2SNIE

Structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN NOVO
publication title Structural comparison of two serine proteinase-protein inhibitor complexes: eglin-c-subtilisin Carlsberg and CI-2-subtilisin Novo.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (proteinase/inhibitor)
total genus 96
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1988-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sniE00
3TI7A 1PJ8A 1T1IA 2Z58A 1AF4A 1SBCA 4H6VA 4WOCA 1SCNE 3I2YX 3BX1A 5AVKA 3ZXXA 3VV2A 2PYZA 2PWBA 4NMXB 1V5IA 3VYVA 3GT4A 3H42B 5AMXA 3EDYA 5ARCA 1UBNA 2ZRQA 5JMOA 5FAXA 2WUWE 2DP4E 1P7VA 1YJBA 3DVSX 1PEKE 4C3VA 1YJAA 3F49S 3AJ9A 2DUJA 4BWGA 1GTL1 1T1EA 1TO2E 1GNVA 1GA1A 2SICE 1C9MA 2E1PA 3DE6X 1DUIA 1BE8A 1HT3A 1NLUA 1EA7A 4OV6B 1OYVA 3I30X 1ST2A 3LPCA 2WV7A 1Y3DE 1SIOA 5B1EA 3DE4X 1IAVA 1Q5PA 3L1KA 1SBNE 2B6NA 3DW1X 1TECE 1SCDA 1SUAA 1TO1E 1WMDA 3EE6A 4AKSA 1Y48E 5FBZA 1AU9A 1WSDA 4H6WA 1SELA 3GCXA 1KDYA 1SUCA 1SIBE 1TM3E 4JP8A 4ZOQI 2X8JA 3DE7X 2P4EA 3LXUX 2Z57A 4H6XA 4K8RB 1SUDA 4DWWA 1JEAA 1SUPA 1TM4E 3PTLA 2Z2ZA 1GT91 1NDQA 1KE2A 3DVRX 1KE1A 3A3OA 1BJRE 2HD4A 3WIUA 1SPBS 3GT3A 1C3LA 3DDZX 1R6VA 1TM1E 1CNMA 4YN3A 4FONA 2WUVA 3WHIA 3F7MA 1VSBA 3VTAA 3SQOA 3DWEX 1YU6A 2PRKA 2W2NA 5I9SA 2W2PA 1Y4AE 2W2QA 3VV3A 2PWAA 4OMDA 1R64A 3TECE 5AQEA 1C9JA 1AK9A 1NDUA 3OSZA 3BPSA 3UNXA 5JXJA 4OMCA 5K7SA 1Y34E 4KPGA 2Z2YA 2XTJA 5FFNA 4HX2A 1YJCA 4CG0A 2ID8A 3A3PA 4Z2AA 3P5BA 4M1ZA 1BE6A 1OYOA 1R0RE 5JXHA 1PTKA 3DE3X 3HJRA 1SCAA 1BFKA 3CO0S 1SBTA 3F7OA 3DE5X 1KDVA 2HPZA 1S02A 1SBHA 2Z56A 1A2QA 3BGOS 1SIUA 3DE0X 3VSBA 5AVJA 3DE1X 4ZARA 4I0WB 3VHQA 4DZTA 1WMFA 4NE7A 2ID4A 1SH7A 1S2NA 1S01A 1TMGE 2ZWOA 2Z2XA 2IXTA 1GA4A 5B1DA 5ARBA 1EGQA 2DQKA 3AJ8A 2X8JB 1PFGA 1THMA 1OT5A 1XF1A 1SUBA 3T41A 4B5LA 4WOBA 4LVNA 1Y33E 1MPTA 4RYDA 3D9QX 1Y9ZA 1SCBA 3QMPA 3AFGA 3A3NA 2PMWB 3SICE 1SN7A 3WQBA 1C9NA 2V8BA 3I34X 2PKCA 4CFZA 3D43A 3Q40A 2ST1A 3EIFA 1GTG1 1SVNA 2Z30A 3QTLA 5ARDA 2SECE 1GCIA 1WVMA 1Y1KE 3DVQX 3LPAA 1KDZA 1AQNA 1SBIA 1P8JA 4AKTA 1LW6E 5CW1A 1AVTA 1BFUA 2W2OA 3DYBA 3ZXYA 2PQ2A 2TECE 1BH6A 2GKOA 1WMEA 1TM7E 3PRKE 3LPDA 1GA6A 4CFYA 1Y3CE 3CNQS 1TM5E 1AV7A 4KB5A 3DW3X 2QTWB 2G4VA 1GNSA 4KG7A 1P7WA 4DJ5X 1AH2A 1ZVKA 4GI3A 3I37X 4LVOA 4C3UA 4MZDA 4NE9A 1T1GA 1MEEA 1V6CA 3GCWA 1ZVJA 1Y3BE 4J94A 1SUEA 1Y3FE 2XRMA 1CSEE 4HVLA 1IC6A 1GTJ1 5SICE 2SBTA 2ZWPA 1DBIA 2IY9A 1ST3A 5JXGA 3WIVA 2W2MA 3QFHA 1TK2A 1Y4DE 3Q5GA 3DE2X 3TI9A 5JXIA 1SCJA 2SNIE 2WWTA
chains in the Genus database with same CATH superfamily
3SEZA 3FUUA 3SZRA 1NIJA 1TT5A 3CG4A 1J5XA 4IDDA 2W93A 3B3QA 4I9NA 1WCWA 3A2LA 3QITA 4OMUA 3SJBA 1JT2A 4BFUA 5B36A 4G5RA 3C3EA 3OLCX 4JBXA 1JSXA 1OI2A 2XUDA 2YW9A 1YE5A 2F48A 2FLKA 3LCJA 5DX0A 2DHQA 2O9JA 2EQAA 3DV9A 1U8UA 3G79A 3V6LA 1M6EX 4BMYA 1LF0A 5F2EA 5DYYA 4E5SA 4YRGA 1RRMA 3CVWA 1ORRA 1RWMA 2Z1NA 1YVEI 3HPQA 4G0YA 4PRLA 1XAHA 5AI5A 2PWBA 4WJLA 4NMXB 2L69A 3UMYA 4NCBA 2UZIR 4QPPA 1G5TA 1XVIA 1W36C 1E4YA 1MNQA 5JFTA 3DFZA 1P7PA 1Q77A 1KOGA 4B4UA 4LCJA 1G4AE 4QQRA 2DVMA 4BTVA 2JIPA 5TY0A 5BQ3A 1GAEO 3N07A 5CTJA 5BN3B 3LTNC 2VHUA 1OX4A 3H2JA 4A2PA 1SXPA 1Y1TA 1JQ3A 3FPFA 2C5FA 3W79A 3AL0C 2CLSA 2P8JA 4C06A 3H9UA 5A5FA 1V35A 2H2HA 3PI7A 4KITB 5K0CA 4XA8A 3K2QA 4MW6A 1F06A 2QUKA 3PDUA 5GINE 3MWFA 1JQEA 3CZ4A 4NEQA 1PR9A 5HJ2A 4OQMA 2WJ3A 4LDAA 4A2CA 3C3MA 4JLJA 2HLPA 3UPTA 1FQOA 2I22A 4NYJQ 3UUFA 4CQMA 4EG4A 3DMYA 1WQ4A 3BS4A 4XYEA 5DWVA 1PQWA 2B3DA 2GK7A 4UBOA 4MQFB 4BWGA 2I1VB 5JUWA 1P2BA 1SHZA 1TU4A 5AHRA 5SY6A 4PR0A 1FFSA 3WNVA 3TQFA 3DAOA 1TK3A 1C9MA 2ZETA 1UKAA 1C7RA 4H16A 2MU1A 4H0CA 5CDFA 1KOJA 1XROA 1P62B 1XE3A 4RAQA 2ZTVA 1IN6A 1R8SA 2Y6UA 1VSTA 3T61A 3LI2A 3NTLA 5EZYF 5ERGB 5UKDA 3EZXA 1CQIA 1HZJA 2YTZA 1DAKA 1G2IA 2JIZA 1ZJZA 2HA0A 2QRLA 4K5QA 2P9YA 1YJ5A 2GYWA 3UWPA 3CR8A 1XA3A 2IITA 2QB5A 4RY0A 4LWPA 4RNDB 4ZHQA 5K0SA 3UB4A 4FXPA 2ZCJA 2GAOA 3DC7A 2IIQA 4TTVA 1WA5A 2ECQA 2GLTA 3AVXA 4GF5A 3MWDA 2BFCA 2R25B 3N2GB 3HSKA 2UUAB 3GFTA 3PPVA 4K6OA 5A0TA 4W4TA 4NK4A 3E4CA 1IXYA 2XOKD 4BRUA 1KS9A 1E8MA 3O90A 3QXCA 4GOND 2GNOA 5FJJA 3AEUB 1YAHA 4CMEC 5JC8A 5G0SA 4HVAA 4HEA1 2DJIA 3AM5A 3HYNA 3ZDAA 2OCPA 2AD5A 2YMLA 1QO0A 2Z2KA 3CPJB 3CSUA 1GYRA 1TLFA 1HFKA 1W59A 3P4YA 4FS3A 4I6JA 4F4HA 1NXPA 3GIDA 3EE6A 2B9EA 1UWCA 4WGFA 3F67A 2GFHA 2OHJA 3UPDA 5CAEA 2R66A 4IEFB 3U3JA 4E0BA 3QU5A 2DFTA 4ZAZA 3TR6A 4AJOA 4E1BA 2EBHX 2UAGA 1E2NA 4JJEA 4NX2A 2DE0X 1PZHA 1WULS 3BIXA 4DG9A 3O8OB 4K9RA 4AZSA 5LYJA 2O8FA 1KY4A 2IV2X 3ZE8A 4JGIA 3NV9A 3KHTA 2CJPA 4DMLA 3BMQA 2AXEA 2BE7A 1RHMA 2VHTA 3KSRA 2LNDA 4E2ZA 5IYZA 2WDZA 4BKRA 3STWA 2I7XA 1Z18A 1MW9X 4PFJA 4WN9A 1T2FA 2F8MA 4DRXB 4G4JA 4EKGA 1P6XA 1GTVA 2GMWA 2PU7A 3C85A 5T7BA 3U7QB 2VDRB 4C4TA 4IVRA 1ZMOA 2DHDA 4IX9A 1YZHA 3VUEA 3ICWA 4ZZ0A 4BVGA 5BR4A 1PWEA 5BWNA 3GRZA 2QM7A 3N59A 5DSZA 1W93A 4PC7A 3I45A 1REQA 1NE7A 3TSCA 1EVEA 1ZUHA 4FIDA 4L2IB 4XFKA 2WILA 4ED9A 1A50B 1OTHA 2HU7A 4AM8A 5CD9A 2H1SA 4YTEA 2GJSA 5DT2A 1NXVA 4HCJA 1JFLA 1GY8A 3L82B 1VSVA 5AR1A 5IK2A 3ZUPA 1H22A 