4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
b'DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl CoA reductase
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
4Y98A 1VLLA 5BNTA 3V1TC 4KQWA 4YEDA 1PJSA 1G1AA 1N5DA 4MINA 3GK3A 3A4VA 3V2GA 4K1LA 4DIFA 1FDWA 1SBYA 3W6ZA 3PGXA 4J2OA 1NPYA 3K92A 2WYUA 3DO5A 5AXBA 4BUCA 4KTVE 4MVJM 1A71A 3AM4A 3F47A 2ZQZA 2G17A 1DIRA 3EVTA 1AN9A 3GMDA 4UVHA 2B35A 5TJ9A 4DA9A 2OBYA 1PR3A 2D5AA 5DOVA 3N74A 1B14A 2CZCA 4CLRB 1NYTA 3G79A 4CMBA 4E32A 4PN3A 1PS8A 4IMRA 5JDCC 4CR8A 4O6VA 3DXFA 4II3A 5GMOA 1PQPA 1LSSA 3UXYA 3PGJA 1DBVO 4BNWA 4Q3AA 3BHMA 4AJKA 4NU6A 3E18A 4P8RA 3NDRA 3H5NA 2IXBA 3Q0EA 4FQ8A 3ZNQA 1I24A 1MLDA 3NGLA 3QY9A 3SBOA 4Y6RA 1EE9A 1C0IA 1QYDA 4XB2A 1BVUA 4GMFA 3GEMA 4J91A 3ULKA 3HADA 3PHGA 4BGUA 1E1LA 3TNLA 5AQ1A 1M76A 3QVWA 4RVDA 2Y66A 2JD0A 2X58A 3QWAA 4R54A 1E6WA 1HYGA 3F5SA 1SZJG 3C7CB 1Z73A 3JQ9A 4QTZA 1D3AA 2ZB8A 2WD7A 1R12A 3ZWPA 1EQUA 2D5CA 3VPHA 4CMHA 4IZIA 2PR2A 1VL8A 2JHFA 3FTPA 1AHHA 3OQ6A 2GYYA 4E5YA 3RUCA 4OMUA 4PLYA 1CIVA 4OO3A 3AU8A 3CZRA 5C37A 1HSOA 3WS7A 5TQVA 3L4SO 2EW8A 2GN8A 2NVWA 3IJRA 3FN4A 4J43A 4R4JA 3T4XA 4BNXA 1K0UA 1OBFO 1BDBA 3BZUA 1C0KA 3STHA 2A9FA 5BSHA 2IODA 4CM5A 3FPCA 3I23A 4AJIA 2V6BA 3RVDA 3MTJA 4XCVA 3VH1A 3L4BC 2RCYA 4IBOA 1HEUA 3NKLA 1O94A 1SNYA 4GWKA 3W8FA 7MDHA 4AJNA 4KZPA 1SO8A 5ADHA 3T7EA 4DC0A 4KUEA 1H2BA 5L40A 2CSUA 2CMDA 1NTOA 2FZEA 1HDRA 3DFUA 4NBUA 3RQSA 3IKTA 1JKFA 4WKGA 1HDZA 3GPIA 4YAEA 2V7PA 1LRKA 4BMNA 4I5GA 4N5MA 1F8GA 1PEDA 1Z75A 4J4TA 5JDIA 3RUAA 3F3SA 4WNIA 1PTJA 5CG2A 4BNHA 2DUUA 4HV4A 1ZK4A 2PZJA 3WXBA 2PV7A 1LX6A 2QZZA 3PYMA 4XQCA 2YQ5A 4RF4A 1PL8A 4ND3A 1ZUD1 2RH4A 1YO6A 1ADGA 4YWJA 2NU6A 2HK7A 1VL0A 4NBVA 1F06A 1W73A 1Y5MA 5CFZA 4JQCA 3TZCA 1F17A 2HK8A 3PTZA 3DBHA 4DLAA 2HRZA 2WE7A 1ADCA 1B8PA 1IHYA 4YA6A 4W99A 1A9ZA 4OXNA 2I3AA 3EC7A 3JQBC 3KSZO 5BNIA 1DFHA 3ROMA 4PLPA 2PWZA 5TC4A 4BQPA 3QV1A 3AUSA 4CR6A 4BO2A 2YDXA 3JCZA 3WQSB 1HLDA 3MTGA 3U4HA 1GPDG 3UCFA 2PFGA 2AMFA 2JFGA 5LC1A 2ZJ1A 3ZCXA 3K2BA 3FBGA 4DBZA 1N1EA 5HS4A 4ALNA 3FWZA 1WMAA 4TMFA 5ENDA 1MXFA 1KS9A 4HWKA 1HWYA 4YT2A 4R68A 3DTYA 2BMAA 2HMWA 5B4TA 4IJVA 3MCVA 5ES3A 3UUWA 1H93A 1EVZA 3WB9A 5EL0A 2HAEA 2RAFA 1GQQA 1S7CA 3GH3A 1HXHA 4B79A 1P33A 1ZNQO 2ET6A 3NDIA 4IINA 1I33A 1JU9A 4XQGA 1FXSA 1DEHA 1MX3A 4QO7A 1GDHA 1GYRA 3WGTA 3OJLA 4CQMD 1R4NA 1F0YA 1JW9B 3PP8A 1ZMTA 2BELA 1HYHA 3BIOA 2EKQA 3LK7A 1V0JA 2Y1EA 3QVOA 4CL3A 4OAQA 2W98A 1SOWA 2YHIB 4NR0A 3INGA 1PJCA 1EMDA 1NQAO 4OQYA 1P1RA 3QVSA 2RH8A 3CINA 4J7UA 1DHRA 2X7HA 3ZWBA 4IXWA 3BTVA 1RYEA 3GUCA 3JYQA 1JKIA 2HRBA 4YJGA 2I65A 2EIHA 3O8QB 4A10A 2JD2A 2O2YA 3JQ6A 4NBTA 4UUMA 5T57A 1WZEA 3SLGA 3AFNA 1JVSA 4JIGA 2D3TA 3U9LA 1BGVA 1I2CA 1HDGO 4WCFA 2VQ3A 4NJMA 1PJTA 4MVJA 3GOHA 3C24A 1XGKA 3K6JA 4BGEA 2CF6A 1BDMA 3A14A 4Z9FA 2A94A 4BNLA 4FD3A 2BI7A 4MKZA 2Y0CA 2O4CA 1WAMA 1DIHA 2O23A 2X6TA 2AA3A 1VPDA 1IOLA 4P4LA 1JDJA 3I5MA 4DLLA 1LSOA 2GZ2A 4CLOA 4PLZA 1SOVA 4LSWA 4Q3DA 2IEBA 4UVIA 1NR7A 5JXWA 4TSKA 4D3DA 3PI7A 5BNFA 3F4BA 4DWVA 3RROA 3VPFA 3PHLA 3W1VA 3NTRA 4D79A 1R0SA 4BNUA 5GY7A 3ZH2A 5B1YA 3LF2A 4B4VA 1V3VA 3L9WA 5H81A 1PS9A 3F9IA 4OM8A 1UJMA 4JXKA 2OORA 5J23A 4ZQFA 1Q7CA 1EVJA 5JC8A 3EVNA 4XGKA 1G6KA 1YL5A 3ITDA 1TT5A 4XIYA 5A5FA 1H94A 3GZ4A 2IZZA 4J4HA 3Q2KA 1FDTA 1I3MA 2X5OA 2VHZA 4R5MA 5IZ4A 3ZHZA 3PQFA 3U09A 4FB5A 3ZWYA 5L45A 1GD1O 3DFZA 2WSBA 4YTEA 1TT7A 3L4BA 1AXGA 4GLLA 4WLEA 4NPCA 9LDTA 3KBOA 2ZB4A 2GLXA 3RJ9A 2AEJA 3JQ7A 2HLPA 4HBGA 2E82A 5KVCA 4GL4A 3VZSA 4GPD1 4WCDA 4E2YA 3DHEA 3DOOA 1ZKMA 2NWQA 2AXQA 5EN4A 2JJYA 1LDNA 1IB6A 4I9UA 5EMHA 1NQ5A 1V6AA 4DC1A 4JBGA 4JJFA 3RKUA 3JD1A 1PGQA 1QV6A 3BHIA 1V3TA 3BMOA 3GNSA 4Z9YA 2FSSA 2PH5A 3H3FA 3H9JA 4LISA 3LT0A 4BNMA 1GQ2A 3ZWMA 5ER6A 2Y05A 3KM0A 2Y68A 2Z1NA 5JNLA 1X0XA 2A35A 2GNAA 3PJFA 4RV9A 4BKOA 1T1SA 2P2SA 1NAIA 5KVSA 5FEUA 3GMSA 3K2EA 4CJXA 3C1TA 3NRCA 2CUKA 2V6GA 3OF2A 2Y67A 3HB5X 2I76A 4BIIA 4CQLB 2EERA 4P4NA 3ZU2A 4N54A 4O59O 2Q3EA 3R1IA 1GZ6A 2J3KA 3BMQB 3CEAA 2G1UA 3JQBA 4MVJE 1DRWA 5TRTA 2X9VA 4Q3NA 3GHHA 3KYBA 1R0LA 3WLFA 1C1XB 1LLUA 3EMKA 3PWZA 4D43A 1UUFA 1H9AA 1BXKA 2CVQA 3EY4A 1I0ZA 3IDSA 3U4CA 3GNTA 5I8ZA 3EAGA 5F1PA 3RUFA 2H5LA 3UF0A 4GSKA 1LQUA 5F3RA 4M54A 4BNIA 2VNSA 3FRJA 4GKVA 1M75A 3OBBA 2VHXA 4GX2A 1U28A 3ZZNA 5JYDA 2C5EA 4FPXA 3C1AA 4D0SA 1NVTA 2FWMX 1U3WA 3OM9A 4IIVA 3WWYA 4NMHA 4BNGA 4FBGA 4MP3A 4W6ZA 2R2GA 3KEOA 3W8EA 2CNBA 4A03A 2RHRA 4CQMB 1NXQA 4CLRA 1U5AA 3CUKA 4MO2A 4KP7A 3AY6A 2PGDA 1ENZA 1LBEA 4NFSA 3U4DA 1SB8A 4NNJA 4QSMA 4E33A 1GZ3A 4R1SA 1FDVA 1M2WA 3ZWWA 4XD2A 1O6ZA 3ADOA 1LRJA 3O9ZA 4LSMA 1E7RA 2O3SA 3JQDA 3WMWA 4JBHA 1VJ0A 2EF1A 3ICCA 4UUPA 4XGIA 4PG6A 4WGGA 1GU7A 4I5EA 3PIIA 1ADBA 4XB1A 5KIAA 1SAYA 1YB1A 5THQA 3GFGA 1C14A 1L7EA 4EJMA 4ALKA 2XPCA 3E82A 3TDKA 4A5OA 3ZWCA 1T2DA 3PHIA 4RLSA 3GAFA 3FHLA 2R6JA 4QEDA 4TRMA 3U49A 3I9MA 3ZU5A 4OL9A 5F5NA 2P9CA 4K9DA 4EITA 2Y0DA 4CM4B 4DYDA 5I7FA 1B26A 1OAAA 3JQGB 4YB8A 3DZKA 1NASA 3KVOA 4JCOA 2JD1A 3WGQA 