4R1UA

Crystal structure of medicago truncatula cinnamoyl-coa reductase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
308
Chain Sequence
DQTVCVTGAGGFIASWLVKLLLERGYTVRGTVRNPEDPKNGHLKELEGARERLTLHKVDLLDLQSIQSVVHGCHGVFHTAPDEMLEPAVNGTKNVIIASAEAKVRRVVFTSSIGTVYMDPNTSRDVVVDESYWSDLEHCKNTKNWYCYGKTVAEQSAWDIAKENQVDLVVVNPVVVLGPLLQPTINASTIHILKYLNGAAKTYVNATQSYVHVKDVALAHLLVYETNSASGRYICCETALHRGEVVEILAKYFPEYPLPTKCSDEKNPRVKPYKFSNQKLKDLGLEFTPVKQCLYDTVRSLQEKGHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
molecule keywords Cinnamoyl CoA reductase
total genus 118
structure length 308
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1uA00
4NI5A 5U1PA 2OXIA 1OC2A 1E5QA 3I9LA 4CM8A 3DR3A 4PG7A 3UCEA 1RKXA 3WGQA 1PSDA 2X9VA 3GMDA 4NMHA 3WJAA 4MVJP 3GDGA 3QV1A 4CM7A 2ZTUA 1PWZA 3MWDB 4BNNA 4HADA 4IINA 3GGOA 1TVEA 2FP4A 4RVUA 1ZCJA 4FIZA 5TC4A 4Q3CA 2Q46A 3FTNA 3QIVA 2IRWA 1RYEA 4K28A 3PFFA 3GC6A 4QUKA 4UVGA 5H82A 5I8ZA 2ZB8A 1LC0A 4H16A 1ZEMA 1D1SA 1PS9A 3T7EA 1GQQA 2C59A 3DAGA 3Q9NA 4UEJA 3I6IA 3ZWOA 4IJKA 3KLMX 2BFAA 1T2EA 2V65A 5CAEA 1P1RA 4B3JA 4E2XA 1JN0A 1EMDA 4BO7A 4PVDA 4OJNA 5MGBA 1M67A 1YB4A 2C07A 2DUUA 4MVJD 1Q0LA 5DP2A 4GSKA 2JFFA 2GN6A 1QYVA 1P44A 2Y93A 2VWQA 3C7DB 2C2XA 1XQ6A 3DTYA 4DIOA 2PZKA 4WLUA 3EZYA 1QYWA 2ZTMA 4DLLA 3RU7A 2EXXA 1SBYA 2WDZA 2J5KA 3BMOA 1BWSA 2E82A 1YE3A 1LBEA 3F4LA 4IIVA 1JKIA 3D3EA 3GAFA 3LYLA 4YB8A 4J49A 4NNJA 1HL3A 2YHUA 3INGA 4TRMA 4NH4A 1ZH8A 3FBTA 1LRLA 3ADPA 2CUKA 1ZUD1 1KY5A 3G79A 3QP9A 1DB3A 3Q2IA 1WXDA 5L7WA 2C82A 1B7GO 1WMBA 5H83A 3RKUA 4D45A 5EMHA 4Q3DA 2DBQA 1NR7A 1X14A 2W2LD 4K6FA 4BNKA 1M6WA 1VE9A 5EQFA 5EERA 4U7WA 1DIRA 2OL4A 3TL2A 3A4VA 4PLGA 1GUYA 5G0TA 4P4GA 3K2BA 3PXXA 1PJCA 2NACA 2DC1A 1ZXLA 4DTIA 1XGKA 2O3UA 1CERA 3TZHA 4BNHA 3L9XA 4R69A 3OA2A 1HF3A 1CEQA 1LUAA 5G0WA 2GD1O 4JP3A 3WDSA 4CMBA 4BNFA 4AVYA 5EQDA 5A9SB 3DFUA 1WDKA 1GQYA 1ULUA 4A73A 5KJ6A 5T8KA 4YA6A 1PTJA 3RKRA 1GZ4A 1U3UA 4NFHA 5IDYA 2UYYA 2WSBA 3ZU2A 4XRGA 2C29D 5L4SA 2PK3A 3UUWA 4LVUA 3BMNA 4XCVA 2ZYGA 3JTMA 4DPKA 3PHLA 3BTVA 1DHRA 1LRJA 3H2ZA 2XXBA 1X7GA 2D2IA 4RVFA 3A14A 2RHCA 3DHYA 3I5MA 3C7AA 3K9QO 1CDOA 3RUIA 4QEDA 1W6UA 3PP8A 1A5ZA 4L9RA 2VRCD 2Y67A 2Q1SA 3FPLA 1ISJA 2I67A 2YV1A 2AQKA 3L6EA 1VJ0A 4JGBA 4II3A 1BW9A 4NZ9A 4L8VA 4YAIA 1VC2A 2EKQA 4DQUA 3V2UA 3BHMA 4NU6A 3CEAA 3RC9A 2FY8A 3PQEA 1Y5MA 1Y81A 2VNAA 4ID9A 4CM5A 2CVZA 4L4XA 1VLLA 1BSVA 1F12A 2IZZA 1JWAB 1U8FO 1Z75A 2GF2A 1HT0A 4ZN6A 1DXYA 3HB5X 4URFA 1IZ9A 3RBVA 5TT0A 4J3FA 2PH3A 2PFGA 4R9RA 4YJGA 1ZVMA 2I9PA 4KWHA 1X1EA 1YOVB 1LLCA 1U7TA 3CINA 3WFJA 1BXZA 2O2YA 4MP8A 3VZSA 4MO2A 1BXGB 4BNWA 2EWMA 4PZDA 3OQ1A 5A9RA 2SCUA 1P1HA 1T25A 3ENKA 4MVJM 4XYMA 3WBFA 2B36A 2VHVA 5JDCC 1YB5A 4OKIA 4W7HA 3OP4A 4E5PA 5B1YA 6ADHA 3ZWPA 4E32A 1KVUA 3GG2A 3AUAA 4XR4A 2QYSA 4J0FA 5A5FA 3LC7O 3PIIA 3UICA 2GGSA 1N9GB 2G82A 1BMDA 4R1UA 1X13A 3PWKA 1EE9A 4CMKA 3N58A 4WNIA 3PFWO 5BSEA 2GRAA 1T1SA 1KEPA 1BGVA 4EW6A 2AQHA 3OFSA 4YJDA 2GNAA 2GLXA 1LQUA 1GEEA 4Y8VA 1IPEA 1UJMA 3BYZA 2YJZA 4IZHA 4PCVA 4ZQBA 3I3OA 1DHTA 2B4QA 4XKJA 3OBBA 2BH9A 4YAEA 4IUYA 1HDRA 3F46A 1IY8A 2AEFA 1HZZA 4Z9YA 3WNQA 3WYEA 4BO5A 1CWUA 4YYZA 3PQDA 5JC1A 5HWSA 1GZ6A 1P0CA 2PGJA 1HSOA 1YQGA 1ZMTA 5JS6A 1L7EA 2NNLD 3WWYA 2OOSA 2HMTA 2XXJA 2UUOA 3RBZA 4CR7A 3ZV6A 2D8AA 3NAQA 4L4RA 4OYRA 3B1FA 5JO0A 3MJEA 3DBLB 4CODB 1XIVA 5DOVA 3QVOA 2FR0A 4M1QA 1CJCA 3K2EA 3CUKA 3WQSB 2O3RA 1KBZA 2I3GA 2YV3A 5IN5A 3F5QA 3VH4A 1E5LA 3U3XA 5L51A 4LVCA 4R5HA 4LRTB 4TVOA 4WOJA 1YL5A 4BHTA 5IZCC 3H5RA 4RPHA 3PYLA 4QT0A 1ULSA 1T26A 1YJ8A 1Q0QA 3NDRA 3CZMA 2Y1GA 4B4UA 4PRKA 4BS9A 3DMYA 2DT5A 4UULA 4IPTA 3HFSA 5C3MA 4JP2A 5ICSA 5JYDA 4CMAA 4C4OA 1HE3A 2NU8A 2OBYA 1QXSA 2TMDA 3FF4A 4BMNA 3DEYX 1NHGA 1CQJA 1U2GA 3I6QA 1I33A 2YQ5A 1IULA 2W8ZA 1O9BA 1PL6A 1DOHA 1DRUA 2G76A 4IS3A 3MJVA 4WCFC 3STHA 4CQLA 4BGUA 3G3EA 2DBVO 4FFNA 3TRIA 2G1UA 2V6BA 5JMPA 2JCXA 1WLYA 4I5FA 1QRRA 4NFYA 1LEHA 3NKLA 4J1TA 1UP6A 4NFSA 3JQGA 3BAZA 3EY4A 2C20A 3S2FA 3K6JA 5A3VA 2VUUA 3L77A 3ABIA 3RFXA 3ZW9A 5JNLA 4N5NA 1U4SA 4NPCA 3U4HA 4WKGA 5IF3A 2PKRA 2CD9A 3DMTA 4OM8A 4RQUA 4YT5A 1MC4A 1M66A 3PQFA 4MINA 4J4TA 3ROKA 3ZNNA 4GX2A 3PZRA 4ZVVA 2IYOA 3G1UA 3MTJA 4Z0PA 4PG6A 2PGDA 2IXBA 4TRRA 3ZU5A 3AM3A 3RAJA 1E0DA 3HHPA 3OSUA 4Z0HO 2C5EA 2QRJA 1ML3A 4QX6A 3WSWA 4KOAA 1ISHA 4YWJA 1D7OA 3H8VA 5ENVA 2YHIA 3I4CA 3TOZA 3OIGA 1KC1A 1Z7BA 3WGHA 2X5JO 5BT9A 4EJ6A 2OGUA 2HLPA 2PGLA 4I9HA 5JPIA 5L9AA 4DYVA 4BOYA 3JQAB 4CPDA 4IDFA 2Z1MA 4I1IA 1HE5A 3DONA 4E4YA 3S55A 1LDEA 3VKUA 3ITDA 5L7TA 4TRNA 4FFMA 4CLXA 2GCGA 3TQHA 5A3JA 4XIYA 2HSDA 3WX0A 5G0SA 3ZV3A 2QX7A 1I32A 1HWYA 4HWKA 4MIOA 1D4FA 1H93A 1ZJYA 1UDBA 3O9ZA 4YT4A 3EMKA 4J7XA 3VHRA 4UAGA 5ICMA 2WE7A 1LDGA 3D5TA 3Q2KA 3W4IA 3M6IA 3W8FA 3WR5A 4IIUA 3QSGA 5CG2A 4UVHA 2CZCA 3CH6A 3JQ9A 3ZWAA 2OFPA 3KV3O 1X7HA 1N92A 2HK9A 5BNFA 3GVXA 5AQ1A 4J7UA 3RD5A 3GOHA 4LSMA 3WQQA 3KB6A 4CMJA 1NR1A 2Y1CA 2X8LA 1GY8A 3JSAA 2Y1FA 3WJ7A 1AXEA 3GG9A 4TKLA 4CMGA 3SBOA 5COBA 2Q1UA 2DTDA 2OP0A 2VYNA 1T4BA 3FD8A 3CZRA 1E7YA 1E1LA 2AHRA 1SC6A 1Y9EA 4DREA 