4EJ2A 3NCTA 4AO6A 4TOIA 3BSFA 3VKWA 4ZEOA 1ENPA 4P54A 1SA0A 4GLFA 1Z17A 5EMHA 1DP4A 3BMNA 4EECA 3ROMA 2G80A 1EZZA 3VYTB 3GJ6A 4QRIA 1FSFA 3A9VA 4UMEA 4NZPA 2VHXA 3W8FA 5L95A 5CLGA 2REOA 3BA1A 5DJ5A 1R00A 4NULA 2M9MA 1JQ5A 4LZNA 5E8RA 1K86A 3CG0A 1DBQA 2XITA 1H5QA 1PL6A 2DUMA 2Y68A 3CTMA 4IO0A 1ISGA 1HE1C 1MB0A 2BM0A 2ZRCA 3UUEA 1U3FA 5HE8A 3V4ZA 4IJKA 1M2OB 1XLWA 3I9OA 3AESB 2PT7A 3J7TA 1IDOA 4IOMA 4OQFA 1OI3A 1NNUA 2MSCB 3CV3A 4AVYA 3F7NA 4JUDX 5G3ZA 3ZIUA 5BN3A 1C2TA 4ZYTA 2A86A 3HCRA 2L82A 4LGVA 2WM3A 3GNLA 1PS8A 3I58A 2ZWIA 1FUEA 3BFKA 3DLPX 3OKCA 1AKRA 5SZIA 1LI5A 3VPFA 1JPUA 1X1AA 3RUAA 2MYUA 1PQUA 3A4IA 3ITKA 3VA7A 4P83A 3O8BA 1TL7C 5E4FA 4PSUA 2JHFA 2I7VA 3PTAA 3PXBA 3OZAA 2YQ4A 3HNOA 4JLSA 5DV9A 2XQIA 3BFPA 1IN4A 1HE4A 4XEUA 5K4AA 1YB1A 2NYRA 3SE7A 4MQFA 4UXIA 3DULA 2RAUA 3T1QA 1XFDA 3H1PA 1LSSA 2I33A 2W2PA 3WLAA 1RVDA 1QH8B 5CFPA 1BKSB 2XUOA 5D3MA 2GJ8A 5G1PA 3ORHA 5AOCA 5MHTA 2G77B 1OIVA 1ZM2A 4MQ5A 4QYWA 1UFOA 1WMBA 2RMKA 3W2EA 4NU6A 3WHKA 1E1NA 4O0MA 5LLSA 1ORVA 3R9IA 2CDCA 2DULA 1UT6A 1RWNA 1B00A 5LNK1 1AO0A 1T1JA 2CL7X 4JI6B 3PNPA 3CNBA 5EJFA 1RLOA 1SKYB 4H15A 4BP1A 3I04A 1QP0A 2A1UB 4FYHA 1O4WA 3HB0A 4GOXA 4GSYA 4LXTA 1YHYA 3USCS 4UM8B 1XHLA 2X8LA 3GA5A 3I6YA 3MJEA 4EPXA 2Q3JA 2CJFA 4DR6B 5DZSA 5K7SA 2A58A 4K40A 2FWBA 3M34A 3PA8A 2GB4A 2Z2YA 4BASA 3AF5A 5C37A 4FP9A 4IEEA 1EP1B 4RPLA 4INZA 1GPNA 1DC7A 2I29A 3AEUA 3EZ6A 3EAFA 1DBWA 4NK5A 3AB3A 1JLHA 5KDDA 5A7FA 4LJ4A 5AK0A 5SZKB 2DYKA 1FP6A 2RKBA 4FBLA 1J23A 3WGJA 1T8TA 1P5RA 2GO7A 3OC0A 4D02A 2AC7A 3LZDA 4EX6A 4LEIA 4J8PA 4RTSA 1A4IA 4MWZA 1Y6ZA 4P1ZA 1ND5A 1PW5A 2AG6A 3THOA 1BMTA 5IXJA 1BFKA 3PX2A 4EIWA 3QLUA 2QGFA 2MOKA 5CU7A 1FQJA 4FKZA 2R79A 2VF4X 5CH8A 3VR3A 5CITA 3OA2A 3O8OA 4TVOA 2V9CA 3RROA 4PPQA 3A25A 2EFEB 4KPFC 1BDHA 4NDNE 3M6LA 1IE3A 1Y8QA 2LGJA 4TS3A 2P75A 3HADA 3GVIA 4JWKA 4AS1A 5E2AA 4UBMA 4FW8A 1QMPA 4DE5A 4LPKA 4V1CB 2RG7A 5B2EA 2X9QA 4DRXA 3N0TA 3F3SA 4PCAA 1JG7A 2QP9X 1FRZA 1NQTA 3ZR4B 4KQJA 2JBAA 2KJQA 2PQMA 3V46A 3ITEA 2XA9A 2WWWA 3FUCA 3FFAA 4RA9B 1RQRA 2INGX 4NZYA 4M1YA 3DT9A 1CR0A 2ID4A 3UXEA 3Q9LA 2H3HA 4B4KA 2RH5A 4QECA 3OIYA 4YREA 1S01A 4IIJF 4EGAA 4I50F 4B3SB 1N6PA 2AF4C 2R87A 1T9KA 1EFKA 2G82A 2I66A 1ZNZA 2F8LA 2PKXA 1UBGA 1YC2A 1JFVA 3Q6MA 4IEIA 4I9HA 3RT7A 1JBKA 4W7IA 4GI7A 4P7GA 2H2IA 2C2MA 3JZFA 2DQKA 3UZUA 4EGSA 3H5RA 1IQ0A 2XE8A 5KEIA 5J4YA 5LQAA 5B3JC 4FWIB 3KXLA 3R74A 1IWOA 2GT1A 3DPIA 1IMJA 3VZRA 2F1KA 3GO4A 3RFUA 4CUJA 2VCYA 4G0NA 3TF5A 4MAFA 1NBEA 1I6WA 3EZ2A 3HB4X 1E3SA 4PLFA 2CXPA 1IEXA 3R5HA 2FR0A 3A3KA 2F6RA 4FEAA 2BRUA 2CYCA 1SCBA 3AESA 4NF2A 5EP4A 3M82A 2QMZA 2OYRA 1AS0A 3MFQA 4EUHA 4DAOA 2HBRA 2GZSA 2C84A 3FRIA 4PWZA 4AY4A 1GPWB 1DQZA 2CCGA 2YIJA 4C14A 3EA0A 1Z5WA 1JW9B 5B37A 4QUGA 4RADA 2LCIA 2GESA 1BWQA 4TRRA 2AEMA 1B6RA 3LQQA 4NICA 2C9DA 2XKJE 1P2FA 2LW7A 3MBOA 3B5EA 1HEYA 2HK6A 1ITZA 2J7KA 2YN4A 3W04A 3P9NA 4MICA 1XKTA 1CUUA 3V9PA 3W7AA 3IUQA 2WU8A 3AFOA 3GP8A 4ZT2A 1U0RA 2FR8C 4RKFA 4X24A 2DQSA 1PIWA 3BD6A 2J7PA 3KQYA 1QH8A 2QNRA 1Z4PX 4RELA 5DLPA 3E2MA 5DK4A 3UM9A 5J58A 3W5CA 5JY1A 2Z83A 2PL3A 1J7JA 3M6WA 5EVCA 1PUJA 3LDAA 2OFPA 3ZXIA 1Y5IA 3U3MA 3VI4B 2D1YA 2FXVA 1TU3A 1N0VC 4TMKA 5DI3B 4DBVO 3OJLA 2FDCA 4L7QA 4P0QB 2AN3A 3I01M 5DNWA 4DANA 3L6OO 2QNIA 1Y9EA 2GKOA 3G23A 2PZLA 3A4LA 2KI5A 1F6DA 2XY4A 4KXUA 3AW8A 5BYKA 1TM7E 4JI0B 1Z7EA 1LV7A 3E3OA 1AGNA 1K5DA 3JU3A 3HRIA 3THRA 4UAGA 1DRWA 2A1UA 4QLOA 2WJHA 3OJXA 4CCSA 4HLUA 1FNBA 1DQSA 1NUPA 1Q1QA 2ORVA 2W11A 2G1AA 3RQSA 1C4KA 2ON6A 3GWGA 4R8KA 1B16A 1YULA 3HY3A 3GLVA 4HQ6A 3O82A 3ZDYB 3GXOA 4CM1A 3K09A 1W8IA 4UTRA 1G7TA 1N57A 5AW8A 4YT2A 5KCMA 1IATA 3DMRA 3GAMA 4FOPA 4F7DA 3AEKB 4KB5A 1EFTA 5KQMA 5KO2A 5IMBA 4MCIA 3OPNA 2JVIA 1COZA 3R7DA 3RSQA 4ARZB 1M0WA 3HRKA 4NMLA 1U0OC 2FEKA 2JLSA 4GYJA 1P7WA 4BFLA 2PUHA 3WXMA 4MS4A 1LY1A 2E6UX 3W6UA 3WNDA 5EIXA 5KSZA 4QUHA 3FW1A 1WPGA 4TPKA 4DCOA 1E6EA 3OAAD 2B4TO 4DC1A 2Z09A 3I1YA 1KAMA 2CVFA 2B1JA 3VR6A 1YZ3A 2IEGA 3OAAA 4DUGA 1ZHOA 3BJEA 1NTRA 2F4NA 4XQGA 2ZU0C 1H2EA 4IHKA 3VBCA 1ACLA 4NE9A 3E7XA 1ZH8A 4WXPA 2RGWA 4O2BB 1Y7TA 4WNAB 1M7BA 1HR0B 1ACMA 2BGTA 3O8QA 3MGBA 5EXPA 1JKFA 1P1HA 1AGRA 4V1CA 2QG6A 2ZR8A 1CUJA 2ZCVA 3L92A 3ETNA 3M33A 3UMGA 4BVHA 2JIQA 4O5AA 4CF7A 3PQ7A 1MEEA 3H2GA 5LLTA 3GGSA 5MN4A 1MT3A 2K6GA 3QE2A 3IXQA 3EWAA 4O2AF 4P34A 1EE9A 4RA9A 2ANBA 1H8HD 1RAFA 2FA9A 1Y5LA 2JHPA 4MA0A 2GRUA 1XKLA 3GYGA 1IXRC 4TGLA 4DUYB 1KU0A 1TE2A 3OKPA 4I19A 4L3OA 3ZQUA 5LU8A 2RHWA 1XZBA 3B6KA 3PUJA 1PG2A 1KARA 4HVTA 3KYBA 1JP7A 4JITA 3CLHA 4PFKA 3LECA 3B8EA 5SV2A 4AP9A 4R0MA 4RPKA 2J3EA 3T5PA 221PA 1P0FA 2IY9A 3CM0A 1P2GA 3CB4A 1IBRA 2PX0A 3IV9A 4FNGA 4CM5A 3LFTA 2XMQA 3PDCA 2WEKA 3R3XA 3VSAA 2HDHA 2XNDA 4KTVE 3ZK8A 1MH1A 2XNSA 3ROZA 2QROA 2A4KA 1UXIA 3K0AA 3Q5GA 4F1JA 1OH5A 3FPJA 3TRFA 2EFGA 1P5HA 1WQ3A 3E03A 4NJMB 3T3NA 3LO8A 2XWQA 3IAS1 2J3KA 2OV3A 3QOWA 2BTEA 3ZZMA 3VC2A 4LE2A 1O9HA 1YE3A 2D2EA 2XH8A 1W25A 5ALMA 5AM1A 4C3ZA 3LHIA 4C30A 2GSDA 3NP9A 1T8RA 4QTZA 2A57A 1U1IA 1YV9A 3U7IA 1C9EA 1XMXA 3GJQA 