4B3IA 3W4JA 1W8DA 2RIRA 4O1MA 1UXIA 4UAGA 3W4IA 2ZATA 4LCEA 1C0LA 3S2IA 1PJLA 1LDEA 1MG0A 4J1SA 4GI2A 3EGOA 3K30A 4O0LA 4XQ9A 3ZHXA 3JQFC 5ITWA 3RASA 4XYMA 1OI7A 2J5RA 5EESA 3H9EO 4ZA2A 1E3SA 1XEAA 4IS3A 5KKAA 1DC4A 2DAPA 4AFNA 1DSSG 2HCTA 5CP8A 3PDUA 1U7TA 4W9NA 4BB5A 1V9LA 1E92A 2C0CA 5KJ6A 5KOIA 4B7UA 1BWSA 4CM6A 4PLFA 1W6UA 1XU7A 1PGOA 1YGYA 3ZNPA 4AJPA 4IDDA 5F1OA 1YB4A 1DIGA 3JQAB 1X7HA 4RDIA 2ZTLA 4GWGA 4B8ZA 1E6EA 4J49A 3WQQA 2LDXA 3G1TA 3E9NA 4NBRA 2PD6A 1ONOA 2NM0A 4ZQHA 1GEEA 1Q2XA 3JYPA 1Z82A 2B36A 2VTDA 2JCVA 3DEYX 1GADO 3F1LA 3U3XA 5I9LA 2TMGA 1HZZA 1WWKA 7ADHA 3PHJA 4KQXA 1QRRA 1XA0A 1P1IA 2UDPA 2DFVA 5HWSA 2P9GA 1LLCA 1R37A 4GX1A 4PLWA 5KJFA 4R3NA 1CEQA 1IYZA 4O5OA 5HM8A 2PK3A 1DB3A 3DR3A 3GN1A 4RVGA 2NADA 3ZWVA 8ADHA 5IDYA 3WBBA 4EDFA 4MKXA 1E77A 3W6UA 4RGBA 4XRGA 5DNAA 1MV8A 2XOXA 1I5RA 4RVUA 2DKNA 2DM6A 3LU1A 4OYRA 5CAEA 2H6EA 4CLEA 4H3VA 3ROQA 1KVSA 5JC1A 1GCUA 4DMLA 4PVCA 2OGUA 5DCUA 4E21A 2UYYA 4MPDA 3O26A 1UAYA 2B4QA 1FDUA 2DTEA 3GDFA 4HNHA 3H9UA 4WEOA 4EGFA 1IPEA 4Y67A 4NJOA 4FFMA 3ORFA 4IDFA 3IUPA 3IP3A 1R4MB 1IZ9A 1PZHA 3C7DB 4M89A 5I7EA 1GV0A 4G81A 3ZWOA 1JA9A 1PJQA 4GGPA 3AUAA 2XXJA 3E1KA 1E1NA 4TWRA 3INTA 1X15A 3GVXA 3R0IA 3H5RA 4J7XA 2V65A 4OIMA 4BNZA 3I9LA 3RCBA 1H5QA 4UREA 1LTHR 3W8DA 2BFPA 4E5NA 2AEFA 1UXHA 1GYQA 4RPJA 1KYQA 2VZ9A 1NP3A 3ETDA 1H6CA 3H65A 3E6AA 4BQRA 5A9SB 5L4LA 1Z6ZA 5U9CA 3UFXA 3LT4A 1C0PA 2X5KO 5TJHA 2Y1CA 4MOWA 3ZV3A 1HE5A 1BHSA 4WPGA 5KKCA 4JX8A 4XA8A 4BKPA 2YHIA 1GZ4A 5ITVA 4BKRA 3B1KA 1LDBA 1RPNA 1K6IA 4IDCA 2Y1OA 3O4RA 4GX0A 1I30A 1HDCA 2W2LD 1YWGO 3ZI0A 3RAJA 4X54A 1LA2A 1H9BA 5IJZA 3IQDB 4LCJA 1GR0A 1PL7A 3V2UA 3JYLA 3O8QA 3TRIA 3KSDO 1RJWA 1P0FA 1T26A 4F6LA 3FCOA 3GC6A 3LC2O 2AE1A 4PZCA 2I9PA 1AHIA 1GL3A 5IZCC 3PXXA 1E7WA 3WGOA 3A28A 5IXSA 3FI9A 4WK6A 4CUJA 3WR5A 2NTJA 4L4SA 3K96A 4RPLA 2QRKA 4FDAA 4E31A 2VRCA 4GBJA 4IQGA 3L6EA 2PZMA 4AJ1A 4YBZA 4BVAA 2H63A 1RWBA 2V6MA 2QZ9A 1KEWA 1PGNA 4R9RA 1XKQA 1NPTO 4B4UA 4QFCA 1P45A 3HUDA 3N58A 4DREA 2JFHA 2IXAA 2DQ4A 5AXCA 3CE6A 1F12A 4DPLA 2J3JA 4ZICA 5JAQA 1B0AA 1VKNA 3ZGYA 4NK4A 1Q7BA 1OOEA 1R15A 3ONFA 3EDMA 4CM7A 2VWHA 4J6FA 2EW2A 2HJSA 4MVJH 4EEZA 2QRLA 3I4CA 3TL2A 2GGSA 5DDIP 4JNKA 3UGKA 4D42A 2ZYGA 4HADA 2GF2A 4URFA 3F46A 3QE3A 5CDGA 4WEQA 3UAGA 1PGJA 2Q1UA 2DVMA 1P74A 2VHYA 3DMTC 1D8AA 2NQ8A 1RM5A 2A92A 3H4VA 3EZLA 1A72A 1DO8A 1C1DB 2UUOA 2UUPA 3G1UA 1Y8QB 5CPFA 4AJEA 4M1QA 5TNXA 3GEDA 3Q3CA 1OZAA 3VH2A 2HQ1A 4I5DA 2VN8A 1O89A 1VL6A 1DC6A 5EQDA 3E8XA 2CDBA 1EZ4A 3CMMA 4CM1A 5JE8A 1UDBA 3OJFA 5JSFA 4CM8B 4IDAA 1XYGA 3NAQA 5I7VA 4BMVA 4GLOA 1E7SA 1IE3A 4MIEA 2C59A 4ZN6A 3MJ4A 3S2FA 3WBFA 1TLTA 3I3OA 4BGVA 5COBA 1UZNA 2IZ1A 4Z0HO 3H5AA 3CXRA 1AUPA 4PLVA 5FYDA 2PY6A 4D3FA 5KNLA 2I3GA 4D7AA 2EGHA 4P22A 4AVYA 4MP8A 3DWFA 3BTSA 5A9RA 2NVUB 5B37A 3QWHA 2HUNA 2IRWA 5CDUA 2NNLD 3JQCA 2JCXA 2D2IA 2GASA 5A05A 1XHLA 2TMDA 3AM3A 3P2YA 2IZ0A 1FMCA 2VUSA 2BRUA 1NPDA 3H2ZA 1GTMA 1CRWG 4MJLA 3HZZA 4YRDA 4IJWA 4GX5A 1DAPA 4J1TA 4CMJA 4CQLA 3QP9A 1OMOA 4IDBA 3VTFA 3AK4A 5IF3A 3BMQA 3ZU4A 5A3JA 4RVFA 4RVSA 5K6AC 1YS4A 3SVTA 5CEEA 3K5PA 5TS3A 1C1XA 2E4AA 4XR9A 3LQFA 3R6DA 5G2OA 3OICA 4KOAA 4YQYA 5G0SA 5TT1A 4WASA 1YBAA 5DT9A 1QLHA 2J6IA 4MKRA 4D45A 4XYGA 4XZ3A 3OEWA 2HK9A 1E1KA 5JY6A 3KEQA 1YOVB 2P68A 3D5QA 2W2KB 1KETA 1T2EA 2W90A 4AJHA 3I52A 2NUAA 1HT0A 2BHLA 3DTTA 1YB5A 1JTVA 1ENPA 5TX7A 1Q0QA 4PVDA 5T5QA 3QA9A 6LDHA 3QIVA 5L3ZA 1QR6A 2B83A 5TGDA 1DXYA 1YL6A 3VPGA 5CEFA 4ZD6A 4CQMA 4BO9A 3NEPX 4NDNE 2AQIA 2RBEA 2VWQA 3H8VA 4MIYA 4G65A 1ZK2A 2PKQP 3DOCA 5JAZA 1BW9B 5JCXA 4Y6PA 4RORA 4J90A 4UUNA 3RU9A 1PQWA 3GHYA 3MEQA 5I7SA 4IY1A 4ALJA 4E5MA 1XIVA 4CUKA 3Q11A 1Y9EA 1V3UA 1N8KA 1ZJZA 3BMNB 3TZQA 1J4AA 4BNNA 1DIBA 5ER9A 2XAAA 5COQA 4DLBA 1H6DA 1SC6A 3GN2A 3OIFA 1LSJA 3GGOA 3TZHA 3VPXA 4D46A 5IDWA 5C3MA 4JP3A 4KMSA 4FJ0A 4TVBA 4FC7A 4JP2A 5B4VA 4ND5A 5DP1A 3IP1A 1KEPA 3JTMA 3V1YA 1NQTA 4MVJI 2J5QA 1HSZA 3GA0A 4CM4A 3P19A 2JAHA 6ADHA 1QSGA 3JQGA 9LDBA 3QJ5A 1JAXA 2X9GA 5A9TA 2J3HA 3UKOA 1WMBA 4YACA 4ROSA 1JLLA 2HSDA 2EP5A 1QXSA 4OGWA 2BGLA 4BOYA 3EK2A 1WVGA 1GPJA 5L95A 5EQFA 4AJLA 2BFMA 3R3SA 2P4QA 5IN5A 1P0CA 3QLJA 4PRKA 3AI1A 3PYLA 1EUCA 4DTIA 1YQXA 3DC2A 2D8AA 1ZW1A 2VCYA 1JAYA 4QUKA 4RDHA 3VKVA 3RBXA 4R9SA 2PZLA 3DONA 3LT2A 4IXTA 4ESOA 3Q9UA 3ASUA 4CMEC 1ZEMA 5KTKA 5LCXA 4FIZA 3SC6A 4K6CA 2GZ3A 4UEOA 3F1KA 3HDJA 5G0VA 1LSUA 3DMYA 4ZRMA 4FGSA 4ZQEA 5K9ZA 2DUWA 1HLPA 4YXFA 1KVUA 1I8TA 5JDCA 3FNGA 1HKUA 3I1JA 2VUTA 2J3IA 1X7GA 1FK8A 4JROA 1HE2A 3JQAA 2FRDA 4KUHA 2FR1A 4DIBA 2B69A 1OC4A 4FR5A 4PG8A 3MWDB 4EI2A 3DMTA 1XWFA 1YL7A 2FSVA 1A7KA 4RF2A 1PGPA 2FR8A 4WOKA 2AQ8A 1GAEO 2R00C 4QQRA 1YKFA 5CG1A 1WLYA 1Y7TA 2CVZA 1T1RA 3IOYA 2I99A 3LVFO 4RPGA 4INAA 2O7SA 1CF2O 3NJ8A 4R5HA 2Z5LA 2YFHA 1ZSYA 4E5PA 1J5PA 1GYPA 4NBWA 4EJ0A 5JCJA 2FPGA 4HY3A 1N1GA 1LJ8A 1KY5A 4NQZA 1PL6A 5LDHA 2C7VA 4LGVA 3MOIA 2BD0A 4L76A 4AL4A 4U7WA 4RZIA 1I01A 2FPIA 3NTOA 4MDHA 4PG7A 2QX7A 1E3JA 3PVZA 4B3JA 3OH8A 1H0KA 2Y1FA 8LDHA 