1GEGA 3DC2A 2GASA 2Y68A 2VZ0A 3KXDA 4BQPA 2AE2A 3NUGA 5I7EA 3JD1A 2IXAA 2B37A 2JFHA 2JJYA 4A7PA 1PJ3A 3EDMA 4I08A 1R66A 3JQ6A 3E03A 4UEKA 1HDCA 3AOEC 3H9JA 1NPDA 2FHSA 1YOVA 1WMAA 5DN9A 2GPTA 2P68A 4R5MA 2BMAA 3HG7A 4WOKA 4ALLA 1IHYA 4CLOA 3R1IA 1J6UA 1PR3A 4JLWA 4B8ZA 1DLJA 1JU9A 1HZJA 4YJFB 4EGFA 3RBXA 1LXCA 2I65A 4M86A 4D3DA 5BNIA 2J5QA 4O59O 4XQEA 2DQ4A 3JQ7B 4EZBA 4Z3KA 2EJWA 2CVQA 2QRLA 4WEQA 4W9NA 3ZNPA 3JQ7A 1PQPA 5A5EA 1XDWA 3S8MA 1UXJA 3IL2A 5L4LA 2X0RA 1G6KA 1PJQA 1DJQA 4FPXA 1XU7A 1V35A 4ITUA 4FB5A 1TI7A 2Q4EA 2NV6A 3VVCA 1HTBA 4B4WA 4YAGA 3DOCA 5KJEA 4E5MA 3WLFA 3DBVO 1Y7TA 4ALNA 2HO5A 1PJTA 1V3UA 3M2TA 4B7UA 1LTHR 3GVHA 4TWRA 4UUOA 5TX7A 3F1KA 2P9EA 5DBGA 4FC7A 4WCFB 4AJLA 2EEZA 3AJRA 3WIEA 5THKA 1I30A 3ONDA 3QWAA 4DC0A 1EZ4A 3ULKA 3U62A 2X22A 3SC4A 4HUJA 4RPLA 3C1OA 2I99A 3D4PA 3QJ5A 3WMWA 3Q3CA 2NTNA 3EVTA 1H6BA 2X7HA 1NFRA 4MKZA 4ZGWA 4TKMA 5TS3A 2ZATA 4RVHA 2O3TA 4DPMA 4UVDA 1XHLA 1YO6A 1W4ZA 4FJ0A 4ILKA 1ENPA 4YEDA 5B37A 2PY6A 4LMRA 3KOUA 4YCAA 4M54A 4FDAA 4KUGA 5DDIP 4MP3A 3ZU4A 4G5HA 4A26A 5BNTA 3DOJA 1LLUA 4HFMA 4Q39A 2GN8A 3CMCO 4W9NC 3JD2A 3UCFA 4L76A 2I66A 1E1KA 2LDBA 1B16A 3FWZA 1MFPA 3BXXA 2NTVA 4PGFA 3A06A 4XGKA 3INRA 3TF5A 4A10A 4OSOA 4S3MA 2C7VA 1FMCA 5A04A 1K6XA 4BIIA 1QKIA 3MOGA 3S2IA 1FDTA 2W4QA 5TJ9A 3VH3A 2HAEA 4CV2A 4PIVA 4LMPA 1MP0A 4CQMB 2O3QA 4TZTA 1DJNA 7MDHA 4NJOA 1DFGA 1J0XO 3BMOB 2AG8A 4YXFA 4FGWA 2O3JA 1RPNA 2VN8A 5IAAA 3HWRA 1Z73A 1PGPA 2P9GA 4ONEA 1PL7A 1SOVA 3TOXA 4E13A 5JDIA 3P7MA 4TVBA 3WIDA 3UAGA 2CDBA 3ONEA 3PK0A 2X6TA 2B83A 3R3JA 1LSSA 2Y0DA 3GK3A 5EINA 4XB2A 2GDZA 1K5HA 4IDGA 2AEJA 4FBGA 4BVAA 1VI2A 4XJSA 4PZEA 1V6AA 1FJHA 3G49A 1MX3A 1M76A 1ZMOA 2BGKA 2AMFA 3MJTA 4FGSA 3ZWMA 2EF1A 4DRYA 1P1IA 1KERA 5TQVA 1I5RA 3W1VA 5HTOA 4GVXA 3DAPA 1WDMA 7ADHA 3PJEA 4OH1A 1HDZA 3ZH2A 4WLOA 4ZA2A 1XG5A 3U4DA 2QZZA 4Q3EA 3OJLA 4B4VA 3CIFA 1TB4A 2R00A 2Z5LA 4W7IA 4AJEA 3ZHYA 1VM6A 5I7VA 3RIHA 1E92A 1WNTA 3GZ4A 1OI7A 3OIFA 4I5DA 4ROSA 4BNYA 2PR2A 2X4GA 4PVCA 4J1QA 3ZZNA 4O5OA 4B3HA 2RHRA 4E3ZA 3OIDA 3C1TA 4WEOA 2Q49A 2Q99A 3TFQA 4O6VA 5FWNA 2YZ7A 4WCFA 2FN7A 1DC3A 2OMEA 3QLJA 1R15A 3LT1A 3QVSA 3N7UA 2FSVA 4YJGB 1TT7A 1LI4A 3GAZA 1Q1NA 1IL0A 3L6OO 4KDFA 4RL6A 5A03A 3DB2A 3WFIA 4JCOA 4UVIA 4ZRNA 4BO4A 1E7MA 5TGDA 2X0JA 4JK3A 2ZB3A 3C24A 5F21A 3W4JA 3GLQA 3K30A 3LK7A 2HMVA 3IAHA 4D3SA 3AK4A 3LVFO 2BF7A 4NJMA 3VZPA 3Q1LA 1DC4A 5JAMA 2Y1DA 1ONPA 2Q4BA 4R3NA 4JJFA 3WGYA 4HFJA 5KOIA 1SB9A 4CMEC 4M89A 1QORA 2WJPA 1K2WA 1X1TA 3OECA 4RZIA 4DIBA 4FS3A 1NQ5A 3JQDA 2PD4A 3C3XA 1P0FA 3W8EA 4GH5A 2X5KO 3EGOA 4HFNA 3MJ4A 5FF9A 3H9EO 4RGBA 4AJIA 2AE1A 4LRSB 3WB9A 4A5OA 1NFFA 3ANLA 4MIEA 4CR8A 3BTSA 2YDXA 3HN7A 3DO5A 1Z7EA 4CR6A 1AE1A 1PZGA 2RH4A 3JYLA 4DLBA 3SLKA 1QV6A 4ZQEA 5G4LA 3WNVA 1QYDA 4CL3A 4BO9A 3ROQA 1RJWA 3OQBA 1O0SA 3QWFA 1A7AA 3VTZA 1LSJA 4GGOA 1Y6JA 4CLRB 1P74A 2A92A 4QQRA 5CEJA 3A28A 3OF2A 3HZZA 3KSDO 5L95A 2JHGA 3AUTA 2JL1A 3IOYA 3DDNA 3WG9A 3H9QA 1HLDA 3EZLA 3G17A 2AW5A 2DUWA 2NU7A 3GVIA 3O8QA 4Y6SA 1MC5A 1GU7A 3AY6A 3V1TC 5F1KA 3DHNA 2D4AA 1X15A 5DBIA 1PS8A 3RASA 2C5AA 4E5YA 1ISMA 1NP3A 3GDOA 5L7YA 1DIBA 2NU6A 1C0LA 2VHZA 4W6ZA 4BNUA 4NBWA 3JQAD 2CF5A 2AQ8A 4GKVA 3DQPA 2WYUA 4J7CA 4Z9FA 1GUZA 1HE4A 1T1RA 2JCYA 5ES3A 4IMPA 1FXSA 4A0SA 4WJZA 3RUFA 2A9FA 2W90A 1I0ZA 4EJMA 1KEUA 3PYMA 3ZWWA 1I8TA 4DWVA 1JA9A 1GPDG 1H2HA 1XA0A 4Z6KA 3HFGA 1IE3A 1EUCA 5HRUA 1U5AA 3U9LA 2DLDA 1HYEA 1KYQA 1DIGA 4NK4A 3ONFA 4CUKA 1F8GA 3NJ4A 1X0XA 3ST7A 3K8ZA 1WZEA 2HCTA 1B0AA 4NBTA 4BB6A 3S1LA 5IDWA 2E4AA 3JQ8A 1LDBA 3NTRA 1Y8QB 5TRTA 2P5YA 1NVMB 3JYPA 3JQAA 2XOXA 3HB4X 3F47A 5GMOA 5K0ZA 3RVDA 1A4IA 1N7HA 1Z45A 4OSPA 1I24A 1IHXA 1DRVA 1WAMA 1CF2O 1MA0A 1U4OA 2DPHA 1MUUA 1LC3A 4PG4A 2YHIB 2Y99A 1OBFO 1YQDA 1ORRA 1Q0HA 1ZBQA 2NADA 5A9TA 3AY7A 4PLPA 3GFGA 5JYEA 5JAQA 3V2HA 3OICA 1EBUA 1ZW1A 4BUCA 1ADBA 3TL3A 3G0OA 1Y8QA 4UUNA 2WEKA 1YGYA 4GL4A 2C0CA 3AW9A 5EPOA 2OBNA 5DCYA 3OJFA 2UUPA 4J91A 2UAGA 1GFSA 2NVUA 1T2FA 3BMNB 5G0UA 3ZN2A 1UXIA 1N2SA 2PZMA 4E5NA 1DIAA 1R0KA 2UV8A 2B5VA 3GRKA 4FFRA 4DBZA 4OGWA 4CLDA 4E6PA 1GUFA 1YBVA 3ENNA 4LCJA 2Q45A 3DZIA 4ND3A 1JAXA 1NVGA 1XLTA 1SNYA 3A1NA 3HE3A 3FHLA 4BNTA 4BNLA 2OO5A 3P2YA 5GZ6A 2OHXA 1R16A 3AFNA 5A4DA 2O3SA 2H1SA 1DPGA 4FN4A 1GL3A 3IUPA 2BFOA 4MKRA 3AI3A 4D79A 3BTOA 3UN1A 3E9MA 4MVJE 3ROPA 4NQZA 4FCCA 1ZK2A 2POQX 1O89A 1Z82A 2DKNA 4HNHA 4N5LA 4XEHA 5JC8A 3WTBA 1NBOA 3NV9A 4B79A 2E48A 2VYVA 3A9WA 3BMCB 2WE8A 2JFGA 5GZ3A 4D44A 2HMSA 3D3WA 2QW8A 3O03A 5T5QA 3H3JA 1E3JA 4NBVA 2E6UX 2J3JA 3PTZA 2ZYDA 4W4TA 1NQOA 4J1NA 4ALMA 4QFCA 1L1FA 4LK3A 5AVOA 1NYTA 1UZLA 4XQGA 4YT8A 1PZHA 4IGFA 1NX6A 3I9OA 2F1KA 5A05A 3WGOA 4AL4A 2D5AA 5EN4A 4WGGA 4WPGA 4OOFA 4EUEA 2DM6A 3EHEA 2TMGA 4MVJG 4RLHA 3PYXA 4BGEA 3O38A 2A35A 4JROA 1QYCA 1ZSYA 4NJMB 4ALIA 4E2WA 5B4UA 4GX5A 2ZJ1A 3V8BA 3EAGA 1XSEA 5ER9A 4F46A 2W2LA 1R12A 3TFOA 4K9DA 3PHHA 3LC2O 3RI3A 1I2ZA 1V3VA 3W6UA 5ITVA 1YQXA 4BKQA 1YONA 1MLDA 1U3VA 3RUEA 4WK6A 2X86A 5JAIA 1B3RA 3P2OA 3M2PA 4FW8A 3U4CA 3QVXA 4GPD1 3P19A 1J4AA 1E3SA 3IKTA 1ADCA 1FF9A 3EC7A 