4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl CoA reductase
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
1UR5A 1DJNA 4R69A 4D41A 4CM3A 1YXMA 3C1OA 3RUAA 4DLLA 1LDBA 1B8UA 4FC6A 1TA4A 3PHGA 1MA0A 1IUKA 1UDAA 2JHFA 2D1YA 4O6VA 5G0WA 2ZB7A 1PJTA 1A27A 1LSJA 3JQFC 3N7UA 2D2IA 1CDOA 2VRCD 4CM8A 2FZWA 4WCFA 2Y1FA 2Y1CA 2B5WA 1IZ0A 2Q1SA 3EK2A 3JQGB 3ANLA 2NQ8A 4GKBA 2JFGA 4UUMA 3ETGA 2OBYA 3K2EA 2B0JA 2F00A 4A27A 1CIVA 3A06A 3DZFA 4BV9A 1EDOA 4XEHA 5EMHA 3NT5A 1WLYA 4IMRA 1C0PA 3RUIA 1I3MA 3RVDA 1K6XA 4QUKA 1BXZA 3VTFA 4YJFB 1MG0A 3HDYA 3Q6IA 3RUHA 5DBIA 4A7PA 2EJWA 4DBZA 2JKVA 1E1NA 3LT2A 4IQ0A 4NBVA 4XQ9A 3ZNQA 2Y68A 2WYVA 3NV9A 5ICSA 4BVAA 5TSDA 2CSUA 3EZYA 3OJ0A 1QYCA 4E3ZA 1EQUA 1V9LA 3I9OA 3MJTA 4OSPA 4YAJA 3GAZA 3TWOA 3RC9A 3AOEC 5KTKA 1IPFA 3U4DA 1Y7TA 3FI9A 4R5HA 4CMBA 3ZU5A 4ALLA 4INAA 3GEDA 2HMTA 2HSDA 4RLSA 1DC3A 4GVXA 3JQBC 5LDHA 1Z7EA 4CQMA 1IYZA 3FTNA 1PJCA 2Y1EA 3UF0A 3L07A 3Q2IA 4UVEA 3PJEA 4F6CA 2CDBA 4CQLB 1K6JA 2P4QA 3E9QA 1E6EA 5G2OA 4U6SA 5TNXA 1UP7A 4CV1A 1W4ZA 5IZCA 1NR1A 5IXYA 3NJ4A 4RF3A 1KEPA 3S1LA 2AXQA 2Y0EA 5L53A 3GHHA 1TXGA 1V0JA 3D4PA 3HDQA 3BMOA 4RPGA 3DOOA 4TRJA 4FJ2A 1ZW1A 2HAEA 1QRRA 3Q2KA 4AICA 5IFLA 4NJOA 1I8TA 3RBXA 3STHA 1CEQA 3TDKA 2C20A 2VTEA 4EUFA 1O0SA 1RM4A 3UKOA 1E3JA 5H82A 1JKFA 1MC4A 1UUFA 1Y5RA 2EW8A 1F17A 1UJMA 2Y0DA 4KTVE 4BNJA 1P1JA 2B4TO 4E32A 1WP4A 2O4CA 3LYLA 3VDQA 4BO6A 2ZCVA 1G0NA 4BO3A 1VC2A 2GPTA 4PIVA 3GH3A 1PIWA 4IGFA 4ND3A 3U3XA 3HHPA 5HWSA 2DFDA 5JO0A 3DHNA 4PG7A 3AM4A 4GI2A 5C3MA 4RVHA 5JSFA 1H2BA 4R3NA 4B4VA 4MVJD 4WNIA 2ILTA 4WEQA 3PGXA 2I5PO 2RIRA 1H9AA 2X5KO 2VYND 2PKRA 1FMCA 1XU9A 1Y8RA 3M1LA 3FR7A 4Z9FA 3WQRA 1N8KA 4CV0A 5KCZA 3M1AA 4CL3A 3X2EA 3GVHA 2HUNA 3D64A 3PDJA 2HK8A 5G4KA 3OEYA 5DBGA 4BMNA 4IDGA 4KOAA 1PQWA 3NYWA 4YQZA 1SEPA 1NNUA 4CODB 2PK3A 1LNQA 4A26A 5BNFA 3WYCA 2GN4A 4UULA 5JW6A 3SVTA 4CM4A 1OI7A 2BHLA 5JBIA 5CDYA 1DHRA 4JLWA 3QP9A 2CDCA 2BFAA 4M87A 1YE3A 3LF1A 4XIJA 4A5OA 5EQFA 4I1IA 2O3UA 2EWMA 1H2HA 4ILKA 1YH3A 1YQDA 1MC5A 5CPFA 3JQ7A 3X2FA 1I2BA 2FP4A 4X54A 5HS4A 4HP8A 4JXKA 1X15A 4PLVA 4U0JA 5I9LA 2FPIA 1NFRA 4BB6A 2VOJA 3A4VA 2DM6A 4BQPA 5TT1A 1U7TA 3IJPA 2JCVA 4D42A 3IKVA 3PHJA 5ER9A 1VSVA 3NGXA 4JJIA 1KIFA 2G5CA 4MJLA 2GCGA 2UDPA 1E7MA 1XSEA 3FWNA 1GL3A 5CG2A 1PR3A 1J5PA 4GX2A 4L74A 2V65A 3C7CB 4WPGA 5G4LA 3JD0A 3BTSA 2EJVA 1KBZA 7ADHA 3DONA 1ZIDA 2POQX 4NIMA 3UCXA 3WOHA 4BNVA 4BNWA 2VN8A 1BTOA 2HCTA 4TVOA 1PSDA 2D4AA 3AFNA 3RUDA 2HO5A 1VL0A 4RF2A 1QMGA 3T7CA 3GA0A 2H63A 4LSWA 1O9BA 1O94A 1PS0A 1UP4A 4BNHA 1H6CA 5CFZA 1BVUA 4E31A 2ZTMA 4LMRA 5AXDA 1W73A 3RKUA 5JDIC 4ZJUA 5JE8A 1ZSVA 3ZU2A 1I33A 4OH1A 2CDAA 2IDZA 2Q2WA 3C7AA 3ADOA 1VJ1A 2X86A 5CAEA 5JY6A 1EE9A 3F1KA 5CDSA 4IIUA 4FD3A 2DTDA 1SMKA 1NVTA 2Q4EA 5IZ4A 3OA2A 1BRMA 3EUWA 3H9UA 1C0KA 2IYPA 1XKQA 4UUPA 2GLXA 3GK3A 1T1RA 3DOJA 1XU7A 4JP3A 5JPIA 3V2UA 2V6FA 3ZV4A 2YV1A 1KEVA 2VYVD 3KEOA 4WJZA 4CLOB 2XOXA 1V3UA 3B1FA 4AJ4A 1ZMOA 3OJLA 1HRDA 5EN4A 4UREA 2B37A 3VVBA 3W4JA 1FJHA 5L7WA 3BMQB 1ISFA 5F5NA 4JQCA 1P77A 2PD3A 2Y1GA 2O3JA 2VUUA 2BFOA 2RH4A 3KYDA 3NEPX 3WQSB 3K96A 3AJRA 3DAGA 1ADGA 3MWEB 4O63O 5DF1A 1X0VA 3B70A 2GNAA 4XD2A 4J91A 2I76A 3C7DB 4J1QA 3DL2A 1YJ8A 1F0YA 1R0SA 4YCAA 3ANMA 4H7PA 3FRJA 3D0OA 3PHIA 4AJJA 2YYYA 5JDCA 4CLDA 1EK5A 3C1TA 4Y8VA 3ZWAA 3R3JA 5IDWA 2O3RA 2PZLA 4ZQGA 4GH5A 2DPGA 2GO1A 2WSBA 2Y99A 1VKNA 1Y1PA 3DHYA 3FHLA 4UVDA 4TZTA 2IE0A 5BSHA 1NXQA 1G1AA 3WGYA 1KVUA 3MTJA 1VPDA 1PJQA 9LDTA 1H9BA 1U8XX 4CMJA 4GLLA 1Z82A 4BNNA 1N1GA 2PWZA 2XAAA 1B2LA 5CDUA 4BGVA 3EW7A 4J4BA 4B3JA 3GMDA 1YRLA 3KEQA 4IGEA 4RPLA 2VUTA 2AHRA 2OZPA 4DWVA 4DRYA 4IM7A 3U5TA 1ZMTA 2FZEA 4H15A 4MKZA 4DPLA 4WKGA 1E1MA 8ADHA 2RH8A 1FDVA 4LMPA 4YRAA 2OP1A 3EGOA 4DC0A 4XR9A 3WTBA 3WJ7A 2VWGA 5A4DA 5ADHA 4M86A 4IJUA 3NKLA 5GZ6A 3W4IA 1NP3A 2X9NA 3FNGA 4F3YA 1Q7GA 4UEOA 1VKOA 1A9YA 1T1SA 2E49A 3UH1A 2B4QA 1X14A 2ET6A 3QQPA 4PRLA 2C07A 3FSRA 3G49A 4DA9A 2WMDA 3QW2A 4R1NA 4Z3KA 3DR3A 4IZHA 5T8KA 3RBZA 4CMEA 5JCJA 5TIIA 3EAGA 4YT4A 3RC1A 5C7OO 3DWFA 3ZNOA 2SCUA 2Q1UA 3F4BA 4MDHA 5BT9A 1Q7CA 4TRNA 3JSAA 3A14A 4BNTA 4M54A 1H93A 4FC7A 4J2OA 1ADFA 3VPFA 4CM5A 2ZTUA 4FOSA 2V7PA 1FDUA 4G5HA 4YJHA 3FNHA 3JTMA 3UCEA 3LF2A 2QRJA 2EKLA 1J49A 1NQAO 3H6KA 1PZFA 3H3FA 5HM8A 1WMBA 5CPBA 4YA6A 4CQMD 4R3WA 2VHVA 4II3A 2VRBA 3RSHA 1KETA 3FPLA 4C7KA 4UEKA 5DNAA 3CINA 4DIFA 3ST7A 5IDXA 1XQ1A 3GUYA 4OQYA 2AE2A 2YDYA 2PNFA 4OQZA 1S6YA 4NJMB 4FJ1A 1KY5A 1Z73A 3G0OA 4NDNE 4HX5A 4ZVVA 4MVJF 4BO4A 4DQUA 4YAIA 5IZCC 3GMSA 4DPMA 3OICA 3I9LA 3V1TC 3U9LA 2NACA 2EHDA 3R6DA 1SEVA 2R00A 3L6EA 1Q0QA 2FR0A 1B3RA 4E5PA 1E7WA 1YL6A 1AE1A 3NDIA 3UAGA 4AJKA 1I3KA 5DCWA 1JQBA 1MB4A 4P4NA 1D3AA 3BYZA 4ROSA 3ZHYA 3WS7A 2I6TA 4MVJM 1DC6A 1RM0A 1KS9A 4CUKA 3HDHA 3KUXA 3L9XA 2VOEA 3JQAB 5JCXA 4GKVA 3U4HA 2YW9A 4XYBA 4MIEA 2GN9A 2A4KA 3I4CA 4BIIA 4Q3AA 3QE3A 2E82A 3BA1A 1PS8A 4GX1A 4EJ6A 2Y67A 4GX0A 1DAOA 3V1UA 3PP8A 4ZICA 2Y05A 1JWBB 1B26A 1E5LA 1NQTA 4MIYA 3KRTA 2WDZA 2BGKA 