5BPHA 2PRJA 2R8PA 2R47A 2X0KA 4W9MC 4C7OA 4MV6A 1ZLXA 2MDTA 4IMIB 1AGPA 3AY3A 1FTYA 1PHPA 3ZH2A 4NV3A 3FI9A 4G1MB 2V59A 4KR9A 1Z5PA 4G0OA 4W6QA 2XZDA 2WJGA 1RJWA 2ZYRA 3KT6A 3ND6A 4F06A 3DZFA 4RPCA 3UO8B 3PG5A 3UGKA 5E6SB 1VMDA 4M54A 3GZNB 3EVNA 1E8NA 3RNLA 4JSTA 1UKVY 2R5WA 2BR4A 5KWSA 3ZTTA 1IOWA 1H65A 2V6MA 3KSMA 4QQNA 4DIFA 4BEWA 1SGWA 1O08A 3ZWOA 5MF6A 2J4CA 2J09A 4MV3A 2MSWA 2JRLA 4LZOA 4BFXA 4JLVA 1B8VA 3EW7A 3OQ1A 2VNHA 2DPLA 4WDQA 2Q6KA 4KIJA 3STVA 3F6BX 3KLBA 1FJ2A 3E7WA 1YJBA 4P3NA 1SURA 4YRZA 5BYAA 4JCCA 1PYGA 2PZBA 4BDSA 4PYQA 4JMPA 2O50A 5K99A 5BWBA 4IGKA 1TVCA 4GRAA 4H4CA 1GGKA 2ZE7A 4AUKA 4TXJA 4YQYA 3MWJA 4ISCA 4BWFB 1VKRA 4LDPA 2JDID 4OI4A 3OJOA 2OXTA 2PGAA 3OZUA 4R05A 5ALOA 5F1YA 3SIWA 3V2GA 2P7HA 3PLRA 2H1OA 3VTZA 3GH1A 1QGED 2JDIA 3PSAA 4DOMA 1XRMA 2GQ0A 4YB8A 5LBIA 1G64A 2YY5A 2WR8A 4V0NA 1IUKA 1VOTA 2PGIA 4LTDA 5AXAA 3W8DA 3WMRA 4CN8A 5BYJA 4LVCA 1QLHA 4LHEA 5EYPB 1CEYA 2APJA 1VJRA 5CGQB 1IM5A 4LC9A 4QM7A 4OXIA 4BU1A 1DUIA 3WL3A 2JNWA 3OUZA 3CNHA 1U3DA 4NAVA 3SQMA 5F23A 1W5AA 4EA8A 4PYIA 5GP1A 1NR1A 2O48X 2WU4A 3HBAA 4AIRA 5KZMB 1KAEA 3FJOA 2OO5A 2NXWA 3PF8A 1VLZA 3FIUA 4UNRA 3G9QA 1KXZA 1NKVA 3PQDA 1YFJA 2ACWA 1J0AA 2WNSA 4A10A 2V4UA 4XUDA 4U2BA 1RYMA 4CM6A 2ZS7A 3RUIA 4GYWA 5AVTA 3PUKA 2COEA 4MUHA 1Y3DE 2JJ2D 2DWUA 4Q93A 3LC7O 4EB8A 3U4DA 4IXDA 3I9FA 1TCAA 3QNUA 2JJ2A 1IHYA 1P44A 3OZRA 2ZOSA 4R9NA 5DGHA 5HE9A 3TTYA 2VTEA 5D1NA 1GXSB 3MGAA 4E6PA 2GBPA 3KXDA 3V42A 2VJDA 1WY7A 1Z6ZA 2GZ1A 2O2ZA 3PS9A 3N53A 4J7CA 4XWOA 1E3LA 5IKPA 3AM3A 3ZXSA 3AHHA 3W7VA 5EWLB 2FI1A 2X3UA 1DOZA 1TO1E 3IA7A 2WJAA 1FL9A 1NVDA 3QXHA 5EJ9A 5J23A 4Y6SA 2B7LA 1I51A 2QM3A 3R6GA 1YFKA 2VXBA 3CNNA 3R5SA 4A3SA 4G5GA 4ZCTA 3M1LA 5CUQA 1WXIA 3CPEA 1QX3A 1EHYA 5F2NA 2V03A 2IEYA 4XDGA 1JU4A 3MJFA 4R1NA 1AKWA 2BP7B 2C9OA 1IBCA 2H07A 3KOOA 3RNOA 4AF8A 3RC2A 8AT1A 1QQ7A 3K30A 1I2ZA 4YP7A 4MWTA 3I92A 5F1OA 1QQBA 2CNNA 2FMUA 3RGGA 1XKXA 1F9EA 3WMFA 5BR1A 4I1PA 1AE1A 2ODNA 3Q2OA 3L6UA 4JP8A 2F1IA 5HJEA 3ZHBA 1VMEA 2BBWA 2GF2A 2O3JA 2ZYVX 3G5LA 4EOGA 4D4GA 2XRZA 3HN2A 4ZKDA 1KOFA 4J3NA 3PFBA 3B1FA 4PYKA 4R98A 3O8CA 1C41A 2HU8A 4HS4A 4NJMA 4MWEA 5BWLA 4EPWA 1SOVA 2BGIA 4I81A 3HWWA 5FOSA 1EXWA 3TAXA 4H60A 2E85A 4LKRA 5G0VA 3NIWA 4H6XA 4MI9A 1RE1A 5ESRA 2V98A 3ESRA 4KYVA 3T52A 4NFLA 1PG5A 3KLMX 2TMGA 1XIVA 2QRZA 3TAHA 4QXQA 1RRCA 4UJ5A 1NUSA 2AJBA 5AXDA 1UP7A 2NGRA 2Z8YA 3GROA 3N2EA 3UTDA 1LPAB 1ZLYA 3LP5A 2FOXA 2YZ2A 3KLPX 5E6SA 2CHEA 3OCUA 3GZNA 2QRVB 1I9GA 1T2DA 4RCVA 4PNZA 5C8YA 4KXNA 5CFLA 3IO5A 1GUFA 3RREA 4BVAA 5FWNA 3NHMA 4JL6A 2E82A 3ASVA 1NKSA 3FCXA 3IE0A 1TAHA 2Y0CA 4DDUA 3OEHD 1A7KA 1TIPA 1YS6A 1J39A 4JYBA 1O96B 2FZVA 3RE1A 5IT9A 3DBIA 4UAVA 3PWZA 1ZAKA 3C7AA 5PGMA 4M7RA 1KMCA 4CYMA 4WXYB 2CNOA 5SYNA 2BM9A 2YIVX 3VZBA 4KKVA 1DAEA 2C4WA 2C8VA 2PT9A 5IEJA 1OFIA 1VQ1A 2C92A 2IEAA 2ZUBA 1XU9A 2B3TA 2OD7A 3B13B 3C5WP 3IMFA 3WOHA 5EUQB 1O6ZA 1IUNA 4PPFA 2NUTB 2PKQO 3ZS9A 2IELA 4EA7A 3GA7A 4JT8A 1WPRA 2O59A 2BGGA 1S9HA 4RIHA 3OPVA 3ELWA 1GZHB 1RRKA 1OAOC 2IY7A 3PJFA 1L9KA 5EJIA 5H7XA 3UMCA 3VQTA 3LQ1A 4UTNA 4DIOA 1N77A 5FWDA 1NQVA 3RF7A 2C0QA 4KWTA 4EQZA 3QJGA 1MB2A 4RY8A 1HO3A 1CUZA 1MC5A 1ZNQO 1PFYA 4JZKA 2HBYA 4EZEA 1P5ZB 2N75A 1ECJA 3NYWA 1AQIA 5I7FA 4BVJA 3U9LA 1YRQA 4IIBA 4QTYA 1PK7A 3GEEA 1VJTA 3PUYA 1GUYA 1AK9A 3L6EA 3ZI0A 2P1RA 5KQRA 5AI4A 1H2WA 4LNAA 4JASB 3KS9A 1VA4A 1XZEA 4PYLA 2UUOA 4O4LB 4YBZA 4FCWA 5DULA 1YL7A 2L17A 3KKKA 3BXFA 3LQ4A 4HRVA 3T0GA 4CCYA 5F1KA 1JDUA 1QG6A 3MMXA 1T3GA 2GN4A 3O31A 1XMPA 2ZRMA 1RJDA 2YWCA 3V1TC 5IUNC 2JFBA 3K5WA 2XUKA 3A0RB 4S1WA 4WN3A 3NM4A 1CFJA 2GLUA 4E11A 2D5IA 2QVLA 3CVYA 5I7EA 1BHJA 1GXSA 3DOOA 3QWIA 4OFBA 2FPXA 2D5BA 4NVRA 6GPBA 4I4LA 3K73O 4YLGA 3K31A 2J0UB 2CSUA 1T8YA 3LCVB 3UT0A 5JNWA 5IDXA 3OJ0A 2C07A 1XCPA 5LB2A 3OLQA 1A4UA 1TCVA 2FPGB 2O7SA 3DEJA 2IGBA 4GKAA 4F0JA 4MR8B 1N7GA 1PTKA 1BG6A 1I3LA 1YJXA 4DV5B 5CJPA 2WLSA 1QCCA 5A62A 2EP5A 3HJRA 6ABPA 2VQEB 4NG5A 4YUVA 3MAAC 4REQA 1JHMA 3R5JA 3O94A 1B6GA 4TWJA 3UK1A 2AFHE 2YIDA 4V0MA 4CM3A 1U8ZA 1Z2CA 3A7DA 3HU3A 4BRWA 1D03A 2ZBQA 3RYCB 5JBQA 1SU7A 1OVMA 4P4NA 1QE3A 3B9RA 2BP7A 2GM9A 1U5BB 1XWFA 1N2BA 5EEGA 5EGSA 3O47A 1Y1LA 3LMKA 2I9KA 3RGWS 1P61B 1P19A 5AW1A 1E0SA 3F2VA 4DB2A 3EBOA 5TPWA 3KR9A 1HQCA 2WJJA 3AIKA 4IYRA 1IRIA 2NXNA 4JFAA 3MQFA 2ONYA 3EG9B 4K81B 5JJBA 5KNBH 1WVIA 3ADBA 5KYGA 4MVJP 3BRWD 4FJ2A 2EBFX 2ECKA 4UC0A 1R5BA 5L45A 1B73A 5A2GA 5KOHB 1EGMB 1PTJC 5DGCA 4AZTA 3FOCA 4DZTA 8ABPA 1E6UA 4GLOA 4HVCA 3ANXA 2MINB 1VCOA 3HSYA 5BSEA 1K2WA 3WGNA 4L8FA 4B4VA 4P0PB 5JCXA 2DBVO 2EDAA 2P4QA 4C4RA 1XEXA 1ZUIA 1AA9A 1GLVA 2P9EA 1T2NA 1G8HA 2FW7A 2QPAA 3E15A 3LX6A 4MV9A 4E2XA 1C0KA 2R6JA 1CG6A 1E9RA 3LXMA 3TUJC 1ATZA 4JC5A 4JUIA 3OOSA 3CWZA 5EC8A 1BE1A 5KTYA 4LOHA 1O97C 4RPJA 1D3AA 1NR7A 1X1RA 4MIKA 4DRZA 2H4YA 1IY9A 1SD1A 4PC3A 2ZYIA 3DOEA 3VJRA 2CL0X 5AJZA 1EX6A 1CY8A 5ULLA 3QVSA 3TGWA 2NT4A 2CXNA 2OZEA 3D6NB 2QRGA 2ZXUA 1KRWA 5GV8A 1CIVA 1H6DA 2QRVA 3TRHA 4QGBA 2VUHB 1E63A 1HNNA 4BAGA 3KDAA 4JGGA 1NKTA 1NMQA 1M75A 1NP7A 3CN7A 