2SNIE

Structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase/inhibitor)
molecule keywords SUBTILISIN NOVO
publication title Structural comparison of two serine proteinase-protein inhibitor complexes: eglin-c-subtilisin Carlsberg and CI-2-subtilisin Novo.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 96
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1988-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sniE00
1SN7A 1SBHA 1ZVJA 2IXTA 4DJ5X 3VV3A 5FFNA 1SCAA 1Y3BE 1SUBA 3AFGA 1T1EA 1WMFA 2Z2XA 2DQKA 4NE9A 2SBTA 1MPTA 1AV7A 2GKOA 2PKCA 1TMGE 1Y34E 1GNSA 1WVMA 3F7MA 4K8RB 3WHIA 4YN3A 1PFGA 1OYVA 1BFUA 3QFHA 5ARCA 1LW6E 1SBCA 3BX1A 1SCDA 2WWTA 1TM1E 2Z57A 1AH2A 2W2QA 1PJ8A 2PWAA 4WOBA 1C9MA 1Y48E 1TO2E 3T41A 5JXGA 1WMEA 1CSEE 1PEKE 1ST3A 1XF1A 1SCNE 3F49S 4ZARA 1TO1E 4OMCA 3I30X 1SUDA 3VSBA 1Y3CE 1Y33E 2V8BA 3I34X 1SUAA 5JXJA 2W2NA 1SIUA 2HD4A 1KE2A 1TK2A 2ID4A 4B5LA 1UBNA 3H42B 3BGOS 1PTKA 3TI9A 3GCXA 5CW1A 2WUVA 3ZXYA 1GA1A 4NE7A 4H6WA 4OMDA 1Y9ZA 1Y3FE 1TM3E 5SICE 1C9JA 1C3LA 4H6XA 3DE6X 2XTJA 3DE5X 3LXUX 5I9SA 5ARDA 2PQ2A 4J94A 3DE7X 4I0WB 2WUWE 2Z56A 3I2YX 1KDZA 3GT4A 1KE1A 4C3VA 1R0RE 4AKSA 3WIUA 2W2MA 5JXIA 2X8JB 3DE2X 4LVNA 2Z58A 1NDUA 5JMOA 1THMA 1KDVA 3OSZA 3F7OA 1IC6A 1TM4E 5AQEA 2ZWPA 1SUCA 1BJRE 2HPZA 3D43A 3TI7A 3DE4X 1GNVA 5K7SA 2SECE 4DZTA 1GCIA 5AVKA 2TECE 1YJAA 1SCBA 2QTWB 3DE0X 4KB5A 3QTLA 3PRKE 2Z2ZA 1DUIA 1T1IA 3EE6A 4KG7A 1VSBA 1SPBS 2PMWB 2SICE 2DP4E 1AVTA 1V6CA 2IY9A 2ID8A 3DW3X 5JXHA 1R64A 1P7VA 2PYZA 4HX2A 3DVSX 2P4EA 3LPDA 3BPSA 1BH6A 1NDQA 1Y4AE 2ZRQA 1Y1KE 2X8JA 3WIVA 1SVNA 3A3PA 1BE6A 1P8JA 1AQNA 4AKTA 1V5IA 1SUPA 1GTJ1 2G4VA 1YJCA 1TM5E 1EGQA 4MZDA 1AU9A 3UNXA 3GCWA 3DVQX 5AMXA 1GTG1 3AJ9A 1GTL1 1JEAA 3CO0S 3Q5GA 3A3OA 3VV2A 1OYOA 4OV6B 3VHQA 3SICE 3A3NA 2Z2YA 3DDZX 2ST1A 1SBNE 3I37X 1OT5A 1SIOA 4NMXB 1WMDA 2ZWOA 3QMPA 1CNMA 4HVLA 1SUEA 3WQBA 4GI3A 4CFZA 3SQOA 5FAXA 4KPGA 2WV7A 3DE1X 3GT3A 2SNIE 4DWWA 1AF4A 1TM7E 1R6VA 3DW1X 5ARBA 1ZVKA 3HJRA 4CFYA 1A2QA 2DUJA 4WOCA 3L1KA 1ST2A 3LPCA 1EA7A 2W2PA 1SBTA 4LVOA 1NLUA 1SCJA 1Y3DE 3DVRX 4BWGA 4RYDA 2PWBA 1Y4DE 1YJBA 2W2OA 1C9NA 3VYVA 3AJ8A 5B1EA 4JP8A 1AK9A 2XRMA 3ZXXA 3LPAA 3D9QX 1S2NA 1P7WA 1SH7A 5B1DA 3EIFA 1GA6A 2PRKA 2B6NA 1DBIA 4Z2AA 1SIBE 3P5BA 1S02A 2E1PA 1T1GA 1KDYA 4ZOQI 4M1ZA 1S01A 1YU6A 1SELA 1MEEA 3VTAA 3PTLA 1Q5PA 1HT3A 1IAVA 4H6VA 2Z30A 3DE3X 3CNQS 3EDYA 1GT91 4CG0A 5FBZA 1WSDA 1GA4A 3DWEX 3Q40A 1BE8A 1BFKA 1SBIA 1TECE 3DYBA 5AVJA 3TECE 4FONA 4C3UA
chains in the Genus database with same CATH superfamily
1D7OA 1E7MA 3JSXA 2ZIUB 2GLUA 1EVLA 1M6YA 1CUWA 1EJ2A 3AF4A 1YHNA 1KZGB 3EASA 2GJKA 2QY6A 3OZTA 4GVPA 2DY0A 3RHSA 3W1VA 7REQB 5KX5A 2MR5A 2B8WA 2BCJQ 2OYSA 4UNSA 3JQGB 1X8JA 3UJ6A 4OU4A 1UJBA 3ZZTA 4AP5A 2WF6A 5DH9A 1SCAA 3L05A 3RI3A 1XMVA 3LDFA 4ENQA 2VJPA 2P2GA 4EL5A 2ZRFA 5CGZA 2CJWB 2QVZX 3UWOA 3E05A 1VLZA 4OL9A 1VPLA 1J7KA 2OO5C 1OGIA 2F7SA 3T7CA 2GA9A 1A3CA 5CB4A 2P9EA 3V1NA 3DGEC 1CQJA 2YZKA 2FWPA 1EUDB 1G55A 1RYMA 1SKYE 1T4BA 1U80A 1QJCA 4L07A 4WK2B 3DNFA 3ZJTA 4G2TA 2NO6A 4YV7A 1YC2A 4KRGA 3P32A 2AOTA 5ALIA 3DXXA 2VXOA 1PQPA 3NAGA 4IG4A 5FCDA 5T8KC 2GBFA 4CEHB 3K09C 2CNWA 4Y2XA 2NXJA 5KINB 2H65A 2CDCA 2FI1A 5EMLA 4F3CA 2LCIA 3QLVA 2M9MA 3I9KA 4FU0A 4XCXA 3HP7A 3ZHOA 4WLEA 2AYYA 2P1RA 3IRUA 4BV2A 2GMWA 2OQVA 1D4AA 1RXEA 1J2YA 3OZFA 4KSCA 3TKLA 2VOJA 3ZX4A 2F9MA 5A5EA 1US8B 1ZESA 2PZMA 2VBCA 2WAMA 2XYHA 3B20A 3KBBA 3KD3A 1I4EB 4PHHA 1ZM9A 1VGVA 2FLWA 3RSOA 3C24A 2C8JA 3UFXA 4D97A 1OAOA 1FDUA 4L4YA 4ITVA 4KHPB 3CF0A 4IJKA 3OE7A 2DZDA 4B3FX 5HK8A 1X7YA 1PJCA 3D7SA 1PJ8A 2QENA 3FSJX 1XAGA 1Z6QA 4BQEA 4UATA 4BNJA 2IIPA 1BIFA 4OQQA 4WOBA 3PWZA 3EGDA 3HRHA 4NH4A 3WOHA 1C9MA 1K1EA 4P9NA 4B85A 3SZRA 3T41A 2C29D 1A5BB 3WIDA 5DNCA 4R2IA 2QP9X 1TADA 5CH3A 3SX4A 4II7A 1HY3A 1J90A 2C42A 3ZTWA 2JFBA 2FP4A 3REQB 5E3IA 2ZJZA 3F49S 3DDCA 4H7EA 1J42A 5K20A 2Z43A 1N34B 5KVQA 4DC1A 4LTDA 3DLPX 3OT1B 3ECAA 5FUBA 4OLFA 5BR1A 2GJ8A 3SR0A 1ZOLA 3LUKA 4B3CA 4MQ5A 3CPJB 3JZDA 5LWQA 3WL3A 3BRWD 4P2GA 2NV2B 3BXHA 3AR7A 3KWJA 1TDJA 4RDIA 2JAXA 5BNZA 1CF2O 2CK3D 3WRYC 2GCOB 3ILSA 4HP8A 1SUAA 5FORA 3VR2D 3OWOA 4BX3A 2HMWA 1V35A 1OA1A 4AKHA 4WKOA 1J0DA 3GYBA 3UN1A 4WY8A 2DF8A 1Y9DA 2GK6A 3IXLA 3MMNA 2Q2NA 4JASB 4MQ6A 4AF7A 2Z3ZA 4F04A 1KDTA 3EY4A 2ZROA 3P2KA 4NZMA 4Q37A 1KOLA 4EHKA 2B35A 4B5LA 4PQGA 3KVRA 3ZEAA 2UUBB 1YE3A 1PR4A 4CQMB 1AURA 1GARA 3E70C 1NJ8A 2R79A 5HKKA 2A33A 3IJEB 5JD3A 4UUQA 2HXSA 4JT2A 2HV9A 5L3VA 4EY5A 4QQFA 1M5TA 1A0OA 1U3TA 4AXXA 2G1KA 1KZ4A 1MOSA 3RS9A 3L77A 1B6TA 2JK0A 2ONKA 4FN4A 3R3VA 3AL3A 1JG7A 4IP0A 1V45E 4PPFA 4ZQGA 3HRIA 3WV4A 4DCSA 1ZI9A 4OMDA 5A9TA 4CMCA 1H9CA 3F9CA 3KKNA 3GUUA 3NONA 1TM3E 2Q5IA 3S2GA 2O2CA 2J5RA 2PD4A 1UC9A 4QRDA 2B7BA 3GHYA 2Q2OA 2J9ZB 3AVQA 5H59A 2IVFA 2E4WA 4MGKR 1PYDA 4E5KA 1UBSB 2FW0A 2C84A 2FPUA 4V1CI 5ESRA 1XD2A 1FDTA 2WDZA 3MJRA 3R0JA 5H9VA 1PTJC 1M34A 3N2ZB 3OQHA 4WOJA 5BSTA 1PP4A 4U2CA 2GZ3A 5BW6B 3T3PB 5IM4A 1BDIA 1Q77A 1E1DA 3JPWA 4IGAA 3WJ1A 2YQZA 3SS8A 3WGVA 2XKAA 