4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl CoA reductase
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
1NWCA 5L3ZA 1R12A 3ZWPA 1JAXA 2X86A 4PZCA 4TRNA 3E5MA 3EHEA 1NVMB 2Y1OA 2BHLA 1YJ8A 3KHUA 4Z9XA 5IZ4A 3OIGA 1H0KA 5COBA 1NPDA 4GVXA 1XG5A 2P4QA 3BTUA 2JD0A 1IY8A 1ZK4A 3AY7A 1MV8A 4YRDA 2NVBA 2HJRA 2O3RA 1YB4A 4ZQFA 3WB9A 2EJVA 3G49A 3HE3A 1EVJA 3F5SA 5GZ6A 1EUZA 4URFA 1X1TA 2YUTA 1R0LA 4MP3A 4QFCA 5I9MA 3UVEA 2O2YA 1LDYA 3G1UA 3WTCA 3GLQA 4CL8A 4CPDA 1AHHA 4CMCA 3FWZA 3ICCA 2NVUB 3SBOA 4YQZA 2CDCA 5JDIA 1ZK3A 4ZQHA 4CV2A 1EZ4A 4LCEA 3WYBA 4EJ6A 1FDVA 3CZMA 1YE3A 1KC3A 3PPIA 1IUKA 1KVRA 2ZK7A 1YL6A 1B3RA 5T67A 5IZCA 3INRA 1DAOA 1ZMTA 2CMDA 4H7PA 4EBFA 3BHIA 2Z5LA 4YDRA 1E3WA 2GDZA 3PXXA 4ZD6A 5AXCA 4AJIA 4XA8A 3QQPA 3WGIA 3FNFA 2FP4A 4YA6A 2V6GA 2YHIA 1Y8QB 1O6ZA 1Y6JA 4ZHSA 5G4KA 1M76A 1C0IA 4D3DA 1BTOA 4BUCA 5JDCA 2X9GA 3C1OA 2GZ2A 3I9LA 1T26A 3JYNA 4PG7A 5CDGA 5G0VA 2HRBA 4HWKA 4TQGA 2DTXA 5F21A 3GZ4A 1UDCA 3FCOA 1TT7A 2OORA 3LT2A 3TWOA 1J0XO 1XSEA 4UEOA 4OKIA 1BMDA 2OO5A 2X0NA 1VRWA 1H94A 4NBWA 4PVCA 5I9LA 2G5CA 4RLSA 3DFZA 2C5EA 4CM7A 4NFYA 4HBGA 5C5IA 1ENZA 1CIVA 3FR7A 3O8QA 3H65A 5H83A 1PL6A 1O89A 3VKVA 2VYND 1LSUA 3DZJA 3F6YA 4NHEA 4YJDA 4DGSA 2J3HA 3Q9NA 3ASUA 4YVFA 2PD6A 4TZKA 4NIMA 1DC3A 2DFDA 2JAHA 2OBNA 4N54A 1PGPA 1A7AA 4IMRA 2HRZA 2P4HX 3E48A 5GMOA 4PFJA 1UUFA 1V3VA 3GY0A 4WCFC 3P2YA 1NAHA 3NKLA 3HB5X 2B4TO 3H9QA 1K89A 3DO5A 3WYCA 1EFLA 4QXMA 4HKTA 4XX0A 1HDGO 1KOLA 4XGNA 4KUEA 1I2ZA 1R16A 3ITKA 4L0QA 2Q3EA 5ER9A 4YQYA 1M66A 3MZ0A 5KWEA 1H6DA 1NHWA 4I8XA 3RUDA 5TF4A 2VWQA 2A9FA 3L9XA 1LTHR 1U2DA 3BTSA 3B6ZA 1XU9A 1A5ZA 1P1KA 3TL2A 5BSEA 1SC6A 4LN1A 4QFDA 3MJTA 2GERA 3VZPA 4IIVA 1I2CA 3JQAB 1BXZA 2YFHA 4RQTA 1E7WA 3NYWA 4L9RA 5L7WA 1KY5A 3QLJA 4D79A 3NDIA 1B8PA 3PYMA 1JLLA 3P2OA 5BNIA 4CUZA 3EW7A 1P1HA 3BMOB 1LSOA 1LDEA 2PY6A 4XJSA 4DC1A 4MIYA 3RUFA 1LLDA 1LI4A 1E7QA 3CMCO 3TFQA 3C3XA 3BIOA 4NFSA 1VE9A 3Q9UA 4J1NA 4ZQGA 1B8VA 3C85A 3OQ6A 5IJZA 2RHRA 3UN1A 5ENDA 3MOIA 3VKUA 4GH5A 4M87A 1BXGB 1HE3A 5CFZA 5I7SA 3PDUA 4LSMA 2O3SA 3E03A 2HO5A 4MVJD 4HFNA 3FNGA 5KJ6A 2DFVA 4Q3CA 2R00C 1CWUA 5EQDA 3DBLA 4LGVA 4ALLA 3DBRA 3ROKA 4BIIA 1D1SA 1E6UA 4M54A 1TXGA 4KQXA 3PJDA 2SCUA 5AXDA 1W73A 1ZEJA 5K0ZA 4D7AA 1ONNA 1DAPA 1ZK2A 3WSWA 1DIAA 1HXHA 4BB6A 3D5TA 3NUGA 3F5QA 3CSDA 1XCBA 4OL9A 1GY8A 1KETA 1QYXA 3H9JA 4BNLA 4RDIA 3JQFC 3WQQA 3RSHA 3JQEA 4OSPA 5HA5A 3PHHA 1B2LA 4MKRA 1UH5A 3RAJA 4YAKA 4GWKA 4R5HA 4WLEA 3V5NA 2JFGA 2WYUA 3TDKA 3PZRA 2JHGA 3ZWOA 5LC1A 1XGKA 1ULUA 3ETEA 1DRVA 2VQ3A 3AI3A 2XOXA 1DRUA 3RBVA 4EJ0A 9LDTA 2IRWA 2Q2QA 2GZ3A 3OEWA 2P91A 4NFHA 1AXEA 5F1OA 4RZHA 4CL3A 3H2SA 1GYQA 3P19A 4XYBA 2QRKA 3NX4A 4DLLA 5B1YA 4BS9A 2O23A 2D2IA 3GRPA 1IPFA 1U2GA 5FWNA 3RJ5A 2WE8A 4IJVA 3JQDA 4IXTA 3L9WA 4UAGA 4I5GA 3JQCA 2UUOA 3NT5A 3UHAA 5JBIA 2GPTA 2XF8A 5AXBA 4YJGA 4ZGWA 1JKIA 2CSUA 3QRWA 1U4SA 1S6YA 4RF2A 4BMVA 4Z0PA 1YONA 1HZJA 1Y8RB 1GZ6A 1Y5MA 1R0KA 2IDZA 3JQ6A 2WSBA 2I65A 2ZCUA 1I5RA 2ZJ1A 5FI3A 1FDUA 4GSLA 3RC9A 1HDYA 2BFMA 3TZCA 3CINA 1HE4A 2NQTA 5JC8A 2G17A 3CPSA 4WLUA 1EQ2A 1H6AA 3VDQA 1R6DA 3KEQA 2CDAA 2NVWA 3I9KA 4JCOA 1SNYA 3PWZA 3KM0A 3TOZA 3SC6A 1F0YA 4E5PA 1JWAB 4ALMA 2I3AA 3GDFA 2EXXA 1ISMA 4OGWA 4NBUA 2Y05A 4CQMB 1RM0A 4XCVA 2GGSA 2W2KB 4IGEA 4Z0HO 3WWYA 4YWJA 1YS4A 5F3RA 1LXCA 4A0SA 3DONA 3HG7A 5BNFA 4OH1A 5ILOA 3OJEA 3PIDA 4FFPA 1HSOA 1ZIDA 1W0CA 3RROA 2PH5A 3AUTA 4Z9FA 1GPDG 3ONDA 3PHLA 4FJ0A 4HADA 4DYDA 5ICMA 3R1IA 5EMHA 3OBBA 5CEJA 4YR9A 1E5LA 2W98A 4JLWA 4QSMA 4ILKA 3U4DA 4WOJA 3E9QA 1XEAA 4J7XA 3T4XA 4CQLB 1PR3A 1WPQA 4WNCA 5KVCA 4LVUA 5IDQA 1QV6A 4OXNA 4FBGA 2VCYA 1WNTA 1QG6A 4MKXA 3WIEA 3KZVA 4UUMA 2JD1A 4KUGA 3O26A 1AN9A 3PGJA 2YV3A 5KJEA 1ISJA 3KRTA 2DPHA 4LISA 1G0OA 5L7YA 3PQEA 2IYOA 2ZB3A 1LUAA 1Z7EA 1SEPA 4JGBA 2AEMA 1I36A 3ABIA 3VH4A 4W4TA 5A9RA 1I24A 1P3DA 5DP1A 4D46A 3F9IA 3VPHA 1X1EA 3AUUA 3NT2A 2C2YA 1A9ZA 1YBVA 1J4AA 2I67A 3FI9A 4GI2A 2DLDA 4CLOB 1PSDA 4TKMA 3V2UA 2Z1MA 1XIVA 3CXRA 4DVJA 3S55A 4GGPA 1ZJZA 3GEGA 4BKPA 1NQOA 3JD4A 2X0IA 3AOEA 2Y68A 3AM3A 3W4JA 1YDWA 3I9JA 1P1RA 3Q6IA 3UKOA 1XA0A 1TT5B 2P9GA 3VH3A 1ZXBA 1SPXA 2AXQA 2C07A 3FRJA 4OM8A 1YDEA 5A5FA 3CE6A 4M86A 4E30A 1GTMA 5EPOA 4XQ9A 4E33A 1HETA 2I99A 1UZNA 5TS3A 3VOSA 2GO1A 4WCFB 3VH1A 1MB4A 3M2TA 4OAQA 1YWGO 4N7RA 5LDHA 2VUTA 4IS3A 4MKZA 4BO2A 3EY4A 3OH8A 2OMEA 4HFJA 1PL8A 2QHXA 4JROA 3U0BA 4IY1A 4J2OA 2FR0A 2NU7A 1IHXA 2B36A 4KZPA 4MVJF 1Y7TA 5AVOA 4BO9A 3AI2A 3H9UA 4WECA 4XB2A 4E2XA 4GX1A 2B0JA 2GF2A 4MINA 5CEFA 4N5LA 1ADGA 1O8CA 3P5SA 4NJMA 4CLHA 4OXKA 1D3AA 2FHSA 1UXKA 2D8AA 3GPDG 3D3WA 3M1AA 3O4RA 2CD9A 3TNLA 2H1SA 4A27A 2A4KA 4R51A 5K6AC 3COSA 1ZK0A 3IP3A 4KOAA 1DIRA 3WGHA 2RBEA 1V6AA 4RVDA 4CR7A 5DP2A 2E6UX 4P22A 4FS3A 1W4ZA 3L4BA 4MOWA 4CM8B 1LDMA 4J9VA 5MGBA 3ADOA 3GOHA 4Y6RA 1FDSA 1GEEA 1BHSA 4UVEA 5DZSA 4AJ2A 4BGVA 2DPGA 1DIHA 3JYLA 4DREA 4BMNA 2VHWA 5DBGA 2FOIA 1XQ6A 3K92A 3WLFA 4ALNA 3HSKA 3DMYA 1CDOA 3B1FA 5C3MA 1QP8A 4WASA 1KERA 1DFHA 