3QMPA 3T3DA 5BMVB 2C7PA 4TYWA 3D7KA 2QM8A 2Y9PB 2JGFA 1T24A 4P38A 3A3NA 1NYRA 1O96A 3KFLA 3LHDA 5D6NA 4CM4B 5M7EA 3U4GA 2IHZA 3A3YA 1ZR4A 3L7JA 1JDZA 1SN7A 2C57A 3PC8C 4PRZA 1C9NA 1B2LA 3SC2A 2BFDB 2XTNA 1SAYA 4FFBA 4FEGA 3SOPA 4ERXA 2OG1A 3FVVA 1CUFA 4JL5A 4MYHA 5F35A 2P7IA 1EG7A 3JQRA 1V71A 1QORA 3C3AA 3I4CA 3I2FA 4IZHA 4F86A 2NUTA 3W77A 4E46A 1SVNA 4H31A 1ADYA 1LDMA 1Q20A 2NYUA 3IEUA 3AVWA 3GEGA 2H65A 1K6MA 2GPBA 4CI0B 3HBFA 3FUWA 5A4KA 10MHA 1WVMA 3MMNA 3IRVA 2GHQA 3DZKA 3ZBPA 4R2KA 3D6HA 4MYRA 4YJ2F 4JJ8A 1ZUNB 4TZTA 4XQ9A 2HIGA 3E9QA 1NWHA 4NHEA 4TWBA 3VPDA 2H5IA 1PJSA 4U2GA 5FUWA 4PLVA 3AKZA 3W0LB 2UYQA 1N9GA 3BDAA 1SUIA 4NJEB 2WV9A 2DFNA 5EIOA 2I34A 4JV5B 3GJRA 4OI2A 5IH7A 1VGRA 1BJTA 2AMJA 2WJIA 4R9SA 5J9FA 2AR0A 4KIUA 2QDXA 1C7IA 1YZKA 3N2ZB 3Q3IA 1GL3A 2P41A 5INTA 3KK0A 4D82A 3LQKA 1UC9A 3REQB 4O4LA 1QYWA 4DIEA 3FWNA 3ZJYA 1E64A 2IWRA 1GFIA 4QTXA 3G9UA 2JIMA 4N76A 4MVWA 3HI6A 4HJXA 1DC6A 4LWOA 1MQ8B 5REQB 2QZ4A 2E89A 2ILTA 4H08A 4HNAB 3L0DA 3PUIA 3G9ZA 2ZDGA 4G67A 2PKEA 4DDKA 4EG1A 1J07A 1FNNA 4FE4A 3WGMA 3RBZA 3CA8A 3N8HA 4J16C 2CWDA 4GO1A 1PDVA 1J42A 2G1UA 4OAQA 2WT4A 2HGZA 1A76A 1CJTC 2J0UA 4R5HA 3FBTA 1V45E 4MQEB 4LJLA 5ALPA 1EHCA 1VRWA 1VSUA 2O2XA 4R8RA 1A8UA 3QW2A 4P36A 1V7QA 3AEQB 3DG9A 1IOZA 1O3YA 3N0WA 3NNNA 5EAIA 4K9PA 3VR5A 4RTKA 2C2WA 1RJEA 1IVSA 4DMMA 4O25A 4Y2GA 1V16B 3MEQA 2CF6A 1ZVKA 1HLDA 3NTOA 3OJEA 4KN8A 1YOVA 3OHPA 4WV3A 2VP6A 3ZY6A 4BNTA 4RKWA 4DCCA 4E5PA 1XP5A 2YJGA 1KR5A 4INAA 4TS9A 2YV1A 3RYCA 4B85A 5FDFA 1G55A 1WF6A 1PKEA 3TBFA 5FHRA 1F48A 1TUBB 3IUEA 1JBQA 1RWKA 4Y2HA 3O4HA 3OBBA 3X1JA 3WMXA 1GSOA 1RAHA 3L41A 3WMWA 2BDUA 1GPMA 2MJLA 3SU8A 1WPQA 1VLHA 3H11B 4IHJB 1MKYA 2FSVC 4ER7A 4C07A 1SZPA 2OFOA 1LDYA 3EQZA 3ZDQA 5GPBA 4TVKA 3MCWA 2OKCA 1JSRA 9GPBA 2D3TA 4RTQA 4CIWA 1N25A 5JYBA 2P30A 4YMWA 2ZRIA 2D2XA 3L0ZA 3TIFA 3ZQKA 4TKMA 3C8DA 3VAZA 4WZBE 2QD3A 3RFVA 1Q91A 4ZV4A 3ZTYA 1W5FA 3KYIB 1F8UA 1EVIA 1A5BB 2GJ4A 4Q3EA 4QIHA 5FPPA 4MW1A 5JDCC 3ZV3A 5AUOB 5JXGA 2NPOA 3M9XA 4PVCA 3T3EA 5DM1A 1ORIA 2IIPA 4LX8A 4UZEA 1J7KA 1YCHA 3BE8A 3W2FA 4FT4A 5F2OA 1E99A 3UA4A 1UC8A 4YRMA 4PAGA 2Y71A 1XJ5A 1YVPA 2DERA 3UMBA 1T0IA 2J5QA 4EVRA 2VVTA 1BDMA 4CMCA 1K7XB 4R1SA 4HTFB 4ALJA 2CJWA 2FOIA 2I80A 4CM4A 1BD3A 1NLMA 3ENZA 3BRSA 4ZT5A 5NULA 2AG5A 3CLRD 1XGKA 1IXZA 2B35A 2I03A 3S2SA 4AMUA 3NWEA 4WKPA 1RIIA 3X3HA 1WUJS 5A03A 1J4AA 1P0QA 1K5GA 3FJ1A 5IVHA 2YYYA 1GCUA 2KBEA 3H13A 3HA2A 4UCXA 2G7ZA 5G4KB 4F72A 5ALVA 4JX9A 2M98A 2VP3A 3TTUA 5G41A 3K9HA 3KAKA 4RGVA 5JMOA 1J1IA 3CEAA 1W0KD 1JH9A 1M1XB 2X15A 2ODEA 3ANSA 3CU5A 4KLCA 2B5WA 2PBZA 1ZGZA 3DHYA 4LWZA 3WRYA 1HI9A 4KQMA 3KUXA 2UV8A 2UU9B 1L7XA 2QZZA 3IPRA 1E5DA 1F4LA 2JIOA 4NJEA 3MRSA 4J03A 4TLEA 2LVBA 1UIMA 4H7PA 2V7UA 3WWCA 1JDPA 4MUGA 4TWAA 3SHOA 3AJ9A 5DHTA 1BGVA 4GP6A 1W36D 3NXKA 2GXQA 1ZWLA 2ZT8A 1KI6B 2DUJA 2MR6A 4A5OA 1GTSA 1A71A 1YE8A 4OM7A 2X13A 5EE3A 3ST7A 1GM5A 3HJFA 1U1EA 5IVIA 4AICA 2H9YA 4EW2A 4WNCA 1F12A 1EM6A 3RYHB 3ZDFA 4CDNA 4YLYA 1EGAA 4X8MA 4HNAA 2HWYA 1ZP6A 1UZLA 1NDHA 1HTWA 2Q9CA 3VHXB 3W5JA 3UB3A 4YJKA 4ZGWA 2OK8A 1H0KA 4QJIA 2FH5B 3EVBA 2IYOA 2XA2A 2IF2A 3GD7A 1OBOA 4MQEA 5CDYA 3RC9A 4AFNA 4G37A 3JAMA 2YFYA 5HMLA 1U9IA 3QXJA 5AIBA 1LQTA 2QYOA 1O5TA 2BEJA 1BE0A 2HC9A 3MS7A 3OTIA 5ETJA 1K66A 2H31A 3JAWB 3UGTA 1SEVA 1NLZA 3FKSA 3OM0A 3ESBA 3F9RA 3H87A 3BICA 5TE9A 2GVZC 4NLLA 4CMKA 1R74A 1ZH4A 1DPFA 2J46A 5KU1A 2Z6QA 1X15A 3GJ5A 4YRQA 3UAGA 3FWHA 5B1EA 5BT9A 1LPMA 3L7DA 3A9WA 1GDTA 4DSNA 4CDGA 4YASA 3W06A 1DWUA 1HBJA 2CCJA 5JAZA 4F3TA 1I3MA 2QJTA 1CBUA 1D2HA 1V3QE 3MWLA 3K96A 2RJOA 4Q18A 5LP6C 1ZGCA 2HPVA 1MR3F 2HV8A 4IXTA 1TUBA 4WADA 1OXBB 1RZVA 5FI1B 4BUCA 3I0MA 3H2IA 4XDYA 1BIFA 5F5LA 5CX1B 2ZXFA 3OC6A 3S7TA 4L27A 2QRNA 5EKDA 5KSYA 2ZZKA 1CEQA 1CIJA 4LKOA 2W6QA 1TCBA 3H11A 3KOWA 4IHJA 1BEUB 2BGJA 4Q4AB 5K0GA 4JYAB 1VM6A 2EYUA 1X7XA 4QGGA 3UXMA 2Q5HA 1O8BA 4KWEA 3UGQA 3QELB 3PP8A 2V7BA 3I5AA 3DZHA 4B6JA 4IDBA 1W96A 2JKYA 3CZ9A 1SHTX 4FI3F 2OCGA 4P53A 3BQNB 2RBEA 1FLAA 1G8KA 1YB2A 2SCUB 3IKTA 2BUAA 2YJTD 3VSDA 2IYAA 4CMEA 5JV5A 3Q1LA 1HFJA 3A1DA 3KZNA 4EUKA 1NE2A 2QR3A 5H3CA 1Z4OA 3DOFA 2D7CA 1RAGA 1NHGA 2XYHA 3FETA 2RCYA 1UJ2A 5A02A 4D4JA 1PV4A 2IOHA 5ISMA 4FSXA 4WMLA 5A7HA 4MUIA 5BUZA 4FFOA 2BGUA 1EVJA 3INTA 3TD6A 1KEZA 2BGLA 2GPNA 1BD4A 1XZAA 2M6SA 4RSRA 4IBOA 5HKKA 1J2UA 3B1VA 2DMRA 3FZEA 1T6BY 1MRNA 3VR2A 4HNUA 4DXHA 2FDXA 5KNCA 2EERA 4L6CA 4MV7A 3BBPA 5GJBA 2BLNA 4MB6A 2R68A 1XNJA 1GGJA 1M6HA 4LV6A 4QUEA 4ZT7A 5JNVA 5BW6B 2CFIA 4ECEA 4M1WA 1W6UA 4MRRA 4WZZA 3R9KA 3NZEA 3H04A 121PA 3NUQA 1UKZA 1KEEB 2FQ1A 4Z51A 1W4BA 1G3QA 5B3KA 2PCLA 2DWOA 1ND6A 3RADC 2DFVA 5FORA 2EP7A 1R6BX 1JAYA 3JY6A 3JQGB 1BFDA 2Q4BA 4BMVA 5C35A 1UP6A 2G3YA 4E2WA 1QQ5A 4FLMA 5HIAA 2FSUA 4ISBA 4Z54A 2Z2ZA 3E7PA 3O9MA 4UD2A 5G4KA 1EWYA 2FP4B 5FTNA 2P5SA 2EHJA 3DT6A 2H08A 1RIFA 3NRBA 3OPQA 4WKBA 3MWEA 4KQGA 4UNNA 3FYCA 2QEQA 4OBEA 2QS9A 3A3OA 5FBZA 4KXFB 3H1GA 1TKAA 2I8AA 4CMHA 4XFDA 4JIMA 2IEBA 3QXSA 4PX5A 1QWSA 4WVLA 1GPLA 1SXIA 1W34A 5CLHA 2QE7A 