5ENZA 1S9DA 1Z74A 3PK0A 4YCAA 4PZCA 5T7BA 4OLJA 2GCIA 1VYVA 4AJOA 4PYLA 1IY1A 1NFRA 3KWLA 3K6KA 3T6KA 1T9DA 3THWA 2NZUG 4HGZA 3VH4A 4ZVQA 5J43A 2EG9A 2OWDA 1YUBA 4RL6A 5TXGA 2Q0SA 4B4WA 3CVUA 1FS4A 1ONOA 2BUBA 2E0IA 3JAWB 1M1NA 2Q4BA 1CJUC 3HGTA 3W7BA 2LIPA 2W58A 3AVPA 4Z4FA 1OD6A 4KUHA 4JJEA 2VH2A 1NDUA 1LSOA 4KR9A 1QR6A 3CPSA 2O0MA 2XYPA 2VBFA 3GGOA 3VO1A 2HR1A 3KSAC 4W9NC 4N6OA 5HEKA 3ZY5A 3S8EA 5EZ6B 2ACKA 5JH7B 1IY9A 5EQJB 5BQOA 5JI2E 1DX6A 1XMIA 2EL7A 3QENA 4NJMA 1QO9A 1QG6A 2WG2A 2BE9A 1WHTB 5HVNA 1QH1B 1E1YA 2IS6A 5GTDA 3HVIA 2XEDA 3HCOA 4Q4JA 4BFVA 3G68A 4M7RA 4MWBA 4CCYA 4D9FA 2CBXA 2O3TA 4NBUA 3NBQA 4L85A 3OKAA 4MR8B 4QTYA 2B4KA 2JS7A 2ECQA 1NQTA 2OPBA 3ZLJA 3VYWA 1RXYA 4M53A 1OXMA 2FOIA 3GD7A 1YVPA 1BG6A 1Z88A 2PGAA 2SECE 3DQPA 1CY1A 3AF5A 1T8WA 5AUPB 1PGOA 1NXSA 4BE7B 2WIJA 4MWZA 4YMLA 1J97A 2P6NA 4BNIA 4U7FA 2GEDA 5L8VA 3ZCPA 1B0ZA 5K6AC 3OX1A 1EVKA 1DC7A 4UAUA 2Q5OA 3DAFA 2AS0A 3UOAB 5JQGB 4X24A 3AESB 4KV7A 4BVAA 2YWJA 1XTIA 2C0QA 4IQGA 4LHWA 1L8QA 4L9WA 3N3BC 1UUFA 1GR1A 4MYHA 3SU8A 3ADBA 2P7IA 1X7DA 5BWMA 1TKBA 4NZOA 2V4MA 3OZRA 4HAXA 1EFUA 5JALA 5TNXA 2GASA 4ZVPA 1E58A 5EG5A 2FSHA 1CDZA 3RT9A 4IS2A 3LBHA 4K5QA 4UBKA 5KOJB 2J5XA 4OTZA 2PJDA 2YBDA 3M2TA 1GN9A 1RQ2A 1SXJB 2YZGA 3FPGA 4MW5A 4QXPA 4YCJA 5DYTA 5CDGA 5EJ8A 4MKGA 3KOXA 4EKIA 3SX0A 2NTYC 1ULZA 3I1FA 2BTOA 2I4OA 2O7NA 3GEDA 3V4FA 3S2IA 3GEGA 4AY6A 3D1LA 4JBIA 1T26A 4UM7A 3WMEA 2EJCA 4PANA 1VKRA 1ZOIA 1W36C 1HSZA 1OI2A 3BPSA 4KV9A 1WWKA 4EEXA 4XARA 3S27A 5JDCC 2YIJA 4WNAB 4NENB 4LXHA 5DLDA 1EHYA 2XHZA 4UHFA 4B4VA 4TLMB 1I8TA 4XB2A 4DCMA 3NP9A 2XQIA 3DTVB 1T4MA 3Q0EA 2IHBA 4XR9A 2O5EA 4IMPA 3CQ9A 4TYWA 2AOWA 3LVRE 1E2JA 1WCYA 3RG8A 1EXMA 5JEDA 4CKBB 3QELA 4MRPA 5KOIA 3KT8A 1W5AA 4PM4A 5H0IA 4MEBA 1V3TA 4E70A 4GE0A 4RHXA 5IMSA 1V16B 5JRZA 4P3KA 3LU1A 2I6FA 5IJ0B 5GZ6A 3OIFA 4OQXA 2FSIA 1JKMA 5CA1A 3C16C 4XOIA 1QFMA 3PF9A 5BW5A 1UK6A 2GF2A 1JMVA 2ZSKA 3DD1A 2QU8A 2Q4RA 1VRCA 4NYJR 5H70A 1VHDA 1YZQA 4YQYA 5JD5A 4OMFG 2G4VA 1TU3A 4P86A 4UDXX 3DZ8A 5IHPA 1OLXB 4P31A 4RXUA 3BC1A 5LDHA 3LQ2A 1XCMA 1WPXA 2D59A 4MJXA 5DN6A 2UUOA 3K2BA 4KPEC 3NVMB 2QPLA 4MZDA 1N7GA 2P40A 4HNHA 2IYNA 4R68A 2P65A 1SHJA 3QV2A 3ZWYA 5FPSA 1S1CA 4TRJA 4CR8A 2PSSA 2GKSA 4ZKDA 1XVUA 3OOHA 1N6LA 3AIOA 2OHHA 1VFPA 5JBNA 3FLBA 5F1OA 3GPCA 4Z3OA 3SQMA 3UMSA 1A95A 4ENWA 2ZRPA 1JHOA 3IAXA 3M1YA 5IKPA 2OHXA 3FROA 1QYIA 1YE8A 5DPMA 3C5WP 4E33A 4U7GA 4Z9FA 3PHGA 2XB2A 5EJMA 1S89A 1IB0A 4UEQA 4IGKA 4NI5A 1XCBA 4V39A 4DF3A 1DMRA 1AUVA 1BQEA 2J9XB 1G8JA 5TE9A 1E3SA 1Z4NA 1XEWY 2P41A 3RUPA 5DVZA 3H8WA 3RUHA 3KQSA 1PAUA 1U9CA 5LLTA 2XZLA 4NTZA 4YP0A 1R6BX 4RZIA 2IOQA 4NICA 5DCYA 4C4TA 4TKZA 3VSDA 2MSDB 2I6GA 4IICA 4YRMA 2R65A 2YJTD 3S81A 1CY7A 1CERA 1XWIA 1P2UA 3DBLA 4ISCA 2RBEA 5CX1A 4HWRA 5IVDA 2Z9CA 3B38A 3UM9A 1TGYA 3MLAA 1CJBA 3O8OB 1BVYF 5KZMB 2BR4A 1F1BA 1I4WA 2JH9A 2FUG1 5EHGA 4IEIA 3QHPA 3VOTA 2PDAA 5IM4F 2YZNA 1YS7A 4W5RA 2QW1A 4MWTA 2QXTA 2DUNA 1DO2A 2JVIA 3FYTA 5J63A 4HPWA 3S40A 2E4ZA 2WINI 1VSTA 3FAZA 4MEAA 5B55A 3D6UA 3B6KA 3D6HA 4E4RA 1Y37A 2NG1A 3Q9LA 1XEAA 4JR1A 4FKMA 1I3CA 1SEVA 2JFWA 4Q1EA 3BZBA 3OPYB 1AHNA 1QWOA 3BHMA 4KXNA 3ZK9A 3MSCA 3NANA 5DNVA 3KJGA 2PU5A 1EBFA 1L7NA 4AZTA 1F6WA 4YUWA 4JX9A 2QV7A 4NIMA 4DCTA 1ACLA 3S29A 1KRWA 1A5AB 2C5AA 3G0DA 4HNUA 1WY5A 1ISFA 4L72A 5E4YA 4S3MA 4F4UA 3I72A 4WH0A 4Y9RA 2WIAA 5H16A 1F8XA 5B7PA 1KWGA 4XVQA 3AB7A 1I6LA 1ABBA 1IVSA 3I2KA 1MJHA 3INTA 3KELA 2HU2A 1KO1A 3UATA 1P4GA 5I47A 2XGMA 4M87A 4ZIRB 4EMSA 2H85A 3G02A 5GZ1A 4AS1A 4EYGA 2FGJA 4G86A 3W79A 2Z1NA 4HYQA 3AR2A 3ZNPA 1ZJWA 3PE4A 2EFCB 3I73A 4D9BA 3PYMA 4F2PA 2CXRA 3WXBA 4JC8A 3IUBA 3MUOA 5B1EA 1G3MA 2W6JA 2F17A 5D6OA 1U6IA 2I2FA 3UMBA 3A0RB 3HEBA 1KH2A 4RSGA 3U7EB 2DBVO 5T64A 4EWLA 4RPJA 3NYIA 1GO2A 4YLGA 3RC9A 1L7OA 1Y63A 4Z51A 5A4FS 1SZCA 5AW4A 3CVXA 3EIFA 1PKEA 4MV8A 4PCUA 1QU3A 1OFTA 2ZSJA 3QVOA 3WI7A 2XDQA 1J09A 5F7ZA 4IILA 4WNCA 2WJPA 2BC9A 2IE0A 4Q01A 2QQFA 4GP9A 5EJ6A 2YXNA 4JX8A 3I6YA 1B6RA 1W581 3STYA 4G2NA 3ZIDA 1KVUA 5FL7A 3K9QO 1PWHA 3CKYA 4FS3A 2KLBA 4GMHA 1DTWA 5IWAB 1N4DA 2P2YA 2YX1A 1S02A 3RTDA 2WYOA 3TLGB 4QPDA 2BFOA 4JC4A 1G3QA 2J08A 1O6GA 1E9FA 1HZJA 1PT5A 1Z4QA 3KKOA 4IQ0A 2O59A 3CGGA 2Q3DA 3RC7A 2Z8ZA 2H59A 2EF1A 4FCTA 1IY2A 1YR3A 1W73A 2GEBA 4OH7A 2GAAA 2XVYA 4GLLA 4UD6A 3B3JA 3TS1A 3RGGA 1EUCB 4IGEA 1CRQA 1JR4A 1ORWA 1S4QA 2I66A 3CMMA 2V6JA 2EWVA 4YAOA 4WPGA 4Z9YA 4N76A 2YY5A 2J9FA 4JI4B 4DLKA 4C08A 2OHFA 4I5EA 1E9SA 4ZCMA 3DCYA 3EJWA 4H6VA 2QZJA 1RRKA 4DQDA 3GUYA 4EF5A 1Y1QA 3AZOA 2O57A 4HNGA 4QT0A 2MYTA 1UM9B 4FE7A 2QYHA 1NU8A 3LQ4A 1G8KA 5FBRB 4EW3A 4BB6A 4CG0A 5D6NA 3AR3A 2R7MA 2D2VA 3HRKA 3ZZMA 1X1TA 2HIHA 7ADHA 3ZQ6A 1WM1A 2O1WA 5EIHA 3UF0A 3KJQA 3G2HA 4I4IA 4WKCA 4I8XA 4ZOLB 5CRIA 1TKAA 2NUAA 5I9TA 4L15A 4MVJI 3PD1A 1LVHA 1X19A 4CQJA 4MQEB 5AOCA 1ZA1A 4K9MA 1P5RA 2P91A 1QYCA 3P45A 5IKEA 5L4LA 1WABA 1Q7TA 1Y4SA 2P9ZA 1XJ5A 3K8YA 1Z17A 4GSLA 4RQAA 2ZVPX 1AGRA 4FGWA 3JRXA 3MTJA 4FR0A 4YXWA 4M8LA 3WLQA 2R6CA 2FW7A 5F9FA 4JJ8A 4OQEA 3VNRA 4Y6RA 3EUAA 