3HB4X 4KQWA 4MPDA 4OQZA 3RBZA 1DLJA 3NRCA 3I6QA 4R16A 1RYDA 3INTA 1UDAA 4ZICA 3DZHA 4B4WA 1GCOA 5L40A 3NGXA 2UDPA 3RUCA 2UV8A 3KOUA 2X5KO 2W2LD 4M1QA 1KEWA 1GQ2A 1C1XB 3H3FA 1Q1NA 1MA0A 1B0AA 3OEYA 2GSDA 3GGOA 3RFVA 4XYEA 2H5LA 3WGYA 3EK2A 5HM8A 1RWBA 3D7LA 1BVRA 4J4BA 1ULSA 4P4GA 3JD1A 3BA1A 3VPFA 3F1LA 3KYCB 3VZQA 3ZW9A 1I3KA 4QUKA 2BFOA 3ROQA 1VLLA 3MJVA 4YJFB 4UUNA 1HDCA 4KWIA 4E6PA 3IOYA 1I2BA 4CLRB 4F46A 1GQYA 1PZHA 1ONOA 5TSDA 1D4FA 4DLAA 3ZZNA 3W6ZA 4YBZA 4GKBA 3VTZA 4M8SA 4L73A 3ZNNA 1JW9B 3VHRA 1U8XX 1K0UA 3ZV5A 4ONEA 4HNGA 3P7MA 4J49A 2X22A 2Q46A 1O9BA 4XQEA 4DC0A 4IJKA 2X9NA 3PP8A 4CR8A 5IDWA 3UGKA 1NBOA 2BFAA 1GAEO 2VHVA 1JDJA 1HEUA 4RCVA 1C1DB 4JJIA 4JJFA 3GFBA 4ZA2A 1WDMA 3FWNA 4R41A 1T2EA 2ZQYA 3BMCB 2HQ1A 1N7GA 3WGOA 2IZZA 3VPGA 2ZQZA 4R1TA 3OETA 1GADO 5TJ9A 3NDJA 1WLYA 1A72A 4S3MA 4XYLA 1XLTA 1E6EA 3WMWA 4M89A 1IB6A 4BNTA 3CUKA 4KDFA 4BO7A 5EL0A 1VI2A 3ULKA 3I4FA 4CMEC 4ALKA 1M75A 3FR8A 2ZB7A 4PG6A 3IQDB 4ALIA 4BNVA 4RPJA 2Q1WA 3LT0A 2YZ7A 3ROMA 3TOXA 2PD3A 5I7FA 4RLHA 5ER6A 1I33A 1SOWA 2D5AA 5CDSA 2D0IA 3GQVA 1I30A 3OJOA 3AY6A 3QVWA 2ZTLA 4R9SA 1ORRA 3GT0A 4BNKA 3G0OA 1I3NA 4XDYA 4NJOA 4OO3A 5HBRA 4B8WA 3S1LA 5A9SB 2QYSA 5DCYA 4XRRA 2VT3A 2JFFA 3G79A 3LQFA 5KNLA 4GSKA 1X7GA 3H4VA 3V1YA 5GY7A 4FR5A 3WG9A 1UZLA 1HSZA 2W4QA 5JAIA 1I10A 1ZUD1 2EWMA 5TIIA 1EVZA 1ADCA 5KJCA 5TT1A 1X0VA 5AOVA 3GVCA 1O95A 3RKUA 2C29D 3IL2A 1DOHA 2QZ9A 3BMNA 5COQA 3JQBC 1F12A 4JQCA 2D59A 5EQFA 1IHYA 2DUWA 1BSVA 4R4JA 1LDNA 3WJAA 1EDZA 5DDIP 3VH2A 4D3FA 2F1KA 1DSSG 1YJQA 1DC4A 3BMOA 4WUVA 1XYGA 1EQUA 1GV1A 1DXYA 3K8ZA 2PKRA 3PHIA 4PG4A 4ZQBA 3L6EA 3G3EA 3TQHA 4AG3A 3EC7A 4WJZA 3WWZA 1JA9A 2IODA 1BXGA 1XDWA 5KIAA 3RUHA 3K2BA 1J5PA 3DQPA 3WQSB 3M1LA 4AICA 4TWRA 2JCYA 2NTNA 2X5OA 3RWBA 2XXJA 2GASA 1HL3A 1QR6A 2Y1GA 1YVEI 5G0UA 1CRWG 4OOEA 1NPYA 3PWKA 5A9TA 2Y66A 3WDSA 4BGIA 3KEOA 2EW2A 4U6QA 1VJ1A 3B1KA 2PD4A 1DPGA 1NQTA 2YDXA 3QE3A 2A94A 4ZJUA 2E37A 1Q0QA 2RHCA 3IDSA 3E82A 4JBIA 3GNTA 3WFJA 4II3A 2Y1FA 3JQ7B 5F1KA 4IMPA 1PJQA 2QZZA 4RPKA 4WLNA 5TT0A 3RUAA 4HXYA 3ANMA 3KLMX 1R15A 4LCJA 4QEDA 4XGIA 1H9AA 1KVQA 3FPLA 5A4DA 4ND5A 1YBMA 2O7QA 4A73A 4CMIB 5K9ZA 3IUPA 1E3LA 1L7DA 2VOEA 1LDBA 6LDHA 3G17A 4ESOA 1DJNA 3A28A 4GLOA 2NLOA 3LC2O 2VWHA 2FN7A 4FW8A 4RZIA 3IMFA 4Q3DA 2O3TA 2P5UA 3A4VA 2O4CA 3FTPA 5KCZA 4GPD1 2BFPA 4FJ1A 4FFRA 1Q7CA 4F6CA 2AHRA 2CY0A 4XR4A 4A26A 4YT5A 3GF4A 3K5PA 4DIOA 1ENYA 5IDXA 3PFFA 4CM9A 4BL5A 4ALJA 1YL7A 2JAPA 1Y8RA 4HY3A 4DQXA 5L51A 4YJHA 3MOGA 1U3WA 3ZHBA 4DRYA 1C0PA 1LLQA 1R37A 2P5YA 4AJ1A 1S7CA 5KVVA 4PG8A 5JAQA 2CF6A 3DAFA 3R3JA 4PRLA 4IIUA 1HWYA 1P1JA 3JD2A 4IDGA 1Q0HA 3RC2A 1OFGA 2IXAA 4CLDA 4B7UA 4GL4A 2QRLA 3U4CA 3MTGA 2EKLA 4MVJG 3WGTA 3W1VA 1HTBA 4EEXA 4FDAA 3DZBA 1HLPA 1YOVB 3PTZA 3UCEA 5A04A 4CMBA 4TKLA 4GX5A 4CM1A 4J1TA 2YFQA 5I7EA 1B14A 3R0IA 4PLWA 3U5TA 2W2KA 1N9GB 3BYZA 5FYDA 1KVUA 3DXFA 1QRRA 1ID1A 2EEZA 4RF5A 2B4QA 3JYOA 3U62A 5JMWA 2WDZA 5CDUA 2C59A 2X8LA 1U8FO 1JKJA 3EMKA 4YXFA 1NPTO 2CFCA 4BQRA 3C7AA 4RVUA 5JMPA 5C7OO 3ZNOA 3VZSA 2EG9A 2P9EA 1H5QA 1U3VA 4R1NA 1YL5A 2WM3A 1HDZA 1JWBB 1JU9A 2ZCVA 1P45A 3KB6A 4CQLA 1FDWA 3JQ8B 3V1TC 1VJ0A 1E1LA 2NWQA 3BXXA 4XD2A 1JN0A 1ZSVA 4PLGA 5A3JA 3QWBA 3OF2A 3WJ7A 3IUSA 2BGKA 3GNQA 3MWEB 4R1UA 2E49A 4F45A 3ZU2A 3ZU3A 5L45A 1T4DA 5A06A 5ICSA 3S2GA 3ZU5A 3U4IA 1PQPA 4E5MA 5FEUA 3PK0A 2RAFA 5BNTA 1NXQA 2HMUA 5T8KC 5KJ1A 7MDHA 3AW9A 1AGNA 5TGDA 2GR9A 3ZH2A 2WYVA 4NU6A 2VZ8A 3KUXA 1HE5A 4U8GA 3RQSA 3B1JA 4CR6A 2BI8A 3VC7A 2AEFA 3OJFA 4ZN6A 2O7SA 2PKQO 2RCYA 5HS6A 1MP0A 1WDLA 3JCZA 3AU9A 2H63A 1QSGA 2AA3A 3LC7O 5F5LA 4BNZA 4E2ZA 1WW8A 4CLOA 5JAMA 1RYEA 5JCJA 1YO6A 2Y0CA 3NT4A 1UJMA 1L1FA 3UFXA 4I5DA 3DOOA 3CIFA 3CMMA 4BQPA 4RF3A 2YJZA 5ADHA 1LBEA 4FJ2A 1IZ0A 1YRLA 3KSZO 2V6FA 1OC2A 1PJTA 1TB4A 1EE2A 2DAPA 5DT9A 3SEFA 5EERA 3W4KA 4NG5A 3PFWO 4GLLA 1ENOA 1U9JA 4OJNA 2GN8A 4FOOA 4JBHA 2JHFA 4XIJA 4RGBA 3BMQA 3IAHA 3I9MA 1ZJYA 1GUYA 1KBZA 1GYRA 2Y93A 4N5MA 4PIVA 4IJUA 1NM5A 3MJCA 2BELA 3TN7A 1NR1A 4BV8A 1GZ3A 3AJRA 5L53A 5J23A 4BNJA 4XZ3A 1ZSYA 1J6UA 1YBAA 1GFSA 3UW3A 1PJCA 2HKIA 4FIZA 2FY8A 3ZHYA 1B26A 4NH4A 1PU2A 2BF7A 3GFGA 3WYEA 1K3TA 3TJRA 1E1KA 3K30A 4YTEA 1MFPA 3DHNA 1K6XA 4MIEA 1Y9AA 3S2IA 3N7UA 4J91A 5THKA 1BW9A 3GEDA 4O59O 1X7DA 1CETA 4AJ4A 1F06A 1D8AA 1V8BA 4BNXA 3QVSA 4Y9DA 5TC4A 1EK5A 1NR7A 4EEZA 2NTJA 3RC1A 2FSVA 3LYLA 4MP8A 2ZYGA 1ZO8A 1UXGA 3QIVA 2A35A 3VPSA 4GBJA 3HWRA 3S2EA 3W8FA 4CM8A 4DMMA 4PLYA 1GUZA 3X2FA 3KV3O 1B8UA 4C4OA 1WMBA 3E9MA 1HZZA 2C82A 4JK3A 4CM4A 4Q3EA 1H9BA 4L4RA 1T2FA 3FN4A 2HJSA 2HMVA 3SLGA 1X7HA 1CERA 1EEHA 2C54A 2EHDA 3UF0A 2CNBA 1MFZA 1AXGA 1PWZA 3ASVA 3GG2A 4KMSA 1O0SA 3GZNB 2IE0A 5CG1A 3IKTA 4JX8A 3RFXA 1RM4A 2OGUA 4BKOA 1E3WB 3MJSA 1LU9A 3OJLA 3BTVA 1X14A 4LVCA 4CMJA 4KP7A 3L6DA 1PZGA 4AVYA 4BNYA 1X0XA 1GCUA 2R00A 3GRKA 2VHYA 4GX0A 4Q3AA 4AJHA 3KETA 3V2GA 4EUHA 2VNAA 1ISFA 1U3UA 4AJLA 3HQ4O 3GR6A 1E92A 4Z9YA 3ANNA 2FZEA 1I3MA 2RH4A 2ZTMA 3ROPA 2VTEA 3D0OA 1U28A 1V35A 3OA2A 4CV1A 