1BWQA 2G1JA 5LUBA 3R0ZA 2UVQA 2XWQA 3AUXA 3DYVA 2XA9A 2P1DA 4IIFA 2APJA 4NSNA 3RV3A 2HHLA 3U09A 1NBMD 3UMSA 3OKAA 1RPNA 2XUZA 4I4NA 1P0FA 2RBEA 1XDDA 3N28A 3O94A 3U3MA 3WLQA 3EIWA 3G23A 4S1PA 3EG5A 3MTJA 4RORA 5CPFA 4FD2A 3KZVA 4F93B 2ODTX 3BGVA 5LBTA 5T7BA 1ZJ4A 2Q2NA 2AB0A 2YWXA 2NP6A 2MCFA 1JEQA 4KAAA 1Q2XA 5REQA 1G20E 3IDSA 2X42A 2G5GX 5KINB 1B3RA 3ZD7A 1G0NA 2O1XA 5LDDC 3ZV7A 4ROTA 5A62A 3EPKA 3WISA 1ZUIA 4L02A 4WY5A 1NURA 3GJZA 4L8GA 1BHO1 3TBHA 2AI3A 3O4RA 2VQSA 3MAJA 5IXJA 1FQKA 1P2BA 1W34A 3GJRA 1M8GA 2P2ZA 1T6ZA 3K8ZA 4G0XA 5IAGA 2FU5C 4MINA 2GCNA 4P93A 2ZJ3A 4WKGA 3SOZA 4MUYA 4I1UA 4GBJA 3THYA 4CLDA 2J6IA 4W6ZA 3QUTA 4X1KB 2Q49A 3OF2A 3THOA 1IJEA 4F60A 1JS1X 1CWUA 4IHJA 1F6BA 1U6JA 3UAVA 5TIIA 5DNWA 3TLCA 1XMXA 1JR3A 1P2DA 3LCCA 4Q18A 1YASA 1ZGAA 2HJSA 4BVAA 5ABPA 3DE0X 1BGXT 5CK4A 4CG3A 1G7RA 3MBOA 3A6GA 4FIZA 4GMHA 4LKRA 1TT5A 4IDBA 3K5WA 4WCFA 5KNCH 3VZQA 3L82B 1WNTA 2YMQA 3KYIB 1UMDA 1W52X 1E9RA 2OO7A 3CUYA 3PIIA 4G25A 1UP4A 2YC2C 1QR6A 1SUDA 4A8JB 4KOAA 1I3NA 3ZHBA 4TVKA 5KYUA 1X9HA 1Z0JA 3R40A 2IPXA 1XTVA 4BAUA 2R1UA 3GJ0A 1UM9B 5JTUA 5K3SA 1ZH8A 3DTVD 3MUOA 2OG2A 3OOEA 5CG2A 1ZGBA 1FJHA 5FL3A 1SHLA 2KSQA 4KE7A 1T2FA 3Q6IA 1XDBA 1YNSA 2NPOA 1TJPB 4Q00A 1CUFA 3U7JA 1J07A 1GSOA 4DF3A 3SSOA 2E4XA 4UHFA 4JWTA 4YMWA 5KYYA 1NT2A 3F4BA 3HJTA 3O5AA 1WP9A 4GMDA 4HO1X 3VR6A 3TNLA 2PKQO 4MH0R 3R77A 4QFCA 4P4LA 3SG0A 5DGXA 4EPTA 2A4MA 3THWB 3FCSB 3U3JA 1PFKA 4S0XA 2GSDA 1PHRA 3QPAA 1R50A 2VUTA 1JECA 1RHQA 1Z6ZA 4J94A 1OLUB 4QUAA 5H80A 1HZJA 2E37A 3E1GA 1LSUA 4RF2A 5DMXA 5FBRB 3FKSD 3WZ2A 1MT3A 4TSFD 4EL0A 5DNCA 1AT1A 1XEWY 3EHDA 4JLDA 4OQNA 5K3BA 3AESB 4B87A 4B48A 3C3CA 1SCIA 2C2GA 1JE1A 3IYLW 4S24A 1PZXA 2HMTA 3DBVO 4F6LA 2YKGA 2ZJ4A 4M9CA 5JDCC 3KETA 3EVDA 1ZOOA 4PHFA 1EP3B 5GJBA 1CEEA 1PL8A 5K0SA 4G5FA 1Q0TA 3S5JA 2O0HA 4NPAA 5TPWA 3IMCA 3B3AA 1V26A 3LECA 4IIBA 5K0ZA 3K9FC 2Q41A 4M3NA 1FSFA 3R74A 2DH6A 3VFDA 2D1RA 4OQFA 4WVFA 2N3ZA 3MGAA 1WZEA 2PLFA 3ZH9B 4NENA 3D0OA 2IXTA 3KPYA 1F4LA 3HACA 3L41A 1NG1A 3RRNA 1GYRA 2GPJA 4NFHA 1E0DA 2Y1GA 3IUBA 3O2JA 3H5NA 1XZKA 4JUCA 4P08A 4PVCA 1HI9A 5AXBA 2QVLA 3U7IA 4WRRA 5EI5A 2B9EA 2DUWA 1P60A 1F2TB 1O6ZA 1Z29A 2H1FA 3EG9A 3EXEB 3I6BA 1K5GA 3RUCA 3FHOA 4YCAA 2J3DA 1LW7A 1G59A 5DHSA 4EB6A 4X84A 4QPDA 2IHYA 5IJXA 4MIOA 4TLDA 3X3HA 3C3AA 3HHEA 3OU2A 3USES 3OJWA 3H4VA 2BFCB 2HK9A 2OAP1 3L7OA 4FNAA 1EFTA 2JNWA 4NCAA 1YS9A 4OLFA 1A71A 2ES4A 2IYFA 4LDNA 4LF7B 2RD2A 1L8QA 1UBUS 3SQLA 3HVRA 5HMMA 1JDVA 4QXOA 4C14A 1EJBA 4QUKA 4G0YA 4KDCA 3A05A 4CQMD 5JS2A 3E18A 3JAWA 2J9RA 1UBHS 5DHQA 4DV5B 1CKEA 1ND6A 4Q21A 2IXBA 1YB2A 5L53A 4RGBA 4R3UC 5AVVA 1NZFA 2JI6A 4YHBA 1X7ZB 3PCXA 2JRLA 3BRSA 3N74A 4UE2A 1W5EA 4X1OA 4N48A 4IJ5A 4AF7A 1UAYA 3M5DA 4HFRA 2UYOA 3STYA 2H9YA 4A0GA 4YJ3A 4CKBB 1QRDA 1HE1C 2IIQA 2R1ZA 3QBJA 5AVZA 1YQWA 5D6OA 3TLGA 2BBOA 4Y3UA 1DBIA 2JGRA 4IXWA 