1N6RA 1I2DA 1TCVA 3WGQA 2ZB2A 3OX2A 3QE0A 4UOEA 2VUSA 4BLQA 1E63A 1K0UA 2PS3A 3D0QA 3QHQA 5CLHA 5AIAA 5EJ9A 5MHTA 3UQYS 4QGBA 5IZ4A 5K3BA 2WSSA 4U7JA 3DULA 2FWNA 1ADBA 2HIMA 5LOVA 1F2DA 2DJIA 3ON5A 3OX3A 1KQNA 4IOKA 5CDTA 3ND7A 4ZAGA 2VXCA 2V96A 1OFUX 2FSVC 3EC1A 4EMUA 1YE5A 4I50A 3MTGA 3PXDA 4HH4A 4DA0A 1XRNA 1JAYA 3CUYA 1RAIA 1B3RA 3CIFA 1U5AA 3LDUA 2VHTA 4JI3B 1KI3A 3W04A 1D4OA 5EHXA 4B76A 5KTNA 4Y67A 2VJQA 1XJQA 3L07A 1NBHA 4JEMA 3DZDA 4MVJM 1Y9JA 1QOPB 4JVSB 3RAGA 1XLTA 1J8VA 1NHWA 2QWXA 2J0EA 1L5WA 1W4ZA 3NM4A 4V2IA 2IKSA 1V41E 1GJRA 4Y2TA 1NBMA 1NP3A 4RVOA 1AH2A 2VQFB 2EARA 3TSZA 4EPTA 4IINA 3FTQA 6GPBA 1O94C 4JLDA 4OOEA 2A67A 4H60A 4YWJA 1O0SA 2BR3A 1RP1A 2VPPA 2A0UA 3H2HA 3N87A 1Z5WA 4HDNA 4M8IA 1TD1A 3PV0A 6PFKA 5KX5B 3W06A 3ER6A 1CETA 4V24A 1WMEA 2RMKA 1FXWA 3QW2A 1CSEE 4FQ5A 1ZK3A 1FNBA 2W0SA 4QJ5A 3K6JA 2P6PA 4S1TA 5HILA 3RK4A 3KYCA 2G70A 4RMHA 1SCNE 5AR1A 3FPFA 4LX8A 3QI2A 2RGWA 3FR7A 1M83A 1JA0A 3CINA 4OMCA 4QDZA 4YRKA 5CB4B 3MIZA 1AHPA 4HYTA 1FFGA 3BERA 3BORA 3RREA 1G98A 4G07A 3SF0A 1LQUA 1YZYA 4EMTA 2OCIA 2ADOA 4XQ0A 4EO4A 2PBLA 1XBTA 3QBJA 3RWMB 4BNDA 3OM1A 1C30B 1CVLA 2XCLA 3HYTA 3WO1A 1BJKA 1DC4A 1QPZA 3GLFE 2H07A 3G2QA 5L4NA 5C80A 1KNXA 1FU7A 3WKBA 3PFIA 3C3JA 1WTCA 4RM3A 2H11A 4PRKA 4G1FA 4RIIA 5FOWA 2WI8A 4GL4A 5EIBC 3UFXB 5JW6A 3WGHA 2A0XA 2QNIA 3HHEA 2F9LA 1R0SA 3DAHA 1CR0A 4UVIA 4A1OA 1K5PA 4DXHA 2YVKA 2B4YA 3B2NA 1EJ6A 1X7YB 3PDJA 2WRZA 2RGYA 1CHDA 5HKBA 1O2DA 1CUXA 4HY3A 2HRRA 1V9SA 4X65B 1QDEA 1RABA 2DYKA 3EGDB 4IZIA 1XD9A 4KBFA 1ZH2A 2HIGA 2ZR7A 2WWIA 3MT7A 5GY7A 4KRFA 2XNKA 4LF8B 2PT7A 4NG5A 2D5BA 5G53C 2WTXA 5BVGA 2PEZA 2FK7A 3TZLA 2AW5A 2G1UA 5TF0A 3SSOA 1P1HA 1U28A 4RKRA 4LJ9A 5CEJA 5EYPA 4EKEA 3WRWA 1Q3KA 1TW2A 1PX2A 2KWIA 3KTAA 4S1OA 1J2TA 3H1PA 3ZZ0A 3W6ZA 2I71A 1R16A 4IIJA 1TGVA 1Z2OX 4BZQA 4HQOA 1ZBQA 1ZLYA 5BSUA 3WDMA 3ZTYA 4BDSA 1C4XA 1ZMOA 1QLJA 1QV6A 3K20A 1ZOOA 3T12A 4PYQA 3JATA 2Q21A 3A1EA 4IFIA 4DSZA 1JXOA 3SQWA 1O5IA 1GAXA 4R1SA 3ETCA 4BKRA 3TIGA 5L4SA 1FDVA 1OFVA 3MJEA 3VX4A 1R15A 5CH5A 1J0XO 1VBFA 1M1XB 4OFWA 5E9AA 3WQHA 8ATCA 2WUEA 5TPZA 4Z6KA 5LQJA 3VNUA 1F5SA 1E3LA 3P9IA 4BV3A 2IX3A 1L7MA 2HV8A 4TTQA 2GBIA 1U5CA 3N6RA 2YWHA 3BMCA 3JR7A 1IZZA 2Q1TA 3BIWA 3LX8A 2X8JB 4D3FA 3T95A 3DT6A 3MWFA 2RC5A 3A6LA 5F73A 1YZKA 1DBQA 3PZRA 3QSYA 3MD0A 3OTQA 1RQRA 5JMOA 121PA 1O1YA 3SFVA 3PJEA 2UZ1A 3UWSA 3OEHA 3NP7A 1H1TA 2G5GX 2B1QA 4LSGA 5LA6A 4WFJA 2QLBA 3NHPA 1W36D 1TT5B 4O3FA 1EINA 2B5OA 2GRUA 2ZB7A 1SO8A 3K0AB 2VXBA 4ZVVA 2POCA 4C5AA 1O87A 3NBXX 2HBZA 5HM6A 4CHGA 2LXNA 1JFLA 3ZWXA 4IZHA 4L9AA 2PEYA 2AN1A 1SOVA 2R3SA 1USVA 1P6XA 2H18A 2HPZA 2YWEA 3I53A 1ZC3A 3BF8A 4HWSA 1YC5A 3TJRA 3ZPXA 4QVKA 1Z0KA 1LDYA 3GD5A 5IBQA 3N7UA 3HUDA 1M34B 4ESHA 4O29A 5EUCA 4CU5A 1YRBA 2WVJA 5FDFA 3ABIA 3UH0A 3BT7A 4BTVA 4Q19A 2H5EA 2HJSA 1B7GO 5HE9A 2BDUA 3KDAA 4IIBA 4UPEA 1C80A 1RRPA 2RB4A 3AB8A 5COAA 4HUTA 3MHPA 4UUNA 1OAOC 4NY1A 4MYRA 4W9RA 3OFNA 5PNTA 5EGSA 1G60A 2R5WA 4WZBB 5HRUA 5THXA 5BRAA 1ZCAA 1TEVA 3WB9A 9LDTA 3PRKE 3THWB 3C98A 2YNMD 1T43A 4MW1A 4QEZA 1YKGA 4CN9A 1CEYA 1KDRA 4BPRA 1GN8A 3RIYA 1G5PA 4ALMA 3O90A 1GQSA 3N74A 1E4VA 2Y93A 4GOMD 2TMDA 4R81A 3F78A 1TK9A 2B98A 3BEDA 5ISMA 4LJRA 3BWVA 2BBSA 1V6CA 2I2WA 4NS1A 3T34A 5FUWA 1UP6A 4AS2A 5EMKA 2IY9A 1Z7BA 3W2TA 4DSNA 3DW3X 3HWSA 3I64A 1EFPA 2ACVA 2W71A 1VL6A 4KMRA 4R1MA 4QYIA 4UUMA 5FNZA 1RWBA 4IBOA 4A2PA 4PLZA 2BZ0A 4NG4A 4NJMB 4QDXA 4DYHA 2CVHA 3H5VA 2Z0MA 4ALLA 1U63A 4YCCA 5KVAA 2ARKA 3DSRA 5IN4A 5KU7A 1YD7A 2PV0A 3FFTA 4TMXA 5CJ2A 2HWXA 4E4YA 2CLEB 1JTVA 1PDVA 5BV0A 2R8EA 1Z0UA 4ADSG 1L1RA 4J3FA 1OC2A 1RJ9A 2RGCA 1BKSB 1UBRS 4FP9A 5U4XA 1AO0A 1R6XA 3EZ9A 4CN8A 2W70A 1JIUA 3TW8A 3LGAA 2C7VA 1VJ5A 2B8EA 2JZNA 4RD1A 4BFUA 2I3ZA 5CCEA 2CBZA 3RSHA 3ACDA 1PJZA 2WHYA 3LHIA 4J0KA 3HKDA 1G21B 1NQXA 2GN1A 1UWCA 2I6TA 2NW6A 3H2KA 1GPDG 3KTFA 2X8WA 4NOLA 5MN4A 4GE3A 2PUTA 3U44B 3FNQA 2IYZA 1KFJB 1LDBA 1SA0A 2EU8A 3KNZA 1X13A 4FYHA 1BS9A 2HA2A 4LYGA 5E6UB 3UPUA 2IE8A 2AD5A 1RD4A 3L7IA 1T5LA 2B4TO 4JSYA 4KLAA 4LY9A 2Q9AA 2QE6A 3AUKA 2JI6A 2JJ2D 3PDWA 1CWUA 1LBHA 2HRZA 2F2TA 2A9PA 2V0CA 3R0ZA 2GZ1A 3OLWA 4M0EA 4YMTA 4M7PA 3WYFA 3SIXA 1CR4A 2YZMA 1MA0A 1PZFA 3R5TA 1WV0A 4A0SA 1EXVA 4AICA 4ZDIA 1UAYA 1NXOA 2QP4A 3PSAA 5AM0A 5EHNA 3U4HA 4D8TA 2R2AA 3HCEA 4B3HA 2VJNA 3DZJA 2VDLB 3DONA 3ITKA 4C20A 5JQGA 5JVDA 4YDSA 4TV9B 3H19A 3UB2A 1M5UA 4FR5A 3UHPA 4R2MA 5A5FA 1QHSA 4YJHA 3HVRA 1UL1X 2VAWA 4DXAA 4FGUA 3WP1B 1ZM2A 5MFZA 4DOMA 1P45A 3RSZA 3IAFA 3JZFA 3OETA 4PCLA 2IY7A 1DRKA 3ZV5A 1B74A 3A3OA 3VV2A 4W8HA 1TQ8A 5IJAA 5B6JA 5FX2A 3HUUA 4GMGA 2GEFA 4MVCA 4NOMA 3I9JA 2PHZA 2YYZA 3A1FA 1P0QA 1Q15A 5JTTA 5JNWA 1FQOA 3DDZX 1OW3B 1VMDA 1SBNE 2LE0A 4IHJA 1NDHA 1KVQA 2M98A 4RF4A 3Q3JB 2IK8A 4JLOA 5TDHA 2QN1A 1A8UA 1NR7A 1VGRA 5C3MA 3GDOA 2DWOA 4OLAA 3PJFA 1POXA 3SVZA 3QE2A 5DM60 2O2ZA 1KEPA 1K8ZB 3A27A 1E2PA 3FNHA 3HPQA 1IRXA 3KKKA 1QJ4A 4FMDF 3WMFA 2D7CA 5CA1B 5K05A 2AMYA 4E2ZA 4I3GA 3P0HA 4OXNA 4Q9NA 4WXEA 4MB2A 3I01A 4XE5A 1OBCA 4LE2A 3FHJA 5A05A 4IIJF 4C0WA 