4Y6PA 4IDAA 3TSCA 4I08A 1HDXA 4E2YA 1CJCA 1Y5RA 1SO8A 3UICA 3KYBA 1E5QA 2NM0A 3DEYX 3PEFA 3JQ9C 4YJFA 3JYQA 1CEQA 1ENPA 1LNQA 3KSDO 1EVYA 3O8QB 1QLHA 4BHTA 4CLRA 4EUEA 3KVOA 4NBTA 3ZWCA 1GZ4A 1UZMA 2GRAA 1ZH8A 1SBYA 4R01A 4W9NC 1QYWA 5JXWA 5MDHA 4ZU3A 1P1FA 3A14A 3GHYA 4PLCA 5JC1A 4L76A 2EERA 2PH3A 1JVSA 2LDBA 1H6BA 3QVXA 4B79A 3Q11A 5GZ1A 2AG5A 1N92A 4CM3A 1MX3A 1I32A 4W7HA 1WVGA 4WEQA 2BRUA 4FOSA 4HX5A 4RQUA 4LK3A 2DUUA 1ZKMA 3L6OO 1KS9A 3WQRA 1B16A 1LRLA 3DZIA 5JY6A 4R54A 3RD5A 3EYWA 1GD1O 4JIGA 3RU7A 3DBHA 3QWAA 3KBOA 4LW8A 1Z6ZA 1QORA 1CQJA 1N1EA 1UP6A 4IPTA 4C7JA 1T1SA 4I9UA 1MGOA 3QJ5A 1WP4A 5JY1A 2FMUA 2BKAA 1X13A 2NNLD 4PLHA 4R9RA 4J2HA 2AG8A 2WTBA 5AQ1A 2NSDA 5T57A 1MG0A 4YYZA 5LDGA 3V2HA 4BV9A 3GHHA 2NV6A 1WXDA 1P31A 3PVZA 2PKQP 2QQ5A 3RI3A 5ITVA 2TMDA 4AJPA 1JKFA 4II2A 3K2EA 1K6IA 3LC1O 4ND2A 3O38A 3WX0A 4O0LA 1NNUA 2C2XA 2X5JO 3PGXA 3EDMA 3OFSA 3Q2IA 4FFLA 4XEHA 1YQGA 4INAA 1H2BA 3ZN2A 2UVDA 2Y67A 4J7UA 4J3FA 3WMXA 3GH3A 4WLVA 3C1TA 1DDOA 3ZV6A 4DQUA 1LQUA 3JV7A 1H2HA 4BB5A 2D3TA 3DBLB 4GMFA 4J43A 2A92A 2X58A 3SJUA 1LEHA 2ZYDA 1IL0A 3DBRB 4XYMA 2YHUA 3AY3A 3ZWXA 3GNSA 3LLVA 3OJ0A 4UUPA 3U49A 4Z6KA 3QVTA 4M55A 2O4UX 3DC2A 2TMGA 4UEKA 4IGFA 2YW9A 2O50A 1F14A 2GLXA 4R69A 4R5MA 5DOZA 3AUAA 3KTDA 1ZBQA 2QYTA 3ORFA 3DBVO 3E9NA 5CG2A 3HN7A 2IXBA 1LC0A 1NWHA 4J4HA 4AFNA 1JTVA 3KO8A 3LK7A 2WYWA 4R3WA 1W6UA 1SEVA 3AM4A 2X4GA 4W7IA 1Z75A 3GDGA 3JD0A 3HADA 1XR3A 1OZAA 3UCXA 4B3IA 2FZWA 1WDKA 2HK8A 3K6JA 3OQBA 1A9YA 3UAGA 3ZWBA 2I3GA 4K26A 5A02A 2GN4A 2X0JA 4RPLA 2JD2A 1T2CA 1U3TA 1ZK1A 4K1LA 2CF5A 4IBOA 4K9DA 4D3SA 4RJTA 1HE2A 1R4NB 4BMSA 3ZWNA 4I1IA 3H2ZA 4RVFA 1I3LA 4CMKA 2Z95A 2IYPA 4BNUA 2GYYA 4YJGB 2W8ZA 1H6CA 3MJEA 3JQ7A 5BSHA 2EKQA 3I52A 3IJPA 4P8RA 5TRTA 3RIHA 4E5KA 4U0JA 1U7HA 1PS8A 2VHZA 1N1GA 4J90A 3NDRA 1FF9A 3Q3CA 1DFGA 3LSYA 4RVGA 3KYDB 1EBUA 3H3JA 2WJPA 4BO8A 4BO0A 5KJFA 1P0FA 1R0SA 2OOSA 5IXYA 3EZLA 5TQVA 4CMIA 4BVAA 3OECA 4CUJA 1GUFA 1UR5A 1ADBA 3F47A 3MJ4A 2B4RO 3ONEA 1Q2XA 2ZIZA 4A7PA 1E7MA 2NVUA 5C7IO 2I5PO 4BO4A 4F3YA 2DTDA 2BI7A 1MC5A 2WEKA 5L4NA 3TF5A 2HMWA 2OXIA 2AEJA 5A5EA 4L4SA 4EDFA 3IJRA 4OHUA 4UVDA 3PYLA 3TL3A 5BSFA 3PQDA 1ZMOA 3WSVA 3GA0A 1DHRA 4BO6A 2OBYA 4CV0A 1UXHA 2HSDA 1ISGA 3OMLA 3PYXA 4NU5A 4GKVA 4FQ8A 4FB5A 2QG4A 1Y8QA 4ZQEA 1ISHA 1JAYA 2FR1A 1A4IA 4Y6SA 2AMFA 3H8VA 1BRMA 3B20A 1GR0A 5HS4A 3ZW8A 5KVSA 2NQ8A 2O3JA 1KVTA 5K6AA 1T1RA 4OXYA 4XKJA 3ZU4A 3DFUA 1F8FA 3U4HA 5B4UA 5T64A 1K6JA 2WD7B 1G1AA 5JW6A 1IOLA 4P4NA 2JJYA 1LLUA 2VZ0A 3E8XA 5G2OA 4XJTA 4XWYA 3ANLA 1N9GA 3MEQA 4UVGA 1JVBA 2HLPA 3TZ6A 5H82A 1I0ZA 3ZDFA 3DL2A 4FC7A 4H16A 3PQFA 5U1PA 5T6BA 2DBVO 3HDJA 2FPIA 2DT5A 2BGLA 3DMTC 3OM9A 4GWGA 4XB1A 4BNFA 3WGZA 3LLSA 1DHTA 4A2CA 4MP6A 5FF9A 4BNGA 4ND3A 3N74A 2VOJA 2Q2WA 4YAGA 1DC5A 3F4LA 3SXPA 1FK8A 4PZEA 3HNPA 4HFRA 4CODB 4NBVA 2BLLA 1QLJA 4ROSA 4AJEA 1LC3A 5JO9A 4MJLA 1NAIA 3DAGA 2PV7A 1P0CA 3DHYA 1WWKA 4B8ZA 3F3SA 3LF2A 4G5HA 3SJ7A 2JKVA 1M2WA 2EW8A 1KC1A 3LVFO 3M6IA 2I9PA 2JFHA 1UP4A 1GU7A 1GYPA 4H15A 2DM6A 4YT8A 2AQHA 4RVHA 3E1KA 1E3JA 1D1TA 2BMAA 2EP5A 3HDYA 4NR0A 4A10A 4IDBA 3HJAA 4KWHA 3OICA 1B3BA 3INGA 2PZLA 3VTFA 2QX7A 4OOFA 1ONPA 3EVTA 3KSUA 3K31A 4H3VA 4I9NA 4ZRMA 1VKNA 1Z82A 3ZWWA 4KUHA 4NK5A 4RL6A 3JQAA 4NMHA 4EITA 1LDGA 3L4SO 3Q1LA 4K28A 4E2WA 2R2GA 2XAAA 4GX2A 2NACA 2DC1A 3JSAA 1KYQA 2X6TA 1UAGA 1SCUA 3IC5A 5T5QA 4BO5A 5JDIC 4FPXA 5H81A 1LRKA 2VRCA 3GC6A 3QHAA 1T4BA 3LT4A 1VC2A 1C0LA 3LDHA 4MVJH 5TLSA 1ZNQO 4B3HA 4LRTB 4NQZA 1PJ3A 4XQCA 3T7EA 5IZCC 2HMTA 1N7HA 4ZVVA 4R68A 5JYEA 5GZ3A 2HK9A 2Q2VA 4TVOA 1EUCA 3UCFA 2JL1A 2Q49A 1P9LA 3IS3A 3UOGA 4O63O 1D7OA 4PZDA 1U1IA 3C7CB 1EDOA 1NHGA 3C1AA 3LU1A 1RKXA 2WMDA 2J5QA 1UAYA 1AHIA 4PLTA 3X2EA 2EV9A 5JDCC 3EAGA 4CMEA 1NQ5A 3D3WB 2C0CA 5COAA 4E0BA 2BD0A 1T2DA 1PIWA 3GDOA 3PHJA 5HWSA 1LQTA 1DBVO 1TA4A 5EESA 3WXBA 5DOVA 3ZWMA 3OIFA 4BGEA 1PL7A 4J7CA 2OFPA 3NJ8A 1HRDA 4JXKA 4PG5A 3B70A 4CM9D 2PR2A 3SX2A 2Q4EA 3V8BA 4DBVO 4RV9A 5JS6A 3U09A 1GDHA 4J1SA 4Y67A 4JP3A 3DTYA 5ES3A 4WPGA 1QYCA 2ZTVA 2CVZA 2B37A 1K5HA 4L74A 5ITWA 4UUOA 2W90A 4K6FA 5HTOA 3DZKA 1LX6A 2PTGA 3JQGB 3DZGA 1KVSA 4E5YA 4WLOA 5F1PA 4UEJA 2Q1UA 4CQMD 3ZV4A 4NBRA 1IZ9A 4IINA 5IXSA 3ZGYA 1NVTA 1UDBA 1MXFA 3GMSA 5DBIA 3JQBA 1V9LA 3ADPA 5C7LO 4E21A 1Y1PA 5DULA 1QYDA 2J6IA 3PJGA 5EIOA 4I5EA 4D0SA 4NI5A 1U4OA 4E5NA 5JCXA 1BGVA 1NYTA 1RM3A 2B5WA 3DB2A 4DWVA 2CVOA 1KY4A 4N18A 3WBFA 1ZCJA 1Z45A 3D64A 1Q7GA 4XR9A 4FGSA 4NK4A 2C7GA 3H9GA 3C24A 1SB9A 5F5NA 4JP2A 5IFLA 2POQX 2VTDA 3H5NA 1NP3A 4J9UE 3GZNA 3V1UA 1E7SA 5I7VA 5KVQA 4YRBA 4N5NA 4ITUA 3DOCA 3PDJA 2PGLA 1V0JA 3AM5A 3RU9A 1EFKA 2DQ4A 2EF1A 2J5RA 1QYVA 4J0EA 4CQMA 3GUCA 3NTRA 3HHPA 2O2SA 8LDHA 4R3NA 3VZRA 4BNHA 2X7HA 1PZFA 4Q39A 4UULA 2NU6A 2UYYA 3D4PA 3GN2A 2IZ1A 5FFFA 1PGQA 2CDBA 1ZFNA 1MXHA 3TFOA 1WAMA 4NNJA 2GZ1A 2CUKA 2PK3A 4PCVA 3I1JA 1KIFA 2Y1EA 3ZNPA 4WLFA 2DU8A 5JFOA 3WOHA 3NEPX 4RPGA 1Q0LA 1EUDA 4TRRA 4DIBA 1AUPA 1TI7A 4WKGA 3K73O 4FSHA 3WICA 5BQFA 4UVIA 5JCJD 