4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cinnamoyl CoA reductase
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
5TRTA 4BQPA 3G0OA 3FCOA 4XEHA 1H6DA 1HYEA 3AM5A 3NYWA 3TDKA 1F12A 3ABIA 2HSDA 4IS3A 4K26A 3BAZA 3ZCXA 3U4DA 3F5SA 2VZ9A 3N74A 1A9YA 4YAEA 4AJNA 2B69A 3RBXA 1CWUA 1E6WA 2B4TO 1QRRA 5EIOA 1DC3A 3T7EA 4DL9A 3AI1A 1DBVO 1UAYA 1U4SA 3L07A 3S1LA 3K6JA 1OOEA 1ULUA 3BMQB 2J3IA 2HCTA 3D5TA 3UH1A 4PRLA 3QW2A 4NU5A 3R1IA 4J1NA 5F1OA 3PJDA 1SEPA 1M6HA 3ITDA 4BO3A 4BNKA 2ET6A 1P1IA 3JQAA 1J4AA 4IMPA 3KLMX 4NMHA 3AM4A 1GQ2A 2XPCA 4IIVA 4XRRA 2W98A 3GEDA 1AHIA 1M66A 1ISGA 3RUDA 1DRUA 3GY0A 1BHSA 4JROA 2ZTMA 1QLHA 2JHFA 4FOSA 4XQEA 1V6AA 2EXXA 1GTMA 2VWQA 5F5LA 4CM1A 4CQMB 1YS4A 3DBRB 3JYPA 2I9PA 1LDNA 1EDOA 2Q2WA 4P4GA 4QFCA 5HTOA 4OL9A 5MGBA 2D2IA 2D4AA 3F6YA 2XOXA 1HF3A 2Z1MA 1GUZA 2SCUA 2DUWA 4JXKA 4WLUA 1ISMA 3OM9A 4OQYA 4YJGB 1XQ1A 5G0TA 4WKGA 1D4FA 4HADA 3QIVA 1ZK3A 5KKCA 4F6CA 1ENYA 1I01A 2OBNA 3JQ7B 3CH6A 1LDYA 4TRMA 1WMAA 4HFJA 3ZU2A 3UOGA 1DIRA 1MGOA 1YBMA 3PWZA 1QYVA 3DAFA 3EYWA 3LF2A 1VL6A 1U9JA 3RKUA 1I3NA 3AU9A 4OKNA 4E13A 5C7IO 4OXKA 3AUAA 4M86A 4KUEA 3NJ4A 1X1EA 3P5SA 4QO7A 3QWAA 1ZFNA 4O6VA 4CL8A 5CPFA 4C7KA 3DZIA 1TT7A 1YQXA 2VT3A 4IM7A 2YZ7A 4JJFA 5GZ3A 4FJ2A 3CZRA 3O8QB 3GVCA 3GH3A 5JMWA 4CM7A 4XDYA 1X7GA 2HMVA 3JQCA 3S2EA 1VJ0A 2E6UX 2NQ8A 4IDAA 2OBYA 3AFMA 4DC1A 4KWIA 1HDCA 1Z73A 4Z6KA 4IDDA 3HB4X 4BKPA 4R4JA 1PL8A 3WGTA 1G0NA 5G0WA 1NX6A 1VM6A 4D3FA 5L7YA 3M1LA 3CE6A 2CDAA 4I9NA 2DBQA 4CQMD 3MWEB 1NXQA 3I9NA 5T67A 1NTOA 2RBEA 1YBAA 3F4LA 2JCYA 4P38A 4E5NA 5DOZA 3JYOA 3SXPA 4MP8A 2E4AA 2CMDA 1PGNA 1Q0HA 2G17A 3BMQA 3PQFA 4KTVE 4PVCA 1P9LA 1ORRA 1L1FA 3PLRA 2AG8A 4RZHA 3VAZA 4IZHA 5KKAA 2FMUA 3VKVA 5FI5A 2I3GA 2PKRA 1K0UA 3OIGA 3EZYA 5CDGA 3AM3A 4NR0A 1H6CA 3TRIA 3U4IA 3HFSA 3ASUA 1ISHA 4CUZA 1V3UA 2I76A 3WNVA 4CMJA 3ANNA 1PGPA 2VHWA 3I9MA 4MVJP 5TNXA 1SAYA 1YXMA 1QYXA 2DTDA 3AOGA 1PL6A 1D1SA 2W2LD 3KYCA 1ZNQO 1JVBA 4MJLA 2FOIA 4WLFA 2GN8A 3DBHB 4EUFA 1JN0A 3DBRA 5TSDA 3BA1A 3RUCA 5IZCC 1NASA 1LSOA 3NT2A 3UN1A 1Y7TA 4PVDA 3GNQA 1NBOA 2NTJA 4DUPA 5CDYA 5AXBA 5CAEA 2AG5A 3E5RA 4YJGA 1UUFA 3QVSA 2Q99A 3E03A 3PJEA 3JQBC 1M67A 4RPKA 3H3JA 4AJKA 3OIFA 3KZVA 5TQVA 2PZKA 1QG6A 5JY6A 4BNMA 5JAMA 4ND4A 3WGYA 1WXDA 2J3KA 4O1MA 5FEUA 4BGIA 3RWBA 3EHEA 4MO2A 1K6JA 1NR7A 2H5LA 4URFA 3E9MA 1WW8A 1R37A 4TRJA 5LC1A 3WGGA 2C0CA 1AXEA 2C5EA 2EW8A 1QYWA 2OGUA 3D3WB 4XYBA 4Z0TA 5G2OA 3RCBA 5B4UA 2XF8A 4XJTA 4XRGA 1ZMTA 1E1LA 2I99A 4DTIA 1GQYA 4LN1A 4AJJA 1A4UA 5B4TA 1E7WA 3O8QA 5C7OO 1XKQA 2NM0A 4YT8A 4BKOA 3VZQA 2B37A 4NJMA 1X7DA 3K73O 4ALKA 4PG6A 3NJ8A 3GRPA 3SLKA 1DB3A 3LF1A 4MINA 3UFXA 4ALIA 5IDXA 3D64A 3GLQA 4BO6A 3PFWO 3INGA 4Y67A 2BGKA 1PGOA 3CXRA 2X22A 5DBFA 4YA6A 3PDJA 1I2ZA 3CMCO 1N7HA 1BDBA 2ILTA 1RM5A 3KVOA 4N5LA 3F46A 3ZWMA 4FFRA 3K5PA 2ZB8A 5HS4A 2FR1A 2GD1O 3RC1A 2IXAA 1U28A 3OETA 3IMFA 4BHTA 3ZNNA 4FW8A 5FFFA 3KYBA 3D4PA 2O4UX 4MP6A 2GN6A 3OSUA 5A9RA 1LSUA 3DTTA 4G2NA 3FRJA 5F1PA 1B14A 1NWHA 4K1LA 2Y0DA 4MKXA 4E4YA 4P4NA 1GL3A 4L4RA 4ZQFA 3RUHA 3MWDB 1CERA 2QZZA 3H65A 4XR9A 2H9IA 1A7KA 4HP8A 5JMPA 3E82A 4Y98A 2O50A 3UVEA 3VOSA 1MFPA 4JLWA 1NR1A 5KJ6A 1ZK4A 3K8ZA 4ZQGA 5EQFA 1GPJA 3OJ0A 4OAQA 2WD7A 3HJAA 3JD4A 2HDHA 5A06A 1FJHA 1HDOA 2X9VA 1ENZA 3VHRA 5IZCA 3FHLA 3E9QA 1JKFA 3TJRA 3X2FA 2PD6A 1B26A 3COSA 2VHXA 3QVOA 1WVGA 2O3SA 3RVDA 3C1OA 3RU9A 3NGLA 4D43A 2WWRA 3ITKA 4R69A 1R4MB 2I3AA 4J9VA 2QQ5A 2VHYA 5IN5A 4JX8A 4YWJA 5TC4A 4B79A 5ILOA 3JQBA 3WBFA 4FSHA 2BKAA 3IDSA 1BXZA 5L51A 1CIVA 2VNAA 3DXFA 1XQ6A 1SNYA 4JBHA 3PJFA 3WGZA 4EBFA 1WAMA 3H2SA 1F8FA 3JQFC 4FN4A 4ALLA 1X7HA 4J9UE 2Q1UA 3GGPA 5AOVA 3D3WA 3NX4A 2C20A 4PCVA 4UEOA 4XJSA 4YT5A 1CYDA 5KWEA 2PR2A 3ADOA 5HBRA 2EJWA 5A5EA 1ZSNA 3GA0A 2A35A 4NI5A 4WCFC 1KBZA 4BMSA 5JAZA 4YPOA 1DFHA 5G0VA 4DLAA 4Q3DA 1HSOA 4CM8B 1ONOA 2PKQP 1ZW1A 1HTBA 5LDGA 5KJFA 4DQXA 1ISFA 4PLTA 4CUKA 4BGEA 2ZIZA 4ZRMA 4AJ1A 4CV2A 2Q46A 4F6LA 4XA8A 1W4ZA 2RHRA 2X86A 1RPNA 5DCUA 1KIFA 1C1XA 2BMAA 1JWBB 5KVQA 4AJ4A 1PZFA 4ZVVA 2X5KO 4E5KA 3G49A 4RLSA 1O0SA 3S2IA 4BV9A 1DJNA 5ILGA 1UDBA 3GMSA 4LMPA 5CDUA 1GUFA 5DDIP 5FWNA 5ITVA 3DMTC 2WYWA 4Q3AA 5KNLA 1EBFA 1PR9A 2O7SA 3IC5A 3KSDO 3K9QO 1E3LA 3UW3A 3RJ9A 4GAEA 2H63A 1VSVA 3B1JA 3HSKA 3ETGA 5TS3A 2P4QA 4XKJA 1EUCA 2XAAA 4IXTA 2O3JA 2Q3EA 3ZW9A 1T2AA 3ZN2A 4RV9A 2B35A 1ID1A 3PYLA 2D3TA 3MJEA 3KEQA 3KSZO 3JQEA 3K31A 4FIZA 1X15A 3NEPX 3PZRA 3WYBA 5KTKA 2B36A 3ASVA 1NFRA 1DIBA 3NKLA 1E5QA 1X14A 4AJIA 5CDTA 4IBOA 4LVCA 3WIDA 3F47A 3RD5A 3QY9A 3ZWNA 1DIHA 4D41A 5F1KA 4GVXA 4I5FA 1SB9A 4U0KA 5EJ2A 1Y1PA 3ZU5A 3C7DB 2D5AA 4LW8A 4ND3A 3OQBA 4GWKA 2PZJA 4ZQEA 1R4MA 2OP0A 2GZ2A 1FXSA 4IUYA 4E3ZA 3EZLA 3AY6A 5MDHA 4CM4B 4RL6A 3GN1A 4YJFA 3AJRA 1YL5A 4NFYA 4JCOA 1Q0LA 3O4RA 3ZI0A 4A5OA 5L7TA 3OECA 1D1TA 2OHXA 4CMAA 1U7TA 5THKA 4DLLA 3CKYA 3VH4A 4PG4A 4MIEA 1C1DB 2X8LA 3WOHA 4B3JA 3JQFA 5JSFA 1KEWA 4BO5A 4CR7A 2HK7A 4CLRB 1IPFA 1TLTA 4DLBA 4GPD1 1M6WA 1BTOA 1BXGB 4WLOA 1OI7A 3L77A 4N5MA 