1DBVO 3QWHA 4IJWA 5T57A 3NDIA 4AJOA 5FFFA 2DU8A 1M6HA 1KEWA 1GD1O 3ZHXA 1DAOA 2DAPA 4Y6RA 1AHHA 3U5TA 1HSZA 3IP1A 3L4SO 4GGPA 4IM7A 3UKOA 3F5SA 4YACA 2VWHA 1AXGA 1H6CA 1NAIA 4CM8B 5G2OA 1M75A 2NQ8A 3IUSA 5F1PA 3DZJA 1KY4A 3SX2A 4FOOA 1GCOA 2DVMA 4DPLA 3JYQA 1NWHA 2H9IA 2D3TA 2J8ZA 3HDQA 3ZDFA 1N5DA 3QRWA 1HYHA 4BMSA 2EIHA 1XR3A 4XQ9A 4A03A 3TZCA 4E33A 5BSHA 1CQIA 1H6DA 1R0SA 1I10A 1QG6A 5CDGA 1H2BA 3V5NA 3ZNQA 1UZMA 4IQ0A 5JXWA 1VPDA 4L4SA 1Q7CA 1NQAO 2PD3A 4LCEA 1JQBA 5JO9A 3D1LA 1C0KA 3FNFA 3GGPA 1R4MB 3ANMA 5DZSA 3UW3A 4YT2A 5EIOA 4BO0A 3B20A 4UVEA 2PV7A 1E3WB 2BRUA 3QVWA 4I9NA 4J6FA 3JD0A 3LF2A 5HA5A 5BSGA 1NAHA 4RF2A 1G1AA 1ISIA 1JKJA 4F45A 2EG9A 1B15A 5U9CA 5F5LA 1DC6A 5FEUA 4I9UA 3RUAA 1VKNA 2ZTVA 1C14A 4DXHA 1UDCA 2OUIA 3D3WB 1ZK1A 5C7IO 1CYDA 2UVDA 2VYND 2WD7B 3PIDA 4FOSA 5A9SA 4H3VA 3C8MA 1Y5RA 2GO1A 4ZJUA 1X7DA 4FFPA 2Q1TA 4BO2A 1V8BA 2GN9A 1V3TA 2D0IA 1GV0A 1A4UA 3GF4A 5DOZA 5LC1A 1HETA 1PIWA 1DIHA 4YDRA 3BA1A 4ND1A 3JV7A 3KZVA 2EERA 3H9UA 1F0YA 4R51A 3BTUA 1H94A 3UXYA 3O8QB 3QW2A 3DMTC 3L07A 3D4OA 3GH3A 2DBRA 1E7RA 3GY0A 4OXNA 1PZFA 1ENYA 1LU9A 1ONNA 1EEHA 1XQ1A 3ZWNA 4UREA 1IB6A 3EK2A 1LSOA 4F6LA 4OKNA 3VZRA 2JCVA 1YBMA 4M49A 3WQRA 2VT2A 4DGSA 1DO8A 3PPIA 2I76A 4FQ8A 3E5RA 1GYPA 3O4RA 3IMFA 1YL6A 2NU9A 3VPSA 4B4OA 1XELA 1EQUA 3PJDA 4Q3NA 4NR0A 1XU9A 2PH5A 1I3NA 3H9GA 1N7GA 4OL9A 1UP7A 4O63O 3DZBA 3ANNA 2G0TA 3NT5A 5I9LA 1GYRA 4N7RA 3SEFA 4BKRA 1YH3A 4OQYA 4N18A 1PL8A 3SJ7A 4FC6A 2E49A 4RF3A 4XJTA 4RV9A 4BKOA 4CV0A 2ZJ0A 1UH5A 3EVNA 3WXBA 3RSHA 4AFNA 1C1XA 1HDGO 4R3WA 2WWRA 4G81A 5JCJA 3WS7A 1YDEA 4IXTA 4ZD6A 2QRKA 3BZUA 3I9NA 5KJFA 1LDMA 1ZKMA 4KP7A 1NQTA 1MG5A 2JD2A 2NSDA 3DWFA 3NX4A 4OAQA 4BV8A 4CLOB 4IMRA 5JY1A 2J3KA 5C37A 2WTBA 4TROA 4XYLA 5TSDA 3GEMA 4OMUA 4U6QA 5K6AA 4RPKA 3FNGA 2FSSA 4CLEA 2C2YA 1B8VA 3ZWBA 3ICPA 4R01A 4XQCA 4KTTE 1EDOA 3WSVA 3FPCA 4EEZA 4J4BA 4S1VA 4K6CA 2PTGA 4CV1A 3AM5A 3IC5A 4EITA 4EUHA 1JW9B 2ILTA 5ITWA 1PR9A 2FZEA 1ENZA 4RDHA 5DF1A 1JTVA 3VDQA 1GQ2A 4WECA 1I2CA 1SB8A 4Y6PA 3LSYA 1EK6A 2OZPA 2Q50A 3GEGA 2AXQA 4IBOA 5I8WA 2HDHA 3MOIA 4D3FA 1ISGA 3AI1A 2EGHA 3PLRA 3AM4A 3JD4A 3EUWA 1N1GA 5F1OA 4YJHA 4K26A 1DFHA 4LW8A 4XGNA 2DPGA 4JBIA 1M2WA 2EJVA 1P77A 1E3EA 2ZKLA 2Y1EA 1QV7A 3U09A 3UCXA 2X23A 3S2GA 1ZSVA 2EV9A 4AJPA 4IDBA 3AOEA 3COSA 3GHHA 1ZXBA 4RLSA 1X0VA 2Q2WA 1ISFA 5JDCA 5AXAA 1PEDA 2GN4A 1TT5B 2VHWA 3L4BA 2VOJA 3V1UA 2PZJA 3E48A 1HE2A 1TA4A 4RQTA 3VC7A 2IDZA 3LLVA 3RROA 4K1LA 2X9NA 1EVYA 3T4XA 3GQVA 3L6DA 5CDTA 1D1TA 1F14A 1PQWA 3DOOA 4AJ2A 5L3ZA 5CDSA 3ZHBA 1PJSA 3IJRA 3DZHA 3KUXA 4MIYA 1E3LA 4J1SA 1EBFA 4CM3A 4CQMA 3P5SA 5IXYA 4RCVA 4XR9A 5T6BA 1YL7A 2AG5A 1PGOA 2AA3A 1I3MA 1S7CA 1SOWA 4OIMA 1BXKA 3FCOA 1VJ1A 1KVQA 3UFXA 1PGQA 5T8KC 5ADHA 1PQUA 3NDJA 1EVIA 2BFMA 5B12A 4WNCA 3ZI0A 3KO8A 2G17A 5KKAA 2YDYA 3H7AA 3GMSA 2Y0EA 2YUTA 2IEDA 1LLDA 2Y1OA 2Z95A 1H5QA 3GZNB 3PJGA 3MTGA 3AUSA 3DBRB 5KKCA 4R68A 3OEWA 4CV3A 4OO3A 5EJ2A 4GI2A 1E6EA 3ADOA 3FSRA 4ZQHA 4BNGA 2FPGA 1P45A 3L4BC 3UHAA 5KVSA 3ASVA 2EGGA 4D42A 3JD3A 2PA3A 1KVSA 4HX5A 4XYBA 2Y05A 1VL0A 4GMGA 4GVLA 4L73A 1NM5A 3OJOA 5TJHA 4RDIA 5JCXA 4TMFA 4YBZA 3CXRA 1C1DB 4BKPA 3TDKA 4U6SA 4MVJI 4XDYA 3W8DA 1DRWA 3LLSA 4EJ0A 3ITKA 1W0CA 2VZ9A 1GV1A 4CMIA 3RFVA 4B7XA 2RH8A 4MP6A 1H6AA 3UF0A 1AUPA 4QSMA 1QMGA 4GBJA 4KUHA 1HLPA 3WYCA 4EUFA 4JXKA 1CRWG 1W73A 3GUCA 3U49A 2PKQO 1QR6A 4XX0A 3F9IA 4IJVA 3E9QA 3WGGA 1NWCA 3H5AA 3TZ6A 3VOSA 3ZGYA 1PGNA 1KVTA 3E18A 5LDHA 5A06A 2E37A 1YB1A 2IEBA 2VQ3A 3DAFA 4ZRMA 3FR8A 2VYVD 5H81A 4BGIA 3AOGA 1OC4A 1P3DA 3T4EA 2B0JA 1C0IA 4Z3DA 1KETA 4Z0TA 3KVOA 4DMLA 4ZICA 3MJCA 3PDJA 3D5QA 4CM6A 3WLEA 1A9YA 1F8FA 3C85A 5CPBA 1SCUA 2XF8A 2GERA 1N1EA 2B4RO 3IDSA 4AJ1A 3AWDA 1YBAA 1GDHA 2RBEA 2FZWA 3BMQB 1OZAA 2CF6A 1E6UA 1PJ4A 3JQFC 4CUJA 3HADA 3WWZA 3LQFA 5DCUA 3E8XA 3IS3A 3U4IA 4NG5A 2HMWA 5CPFA 1PZEA 4OXKA 4DUPA 3OJEA 3PGXA 4MKXA 1MGOA 4DIFA 3ETDA 2ZB7A 4LGVA 4YVFA 3CPSA 3RQSA 1VL8A 2BI8A 1T24A 2VCYA 3NTOA 4W82A 3RU9A 4M55A 1YRLA 3RJ9A 1A27A 4JNKA 2IYPA 3OHSX 4D0RA 2QHXA 2YQ4A 4JBGA 4PLZA 2H5LA 2ZK7A 4IDCA 3WMXA 3QHAA 2X1HA 2QYTA 3FTPA 5IG2A 4DMMA 1GR0A 3DHEA 4DVJA 1B2LA 1E1NA 5TF4A 3UH1A 4M8SA 2P4QA 4CM9A 5J23A 5EESA 1EQ2A 4E5KA 2ET6A 5TT1A 2ZTLA 1QP8A 4DQXA 3CSDA 4CM4B 5CFZA 5CP8A 4RJTA 3TNLA 3PWZA 3GN2A 1Z74A 1ZEJA 4N5MA 4CLRA 4JQCA 1Y1PA 3SLGA 3FN4A 1HDOA 2HJRA 5KIAA 1T2CA 3LT4A 2O4UX 1EUDA 3S2EA 4GQAA 5JY6A 1EE2A 1U1IA 3GNSA 3I52A 2NVBA 2YV2A 4BO6A 5IXSA 1D3AA 3Q6IA 4GSLA 1LNQA 4MPDA 3VTFA 1TXGA 4KQWA 4UEOA 4CM9D 1IZ0A 4CQMD 4YAKA 3E1KA 1BDMA 3UVEA 5BSFA 4IY1A 2VOEA 2EP7A 3Q9UA 4R16A 4IXWA 4BKUA 1S6YA 4IDEA 1FK8A 1Y8RA 2VHYA 4BNJA 2VTEA 2B5WA 5C5IA 2EW2A 2D5CA 5DT9A 2X9GA 1XEAA 2DBZA 4DL9A 5A02A 3FBGA 5AXDA 3FNEA 1BW9B 3LZ6A 3O26A 2GUGA 1NTOA 3TZQA 1UZNA 4J0EA 4OQZA 4YJFA 1JLLA 3U0BA 1P31A 4J43A 4YTEA 9LDBA 4Z9XA 1B8UA 3VH1A 2GZ2A 3DZFA 1WDLA 4NIMA 3TN7A 1XKQA 2V6GA 1DAPA 4YRDA 2EP5A 1MG0A 3NYWA 4BNZA 3VH2A 2WYVA 1WW8A 3B70A 1AN9A 4CMIB 3AU8A 3KYCB 5IJZA 4C7KA 4A27A 3HQ4O 4NHEA 3ZW8A 1IUKA 2O23A 4IJUA 4I8XA 4AJKA 3MEQA 