4OY3A 3AP3A 1HYQA 2HQSA 4PAWA 4Q7MB 4FR2A 2WOOA 1YHYA 1GRRA 2AXEA 5GP1A 4D57A 2AFHA 4JI5B 3WLRA 3H65A 3U4QA 2GWHA 2XBUA 4ZU6X 1PFYA 2HUNA 5SZHB 4FI3C 1W88B 3ONFA 4FDLA 3UKDA 4TYPA 4AYTA 1F2VA 1R88A 3JYOA 5J5VA 5HX7A 2AN5A 1EH5A 2FEMA 3UB4A 1GR0A 3UJ3X 3BKXA 3FVWA 1FRZA 2GQ0A 2JIBA 1TO6A 1HNWB 5P21A 4BNUA 2WWYA 1XZIA 1GPMA 4P4GA 4LDPA 4M0UA 1GFZA 4OBXA 1RLIA 2W2XA 1JEQB 2VYQA 3FYUB 4KR0A 5A6VA 2XZOA 3MJHA 4E5NA 1XTBA 1A2QA 5KWSA 1YRYE 3V1UA 2H52A 2V4ZA 16PKA 1PO7A 1Z75A 4WQMA 1U7TA 4LY3A 3VR5D 2QTAA 1RWPA 4TUYF 3L4SO 2N47A 3JQFA 4Q1VA 1L6RA 2BFAA 3E9CA 4OXXA 1ECFA 4RD2A 1DU4A 5HKOA 5LXTF 4Q3NA 1OXKB 4YWHA 2LCQA 1C4WA 3AB3A 5LA6F 4W82A 4E7OA 4AP9A 3H9CA 3KSDO 3SP1A 2NOAA 1CNFA 3M6WA 4FX2A 4XI9A 5AXDA 4RETA 4REQA 4ZMRA 1J24A 1KRXA 4ND3A 5HBGA 3WBBA 4UM9D 4M38A 3QZUA 3DBLB 4ODIA 4JP8A 3U1VA 4HQ0A 2G4LA 3O7MA 5CX1B 2AG1A 5EVJA 3WLSA 3ZE2B 4J76A 2QTHA 1KAHA 2ICAA 5NLLA 3TB4A 2WA2A 1IULA 2R4QA 2FPWA 1OHHA 2XE8A 4ZT3A 1T0UA 2HUPA 1J9GA 1GUDA 4Q16A 4OFZA 1BD4A 1S2NA 2OQRA 4B7ZA 4CM6A 1AJEA 4WCFB 2DM6A 3V3KA 3VVBA 1HE1C 1IIBA 1ZXLA 3O5AA 4U7TB 2FZEA 5CTJA 2AN9A 3V4SA 5KS2A 2DCMA 1EUQA 2VPQA 4KKVA 1GA6A 3ZXUB 1VJRA 4MHOA 1CJSA 1ZN9A 5HJ5A 3R4VA 3U4DA 4OHWA 2R86A 3A36A 3A4NA 3ZE8A 3V6MA 1X1AA 2H8KA 1C14A 3E6AA 4D0LB 3NCHA 4OEHA 1DG9A 3QU7A 1VRWA 1Z6YA 3CMCO 5AKZA 1ZD1A 2RDMA 4NCHA 1QIDA 1Z47A 3OJFA 1QTRA 3QA3E 4RKFA 3KQUA 1DIGA 2ZE6A 3R6GA 1LUAA 3FOZA 4FQ8A 4LNUA 2XEXA 2JEZA 1XTRA 2WYHA 5HW0A 1GZ3A 3NOVA 4U39A 3H84A 3Q3HA 4PHGA 4PIMA 5JAZA 2Q6LA 3LAWA 1KYIA 4HWTA 5ALKA 1ECBA 4KEAA 4GPEA 1G63A 2IYOA 3ZJYA 4I1PA 1WCIA 2QAJA 4NPCA 3I5MA 4IIVA 4WMLA 3IPRA 2VNJA 4HFNA 4DIUA 2NU8A 3UMRA 1ZPDA 4LOKA 2DUWA 3B85A 5A9SA 4BNHA 3EDYA 5A3JA 2WJYA 1L5ZA 1Z4JA 3PI7A 1A5ZA 2OY0A 4KQ9A 4A2QA 4B4OA 1M2OA 1O03A 1HI9A 2M6KA 5JJBA 4L5IA 1MO3A 3DWEX 3CB2A 1MVLA 3FHCB 2HCBA 2VPZA 3KUUA 4UHJA 3W9UA 4BYMA 5EQDA 2BEJA 4ZVSA 2XGGA 3O74A 4E2FA 3MTIA 3VSCA 1Z7WA 1XVLA 5AVJA 3K72B 5ADWA 2A84A 1KJZA 1GU1A 3LG2A 1EGVB 4HEA6 2UZIR 4Q02A 2HA6A 1KA9H 1Z5GA 2ILVA 3RBAA 1DTWB 2AZTA 1RM0A 2QROA 4GMXA 3T5CA 3V8MA 5JY6A 4MV3A 1LB1B 2IGTA 1E2DA 3ED1A 3HFGA 4JOSA 3Q15C 4JA0A 2O2IA 4H18A 3PFCA 4INOA 3PHHA 2FEAA 4G9EA 4R2XA 1F8GA 2F3TA 4G01B 5B7NA 3T1HB 2Y05A 3MQ2A 1T1EA 2P79A 3AUXA 1R0CA 3E0QA 1HL7A 4DR6B 3JS5A 2BZSA 1HFKA 4QHYA 3TKYA 1K8XB 1LI7A 5IBCA 3B5JA 3IX7A 4I81A 1IBCA 4FD3A 4ZVKA 2ERCA 2J9FB 1QYDA 3LWNA 4KWEA 1TMGE 5CHYA 5JLAA 3CSSA 3PD7A 3C45A 3WKAA 4E6PA 3FGNA 3IAEA 1KQ3A 1V8OA 2GZSA 1XCOA 3FDIA 1JI3A 3NRBA 4LSZA 1XZ8A 1J5EB 1VE9A 3U48A 2PQ6A 1H2YA 3U80A 1G5IA 1NTOA 5G0UA 2D3TA 1NP6A 3RHZA 5A5VA 2C0CA 1XAIA 2OG2A 5HE8A 2DVMA 2QP3A 3DD5A 4YN3A 1L5HA 1PFGA 1BQ4A 3ZGLA 4DAOA 1W29A 3B9RA 1M34E 4YJGA 5JLJA 2NUAB 3ZE9A 1PJBA 4ZZ1A 2VS1A 2CLSA 3CPHA 2Y4NA 3KOUA 4WW0A 2R85A 1PZMA 3T4EA 4R1NA 3U17A 1EXNA 3CSDA 3CZPA 4DIEA 3IMKA 3OIUA 4DA8A 4L0MA 3RSSA 3SR4A 3FMIA 4EPXA 5DO9A 2I03A 4W5JA 1E8MA 1MTZA 2COUA 3B6MA 3FGZA 1IXSB 2GPNA 2QTLA 2ZJ0A 4O63O 1DBVO 3V3TA 1A96A 3G8BA 3W5VA 3KSZO 1MIHA 1YDGA 1PFQA 3C8UA 2XX3A 4MICA 1SCIA 4DSOA 4ZARA 4GU5A 1S1MA 5DHAA 2F59A 2HU5A 4RVGA 2FZLA 3HP1A 1XVVA 1QIHA 2PSDA 3I30X 3KOZA 4TKVB 5BN3A 5IJ9A 4BX0A 1OBFO 5LOVB 1JV2B 4MVJF 1RYEA 2AOVA 3OFSA 2H08A 1LLFA 2OESA 3ZWDA 1Y33E 5HCUA 3AVUA 1K3UB 2PZBA 5BPFA 4OG2A 2HSJA 4WEQA 5KYYB 3UWDA 3MVEA 3ZGVA 2VDWB 3M83A 4I50B 3A6DA 4Q9LA 5DGXA 3WDKA 1DIRA 2VAMA 3GRYA 4HS4A 4E3ZA 1Q6YA 3S2FA 3PUYA 2WB4A 3GUCA 3H8JA 3TNLA 4B43A 1WBBA 2V1UA 3J7AC 1NYQA 2VRCD 3NGLA 5G0TA 4KMMA 1XRQA 2JIRA 2R44A 3CZRA 2PRYA 3GVPA 4ZC1A 3ZV6A 1G7TA 1LA2A 1Z3CA 1ZU4A 2RHGB 4LQCA 4BJ3A 4BN5A 1ZD8A 3KZVA 2XDAA 2IHVA 4FIZA 4HLCA 3QM1A 2JFVA 3AY3A 1XCJA 3KYJB 3Q98A 5CT6A 3IAS1 2J7PA 3N0XA 4C30A 2GFHA 3VMFA 4HDAA 4L95C 4YK7A 4ARVA 1Q1GA 1ZD5A 4MV5A 5EY5B 3IR7A 4KP7A 4WY2A 1EGHA 1PZEA 3I83A 1W48A 3D54D 3NWOA 4HDNB 4CU2A 1FRFS 2I2CA 3E9MA 5A6SB 3RYIB 3TI9A 1KH1A 3MQFA 3AU8A 3THXB 4B8YA 2GAIA 3GRCA 3WBKA 1OIXA 1QQ7A 1V7CA 1EWKA 1UBUS 3M34A 2WYUA 3DV0B 3EFHA 4FBGA 4L22A 4UU7A 2JNWA 3INNA 1XEXA 3V42A 2YHAA 2CNWD 2JAQA 3R9IA 2J48A 3KQHA 4EHHA 5I9BA 3N07A 2YY6A 3S1AA 1JKIA 5DNWA 2DHRA 2AKAB 3A2LA 5AHXA 2FW1A 5K0NA 1MQAA 4N12A 3QTBA 5D2CA 1F4PA 1TJ4A 3VKWA 5C0OE 1EE9A 1GPNA 2F43A 3GLHA 3OIGA 1FNMA 4HC4A 3PLRA 4TXMA 4C5CA 4Y6SA 2EKZA 2OXRA 2PZKA 1C1XA 2IEYA 2CWDA 3GVCA 2R1TA 3H97A 2B1GA 1UMDA 1AKNA 3FCXA 4UE6A 5LL6P 2FUCA 1W4CA 2XB9A 3T52A 2JGLA 5I45A 5L9AA 5JJKA 4ID9A 1ZCJA 2Z4SA 3LSTA 2BIFA 1WNTA 4G56A 1EZ4A 1UZAA 3SIPA 1WLYA 2I76A 4PLWA 2WM3A 2HW8A 2AA3A 4AX8A 5GINE 1KZYC 1SG0A 4HHEA 5F2KA 2ZKLA 2F64A 1EUZA 1LBQA 3B9QA 3OMLA 1NVBA 1U31A 1GY8A 1AS0A 4TKUA 2R6HA 4PAOA 4KPFC 5AM3A 1JT9A 1Y82A 4ARCA 1P91A 3DGFC 4JP5A 4BBZA 3ITEA 2EKPA 2EHDA 3F3SA 4FDVA 5C18A 5LIRA 4XWTA 1C9YA 2AJCA 2RARA 4JCOA 3VGJA 2RAPA 2FW8A 2J3JA 4KAFA 5U4QA 2IUEA 2EGUA 4KIJA 1ZRNA 3V8NA 4LZZA 1KDVA 5ETJA 3HJGA 3RSFA 4GOND 3G85A 4LC9A 2QTGA 4RQTA 1YZHA 1OGJA 4C4AA 4DY4A 5K6RA 5BVGB 3OF3A 2P35A 4Z4HA 1SD5A 3QE3A 4IQFA 5ADUS 2CXQA 1LLUA 2AOUB 3A1TA 3GMDA 1N0UA 1GYRA 4FMCB 