2VWQA 1XELA 3E6AA 3G3EA 1E6WA 2FPPA 3DBHA 3PI7A 4N5MA 4RLHA 2X4GA 4B4UA 3DZHA 5AXCA 1YBAA 5HRUA 5L3ZA 3PQFA 3QRWA 5IXSA 1TB4A 1J0XO 4U5QA 2BD0A 1B16A 3PTZA 2CVZA 1ENPA 3GGOA 5DULA 4CMAA 1NQ5A 4TRRA 3H2ZA 4CR6A 3ANNA 2OBNA 4QECA 3RASA 4OMUA 1PJSA 4OYRA 1AXGA 1LDGA 1XGKA 3GGGA 4FDAA 2VYNA 3E9NA 1U5CA 1CYDA 2Q50A 2Q1TA 2HMUA 2HRBA 1OC4A 3RBVA 4B7UA 3W8FA 1B15A 3HSKA 2C54A 4MVJP 1X1EA 4XIYA 4E13A 4E12A 3FN4A 1P1RA 3DZKA 3GDGA 2D8AA 1PWXA 4YAEA 1PJ2A 3H65A 3SJUA 3IMFA 5KJCA 5CEJA 1VJTA 4IDBA 4BNZA 3LZ6A 1CQIA 4Q39A 1E3SA 2Z1NA 5FYDA 2P68A 3ZZNA 3GG2A 2EGHA 4FPXA 4YJGB 4LK3A 4J1NA 4R01A 3GZ4A 1E77A 1U2GA 1NR7A 2AA3A 1H94A 1YB4A 1Z74A 2ZB3A 3H5AA 3GPDG 4GBJA 4L4RA 2Q3EA 5MDHA 3JD2A 4GSLA 4Z9XA 5F1OA 4MVJG 2Y0CA 1XR3A 3FTPA 3WXBA 3RFTA 1FDSA 1HLPA 2CMDA 4ALKA 4RQUA 4Y9DA 2C0CA 4QT0A 4PN3A 5A5FA 4BO8A 4FFMA 5BQFA 1ISJA 3S2IA 1YBMA 5AOVA 3LVFO 4DBVO 1U3WA 2W2KB 4ZRMA 1LLQA 4OKIA 2VT3A 3ONFA 4Z0PA 3GF4A 1YVEI 4CLRB 3S2GA 5A9RA 1W0CA 2P5UA 1Z6ZA 5KJ1A 1QLHA 1YONA 4PGFA 1PQPA 2C5AA 2VNSA 3AFMA 4IJVA 3UUWA 4W9NA 5JAZA 5L40A 4L0QA 4YXFA 1EE2A 3D3WA 4WOJA 3KETA 2PZJA 5FEUA 1P0FA 3ICCA 3IQDB 1A7KA 4U7WA 4DYVA 4NNJA 2JJYA 3WFIA 3GN2A 3CPSA 2EKPA 1ZK2A 2C5EA 3IP1A 4GQAA 4CPDA 5B4TA 3M2PA 4RVUA 4KP7A 4I9HA 2BI7A 5I8WA 4MP3A 1BW9A 1E0DA 4ALJA 4I9UA 3DOCA 4JJFA 3PLNA 3Q3CA 4NR0A 3ON5A 4Z3DA 3GFBA 4A03A 1QYXA 3KSZO 3I3OA 4GMFA 5I9MA 3ORFA 3IL2A 3NT2A 5GZ1A 2V6BA 4RPHA 3VZQA 3G17A 4LCJA 5KVVA 4C7JA 1WDMA 3PYMA 3ZWNA 4FN4A 4Y6PA 3NGLA 3ZHZA 5IDQA 1ZFNA 3PZBA 3I9NA 3UICA 5IF3A 1QYDA 1SOVA 4CLXA 4NHEA 1HYHA 2CF6A 1XDWA 2Q99A 1FXSA 4CLEA 1XG5A 2J3JA 4CMHA 4ZQFA 2E4AA 1GAEO 4D3SA 2G76A 2VYVA 3O9ZA 4FOOA 3A28A 2PV7A 3UHAA 4NG5A 3OJFA 4RGBA 1GQ2A 4GGPA 2VT2A 1C0LA 1EVZA 3HNPA 4HADA 5T5QA 4XYLA 2EXXA 2W98A 3HFGA 3TNLA 4CMIA 1BGVA 1M67A 5EIOA 5A05A 5BSEA 1YO6A 1ISIA 3S2EA 3CE6A 1C1DA 3AOGA 4B7XA 4E5YA 3JQ9A 4TWRA 2NADA 4E5NA 4R9SA 3RQSA 4BO0A 3DMTA 3IUSA 4J1SA 3RU9A 1E5QA 1DIGA 2BRUA 2DTXA 2AE1A 3ZU3A 5A9SA 4YEDA 3VAZA 3N58A 1JA9A 1NFQA 1R4MA 4NZ9A 3DEYX 3PWKA 2F1KA 4W82A 3LT4A 4XDZA 5JC1A 4MINA 4A10A 4D0SA 1R4NA 3HZZA 3INGA 1YB5A 3QVOA 2JD0A 1I30A 2V6MA 3MCVA 2DQ4A 3ROMA 4A2CA 1X7GA 5THQA 1QV6A 1JAYA 4ZRNA 3W8EA 2WE8A 2DC1A 3VDRA 1EFLA 1ZXLA 4LN1A 3AY6A 4XYMA 3WR5A 3OQBA 5IAAA 1LRKA 2X0RA 4YWJA 2Y1OA 3ICPA 4LRSB 5DP2A 1GTMA 3WJAA 4N5LA 4WLVA 5A9TA 1AHIA 1F8FA 4BGUA 1PL7A 3GRKA 4WE3A 1IULA 3H8VA 3OH8A 4BKRA 3FR8A 2J5QA 4Q3BA 1DFIA 3WWYA 4PZDA 5KKAA 1PX0A 3PZRA 1MXFA 3L4BA 3ROQA 5F21A 1VLLA 1UXGA 2B5VA 5AVOA 2OHXA 1OMOA 2VUSA 4RF4A 1ZXBA 4J4TA 3KLMX 3E18A 4R16A 1HSZA 2X1HA 1R0KA 5JCJD 5L7TA 1YOVB 4NH4A 3ABIA 4EI2A 1T4BA 1XA0A 1HDYA 1U2DA 1UDCA 4WCDA 4A73A 3H5RA 4QO7A 1RYEA 3FBGA 1WMAA 1F06A 4IDDA 2JHGA 3Q0EA 4L76A 3B6ZA 5F1KA 1HLDA 1PQUA 2YQ4A 1SBYA 5ILOA 1SC6A 4QXMA 4NI5A 1KC1A 1VM6A 3TSCA 3MJVA 3BMCA 3H4VA 3K31A 4QEDA 3TJRA 3JQEA 4BNXA 2CD9A 3GY0A 3H2SA 3JQ8B 4UEJA 3PIDA 4XYEA 2D5CA 1PGOA 1DIAA 1V3VA 4WUVA 3WGIA 2LDXA 2HKIA 1DDOA 5U9CA 3ONDA 1LDEA 1C0IA 2ZQYA 4M49A 3MTGA 1DRUA 4AJOA 1D7OA 4O59O 3DBLA 1HL3A 1SNYA 1ONPA 2WEKA 4JCOA 1B3BA 1D8AA 1LSUA 2GRAA 3DZGA 1NWCA 1FDTA 1EFKA 2BI8A 4PG4A 4RCVA 8LDHA 2GF2A 4ZQHA 2I3GA 4PLHA 3WMXA 5CG1A 4J9UE 1NYTA 2A94A 1H5QA 1Y8QB 1NWHA 3RD5A 2CUKA 5FFFA 5DT9A 3RC2A 3P5SA 5T6BA 1I01A 4GPD1 1V8BA 3O26A 4K1LA 3F5SA 4PLWA 2Y1DA 3RC7A 5L4LA 1T2FA 3KSDO 1UAGA 4GX5A 4ZGWA 4XYGA 4IIVA 1IZ9A 2FSVA 2CZCA 1MLDA 4MP8A 4JBGA 5JAIA 4P8RA 3NTRA 1E1KA 2BLLA 5FI5A 1DC4A 2RAFA 1EUCA 1K2WA 3OP4A 4CM8B 4WCFB 2HMWA 4JP2A 3VPSA 3G79A 4CR8A 2I99A 1B8PA 1C3VA 2ZB4A 1N9GB 1NHWA 2HMVA 3AK4A 1NVMB 4R9RA 1LTHR 4I9NA 2IODA 4AVYA 4CM6A 3ZV6A 1FF9A 3UFXA 5KOIA 1QKIA 2X0IA 4PLFA 2VHXA 1T4DA 5TRTA 2BF7A 4B79A 3FNFA 2R6JA 3I9JA 3E8XA 2NU9A 1VJ0A 2GD1O 1CQJA 3JCZA 4WOKA 4JIGA 1K89A 4ZHSA 1HDXA 4CM7A 4E2YA 3KYCA 3WMWA 1LDMA 4UUNA 1T2CA 1R15A 4FFOA 1HE3A 1ZCJA 4XKJA 4Q9NA 1L7DA 2DBZA 1TT5A 4IMPA 4XB2A 3HG7A 4PLZA 1PZEA 4YT8A 3AU9A 1B14A 3JD1A 2FHSA 5COBA 4BNUA 4RPKA 4CQMB 1EDZA 4O5OA 3VPGA 5TS3A 2ZK7A 3ZNPA 1DJQA 4BQRA 4YYZA 5TQVA 4BMVA 4R1SA 4DQVA 1U5AA 2FOIA 2TMDA 3GZNA 3KB6A 4I5DA 3DBRA 3L4SO 3HQ4O 4AG3A 1BDMA 2HJRA 3AI3A 4L4SA 3RKRA 4YJDA 2HMSA 3PJDA 1WPQA 1PJ3A 4M8SA 4MIOA 5F1PA 3DMYA 4EEXA 1YL5A 4UVHA 4L4XA 1OC2A 3BMOB 3L6OO 2X7HA 2EP5A 5G0SA 4W9NC 1DHTA 1NASA 1X1TA 1ZEJA 4K6FA 5EL0A 2NU8A 3DAPA 3T7EA 1ZJYA 2AQIA 3AM3A 2YV3A 3AWDA 4L9RA 4PG5A 1U28A 5L95A 1YQGA 3SC4A 4DLAA 3D3EA 1LRJA 1LDYA 4WLUA 2NV6A 2NUAA 2OL4A 1R0LA 5K6AC 5CEFA 4AJLA 3WQQA 5KKCA 5JYDA 1GCOA 4M1QA 5T67A 3SJ7A 3ONEA 3QIVA 1GZ6A 3G1UA 4BNYA 1JKIA 1DAPA 1ID1A 3GVPA 1U3VA 1IL0A 4O0LA 2UAGA 1HDCA 1UXJA 1A71A 4EEZA 1RM5A 3VOSA 5MGBA 1Y9AA 4ALMA 3HUDA 1Y8RB 1KC3A 2QIOA 1PJLA 2QG4A 3ZWPA 4KWIA 3F6YA 1NPTO 4WK6A 3VVCA 3FBTA 5G4KB 3JV7A 1I0ZA 1JDJA 2VCYA 2JL1A 1PGQA 2J8ZA 3O8QA 3DTTA 1ADBA 1LA2A 3F9IA 3PLRA 1VL6A 4UUOA 2X58A 4D3DA 2VTDA 2YHIA 5EINA 3AW9A 4CM4B 5L51A 5HTOA 3GG9A 1BXKA 3TZHA 5L45A 1ZSYA 3ZHBA 4BNKA 4NPCA 2NTVA 2X9VA 3MOGA 1Z75A 3MEQA 