5CD9A 5AHWA 3HSKA 2B0CA 4XIJA 3DPIA 4AP9A 4BECA 4JUBA 1IHOA 1LK5A 4WASA 2WT8A 4BZZA 1YD7A 4MPTA 3Q8LA 1WB6A 5E2IA 2P9BA 3O2NA 1EKXA 5DV9A 3ZD9A 4M1KA 1XAIA 3WSVA 4LGCA 1D0IA 4WXEA 4Y6GB 1OZGA 1I3KA 3ZVRA 1IK4A 1DTWB 2D7JA 3R76A 5LA6F 3DL4A 1HURA 2R65A 1TA4A 3Q9NA 5I7SA 1PJCA 4KHZA 1QQAA 3NEYA 4HB3A 4IVPA 3PQ6A 4UC0A 3JD0A 4BO0A 1M1YE 4QWMA 3CLSC 1YT5A 2D4AA 1MG0A 2R8OA 3E05A 1QV9A 4V0QA 5LLTA 4S05A 2Z5FA 1JIUA 2Q9CA 5K4HA 2I67A 1F5NA 4ISBA 3IAAA 4NBUA 4MVJF 3LY7A 4YWHA 1P9LA 5JFOA 2OD2A 3DG9A 3WXBA 2NAPA 2D5AA 3RUPA 3WBKA 3KVVA 2OV2A 4C7OB 1VPVA 2PYDA 1IAQA 4LCEA 3HBAA 4Y2JA 4ECEA 5F9FA 4WZAE 3PC3A 4Q7KA 3QMVA 1KOGA 1P45A 2FUCA 5KCMA 1PGQA 3SJBA 3L07A 1D2EA 3D4NA 4B7AA 3E1SA 3TD6A 1JGTA 2RH5A 5JS6A 2K87A 3FPHA 3KVYA 1ESCA 1HNNA 5AYVA 3X43A 1ILWA 3R5TA 2ZQ5A 2GK3A 1A9XA 5HMLA 3SX2A 4FDUA 1QFMA 4AO6A 3E0QA 4HX2A 1CIPA 1SOAA 4CL2A 2CFRA 3O84A 2HIMA 5KKNB 3FI0A 3M5WA 1SAYA 3PQ3A 2QW8A 1YRLA 3PVZA 2FMFA 2FW0A 4DCVA 5ADHA 1P9OA 5IJ0A 2FEOA 3L93A 4XX0B 2X14A 3Q8XB 2BFBB 3BXHA 4PLFA 1H6DA 5EUMA 5G53C 4R1TA 1OROA 1YVDA 5HR5A 3PEUA 5KQPA 5LIRA 3GN1A 2LUOA 3ICQB 4HL6A 4NQRA 5JRJA 2HK6A 4DJTA 1NE2A 4ZVSA 4MCAA 2D0OB 2RHDA 1ZU5A 1HT1E 1CDZA 2J5XA 1TTHA 1X94A 1X74A 2NZJA 2UDPA 1Y3HA 3EZYA 4HLQB 5JJKA 4LQ4A 1T34A 4ZO4A 2P8JA 4DTCA 5EKUA 4HI0E 2XUFA 2CXOA 2GEKA 5J40A 3U4AA 2C5LA 2JLYA 1ZJJA 7ABPA 4YCDA 1Z62A 1FFGA 1QH0A 4JLWA 2PGAA 1TX4B 1I2AA 4MJ7A 4PU0A 5BPFA 3FCXA 5SY4A 2FZ5A 3NBYC 4Y2QA 3WMXA 2QE7A 3QH4A 2XAUA 3RO7A 1PLJA 1IEQA 4GOKA 1R9MA 1U6IA 3W90A 5JXHA 1PJQA 5L6LB 2I65A 1AV6A 3ZHZA 4ZQHA 2WRZA 1KO1A 1QVZA 4FMDF 4L15A 4X95A 1X6VA 1QZTA 4QODA 1SJ9A 2GZ1A 2HEIA 2PKWA 2ZIGA 4D57A 2E9SA 1Z39A 2HKIA 2MU1A 3V4PB 4J0GA 3ELWA 3DT8A 2OAGA 4UTNA 4FGLA 1GPDG 1VSUA 3WLRA 1VMKA 3E8XA 2AD1A 1QGED 3QF7A 1D1SA 4MLDA 4X1KA 2GKSA 3KJIA 4P7JA 1JNXX 1X1SA 2F8MA 4PZ9A 4NCBA 4D02A 3ECCA 1UBNA 3ZI4A 1YC2A 1U4SA 3GT3A 3K09C 2HA2A 2VPTA 2R6DA 5J3JA 1WPRA 1AHIA 3WNQA 1KI2A 3RJTA 4I8DA 1IOZA 4AJOA 1BMTA 3BK2A 2OC9A 3EWIA 2HTFA 3GFSA 3H1BA 1IH8A 3N70A 4CKCB 2PS3A 2JFVA 1MJGM 2W2PA 4WMLA 3SJ7A 4BFCA 4JI4B 3A3KA 3WICA 4WKPA 3UBMA 5C1PA 1SOWA 1RBQA 1F12A 1C7IA 1I5RA 3LT1A 4Z99A 5E9JA 5EJIA 5TEVA 4L7VA 3CR3C 4R54A 2OBFA 4R1NA 3OZEA 3MGKA 3FVTA 1SULA 2HDNB 1JVBA 2WKSA 3AUSA 1UM9A 1PG0A 5KNLA 4JLBA 4ON9A 1IY9A 1Y7HA 5CFZA 3B9RA 5CGQB 3PDIB 2P3SA 3DEJA 2IBTA 1QTRA 1T29A 3ANYB 4MV4A 2RC5A 4MEAA 2BMWA 2OXIA 1N3IA 3WY9A 5EVCA 3BIJA 1N6NA 5GVSA 1LTHR 4IUBS 1JIVA 2EKQA 2AXEA 2GPNA 3OEHD 1TUEA 4L7QA 5TE9A 3RG2A 1V48A 4TS9A 3ZHXA 5ALRA 4EBFA 1KK0A 3LKBA 5IF3A 3OUZA 3THWA 5BW5A 4FYWA 4WXMA 4PNEA 2Q5OA 3NC0C 2X13A 4H27A 1A9RA 2Y93A 3D6MA 1SBCA 1OLUA 1VE7A 1NW8A 1JXOA 1TRKA 4IIHA 4WK2B 4XFDA 3DKVA 1ECBA 3KWMA 3PC7A 3HJUA 1DOHA 5EQFA 1KYIA 1RXYA 2GYWA 2O7NA 3AESA 3I2IA 2B4KA 3HDHA 3JTEA 3IJRA 4MHOA 4AMYA 3Q3HA 1DKOA 5CR9A 2KE5A 3PLNA 1JLRA 1MRZA 4B4DA 4QELA 