4OQZA 8ADHA 2D1YA 3JD2A 1MLDA 3KRTA 3SJUA 5JO9A 4WCFA 4RJTA 4HNGA 4HFRA 4P22A 1F8GA 4DPLA 3IJRA 1GYQA 4YCAA 1FDUA 1WNTA 2NU7A 4AJHA 1Y9EA 4G65A 1GFSA 5L7WA 3O9ZA 4R3NA 1I36A 3ZWCA 2B83A 4D3DA 4CR6A 5I8WA 1KOLA 3KUXA 2VTEA 1BG6A 2HUNA 5K0ZA 1T2EA 3GHHA 1LRKA 1M75A 3HB5X 4PLGA 3QE3A 4PLHA 1SZJG 2CZCA 1KETA 1Z45A 1KY4A 1X0XA 4LK3A 2WE8A 2WSBA 4K6FA 1O9BA 4NFSA 3GR6A 5L40A 3HN7A 5KJEA 3KV3O 4II2A 3DMTA 1VE9A 3IUPA 3OEWA 3GQVA 3FI9A 3UF0A 1Q0QA 1C0KA 1H6BA 1HSZA 2RAFA 5BSHA 4PRKA 4KMSA 2IZZA 4DMLA 1UXHA 1LA2A 3ICCA 1GEEA 2HU2A 3VPSA 3ZWWA 4MVJE 3JQ8A 2P9CA 3FR7A 1IOLA 2NVUB 3SBOA 2VT2A 5FYDA 5G4LA 2RH8A 4I1IA 1C0IA 4YTEA 2AE1A 3ZV4A 2IE0A 5I9LA 4OSOA 2EG9A 3NTQA 4E2WA 1TT5B 3I9LA 2X6TA 1PZGA 4TVOA 2LDBA 1BDMA 5ENVA 3TPCA 4CM4A 2O2SA 3PDUA 3GMDA 2O4CA 5BSGA 4UVEA 1J5PA 5HA5A 3FF4A 4LSMA 4NJOA 2P4HX 1IPEA 1R4NB 2ZKLA 5T64A 2IYOA 2YUTA 4G5HA 4GBJA 4MVJA 3LVFO 2QYSA 1ONNA 2HMSA 3H9GA 3KLPX 4MVJG 1O5IA 3GK3A 1YDEA 4BNFA 1K2WA 4FD3A 1FDWA 2JAHA 4KP7A 4CLRA 1PJCA 4FGWA 4Q39A 3IKTA 4YVFA 1VPDA 1WLYA 3E8XA 5COAA 2JD2A 3FNGA 2AA3A 2HK9A 3O26A 3WDSA 4JP2A 1RM0A 5JY1A 1U3TA 2IEBA 2UYYA 2VZ8A 4XGKA 2BFPA 1ADCA 1Y6JA 4NIMA 2C7GA 1PWXA 3EMKA 4BO4A 3PGJA 1E1NA 2DKNA 3HZZA 2PY6A 1PEDA 3PYMA 4NU6A 4FC6A 3IIEA 2X9NA 4BO8A 3IS3A 1JQBA 3D4NA 4IDEA 1ISJA 3X2EA 1HDYA 1DPGA 2BGMA 4W99A 4ZHSA 3UUWA 4B4UA 3GEGA 4CJXA 3RUFA 2PGDA 3DHYA 2G1UA 5AXCA 2YYYA 3DC2A 2DPGA 3HG7A 1WDLA 4IDCA 1EMDA 4E33A 1KY5A 3TQHA 1KEVA 1U3VA 2C2XA 4E2ZA 1VSUA 4UREA 4ZGWA 4PLWA 1BGVA 2PGJA 2VYND 4I08A 2CFCA 4OKIA 3ENKA 1XELA 2YHIB 1Z7EA 1R0SA 2JAPA 4TRNA 4H3VA 1K89A 4PLCA 2Y1DA 3AWDA 1ZXBA 1HZZA 2VOEA 1T2CA 1EFLA 2DM6A 3BZUA 2NVUA 5JNLA 2IEDA 1R15A 3GZ4A 1WWKA 1XDWA 3HDYA 3KXDA 4DIOA 1Z74A 3RC7A 3HN2A 3B6ZA 1MG5A 5JCJA 1KC3A 1L7DA 1XIVA 4IJKA 1PIWA 1Z75A 1TT5A 3FR8A 2VNSA 4BMNA 5T57A 5ADHA 1MC5A 1DIAA 2Q1SA 3QV1A 4CQLB 1DO8A 5IFLA 1N9GB 4HY3A 1UH5A 2VYNA 1JA9A 3GVIA 3UCEA 1E7MA 1R4NA 1DFGA 2YJZA 3ULKA 4C4OA 1XHLA 5TT0A 5ER9A 4LGVA 1IE3A 4AJOA 3WB9A 4GSKA 2X23A 5AQ1A 3QVXA 4EEZA 4A26A 1O8CA 2POQX 3ZV6A 4Y6SA 3HUDA 4U5QA 3F4BA 3GZNA 2F1KA 4RZIA 1LDEA 3IKVA 2B0JA 4BNGA 2R6JA 4IINA 4EZBA 2UVDA 1N8KA 2Q4EA 2FRDA 1P1RA 3GAFA 4B8ZA 5CP8A 2Y05A 4KOAA 3PZBA 4NH4A 3DMYA 1LXCA 4GSLA 1ADBA 4J4TA 1P45A 2PNFA 3DZHA 3U4HA 4P8RA 1P1FA 5TGDA 1VLLA 3GUCA 4Q9NA 3PWSA 4WLVA 4GKVA 4OGWA 4TSKA 1PX0A 3W8DA 4UVGA 1JU9A 3ZHBA 3B70A 1I30A 1EFKA 2O3UA 2PFGA 3R3SA 2GDZA 3M2PA 3SEFA 1DSSG 4OJNA 4QX6A 3IL2A 2VHVA 5HM8A 1M76A 2CDCA 5DCYA 3VZSA 4GQAA 4RLHA 2QYTA 3LQFA 3OQ6A 2Y68A 3PYXA 3WG9A 4MVJF 4BNLA 1NQTA 2EJVA 2OZPA 5L4LA 3F1KA 1T24A 2WJPA 1GPDG 1AE1A 3IUSA 5TLSA 1K6IA 4J16A 3FNEA 1T4BA 4XWYA 3LU1A 3HE3A 1EQ2A 3ZWPA 5AXAA 4M87A 2NWQA 3NT4A 1NVMB 2VYVD 4QECA 1DC6A 1H0KA 4GGPA 4J49A 3VKUA 3T4XA 4PLZA 1ZMOA 4CR8A 3GGOA 4EUHA 4J2HA 1BMDA 2V6FA 3DHNA 4NK4A 1I32A 1SPXA 4YJHB 1SBYA 2EKLA 3DFUA 2DPHA 2ZTUA 1QSGA 3S2FA 3GEMA 1LRLA 3WIEA 3I6QA 4FCCA 3V2HA 2PWZA 4YT2A 1NPTO 1ZXLA 4FJ1A 3HNPA 6LDHA 1PR3A 1DHTA 2ZK7A 3G17A 3ICPA 3QVTA 1JW9B 8LDHA 1YL7A 3OP4A 2X9GA 4GX2A 1E5LA 4BNUA 3N7UA 1S6YA 1QYDA 4HUJA 3DBLA 2X0JA 3VZPA 1MXFA 2Q49A 3C8MA 1DC4A 3ADPA 3BTUA 2Y1EA 3LZ6A 4U8GA 3A9WA 4UAGA 2QW8A 9LDBA 1W8DA 4MVJM 3I4FA 3EVNA 3ZHYA 4IIUA 3ROPA 5LCXA 3LC7O 2ZQYA 4L73A 4A27A 4L0QA 1ZJZA 4WEOA 4YRBA 3CTMA 1JKJA 4PN3A 2AQHA 2PH5A 4XB2A 2HMWA 1XU9A 3GDFA 3EGOA 3WJ7A 2NQTA 1IHXA 3KYDB 1KERA 3JD0A 3TOXA 4RVSA 3V8BA 2O3QA 3DOOA 3TN7A 4NK5A 5DP2A 2AXQA 4EI2A 5A4DA 1LLUA 2AQ8A 1O94A 4J1SA 4W7IA 4XYGA 1I2CA 1W0CA 3H6KA 3Q1LA 2PK3A 4QTZA 1MG0A 1SB8A 4DIFA 2V7PA 4L8VA 5K9ZA 4R9RA 3PFFA 3Q0EA 1TXGA 3FTNA 4R1UA 5I9NA 4LRSB 1QYCA 4DVJA 1CDOA 1GZ3A 3H9EO 3VH1A 5IF3A 1HDZA 2X0NA 1V8BA 1MP0A 1GCUA 2RH4A 4R41A 4ZJUA 5I7EA 1B8PA 1U2DA 1Z82A 1NPDA 3IOYA 1H9BA 4BNZA 1Y8QB 1WZEA 2GASA 1TA4A 2JCVA 1GV1A 1HZJA 3E18A 3HDJA 2WDZA 4NZ9A 4CQMA 4R1NA 4D45A 4J3FA 1QV6A 3SX2A 4NPCA 4E12A 4BIIA 3TWOA 5TIIA 5JBIA 1Z7BA 4WLEA 1VL8A 2EHDA 4AFNA 4Y9DA 3JSAA 4YEDA 3Q2KA 3GG2A 1YB5A 2JHGA 3K96A 5TJHA 3ZWOA 2Q1TA 3ZNQA 3I5MA 2BRUA 2DBRA 3JQ7A 5DF1A 5DZSA 4RVGA 1O6ZA 1TEHA 2FR0A 4IQ8A 4PLYA 1WMBA 3GHYA 4J7UA 5CEEA 4ND2A 4Z9YA 4A0SA 3K92A 1YGYA 4IDBA 4WLNA 1GADO 5EN4A 2W2LA 3GAZA 1HXHA 2FHSA 3ANLA 3OHSX 4RVUA 4YAIA 3OJFA 3O38A 3WQQA 3IJPA 4W9NC 1VC2A 4OSPA 2E48A 1E77A 3ZU3A 1B8UA 1DAPA 4XIYA 2O2YA 3GG9A 1P3DA 2DTEA 4KQWA 1X13A 3P19A 3PP8A 1FK8A 2BF7A 2GN4A 3NGXA 1RKXA 1HLDA 2FSSA 1Y5MA 3H9JA 2IYPA 1W73A 3DAPA 4Z3DA 3HADA 1LDBA 1LUAA 1R6DA 3DFZA 3E9NA 2Y93A 2OUIA 2QIOA 3MOIA 1LEHA 3ORFA 1WP4A 4OOEA 1WDMA 4TZKA 4WNCA 3SJ7A 1EVIA 5KVSA 3C3XA 1MUUA 2X1HA 3WBBA 1DRVA 4IQ0A 1HDGO 1ZUD1 3EK2A 5A05A 2Z1NA 3DZFA 4CLDA 3OA0A 1RM3A 4U0JA 2EERA 1UDAA 5JW6A 1N2SA 4GMFA 3TL2A 1H2BA 2C82A 2A94A 2Y1OA 2C29D 4TZTA 4RPHA 3H9QA 4DQVA 1GYPA 2RCYA 3F9IA 4J4HA 5KIAA 1TB4A 1E7YA 4IJUA 4J1QA 3JQ6A 4R5MA 3ZNOA 4YBZA 5KVCA 1PU2A 1E3WB 2G5CA 2HJSA 1EE9A 1HKUA 3I9OA 3GPDG 5ICMA 3WGIA 4LRTB 4R1SA 2DQ4A 1DEHA 3PHHA 1RM4A 1I3LA 1R66A 3DBHA 1P1HA 3PK0A 