4NFSA 1KVTA 3A1NA 4QQRA 4RVGA 4WLNA 5TC4A 4FFRA 4LRTB 1HF3A 2GUGA 3QJ5A 4J7CA 4OKNA 3JQ9C 3JQ7B 2Y93A 3U4IA 2Z5LA 4DREA 4E33A 4EJMA 1HTBA 1XEAA 2IEDA 3DMTC 2O3TA 3RUFA 1Z7BA 5B12A 3C1AA 3WGQA 3LC1O 3ZV3A 4NK5A 5F5LA 2G17A 2XF8A 2XXJA 3E48A 4Q3EA 1QG6A 1IHYA 3CZMA 2J3KA 3RJ9A 4J1TA 2WD7A 1ZK1A 4EUHA 3MJCA 4FGSA 3FNEA 4FFNA 3ZI0A 3GVIA 3R1IA 1R66A 1TLTA 2G1UA 1VE9A 3HDJA 5FI3A 3ASVA 1H0KA 3WLEA 4KUHA 3GEMA 2AG5A 1P33A 1F8GA 3V2HA 1EVIA 1GD1O 2PH5A 1WDLA 3WTCA 4D44A 3SX2A 3TRIA 4BO2A 4RF5A 3W1VA 4NBTA 1YKFA 1LC3A 1NVGA 4W4TA 3CEAA 1CWUA 4BNIA 4BHTA 2Q45A 5B1YA 3OSUA 2WM3A 4XGKA 4Z9YA 5CDTA 5ICMA 4U6QA 3NDJA 3I4FA 1P74A 3L4BC 3ZWBA 3NJ8A 5ITWA 3N74A 3C85A 5DP1A 3TFQA 4NFYA 4W7IA 1HDRA 4WCFC 3GNSA 4NBWA 5CEEA 2X5OA 1U1IA 3F46A 3F3SA 3EYWA 1N1EA 4OIMA 2A9FA 1NPYA 3IIEA 2Q4BA 2HRZA 2W2LA 3R3SA 3UXYA 4F45A 4HFJA 4ONEA 1DB3A 1G6KA 3RCBA 3KSUA 1QLJA 3MZ0A 3UN1A 3I83A 5BNIA 4R1TA 3RIHA 1GR0A 2I65A 1YJQA 3KHUA 4FGWA 4RPJA 4GWGA 4HKTA 4P4GA 3K9QO 3ZN2A 3OJOA 1QYVA 5JMPA 3E5RA 4QFDA 3RAJA 3KYDB 3WDSA 4WLEA 3LT1A 3WFJA 1YDEA 4FJ0A 5IG2A 2EF1A 1QV7A 5L9AA 4IDCA 2AMFA 5T57A 3PWSA 4J4HA 5AYVA 1QP8A 2J3IA 4OOEA 1JVBA 1M75A 1E92A 3V8BA 1C14A 4ND4A 3VH4A 2BFPA 4KQWA 3AY7A 3BMNA 4RO0A 2AW5A 2JCXA 1X0XA 1E1LA 4H3VA 3GUCA 3VZPA 5FWNA 4PLYA 3TFOA 5ES3A 3W6ZA 3H5NA 2YV2A 2AEFA 3AU8A 3ENKA 3PVZA 1LQUA 3JYQA 4RVDA 1PGNA 3OIDA 4C4OA 5H81A 4YT2A 1XYGA 5A03A 1HE4A 4HWKA 4J9VA 4OXKA 5HS6A 2WYUA 1EUZA 3JYLA 4NBRA 4ZN6A 2WJPA 2I67A 2ZJ1A 3QLJA 3L6DA 4EDFA 2PR2A 4B4OA 2EIHA 1E7SA 3CSDA 4NBUA 4J7XA 2AQHA 4XJSA 3TOXA 3NDRA 4GAEA 5JAMA 3JQBA 2DBQA 2WWRA 4TKLA 4E5MA 3FWZA 2VWPA 1Y81A 3GT0A 4HFMA 1LC0A 3DZIA 1MGOA 7MDHA 2CFCA 2WYWA 4WNCA 1NQOA 4DYDA 1LJ8A 3HADA 3SBOA 3WGZA 4D0RA 4WASA 3HFSA 4RL6A 4YPOA 1MXHA 4ZQEA 1SB9A 3EVNA 1I3NA 3GEGA 1Y5MA 1XCBA 2NVUA 3C3XA 2B36A 4OHUA 4W99A 4TROA 3GN1A 4ID9A 1ZEMA 2EGGA 2O7SA 4OM8A 3PFWO 2PGLA 3H9JA 2R2GA 1MP0A 3M6IA 4Q3CA 2GZ2A 3HE3A 2HQ1A 2AQKA 5CDGA 1WZIA 1P45A 3GC6A 3NT4A 1DRWA 5B4VA 1ZVMA 1NPDA 4IY1A 3I6QA 2ZIZA 4R51A 1A9ZA 3QHAA 4IS2A 2QHXA 2J5RA 4G2NA 4R5MA 2NQTA 4RQTA 1JKJA 1RWBA 1E3WA 1S7CA 1T2DA 3JQDA 4YJHB 1H6BA 4IQGA 1DFGA 3AUAA 3DDNA 1KY4A 4AJIA 1HZJA 3GVXA 1QYWA 4YR9A 1A4UA 1Q7BA 2ZCUA 1ENZA 2O7QA 5C5IA 4RDHA 3P2OA 4ND1A 4CR7A 3I9MA 1KVSA 4XB1A 2QYTA 3INTA 1OOEA 1N7GA 2W4QA 2YDXA 5C37A 1UAYA 1RKXA 5I7VA 1IB6A 3SLKA 3V1YA 4DUPA 1Y6JA 3AUTA 4YVFA 3WNQA 3WGTA 3DAFA 3VPXA 4DGSA 1C1XA 1U9JA 1GEGA 5I7FA 3CXRA 3PFFA 1CF2O 4OXYA 3H9GA 4YT5A 3PJGA 2GR9A 4HNGA 3GDOA 4XQCA 4JBHA 4EUEA 1P1HA 3IAHA 3W8DA 2DU8A 3DFUA 4AL4A 4BNGA 2PLAA 2BFMA 2I3AA 2YQ5A 1X13A 4BGEA 5I8ZA 1HDZA 3JYOA 2PGDA 4IZIA 3SXPA 2NM0A 2PKQO 1DBVO 1DOHA 4HFRA 4OL9A 1R16A 1BXGA 4P22A 4QTZA 4E4YA 4D79A 3MJSA 1ARZA 2Q46A 3WLFA 3OMLA 1O5IA 5EQDA 4P38A 1GUFA 2IZ0A 1HT0A 1PWZA 3DBHB 4PLCA 4HBGA 4TZKA 3INRA 4DTIA 3Q11A 1PJ4A 1HYEA 2GN8A 2HU2A 1CETA 1YS4A 4BS9A 3WIEA 2AEMA 1QR6A 3DTYA 4S1VA 4BKOA 1WZEA 1DLJA 1AN9A 1HE5A 5COAA 3H7AA 1UDBA 1VRWA 2FSSA 5C7IO 3KLPX 2J6IA 4FFPA 2QZZA 1YDWA 5BSFA 1R37A 4Q3DA 4FQ8A 5JDIA 1LLUA 5CP8A 2H5LA 4NQZA 5KNLA 3H9EO 5TJHA 1ZK0A 4OOFA 3OEWA 4YRBA 1U3TA 1TT7A 1ZH8A 1YL7A 1D1SA 4R41A 2A35A 1QXSA 4FFLA 5AQ1A 3ZCXA 5IN4A 3VZRA 3PQEA 1GV0A 3LT0A 4IXWA 1M76A 3UGKA 2ZQZA 3BXXA 1HE2A 1T26A 3JQGA 4L75A 2V6GA 2PTGA 2YFQA 3MWDB 5A3JA 5JDCC 4BKQA 2GERA 1GCUA 4CLHA 4BKUA 6ADHA 1DIHA 4LVUA 1DC5A 2VWHA 1JLLA 1ULSA 5TLSA 1DLIA 1AUPA 1L1FA 4II2A 2ZJ0A 2PA3A 4RDIA 2X5JO 3DC2A 4J3FA 4YJFA 1LBEA 4UVGA 4CMCA 3CTMA 4BOYA 2FN7A 3SLGA 5J23A 3TZKA 3DO5A 2OP0A 4IJWA 5KVCA 1GZ3A 1B0AA 1ZJZA 4Y67A 1SAYA 4QFCA 4E21A 2QZ9A 3F5QA 4MKXA 1Z45A 3EVTA 2D5AA 3BZUA 2B69A 4CJXA 1LI4A 4R68A 3D3WB 1UZMA 4XWYA 2OUIA 4N5NA 5BNTA 5CHEA 1UZLA 2HDHA 2VNAA 3WGHA 3DHEA 1UP6A 4PG6A 1NBOA 3HN2A 2Q49A 1P0CA 1LUAA 5C7LO 1O8CA 1U4OA 1JWAB 2GN6A 2YJZA 4PLPA 2YY7A 4DVJA 2X9GA 4XRRA 1GYRA 5DBFA 4MVJE 1VI2A 1BW9B 4GGOA 4FSHA 2W2LD 3Q1LA 1UZNA 1DSSG 3LDHA 1KEUA 2PD4A 4ND5A 1QSGA 4B3HA 4W7HA 5JNLA 2PFGA 3KM0A 3BHMA 5HBRA 5JO9A 3ROPA 4CQLA 5B4UA 3IC5A 3R0IA 2DPHA 4LCEA 3ZNNA 2FR1A 1KOLA 1ISMA 1N2SA 1WW8A 2EP7A 1U7HA 3BHJA 4NFHA 3WIDA 1HXHA 1PGJA 5K9ZA 1IOLA 4PZCA 4Z0HO 2XPCA 2C2YA 2I9PA 1JW9B 5T8KC 4CMEC 3B1KA 2X6TA 4YQYA 2RCYA 3F1LA 4HNHA 1RM3A 1LSSA 3AY3A 1ZUD1 3V2GA 1EVYA 3GLQA 4NMHA 3TZCA 1NX6A 2IYOA 5T64A 3IDSA 4E5KA 4QO8A 1N9GA 4AJPA 4CMIB 1I36A 2WE7A 2BGMA 3ZWYA 5I7SA 4DMMA 4N18A 4J6FA 1GU7A 5L4SA 3ROKA 1C1DB 2UUPA 3JYNA 1GPDG 3RROA 4PRKA 1D1TA 1GYQA 2TMGA 5IDYA 4BNLA 1T25A 2YZ7A 4IPTA 3LC2O 3ZH2A 5GY7A 1T2EA 3BHIA 2B4RO 3DZBA 5A9SB 2DLDA 4E2ZA 1ONOA 1R4MB 4ALIA 3KBOA 3PQDA 4RJTA 2P91A 5ENDA 3QVSA 2Z1MA 1R4NB 4GL4A 4ITUA 4J2HA 1SB8A 3B1JA 3GHYA 1EK6A 3DQPA 2JAPA 2O48X 3WBFA 2X8LA 4OSOA 3PRJA 1FK8A 1PU2A 2EW2A 3GPIA 3GVCA 2R00C 1R12A 1GFSA 3EY4A 2Q1WA 3AI1A 1P1FA 1R6DA 4DMLA 1CJCA 4E2WA 3BIOA 2NTNA 2Z95A 3W6UA 3VKVA 3GNQA 2OMEA 1ZK4A 1Q0LA 3ITKA 4WLFA 2BGLA 4OXNA 1H6AA 4NK4A 5U4QA 1GADO 5U1PA 3D4OA 3I9KA 1DEHA 1GUYA 3ZWVA 1ZNQO 4BMSA 