4F3RA 4W9MC 3EC2A 1WULS 1X87A 2AKYA 1U3GA 1GPWB 1SVKA 2O3UA 1WQ3A 4II2A 1ZBQA 3QVSA 4M89A 4TTQA 4UHEA 3CTMA 5KHAA 3LFTA 4WNCA 4G1MB 3BK7A 3Q3EA 1OZHA 4RDHA 5KSWB 4II7A 3LPMA 4B31A 2PANA 1M2GA 5JHHB 4DC9A 4A8PA 4JHLA 3OIUA 1NXWA 1K8ZB 4IGEA 1N8SA 5CFQA 4WJZA 1F2TA 3W04A 1NN0A 3KAJA 5KQMA 1C7RA 3EXEA 1OV4A 2GKOA 3E3NA 2J3QA 4XR9A 1H5UA 1K6EA 4L6AA 5BORA 3ND9A 1FYVA 4AECA 4HP8A 1Q6YA 4D9EA 1EVLA 5H5JA 3WWPA 4JA2A 3FMVA 3GUVA 5HF9A 2BFCA 3E3AA 3HXPA 1P1CA 3VKWA 4WLNA 4I36A 3KL2A 4DJJA 3O8QB 4OJNA 4EJFA 3IBGA 3O0DA 4LPSA 4LF5B 4P1ZA 4QUGA 4LRXA 3SHTA 1FSZA 1TIBA 2X1LA 3JALB 2XNJA 1KORA 4G89A 3UOGA 3SJZA 1JKMA 4AY5A 4M1WA 3EXHC 1G8GA 4FQ5A 4HN4B 4J4TA 5CYPA 4G85A 2YFKA 3HXMA 5CNKA 3GGSA 1IXZA 4N40A 1NP3A 1JAZA 3F5QA 1XD8A 3Q3GE 3IBTA 4WFIA 5GJWC 4EYEA 4UOEA 1X7ZA 4WT7A 5ADWA 2B30A 5KTPA 4BRZA 3A70A 3K94A 1PX0A 2E2WA 3NNSA 4DCJA 2IZ6A 4C0AC 4WH0A 1FTGA 5E6SB 1MFZA 3OZRA 2GZSA 3RK0A 4RD1A 3E22B 4Q15A 1XNHA 3I39X 5JSYA 1JSCA 1Z4NA 5I5EA 4R0NA 3EVTA 3U5TA 5CDGA 3MWFA 1FVOA 4BVFA 1L5SA 2EL7A 2GXQA 1DU4A 3JVIA 1NWHA 3IPXA 4YRLA 3ROEA 2V0GA 4ZJZA 3RADC 1CZRA 5BWCA 3AYZB 1JIQA 2EU8A 3MBIA 5TY0A 3PX3A 2EFJA 3WWZA 1Q74A 3C41J 3KDSE 1DTWA 4EZEA 1S9DA 5IZ4A 3I6QA 1AOXA 3A3NA 2YXLA 2QY9A 2OB2A 3I42A 4HEA6 1IG3A 4Z7JA 2X19A 2XRFA 1DC6A 1N0VC 3TQCA 5INTA 3DFFA 1PJRA 5SY9A 4F9GA 3IMEA 3AI7A 4FPXA 1GNTA 3CINA 1BE8A 1HKUA 4CF7A 3BVPA 2EOAA 2GK6A 5AKGA 3WNVA 4IW3B 2OCIA 2R4QA 3BWCA 3OMXA 3OPNA 4C7OA 3VPGA 8OHMA 1N0IA 1Z6XA 1KYXA 1TZJA 4HX9A 4TN1A 4ZCIA 1JR6A 2UUBB 4DGSA 1B0PA 1ZQ1A 3LYAA 3G2LA 3NOVA 3SMQA 5FL7D 5FA5A 3K0KA 1CZUA 3ZY4A 2O8VA 2PZEA 2JFPA 3NAZA 4G0PA 2XA1A 3HFRA 4AF6A 4GVPA 4OYRA 4N41A 1DAFA 1XQWA 1NLZA 1P4JA 2PEYA 2PSEA 2QVXX 3L6CA 4PQYA 4CG1A 1B43A 1WQ1R 4GD3Q 3DGEC 4NNJA 1GG8A 3IH5A 1LZKA 4Z5XA 2PS0A 4WJLA 2IOHA 5IJWA 5LLDA 2PU5A 2XXBA 2XQJA 4FYXA 1K7EB 1QK3A 4WL0A 2Z2XA 3PDJA 1PK7A 3IEKA 3W6ZA 5BP7A 2L69A 6REQB 2PX8A 1BU8A 1H1DA 5AM4A 4B6SA 1RMQA 1ZITA 2NTYC 2WUWE 3OTIA 5EZQA 4Z2YA 3G02A 4FZ3A 5L4LA 1KEUA 2VOEA 3I83A 4XX0A 2XXAB 1ZD3A 2BFBA 1Q1ZA 4MROA 3GZNA 5DNUA 1R4MA 4JVNA 5C32A 3R7WB 2B4QA 1OILA 5K0CA 1MZPA 1NXVA 4KNVA 1W73A 2I6QA 2WJYA 1FNDA 4HLCA 4C4XA 5JO0A 1NXXA 2NZ2A 2JIBA 5G40A 2W5UA 1ZIDA 4XRRA 3RG8A 2QTCA 1VL2A 1QG4A 1WKVA 1YR1A 5FOXA 5DHUA 2IUTA 2WSYB 3P2YA 4MDYA 1UK6A 4YRGA 5ALQA 3HKEB 4MV3A 4G5RA 2AA3A 4TRRA 2FUG6 4I14A 5JS8A 3VR4H 2VQEB 2YJ3A 3G6WA 2OBYA 2XVZA 3PWKA 4ZFNA 1WB5A 4DB4A 1FXSA 5CYGA 1AHPA 2OV3A 2XNHA 1T0BA 4FCTA 4F9FA 3D1LA 4KXNA 4MUHA 2WU3A 1ORHA 5AKJA 4ENWA 1TA0A 4CKYA 3UQZA 4US1R 3E4DA 4UVDA 1NVXQ 1FS4A 5E95A 1ECCA 5AI6A 3WWCA 1G5PA 3OT5A 2GFIA 1TL7C 4PAQA 4PZCA 3SVZA 4PTYA 5GAJA 5CG1A 5LIPA 1I5EA 2HSEA 4Z0NA 3KEQA 2HL6A 4YVFA 1FFCA 3FOBA 2XE8A 4H08A 3CWZA 1WXDA 2A3NA 1JAYA 1JJBA 3T3PB 3IV6A 1E5VA 2Z3WA 4HSGA 1D0SA 3IIJA 3LX6A 3EPHA 3QLVA 2GXAA 1KI9A 5CM8B 5F2OA 2I0FA 4UXJA 