4LMRA 3ZNQA 5L4SA 5BT9A 2GCGA 4NDNE 2LDXA 3W8DA 5G0TA 4BKRA 2J3JA 1R4MB 3EVNA 4FN4A 4KTVE 2WE7A 3H5RA 1TVEA 2DBZA 2GD1O 2IEBA 4UVHA 2OL4A 5DBFA 5EINA 3ZHXA 2VNSA 2VWPA 3I9NA 4GGOA 4FD3A 3FTNA 5JPIA 2YYYA 4G65A 3PI7A 4B7CA 1PJ4A 1QXSA 3L07A 1XKQA 3ZWYA 4PLVA 3RKRA 1KEVA 3HFSA 4YB8A 2F00A 4LMPA 3DTTA 4IDCA 1G6KA 4UREA 3AOGA 3E18A 3HDQA 3W6UA 3WTBA 1OC4A 3DOJA 4OIMA 2VYNA 3OIDA 3I23A 3KXDA 4D0RA 4DPLA 3BMNB 1EBFA 3EGOA 3GEMA 3DDNA 3GMDA 5TX7A 3GPIA 1TT5A 5U9CA 3PJEA 3K9QO 4BOYA 2VUSA 1CQIA 4EI2A 2GNAA 4BKUA 4DL9A 1I8TA 1E6WA 1PJSA 2YV2A 3GN1A 3VDRA 1FMCA 2FRDA 8ADHA 2VN8A 1Y81A 3E5RA 3GGPA 4NZ9A 2IZ0A 2P9CA 2JCVA 4MVJE 3RCBA 3ICPA 2FWMX 1UXJA 3I83A 4RF4A 4RPHA 2G0TA 2PZJA 4P4LA 4BNMA 3O03A 1E3EA 2I66A 5HRUA 4WCFA 1SOVA 5A05A 4KDEA 3SLKA 3D3EA 2DBRA 1E0DA 4EGFA 1HF3A 1PJBA 3FBTA 1V3UA 4E31A 5B37A 3R6DA 4XIYA 5JNLA 3WBBA 3O9ZA 4Q3NA 4ID9A 4MVJI 4BNNA 4WEOA 3HZZA 3RUEA 2OHXA 2B69A 5G0SA 4TRMA 4E13A 3I4CA 2HK7A 4W99A 1BG6A 2EP7A 3H5AA 1I01A 2Q1TA 3NJ4A 1ML3A 4G81A 3I3OA 4HNHA 2Q45A 4B4OA 4E3ZA 5T8KA 4BGUA 2GN9A 2J3IA 4G2NA 3ON5A 1TLTA 4OYRA 4JN6B 3WIDA 2D1YA 3FNHA 3Q2KA 3H9EO 4W6ZA 3SC4A 1OMOA 3ETGA 2G1UA 2FR8A 4PRKA 3WFIA 4MVJA 3GUYA 4ND1A 2P2SA 4MDHA 3S2FA 3JYPA 2QIOA 5EN4A 4FFMA 1NFRA 1EMDA 4K6CA 3G1TA 4D43A 1NX6A 2NU9A 1R4NA 2J3KA 3EZYA 2I6TA 1PTJA 2E48A 2ZJ0A 4MIOA 4X54A 1DLIA 4EJMA 4CMGA 3RUIA 2RIRA 2R6JA 4AJKA 1RJWA 5AXAA 3TZHA 2HU2A 2OP1A 4MO2A 1VJTA 2WWRA 1N5DA 4PLZA 3MTJA 1E3IA 2Y0DA 5JYDA 1PJLA 1T24A 4YJHB 3WNVA 2GN6A 3LZ6A 3OQ1A 4RVSA 2YHIB 1W8DA 2D5CA 4EW6A 5G4KB 3CEAA 4QO8A 1QMGA 3QWHA 5IAAA 3KYDA 3AFMA 2O3UA 3I9OA 5G0WA 2ZYAA 1C1XA 1VL8A 3AU8A 2NADA 1GQQA 4L4XA 1DRWA 3AOEC 4IQ0A 3GK3A 3ZV3A 1P77A 4IDDA 4YRAA 1OBFO 1E1MA 1RM5A 4CM5A 4BO3A 3KYCA 1YH3A 3A1NA 3JQFA 5JLAA 5A3VA 1XHLA 4J1QA 2V7PA 3FNEA 3QV1A 4YCAA 3ONFA 1DIBA 4YT4A 3ZWVA 2VYVD 2B83A 3HFGA 3HUDA 4R1SA 1DFIA 3FD8A 1LRJA 2ZB4A 4Z0TA 2PGJA 3ITDA 3L77A 4I5FA 1FJHA 3PLNA 3ZWAA 5IG2A 3R3SA 3TZQA 4XYGA 1N8KA 5CEEA 4DYVA 4YAJA 4YT2A 1FDTA 1R66A 4TZTA 1SAYA 3BHJA 3Q0EA 1HDRA 3CZRA 4U7WA 3RBXA 4O1MA 4WE3A 4MVJP 3WGQA 1C1DA 1OI7A 2PGDA 4PLPA 2PA3A 1VL6A 3I5MA 3N58A 1LJ8A 3GVPA 4WGGA 1VL0A 4QT0A 4YEDA 3ZCXA 2O3QA 3GVIA 3F4BA 4IDEA 4IJWA 1Z74A 4OQYA 3BMCA 2WD7A 4RORA 4QECA 2E82A 1WMAA 4IQGA 2CZCA 1SZJG 4QX6A 4TROA 5CDYA 4AL4A 3E6AA 3FF4A 1M6WA 4J16A 2PZMA 4IXWA 5CAEA 2VYVA 3BZUA 1E3SA 3DHEA 1WZIA 3PWSA 4FGWA 5KTKA 2DKNA 2EGHA 3W4IA 3QWIA 3JTMA 4JJGA 1O5IA 4HV4A 4HFMA 3PHGA 3I6IA 2C20A 1BDBA 1ZSNA 4HUJA 1ZZEA 3QA9A 1QV7A 1PS9A 1Q7BA 1MC4A 1U5AA 4A5OA 1F17A 2V65A 5C37A 3L4BC 1YB1A 1ISIA 2G82A 3BTOA 3GVXA 4D41A 1LSSA 3QWFA 1P33A 2C5AA 3HN2A 5A9SA 1DO8A 1BVUA 1XU7A 4WNIA 4DBZA 3U3XA 4XGKA 2VZ9A 1NVGA 1ZW1A 1U5CA 2QW8A 2PFGA 1VSVA 1DEHA 1SMKA 4P38A 1VM6A 4EUFA 2DTEA 3C7DB 5A1TA 4FCCA 4CJXA 2IEDA 2NTVA 5B12A 2ILTA 3ENKA 4CMHA 9LDBA 2RH8A 5LCXA 4IZIA 2EIHA 3STHA 3JQ9A 4D44A 5TNXA 3CKYA 3BAZA 5DN9A 4DA9A 2Y1CA 4E32A 3PIIA 4IS2A 4GQAA 4B7XA 3WNQA 5L7TA 3TPCA 4W9NA 3ENNA 3L0DA 3BMQB 4AJNA 1PGNA 2C7VA 3HDHA 1T25A 4QO7A 4DUPA 5KOIA 2HCTA 2OZPA 4IUYA 1V3TA 3AUSA 5I8WA 2ZTUA 3QSGA 1C0KA 1PS0A 3FBGA 4EZBA 4S1VA 2NU8A 1YGYA 2H6EA 2YQ4A 1MG5A 4DQVA 1HYEA 4OSOA 2DBQA 1JQBA 5KKCA 3GAFA 3FSRA 5THQA 4JBGA 1HLDA 3LT1A 1YXMA 1KEPA 5FI5A 4F6LA 1DB3A 5G4LA 1PJ2A 1SB8A 3EUWA 1PGOA 4FFNA 4U0KA 4C7KA 5JAZA 2YY7A 4AJJA 1IYZA 2D4AA 3H6KA 1N2SA 4GVLA 5A03A 2J5KA 1A7KA 1BDMA 1XQ1A 1BW9B 2X0RA 4JNKA 1GL3A 5IN5A 2VT2A 1OAAA 1NFQA 4EYEA 4TSKA 5BR7A 3WLEA 5B4TA 3WS7A 1DJQA 4MVJM 3S8MA 1G0NA 3SVTA 1BWSA 4DTIA 3T4EA 2XXBA 1XWFA 4I9HA 1AE1A 3NGLA 2AQIA 4PVDA 4CMAA 5ENVA 2AE2A 2J8ZA 3MWDB 1E77A 4M49A 1M6HA 2PLAA 3W8EA 1DIGA 1E7RA 2HMSA 4CM4B 3IP1A 5L9AA 4GMGA 4OKNA 4O5OA 5DCUA 5AYVA 5I9NA 5DF1A 1EVIA 3VVCA 3BHMA 1CYDA 2AW5A 3JQGA 3DWFA 1OOEA 1PZEA 1LSJA 2FPGA 2EKPA 1GEGA 2H9IA 3OP4A 2X9VA 2HAEA 1HT0A 4OMUA 5B4VA 4BKQA 4AJOA 3UXYA 1A27A 1ZEMA 2OUIA 2G76A 1VKOA 4E4YA 2VWGA 4CLXA 1T2AA 4DIFA 1M67A 4D42A 1E1NA 1K2WA 1L7EA 2YQ5A 3QVOA 4J4TA 4Z3KA 1WZEA 2AQ8A 4DPMA 1P44A 2Q99A 2V6MA 4FFOA 5L95A 1A4UA 1GPJA 3WR5A 2UAGA 4W82A 5EJ2A 3H7AA 2BH9A 2CVQA 1RPNA 4J6FA 5JE8A 4CLEA 4YPOA 3RASA 4Z3DA 3GGGA 1ARZA 4YAIA 4NPCA 3VPXA 2Z1NA 1TEHA 3QP9A 4DMLA 3D4NA 3D4OA 4IQ8A 3AK4A 3QW2A 1PQWA 1YOVA 5L4LA 3FPCA 2QRJA 2Q50A 3WGGA 1UP7A 7ADHA 1B7GO 3AFNA 4KTTE 5CPFA 2ZATA 2GUGA 3NTOA 3OA0A 5I8ZA 3CTMA 1NTOA 1LA2A 4Q3BA 1IULA 1PGJA 2ET6A 2UUPA 4TMFA 4Q9NA 2ZB8A 4QQRA 1XELA 1C3VA 1P1IA 1ZXLA 2W2LA 5TJHA 4GAEA 3RC7A 3UH1A 3DR3A 2Y0EA 3JQAD 1ADFA 5BSGA 4IDFA 3CH6A 2PNFA 4U6SA 4IZHA 3KLPX 4U5QA 3M2PA 4BNIA 3AWDA 2BGMA 1ZVMA 1GV0A 4WOKA 3DBHB 5JSFA 3NAQA 5IDYA 3PRJA 1CF2O 5DNAA 3AI1A 2VHXA 2VRCD 1HYGA 3JQ8A 1HDOA 2Y1DA 4LSWA 1H93A 4B3JA 2EJWA 3DAPA 5U4QA 1MUUA 4PLFA 2XPCA 3RFTA 4CM6A 1LLCA 2P68A 5JO0A 3PJFA 4FC6A 1IPEA 1UXIA 3A06A 4ND4A 1R4MA 3F46A 5ILGA 3GVHA 1PQUA 3D1LA 3TRIA 1A71A 2B5VA 3JD3A 4L8VA 1NQAO 1EK6A 2YV1A 3NTQA 4DPKA 4E12A 1QKIA 4J0FA 5CP8A 2V6BA 2PWZA 3F1KA 1KEUA 1YKFA 3DZFA 