1TCCA 3PU6A 2GEFA 4RGBA 1JG3A 5KTTA 4KXYA 3Q7RA 5JRJA 5JU6A 2RC6A 3TOXA 1NJGA 1I2BA 4PSAA 5KHLB 2C3OA 4ND4A 2HWWA 1DFHA 4HDMB 2C99A 4I1YA 4ON9A 1SJ9A 4ZQCB 3A36A 3QHQA 3T5CA 4IKPA 2VZLA 4JFRA 1YU6A 3LDHA 3WGLA 1KI6A 5GVSA 4P4SB 1IFXA 3EA4A 1E0DA 2ORWA 2Q2OA 2P2NA 2V6FA 1YHZA 2EZUA 2X0IA 2P2DA 2YWHA 2Y0PA 1BAPA 1RXYA 1MV8A 2QY9A 4I36A 4PS1A 4XIIA 5DLDA 2ZAGA 1IHDA 4D3SA 2CT8A 2CLHB 4YDHB 3PPWA 4WPGA 1T5SA 3QKWA 4EPRA 2ZRJA 2ZATA 2QPOA 3IBTA 1QSGA 3BSYA 3FUXA 4E5YA 5JCOA 1V2GA 2FJUA 1TW3A 4ZDIA 1UM8A 2FX3A 2H9IA 4N3CA 4YJGB 1EH5A 1C9JA 4JB3A 4CEHB 4HP8A 1VJGA 4CIBA 4XUGB 3ACDA 1OGYA 1N6RA 3V8RA 1NVTA 2J5BA 2QN2A 2DG2A 1FSSA 4MQMA 4NBLA 3TJMA 1K8RA 4G5XA 2V5VA 3JAWA 2YKGA 4JR1A 1MD9A 2R6HA 1R6AA 1OWPA 4ZODA 2R5NA 1T5TA 5FOVA 4J7UA 1JRLA 5F9FA 1U99A 3AEXA 3BGSA 3ZWPA 5C80A 4OO3A 2YWXA 1KA9H 4MJLA 1WZCA 2XTJA 1NR5A 2HSGA 5LYYA 4X64B 4ID9A 1A1VA 4HWPA 5B7QA 4L4ZA 4DSAA 3NONA 4HWOA 4MKGA 3EX7C 3U7EB 4CJXA 3NBQA 4DIMA 5EIBC 4B2PA 5I7UA 1X14A 5LP1A 2I55A 2EHDA 3CMMA 4MR7A 1V3TA 1Z0KA 3TD9A 4GR5A 4UJ3A 2GM4A 3P97A 2Z0MA 2H1IA 4Q34A 4S1OA 4ZYYA 2IQ5A 2ZI9A 3HPRA 1ZM9A 3M1YA 3LUFA 2I67A 2EU8A 3HUUA 1ZI6A 4TKUA 3A70A 4ZJZA 1RRPA 4Q4AA 1U2RA 3L6BA 1A0OA 5AVOA 1N8NA 4M8SA 3M3HA 3G82C 3QELA 4Z0TA 2WE8A 2IPMA 3G1WA 4OK3A 3ZLUA 1C4OA 1SBTA 4XWKA 1GZDA 4G5FA 4XUCA 5LN1A 3IAHA 5ELLA 3S3TA 1JPVA 4BV9A 4DLUA 1QC5B 1V8OA 3L0BA 1NW4A 2ZI7A 1J8YF 2MSKA 2SCUA 3KSZO 3GGDA 4IFIA 2IUEA 3VYSB 3EOAI 4JROA 1V5FA 3IMKA 3EF3A 1II8A 3NUGA 2W2VA 4KOEC 1OLOA 2AWNA 2I65A 3LNTA 4RETA 5TVKA 4DVGA 1QRAA 1OD6A 1K7FB 3NEYA 3OU6A 3PUZA 2BKLA 4F6RB 5CXUA 2IK8A 3I8OA 3L79A 2Y0BA 3L9WA 4PRYA 1Z0ZA 3WBJA 2B0JA 3IUBA 3D31A 5K1ZA 5CYFA 2X40A 2I4IA 4DCJA 1QQTA 3ODPA 2BC9A 5HSGA 1S2NA 1R88A 2VOEA 3SZ3A 2GX6A 4JI7B 2EWMA 1HNWB 1HQDA 1G7SA 3C7CB 1Y89A 1IOLA 1P2SA 2GVNA 4YBRA 3PYLA 3RVBA 2CZCA 2YWFA 3MJVA 3PRJA 1ZM7A 3ICPA 2CYBA 4K9OA 4M1KA 4N03A 1E3QA 1QGUB 1ZY2A 2OHGA 2XYGA 4YUAA 3LLSA 4OCZA 5M34A 1P2UA 1SXQA 3KJIA 3AO0B 4XYLA 1Y1SA 1THMA 4CQLB 3B1KA 1KEEA 1IY0A 1WDTA 2XWPA 5LA6B 5AD1A 1TKBA 5FYDA 1QHSA 3JQGA 4R31A 3CWCA 3NBUA 4D46A 1K0UA 3F6SA 1Y6FA 2OO3A 3IVGA 4FYIA 4FE3A 2X1VA 3KZOA 3IDZA 3QX8A 4L4YA 4AN0A 4F9FA 4HV4A 5BVGA 2XXAB 2YFQA 3QU4A 1BVHA 2FRXA 3TWOA 2FP4A 1ES9A 4CVNA 2OBBA 4LZZA 5HKAA 3RSGA 4PZAA 3SBXA 1YRWA 4IILA 4JMLA 1WCXA 3HKEA 2CKMA 2FR1A 3D7SA 3KVRA 4II2A 1E7YA 4W9RA 1UDAA 5CFZA 1SOWA 3OTQA 3SICE 1JHQA 5DTIA 4YHHB 2D0PB 4M7PA 1ULHA 2IUTA 3P52A 3I34X 1CF2O 1N2ZA 2RGBA 1S8AA 3ABOB 3OE5A 3OPMA 4QBFA 4Z3DA 4CFZA 1OH7A 3D3JA 5DCWA 1CTQA 3W1VA 2RGNC 3KC2A 1N6NA 4I8XA 5PNTA 4GZ3A 3SZLA 2W2LA 2WF6A 3TZHA 3QTLA 5CYPA 5ALWA 3ABZA 3OWHA 3P94A 5KYVA 3TQTA 4F6CA 1WBJB 1OJLA 1VA5A 3R3WA 3T3HA 5EMMA 4HWRA 4H3SA 3LPAA 3TXYA 4H1WA 1KDZA 1U1FA 5K20A 4B47A 1SBIA 3I1IA 1LTQA 1SFRA 1OYWA 2JF0A 1EA5A 2GGSA 3FIJA 4BCDA 5D3QA 4OIMA 2V6JA 2DHRA 3OD5A 3D0RA 1GN8A 4WK6A 5TLSA 4OLAA 4PGGA 4MGYR 2Y1CA 1KZ1A 1GVHA 3N8KA 4JT4A 3WSTA 1DT5A 1PUIA 4JXZA 3RWOA 4JYPA 4ZD6A 1QZXA 4BQPA 4Y7DA 4YJGA 2VDQB 2VBCA 1JQBA 1ESMA 2VSQA 4GECA 4FYXA 4OP1A 4X1YB 5EJ5A 5C9ZA 1A77A 3IP7A 1O6BA 3G5TA 4TKLA 2WKQA 3R2JA 3UJ3X 1DX9A 1KS2A 1Q7GA 2FQXA 3ENNA 4IDGA 4QU5A 5IKMA 5E2IA 2VH1A 3NBKA 4EI9A 1YC5A 2UYHA 3LKVA 1VPTA 1SWVA 3D5TA 3PXAA 4XVHA 4YRBA 5KWJA 1LI4A 3S2UA 4D56A 2FLVA 4GR4A 4BAUA 4DLPA 3WAKA 1YI8A 1X7YB 2R751 1AJEA 1W35A 1E1RA 1CE8B 2SKDA 4NCAA 2XE4A 1I7LA 2PK3A 1NXQA 1ZGJA 3K53A 3EDOA 3PEWA 4N5LA 2OCBA 4ZAYA 5HBRA 3F5FA 3HQ4O 1I5RA 5TSDA 2Z6VA 1ILEA 1BHQ1 2C8JA 2WP0A 4MSUA 2F1HA 1FTSA 4L5IA 5J4KA 3FLBA 3SQLA 3CUTA 3KLOA 1OX5A 4WT7A 4ETNA 2B1RA 3RD5A 1SKUA 3RVNA 2XECA 5GQSA 1F4PA 3T4EA 1DCTA 4GX2A 1I4WA 2JL1A 3OU2A 1HEIA 3JYPA 3FFWA 1V7ZA 2Y1DA 4HX5A 5LBUA 3UB2A 1M2KA 3FX2A 3NKLA 1S8NA 2OHFA 2GR9A 2W90A 4Q3DA 5TMBA 3Q7PA 1NJFA 2FZLA 1E1DA 5F77A 3ETEA 2WMOB 5DLYA 5BRNA 3JSXA 4FOOA 2G72A 3HXMA 2QQGA 1WSWA 3BC1A 4NWIA 2XEXA 3OZFA 4AW9A 3IT1A 2C1ZA 4N65A 4LGYA 2X8BA 4MZDA 3A26A 1QC5A 1DAFA 4X00A 3U49A 3WY9A 4RM3A 4UMDA 1TPZA 4TMYA 4OG2A 4AJNA 1LF5A 1GSIA 4PIPA 2OCDA 2QAGC 1KJWA 4US0R 1D1SA 2XCQA 4IR7A 1QK3A 4BFVA 4GAEA 4EGQA 1QZTA 2O8CB 2OC9A 1H6BA 3RJZA 3MM4A 4U2CA 2Z9CA 1VE7A 2ZI3A 3U61B 4C87A 1QXSA 4KV9A 1Q2UA 4PZYA 1Y3BE 1KGDA 3QLVC 2YX1A 3H05A 2V6GA 1R5JA 4Q01A 2IS1A 4L51A 1NVAA 2ZB4A 1ZIYA 4L02A 4B3DA 3KJEA 4QJBA 3K94A 1OXVA 2W6OA 4I5GA 1UMDB 3LBIA 5CNIA 4IDNA 4ZWNA 3UMJA 1I5OA 2EGUA 1T26A 2JLAA 4MUNA 1G9SA 3HGMA 4DARA 4YMGA 2FSIA 2OAQ1 3IMCA 4NH0A 1V8DA 5EESA 2GZ3A 1BVYF 2KYRA 1QGUA 1NI3A 1P33A 3T12A 3AT1A 2KBFA 5GJVC 4I55B 5EJ6A 1TK2A 5K6AA 1UZNA 4CQLA 1MOPA 3P4UA 2X5JO 1OH8A 5LA6A 1YZTA 2IU4A 3HM9A 4TQUS 4S35A 4ZQEA 5K3AA 3SVTA 2NO9A 4P84A 1HY3A 2VRCD 5AVSA 1KSFX 2WWTA 3PXGA 4DLXA 4KYTA 4YCBA 4RV9A 2VCEA 3VFDA 4C2TA 2I3DA 1NHWA 5BSKA 2VJPA 3DLHA 4URYR 5JZMA 4WWHA 3O4GA 4V03A 4X45A 4K6KA 4DCMA 8ATCA 4DZRA 2HMAA 2ZBVA 1H3FA 2FJ0A 1OCEA 4E1AA 2WJWA 2ZVPX 2XRYA 1NSFA 2JATA 2ZKLA 2RGYA 3DKPA 3DM9B 1LS1A 1Q0HA 2C1XA 1A3CA 1HLGA 1VIAA 2AFHB 3KG2A 1II9A 1CUEA 3QUQA 3QVGB 4KKXB 1FS4A 4D79A 1HLPA 