5K6AA 4H16A 2V7GA 4P3KA 4KN6A 2D3WA 4H35A 3U56A 4OXIA 1KFCB 3AHEA 1ZRNA 3ZJVA 2JGAA 1FNMA 1EWKA 3MUNA 4DMRA 1G5IA 1ZJYA 2FOXA 3GD5A 1Y37A 4CKCA 1H4SA 3QE0A 3DOOA 3RTAA 4FGKA 2B61A 2MMGA 2P6PA 5IBCA 4OD0A 1R6AA 2X0EA 4JL6A 3IR5A 4RTNA 2OCGA 4HS9A 3GMTA 4QXPA 5TVGA 3NCHA 4JX8A 1JDUA 4D97A 4R2IA 5DX8A 2X4IA 1JKIA 1XO1A 2BFFB 1PVVA 4M8NE 2HEGA 3H2KA 4W6QA 4B73A 3SP1A 5HG0A 4XGNA 1NBAA 1RI4A 1YU9A 3PDIA 4M6WB 3L7BA 1PFVA 5TSDA 3ADBA 1R6BX 2BD0A 1ZVMA 3JQ9C 1MTZA 1BXKA 2CLCX 3BD9A 4L8FA 5CVEA 4ZU1X 4ZCSA 4GOXA 1USGA 3VU0A 3CNQS 3HGQA 2E4ZA 3FYCA 1NASA 2QPOA 3PP8A 4BO6A 3WRXC 4ERNA 5FORA 4PYOA 2C42A 4MV8A 2VUHB 2Q21A 4PCUA 3CJTA 5TEWA 3CEHA 3K9HA 4FVTA 1E6UA 4QQNA 3L8ZA 1TQ4A 3NHJA 1CQWA 1MD9A 1XA0A 4U39A 2PAFA 3KBOA 4RCYA 3ZGYA 1ZP6A 2IBMA 3GRVA 4QFMA 3UJ6A 3PITA 3GBPA 3UTCA 1BMFA 1SUBA 3NANA 4YMIA 5BWOA 4P7KA 3AJDA 4TQGA 5BT9A 5LB4A 3GFFA 3RSGA 2Q4TA 3DUWA 1PZGA 4Q4HB 4L9WA 1I7QB 3WGYA 2B5OA 2RBKA 2O6HA 1GU1A 4XW2A 4E4TA 1YC5A 3ZG6A 3FIJA 1FE8A 2XKBA 3L8DA 3AV0B 1T4BA 4TS1A 4HNSA 1R7RA 1SIOA 3DT6A 1QYWA 2FXVA 3OO1A 5DI9A 3JZFA 5T4FA 1JW9B 4J0HA 2GF0A 2VJNA 1XHFA 1X13A 1PV1A 2J30A 3DD1A 3U17A 3VI4B 2DR0A 3WGHA 4BQNA 1GNQA 3NWEA 1ORTA 4DS3A 2RHLA 1N6LA 2PMKA 3E3OA 1KO4A 4DHEA 4BQQA 2W93A 3OZWA 1RKUA 2H1SA 1GA4A 1K5PA 1FNBA 1IHUA 1PS9A 1X3LA 3RYCB 2DUNA 2XMCA 2ZR8A 4MAAA 3U7HB 2C7OA 1JYEA 2I62A 1CR1A 2PX6A 3ED1A 3M6FA 4GR5A 4MX8A 5HE8A 4AJIA 3D3JA 1WPQA 4PGAA 4A92A 3ZHUA 2F3RA 1XZGA 5FPKA 2QZ4A 2VQ3A 2QXTA 2YRFA 4O4HF 3N2NA 3O8QA 4QIHA 2IPMA 4E6PA 2DUUA 2GTPA 1XNQB 3JALA 1U90A 3TAHA 3DTTA 1J1IA 4KVGA 4ID3A 2R8BA 4I9UA 5A7FA 2IP1A 2GBPA 2JJ2D 1A5AB 1RI5A 3PKIA 1VOTA 1ZK0A 1SQFA 5J5VA 3LLMA 1GAWA 3CZ4A 3FIUA 1OXKB 4D8TA 4C0XA 3A0RB 3LCVB 1MB2A 1YCGA 2GEDA 1N6RA 1D3AA 1DZ3A 1OI2A 4KSYA 2FK7A 4UMVA 5E6SA 1Y8QB 1QGYA 3G5MA 4LJ4A 1G3MA 2HV9A 3E22A 5A4AA 5DB4A 1HEYA 2YVQA 2VA9A 4MOWA 2VJAA 4RNCA 1MMFB 2BE9A 4RVNA 2RCNA 3PHCA 1UKVY 5FFFA 3NFRA 5K01A 3LVBA 2V3CC 4HNHA 3W6OA 2I91A 2COUA 1QSGA 2FDXA 2EARA 5D5HA 1FYXA 2I03A 4GW3A 4TL6A 4Q1AA 2JAPA 1KPIA 3HNPA 3PUHA 4V0KA 1I7DA 1ENYA 3HK2A 1TZCA 4FEGA 3U6KA 2D2FA 4ETMA 4WK6A 1XJ0A 1C4KA 2Q0QA 1C3EA 4HATA 1W93A 3D8BA 3TG2A 5A3SA 5I4CA 1N2GA 3DVQX 3SQXA 4W1QA 1S0UA 3QM1A 4C22A 3SNKA 3IHTA 4QLOA 3ZGLA 4XQ0A 1Y3AA 3LCMA 4UBIA 1HLFA 2XV1A 5JDIC 4ITVA 5HCIA 1K4KA 5SYMA 1NMSA 3A1UA 4HYYA 4BCCA 4F3YA 4YT5A 1KIFA 1VRCA 3ROXA 3NDJA 4N8DA 3AR6A 3QVVA 3I9V6 4PAMA 4DR7B 5EPUA 4M1SA 3L01A 5BUSA 1Z5GA 4H4CA 1MAUA 5ELXA 5JS7A 5ELMA 3OM8A 4IILA 5M29A 3D5TA 4UMDA 5ALIA 4Q37A 3PA8A 2G63A 3N39C 1GPJA 2B1JA 3AUYA 3PDWA 3LF1A 1HEIA 1UKEA 4F1JA 1IXKA 4AF8A 1U0SY 1RXCA 4BBJA 2AN9A 3GVCA 3B85A 1D9ZA 5A5EA 4DVGA 3W5CA 1MO4A 5FV7A 1E0KA 2HB6A 1EX6A 1TF5A 2J8ZA 3TRFA 5MHTA 3FPBA 4AFNA 2OLEA 4B47A 2J3IA 2PJDA 4DA7A 5SYNA 2HSGA 2Z0MA 3V8PA 4J91A 1FUUA 1HT0A 1VSQA 2HJWA 2VHQA 3L40A 2A9OA 1BG6A 3V4LA 2GDJA 