3H5NA 5ICSA 1A72A 2DAPA 4FFMA 3OIDA 1MFZA 3GNSA 4PFJA 5A5FA 1JTVA 2V6MA 4RF3A 2J5QA 1LBEA 2DBVO 2Y1GA 2DVMA 3M6IA 2C2YA 4BUCA 1Y5RA 2BD0A 2D59A 5HS6A 3DOJA 1MXHA 3EVTA 3QA9A 4X54A 1YRLA 3SC6A 5JC8A 1XA0A 1ZZEA 2G82A 2CVZA 3GVXA 1NNUA 3JQGB 2ZATA 1B3RA 5GZ6A 1P1JA 4E2XA 1AGNA 2NLOA 4IY1A 4MVJH 3RC2A 5A04A 2VHZA 4HWKA 3OJEA 4J1TA 4FQ8A 1YO6A 1HDXA 4R51A 5JCXA 4ALNA 3EY4A 4IPTA 2JD0A 3DR3A 4DBVO 2Q2QA 3OMLA 4Y6RA 3UHAA 2E82A 3VPHA 4CL3A 4F45A 1MV8A 4CM9D 3LLVA 5EINA 3JCZA 1DHRA 4UUOA 3TZCA 3IP1A 4ROSA 2CUKA 4FFPA 2GPTA 2WYUA 2D8AA 1N1GA 3NV9A 4XYMA 3OICA 1CETA 1H6AA 1K6XA 4IMRA 3BIOA 2BFOA 1GY8A 5DBIA 3GFBA 4R9SA 4M49A 4B4OA 1KVSA 5C37A 1V0JA 2BH9A 5A1TA 4YRAA 1A71A 3MTJA 4RPLA 1BVRA 3GOHA 7MDHA 3I83A 1ADFA 1KEUA 2G0TA 4L9RA 4RPGA 1E6EA 1LQTA 1LNQA 1PS9A 4ZRNA 1HDRA 2OMEA 1A4IA 4CM9A 3F1LA 3FPCA 1AN9A 1NQ5A 2X7HA 4L74A 2CVQA 3D5QA 1XU7A 1DLIA 2AEMA 2NV6A 2R2GA 2CSUA 3OQ1A 4LMRA 5ITWA 1P77A 5TF4A 2YV1A 1Y9AA 2VCYA 4RGBA 1TI7A 3OJLA 3E48A 1E3JA 1RYEA 1T1SA 4MIOA 1UZNA 4NBVA 1XGKA 1GAEO 2R00C 4B7CA 3AI2A 3JQDA 3OFSA 1YWGO 1EUZA 1UP6A 3VVBA 2BFAA 4TKLA 5JXWA 3ONFA 4GGOA 4PLPA 1BRMA 3RU7A 4OMUA 5B12A 4D3SA 1JDJA 3A06A 3MJVA 4R1TA 2IRWA 4XGNA 2FN7A 3V1UA 3GT0A 1YKFA 5J23A 1Q7CA 1NQOA 3NDIA 1QORA 2VOJA 5CG2A 1HYGA 4XIJA 3FTPA 4IXWA 5I7VA 4GL4A 2EWMA 2P5YA 5I7FA 4BVAA 3AUSA 9LDTA 1IY8A 2YFHA 2ZCUA 3FNFA 4WK6A 3MEQA 4WGGA 3JQGA 1EDZA 4R16A 5BSEA 2ZYGA 5I8ZA 4UULA 4AJEA 1PZHA 1UR5A 4ILKA 5JFOA 2QX7A 5C7LO 4FJ0A 5U1PA 4U6QA 1HE4A 4DPMA 2BELA 4K28A 3CIFA 4N5NA 5FI3A 4DWVA 5L3ZA 2JL1A 1DLJA 4QEDA 2X5JO 2O23A 3WICA 3CINA 4RO0A 3WWYA 1NP3A 1SCUA 2HLPA 2VUSA 4WECA 3S8MA 2VQ3A 3PVZA 3I23A 4H16A 4I5EA 1H5QA 1NQAO 1P1KA 2EKQA 1PGQA 4OXYA 1PS8A 4BNJA 4CM8A 2PZLA 4BS9A 4D44A 3V1TC 3FSRA 1E3EA 3OA2A 3ON5A 1OC2A 4BNWA 1A9ZA 3DZBA 4W82A 1BXKA 4W7HA 2CD9A 4B3IA 4CUJA 1H2HA 2HMUA 4CMKA 1UXGA 4K6CA 1MA0A 3C24A 5EL0A 1PQUA 4CMCA 1YQGA 2EP7A 2V65A 3AUUA 4DYVA 4G81A 3DZGA 3C1AA 2BGLA 3PIIA 1PGJA 2QHXA 4CMBA 2NU9A 4HX5A 5A9SB 4BO7A 3WLEA 4GI2A 1ZK1A 3DAGA 4R54A 3VH2A 4WOKA 1XR3A 3VPGA 3WS7A 2Y0EA 2YDYA 3NDRA 1EUDA 1ZK2A 4OXNA 3VTFA 1IHYA 2WE7A 4GLOA 2R00A 3BMCB 1HETA 4N54A 4YJDA 2I66A 2PD3A 2Q2VA 4EDFA 3WSWA 1O95A 1U3WA 1PJ4A 1GYRA 3FNHA 2J6IA 3TZKA 5ENDA 1AXGA 4F46A 3RBZA 3SC4A 3PHGA 1NWCA 1UAGA 5A3JA 3FWZA 1NHWA 4PIVA 5LDHA 4MKRA 3QLJA 4UVDA 3W6ZA 1UXJA 1E92A 4B7XA 2A9FA 2YV3A 3PGXA 3LT2A 5DBGA 4NHEA 2B5WA 5IDWA 1Q7BA 2OP1A 4NBTA 4B4WA 1XEAA 1ZJYA 2ZCVA 7ADHA 3L9XA 5TJ9A 4E6PA 5C3MA 2DU8A 3LDHA 3IQDB 5B4VA 1OZAA 1EVYA 4IJWA 5JO0A 1I3MA 4UEKA 3MJCA 3VDQA 3R0IA 1YDWA 1U8FO 4CV1A 4CLOB 4IGEA 4E32A 3DTYA 5JYDA 4JJGA 4BNVA 1C1DA 3GFGA 5BNTA 2YV2A 4HXYA 1NAHA 4L4XA 3DEYX 4WNIA 1SOWA 2EIHA 3C85A 2HK8A 5JYEA 1BXGA 4A03A 1LJ8A 2NUAA 4BNXA 4D7AA 2GN9A 2WYVA 1FF9A 3I52A 1LRJA 4KUGA 5T8KC 3G3EA 1QV7A 2NNLD 3MJ4A 4D0RA 4WOJA 1EK6A 4J7CA 4KTTE 1R0KA 4WPGA 3KSUA 1H94A 2AQKA 3EAGA 3JYNA 1DIGA 4E21A 5IXYA 2FY8A 4XB1A 4CMIB 4RDHA 3QQPA 3QVWA 3T4EA 4LISA 2BI8A 2GR9A 4QUKA 4R3WA 4Z0PA 5H81A 4BQRA 4YYZA 1HEUA 1FDTA 1NHGA 1QMGA 4JIGA 4OH1A 2VRCD 1V9LA 2XXJA 1JKIA 1BW9B 3H5AA 1U1IA 1PJLA 2I65A 1BVUA 2AQIA 3ETDA 3KBOA 4B7UA 3H9UA 1ZSYA 3RROA 4AJ2A 4UEJA 3A1NA 1J0XO 3RBVA 4HFNA 1CJCA 2NVBA 1IZ0A 3BTVA 2CF6A 5CDSA 4O59O 4HV4A 3BMCA 3I9JA 2CF5A 3K2BA 3LT4A 4EUEA 4OHUA 4BO0A 1KC1A 1EZ4A 4FS3A 4PZEA 4JJIA 4WJZA 4QT0A 1U5CA 1PSDA 3JQAB 1A27A 2EW2A 2VRCA 4JP3A 4R01A 5B37A 4XX0A 4PG8A 5L4NA 4I5GA 4U6SA 5T6BA 1LI4A 4O63O 2AE2A 2GZ3A 2B5VA 2ZTVA 3KTDA 4JBIA 2VTDA 2J8ZA 2CDBA 3RI3A 2JKVA 3VVCA 2FPPA 2PZMA 4N18A 2EF1A 3ZHXA 1QXSA 2ZB3A 5L95A 4RF5A 4K9DA 3Q9UA 2P5UA 3U9LA 3WGQA 3WWZA 1HE2A 3DWFA 1P33A 3JV7A 2GRAA 1MC4A 3KEOA 2UUOA 1PJ2A 3PXXA 3I1JA 4PG5A 2BFMA 3T7CA 4I9HA 3TSCA 1GCOA 4GH5A 1P44A 4YB8A 2O3TA 2BLLA 4Q3EA 3WMWA 1A5ZA 2OOSA 4PG7A 2W2KB 1HRDA 3V2GA 1PJBA 2XXBA 5H83A 1I10A 3ROKA 1LLCA 4ZN6A 1EQUA 3PTZA 1LDMA 1PL7A 2PH3A 1DDOA 1J49A 5T8KA 2CNBA 1EE2A 3PLNA 4JK3A 1CF2O 3HDHA 2X5OA 1X0VA 1VKOA 3PIDA 4AJLA 4ID9A 2EGHA 1ENOA 1PJSA 4CMIA 1LQUA 3U0BA 1D3AA 1GR0A 1ISIA 3PQEA 4YACA 3JQAD 3QSGA 1RYDA 1T2FA 3L6EA 4GX5A 4U7WA 2FPGA 3JYLA 4DA9A 3ZWYA 1UJMA 1YONA 2OXIA 3ONDA 1GV0A 4E30A 1YL6A 1Y8RB 3C1TA 2GCGA 5JAQA 3QWBA 1PS0A 2Q4BA 2O48X 5CEFA 2GO1A 2RIRA 3RASA 1WDKA 3NUGA 2JFFA 2VWGA 4B3HA 4TQGA 1B16A 1G0OA 2ZB4A 1JAYA 4YAGA 3FPLA 3RC9A 2YHIA 2NTNA 2P91A 2QRJA 2QRLA 4L75A 4YAKA 1ZEJA 5JLAA 3QWIA 3NTOA 1N1EA 2Y1CA 2Y0CA 5BT9A 3FD8A 2NU6A 5JE8A 3UCFA 4AL4A 3L9WA 4CM5A 2ZTLA 1AUPA 3KYCB 3GDOA 1B8VA 1N5DA 3W6UA 4YT4A 3VTZA 2PGLA 2J3HA 4OYRA 2H6EA 4XCVA 3PI7A 2AHRA 3WYCA 3ROMA 4CQLA 5KVVA 4ND5A 2EV9A 2W8ZA 1N9GA 5A9TA 2VYVA 1OMOA 4IDGA 3D3EA 4RPJA 5AXDA 3INRA 4FGSA 4GKBA 1U7HA 2P9GA 1ONPA 2O3RA 3DZKA 1I24A 1AHHA 4MOWA 5G0UA 1UXKA 3A14A 3TFOA 2J3JA 2W2KA 1M2WA 2JJYA 5BR7A 1U4OA 5IG2A 4FDAA 2AMFA 2PA3A 2Y99A 4GWGA 4NBWA 2VZ0A 3PEFA 2Y66A 4XR4A 3RSHA 2DT5A 3D4OA 5KJCA 1V3TA 3U5TA 1ZBQA 3HQ4O 3ZDFA 4KUHA 5L45A 2DBZA 2GNAA 4ONEA 2FZWA 5T5QA 1U8XX 5COQA 