1N0WA 2QTFA 5M5BA 4L3VA 3JQFC 4R41A 1RAIA 2C2BA 4FLFA 1K92A 3ZXXA 1KI4A 1XG5A 3L4EA 2YJ6A 9MHTA 4BMCA 1V6SA 4I4IA 2UYGA 1ZD8A 2XDYA 5IF3A 1ZI8A 1CUIA 1NXSA 2TMYA 4CLEA 2NYAA 1N5MA 2EKBA 5LDGA 2WUEA 3PV0A 5K4HA 1XYYA 4Q21A 4AMGA 5JYCA 3I9MA 3BF7A 1MN6A 2C0PA 3L7AA 3S0JA 1G5PA 1VG8A 3FTNA 4BLRA 4HLDA 3H8WA 2DP4E 1I30A 2E18A 3DFFA 1SKAA 2E7ZA 5F3DA 3H7AA 3COSA 1JMVA 1GNPA 5T8KC 3HVRA 1JR3D 2FKAA 3FLMA 4M98A 3W05A 5AVQA 3BTUA 3M6UA 2X19A 4G5SA 3S8YA 3TLZA 1H4SA 4LJRA 4BBZA 5CBPB 4WCDA 4WD3A 1OT3A 1QYRA 2Z8YM 5K3EA 3KJXA 1QZ3A 4DEVA 5KPDA 2GI4A 1MZPA 3KPUA 1P4JA 3DQZA 3NTRA 5JFOA 5KOJB 3FGNA 4I4TF 3L4KA 1ADCA 1K27A 1X7YA 3NHWA 4UUAA 2H4ZA 4JC0A 4PVDA 4B2IA 4N5MA 1CE8A 1SCIA 2E21A 1P1BA 4QDOA 1H2YA 1EHIA 1L3BA 1BCSB 1YL5A 2E1PA 2OFWA 4XWWA 2NO4A 3ZHCA 1WRBA 4GZ6A 3HDHA 4LTMA 2Q6IA 1AHNA 3NPMA 1XJ0A 4A26A 2YHAA 4E4YA 1KZGB 2G17A 1PR0A 2AN4A 2B36A 2A9KA 5B57C 3LL7A 2BUBA 3I3OA 3C5CA 4N4AA 2NVBA 4MKXA 3O3NB 4RM2A 2Y27A 1ST2A 1V3VA 4ABYA 1COWA 2J1LA 4HFMA 2OZLB 3CF2A 1FFGA 1KH1A 2QMQA 3E9YA 2XT9A 4GWLA 4O2BF 2G0NA 1YDHA 2WSLA 4W5TA 1XOIA 4YFYA 3GUYA 2NACA 1KYIA 4IDQA 4MAAA 3DEYX 1ZCZA 3ER6A 4Z7JA 4QOEA 5L4NA 1QNFA 4S1NA 3BMOB 1EJBA 4AZVA 3Q87B 3KSUA 4YMUA 3WA6A 3PWSA 1DJOA 3RUFA 2HKIA 1M1NB 2JPDA 4FD3A 2B6NA 1XZLA 2YCLA 2ZTMA 2W43A 3ELUA 2ODBA 2NUAB 4MEAA 1B42A 5EKSA 2C9YA 2GBLA 7YASA 2P6MA 1I0IA 3P9PA 4L5BA 5IEBA 3SC4A 1W0JA 2FQQA 1R0XA 2XMDA 4ATNA 2O8CA 4E07A 4QYIA 3H3XA 4HAXA 5THKA 1X19A 1WV0A 1AHIA 1QYCA 2OHVA 4C6RA 2Y1KA 1P81A 1S8FA 3KVOA 3ZOZA 5JAPA 3ZN2A 4EYKA 2ORED 1ZIPA 3IKVA 1HDCA 1WY5A 2W6IA 5DGIA 1CF4A 1NMZA 4IMRA 3T5AA 4K46A 1HYGA 3NHYA 4RMIA 5TC4A 1UMDA 3DZ8A 4IFEA 3P19A 5HF8A 4D8VA 1GL9B 4PPNA 4ZMBA 3PD0A 1QKKA 2VTDA 2GDJA 3HXPA 2P9TA 4UHHA 2NU7B 5ALRA 2IYRA 1NFQA 3D8NA 1XMJA 5J5CA 3T7CA 2GBCA 4E5KA 4I9GA 4KE7A 3FYSA 3CNEA 1SVIA 1I0LA 3IURA 1JVBA 4FGWA 4RJTA 3FYUB 4RVUA 3VR1A 1AX9A 4FNAA 4EFDA 2NO0A 2VXCA 1Z15A 3ESAA 5EQFA 3GVXA 2HUNA 4JEUA 4OAOA 1N8TA 2QJWA 4I9FA 3VNRA 3L1IA 2QTNA 3ZU6A 5EWJB 4RO0A 5E4TA 4MVYA 3B6IA 3TMAA 1I6LA 2O8EB 3ZWDA 1OGJA 1O9GA 2GPYA 4EJ6A 1K4MA 5G53C 2HY7A 5FCDA 1K0FA 1UM9A 1IJBA 1OTYA 4RPHA 3ZGLA 1WCIA 2ZRKA 2D6FA 3WLHA 2NLOA 3S5JA 1NQAO 3WG9A 1TA4A 4TROA 1H3EA 1XALA 2AFHA 3KQKA 16PKA 1IHPA 2WYHA 4B79A 1U0JA 3O4IA 1U0TA 1X7DA 1OU4A 2A3NA 3AHEA 2G04A 5JNTA 4XB6B 1A5AB 4DMHA 5I8PA 1ZCJA 3N9IA 1O8CA 5TGTA 3PTLA 3SJUA 1C50A 1W4AA 3L7YA 2PX2A 4GX1A 4P3XA 5HA5A 3WV5A 4BLWA 3M49A 4G97A 1ACJA 3E84A 4ZU1X 4B1FA 4BEBA 1KQGA 1M6WA 3H2ZA 5IM5A 4D4LA 4HJRA 4H1UA 1JQJC 1S2MA 4YMLA 3FPAA 3W3ZB 1CZUA 1NWCA 3VKFA 4KR7A 3D6TB 4I99A 1AUQA 2VBIA 4XQCA 2NU8A 1QMGA 3JPWA 3F5MA 2Z2JA 4D0LB 3R0VA 1E61A 2ZRPA 1W44A 2Q29A 4MO9A 4KQHA 4PLZA 3HDQA 3K9FC 2FHSA 4BLTA 2BOVA 3BXHA 3VNAA 3WWZA 3BGIA 4XM1A 1I32A 1RLJA 4WZBB 3S70A 4GICA 3PFHA 2A9VA 4DNOA 1NV9A 2QLLA 2BONA 2WG0A 3ASUA 1JFSA 4J4HA 2KMLA 2DEUA 1QJ4A 1G8GA 4NDAA 3ZI4A 1EWKA 5TQJA 1EDBA 1QHXA 1CY7A 4I4NA 3R09A 3SQOA 4BFTA 4L4XA 4C6TB 4D2IA 1CUVA 2H7YA 1UC4B 1DOAA 2W2NA 4IQ4A 4EUSA 1U6JA 2DCMA 2JFQA 2LR0A 1R6XA 1HMPA 1DAIA 4LY0A 3QG5A 2JG3A 4B3GA 2I8CA 2CXSA 1QAQA 5GV7A 1GOTA 3L5KA 5KOJA 3R9WA 4HN9A 3BHIA 3UCFA 1DIAA 1MIOB 2XUHA 1P91A 4DDVA 4YACA 1ZH2A 3TLXA 5KYUB 2V1UA 5AQEA 4Q48A 2ATXA 4IMPA 1SC6A 3OOEA 4FHCA 4GOLD 3U9SA 4DVJA 1NVXQ 3NANA 4J6FA 1O87A 1RKUA 3INYA 1H4VB 2HIAA 1BS1A 1ZW6A 2HSJA 1AQYA 1I4DD 2BFEB 4HH0A 4E7OA 5A4MS 1EP3B 1JJIA 3VPXA 2C7RA 3AWIA 1S2DA 1P75A 3OSZA 2NNWB 4EGCB 2IX3A 3PFKA 3STUA 4RLFA 4KNYA 4P92A 2WSSD 2E1RA 3O7WA 3ZZ1A 2FEXA 5B1HA 4MWOA 4GMHA 4RENA 3W9SA 1N92A 1YK1A 3PQFA 1U2TA 2YW2A 2Z2IA 4KPGA 2ES4A 4WLUA 4Y6QA 2PH5A 4B80A 4CKYA 2GTPA 4HSEA 3KAPA 4B3BA 2BI8A 3WL4A 4DN6A 3IVRA 1W19A 3A2MA 4Y2SA 5DX1A 2BFMA 1SXJC 1M1NA 3HUFA 2DF8A 2IXEA 2HW8A 1H1DA 3EUEA 1WEHA 2NUAA 4N48A 1JMKC 1ZW1A 2YJNA 4QT4A 3IJPA 4HWSA 2WYUA 5EJMA 2IHVA 5CT8A 3EGXB 1R0RE 1DC8A 1VC2A 2FFRA 1CNFA 1V2HE 3IQIX 2V45A 3KO8A 1JEOA 1NM5A 1CFZA 2J6IA 2BHNA 4PPGA 2X2EA 5T6MA 2QLNA 2JLVA 4GEGA 5CNJA 2FEMA 2C3UA 1CJUC 1JEEA 2W58A 2CB9A 1EB9A 2D7JA 2FW1A 2O2CA 1ONOA 3COZA 2H4XA 3B5IA 1R0LA 3GLHE 3UMMA 4Q9AA 4GMGA 4KAAA 3WGKA 2XCUA 3CB2A 3DAFA 1XYVA 3HABA 4LI3X 1DS6A 3U1VA 2NU7A 4AULA 4DMUB 1MHTA 2DGDA 1LFAA 1PT9A 1TU0A 1Z5VA 2N46A 4NR0A 1MA3A 2B1QA 2IZ0A 4QBTA 3FYUA 3WNZA 1JQDA 4ZPJA 3S6JA 3PJEA 1B2RA 4MMYB 4COOA 4QU8A 4FE7A 4FUQA 1P1IA 4F71A 2MIIA 2VF8A 2V6IA 1U28A 4MHTA 1G9XA 4C6HA 1J1UA 2O8EA 3PRHA 2OP0A 1CUDA 1JE0A 2BF4A 2G4CA 3N28A 3RRFA 3FTPA 1ZA1A 4BV2A 2BYTA 3KQWA 1K3TA 4AY2A 1Z62A 2FFJA 2IXTA 1NI4A 5L40A 2FUNB 3W5IA 3RS4A 1AF7A 3MJTA 3R3HA 5ARBA 1N5KA 5HZKA 1JKXA 4EY7A 1E92A 4R0VA 2X8JB 3CH5A 5DP1A 3ORYA 1SQFA 1XTSA 4GPD1 3JARB 1YZYA 4IO1A 4JOCA 1JQAA 5LIRA 1XF1A 2FG7C 1ZOPA 5J43A 1JSLA 5JROA 3N2KB 3A9UA 3A1WA 1J00A 1UBUS 3M8KA 4MKHA 3TSZA 4CQJA 3EXAA 1O54A 3R7BA 3VOSA 1L8XA 4BDTA 2GYVA 1F3OA 3D9QX 3RC1A 4GGPA 3L1HA 3AK4A 1MAVA 4R1PA 2OFFA 4AN1A 4YRIA 2COKA 2LWIA 3MT9A 1K8QA 4R2LA 2JCYA 4F5YA 4UNIA 2I4NA 1FLNA 2YDYA 3PFFA 5HJ5A 3RHFA 4RBNA 3ZDEA 4D1YA 4R71A 2JAWA 