4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
molecule keywords Cinnamoyl CoA reductase
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
3UW3A 1DHRA 1KEVA 3G0OA 2EV9A 3K2EA 4ND1A 2G0TA 4B4VA 2HUNA 3C8MA 4BO9A 3DZIA 3H4VA 1J6UA 3ZW8A 5JO0A 3CE6A 4MVJH 3I1JA 3VZPA 5EQFA 7ADHA 2JFHA 3GR6A 1TA4A 2YHUA 2D5CA 4Y67A 2IYOA 1P1HA 3CPSA 1VRWA 1I2ZA 4BO7A 3DHNA 2Q1UA 4GMGA 1XR3A 1LLUA 1DLIA 2WMDA 3KHUA 1E92A 3Q9NA 3NEPX 5GZ1A 2IXBA 4J7CA 1MFZA 4J43A 4PG6A 1PGNA 1QRRA 1YB5A 3DO5A 3DBRB 1PIWA 3O38A 1PZHA 5CFZA 3HB4X 4NBRA 2D1YA 2Z5LA 3ICCA 1MFPA 1CRWG 5JCJD 4EEXA 4G2NA 1YGYA 2UDPA 1O6ZA 2NQTA 1UJMA 3KEOA 1SNYA 3L07A 5L4LA 1H93A 4RPKA 1UAGA 2B4TO 4Z3KA 3AUSA 3QJ5A 1FK8A 1T2CA 2Q45A 1LI4A 5IAAA 3TNLA 4C4OA 1C0LA 3WDSA 3D64A 5A5EA 1BXKA 5IZ4A 3FBGA 4BQPA 2NVWA 2GLXA 3HZZA 1E0DA 3ANMA 2DBQA 1E7SA 5TC4A 1LRJA 4DLLA 1VKOA 3GN2A 2E4AA 2R00A 1EDZA 4RVUA 4DPKA 1C1XA 2PKQP 1NHWA 1WNTA 4TRJA 3ITKA 3H6KA 1S7CA 1TT7A 4L8VA 5JMPA 2PZMA 1WLYA 4FDAA 4YPOA 4Q3CA 4YRAA 4JBGA 1IB6A 2O3JA 5KVQA 4BKUA 1MG0A 2X23A 4Y6PA 4CM8B 3TFQA 5JY6A 3JQ8B 2R00C 1OMOA 1J0XO 1E77A 1GPJA 3A9WA 3L0DA 2EERA 3PXXA 3PZBA 4BOYA 5HM8A 3DZFA 4PZDA 1X1TA 2CD9A 4WOJA 4ZHSA 3VPXA 1EEHA 4R9RA 3W8DA 1UXIA 4BGUA 3ZWNA 2X5OA 1PQPA 3BMOB 1ZVMA 2BD0A 3WYEA 4JJGA 4E13A 2WEKA 3UFXA 3ZDFA 1GYPA 3PFWO 4BGEA 1U7TA 1YONA 1Z82A 3I6IA 3NX4A 3ADPA 3RJ5A 2VNAA 1HYEA 1C0IA 4H3VA 4BNMA 2IEDA 5CDUA 4IINA 3O03A 3NTRA 4P38A 3SVTA 2Y67A 3U4HA 1BRMA 4HFMA 4XB1A 4MJLA 3ZI0A 4ROSA 3ICPA 3JQAD 3D7LA 1IY8A 2CNBA 3U3XA 4NK4A 3BMNA 1Q7CA 4JROA 1WDKA 3RUIA 1B3RA 3HDJA 4LCJA 2Q1WA 2IRWA 4WLUA 1O89A 4YAIA 1NFRA 1NYTA 1WW8A 1NPDA 4R16A 4QQRA 3NAQA 2O7SA 4AJLA 1JA9A 4L9RA 3C24A 4UEKA 3RBVA 3H9QA 3IKVA 4Y98A 4DUPA 4J4BA 4I1IA 1GZ4A 1CJCA 3QWBA 2P91A 1QV7A 1P44A 3BHMA 3H2SA 1LC3A 4F6LA 3QY9A 4IMPA 4J7UA 4CV3A 5C7OO 3DTTA 1GQYA 1GV0A 1XDWA 3GHYA 5TT1A 1GADO 3DXFA 3KLMX 1VSVA 2CSUA 2HMVA 4BO4A 4L76A 1M2WA 3B20A 4BKOA 2CF5A 5IXSA 3FBTA 5K9ZA 1J5PA 1PJ4A 1OOEA 3OECA 4J7XA 1GY8A 3D4OA 5K0ZA 2Y1FA 4HWKA 5BQFA 4XDZA 1HDYA 4P4GA 4UVDA 1DJNA 1EQ2A 1GYQA 5HS6A 2NQ8A 2AW5A 1EVYA 3QRWA 4QECA 3K96A 4BNHA 2GO1A 1QYCA 3CKYA 3GVHA 5ITWA 1YL7A 1CYDA 4KQWA 4RVDA 2AHRA 1IL0A 1NX6A 3GAFA 4ZRNA 2Y1DA 2B5VA 4UUOA 2Z1NA 1C14A 3WTBA 4Z6KA 1PTJA 2RBEA 4J91A 1MUUA 1KEUA 3A1NA 1GU7A 1B7GO 1JKIA 1U2GA 5A05A 2Q49A 4IBOA 1PWXA 4RPGA 3V5NA 1Q1NA 4J1NA 4QO7A 4PLCA 2HDHA 4GPD1 4IXWA 1V9LA 5EESA 5DZSA 3TOXA 3D3WB 3ZWBA 3GRKA 4IM7A 4N5MA 4RGBA 1EE9A 3D3EA 3FD8A 4O1MA 3WGOA 3E6AA 3L4BA 4KMSA 1W4ZA 3EW7A 1ENPA 4OOEA 1HDXA 3FWNA 3I23A 1SEVA 4GMFA 2FP4A 3QE3A 1B2LA 2NU8A 1PZGA 4E33A 3PHHA 1N5DA 1ZIDA 1UDBA 3OQ6A 5DDIP 2VWPA 5ENVA 1H94A 1DC4A 2W4QA 2J3JA 1DO8A 3O8QB 3CXRA 4D41A 2JFGA 5B4TA 5BT9A 4W7IA 3TFOA 4CUKA 2J3IA 5KJFA 3M1AA 2EW8A 1EK6A 3I9MA 1EE2A 3H2ZA 4OSOA 4KQXA 1EBFA 2YDXA 3PI7A 4MP8A 2V6FA 2X22A 2HK9A 3DOCA 3GRPA 3HFGA 4FS3A 5ITVA 4HUJA 5I7SA 1EVIA 2J5KA 4TZTA 3TL2A 4CR6A 2PLAA 3D3WA 1HZJA 3H9EO 3WBBA 3NT4A 3OMLA 5T8KA 3CH6A 4UVIA 3RAJA 4E32A 1YDWA 4CM4A 1QYXA 3ON5A 2VWQA 4BNWA 1EMDA 1AE1A 1ADFA 1IZ9A 3RFTA 5DOVA 4R69A 1Z6ZA 3WNVA 1ZUD1 1MXHA 3LU1A 1QYWA 3E18A 4JGBA 2QRLA 4F3YA 4EW6A 2X5JO 2V6BA 4FFPA 4FPXA 3GEDA 1I3NA 2D8AA 1SOVA 1TT5B 3AY6A 5T57A 3QVSA 1T2EA 3ZGYA 5BSEA 3M2TA 4RO0A 2CVOA 1ZH8A 4BVAA 3JQ7A 2FY8A 2FPPA 1R6DA 2CUKA 4W6ZA 3ZV3A 4EITA 4LRTB 1E3IA 3COSA 1HF3A 1T4BA 1A27A 1X14A 2OBNA 3ITDA 4KOAA 5KJ6A 1ORRA 1Y8RA 4BNLA 1NNUA 5B37A 4DBZA 1E7MA 1NR1A 3MZ0A 3BHJA 3OP4A 4FJ1A 4MVJP 3GOHA 5CPFA 5AVOA 1CF2O 2QZ9A 5DCUA 5GZ6A 1WMAA 5DBIA 2ZTVA 2FPGA 3W6ZA 1V35A 1N8KA 5ILGA 3RJ9A 4W9NC 3V8BA 4BNIA 5I8WA 5TNXA 4R51A 4BO0A 1VKNA 4E5PA 3ORFA 1HETA 5G0VA 1XU7A 3STHA 3DONA 2X0IA 4D44A 5CAEA 5BSHA 3BTVA 1PL8A 1D1SA 3HDHA 3U62A 2AG5A 1M6WA 5IDXA 5KTKA 2GN8A 4HFRA 3TWOA 5I9MA 3HG7A 4R1UA 2R6JA 1H0KA 1SB8A 1SOWA 4WNCA 3N58A 1HE2A 3GNTA 4R3NA 1MX3A 2Q2WA 4CJXA 3E8XA 4I9UA 3D1LA 2ZTMA 5A06A 5GZ3A 1H9BA 5COBA 1SMKA 3EAGA 4XKJA 1DLJA 4CLOA 4MVJM 1EUZA 1R0KA 3PQFA 1Z7EA 1PSDA 4J1TA 3RC1A 3UAGA 2NTVA 2Q3EA 4CL3A 4CLRB 1ZNQO 1ISHA 3RVDA 3QVXA 4P8RA 4AJ1A 1ISMA 1Y5MA 4BO6A 3RQSA 1BWSA 3ZNPA 3E5MA 5L53A 3ZZNA 1I2CA 1UXGA 4J2HA 1B14A 1B8VA 3F1KA 2YJZA 4TVOA 1C0KA 5L51A 3TF5A 1VI2A 2AXQA 3PIDA 4IDBA 1JAYA 5TX7A 4B7XA 3HFSA 4R9SA 4B8ZA 3DBLA 1T2DA 3E5RA 2F1KA 2OBYA 1PJ2A 2P5YA 3GMDA 2R2GA 1HRDA 2GNAA 3GHHA 4BHTA 3H9JA 1PJQA 4N5LA 3RBXA 4HP8A 1HYGA 2J3KA 4EBFA 5AXDA 3LF2A 5DCWA 1E3EA 4UAGA 1Q7GA 4B4WA 1E1NA 3OIGA 2YW9A 1JWBB 3ZU4A 3CTMA 3H5AA 3R3SA 1FDVA 3QV1A 1L7DA 2CDBA 1A71A 1NPYA 3CZMA 4RORA 1IZ0A 2X7HA 4YAGA 4OHUA 3RC2A 1DB3A 2AQKA 1MXFA 2PD6A 3VPHA 1ZSYA 1ID1A 1O94A 3OA0A 3PTZA 3OICA 4M55A 3KLPX 4DC1A 1DBVO 4EUEA 1Q0HA 2DAPA 5AXCA 2NVUA 2PKQO 1LRLA 2VYND 4E5KA 1NFFA 2EGGA 5DULA 1E1MA 1ONNA 4YTEA 2YV3A 3WGGA 1ENYA 1H6CA 3JQFC 2PY6A 4FW8A 1T2AA 1O95A 3LYLA 4Q9NA 3VDRA 3ZWVA 1IULA 3HADA 4FQ8A 1EZ4A 5U4QA 2YUTA 3DEYX 4TKMA 4J4HA 4E21A 1DC5A 4LISA 3AFNA 1LTHR 1PQUA 2HMUA 3I5MA 4NBWA 5DP2A 5CG1A 4D3DA 