3MCVA 1HKUA 1NASA 3QY9A 1IE3A 4QTZA 4XQGA 1C14A 3K96A 4WK6A 4Y8VA 3LF1A 3ZI0A 1PEDA 1VPDA 2FPPA 4D45A 4Y98A 1P74A 1YQDA 2AE1A 4B4VA 1B15A 4YACA 1NFFA 4WCDA 4IM7A 1YB5A 2Q1SA 3D5QA 4O6VA 3RJ9A 4HP8A 5CHEA 3OHSX 2OP0A 3GAZA 4A03A 4B4UA 4BNWA 1YQXA 1F8GA 3FHLA 3RVDA 1BXKA 3ST7A 4CV3A 5IF3A 4XRGA 2JCXA 4BO1A 1PR9A 3ETDA 2AQKA 3C8MA 3IKVA 4DXHA 3GG9A 4RO0A 2HUNA 1VSUA 4PGFA 1MLDA 2EGGA 3UUWA 3OSUA 2I76A 5DCWA 3VAZA 2Q4BA 1FXSA 1Z73A 2WD8A 4L75A 2X23A 4NJMB 4XDZA 2NUAA 2E4AA 1J49A 4PN3A 3VVBA 2X1HA 1Z7BA 3PLRA 5IN4A 2Y99A 3IIEA 1EE9A 1Y9EA 2PZKA 4YAEA 4ZRNA 3DMTA 3PZBA 1DC6A 2ZKLA 1PX0A 5CPBA 3TZKA 2VUUA 2VRBA 1PWXA 4DLBA 3A9WA 1E7YA 3T7CA 5KKAA 5CDTA 1U7TA 1HYHA 2HDHA 4TRJA 6ADHA 3NV9A 4LRSB 2DVMA 4TVBA 3U9LA 2YDYA 2B35A 4CUKA 1O94A 2O48X 3ZHZA 1X15A 4RDHA 2FSSA
chains in the Genus database with same CATH superfamily
1RBYA 3ASZA 3IBTA 1R12A 4BN5A 1HORA 1XQ9A 2X86A 4TRNA 1AK1A 4HDNA 3WRWA 4FVTA 2ONJA 2FFJA 4EYKA 1UKCA 3FFWA 3X43A 4Z9XA 3NORA 5IZ4A 1JB9A 4LAFA 4QPJC 4OUDA 4W5TA 2ZBPA 3ESQA 3EVFA 3R6GA 1CUYA 4GOOD 5K2OA 1XG5A 1K7EB 4KACA 4JIMA 4LZJA 3UUFA 2JD0A 4MRAA 1IY8A 4QWWA 1C7QA 3W5SA 3OKPA 3N0VA 1MV8A 2PZBA 2O3RA 3WB9A 4HGZA 1AKYA 1AQLA 2CJPA 3M1IA 3OLZA 3M70A 3HE3A 2REQA 4P6VF 3G5TA 4YCBA 1EUZA 2GT1A 5ALGA 5EUQB 3H5IA 3OT1B 1X1TA 1X38A 1J9ZA 1SVNA 2QJOA 2YUTA 1PWEA 1IQRA 1JHPA 4N8EA 1BKDR 3BPSA 5CRIA 3SQMA 2QL9A 4CL8A 1YJCA 4FSDA 3SQOA 1YR6A 2IP2A 3ICCA 3SQWA 3U60B 5JSUA 4P4UA 1SCNE 3ROEA 5JQGA 2DE0X 4X8HA 4G1FA 1ZK3A 5JDIA 4IHQA 2GB4A 1JMYA 4CEIA 4EVSA 1YRHA 1GNSA 3I9V6 5FOQA 2VHEA 3A3PA 3LYAA 5D85A 3O4VA 4WOPA 3K6RA 1EB8A 1B3RA 3R4VA 4QG7A 4H7PA 3I76A 1GFZA 7GPBA 3LGSA 4M3NA 4EBFA 2Z5LA 2H7XA 4HH3C 3M6AA 5KQRA 1G20B 1G8HA 3CNQS 4ND8B 4YRTA 1EINA 1UDXA 3FNFA 1ESDA 4MKHA 2FP4A 4GMXA 4RK6A 1YS9A 1E62A 2V6GA 4YA6A 4LDPA 4U63A 1L7QA 4IIFA 4M0FA 1L4UA 2IEAA 3O31A 5DXJA 3JZMA 4QPNA 1FX1A 2GZMA 2X0EA 1E1QA 4MEJA 2H0QA 3NATA 5AJUA 1QRSA 2HFKA 4CG1A 5DIFA 5CDGA 1ZOSA 3CO5A 2HRBA 4LJ7A 2DTXA 3PKZA 5KPDA 5GQSA 4Y2VA 4F3RA 1UMCB 1UDCA 3FCOA 5BSRA 3D59A 3OCZA 1PG5A 1YCDA 2JAUA 1XSEA 3TWOA 3TIVA 2BR5A 3RAEC 4G0ZA 3F8SA 2OO5A 3SFZA 4PVCA 1VRWA 1H94A 2PKCA 3OZXA 1QP7A 2G5CA 2XD4A 2OFXA 3Q7SA 4OREX 4KE8A 2CLKB 2JI4A 1X1RA 1PFVA 1ZUWA 4LMAA 3O8QA 1AT1A 1C3JA 3H65A 4DMGA 4OHOA 1T8UA 2P35A 3EIUA 3HJBA 4KQKA 1JX6A 3AW8A 3DZJA 5M3BA 2LD4A 2X6QA 4KI0A 4L72A 4PAOA 3T9EA 3ASUA 1V9CA 4EF4A 3SU8A 1BA3A 1L1EA 4N54A 3U0VA 3C6KA 1A7AA 3D6TB 3NAZA 2V0GA 2P0EA 3AC0A 4OK3A 1NVKA 3DDWA 4GW3A 1UUFA 4QOHA 4EARA 1K3FA 2OTCA 2AF4C 3NKLA 3GD7A 4Z4CA 2VNIA 3EG9B 3WIUA 2JKYA 4NY1A 1RE0A 4R8MA 2E1RA 2ZIVB 1E2KA 2FSUA 1KOLA 3B51X 2PHZA 4WT7A 4B84A 3MUEA 2IHJA 4O0MA 1NHWA 4JYPA 4WK4B 5FUVA 5BR1A 4I8XA 2CHFA 2HSJA 3MTDA 4ASUD 1TQHA 5TF4A 3S81A 4DABA 1CR0A 4MRSA 3EOAI 2QVCA 4IMJB 4J07A 3PQ4A 2HIGA 4ZIRB 5LFAA 1KDZA 4H1UA 3ZC3A 1CNFA 3B1XA 3T1HB 2OHOA 3HWSA 5EE3A 1XRLA 3I0NA 3M3HA 4EB6A 3PFNA 5LOVA 4NOMA 2C2GA 4AQYB 3VZPA 1SRRA 3OQIB 4OB6A 3CVUA 1RJ9A 4N1AA 4KR7A 1FXWA 1SVLA 3IHKA 2YFHA 4RQTA 3UJHA 3P0HA 1XN4A 1YZNA 3OCYA 3NYWA 4L9RA 2HYDA 4ZZ2A 3H4IA 5JHGB 3NDIA 4ZVLA 1X1QA 2UVPA 3LUKA 1N6PA 4J76A 2BDEA 2YICA 2R47A 3DLTA 2PY6A 4DC1A 4MIYA 2CFRA 3TLAA 1OX5A 4NFLA 1KYWA 4L85A 4RW0A 5AK6A 3Q9UA 4US1R 3RRXA 1E1CB 1VFPA 3C85A 1T0IA 3OQ6A 5IJZA 1XCOA 4IV8A 4ZTUB 4M87A 3OZFA 4PS1A 3IXQA 5CFZA 2H07A 3ADKA 4FHCA 3PDUA 4YP9A 3HVRA 3E03A 3BJIC 2FLKA 2XE7A 4L7QA 2A9OA 4HFNA 2P2ZA 4Q3CA 3DBLA 3R20A 4LGVA 1T6YA 1YZKA 2P79A 4Y6OA 5IT9A 1EP2B 1QF6A 2Q5CA 4K6MA 1XEXB 1E6UA 3HXKA 1CJMA 3S4YA 2D4HA 2NPOA 4KQXA 2HJWA 1P19A 2SCUA 1MX1A 1H3EA 5EKSA 2NXWA 5TVKA 1TKAA 1W73A 1S2OA 3F3KA 1IDN1 1KSFX 1KAMA 1RQPA 2B6HA 3BMXA 1WOMA 1YUNA 4KBFA 3AR9A 1ONNA 3VU1A 4IUBS 2W6IA 1YZYA 2BL4A 2FWNA 1JPNA 1MMFB 3C5EA 3D5TA 4LJYA 2YV4A 3CSDA 3FPGA 4RK0A 3DFKA 4LPKA 1GY8A 3TL6A 3HSYA 1QYXA 3ZIAD 3CUTA 3WQQA 3JQEA 1Z35A 3CGWA 3LBYA 2KQUA 4MKRA 4EIWA 3RAJA 1KK1A 2FMHA 2AZ4A 2ZBDA 3F3MA 4KLRA 4R5HA 1KMHB 2HA2A 4H7HA 2IYQA 5CA0A 3TRFA 3WV5A 4ZYVA 1I7QB 1UKYA 1QOZA 2RI0A 3H4TA 2JHGA 2AR9A 2XGOA 4I36A 5LC1A 3IV7A 4RM2A 4MQEA 2EJBA 3NBAA 3VBCA 1DDGA 2HJVA 2HLDD 2ZBVA 3AI3A 2WIKA 2ZUEA 4G8JA 4OQFA 1GU0A 2Q2QA 1VMEA 2GZ3A 3IO5A 2P91A 2ZRFA 1DKLA 5CNKA 2ISSD 3QVUA 3ODPA 5FOWA 1XCLA 4CL3A 1A8UA 3H2SA 1GYQA 1TJYA 2JB9A 3WWPA 3CF6R 3EDOA 4BX3A 4BS9A 4F7DA 3LE8A 1JLKA 4EG6A 2OQRA 1BQEA 1DJOA 4LHZA 5FWNA 3UWMA 3L9WA 2ACEA 2B4KA 2YWJA 3A6HA 3NT5A 4UTZA 3LAWA 2SKCA 2XF8A 2VJLA 1PUXA 1BCSB 2OZLB 3I2HA 4G63A 4YJGA 3T9DA 3WHIA 2Z6VA 1RXVA 3QRWA 1EIWA 1KKLA 2PGNA 1S6YA 1RJGA 3VHQA 1KZ6A 3OCWA 3BD7A 4RIHA 5EJ6A 5FWXA 3V55A 1T3TA 1Y8RB 1LPNA 3AB3A 1R0KA 1VBKA 2IDZA 2WD9A 3AILA 4EYOA 4YCNA 1MBZA 3UPUA 2WT4A 2QTHA 1QHEA 2QTLA 4KQ1A 1LV8A 4JBNA 5BW5A 1GZVA 4EY4A 4B83A 2RHMA 3DD5A 4NYIR 4UCFA 1J06A 1W9HA 1RLMA 2C00A 4MWEA 4DCTA 2QL5A 2CBZA 4TTQA 4TTVA 5E9AA 2IKQA 4GSLA 3SDBA 2J9YB 3BE8A 3VC3A 4BMYA 2G17A 2RK6A 4WLUA 3W05A 3A4TA 4E5VA 1H6AA 3H04A 2Q4OA 3HA2A 3VO8A 2NVWA 2QX9A 3H17A 3I9KA 