1RJWA 3RUIA 4BNTA 2BHLA 3AY3A 4E2YA 4FBGA 1E3IA 4RDIA 1KVRA 4DYDA 5BQFA 4ITUA 2X0IA 4MPDA 4CLEA 3L6DA 3MCVA 1YBVA 4NJMB 3O03A 4H15A 3WQRA 4D42A 5K6AC 4OO3A 1IULA 4PZCA 3EUWA 1F06A 4BNYA 1OAAA 2OL4A 3DDNA 5TX7A 2QZ9A 4GX0A 4LCEA 1Y8RA 1SOVA 1DAOA 3I3OA 4Y8VA 1IB6A 4I5DA 4JBGA 4BL5A 1BWSA 2EP5A 1JWAB 4EGFA 2NSDA 3ENNA 1CQIA 4J7XA 3UAGA 1LU9A 4NBUA 4B8WA 1C14A 1L7EA 3DL2A 3I4CA 2ZQZA 3FBTA 1VJ1A 2UUPA 3JQ9C 3ZWVA 5GZ1A 3ST7A 3B1FA 4FR5A 4MDHA 1SC6A 3CSDA 3V1YA 4PLFA 3MJTA 5BNFA 3DO5A 1S7CA 1U5AA 1RWBA 4W4TA 4XZ3A 3IAHA 5DN9A 2Q45A 3W4JA 2P9EA 5A03A 1V35A 2Z5LA 4YJHA 3AU8A 3BMOB 3BXXA 2C07A 1WZIA 1MB4A 2DFDA 4YXFA 4FFOA 4MKZA 3AUTA 4FFNA 3W1VA 2V6BA 1XSEA 1P0FA 1OC4A 2C54A 5A02A 3GC6A 2NADA 3H5RA 4Z3KA 1LSJA 1R12A 2JFGA 3ZV5A 4YR9A 4HNHA 2WMDA 2IZ1A 2HRZA 3CZMA 3TL3A 3R6DA 1NAIA 2B4RO 1KVQA 2B4QA 2WD7B 4BV8A 3WXBA 3AW9A 2UAGA 3PPIA 3V2UA 5HRUA 4JGBA 4Q3BA 4TKMA 4TWRA 3OF2A 4JQCA 1HWYA 3BTOA 5F5NA 2YY7A 4IS2A 3PRJA 2JFHA 5CG1A 1FDSA 1DFIA 2QG4A 3G1TA 3RUAA 1P74A 4P4LA 3HDQA 5DULA 4QQRA 4KDFA 4RQUA 2NU8A 3Q2IA 5L9AA 5F21A 1VJTA 2JD1A 2ZJ0A 3Q6IA 3BHIA 2HMTA 3U49A 4PGFA 4ALMA 3U4CA 3KYDA 4RVDA 1I3KA 2EKPA 3NTRA 3HWRA 4FC7A 4C7JA 4I9UA 3L4BC 3PHIA 4I8XA 2W4QA 3NT5A 2PD4A 4DXHA 4LVUA 4W6ZA 2D5CA 1NFQA 1YE3A 5DP1A 4TRRA 2HO5A 4PZDA 4ESOA 1B0AA 4BNHA 5ER6A 4E5YA 4L76A 5K6AA 3JTMA 4ZQHA 1SMKA 2Y1FA 1U2GA 3FBGA 5L53A 3WX0A 3MTGA 3OEYA 2G76A 1C1XB 1C3VA 1K3TA 1ML3A 4TMFA 3TFQA 4HFMA 4BO9A 3C7CB 1Y8QA 1B15A 1IYZA 1HLPA 1I33A 3JQ9A 4Z9FA 4ND1A 2W90A 4J91A 1ZKMA 1Q2XA 4Q3NA 3TZ6A 3JYQA 3UKOA 3LLSA 3AY7A 3BMOA 2I5PO 4QXMA 5CHEA 4CLXA 2NVWA 3I6IA 1LC3A 1ZH8A 1QR6A 2PV7A 3OJOA 1EVZA 4NNJA 3VZRA 4RVHA 3WNQA 1UP4A 4J4BA 2DFVA 3WLFA 1UZMA 4O5OA 2HJRA 3VDRA 1MX3A 3KOUA 1ZCJA 1GU7A 4NQZA 4ZD6A 4LSWA 3W8FA 3D0OA 4AVYA 2GERA 2GGSA 4DBZA 1DRWA 5G0SA 4CM3A 1XG5A 4W9NA 3L6OO 3MOGA 3QP9A 5IDQA 4D0SA 1E7RA 4II3A 4A73A 2WM3A 3JD1A 4YJFB 3Q9NA 1C0LA 5DCWA 3SVTA 1F0YA 5IZ4A 2AEJA 5AYVA 3ZW8A 1I5RA 2ZYAA 3DZJA 5EESA 2Q50A 2AEFA 3ONEA 3GUYA 3RFXA 1EBUA 3B20A 3OBBA 3H2ZA 4TROA 4TVBA 3ZWXA 4J2OA 1T1RA 4EYEA 1YJQA 5JDIC 4BKUA 4BGUA 1PJQA 3NDJA 1R16A 1VRWA 1D7OA 3KO8A 1EVJA 3LC2O 2UDPA 4OOFA 1P31A 4A7PA 3LT1A 1UXIA 3ZGYA 4Q3CA 2GZ1A 2VWPA 1EK5A 3L4BA 4WE3A 4WCFB 1E1KA 4BO2A 4NG5A 4XDZA 1HL3A 1GQQA 3KHUA 1ZEMA 1B7GO 1EEHA 5IJZA 2OFPA 3ZNPA 1C0PA 5HWSA 2DUUA 4BKRA 1T2DA 3RIHA 3WYEA 1PWZA 5H82A 1N92A 3CEAA 1GDHA 1I0ZA 3TZHA 3LYLA 4ZU3A 4CLHA 3ZHZA 3NAQA 4CMEC 1E3WA 5F3RA 3VH3A 3WTCA 5THQA 3RQSA 3N58A 1XCBA 1HE3A 3LK7A 5JPIA 1YB1A 4L4SA 2PTGA 1GZ6A 3ETEA 3VPXA 4MP3A 5JDCC 3AK4A 5GY7A 4BB5A 3DOCA 1DXYA 4XD2A 1BSVA 2YFQA 1JLLA 1NYTA 3GVHA 3P2OA 3ANMA 1PJTA 2C59A 1KS9A 2AW5A 1WPQA 1LSSA 1LLQA 3RJ5A 4A10A 4S3MA 1OBFO 4M1QA 3H3FA 3STHA 1YH3A 1LX6A 4QO8A 3LC1O 4IDFA 1UDCA 3G79A 1H9AA 3JQ8B 2GSDA 1U3UA 3WMXA 1GUYA 3LSYA 2YQ4A 5U9CA 1B3BA 1O89A 1N7GA 1ZSVA 4R5HA 3U3XA 1XLTA 4UUPA 3IP3A 2GYYA 4Y6PA 3RFTA 4EEXA 4D79A 2Q1WA 5AVOA 2CVOA 4LCJA 3K30A 2F00A 4KQXA 3F5QA 4NBRA 4EJ6A 3ZWAA 4QSMA 4FOOA 1YVEI 4GMGA 3EW7A 2GF2A 3UXYA 2FPIA 3ZWBA 2I6TA 1T26A 1LLDA 1KYQA 4UUMA 1ARZA 3QHAA 3BHJA 1Q7GA 4J6FA 1HYHA 1KVTA 2JCXA 2FWMX 3Q11A 4CV3A 2D0IA 3WGOA 5KOIA 1DC5A 1HE5A 3M2TA 4XQCA 2VRBA 4BMVA 1Y81A 3QJ5A 3WFIA 4J90A 2RHCA 5JDIA 4J43A 1XYGA 3M1AA 2FR8A 2YHUA 4IGFA 3TOZA 4DREA 3NRCA 2FP4A 1H93A 3CPSA 3KM0A 4DMMA 3K2EA 5COBA 2VWHA 4IQGA 2YW9A 3G1UA 3BMNB 4M8SA 4AICA 4FB5A 2Y67A 2IXBA 4QFDA 2HRBA 3F3SA 1CEQA 1G6KA 3I9KA 5EPOA 2ZB7A 2GLXA 4ZA2A 2OORA 3E5MA 1ZVMA 1CQJA 1DJQA 1E7QA 4WCDA 1Q1NA 4OM8A 5DNAA 2HAEA 1KEPA 2WD8A 4Z9XA 3AOEC 2PKQO 1VL0A 2CY0A 2TMGA 4MVJI 5A3VA 1LTHR 3E1KA 4PLVA 4YAJA 3R3JA 5KJ1A 2EEZA 3D1LA 2A92A 4XYEA 2WTBA 1GEGA 4RF4A 3ZV3A 4CMEA 5L4SA 1R0LA 1E1MA 1UP7A 4WEQA 5KCZA 1YB4A 2QRKA 3VC7A 1A7AA 3FN4A 3TNLA 3E6AA 4CV0A 4S1VA 5I9MA 1E7SA 3GRKA 1TVEA 3D7LA 5JDCA 3UCXA 5G4KB 3U09A 5EMHA 1X1TA 3WFJA 3S55A 3DB2A 4NFHA 4CMHA 4XYLA 1ADGA 5DOVA 1E3SA 2X58A 2DLDA 4BNNA 3BTSA 4OIMA 5TT1A 4CPDA 4KWHA 1YOVB 4JN6B 1NFFA 4MVJD 5IXSA 5I7SA 5GMOA 2FZEA 3TF5A 4DQUA 3B1KA 2C7VA 4R68A 1VKNA 1QKIA 3H4VA 1V3VA 3ROQA 3HHPA 3DBVO 4YQZA 1P0CA 1UZLA 2C5AA 2O7QA 4M54A 3ZH2A 4BO1A 2TMDA 2NACA 1JAXA 2VUUA 1IZ9A 1Z6ZA 3AFNA 1VI2A 3GVPA 3PJGA 2YQ5A 4ZQBA 1LDGA 1I8TA 4YDRA 1G1AA 4EJ0A 2ZYDA 1FMCA 1NVTA 2IDZA 3KETA 1YQDA 5JC1A 2NTVA 3Q3CA 5IAAA 4Z0HO 3GN2A 5BNIA 3DQPA 4J0EA 1ZIDA 5CPBA 4F3YA 4BOYA 3UGKA 3GDGA 3GGGA 4XQ9A 4WUVA 4XGIA 4GVLA 5DT9A 4EITA 4XQGA 1E0DA 4B4VA 3JD3A 3V5NA 1CRWG 5CFZA 3VPFA 3ZU4A 2J5RA 2Z95A 3OH8A 1JVSA 1HT0A 2BI7A 2I67A 3QWHA 4KZPA 3GPIA 3CUKA 1K5HA 4RCVA 3BYZA 3RFVA 3S2GA 3GZNB 3EC7A 4AJPA 1DOHA 4IJVA 1ENPA 2IODA 3RUEA 3BMNA 2X0RA 4GX1A 2HKIA 3PHLA 3W8EA 2P2SA 2H1SA 2GUGA 3UICA 4ALJA 3P7MA 3QRWA 1B2LA 1PJ3A 2DTXA 1D8AA 4KDEA 5A9SA 4UUNA 4E0BA 2VUTA 1GD1O 4DC0A 3CMMA 4WASA 1PTJA 4E31A 1ULSA 4E5MA 4BGVA 2J5KA 4DPKA 4IZIA 1IUKA 3AOEA 3W4KA 4JNKA 3A28A 4A2CA 4DGSA 2LDXA 4RORA 3PWKA 3ZZNA 5ES3A 3PHJA 1KVUA 2UV8A 3H8VA 2P68A 5EERA 5U4QA 