4CMCA 1K2WA 1E3LA 5F5LA 1V8BA 4YDRA 1T25A 1WP4A 4R1UA 2O2SA 3K9QO 1KVTA 3ANMA 3HHPA 2C2YA 1Y6JA 4OQZA 4WE3A 4XDYA 1IHXA 4GVXA 2EV9A 3DBRB 5A4DA 3IKVA 4OOEA 1R4MA 4QT0A 4R1TA 1XU9A 1WXDA 4EUFA 3D3WB 4CL8A 3WTBA 3ZU3A 3RC9A 1O5IA 3GF4A 4CMIB 3NX4A 1VKOA 3OA0A 3S1LA 2X9NA 3I9OA 2ZCVA 1HTBA 3FF4A 3V8BA 4U0JA 5T8KC 4YYZA 4BO1A 2W8ZA 2PKQO 5A9SA 2Z95A 4D3SA 3NTQA 1QORA 3C1OA 1YQDA 1E3IA 3GG2A 1ISJA 1ONPA 5A1TA 3LC7O 1KC1A 1N7GA 3QRWA 2C82A 2Y99A 5A02A 4F6CA 2JCYA 1FF9A 3FD8A 4PCVA 4Q3CA 1U1IA 4F46A 1Y8RB 1MA0A 1Y9AA 4BNTA 3NUGA 3RC2A 1JKJA 4D0RA 2OUIA 4CM9A 2DC1A 4PZDA 2PA3A 4XQEA 4ITUA 3WSVA 1YVEI 1CDOA 3GZNB 4WLUA 3KZVA 5LDGA 3GQVA 1HDXA 1QYCA 4PG5A 1O8CA 1P3DA 1NVMB 3D4NA 2ZB3A 1DJQA 1NHGA 1DAOA 4L4XA 3HFSA 3KOUA 1E7YA 1A27A 1CYDA 1BG6A 5BR7A 4XX0A 4B3HA 4FFOA 1ZO8A 2EWMA 4GMGA 4U8GA 4WUVA 1YJQA 2H9IA 1DOHA 4EUHA 4IQ0A 3ST7A 3WLEA 3PLRA 3ROKA 1YBVA 3VDQA 4YT5A 3NT5A 1ISFA 3MWEB 2NVBA 2O50A 5B4UA 3D4OA 3F5QA 2HKIA 2ZTVA 3RJ5A 2E37A 3VVBA 2G82A 5GZ6A 4J1QA 3ZNOA 4KUGA 3IJPA 4TRJA 4M87A 4ONEA 5F1KA 4OJNA 3SJUA 3WFIA 3BYZA 3CIFA 5JY1A 3RKRA 2DTXA 1XQ1A 3ZW8A 4F3YA 3VHRA 1PWXA 2D1YA 2I67A 3GUYA 2Q4BA 2AQKA 2HJRA 3DL2A 3QQPA 2C5AA 3OECA 2VRBA 4NZ9A 1P1JA 3LLSA 2VT3A 1X1TA 2C2XA 1W0CA 3PJDA 3DZBA 3VPSA 2EXXA 2H1SA 3L77A 2GN4A 2F1KA 5L4NA 3AI3A 3B70A 3HNPA 2YDYA 3CH6A 3GAZA 1ZSVA 2NLOA 3BTOA 1BXZA 2ZQYA 1KC3A 1PQUA 1TA4A 4LVUA 2DLDA 2WMDA 3LF1A 4MP6A 2QW8A 1C1DA 4A0SA 1KIFA 1VC2A 1Y8QA 2YHUA 3TFQA 5U4QA 3UVEA 3GFBA 3LZ6A 1BRMA 1N92A 1P1FA 3AOEC 1WZIA 5AXAA 2JHGA 3UH1A 4YJFB 1SEPA 4XKJA 4PIVA 4RQTA 1ARZA 4UVDA 4CLDA 4R51A 2YV3A 3VOSA 4CM8A 1ZXLA 3DZIA 4B4WA 2C7GA 2O3TA 4CMGA 3VDRA 1SCUA 3KXDA 3PYXA 2P4HX 4LRTB 5G0WA 3LDHA 4OH1A 2AQHA 4Y8VA 3FSRA 1LQTA 2UVDA 3M2TA 1LRLA 4HKTA 4IPTA 4XGNA 3GG9A 1PIWA 1ULUA 1KOLA 5GZ1A 3ENKA 3GT0A 2EKPA 2ZTMA 3ZV6A 1SPXA 2Y1DA 4AJJA 2JL1A 5EPOA 3JQ8B 4NIMA 4Q9NA 2Q49A 2F00A 2J8ZA 2NVUA 4QECA 1PSDA 4IM7A 3ZWXA 1NWHA 3ETGA 4ZHSA 3TF5A 2OMEA 3RBZA 2GSDA 4NFYA 3T4EA 4PG4A 3VH4A 3TOXA 3BAZA 3QSGA 3WICA 1EFKA 2Q2QA 1RM0A 4W4TA 4IUYA 3FNFA 3RC7A 3RFTA 3GRPA 1B8VA 3O03A 3ONDA 4YAJA 1YONA 4D44A 1B3BA 2VYVA 3KUXA 3I9NA 4JJGA 1UXJA 1YH3A 3ZV4A 3H6KA 4OKIA 1VJ1A 5L9AA 1Z7EA 3VZRA 1X13A 2Q45A 4LK3A 3W4KA 4DQXA 4E30A 1G0OA 4BL5A 5C5IA 2B4RO 5JFOA 3QWIA 1UZLA 1ZVMA 4HX5A 3MOGA 1VRWA 4TRRA 4UULA 3ZHYA 4CV0A 1ZK3A 2GERA 2NTVA 2YZ7A 3COSA 2HMVA 3MJVA 5BSFA 4J1NA 4ALIA 4FS3A 1E5QA 3KYDB 5THKA 3GNQA 3DHNA 1YOVA 1D7OA 1H2HA 5GZ3A 1F8FA 2X0JA 2VZ8A 1ZZEA 2W2KA 3AY3A 4BO3A 4YAKA 1NFRA 2AEMA 3I9JA 3AY7A 3JYOA 3KLPX 1VI2A 3LT1A 1DC3A 1U8FO 1OFGA 3UW3A 4J4BA 4IGFA 1VM6A 1A4UA 2NU9A 3HWRA 3PWSA 3GEGA 1HL3A 3TSCA 3OEYA 1M6WA 1IL0A 1ZK1A 2VTEA 3TPCA 4FSHA 1EDOA 1BW9A 4FCCA 3LLVA 1O9BA 3E03A 1HYEA 5HRUA 4PRLA 3ROPA 2EEZA 5JLAA 3KYCB 4EJ6A 1CWUA 4NI5A 4OXYA 1DDOA 3AM5A 1LDGA 1I32A 1NM5A 1N9GB 3HG7A 2VHVA 4ID9A 2E49A 4OHUA 2EKLA 2P9EA 3BMNA 3MJTA 4FJ2A 3U62A 2EJWA 1TB4A 2X0NA 5BSEA 1ZIDA 1UXGA 5AXDA 1EDZA 2DBVO 4N5NA 3D5TA 1ISHA 2VWGA 3OQBA 4Y6SA 4E4YA 4DPKA 1UP7A 1KY4A 4B7XA 5DZSA 4W7HA 3V1UA 2X8LA 2QIOA 1TEHA 3ANLA 3PK0A 1GV1A 4GH5A 4I9NA 1UXKA 3TJRA 2DT5A 3T7CA 5AYVA 1QV7A 2LDBA 3OSUA 4RF3A 4E2XA 3JSAA 3INRA 4NG5A 4FGWA 3QWBA 3RFXA 4RQUA 3AFMA 2O7QA 4J9UE 4QFDA 5KJ1A 3PWKA 5KVQA 3GVCA 1Y81A 3PZRA 1DIAA 2SCUA 3E9QA 1E7QA 1VE9A 1O0SA 4DL9A 2HO5A 5FI3A 3AUUA 2AG5A 3PJGA 1E0DA 3VAZA 5IDQA 1F14A 2OP1A 3HSKA 4Z0TA 3VZPA 4R41A 3U5TA 2VYND 3EUWA 2GN6A 3BXXA 4XEHA 3UICA 1LDYA 1UP4A 4GKBA 3WGHA 4B8WA 2Q99A 3TQHA 3HE3A 2GCGA 4ZQGA 2VHWA 2EGGA 5HA5A 4A26A 1B3RA 4BNYA 1CETA 1ULSA 2Z1MA 4R16A 3VZQA 1ZMOA 5L7TA 1QYVA 2O4UX 1HF3A 2PH3A 2QHXA 2VUUA 3L6DA 3PZBA 2OXIA 3FWNA 3ANNA 5ICMA 1U9JA 2OL4A 1Y5RA 2DBQA 3AOEA 1U8XX 2YY7A 3OIDA 1BXGB 3C3XA 1UZMA 3GDOA 1KVQA 1SB9A 4YRAA 3ZNNA 3MJEA 1EVIA 2YYYA 2JKVA 1MG5A 2VT2A 4RL6A 3RC1A 3CKYA 4KTTE 3D0OA 2OP0A 1KEUA 1A4IA 4XRRA 2CVOA 2Q46A 5A04A 3BHJA 5JO9A 4CUZA 4IJKA 3Q6IA 4GQAA 1NBOA 1P44A 3HFGA 4BNJA 4DPMA 5FF9A 1MFZA 1I36A 5KVVA 2JAPA 1P1HA 4DQVA 1C3VA 1T2CA 4BKQA 1GY8A 2POQX 3CTMA 4YR9A 3E5MA 1TXGA 3VVCA 3PHHA 3JQFA 4FOOA 4PLHA 5DBFA 3OMLA 3DBRA 2OO5A 5I8WA 4AICA 5C7IO 5T67A 1JVBA 4YT4A 4DYVA 4YJDA 3D3WA 4WECA 4YT8A 1Q0LA 2CF5A 4CMIA 2WYVA 1KVRA 1QYXA 3FTNA 4K6FA 1DFGA 1AE1A 5TIIA 1LXCA 1ZEJA 4DMMA 3SEFA 4XYLA 4EEXA 4BO6A 4JN6B 1I2ZA 5TSDA 1IZ0A 1PZGA 4NK5A 5IDXA 1NQOA 2NV6A 4WCFC 4YPOA 3ETEA 3PRJA 4E3ZA 3K73O 3F6YA 1Z74A 4TKMA 3NGXA 4M55A 4L8VA 1OC2A 2YJZA 1ZJYA 3M6IA 4RVHA 4MIOA 5K0ZA 1B15A 5KJCA 1CJCA 2ZJ0A 2VRCD 2HMTA 4I8XA 5KWEA 3WGZA 5IAAA 2DPHA 1LLDA 2PZKA 3S2GA 4HNGA 1Y8RA 4K28A 2HMSA 2EHDA 2GZ1A 1MC5A 3ZHBA 5L4SA 1EBFA 4EUEA 4J0EA 1XLTA 2IEDA 3CZMA 4GVLA 4OSPA 1NR1A 3MZ0A 3GZNA 4ZVVA 3K31A 4R3WA 3UOGA 4CV2A 1K3TA 1MB4A 5G4KB 3RUEA 1T4DA 3ASVA 3HDYA 3WDSA 4U5QA 5F21A 2FHSA 2P5UA 3F4LA 4YCAA 2ZCUA 2GRAA 2GPTA 4QO8A 4DVJA 1J6UA 5CDYA 2NU7A 1E7MA 5DCWA 5JMPA 2OFPA 1PJ3A 1AGNA 2O3JA 2IYPA 1MFPA 4MVJP 2CY0A 4IDGA 3TZ6A 3GVHA 4BNKA 2PD4A 5CDSA 3L07A 3C85A 2I66A 5EJ2A 