2QQ5A 1BG6A 3OECA 2IXAA 2NU7A 4HUJA 1K0UA 2GGSA 3L9WA 4F6LA 5ITVA 1WXDA 2ZB8A 1GV1A 3LSYA 5TT0A 4BO7A 5L7YA 1KEWA 4BL5A 3WSVA 4D45A 2PZMA 3AUUA 2Y66A 2ZATA 3IJRA 4MKRA 4BUCA 3QWHA 1O95A 2HLPA 3BAZA 3ULKA 2NU6A 4KQXA 4IXTA 3TN7A 3FD8A 3NAQA 3QWAA 4JX8A 2UUOA 2GASA 2LDBA 1HETA 1XWFA 2J5KA 4LISA 1I32A 1TI7A 4L8VA 4PVCA 4EZBA 2C82A 1K3TA 3BTUA 4QX6A 3BMCB 2DUUA 3DZJA 4G65A 2I66A 3QY9A 4PFJA 3MOIA 2YHUA 1Q1NA 4ZQBA 1PZHA 1SCUA 3DB2A 3RU7A 4H16A 1EMDA 5DCUA 4EGFA 3HB5X 5EERA 5JMWA 3WX0A 5A02A 3DBLB 1E7QA 1PEDA 2E37A 1JVSA 1F12A 5JYEA 3U09A 1XIVA 1BWSA 3ENNA 2W90A 1I24A 1J6UA 4CLOA 1DFHA 2QW8A 3T4XA 4JNKA 3TQHA 1AHHA 1D4FA 2FMUA 1N92A 2ZTLA 4K9DA 4PLGA 1HZZA 2P9EA 1DRVA 1JTVA 2QRKA 3ADPA 3PXXA 3C8MA 3KVOA 4E30A 3BMQA 2CVQA 4J49A 5A04A 2X23A 2OFPA 1A72A 3PYLA 4MOWA 2NNLD 3Q9NA 4OJNA 3TPCA 1NTOA 4E0BA 4IQ8A 4LVCA 4MP6A 4YACA 4M55A 1ENOA 3TOZA 3O03A 4AJHA 4Y6RA 3OF2A 1PL6A 3VH2A 2GYYA 4DIBA 2X0JA 5IJZA 3KV3O 3V5NA 3KYBA 1TVEA 4XX0A 2HJSA 5B37A 2UV8A 5BR7A 5JC8A 3VHRA 2C59A 1LU9A 3CMCO 4FR5A 1A5ZA 4M89A 5HA5A 4WECA 1ZSNA 2WTBA 4BO5A 1VSUA 3KO8A 3RFVA 4CUJA 3E03A 2IXBA 1I10A 4P4LA 2UYYA 3P2YA 3OIFA 3ZWXA 4D46A 3VH3A 4BNFA 4JROA 3HN7A 4BV8A 9LDBA 2B83A 4TSKA 3SEFA 4LGVA 3UOGA 3ZWWA 4CUZA 2DBRA 3HB4X 1G0OA 4YAKA 3KXDA 4GWKA 2IRWA 3AUSA 3H3JA 3PHLA 1PGPA 3I1JA 1T2AA 4D7AA 1Y9EA 3NTQA 3ZW8A 4ZD6A 1XQ6A 2P4HX 4ZU3A 3VZSA 1NAIA 3LC7O 4XGIA 2DT5A 3RJ5A 3JD3A 4HXYA 5DOZA 4U0KA 1PJBA 1M66A 2OGUA 3D1LA 2DUWA 2P9GA 3KYCB 4XZ3A 3CZRA 4KDFA 5KWEA 4IJKA 4XQGA 3GGPA 1OZAA 1U4SA 4MO2A 2FRDA 4XA8A 1TT5B 1M6WA 5DZSA 2RHCA 1ULUA 4HFNA 3RFXA 6LDHA 3QA9A 3T4EA 1LLCA 1NHGA 1EEHA 1AXEA 1V3TA 4PCVA 4BGIA 1I3LA 1SOWA 2BH9A 3GZNB 3GAFA 3DBRB 5JFOA 4HV4A 1CERA 1GYPA 1IE3A 1EBUA 2ZYAA 3ZWOA 5COQA 3BTOA 3EZLA 3D7LA 4URFA 3AM5A 3C24A 3K30A 2JD2A 2DAPA 1K6IA 2JCYA 2ZYDA 4BNMA 4CM9A 2UVDA 1IPEA 1E7RA 1L7EA 2O2SA 3W4KA 2JFHA 1ISHA 4FB5A 4IINA 3QVTA 1WAMA 1HYGA 1GZ4A 1PZGA 2NVBA 4E6PA 2QYSA 3IP3A 1YWGO 4AJ2A 3IOYA 3RUCA 2GZ1A 3MJEA 4Y6SA 3ZV5A 1H6DA 4AJNA 4IS3A 2HK7A 2NTJA 1IHXA 3ITDA 2DBVO 4EYEA 1UXIA 3QVWA 2OO5A 2EKQA 3E9MA 4NJMA 3E1KA 4YDRA 1O89A 4KMSA 1KVRA 2RBEA 4MVJH 3DXFA 4JK3A 1UXKA 4B7CA 2FWMX 3TZ6A 1GPJA 4B8ZA 1U3UA 5AXBA 4ND2A 3WWZA 1XHLA 4WEOA 3RUEA 1HEUA 1KYQA 5KJ6A 2O3QA 3EMKA 3O8QB 3OETA 4XGNA 1GDHA 3ZHXA 5DCYA 4JJGA 2P9CA 3G1TA 3QWBA 3E82A 1P44A 4EITA 2YHIB 3JQAA 1ZK3A 3UCFA 4GSKA 3NRCA 3CIFA 3PIIA 2J3HA 2ZYGA 4YRDA 3OA0A 3PYXA 3PHHA 4ESOA 1F14A 3K6JA 3JQFA 3TL3A 3PDUA 4CMKA 3FCOA 3OIGA 1ADCA 5GMOA 3ZWCA 3CKYA 4IUYA 1P1KA 4GMGA 4BO1A 4J90A 2VRCA 4PZEA 4Y98A 3GNTA 2OXIA 3S2FA 5A5EA 3KZVA 4K28A 5FF9A 4Z6KA 3WYBA 2GZ3A 1ORRA 2PKQP 1GQYA 2EG9A 1MUUA 1RYDA 4XCVA 3WICA 2IZ1A 4RZIA 4CL8A 1CRWG 2AG8A 2VZ0A 4RVSA 2PGJA 5A3VA 3IS3A 1LX6A 3LU1A 2X0NA 4MVJI 2O23A 1LSOA 2WD7B 4TRMA 2BMAA 1JAXA 1N5DA 3D5QA 1A4IA 3K73O 3UVEA 3OJEA 3RWBA 3WG9A 1ONNA 2FY8A 5ENVA 4KDEA 1DIBA 3JD4A 3P7MA 4K26A 3MJ4A 1HWYA 5LC1A 2PZKA 1LRLA 3EC7A 1E3EA 4YTEA 4F46A 3WYEA 3GR6A 4J7UA 1UXHA 4BB5A 1KVQA 4XR4A 3IKTA 4CV2A 1DXYA 1A7AA 3AOEA 4OO3A 1U8FO 3TF5A 1EBFA 4KTTE 4DQXA 1LLDA 4MPDA 4UAGA 5F3RA 4I8XA 3KTDA 3PEFA 4YJGA 4ZA2A 4I5GA 1WNTA 2DFVA 4W6ZA 3LLSA 2JD1A 4D3FA 4DC1A 1K5HA 3ZGYA 3EDMA 1LQTA 4JBIA 4XJTA 3FPCA 4JN6B 2DTEA 4OGWA 5KVQA 1EZ4A 1E7YA 5EESA 1I5RA 3K8ZA 4BKPA 4FCCA 1P9LA 3O38A 4EW6A 2P5YA 2YUTA 4KWHA 3NX4A 2FR8A 4BO9A 1IY8A 4R1UA 3PGJA 1GEEA 2E6UX 4DL9A 1KERA 3QWFA 4B3IA 2W2KA 4RORA 3HJAA 5G0UA 3ZU4A 2Q2VA 4RZHA 4I08A 4CLRA 1E6UA 3B20A 4UVIA 3GDFA 2JFFA 3ETDA 3U0BA 3LQFA 2CNBA 1WWKA 3O4RA 3S55A 4DXHA 1M6HA 1N7HA 2NWQA 2D3TA 2O3SA 4IDAA 4DLBA 1SPXA 1QORA 4AJ1A 1GUZA 3VC7A 4EBFA 4E2XA 2YFHA 4WLOA 1P1IA 3OQ6A 3ZW9A 5JLAA 4TKMA 3SC6A 1WVGA 4J16A 3A9WA 1Q2XA 1LDNA 3WGGA 3D4NA 3I5MA 1BHSA 1EUDA 1GY8A 5ER6A 3P19A 1XLTA 1YB1A 3GRPA 3TL2A 2C29D 2GSDA 3BMNB 5LCXA 3I52A 3EHEA 3RI3A 2D59A 1HDGO 1NAHA 4XDYA 4MVJA 2B35A 4R54A 5LDGA 5KJEA 1VL8A 1DO8A 1E3LA 5G0TA 1GQQA 5KIAA 2PD6A 1T24A 4Q3NA 3ETEA 4GLOA 4NU5A 5EJ2A 2FPGA 5EPOA 4IDEA 4D43A 5I9NA 3PPIA 4FS3A 2C7GA 2E48A 2AQ8A 2W8ZA 1WDKA 1ZBQA 1ISGA 2ZKLA 3NUGA 4O1MA 4R4JA 2IEBA 4CMGA 3M2TA 4J43A 1ZZEA 3CUKA 5G0VA 1SZJG 1AGNA 1JU9A 1MFZA 2NSDA 4DPKA 4YBZA 5TF4A 1PL8A 2NLOA 4TMFA 3H9QA 3WNVA 1BDBA 4TVBA 3CH6A 3GQVA 1MX3A 2HK9A 4KUGA 5DDIP 2H1SA 3E5MA 4S3MA 2NVWA 5TGDA 3WGOA 2D0IA 3L77A 4CM1A 1EQ2A 1P3DA 4JGBA 2EEZA 4B4WA 1YQXA 4FBGA 2NVUB 2QRLA 1P31A 2EV9A 2VQ3A 3QSGA 4J0FA 3HWRA 4K6CA 4Z0TA 1B7GO 2PH3A 2G0TA 4L73A 1BMDA 2VZ8A 3VKUA 4GVLA 3OM9A 5TJ9A 4I5FA 2AEJA 5GZ3A 2A92A 2BELA 4QSMA 5I7EA 1YBVA 1OAAA 1NFFA 3Q9UA 2GDZA 4N54A 5JS6A 1ML3A 2EERA 5L4NA 3COSA 3PWZA 4G81A 1FDWA 3GFGA 5IN5A 1MFPA 1ENYA 1PR9A 2OOSA 5JXWA 3VH1A 1V6AA 4A0SA 2Q2QA 5K6AA 5JY1A 5H83A 3U4CA 1M2WA 2G82A 4KUEA 2C2XA 3TZQA 1RJWA 5BSGA 1B8VA 3QWIA 3OQ1A 3ASUA 1E3WB 4PG8A 3DFZA 1OBFO 1X7HA 4TQGA 4FIZA 2O4UX 2CF5A 3VPHA 4EJ0A 1V35A 1PS9A 1RPNA 2O50A 3D5TA 3KOUA 2VHZA 4RVFA 3K2BA 2DKNA 5A06A 2C7VA 3BTVA 4U8GA 1I2ZA 1MV8A 3LLVA 3NTOA 