3USZA 5DF1A 3L6UA 4CGYA 1I80A 2DH6A 2IUYA 4KXQA 4MUAA 2WMOB 1Z2EA 1E77A 4RVFA 5AJHA 4OL0A 4FGZA 2DPMA 2C31A 5DI3B 3E81A 3DOFA 1N8SA 4PTZA 4M7OA 3JZIA 4GEKA 1BVUA 2ISSD 3HN2A 5K7SA 5FPQA 3AHGA 4NESA 3UANA 3AR8A 4WWHA 5J40A 3IKTA 3E3MA 4B40A 1SUSA 1CEEA 3MERA 1WZUA 5FLYA 5EA2A 1SIWA 1U0BB 1RDFA 1FA9A 2QRVA 4BFXA 2BBTA 2IYYA 4TMKA 1PF7E 4NV0A 2ZVQX 4O1HA 5DX0A 1KVRA 2C7OA 1XLTC 3K9FC 1FZQA 2B7CA 2IEBA 5FADA 4ZI3A 1SCBA 3L7AA 1Y7HA 1ZHOA 3OKPA 2FKNA 3FOCA 4WI1A 4JKYA 5DM1A 4IRXA 2OZPA 4HWPA 1HDYA 1O6FA 1KKLA 3ZBPA 3M4XA 3FFBA 1P0IA 3DOIA 4RS4A 2GK7A 4EVIA 2ZB8A 2C4MA 3BFPA 4PXYA 3U3KA 3T3HA 2VQSA 1B8NA 2XUOA 5K9ZA 1FFAA 4WCVA 3KZOA 3ZNNA 4DQLA 4GBED 2FPXA 2JCVA 4LTMA 1ISMA 5JSZB 1A4IA 3ENWA 2IPOA 3PR2B 4G4IA 5IKXA 4B4KA 2IWHA 3V1KA 1NZJA 3A25A 4F38A 2QRUA 1DB3A 1PT8A 5E1BA 3C74A 2H16A 2WUGA 1PFUA 1P7VA 4C0QC 1VYHA 4JB0A 2AI1A 3ZY2A 4E7PA 2O2JA 4URXR 3M4JA 4J16A 2HBYA 1EI9A 3UC5A 2AK3A 4MGIR 2Y71A 2X5KO 4QIHA 2W2LD 2VJLA 5K8TA 2PJRA 3RAPR 3C6MA 1YVUA 9ABPA 5HK9A 1ZVMA 2WVAA 2OCLA 4I1IA 4LJLA 4P38A 4H3VA 3T9BA 4P33A 2F55A 1I14A 2J9GA 4M89A 3FD8A 4D3DA 3HDYA 1YONA 3K1ZA 3ZDFA 1G0NA 1K88A 1GLGA 2DAPA 1ZQ1A 3NHJA 1H8HA 1L5NA 1C1YA 3L7JA 2OPHA 1NQAO 2JEYA 3DMYA 3CEAA 1L5OA 2PGIA 3IDOA 5ELLA 5B2EA 1XP5A 1BMQA 2DH5A 4XX0B 4C89A 1UFOA 3U60B 3A3PA 2GM4A 1DEAA 1Q0HA 4JENA 2VPIA 1DTSA 3UUWA 1HF3A 3QVSA 2QMQA 4D9NA 5KO2A 3HL0A 1B8VA 1J49A 3C87A 3GLVA 3U3RA 4JKOA 5K09A 2HU8A 4N5DA 4DNXA 1YBAA 4HUQA 2CVOA 5DEIA 5IANA 4RE5A 4I55F 4V38A 3QJ5A 1NMZA 3ZW9A 4CG2A 3GAFA 3E7WA 2HF7A 4GXQA 5DJ5A 2VO1A 5IDVA 3GMSA 4JOCA 1E3JA 5LCXA 1U28C 2BR5A 1MA3A 5KHLB 4N3BA 1JLLA 1PRYA 2BCGY 1CFZA 2PT5A 4QDUA 4QICA 1EFPB 3E7DA 2E1RA 1FDIA 5FPYA 2MINA 3SSMA 1ZH8A 2IZZA 1SVSA 3G8CA 4KAAA 1IBLB 1XA3A 5D5QA 4XWWA 1Z2DA 3NPMA 5LM3A 2BEWA 1DC6A 1Z73A 3HCCA 3M5CA 1NKVA 1UBFA 1E0KA 1HTTA 2HJRA 1K2VN 2C1ZA 3VOAA 5EHIA 4EKNB 1JQLB 1U4OA 4NBKA 2OEPA 4EITA 3RYCA 2YWCA 3O26A 4EGFA 1U0NA 2CZGA 1SQFA 4MZXA 2X1MA 1GTL1 1RJ9B 1JEAA 4C43A 1NM5A 4D92A 4F84A 5A7FA 2ORVA 5CAEA 1MOZA 5HF8A 1GCGA 2Y6VA 4O2AB 3TW8B 5C1BA 3X1MA 1MJ5A 5AUOB 5JASA 1CDEA 5IARA 4G0ZA 4OUKX 3WISA 3UTCA 4BYGA 5LKRA 4MAAA 4XDHA 2QPOA 4OV6B 5ALVA 2WPDA 1NXQA 3SICE 1WBDA 1XB2A 5EP2A 4V0NA 3F0TA 3L9WA 2ZT5A 2WBLC 3OLYA 3G49A 1ZM7A 4NYIQ 4F5ZA 2ZYTX 1IPFA 1T9ZA 2KJQA 3T38A 1APBA 3H5LA 1SIOA 2QT9A 3NB0A 1S2OA 2F4VB 3IT2A 3MW8A 3RRZA 1QGUA 3FBTA 5KPJA 1E3WA 5KC8A 4HDSA 1HORA 1X94A 5U9CA 3OZSA 4AURA 1W49A 3V4ZA 4XASA 5EZ5A 2B8NA 1JIIA 3PPXA 4JJ7A 1Z25A 1GUZA 4EG6A 5B4UA 1R8JA 3O4HA 3HXLA 2WT9A 5DSZA 1NBWB 4RELA 4BVEA 1PUJA 5KTYA 1KEEA 2JLYA 4CFZA 1AK2A 1N1EA 1R5BA 3CLTC 2YTZA 3GAZA 4C3OB 5IRCD 4YHBA 3OM9A 1GCAA 1RIIA 2BFFA 4EECA 1IXRC 3UA4A 3IIJA 1A69A 2QG6A 2XUAA 5ALWA 5JVDB 3KKLA 4C0JA 1E99A 1X7XB 1Z82A 4E2YA 3U3ZA 5IN5A 1BGXT 4BUCA 1E1CB 1WXEA 2E5WA 2REQA 1JPVA 3ZU5A 4YJHB 2ZIGA 3E84A 1ZP6A 1YHZA 5ALNA 4OJYA 4HVAA 5HZHA 1FDSA 4FDAA 4RSRA 2VOEA 1XV5A 5EJFA 3QU2A 5KKCA 1M6VB 2ZRHA 4RFLA 4BIMA 4ENVA 4G0WA 2J5QA 3EXIB 2YRFA 4S2EA 1DQSA 3W6OA 4A5OA 1V37A 2OXCA 4EHLA 5H9WA 5LZ4A 5EZQA 3AM5A 3ZJUA 2FWJA 4BNZA 2RGGA 1Q0SA 2HK7A 1PQYA 3II6X 4RPLA 3THOA 1E79A 1U4NA 2HDNB 4CLHA 2B34A 2ZCJA 4AP6A 1JBQA 3DOUA 2L69A 3NWJA 3AFMA 1SHUX 4DL9A 2ZAGA 1MX9A 1YA8A 2ZJBA 3KFVA 1J8YF 2ZRNA 2A9VA 5DWQA 4DLPA 1Q20A 4EJSA 3CNLA 1PNQA 4ENSA 1B23P 2W6NA 3NBUA 3DFZA 4EUSA 4FEEA 5CITA 4OGLA 4OK5A 1M66A 2ZS8A 5KCZA 3F5SA 1AQLA 2VF4X 3HFRA 3NHAA 2J33A 4HN4B 4EI2A 1ONNA 3JARA 3EGXB 4J2OA 1OH5A 4TWZA 3M6IA 2O07A 1YQWA 3EBOA 4RQUA 2NP6A 2JI8A 4XFDA 3RKUA 4O59O 3ZXXA 2ZBGA 4CMHA 3RCBA 1OGYA 1JHVA 3WC4A 1FVOA 1RTKA 4BFWA 4R8RA 2GEJA 2H6EA 2H7CA 3WK9A 3UT6A 1QONA 1NKSA 1T8RA 2A78A 2XUKA 3E58A 3HCNA 1SHKA 2C83A 4HBZA 1N0IA 4K3UA 3L5OA 1EMDA 4R1OA 4CMIA 2FPGB 4WVLA 3A26A 1NMYA 4J9UE 1T2FA 5JRJA 1NXVA 4GX0A 4W99A 5I8WA 2R4UA 1KU6A 2C82A 1VOTA 2A7XA 4L4ZA 4IHAA 2OR3A 4H17A 1WDKA 1CJVC 2QV0A 1Z6ZA 3LY8A 4FFWA 4L4RA 3FX2A 2G06A 5EC8A 3QQ5A 2QN7A 1RYYA 3OJ0A 4U2FA 3GGJA 3UHFA 1JHUA 4UQLA 4O8CA 5JYEA 2V3CC 3IKJA 1G2QA 1NBME 3D6VA 5FUYA 3P0JA 1O0CA 3SR3A 4YRBA 1XZFA 3EPJA 4CV1A 1LJLA 2QL5A 4FJ2A 3N9IA 4ETIA 3UG6A 1KO8A 4P3YA 2PZFA 2O8FA 1Z9BA 1BRTA 5B7QA 2EZ8A 2YWDA 4ZXFA 4ZOLF 2AG6A 4REQB 1T4CA 4CF3A 4XPZA 1IM5A 3VTAA 1HT3A 3RTCA 1TYBE 3L7BA 5JAPA 3AEQA 1DOZA 3LT5A 5DBIA 4KGVA 4KGZA 3UYKA 4EUHA 3SEFA 3RS3A 1V8ZA 1X1QA 3GPIA 2QN2A 5K1ZA 4E13A 3RAEC 5CFPA 1T0PA 4R31A 3P2EA 4HJXA 3QTTA 5LP6B 3CM0A 3T4PA 1V1MA 3JQQA 2O7VA 4YFYA 3ZY6A 4G5SA 1TU0A 2FKAA 1YVRA 1ADCA 4HN2A 3ZQJA 3RC2A 1HYBA 1NJFA 1O4WA 2AKYA 3UMMA 3C1UA 2ZUWA 4HXYA 4KQEA 4MAFA 3S6JA 4WT7A 1QU2A 3RROA 2IUTA 3ZQ4A 4C3UA 3H2JA 3ZW7A 3HS3A 3JTMA 2ECPA 2PX4A 4DB2A 5AM4A 1QP7A 3U9LA 4MUHA 1EEXB 3I76A 1WXHA 1GKUB 5FWXA 3I4LA 4HMPA 4XGQA 4IX1A 4MK4A 2C92A 3OH8A 4P5PA 4DDMA 2Q5FA 1KWKA 3WA7A 2W6JD 3ZHUA 4GH5A 5FHQA 4IDGA 4OJMX 4XIYA 3ODPA 3DB1A 2VH1A 4NONA 3SNKA 4LNUB 1JJBA 4ZO6A 2I22A 4ONEA 3G6WA 3GELA 3VDNB 5JMWA 3IQDB 2QBYA 2HHLA 4FW8A 5EXDA 1E5TA 3G0OA 1EFVA 4W5OA 3D3QA 3UJDA 2YIMA 2Q8PA 5IVKA 4WFKA 