2WD8A 3FNHA 4TQGA 1D4FA 4YAGA 1UAGA 1DPGA 4AJ4A 2AW5A 2B37A 4TKLA 5MDHA 3LSYA 1QYWA 3WYEA 1ENYA 2FR0A 2BFAA 3O38A 4LW8A 3CSDA 2IE0A 4FFLA 3GLQA 2WDZA 1BSVA 4HXYA 1SEVA 4P38A 1QP8A 1QMGA 4Y9DA 2Y1GA 3G0OA 3I4FA 4PFJA 1J49A 3H9GA 4RF5A 1PJBA 2Q1TA 3WIEA 1I2BA 2QG4A 4IIUA 4YJHB 5C7OO 3GGPA 3SC4A 1VJTA 5TT0A 5A03A 5BSGA 1ML3A 1ENOA 1E3WB 3B1JA 1YBMA 2C20A 2X5JO 4WLVA 3WNQA 3B6ZA 3JD4A 1ID1A 2GR9A 3DAFA 3HN2A 4YRBA 2GUGA 1U3TA 1CQIA 1PS0A 5DP2A 1A7AA 1I3KA 3RU7A 4BB6A 4OSOA 5HBRA 3WFJA 2B5VA 2Q1WA 5A3VA 3S55A 1UDCA 3ENNA 3IC5A 4YJFA 4TROA 3WX0A 1PJ4A 3MJCA 4QXMA 4ALLA 3NJ4A 1YJ8A 4PLGA 2NU8A 3RUHA 5JYEA 4IMPA 1YQGA 3IMFA 4OKNA 2NSDA 2VOJA 1ZK0A 2WWRA 5IZCA 3GRKA 3V2HA 1Z7BA 3PQEA 3A1NA 5JAMA 1ZH8A 1JQBA 4L0QA 5ILGA 4E12A 3M2PA 3PEFA 4J16A 1EFLA 3WWZA 3RFVA 2P91A 5IN4A 4BO8A 5L51A 2X86A 1DRUA 3C8MA 3QHAA 3CMCO 5CHEA 3VC7A 3TOZA 3OIGA 3R3JA 1YDWA 5CDTA 3KTDA 3KSUA 3JQ8A 4N7RA 4RPKA 5L7YA 4A7PA 4HFJA 2C07A 3P5SA 2W4QA 2V6FA 5COAA 1X14A 3AUTA 3RUIA 2CFCA 2B5WA 4GSLA 4I9HA 3BMCB 2Q4EA 5H83A 4WLOA 3RI3A 3OQ1A 5JMWA 1DFIA 2ZK7A 3RIHA 4ND1A 2D0IA 3D7LA 1ZSNA 4Z3DA 5HTOA 1YRLA 2GD1O 3DBLB 4WJZA 1BTOA 2FZWA 3AJRA 4CPDA 4EW6A 1LC3A 2PTGA 4GAEA 4RJTA 4XYEA 2GN9A 3PFFA 2ZYAA 3G49A 4ILKA 3AU9A 4IDEA 4YAIA 3ZWNA 3PPIA 5DBGA 4CLHA 3RBVA 2PD3A 4WLFA 5JW6A 4M8SA 3CPSA 4A27A 4I5FA 1R6DA 1N7HA 3KYDA 1DLJA 2DTDA 1Q7GA 4RO0A 3L0DA 3GY0A 1WDKA 1EBUA 3UN1A 4IS2A 5HS6A 2X0IA 1NWCA 1GFSA 3H2SA 1BVRA 4FW8A 4CV3A 1LUAA 2BLLA 3ON5A 4FFNA 3DQPA 2UAGA 2BI8A 3DZJA 2FP4A 2P5YA 2PGJA 1FDSA 3I6QA 1P77A 4LMRA 5JAIA 1ZFNA 5KJEA 2PNFA 3NT2A 2O3RA 1U4SA 1O95A 3U4IA 4LN1A 4F45A 2VOEA 3DBVO 3FR8A 5EERA 2PGLA 3I6IA 4JJIA 4XYBA 2O3UA 4YQZA 2NQTA 4EBFA 2EG9A 1WW8A 4BHTA 1P31A 3KYCA 1JWBB 1GEGA 1PZEA 4ZJUA 4JBIA 3TN7A 1N9GA 4E5KA 4NH4A 3DZHA 1UP6A 1XQ6A 1X0VA 3AW9A 3SXPA 3DDNA 5FFFA 4EYEA 4H15A 4ND4A 3PJEA 4R01A 4CMKA 1PR9A 4KWHA 3DZFA 3IAHA 2C29D 3WMXA 4W9NC 1B16A 2YW9A 4HUJA 4BV8A 4C7KA 1E1MA 1T2FA 1XG5A 2BGMA 3UHAA 4DBVO 4N18A 1BMDA 1GCOA 2WEKA 1UH5A 3BA1A 1RYDA 2Y93A 1HE4A 3Q9NA 4S3MA 3OETA 4NU5A 3LC1O 3GVPA 3JD0A 1EK6A 4UUOA 3PLNA 1T4BA 2X22A 3X2EA 5K6AA 4S1VA 1UDAA 3JQAD 5JS6A 1NVGA 3I9KA 3AWDA 1B7GO 1WPQA 4BO0A 5A5EA 1LDMA 1XDWA 4FJ1A 2G0TA 4MVJD 1HDYA 5L7WA 1I10A 5DN9A 1RM3A 5B12A 3E5RA 3RD5A 4N5LA 1QKIA 4D41A 1SMKA 5C7LO 2FY8A 2EP7A 4BO5A 2E48A 2QYTA 2X0RA 2XF8A 4UVGA 4CV1A 2WM3A 1B8UA 3WQRA 1QLJA 3RSHA 2HMUA 1PU2A 4BNFA 2ZTUA 4XR4A 1PWZA 4L75A 1EK5A 4RCVA 2VZ0A 1EEHA 2ILTA 2X23A 3JD3A 1PZFA 3KETA 5DOZA 1YXMA 1ISGA 1U3VA 4UEKA 4CMAA 3AOGA 5JCJD 2CD9A 3LYLA 2UV8A 1RM4A 4IJUA 5G4LA 4M86A 2WD7B 3BTUA 3L6OO 2PLAA 2IYOA 3TL3A 3OHSX 1A9YA 2G5CA 2ZB7A 3WJAA 4WOJA 3OJEA 4LVCA 5G0TA 1ZXBA 5JO0A 3KHUA 3WOHA 5DULA 4KWIA 1LEHA 4RPHA 3C7AA 4IZHA 2EJVA 3FPLA 1JWAB 4HP8A 1LU9A 3HN7A 1FJHA 3NT4A 5DBIA 2AE2A 2RHCA 2Q50A 4J2HA 2J5KA 4CM3A 2BFOA 5ENVA 1BXGA 4PLTA 1MP0A 5I9NA 5I9MA 1VSUA 3ICPA 3IUSA 3U0BA 2FN7A 4JGBA 4HFMA 4MVJF 1LI4A 3IS3A 3B1FA 4Z3KA 3WGGA 3DB2A 1DLIA 2YV1A 4FFRA 1NFFA 1MGOA 4YVFA 2D4AA 3EYWA 3TWOA 3ABIA 1A5ZA 1RKXA 1I3LA 4CLXA 5FI5A 1NHWA 5BT9A 2DFDA 3DAPA 1E3EA 3PIDA 4GGOA 3RUDA 3PDJA 2DU8A 4QX6A 4TRNA 1DC5A 5G0UA 3SJ7A 3D1LA 3HB4X 1MC4A 3TZKA 3WG9A 3N7UA 1R66A 1GQYA 3D64A 2OBNA 4B7CA 3SLKA 1WNTA 1HETA 3GPDG 5AOVA 2ZKLA 1H6BA 4XJSA 4IQ8A 5A06A 3ZWAA 2BGKA 1Q0HA 4XJTA 1GUYA 4CMEA 3WYBA 4E13A 1ISMA 1ONNA 2D59A 2IDZA 4R69A 4CM9D 3DHYA 1ORRA 1S6YA 2FOIA 3ZDFA 4DGSA 4Z0PA 3JQEA 3OFSA 1ISIA 2OZPA 3DBHB 4UEJA 4U6SA 4W82A 5EIOA 2YV2A 5JPIA 3VKUA 4IGEA 4HFNA 3PQDA 1DRVA 1CERA 1NAHA 4RLHA 2A4KA 2R00A 3H7AA 5H82A 4AJ2A 1IY8A 2Q2WA 4Z6KA 3ADPA 1I3NA 1KERA 3A9WA 3ZW9A 1P9LA 2DBRA 1E5LA 1K6XA 4PZEA 2VNAA 1M66A 2E6UX 4B4OA 5MGBA 5CPBA 3G17A 1U4OA 3HDHA 4KDEA 3KLMX 3ZN2A 1EUZA 1AXEA 2B0JA 3S8MA 2HU2A 1CQJA 3NV9A 3G3EA 3ONEA 4DXHA 3Q1LA 3QVXA 4TZTA 4H7PA 4K26A 1TI7A 1N2SA 3RWBA 2BH9A 4DRYA 5ICSA 5BQFA 4P4GA 2Y0EA 2GDZA 5G4KA 3KO8A 4HFRA 3UCEA 3DZGA 1WDLA 1GUZA 3D4PA 1R4NB 4I08A 2VWPA 3JD2A 1YDEA 3X2FA 3WYCA 2Q1SA 3OJ0A 4Q39A 1XR3A 2DBZA 4FN4A 4M49A 4E2ZA 3GGGA 1WDMA 1Y1PA 5T64A 2XXBA 4KDFA 2O48X 1T24A 3DAGA 5TF4A 4E6PA 1YE3A 1LC0A 1R0KA 1U7HA 1XSEA 4LRSB 3VH3A 4AJOA 1IPFA 1EE2A 3FR7A 1EUDA 3P2OA 3VTZA 3WGYA 3DOJA 2JFFA 4J7CA 2X4GA 3M1AA 4YJGB 4MVJG 1ZBQA 1XCBA 1Z45A 4J3FA 4Q3EA 1K89A 4DIOA 1M6HA 1EVYA 4PGFA 5DCYA 4ZQBA 4O63O 2QYSA 2FPPA 4A2CA 4E2WA 2X1HA 4XIJA 1P1KA 3MJSA 1R16A 2CDAA 4A73A 5T8KA 4WCFB 4NJMB 1ADFA 4YJHA 4L73A 3TFOA 3JQ9C 1U2DA 2OOSA 2PKRA 3B20A 4XDZA 2QRJA 1QG6A 3ITKA 4TVOA 4WNCA 1E3WA 1U5CA 1L1FA 2YFQA 3H3JA 5IFLA 3UCXA 4BO7A 4ALMA 4XWYA 3WJ7A 4CLOB 1LNQA 3ZV5A 3V5NA 2C54A 3PFWO 2W2LA 1EQ2A 3EZYA 4G2NA 4JK3A 1Q1NA 1K5HA 4L74A 2VYNA 3GDGA 4R1NA 4U0KA 1MXHA 3Q2IA 5AVOA 4DQUA 4BS9A 3WNVA 4PLCA 4Z9XA 3QW2A 3GR6A 1VSVA 4L9RA 3AI2A 2OHXA 2WE8A 3M1LA 3KV3O 1IUKA 4EZBA 2NTNA 1PJ2A 4FC6A 3EW7A 3WIDA 4LMPA 4OXKA 2ZYDA 3QVTA 1U2GA 1W4ZA 5U1PA 2VYVD 3E48A 1B2LA 2QQ5A 4I1IA 3L9XA 4BV9A 1ZCJA 5KCZA 1TT5B 4II2A 3WGIA 3WTCA 5DF1A 1HDOA 