2ZAIA 4NCHA 3V9AA 4PAMA 2IOFA 1KP9A 1C3VA 1U81A 1WUHS 3CX6A 5BQFA 9LDTA 1NX9A 2OV6A 2V1XA 1O97D 4Q9NA 4O4HB 5FNVA 1ZK2A 3V2IA 4MZXA 3OTWA 3Q2IA 1E2PA 3SEAA 4QAJA 4HATA 4WZBA 5IJ9B 1IJEA 4MNTA 2V7PA 1GUZA 3LOPA 1YIOA 5JH7B 1SXHA 4DJEC 1H8ED 2NUPA 3VM6A 4BPRA 3N86A 4GP7A 1QG0A 2M6LA 4QDKA 4C6TA 2QPTA 1Y1KE 3EUWA 3WP0A 4AP6A 2XODA 3VSCA 1AUOA 1P8JA 3JYOA 2OP1A 4KAJA 3H2KA 3ASYA 4XCQA 3ZY5A 1FVXA 3IXLA 4P3PA 4G0MA 2NU9B 5IM4F 4YV2A 1UBSB 3ENQA 4CV1A 4N54A 2XSZA 4GGMX 4KXXA 1MIOA 1C1HA 1RXCA 2B2XA 3FTCA 1J2RA 3HM2A 5IDYA 1A9TA 2XUFA 3UBMA 3DYBA 3WJ1A 2G8NA 1QIHA 1S4QA 1TF7A 5KYUA 1O95A 4YMVA 3E05A 3HV2A 3WLMA 1WHSB 3KQPA 1KEUA 1A2OA 3ZJUA 4O2LA 1TC1A 4R0NA 4MULA 2IE0A 4R7ZA 4A7PA 2YNMC 2RGGA 2WAYA 1RCTE 2HBZA 3N2NA 3F6PA 1HQKA 1JDBB 1C8BA 2WNHA 1IEVA 2G0AA 4ND3A 4QTTB 4UCQA 4RGYA 4XYMA 1QLWA 5DNVA 4G9BA 3OZEA 4M89A 5EL0A 3B3AA 4LDNA 3MPUA 1HG0A 1PSWA 3OX1A 2FPUA 1DRVA 2VYND 1DIBA 4RJ2A 1CETA 1Y3CE 1LPNA 3WR5A 1ZOOA 2BFOA 3AR5A 3EWNA 3DUWA 4ZVTA 4Z4IA 2ARKA 2QK4A 3BDIA 1C1YA 2EQ5A 2C2KA 2YH2A 5E2BA 4AO7A 4L8WB 5L3VA 5DP2A 5JAHA 5B4TA 1OI4A 1GFZA 1XAJA 2ZVJA 2P65A 3ICOA 3O3MB 4HGQA 1GG5A 1J97A 1MLDA 1USUA 2QTWB 2WF7A 3IBSA 1KKMA 3EQ6A 3MA0A 5JCJA 1E3IA 2G1KA 1UQUA 2JHAA 4NBKA 4EAAA 1VECA 5F73A 4FZ5A 4LBWA 4DJ5X 1M6YA 1UJMA 1Z7BA 4CKCB 1SY7A 2WJZB 1RQ7A 2XCTB 3LNCA 3TBKA 3GNSA 4D8TA 1J2JA 1K6JA 3EEBA 1UMKA 4XRRA 4Y8VA 3W4IA 1YQUA 2W37A 3KOXA 4KXMA 4FX2A 2ZRGA 1DDGA 1P45A 5C81A 3F5DA 2GEDA 4XYBA 4UHBA 2VWHA 5GTDA 3CUKA 3JW8A 1NP6A 3GPCA 3GUCA 1PL7A 2C5HA 1EK2A 4H6PA 4HXEB 1GDHA 1GRCA 5AI9A 5GOZA 4U8GA 2NZXA 3NNSA 4ZT4A 5KSOA 2ZITA 2GAJA 3ESYA 4HO1X 4QQ8A 5AXCA 4ZQGA 1VI5A 1US8B 5H16A 1XQWA 2YVAA 2HEGA 4M55A 4NMHA 2QI9F 4QGAA 4FIZA 1WL8A 4BY9E 1NZFA 2H2DA 4TTIA 4GOMD 2WZCA 4EFKA 1BHO1 4KJXA 2CEAA 4RD6A 5AJWA 1ZL2A 5CT6A 2QY6A 4BUJA 1KWKA 2DWQA 4JLAA 1OY1A 5FOUA 3GCZA 2WD8A 3RUPA 2F9LA 3LIPA 1LDNA 3MWYW 4RHYA 3K9LA 2Y1FA 5AVYA 2PH1A 1IULA 2YXLA 2Z5VA 5EJ4A 2A7QA 3L0YA 1JLMA 2AC2A 2OV8A 3L7NA 3OLYA 1T0BA 1CY4A 1MJFA 2E48A 1Y7HA 2HYDA 3PDJA 5A4JA 3B2QA 3B78A 3GFPA 4DR3B 3DA8A 1Z9BA 5KX5F 2O19A 2VJQA 4OIFA 2C8KA 1TT7A 3QFCA 3CUVA 3VR4D 3WL6A 4EI8A 4Z4FA 1L4HA 2XNCA 3JARA 1OV6A 4X93A 2IHUA 2AJDA 3HGTA 2D00A 2SNIE 3CH6A 4QRHA 3N2KA 5K0NA 5BMVF 3ICQB 1Z2DA 5DB4A 5LSAA 3P1JA 1G1AA 1D4OA 1FXWF 3PVCA 2XD9A 3IQDB 4L5YA 4A5SA 2I76A 1H4QA 4O4JB 2IV3A 4RE5A 1N32B 3ZIAA 3LWBA 1QHNA 2IDKA 1GU1A 3DVAB 1G19A 2FN4A 4NH4A 3PQ2A 3D4NA 1HYHA 3GFFA 5I8ZA 2ZUWA 2JA1A 2BTOA 2ZP1A 2VSNA 1E18A 4QGSA 1NBIA 2PMCA 4YDSA 2XQJA 4CODB 4KFUA 3GMDA 3S40A 1U0FA 5KAPA 4Z1MD 3DT8A 3LCUA 5CHEA 1VYTA 2KS6A 5EJ8A 2Q1WA 3KAJA 3K5PA 3O9VA 1IZ8A 3NJRA 2WSIA 3LAWA 4GPBA 4O4HA 1QHYA 1CP3A 2B1IA 4BN0A 1CB0A 4PGFA 2UXDB 2VHEA 3VAAA 3I76A 2NADA 4D44A 4A0GA 5LQDA 5JH7A 1QIMA 3PWTA 1UJCA 4BZXA 4C89A 3HA5A 2ZULA 2JJYA 2OUKA 3L04A 4TXMA 3IOEA 2C4TA 3E8XA 2AXNA 4PZLA 5BSUA 3KWJA 1R6UA 3OTOB 3IE1A 4ITUA 3RWMB 1NT4A 1DRJA 3PC6A 3QTTA 1E5VA 4NBNA 4OHCA 1GRNA 4OQDA 4WLOA 2NU9A 5BN5B 5EE0A 3KX2A 2A4MA 1GL7A 3UKDA 5CLJA 1NW7A 5K8LA 2CBXA 4HADA 3F8WA 4KBYA 4BE9A 4AWBA 5U1PA 4CL8A 2O2IA 2QN7A 4JH0A 4P7JA 4Y2XA 3IIJA 3DUFA 3HP1A 3OIWA 4ZOLB 1H94A 1T9CA 1WHSA 3CZCA 1D0SA 1ADGA 4EJFA 4KFCA 4PM4A 3JWJA 1DC4A 1L1EA 4U7HA 4GSLA 2GLXA 4Y9RA 4MIEA 4URWR 3ZWXA 4YQFA 3ZHRA 1E1CB 5JWHA 3KCQA 2HREA 2R9VA 1OXMA 4RZQA 4N49A 5HM6A 1G3IA 3UXHA 1ZC4A 3NWOA 4FLEA 4D98A 3GAFA 2G5PA 1QE0A 2OGWA 2FV8A 2I4MA 2A14A 5K0ZA 5EHIA 1CEXA 5ADHA 1TAUA 3NDJA 3HLKA 4TN5A 1NQXA 1W5TA 1N5LA 2D1QA 3GVCA 1YA4A 1YR1A 4L28A 4AF6A 1HT3A 3C6BA 4B8ZA 4F04A 3EGDB 3GGJA 1D5WA 1I10A 5BOSB 5AW2A 3W2GA 4JNKA 1I7PA 1XZMA 2N47A 2NOAA 1APBA 3UWMA 3NOOA 2LXNA 5E7MA 4UOEA 1O5OA 2XUQA 3A11A 2EATA 4IIEA 1DKPA 1TFUA 1C14A 3KYDB 1V25A 1XDDA 4P5DA 4URZR 5B6PA 5C7LO 2GF0A 2J9FB 2QA5A 5C53B 5MGBA 3T9BA 4CKCA 1MJNA 4UM7A 3W5SA 4GQIA 3RODA 2HWXA 4K9NA 2EIHA 5FL7D 1Z16A 2ZI5A 3CS3A 2Q2QA 1MB3A 2IHYA 5C5DA 5LJIA 3E9DA 1SBNE 2VA8A 3EODA 1P7ZA 1UQRA 2G5TA 1KFBB 2IY8A 4IJWA 1H6AA 2NTYC 3TQRA 13PKA 2ZSAA 2FFQA 2FXIA 4NYMQ 5K3CA 2ZXEA 5CNKA 2HHHB 2H5LA 2UYOA 3HBNA 2YY7A 4YP0A 4BUZA 4CM7A 3KKNA 4RZSA 3PKJA 1LZKA 2BBOA 2NIPA 3TLGB 1T3ZA 2PUWA 1E0JA 3CXRA 4AYXA 3IUMA 3A6GA 1HDZA 4R6XA 1FCJA 2EX4A 2B1GA 1L8LA 3LT2A 1CZNA 4NE2A 3HO1A 1IIBA 2HR1A 4IXNA 5CCEA 5D01A 3OPYI 4IV8A 1G8FA 4M1MA 4D0NA 2ZBGA 2GPTA 3AINA 1QR2A 3G2LA 3MBKA 4OA8A 2QAIA 1HYEA 4E5DA 1XEWY 2X5NA 3EFBA 5CA1F 4Q3OA 1KDYA 3U16A 1AKTA 4JJFA 1R0SA 2HCFA 1A8IA 2YRWA 3C7DB 4C21A 5ALTA 2I6GA 1GITA 1DAOA 1WS6A 1BC5A 4UM5A 5AHWA 3EK2A 4KFSA 4LSMA 1TQ8A 2ZUVA 4Z0NA 3VOTA 1OQAA 4QULA 4M37A 2ZDQA 3AY7A 1DKQA 3JX9A 4JC4A 1U6KA 2H4HA 4IMJB 3NS7A 2QX4A 3EEFA 5DHAA 1RW4A 3UOGA 1U7ZA 5IT0A 4L57A 1LZLA 2VDLB 4UPVA 5K3BA 3C41J 3D54D 5HNKA 4Q1FA 3UWOA 3QWHA 4J90A 3WO1A 2ZBEA 1RYEA 2FE4A 2HI0A 3GJXC 4O4JA 2C00A 1BMFD 3EXG1 3LTEA 4XPZA 2IYWA 3DVAA 1XZGA 3CUUA 3WBFA 3ND8A 5FWYA 4CIDA 2P3OA 1EEHA 3QVJA 1AZLA 1WZUA 1D4ZA 1SG9A 5KTNA 4JODA 4RTLA 3SBEA 5E9AA 3RAGA 3KXIA 1RU3A 2PRSA 2HXYA 2YYZA 1DJPA 3HEAA 4V0KA 