4E3ZA 2YFHA 4AJHA 4MP3A 2EIHA 1I01A 3BAZA 3JSAA 2AEMA 4OGWA 4K28A 4WECA 3G3EA 5F1PA 3OM9A 3LT4A 2AQ8A 1A72A 4A5OA 4FFOA 3KYBA 3ROKA 4JBHA 1ISIA 3WWYA 3HHPA 3VKVA 2Q1SA 1V3VA 5CDTA 4UREA 3PJDA 1ZK4A 3FTNA 4YB8A 3AK4A 4EGFA 4M54A 2OP0A 1KEWA 1HEUA 3S2EA 4RF5A 4L4SA 3VTFA 3WFIA 4L4XA 2Y66A 4HX5A 4LVUA 4DQUA 2JFFA 4BNYA 1DHTA 1LC0A 1ENOA 3VDQA 2YZ7A 4CUJA 1Y81A 1ISGA 1EUCA 4B7CA 4II3A 1C0PA 4QO8A 2BGMA 2YV2A 1DJQA 3GNQA 3G1TA 2EHDA 3JQAA 3GK3A 3OJEA 4Y9DA 1ISJA 3IC5A 1BDMA 5EJ2A 1SZJG 3JQ7B 1YXMA 1FXSA 3JQGB 4Z0HO 5I8ZA 4PG8A 3F5QA 3F5SA 1E1KA 4RVHA 2DBRA 2NU6A 4O59O 3NGXA 4S3MA 3TDKA 4RJTA 4GAEA 4CMBA 2JCVA 2GGSA 4RZIA 5TS3A 1Z74A 2IZ0A 1NQ5A 1FDSA 3WYBA 4UVGA 3ZH2A 1U8FO 1U4SA 1G6KA 4E12A 2VYNA 5IJZA 1WZEA 3ETGA 3FN4A 4QT0A 1KVRA 3X2FA 3PVZA 4LCEA 2D0IA 1AN9A 4HADA 3ZN2A 4JNKA 1R4NA 3ZWXA 3L6EA 3WX0A 1HE3A 3H3JA 1B26A 4RQTA 1HSOA 5CG2A 1K0UA 1T25A 1U5CA 1H6DA 1LUAA 1XHLA 1ZJYA 3LVFO 5JAQA 3SC6A 3DZJA 3I52A 4NBTA 4MDHA 3DFUA 5G0TA 4ND3A 3RASA 3H9UA 4X54A 3AI3A 3F3SA 3UICA 3WLEA 4PLPA 1EVJA 8LDHA 4L0QA 4CMCA 4GQAA 4RZHA 4CQLB 1ULUA 1E3LA 2B35A 4MPDA 2UVDA 3AUUA 3M2PA 4CM3A 4CMEA 3JD0A 2PH3A 4HY3A 3NDJA 3WXBA 1DEHA 5ER9A 2ZYAA 4IJVA 4CMGA 2POQX 4AJ4A 4EI2A 3OSUA 1VLLA 1MGOA 3F4LA 5ES3A 2VHZA 4NPCA 3EY4A 4P4NA 4BO2A 2CVZA 3R0IA 4U6QA 4CV0A 4GVLA 4TRMA 3JD2A 3L9XA 3U4IA 1D1TA 4CM9A 1X13A 4BL5A 3DDNA 4J0FA 4NK5A 1V0JA 4CMEC 4FJ2A 3MTJA 1U3WA 3JYPA 4J6FA 4GX2A 2O7QA 2VHVA 4TRNA 4O0LA 2B4RO 1U2DA 4NDNE 2G5CA 4J9VA 1SC6A 3QVWA 1XG5A 3H3FA 2ZCUA 1UDAA 4U6SA 4IPTA 5F1KA 3IUSA 2NTNA 2EJVA 3E9NA 4UEOA 3KYCB 1DIBA 1QMGA 1I36A 4XYEA 3ZV5A 3LLSA 4ND4A 4Y6SA 4BKRA 1DRUA 5CDYA 3GGGA 1JVBA 1LRKA 1GD1O 1U8XX 5LCXA 3PWZA 3W1VA 4AJEA 2BFMA 1C1DA 1B8UA 3VH3A 1UXKA 1YL5A 1ZKMA 5HWSA 4JCOA 3DMTC 1OC2A 1QP8A 4DC0A 1NR7A 2ZK7A 4EJMA 4NFSA 1NPTO 4R1TA 2HRZA 3FNEA 2HJRA 3FNGA 1A9YA 5G4KB 1C1DB 3WGHA 1BVRA 3INRA 3NT5A 1MP0A 3WMXA 4JN6B 3FI9A 1UZLA 1I3MA 1I5RA 3WWZA 4BB5A 5T64A 1V3UA 3OFSA 3KYCA 5JLAA 2VWGA 4L75A 1ENZA 4AFNA 4ITUA 1RKXA 3MJCA 2J6IA 3RC7A 4CV1A 2ZQYA 3AM4A 4L4RA 3W8EA 4BMNA 4OH1A 1AHIA 4AICA 3OA2A 4CMKA 2HLPA 4TKLA 1Q7BA 3K92A 1NTOA 2B4QA 2ZJ0A 4ZRMA 4Z0PA 3BTOA 2XAAA 1Z45A 1DDOA 4INAA 1LQUA 2WSBA 5JE8A 1Y1PA 3PYMA 4Q3EA 4XEHA 1R4MB 2HKIA 3DAGA 1IE3A 1XYGA 4OQYA 5A1TA 4DIFA 2CY0A 4R41A 4XD2A 4AJNA 1Y8QA 1XEAA 3DBLB 3S2FA 1CERA 1UH5A 3RD5A 4ALKA 2A92A 3PQDA 3PLNA 5CP8A 2BFAA 4IGEA 4NIMA 1JN0A 5JSFA 4J90A 1PGOA 4LN1A 3GFBA 1D8AA 1Y9EA 3MWDB 1WWKA 4OMUA 1K89A 3PPIA 5L7WA 4CR7A 3FWZA 4E0BA 1N92A 1HE4A 1K6IA 2DFVA 2I9PA 4CLEA 1NWHA 1OFGA 4GGPA 1FJHA 4YRBA 4D7AA 1HL3A 4IZHA 3PEFA 1K6JA 1R0SA 4BNGA 1YL6A 3WFJA 2DTDA 2EWMA 5LDGA 4OM8A 3KBOA 1I2BA 1LX6A 2PH5A 3UKOA 4PLWA 3PRJA 4XWYA 5DP1A 1JKFA 3QWAA 4NFYA 4ZN6A 1HTBA 4M86A 5A9SA 1UP7A 3AJRA 4E2WA 3TJRA 4U0JA 4A73A 2PV7A 2FN7A 2A35A 1VSUA 3ST7A 4XX0A 4OYRA 2JHGA 3LK7A 4XRRA 4BMSA 3K8ZA 3JQ8A 3KYDB 1HDGO 4PZEA 4CODB 3TRIA 1D4FA 2D59A 4YT5A 5G0WA 1CETA 1QORA 2WJPA 4RVGA 2FSSA 2CZCA 1NFQA 5KCZA 4YXFA 1QXSA 3LT1A 1LDGA 3RIHA 3FTPA 2PKRA 4FOSA 2ZATA 2CF6A 4WEOA 1YS4A 1U5AA 4ZQHA 2VZ9A 2VCYA 1HDCA 5KJ1A 2O3RA 4Z0TA 3IMFA 2QW8A 5FFFA 5JC8A 4XQEA 2BRUA 4I8XA 2A94A 2TMGA 3IP3A 4RF4A 5K6AA 2NTJA 5THQA 4GL4A 1CQIA 1LDBA 4FGSA 5EMHA 1EK5A 1RM5A 4B4OA 3OETA 2ZB7A 3WTCA 2WD7A 4B3IA 4MVJE 4YA6A 4MOWA 1BGVA 4DA9A 1R0LA 2OZPA 3QHAA 1YO6A 4B4UA 3FRJA 5G0SA 5TRTA 4MO2A 4ZU3A 3TQHA 2G1UA 4WLOA 2W2KA 3AM3A 3LQFA 1MB4A 3D4PA 3I6QA 2VTDA 4MIYA 3JYQA 1YKFA 3BTSA 5COQA 2P9EA 4D46A 5BR7A 4NJOA 3L4BC 2P4HX 2AQHA 2X6TA 4RCVA 2OXIA 4OO3A 1ZK1A 5ILOA 5DN9A 3P5SA 4ONEA 2WD8A 2GDZA 1VJTA 3SLGA 3UN1A 4F46A 1AXEA 2XPCA 3M6IA 4E2XA 2VRBA 3C85A 1CIVA 5G2OA 5LDHA 1Q0LA 2YDYA 4KWHA 3I83A 2DPGA 3WB9A 1BXGB 4TSKA 3DBVO 3KUXA 2BELA 4MVJI 1YBAA 5CEJA 4Q3NA 4Q3AA 3RUAA 2C5EA 3SJUA 3VH1A 4A10A 3RFXA 2A9FA 2GPTA 3ENNA 3IAHA 3IQDB 3G79A 3TN7A 1AXGA 3WNQA 2FWMX 1RM0A 5L4NA 1JU9A 3TOZA 1QG6A 3UOGA 2P5UA 3GDOA 2C2YA 2DQ4A 4O6VA 4U7WA 2HSDA 4DIOA 4XQGA 2X5KO 5L3ZA 2BGKA 1DRVA 1T1SA 2ZIZA 4Q39A 3R3JA 5HBRA 5J23A 2JL1A 2LDXA 2DT5A 3L6OO 2YYYA 5HTOA 4YWJA 3TZ6A 5A3JA 4MVJD 3H5RA 4QFDA 2C82A 3FPLA 1BG6A 1DIAA 1UZNA 5THKA 3MJVA 3WBFA 2Y0CA 2Q2QA 5MDHA 1R66A 2BKAA 3N74A 1LLQA 2AMFA 2DC1A 3KV3O 1AHHA 3NGLA 5A9SB 5CDGA 4E5NA 2ZYDA 4NFHA 4NU5A 1I0ZA 2EKQA 3ZWPA 4NH4A 2Q1TA 2Y99A 4ALLA 4XYBA 5FEUA 3PP8A 3F6YA 3FNHA 5A3VA 2ZJ1A 5H82A 1B8PA 2IXAA 3LSYA 4MKXA 4Z9YA 3TPCA 3ZWMA 1GFSA 2W2LD 2GYYA 4XR4A 2AE1A 3C1TA 4XIYA 3JCZA 1E3WA 3O4RA 4RDIA 4R4JA 4WCDA 5FI5A 2I6TA 4B3HA 1M6HA 1H2BA 3LC2O 3NT2A 2ILTA 1F14A 3WSWA 4E5MA 4ZQGA 2B5WA 2O2YA 2UYYA 4BO5A 3EZYA 1E7QA 2FMUA 2PR2A 4ND2A 3OEWA 1VJ0A 2YV1A 1EDOA 3HUDA 1LSOA 1Y9AA 1U7HA 3IDSA 3GLQA 4MKZA 3CZRA 5JAIA 1F8FA 1WPQA 1UP4A 3IIEA 5JDIA 4J4TA 1DAOA 2C29D 5L9AA 1GAEO 2WYUA 5DT9A 4D43A 2QIOA 2NLOA 2JCYA 4PLTA 3ETEA 1NM5A 3M1LA 1S6YA 2CFCA 2QZZA 4FOOA 4RF3A 2GZ1A 1F0YA 1YRLA 3QSGA 1LLCA 2JD0A 1ZEMA 2FOIA 1JVSA 3RBZA 4PN3A 1E3WB 2HQ1A 2WDZA 5F3RA 3ROPA 4HNHA 2W8ZA 2IEBA 2DUWA 