3NBAA 3C6BA 4BZQA 2XXAA 1ENZA 3R7WA 1AKTA 2V58A 3E7XA 1KSHA 2REOA 3A9TA 2QVCA 2OYCA 3W8NA 1MR3F 1OWMA 3EXFB 4Q1CA 4M76B 4NJOA 4UUPA 4ZTZB 3DMTC 1L7QA 6ABPA 3LE8A 4BMDA 1X2EA 4I4CA 3N7UA 1W36B 4FDLA 4E2ZA 3G9TA 2MSWA 2H2AA 5I4KA 1I4TD 2JBHA 2N46A 3I1FA 4PW0A 3RW9A 3S68A 3GH1A 2I6SA 3MQ4A 3TTVA 4UHBA 3HKEA 1G6Q1 4EIWA 4WBNB 1SG0A 2RGNC 4Z9BA 2JI7A 3PXAA 3ER6A 1A82A 3LUDA 4CN8A 2CXSA 3NWPA 4TS3A 3DMYA 4RDCA 1KZHA 2W42A 2P11A 4WOBA 1X8LA 2ZSEA 3A1FA 4ZQCB 1SUEA 3U9TA 3AB7A 3EDRA 2FX3A 2JZCA 4AWAA 3GX1A 4ZOAA 3WX0A 2JCXA 1X8JA 1YJ5A 2BR3A 1W5SA 4IXMA 3ICPA 2BY4A 3DOIA 4P4UA 3UT5B 3JQBA 4IHKA 5TGDA 2Q0SA 3LT5A 3WP0A 2DBZA 3F73A 2I6GA 1R0LA 3R44A 3L8FA 1XRQA 4I7EA 1L7RA 3A31A 2GZ2A 4YMSA 3UK2A 1K0UA 1PYDA 3O9VA 2GR9A 4BAGA 5CFLA 4WBNF 1WB9A 1FTNA 1MAAA 2QK4A 2FEPA 2WHYA 5EHIA 5KAPA 2ODPA 4BVLA 2WF6A 1JKFA 1E9EA 1JMVA 4M7RA 2DPHA 2PR2A 4AIIA 2P9HA 4LXIA 3HYNA 2HWXA 2QRUA 2VUUA 4LRQA 7REQB 3ZCXA 3C7TA 3MT0A 4NZYA 4E2XA 2GYYA 4HDOB 3VR6H 4ZI7B 1UIRA 5AM1A 4FT2A 1M0WA 1AE1A 3LP5A 3L18A 4CGZA 3NI2A 2YFYA 4BNUA 3TRDA 2PBFA 3L0SA 4ZCPA 3VNSA 2YHAA 2XX3A 3UEOA 4K05A 2MTBA 1SUIA 2OHJA 2XI4A 3BRWA 3RWBA 3ZU5A 2FLVA 3ZWDA 1NIJA 1SCDA 4MRSA 3EUEA 4OB8A 1K2VN 2BFFA 3E15A 5DM70 1C3JA 4V39A 5BVGB 1RYYA 3DDUA 3PX2A 2HFJA 3UNXA 1HE4A 4I9FA 4OQXA 5J4HA 4PHHA 4M6WA 3BIOA 2WSMA 1LPSA 2A9PA 2G1PA 2AIRA 1EX1A 3PC2A 2OHFA 4QGSA 1QLJA 2OYSA 4UDOA 4ZI7F 3E9MA 2DJIA 3FETA 4Q5IA 1TO6A 2FWPA 5K0NA 121PA 3OMWA 1E9SA 3F8TA 4BC0A 1YZ3A 3UGJA 3EF1A 3FDXA 4CDNA 3L04A 2A1IA 3TMKA 2FN3A 3GY0A 1SMKA 3OBIA 5JNUA 4IS3A 2XCTB 3AVOA 5AM2A 3QFHA 3VAAA 4REMA 3HU3A 1AZWA 1SPBS 2PD6A 4AMBA 3PTZA 2DFNA 4FIDA 1A9OA 3LP6A 2YINC 3GQVA 1OFHA 1E9DA 1LU9A 2J09A 4C7BA 4GR9A 2ZE5A 1M0TA 1Z68A 2VNIA 3GNTA 4FLEA 4BKUA 2ZJ1A 3SHQA 4P5PA 1N6KA 3BL5A 4GM1A 2B34A 3OFNA 2RHGB 3C7KA 1VP3A 1OAKA 2W48A 1N9GB 4PYLA 5C7LO 2K7FA 2P6OA 1RXWA 4Q4HA 2BHTA 5EXSA 4L4XA 4MDEA 4H18A 4ZC8A 1M6NA 3N2ZB 4Y7DA 5HFJA 2B7BA 4CDMA 2CYBA 1XDUA 3R0QA 4RK7A 2QJTA 2H85A 4IV8A 4JDUA 4HFNA 4RPLA 3BPSA 1E1NA 1G20B 3OM0A 1H6AA 1Y4UA 4F91B 2DQZA 1RQ7A 2WM9B 1B8PA 1XD9A 3ZOKA 2G0AA 2EEZA 3ZDAA 4GLFA 4YT4A 4D25A 4ZDJA 4TKMA 3UTDA 4XGKA 4QGGA 3FR8A 4IRUB 3CRNA 3C1UA 2MT9A 1GILA 2Y0BA 3RYCA 3UUFA 1XP8A 3UG7A 1ZI9A 4WGGA 3KP1A 1F2VA 2C4HA 2GNAA 4RD2A 2JL1A 2ECQA 1C7FA 2ZRQA 2VT2A 3PSAA 4FJ2A 4U6NA 2G4VA 2OP1A 1YR7A 2Y8EA 5HF6A 4ZEWA 3SZMA 1J33A 2HK7A 2MDTA 4XD2A 2ZSHA 3VKHA 2BRUC 4O8CA 1MC8A 4DMCA 4UNQA 5DYGA 4OHRA 1L4MA 3HBLA 1C0KA 1X14A 2AXQA 3F97A 5M2QA 3NBUA 1AS0A 5F1PA 2WTUA 3TCXB 1R8XA 3L1KA 4G63A 2GO1A 4HNAB 3V42A 2XOXA 3LPLA 2UXDB 1I6KA 3KBBA 1R8SA 5B64A 2FOIA 5C35A 5KOIA 1DKMA 2ZULA 5H3HA 1MAHA 1V16B 2RONA 2VCHA 3LDFA 3IIMA 1P0CA 4BMSA 1E6CA 2B1IA 4FB5A 4YCNA 1H8EA 1XHEA 4LJ5A 3DMDA 1NQWA 1Y8QA 2BEWB 4Q9HA 5AW0A 3ZLBA 1AXRA 1DIAA 3ZC3A 1IDN1 5KX5B 1ZAYA 4LOLA 1MORA 2OZEA 4G5YA 2C4KA 5E8RA 