3NYWA 1D1SA 4RZHA 1M67A 2ZIZA 1NX6A 3WSWA 1G0NA 1LLQA 1T2AA 5ILOA 4L4RA 1TVEA 2O3QA 4G5HA 4E0BA 5TLSA 4NHEA 1HE3A 3KB6A 5JDIC 3IL2A 3NDJA 4TZKA 1HRDA 4DUPA 3D3EA 1KEVA 3IIEA 1H6AA 2HDHA 3SX2A 3GVIA 1NNUA 1MUUA 3JQ7B 3H9QA 1HZJA 4BO4A 3BMCA 2B4TO 3OJOA 5EINA 2NACA 2G76A 1L7DA 2YUTA 5IXYA 2BF7A 3KRTA 4UVEA 4BKUA 4ZGWA 1DHTA 1D1TA 3P7MA 2DPGA 4ND2A 4J0FA 3DBLA 1DJNA 4JLWA 5JBIA 4ZU3A 4ZRNA 4CR7A 5FWNA 1J0XO 4NFHA 2I5PO 3BMOB 3HJAA 2FMUA 1U3UA 3FNEA 1E6UA 5T6BA 1GUFA 1KBZA 2AHRA 3JV7A 4W7IA 4WLNA 1IULA 1X1EA 4CODB 4AG3A 1V35A 2YQ4A 3EHEA 2CDCA 3E9MA 1X7DA 1XELA 4C7JA 3QWFA 4H16A 3A06A 2Q2VA 2WTBA 4BNVA 4OOFA 3FBTA 3K8ZA 5CEJA 4BMSA 1JN0A 3HQ4O 5IG2A 2GO1A 3OP4A 2BKAA 4BGIA 1UR5A 4U6QA 2WJPA 5L53A 3OA2A 3HDQA 4C4OA 3S2EA 4FOSA 1NFQA 3I83A 3JYNA 2WYWA 4FFPA 2I6TA 4J9VA 4Q3BA 2AG8A 1PX0A 1K6JA
chains in the Genus database with same CATH superfamily
4ZYYA 2NOAA 3TSZA 5D3KA 1QWSA 2QTBA 5BNTA 4KQWA 3WJ2A 4FE4A 3ZIUA 3JRNA 4BQIA 3VHXA 1P91A 1G3QA 4GYWA 3RE1A 1US8A 5A62A 2QD4A 3BM5A 2DQSA 4AUKA 3Q10A 3GLFB 3SDSA 1WO8A 2B1IA 2PGIA 1VJRA 1LW7A 1PO7A 1X8KA 1CUXA 1EWVA 1QGDA 3DO5A 3L5KA 3MJHA 2G70A 3P0RA 2W6NA 3P9PA 3AM4A 4BUCA 4DLSA 4Z4FA 1DIRA 1L5ZA 3EB9A 3GMDA 1EXDA 3MQ4A 4GNKA 4UVHA 5G41A 4LHXA 4CE6A 1L4BA 4BJ1A 3KFXA 2YXDA 1YS7A 3ITEA 1P4HA 1JJFA 2HW8A 2CZCA 1I6LA 2OB1A 5FOVA 1WRBA 2JBAA 3SHWA 4CLRB 1FLAA 4IV8A 1PS8A 4I4LA 4MWZA 1Q1EA 4L28A 3BJZA 4EG4A 2RI1A 4PFQA 4O6VA 3DXFA 3EFHA 4YWHA 2WG2A 2UZAA 4IH9A 5EE1A 1LSSA 1CS0A 3UXYA 1J0AA 4UDNA 1XEXA 4BNWA 5JAPA 1U9IC 1USIA 1ZUNB 1QH0A 3BHMA 1ZQ1A 3K9WA 3SJZA 1X1CA 4IEIA 1N3IA 2Q0HA 5FPTA 1TO2E 3DXXA 3ZNQA 4KITB 3ZDBA 1U0BB 1PN3A 3V3KA 1MLDA 4W5HA 3ACDA 3Q5DA 1WCV1 3QKSA 4TZ6A 1KSFX 1CY4A 2FMTA 5EMJA 1X94A 1F7VA 5K2OA 3BFJA 2Y0PA 1BVUA 3BPSA 2PMCA 3NALA 4Y6GB 5BVGB 4J91A 5FLXA 3HADA 3PF8A 4P08A 3FDIA 3PHGA 4ARBA 4OUDA 2C9YA 5AQ1A 3PJRA 1T3GA 3HFRA 4WFJA 5B53A 1NIPA 1VYHA 2WNIA 3QVWA 4RVDA 2QLJA 2JD0A 3UB3A 5LJIA 1HYGA 1R8XA 1WJGA 1Y1KE 1GM5A 1SZJG 2V7XA 3L8DA 5LBUA 1E60A 3PR2B 2XQVA 2EWVA 2WD7A 1G8GA 4BMZA 1EQUA 4IRUB 2CFIA 4IZIA 2VJNA 4NCKA 1YR2A 2G4LA 2JHFA 2PSJA 1ZU5A 2F3RA 3FTPA 4HDKA 5LZ8A 2IUUA 1CY0A 4TV8A 4ATNA 3ETHA 4PLYA 1JZTA 2BEWB 4Z4CA 2HPAA 4HG2A 1MH1A 5C37A 4CL2A 4KQ6A 1HSOA 3WS7A 4EH1A 1RYMA 2DRIA 4HTFB 3HCRA 3L4SO 1W4BA 3IOBA 4I50A 3I58A 3SS8A 4D0LB 2CGEA 5FPYA 1K0UA 1N6IA 2IF0A 4YCDA 4OMDA 1TMGE 2QRUA 3BZUA 2A9FA 1Z0IA 2WQZA 3TVTA 3FPCA 2QBYB 1BRTA 4G0YA 3HBNA 3QBDA 3VVLA 1GAJA 1K68A 2X19A 4MB0A 3PS9A 1KWKA 1NZFA 2O0HA 2Q3CA 3BGSA 4GPIB 4FVTA 5EYPB 3WLPA 2HJWA 3ZX4A 5KSZA 5KOJB 3L4BC 2BBTA 2RCYA 3WKDA 2QNRA 4M8IA 4W8OA 3PEEA 3ENWA 5LM3A 2AUNA 1SO8A 2PWBA 4JI1B 4CFYA 3VYRB 4DC0A 1QV9A 3UXMA 2XIQA 2YKGA 3EF3A 1QQAA 4S1OA 1E3QA 3DFUA 4MUNA 2VO1A 2WF5A 4E07A 1N7JA 3OU6A 1JKFA 3BWCA 2A7XA 3P20A 4YRCA 3GPIA 2AUTA 1LV8A 1M1NB 4YAEA 4WZAA 2Q5FA 2ZJ8A 5FTJA 4BMNA 3P9YA 4Q9HA 1P5JA 2JFQA 5M5BA 3W6NA 3CWCA 2YX1A 3ZYCA 4ARUA 5ESDA 3EG5A 4J4TA 1NE2A 1T8SA 3PENA 5KQMA 3MAAC 1NATA 5DTEA 3L0BA 2FLVA 4ZVUA 1NF8A 1FE8A 4GS5A 3OD1A 3DH0A 4BNHA 3UW1A 4IIGA 1ZK4A 2PZJA 3A3OA 4TYMA 2PMWB 3G7SA 4KK3A 5BQ3A 1BFDA 2RSLA 2JVIA 1C8VB 3EEIA 4FYJA 3V4SA 1EESA 1ADGA 3R3XA 4YWJA 3RAEC 3H1AA 2E2WA 4NBVA 3LKBA 4AO6A 2QQGA 1Y5MA 1Z2PX 2HIGA 4BTVA 5JEEA 1RD4A 1FP1D 1T5HX 3EIQA 4JQCA 2JBWA 1CUSA 5ARDA 2HK8A 1YR6A 4PZUA 5KWSA 1V5GA 5E9AA 3HXMA 1YFLA 2L0XA 1OZFA 4RXMA 5CDHA 4N47A 4HH1A 2FAXA 3ORHA 4Q02A 2ZSDA 3CIOA 4QJIA 1IHYA 1G3RA 2IV2X 1DRKA 1R18A 2HPVA 2C5GA 1A9ZA 3EDQA 4OXNA 1U0EA 2ZRLA 2WJGA 3EC7A 3KSZO 4EG0A 1XTRA 3W2EA 1EVKA 4HAUA 5TC4A 4MARA 1SKBA 4MR7B 2B8WA 4RTMA 3CX8A 3GZTB 1RXIA 3PC6A 4ZTUB 1HLDA 1ZL2A 1E6CA 3DT6A 4M37A 1GPDG 1NQUA 3UCFA 4CN8A 2J3DA 2JFGA 2N9UA 5HGXA 3HPRA 1H2AS 5JZSA 2WZDA 2ZJ1A 3ZCXA 3K2BA 2HLNA 2ZI3A 2GF0A 3FSGA 1WMAA 1RRGA 3WK9A 1MXFA 2PIDA 4MRMA 1SG0A 1JH8A 1KS9A 4FB4A 1E9BA 2V5UA 4YT2A 4IZ6A 3K70D 4IJVA 3AFGA 1HQDA 1EVZA 1H93A 4BQEA 4MV5A 4DKXA 3AHEA 3DMRA 3K0CA 4JBYA 4LY0A 5ICEA 1O4WA 4ZI7A 1ZNQO 4REQA 4IINA 4U7JA 4V0NA 4UHHA 5EHNA 4C43A 1AF7A 4FXOA 3UHJA 5JROA 5TEVA 2W48A 4FDTA 1R4NA 4IV0A 2C99A 5TPWB 1HYHA 3BIOA 3LK7A 2Y1EA 4EHFA 1JLSA 4OAQA 2W98A 5FBZA 1JHRA 1RQNA 1SOWA 3CF2A 3QMPA 4O2BA 1VP3A 4Q19A 5MGNA 5C5CA 1QF6A 3NC4A 1P1RA 1VTKA 3TW4A 3IR7A 3ZVNA 4YI5A 2XB6A 1RAGA 2ZGVA 3IUEA 1DHRA 2X7HA 3Q7TA 4K03A 2VAVA 2QY6A 4DG5A 3MT9A 2FEOA 2YRWA 3MQFA 3NP9A 5B58T 1EM8A 4DS3A 5KYYB 1JHAA 1NP6A 2EQBA 3LXUX 4L0DA 3RGWS 3ZIDA 5CCDA 4URXR 4HNSA 1R0CA 2PKWA 4L85A 4X63A 1AB6A 4A10A 2QKYA 4QUIA 4B9AA 4K9PA 4RDXA 1LZLA 4N3BA 2JGJA 5T57A 3BK7A 4AK9A 4WUTA 2GM3A 3EG9B 3SLGA 4G0VA 5AVYA 4JAVC 5LQAA 1I2CA 1YC5A 3H7IA 3I09A 1GLVA 1BMQA 2VQ3A 2R0QC 1QIHA 3C24A 2Q9CA 2HD4A 3A14A 3CSSA 3UV3A 1XKXA 1U98A 1TD1A 3E3NA 3FWPA 5KQPA 2BI7A 2V4UA 1ACJA 2A5JA 1TM5E 2O4CA 2Y0CA 4AX4A 4DIUA 5CCXA 5FPPA 2O23A 2X7JA 2FW8A 4AXXA 2Q3HA 2Z04A 4Y6OA 2O0LA 3EPKA 4PLZA 1SOVA 4Q3DA 3RFUA 1H66A 4UVIA 5TE9A 4PC2A 4TSKA 5FORA 4D3DA 4ME6A 1JG2A 2ZI4A 4ARCA 4QGSA 1YNSA 4G5SA 