1PL6A 3RUHA 1X15A 4F6CA 1JQBA 3EHEA 4LK3A 4DQVA 2NV6A 2X0NA 4GLLA 4LVCA 4MVJG 3FR7A 1K6XA 2Q46A 1KY4A 3IOYA 1GCOA 2PD3A 4DGSA 3QQPA 2V6MA 5IDWA 5H83A 2X0JA 4FR5A 4DLBA 1JLLA 5KIAA 4E5YA 1CQJA 4DMLA 4XJSA 3DZKA 4JQCA 5JDCC 1I10A 4BV8A 2NVBA 1A9ZA 3RROA 3PHLA 1BHSA 4YQZA 3VAZA 1OI7A 3ZWWA 4WE3A 4ZJUA 3GZNB 4YT4A 1E6EA 2OGUA 1HYHA 4WK6A 4YBZA 5T5QA 5TGDA 3NJ4A 5U9CA 2HU2A 3GNSA 4IQGA 3UCXA 1R16A 3F4BA 4GKVA 3KM0A 1PJTA 4OXNA 4ZVVA 3MCVA 3P7MA 3JQCA 3KEQA 3ZV4A 5CEFA 1KVSA 4RQUA 1HT0A 1NWCA 4K6FA 2VNSA 3PZRA 3ZHXA 3HDQA 3DB2A 1LXCA 3GY0A 3ANLA 4ZICA 5DOZA 4BS9A 3ADOA 3PYLA 2QQ5A 4NG5A 4I9HA 1WP4A 5JPIA 4GI2A 4YR9A 5TLSA 3CMMA 2IZ1A 4ILKA 4GX1A 3D0OA 3HWRA 5DBGA 4D79A 2NUAA 5KJCA 2X8LA 1I24A 1LJ8A 1VPDA 3VPGA 3T7CA 4MIEA 4KWIA 1KS9A 4K1LA 2WM3A 2ET6A 1DSSG 3DBRA 2DUUA 3GH3A 5L7YA 2VRCD 1DC6A 1MLDA 4JLWA 4KTTE 3WSVA 2PZLA 4PLYA 2VWHA 3Q9UA 3U0BA 5T8KC 3N7UA 4W82A 2QYSA 1P0CA 4DTIA 4XA8A 3BA1A 3MEQA 1E6WA 1PQWA 2G17A 1ZSVA 2DLDA 4LW8A 4WASA 2C0CA 3KSDO 3CUKA 1ONOA 2CVQA 1X1EA 3S8MA 3IKTA 1YDEA 5FI3A 1TI7A 5L4SA 3I4FA 4J9UE 4DLAA 1PJ3A 1HZZA 3GUYA 2Q4EA 1A5ZA 2O4UX 1SCUA 2O23A 1KVQA 2B69A 2V7PA 2PNFA 3KO8A 4Z3DA 1AUPA 1Y5RA 1RM4A 1H6AA 1GTMA 1OZAA 2GN6A 9LDTA 3DMYA 4TMFA 4FIZA 2X4GA 5IN5A 1PJBA 1XU9A 3CIFA 3DAPA 3R1IA 3MJEA 2HMSA 2PTGA 5DCYA 3V1TC 2UAGA 4CMIA 4XB2A 2C07A 4CMHA 2CDAA 3PHIA 1OC4A 3H7AA 3WJAA 4CMIB 3U09A 5A04A 1GEGA 1T4DA 3H5NA 3JYLA 3QWFA 3U5TA 3KRTA 1G1AA 1OBFO 3JQAB 1GUYA 3FHLA 3C1AA 1HKUA 3FCOA 4KUHA 5C7IO 1ZXLA 1DOHA 1XWFA 5GY7A 3KYDA 3VKUA 4QX6A 5CDSA 1YJ8A 2BLLA 4OIMA 5G4KA 2ZTLA 3G17A 4FSHA 4HNGA 4JBIA 3C1OA 3HDYA 4II2A 1PS0A 1ULSA 1XIVA 2C54A 3GVIA 1F17A 1KETA 1JWAB 4CM1A 3B1KA 4IS3A 3IS3A 4HV4A 3HB5X 5FYDA 3WYCA 4MIOA 4YYZA 4BMVA 2NACA 4G81A 3K6JA 1LSSA 5ICMA 2PGJA 3BMNB 3IJPA 2DM6A 4TROA 4AJ2A 1LDMA 4DXHA 3FPCA 1ADCA 4B7UA 4EEZA 4BNNA 1VC2A 2H6EA 1E6UA 4CPDA 1J49A 1YVEI 3UHAA 3JQ6A 1N2SA 3O9ZA 1L1FA 4KDEA 1P3DA 2NADA 1YQDA 3I3OA 5BSGA 3NV9A 4XGNA 2I3AA 3SEFA 2WE8A 5A5FA 4PLVA 4E2YA 2CMDA 2X0RA 4ZA2A 1ZK0A 4IJWA 4TZKA 1O5IA 4YVFA 3PHJA 5ADHA 4IDAA 3OEYA 3WR5A 4BNXA 3PJGA 3W4IA 3GC6A 2OL4A 2VOJA 1I30A 3W6UA 4N18A 1P1JA 3SC4A 1P45A 3K31A 4R5HA 3FF4A 1N9GB 4W7HA 2C5AA 4NBUA 3AOEA 2J5QA 4WGGA 2HRBA 3ZU2A 2X9NA 3C7CB 1SPXA 5JCJA 3PDUA 1LEHA 1MC4A 4M1QA 1U9JA 4CLXA 1KC3A 4D0RA 1IPFA 5KVCA 2ZB4A 4PIVA 3ZWCA 3GDGA 4A26A 5FF9A 4J49A 4CM8A 1NASA 3VC7A 4TVBA 2RAFA 4Z9XA 3ROQA 2GR9A 1JTVA 3BIOA 4JJIA 5JYDA 3GZNA 1UDCA 1ONPA 4JP3A 1C1XB 1X0XA 4RDHA 4BIIA 4FC7A 3QIVA 4R68A 4GVXA 4Y6RA 2HCTA 2Y1OA 1QYDA 3DMTA 3GGPA 3QVTA 3JD1A 4BV9A 4ZGWA 4XDYA 1DXYA 5KVSA 4PG4A 3PDJA 4ALJA 3TZKA 3VHRA 2E49A 1GZ6A 1KERA 2Y68A 3NYWA 4WLEA 2JHFA 1PR3A 4DWVA 1HWYA 3JQFA 2OO5A 1P1RA 3OJ0A 1BVUA 5JW6A 1GZ3A 4W99A 3GT0A 1KY5A 4IXTA 2OP1A 2ZB3A 4B3JA 5JDIC 1PJSA 4IJUA 1H9AA 1CEQA 4JXKA 1RYDA 3ASUA 1GEEA 3DTYA 3ZWYA 3I9NA 3FR8A 2D4AA 1ZJZA 3P2OA 1ZK3A 2EXXA 4UULA 3PJEA 4BGIA 4BNUA 3BHIA 4AJIA 1PZEA 4C7JA 4OL9A 1B16A 1VL0A 4BQRA 3NTOA 4AJJA 2EP7A 3RUDA 4LGVA 4AJPA 5KVVA 2ZYGA 5COAA 2YFQA 4R3WA 1X7HA 1RWBA 3V2UA 1P33A 1HXHA 1IHYA 1UZMA 2EG9A 3EYWA 4EYEA 4E6PA 1EFKA 1P9LA 1GL3A 1NAHA 1M76A 4R01A 1H6BA 3Q0EA 1RJWA 4FB5A 3ETDA 2VHYA 3DHEA 4WLFA 3MOIA 4MVJF 4RF2A 1P1KA 1RPNA 4NQZA 4XYGA 4NR0A 5JAMA 2Z95A 4IGFA 2EJWA 2BF7A 4CQMB 4BO3A 4R1SA 1K5HA 3V2GA 4GX5A 4D0SA 2Q50A 1BDBA 2BHLA 2H9IA 2F00A 3ZCXA 5KKCA 1IHXA 5G4LA 1I8TA 1KIFA 2VZ8A 4GSLA 4XQ9A 4YQYA 5AXBA 4B8WA 4YACA 1LDNA 3VTZA 4DBVO 1BSVA 3GUCA 4EUHA 2GRAA 4J0EA 3A4VA 3S1LA 2E37A 5IDYA 3DFZA 4AVYA 4FFMA 4AL4A 2NVUB 4WKGA 1O8CA 5I9LA 2A4KA 2RH4A 3WGQA 1EVZA 1ZMTA 3H65A 4CR8A 2JJYA 3AUAA 3MTGA 4GWGA 3W4JA 4LMRA 2O50A 4OKNA 1TEHA 1YBVA 4M89A 5C5IA 4YJGB 1XQ1A 3IUPA 2FR8A 2Y1EA 1MA0A 3SXPA 2TMDA 1NBOA 3CMCO 5A02A 3GVCA 4QTZA 2B83A 3WLFA 1GYRA 4PG7A 4YT8A 1QYVA 1FMCA 4K6CA 4GGOA 2PGLA 4OSPA 2FRDA 2OOSA 3PQEA 1MG5A 4PVCA 5U1PA 3RI3A 3VH2A 1QR6A 4FCCA 4XGIA 3C3XA 1P1IA 3RWBA 3CSDA 3O26A 3HSKA 5K6AC 2C7GA 3D4NA 3WGIA 5KOIA 2W2LA 2DPHA 3Q11A 1EBUA 5KWEA 2E82A 3U4CA 3UH1A 1Z73A 2I76A 2AA3A 2H1SA 3BMCB 3NDRA 3OIFA 6ADHA 3AOGA 4N54A 1JKJA 4FFRA 2P2SA 1ML3A 1M75A 3LZ6A 1N9GA 3GG2A 3NJ8A 2JAHA 3DBHB 1PJLA 3H9GA 1E7YA 3UF0A 2O3QA 5EN4A 4R54A 5JS6A 2XXBA 4CLRA 1WVGA 3DOOA 3HN7A 4RPJA 3ROMA 3CINA 4XGKA 1DFGA 2VHWA 1X7DA 2VUUA 1W8DA 4JJFA 5AOVA 3VZRA 3DHYA 2Y1GA 3JQ9C 4RLHA 4XCVA 3NTQA 4PLFA 4XJTA 2WYVA 1NAIA 4U5QA 4Z9FA 3V2HA 1HDOA 2YY7A 5KKAA 5CEEA 1TVEA 4IQ0A 5I9NA 1A7KA 3R6DA 1MC5A 3B6ZA 2BI8A 3AW9A 1I32A 2BMAA 2ZTUA 3SBOA 4TRRA 3W4KA 2AEJA 3MJSA 5FWNA 1LA2A 5IZCA 2NSDA 3HQ4O 3UCFA 2BFOA 2J5RA 1PGPA 5B1YA 3W8FA 3VZQA 4BO8A 4I5EA 4DYVA 3JV7A 1SAYA 4WCFB 3WIDA 4YRDA 1ISFA 5JC1A 2VYVA 3ZNQA 1XKQA 1GPDG 2EKPA 4BNKA 3UXYA 1XCBA 5T67A 2C20A 3JD3A 1ARZA 4URFA 3I9OA 4KUGA 4DL9A 5I7EA 1LNQA 3HJAA 3ZHZA 3GGOA 4BKQA 4CL8A 5JNLA 4PVDA 3LT2A 2VZ0A 3KXDA 1DFHA 4KUEA 1CDOA 1YB1A 4XRGA 2I66A 5TIIA 3SLKA 1JW9B 2YHIB 1HLDA 3LDHA 3KSZO 1W0CA 1K2WA 2JKVA 3ONDA 1TT5A 1FDUA 3P19A 4OKIA 1HE5A 