3G9XA

Structure of haloalkane dehalogenase dhaa14 mutant i135f from rhodococcus rhodochrous
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Rhodococcus sp.
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
total genus 107
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9xA00
1DWPA 3FWHA 3M3DA 3WYDA 2PKYX 4I19A 2PL5A 1UT6A 1LPBB 5DYYA 4WY8A 1VA4A 2AJLI 5FXMA 5FUMA 1EB9A 1EINA 3Q8WA 2JEYA 5JZBA 4Y2RA 3H19A 3M83A 1ZI6A 2GBFA 2O7RA 3I6YA 2XUGA 2OQVA 4DM7A 4G8BA 2WLSA 5FPPA 1LGYA 2HA5A 5H3HA 4Q3LA 4KYVA 1AQLA 2DCMA 1Q84A 4N5HX 5HQ3B 1MO2A 4J0DA 2OCLA 2HRQA 4ZXFA 5K3FB 5AKYA 2RAUA 4UBJA 1AGYA 3GZJA 5CH5A 1HPLA 5BOVA 1WOMA 3C43A 5K3CA 2HFKA 2QMQA 1E8MA 1N1MA 3G9UA 3SWWA 2YXPX 4X93A 1LZLA 4WFJA 4WDQA 2B20A 5T4EA 4B81A 2OCIA 3DYVA 4ZV9A 4LKOA 1XZCA 1QFSA 3YASA 1YAJA 4FHZA 2AXEA 5HZGA 2X5XA 1QE3A 1UKBA 5DWDA 4U2DA 3H1BA 3PUHA 4EY5A 4G4IA 3DDUA 2RIPA 4OPMA 3WKEA 1LPOA 5CURA 4PSCA 1PFQA 1FJ2A 4AB1A 1A8SA 2AJCA 1XQWA 1X2EA 3FVRA 2WSLA 2JGJA 2BAGA 5FPQA 1OXMA 1JT2A 3GUUA 2PUJA 3F97A 4Q3KA 5AM0A 3FCXA 5EGNA 2WIDA 4IH1A 1Y37A 4ROTA 2HADA 5ALDA 3BDVA 2XQGA 2GYWA 3AZQA 5EHZA 4BAUA 2WQZA 2HU5A 4HXFB 5JASA 2QOEA 1AUOA 3C87A 2C7BA 2XUKA 4PSDA 3R3ZA 2RI6A 3LIIA 1WHSA 2H1IA 4M0EA 2XMZA 4X71A 1CUHA 1E8DA 3ZPXA 5ISMA 1UXOA 1XRQA 2WU4A 4CIBA 2VA9A 2ZYHA 2QKYA 1LPSA 4Y2YA 2VJAA 2XDWA 1EK2A 3QMWA 1JI3A 1BCRA 1YR2A 2ORYA 3DCNA 1W4LA 1FFEA 2V98A 5CRIA 3H18A 4CG2A 2WIFA 3AZPA 5JAOA 2J3QA 4AZ0A 1R1DA 3GBSA 4DNQA 3N2ZB 1WB6A 5ALMA 4BBZA 1QO7A 4BB0A 4HAIA 5BWBA 2J4CA 2ACEA 4BRZA 4O08A 1WB5A 3C6XA 3D7RA 2XMGA 4OSEA 1AZWA 3G7NA 4QWWA 3W06A 3L1IA 3WWOA 3HLKA 1JJIA 4FNMA 3C45A 2BGNA 2WFLB 1J1IA 1ZGBA 4FDMA 4DTCA 3O4HA 5T4BA 3EF3A 1DWOA 4DSZA 2XMSA 3JYHA 1WPXA 4F60A 1EDEA 1CUYA 1SCKA 1I6WA 4B85A 5JAUA 3TJMA 2JBWA 1W1IA 4MEBA 1N8SA 4BZWA 4JYMA 1W52X 1OCEA 2CZQA 3IUJA 4K5QA 4ARAA 3MGAA 3V9AA 4JYPA 1A7UA 4GEGA 1CQZA 3R40A 1BN6A 4I3FA 1CUEA 5AM4A 3T4UA 4A16A 4YX9A 3HXKA 5AOAA 4EY4A 4ZGBA 3WK6A 2XUQA 2DHDA 1AKNA 3WA7A 3VISA 3S8YA 4K6GA 3PFBA 1ZGCA 1ZJ4A 2IITA 4WFKA 5ALGA 1FFDA 2AJ8A 3QMMA 2IX9A 2ZJ6A 3AJAA 5LZ9A 4AXBA 3A70A 4M0FA 3OM8A 3QBJA 1D07A 4YPVA 3WL5A 1CUJA 3IA2A 2O2GA 5ALPA 3WJ2A 3D5EA 5AK5A 3TGLA 4Q1VA 4H7KA 1YB7A 4MWSA 2QRUA 4N8EA 4BAZA 5ALKA 2XUJA 3FAKA 4UBOA 2ZJFA 1VE6A 3VJMA 5ALUA 1L7QA 1DTEA 