1OFGA 1JN0A 3IUPA 2CVOA 2JAHA 3QVXA 4CV3A 2BKAA 4DIOA 1SO8A 3JQ6A 2QX7A 3I23A 4NU6A 1YOVA 1HDOA 1NM5A 3I6IA 5AXAA 3OFSA 5TX7A 4HY3A 5DOVA 1ZKMA 3OBBA 1W8DA 4CM9D 4I5EA 4N7RA 5THKA 2RHRA 2CY0A 1C1XB 1Q0HA 2XXBA 3WB9A 4LSMA 1J4AA 3K5PA 4J0EA 5ILGA 5K0ZA 1W6UA 2OORA 3VTZA 3LK7A 3DBVO 5KJFA 4ALNA 1I2CA 2WD8A 2H9IA 4LW8A 2IZZA 2VHYA 5JAQA 2VHWA 1HKUA 3F47A 2X22A 3PJFA 3L0DA 1LEHA 4KZPA 3U49A 2P2SA 3S8MA 3JQ8A 4PVDA 4PLTA 1X7DA 1MG5A 3WBBA 3U62A 4YB8A 3CMMA 4B8WA 2ZTVA 3ZWMA 4IDFA 2O2YA 1BVRA 1PTJA 1BXGB 3WSWA 1DIRA 1E3IA 3OHSX 3GOHA 4FW8A 4AJEA 3QV1A 3PK0A 2H6EA 1O6ZA 1DPGA 1LXCA 4XRGA 3JYPA 1BSVA 1Y8QA 2DVMA 3FF4A 3ZDFA 5KVSA 1TEHA 4YAGA 4OAQA 4RV9A 3F4LA 4XQEA 3UW3A 4IBOA 4WGGA 4AFNA 5DN9A 3K92A 2PY6A 1YGYA 5A1TA 3JQCA 1UH5A 3JQAD 1HSOA 3AI2A 1EVJA 2VZ9A 1ZO8A
chains in the Genus database with same CATH superfamily
3G9TA 4N76A 2I1QA 1BCRA 1XMJA 3T0GA 3BFXA 1KO4A 4CM3A 1EE1A 3ZPXA 2HWKA 1ZN8A 3RVKA 3KPUA 2D2VA 1IJFA 1B8UA 5C81A 4QGGA 1DO2A 1KKLA 2JI6A 2OHHA 2VH2A 3OPYB 4FC6A 2GO7A 5H4HA 1U9YA 4B5KA 2EYUA 4MWOA 1MA0A 4HDNA 4RUKA 1FP7A 5DGTA 5EG5A 3QYFA 4YGXB 4RKWA 4ZOLA 3N7UA 4I50F 5FWXB 4QPCA 1CDOA 2ZBUA 2PVCA 1H05A 1DZIA 1J2EA 3R5SA 2M2IA 1OBHA 4CCWA 1TM4E 3BF7A 1KQ3A 3JWPA 3PR3A 4J0HA 2B5WA 1TMGE 2Q1SA 1CBUA 4KQ6A 4JYPA 4XIGS 4YH1A 3SXUB 1NBEA 3U37A 4E15A 1NLFA 3L82B 4RWEA 1EAMA 5EMJA 2P69A 3K2EA 2ZJ8A 1VGVA 4NONA 2A7XA 3AL2A 2HGZA 3A06A 3MIZA 1FOEB 1TK2A 1IEVA 2CE2X 3DKKA 2QB5A 2F43B 2QLMA 2AI3A 4POOA 3NT5A 3W0LB 3NNSA 4X45A 4O4LA 1E2LA 4AN0A 4IKEA 3MCTA 1TZCA 3AHEA 4M1YA 3VTFA 3TIVA 3RDPA 2JVKA 3HDYA 5TVKA 1JH9A 1HG0A 5DBIA 2Z4SA 1ZVQA 2KLBA 4J03A 4YGYA 1OLOA 3HKEB 3IAEA 5C7YA 1ZOSA 1GWNA 2WYVA 2Y68A 1WBDA 4Y1EA 5AK0A 4BVAA 5TSDA 3WRWA 1TZBA 1EP3B 2DLCX 1EQUA 3I9OA 5FA5A 4MV5A 2CE7A 1RP1A 4OSPA 2F6RA 4YFVA 2GKSA 3CNQS 2JARA 3GAZA 9GPBA 1A9XB 1N6PA 1M54A 2HHAA 1S3FA 1I2DA 4KC0A 1QANA 3EIXA 4CMBA 3VR3D 1ES9A 4INAA 3WHLA 3FLMA 3GJ8A 2YYSA 2I71A 4KKVA 2X6RA 5K03A 3P0FA 1AD2A 1B2RA 2JIZD 4CQMA 3G2IA 3IE0A 2WYOA 4I50A 3W7AA 3WLNA 3AKZA 2I4IA 4MGEA 1PAUA 3TM5A 3ZK8A 4UVEA 1JQEA 1ZHHA 4JSRA 1JH8A 4F6CA 5HSGA 2C5LA 5I6DA 2FP3A 3MHPA 1Z8FA 2RGXA 4H17A 1D4OA 1UPCA 1K6JA 4WHMA 3SYTA 3BQ9A 4U6SA 4EYKA 5IZCA 1W4ZA 4Q15A 4RIEA 3UMBA 3NJ4A 4RF3A 3ABSB 5IXYA 1WCV1 1GTG1 1JIQA 1RRPA 2Y0EA 3IKMB 3OT4A 4UU0A 5KYUA 3TTWA 4POAA 1HURA 2VK8A 3I1YA 5BRJA 5HJ2A 3ZCRA 5K05A 3DOOA 4TRJA 3M5PA 4FJ2A 2HAEA 4AICA 3P4XA 5KYXA 2YRXA 1PG0A 2H4XA 4Q3LA 1ESDA 2PL9A 2WMNB 4Y2VA 3STHA 2RAPA 4PO9A 4L07A 4G1EB 1P8JA 4W5TA 1O0SA 5EJGA 1RM4A 3E9CA 3UKOA 2V1XA 3HACA 4KTVE 1Y5RA 1JG4A 1Z4JA 1UJMA 2I1WA 2Y0DA 2GFIA 2BHNA 4MMZB 4A4DA 2J7PA 3PDWA 1ZYUA 4UMEA 1YZFA 4H9GA 4E32A 1OE0A 3ZBTA 2I22A 2VXYA 1PV1A 2CNKA 3PA8A 3U3XA 4BBAA 2C8KA 3KZCA 3AM4A 1G8FA 3IQXA 4Z3OA 2ROQA 5C3MA 4HG2A 1H2BA 4X3OA 2AYXA 1GRQA 1XLTC 3R24A 1N2CE 1KBQA 3QFRA 3F5FA 4MVJD 4WFQA 1U2PA 2FFQA 2Q3JA 3RJMA 4WEQA 1XEWX 1YCHA 5FYQA 1UJ6A 2BF4A 2WUFA 4TUYA 2PKRA 3FSGA 3H8SA 1Y8RA 2I03A 3H6GA 4K9KA 4EENA 2J4DA 4MV0A 4V0LA 1QHNA 4CV0A 1QO7A 3OKAA 3OD1A 4RMIA 4ODIA 5KCZA 2HUNA 5AKEA 2F1IA 1L5YA 3UK7A 2EZTA 4C2TA 4DR7B 1DDGA 4TL9A 4DSUA 4BMNA 5DXJA 4KOAA 2Q1YA 4ZJYA 1PQWA 1UBLS 4QPJC 1GP2A 3SR4A 4YQZA 2CUTA 2HGSA 2FJUA 1W2HA 3NASA 1JFRA 4ZEXA 2VJQA 1NNUA 4RMJA 5AM0A 3V1LA 1FJXA 4L08A 3CSSA 2FUNB 3OY7A 4XM1A 1B0PA 1N1MA 3NWOA 4A26A 5HX7A 3OZGA 4OKSA 3WYCA 2HHHB 1J7JA 2ZR0A 4MUKA 5AVXA 2Z5GA 1OI7A 5JMOA 3IPXA 1D6NA 5F7OA 1ZWLA 3FG9A 4KQCA 5CDYA 1M7GA 3KKKA 1OTHA 5B30A 1CF4A 1QHHA 4HWGA 1OH8A 4XARA 1GDTA 5FJJA 1JQ5A 5DH9A 4A5OA 1GVNB 4ILKA 1H2HA 1BOFA 3ZBPA 1Z4KA 4WFIA 5BNZA 2WLSA 4DR5B 4YREA 3G88A 5CPFA 2NP7A 3DM5A 2C3OA 3ZJUA 4GQIA 3K20A 3MPOA 4G1UC 1UT6A 4HP8A 3TNFA 1IVSA 4U0JA 3C45A 1WXIA 2FPIA 3V7UA 2H5JA 2GTHA 4HQ0A 5TT1A 4AY5A 2Y0BA 3KUKA 5HGXA 1F4LA 5IT5A 5LVAA 1XC7A 4UU7A 4M7OA 3LCUA 1QOQB 4WNAB 3SS7X 3VISA 2NU7B 2UDPA 3I2JA 1R8QA 1XSEA 3OU6A 4L8WB 3A3KA 3SD7A 4BEVA 1QGOA 2V74B 1J5PA 2CZQA 4RV5A 3PJRA 1Y3HA 2V65A 4DY6A 3EMVA 5J2TB 1EDBA 1IY1A 2PXXA 4EGJA 1S4QA 1VMEA 3H2GA 4QATA 2EJBA 7ADHA 4YRLA 4LXIA 4A23A 1GGMA 1YRHA 5DRYA 4BNVA 2PXCA 3FKJA 4RH3A 1KJJA 5ALSA 3I1IA 4CCYA 3IMCA 4TVOA 4GPIB 3RUDA 4OJMX 2HO5A 3UYKA 2VA9A 3T7CA 1Z7YA 2BGRA 1Z0JA 2OQ2A 4LSWA 3U3JA 2HV8A 2JHAA 4PX5A 3T35A 5K0EA 1BVUA 4LMRA 1GLVA 5SY4A 2VJYA 1MJHA 5HDQA 4N3BA 3S6JA 1SUDA 1ZUIA 1JHYA 1GQFA 1UM8A 2O1SA 3C2QA 3ML1A 3ZU2A 1I33A 4CEJA 5JS2A 4LZNA 3CCCA 3W90A 4MV4A 1KNQA 4ZAFA 1Z56C 3JASB 3ZGNA 2A0WA 2HRRA 1VJ1A 2X86A 2PGNA 3UJHA 5J4YA 2IH4A 1EE9A 4EAAA 1KMHA 2JDIA 5JCPA 4FD3A 3QEKA 1NVTA 1RWQA 1SCUB 2JFUA 1K6MA 2RFLA 2WYHA 4Q19A 5IUJC 1C9EA 3OA2A 4OQXA 1K9VF 3H9UA 2IIVA 2Q9AA 3HPQA 3KJGA 5IBRA 1C0KA 1P91A 4FYXA 3Q8WA 4Y9UA 1WXGA 2P77A 4BY9E 1ZHFA 3AR2A 1EG2A 1EGMB 3CONA 3OOHA 4PONA 1XU7A 1TO2E 2Z2ZA 3V8QA 3TPZA 4CLOB 2NO0A 1V3UA 4AJ4A 3CZ9A 4N3AA 3I72A 4YDSA 3UOAB 1RJEA 3W7VA 4D8UA 3IBCA 3OJLA 4LYAA 2BFNA 1JFFA 5EN4A 3SC3A 4HSEA 1FJHA 3MK31 3BMQB 4NV3A 1ISFA 1WKBA 3HZHA 1IUPA 1S2LA 