3RKRA 3KOUA 1E1LA 1W73A 5G0UA 4WOKA 1BW9B 1Y7TA 4J1QA 1YOVB 3WQRA 4OQZA 4BB6A 3L4SO 2VN8A 3NKLA 4E31A 2EEZA 1NHGA 3EC7A 1PS9A 4RL6A 2EW2A 2O3SA 3ANNA 1N7GA 3GPDG 4IDFA 4W9NA 2HMWA 5DF1A 4A27A 4IJKA 4CM4B 2ZCVA 4IUYA 3ZNOA 2SCUA 4OXYA 3GFGA 1SO8A 2RCYA 4YJHB 5EL0A 1XSEA 2JAPA 4CM6A 2FPIA 2Q4BA 4PCVA 3WQQA 3AM5A 1TB4A 3VOSA 2H5LA 2W90A 2JCXA 4IY1A 3GVPA 4FJ0A 1NQAO 2O3UA 1YBMA 2VUSA 3BYZA 4RLSA 4CM5A 3E03A 1PS8A 1XGKA 3EK2A 2HO5A 3TZHA 2DFDA 2VUTA 1YB4A 4LSMA 3AY3A 3Q2IA 3GZ4A 3DZBA 1T24A 3V1YA 4NMHA 2W98A 1H2HA 1YOVA 4LMPA 1IUKA 4D45A 2IZZA 4DMMA 1LU9A 3A14A 1H5QA 3BMOA 2GD1O 3PIIA 3I9KA 5JDCA 2ZKLA 2FZWA 5TJ9A 1U3UA 2O3TA 3IJRA 4Q3BA 5IXYA 2PWZA 1XQ6A 2VRCA 4G5HA 3OF2A 2YHIA 5EPOA 4WJZA 4I5DA 3K73O 5JXWA 1QLHA 1P0FA 4JP2A 3JQBC 1NQTA 1QLJA 4CM7A 3TZQA 4WPGA 1GR0A 1T1RA 1RYEA 1ADGA 4FN4A 2GERA 4I9NA 4JIGA 1WAMA 3VVCA 3UVEA 3GQVA 4ZD6A 1J4AA 1A7AA 1U4OA 1DIRA 2DBZA 2W2KB 2E48A 4DPMA 2UV8A 2AE2A 4YJGA 2VTEA 1FDWA 3S2GA 3JYNA 1ZCJA 4RPLA 4RV9A 4ZQEA 5JFOA 4U0KA 1DRWA 1NQOA 2NNLD 3JD4A 4B79A 4CLHA 2X58A 4CQMD 4E2ZA 2IDZA 3L9WA 3OIDA 4CM9D 1KEPA 4PLZA 4P4LA 4AJOA 3U4DA 3QLJA 4PGFA 1E7RA 4J3FA 5H81A 3KB6A 1O0SA 2BH9A 4HFJA 4OOFA 1Z7BA 1B15A 2BFPA 4C7KA 4A2CA 3X2EA 4DREA 4NZ9A 3VH4A 1PGQA 1NXQA 4ALMA 4HKTA 2G82A 5A4DA 1KOLA 1SEPA 2GSDA 2YQ5A 3A28A 3DWFA 3PWKA 3Q2KA 1ZSNA 2NU9A 1QKIA 1I3KA 3F47A 1XA0A 1E7WA 1LSUA 2NM0A 4CQMA 3FSRA 3ZU3A 1ZXBA 2I3GA 2WWRA 5B4VA 1R37A 3BXXA 5KNLA 3C7DB 1K3TA 3JQ9A 3PWSA 3PJFA 5IG2A 3JQDA 3DAFA 3ASVA 2WD7B 2GZ2A 2QG4A 4YT2A 3DOJA 3I9LA 1I33A 5LC1A 4DYDA 3OQBA 1U3TA 4MP6A 1GUZA 5JBIA 4KDFA 2WE7A 2BI7A 1WXDA 2P9GA 1U3VA 9LDBA 1RM3A 1PGJA 4QUKA 1KBZA 1ZFNA 4CUZA 3OH8A 2D3TA 3Q6IA 4GWKA 4ID9A 4DRYA 2OHXA 5L45A 4H7PA 4BNVA 4UEJA 2RHRA 1U28A 2PZKA 3AI2A 2I5PO 4NHEA 5IFLA 1OAAA 4HFNA 2DTEA 2EKLA 4OJNA 5EQDA 3I9JA 3TZCA 3WQSB 1JAXA 4G65A 3KTDA 2VHXA 3ZWAA 2Q99A 3DC2A 1DFIA 1FF9A 5B12A 4YCAA 1UP6A 4YAKA 4PFJA 4D3SA 4IS2A 4Q3DA 2X9VA 3ZW9A 1WMBA 2RHCA 2OFPA 1FDTA 4IDCA 3PGXA 1G0OA 3OJFA 1PWZA 3WGZA 1R4MA 2P9CA 3RKUA 5B4UA 1HSZA 1F8GA 4NNJA 1R12A 3UCEA 3CEAA 1F12A 2VOEA 3AU8A 3WOHA 4M49A 3LF1A 2PD4A 2HMTA 2AEFA 1GCUA 3BMQA 5BNIA 1HLPA 3WGTA 4D42A 1IYZA 1X7GA 2IYPA 1ZMOA 3B70A 5JY1A 3ZWOA 3DQPA 7MDHA 2NU7A 1PEDA 1ZO8A 1MV8A 2O48X 5DNAA 1VE9A 4WCFC 4FC6A 3T7EA 2FHSA 1LBEA 5TF4A 5TJHA 4CMJA 3LLVA 1BXGA 1UR5A 4ZQFA 3GA0A 3Q1LA 3IP1A 4RVFA 2QYTA 2B0JA 3I4CA 4BNTA 4PRLA 3G1UA 4AG3A 4GH5A 4TWRA 1PL7A 3LC7O 1VL8A 3AUTA 1EQUA 2EGHA 2HK8A 6LDHA 2DU8A 1GQ2A 4GX0A 3E1KA 1GV1A 4WUVA 4DQXA 4YDRA 3RUFA 1YQGA 1V6AA 5CPBA 2PFGA 4PZCA 4XZ3A 1TLTA 2X1HA 4YJFA 3NUGA 1XELA 5IZCC 4XR9A 3WMWA 1T26A 2IODA 3K5PA 1LDEA 2RH8A 4UUNA 1C3VA 2WTBA 4W4TA 1L7EA 4O5OA 3GAZA 4BGVA 4BO1A 2V6GA 3PHGA 1KVUA 1N1EA 5JO9A 1LLDA 2DTXA 4QSMA 4MVJA 4BUCA 4R1NA 2DKNA 3E9QA 3PK0A 3ENKA 2XF8A 1BMDA 1YH3A 2Y0DA 1YE3A 1WZIA 3HE3A 3B1JA 2VT2A 1P1FA 5TQVA 1UUFA 5JMWA 3BTUA 4YJFB 4GLOA 4IIVA 3GMSA 3RC9A 1LDYA 2PK3A 3ZHYA 1Q2XA 4KTVE 4UUPA 1HDRA 3NRCA 4WNIA 3IL2A 4H15A 4U8GA 1LSJA 3KVOA 3RU9A 2GF2A 2Y93A 3EZLA 1BTOA 4CV2A 2C59A 3QVOA 3ULKA 1YWGO 4NJMA 4LRSB 5HA5A 1XLTA 3BMCA 1EFLA 2PA3A 1I3LA 2XXJA 1UXHA 1D7OA 4GBJA 3U9LA 1NVTA 4A03A 3KZVA 4DPLA 2JD1A 2VT3A 5JCXA 3ONFA 1WDMA 4E30A 3TSCA 3U49A 1E5QA 4FD3A 3WG9A 2DVMA 3OBBA 4JX8A 1B3BA 2QRJA 2GCGA 2B36A 2OUIA 3VPSA 4I5GA 4OAQA 4QEDA 3L6DA 1U1IA 3VZSA 3MJTA 4F45A 4ALNA 3FNFA 2C2XA 4I08A 2D5AA 3T4EA 3BMQB 3E82A 3VPFA 4XYMA 3TL3A 4DVJA 4P22A 4ZQBA 4EJ0A 3BZUA 4O63O 4NU6A 4YAJA 5L40A 4NI5A 5DBFA 1N1GA 1W6UA 5ICSA 5IF3A 5BNTA 2UUOA 4IIUA 5C37A 4UVHA 5AYVA 3QW2A 4EZBA 4ND5A 3D5QA 3P2YA 3UUWA 2Y0EA 1O9BA 3EGOA 4BNFA 1PJCA 3EDMA 4HXYA 4LSWA 3AWDA 4CLOB 2I65A 1IOLA 2WYWA 5L7TA 2IE0A 3DZGA 2HJSA 4PG5A 2I99A 1Y8QB 1ZW1A 5EIOA 3MJ4A 1DPGA 1KC1A 3EMKA 4YJHA 5F1OA 2VYVD 4EDFA 3ZV6A 1PZFA 4KZPA 2FSVA 5IN4A 1V8BA 3GEMA 1DIGA 4OXKA 4WLVA 3ZHBA 2OORA 4YAEA 4ALIA 4BKPA 2E6UX 5ER6A 4TQGA 2NWQA 3AOEC 3K9QO 2QRKA 4PLHA 3RFVA 2DBVO 3WIEA 2VQ3A 1BW9A 3HNPA 4J2OA 4D3FA 3OHSX 1X0VA 3PGJA 5AQ1A 3GN1A 3MOGA 2RIRA 1LQTA 3PYXA 5GMOA 3EUWA 1PX0A 1Y6JA 5EERA 2J3HA 3JQGA 4CMAA 1Y8RB 2B37A 3Q3CA 4NBVA 3MWEB 2Q2VA 1NVGA 4BNZA 4KP7A 4L73A 3K2BA 2JD2A 3C7AA 4BNJA 3AY7A 4EUFA 4NJMB 4YJDA 4MKRA 3WICA 4IMRA 1P74A 1CWUA 1P31A 3F1LA 3L77A 4UUMA 3HN2A 1GUFA 1R15A 3WGYA 2FR1A 1B0AA 4EJ6A 1A4UA 3AFMA 4RPHA 3F9IA 5JAZA 1UAYA 3JQEA 3DR3A 3ONEA 1AGNA 3RU7A 1NVMB 4WCFA 4DIBA 1YJQA 4Y8VA 2V65A 1DAPA 4WEQA 4FFLA 4XIJA 4PLGA 3DL2A 3DZHA 3EVTA 2O4CA 3SJ7A 1T2FA 1HDZA 1A4IA 4AJKA 3ABIA 4N7RA 2H63A 1DIHA 5F21A 3E9MA 2GUGA 2ZQZA 4QFCA 3RCBA 2BGLA 3ZU5A 4M87A 4FFNA 4J16A 3EVNA 4K9DA 1ZEJA 3SX2A 2FR0A 2LDBA 2GZ3A 3QA9A 1E5LA 1ZK2A 3D5TA 5TSDA 1G0NA 2PGDA 1Q0QA 3B1FA 3O8QA 2EF1A 4I5FA 2XOXA 2GASA 5AXAA 3PFFA 5A03A 1M67A 3DBHA 1Z75A 3E48A 3OJLA 3QWHA 1WDLA 3H8VA 4L74A 2G76A 1JDJA 5C7LO 3LC1O 2UUPA 2OMEA 5KJEA 3RSHA 1D3AA 1VM6A 1BXZA 2HK7A 3G49A 4GSKA 4CQLA 1TXGA 3QWIA 4R5MA 3PLRA 3F46A 3NDIA 1E3SA 2QX7A 3GG9A 4CLDA 5EINA 3S2IA 