2QIOA 1E7QA 2BELA 1G0OA 4HP8A 5C7LO 1ZO8A 5DCWA 4BL5A 3GFBA 4AJHA 3ZU3A 1U7HA 2CVOA 3GA0A 3GHYA 4XGIA 1HYGA 3ETEA 4IGEA 4AJNA 2HU2A 2X5OA 3OEYA 3PEFA 3V2GA 1LJ8A 4HV4A 1EDZA 2O7SA 4QO7A 2FR1A 2NUAA 1K6JA 2YFHA 3KLPX 3I4FA 3R0IA 1EUZA 3SXPA 3AFMA 3GUYA 4BO3A 2CFCA 2IZ0A 3ZWVA 1JVBA 1ID1A 2PWZA 3R3SA 3WOHA 2ZB4A 1I3LA 5ILGA 1YS4A 2X58A 4EDFA 2JAPA 3AUUA 3JQCA 4FD3A 4H7PA 2PKQP 2I6TA 4GLLA 4OHUA 3ZWYA 4IQ8A 5BQFA 1RYDA 3JQEA 5AOVA 1EVJA 4P22A 5I7SA 5JLAA 4D43A 2IZ1A 3CMMA 3CE6A 2P91A 4RVDA 3UGKA 2ZCVA 1Q7BA 2GZ3A 1IPFA 2Q1WA 3GGGA 1DC5A 1OFGA 1E1MA 1H0KA 2BD0A 3DBLA 4J16A 4EI2A 2O48X 4ND4A 1J49A 4B8WA 1E7WA 1UXHA 2BFPA 4HFRA 1PJ2A 2XPCA 4L0QA 2HQ1A 4E2ZA 3GR6A 2Y0CA 4U0JA 3T7CA 3RUDA 3DBHA 3Q0EA 3H3FA 2HK7A 2VWPA 2ZQZA 2NWQA 5JW6A 5L53A 3HSKA 1Q7GA 1NNUA 4PLFA 3LC1O 1YDWA 3D64A 4XB1A 4XYEA 2P5UA 5GZ1A 1N8KA 2PLAA 2XAAA 3QQPA 5HM8A 4P38A 3K96A 4E21A 2YY7A 1VSVA 4NU5A 3HNPA 1EK5A 1KIFA 1ADGA 4P4NA 3I9JA 1I2BA 1ZK3A 2J3IA 2CDCA 3L9WA 2NLOA 1E3IA 4GX1A 2DFDA 1ADFA 5KNLA 3X2FA 4IDAA 1V9LA 4ND5A 1G0NA 4YJHB 2VRCA 3PJFA 3ROMA 3WTCA 2WMDA 3BIOA 3QWBA 4PLYA 2YW9A 4FSHA 3ASUA 4N54A 5L40A 2O4CA 2DTEA 3RWBA 3VPGA 2OP1A 1L7DA 5IDXA 5AXCA 6LDHA 3OQ6A 3MJSA 4FR5A 1V0JA 4E0BA 2F00A 4KWIA 3K92A 3JQGB 8LDHA 4E2YA 2V7PA 4MDHA 5K9ZA 1SO8A 3DZGA 5CG1A 2JD1A 5K6AC 1NHWA 3IQDB 5HS6A 4QTZA 5I9MA 1BRMA 4PLHA 3M1LA 4TZKA 2VNSA 4OOEA 3K5PA 1F06A 2GZ1A 4BNXA 4TRJA 4ND2A 4AJJA 4ZQFA 2FPIA 3C1AA 3ON5A 3KTDA 4HNGA 4BO1A 3HJAA 3RUCA 4CQLB 1ZK4A 1ZZEA 4EBFA 3RC2A 4WLFA 5TNXA 1HKUA 1PS0A 3HDJA 3W6ZA 1A7KA 4J90A 1GCUA 3OM9A 1YKFA 4KZPA 2Q3EA 2W2KA 1VSUA 4QFDA 2Q2VA 3G1TA 4H15A 4Y9DA 4F6CA 2VTDA 5CDYA 4KDEA 3KEOA 4HY3A 4NDNE 4JN6B 3PHGA 2NVWA 5DP1A 3SC6A 4XZ3A 1EFKA 1T2AA 1UR5A 1TLTA 2YYYA 3I9MA 2W2KB 3C7CB 5FI5A 1PX0A 3KBOA 1U3TA 3GVCA 4PZCA 5I9NA 1ZNQO 1U5CA 3FI9A 3KHUA 1LX6A 2FR8A 3NGLA 3PHJA 2P9CA 3GVPA 3OA0A 4WUVA 3ETGA 5JDIC 5F3RA 1IOLA 2I3AA 1O6ZA 4CMCA 2OORA 5IFLA 1EVZA 5HS4A 4DQVA 3RC7A 2D1YA 1YWGO 2H6EA 4C7JA 3B1KA 4DA9A 4J4HA 4DC1A 5I7FA 4M87A 3I23A 3W4KA 3DXFA 2WD8A 2P4HX 4D46A 2Z1NA 2NM0A 4LSWA 3TPCA 4XA8A 2HUNA 3PDUA 1MXFA 1VKOA 3RJ5A 3N74A 2HJSA 3TSCA 3WICA 1NFQA 4HXYA 1WZIA 4RF4A 3H65A 4FJ2A 5T64A 4PLTA 3PVZA 2FPPA 1NXQA 1AGNA 1KVRA 4I5EA 4IDDA 4J9UE 3LDHA 1UXGA 2FRDA 1N9GA 4GMFA 4Q3AA 4Y67A 3GRPA 4MOWA 4XDZA 4PRLA 3FWNA 1BTOA 3K31A 1DFIA 3GN1A 5BR7A 2WD7A 5JFOA 2R6JA 3JQBC 1A72A 1T4DA 5COAA 5KCZA 4PG8A 5B4TA 1ZIDA 3E82A 2BLLA 1I36A 2ZYAA 5G4KB 4BO8A 4CL8A 4CUZA 3PLNA 3JYOA 5G0VA 1R0LA 5COQA 3DBHB 5DNAA 4WCDA 1NPYA 3OETA 2VUSA 4BNVA 2VT3A 2Y66A 1O95A 5EL0A 1LDYA 1YXMA 2PD6A 3D0OA 4R1TA 5U4QA 1U28A 4R1SA 1WP4A 2VZ8A 2HRBA 1ONOA 2R2GA 4RVGA 1R4NA 3GPIA 1P33A 1U2DA 4ZHSA 3WGZA 4GX0A 4DLAA 1E7SA 3DFZA 3TWOA 8ADHA 2GR9A 2AQIA 4CJXA 1E77A 1B14A 4J2OA 1VL6A 4NK5A 2A4KA 1MB4A 3VPXA 2IODA 4G65A 1MV8A 4J2HA 1LQTA 4EYEA 1R37A 4WE3A 1A71A 3MWEB 1P1FA 4R4JA 4BV9A 4ALJA 1T2DA 2WYWA 3I1JA 4AICA 1JWBB 3ICCA 4L75A 4JX8A 1P9LA 2PNFA 4I5GA 2P2SA 3VZQA 1WWKA 3NT2A 4MVJA 5C7OO 3ZNOA 1B26A 5KJCA 3NRCA 4GKBA 4ALKA 3NTQA 9LDTA 3DZKA 1Y9AA 2B69A 1MXHA 2WM3A 3VKVA 4GLOA 1XYGA 2ZIZA 3VPHA 2EKPA 5KVVA 1PJLA 1OMOA 1UDAA 3JQBA 2JD0A 2VRBA 4TSKA 4RZHA 3NJ8A 1C1DA 2HMUA 3TJRA 3I83A 3ZHZA 4YQZA 3JQ9C 3K73O 1AHIA 3E9NA 3PI7A 4CMHA 3JQFA 3H2SA 2J3HA 4ESOA 3KYCA 5JCJD 4JBHA 5L45A 2D59A 1BG6A 4LISA 3FRJA 4MVJH 3V1YA 4R9SA 4E12A 4TQGA 1XWFA 1FDWA 5CEFA 3D4NA 4U0KA 3VVBA 1GZ3A 3KEQA 2A94A 1U9JA 4UUMA 1CETA 2JKVA 1F17A 1QLHA 4Q9NA 1LRKA 1C1XB 5ENDA 5AYVA 5AXBA 1I3KA 3IP3A 1LDNA 3H4VA 4CM1A 3OMLA 2GYYA 5L4NA 3IJPA 3GEDA 3OJ0A 4R54A 1KC3A 3WYBA 4Q3BA 2J6IA 1Y8RB 2CSUA 4F3YA 1ZFNA 3GNTA 3PZBA 1K3TA 2CY0A 3JCZA 4WLVA 1DDOA 4R1NA 4O0LA 4XWYA 4AG3A 4KTVE 1VRWA 3E5MA 1TEHA 1YJQA 5LDGA 2W98A 3OH8A 1GYQA 3B6ZA 4INAA 4KUEA 3QWIA 4D0SA 1XCBA 4HKTA 4RPGA 3QA9A 2AEMA 5MDHA 4A2CA 1PU2A 2RCYA 1H9BA 2X0NA 1SZJG 4IS2A 2RAFA 5KVCA 3L0DA 4OXYA 4FFOA 2JAHA 3JYNA 3BMCA 5DBFA 1SMKA 2FMUA 2UDPA 3GDFA 1ARZA 4YQYA 2FOIA 3WGTA 1BHSA 1IYZA 2O2SA 4G2NA 1PJBA 2RIRA 3LT0A 4CM4A 2DFVA 4E31A 4FFLA 4YRBA 4PFJA 4HBGA 3INTA 4YAJA 5GY7A 3ZCXA 1DEHA 3WBBA 4XD2A 3NEPX 3SJUA 1Z6ZA 5F5NA 1GTMA 2CNBA 2Q2QA 4PLVA 4JJGA 4RVSA 1CIVA 4R41A 1DLIA 1RM5A 1SEPA 1QYXA 2GSDA 3RUHA 3QE3A 3BHJA 1YVEI 1ENOA 5CDUA 1NVTA 3F6YA 1U8XX 1OAAA 3VAZA 3GT0A 1WVGA 4D41A 2X0IA 4KMSA 4B3IA 4L74A 2BKAA 2G5CA 1OOEA 2NQTA 1P1KA 2BGMA 3GNQA 3VDRA 1K89A 1SPXA 5LCXA 2VWGA 3B1JA 4FJ1A 2NVUB 5B4VA 4XRRA 3HDYA 1B8PA 3ZV4A 3MCVA 1BXGA 1PGJA 1WPQA 3EYWA 1GADO 4UUPA 1UXKA 3BMQA 5KWEA 3LF1A 3KSUA 1FDSA 1E3WA 2DTXA 3KM0A 1RM3A 4IQGA 1UP4A 1JKFA 2BGLA 3DTTA 3AU9A 2EKLA 1ZSNA 4U5QA 2JHFA 3ORFA 5CEEA 1NASA 3H5NA 4GWGA 1UAYA 3F4BA 1A9ZA 2HRZA 4B7CA 1O8CA 3NGXA 5JMWA 2PZLA 3FNHA 3PWSA 4WLEA 1HXHA 2ZCUA 4DYDA 4LN1A 4XYGA 3DL2A 2C7GA 1RWBA 1R4NB 4GWKA 3KYBA 5CHEA 5IZCA 2B35A 1RM4A 4BNMA 1JAYA 5JBIA 3LU1A 2HK8A 1C3VA 4GAEA 3JQ8B 5FYDA 5JE8A 1HRDA 4PLCA 3UOGA 1QSGA 4YPOA 1O5IA 3F1LA 1SEVA 1NPTO 1MFZA 4KQXA 1VJTA 2EW8A 4W99A 4BNIA 1K0UA 1BVRA 1SAYA 1BVUA 4YRAA 1PWXA 5G4KA 3EW7A 1BDBA 4ZQGA 