4INAA 5JCJD 4AG3A 1SEVA 2DC1A 3QWFA 4N7RA 5JS6A 3AI3A 4HKTA 5BSFA 2V6GA 5G4KA 4RQTA 3WTBA 5C5IA 2WEKA 3SLGA 1OFGA 3C7AA 1LC0A 5IDYA 3RKRA 3U62A 4MIYA 4YQYA 2A4KA 4DRYA 1F17A 2HQ1A 3LT0A 2IZ0A 2X4GA 1YOVA 4GLLA 4HBGA 4O0LA 4EJMA 3GF4A 4RF2A 1NVGA 3A4VA 1QLJA 4CODB 4YRDA 3KB6A 3L0DA 1IL0A 3WGHA 4CLOA 3W4IA 1YJ8A 1ZK0A 4FPXA 3HFGA 2EGGA 4M89A 4E5PA 4NDNE 1XWFA 4CM6A 3RAJA 1SO8A 4BNIA 5FF9A 1PQWA 4DIBA 3PQDA 3MJSA 4BB6A 1PZEA 1W6UA 3BHMA 4RVFA 4EW6A 1FDVA 3INTA 3H7AA 2E49A 2ZJ1A 1ZO8A 3DHEA 1F14A 3DBLB 4J0FA 3DONA 3TZQA 2FSVA 2E37A 3GNTA 3WJAA 4CMGA 4UVIA 2VN8A 4UVHA 3MZ0A 3WQSB 3WR5A 5CEJA 1T4DA 4BKQA 1PQPA 5IN4A 1GZ4A 5B1YA 1NM5A 1QP8A 2YDXA 1T25A 4H7PA 4D46A 4M55A 6ADHA 3EDMA 1J6UA 3L4SO 3WSVA 5JAIA 3FWNA 1I2BA 2PLAA 5EQDA 4FFLA 4ZICA 3P2YA 2OO5A 1NPYA 1E6UA 1BW9A
chains in the Genus database with same CATH superfamily
1RWXA 5JZSA 4YRQA 1Q57A 1L7PA 3B78A 1BYIA 3EGIA 3G0OA 1SBCA 1XQXA 3AM5A 3MBOA 4LHVA 3HYRA 1Y4ZA 4GE0A 1F12A 2OD9A 4MYSA 1XA4A 3ILYA 2WFLA 4H6VA 1ZXXA 3ILVA 3SQWA 2VJMB 4AN4A 4DV0B 1QH1A 5FORA 3F5SA 5FTKA 3ETNA 2V5AA 3QFSA 3IOMA 2GD0A 3W06A 1WJGA 3SKYA 1CWUA 2B4TO 3C3JA 4GPTA 3ZGLA 4ERXA 2JKYA 3FSJX 2AWOA 3WADA 1N0UA 3E9ZA 1UWLA 4DL9A 3AI1A 3JVEA 3F8SA 1YGPA 4QBHA 2WMYA 3L07A 2RK6A 1OOEA 4MVYA 1FCJA 5EHZA 5M5BA 4WSOA 2J3IA 2ZZKA 3UK6A 4HB4A 1YHYA 4KQIA 1XZHA 2I03A 2XTAA 4NARA 3O4GA 4EVSA 4J1NA 4UHJA 3PJDA 5K3BA 4NNPA 3ITDA 1AV6A 2I1WA 3Q7PA 2V97A 4OJMX 3JQAA 3IPXA 3KLMX 2VYQA 2CXSA 4I1VA 2XPCA 2CNWD 4IIVA 4WBSA 2W98A 4JYMA 2XHZA 4DZZA 1M66A 3TLAA 4EG0A 1FJXA 2Y6VA 5CIWA 4PGAA 3RYHB 4B74A 2ZTMA 1QO7A 1QLHA 4FOSA 4AI6A 4ZYZA 2IUSA 3ETJA 3PFGA 1J2RA 1V6AA 3BRQA 1DWUA 1F9EA 2GJAA 3GJYA 1Z5ZA 2EXXA 2VWQA 4RKWA 5F5LA 4YRZA 3GYGA 4CQMB 5ELLA 1EJ6A 3JYPA 1KAEA 2I1LA 4ZV4A 5HTOA 3I1IA 4MB2A 3AF6A 1IJKA 2OCXA 5MGBA 3GLRA 1JXQA 2D4AA 2D2IA 2D2VA 3KU1A 5C35A 3EXIA 3B2QA 4I19A 1OFIA 1RQ2A 2AWNA 4DBLC 3FUUA 3RAPR 5BXQC 1RMTA 2DR3A 1FFYA 4JXKA 2IX9A 3OM9A 4YJGB 4AIIA 1D4FA 3SQMA 1FMFA 4F56A 2DZDA 5GM1A 1I01A 2G1JA 3FDIA 3UWMA 2XBMA 3F7MA 2XGMA 1MO6A 4TRMA 1PUIA 3MF4A 4YK7A 1QIKA 2VP3A 1EIZA 1ZWLA 2BDEA 3D4IA 4XVRA 4G2TA 1DQZA 1MGOA 2Y9MB 1YBMA 3HVRA 4X6LA 1QYVA 1AUXA 3DAFA 1VL6A 4MPJA 1SJ9A 2F3SA 3GRUA 3LPNA 3RKUA 1I3NA 4H3HB 3AU9A 3ZVMA 4OKNA 5C7IO 3MJFA 1UFQA 2GF9A 4DA7A 4OXKA 2JPDA 4MUIA 1CKEA 1O94D 1W0KD 2F8TA 1XAGA 3NHJA 2RB5A 2YY5A 3NNSA 2DFKB 3Q5EA 2QX9A 3QWAA 3HHEA 2FX2A 3B3GA 5DN6A 5J1TB 4KGXA 3AHCA 2CLLB 4O6VA 5CPFA 3T94A 3ZV7A 4CL8A 5AW2A 1C9KA 1TQ2A 3FCSB 1TFRA 1YQXA 4CXMA 2YZ7A 4JJFA 1LD3A 5AJYA 4R9UC 3COJA 4HAWA 5JMWA 4MDFA 4JA0A 1QQ7A 2BLNA 4F5WA 2CBXA 3JQCA 4ZDIA 4NECA 1G42A 5LBIA 3W5CA 5CFLA 1T1JA 3L4EA 2HFKA 5A0FA 3UC5A 1G2PA 2E6UX 2FE1A 3DFIA 5KYXB 2OBYA 3AFMA 4Z6KA 5E4FA 2P4UA 1ZI8A 3FPFA 1KS2A 3QEKA 4R4JA 3CX4A 3EC1A 3TK1A 3VYUB 4KGDA 2W6CX 4N0MA 1YU6A 2RIPA 2GFIA 1SKUA 4M60A 2DERA 1NQUA 4I9NA 3HABA 2DBQA 4WDRA 3RHFA 2E5WA 4PN7A 2O54A 1DAHA 3GGJA 3I9NA 3W7AA 1NTOA 4PIMA 5CH8A 5IYZF 4C88A 1NNSA 1N6HA 1YR6A 3KPJA 4U7HA 2BFWA 3JYOA 2VKQA 5DOZA 2HF2A 2OBFA 4P7BA 1O97C 1U0HC 3C3PA 2JF0A 10MHA 2CMDA 1PGNA 4KTVE 2F1HA 3H83A 4QD3A 4I1YA 2JLUA 3TQRA 3G5LA 2FMUA 2I3GA 3OIGA 2H1WA 2WAMA 3EZYA 3AM3A 2HEGA 2IHTA 3KPYA 2OQVA 5MF6A 2BJVA 2ADOA 1UMDA 2I80A 1VCOA 1SVOA 2CFIA 5EXEA 2I76A 5DTJA 3WNVA 5BPHA 3ANNA 4QELA 3IQHX 5DGCA 5TNXA 3T3PB 5CCEA 1Q0TA 2EEPA 2SHKA 4LC0A 3RYHA 2C9CA 3T9AA 1ZNQO 2C8LA 2FOIA 1YAJA 4QU8A 4WLFA 5I5EA 4ZAYA 4O4LA 1AKEA 1Y82A 3FZNA 3SE7A 1G3IA 3E05A 4HNTA 5TSDA 1C4KA 1Y89A 4OXRA 3U6KA 3TBHA 3FOCA 1BWQA 1H8EA 3UN1A 4EUSA 4RIGA 2B2CA 1PWHA 3BD7A 2PANA 4X63A 5CDYA 1U9YA 1IXSB 4YJGA 2IYFA 2AZXA 3LZCA 3QVSA 1A5SB 3BZWA 2E85A 1WUJS 3O84A 1LW6E 1BD3A 3JQBC 4RK0A 1M67A 2JHAA 5TDHA 1J42A 4JJZA 1APBA 3LNCA 2JCSA 1TLLA 4AJKA 4BE7B 3H17A 1VLZA 1CFZA 3M6AA 3C41J 1X1AA 5TE9A 5LYJB 2PZKA 2Y1XA 5JY6A 1GSIA 3R3ZA 3WYDA 4BNMA 1IHDA 4ND4A 5C18A 4CETA 1WXDA 3FKSD 4HXGA 4RMIA 3RWBA 2OSVA 4BGIA 1ZD8A 3QE0A 4MO2A 4URFA 1NR7A 4MR9B 2ENUA 2W43A 2WY2D 3GFSA 4ZDWA 3H1AA 4KXVA 2I8CA 4TRJA 5K6TA 3BE5A 3O8OA 3UAYA 1V16A 5G2OA 2UZ1B 4XQ0A 5DHUA 3BXFA 2IHVA 1QPBA 4G0XA 4RZSA 2XF8A 3N7AA 2EQBA 5DSTA 2A1TR 5ALIA 1WVMA 1R0XA 4WKPA 1IBMB 4JUFA 5F64A 2R68A 1TK3A 1ZG3A 3SHWA 5C7OO 4C04A 2QL6A 4BKOA 2B37A 2AH5A 2PWAA 4MQFB 5AT1A 3NJ8A 3SLKA 4P1ZA 3WYGA 2BTQB 3FB4A 4MINA 5IDXA 3D64A 3GLQA 2L42A 1UOOA 4CKCB 2WB2A 4X84A 3OZXA 4FYKA 3INGA 2FGKA 2CFOA 3NWPA 3OZ7A 2NZYA 3KFVA 4AULA 3LTNC 1CS4C 3KCQA 2ILTA 4IF6A 1EKXA 3KVOA 3CJQA 1CR6A 3P1JA 1OQAA 2JC3A 4L3VA 3ILXA 2FR1A 2GD1O 2RHGB 3WK4A 4YV1A 1B1AA 3ZNNA 3T7TA 3LHFA 4CCYA 2VJKA 3L49A 2O4UX 3AHJA 4JVOA 2GFHA 4Q6BA 5KTMA 3OSUA 3IJEB 1CP3A 2QQEA 2BCGY 3PPWA 1FVXA 2XYRA 1R5OA 2OV1A 4G2NA 4UAJA 1TF5A 3FRJA 2YWJA 4QEZA 1B14A 4QA9A 1NBME 3Q9LA 1RJDA 1SHTX 5DXAA 1EUCB 4DDVA 3B1YA 4YMVA 3E1GA 2V98A 3OKPA 5ALPA 2XODA 3CH5A 4ZV9A 2ZXFA 2MSDB 1A7KA 1OLUB 2O0KA 4B81A 2WWGA 3SYMA 3B60A 2O50A 3UVEA 1SD1A 5KJ6A 2YVQA 4KQMA 2CZQA 4PY2A 3K8ZA 5LKAA 4BVJA 4BKMA 