1QV6A 1M66A 2I67A 5F5LA 3GEGA 4IZIA 1GDHA 1VL6A 1YQXA 4H16A 1EUDA 2Y05A 5L95A 2AG8A 4XQCA 3AU9A 2J8ZA 4A7PA 2QHXA 1R4NB 4ESOA 2HAEA 1DC3A 4IDEA 2O2SA 1F06A 3INTA 3JYOA 4UVEA 3UGKA 4WLNA 2D2IA 5HRUA 3JQBA 1PR9A 3WJ7A 3A06A 3V1UA 2GN9A 3OJOA 5BSFA 4HBGA 4IQ8A 4MINA 5T6BA 3KETA 2EP5A 2P4QA 4IDGA 4XYLA 3T4XA 3GF4A 3GPIA 2PZJA 3RUCA 3K30A 1PU2A 3S55A 1E3JA 2CDCA 3AI1A 3WS7A 1VJ1A 1UXJA 5C3MA 1KVTA 3GVXA 1SB9A 2GN4A 3ZNNA 2AQIA 1GQQA 2YQ4A 1N7HA 1SBYA 1V3TA 2ZB8A 3GDFA 4K26A 4PRKA 5MGBA 3RUEA 2X9GA 5HS4A 1NP3A 4QXMA 2P68A 3QP9A 4RVSA 5ENDA 5BNFA 5I7VA 8ADHA 5JYEA 4FGWA 5IDQA 1P77A 1ZZEA 1QSGA 2Z1MA 2Y1CA 4N5NA 5CHEA 4YEDA 2FZEA 4JK3A 3INGA 4FBGA 4S1VA 3KSUA 1IPEA 5A9RA 4E4YA 3VVBA 4GKBA 1ADBA 3JTMA 4M8SA 5TT0A 3LT0A 5A9TA 5F5NA 3OQ1A 2C7VA 2X86A 1ZBQA 4A0SA 5I7FA 1KYQA 4IDDA 4J1SA
chains in the Genus database with same CATH superfamily
3UW3A 3L1JA 5JPCA 2JI8A 2EV9A 4TTAA 5GOZA 2R4TA 4ND1A 2G5PA 4LX0A 4NMMA 5CYFA 4B4VA 1ESMA 4GE3A 2VT7A 4BO9A 3IQHX 2ZT8A 1J6UA 4YP7A 1OFVA 3LW8A 5E7QA 3CE6A 4MVJH 3CJRA 1GA4A 3VZPA 2A84A 2JFHA 4GPBA 3T7AA 4HUTA 1S5PA 4YQFA 5F2EA 3TKYA 3D6MA 4K9NA 1UFRA 3MT9A 4OYYA 3A2LA 3IOBA 3Q8WA 3CPSA 3LCUA 4OCZA 4A8TA 4FKMA 4QBGB 4GKKB 2XB4A 3L1VA 1T29A 1LLUA 4LWPA 3SQWA 4A4DA 1K4MA 1U0HC 3NEPX 4B0OA 4DG5A 2BTOA 1DAMA 1TRKA 3DEAA 4D8WA 1YB5A 4PSVA 3SQXA 4IV8A 2O2JA 2HEGA 4RTRA 1X80A 2R96A 4IWYA 3F74A 2OXRA 2Y3IA 4PPFA 5FX2A 1EGVB 1Z5GA 3TJMA 5HR5A 4LHWA 4FMCB 2NN3C 2R2AA 5C7YA 3ETHA 2P7HA 1FP1D 4HATA 2NQTA 1UJMA 3R9KA 1SNYA 4D8TA 4E11A 1RZRA 5LZ8A 3QEMA 5EXXA 2GMWA 4Z3KA 3QJ5A 1MEOA 1XZAA 2Q45A 2CFOA 1MABA 1XU4A 1U02A 4ENSA 1QIKA 4H1UA 4DDHA 4L78A 3D64A 3T0IA 4D2IA 1YGPA 2GXUA 5HXAA 2Q3CA 3IHTA 2DR2A 2FU5C 1G20B 1ZGZA 3U9SA 1ZC4A 2J3EA 3BIFA 4I8DA 3REGA 3VR1A 4BZPA 4PSAA 1S7GA 3MINA 2Y8EA 3ANMA 4EZEA 5BNWA 1T0UA 5CLJA 3KKPA 3MN1A 5TC4A 3W05A 3LLMA 3GN2A 5J47A 1VSTA 4LXXA 5A3RA 4K6OA 4KO1S 4RVUA 2FZLA 3OTGA 4WN3A 4DPKA 3KSRA 1EUQA 3IQFA 2B9EA 1JAHA 1WNTA 5IAGA 4PY2A 1KO4A 1C7FA 3NHLA 4KXVA 4P5EA 3RHSA 4G0VA 1ZVJA 3UEOA 1KRXA 1T2NA 3F3KA 1WBDA 3HJGA 4L8VA 4PC6A 3V33A 3E3NA 3PC7A 2XMPA 2PGIA 5KVQA 3G0HA 4ENRA 4LIPD 5E4YA 2X23A 5G41A 4AX8A 2JRCA 3CB2A 2R00C 3JQ8B 2J7KA 3B5JA 3GWZA 1J0XO 5E2IA 3A9WA 3L0DA 1YASA 2EERA 3PZBA 4RW0A 1JNXX 3DQZA 3AP1A 1B42A 2CD9A 4NEGA 5DW3A 1A3CA 3OSZA 3SYMA 2CYAA 2G1KA 3O4HA 2V7TA 4A8PA 5AW0A 1ZN2A 3ZWNA 4MCJA 2QUAA 5B64A 4RJIA 3EEIA 4JB8A 3PCXA 2JBWA 3B48A 3BE5A 1JEQA 1LKZA 2PGAA 1Y1QA 1TLLA 3EMVA 3ER8A 3EC1A 2O54A 3BMOB 1D4ZA 2QUBA 5HZHA 4CCAA 4E13A 2GPJA 2IW3A 2GAOA 3R9XB 2JAQA 3PBKA 1GYPA 1Z3CA 1YONA 4R1PA 4N3AA 5E1MA 1GAQA 1P2BA 3RJ5A 2QV7A 3U1TA 5EIEA 2AF4C 2PPVA 4ZI7F 1HT1E 2IEDA 2M2IA 3LY9A 2YFKA 2EWVA 1XD2A 3OQMA 4DW8A 3A4LA 1UJ4A 1NQUA 4OQPA 2JBAB 3PJRA 2VPZA 5J63A 4AXBA 3M4YA 4HFMA 4XB1A 1YQEA 2ARKA 3L7LA 3R4CA 2EFDB 2XT0A 5IJ0A 5AM5A 1LNZA 2R6GA 4KH1A 1IY8A 3OHMA 2IDKA 5TMEA 1R4ZA 3T61A 5CNJA 3U3XA 2WU0A 1Q7CA 2YC4C 4R1MA 1TMOA 2R8YA 1OYYA 3BHNA 3HDJA 4LCJA 3RUIA 2Q1WA 2IRWA 2IY9A 4HDKB 4EJSC 1NFRA 4BNDB 1NPDA 2I4MA 2XZPA 4QQRA 5DNDA 5ELMA 1L4YA 2R60A 4RHEA 1K1EA 1JA9A 4JFAA 1QE0A 5ALQA 2FYTA 3G5MA 2ERXA 4UEKA 3L0CA 5GGYA 3SM9A 1Q22A 4DUPA 4IF4A 1G5PA 2OB2A 2OHFA 4OQMA 1B6RA 3IVAA 4F97A 2FE1A 2JF0A 2P91A 3FPJA 3AR3A 3ETLA 1A04A 5DIZA 3FKSD 3BHMA 4KACA 1QP0A 5BO5A 1SQ6A 4C4XA 3D59A 4D9HA 3TE7A 1N3LA 5J5VA 4F93B 3QY9A 4MUKA 2DHRA 3C5EA 2FQQA 3DTTA 4OQEA 2FPSA 5TEVA 4DV6B 1GQYA 1GV0A 2AJCA 1M8PA 1RYYA 5L8VA 5JS1A 1OYWA 4JLJA 2OLEA 1ZBDA 1KAQA 2YWDA 3K8QA 2F3SA 4Z86A 5KYUA 1M0SA 1NRJB 2H65A 2NZVG 2WJAA 1I6LA 1KI2A 1M2WA 1AZLA 2W0MA 4L76A 4PAMA 4B85A 5K9ZA 3L6BA 5BR4A 5CA1A 1XHEA 5THXA 2Q5FA 3O1IC 4PQEA 1COWD 3D8BA 1YA4A 1A9PA 2CXSA 2EFEB 2Y1FA 3BK1A 3T1QA 5KZMB 5ADUS 5LWHA 1FYXA 3GLIB 3UMBA 2FPMA 4BXOB 1XRNA 2XKJE 2BHNA 5DV9A 5JJBA 2F1OA 1B93A 4ZI7A 5BUQA 4RL4A 1DQRA 3HKBA 4H08A 2CL6X 4YRKA 3HYTA 1KZ6A 2AW5A 3BERA 1EVYA 5INTA 2B7LA 5JPDA 2AUMA 2LUOA 1YIDA 3THRA 4HQ0A 5HYVA 4YH1A 1NSYA 5DRYA 5ITWA 1JZQA 1YL7A 1CYDA 3G2OA 5ICFA 3AYZB 5CURA 3E8MA 1QE3A 2QTVB 1HFKA 3HA2A 3KQPA 3DOIA 2Y1DA 4BJ6A 2B5VA 5DWQA 3U7JA 1E1CB 1C14A 2PX3A 4Q9DA 4G1EB 1PTJA 1HNWB 1BCSA 1G4AE 4E51A 1LNSA 2Q5JA 3HB1A 3A1NA 4HLCA 4BFUA 4K9QA 3U7QA 3X1JA 1RVV1 1JKIA 3O3NB 4G0QA 3UNXA 2FEOA 3D54D 5IULC 1PWXA 4RPGA 4HRYA 5JNVA 2I87A 3V5NA 1T6BY 2F8LA 2QL6A 3M0EA 4L9WA 2FUG6 2GYWA 3RWMB 1XZCA 2EKZA 1WB5A 5CFRA 3FPHA 4R9VA 2HDHA 1EHYA 4FYKA 4DJDC 5IFKA 3Q7IA 4QVKA 5DZSA 4DS3A 1WB6A 1LH0A 3G82C 5FI0B 2ZBEA 1ZU4A 1VLQA 5IKPA 5JNWA 3L4BA 5F4ZA 2IHJA 2F9FA 3B52X 3RFUA 1OA0A 2R5WA 3NHBA 4DLYA 3TLZA 3P0HA 2CMKA 4JJ6A 2N1BA 3FWNA 3I23A 3OFVA 4EW1A 5LMUB 2QN1A 1SEVA 1T6NA 4Y0VA 4F8EA 2QL7A 4OSEA 1Z7YA 1QE5A 4L3VA 3PL5A 8ABPA 1PK8A 1NJ5A 2PKXA 1ZIDA 3PHHA 3K4PA 5ESWA 3DE1X 1KJQA 4V0SA 2BFFA 3EAQA 4M1KA 4TKUB 4YX9A 1UPTA 1OWPA 1TJPB 3N87A 3TLCA 1AGXA 2O20A 2Z2IA 2H9YA 3CXRA 4D41A 2JFGA 3EC2A 2DG2A 4QAJA 2R8PA 3S5JA 5KJFA 3F7MA 1A9OA 1D2CA 3Q6NA 4EVSA 4B6EA 2O8CA 1ICIA 1JSZA 2WUWE 4BKMA 