3HUDA 3ZV5A 3Q11A 4BQRA 5TLSA 2BHLA 3KYDA 3X2EA 3F3SA 3H6KA 2YFQA 1K6IA 2O7QA 4QO8A 3NT4A 5JSFA 2O50A 1FDUA 4BGVA 3KSZO 1W8DA 2CMDA 1Q2XA 4PG5A 4E30A 5KTKA 3CKYA 3HN2A 3RCBA 1P1JA 1C0PA 1KOLA 4X54A 3VPFA 3R6DA 5KVQA 2LDXA 3KETA 4II2A 2QG4A 3AY3A 1D8AA 2IE0A 5A1TA 1B3BA 4CLHA 1UAGA 4P4LA 2V6MA 3KRTA 3QY9A 2BI7A 1LSUA 2QQ5A 1ZJZA 3DBRA 2R00C 1HEUA 3GZNA 3IIEA 5JAZA 4IZIA 1O94A 2I5PO 4Y98A 4RF5A 2J5RA 1E6WA 2CDAA 2FWMX 3KYDB 3WGIA 3SVTA 1EFLA 1LA2A 3E6AA 4JIGA 1HDYA 4MJLA 1GAEO 2VUTA 5IN4A 1H9AA 1HDXA 4YR9A 1RM0A 4U8GA 2EHDA 4QECA 3PRJA 5IDQA 5ILOA 4NBRA 1JDJA 4P8RA 3CTMA 1I01A 2C54A 3D7LA 3I9KA 1R6DA 3AI2A 1U3WA 4WLNA 4RPJA 4RORA 4CMEA 3RC1A 1LLQA 3TZKA 1R4MA 4AJ4A 2QZ9A 4JJIA 1DSSG 2B4TO 5T67A 1FDVA 4BMVA 3HDHA 3FR7A 5ER6A 3LT2A 3ZWCA 3GPDG 4PLWA 3PHIA 5DULA 3ZWXA 5IZ4A 4EEXA 1KEVA 4PN3A 4BB5A 1UUFA 2H63A 2V6FA 1GPJA 2VHXA 3PGJA 4NBUA 4O1MA 1JVSA 4ZU3A 1TT5A 1J5PA 2ZQYA 3IKVA 3QVTA 4D7AA 1QLJA 4QXMA 2NTJA 4WASA 1KS9A 5HBRA 4J9VA 3MZ0A 5THQA 3M1AA 3BHIA 4XIJA 4RO0A 4DBVO 5KJ1A 2HKIA 4MVJF 5TIIA 1ZK0A 3RFTA 5FI3A
chains in the Genus database with same CATH superfamily
4URXR 3QEOA 5FTLA 4LY3A 4RSHA 1E5QA 2JIQA 1QLWA 1I51A 4JL8A 3QKUA 4PG7A 3C5CA 3GV0A 2AK3A 3ISJA 3WGQA 2FE4A 2QMYA 3QMVA 5B7PA 2I1QA 5AW6A 1BE8A 2AOUA 2XE7A 1T9BA 2JH9A 1HI9A 2ZTUA 1V7QA 4QT4A 1Y33E 1J2TA 1AK2A 1ODSA 3INNA 2ZZMA 4DLNA 1RBYA 1TVEA 1BMTA 3IV7A 3FZGA 1TPYA 1WIWA 3FZQA 5DKFA 1YDMA 1SU6A 2H4HA 4EB3A 1JH9A 1UFVA 4K28A 3GC6A 4EGJA 1H4VB 1IQRA 4MW1A 2G0AA 5I8ZA 1FS5A 1WQ4A 1LC0A 2YUIA 2ZB8A 5AKHA 3NAGA 1FFYA 3F7OA 5LUBA 1PS9A 2NPOA 3D3QA 3KZOA 5DH9A 4H1UA 1NU8A 1L9XA 3UKJA 1GQQA 4E07A 1PHPA 2C59A 1ADJA 3H11B 5K7SA 1EZ1A 1ZR2A 2VNHA 3O7MA 2BFAA 2NQ2C 4D9BA 4E15A 2IEYA 3AV3A 2PV0A 3AVWA 4E2XA 2J3QA 4R1QA 1XU4A 3T6KA 4OAPA 4R2IA 3JZFA 3WADA 4FU0A 5M29A 5MGBA 3ZJUA 2R6FA 5JSQA 2Q5OA 5JAHA 4JVNA 1W48A 1BX0A 3D0RA 4EL5A 5DP2A 3CX3A 2FPLA 3HYTA 5C7YA 1QYVA 2YJ6A 3MFQA 3CRW1 4GNKA 3UTCA 5AW4A 4IFTA 4D5GA 4D0NA 2IU4A 1IPHA 3KU1A 1ZD2P 2ZS8A 1AIPA 1KJWA 1RAEA 1P7CA 1WG8A 2BR4A 3C7DB 3LHFA 3IR7A 3EZYA 2XB8A 2OFXA 3RS7A 3G2JA 4UU8A 3RT7A 1OGIA 2FN3A 4BP3A 4DLLA 2JIOA 3U3MA 2OE2A 2A0FA 1DOZA 2O7VA 8GPBA 2WDZA 1JQ5A 1YC5A 3KLOA 2NSJA 2PX3A 1YE3A 1LBEA 4CE6A 2FWAA 1JKIA 2JAOA 4HGNA 4IIVA 3LYLA 2GAAA 5LZ4A 1CUSA 5ALFA 4JLKA 4J49A 4NNJA 1TM1E 1BH2A 2VJKA 1FRZA 2ZDGA 4KODA 1C30B 3EVDA 4MITA 2IW3A 4RZQA 2CUKA 3DO6A 1ZUD1 3MPUA 3QP9A 4F4FA 4HEHA 3VPAA 2FFJA 1B7GO 4PANA 3MTIA 1SUBA 2Q6KA 4Q1CA 4YRFA 5T6MA 3H5WA 4D45A 1OT5A 1BA2A 1UXOA 3BERA 4R81A 1K3UB 3AFOA 2DBQA 1NR7A 4S0XA 5DNEA 5FBHA 4Z2AA 5DBOA 4BNKA 2WSMA 5CFLA 2GKSA 3K09C 1M6WA 4NYIQ 4Y6GB 5EERA 3RRFA 2WSYB 1L5HA 4X8LA 4RFSB 5KC9A 5ALYA 2QDXA 2QQFA 1EWQA 3TTUA 3BWYA 4RHCA 4GRIA 4AN0A 4BEVA 3TSYA 2XUHA 2YYZA 3ZCUA 4F7WA 1LF0A 3KZMA 5B3LA 1GUYA 1PFVA 1HT3A 1SHJA 4RGYA 5CW1A 5EYPA 5CXQA 1I6WA 2FFAA 2GM3A 3K2BA 2IEIA 1K4YA 3PXXA 3NOXA 3OOYA 2FLWA 3R44A 2P0EA 4IDOA 1XGKA 2COKA 1DI0A 2VF4X 2GTIA 4LJKA 4UUAA 3E2MA 4DCMA 2WNSA 1SQ6A 5AVJA 1HF3A 2IP2A 1LUAA 1XDZA 1X74A 1VDZA 2O7RA 3C6XA 4C01A 1J70A 4BNFA 2A5GA 2NXNA 3D6TB 5EQDA 4FGUA 2ASVA 1I5EA 3TQOA 2PRIA 1WDKA 1SU4A 3DFUA 2CLEB 4A73A 3BBPA 1R74A 1Z6PA 3FUUA 3OZEA 1WV1A 5JH7A 1PV4A 1KKLA 2H4XA 5FPPA 1PI3A 2P6PA 1U3UA 4NFHA 3PXGA 5IDYA 2JGJA 2UYYA 4XRGA 5BUQA 1KK2A 5KZMB 2I2CA 3H2HA 2PX8A 1V25A 2D00A 3AONB 3Q7PA 2C29D 5L4SA 3T3MB 1IQPA 3EUAA 4FW9A 3GX1A 1L7VC 5B1SA 3C8DA 2VHEA 1MRNA 4DPKA 3E9ZA 1MCZA 2HK6A 1BHQ1 3NHLA 3P4UA 4HWSA 4LC1A 5LP6F 1N5OX 2ERXA 2XXBA 4RNDB 4RVFA 1UK7A 4HVCA 1H8ED 2VF2A 5LMUB 3EWNA 2RHCA 2C97A 3K9QO 1DP4A 1EKXA 1NVAA 4QYMA 4Q82A 1R8YA 1UBEA 3ZXIA 2W5UA 5ETJA 4GC9A 2VRCD 2Y67A 3FPLA 1NRXA 3KQVA 3TIFA 1BW9A 3QFFA 4IMJB 2XTMA 1FXWF 1Z16A 4L8VA 2GVDC 4MV3A 4W1PA 4YAIA 1VCMA 4Z8YA 5EXSA 3V2UA 5JVDF 2QNIA 5FX2A 5HZGA 3PQEA 2FW6A 3N6XA 1D7AA 5BSKA 1D0VA 5FTJA 5UKDA 4QJ3A 3CJRA 1WU8A 2XQGA 4PIMA 4TMZA 1C7ZA 1REQB 1XP8A 1B43A 1ZITA 2DY1A 4G1VA 2IQ5A 4H77A 1BSVA 2IZZA 1JWAB 1P73A 5JI2E 1Z75A 5HMLA 2W6ZA 4WNYA 1EXVA 4RTMA 4CFZA 1NW3A 2AT1A 3QXSA 4KLNA 3HB5X 4NBNA 2A7QA 3W3AD 5BWBA 3DFKA 1HZZC 3GLHA 6NULA 1IZ9A 1FB5A 1SBTA 2F1JA 2IOFA 3ITNA 4UHJA 3OESA 5TT0A 3RBVA 4BTEA 1TQ8A 3ZW7A 4J3FA 2PH3A 4OP2A 4R9RA 4ZAZA 4C4PA 1N2ZA 1ZVMA 2I9PA 3KB8A 3MTDA 5TY0A 4RFVA 1LLCA 1U7TA 1EUDB 1B2RA 1X9IA 3OVMA 5KPDA 2SICE 3ZCQA 4CTMA 3ZJTA 4LOHA 2C4VA 1SM4A 1U9CA 3DDUA 2EWMA 2VDWB 3E7FA 2YOFA 1P5RA 3BQMB 4MEAA 3OQ1A 4PZDA 3U81A 5KTOA 5M7EA 2SCUA 5DN6A 3UO8B 2BKLA 3KFXA 1OLXB 5JVDB 2AI2A 2I4IA 1EK2A 2VHVA 1CZHA 5B1YA 2JHPA 3HCNA 1ESNA 1THMA 3ZBUA 1WBDA 2WLTA 4BJ5A 3LHSA 1TYEB 1RBQA 3AG5A 5GP1A 3VJKA 3ZWPA 4EGAA 2EQBA 1XQVA 5JT1A 3F9RA 4OJQA 1FSSA 3EZFA 2QYSA 5EG5A 1G42A 1KJIA 1Z18A 4RH3A 5HRCA 3QF4B 3QGMA 2X0DA 3CUSA 2PT7A 3WWYA 1K6MA 4EX7A 1W2GA 4F9GA 4YC7A 5GJWC 3CRZA 2XTJA 1C9NA 2VDNB 1IHUA 5H9WA 4NSNA 3PFIA 4S12A 4EI8A 2YXDA 3MHPA 4MIKA 2I80A 5GJVC 1CPYA 3CO0S 2FDRA 2GRAA 2O5RA 3EGXA 2J3DA 3K0CC 1JKXA 1MGPA 4EW6A 2AQHA 5FQNA 2JC3A 1LQUA 4OQDA 4PCVA 4LGYA 4ZQBA 1H3NA 3I3OA 4RLQA 3O0DA 3UGQA 