5DM1A 3HA7A 4CL2A 2HB6A 3HJAA 1OASA 5A06A 4IDPA 1DPFA 1T4GA 2BFBB 1RKVA 5LR6A 2QR5A 1SUDA 3FHLA 3GJ4A 1QK4A 1X9HA 3SC3A 1B26A 1YQ9A 1CUDA 3COSA 3KS9A 2IY9A 4LA4A 3T7SA 2FMHA 3DLTA 1YMVA 4Q48A 4E70A 2XWQA 2I3AA 4UAUA 4CTJA 1M2VA 5B3LA 4B79A 1H2RS 1KEZA 4PBTA 1NBMA 2MTBA 1WW2A 1JDUA 4BQFA 2F4VB 4MGEA 1E3TA 4FSHA 4PC6A 2BJWA 3QVJA 1XQ6A 1SNYA 1J2JA 4RVOA 4WA7A 5LZ2A 1AT1A 5DHSA 5GTDA 1NVBA 1YU9A 3H1BA 1NP6A 3H2SA 5JJ5A 3OFKA 1YCFA 1FMTA 4MWOA 2Q1UA 2UZ1A 4XJSA 5FLEX 4JQSA 5KAPA 1CYDA 1ZY2A 5BW8A 2PR2A 3ADOA 1DKNA 1ZSNA 3R6WA 3NHKA 4WCFC 4UZSA 1U1DA 5DPMA 1P73A 2X2FA 2QVGA 3C6KA 3Q8KA 3VDNB 3I62A 2WPDD 5G0VA 4MQFA 4DLAA 4UTNA 1HSOA 3WL5A 2YZ2A 3CBGA 4B4KA 4C03A 3UK1A 4NZZA 5JJCA 3BERA 2HIMA 4CKCA 1RFLA 3COPA 3DCIA 4PLTA 1E1DA 1KQOA 1C3OB 1CLEA 1MNAA 1V8DA 1Z5PA 2QY6A 2W2XA 4R8VA 4AJ1A 4HB3A 4F8EA 3L1KA 4AIRA 2QTNA 1R6UA 5KOHA 5LMUB 4XIGS 1TAUA 4F6LA 4IDQA 2ZBQA 3OU6A 2N1BA 1CEYA 1RPNA 4QULA 5DCUA 1C1XA 2BMAA 1JWBB 4U9HS 5AQEA 1PZFA 4AJ4A 1R2QA 4ZI5A 3JVDA 4E5KA 1CPYA 5DSXA 4RLSA 1O0SA 4X1YB 3CG0A 3ICVA 5ICCA 3A2KA 5T4BA 4LMPA 3CNEA 3M5CA 4PSVA 4DJFC 5DGTA 1RC0A 5CDUA 4QDTA 4IGKA 1GUFA 1ATIA 4AO8A 2I3ZA 4Q4AA 5FWNA 4P54A 2GXQA 3MHTA 4LFBB 2ZYRA 2B8WA 4RHCA 5KNLA 3TVDA 1L5GB 3IC5A 3ENWA 4I36A 3RS4A 2H07A 3OMWA 2I6UA 3U3ZA 3Q7IA 1KDOA 1X87A 2DOKA 2H63A 4R8MA 3T9BA 2A78A 2H8KA 1S89A 2P4QA 1GUBA 3ETGA 3OEEA 4E5UA 3NBFA 4KXMA 3L1JA 2D62A 1EUCA 3QLVA 1E94E 3BFVA 4M9UA 4QU9A 5M2QA 5JZMA 2KLHA 1U0SY 3ZW9A 2V1UA 3BN3A 2QDXA 3RRMA 2V3CC 2O2DA 4LWZA 4PZUA 1SGWA 3PYLA 1RMQA 1OLUA 5HGJA 3R5KA 1BVYF 2YWHA 4HY3A 4E08A 5AW7A 5AHOA 1L4NA 2XXAA 1CR0A 1NFRA 2Q7XA 4P81A 1DIBA 4P82A 2BWJA 5EFOA 5KO2A 2Z08A 4UHBA 1V6CA 5IVPA 1U7PA 1CY2A 2JLQA 4QL3A 1G64A 5ALEA 4GF5A 3T8YA 1JFSA 2DLCX 3WIDA 4QHTA 3F47A 2BFBA 2ARKA 3KJNA 2E7ZA 2EFJA 4IWXA 4X3OA 4Y2JA 1C9MA 2BUAA 3TW6A 4L0MA 5EMLA 4DFDA 1H22A 2ZULA 2OCPA 1JALA 1NXWA 3BGSA 1BU5A 3C7DB 2D5AA 4U0KA 4U2GA 5EJ2A 4G8CA 3BWMA 2OD2A 1P4JA 4IUYA 2GZ2A 1FXSA 4V0OA 2B1RA 1XB2A 3PQ5A 4MW6A 3RHZA 3TAUA 3ZI7A 1QIDA 3QBVA 4YUZA 5SY4A 4QVIA 2W9XA 3KOOA 3L8HA 1W1WA 3PNMA 4YJFA 3D8HA 3R4CA 3VZBA 4KPYA 1P80A 1V47A 5HOQA 5JPCA 2RGRA 3KC2A 3WLPA 3EFOB 2QE7D 2GS9A 4GYWA 3RDPA 2WBLC 1DU4A 3HU2A 4ENVA 5BSMA 1WULS 2C2KA 3LXXA 1XTUA 3O93A 4A0QA 4CMAA 1U7TA 1YB7A 2ZRQA 3PSHA 1H65A 3THYB 2ID4A 3A37A 3VH4A 4CF3A 3WOHA 4B3JA 1HT3A 3ABOB 2DJ5A 2IKQA 1SZCA 3DVSX 2VYFA 3GRYA 4NMMA 1XRMA 1MVNA 2HK7A 3DO6A 4P34A 5EHXA 4ZTBA 3SJAA 2X76A 3E61A 3GARA 1CUVA 1CZRA 1M6WA 2PYZA 3IHTA 3O8LA 4LMAA 4QXAA 1OI7A 1EZZA 4DJ5X 1MDBA 2QI9C 4OQZA 3I30X 2CWWA 8ADHA 3FVRA 3HJHA 4JLMA 1MLDA 3KRTA 3SQLA 4RJTA 3DCNA 3IELA 5DTIA 1W49A 3EQ6A 4QAQA 3ZPXA 2WAAA 4JH0A 2LIPA 3UAZA 1Y7LA 4IIXA 3DF7A 1FUUA 3UPUA 1C9NA 5LXTB 2ZT6A 1OR8A 1WNTA 2J9ZB 1C3OA 4HTFA 1H2WA 3PSAA 4G65A 5KWSA 5NLLA 3QBEA 3V6MA 5L7WA 1KPGA 2DWCA 2H4XA 1EDDA 2IXFA 1CBUA 2QTLA 2YIDA 3FGNA 3OE4A 4R3NA 2IW3A 4U1RA 1I36A 1ICIA 1WZNA 2X13A 4FFBB 4FXOA 4MAFA 3ZWCA 5BR1A 4V2UA 3RYCB 3VU8A 3A6LA 2VHEA 3C3EA 3R24A 5BSKA 3I6ZA 4P3PA 5KSWB 5J1SB 3V3TA 3KUXA 1NNI1 2VTEA 5K0ZA 2UYQA 2ZWMA 1LRKA 1FL9A 2G9RA 5BUCA 3EW9A 5JADA 2IA5A 2BFNA 1F8UA 1KOJA 3QI2A 2CZCA 1R0ZA 4YRGA 1RBMA 1KY4A 4LK3A 4RULA 1QH8B 4HB0A 2WE8A 3E22B 4JLVA 3QNWA 4BPRA 1AN0A 2AFVA 2WSBA 4K6FA 4I3HA 4P0TA 3GR6A 3DMTA 1VE9A 2MSNA 2ZRFA 1GUAA 2VKTA 3DDWA 3VNUA 4NL4H 4RPIA 2XZPA 2EQ5A 1NLUA 4JSTA 4XE5A 3RSOA 2EZTA 2WJWA 2BFFB 4FKBA 2QAJA 4HVTA 1QV9A 1LA2A 1RVV1 3ICCA 3FDZA 1GEEA 1PJZA 3OY2A 2P2DA 4FSXA 3VPSA 3BF7A 1IWPB 2I54A 3C0KA 3BGOS 3FR7A 3GW8A 1QWOA 3KB8A 3GD5A 2V6JA 1XTVA 4OBXA 2A1UB 4U2BA 3NONA 4XUGB 2JRLA 3WXMA 2YWXA 5IHXA 2PT6A 4B84A 1FFSA 1O6BA 1Z0DA 2I2AA 1MW9X 1ZMBA 4KPFC 1WP9A 3RB8A 2EG9A 1UM9B 2JAWA 1L5ZA 3E2MA 3NTQA 4N3NA 2FPPB 3RKSA 1PFWA 3I9LA 4GUAA 2F43A 1RQXA 3EX7C 2X6TA 1PZGA 1U6IA 4WOPA 1E2PA 4H08A 2WB4A 3T95A 1I0IA 3U4AA 4OFZA 4BQSA 3M49A 5DX0A 3ELYA 4BAUA 3PDUA 5KX5B 3EFOA 3GMDA 2IK8A 2I7DA 2I4IA 4UVEA 5IT4A 1NL3A 4BMZA 4Z1MD 2ZUFA 3THYA 3BRSA 3BAFA 2Q7DA 4E1AA 2V7EA 4L7QA 4FIDA 3MT8A 2CNDA 4OCZA 1FTGA 1L1QA 4MVJG 4HGZA 4BNFA 1NXXA 3GK3A 4Z2YA 2D7DA 3PR1A 1BE0A 1DARA 1PJCA 1SUAA 3VHXA 5BSWA 1NV9A 2Z9BA 1QVRA 4WZZA 1WKCA 2QTRA 3M1YA 2R4UA 3SZOA 3WB0A 3W3AA 3JASA 2IPOA 4HQKA 4GPBA 1K7FB 3GCDA 4A5SA 3ZD9A 1F4PA 2FRDC 1AK1A 2ZJOA 3L06A 3L0SA 2HBYA 3V80A 3RYTC 2YQZA 2J9RA 1CUJA 4V0NA 4WL0A 5JECA 3GL9A 5LXTA 1SBTA 2C0PA 2Q5JA 2R7LA 3H0CA 4XGKA 1ADCA 1BWPA 4FFWA 2C7GA 621PA 4I14A 5A7GA 3H1PA 4YP6A 4FFBA 3D3NA 4A82A 2D1RA 3OE1A 4ZIRB 4L78A 4BO4A 3RYCA 1Z15A 1G2IA 1PEDA 3DUFB 3GBPA 1C30A 4N5DA 2YMLA 2VF7A 1CJSA 3SJZA 3I64A 2FPGB 1JEDA 4RNCA 2NYRA 3SDZA 2ZBFA 3SFVA 1JG1A 3Q3VA 2AS0A 4IDEA 1HDYA 3E8MA 1DPGA 4B46A 4GECA 3UUWA 1LQ2A 4JL8A 4B4UA 1HTWA 1JT9A 3RUFA 4V1CI 1TUEA 4ZPJA 1LGYA 1SQ0A 2G1UA 4F3NA 2QVXX 2P1ZA 2DPGA 2XUQA 2SECE 1J9GA 4EY3A 3HG7A 3FOFC 4D3XA 4OATA 4PEVA 1OFVA 6YASA 4P80A 1EX1A 5LLSA 4ZT3A 3G8YA 5EJ8A 1L7XA 4GQBA 1X7ZA 2NZ2A 4UREA 5K20A 1N25A 2GEUA 2O20A 1AHNA 2NYUA 