3MGAA 4N76A 1ZITA 4P3OA 2YDXA 3UM9A 3T0FA 4CT0A 1YBFA 1P7ZA 2EBWA 2HK9A 2V6FA 3QXGA 4FS3A 3GRAA 1C2TA 4JH0A 1DG9A 5ITVA 1U9IC 1V3QE 2BKVA 2J5KA 3ELWA 3OFKA 4KLCA 3D6JA 4TT3A 1P2VA 3QTBA 4X6XA 3VSEA 4A36A 4KFRA 4G5RA 3WBBA 3NT4A 1UZAA 1INLA 1L4BA 2HBQA 3CH6A 3RAJA 3GEPA 4E32A 4AKTA 2JFPA 7GPBA 3KKKA 3HP1A 3U1VA 1SQSA 4BNWA 1EMDA 2JGMA 3EXHC 3OPVA 3NTVA 2TMYA 1SKYE 2PCJA 2QG6A 4TV9A 4JI0B 4R69A 5IVDA 2WFLB 1XPRA 1QDLB 2Q27A 4ZOLB 1OH7A 4I4LA 1QYWA 5LP1A 1FSSA 3ADKA 3O3CA 4DLVA 1RKQA 4F3YA 1WSDA 4L4UA 4Q48A 5H7XA 4RNCA 4QODA 3RVJA 3G02A 1I3NA 3GJ8A 1ULBA 1Z08A 4MRRA 3QVSA 2B94A 2B8WA 3M2TA 3QBTA 4I50B 4LKOA 2CVOA 5IBQA 1ZH8A 1C8KA 3KD3A 4H6VA 4BVAA 3JQ7A 2R25B 4ZI7B 2XV1A 4H6PA 1RHUA 1FP7A 5KAPA 3COSA 3GV0A 4C6TA 3QX7A 5ITSA 2O2EA 3BL5A 4G41A 4MQ4A 5B37A 1TFUA 1R0XA 3OP4A 4Q9AA 5IUNC 4MVJP 4UUQA 4DLZA 1CF2O 5ABPA 5L3VA 3SVLA 5GZ6A 1S2OA 3IP8A 2JFBA 1IIBA 2ZTVA 3ZGLA 2ZIUB 1N8KA 4EO9A 1GQSA 2DP4E 4BNIA 4MSUA 3B1VA 3IUNA 3UMFA 2B8NA 2OUKA 1QS0A 1JG3A 1XU7A 2IX9A 4JB2A 3T7RA 5CAEA 2OBXA 3RJMA 5BSHA 3BTVA 3PEUA 3HDHA 2CHUA 2NT3A 4NY1A 2AG5A 3HBNA 2GN8A 4LV5B 4R1QA 3UMYA 1NLZA 1PI3A 4R1UA 3E3AA 3E1GA 1ZVQA 3EOAI 1W2WB 3K2QA 1H0KA 3OEEA 4WNCA 2IPOA 1FQWA 2I3BA 1AQYA 1GKUB 1RADA 2W5UA 3AF5A 2ZUUA 3N58A 3DDCA 4FZJA 2IVFA 3EODA 1N6OA 5CTAA 5EUQB 2J6CA 3BIJA 4I9UA 3SSMA 3D1LA 1IQRA 2OILA 5KSZA 4W1QA 2JLYA 2ZTMA 1VE6A 2BY4A 3N05A 3CG0A 2RC5A 4TLCA 3M8KA 4XKJA 3OWXA 2B0CA 1U7WA 4X6UA 1R0KA 5C1PA 2VBIA 2NTVA 4OJKA 3DZCA 1AHPA 4YJ2F 3LTNC 3AZQA 1FLDA 4PSCA 4A0HA 5K0JA 3BB3A 1KQFA 1W2HA 5FFNA 3HSSA 4AY2A 1G4HA 1U0JA 1DQYA 3ILSA 4G5YA 4MS3A 2Z1DA 4MRMB 3C7KA 3C3BA 1H0RA 5BW8A 3KQQA 1FJ2A 3NIFB 5DTEA 3F1KA 1I2DA 3J80A 5E2BA 1QZZA 1TTPB 3TF5A 1VI2A 4IDBA 4B7XA 3CY6A 2EJUA 1E5DA 4LUCA 3RIGA 4R9SA 3WDKA 3A8TA 3QVJA 3PF9A 4MV1A 3S29A 3VJKA 3RHTA 4XVRA 3DVRX 2F1KA 3N0WA 4MZDA 4DJEC 2O7VA 3ILHA 5BYAA 4RPCA 2I6SA 2CJPA 2PSEA 1MTOA 3GHHA 1XP8A 1X86B 2FWIA 2GBPA 1PJQA 3HV2A 4LHXA 3RS5A 3QFTA 3BICA 3DKVA 1EX6A 4EBFA 5IU6A 3CVYA 4I4CA 3LF2A 4C4YA 4MJ7A 1E3EA 1CUWA 1XNRB 4ESEA 2HRRA 3H86A 5JJIA 2XY4A 3SFZA 4LZPA 2Q3JA 3TLBA 4PFQA 1J1IA 1JWBB 1D2AA 1S3IA 3QYPA 3ZU4A 4B73A 2JFOA 3R09A 2RJOA 3AFHA 5E0KB 3HXOA 3W78A 4LXQA 2GBCA 1B73A 1Y1LA 1I14A 3H5AA 1JAZA 3NJRA 5FEMA 5ITZA 5JI3E 2QX8A 2RHBA 3LUGA 2G1AA 2VAPA 1I9CA 2CDBA 3AKDA 4X3PA 3TVYA 1XAIA 1LBQA 2G67A 3NIGB 3WHLA 2ZBGA 4FDMA 4GS5A 1ANKA 3AILA 4DC1A 1T4MA 3BC1A 4EUEA 5DM2A 5E4FA 1LRLA 2VYND 4O3FA 8GPBA 5I3CA 1DRJA 4ZAYA 4LNAA 1G20A 4BRWA 2EQ5A 5HE9A 4NNOA 1ACLA 3H11A 4AURA 4EJSA 2GZRA 4F21A 3UJ6A 2IU3A 4LOLA 1H6CA 3WLLA 3A4TA 2MSNA 3HFJA 3ZCSA 1SD1A 1QVVA 3EXAA 1GRNA 1XN4A 3G7UA 2PXAA 3KXPA 3ZY5A 4G9GA 4ZI2A 5DNUA 1SM4A 5E8RA 4Q9NA 3FSEA 1QF7A 1E2EA 2FH5B 4FWTA 1UOOA 4FQ8A 4EPWA 5F3WB 2D2FA 3THSA 3V9AA 3ZBPA 3LW7A 4DMGA 3D1JA 3FCCA 4E21A 4LISA 3AFNA 3OIWA 1BZYA 2Z58A 3B2QA 1AD2A 3N6VA 5CJPA 3BXEA 3I5MA 4BU0A 5CG1A 2YFHA 2R65A 3R6TA 3B3QA 4YCBA 2AB0A 2VC2B 1HNZB 3BAZA 2P41A 2IZ7A 3JSAA 3OE1A 1K68A 4HAZA 1SHJA 3C45A 3T3OA 1A72A 2RSLA 4XLLA 3KYBA 5K4HA 5DGCA 5FTJA 2AL7A 5C51B 3FTFA 5BN4A 2E4VA 2N1MA 2XCQA 4B3XA 2B9VA 4EGFA 4YMVA 1Q57A 4ZCRA 1M0TA 4Q4DA 1MF7A 1HEUA 1YZTA 4HX2A 4LYJA 2WZDA 2QSYA 4ZI3A 4J0IA 3H18A 1PR6A 3OX1A 4L4XA 4PO1A 3ODGA 2Y66A 4B40A 4D9JA 1B8NA 4HX5A 4JLOA 4BNYA 4P83A 1LC0A 1ENOA 4I2VA 4MKHA 4OGFA 3VDQA 1J07A 2X2PA 5ALXA 5C35A 4FXOA 1KU6A 3DV2A 1DBQA 2ZAGA 3X0DA 2BGMA 1M2OB 3GNQA 3D3JA 3H2YA 3G1TA 2HXYA 3OZWA 3JQAA 1M8FA 1ZUNA 3GK3A 4Y9DA 5ALGA 1ISJA 1V5FA 2FR8C 3WC4A 4DR4B 2JNWA 3IC5A 4DV0B 3K8OE 3NHZA 2IGBA 1YXMA 1J2RA 1SA0A 3V9PA 4TKVA 4PG8A 3F5QA 4EYGA 2YVKA 3O7MA 4NJEA 4HUQA 1YU6A 4RVHA 1NL3A 3AF2A 4S3MA 1UKAA 1U6IA 2SKEA 4GQIA 4B9EA 4I14A 3H5OA 5KQPA 5ESDA 5H5JA 4O2BB 3T4PA 2JI4A 2O05A 4ADSG 5DEIA 4CL0A 4RZIA 3TPZA 3OCUA 3QUQA 3BF7A 1M8KA 4G0ZA 3ZR4B 3L7YA 5BSKA 5EJMA 1Z5PA 1VCIA 1UIRA 4Y7DA 4UVGA 2F9MA 3UT0A 5E9WA 3TLMA 4D99A 4W1RA 5EIXA 4Q3OA 4LJ5A 2JFQA 1MZVA 4P7KA 4FNAA 1XPUA 1SZPA 4LCEA 16PKA 3CISA 3QBDA 5HHTA 5FL7A 3FTEA 4Z7JA 1KY2A 3CEJA 3ZWXA 3P71T 4X8OA 3G9XA 3G0CA 2B98A 5KNBA 3MJHA 3TUZC 4JYMA 1G5TA 1P81A 1IUNA 1B26A 1PTJC 2OAGA 2BR3A 3P9SA 4C4ZA 2O2ZA 4Q1EA 4RQTA 5CM8B 4BX2A 1EVEA 1K0UA 4O2BA 3RB8A 3SLRA 5JAQA 5CG2A 4NLLA 2PYDA 3R20A 4OFBA 4XAQA 1YAHA 4Y2UA 2HPZA 2P1RA 2FG6C 2R47A 3H1PA 4NBTA 4MDHA 5EZSA 3MMXA 5F73A 4ND3A 3KYJB 2BKXA 3H9UA 1QVAA 4X54A 4XTCS 3RYIB 5JVDF 2QG9A 3F3SA 3KR0A 4KIWA 4M37A 1LZKA 4I55A 2VZEA 1TKBA 4CQLB 4S05A 4JYAB 4PZ0A 4HTFA 3LZCA 2ZDGA 2ZAYA 1AKQA 1G2QA 4K88A 4UNQA 3SQDA 4PHFA 5BY2A 3M2PA 4CTMA 4CMEA 5HUQA 3JD0A 2PH3A 2QVYX 4PFKA 4O8CA 5H0IA 3T54A 2NU8B 1KIMA 1UMKA 1ZI6A 2ZYAA 3IO5A 4IJVA 2POQX 5G02A 5MN6A 4KLAA 2BR4A 1MGOA 4KRYA 1XZPA 4WK2B 3SSNA 3TQOA 5C80A 1R5BA 3FFTA 4P4NA 3NFYA 4PNZA 2CVZA 1JDBC 2J9ZB 4QATA 4BO2A 5EHNA 3CTPA 3JD2A 4MHTA 2ZJ8A 1O58A 1WTCA 4M9SA 4EJ2A 1YZUA 3O2QB 4M88A 4FJ2A 2AMYA 1GAJA 5A0TA 1JL3A 1KAHA 4GX2A 4DLNA 1ONSA 1BQEA 3MHTA 1U2DA 3DJYA 2YNMA 4QDKA 4U6SA 3QVWA 1XG5A 