4XKJA 4Y1GA 3OBBA 3V4RA 3GCGA 2H2HA 2KB0A 3HA3A 3VYTB 3WYEA 5J5CA 5C5EA 3PQDA 3KE8A 5HWSA 3WB0A 3KWFA 2GPYA 2PGJA 3LBHA 4LBYA 4NZYA 4G5GA 1YRQA 5JS6A 1IG3A 2Z6AA 2C9MA 2HUPA 3GJTA 4QZVA 2UUOA 3GJSA 3QHQA 2QR3A 4OQLA 5EY5B 4O1HA 3ZV6A 1P60A 4CF6A 1F6DA 3TW8A 1SCUB 3HACA 2FU5C 3EXHC 1EWYA 4HEQA 5HDQA 4ZO7A 5SZIA 1OE0A 1YJAA 4ABYA 3UZUA 4CODB 3KT3A 1ZL2A 3SJBA 2QIPA 4MCIA 2BBOA 1ESDA 2FR0A 1KFJB 1NOKA 3IKMB 4GR5A 3EE6A 2OV1A 3WQSB 5JV5A 3VNAA 1KBZA 1E3TA 3L1VA 2I3GA 4R7TA 2YV3A 1G66A 4W1SA 2WQ6A 4MLPA 4LRTB 1L8XA 4TVOA 1YL5A 4HXFB 1JE1A 5E8JA 4V1CI 2QTAA 3PC8C 3KNZA 2EDAA 4RA6B 2OR3A 3ESRA 1FVXA 2PXAA 4IOLA 1Q0QA 3PPVA 1QE0A 3RWOA 4B4UA 2VK1A 4PRKA 2DT5A 4JP2A 1L5VA 1JQAA 4L0CA 5ICSA 4I2VA 4KXQA 4F97A 5JYDA 4KJZA 4EAAA 1UJ2A 2A5YB 5FBQB 4BMNA 2Q6IA 4ZDWA 4RC9A 3UMJA 1NHGA 1KY2A 2YC2C 3HVJA 4V0RA 1KAGA 4OHKA 1IULA 2LKCA 4WCFC 1DOHA 3K70C 4IS3A 2FUKA 1KYYA 1YQQA 4BGUA 2HSEA 5JQWA 4WL0A 1UEJA 2ZJBA 2I6FA 2OK8A 4EUNA 2CSXA 3RDPA 3G3EA 3HXQA 1N2JA 5DX1A 4FFNA 4RVNA 2G1UA 2V6BA 2JCXA 1V4VA 1XXHB 1H3FA 4JJ6A 1VMAA 1N5RA 4NDZA 4JI5B 3OEED 2JIPA 4P82A 4BX2A 4J1TA 2UYGA 2X3UA 3U3RA 2OHGA 1XXHA 4OHFA 1ECLA 3JR7A 3UK1A 3NH9A 4LV6A 4ZOBA 5K0SA 3GRRA 1KU0A 4B6GA 1RBMA 2NZXA 5LJIA 5PNTA 4I8IA 1T8RA 2ZR8A 3FWPA 1HRKA 3M3DA 4US2R 2XDWA 3UJNA 2WZDA 1N8SA 4K88A 4B87A 2CD9A 1N5MA 3DMTA 1GAJA 2D13A 1MC4A 2QPLA 4MINA 1OWOA 4RPCA 3ZNNA 1JBQA 4WJLA 1FP1D 3G9TA 4MS4B 3RT1A 3PZRA 3QLVA 3CLTC 2IYOA 4Z4IA 1IQUA 2F9LA 4C7XA 3K9NA 5F7XA 4TRRA 5DTMA 4RD4A 4NZOA 5JARA 2GK4A 3LVRE 1SUIA 1UJ5A 2V7GA 2C3OA 3RAJA 1LK0A 1Z28A 1XTTA 1V39A 3P0FA 5DLEA 1N9ZA 2QAGC 5BQXA 3HXOA 4K2HA 2C5EA 4O2BF 2PKEA 4QX6A 2IV7A 3PJRA 2PLWA 3GH1A 1GGKA 2WVGA 4HH3C 6ABPA 2ZE6A 5T7BA 3R9XA 4C6HA 1D7OA 2DFNA 4G5OA 5TQ0A 2YHIA 3I4CA 2WC1A 2ODQA 1KC1A 3BWBA 4NYMR 3A04A 2X5JO 4EJ6A 5HM6A 2HPHA 1ULTA 4U2GA 3HA2A 4LOJA 4EJSC 2PGLA 3GFSA 2AVNA 3QKRA 2BFDA 4QDXA 5L9AA 2WPDA 2HWWA 4BOYA 4RH0A 3H8WA 4IDFA 2Z1MA 3WE7A 5CIYA 4I1IA 4WCVA 4AVYA 3S55A 2YS7A 3O3CA 1BIFA 3QPWA 5ELLA 5EXEA 4EPWA 2ODBA 1DZ3A 2VPPA 3G5LA 1O7JA 3DKIA 4D74A 1BMFD 4PPFA 5D87A 3WK4A 1ST2A 2R87A 2J0SA 3VPBA 2O2HA 4RD6A 5JASA 4HWKA 4YPFA 3DSRA 4ITVA 1SIUA 4MIOA 1FLVA 1J5EB 1ZJWA 3G2MA 1PDVA 3T0IA 2PXHA 2BGNA 1VCNA 3VHRA 1X3LA 2R7NA 2ONJA 4M7PA 3TBKA 2XKKA 2IXDA 3HCOA 3MCWA 3H0CA 3QSGA 3QXXA 1TM2A 5C4IA 3CH6A 3OCWA 3JQ9A 3QF7A 4R40A 4D4KA 2BKEA 1SUAA 2HSJA 4I50A 1WUJS 1M6VB 2HK9A 5BYAA 3AKYA 3T1HB 2XDAA 4J7UA 2FDXA 1D1PA 2VH2A 2QUKA 3AWIA 4AY3A 3VVLA 2ZUFA 1BAPA 5BORA 1NR1A 1YJBA 2X8LA 2IYXA 3JSAA 3B2EA 2I3BA 2VYCA 2IDJA 3BJMA 1FBNA 4QQNA 5DT2A 3LA6A 3SBOA 5FLXA 5COBA 2Q1UA 3WLAA 2DTDA 2OP0A 3LIPA 3KXIA 2FK8A 1E7YA 5ECDA 1M2VB 3G8YA 5IH3A 1XDDA 4RSGA 1FRNA 3DC2A 1WETA 5E7MA 4MRPA 4KRFA 2YWCA 1Z8NA 2ZJZA 3WYDA 2BEJA 5TR9A 3IBCA 2AE2A 1USIA 2H07A 2OA0A 1TLFA 3JD1A 3USES 2XGOA 4DR7B 3ND7A 2JKYA 1VLQA 1NT4A 2PWAA 3W7VA 1PJ3A 3E03A 3QELB 1XRSB 2GBCA 4UEKA 1FFEA 2RHLA 1W4LA 1WVMA 4L4ZA 1CT9A 4B2LA 3BK2A 3IA2A 3G85A 3M83A 3JPYA 1RPZA 3I76A 3IXQA 4KBYA 4ALLA 1VHLA 2EU8A 4HDOB 1U0NA 4B4DA 2WKWA 3UJBA 4KN9S 1K27A 3PTAA 1DUSA 1M7HA 2N47A 5KQRA 3IEUA 1PR3A 2V3VA 3K7EA 3VDMA 3HR8A 2OHOA 4X62B 2JJ8A 1MT3A 4GZ3A 4GYWA 4NG4A 1HZJA 2DSTA 1DCMA 2DLCX 1MR3F 4DG8A 1SUWA 3I8OA 3CX7A 5BN3B 5CU7A 3SX0A 2P6OA 4EVRA 4O3FA 4BTLA 5CM9C 2DQ4A 1PYDA 4Z3KA 2G1PA 2IZ7A 2QRLA 3BXOA 3O8CA 3Q5GA 3JQ7A 2K2QB 1PYOA 1UXJA 1JXAA 3OHPA 2OO3A 1EFAA 3PUHA 4ZT5A 3FHTA 2A0WA 4H7KA 1DJQA 4FPXA 4NXNB 5E38A 4JT9A 1CP3A 1ZH0A 1P75A 2FLVA 5BQ5A 4DY4A 1QO9A 3ET5A 4HZUA 2YNMA 5AKYA 4YAGA 3S99A 4EP1A 4EOGA 4ZV9A 5B1EA 2ZRLA 3DBVO 5AM4A 4XDGA 3KQMA 2HO5A 2P62A 2WWGA 4QGFA 3ZQKA 2VFAA 3D8NA 3G1WA 2VQDA 3MIIA 3V2IA 2P9EA 5DBGA 4EHAA 1CJTC 3U61B 4AJLA 2EEZA 1MORA 3KS9A 4D56A 3DVAA 3WQHA 2VT6A 4A8JA 3C8ZA 3QWAA 3WQBA 3U62A 4BQNA 3RFFA 5J40A 3PNYA 2FAXA 2QLBA 4ASUD 4HUJA 3IHWA 3KU4A 3WMWA 1JEOA 3D4PA 3FWYA 3NM6B 4IUCS 4TQAA 5JMOA 4BE7B 3G9UA 3EVTA 3WISA 4HPXB 1ZQ1A 3IHLA 4DIMA 1NFRA 4UEWA 3ZD9A 3IDOA 3SM9A 1XHLA 1YO6A 2BEKA 2WRZA 5B37A 1S02A 4LMRA 3KOUA 5IEBA 3NNDA 2W93A 1AQYA 3VBCA 4BTVA 3BQNB 2J7PA 4FFDA 2P4SA 2ZWPA 1TKAA 3L04A 2JIZD 4HFMA 4LY0A 3TTSA 3CMCO 3V8RA 2HIHA 4COOA 1E66A 3JD2A 2IEZA 3R75A 5C5DA 1T9CA 3KZXA 3PWTA 5EMNA 1GQRA 4MGIR 3LUJA 4G41A 2H8KA 4PGFA 2KS6A 2HPZA 3INRA 3P9NA 4A10A 3AVTA 4OSOA 2QTCA 4IQ4A 4S3MA 2C7VA 1J9EA 4BVEA 2O1WA 3TQRA 1ZY2A 3RF7A 1GQOA 4ZYLA 4EEKA 3MOGA 2TMYA 4N1AA 1FDTA 2Y4OA 4P1ZA 4PAWA 5C1PA 2SHKA 3ENVA 1C30A 5TJ9A 4O4HB 4Z86A 2OQVA 4BFVA 5MN5A 4V1CB 2AUMA 1BKYA 4CV2A 5CLHA 4PHTA 1PR2A 3AF5A 4LMPA 1IHOA 2P4EA 2Z5GA 3N3AC 4TZTA 2VDOB 2HCJB 1DFGA 4OFZA 3ZY3A 5KHOC 1J0XO 1TZJA 2Z9BA 2DWOA 2O3JA 3U7HB 2N42A 3HWRA 1PGPA 3ORRA 1H8EA 2DHRA 3FHOA 1XV5A 3P7MA 1ZESA 5JDIA 1U02A 4LC0A 2RHWA 3ZEAA 3Q72A 4DBLC 2UVPA 2WNIA 4V1CA 5LP1A 1GLGA 3IBYA 3H9BA 4KXFB 5JSZA 1AG9A 5CHYA 1W93A 2GDZA 1K5HA 2Z3ZA 3N8HA 2AEJA 2JGAA 2QTBA 3JQRA 1TMKA 4QOHA 4PZEA 2WAYA 2C7QA 4JODA 1K6EA 4AU1A 3ZQJA 2M32A 2UYHA 4DUZB 2IYTA 4BCCA 1VHTA 4AY5A 3NNNA 1C0EA 4CEHA 4FGSA 2AMFA 2H1HA 1W87A 4FHEA 1KERA 