1ZAKA 2PT9A 3TOZA 4ALMA 1TF2A 3I2IA 2I3AA 1LVHA 2EXXA 1ISMA 1GQSA 1VLJA 4NBUA 2VTBB 5KNBH 4UM9D 1N2OA 1G8GA 4Q1DA 2A9PA 4XCVA 1T4MA 2GGSA 1YR1A 1OX6A 1VL5A 1EWRA 1WXHA 4YCJA 4Z0HO 4AMZA 1YS4A 5F3RA 3SX4A 3WGVA 2VQEB 4Q4AB 4C1BA 1ZA2A 3HG7A 4MUGA 2DFTA 5BNFA 4OH1A 4C78A 1AQJA 3LUHA 1PT5A 2HA7A 2WA2A 3F6EX 3OJEA 4R81A 1ZIDA 3G0BA 1AQNA 1OAOC 2FW8A 2NU6B 1Q5PA 1IWBB 3EIWA 3LWNA 1RXSA 2H4HA 3AUTA 3UMVA 4IIJA 5C32A 1GPDG 2C7PA 3PHLA 4FJ0A 3RF6A 5DWQA 4GPEA 2XLBA 3G0CA 4UE2A 5DTRA 5CX1A 1UC5B 2ZRNA 1OX4B 1XKTA 1J90A 3MCAA 2YNMA 1C81A 5HGXA 5MN4A 3HBFA 1ECCA 2ZIAA 1UJ2A 1TCVA 3GAAA 2YRWA 1ABEA 1ZC4A 3T4XA 4UTVA 5CFRA 4ER6A 5K5EA 1PR3A 4Q4CA 1UK6A 2Q5OA 3M8KA 1RXCA 4MPRA 5I4IA 5JSHA 3LZCA 1EFUA 1QV6A 1A2BA 1NUHA 2C03A 4OXNA 4FBGA 4RHEA 3EW9A 1C4KA 1WNTA 2GARA 5DO9A 2O05A 3C3KA 3WIEA 4F0JA 2HU5A 3TMKA 1QCDA 2J0EA 1DZIA 1CJBA 2GETA 2C92A 2DUMA 3EDQA 1ZIPA 3QA3E 4NE9A 2EAUA 3HP4A 2HSGA 3TTUA 1OTYA 3KRTA 4LISA 4C3VA 1IN6A 3GCZA 3LXUX 3PQEA 4TS3A 1N36B 2ZB3A 1MO5A 3HDTA 4ZI5A 2FUCA 4UPVA 3ZQJA 5JARA 3K53A 2CL0X 5A3QA 4KR9A 1ZJ4A 2XH8A 4AZSA 2IXFA 3DOIA 4B0OA 4S05A 4OAOA 4O2RA 1I24A 1M7BA 4BMZA 5TE9A 4RTKA 4ZYWA 3B2EA 5IK2D 2XCSB 1NKVA 4IHJB 4RX1A 3W6PA 3CZ4A 1F8UA 3NT2A 3OCUA 1M8FA 2HA5A 4CCWA 1C4WA 1N2CA 3CLRC 4I1UA 1OI4A 3EXEB 1UPFA 3FI9A 1JR3D 4CLOB 1PSDA 2DWOA 1K4YA 3E9ZA 1GL6A 4MCIA 1Z6AA 2H54A 3OCCA 4N0QA 2QI9F 1VDMA 2CK3D 1ZGCA 2W6NA 2WFLB 3N0XA 2QRZA 2XV1A 1GAJA 3ELUA 5K3FB 1GPLA 1ZJZA 1VMIA 3UFXB 3UK2A 5FNVF 5CXXA 4H08A 3KKZA 1OASA 3GO4A 1FP4A 2X0IA 3EVGA 2GPWA 1FUUA 2R8XA 5CH8A 5HJ7A 3AM3A 4X7BA 3W4JA 5TV2A 5AUNB 3I9JA 1P1RA 4CCAA 2VH2A 3Q6IA 4K3VA 2ZUTA 2P9GA 2FQQA 5ARCA 3K0AA 3VZCA 1VCMA 4ZDWA 1FBNA 4EOGA 2C07A 5IKEA 1OWMA 3HVJA 4QXAA 4YCLA 3MFQA 5HOQA 1CDZA 2ZJAA 1CQIB 5F23A 2Q8NA 3GBPA 2JVIA 1L5OA 1QB8A 4K88A 2I62A 1SXJC 2WIAA 3IQFA 2MSNA 3G2HA 5DGTA 2DR3A 5BQ5A 4YUXA 1E58A 2JGEA 1P8AA 1KEZA 1Q0PA 2Q4TA 2QMHA 2ZAOA 3NR2A 2Q5IA 5HCNA 3CO0S 3THXB 2VDPB 2VJYA 3HO8A 2IS4A 2Z8YA 3D6NB 2UZ0A 3TTYA 4EY3A 1OTXA 3C3BA 1SHTX 3O2SB 4FYHA 1LPPA 1E0SA 2JK1A 2AKEA 1QCYA 5CFMA 1CNMA 3TR5A 1GLNA 1RYHA 3O83A 4I19A 1U99A 1MJ5A 3VH1A 5IANA 2WJWA 1XAIA 3QW4B 5I01A 1B1AA 5LDHA 1L4FA 3P9ZA 2B5OA 2DCUA 5EZYB 5DNUA 3W3ZB 3I72A 1T3HA 4AYXA 2F4VB 2XUKA 4U3JB 2IVZA 1MJGA 1LS6A 2I7VA 2Q3JA 1O5OA 3FB4A 3H99A 4BQQA 4EYGA 2WIJA 3NWPA 3UO8B 2ZYRA 1K7SN 4KIJA 4DSAA 1GNRA 1XMJA 2NU7A 3BVPA 2HWXA 4FHGA 4KZPA 4RKWA 4TN1A 5AVOA 2QR3A 4X65B 1FSPA 4COKA 2EDCA 3AI2A 1XZKA 3E15A 1JS1X 3H9UA 4XB2A 3P5BA 3A1DA 2W9XA 3ND9A 3O9VA 1FRFS 3JS5A 2R7LA 2ATIA 4ENPA 5A6VA 2JANA 1RR6A 4MQ6A 2VPWA 1M2FA 2D8AA 2MYTA 2WTEA 3MAAC 4WN3A 4F06A 1AKQA 2QX4A 4BRWA 1RXEA 3DE4X 3G6WA 1ZJ6A 3E9DA 3RU2A 2EFDB 1NN1A 4A27A 4R51A 1U02A 1MB0A 4OIFA 1VGQA 1ZK0A 1S02A 1B8NA 2BEVB 1CUVA 2G09A 3MYYA 4KAAA 4KOAA 2JBWA 5CYPA 5E4TA 4KPFC 1Z0ZA 1V6AA 3WGHA 1U8TA 4HB3A 5DP2A 5AI4A 2OFFA 2E6UX 1BO6A 5BSUA 2P8SA 4FS3A 4QWMA 3A6GA 3QF4A 5GONB 2DFNA 3BB1A 3IE2A 2IVFA 1LDMA 1T1JA 1YS7A 3CZ9A 2O0JA 3RG2A 3S99A 2Q1XA 3ZUPA 1BHSA 4UVEA 3COYA 1VJDA 3GUZA 5D3MA 5E1DA 5DZSA 1DIHA 3H05A 9GPBA 4J2TA 5BQ3A 3T3HA 4M9ZA 2R7MA 4F91B 5LVAA 3EMDA 1QFMA 2GEKA 4IZOA 2IIVA 1NBEA 2FZLA 2GEDA 1J42A 2FOIA 2WTAA 1ADYA 3FBWA 1BHO1 4DDVA 5C3MA 5CFNA 4FE3A 2XD9A 1QP8A 3N28A 4WASA 4PC2A 4QYMA 3RREA 4H1VA 4C07A 2O5EA 3UAYA 1P9RA 4KQWA 2GESA 4U9IS 4CFYA 2TSYB 7REQB 1DLJA 2NV2B 3WY9A 3I6QA 1QHHA 5FQOA 3V4RA 2A0YA 4HLCA 4J0GA 3INTA 1NV8A 2AN1A 3L93A 3THWB 2Z9DA 4LJSA 4J43A 5CM9C 1JFSA 1L5LA 1D09A 4C89A 3KPWA 1EHYA 3G2MA 5HBGA 13PKA 3FOAA 4M1QA 4B75A 1QUFA 1CJVC 1C1XB 1XROA 3GOQA 5DNVA 1TTTA 3CG0A 3QGMA 1AG9A 1B41A 1UBTS 1G8AA 1TA9A 5HIJA 1G9TA 3D7LA 3JZAA 1ULSA 5JS7A 1FQWA 1DELA 2XB6A 3JD1A 3RF7A 2IOYA 3VZQA 4ISCA 1YKSA 3E0XA 3ROQA 2R8EA 1NVAA 3VO9A 1O0CA 1VLLA 1XDGA 3E2PA 1HDCA 1WKVA 1X19A 4E6PA 1MENA 3SOZA 4L9AA 1KWGA 3HJGA 2QBYA 1JQAA 2D3WA 3OUTA 4RNCA 2UZIR 3L8ZA 1ONOA 2VNJA 4ICIA 5DH9A 1VZ2A 3ZHQA 2MT9A 2W4MA 3B53X 1HMPA 2O07A 2OHGA 4QOJA 4Z7OB 1JW9B 2GZDA 1U8XX 2IYAA 1K0UA 3MK31 4LYFA 1JAIA 5A3RA 2Y6VA 4J49A 1W52X 1ZS9A 1GM5A 1OIXA 2Q46A 3S27A 1E9CA 4QTTB 4DC0A 5KQLA 4IJKA 1R6AA 2ZR0A 5BYJA 4C0HA 3UGKA 4AX8A 5IDWA 2BFAA 3TQFA 4OYYA 1XD2B 3U3MA 1HEUA 4RCVA 4XWAA 3VUEA 4A1FA 1M6YA 1KH1A 1J9GA 2A8YA 1YBHA 2RKWA 3GFBA 2XX3A 4KWEA 1C4XA 1PK9A 2RBGA 1CUEA 4V03A 2L42A 3O8RA 1U9IC 1QCZA 4EBBA 3WGOA 1N7GA 1EFPB 1NMZA 2PQ0A 3HTXA 2ZQZA 1I0IA 1IG3A 3OETA 4L2IA 4Q9LA 5TJ9A 4L5AA 3W0LB 1TF5A 3KIPA 2UYOA 1XLTA 2MU1A 4MCHA 3WMWA 3V4FA 4UM9B 3CUKA 3TLXA 5EE1A 4EFLA 1VI2A 3V6MA 1AOXA 4MYUA 3G0GA 1BU5A 3AKZA 1TU4A 5FRDA 1QOPB 2ZB7A 4FGUA 5HQ3A 1CLEA 1GTL1 2WHPA 1VB3A 1XZEA 4UTPA 2HBQA 1Z0JA 4Q1EA 4RPJA 2YZ7A 1F6WA 2VFAA 1ATIA 5EHGA 2XITA 3LGAA 2PD3A 2WICA 3HVKA 3LPDA 5FKJA 3ZY4A 2XCIA 1E3DA 1SH7A 2FFAA 4R83A 2I7TA 4FFBA 3RHSA 1SVSA 4J0QA 5A4JA 5CDSA 3IEIA 1HFWA 3HFRA 1XMOB 5K01A 3SBXA 4R9SA 2BEKA 5KX5B 4NCBA 4GYYA 1I3NA 4M38A 1OHHA 4TTJA 6REQA 1BYUA 1Z9BA 4L5YA 2OSBA 4TKUA 5B58C 5DCYA 4XRRA 5BN3B 