4BXOA 2RHCA 1JZSA 2OM2A 3KB6A 4IJ5A 4MIEA 4A23A 7YASA 4COKA 5A9SB 1LK0A 3MRXA 3N8IA 3U31A 5KQLA 3ACBA 3DAOA 2D1TA 3OHMA 3ICWA 1YZVA 1ENPA 4Q3OA 5REQA 5HNKA 5DSXA 2ZTHA 5AW9A 2OFXA 2QRPA 4K8RB 3JD2A 1ND5A 1R5JA 5MGBA 4QOJA 3JAMA 2FU5C 3N8GA 4NDNE 3BGIA 3TIFA 2FDRA 4RZSA 1MOPA 4F6RA 2VTDA 4FYMA 1HO3A 4R4JA 1JHPA 3ZZUA 4OLHA 2NSYA 1SJ9A 4FJ1A 3O4GA 1UT5A 3WKEA 1X9GA 1FYWA 2Q6VA 5EJ7A 4BFZA 4CGZA 2W6ID 3FXAA 1UBJS 3JQFC 1U8ZA 2JIZA 1OX4B 5FNVA 4C0LA 5B64A 4M99A 3ZDRA 1MCZA 2OMKA 4XDGA 1L7QA 4QBHA 2HZ7A 1XEWX 2FH5B 5KTSA 3KT3A 2XWBF 1N33B 2FYTA 2PR2A 1WEHA 2JEOA 3IPLA 4ROTA 2VA8A 2WTNA 3PG5A 4HNVA 2IP4A 3O1IC 4PXSA 3IVAA 4ERXA 3ICQB 1QANA 5J5CA 5C34B 2HT1A 4MKIA 3RRNA 1I2MA 4MVXA 5CLQA 5CDHA 3FMGA 4LF5B 3H2GA 2C2ZA 4X41A 2P2SA 3KOYA 1U1DA 3KZNA 1XL1A 2CE2X 1M5RA 2VDUE 1OXUA 3L82B 1VYUA 2AEMA 1HYHA 3EN0A 3QVGA 2C04A 2C98A 1U3FA 2AXQA 4Z3KA 3CWCA 1KSFX 4JYZA 2QZPA 3DZCA 3TLYA 1Y5RA 4YP6A 2ZFUA 1K8RA 1GWNA 1EX6A 4YQEA 5K8UA 1O8CA 2JCXA 1SQSA 1FBNA 5E2IA 2JW5A 1JIVA 2IZ1A 2LW7A 4LF9B 3FSRA 5HQ3A 2UZAA 3PQ3A 4MA0A 1QDLB 2HD4A 2Y0PA 4JT8A 2DFKB 5E7JA 4YV0A 1RC8A 4F8EA 1DQNA 4OYHA 2JBHA 5FP0A 1ZX1A 4FFVA 2OV4A 3DR5A 3L8FA 4L2IA 4JUDX 3OLVA 4PFQA 5KYTA 2FPRA 3R5SA 3RBXA 1IMJA 3BMXA 1C7ZA 4KXXA 4Y2JA 2GBPA 3BMNB 3UWMA 4DLRA 2XCSB 4LV6A 5CK5A 4YASA 1CB0A 3ZWBA 4L9SA 4AT1A 4DCNA 4OUDB 5DGTA 4G1EB 4K88A 3LW7A 4JXZA 2C5GA 1AXRA 1R4NA 1G42A 2WM8A 5F12A 3J80A 2PKXA 3BQNB 4ZYUA 1GGEA 3PZBA 1K6IA 2WWRA 3QEOA 4DMGA 3FN4A 4ZYYA 1QE3A 3G13A 4DR5B 4EHIA 2CMHA 4ITUA 1Y3FE 3BFVA 3OMXA 1M1UA 4Q66C 1Z7YA 4NL4H 3DPUA 4YMSA 3LBNA 3S7ZA 4CV0A 5IYZB 4GOXA 1ODCA 2BY4A 3COSA 2Q99A 4N3GA 2D5CA 3COWA 3QFTA 5KTPA 3N5KA 2AQHA 4L75A 5EZYF 3AI3A 1L5KA 2TYSB 5BSFA 3VMMA 2JLUA 2QL9A 3GOHA 5EFOA 1DAFA 2ALJA 2NSJA 4GPD1 1X2EA 2DWPA 1UR5A 2ZREA 4AUNA 2OG1A 1E2FA 4IWNA 5I3ZA 1H9BA 3GP8A 2E6UX 2PL1A 1N77A 1T9BA 5A0VA 4DUZB 3OQMA 2NVOA 4I66A 4M0PA 3RWBA 4C88A 2HMSA 1U7ZA 1MR3F 2LUOA 4XYMA 5HJ7A 2E37A 3GAAA 2OV6A 2VHYA 4Y18A 4A8HA 3GT4A 1KOGA 1GSAA 2WFLB 1G9XA 3EA4A 1E7SA 1XAHA 1KZ7B 3SOPA 3VR1A 1OLUA 1JJ7A 1T2DA 3HCRA 3HMQA 2G9NA 1J23A 4Z0TA 3UA3A 5KNDH 5ES3A 5ITVA 1T5DX 3U6KA 4RDCA 1VDMA 3VAYA 2YS6A 2N42A 3CZCA 1QOQB 4JIMA 1IONA 1VJTA 2OAEA 5FOQA 1TQ4A 1V0JA 4D80A 3IQZA 2FMIA 3TOXA 5L6LB 3M6VA 4KI7A 4A6PA 3D4NA 1OYWA 1CNEA 1G3UA 1HQKA 4BQSA 3E9ZA 2XYQA 1QGAA 3B1ZA 2J5KA 4H3SA 2HHHB 1R0XA 1JR2A 4G23A 4IFBA 4UAJA 2GH1A 4N49A 1Z6XA 2SKEA 4XYEA 2QN3A 1MAWA 3N59A 4D81A 5IF3A 3X1WA 4XD7A 2Z6AA 1SUCA 1WA5A 2P8SA 3ANSA 3INRA 2LIVA 1TQ6A 2F43B 3HY3A 3GLHB 2XMQA 4FT2A 1L9KA 4U9UA 3V32A 5KJFA 3ETEA 4B6PA 2YYAA 1AD2A 3TI7A 2ZJAA 3U0BA 4ZHQF 3DEZA 1GNVA 3P0FA 1RZRA 3MAGA 4ML3A 5JT1A 4DV5B 3C3XA 4KJZA 4AWAA 2R1TB 2ZQZA 1H2BA 1UMDB 1QK4A 3JRNA 3EMKA 1LXCA 1T29A 3H6KA 1WDWB 4DIOA 1TYCA 3OAAD 2GCPA 2HF8A 1Q1QA 3PHIA 1DINA 3GVIA 4MKXA 3CTPA 3FDZA 2RGXA 3V46A 4PBRA 3SBDA 3I5YA 4BNLA 3KYDB 3IP1A 4KB5A 2PUJA 5JSFA 4MOWA 3A1WA 4OI0A 1DJLA 2IDMA 3FF4A 1SOWA 2I80A 3ET4A 1UQUA 3HNOA 2DT8A 4KNWA 4B3MB 3HCPA 3MAJA 4L78A 1KMMA 2IITA 1P19A 3KX2A 1EJ0A 1X7ZA 3KQWA 2VBIA 1UPTA 5ERYA 3MJCA 2F1HA 2OAQ1 3D2BA 1T8YA 1R8QA 3JQRA 4IHKA 1VIMA 4MJ3A 5JS6A 2XF2A 4C1BA 2YJZA 3ABOB 2PNFA 1Z35A 4P36A 3VISA 5C1OA 1XN4A 2BGWA 1W4AA 3M6FA 4YJ2A 3EA5A 3FFXA 2B83A 3A1SA 1ISPA 4DT1A 3RHTA 3GG2A 2D06A 2BRUA 1F14A 3AMVA 1XMJA 3IEKA 3LUGA 4KO1S 3H8SA 4K9QA 3PDUA 4RWZA 1V7ZA 3ZDEA 3R5FA 4BKPA 1JLMA 2RHOA 1O6ZA 4ZMSA 4KH1A 2WD8A 2BGLA 2DR2A 1PNTA 1C4OA 3MUEA 2I3GA 2Z5FA 3LPDA 5E95A 3U26A 4BLRA 4CKEA 3GL9A 2AFHE 2WTUA 3SEQA 2C9DA 5D00A 1G9TA 4M1OA 2WIBA 4S1NA 4AJEA 4B74A 1U2GA 4CKZA 4P3XA 2QRVB 1RKUA 4L4XA 2HA0A 3PHLA 5K3FA 3ENKA 3IR6A 3SMQA 2PRJA 3ZH2A 3AEXA 1HE2A 1FLVA 3C14C 5BRNA 2VCYA 2XZDA 3S7TA 4INJA 3SQNA 2Z6VA 3CZ5A 3URKA 5AW8A 5FNVF 5LNK1 5KPDA 5CNKA 1W5TA 1SBYA 3RVKA 3ZD8A 1O97C 1II8B 2PR7A 3WFIA 4BVJA 4EDHA 5FB3A 4CTNA 1RRMA 1Y4UA 3ZS9A 2J8ZA 2QK4A 4NFSA 3RVJA 2JA1A 1E1RD 4GI2A 2QEQA 4IH9A 1DBRA 5DXAA 2IWRA 3TMYA 3O7WA 3P9ZA 4FOOA 5TQ2A 3DTTA 4EBFA 9GPBA 2Z83A 4AQYB 3NI2A 3SIWA 1A77A 1CK4A 3GEBA 5K3DA 2Y1WA 1YI1A 4GZ5A 2I4RA 4D9GA 2WHQA 2K2QB 1TAHA 3E35A 3KG2A 5JCJA 5DI9A 2M2IA 4EQ6A 1DBPA 3CX4A 5FUMA 2AG0A 4RLFA 5TVGA 3VPBA 3B3FA 1VLHA 1VIYA 4DWJA 1QQAA 3OFND 3EBPA 1QVAA 1ZGAA 3PNBA 1TIPA 2X23A 4YP1A 2VSFA 1Q21A 7GPBA 5HWSA 4M3NA 5CXXA 3RK1A 1CZHA 1O95C 1DRUA 3KQPA 5BQ5A 5L51A 4TV8F 3E9EA 3U4CA 3UZUA 4S24A 2ODAA 3LF1A 2QSYA 3O9ZA 3HCAA 1A1SA 3AUTA 3EVNA 4QFDA 1WU7A 3MMSA 5AK6A 2O23A 1FRNA 1RWQA 1XKTA 3PGMA 3VHQA 3L8MA 4DMLA 1E6MA 5I7EA 2LKCA 3T0GA 3NNDA 3O0DA 2CEAA 4XVUA 5JJCA 1RLJA 2V7VA 4R54A 1QYXA 1DELA 1I1NA 2F3UA 4DBVO 4ZJPA 3E3AA 3QXXA 5CXUA 3L4BA 2C4WA 4M98A 4Q48A 5E6SA 1QRUA 2C88A 1SXGA 1WMDA 2DBQA 2P62A 1E8NA 4JLPA 4HUQB 2WA1A 1PG5A 1RIFA 3MA0A 1B3BA 3O82A 2IYTA 1F3LA 5JD6A 1VL5A 3I01M 4MULA 4EJFA 4ZJZA 2RH8A 1VBNA 1CVRA 1QMGA 1GL6A 2OT3B 5ED0A 1SG9A 4JUCA 3SZ3A 2Q5LA 5C53B 5CBKA 1Z8FA 1EFAA 1H3FA 1O6BA 4C05A 4RYLA 2JATA 3MBOA 1JLLB 4KSYA 3CNEA 1NW6A 1OF1A 1Q12A 2X0JA 2RAVA 3WQBA 1VA5A 1D2AA 