2FX2A 3UJHA 4EKGA 5TMPA 1E59A 1U0FA 1NKSA 2BMEA 2ZM5A 4BN0A 2VAMA 3EFOB 2P7HA 2E21A 1Y8ZA 1JHPA 4QDTA 3W3AA 5AJYA 3ZWKA 5K3BA 3D81A 4RDXA 4KXLA 4KXYA 4QUHA 5B3AA 1CRQA 1J2YA 3DHWC 4A6XA 3PDIB 3MRVA 3IURA 4I4TB 1VM6A 1PFQA 1SBIA 4E1VA 3AR4A 4JC4A 4U2CA 3MTAA 1OI7A 4ROSA 3C5VA 4BNYA 4R9UC 4JBLA 3VR2D 3ZZNA 1QCCA 4IX1A 2GYWA 4NCKA 4QODA 1FNBA 1B76A 1B8NA 1FRVA 2BBTA 2CLKB 2FFHA 3KL4A 3ANTA 1RQRA 2Q99A 5FWNA 1JEYB 2OMEA 1JQLB 1R15A 3B38A 2XRYA 4MWOA 2FMKA 4IH4A 3B12A 4NEGA 4DR4B 3TVTA 3FNRA 1LI4A 1XKTA 4RTLA 3GAZA 4REQA 3IQEA 1IL0A 2QL6A 4MAFA 1JIQA 4J75A 3HK2A 2VUHB 2DYKA 3QJGA 3BD7A 1AUOA 4KC0A 3NVMB 2C2KA 3QOFA 2G7MC 1E9VA 4EF5A 1KHTA 2OSBA 3GLQA 3HJTA 1MEEA 2RGNA 1JDBC 4PX9A 5DTJA 3M4XA 4NMXB 3FTEA 5B57C 3LVFO 2BF7A 1FQKA 4LNUB 2BI4A 1EP3B 1QGAA 3Q1LA 1R18A 1VL2A 4M8LA 5IKEA 1ONPA 4EBBA 1TUIA 2LGJA 3UT0A 2RK4A 3HXLA 2WIDA 5AJXA 4E70A 3CEJA 3TEJA 1FFWA 4Q48A 1NNEA 1WW2A 1L4GA 4MTLA 1X1TA 1Q3TA 1XTJA 1H2YA 2Y71A 3VO2A 3JVDA 4CG2A 1IBMB 3J7AC 5KQLA 3THXA 3JQDA 3AERA 4HNQA 3FMIA 5LQJA 3CG4A 1P0FA 4WY5A 3DEJA 3W8EA 4B2YA 2X5KO 3CZAA 2O06A 4FTWA 4HFNA 1AHNA 3OT1A 4E08A 3BG5A 4DNQA 5LKRA 2WIKA 1UM9A 3PUIA 3SYNA 4B33A 3I61A 3B3JA 3WRYC 3ANLA 1U2RA 3BTSA 2DSNA 1DAMA 3HN7A 3O8OA 4Y9TA 1RZUA 2CLCX 4DLVA 1R8SA 1PZGA 3EOAI 4AP6A 1QV6A 1YJ5A 5ELXA 2R1VA 1VYVA 2HXYA 3A2KA 4HAUA 3M5WA 5JEEA 5IBPA 4IL5A 1FTYA 5CT8A 3VTZA 1WCWA 1L1EA 1LSJA 3CR8A 2ZVDA 3E58A 3EZ9A 3H86A 2R47A 1P74A 3QOWA 4FYMA 3RIXA 5CEJA 3I92A 1JDSA 3CVJA 3OF2A 3VJMA 5L95A 1E9BA 3AUTA 3CEPB 5G02A 1U2ZA 4FB4A 3O8QA 1N6LA 3GVIA 3P0JA 2AW5A 4Y6SA 3PQ5A 1V6CA 3PITA 1MC5A 1GU7A 3CNNA 1W6RA 5EXTA 5FL3A 3CZCA 4H3SA 4KVZA 1G7TA 1K5GA 3QVLA 4S1PA 1X15A 4DCGA 1PS8A 1VI5A 3DOIA 4I1YA 4ZOLA 2CBGA 2WT8A 3KUUA 2OD9A 4QOGA 1ZVKA 4PC6A 1NMQA 3ILXA 4BRSA 1EGQA 1QFZA 5T4EA 4AAYA 4A23A 4NBWA 2CF5A 4ZCTA 2V7EA 4X1OA 1GNVA 3DQPA 3ETCA 2HYDA 3I05A 3REQA 3C6QA 1LW6E 1HE4A 1G8KA 1QS0B 1UMDA 3C39A 5ES3A 4DJAA 4ER5A 3QG5A 2XKAA 3FFWA 4WJZA 3RREA 2W90A 5IJAA 2Q1XA 4UD2A 3RIEA 4RNCA 3ZWWA 1YMVA 4UBIA 5JSHA 1XA0A 3U44A 3BSWA 3AEXA 4GE0A 2JJ1D 4Z1MD 5IKPA 2EFGA 1EUCA 4KE8A 1U5AA 1XHEA 3WLJA 1CBUA 1KIMA 4K9SA 1VE5A 3B3GA 2ZSJA 1HYEA 5ARDA 2Q29A 1OLOA 621PA 1I4OA 1D09A 4OJKA 1F8XA 2HCTA 2BFBA 5B53A 1HA3A 5IDWA 5E6RA 2CV2A 2Y1XA 2PX2A 1NVMB 2XVMA 3D6AA 3ZCPA 3QUTA 1CUIA 3OT4A 1D9ZA 3FROA 4QXQA 1E6CA 4C2AA 2EC5A 5K0ZA 2IS1A 1AQJA 2AL7A 1H0RA 1KWKA 4OSPA 5DIFA 4HDMB 4JYCA 1QO0A 4UE6A 2WB4A 1FFAA 1CF2O 4GRAA 2DOKA 2VSQA 2CZQA 2QR2A 4PG4A 2YHIB 3HL0A 1J8FA 4X6LA 2O5VA 1VJ5A 2F43A 1ONSA 2W42A 1Q0HA 2P3OA 1T4MA 2NT3A 4L4YA 3K2IA 1D07A 4P4UA 4LF8B 2AFHB 2G1KA 1KI6A 4HPWA 1ADYA 4P4SA 5E95A 3SHVA 1NLZA 4J16C 5ALMA 3EAQA 1CZRA 1Z4MA 3G13A 1TJNA 3P52A 4N0MA 2F59A 4BUCA 1UIMA 2P11A 2W83A 5ES4B 1IMJA 1IUOA 5KYYB 1NJ5A 1SFRA 1Y8QA 4PXYA 4WXRA 2WEKA 4WXHA 1KOJA 3H1GA 3R3ZA 5JG7A 1YB2A 1HQKA 2O20A 3AW9A 3EXHB 4KO2S 1GDDA 5EPOA 3BWEA 2OBNA 3RANA 2OCKA 3OPYI 2F3PA 2GCPA 2UUPA 2I3ZA 4J91A 3G0IA 1JR2A 5MF6A 4DF3A 1AXRA 1T2FA 3BMNB 2WHXA 5G0UA 3PQ4A 3W2GA 2HEIA 4HK4A 2BY4A 3VVBA 1Z5GA 5CB4A 4L8WB 4HX2A 3W7AA 1MN6A 2V5AA 4FFRA 3VR6A 1NG9A 1TM4E 1VGQA 1FXUA 3GL9A 2CLDX 3PR2B 4RTRA 1GUFA 3ACCA 3BWMA 3ENNA 4XLTA 4YDSA 3C16C 1K1EA 2R8YA 5BRJA 2I6UA 5JRDS 1M1NB 2PUAA 3GUUA 3OPYA 4Y6QA 1SNYA 1EDDA 3A1NA 5EUCA 1F1BA 5CFRA 2Q4TA 4TL6A 1FFCA 3HJBA 3QKIA 3CNOA 3PE3A 3UHPA 2GPJA 4BNTA 3P2YA 5GZ6A 5H3CA 3H42B 1R16A 4RU1A 1BHJA 3K9FC 1GUDA 5JCOA 2D8MA 5A4DA 3K5WA 1OBOA 2Y3IA 2KE5A 3H2YA 2PPVA 3FPEA 3EEYA 1TDJA 1ZGAA 2C98A 3QXCA 3IUPA 1I7SB 1GTJ1 1A2KC 3KDSE 3UN1A 5K6TA 4N5LA 2POQX 2YHAA 4XEHA 2QX6A 4MYDA 3KR2A 4CRWB 2QRHA 2HDNB 4B79A 2AZ4A 3TG2A 2E48A 2WU8A 1XN1A 3A9WA 4JXJA 1BOFA 4EQZA 1FRQA 4DUYB 4GICA 3W1EA 3W34A 4K0RA 3MWKA 2YIMA 1ECBA 2ZRFA 2QW8A 1CZLA 1U3GA 4MWSA 4PIPA 1K4KA 5HF9A 2ZPAA 2B2NA 2R6AA 2WU3A 4NBVA 5JNUA 1XCPA 5LZ9A 3O3OB 2ZYDA 1RJ9B 5A3SA 1NQOA 4J1NA 4ALMA 2X4LA 2BUAA 3G0GA 5JPCA 1NJFA 3RVKA 5DYWA 3C98A 5AUOB 2VK8A 5AVOA 4PYOA 3FSJX 1G8YA 5CVCA 3TW8B 3W6NA 3MINA 1OX5A 4Q4CA 1CIJA 1WUHS 2C83A 3TI7A 4DHWA 2AEEA 3JASA 1PZHA 4YT8A 5FOWA 5JS1A 4FR2A 3C3CA 3U17A 1KYWA 4H4CA 5GJBA 4I1SA 4WPGA 3RTBA 4XGQA 4EUEA 2O0LA 2Y4NA 4I36A 4C4RA 1AKMA 2LTAA 3A6ZA 3C5HA 3LGXA 4MVJG 3AM1A 2PX4A 3NETA 3V42A 1Z4IA 2DQZA 3N9IA 2HQBA 2GTPA 2OZKA 3L1HA 3C97A 4BPBA 4CGZA 4MVWA 2EATA 2ZJ1A 5AICA 4XVUA 2VBCA 3EAGA 3T7KA 3TJMA 4ER3A 3N75A 3VU3A 3FDZA 1ZDMA 5TPWA 4F46A 4ZYTA 1JFVA 2G9VA 4IRUB 1R12A 4G9EA 4U7JA 3PHHA 1VKHA 1V3VA 3E7PA 4JJEA 5FULA 3FZYA 2F3RA 4BKQA 1WUYA 4JUDX 4X45A 3O95A 4B6SA 5HHTA 1U0BB 3C3PA 3EGDA 3P2OA 2XWQA 3M2PA 5JAIA 1MZVA 3WDKA 3HZRA 3IKTA 1ADCA 4IIJA 3PSAA 2A9QA 5AM1A 4M1ZA 4MEBA 3AB3A 4BQFA 3SIXA 3QWHA 1A76A 1QPBA 1BE1A 1SKYB 4BQQA 2HWYA 2DU8A 1M6HA 4RIEA 1KGSA 4RVOA 1TJYA 1NN3A 3Q4GA 4MB6A 3LX8A 2DAPA 5BOVA 3L7BA 1DWQA 5TEVA 2SCUB 3U5TA 3L4SO 3PGA1 4EGCB 4X1KB 3D6UA 4MLZA 1QRTA 2NPFA 2F3QA 5IDVA 2BSXA 3WL6A 3UMRA 4QYXA 3V32A 4AYXA 3DCIA 4AN1A 1SC1A 5I7AA 4ER6A 3IQXA 5IF9A 3JYQA 2QLJA 1AKTA 2H9IA 3HCFA 1G291 3ACBA 4MRSA 4XFJA 3ZDFA 2B1GA 1MB9A 