2A67A 4HDSA 3WMFA 1ZI9A 2ACWA 2OZVA 2IIPA 2JF0A 2ZVDA 2FCAA 3NHZA 1X7GA 4GSKA 5AH0A 3MWJA 2XT9A 2I6GA 3QKUA 3V1YA 5GY7A 3WG9A 2AFIA 1HSZA 2ZYSA 2W4QA 2TMKA 5JAIA 5BOVA 3HACA 1ZUD1 3HY3A 1BFDA 1QUEA 1MIOB 5H9WA 4G2TA 3FTQA 2I2FA 5KJCA 1T9BA 1X0VA 4I0WB 5AOVA 4PBTA 3RKUA 2C29D 3IL2A 2BGNA 2V7QD 3Q6NA 2XECA 4TMXA 1KYVA 4C0QC 2QZ9A 2AK2A 1OBCA 3BMNA 4OB7A 1J0DA 4O4HB 1D6MA 5T4BA 1Z6XA 1NQXA 4ZAVA 1Z5ZA 1YFJA 2CLMB 3KPUA 4LXYA 2WUFA 1GNLA 1T91A 2DUWA 4RTOA 1S2LA 4LA4A 4KK4A 4UXHA 3VHLB 1EDZA 2H8KA 2YXNA 3OJWA 3I5XA 1DSSG 3SKXA 4LOKA 1DC4A 3MXOA 2HCJB 4TS1A 1GV1A 2BFCA 1DXYA 3K8ZA 1J1ZA 1VIVA 3PHIA 4PG4A 4DQLA 1P5FA 2RBKA 4K6GA 4F96A 1H4TA 1XJCA 2X8WA 4BRSA 4AKGA 1YGPA 1J8DA 4WJZA 2RAVA 1C41A 3PE4A 4UM5A 4X6UA 2EW1A 2IODA 1DKOA 3K2BA 3F74A 1NLMA 2HSWA 1U7UA 4NCJA 3OOHA 5LU9A 2QIPA 3BGSA 1M8KA 1ETHA 2A6PA 1JAZA 2EQAA 3V8VA 1WUHS 2NTNA 1YQEA 2X5OA 3RWBA 1T5BA 2XXJA 3F2VA 4CM8B 3R6WA 1Z5OA 5F2OA 5JIBA 4AIRA 1XD9A 5G0UA 3VV3A 3ZG6A 2VXOA 2DPYA 4UCQA 1NPYA 4RDXA 1FY2A 2YIMA 5A9TA 3WDSA 3H2YA 3VR5H 3FPSA 4MWZA 1C9JA 1VJ1A 3B1KA 1NMYA 4S12A 2HM7A 1DPGA 4YI5A 2QQGA 2YDXA 2VSQA 3P96A 2E37A 4B5KA 1KF0A 1TDJA 3CKLA 1N32B 3H84A 1JQEA 4K8RB 5FBHA 5CDHA 2W2OA 2AMYA 1ZOPA 5IASA 2AZXA 3U7GA 5F2NA 1F8YA 1YK1A 1XVLA 1Z4QA 4AULA 1UMDB 1OLUA 5TT0A 3NYIA 4KB5A 4HXYA 2DERA 1P4HA 2C2MA 2RHDA 3KLMX 1R15A 2LKCA 1SHZA 1L7AA 3FPLA 1E1QD 1LPAB 4XGIA 4LKOA 3TZEA 3ZK9A 1ZI6A 2QGZA 3LQRA 4BVLA 5LMUB 3BILA 1F60A 4OI0A 1AKUA 2FRVA 3ZI7A 3IUPA 1C3XA 5REQA 1O6GA 1KQOA 3C6BA 4PONA 4YP5A 6LDHA 5CA1F 3A9CA 1UKZA 1IWOA 1QE0A 2WM9B 4ESOA 2FWAA 4C88A 2VDWB 4GLOA 3H2BA 4HPJB 1C3OA 4OLHA 3WIOA 1DG9A 1QWSA 1N2ZA 4XSGA 1YTUA 4RZIA 5CK4A 5TEWA 4AURA 3WYNA 1E2LA 3I9FA 3ZK8A 2WUGA 4OU4A 2GVDC 4MS4B 1OB2A 2BFPA 3CX4A 4ISBA 2GFIA 2F8LA 4IDHA 4A26A 4MCAA 4XR4A 3GF4A 3K5PA 4G8DA 3OWOA 1XB2A 3ZH9B 1ENYA 5HVNA 2UZ4A 4I1PA 4CEJA 3DBIA 3AKEA 4IGAA 3BSWA 4M1OA 3FUXA 1P6UA 2YN4A 1V6CA 2QW0X 4MQBA 3MOGA 4P9NA 4QPZA 3AJEA 3NC0C 1C0PA 1HK7A 4P5EA 1TZBA 4JASB 3K8QA 3GBVA 1KSGA 3RYTC 1H4VB 2I2XB 3LRXA 1Y1QA 3W06A 4D9NA 5KVVA 4MARA 4I6EA 3JWJA 2ADOA 3EYAA 2CF6A 5J5CA 1W5FA 4G4SO 2NTEA 5DMXA 4IIUA 5DU2A 3K32A 4J03A 5T4HA 4C03A 5LM3A 3GFFA 1Q0HA 2GM9A 5FLYA 3RC2A 1CRQA 1EGHA 1HA3A 2PSEA 4CLDA 2BT4A 2CW5A 5JAOA 5BSMA 4DV6B 3U4CA 2V9CA 3RW9A 1QBGA 4G9BA 4POOA 3CKKA 3LPLA 3DZBA 3PX3A 4N4AA 4BP3A 4HTAA 3O82A 3SC3A 2DSTA 3NBZC 4G1BA 3IBCA 4PLWA 2OG1A 5FYDA 4DLRA 1QRRA 4N0EA 4QHTA 1N2EA 1ID1A 4KAFA 4L6AA 1OA0A 4Y2HA 4RF5A 1LBSA 2HPAA 2HLNA 2EBWA 3J7TA 3RG8A 3EGVA 4G41A 2CHEA 5JT1A 5LYJB 1M1NB 4A36A 2F1RA 2WDZA 3BH0A 5CDUA 1FFEA 4YRLA 4YV2A 3B3JA 4NULA 1MB3A 3EMKA 4PANA 5TQJA 3O84A 1WOYA 2XGJA 2CNDA 4OMCA 5LB2A 4LDNA 4PINA 5C7OO 3COVA 4EJSA 1F7VA 3RRYA 2P9EA 5AM5A 2XIQA 3I2GA 4Z4EA 2IHYA 2CKMA 1IC6A 5JI2E 1J2EA 1D6JA 2ZCVA 4J8PA 4J94A 1JU9A 4CQLA 1SIOA 3CUSA 3RSZA 1E1LA 4OJYA 1UK7A 5DYWA 2ZUCA 3GT4A 1G3RA 1JN0A 4K6KA 5AW1A 4AKTA 1GKUB 1L0BA 4WN9A 3GNQA 4JI0B 3KT6A 4P84A 2Y9PB 4DQ0A 1SCKA 2QUHA 3AUXA 3DV2A 1PWHA 2I34A 2B98A 3QOYA 4JL6A 1G59A 2H3EA 1JGTA 1XPJA 2OCIA 2QJRA 2ZP1A 3K4HA 3S2GA 3ZU5A 2ZE7A 4YROA 2FDXA 1IEWA 3MT7A 1PQPA 4I99A 4E5MA 4E5UA 3AIOA 1NXQA 5T8KC 3RNOA 4F38A 3R7BA 2EX0A 1HYBA 1ND6A 4RMGA 4YRIA 1P5RA 3F6CA 3ZH2A 1V25A 4B71A 1BFKA 4CI0B 1V8OA 2XZLA 4R40A 1TCUA 1QIFA 1V41E 2WNHA 1TADA 2O7SA 4GP7A 4ZN6A 2PKQO 1RZRA 2J31A 2W6ID 5HS6A 4G5QA 1OV6A 2FXVA 4D99A 4ZKEA 1WDLA 1WCIB 1SCUB 2H63A 1P1CA 5JAMA 2DQYA 1CPYA 1W4RA 2XVXA 2J5XA 1R2QA 3FYCA 1E2FA 1ZR2A 4X41A 1YO6A 1YVDA 2WK1A 5AW4A 4KSBA 2YWGA 4URVR 2XNCA 1AO3A 1PYDA 4CIXA 4NJEA 5HFJA 1ORDA 4IEFB 3CZPA 3C5WP 3VM6A 3L4KA 3ZDYB 4REQB 4AKSA 4MKFA 4LF8B 2JJMA 1TAGA 4RF3A 2BOVA 3CW9A 4GR4A 1NZDA 1LBEA 4FJ2A 4NKRA 1YRLA 2OFWA 5CD9A 5JD6A 2V6FA 1NE2A 1TB4A 4O4JB 4O4LA 2YH2A 5DX8A 1TM5E 3IPCA 5K0TA 3DEKA 1WMFA 3HY6A 1W96A 4I3HA 4DB4A 4P31A 1L7BA 5HF8A 4IDPA 4N9QA 1UBGA 2NUAB 3LDAA 4K3UA 4LOAA 1M34E 1TRKA 2XKBA 3HCWA 1FXUA 1KQPA 3HO6A 3QEKA 3T7JA 3NHUA 4XIJA 3K0CA 4RGBA 1DJMA 4C4TA 3IAHA 2QMZA 4LXXA 3TFQA 4ZKDA 3ZVKA 1GUYA 2QZ4A 4DG9A 1YMUA 3S2YA 1J99A 2WWWA 2ZJ2A 3STTA 4D0GA 1JU4A 3TN7A 1X7ZB 1RWOA 3BWCA 4XZ3A 1OB5A 3JPWA 4M8NE 4FXOA 4NBSA 1GFSA 2EFEB 2ZRGA 2VP6A 4RACA 1XOIA 3STYA 1OBOA 3S1SA 2WYHA 4D8XA 2QQFA 2WU4A 3NYQA 2G6TA 2V1XA 1ULAA 4E22A 5A0TA 1HV8A 4OAPA 4EY5A 3ZJTA 2BF7A 2ZPTX 3F3YA 1J20A 1IEQA 3GFGA 4LYDA 5C81A 1MABB 1E1KA 2OFOA 1EAMA 1H23A 3R7FA 3WKDA 3MB8A 1AS3A 4W7SA 3UJ7A 4BTLA 5DNCA 4HDNB 3DLPX 1K6XA 3BF8A 2PSDA 2X1VA 1XAHA 2ZSHA 1H8HD 1Y9AA 1ZY2A 2X7JA 2Z9BA 3ROGA 1UEIA 1Y5IA 2E4YA 2R8RA 4J91A 2K4MA 5EFZA 1BW9A 4OUDB 3HXOA 3GEDA 4O59O 1LQ2A 1T8RA 3HYTA 1QE5A 5D51S 4P82A 1CETA 4MMZB 4LIPD 3ZGLA 1F06A 1CUZA 2J3DA 2VAVA 2GXAA 4UFNA 4TMWA 4Q21A 3FTEA 5TC4A 1MAUA 4RUKA 3HA3A 4QA9A 4GXQA 2VJAA 4AG6A 3EQ8A 2JLWA 3CH4B 5CT5A 2VSOA 3G5MA 2ZYGA 4JUCA 4MGEA 2REQB 4UC0A 3FWYA 4J0IA 1UXGA 3QIVA 2A35A 3VPSA 3NHRA 1NW5A 2QN8A 3S2EA 4JVLA 1LK7A 2QWXA 2YW2A 3EHDA 4PLYA 1ORVA 3X2FA 3KV3O 1B8UA 2EX1A 