2GM3A 2HRDA 4KMOA 4WZAB 2NZWA 2PD3A 3I6YA 1OBVA 1IN7A 2OORC 2B2CA 2O3JA 1L5RA 3KYDA 3SG0A 1HNWB 1BQ4A 3N2GB 4FWBA 3REOA 5K3SA 5AMXA 3VQTA 3HUEA 3AJRA 3DAGA 4PHHA 3FHCB 3MWEB 1C3OA 4O63O 3I6ZA 5DF1A 3SZMA 2ZXEA 2GNAA 3KKEA 1QHFA 2I76A 3CO5A 3RV4A 3VPCA 3MCAA 2EBWA 3UMVA 3ANMA 2JNWA 2PX8A 5FV4A 1CR2A 4DDTA 3SF8B 1F51E 3AV3A 1J42A 3OOJA 4YCCA 4P3OA 4CLDA 3IDQA 4EQ6A 3PEYA 1YDHA 3C1TA 4Y8VA 2WUWE 3SSMA 1EFRA 1U90A 4MS3A 3MWJA 2WG2A 3VBCA 4ZQGA 4GH5A 2B2NA 4BP1A 2QQGA 2DPGA 3T4UA 4DRZA 4EEKA 5JRDS 3A25A 4PZZA 2FPUA 2GUWA 2QAGA 4HXEB 3LA8A 2IS2A 2J0QA 4N48A 1E20A 3U7HB 4TZTA 5DNCA 1OFHA 2IE0A 1LD3A 4P6VF 2Q6OA 5D7BA 3WGYA 1UBFA 3MTJA 1VPDA 4F3KA 2F8SA 4HLCA 1QCCA 2XVYA 4GLLA 1T29A 2BZGA 3ZKWB 1QP0A 4MV8A 5ICCA 2KYRA 2XAAA 2WF6A 2YYAA 4NCJA 3EZFA 1KR5A 1NYLA 3H1PA 5AKGA 1F7VA 3OSZA 1FMFA 3FROA 4DT1B 3PFCA 1TQHA 4PBSA 3KEQA 2FUEA 1E1YA 3EXFA 1RTKA 1DKQA 3ZZ0A 3IBGA 3U2QA 3A26A 1PG5A 2ZT7A 1EPUA 3SEAA 3VYVA 3QKWA 2BT4A 4JHXA 4JI3B 8ADHA 2OWDA 4XOIA 5BSKA 4NG4A 3U5ZB 4I55B 1VI6A 2PRJA 4YRAA 1MAHA 1W9MA 2GLTA 3D6HA 4EKIA 2XXAA 5ADHA 4M86A 2YVAA 4IIBA 2AC7A 1B41A 3NKLA 1E62A 2ZJ4A 4G1VA 4RETA 1H1DA 1Q95A 1TUBA 2VSFA 4OI0A 3FNGA 2PN1A 3CVOA 2A5FA 2ZSBA 3KQWA 4UEOA 3HLTA 3RS7A 1DQPA 4KYVA 2VDUE 2V7QD 1A9YA 2PUJA 4EB3A 4LKOA 3V8RA 3EXHB 3DT8A 3COPA 3QEMB 1X14A 4PRLA 5DO9A 1Q0TA 5C9ZA 1G8JA 2CXOA 1FRQA 1TZKA 4QRDA 1Z0ZA 3L7NA 3QVKA 4KVGA 3DR3A 4MVWA 1YU6A 5TIIA 2QUZA 5C7OO 2FN8A 4C0BA 2B0CA 2SCUA 3H97A 3QNMA 4MDHA 5BT9A 4AIRA 5HZHA 1W1IA 3EQ7A 1BHQ1 5IP5A 4QTXA 4Z53A 1XNRB 1UJ2A 3OTHA 4UCFA 1G60A 5LP6F 4M54A 4ERNA 4FC7A 4JFRA 3OHPA 1ADFA 4R2KA 3A6FA 1ZW6A 3WNDA 5IJ0A 5KHOC 1YTUA 3BBPA 1YHYA 2G67A 1VIAA 4C78A 2Z5VA 4DLNA 2V7PA 3AHIA 4G5HA 3OTWA 2IY7A 1GSOA 3LBAA 1X7XA 1H9CA 2PHZA 4RW0A 2QRJA 2XE7A 3IPYA 4NBKA 4Z1MD 1TU3A 5HM8A 4R3WA 2FB9A 1BYUA 2VHVA 3U17A 3WADA 4OCZA 5AW0A 3RSHA 1Z2CA 3MVEA 4Y2JA 4C7KA 3UHOA 1Z5VA 2QYOA 1ETUA 4HLUC 1V71A 2CJXA 4UHJA 4U1RA 3ONWA 5EGNA 2UZ1B 4RIIA 3EDOA 5LWHA 3FKQA 5IDXA 1QIJA 2W6QA 5JWOA 2YC4C 3T41A 3U3DA 1XQ1A 2POCA 1CNFA 4L28A 2FDXA 5CIYA 1KQPA 1M1UA 1M1NA 2AE2A 5AKZA 1W36B 5K0LA 4PX9A 2JAUA 3ND7A 4FJ1A 3VU1A 4NDNE 3OPQA 2ACWA 4DQUA 1JXMA 3GMSA 1T9CA 3CUUA 3QLUC 3V1TC 5L3SB 2H5EA 4I4TA 4RDCA 1ESNA 1W4LA 2FR0A 1B3RA 1IBCA 4E5PA 4H27A 2JAXA 4BPRA 3NDIA 4HS9A 3E9EA 1XXLA 3GL9A 4HH4A 2WM8A 4FWIB 3MMSA 5JNUA 1K8RA 4CG1A 1FLNA 1KYVA 2QVCA 5DGXA 4PAGA 3VZBA 4ZOBA 4BFLA 1KS9A 1RYNA 4UBOA 2OLEA 5H3CA 3LCCA 4H7IA 2J32A 2W2TA 3JQAB 3PVCA 4DJ5X 3QEJA 2EDCA 3FYDA 5CD9A 5LP6A 2RD2A 3HUTA 4DBLE 5KQRA 4RXUA 2YW9A 4TMYA 3RLFA 1E6CA 2A4KA 1QH0A 1CRLA 3DLIA 3I4CA 4UUQA 3NM4A 4Q3AA 2GLUA 2ZR7A 3LWDA 2YMLA 4I4CA 1EU1A 2QY9A 3K70C 3X1YA 5DLEA 2W93A 4EJ6A 1S3IA 1DAOA 1AUOA 3OIYA 1NC3A 4LBYA 4PGAA 2VQEB 1UK7A 1JWBB 1DJLA 2I2AA 2VWQA 3GPBA 3C70A 1XELA 1JHOA 3E6AA 3Q72A 3G3EA 3Q7TA 4BATA 3DBHA 3WAJA 2Z3ZA 2CV2A 4JYZA 3DZHA 1W36D 1W5SA 3B1ZA 1BHJA 4MQEA 4ND6A 1DBIA 4RHCA 3AM1A 3QRWA 5BMOA 5HUJA 1HI9A 1U8YA 2HCBA 2I6XA 4NEHB 3EIFA 2CVZA 1NMXA 1ENPA 1MAWA 1Z5ZA 1E2PA 4LNUA 1ZD2P 1G5FA 1XZEA 5BN3B 4PWZA 2WA2A 1UBJS 4EPVA 4LDJA 4GECA 3L93A 4JLOA 5A4IS 3WL5A 5KQLA 3RFCA 5GWXA 2CK3D 3GCZA 1PJSA 3M7IA 4OMUA 4OYRA 1RXWA 3VNBA 3GGGA 2OG1A 5SY9A 3ZBQA 5KWJA 1OTYA 3E9NA 4B3FX 1G20A 2GILA 2XEDA 2O54A 3UMYA 2HMUA 4LYFA 2HRBA 2NW6A 3RBVA 2XT9A 5DNYB 4MV3A 1MBZA 1B15A 3NEYA 8GPBA 1X80B 1DGQA 3O94A 4CIWA 1CIPA 5K3FB 2BSAA 1FMTA 1UBCA 4E12A 1VJGA 4XI9A 3DZKA 3GDGA 2XR1A 2D8AA 4KV7A 4YAEA 2VH5R 3ZHVA 3EIUA 3H65A 3SJUA 5B36A 1DZ3A 2BZ0A 1PI3A 5DW0A 2XZTA 1DUVG 3A3NA 3MGAA 2CBXA 4LFCB 4BTEA 2QR2A 2CL5A 3QVUA 4BNZA 1GU1A 2Z1NA 1TIKA 5FYDA 3CLVA 2QUJA 2XF2A 3U44B 4MV6A 1U3DA 2EGHA 1Z0SA 4YJGB 1LW6E 2FEMA 2OY0A 1CW2B 1E77A 4HYQA 5G0TA 2QGZA 2X7XA 2DBYA 2HWXA 2ZLBA 3AR5A 3B3FA 3FSEA 4L4RA 3UY4A 1Y9ZA 2WP0A 2Q3EA 4M46A 5DTQA 5BN4A 4PGHA 2XGOA 1E2MA 4GSLA 4C6SA 1J8DA 1I0IA 4MVJG 4IOKA 4WJLA 3CVXA 2NO4A 3FTPA 4RX1A 2DYKA 1AU9A 1N8SA 2P5SA 1HLPA 1SR8A 2OFWA 2AVDA 6GPBA 4IJMA 1QCZA 2C0CA 4DARA 4IOMA 4EW1A 4Y6OA 1OYWA 3RG2A 3PGLA 4G8JA 1FYWA 3U48A 5BQFA 4O3MA 1XZPA 1ISJA 4ZOEA 2CKDA 3GLSA 4OI4A 5IAGA 4IZOA 2W2KB 4ZRMA 4QYMA 4Z0PA 3L7BA 4MTCA 1YVEI 2WFAA 3B36A 3K6SB 2E5FA 3T5AA 1W0CA 2P5UA 2WF9A 3RSCA 1Z6ZA 1XN1A 2VNSA 4IJVA 3AF5A 3ZY5A 1ZJWA 2E9SA 2KM1A 1O94C 3TL6A 3E2MA 3L7AA 4YXFA 3D3WA 4K87A 2HD4A 2AOWA 2QDXA 2P9QA 3KETA 4KO8A 2REOA 1PP4A 4BX3A 4C0WA 3DB1A 2C3MA 4HXGA 1C9NA 2NXCA 4S24A 3CPSA 4OJQA 1NX9A 2QNBA 3IP1A 5B4TA 2NXWA 3TRJA 3IOEA 4NCAA 4AMUA 1M0SA 4ALJA 4C88A 5K8UA 2Z8XA 4OGKA 5E8RA 4Z4CA 1I6WA 3H5TA 2G88A 4O2BA 1ILWA 1VA4A 3FLBA 3FDFA 1Z7GA 3QENA 3KSZO 3DCYA 3OJXA 4KL8S 1JG1A 3TBKA 2JJ2D 5LZ8A 5IWAB 2Q6LA 3IL2A 1YCDA 4E4TA 5BYAA 2V6BA 3G8YA 4BQOA 3SQWA 4AWAA 3QJYA 5I9SA 5EHZA 1XXHB 4FN4A 3D7MA 4G1CA 1RVV1 4R6WA 5D8DA 2VNKA 3DUFB 1ISRA 1OAOA 2WHYA 2ZT6A 3HJCA 4HZIA 2UYOA 3ZHZA 3MTBA 3PZBA 1BMFD 5GONF 1JXQA 2XT6A 4RMNA 2ZROA 1JG6A 5DM4A 4UNRA 1QYDA 4YUAA 1G3UA 5FL3A 1LGYA 3W8NA 4PZ9A 4JI6B 1MX1A 2FWNA 