4Z4GA 1QOPB 2XTNA 1XZPA 3QRWA 1VIVA 1HYHA 3B3QA 4Y6LA 4A03A 1XR3A 4XQ9A 5BSHA 5LL6P 1CQIA 1EFPA 4ENWA 1R0SA 4GRDA 1I10A 2PMFA 3N8DA 1G9SA 3IH5A 2PU5A 1DT5A 3AHFA 4B5LA 5CDGA 3CVVA 3U1TA 3A6PC 3AYXB 2BCJQ 4MV0A 2QJWA 1UZMA 4ZCQA 2WWYA 2C57A 1EJ6A 4M22A 4D4GA 1P4GA 5DNWA 4G0VA 2ZI9A 4XW2A 1L3IA 3G02A 5KWIA 4R6WA 2FYTA 4EJ2A 4LV8B 3D1LA 4G5QA 1C0KA 1YRBA 4LPSA 3O4IA 1N0UA 2PXCA 5DZSA 4DCUA 3VV3A 3O47A 4DWWA 3P2MA 3B20A 2E4WA 4UVEA 4Q18A 4I9FA 4I9NA 1XNQB 4MMXB 2V55B 3JD0A 3LF2A 4BFUA 1NAHA 1O4VA 2ADMA 4EYQA 3LY9A 1WZ2A 4DLTA 2P1RA 3N8KA 1CCWA 3KKMA 4X8HA 4WZBE 1RP7A 1I7QB 3OUUA 5F5LA 2GQ0A 5AM2A 4ZHQB 4DXHA 1WRBA 4PHCA 3D3WB 5LD2C 2EAUA 3NNSA 1ZG3A 1ML4A 4AKEA 2PMDA 3SZ3A 5JH7B 2VYND 2WD7B 7MHTA 4MWEA 1WB9A 2J5XA 4ZJYA 3ZDZB 4H3VA 4C30A 4M6WB 3C8MA 5KYWB 1Y5RA 2W0MA 4G4SO 4OGGA 4WADA 2P75A 2Q1TA 4XAQA 2R6ZA 4HF7A 2CZGA 2FF5A 2IKQA 5DEIA 4EY8A 2D0IA 4KO1S 1JEJA 4ETNA 2WWIA 3DDWA 1HETA 1PIWA 1U5BA 1F8YA 1GNLA 3L40A 3U3DA 4WK0B 3GBSA 3PBKA 2OCLA 1NUAA 2JBWA 1EB9A 2PMKA 4ND1A 3HN6A 1IMOA 3IKJA 3JV7A 2J9FA 2QP3A 4ARSA 4BATA 1OTHA 2O7NA 2BBWA 3UXYA 5JSUA 1N1DA 2ZXEA 3QW2A 4FEEA 4L5AA 3GJZA 3L07A 2XODA 4PZYA 1E7RA 1T15A 3K05A 1PZFA 4RFSA 3UK6A 2WU4A 4MUGA 1K7SN 4QDUA 2BUBA 1XQ1A 3ZWNA 2RGAA 1U0RA 4UREA 1JYFA 3DW3X 4DMCA 4JVSB 3NONA 4NCHA 4CDGA 1CY2A 2D2VA 3QFTA 1ODJA 3FI0A 3ENQA 4B2PA 4DN6A 3FOZA 3P4YA 1J1ZA 2ZT7A 4J0DA 4TSFD 4MA5A 5KTPA 4DGSA 1DWOA 4UBKA 1ULAA 2Q28A 1VPVA 1BOOA 3R5KA 3PPIA 4U7FA 4YMUA 2PL1A 4OBXA 1QQ7A 2I03A 1XLTC 2QR5A 3FSEA 4DAEA 1FFSA 4ZCLA 4WKPA 1YL6A 4AQYB 1E1DA 1J0BA 4C1NA 3PJDA 1CUBA 4NY1A 2ZYWX 5H7XA 4AX8A 1K8XB 3GELA 3LZDA 2BCGY 4OI1A 1GYRA 4N7RA 1NVFA 1BEUB 2PZ8A 4YP0A 2H7VA 1IM5A 1OGJA 3NPMA 3Q9LA 1C9YA 4JT8A 4N18A 4OQYA 5K3SA 3S5UA 3SJ7A 1G5PA 5JNTA 1HFEL 1T5SA 3B85A 4RF3A 1SZDA 3WGJA 5HOQA 4JUBA 3RS5A 1ACJA 1Y3DE 4D9NA 4ZKDA 4H1HA 3L92A 2G08A 1UH5A 5LJLA 3WXBA 1ZINA 1LV8A 3RSHA 1YR1A 4FI3F 3PXAA 1C1XA 3HSSA 1WE2A 3Q40A 1HDGO 4HI0E 2CT8A 4Q7EA 2WWRA 1PEKE 3KJQA 4G81A 5ERYA 2Q6LA 5JCJA 1IRXA 2VDPB 1Q20A 4UBMA 1TRHA 5DGHA 5FPQA 3SXUB 3UBTA 3M0EA 4DM3A 1MG5A 3NX4A 4F3KA 1JLHA 3S1SA 1KOGA 5CFMA 2R7AA 4TROA 4TT8A 4UEQA 5TSDA 1FNCA 4XYLA 2I9KA 2G3YA 4U6QA 5K6AA 1RIIA 2FSSA 4C5BA 3DTVD 3ZWBA 3CKLA 1T3HA 5H5JA 3WSVA 1Y82A 4N7BA 2PTGA 4EITA 4EUHA 1JG4A 4DYHA 5ICGA 2HREA 3S29A 3FYSA 5HP4A 2P3QA 1ENZA 3O4GA 5DF1A 4E88A 1ORDA 1Z3IX 1T36B 2PCLA 1SB8A 4M0UA 2WF9A 3KHTA 4WJKB 4KWEA 3SC2A 4QDJA 4RS3A 3NOQA 5IANA 2CHGA 2Q50A 5G1NA 4KMOA 3GEGA 3FPJA 2AOUB 2AXQA 4IBOA 4DLWA 5I8WA 1APBA 1WCV1 4D3FA 1CULC 1JPNA 2PA0A 3ZLUA 5HKAA 4NEQA 1PJAA 3K0AB 1GSIA 3OIWA 3PLRA 2J45A 1L8OA 1XVIA 1ZN8A 1MB0A 4A3SA 1ZX1A 4K26A 4F96A 1Q16A 2F17A 4XUDA 2LCQA 4LW8A 1F8UA 1FZTA 2BFEB 5A6VA 2JLRA 1KEEA 1P77A 3ZOKA 4OHPA 1HE8B 4YCBA 3TSWA 5IAOA 2XOKD 2EDCA 5HNKA 1QV7A 5CJPA 3U09A 2AUNA 2OCXA 1B0PA 3AEUB 3VM6A 1N1MA 4WY2A 3NBZC 3RYFB 1XUOA 10MHA 1U2DC 2HU7A 4G1EB 4IDBA 1IHPA 2IJGX 3IAUA 1HFWA 2AKYA 1I2AA 1WTAA 5AVYA 1KAHA 2RGBA 1YASA 5AXAA 3L4BA 3V1UA 2VOJA 5K0NA 3EJ6A 4X85A 1HE2A 1M8GA 1TA4A 2WHQA 4X93A 1ZD4A 3VC7A 3JTEA 4FNAA 4HLQB 1A2BA 3RROA 4BUJA 2C58A 4K1LA 3UXHA 1NBAA 1Z2NX 3L6DA 3CF4G 3HR7A 1D1TA 3G5AA 4LE1A 1PQWA 2H3HA 4TL9A 3TD6A 4AJ2A 1GPLA 4UTXA 3T1OA 1YZGA 4UM9B 4LPKA 3LYUA 4LJ5A 3GCDA 1YTLA 1J07A 3DZHA 3IJRA 2W6IA 3KUXA 4MIYA 4BWGA 2BKVA 4J1SA 1H2EA 1JLSA 1FS6A 2I4RA 3EWIA 1M2GA 1EFTA 2KM1A 1FE8A 2JDID 2M9MA 1YL7A 2X7XA 2AG5A 3AGPA 4R0NA 3S81A 2F1RA 1F4PA 1QFMA 1X39A 2AA3A 3KXKA 4N0DA 4Z99A 3ICOA 4OIMA 3JY6A 3N7AA 1Y1TA 1XALA 5CNMA 3TSOA 1PGQA 1R5NA 1TFUA 1KDPA 4ZMSA 2AXNA 3R5HA 3PKIA 2I6GA 2TYSB 3ZI0A 4PG8A 2YDYA 3UMBA 3Q8LA 3G2LA 3TDNA 3GJ5A 5AI6A 2Y1OA 3Q9SA 2DHQA 1VCIA 1TCUA 2EYUA 1ZMBA 1PT6A 2OESA 5K45A 3P96A 2QLTA 2VQ6A 2X42A 2Y1LA 3OEWA 5IJ9A 2IIPA 3Q2OA 1RXWA 5EJ2A 4G97A 4KEAA 5F98A 4K8RB 1XXLA 1AA9A 3F6PA 2FKNA 2IUTA 5DM2A 5LQNA 3ADOA 3E84A 4RK0A 3DLBA 1F9EA 3UHAA 4I4TF 2QMZA 2WA1A 3JD3A 4GYKA 1BMQA 4OXQA 1E79A 3KWMA 4RGQA 4V38A 4Z54A 4QGAA 1N5JA 2Y05A 5HF8A 1FNNA 4GVLA 5IM4A 1O0CA 3SX4A 4L73A 4QNMA 1NVDA 3CR3C 1NM5A 4L0MA 1TJPB 1JSLA 2FQWA 2JLBA 3OF3A 2CW5A 3O1LA 2EQAA 4RDIA 4X1IA 1Y5LA 3GEIA 3Q0TA 3WGKA 3X3HA 4CLXA 5JCXA 4NMWA 4YBZA 3ORHA 4DA8A 3TDKA 1USVA 3NW9A 5HZHA 1A04A 1Z12A 4FZ3A 5IUKC 3N8NA 3PL1A 1KMMA 5ERGB 4F2HA 1ZHOA 3BT7A 2O14A 1W0CA 2VZ9A 4QNNA 4CMIA 3F6EX 3RFVA 3SHFA 3O73A 4MP6A 1H6AA 5FTKA 1XAJA 1AUPA 2RHTA 3AETB 4ZI5A 3UF0A 5M5BA 5KDOA 3R0JA 1C8BA 5SZHB 3OQHA 4RESA 1KP2A 2FG5A 4HGRA 5AUQA 3FVWA 3WYCA 2IZ6A 4JXKA 1CRWG 1R50A 3X1KA 2WKSA 2PKQO 4OQXA 3IPLA 2RG1A 4LZWA 4JLBA 1JLLB 4NJEA 5FADA 2DXIA 2I71A 1X7WB 5JFTA 1RWMA 3FPGA 2M6LA 5BMVB 1SOMA 5C1OA 1MAAA 3ZXXA 2YZGA 2XCRB 1NWCA 5K4AA 4RJJA 1YR2A 1S2MA 3ZGYA 3E18A 1N34B 1NW4A 3IPXA 2WF6A 2E37A 2Q5CA 5BVHB 1VE3A 1C1YA 2IEBA 2L2QA 2N0SA 2ZIXB 3LPMA 3NYQA 1G4UR 2NPIA 3FR8A 4LZLA 2GA8A 4NFLA 4NENB 3VR5H 4KJXA 5AW0A 5LU8A 1T4CA 4YUAA 2R6CA 1N75A 1Q0RA 3EVCA 2B0JA 3CA8A 2WKPA 3O4VA 1OFIA 2QW0X 3KVOA 1JAHA 3LDUA 2ZT6A 2AMLA 4PAQA 2AN3A 1H8HD 1MO4A 2MSLA 4G0XA 3ANSA 5J5VA 2Z8YA 3WLEA