2ZCUA 4IPTA 2ZULA 1CR6A 4GMDA 1VJCA 3QUBA 2EJVA 3WMFA 1PUIA 4KN5A 4U00A 1QMGA 5EIBD 3ZY3A 2UXCB 3LLSA 1SULA 1IM5A 1NBEA 4INZA 4QHSA 3ZUGA 4D26A 1YRHA 3DVAA 1RQPA 1ZU5A 3H5LA 1EP2B 1JVBA 1LRKA 2C3OA 2OXFA 3B8HA 4IGIA 4AJEA 5I01A 4JI4B 1XZNA 3MD9A 5DNEA 4DGQA 1C1DA 1OH5A 4DB2A 3BJZA 3WWDA 3NONA 5HWSA 1M74A 3COVA 1OC2A 1I1NA 1C4XA 4YO8A 1NR7A 4L0DA 1NPTO 3URMA 2FDCA 5MFZA 4DILA 2EJBA 1H2RS 4F4CA 1DWQA 1V6CA 2C4UA 3GCWA 5ETJA 1QM5A 1C1DB 1FYVA 1UBMS 2G9NA 1BVRA 3NT5A 5JQGB 4XVCA 1I4TD 4FFWA 4PW0A 1I3MA 3JQPA 4M46A 4EB6A 2X9LA 1PUJA 5T64A 3OFSA 1T3GA 1IATA 2P6UA 2QIPA 2IH5A 1GZSA 1N2IA 1BX1A 1Y1TA 2BZSA 3I2FA 5EJAA 4AFNA 3FFXA 3MMNA 1IQUA 1GQFA 1E18A 4IMIB 3SEQA 1JEAA 2NT4A 4KB5A 5CM2Z 1W1UA 1F4LA 3BDIA 1RRFA 4DSZA 2ZSFA 5LIRA 1L8QA 3L8EA 4I4NA 4B32A 1KH3A 3MJCA 4AYWA 2YXDA 4DVGA 5EWMB 1RMYA 2ZQYA 4II7A 3ZGNA 3CJTA 3C43A 2PX0A 1XYYA 3FHJA 2PNJA 4WESB 4CMKA 4EBBA 4EQ6B 1TJYA 5B6PA 5F35A 1CULC 2PZEA 3WSTA 1FVHA 3UKDA 3K0FA 4QRHA 1UT6A 1FMFA 2VR1A 2D3WA 1UBOS 3BTOA 5JCOA 1Z45A 3NBKA 4WK4B 5AICA 3HVKA 1V48A 4INAA 2H2WA 2WSBA 2ZJ3A 1W6RA 3BQMB 3FUCA 5JE8A 3WLPA 4CKEB 4DWWA 3KVNA 5CFLA 4XEHA 5IMBA 4KKXB 4TQUS 3WK5A 3ZI7A 4EG4A 1NUSA 3K8YA 3G68A 4HAYA 4Y6OA 3W3AH 2GQ0A 3FUVA 4PGGA 4RD0A 1TK9A 3K05A 2H2FA 3QLTA 4FYMA 4G5SA 3F5FA 1Q92A 3GRUA 3S2FA 3ESBA 5SY4A 4AUNA 2BI4A 3PLNA 4N12A 4IGEA 5HCIA 4GIBA 4S12A 3WGVA 2Q4TA 1D8AA 3OI7A 5L7WA 1TW2A 4ZODA 4E0BA 4ER6A 3TOSA 3WZ2A 1HE4A 3Q8KA 2DFVA 2I9PA 4CLEA 4IYJA 2PM8A 4CEIB 1R00A 2DPLA 1GLGA 4S1WA 3G1WA 3PEFA 2UKDA 1M72A 2CJWA 3N07A 4OP1A 2HC9A 1WUIS 1IJKA 2FWJA 2EWMA 2TMKA 3OCXA 4D9MA 3WBKA 2GPNA 1GJRA 1LX6A 1GFIA 1P5JA 3M34A 1RP1A 3BH6A 4LCBA 3P5BA 3KU1A 5SY9A 1QZ3A 3PNYA 1EFHA 3K15A 1JKFA 5FWAA 3TD9A 3DW1X 3C6YA 5K6TA 1PJAA 1RWNA 2Y4NA 5AM1A 2F55A 2AX3A 4BC1A 1T3LA 2Q9CA 2PV7A 1WXEA 2O2GA 1YZVA 2QAIA 1VE7A 2A35A 4EGAA 1ID8A 4TMWA 2DR0A 5AOCA 4OXRA 3B1WA 5IC4A 1Z5WA 4ND8A 3KYDB 1EZ1A 2FLWA 1Z0UA 2D59A 4YT5A 3SR0A 5G0WA 4PBTA 1CETA 1LPBB 1QORA 2GKSA 2QYOA 4HH3C 3UZUA 2Q4DA 5LA6F 2XYRA 4XDHA 3VC3A 5KCZA 3BB4A 2QEQA 4YXFA 3WISA 2C03A 3PD1A 4EA7A 3FTPA 1RCUA 2PKRA 1P7VA 2CF6A 1L0BA 4JJKA 3CVUA 3ISVA 2PUDA 4Y3UA 1U5AA 1YMUA 3LQKA 4HQLA 3OKFA 4X0EA 2PU5A 2YWEA 2BSQA 4LVOA 2NUTA 2YVUA 2EQBA 5FFFA 3D43A 3UMJA 1E1YA 1GPH1 3PQ6A 4HAVA 1GUDA 2GM3A 3E53A 4HD8A 4OK5A 5SZKB 4A6PA 5KNCD 1M1UA 5ALWA 1MIOB 1DEXA 1TIBA 3MWFA 4NOKA 3FDZB 3TL6A 5EMHA 1AKRA 1Z6YA 1RM5A 4IIJF 5E7IA 2EJTA 5F2NA 4XASA 2P3OA 1SUSA 4FLFA 4LXHA 3WTCA 2WD7A 3DLPX 4B4OA 1JG1A 2P6PA 4B3IA 4GC5A 2YWRA 4JR0A 1HTWA 4AMUA 2OV6A 4MOWA 1GSAA 1G6HA 2JHCA 2NGRA 2OXEA 1R0LA 2CCJA 3B82A 3RM3A 1UFVA 2V98A 3AHGA 4MB6A 4UBMA 4EHIA 5LNK6 4PC7A 1X7XA 1QGOA 3OFND 5TRTA 3EGCA 4RD1A 3W6OA 5AHWA 4ZU3A 3WYAA 3X1WA 4HC4A 3TQHA 2IHZA 3S3TA 2NSYA 3I2YX 1KZHA 4B83A 1AQ6A 2HSGA 1Z35A 2ZS7A 4EI9A 4GOOD 3LQFA 3I6QA 2XEDA 4ZQCB 5HKOA 1EFAA 1QRUA 4C4PA 1NJ8A 1QCCA 4MIYA 1TC2A 1TD1A 3OAAA 1DEKA 2F1JA 5DYYA 1L5SA 1QHHA 4K0RA 5COQA 3A9RA 1YI0A 4P82A 3IOMA 1OFUX 1XVIA 1Q16A 3TZLA 3EGDB 2NZ2A 4R05A 3UPTA 2AQHA 5I9IA 2VF5X 2R8BA 4L51A 1VJRA 5DN9A 4ZT2A 2COUA 3P5SA 4M98A 4ONEA 4IJQA 2Z09A 3L7JA 3HA5A 1VJTA 3LBFA 3B36A 3K6SB 2XPCA 3M6IA 4E2XA 2VRBA 3C85A 3H5IA 5G2OA 5CX4A 1R0CA 2RGGA 4YRMA 1FFYA 5LDHA 1Q0LA 3PUZA 4BMXA 5I7RA 4KWHA 4MULA 5KPDA 1D9XA 3OF5A 5CEJA 2BELA 3VDXA 1YBAA 4FHZA 2G0NA 1L1RA 4Q3AA 3RUAA 3FPKA 5KREA 4PXSA 3RFXA 1BWRA 2IYQA 2OFOA 2ZIAA 5DX0A 5K4GA 2WTNA 2XR1A 1KMHB 3WNQA 1RM0A 1ZN7A 3LRTA 3ZQKA 3TOZA 1QG6A 2OBMA 5ALMA 3CVWA 1W36D 2C2YA 2PUVA 4R0MA 4NCAA 3C6XA 2HU5A 4XX1A 2UYCA 4DRZA 1E89A 1WPRA 3PICA 4WOPA 4LFBB 1T1SA 2ZIZA 4Q4AA 1TLFA 4C89A 4RM3A 1NZJA 1BD4A 1J1UA 1W96A 1KZGB 4URYR 5J23A 1ITZA 1KZYC 3GD7A 4PPGA 3ZDEA 3OO0A 1JIQA 3L6OO 3K0HA 4YWJA 1H0SA 1PSZA 4NV1A 3HM9A 3KKNA 2C82A 3FPLA 4OQQA 4V03A 5ERGB 5HNKA 2LIVA 1M34E 2AMJA 4DCVA 1BG6A 2ZIGA 2ZRNA 1IEXA 3ET4A 1SHLA 2GWRA 1V5GA 4YMTA 3PC2A 3OZRA 1WCXA 4AP5A 5LP6C 3F5MA 2BKAA 3FPFA 5ISMA 3B9RA 4QRDA 4A6EA 4E5VA 1XI2A 1K88A 1XRSB 3G8YA 3ILXA 3K9HA 4JP5A 4QASA 4YCLA 2H4YA 1B0UA 4R0VA 1AHHA 1O6GA 4V0QA 4Y2VA 5HVNA 4FONA 4HL6A 1GRRA 2XMRA 1HY3A 5E4TA 3TMYA 5AW7A 3SDBA 3I72A 4JEUA 4ALLA 3HWWA 1J23A 2AF3C 2DF8A 5KWSA 5A3VA 3ROEA 1ECLA 1G8FA 2VT6A 3LSYA 1C1HA 1ZONA 1UOPA 3D4LA 5HGJA 1Z16A 3TPCA 2WF7A 3LA8A 4TX1A 1MRSA 4TN1A 3ZWMA 5BR8B 1QGUA 4NX2A 4KRFA 2W2LD 3A9TA 2AE1A 2YZGA 3AXSA 3NV7A 5FWXA 5IF9A 3JCZA 4DA6A 3R3WA 4H31A 3O4RA 4RDIA 4WCDA 2HOQA 3MPUA 2I6TA 5FI5A 5DN6D 3FCEA 5FAKA 3ZGZA 4EFLA 1VCOA 1YFZA 2ANCA 3U1BA 4WXEA 1W7AA 2UYOA 3LC2O 3QU4A 3N8NA 2ILTA 4QVGA 4E5MA 3L49A 4B17A 2B5WA 4B3GA 2XZOA 4NE9A 3CRNA 4F4FA 1IOZA 2FMUA 2PR2A 2C8LA 3L7CA 4M99A 4OGKA 1U2EA 1VJ0A 2RGNC 3BIWA 3H1GA 3HUDA 3W2GA 2XCTB 2H2HA 2J0UB 4TLDA 3CZRA 3ILVA 1F8FA 2ZYUX 3AVQA 4TV9F 3H0EA 1D7AA 4J4TA 4RTJA 4P31A 1FE8A 2VH1A 5HF6A 3TIFA 5L9AA 3MFYA 5MGNA 1A5TA 1GO2A 1YBHA 1RMTA 5E6RA 1E0SA 2CFIA 3KQWA 4JLVA 3PSHA 3KVYA 4TL9A 5KI6A 1S6YA 2CFCA 3K35A 3P0FA 4F8JA 2DXIA 1XHFA 2DULA 2GZ1A 4OKSA 