4MUXA 5CVVA 4INAA 2WU0A 3EZXA 3I28A 4A10A 4MWDA 3PWTA 1KDTA 1OX5A 2ZIVB 1SCJA 2C5BA 4G5OA 3ZGNA 5BN1A 1TEHA 3LK6A 1GPKA 5DNAA 2PL3A 4G07A 1MIHA 1XCOA 2BT4A 2I3GA 4H4EA 4QBTA 2CHGA 2P90A 4I6EA 1JHMA 4J1TC 3ANXA 3M2TA 3RIHA 1T0JB 4MAFA 2WJAA 1CUAA 1HOXA 3V2GA 3VHXB 1NLMA 3PDHA 4MB6A 1I1HA 5AJUA 3FVRA 1DJPA 3EHEA 4Q0MA 2W71A 4YBZA 2PVCA 2JAXA 4RELA 1JEAA 1N36B 1UT8A 5KX5F 1MVLA 4RTSA 1PJBA 1V96A 2GN8A 4QYTA 1RAFA 2I2AA 3FAKA 4MJ3A 4RHUA 1OX6A 3WL5A 4DFDA 5BQPA 1IBLB 3K9CA 4UNPA 3WGVA 2Q5JA 1DS6A 3OWXA 3R20A 1WMAA 1WVGA 4F8JA 4OA5A 3LQKA 2EZUA 1XLVA 1XRNA 3WMGA 3A0UA 3IALA 4QHYA 2D0IA 3DKIA 1DIGA 4DJAA 3C24A 5KNDD 5B1IA 2D1TA 2XYGA 4OKNA 4R1LA 4A2PA 2UZ4A 1UPAA 2SKCA 4MXDA 1FP4B 4D43A 1II8B 4UM7A 4BB5A 2C8VA 3U9LA 4AWBA 1PJLA 3AJ9A 1C8KA 1IUNA 1MJFA 3WKAA 2F43B 2V6MA 4PC6A 4A1OA 1UXOA 4H0CA 5D3MB 1HNXB 2EGGA 4MVWA 5BN3B 2IYEA 1GFIA 4DPMA 4YXWD 2RHHA 3CX6A 2X8AA 4UU7A 4V1CI 3HPQA 3QEJA 3V4FA 2CKDA 2D2IA 2H5JA 3H8JA 5FWDA 2BAGA 2QRJA 1XYVA 1SHJA 3UMBA 1EFRA 4CM1A 2G0TA 4IQGA 3EXFA 4J43A 3RHFA 2YBDA 1LRKA 3JQAD 4KAXA 4I08A 2I9KA 5CX1B 5BY2A 2WAYA 5A2QA 3DO8A 3E9ZA 1DG9A 1T1RA 3ZY3A 3BL8A 2P68A 3QOFA 4UVEA 3TW0A 3NHBA 1W0JD 3ZIAD 1GZ5A 1WA5A 1IATA 4OXKA 2OE2A 1T9CA 4R2WA 3SSNA 3PZBA 1XMPA 4R8RA 2VA8A 1C9EA 1YH3A 2JD0A 2QT9A 2BIFA 4WBNA 5AJVB 1ODJA 5HIMA 1UT5A 3TEMA 3WV4A 2G9NA 1HFEL 3SC2B 1ZD4A 2HHJA 3O3MB 2J5QA 1RC0A 4CIYA 2CLSA 2AOVA 1LC0A 3CB2A 1M8PA 4B8ZA 4OHXA 1XL0A 3I2YX 3PNSA 3G5UA 3VKVA 1E6LA 1I6LA 2OQVA 4ZYLA 3PDUA 4BB0A 3ZY5A 1N5MA 3FTCA 3UT5A 1NRWA 4CL0A 4LXUA 4EO4A 3H3FA 3E82A 2HQRA 3U48A 1D0VA 2HJGA 3MELA 4GQBA 1GGEA 1IZYA 4I6JA 2JH3A 3W8FA 2E6KA 3FB4A 1KQOA 2Z58A 4ND2A 4R8MA 4NFLA 1WDWB 2JHPA 4Q1BA 4TV9B 4YPOA 1XTQA 2B78A 2JZNA 5AW5A 3H17A 5ALEA 1ST3A 4Q9KA 5ERXA 2FETA 1M1YB 3ABIA 3PJDA 4PF1A 5D7NA 1J56A 3T4EA 3KJQA 1CR4A 2I2BA 3X2EA 2LW7A 1OTHA 2VQDA 2VJDA 2W6JA 3H2IA 4Y1EA 4AKGA 1LD3A 1E2HA 3ZGOA 4BMOB 3I92A 7REQA 2JB9A 3OZIA 3A10A 4Q9IA 5AOVA 1JEOA 4CKWB 4YP7A 4ZI7A 2PIDA 1DP4A 4CDRA 3BT7A 5ALNA 1XB2A 4I9NA 4BO1A 4WZAB 5B5SA 4BIMA 1DRJA 4M8IA 4KFSA 1E3IA 2KPOA 3IEVA 4QJ3A 4LV6A 1JDPA 4D3FA 2FEKA 3L6EA 3LD9A 4LWQA 4Z9AA 1VSTA 4GECA 3QVTA 4TV9F 1RQGA 1QYDA 3BH6A 4HRVA 1LRLA 4RJ2A 2RI1A 1I9GA 4AG5A 4HNQA 5BVGA 5BYBA 2IL1A 4CMIB 4V24A 4X7RA 1ODCA 1L3IA 3W1VA 5F51A 2QRGA 5I7WA 3H84A 4OBWA 1YR6A 3FYUA 4OMCA 1A5BB 1XCGB 3AR2A 5CLJA 1A4XA 2YXBA 4J6FA 2BDEA 2IYRA 2RAVA 2Z83A 3LUFA 3AI2A 1N0UA 4I2NA 1CIVA 4KUHA 5LL6P 4OH1A 3JR7A 3TOCA 2ZWAA 2KLHA 2Y6UA 3B3JA 3G17A 4CUZA 1MH1A 4IO0A 1CYDA 4E51A 1YIOA 3EA0A 4LHXA 3TXAA 4HLDA 4MI9A 4OAOA 1A5TA 3VR4D 1Z8HA 2ZBEA 1NJ2A 2C29D 5D5PA 3WGKA 1NF3A 5AVRA 4DR3B 2P2DA 2R7KA 5EWLA 1CLUA 3HABA 2AN4A 2QM7A 4OCZA 5J9FA 2CJXA 4DKJA 2QDXA 1Q14A 2FZGA 2JI4A 2OXRA 3GELA 4H1UA 5M7EA 4NARA 1U7DA 1T4CB 2G76A 5DNVA 5LNK1 3GAFA 5JU6A 5MFZA 1AUPA 2C94A 3RC1A 3UANA 2JVKA 4DUGA 3NVKI 