2FMKA 1QQ6A 2CD9A 2GEKA 2MINB 3NOXA 4IKPA 4YRRA 4B6GA 4LF7B 3H0KA 1UADA 3DOOA 2BEWB 3N7AA 4UZFA 4ER7A 2FK8A 1ZO8A 4RH0A 1YZNA 4ZYXA 4MH0R 1T10A 3GZTB 4H08A 4BMYA 1C1HA 1TD9A 4P54A 5AJZA 3NIFB 2PUBA 3EVCA 4E12A 2AG5A 3KQQA 3PR3A 4HQNA 4HPJB 1AF4A 1TM7E 2Z8XA 3AYXB 3CUEF 5CAEB 1NR1A 2R84A 3ZEIA 1HQCA 1OX5A 4G81A 3VTZA 1ZVKA 1PT7A 4XIFA 2NGRA 5F35A 1XMPA 3WVNA 3Q8WA 1QG2A 4RY2A 4WOCA 3LKZA 1Z12A 4LXUA 3TDKA 2DLCX 5K8CA 2XOKA 1PL0A 2CF5A 3OBIA 1CY0A 1ZKMA 3TD6A 2Z5GA 4QBIA 3W6NA 2CF6A 1E3WB 4TSRA 3M5DA 2I1WA 2WD9A 4RIGA 1HMPA 1T3GA 3GA5A 3GGGA 4HDSB 1KTIA 1SXQA 3K5WA 1YJBA 3RR2A 2ZE5A 5FLKA 5G4KA 1ADYA 1EK2A 3Q7RA 1OUMA 1G8AA 2C2OA 2XMCA 5FXMA 2QTVB 4WDQA 5MDHA 1ONSA 1TTPB 3BEOA 4F12A 2AZDA 3C8MA 4KCGA 4C07A 2O1XA 3IO5A 2X58A 3DLCA 4DARA 5JR3A 1EDOA 1G4UR 1QC5B 1XFDA 3E61A 4J16C 4LECA 2IU0A 4E22A 3AI1A 2X3UA 3LPAA 4YO8A 4E6EA 3FOBA 4CEJB 4EFMA 2IW3A 4GX1A 4M37A 4DMHA 2REQB 5CCDA 1MC4A 3KEMA 3ROGA 1TIKA 3RC8A 3Q5EA 3OSUA 3N0TA 4LE1A 4NU0A 5AOBA 4O2RA 3RVDA 2GESA 1W85B 1P9OA 1PGNA 1Z39A 4WZZA 3W34A 1Z18A 1JFSA 1DWOA 1FXUA 1AQYA 1MX3A 3OCVA 1A82A 2JGDA 4V3CA 2GO7A 4GOLD 6REQB 1KI9A 3G6KA 3GFRA 3P5SA 3FCOA 3TIXB 3OHSX 2ASVA 1P1BA 1FP6A 5GONA 1QRTA 4BLPA 3LQYA 3PFBA 3RB8A 5BV7A 2XGSA 2YCBA 3BWXA 2AD1A 3UCEA 3QJYA 4YRNA 4HMQA 2XBLA 3RV3A 4JLBA 4H7JA 5AJVB 1K98A 2UU9B 3LWBA 4JBYA 4RA6A 5CPFA 2I0FA 4MVJD 3I6ZA 3HKBB 4ZCQA 2B4QA 4XRRA 5ADVA 4YJ2F 2G9UA 2NVBA 3KJEA 3NCTA 1Q7BA 5AVSA 3MWJA 1Y0BA 1E5XA 1D2RA 2NUBA 4RD3A 5LPNA 3QVMA 5IDQA 2P4UA 4DVJA 3HXPA 3W9YA 1I1HA 4CUJA 3VR6H 1YF3A 1R5OA 3HKEB 3R0VA 2QN8A 1FU4A 1VCMA 4QM7A 3CNQS 1TJPB 2I6SA 3N2GA 3P27A 1CU1A 1VCIA 2GXSA 2OBYA 3PTZA 1V7PC 3A4MA 5E8RA 5IDYA 4UHDA 2OLKA 3TYXA 4LI0A 2ZRJA 5I3CA 5DBFA 1T36A 4RULA 3FOFC 1SBQA 4ARZA 4F1KA 4A82A 3OJWA 3RJ9A 1BMFD 2WZCA 4NCIA 4RK1A 3GR6A 1NM5C 4FXOA 2X0EA 3UCFA 1LW7A 1BXGA 1AKVA 3HA5A 1NIJA 2CYBA 3B8HA 3HV2A 4JDUA 5H82A 1MQ9A 2G83A 2YDXA 3NOOA 3K9NA 4K40A 1DKUA 4MS4A 4UHBA 2D1SA 3UJCA 2J59A 3X2EA 3R23A 3U3XA 4F86A 5JPCA 1MP0A 3G5AA 2AF4C 2IEDA 3RTBA 3TVDA 4A26A 5K0TA 1WXGA 5HTOA 3MK31 5JY1A 2YY7A 2PH7A 2DULA 4F1WA 2I55A 2DFTA 2VAPA 3IP9A 5B6PA 1XZLA 4K46A 3A05A 1ES9A 3AKCA 4MRMA 4YLEA 4PNEA 2P75A 1AE1A 4MQMA 2DEUA 1FUYB 1R2QA 4L1KA 3TOCA 4N8EA 2SKCA 1XXLA 3CNNA 3I92A 1S2LA 2I5PO 1XZKA 4OXQA 4YX9A 4CIWA 4E32A 2P1ZA 4O33A 3IO3A 1KMHB 3DT9A 2RGUA 3HA2A 2RI0A 3NHWA 3I2IA 3WRXA 4QWWA 4B87A 1UDRA 2RGBA 2P4HX 2OXTA 2PBRA 1T9KA 4K9NA 2PAAA 4C14A 1OE0A 3AEQB 1K08A 3FDFA 1MC8A 3D0OA 1NOKA 4DDKA 4EKYA 5J4LA 2OGUA 1NUUA 1JR3A 1OI3A 2II6A 2P0YA 3F4BA 1U9JA 3CVWA 3GLHE 1FSSA 5LYJB 4GLFA 3T8YA 5T3UA 1FEZA 5I8ZA 4Y9DA 1PJLA 4HT3B 1E2MA 1XELA 1ISIA 1MO2A 2AYXA 2Y1OA 1YB5A 1H93A 2HBRA 2FLVA 1UAGA 1NKTA 3KXPA 3UHAA 1OYVA 3MCAA 4M46A 3IAAA 3IQGX 4MLPA 4V0SA 1KERA 2YHBA 4OMUA 2XSZA 3HI6A 4EJ6A 3KLBA 4I4LA 1N75A 4Q9KA 1CZKA 1MFPA 2P11A 2PTHA 3I9NA 4Y9SA 2XGJA 4MI6A 4ZZ0A 4K6HA 3PA8A 1Y5NA 3BILA 3IYLW 3PJGA 5BN1A 5FOVA 1KZ9A 1T6NA 3BICA 1G2PA 2A14A 3LLUA 5FA8A 2XKJE 3RF6A 2AZXA 1K6EA 1Z2CA 3C85A 1NSYA 4U7PB 5FWXB 1QCZA 1FTGA 3HR7A 3KSMA 4BO6A 1TO2E 4NJOA 5IJZA 1U8FO 4YNBA 1P29A 2HWYA 4UBLA 5IF9A 3PUHA 3FLAA 4N3CA 4R9UC 4EJSC 4ZZ3A 1U2PA 5ALUA 2CN1A 3H1GA 3AEUA 1UK8A 2ZJ4A 4OU5A 2YCLA 5EEGA 5IUKC 5LB2A 3UXYA 1JEOA 4A6XA 3LHFA 2QBYB 2CDNA 3EEBA 3LZCA 1VG0B 1H5QA 1SUDA 1NA5A 3I2FA 3KTOA 3QHAA 2PO5A 1JF8A 2F3QA 4WDRA 5FI5A 1UKVY 5EL0A 2R87A 2BMEA 4WLVA 5ICEA 5KAMA 1W5FA 3EZYA 3RS8A 1EM8A 1Y6RA 2WEKA 1SXJD 3VR3D 3VBEA 3ZE7A 5KNBA 1PSZA 2W22A 2EZTA 4ZOAA 3LP6A 3DXZA 1XMOB 2NO5A 4K9RA 5F2OA 3SZUA 2OQIA 4DJFC 1WCV1 5L3SB 2ZIEA 4F6RB 1YZFA 5M34A 3N2KB 4NZ9A 4P82A 5D01A 5E7IA 4F4DA 1P33A 2JRCA 3PHBE 3ZU2A 1UF9A 2XD9A 5ICCA 3BWBA 3RKRA 2NT3A 2X5XA 1DC8A 5HFAA 1H05A 2UZ0A 5IZCA 3IEUA 3IESA 2OSVA 3K8OE 1VXOA 3QU5A 3KU4A 1PTKA 3PGVA 3ADKA 3K9CA 4ZODA 4PX2A 4B35A 3OQNA 2HGSA 3IUJA 1G2IA 4KO3S 3AF1A 1KHHA 2AN3A 2XCOA 1E3MA 1TPYA 2QRNA 1DPGA 1M76A 2WYVA 3DHYA 3G5MA 4LMAA 1QF6A 2GJ4A 2J31A 3C7DB 5LZ8A 4BX8A 5FTLA 1UQTA 2CHFA 2GERA 4MUJA 4YT5A 2ZJ2A 4EUEA 3DE6X 5SY4A 5KWEA 2IBSA 3WO0A 5FHRA 4CEJA 1N3YA 5AHWA 2Q3BA 4UM5A 1C7JA 1GGNA 1AOXA 1K75A 1UDXA 1RMQA 2L19A 1NMXA 4F3YA 5BW8A 3PGKA 1N2EA 5JADA 2GZRA 1B8UA 2VBGA 2C5EA 3KVOA 1G7CA 2EVWX 4B3SB 4BDTA 4CL0A 3DAYA 4DSAA 2BOVA 2P3QA 3R3JA 3H5NA 4UOZA 2P2CA 3DE7X 4BNYA 1HDEA 5DK4A 4B33A 1B2RA 2QD4A 3Q3VA 4MQUA 5CB8A 5IEJA 5LMZA 4DUYB 3AFHA 2HYIC 1GAQA 1ZOPA 1P9NA 2CY0A 3KIPA 5ESWA 3Q12A 4DWOA 4RK4A 3NNSA 1Y7PA 2V7TA 1QIMA 3O73A 3SFTA 5KYWB 1KE1A 2QW0X 2FHSA 2NO9A 2YVUA 1S2DA 2A59A 2A9JA 2FMFA 4M1WA 3CX8A 1U2ZA 3HB1A 3PL5A 4ZQHA 2BMJA 1C7EA 1PSWA 3EVGA 4ZAVA 1TQ2A 3S68A 4QOHA 2CXXA 5GMOA 4D82A 4JT9A 3V1MA 4R83A 2G8LA 3L0PA 5ALOA 2G4CA 4C87A 2MMGA 1LTKA 3F74A 3QVTA 1R4NB 5TMBA 2IYQA 3Q87B 3WL6A 2C0PA 2O8DA 3UT0A 2QR3A 1P74A 1JDBC 3ME5A 4YRQA 1MH9A 3VU3A 3WYCA 3QP9A 2ODQA 4L3VA 2RKBA 3NXSA 4LQ4A 1W87A 4DM3A 3DO5A 5BXQC 1Z33A 3NVAA 3GYGA 3ZKAA 1AZSC 1A2BA 1N5LA 3D43A 1DCMA 2IGBA 2PKEA 5DGHA 2RH5A 2BSAA 4JWKA 3VZCA 1Z6AA 3LT1A 4N0QA 2IQIA 