2B6HA 1K3FA 4MARA 2JD0A 1ZEMA 4JLKA 1SBHA 3TLYA 3I01M 2PUTA 4Z2AA 1BE1A 1MT0A 4PYNA 5F3RA 2HJVA 3DTNA 3BK2A 3KV1A 4HNHA 5D6NA 3TSAA 3UGTA 2IEBA 3GCXA 4JLBA 2DPYA 1X15A 1NVDA 4F6CA 1Z26A 4UTPA 1Y5IA 2I34A 4LK3A 2VP6A 4DQVA 2CE2X 2X0NA 4HSEA 5IJ0B 3T1YB 3JZFA 4CEHB 1D2RA 1I5OA 3P26A 1K6XA 2Q46A 2Z8XA 4TT3D 1PHRA 1GCOA 4DGSA 3QQPA 4KSCA 2ZETA 5BVGB 4WXMA 1DXOA 1Z29A 2V6MA 4F5WA 4JGGA 5H83A 3QVGB 5MF6A 3AG5A 4EFMA 4FR5A 3O74A 1CVLA 3LL4A 5KIAA 4IV5A 5JOQA 3BF8A 1CQJA 2WJIA 2XE7A 3G0DA 2YX1A 1YDMA 1VFNA 4IXNA 4XJSA 4DMLA 1EKXA 1I10A 5FPHA 3R9XA 1NXPA 1YQUA 2JJ8A 2EW1A 3KTAB 3WIBA 2BZ0A 1YI8A 3FA2A 4RPIA 4TWJA 4DHEA 2M98A 1OASA 1Y4ZA 4A0RA 4YT4A 3SS7X 2IIBA 1IN1A 1JFLA 1M10A 2XGJA 1E6EA 2CJFA 1HYHA 4YBZA 4QTTB 5EVJA 1EIZA 3T1HB 3AL0C 1CUDA 4IQGA 2AJTA 5SY6A 1YQQA 1ZW6A 3F4BA 4UXHA 4Z4GA 3VMFA 1USWA 4OXNA 2REOA 5CXSA 2Z4RA 3KQOA 1TD9A 3JQCA 3ZV4A 1I5EA 2XXAA 2P9QA 3BKXA 4QUIA 1HT0A 2KM1A 4RQUA 4DMRA 1VA5A 2P62A 3R6GA 2XZLA 5H3CA 4L9AA 3NW9A 3DVLA 3HJTA 1OZHA 3PNLA 3GY0A 3ANLA 1T4GA 4UUBA 4ZICA 4YJ3B 3AFOA 1EDBA 1M1XB 3O8NA 4BS9A 1H69A 5TF0A 5JTTA 5FULA 1YF3A 3GJSA 1EXNA 4JEHA 2AFHA 1L8XA 3HU2A 4YR9A 4KNVA 2WWHA 3CMMA 3TCKA 1SQGA 1AQUA 1RRMA 2HF9A 1W5FA 2YL2A 3C6ZA 3KQTA 4ILKA 5D3QA 1MC8A 3P9KA 3K9FC 1JEYB 1P6XA 1I24A 1QBGA 2R6DA 3HYLA 1VPDA 1XZJA 3I2KA 3VPGA 4Y2XA 2HTFA 2YC2C 4MX8A 3VHLB 4Q7MB 3IP5A 4BJ5A 2GOYA 3H17A 4U4AA 4RTNA 5IT4A 4G0OA 4B5KA 2QLFA 3EPKA 3AVTA 2WYHA 3KL4A 1RZUA 1RW4A 3MSXA 1DC6A 4IZOA 4MUHA 5AW8A 5KDDA 3C97A 2PQ2A 1SQ0A 1GN9A 2VWHA 4LHSA 3U0BA 5T8KC 4KITB 4X62B 3FPSA 3HRKA 3Q3EA 4IIEA 1TUBA 4DTIA 3IXMA 4LFAB 4K03A 4NE7A 3HBFA 4XA8A 4DQKA 5LJIA 1T1IA 3CRZA 2AVDA 2F64A 1D9ZA 5DYGA 4DDMA 4RZXA 3SK0A 2KE5A 1Q3HA 2DLDA 4M2LA 4LSGA 3W0LB 1KK1A 3T35A 4WASA 4G4GA 4Z51A 2C0CA 1E1CA 5K0EA 3CUKA 3U39A 4K8OA 2CVQA 3LTEA 5JD6A 1MRNA 3FE2A 3S8MA 3IKTA 5FI3A 4YDSA 3FW1A 4FMCF 1IN6A 2OGWA 1XROA 1U11A 2Q4EA 1UJ5A 3KO8A 5ALLA 2XKBA 3OTIA 2J30A 4Z3DA 4EW2A 5CBPA 9LDTA 3KQSA 2WUDA 3BSYA 4TMFA 3ZLBA 3DLBA 2YTZA 1GNLA 4O33A 1Z6QA 3U17A 2YY5A 3FDZA 5ALHA 2OCPA 1VYUA 1QIJA 1OJ7A 2VSXA 4GECA 5E0OA 1Y8AA 1AK9A 3IQWA 3IRVA 3R1IA 3MJEA 1FUKA 1GCGA 1F2VA 3ZX5A 1XP5A 2PTGA 4EX6A 5BN3B 3V1TC 1JHYA 4X85A 4YECA 1YV9A 3LG2A 4MWOA 3D6VA 3LUAA 1X3LA 1RYMA 4GR4A 3WB2A 3WJAA 1VL1A 5EP3A 2H06A 2AKAB 3PI6A 1EINA 2WVGA 3H5NA 3QWFA 1DZIA 1G1AA 1H2XA 1S3SA 1GUYA 3VGPA 5AOBA 4CU2A 4B35A 4LY6A 1HKUA 2BEUB 4N6NA 4J16C 1ZXLA 2AZDA 1DOHA 1H66A 1XWFA 2H5IA 4PSKA 4W5WA 5IEBA 1Q12A 3S7TA 3KYDA 4MROA 5JQGA 2E4YA 1JZSA 5C9ZA 4MVWA 2MSKA 5AUPB 2BLLA 3NBUA 2DPMA 3LRXA 2FRVA 4BV2A 2ZTLA 1WP9A 2JIZA 2OAEA 5ICCA 3UJAA 3FYUA 1E2QA 1QGED 2CNWA 3OCYA 3SOPA 3TD2A 1LD3A 3IBFA 1KETA 1JWAB 1WJGA 2PA0A 3IS3A 1AKEA 4KE8A 2XNSA 4MIOA 5FYDA 3CC8A 1K8XB 4R3UC 2BE7A 3BDVA 3K6JA 1SCJA 5ICMA 3QF4A 5F7ZA 3SQNA 5JAUA 2DM6A 2HJGA 5FBWB 3M1IA 4AROA 3G7SA 1ADCA 3OTQA 4WZAB 2GJSA 4CPDA 1ZD8A 1YVRA 4DNXA 4KDEA 2D5IA 3B6KA 2C42A 4AO8A 3F0TA 3TLJA 1J8MF 5A5FA 1A9QA 3UWKA 1BNCA 4PXYA 3THWA 4PLVA 2YYAA 3HV0A 4AC9A 3OQJA 4AMVA 1RZVA 4YVFA 4LJAA 2QMYA 3WZLA 2IEAA 3MTIA 3PHJA 1GTJ1 3RC3A 1H2AS 2WVAA 4TZ6A 3WR5A 1J33A 1DPFA 4BNXA 3W4IA 4AZVA 4YJ2A 2VOJA 3LGXA 5D7NA 2J4CA 1P1JA 5G3YA 3F7NA 2XUOA 4BQOA 4EHDA 1XN1A 5I51A 3W5UA 3FF4A 1JWLA 2EP8A 2C5AA 4NBUA 3G2HA 4LYFA 2HRBA 4PYKA 4ZVQA 3C7CB 2EU8A 6REQB 2C7QA 1KWGA 2FFRA 1CFZA 7YASA 4D0RA 1EFUA 1XXHA 2Q07A 3RYHA 4OH7A 1DVRA 4WINA 3ZWCA 5BWLA 4J75A 2INGX 2IL1A 3A1WA 1XAJA 3IFSA 4O5AA 4EQ6A 2GK6A 5IT0A 2PZ8A 4Z9XA 2IF0A 3ZE7A 3UHJA 3VX4A 4MWBA 1AH2A 1Q3KA 1N78A 4AKHA 3BIOA 2DH6A 3NEAA 1O6CA 4AQYB 2F3UA 3QPCA 5ECDA 4ZC1A 4EFKA 2BM0A 5LFAA 3W5JA 1LPOA 4IIJB 4RDHA 1VRVA 1J42A 2ID9A 1U2RA 4U2DA 5AT1A 2NYVA 5IYZB 1KPIA 1MVOA 2XWQA 1ZGCA 2BFCA 3A6JA 4MYHA 4WXHA 3KFXA 1F1JA 1NBWB 1QYDA 2BF4A 3C4QA 4KVZA 2FQYA 2Z4TA 4TXLA 5D8DA 4BV9A 1IBLB 4XDYA 1DXYA 2D1FA 1ILEA 1OGIA 3QYAA 2FVXA 3CH4B 1THMA 1TUGA 2GM9A 5JS2A 2E49A 1GZ6A 4Q7KA 3T1TA 1FQJA 1KERA 1QOPB 2ZJFA 1JU4A 5HFAA 1Z9BA 1ADYA 3NYWA 2X1MA 3PE3A 3A6LA 3NM5A 2QRGA 3A2NA 2JH3A 3GWGA 2OO5A 3L0IB 2VJMA 2ODAA 3MHPA 1JDZA 1BVUA 1GL9B 2H0QA 1YDHA 1I4OA 1XZGA 4R7GA 4W99A 1TPYA 4IXTA 3UGJA 1NI4B 3V4PB 4DQDA 3UJ3X 2AOTA 3VISA 2BV3A 1L4NA 2BEUA 1S01A 2R6HA 4OY3A 1QIEA 4YUXA 4ZV4A 4CEJA 2FFHA 5GIPE 2YS6A 4D4KA 2PUBA 3OZIA 4HVLA 2XMGA 3IVGA 3ZWYA 4ZCIA 3QZUA 5KSPA 3LCJA 2D4AA 2D5LA 4LE1A 5I47A 1SUWA 3UHOA 1V8OA 2GHRA 1PZEA 1RRKA 2IXTA 4OL9A 4RWEA 2OG2A 4D81A 1VL0A 2WKPA 4FLMA 4LJYA 4QU0A 1YNOA 2QM0A 2UZ3A 2Z5FA 3PSAA 1JBQA 2AG1A 3DR5A 5KCMA 1YZKA 4AJJA 1G5IA 1PSWA 4HDNB 3OU2A 5EZYB 4DUZB 2YFQA 1KU0A 1W9MA 3LFTA 4OQXA 1RWBA 3TW6A 1B74A 1HXHA 1IHYA 1GXSA 3EYWA 3LDFA 1FFHA 2X2OA 4HAWA 4QPCA 1C8BA 4E6PA 4EYEA 4D98A 3AIMA 2D2XA 3Q5DA 3TTSA 1GL3A 2JGAA 3UAVA 5DNYB 3DC7A 1ZN8A 1O6BA 1LI5A 3HL4A 2OD2A 1HBJA 3T3IA 3G13A 1NXVA 1I4LD 2RGNA 3ETDA 3PDCA 3DHEA 4HAIA 4ZTBA 4RF2A 4BN4A 5JAHA 5EFZA 1P7PA 3VU1A 2O7NA 4XYGA 2Z95A 4ODIA 5AO9A 2DHQA 4CF3A 3VYUB 4CQMB 1DAFA 1U9YA 2AYXA 3V8NA 4CDGA