1N9GA 4GZLA 1IRIA 1WLSA 1A7UA 2PH3A 4GRAA 2PZLA 3K20A 1Z2PX 3KTDA 1DLJA 3GRPA 3DMPA 4HH4A 4LYJA 4LHYA 4YFYA 4XLZA 2OOKA 4MUGA 3RUDA 3VV3A 3ZQ4A 2DR3A 3KT3A 2VF4X 1DBQA 3THSA 1WMSA 5CB8A 3O8NA 1ACMA 3EFOB 4RPCA 5C3UA 5DT9A 5J2TB 1G20A 3ZDYB 4F7DA 3V3TA 3PCRB 3KYCB 3N6VA 4PGHA 2QN2A 1H23A 5CCBA 1SHTX 1QIKA 1FL9A 1JIKA 4M36A 4B9AA 4D9HA 1E4VA 3VNRA 5IUNC 2QPLA 2ZJ2A 1QQ7A 4MVJH 1N77A 3TSCA 4OBXA 4DDVA 1QQBA 3OLQA 2PBLA 5FPTA 2F1OA 1HE2A 3TTTA 3UWDA 2QVYX 4UM9B 3DBRB 3E9RA 3RM3A 2QR2A 4ENTA 5LJIA 2F90A 3KLOA 1AJEA 2QW1A 1I8TA 2QTMA 3FDIA 1GEEA 1NDQA 1C9DB 4Z8YA 5HHTA 2QGFA 1W2HA 4E4RA 3H99A 5JMPA 4CODB 3VGJA 3ZJUA 1L5WA 3OJEA 5J2TF 5ILGA 4YRMA 1UXJA 1CZKA 3AOGA 4HNAA 5IKMA 1VQ1A 2XB6A 3HMQA 1DWOA 3DHVA 4IDPA 4CETA 1L8LA 2O6LA 3BRQA 4BYMA 2FSSA 3HP7A 4F21A 2ZVDA 3V4RA 4B3BA 4POAA 1XK7A 3L9WA 4OKSA 2FR1A 2BEWA 4N6NA 5FFMA 2BJVA 2VI5A 1E6KA 3LX8A 3NYQA 4XYGA 1A9ZA 4EITA 5I45A 1HLGA 4GFDA 5KX5A 2VIIA 2HSDA 1ESEA 1EX9A 1N1GA 1UWLA 4RYDA 5BUCA 3ENQA 1C8LA 1IPFA 4RL4A 3SYNA 3KLPX 1E64A 3L5OA 2AZMA 2FMIA 3O73A 5DOZA 1DAMA 1TUBB 1SU4A 2FCRA 1XPRA 3CISA 1QZ3A 1CY2A 4PRZA 2Y6VA 4BLTA 1GAEO 2QY6A 4CFZA 4QYXA 3PPIA 3IR6A 5EIEA 2VTEA 4B8YA 1QCYA 4JLOA 4LNAA 1H3EA 1FP6A 4LQCA 4L5BA 3T15A 2QLJA 4DBLC 1Q44A 3VPBA 2H9AA 1Z37A 3OP4A 1RP1A 3TSAA 2WWWA 3TZQA 4R71A 1E5XA 4PO8A 2PL9A 4WGFA 3T95A 3VHXA 5B6PA 2IZ1A 1KMNA 1WQ4A 1ES9A 3I0NA 2PL1A 2XDWA 3DVRX 5F33A 4CDGA 1OZAA 2GVZC 3IS3A 5C18A 5KTYA 4Q4JB 1L4YA 1Q0HA 1Y81A 1JDBC 3KJHA 3A1EA 4GQIA 2B3DA 2CF5A 3FYDA 4KH1A 4LGMA 4P2GA 5HRCA 2O8BB 3GN2A 4GQAA 5P8WA 3IE0A 4OP2A 3MZ0A 1UEIA 2J1LA 3OLZA 1XCPA 1O89A 3VR3A 4L3OA 1Y3IA 1JUDA 4JCCA 3GT0A 4U02A 3RT9A 3ZTTA 3LPDA 2PJZA 4B3DA 4CIVA 3OAAA 2QTGA 2H5EA 3QU2A 1FP4A 3H5TA 3ZHYA 1II8A 2RHJA 4ZRDA 4AMZA 4HHEA 4DJEC 1N0HA 2YYZA 4DLTA 4XRGA 1R6DA 3CVWA 2M6SA 2CHVA 2VLBA 3BN3A 2F43A 2VAPA 4EABA 2PGLA 3TZLA 5LKAA 2YFQA 3U4QB 5IK2D 1WUYA 1TLTA 1V0JA 5D3MA 1NN3A 4Q9LA 5BN3A 2HF2A 3KPUA 3UKOA 1DL5A 1YQTA 3A04A 4KR3A 2GX6A 3N2LA 3RF6A 2IF0A 2PSHA 1HDXA 2DKFA 1JTEA 3P0EA 2HDOA 2HY7A 4GPIB 1JI3A 3GMSA 3DLAA 4OXXA 3IMFA 4AKTA 2PNJA 3BRCA 2WIBA 1PFQA 2DHRA 1SQ0A 1WX1A 4ODIA 3AVQA 1TMKA 2ONZA 4LXYA 2HI0A 1C4WA 1MQAA 5CX1A 1ADFA 2BZGA 5MN5A 1G3UA 4WK0B 3W06A 4K3UA 1JHDA 1UK7A 4O4IF 4PM4A 3UHPA 1TCBA 3BIWA 3VU1A 3M6VA 2R44A 2IYNA 4FB4A 5JC1A 3L1VA 3HO1A 2I7XA 3ZBUA 2FEAA 4DCPA 3H9UA 2CVPA 3SC2A 1KI7A 2EFHB 2DCUA 4BTLA 2G5TA 3H16A 1FUEA 3K9LA 4WFQA 1ACLA 3RVQA 3U3ZA 1Z5PA 4MI3A 3U19A 4OLBA 5FKJA 1OHHD 1J5PA 2YCBA 4E2WA 3L84A 4L9AA 3REGA 1YZUA 5TPZD 3NTRA 2ET6A 3DBHB 3NBZC 3IIIA 5DLQC 4C03A 4MGEA 1V9SA 1E2PA 1EU1A 1NXPA 2XUKA 5IVKA 3F2IA 4R2HA 1N2ZA 1QCZA 4E5MA 1FFDA 2IY8A 4HWPA 4QU0A 5F78A 1QHYA 4MW7A 5JTTA 3BA1A 4QULA 5KAMA 4AG6A 3L0YA 2ANCA 1T0PA 4RJIA 4TV9A 4I1YA 1USKA 2KYRA 2AV6A 4UTXA 1QJCA 3DVSX 3KKEA 5EP1A 3T5MA 4P7GA 1V1MB 1NMQA 3KQYA 1M1YA 