5KB3A 4QTYA 1ZU5A 2QTBA 2VK4A 4ZVLA 2VHCA 1VYUA 2RG1A 2VYND 4OUDA 2QMOA 1XELA 4QQ8A 1PJ8A 4TV8B 2YHIB 1GNQA 1G8PA 2BM9A 2H1OA 5CJPA 5JZBA 1JTEA 1XA3A 1QJ4A 2JAPA 4TRNA 1O03A 1FFWA 1K89A 1U1FA 2OLJA 1T4CB 2O8CB 2TSYB 1TC1A 2WWIA 1JJFA 2IOQA 2R8RA 3HCRA 3CVOA 2OWDA 1SUEA 3BZUA 3K9LA 4L1KA 2A1UA 1WWKA 2H0QA 4KYUA 4PICA 2Y1KA 4RA6B 3HDYA 4RH0A 4EJSB 4A36A 3IPRA 2A86A 4S1TA 3OZGA 2VJDA 1KC3A 1L7DA 4BTEA 1UM9A 1VPEA 4OPMA 3RGGA 4IJKA 1PIWA 1TIKA 2X7JA 3DD1A 5EXDA 2WHPB 1VP3A 1HR0B 4BMNA 5B6IA 5T57A 4BU0A 4EY5A 5ADHA 5HUHA 1MC5A 4H1VA 4G9GA 5IFLA 2C84A 1L4FA 1Z56C 3CWQA 2G0NA 3IE2A 2VP6A 5BW6B 3DE4X 4MICA 3ULKA 1G8FA 4HDSA 4YV0A 4YRKA 4LGVA 3UJ9A 3AGQA 3CJTA 1U98A 4GT1A 4MWDA 1H0SA 2C3PA 2WTNA 4C07A 5KOYA 1NDHA 5IFKA 2B78A 1U0TA 5I4IA 1ONSA 2P3LA 5HZKA 1U2TA 1ZH4A 2IS2A 4Y6SA 1BA3A 3ANXA 3HUDA 1IM2A 5HKOA 4LF4B 1ONBA 3F4BA 4HEA1 2QBYB 4RZIA 1RPTA 3VRHA 4LE2A 3SZMA 1E9FA 3JWGA 1NUAA 3A6JA 2Z57A 3ODPA 3EF3A 2I2XB 3NP7A 3T34A 1PSWA 4IINA 4BJ6A 2UVDA 3S28A 1N8KA 1QUFA 1O94C 1SZDA 1VIMA 1N77A 1QQAA 3SIRA 2XECA 1NW5A 5F9FA 4B8ZA 3DMYA 1KEKA 4N12A 1V2GA 4B6GA 3U4HA 3LXMA 3TXAA 3IX7A 2PL9A 3C45A 2ZAOA 2OLKA 2WA2A 4OGWA 4Q9NA 4XJVA 3TI9A 3W8DA 4F4JA 3RRNA 4HNAA 1QBKC 2I22A 1I30A 3RLFA 1RWWA 1N5JA 1JH9A 2WOOA 1I1HA 1IQ0A 2NIPA 3SEFA 5EYPB 1DSSG 4QX6A 2R7AA 5AVQA 1Z34A 2TECE 4Z49A 3IL2A 4G36A 2Y1LA 4P3YA 1CQIB 2AV6A 2HHLA 2J7PA 5EE3A 3VZSA 2AJLI 2VBCA 4GQAA 1AV7A 1U2DC 3PFKA 1JEQB 2J6BA 3LQFA 4I4CA 3AUFA 3F6CA 3VUEA 4FT2A 1K86A 2H1VA 1BU8A 3IEUA 4JJEA 1AGRA 4UFNA 2VPQA 4XWYA 3A9VA 4KLZA 4MEJA 1KAQA 3NT4A 2H1IA 3L8FA 3OAAD 4QECA 1DC6A 3NBUA 3DVQX 4TV8A 2OESA 3VKUA 4OYHA 4PLZA 5HMMA 4EKDA 4YBRA 1Y5LA 1UL1X 2XMCA 4FYHA 1C9EA 2V6FA 4EUHA 1Y4AE 1V5FA 3F5DA 3IXQA 3OLXA 4DTCA 4Y2UA 1T9GS 3IA7A 1A04A 4TUYB 4PS1A 1SBYA 2LV8A 2YFYA 1JDPA 1SKBA 3PNKA 2PAAA 2DPHA 2ZTUA 1FFHA 4HPJB 1QSGA 5LXTF 5B3KA 2VF5X 4EJSA 2WKWA 3G9XA 3JWEA 1WXXA 4IFTA 3I6QA 4IHAA 5FHRA 1V96A 4ANFA 1ZJ6A 2ATCA 1V41E 1EX6A 1LK0A 1OU0A 2EFHB 3V2HA 1NPTO 4YT2A 2IEAA 5DU2A 4FJ1A 3ZHQA 2QW1A 2JJ1D 3NHLA 2CL7X 3OX1A 1JW9B 1XT6A 1VZ3A 1MH1A 2AMVA 2JEYA 3LHDA 3IQWA 1TJ4A 2GJ4A 3Q7SA 4P36A 3T1OA 4HUJA 1WF3A 2WHEA 3AW8A 1MXFA 5ECWA 3TQCA 3ET5A 5TVKA 4UBIA 2IUTA 3EEQA 2WYHA 2QW8A 9LDBA 5K45A 1W8DA 3O90A 1OYYA 4K8OA 4KYIB 1Q17A 2PN1A 4IIUA 3UIEA 1RMYA 3P0FA 1RSZA 5FDFA 2ZJ3A 4DWJA 3O3NB 4QHSA 4EECA 3A0UA 2XA1A 3FHCB 4EWLA 3P2KA 3KJEA 1CJBA 1ZJZA 3A1SA 4WEOA 4BDTA 3PFCA 4PN3A 5AW1A 2X6QA 2AQHA 1K98A 1Z07A 2REXB 2XUZA 2PSJA 1R88A 4XB2A 3T9FA 1E2KA 1XU9A 3UY4A 5LD2B 3EGOA 2NQTA 1L5MA 2IEZA 1ND6A 4ZYUA 3TUZC 2IQ5A 4NHOA 3LLCA 1KERA 4WN9A 3DOOA 1RXWA 4NK5A 2WWWA 5DP2A 2C7OA 4DT1B 4ACAA 2AXQA 2AQ8A 2CJFA 4J1SA 2RCNA 1NY6A 1EM8B 2O52A 1I2CA 3NB0A 4M8LA 3H6KA 5E9QA 2VT6A 2AMLA 2PK3A 1KK2A 3I92A 2OHHA 3PXGA 4UMFA 1IEVA 5JARA 1U8YA 2GHIA 4IG4A 4L8VA 1K66A 3YASA 5E38A 3UAWA 4A2QA 3Q0EA 1GFWA 3CRRA 4H4EA 4K0KB 3V8EA 3IDZA 1DDGA 3MTEA 5EYPA 5KX5F 4DVJA 3OSZA 3H9EO 3K71B 4FCVA 2A9PA 2XNDA 5JR3A 2PHZA 5TMBA 1MP0A 1JEQA 5EA2A 1GCUA 1Z6AA 4EIWA 4R41A 2ZJFA 4KQCA 3SYTA 4H4DA 3P9PA 2DWOA 1ZLXA 2YJGA 3L6RA 4KIUA 5EGSA 3PICA 5DYGA 4HC4A 1NPDA 4D56A 4V3BA 221PA 4H18A 3C14C 4R0NA 1KAGA 1N6RA 1X38A 2HWWA 5DWQA 1E96A 4BWYA 1TA4A 2JCVA 5ITZB 1W5FA 3E18A 3HDJA 3A10A 1GITA 1VKHA 3QEOA 3HDGA 5AKXA 4ZHQB 1Q1EA 4O8ZA 4ZP1A 3KD2A 3KHTA 4JBYA 5TIIA 3THSA 1WU8A 4Y0NA 1ZW6A 1Z7BA 3TDNA 3WAGA 3TR0A 1VL8A 1B8OA 4TUYA 4QUGA 3W5DA 3BWEA 2DQYA 3HVHA 1B74A 2R2AA 3JSAA 3K96A 1GN8A 2BN4A 2IY8A 1C8LA 2XE6A 3ZE9A 3THOA 3ZNQA 3G9UA 5FL7D 2VYCA 1MV5A 3EN0A 4B34A 5B57C 2PWBA 1SHKA 1PNOA 1YZLA 5EJAA 4HDNB 5K2OA 2FR0A 1F0NA 4J1TC 3EGXB 3JWJA 2XCRB 2FMKA 1G6Q1 1ES9A 3BIWA 1KQFA 3EXEB 2CCJA 2O2IA 4ID3A 3K92A 5ERGB 1ISSA 1GADO 1W2GA 1JAZA 3DF9A 5EN4A 3TRDA 1K27A 1HXHA 3ANLA 1H5NA 2QUKA 3OHSX 3PT5A 4RVUA 5CNIA 1JILA 3BILA 2F62A 1OVGA 2IPNA 3D8BA 1J20A 3PF9A 4OFWA 3RUPA 3IDAA 2WUDA 4IKPA 4NSNA 2FPSA 3IJPA 2JZNA 3MCUA 3FOBA 4JFAA 4MYDA 3ZX4A 4UPVA 3WISA 2F9LA 2GZAA 1E77A 5JCOA 2I7VA 4V0LA 2QRZA 2WIDA 2PXCA 1G6OA 3Q1KA 2FMTA 2FDCA 1G17A 1P3DA 2DTEA 4KQWA 3VOTA 3L82B 2G9ZA 4YCSA 1A8IA 1X13A 5I7HA 4DNQA 4ZAZA 2ZYIA 4HMOA 2FW9A 5HHTA 2F3RA 1R3DA 4UOZA 5AW5A 4TV8F 2RC5A 4LDPA 1RVDA 2C4UA 1VHWA 2HREA 3DAPA 3HADA 4ZO9A 1XU4A 3A70A 1LDBA 4WT7A 4BASA 1RXEA 4CTKA 1ZRHA 3E9NA 2Y93A 4EG5A 4TM7A 5KC9A 3U44B 3O4HA 3OX2A 4OOEA 5B55A 1WP4A 2IZ7A 5FUQA 3PHCA 1WDMA 4MUJA 4TZKA 4DT1A 4WNCA 4KVFA 5KVSA 4TWJA 2C2ZA 3C3XA 1MUUA 2X1HA 2W2OA 3UWKA 3VYSB 1JZSA 1AUOA 3WGUA 5BQXA 3HJFA 3BMXA 2JJ2D 5I5GA 1ZUD1 3VC3A 5KWVA 4R9NA 3DZFA 4AXBA 5JW6A 1WZUA 4TN1A 4B4DA 4DV6B 1G2QA 3TIXB 4UCXA 4F9FA 4FHZA 4RPHA 3RWOA 1HT1E 4YN3A 4Q7LA 1GYPA 1O3YA 4EP1A 4EHIA 2HN9A 2H1RA 2OHGA 2RCYA 5KIAA 2ZWIA 2H2HA 2PSDA 4FGZA 5GONA 3V6LA 3V4LA 2N47A 3ZNOA 4BC0A 1MENA 2OVBA 4D9JA 4LYFA 4KR7A 3U39A 5KVCA 2H06A 2ZGVA 1PU2A 3WGIA 1HKUA 3EVCA 3GPDG 3PFIA 5ICMA 1SXHA 2EAUA 4LRTB 5LU9A 3N6RA 3AHFA 4MGIR 3FPEA 5D1HA 1H2FA 1ZUWA 2ZR0A 4TXMA 4Y2QA 4O2BB 3H5NA 4ZHQA 