1K4KA 4V24A 3VR1A 3VPFA 3QF4A 1DG1G 1R0SA 2XLCA 3DVSX 4D79A 1RZVA 1J0CA 5B1YA 5F9FA 2GVNA 1N57A 2PS0A 4NYIR 1SU7A 1VL1A 1V3VA 2AFVA 3EGWA 1NIJA 1ZM3A 4LJ7A 5H81A 4RTQA 2H5EA 2QLFA 4QUJA 4F11A 2B6NA 3EVFA 2IEGA 4FYVA 4F56A 3TMKA 5KAMA 4MGIR 4H0NA 5J23A 3B3QA 3DV2A 4M1YA 1IJFA 4X8HA 4O4HA 5AK5A 2N0SA 2VDJA 4P54A 3M9WA 3E9YA 1XJWA 5CCBA 3HEMA 2O20A 1ESEA 1OY1A 2CDNA 3ZZTA 4K1XA 1CF9A 1WDWB 1GAXA 2V7QA 4XIYA 3WMGA 1F0KA 4BLSA 4UPEA 2IEYA 4INZA 4HQOA 1E2HA 3EXFA 1H94A 3IVAA 3RT1A 1VI6A 3KAKA 3LTEA 3V1NA 1JNYA 3L0IB 2W93A 5G1PA 4NONA 1XZQA 4QGBA 2H9AA 2ZPTX 3L1JA 5FTKA 1DQPA 1T6XA 3OPMA 1IQUA 3BXHA 4N0MA 3PQFA 4NZOA 3U09A 2XA1A 1KFBB 3HI6A 2SICE 3UJ8A 1G7TA 2E6KA 1I3OA 3UBTA 1XL0A 4YTEA 2XYHA 3V7WA 3EJ6A 1AXGA 2Q1XA 1Y7IA 5FHQA 9LDTA 5FTMA 3DAYA 5DN6A 2ZJYA 1LBTA 4MA0A 2J6BA 2ZB4A 1P4AA 2EAUA 2GLXA 5EKTA 3RNLA 1RZRD 2HLPA 3WP0A 3CWQA 2UXBB 4JLOA 2DJ5A 1PE0A 1VB3A 3HYSA 3VKWA 1BGXT 1YQTA 4E2YA 3DOOA 5ULLA 3IPXA 4TTIA 3O1JC 5DX0A 5EN4A 2JIDA 1AURA 4E46A 3ILSA 1LDNA 2JGEA 1IB6A 2H4YA 2Q2OA 1DDGA 1N0VC 1RQRA 1GVHA 2ZULA 2YASA 4JJFA 2PL9A 3CRZA 1SGWA 1II8A 1N2CA 1UK7A 1Z2EA 3NBMA 4JP1A 3RKUA 3U7QB 2HMAA 3W2GA 3QVVA 5CNMA 4Q1FA 4MRSA 1OF1A 5BN5A 5IMSA 4WK0B 4MSUA 1OXSC 3AUXA 2FGJA 1R0YA 2PH5A 2JJ2D 1PJRA 4LISA 4OK5A 4BNMA 1GQ2A 1Y6FA 3LRTA 3NCTA 1UJ6A 1EFPB 2XUZA 2FDCA 2CNNA 5J59A 1NW4A 2A35A 3I2YX 4RV9A 4WNAB 4BKOA 3BF7A 1OH5A 1I4OA 2P2SA 5F9MA 2PKXA 2VF8A 1N6HA 4IUDS 1FFAA 2PT5A 5FEUA 2FXIA 1UFKA 5K3SA 3K2EA 4D82A 3SKYA 5KNDA 1R5NA 2CUKA 4MK4A 2Y67A 3DZCA 3HB5X 4P2BA 2I76A 2OHGA 3AERB 4PSCA 5HPYB 2WD9A 4RLFA 1FPMA 5AI5A 3EPHA 3EZNA 3FCEA 4Q7LA 3HSYA 4M0EA 3AHCA 4O59O 2QTHA 4FWTA 2G1UA 2AN5A 4RS4A 4RY2A 4WXEA 1DRWA 3OWHA 2X9VA 5G1OA 4WH0A 3IUYA 1UKCA 4Q3NA 1O6CA 3AEZA 3KQTA 5HYVA 2DWOA 3L1UA 2W6ZA 4NWIA 2WJ6A 3RIYA 4M7OA 3EY4A 3HVUA 3SCZA 1AOXA 3AGPA 3GNTA 3RUFA 3U4CA 4D9MA 2H5LA 4URWR 3UF0A 3CC8A 4AMGA 5FV7A 5I8PA 4GSKA 4N03A 4M54A 4B45A 4L27A 5EMNA 2L19A 2VHXA 1J0DA 1U28A 3GEPA 1JAHA 1R9NA 3TRKA 5K3OA 1DBQA 3ZZNA 2B20A 3OT1B 4FPXA 5JYDA 1FA9A 3G2HA 1U3WA 4UFNA 3KALA 4LKOA 3QU4A 1FZQA 4BBZA 4W6ZA 4MZDA 3UAWA 4DSTA 4C89A 4OL0A 1RR6A 3W8EA 3PKJA 2VPXA 2V9ZA 3PXAA 4QHTA 1Q1ZA 4CQMB 2XSZD 3BB1A 2OGTA 3WL5A 3IEMA 1ML4A 3SR3A 4A0QA 3U7FB 3Q7SA 2FFQA 2YFKA 4KDCA 3AY6A 1PG5A 2VTVA 3SYRA 3ZS9A 1FIUA 4FK8A 1SB8A 2J6HA 4LMBA 4NNJA 1BWRA 4CKXA 2PDAA 1S2NA 2GPSA 5CFPA 4XD2A 2PXAA 3R3HA 2HHLA 2XX3A 2YC2C 1ZNZA 4LXUA 1PK7A 2ONJA 4A4DA 5FLEX 1II0A 1DAKA 2O3SA 3HKBB 2XRYA 4MV4A 4RAOA 1WHTB 1VZ2A 3G89A 2ZROA 1FFBA 1PQ4A 4C6SA 3ICCA 4PG6A 5FBHA 2AT1A 4O2RA 4FYXA 3LS2A 1SOAA 4IHAA 4JSRA 3KX2A 1MIOB 1OXBB 4XB1A 2WFAA 5KIAA 1UBKS 1SAYA 1W36C 1UBFA 1P4JA 3LHIA 3KL2A 4OBEA 3EZ6A 1JT2A 5EMKA 1W48A 1VCHA 3IESA 3E82A 5J43A 4MH0R 2WA1A 1T2DA 3M5CA 1N2ZA 2QTWB 5KDOA 1E64A 2GKOA 1Y3FE 3FHLA 4QEDA 4TRMA 5LVAA 4FHFA 4QXQA 2W43A 3ZU5A 2OYCA 2CMHA 2BV3A 3VJLA 1LV7A 1M2OA 4MROA 3T7RA 3AVPA 3FJYA 3ODGA 4Z53A 3JQGB 1QVWA 1QH1A 1KQPA 2H0RA 4HLQB 3IAEA 1FTWA 4C1NA 3AMVA 3R2JA 3KUKA 3KVOA 1OBOA 3S2SA 1QOQB 5CA1A 1K9VF 2JK0A 3WGQA 1M2KA 4UCFA 2NMVA 5L3SA 3S8YA 1U7PA 3LUFA 1PHPA 4Z8YA 3F7TA 4LCEA 3S1AA 4HRVA 1R50A 2O7NA 1WMFA 1O6GA 3QU7A 2QTNA 4J1SA 4BQQA 3K30A 5E6UA 4C2UA 3LIPA 3ZHXA 4ZV4A 3Q41A 4Z3OA 1PNRA 3RASA 3X1MA 4XYMA 4JLBA 2OO5C 1AG9A 4R9NA 2D5LA 4NENA 1F1JA 4QL3A 3NWJA 3AXSA 2DAPA 1Z83A 4PQEA 1XVUA 4BRUA 4EWLA 4W9NA 4BB5A 4AMYA 4HDMB 4E6EA 4EX7A 3L18A 1EM8B 3T4UA 1BWSA 1W47A 1U2EA 2P3LA 5JD3A 2FPWA 2X13A 1XU7A 13PKA 4FYMA 1YS9A 4AJPA 1AKEA 1DEXA 2D5BA 3JQAB 5EJ4A 2ZUWA 2ID7A 2ZTLA 3EGCA 1MJGM 3CT4A 1N5RA 3CZAA 3WK4A 2B1JA 2QTTA 1HTTA 2VDNB 2NYAA 4FR2A 5CFRA 3L7AA 5AW4A 4NBRA 1CVIA 3L40A 1ZN7A 1BCRB 4IDOA 3OM0A 4XWGA 1ISRA 1PSWA 3PB3A 1PBTA 4ZQHA 1PLLA 4EO9A 2WNSA 2XCUA 1KDPA 1Y82A 2WK1A 3GLFE 4TN1A 2VHUA 1JIXA 4Q5IA 3H9BA 3U3XA 5I9LA 1JJIA 2O1EA 1UCFA 5K3DA 5ELLA 3ZE9A 1R6TA 1X7ZA 1Y8AA 3V6MA 4DZZA 1T5IA 4N7JA 1K7YA 2OFOA 5IC6A 1R37A 3VNBA 2BR4A 4PZ0A 5EXTA 2A0XA 5B3JA 1UFOA 3K8QA 5LLSA 1UAAA 1J8YF 3NHRA 3SQOA 1Z5PA 3E4DA 1U02A 5HM8A 2PK3A 4RVGA 4YR7A 4JYZA 1T5TA 4MEAA 2NADA 4MVWA 5IDYA 3WBBA 3F8SA 2R6R1 2OM6A 4M1OA 2WAAA 4QUHA 2D1RA 4RGBA 3W6UA 6CHYA 5KYTA 1H2YA 4IEFB 4DXAA 1JWLA 2AJTA 4N3NA 1U9YA 4XW2A 3CUYA 2Q28A 3O3OB 3EXIB 1L6IA 2PJZA 3BDIA 2KBEA 1KVSA 2ZYTX 3I9V6 4NF2A 4DKJA 2OD7A 2OGUA 4BDTA 4LQCA 1QP7A 3H9UA 4Z4IA 1T1EA 3RYIB 4Y67A 2JVJA 3OEHA 4JSYA 3ORFA 3W5HA 4BWYA 3QOWA 1T5OA 1IZ9A 5I7EA 3KVYA 4M89A 1GV0A 4G81A 5GGYA 1PJQA 4NOMA 1T29A 4BMXA 3AUAA 5TQ2A 2XXJA 5ALWA 3GLGA 4IUBS 1AMNA 1W75A 4JOSA 1JIKA 1B6RA 4J7XA 4Z4EA 4M9RA 2B8TA 3A6GA 2ZBGA 2HSGA 3HYTA 1V95A 2J0VA 4OIMA 5FTWA 4TQUS 3FNBA 3W8DA 3GMTA 4V3CA 3WMWA 1XALA 2AEFA 4QRDA 2ZI9A 1UXHA 1N0WA 2ATXA 2QE6A 1XLUA 4RPJA 4R6WA 2XOEA 4EG3A 2AJ8A 1W4AA 4HGQA 3H65A 2JAQA 2R8XA 2RK3A 5A9SB 5L4LA 1Z6ZA 3PUZA 5DH9A 1X19A 3UFXA 5EA2A 3WIOA 3A6JA 4HYEA 4D9GA 3O8OB 7REQB 3LT4A 4G26A 3A1CA 1OJ7A 3U39A 3DB1A 4QYIB 4WPGA 4OU5A 3DYBA 4M22A 4M53A 4BKPA 3MT8A 4W5NA 2YHIA 1GZ4A 