3PU6A 3QY0A 3NH6A 3E9MA 5D3ZA 5HG0A 5C1OA 1HZZA 4J16C 5JQGB 1OU4A 1KNQA 1TO2E 2G3YA 3MQ4A 3D8UA 3D4LA 1PQ4A 4W1RA 1WD5A 2F6RA 2CJYA 3I53A 4C9BA 2YNMD 2FN3A 4IFEA 1K5GA 2CV2A 2A84A 1T5IA 2HCFA 3MD9A 1CERA 3Q5DA 4ENQA 1XXHA 3BEOA 1Q92A 1WG8A 3ASVA 4U8HA 3OLWA 1CQXA 4M76B 4RKYA 4TN5A 3GZNB 1P6XA 5IAGA 2EL7A 3DGEC 3HO1A 1BQ4A 2OGUA 4ZYYA 1C1YA 3MJSA 1LU9A 5EAIA 3VR5A 1QRUA 4DCMA 4TV8A 1ZISA 4KP7A 1PDOA 4AVYA 2PL9A 1D0SA 1X0XA 4UQOA 3RSLA 4TVSA 3IP5A 3RRFA 2ZW9A 4Q3AA 1E63A 3EA4A 3H0CA 4A23A 3LX5A 1ZD1A 4IX9A 4NE7A 4L15A 1NXOA 2C9OA 2PU5A 1GU1A 3ZVNA 2PKWA 3GR6A 3R44A 2OV3A 2IH4A 2AUMA 3NLLA 1ZW6A 1I3MA 2H4WA 2QSJA 3O4IA 1RC0A 3T95A 4BCBA 4A2QA 1U28A 3BIJA 3B5EA 4CV1A 2ZRBA 3SSAA 4JYAB 3EC2A 1VB5A 4JSTA 1VG8A 5CIQA 3GFVA 4B3GA 3V4VB 1P7CA 2XEDA 4KKXB 1C80A 4F3KA 1P4JA 2F7SA 5AHOA 2WUDA 1OVGA 1Q1GA 2IOFA 1GUBA 1UWLA 4IXMA 5BRAA 1K8RA 3VGJA 1LNQA 1F4VA 1O1YA 1U0FA 3O8QB 1QLHA 4ZU6X 4D8UA 2EYUA 1MV5A 3CA8A 4MMYB 2I03A 2WC1A 3KVOA 4XSHA 5DYIA 2FKNA 4NBTA 4YV0A 1G2OA 2JH9A 4LBYA 1ZH8A 4R01A 3LOUA 5AKJA 5CBPA 4WZBA 5MDHA 1NF2A 3V1LA 1F2UA 1NMSA 2OO7A 1E2GA 1J25A 3GHYA 3ELBA 2WTUA 5JC1A 4FI3C 2IOFK 1JVSA 1QIEA 1H6BA 3QVXA 2OGSA 2AC2A 2P9JA 2BF4A 2CLSA 2AG5A 3WKCA 1VXRA 3OWHA 1I32A 4W7HA 1UINA 3T1TA 4N8DA 4FOSA 3MNFA 1K5PA 4RQUA 4LK3A 5ALNA 5BN4A 4MUAA 2DUUA 4F8YA 4PZ0A 5AM0A 3T3EA 3PNPA 4MVCA 2F43A 4XI9A 4FMCB 1B16A 3EEFA 4TTIA 3DZIA 3WQRA 1IPHA 5ADWA 2FN8A 2QN6A 3EYWA 1GD1O 3A8TA 1ORIA 1RKUA 2FPUA 2O0KA 4JIGA 3RD5A 5AVYA 5HOEA 3D31A 1W85A 1XMPA 1Z6ZA 4FYXA 4D3ZA 4I4LA 5AK3A 1UP6A 1BFUA 5BW4A 1R9GA 2KHZA 5JJCA 3QJ5A 4A2WA 5F51A 5JY1A 1UFKA 2BKAA 1X13A 3TINA 2NNLD 4EB6B 5LOVB 2AG8A 1UJNA 1KDVA 5AQ1A 2VXYA 2NSDA 4I55B 4H6PA 4M98A 5T57A 3PFCA 1RJ9B 1R8QA 1TGVA 3UV7A 3DF9A 2QP4A 4DBLC 3AR5A 2NV6A 5CLLA 1WXDA 1P31A 3MSXA 2O8FA 3BWXA 4RYLA 2VIIA 1Z18A 2JFVA 2QQ5A 4TV9B 5CVVA 4CDNA 1WRBA 2NZ2A 3ANXA 2J3EA 4WL0A 4AJPA 4H7JA 3K2EA 1K6IA 3FE2A 1DKMA 2QL6A 2OECA 1KE2A 3PEYA 1TCBA 3EBPA 2X5JO 1XV5A 3EDMA 3QUBA 4FFLA 3RDPA 4HNVA 1DO0A 2NGRA 4DHEA 1DOAA 4JYBA 3W9SA 1EIZA 3WRVA 4AMUA 3OMXA 5KTRA 5TXGA 2PE5A 4J3FA 4PC6A 2AR0A 2VK4A 3NW9A 3Q1KA 4V3CA 1VKRA 1DDOA 1RZ3A 4FGKA 1CS4C 3RLIA 3U19A 4DQUA 2ONZA 1L4GA 1T8WA 1UWKA 3LOQA 4FUQA 1LQUA 4HAXA 4HF7A 4B76A 4DJFC 2PEYA 5HUQA 3TSZA 1E2IA 3DBLB 5EA2A 2YWEA 1XVVA 2ZYDA 1IL0A 2ZRKA 4XYMA 2JI8A 2OMKA 3AY3A 2QVXX 2WJAA 3KXLA 3R6TA 1NW3A 2ODPA 2DPXA 3PA6A 3HP7A 4V0MA 1GGFA 2R79A 5AKKA 5JISA 3AIKA 4M55A 3DC2A 4ER3A 1G17A 1U6KA 1P2VA 1WUKS 2TMGA 3CR3C 3FZNA 4QVKA 4V38A 2UKDA 2YW9A 5C8YA 1FJGB 1TZMA 2Z56A 3R9IA 2O8CA 1HG0A 1ZBQA 4NS4A 3DBVO 3GL9A 3WL5A 4DSUA 3GLFE 4LWQA 1H4SA 1EK1A 2HIHA 1XTQA 4P0QB 5C18A 3EH2A 3UA4A 2IXBA 4P3NA 3WL8A 1LC0A 2JBAB 2MHCA 5FA6A 2QVGA 4RIEA 2FSIA 3LK7A 3GEPA 5CA0B 4AM8A 1OGYA 2A3NA 1VLVA 1W6UA 1SEVA 1UKBA 1E9RA 4GPAA 4V0NA 3THYA 1SC9A 2IEIA 3GDGA 1TA0A 3JD0A 3OFVA 1XCPA 2X8BA 1XR3A 2WDPA 2ZROA 4RWEA 2HX1A 1OZAA 1CULC 3LKBA 4XB6B 4MQEB 2FAXA 3UCXA 5B7PA 1Z0KA 2OD9A 4QUEA 4EL5A 5IT0A 2HK8A 3G89A 3K6JA 2FQXA 1GSOA 3OQBA 2BDUA 1J56A 3LG2A 3UAGA 3ZWBA 3PGA1 4AP9A 5A02A 1EWVA 3KB1A 1U8EA 4LZWA 4CIWA 4CL2A 2PX4A 4H35A 4L8FA 4Z4IA 1U3TA 1DX6A 2GBLC 3BXOA 3E58A 5FUXA 2CF5A 2F3TA 2FF5A 4IBOA 5EVCA 3SZ3A 4RJTA 3ABQB 3ZHCA 3NNDA 3H1GA 3ZHBA 1THZA 1TFUA 3H2ZA 1I3LA 2NYAA 2VATA 4YASA 5BOSB 4CKBA 1ES9A 4RHXA 5BWMA 4YJGB 2W8ZA 3T3NA 1RD4A 3NETA 4EG0A 1UK8A 3JQ7A 4AN4A 1G3MA 3IJPA 4P8RA 5LPNA 1K8QA 1TAQA 3PVCA 2QYHA 5E6SA 4W5QA 4E5KA 3AQIA 4U0JA 5AR1A 5FHQA 1V39A 4FNGA 2NNWB 4J90A 4FGZA 5KDLA 2O2CA 1YV9A 2R85A 1FF9A 3OZIA 1DFGA 3Q3CA 3RO7A 1EBUA 5KJFA 4ZO9A 1P0FA 1R0SA 1S4QA 3DDHA 5DX0A 4COOA 2RGRA 3NXSA 4CMIA 2H59A 2AF3C 1UR5A 2DQSA 4TT3D 2B2NA 3GCGA 3H5LA 3F47A 3KQYA 2O2DA 3ONEA 1D2AA 4EY8A 1FTWA 2R44A 4N5HX 1E7MA 2NVUA 1NJ1A 2L0XA 3QXHA 4WD3A 2NPFA 3RRJA 3SC2A 1Y1LA 3INYA 5C7IO 1V1JA 1FQJA 4JOQA 4RM3A 2WF9A 1Y1RA 4F3YA 2C4KA 2DTDA 1MC5A 1YHNA 3RTEA 4W1SA 2FFBA 2HMWA 2AEJA 4LBVA 4D02A 5A5EA 4OHUA 3TL3A 5L3VA 3OU2A 4JUDX 5G02A 1ZMOA 4X84A 2PX6A 5BSFA 2P1DA 2C3MA 4CV0A 2OBYA 1ZDMA 2H1LA 1I14A 1UXHA 2HSDA 1GPMA 1GPUA 3GEHA 1NSYA 2CHGA 3ICOA 4DEVA 5BY2A 5KNBD 3LLUA 3AKCA 4EUSA 3UAXA 4H17A 4FQ8A 4UZSA 2QG4A 1Y8QA 3HI4A 4FONA 5ERGB 3BKXA 5GVRA 4B6QA 1A4IA 4U2KA 3VNSA 1XT6A 2YYAA 4Y9SA 1TMYA 4Z49A 1BRMA 1SBTA 4DTCA 4TKVA 2RG1A 5HS4A 1WTAA 1JLMA 4CQJA 1WVIA 5KVSA 1YOBA 2DT8A 4ML3A 1MRNA 1FSZA 3OTQA 1KVTA 5E6UB 4ZYUA 4NBKA 3ZKAA 5B55A 1T1RA 6GPBA 5ICCA 5JAUA 3AHCA 1XLVA 3DFUA 4DR4B 2XTAA 1CY8A 3Q2OA 5T64A 3UMRA 1VBNA 1VKHA 3LBIA 5EWLA 4O2BA 2A88A 2VZLA 5T6MA 5E0KB 3DUWA 3VDNB 3VJMA 4GE3A 4A6DA 4P4NA 3AKDA 1IZYA 5EP3A 3WNCA 4DW8A 1TEXA 4XJTA 2WU1A 2R65A 4PZAA 5EP4A 4KX3A 1CZUA 3F6SA 5HIMA 3UB4A 1D5CA 1T35A 2HLPA 3TZBA 2ROQA 1QPGA 5H82A 1I0ZA 2CCJA 5CB4B 5B2FA 3Q8WA 3RADC 4B46A 2FPIA 3PHBE 4XB1A 2P1RA 3OM9A 4BNFA 1W19A 1AMNA 5AK0A 1OYVA 3G7UA 2OHJA 1F5SA 3WGZA 4A2CA 4MP6A 4WQMA 5EXPA 3DYIA 4HDMA 4PSCA 4EENA 3KQKA 1U0JA 3AFIA 3DO6A 3LCCA 3PNMA 4BN0A 4UNQA 5ALFA