2PV0A 3S2YA 3IDZA 2J3JA 3PDIA 3STTA 4ZQFA 4CMHA 2RHWA 4CLEA 4D3SA 3JARB 1O0CA 2ZWAA 4BE4A 1TJNA 2FI1A 3A28A 1IU9A 3B3QA 3DXYA 3LV8A 4EG5A 3GXBA 1T15A 4RGBA 3OJFA 4JHLA 5JD6A 2VT2A 3HNPA 1SVKA 2I6FA 2EXXA 3HFGA 1XTUA 4YMWA 2FGJA 4KR0A 3MSXA 4TS4A 3S0JA 1Z15A 3SHWA 5JQWA 1BVYF 3KXIA 5A05A 1VFNA 3K6KA 5BSEA 3Q88A 3K9BA 2GYVA 4HH3C 3SXUA 2YXEA 3HABA 4JGGA 1NJ6A 4MW2A 2RGRA 4JQOA 4QJIA 4UMFA 1QVZA 2OV3A 3JQ9A 3OCCA 4TWRA 4DQLA 2FMKA 2PVPA 4R9SA 2AG0A 4R7TA 5F3WB 2IPXA 2JKZA 4I1YA 3R3ZA 4N0QA 3DMTA 1XV5A 3PB3A 4J1SA 4YFYA 2F55A 3GQBB 3RU9A 2NNWB 4PSUA 4RNDB 1E5QA 1DIGA 1XT6A 2DTXA 2HF7A 2X6QA 3HYTA 3ZU3A 1EIWA 5KTTA 2JKYA 2BM8A 1BGWA 4IEFB 5JC1A 3G0GA 2RDMA 1P0MA 2WV7A 1R4NA 1UEXC 3INGA 3R7WB 3I32A 1SU7A 3WA6A 1I30A 3ZG6A 4M1OA 2V6MA 1IK6A 2VRWA 3LW8A 3VO2A 3ROMA 3T0FA 5CT9A 5E1DA 4EM6A 2WE8A 1G20E 1DT5A 4Y0NA 1EFLA 5UKDA 4CM9A 3TM4A 3WR5A 2AL7A 2FDCA 1FXWA 3CPJB 5GONA 1WMFA 1V1RB 2FPOA 1LRKA 3AIKA 3VSAA 2X0RA 2H1WA 5IAAA 2VLBA 3BSWA 1IONA 5FBQB 4ZI7A 2I91A 2LRHA 1R6XA 3NHYA 3WJAA 4WLVA 1XCPA 5A9TA 2JFYA 3IAUA 3Q3GE 2ZSKA 4WBNF 4KBFA 2IKQA 4JC8A 4TYMA 4BGUA 3GRKA 2AN5A 1L8AA 2IHBA 1JDSA 3OAAD 5HCUA 4U63A 4D6YA 1E3TA 3AEUA 2JAOA 3OH8A 4BKRA 2WINI 1LPOA 2ST1A 5FBHA 4BVHA 1Y37A 1P7WA 4Q3BA 1DFIA 2R96A 4V0ME 1Q17A 1E1QD 2C7PA 4A8HA 1YAJA 1G6HA 5BN1A 1PX0A 2GPAA 4UU1A 3A6PC 4LA4A 2FWPA 1W96A 3L4BA 3OT1A 5K99A 5F21A 1LWNA 1UXGA 1E5XA 5IW8A 1MQ9A 4RF4A 3CLHA 3F73A 4KZKA 3E18A 3OCJA 5BSRA 1U31A 2X1HA 4REQB 1R0KA 2IEGA 2YR0A 3N5KA 4S12A 3L1IA 5L7TA 2F7SA 2HJHA 3EX7C 5CK5A 2DQSA 2QMHA 3NHSA 4KQEA 1UDCA 1VP9A 3EDCA 4G1MB 2WT4A 4UEWA 3FHTA 1RYEA 2MYNA 2CXHA 4GXRA 1WMAA 3A1SA 4QOSA 4H1WA 4IDDA 5H7XA 3TQRA 4BVFA 1ECGA 2YICA 4YBRA 3EA5A 4Z7QB 1HTTA 1ESMA 3DF9A 4RFVA 3EUFA 3WVNA 1ZH0A 1XTPA 2V4ZA 1CE8B 4UM8B 5HIIA 1MAVA 1J0AA 2FQWA 4X7MA 2VJCA 2QG6A 4CDMA 2JJMA 3E2IA 2RHTA 3S5JA 3TG8A 3AI7A 3PD7A 1TE2A 3FPKA 4XCXA 3I12A 4X6XA 3A2KA 3PG5A 4GM0A 5LQJA 3BT7A 4Z4QA 1IATA 1UBTS 3JQEA 4FYYA 4XYEA 3H2SA 3BMXA 4UEJA 3PIDA 3RK4A 4CTOA 4EAQA 4F84A 4WBNA 4LBWA 2XYVA 2Z3WA 2BV3A 1QC5B 2GETA 2VJPA 1LDEA 1P7ZA 2B8WA 4ARBA 4BP8A 1INLA 4M49A 1MJ5A 3MTGA 2Z09A 2F64A 1DKMA 5KJEA 1R00A 1RIFA 2A33A 1EI9A 3FW1A 1HL3A 3KB2A 4RE6A 3AONB 3ZHXA 4X95A 3ABZA 2PBLA 4BU0A 4AY6A 4YNBA 4JCOA 2DY0A 1B3BA 1KYTA 4YLYA 4YV0A 3UV3A 3DZGA 1NWCA 3HCEA 8LDHA 3AHFA 1JG2A 4GOLD 1W7AA 1WOMA 4ZI2A 4KLZA 3WXMA 2I3GA 1UKZA 4PC7A 1MC8A 4YYEA 4R8RA 3WMXA 1GVHA 2A94A 4Z99A 4B6OA 3KQLA 3ZD9A 2X0FA 1H5QA 4AKSA 1F6DA 3T3NA 1NWHA 3C39A 3FZEA 4INPA 1E6KA 4MUAA 3H9CA 4EWLA 4DV3B 3RD5A 2QRMA 4QXRA 5FFFA 3CNHA 4YCJA 2VDOB 3VR6A 1RE1A 1JYFA 2CMHA 3FZYA 3E05A 1ZESA 2PZFA 3X3HA 3D2AA 3Q6MA 1IPHA 3RC7A 2WJAA 1UAGA 1VRVA 1NATA 1OVMA 3HP4A 3NKVA 1P5JA 3QQ5A 2AOTB 2NOAA 3IQFA 4NTZA 4XYGA 3W6NA 1TVCA 3UZUA 4GRAA 3S1AA 5A2QA 1P6XA 4XJXA 4JBGA 4P5DA 3E4CA 1PFUA 1C30A 2E18A 2GJKA 1NUQA 5LQCA 2GS9A 1YVPA 2KBFA 1KI2A 4DNQA 3OPMA 1GQOA 1SQ6A 3OP4A 3OFJA 3R0QA 4CM8B 5B64A 1QUEA 1LVHA 2E4ZA 4WNAA 3R0JA 2R86A 4JP2A 3G79A 5CT8A 2UXDB 1MF7A 4WDRA 1C3VA 3CV3A 4V3CA 4CR8A 4WSOA 2GAJA 4GR9A 1NVMB 5D5QA 3UA3A 1J0EA 1LTHR 1QH9A 2JAWA 2WIBA 1UPAA 3DLAA 3LPAA 4QC2A 4AVYA 2CFOA 3H1AA 3O0TA 5JEDA 3MTEA 3VR4H 1FF9A 4LWPA 4JCCA 4P98A 3MWYW 2DFNA 1QKIA 2E1RA 5H0IA 1FVOA 4Y9TA 4M7WA 5BR1A 1IHPA 4QXOA 2JGDB 3T9EA 4I3FA 2WQ7A 2AC4A 4MW9A 3G2KA 1VZ2A 5SY6A 3EGXB 5KAMA 1RR6A 5TRTA 4B79A 3H18A 5JFGA 4GC9A 3RW9A 4G4JA 4MYSA 3ER6A 1J24A 2HQRA 1QH8A 3HYRA 4FQ5A 1ZIXA 5JU6A 4EGAA 2HIGA 3C3AA 1CQPA 2GD1O 3AF1A 3JCZA 4K9LA 4WOKA 4NAUA 3KBBA 4R9UC 1NUAA 3QU5A 1PV4A 1QB8A 2R6DA 4DCTA 4OI1A 2W22A 1WVMA 3WMWA 2J45A 3PNMA 3HCWA 1E8MA 4E22A 3EEBA 1W0KD 5LZ5A 3EVEA 3WRXC 1J1UA 3GXOA 4CN8A 3O47A 2VHTA 4D9CA 4PC6A 1TTTA 3IVCA 1Q12A 1MA3A 4I2VA 4P7JA 3VXKA 1ICEA 1RPAA 3GFVA 4XB2A 2WTEA 1T3GA 2D13A 3HG7A 4PLZA 5IMBA 3VR5H 3FPJA 4JWKA 1B14A 3JD1A 5BQPA 5IF3A 2FSUA 4DMFA 2EARA 2PYDA 1QM5A 1SKUA 1V48A 2QTMA 4QDKA 1SZPA 3NVDA 1TYDE 2VZLA 3LXRA 3GLVA 1Z2PX 4RAQA 4BQRA 3ESXA 3K9WA 3TSZA 5DHRA 4BWYA 5D86A 3Q2OA 5TV2A 4UHEA 3FX2A 1U04A 4I3HA 2N1BA 4AG3A 2O0KA 3AI3A 1QE3A 3I58A 3L0BA 5AKIA 4YJDA 1PK7A 3TR0A 4PHTA 1WPQA 1DUSA 3RM3A 2BGUA 3E58A 3ENQA 4GNRA 1BNCA 1E79D 1KDTA 1UM9A 1F48A 3NC4A 4EEXA 4TWIA 1YL5A 2ECPA 4L4XA 2QI9C 4MICA 1Q20A 3QHQA 3BMOB 5JHGB 5JD5A 3D3KA 2X7HA 1EGQA 1W85A 4DJTA 4CKWB 3YASA 5AW1A 2EP5A 4KGZA 2KQUA 1DI0A 2GHIA 3ZQJA 2JLCA 1CFZA 1EM8A 1Z0KA 4JR2A 4NMWA 5LYYA 3DO8A 3T7EA 1FLAA 3TTYA 4ASUA 5L95A 2DXIA 2QLBA 2CT8A 1DG9A 1TC1A 1D6JA 2XZDA 4BVBA 3R9WA 3SC4A 3D3EA 2BL4A 1LDYA 4G8CA 1KYXA 4C08A 4LY6A 1IY2A 4BX8A 4DQ0A 2QAIA 3EEQA 4QKQA 1HYBA 2RHOA 3ROGA 1N4DA 1SU4A 4P4TA 3WQQA 2AJLI 4BMXA 5CEFA 5T67A 4HQKA 3K70B 2DLNA 2OBXA 5CNJA 1GZ6A 1YZKA 3H2BA 1G5TA 2C04A 1L1RA 1EVEA 2GN0A 1ID1A 2NZUG 3GVPA 4GUAA 4X63A 2JZOA 1IL0A 4YRMA 2CCJA 4MW6A 5F33A 2VBFA 4EEZA 1CUVA 3NBYC 1RM5A 4UNNA 4LJAA 4M0CA 4YRRA 4IUBS 1AM4D 1R0CA 4Q1BA 3UPDA 3UTCA 4ALMA 2CVPA 2Q6KA 3ZWDA 4M3NA 1Y3AA 1KC3A 2AN4A 4EPXA 3ZWPA 2R25B 