2ECPA 2GCOA 3R7SA 3WGNA 4E09A 2BM9A 2O8BA 4AZSA 3KOZA 2I22A 1K6IA 3RSCA 2BDTA 1TTPB 2DPXA 5IAEA 2X2OA 4KWCA 2F8SA 4TV9B 3SSMA 1QVVA 1XOIA 1JKJB 4NVRA 3RAJA 1TM2A 4LHZA 3IQDB 3ETJA 1PL7A 1JNXX 5B1DA 3V2UA 5LQUA 3JYLA 3RIGA 3RTCA 4JV5B 2XV1A 2IOFA 2DHRA 1G6Q1 1WPRA 2FOXA 2XTNA 3BSWA 3T06B 2X77A 3HACA 1VSTA 2C3UA 1GL3A 1GN8A 5AVVA 5JWOA 3THYB 4WN9A 4OFWA 5ESRA 2AN9A 2WT9A 1WVIA 1U5BB 3KWLA 4AUMA 1KSJA 2WHYA 1S3GA 2ATIA 2I1LA 4Y0NA 3WR5A 4LRUA 2QRKA 4B6FA 3AETB 2NIPA 1UKBA 1AKYA 3L6EA 3O3MB 1VE6A 3OX4A 4UOQA 1S4QA 4Q9JA 1HDEA 3WLOA 3AL0C 1SM4A 3RSLA 1KJQA 1RRKA 2QZ9A 1OREA 4JLNA 1NNLA 1NPTO 1W5SA 4G0ZA 1P45A 1P29A 3WIBA 3N58A 2B1RA 3MUEA 1BA3A 2IXAA 2DQ4A 3KKMA 4CKCA 5AXCA 1AQLA 2OB2A 4ZYWA 4PYRA 4Z7QB 5B6IA 1XK7A 3MG9A 4RSMA 3HJTA 4ZO8A 4ZICA 1JQDA 3R9KA 2HC9A 4B7XA 1VKNA 4Y2RA 3N2GA 3IB3A 1GPUA 3USCS 2RARA 4NK4A 4KE9A 1Q7BA 3EN0A 2C96A 4HN2A 1WHSA 4OI0A 3WYDA 3WZ2A 2VWHA 3M49A 5ALZA 1ZIXA 4J6FA 2XWJI 2KMLA 2SHKA 4OB8A 3RV3A 4DIEA 2QRLA 3I4CA 3TL2A 1J9ZA 2B2NA 2IYAA 1XCGB 4N0PA 5EUQB 1HR0B 2J32A 4GL2A 1LCIA 2ZYGA 1P2GA 4URFA 2GF2A 3F46A 1CK4A 4WEQA 3Q72A 2X41A 1YR7A 4EY5A 1UDXA 4GMKA 2WKWA 1L5LA 1UFVA 1G9TA 3A2NA 3D1VA 3TQOA 2C7QA 3VO9A 4HD8A 2IT1A 2NQ8A 4I55F 2A92A 1EP9A 1Z22A 2FR8C 2GOYA 4K9MA 4NYJQ 3EPLA 3QOXA 1Y8QB 3S70A 1E18A 3LUAA 3M70A 2PS3A 1X3SA 2PRIA 3IBTA 5TNXA 1YD7A 4TMXA 2Y1XA 1XRPA 4I5DA 4CQJA 4YLGA 2ZBEA 5EQDA 3BEOA 3GEBA 3NRBA 1X1QA 3FOBA 4PTZA 4AP9A 5HQ3A 1O77A 3CB2A 3CMMA 1P7VA 4ACBA 2NO6A 4LY6A 4YROA 3OJFA 3LQ4A 1PUIA 1Q6ZA 3PUXA 4TSFD 5J58A 3SNKA 2IGTA 2YVAA 1C7IA 3NAQA 4RHFA 4BJ5A 2MMCA 2O6LA 1V8OA 1E7SA 1IE3A 4B6JA 2C59A 2FW1A 1BAPA 1YTLA 4O5AA 1NYRA 3IHKA 3LGAA 3GFQA 3NIGB 1IXSB 2YMMA 1QH1B 2G1JA 2CNWD 4N1AA 1CQZA 3D6AA 1VCIA 1OI3A 3VO1A 1A7JA 1JFLA 3CXRA 1XZLA 4A6XA 1NI3A 1OFUA 2QTFA 3KB1A 5AHOA 1RC0A 2YVUA 2JAUA 3V4RA 3I30X 5J2TB 1SUWA 1GGVA 4LYHA 5C8VA 5MF6A 3E5HA 1KRHA 1M1YA 2VJCA 4LI3X 4M60A 4LC9A 4O1HA 2FZLA 3N3BC 4M1MA 2NVUB 4M0KA 3QWHA 5CDUA 3V8VA 2W37A 1BQ4A 4CTJA 1Z88A 1QFYA 3DV9A 4X0EA 1QOPB 3GP3A 1PT7A 3C3PA 2JCXA 1RAHA 4L8LA 3L7NA 1AQUA 2XVMA 4RQBA 5A05A 4Y2VA 2IZ0A 2R7AA 5KKNB 5IC5A 2ORYA 2VUSA 3H2ZA 1NPDA 3MT0A 4TM7A 2QXUA 1W5AA 1XHFA 4DB4A 4QASA 4KIJA 4KMRA 1TW2A 3CEHA 2XGGA 3QP9A 3ZY6A 4CT0A 1UBRS 2IPOA 3AK4A 1G291 5K01A 3BMQA 4QYXA 5H3LA 4RVFA 2VHEA 3JAKB 3SVTA 5CEEA 4FMDB 4W5JA 5TS3A 4H1HA 4EI8A 2PM8A 4RWZA 1RBMA 3OPYA 3UATA 3UYKA 2PU5A 4YQYA 5G0SA 2E5LB 4V2IA 5DT9A 5FULA 4WKNA 1Q50A 4XE5A 4F85A 2ZRDA 4L8WB 4XYGA 1LTKA 4XZ3A 3S0JA 4PHFA 4AUNA 3NIDB 5IJ9A 2GZRA 3EUAA 4MYDA 1ZUIA 2W2KB 4AZTA 1C3LA 1VDZA 1UKYA 3HP1A 3K5HA 4PWZA 3I52A 1DCMA 1NU8A 1R9GA 1HT0A 2IZOA 2CL5A 2NUAA 4K46A 1YB5A 4QVKA 3Q3HA 1ENPA 2OHVA 1TUBB 5TX7A 5AOBA 3SZ3A 4YUAA 1U3CA 1YA8A 1VSQA 3QEOA 2B4AA 4G0XA 5E6RA 4YAUA 2B83A 5TGDA 1UBSB 1DXYA 1YL6A 2FSUA 3FSEA 4BVKA 4ZD6A 3LQKA 5C32A 3COJA 4IKEA 4HEQA 1L3IA 2P9HA 4DC9A 4NDNE 5EFOA 3N86A 3WK8A 4MIYA 2ZJ6A 1VKRA 4KR3A 2J41A 2PKQP 5JAZA 1K92A 1ORTA 3IOEA 5JCXA 3WLKX 4P3NA 4Y6PA 4RORA 2WIAA 3W2HA 2ICAA 1NJ1A 3IQFA 4MQLA 1XTJA 3BORA 4YV7A 3E22B 4GXRA 1L5WA 4M1ZA 2IY8A 4ALJA 3F78A 4ICIA 1T36A 3EGIA 4CUKA 1DCTA 2BBSA 2IXTA 1UC9A 3BMNB 2ORWA 1X9IA 1WW3A 1Y1LA 2XZOA 1DIBA 2XAAA 3LY5A 4QVGA 2VF7A 4DLBA 1IWPB 1QUEA 1QF7A 1XRSB 3GN2A 3CF4G 3QM1A 3JWGA 2HWYA 2Q9BA 1EJ6A 4EABA 2HJGA 1PG2A 3SM9A 1Q22A 4D46A 3RVKA 3JS5A 4NYMQ 4B33A 5IDWA 3DNMA 3H2JA 1IAVA 3P52A 2A1TR 1NOJA 2WW8A 3WHIA 3V1YA 1VXOA 1QGAA 3MSXA 2UYQA 1A8IA 2YH2A 1N6OA 4FHEA 1CNMA 3PT9A 3X1WA 1PUJA 2IWHA 3QJ5A 3DTNA 1W9HA 1KBOA 5KQGA 4X7RA 5ESXA 4L9SA 3GLIB 3UKOA 4YACA 4ROSA 3IQGX 3N75A 1BXRB 1CFJA 4LTMA 3ZBQA 5JQWA 5EVCA 4KV9A 1W581 4CEJA 3E9CA 5L95A 5EQFA 3QVGB 1ZMRA 3FOFC 3U60B 4ZAGA 4P35A 1K7SN 5IN5A 1P0CA 2QB5A 2VSFA 4OXIA 5LYYA 2EZ9A 5EMMA 4TVSA 4RH0A 4G1MB 2BR5A 3OTGA 3S5JA 4KRXA 1GTVA 3BD6A 1U0SY 3P2KA 1X3LA 4PXAA 3RBXA 2BEUB 4CMEC 2ODAA 4RVCA 3VJRA 3U3RA 1N0HA 4FIZA 2ADOA 1Z9BA 3KDSE 5SYNA 2SKCA 4NEQA 4DZRA 3RUPA 3F1KA 1Z2AA 1JRLA 2O2GA 3HBFA 3R5TA 3D8UA 5G0VA 2ZFUA 1EGQA 5AESA 5GADl 4ZRMA 2EGUA 4GZLA 5DXFA 4X97A 3IOMA 2PQ6A 1M7GA 3Q8XB 4R9VA 3FNGA 3N8DA 3SSAA 2VUTA 2AMYA 3I0NA 3LA8A 4JROA 2J09A 2VC2B 2FRDA 4DIBA 1KK3A 1YVUA 3CH4B 2HH9A 2G83A 1LVUA 2XMGA 5LQCA 5JJCA 3DCYA 1A7KA 3VPAA 2VSNA 2AQ8A 4ZYZA 4QQRA 2RJ3A 5CG1A 5DLDA 1VFPA 2JLWA 2CVZA 1NURA 4I1PA 1Q7TA 3BT7A 2EFJA 1RNLA 3GEEA 3LY7A 3RU2A 1EPUA 1P1CA 3L7MA 5DK4A 2E5FA 3B60A 2I1WA 4R5HA 4D0GA 5JANA 6Q21A 1QHHA 2JFXA 2R7LA 4MJ7A 4C4RA 3FZNA 4QA9A 2CYBA 2W11A 4GOOD 4GXQA 3C98A 4HWGA 4NAVA 1IK6A 4WA8A 4Z0NA 3WLHA 2ZM6B 4MQEB 2P6NA 2XWQA 3TJZA 2Y2VA 4EJ0A 3PXDA 4TOIA 5EIHA 1J2UA 3NBZC 4G5XA 5AKZA 1F51E 2C7VA 4LGVA 3GRYA 2WVGA 5AI4A 1Z6QA 4R84A 2HTEA 4ER7A 5I3CA 5B6JA 4MPRA 4RZIA 1GRCA 1OTXA 4MW9A 3SR0A 1ES9A 1Y3CE 2FUG1 3PVZA 3TLMA 4B3JA 1ZY2A 4ZCIA 4S1NA 2Y1FA 1R2QA 4FKZA 1E3LA 1YZQA 5F5LA 1V8BA 3EF1A 2C2WA 5LR6A 3N2IA 1T25A 2ONCA 1L7AA 1WP4A 3EA0A 4RV5A 1ZM2A 5DEIA 3ANMA 3HHPA 3OG9A 3OFNA 1SA0B 1TYZA 2D54A 1B74A 3PQCA 4H1UA 