3AW9A 5EKUA 3RIGA 3WADA 3V00A 5REQA 5HZGA 4HL6A 3D6MA 4Z9BA 1CR4A 3RM3A 5AVVA 3IUYA 2HSDA 4YMSA 3E2PA 1X94A 1E9BA 3HL4A 1MC8A 3K6SB 4A0FA 4NONA 4G0VA 2P3QA 4ZJUA 3UFXA 3EH2A 5D84A 1GT91 1L8OA 5L9AA 5EHNA 1KI7A 5F3RA 1TJ3A 1EJ0A 1I13A 1BEZA 3U3DA 2HA6A 5JNSA 5K3FB 4F4JA 2J30A 1MAWA 3F71A 4W5HA 1UDXA 3U3OA 2IBSA 2NVOA 5CURA 1G16A 4Y1GA 3GH3A 4N0MA 2VPXA 3INGA 1DKMA 2UZAA 5BN5A 3QBTA 1NULA 1KYZA 2ADFA 2P40A 1OAKA 2WTAA 3BD9A 4K2AA 1AV6A 1FRVA 1GQFA 1B0ZA 3BWDD 1M8GA 4KAXA 3K1JA 3WMEA 1GN9A 3LQYA 4DLTA 3EPHA 1NMYA 1Z35A 2XW6A 1QCZA 3PX3A 4FBMA 2WAXA 3EQ7A 4OOEA 5TQVA 4HGYA 5A06A 3ACBA 4EJSC 4YCSA 5KNBA 5JRZA 2FSGA 1USWA 3OIDA 3DWEX 2Q2WA 4UKDA 5LMCA 2PRKA 2Z98A 1UADA 3DKRA 4KVAA 5DBFA 4GXTA 3ANMA 4W99A 3U1TA 1SC9A 2C4KA 3ZGOA 1UEJA 2YZ7A 4F1WA 3DEHA 1FPMA 4UTXA 2FFHA 5ICCA 1E1YA 5ESWA 4QOIA 2ESRA 1KQ3A 1VP3A 1QVWA 1O5IA 1DRUA 2FEWB 2IZ7A 3RVOA 1GUAA 4CIXA 5EIWA 4IIFA 1LFDB 5A5VA 4D97A 3EGDA 2HMUA 1R0ZA 3E2IA 5BOSA 1E2DA 1MC1A 1N2GA 1Y1RA 4DCNA 1IUPA 1N7IA 1L3IA 2JGNA 6LDHA 2O0MA 3G5AA 4MW0A 1QO7A 1WU8A 1ULTA 4CG2A 4G5QA 2EEPA 5DNYB 1UJBA 3IALA 3R6DA 3FUTA 1YVRA 4MS1B 5HKBA 3MJRA 1GRVA 5LKRA 1AN9A 2J9FA 5JATA 1FS5A 1P2DA 2C31A 5GMOA 3NCHA 3H17A 3TRJA 1Y34E 4WCFC 1DQNA 4C0JA 2V3CC 3MMPA 2VAVA 3AOEA 5FFNA 3SIPA 3PCTA 1VLQA 1JFFA 3AY0A 4KVFA 3RV4A 3NBAA 2PLNA 3FOWA 3O8DA 4HYQA 4QVKA 1NPYA 4F84A 3LHKA 4NPAA 3BERA 2G9NA 2OSBA 5ALYA 2RCNA 4OJYA 3C6KA 3C3PA 1DEOA 3IIMA 3JWPA 4D8YA 2ZRAA 3ZZTA 2AK3A 4LYJA 4PTLA 3AOGA 3UFBA 2I54A 1G8PA 4ZVKA 2P9CA 2A33A 4D9IA 3YASA 4J29A 4XJVA 5ENZA 4NBUA 4M7OA 3MHTA 3C8UA 3LS2A 2AKYA 3TRIA 1OR8A 1IPEA 1EFDN 1MOSA 5JO9A 3VNUA 4GVLA 3WRXC 4XGKA 1SBHA 1T9AA 3EY4A 5EIBD 3QENA 3H83A 2E4VA 3F98A 4CTMA 1G6OA 3RK0A 1SM4A 2R7MA 3A1CA 4Q37A 4R2JA 5ALNA 5BNTA 2QN8A 4MWSA 4UUOA 3DLCA 2BIFA 1ZKDA 4QJ4A 4L72A 3WB9A 3E9CA 1K7YA 3S2IA 3H2HA 1OF1A 1NBMD 1X13A 1YDMA 2DBQA 4L4SA 1II0A 3F2IA 3VSBA 3QMMA 4X65B 4FEEA 2EJBA 1UWKA 4RL6A 4DFDA 2DQ4A 1PWYE 1D6JA 1ESZA 3CVUA 3LF2A 1NLYA 3F78A 1RHJA 1U7TA 1Z4LA 3QUBA 3VU1A 1T36B 1XZNA 2ATVA 3DZIA 3UMFA 5ITVA 2FN8A 1VE6A 3LA6A 5E0OA 3U81A 3GLQA 1F2TB 1BW9A 4FFSA 4WXEA 3SI7A 5HOEA 4DR1B 3ZD7A 1Z0SA 3HFRA 1GA4A 4MAMA 1Z56C 2RHMA 4TL8A 5B1DA 3V32A 3ZGYA 1JHVA 3ZWAA 1JU9A 1O6GA 4GR9A 1A97A 2I7TA 2Q3FA 4EZIA 4EL5A 3FMFA 2QAGB 1JHUA 1TEVA 4RWEA 1ECCA 3X1DA 5KOYA 2FN3A 5IT5A 4TWIA 1NJ1A 4JLNA 2D1FA 4CTKA 5TMPA 2JI7A 4IIVA 1LTHR 3DEIA 1Z0IA 2IXFA 4GD3Q 4GH5A 3RQIA 2UZ3A 2QUJA 4MVJE 3O74A 4BTLA 4WFJA 1E3TA 2M32A 1JG2A 3E58A 2YV3A 2ZIXB 1YNOA 3OCWA 1XLTA 1LPSA 4M46A 4EF4A 2HO4A 3U1BA 1FMFA 5BV1A 1ZXLA 2ASVA 4X44A 1KHTA 3W9UA 3I8SA 2PAAA 3QEBZ 1DQPA 1GV0A 1PKXA 3N2YA 4Q4LA 1JAXA 3JSAA 5FTJA 1IQRA 2Q5IA 2PKCA 1E3MA 4OLHA 5BSHA 3G2PA 4M38A 4EW3A 3FNFA 5L3QB 1Y7IA 5CXSA 1MG5A 1FQWA 3W8NA 3GLGA 1AKEA 3LWDA 1BKDR 3SR0A 2PUEA 1QNLA 3VZCA 4UUPA 5CIYA 2B0CA 2JGDA 2XF2A 3OHMA 1MPXA 4UMFA 2ZJYA 4MUXA 1E7SA 3T3GA 4TUYF 1DX6A 4RCZA 4UVDA 1ULBA 1O1YA 4K9QA 4YYEA 4JVNA 1NJ8A 1IM2A 5AHOA 5TJ9A 3OQJA 3TQHA 1UDBA 3GOHA 1B14A 3WTBA 4AJHA 1PDOA 1HRDA 2Z95A 3BXGA 3SQWA 2VZ0A 1PJRA 1S5PA 4Q1EA 3ZXYA 1EDZA 1Z2EA 4NARA 2A9OA 1KOLA 2JZCA 3RUCA 2HMWA 3GXBA 5TT1A 2H7CA 2QV7A 2OK7A 3EHEA 4RD3A 2Z5LA 2WTEA 3HR4A 1NVVR 3IAFA 2JD0A 4LYHA 3ZY2A 2Q6TA 3I23A 3ROEA 1PRYA 3EGOA 1PGOA 2VJNA 1V43A 2YV2A 3NWBA 1POXA 1X70A 4DLKA 1UKBA 2CDAA 2BBTA 2ZIEA 2I5PO 2V65A 3FSEA 4MS1A 4WJZA 1E2EA 1ZITA 3PENA 4BNWA 4ZYUA 1GA6A 2XCOA 4M4SA 4IPTA 4R6WA 4Z5XA 3PC3A 3WYCA 4BMDA 5CEEA 3ZNPA 2ABWA 1EINA 2X0DA 3ZHUA 1Z63A 4LJSA 5T3YA 3WSWA 1KPHA 3PR1A 3C6XA 4EA6A 2IYLD 2OD9A 2RIPA 2ONKA 1HTTA 2VPTA 1I14A 4LS3A 4C4ZA 4DLAA 2I6SA 1C3JA 3QVKA 5DDIP 5EJ2A 5JAQA 5BR7A 1Z33A 2RHRA 4F4DA 3CN9A 1D1TA 1ZSNA 1GPDG 3EVTA 1HE3A 3PHGA 4FEYA 4NXNB 3LCMA 1GNSA 1RTTA 3DXYA 1KJYA 4KG7A 1KVRA 1LRLA 2VH5R 2R84A 2NP7A 3RRXA 3JRNA 1J06A 3BL6A 3CHYA 5HGXA 1B8PA 2PUCA 1ZXXA 4FMDB 1UMBB 3LCCA 3TYXA 1FNSA 3WLLA 1DXYA 2CHFA 2H59A 2OVFA 3BTOA 1L5MA 3HMQA 4J07A 4RXTA 5IT4A 3JZDA 1H2BA 2J6CA 4G63A 2C42A 4AQDA 1GLNA 3ES9A 3LYAA 3LFUA 4JWTA 3RVPA 3G59A 2B8TA 4UQOA 1U9CA 1DX4A 2JLRA 1N3YA 4R68A 3VJMA 3D64A 4B6EA 3EY9A 3LE8A 3QF4B 1JHAA 3BD8A 1KO7A 3UJ6A 4ND8B 5BSMA 3TJRA 5GJWC 4JR0A 1OA1A 2B83A 4K88A 2QL5A 3AIOA 2QLBA 4KP7A 2F43A 4KR6A 2QORA 3T9EA 3EQ2A 3OX4A 4YIKA 1FIUA 2BEWA 3DBLB 1R9NA 4K7JA 2I7DA 2L0XA 2DTXA 2WPDA 4JLUA 3DXFA 4BC1A 1CUWA 4EVIA 3O5AA 3LG2A 4AS3A 3LZCA 4CCAA 4MS3A 1W5SA 1LTKA 3DLIA 2YZNA 2D0DA 1YTLA 1RQXA 5IZ4A 5I7RA 1JKJB 1TTQB 4KX3A 4W8HA 4BMOB 4DNFA 2P79A 3KHKA 1J24A 5F21A 3VR0A 1GTJ1 4DREA 5DN6D 2QLMA 1W7AA 4RSGA 2AHOA 3SGLA 3L46A 4KSCA 4DSZA 1YMUA 3JYNA 4DXDA 2CYAA 1NW6A 1PJCA 3CH4B 1AS3A 3DTVD 3KKPA 4JB2A 3QBJA 5HEKA 4JS0A 2QTTA 2R0QC 3FTQA 2RHCA 5ALZA 1YTUA 2Z3VA 3C3CA 4TXNA 3UK2A 4CG1A 1G3UA 2HFKA 3T3PB 1T9GR 3P9SA 4L50A 4W82A 4KE9A 1T13A 3EA5A 5DVZA 4PZ0A 4GFDA 3P2OA 1DO8A 4X7PA 2HQ1A 2Z58A 3CPHA 2OB2A 2XLCA 1UDRA 4L4UA 5LZ9A 5J1SB 2O3TA 1ZC3A 4AXXA 4MDFA 4KR3A 2ZIXA 3H7IA 5IC6A 3TTWA 3LHSA 1HH4A 4KGXA 4B3CA 2VHJA 4R1TA 5E6UB 4BOYA 3V4RA 3KSAC