3L8ZA 3LMKA 1II0A 4MQ4A 1WUTA 3MS7A 4I3FA 1Y9AA 3FRJA 4GGOA 4IKOA 2R6JA 1U3WA 4WA8A 1L4BA 2BFDB 2OP0A 3DL2A 3CT6A 4E2XA 5K5EA 1Y5IA 3B48A 5D3QA 3CVVA 4AF6A 4Z0NA 2OOKA 4AU1A 3V4LA 3LBIA 4ZAXA 5H1YA 3TX2A 3GWGA 3SBOA 4KPUA 1SFRA 3O8DA 1NBIA 1DFHA 1OT3A 1T2UA 1FFHA 3VH2A 2C4TA 3KEQA 4DJDC 5EMHA 3RLIA 1VCHA 2CFTA 2FPIA 2FV8A 2Z8YA 1OLUB 2VCHA 2WU3A 3NEPX 3SYMA 1K27A 1G5RA 4U7DA 1MC1A 5HUHA 1JILA 1D2MA 5KTMA 2N1MA 2F4NA 2VL7A 3F4KA 2D0DA 4AYXA 5CYGA 2BFEB 3LVFO 3HKCB 5DMXA 3KHUA 1QZXA 4H7IA 2QX6A 3ISJA 3WGNA 1G17A 3GF4A 1YASA 4MEJA 1N57A 1W52X 1WR8A 1U7DA 1YJXA 4CM5A 4F60A 5DV9A 2YRXA 1QFSA 1KAGA 4M4SA 1O95D 4P4LA 2CHVA 3DQQA 1XQ9A 2WFAA 2JKYA 3CJRA 1E6WA 2R8RA 2WU1A 5F2NA 2GZHA 1Q84A 2NXEA 3IDAA 2NVWA 4Y1FA 4JYAB 3E2PA 5B3LA 3QPUA 4C5BA 4YMVA 1FX1A 2PVPA 3QF7A 4RADA 5ICFA 3IVXA 1YQTA 1M2HA 4IW3B 4IS3A 1ONBA 3LXRA 1K4KA 4PC3A 1KXZA 4UBOA 4C21A 5EPUA 2VP3A 3H3JA 3OZUA 4XW2A 1BH6A 2CEKA 2CMFA 4P4TA 4Q9IA 4RH3A 5KWIA 4TMWA 4RAQA 4TKMA 3VJLA 3FDZB 4Q9JA 1QG0A 2CLIB 2PKQP 1G20A 1S8OA 5EUBA 3WL8A 2FMTA 4FYVA 1QTNA 4LYAA 4QBFA 3TFOA 5BYAA 4N5IX 1DMSA 1CZUA 5PGMA 2ZSIA 2KBFA 1XTJA 1QSGA 3DO6A 1RVV1 3DBRB 4A6EA 4CLXA 4M1TA 3DV2A 3IT0A 2FMXA 4QBKA 1JQJC 4EF4A 4XGNA 3EEFA 4I1YA 4YPOA 3EC7A 4OF4A 2VSXA 1OYYA 5CNJA 1O0BA 2DWUA 1X7ZB 2QN9A 1ULBA 1E5QA 4MA5A 3P26A 3DKIA 4JSTA 1NBOA 4HTAA 4OHZA 3KJNA 3UKOA 3D8HA 1UEIA 3L8HA 2NU6B 4LCJA 3R7SA 2HMYB 1QKKA 1SUPA 2C1EA 4O2AF 1B00A 3F98A 4DNPA 2V1XA 1AG9A 5DTQA 1GTJ1 4BJHB 1CFJA 4UFOA 4CR6A 1RYHA 1D04A 5KNCH 1U2DC 4Y0VA 2VT3A 1WP4A 2W5UA 3KJFA 4TSKA 1L1FA 4DT1B 4F8JA 4B48A 1L8LA 1M1YA 2JC3A 3A6HA 4JKIA 5TEWA 1OZHA 3FCCA 1UJMA 3DTYA 4MRRA 5DM4A 3ROFA 2PGDA 3QBTA 1RJWA 4QPZA 4YC7A 3K0CA 5BNTA 2A5DA 3BCSA 3F3YA 1PV4A 4RFSA 3MXOA 3BE8A 2XCUA 1PG0A 1V5FA 3T9AA 5HCIA 4DLLA 1NT2A 1GRVA 2DHEA 5AMXA 5ANRB 3MINB 3AEZA 4NC9A 3CO0S 2UZ3A 3KPUA 3UMVA 5KTRA 2NO0A 2BISA 1TVKB 2GHIA 5B3AA 4IMJB 3A7DA 3JWPA 1KQGA 1O96A 4DEYA 3GRFA 3MGBA 2DPGA 1T3LA 2Z2YA 4AI6A 3BRWA 1KP2A 4D46A 1E89A 4YP5A 1M8KA 1P75A 5MN5A 3ASUA 3WADA 2CK3A 2PMCA 1NN5A 4LK2A 3VJRA 1V3VA 1VHTA 3DEJA 2O0HA 1ENYA 3DZFA 3TNJA 2IDJA 3VR2A 3K9HA 3W3AD 1G2OA 4P08A 4QELA 5DLEA 3TPCA 3EPLA 1T25A 1TA0A 3C5CA 3PFKA 5KTOA 4OQ4A 3UV6A 1L7RA 1HDZA 1X1CA 1DX9A 1UPUA 3DBIA 4LHVA 2IDZA 1AB5A 2AEEA 2BH9A 4MTLA 3T7JA 4LF4B 1G8FA 1LJUA 1NVVR 4TWIA 4B7CA 5I01A 5LB4A 2GNOA 2OGSA 2YV2A 3REGA 3DP9A 3IOCA 2IDKA 3VC7A 2BMWA 4AXBA 2OTCA 1GZUA 3V8BA 3FNBA 3ZN2A 3EUWA 3W77A 3OZDA 2W6PA 3ENZA 3JQ7B 3F8WA 2C94A 3I1IA 1BSVA 3AXSA 3DE1X 3HSKA 4R1LA 4TT8A 3ZX5A 3DQZA 1BYIA 2O6HA 1DPFA 3DFUA 3LT0A 3GT3A 3JALB 3I6IA 3WP0A 3TRIA 4M0FA 2YZ2A 4A27A 1IBMB 4X1IA 4AJ1A 3E0XA 1DOHA 1UK9A 2HO4A 4O4HB 4BLVA 3EIEA 4BNNA 2BKEA 2PIDA 3GIDA 4EP1A 3SJ7A 3HO1A 3PE3A 3NHBA 4IJUA 1P4SA 2GHRA 1HZZA 5TVKA 2ZANA 3STHA 4FE3A 1ZK2A 4QPJC 3STTA 1RRCA 2Q9UA 1AY0A 2BDTA 1DADA 4RTJA 3LPCA 4D2IA 1J70A 3C3WA 5F2EA 3OOSA 4E11A 1SXHA 2X15A 3KT6A 4U6NA 4F7DA 2EAUA 1UDWA 2Q5QA 4RJTA 3TPZA 4KOEC 4F96A 4E0BA 4UXIA 2K87A 5E6SB 4ZD6A 4G1MB 2EFHB 1RXSA 4LFCB 1D2EA 2BMAA 3BDAA 4DV6B 3H5IA 2WJGA 3W8NA 5JSQA 4RTNA 5CJJA 4B34A 1K7EB 2WABA 2X6RA 4X6XA 2I2XB 5IAAA 3DLBA 4JWTA 3VUEA 2AEFA 1KS9A 3TE7A 2MWMA 1JQAA 1EP3B 3KE9A 4QNMA 2CE7A 4A8PA 3LD9A 1Q11A 1XL0A 4QBTA 3C97A 2BRUC 1EYZA 2ZTVA 3CRW1 2UV8A 4NAUA 3BCHA 3C6YA 3BL8A 3DXYA 4DFDA 2IF0A 5LQUA 1N2SA 2WB2A 1I9CA 5DTJA 4EOGA 4WK0B 1R8SA 1E8DA 1Q7EA 4EYOA 3OE1A 5EJ2A 5K2MA 2WZBA 2QUAA 1AT1A 4MS1B 3E1SA 3GC6A 3OZAA 1KYQA 4YT4A 2O9JA 5BQFA 1P72A 3CURA 5JSHA 1W46A 1XROA 3L5KA 1IZ9A 2ON6A 1WKVA 4LMRA 4CL8A 1YB4A 1E1LA 2ZQYA 4U6QA 2ZUDA 5HBRA 1DQYA 1T6YA 1AC5A 1YK0A 2EP5A 1OSNA 2KHZA 4IXWA 3T0IA 3L4JA 4OAPA 4BUJA 2C78A 4EJ0A 1AUOA 4XTCS 2FXVA 1Y42X 5AI6A 4DIFA 3IXMA 1EAMA 1W93A 1WQ4A 2BSXA 5SYMA 1EFLA 1JYFA 2O4CA 2JJQA 2QAGB 1KFEB 2XVAA 4WXYB 4QVGA 3X43A 1XYYA 4W6QA 4C4SA 4JFAA 3O03A 5LP6F 2I91A 2EBHX 3R0IA 2XUDA 3I52A 4KQFA 1O9GA 2EW1A 3WIBA 3S44A 2CFSA 5DTMA 1AQJA 2CV1A 4TS1A 3B89A 4KO8A 4HDMA 4X1OA 1V1RA 4D4JA 1Q5PA 1IM2A 1NVDA 2QAIA 1XZHA 2O8VA 3MJVA 4BQNA 1KK2A 3HSYA 3IBFA 1K5GA 4Q05A 5ED4A 2OV2A 4DJTA 4PNZA 4KUGA 3ZV3A 2ZT8A 3OC6A 4EEZA 5AIBA 2CSUA 3H5TA 4YJFA 4PZ9A 2QX8A 4F1JA 3IRVA 2HZBA 4IXTA 2CW5A 5JWHA 2H2WA 2P9QA 3QVUA 1GGMA 1RC0A 2RKOA 1I2AA 3UYLA 1LPBB 4Q9HA 1FVHA 4QGFA 4FONA 4Q1DA 4NKRA 4EUKA 3AL0C 4JH0A 1Q91A 3CZMA 3EDMA 4I9GA 1SN7A 4Y0AA 1HDGO 2RHHA 4LJSA 4R1TA 1X7GA 4TVKA 3JR3A 3K0HA 1O9BA 2RGNA 1Y8QB 3O2NA 2R97A 3R3SA 4H0CA 3X1JA 1DKOA 3AUUA 2XWPA 2XZTA 3L4BC 4JXKA 2BLLA 1NVUQ 1AZWA 1JZQA 1QVZA 3ZDXB 2B4RO 5CX4A 4F3NA 5CIWA 3AFGA 3BJEA 2IA5A 1DG1G 4HZIA 3IHKA 4F4IA 1U8TA 3LHKA 1RBZA 1G41A 2G71A 1SVOA 1X80B 4EFDA 3ULKA 2A1UA 1DQZA 2X6TA 2WIKA 1IB6A 3U5ZB 2H1HA 3NYRA 1ZUWA 2WNSA 2ZIFA 4B6OA 3MTBA 4RKYA 2PA0A 4JU8A 2JGFA 2ZWVA 2FFHA 2PVSA 2D0IA 4D9CA 2ZB4A 3OJEA 2E55A 2K2WA 3N2GB 4L3OA 3RBZA 4BN4A 4W9MC 4FPXA 3O9MA 4H1WA 1E64A 1D0SA 1T15A 1XVTA 4UE2A 4LV8B 2VP5A 1UT8A 4ARZB 4D9EA 3H2ZA 1ZZEA 4ECAA 3BIFA 1PGJA 3QITA 2J3DA 4BC1A 1IN1A 3PICA 2YZ7A 1N9GA 3DP7A