2YN0A 4IMIB 4OQZA 4PGAA 3K9FC 1K63A 3TQSA 1YZTA 4DMUB 1E5DA 1Y1SA 2OYRA 1JHYA 4QT0A 4R1TA 1XU9A 4NYMR 2H48A 4L8YA 4FCTA 1E6LA 3D3WB 3NASA 4QLOA 2WYIA 3H19A 1O5IA 4LOHA 3ZKWB 5FAKA 2HQBA 3NC1C 3NX4A 3S1LA 1TD9A 1UJ4A 2AOXA 1EXMA 1TYCA 2X9NA 3AEUB 3C43A 3DEFA 1WXFA 2GVDC 5A0VA 1E2UA 3FOEC 1HG0A 5AM1A 4GI1A 4DCGA 2CHVA 3DR5A 4B46A 3V8BA 5TPZA 1YZVA 1ZX1A 3FYUB 3ZD8A 4BLQA 4BTEA 2P4UA 5AH0A 4EO7A 3T5AA 1IK4A 3MB8A 1OYOA 1ZM7A 2B34A 2Z95A 1NBIA 3AV0B 3IP6A 3NTQA 4RH3A 2FMKA 4BJ3A 1TMYA 2BGJA 2PQ2A 3GG2A 1ONPA 3KKLA 5A1TA 1PR4A 1WF6A 1FFCA 3M6UA 4LOKA 3UAYA 5A02A 4JYBA 1RKUA 3HUEA 3PI6A 1B6TA 4B9EA 3BD9A 3HLTA 1DBRA 4ZYTA 2VYQA 1TK3A 3NM5A 5AW8A 4G8JA 2JLRA 1XEWY 1U1IA 1HQKA 3CLTD 1Z39A 4BNTA 1H05A 1MA0A 4GPBA 3HXPA 2FQQA 4YGYA 1FDRA 3C15C 3GDWA 3GNLA 5C5EA 2GFHA 5B2EA 2XUAA 1KJ8A 1NXVA 2VA9A 2Z83A 3LZDA 3ZGVA 3GZNB 3QLEA 5F73A 3U13A 1YASA 2YV4A 5BO5A 5ARBA 3GW8A 1XE3A 1YZYA 2IV3A 3W2FA 1JLMA 1NVMB 2ZB3A 1NHGA 1IG3A 2AK3A 3MCTA 5EUCA 4M9XA 4QQ8A 3HFSA 1HURA 4FYKA 1AA9A 1E7YA 4TS4A 4WT7A 4XX0A 3K53A 4FFOA 4N01A 1ZO8A 2EWMA 1SCJA 1X80A 4U8GA 3N8NA 2H9IA 5D01A 2BZGA 2GUWA 3LCMA 3MNFA 1CR1A 4PPFA 4W7SA 4ZDJA 4R8RA 3I5UA 1R0ZA 4ZIRA 1ODKA 5HF6A 1DG9A 1HMPA 5TB5A 2V58A 3KR9A 2RHDA 2ES4A 3ROKA 3W5DA 4X3OA 3K0SA 1R5JA 1XAHA 1ISFA 1H22A 2O5CA 2QNIA 1SBZA 3B36A 3T3MB 5EXEA 1L5RA 4H1TA 4QIHA 2O50A 5KNCH 2PT6A 2QTAA 2P9BA 2Q6KA 16PKA 3AF4A 2Z9CA 3CLRC 2KJQA 4G5RA 3GJ6A 4HGZA 4XQ0A 2G82A 1GIAA 3EFOB 4J1QA 5T3YA 3WDKA 3ZNOA 4KUGA 3THXA 3SXUB 3IJPA 4ZVKA 4M87A 2PLRA 1MAUA 4JDUA 1M72A 2CN1A 2VKQA 2DTXA 1TRKA 2YC4C 2YZGA 4U7FA 3HVHA 2ZIFA 3DE5X 2VSOA 2I67A 1T4MA 2Q4BA 2AQKA 3QQPA 1H4QA 2C5AA 4BRWA 4LK2A 4DEXA 3H13A 3CBGA 1W44A 2VDWA 4PN7A 1O7JA 3LLSA 4Q03A 4ZT3A 2C2XA 4UMVA 5BSKA 5CGZA 2IX3A 4DA0A 2EXXA 3RSFA 2H59A 2WJIA 4JT4A 3YASA 4DBLE 2F1KA 4B3FX 4PU0A 2Z8XA 2YDYA 2H7CA 1PSZA 2Q5OA 3B3AA 3LV8A 4QSHA 1FYDA 5IT4A 1MHPA 1GSAA 2VA8A 2XVAA 2ZQYA 3MGKA 1P4SA 1QK5A 5IHXA 3L8MA 1HBJA 1NQWA 2QW8A 4S1TA 2D0PB 4A0SA 2YHUA 1QJCA 1X39A 1A9XB 2IYZA 2MR6A 3TFQA 1BD3A 3IT0A 2WIDA 3UVEA 5BN3A 1UFQA 1JDNA 1KAEA 1BRMA 3UMBA 1IPHA 1S96A 1X7WB 2JJMA 3DTVA 3AOEC 3JR3A 3NPMA 1T4CB 2JHGA 5AXAA 4BJ6A 4Q4JB 5ENZA 1N6RA 2VAMA 4M9SA 1RI2A 4MPTA 3KD3A 4KKVA 1KOGA 1ZYUA 2VUHB 2AOVA 4R51A 3VOSA 5TGZA 3DZIA 1KR5A 4B4WA 3HLKA 5C18A 2HN9A 5KNDD 1VKZA 3P0FA 1SXJC 3VDRA 2YIVX 3ZY5A 5LPNA 3CVUA 1QHXA 1BCSA 2P4HX 2W6QA 4LRTB 1MIHA 2IELA 2QU8A 3GELA 4Y8VA 5EE3A 4EYOA 2UVDA 4H7FA 3ZYZA 1MW9X 4XGNA 4DJDC 3AQ4A 1GOTA 3EXHC 1KEEB 3Q4GA 4LA4A 5J4HA 4KHPB 1OGJA 1ULUA 1L7RA 3GG9A 4TS1A 4C6HA 3HYLA 2AR9A 2GNOA 1ZS9A 4RZQA 3KQLA 4GT1A 2EKPA 2ZTMA 5CVDA 3SGLA 4FN5A 4AJJA 1UWVA 1ZIOA 5EPOA 2YXNA 2Q49A 3H99A 2C5BA 1SCIA 3A4TA 2AZ4A 2BFBB 4PR0A 4XLTA 1QE5A 1EA5A 2EVWX 1NWHA 3ETGA 1U31A 3FVWA 3RBZA 4DDMA 2LIPA 2TSYB 3AQIA 3GLKA 4TS3A 3TOXA 2ZJ2A 3QSGA 4O4LF 1EFKA 4TUYF 5IJXA 1JEQA 1NZJA 1X2BA 4BFWA 4IUYA 4BPBA 2QXYA 3RC7A 3ACCA 1U7DA 3GLVA 1B8VA 3GRPA 3RFTA 3ONDA 3TOCA 3EW9A 2QI9F 2B7BA 1OFHA 2WWIA 1B3BA 1FRNA 2GB4A 2ACWA 1NNEA 3UT5A 3IXQA 2BEJA 1EAYA 4OKIA 3BWXA 3EFBA 4I6JA 3NBAA 3SPXA 4OJTA 3OZXA 3P2JA 1BYUA 4K88A 5J5AA 3W4KA 2HT6A 1G0OA 1TYBE 1Y8CA 2YINC 3QWIA 1SCNE 3MOGA 3ZHYA 4UULA 4JI2B 3T7IA 5BSFA 3AF0A 3COSA 2HMVA 1PV2A 1TJNA 2JIRA 3D9QX 4J1NA 3GO4A 3RIXA 2C0QA 3ID6C 4Q37A 2Q7XA 3PUWA 2VK1A 2I4TA 2RAPA 3TQIA 4PAOA 3IAM6 4B71A 2P27A 3DLPX 1YOVA 1D7OA 2MINA 2DFNA 5BN4B 2Z2ZA 2X1LA 3AY3A 1WXWA 2VZ8A 2PZGA 3TIFA 4YAKA 2MMGA 3JYOA 1Z0UA 4EKGA 2CKDA 3KLPX 4NCNA 1W34A 2REBA 3A3KA 1U8FO 4QHSA 1Y1TA 1IN8A 1ECLA 2FW7A 3UWOA 4BUZA 4D9HA 3PPWA 1R00A 3F9RA 3LQ1A 5IHPA 3UW3A 5DX8A 2AJBA 4IGFA 3ZJVA 1FMFA 2NU9A 1IIBA 4Q9DA 5IBRA 2ZIXB 3LDUA 2JRLA 4KVFA 1K6MA 4GI5A 3WGJA 1HL3A 1GNRA 2VYFA 4WDRA 3TSCA 3VNSA 4BV2A 2FPMA 2PN1A 1ZJJA 1T13A 2FP4B 2WWHA 1OFIA 3BJMA 3OLCX 3R6LA 4WSOA 2WILA 5H5JA 1EDOA 3ZR4B 4PTLA 2E3JA 1BW9A 4WXYB 2YWBA 3FNIA 1O9BA 1MC8A 1ZCFA 1AGPA 5HRUA 2O57A 1OW3B 3ZV7A 2EEZA 2XJ9A 4X62B 3ILXA 4EJ6A 1CWUA 5AWFC 2JGNA 1YMQA 2VLBA 1NM5A 5JCOC 1YUMA 2VHVA 4ID9A 2E49A 5CK5A 2EKLA 2C3OA 4J0DA 3X2SA 3NMUF 3INYA 5LBTA 2OGZA 3SBDA 2WI8A 3LYHA 1YDFA 4H1VA 1SELA 3JX9A 5LYJA 4YDSA 1EP1B 5U4XA 2R8RA 3ENQA 4I55A 5AOCA 4ED9A 4UCXA 4RNDB 5IANA 3D5TA 1ADYA 1ISHA 1TYDE 3QNMA 1KDZA 4HF7A 2B25A 3KSBC 2A6PA 4LRQA 2WJWA 4E4YA 3VV3A 1KI2A 4DPKA 4ZJPA 5CT8A 1KY4A 3JALA 4D4HA 3MHTA 4JB2A 3DFMA 1EWRA 3K1AB 4YUYA 5IVPA 3QKIA 5IK2A 3SHTA 1RQXA 3LWNA 3B2QA 4E51A 3HC7A 3FB1A 3OOHA 4TL6A 2ERXA 4E2XA 2C9OA 2QPTA 1CZLA 3AFMA 2JI8A 1C9NA 2BAGA 2W9XA 3WK5A 2F3PA 3BGOS 4YRRA 2H16A 5KVQA 3L1KA 3O0TA 3PZRA 3Q88A 3HUFA 3PT5A 3GOQA 1E7QA 3HL4A 2IA5A 2RJOA 3IDAA 2HO5A 2POCA 3KJGA 2G67A 3ZHCA 4F91B 5AW2A 3PE3A 2AG5A 2COKA 3I04M 3CO5A 3IBCA 3VAZA 4WX2B 4ZVLA 4BQOA 2F2TA 4CKBB 3BFXA 2FDXA 1ECFA 2VYND 3DD5A 1I4LD 4F12A 2E4VA 3A4NA 4F5WA 3DWGA 3G85A 1PL0A 2A1UB 1KZYC 3NEYA 5HZMA 1D6JA 2PO7A 1LDYA 1UP4A 3BK2A 4LF6B 3T8YA 1L5VA 3RHSA 1HOTA 3UH0A 1BZYA 3I2GA 2CLLB 4OBWA 3HS3A 3I6MA 1U7UA 1B3RA