2UXCB 5D1NA 5BWNA 1C9DB 4FFMA 3GNSA 4RZ3A 2O5VA 2C77A 4CCSA 4W5OA 1GL7A 1AGPA 4BBAA 3GRZA 2G63A 1LBEA 1JLLB 1LF0A 2EWWA 2Y1GA 3M6IA 2C2YA 3DR5A 2D59A 2E18A 5HS6A 4Z7JA 4Q93A 1KI1A 2A6PA 2F3QA 4GM0A 2QE6A 3EVTA 1O96A 3KQVA 4PZPA 3QA9A 5JC8A 1YRLA 1Z2NX 3SC6A 2BFDB 2G82A 1KK1A 4K81B 2PQMA 3EGXA 2XCOA 4E2XA 3DWEX 2YASA 5CK4A 3EXEA 4JT2A 5A04A 3OJEA 1YO6A 1HDXA 1HMYA 3A2MA 4ALNA 4YP1A 3KKEA 2UZAA 2OO3A 3EZFA 5LOVB 1H2EA 1XTJA 4P35A 3U5ZB 421PA 1TDJA 2E82A 4U2DA 4F45A 2WK1A 2GEKA 2X8BA 2E9SA 2L19A 2ONYA 3C5HA 5EINA 2RHOA 1UJBA 3GEIA 3EIOA 4ROSA 4OLJA 4UUOA 5F77A 3LRPA 3KQHA 1M33A 4ARAA 3SHTA 3PVCA 2GPTA 2WYUA 2AX4A 1I3OA 2D8AA 3FPBA 3NV9A 3SM3A 4XYMA 2B2XA 1SA0B 2FPIB 4NP6A 5DLEA 1QAMA 4DQLA 1G5TA 4IDOA 5KDLA 4V0QA 3SBXA 2I33A 2O9JA 3QJYA 2VDOB 3UHOA 2X4DA 3FLAA 4CGYA 4P3NA 3ZD6A 2QN9A 1U9ZA 2BTOA 1DO0A 1ZJWA 3S44A 2VPWA 4DLZA 4KAJA 4HMQA 3ZVLA 4BRUA 1KO4A 3FMOB 1N2JA 1EG2A 4GFDA 4CIVA 2V5VA 1P7WA 7MDHA 1Z4LA 3U44A 5IS2A 3DMGA 1J0CA 4TUYF 1GNPA 2R1ZA 3VR5D 1MA3A 2DH6A 3W5HA 4EFKA 3RODA 3HFJA 1IM8A 4EG1A 1M8FA 1Z06A 4K6KA 1BS9A 2BF4A 2ZTHA 1PS9A 1RRVA 1QFXA 3A31A 4JOSA 4L6IA 2QGZA 1W581 4FM9A 1HDRA 2VXOA 2XBLA 2D4HA 1YSCA 1ZVKA 2E1RA 4CM9A 1MVLA 3F1LA 3AUYA 2X7HA 2FW7A 2HT6A 2BGNA 2XVZA 5E7IA 1KOFA 3OKFA 5G1PA 1FSPA 3G2QA 3CRMA 5HTKA 1G7TA 2GN2A 5ALZA 2YXNA 3E53A 2PRSA 5FV4A 3O47A 2YV1A 3C3AA 2QKYA 1Y9AA 1G3MA 5TV2A 5JBNA 5F4ZA 2BL4A 3M89A 4RGBA 1J8FA 3DZDA 3OJLA 1E3JA 1QZUA 4KV9A 1RYEA 1T36B 2OM2A 3ROXA 3FZYA 1R6VA 4FOLA 4MRAA 3A4NA 1CB7A 1L1EA 4A8TA 1Y7HA 3ZDAA 4REQA 2AJDA 1TW3A 4PU0A 1EUDB 2BHSA 3MWDA 1O95C 2FRVA 1QK5A 3DXXA 1N2OA 4GGOA 5EWJB 1ODJA 3WLAA 1BRMA 1L8QA 1XZFA 2X0EA 1SWWA 3N39C 5CNKA 4OMUA 4QICA 1JDJA 1L7OA 1OY1A 3A06A 3GJTA 2WHYA 4R1TA 2JGEA 3WYFA 3WFZA 3GT0A 4QLOA 3HKCB 5CT9A 2XCIA 2B3DA 3NNNA 3EPPA 3QEMA 4ZO6A 1N0HA 1QORA 4A0RA 2FPXA 1HYGA 5CG2A 2YXEA 3FTPA 1VIVA 2EWMA 2P5YA 4GL4A 3T5BA 4JELA 4IMJB 2QRGA 4BVAA 4UKDA 2IUYA 3KTOA 1IY8A 3WGMA 5F2NA 4RZQA 2XRMA 4CBVA 1JLKA 1DADA 4FX5A 4LK2A 4MUKA 4Y7CA 3PE6A 2BFDA 1EFAA 2BGUA 4C7VA 2HD4A 1NVVQ 2XQFA 4Z4HA 3GLVA 4B2IA 1GSOA 1ZN7A 2YYAA 4G09A 1Z4OA 3QUAA 5E4YA 2QXYA 2E0IA 2EZ9A 4AJEA 5BW5A 1PSZA 4PPQA 1IJEA 2HWXA 4AYTA 3VC1A 2XTNA 1JLHA 1BMFA 4M3NA 5U1PA 5LOVA 3HSYA 4C0WA 1UFRA 1TRHA 1HE4A 2I4OA 4BQIA 1N34B 1JI3A 4K28A 4UOEA 4L4ZA 1KZGB 3EFHA 3PXUA 2JL1A 1DLJA 1J8DA 3BWBA 1RXIA 1G20B 3NBAA 3WICA 1XMOB 4CNBA 2WSLA 2WF9A 1RAEA 1NP3A 1P4AA 1SA0A 1IB0A 4WECA 3S8MA 2OYSA 1AQUA 3PVZA 3VR6D 4I5EA 1R74A 5WRFA 4TLAA 4Y30A 4OXYA 1LPOA 2ID8A 3K8QA 4QRHA 5DGDA 1HNWB 3RGWS 1PS8A 3C97A 3MAAC 3QX7A 5DIZA 4CM8A 4CL0A 4ZHQF 3AETA 4IIHA 2NO0A 3OA2A 1IY2A 1Z0ZA 4A15A 2BUBA 5ESWA 1CNEA 2XEDA 1D6MA 3K1JA 5EHQA 3DZBA 2PZ8A 4W82A 5JSUA 4ZGGA 5LBTA 4Q01A 5EOVA 3O2SB 2BKUA 4E22A 4PSAA 4EGQA 4K6CA 5CH5A 3E4CA 2CBZA 1L1FA 2FOXA 4KLCA 1CC1S 1YQGA 4CMCA 3UATA 4C2BA 1X1CA 3C5EA 2AZ4A 3OJXA 5D00A 3HCCA 4HS4A 1NZDA 5IK2A 4KG7A 3GRVA 4YRPA 3AUUA 2D5BA 5EE1A 3TDMA 4CIWA 1TJPB 1VRVA 1RLMA 3R8CA 2P6UA 3BQNB 3ZE2B 4CMBA 2WA1A 2PE5A 3AF5A 1UKAA 3QKRB 3P2MA 4GI2A 1IH8A 1SM4A 4F4UA 2NTEA 5LZ4A 1VG0B 2H8GA 3MINA 1TEXA 1T36A 4GI7A 5C1DA 1NATA 4WH0A 4WOKA 1XR3A 1VB5A 2KYRA 3RAFC 2PBFA 2PZGA 5IABA 4G0YA 3NDRA 1EUDA 3IRVA 4ZARA 3WKAA 2WFAA 1Y3FE 1EHCA 5JS8A 2R00A 3BMCB 1CIJA 1HPLA 2EKZA 2RHDA 4M8IA 1OXUA 1SCIA 4N54A 4J0IA 4YJDA 4B09A 4NBSA 5BYAA 5JI2E 2WABA 1L9XA 3M6XA 3WSWA 5KZMB 4LBYA 1S7GA 1Z5VA 4EYGA 3TZKA 2VNHA 5ENDA 1AXGA 4D02A 3RBZA 3SC4A 1WMSA 2VJPA 1N5IA 4HOYA 1J8MF 5CYGA 1M7HA 4K40A 3KSBC 5A3JA 3BH6A 1C81A 5FUMA 1UMBB 4LYEA 4QDKA 2SKCA 5EIXA 5DBGA 4NHEA 3VC2A 2BMJA 3LG2A 5IDWA 4NBTA 1FUKA 5EMJA 4ZOBA 1HM5A 4N5HX 4MWBA 5EXSA 4IL5A 4C87A 1ZVVA 4RKFA 7ADHA 4W5RA 1U6KA 2VXYA 4OHPA 1JAHA 4IJWA 1KMHA 2B82A 4IYRA 4B44A 3MJCA 3KOWA 4NG4A 3VDQA 4A1OA 4B2LA 3R0IA 2ZBPA 4BCDA 1DKRA 1KL7A 4TT8A 5K3FB 4IGEA 5JYDA 3AF0A 1RDFA 4JJ8A 3LP8A 3UBMA 1J39A 2ODWA 2AMJA 3P2IA 1LI7A 2DHQA 2XUDA 2YINC 3GFGA 4ZKEA 3DG9A 3RS0A 2YV2A 1ZU4A 5BNTA 1NAHA 5JOQA 3QX3A 4KKVA 1BJRE 3A8TA 3R3HA 4RIHA 4ZOLB 1G20A 2AOXA 2QJTA 1CFJA 2I6FA 1KDYA 5DK6A 4ISBA 4JSRA 2NUAA 3SOPA 4B5LA 4AZSA 1MOZA 3NFYA 5HKLA 2GN9A 1IWBB 2B21A 4EG4A 4V1CB 1X1SA 1KJJA 2MR5A 5T8KC 3VNAA 1QV7A 4D0RA 5BMOA 4P53A 3TRJA 1WS6A 1RHMA 3BXGA 4NZNA 2TYSB 1CJVC 1YD7A 4J7CA 4PYNA 4WPGA 1ZA2A 4HDQB 1E2MA 4LJ9A 4EEKA 2FY8A 1BHJA 2OUKA 3AZOA 1GGKA 3R41A 4NAUA 5SYNA 3FOAA 2IGTA 5L8VA 1WKBA 3OFJA 3GIDA 1FS4A 3QVWA 3T4EA 1N3LA 3AEUA 3DTVA 1A9XB 2C31A 2XMRA 3IBTA 3Q72A 5FI0B 4BFLA 2FWRA 1NHGA 1UC9A 3NVDA 4J6EA 1J0DA 3JZFA 4XUDA 1JKIA 3GLGE 1BW9B 4NCXA 2QJOA 2FN4A 4IHQA 3RS2A 3WBJA 3GDHA 2ROQA 3HPQA 3B2EA 1BVUA 4FBMA 1QHEA 3I37X 2AQIA 5JWOA 3KBOA 2XMPA 3HR7A 4H31A 1HMPA 3OUTA 5FL3A 3W2IA 1U6JA 3QKRA 5LOVF 3L4KA 2ZRHA 3D2LA 4TLDA 1MJFA 4UEJA 3IHLA 4L9WA 3B3JA 3A1NA 3VSAA 5DSZA 3RBVA 5AVYA 1FQJA 4KIFA 1QFZA 2QAIA 2G5TA 3PQ3A 4W1PA 3BTVA 3PG5A 1P4SA 1S0UA 2CF6A 3PR2B 4F2HA 3O4FA 4OYYA 4RQBA 5CDSA 1DVRA 1U94A 3BMCA 3I9JA 2FW6A 2JZCA 3ACCA