1YL5A 3G0BA 4QFBA 1J2UA 4C5AA 4GWLA 2HNAA 5JASA 1AB5A 1YQXA 4R8SA 3FRJA 2BN4A 4Q66C 5BUZA 5HBRA 5JROA 1UBOS 3U7GA 1WIWA 1QIFA 5BSFA 5J58A 1OPRA 3I2KA 3LOQA 5TF0A 1EXNA 1Y9AA 1Z74A 2QLNA 4GPAA 4M9ZA 4CKWA 4YRZA 1YMUA 2PCLA 2YJTD 4MARA 1PJ3A 2FQXA 2WHPB 3H3JA 4WZAA 5CIWA 1L7EA 5AK5A 5ILOA 4N5MA 3V34A 5HTOA 1VB5A 1Z5VA 4PQRA 5KMGA 3EZ6A 1TAGA 3KZOA 3K72B 2ATIA 4KGVA 1P2TA 3I04A 3RGWS 4AJNA 4BU1A 4H1VA 1XLUA 2Z6VA 3DOUA 1U2GA 2HWKA 1DJLA 3ONEA 3TSZA 5GZ3A 1P81A 5CMLA 1M9NA 4CMIA 3L7NA 1XI2A 3UXMA 4ZT6A 1CUWA 1AZSC 3KALA 5AKEA 2HIAA 1LBHA 3BZBA 3GPCA 4GF5A 4RDIA 2VDLB 4EL5A 1JHYA 2R7LA 4FNMA 2P9TA 4KYIB 4GI5A 2ATXA 4J4BA 4I4TB 3VBEA 1UQTA 1UH5A 2QUZA 3IVAA 1D2AA 3U26A 1F2UB 4YJDA 2VZ9A 4KN9S 2FPKA 2TMGA 4RAQA 5AW3A 5ALHA 1JH8A 5D84A 1NY6A 3DW1X 3GMIA 3LL4A 3OH8A 3LUPA 1I94B 1M1XB 4XVRA 3W8DA 3WDSA 2F9MA 3FMOB 1WHTB 1OD6A 3AZOA 1JR3D 1BE6A 2ENUA 3N8KA 4GRDA 4NMWA 4G97A 2YJGA 3IAM6 3VDQA 3SLRA 2DXIA 4EKIA 5B2ZA 2IHNA 2AK2A 1OBFO 1T4CA 1LGYA 1VJ1A 4GKBA 3ECSA 4QDTA 1O4WA 3STTA 4JUAA 1QM5A 3V80A 1PVDA 2UZ3A 2B1RA 4DV3B 2VXCA 1GO2A 2JARA 5EJ8A 5JLJA 4ALNA 4EA9A 2JGEA 4I4TF 2I34A 5G0WA 5BSMA 3BGOS 3OQBA 2VRCA 5IDWA 1M75A 1SKQA 1Z56C 4L0MA 5LQAA 1QE0A 1XROA 4XJTA 4U8GA 4H77A 3V6LA 5J2TA 1G17A 2B9VA 2PMCA 1H2BA 1Q7EA 2CXHA 2QTLA 2RKBA 3KYCA 4H7JA 4BNHA 4NXMB 1E2DA 1U3CA 2RG1A 2RI0A 2X8JB 1KJYA 2JBAB 2VRWA 3PQ2A 5LP1A 1AUOA 3C8MA 4R40A 5J1SB 1PR4A 1L3BA 1LQ2A 4ITRC 5H9WA 3GARA 3NNDA 2ZETA 5A0FA 1QK5A 3HEBA 5FRDA 2C2WA 2G88A 4U7FA 1LUAA 4OJMX 3RSCA 3VR6D 3ZYCA 3K16A 5C5CA 3DBRA 2RGGA 1S8NA 1Z0AA 2P7HA 3KKKA 3QVUA 4TVBA 3PLAE 3L9XA 5E0OA 1VG1A 5FCDA 4EVRA 2ETVA 4WJKB 3IDZA 1Q22A 1KK2A 4K86A 4F86A 4YMVA 3K2IA 2YX1A 2BI4A 4KRFA 1DPGA 1OT5A 1GDDA 2YUTA 3PR3A 4K8RB 4R7TA 4URUR 5JJIA 3IKTA 3OICA 3SFTA 5BSGA 3W0LB 2GARA 3GGCA 1DBRA 4ESEA 4W5QA 3AL2A 3ACBA 3BDAA 4IIUA 1O6CA 3NUZA 3GDFA 1P6UA 1DDOA 2IYQA 1FNSA 3MILA 1SHZA 3LVQE 1Y5LA 1II9A 3I4LA 4URZR 1K3TA 1U8TA 1QHNA 2HFKA 4YQZA 4Z51A 1ZCZA 5CXSA 4KQKA 5FBQB 3D3WA 4LDZA 1LVGA 1WEHA 3U3DA 4MKIA 2R86A 2NO0A 2P5SA 3UB4A 4DZZA 3RWMB 1Y1QA 4S0ZA 1P1KA 3DDOA 1TUBA 2WIFA 3H4TA 4DT1B 2XZPA 3N2GB 4MA4A 5JAPA 4RK0A 4UXIA 3QKIA 1GAJA 4V0OA 4G5QA 3PUXA 3VR2A 2PXAA 1TC1A 2VWPA 1OU0A 1SUPA 3GJYA 1B73A 1O0CA 1C50A 3UV3A 3TR6A 1T4DA 1FX1A 1RLJA 5TLSA 5SZJA 4PAWA 2C07A 4X63A 4FLFA 3RFUA 2KQUA 3U39A 3X1KA 4A3SA 3EPLA 4QDUA 4OAQA 4C0KA 4EX6A 5EJ7A 4O4LB 4Y67A 3R5HA 4CF4A 3G85A 3RRBA 4B09A 4ZPXA 1D4AA 5KWVA 2H2GA 1GQSA 1FMFA 4EVSA 4Q4JA 2CJYA 1PV4A 4XQ9A 2ZAMA 1YBHA 1DIHA 4YAJA 2O8BA 3NHLA 4CV0A 2HPAA 4ZYVA 1CPYA 1UFKA 3P2EA 3TLBA 1ZI6A 5EJ6A 3RVNA 1THTA 3CIFA 4HADA 1EK5A 1OSNA 1YZQA 4JQZA 1DADA 3BAFA 4JYBA 5D3ZA 5ALDA 1WXEA 1UUFA 2HA0A 3DCYA 4UBOA 5DLEA 5HP4A 3NMUF 5H4GA 1D7OA 4L5IA 3QE9Y 2GJ8A 1FW8A 1CUEA 2PBZA 1JU9A 5C5DA 5EN4A 5DWDA 3QSGA 3FGNA 2BHSA 2ZRPA 4MW4A 4H3VA 4W9NA 3U4QA 2EX0A 1ZK1A