3Q3IA 4KWIA 3QBDA 3KOYA 3SFZA 4D5GA 3F6YA 4WK6A 3QA3E 3ZJVA 3N76A 3WRVA 3QPUA 4I2NA 1H66A 1I0ZA 1QV9A 2RGEA 1MB2A 1Z4PX 2J1LA 3TLZA 1MT3A 2R1ZA 1AX9A 3H1EA 4HXFB 5EA2A 5KHAA 1JDVA 3ESZA 4X20B 4B34A 1VL6A 3EE6A 5GM1A 2FSIA 4D3DA 1W9HA 1MO4A 2J09A 2VTDA 1YR2A 3A9SA 5TMBA 1ZVKA 2YHIA 3EG9B 5EINA 4EX6A 5DYTA 4QYXA 3L5KA 2ZITA 1BN7A 1YSCA 1FU4A 3BK2A 2DZDA 3LGXA 3KSMA 3USZA 4ON9A 4YJ2F 1AOXA 2A8YA 2X9VA 5JXJA 5KPJA 1IIRA 4F72A 2D1RA 1KVTA 4WLNA 1HQCA 3K9FC 1HUQA 1IG3A 3INYA 1DTWA 3PC8C 4LPSA 2PX0A 3BZBA 4OKNA 1HFJA 3KHKA 4TXHA 2IPMA 4NU0A 4Q37A 4N1AA 3LCRA 4ZJZA 4E33A 2IYRA 1V5GA 2W00A 3OWXA 1KE2A 3E7FA 4I5IA 1UMDB 1YACA 4D9KA 4EHJA 1DWQA 3C1AA 1Z0IA 4BCDA 3I28A 3ESBA 4U7PB 4E1VA 1G41A 1CUAA 1Q7EA 3ETLA 3EXEA 1OV4A 2G17A 3LG2A 3CN9A 1QG6A 4PSKA 3CZMA 3L0OA 2MIIA 3ZVRA 4EKDA 1R9GA 1WXFA 2VPYA 1CUHA 1PZNA 3LBIA 5FXMA 1ZCZA 1M8PA 4FGSA 2B82A 3AVOA 5ALMA 5EEGA 3FNEA 1R66A 3PX2A 3BJZA 3RSQA 5EXEA 2G1UA 1S3GA 2EWWA 3OC6A 4LSZA 4OHXA 2BDUA 2VF5X 3LO8A 2AG5A 1P33A 3DAOA 1UC8A 3SNHA 4JLBA 3ER9A 1I3CA 1Q1AA 1EVIA 1GPH1 5JV5A 2J67A 3DS8A 4MKIA 1QJCA 4H2DA 3TRIA 2BN4A 2WIGA 3A1TA 3WWDA 1RJFA 1U7PA 3CH4B 4AP6A 3LX4A 3W1VA 1NVGA 4W4TA 3L8MA 4MB0A 5EWLB 1XKLA 3CEAA 4BE7B 4HBZA 4BNIA 4BHTA 4ZZ1A 2Q45A 2UVPB 5B1YA 1PDOA 1SOAA 2WM3A 2ODBA 5ICMA 3VR5A 4OH7A 4X6YA 1YQWA 4U6QA 3NDJA 3VHXB 2R4UA 5CAEB 3NVKI 5ITWA 3SIXA 3NJ8A 4TMTA 2ENWA 2O2ZA 3AGQA 3PPYA 1C4XA 1FNMA 1KZ1A 1SUWA 2BGIA 4WCFC 1UPXA 1ZUHA 2QV7A 3GNSA 2G08A 4NBWA 5DNUA 2ZBRA 1U1IA 3FTEA 3F3SA 4ZGBA 2DR0A 3TE7A 1N1EA 5J59A 2A9FA 2PWYA 2XCIA 3OU2A 2QENA 3UXYA 4AYWA 3UA4A 3TIFA 4CL0A 1DB3A 4D8WA 1G6KA 1FFHA 3RCBA 4CFZA 5HG0A 4F91B 1Z7WA 2C94A 2CCKA 4R1TA 2HU7A 2V7GA 3HGTA 3OPNA 1NF3A 3DE3X 3O3CA 5ESRA 1OI4A 4IJ5A 3E7DA 4C4SA 2JC3A 4KXYA 2QF7A 2XUPA 1GZ7A 5KDDA 3ES9A 3K9QO 2X77A 3S7ZA 3OJOA 2NYAA 2H1CA 4FK8A 5KYKA 3E5RA 5JBNA 4QFDA 1E4EA 3LS2A 5D51S 4WLEA 2FPMA 3WFJA 5HZMA 1YDEA 5CHYA 3N0RA 1QS0B 2EF1A 3UT0A 3OF3A 3H11A 1QV7A 1JALA 2BFBA 1ZM3A 4IDCA 1XZFA 4YY3B 5DN6D 3K0CC 4J4HA 2DHCA 1IJKA 1V16B 3S5UA 5HOQA 2IKSA 4PIMA 2CYBA 2V98A 2WJ6A 1YI8A 2V5AA 4OFBA 5H8WA 5DSZA 1Y82A 3HY4A 1ODSA 4RO0A 3AY7A 1Z28A 2AW5A 2JCXA 1X0XA 1PSWA 2WW8A 1ZOPA 2GD0A 1RWWA 2NTYC 4GYWA 2P9TA 3HKBB 4TTPA 4LI3X 5CYOA 4N0MA 5DEOA 5ES3A 1BRTA 3W6ZA 1DVRA 3GFSA 2ODWA 2F90A 2B5OA 3PVZA 4UNQA 4HQ6A 5J23A 4CTJA 1LQUA 3O4GA 2AFIB 3DVAA 4UMDA 4URUR 2CDNA 1Z35A 1PGNA 3QE2A 2FLVA 2G1KA 4Z8XA 5HFAA 1J70A 5GGYA 2UXCB 1VGRA 1XYGA 1ZH2A 1K9SA 1LQ2A 1HE4A 4RY0A 2BTEA 2Q5LA 3TOVA 1YQ9A 1PO7A 4OL0A 1VB3A 1X70A 2QD5A 3BEOA 3UT5B 2NZJA 5BW4A 3MJFA 8ABPA 2WJPA 1O6BA 3JWEA 4D57A 3K5WA 1WV0A 1ECBA 3L6DA 2PR2A 4B4OA 2B4AA 4PBRA 1Z08A 3L1KA 3O82A 3PQCA 1MN6A 1IXRC 3K8OE 2QT1A 3T9CA 3D6TB 4QRIA 5C0OE 4EPTA 4V0KA 3IQHX 2X3YA 1G9TA 3WQHA 1V1MA 2NXJA 4E5MA 2VWPA 3U7RA 1GN9A 4WZBB 5HXAA 4F71A 2JGJA 5EZYA 3GLGB 2CJWA 2OGSA 1N5KA 1JL3A 1K63A 4DG9A 1NQOA 2XWPA 5K8JB 1UK8A 1D2MA 1KORA 4E1BA 4ZAZA 3B9PA 3AR9A 3ETCA 4C6HA 2MYTA 8AT1A 1JG7A 4BBJA 1SB9A 3EVNA 3GGDA 3KQOA 4UZEA 1Y5MA 1UAAA 1J56A 2B36A 4OHUA 3WYFA 1GITA 4FWTA 3GN1A 4ID9A 1W4CA 1RAFA 2V03A 2NGRA 3L7OA 3CLUD 2R8RA 1NUPA 4G4SP 4KO4S 2YOFA 1CUFA 3M6IA 5E9QA 4F5ZA 1E6MA 5BVGB 3HE3A 3ZCPA 4DS3A 1TRHA 1PV2A 1JQ3A 4NY1A 2IP1A 4KE8A 4NMLA 4CKEB 5JJCA 3QMMA 3HA7A 2ZG6A 2G70A 5DGCA 5HMLA 1Z4IA 1JA0A 2OZVA 3UG7A 2ZIZA 2R7KA 4F5EA 1A9ZA 1ZGHA 2G40A 1R3DA 2FMHA 3QJGA 3Q9LA 4UXHA 3LUDA 5HCIA 1RD4A 2IYQA 3FAZA 4G2NA 3AFOA 5CD1A 2VS1A 1N0HA 4DHEA 1E3WA 3KCNA 2ZRIA 3OPYI 4M36A 3NWJA 4R8MA 3DDNA 4QPZA 4AG5A 1HZJA 3C48A 4OLBA 3CLSC 3FMVA 4N47A 1Z13A 1EHIA 1U0RA 1GNTA 4O4IB 4OU4A 1BDHA 1HC7A 1CUYA 3I8XA 2AXNA 2JJ1D 3I9MA 1DDIA 1REQA 3P2KA 2XNJA 1RZRA 3GIWA 5GV8A 5B2EA 2A84A 1BD3A 1UCFA 3Q15C 1OOEA 3GRAA 5I3ZA 1C0EA 1N7GA 3LCJA 3FPEA 2GKGA 3M4YA 4HDRB 1R27A 4KPUA 4MS1B 2Q3DA 4J0QA 1UAYA 1RKXA 4EA7A 1F9EA 4JI4B 4DUPA 2BEUA 5GVRA 4OHCA 3RK0A 5K8IA 3TK1A 2I55A 3ONNA 5L3VA 4DMCA 3AF0A 3M5CA 4QU9A 1OZFA 1SCKA 2C1EA 2R2AA 3H7IA 3LSTA 3LWZA 2X15A 3VPXA 3GB9A 1S96A 1EP1B 1WDTA 1IM8A 3P5BA 4DGSA 4IAOA 1L3CA 3C98A 1A69A 3H9GA 3NYRA 3R6LA 2Z1DA 3PJGA 2ADFA 3FYUA 3HEBA 2J7KA 2CLCX 1DX4A 4F8YA 3BHNA 4PAMA 1G5HA 4QQFA 1MV5A 3L6RA 4QFBA 1I7QB 3RS0A 1I7SB 3NFRA 4AWXA 1L7PA 1Y0BA 1X13A 4CIYA 2RGNC 1UJBA 4BGEA 4OFWA 2O2CA 1HDZA 3FMGA 2PGDA 2XCLA 2JPDA 4X8LA 1Q15A 2NM0A 3B60A 2ETXA 3RS3A 2Y0PA 1NDQA 4W63A 3VNUA 4TMKA 1T5LA 1VYTA 3IHLA 3KZ1E 4I6EA 2OQVA 5BXYA 1E60A 1R16A 2O8DA 3EVFA 3EXIA 4D79A 1RRGA 2AZ4A 1L4NA 1YFZA 2FWRA 3MJSA 3WLFA 3FYSA 3OMLA 2AFHB 2MINA 4GPZA 3RKSA 5M2QA 5FOTA 1PWZA 3MILA 3F6BX 2V3VA 1Q3TA 1X8LA 1I14A 1PEAA 3INRA 4U2CA 4Z7NB 2FDRA 1FBNA 3H2HA 3Q11A 2GN8A 3CHYA 3FPHA 2P40A 1XMOB 1K68A 1VIMA 5G41A 2JBWA 3PUYA 3QUBA 3WJ2A 3IVMA 4NS4A 4FMBB 3QPVA 3G9ZA 3FYTA 3U16A 2FSSA 3EQ6A 2VEDA 2WF8A 2CW5A 3O1IC 3P45A 4MR9B 3D4LA 4N0DA 5EUBA 3V4LA 2J6IA 4K8OA 2QZZA 3MT7A 1YDWA 5B1IA 3FUTA 1R37A 1E61A 1LLUA 3PF9A 3VFDA 5CP8A 3W6OA 1QR2A 1NI5A 2COEA 2H5LA 2A1UA 2JIMA 4LRQA 3VHQA