2HM7A 2PSHA 1RP1A 1DT5A 5ALTA 4DIUA 3VVMA 2QZPA 5K3FA 2DQYA 2XQJA 3AIKA 5A62A 1IUPA 2PSJA 5AHXA 2HDWA 2XT0A 1DWQA 1H2YA 2H7YA 1ZI9A 3WZLA 3DQZA 4KAFA 4N8SA 4FBMA 4D9JA 1Q0RA 1LPNA 1J07A 3JW8A 7YASA 1P0IA 1AMNA 1VKHA 4KE8A 4QNNA 1EDDA 2QXUA 1R88A 3EIOA 2XQFA 1TCAA 3DS8A 1XQYA 4M0MA 5LIPA 3RKSA 4BTLA 4JH0A 3VJKA 2G5TA 3KD2A 1XZKA 4V2IA 1XZHA 2XB6A 4X85A 2QS9A 4HVTA 5AKHA 3PF8A 3BIXA 4LXGA 5AKJA 3QMVA 2EDAA 4RGYA 4MEAA 5ALZA 2D5LA 2QJRA 4Y2JA 2Z5GA 3FYUC 3UUFA 5FKJA 3WL8A 1AC5A 1YA8A 5EIHA 1RWQA 2UZ0A 2VEOA 1O6FA 2DHEA 3WL6A 4DLNA 5C8ZA 1CUGA 2CBGA 4X00A 4B82A 1CQWA 5T4HA 1G4HA 5AM5A 4OB6A 5E4TA 5SYNA 5LZ5A 3IIIA 4KACA 2P8SA 1MX9A 3G0DA 4I4CA 4K6HA 4XIIA 4X92A 3L1HA 4AMZA 2OGTA 5HK9A 2CB9A 2YH2A 3I2KA 4LYEA 1ZI8A 2J3DA 2GYUA 4UHDA 4TPKA 2FX5A 4B9EA 4BC0A 4J0IA 2XMDA 2C0QA 4WDRA 2I3ZA 5AI8A 4F5ZA 4AO6A 3ZI7A 2JIDA 2WFMA 4XWGA 1YA4A 5CT5A 1YB6A 4G9GA 3AUKA 2GBIA 1VA5A 4X90A 4AN0A 4Y2XA 1GQRA 3W04A 3FLAA 2W6CX 2X8BA 4FOLA 1JKMA 3TRDA 2C5GA 4NMWA 5CTAA 3W2TA 1L7RA 5AICA 4DSAA 4Y2PA 4FLFA 1F0NA 1GT6A 2QJWA 1QFMA 5AKEA 3QPDA 4EZIA 4G4GA 3N0TA 2WFLA 1IVYA 3R3XA 4G9EA 1OILA 3Q0TA 2VTVA 4UBIA 2ZJ7A 4Z49A 1DX6A 2WTNA 3LP5A 3STXA 5LZ2A 3AZOA 1QIHA 4FKBA 4H7FA 3CCBA 4UHEA 2OAGA 5JATA 4X91A 2QUBA 4J7AA 2Y2UA 4QDZA 1QOZA 5E4JA 1VZ3A 5DNUA 3ED1A 1H2WA 3D2BA 5C7YA 3H2JA 3FOBA 1NU8A 4NZZA 3STWA 3H2KA 4CG3A 4W1SA 2CUTA 4S0XA 2XMQA 4GXNA 4QWMA 2GZRA 3QPCA 2DR0A 1XRPA 4X6UA 4QDXA 5IVDA 4CFSA 5I9IA 3O4JA 4Y2QA 2AJBA 4BDTA 4QLOA 1EK1A 1O6GA 2BUBA 2Y6UA 3W05A 5DNWA 1XRLA 2XMCA 2PPLA 2AJDA 3O95A 3HYSA 3IULA 1X70A 5LKAA 4B6GA 3C8HA 2XMBA 1N5RA 1ZD3A 1XZFA 5ALWA 2J4FA 4LXHA 5JAHA 1UK7A 4ITVA 5AO9A 4NVRA 4J0HA 3JWEA 1Q83A 1BS9A 4EHBA 5A7GA 3G0IA 1EH5A 3R41A 4JNCA 1WB4A 3ANTA 1E66A 1XRMA 3E1GA 4MYDA 1YS1X 5FOQA 4UHCA 1IZ8A 3G0GA 5AH0A 5AOBA 1DINA 2XUAA 3DYIA 3O4IA 4FFWA 4QLAA 1GPLA 3V1KA 3DKKA 2WUEA 1QJ4A 1YSCA 4H7DA 4H18A 1NU6A 5JALA 4EY8A 4W1RA 2OPHA 4WFIA 3FYTA 1VXRA 4XVCA 4RE6A 1CUAA 3F9CA 1PV1A 3FYUB 4QDUA 2WTMA 3V1LA 1R9MA 3NOXA 5HF8A 3DKRA 2R11A 3I6ZA 2LIPA 4KAJA 3QM1A 4YK7A 2WKWA 3WKBA 4Y7DA 4X95A 5LYYA 1QZ3A 2YYSA 3V48A 3STYA 2QR5A 1K6EA 4BCDA 4B83A 3B3QA 3LLCA 3G0BA 4H7JA 4FNGA 2BKLA 1EXWA 1LZKA 3I2IA 5IVIA 3DLTA 2QM0A 3KOOA 4H7HA 1VXOA 4J0GA 4KAAA 1HQDA 3ESDA 4J3JA 3DEAA 3ZLTA 5KWJA 1GPKA 1LPPA 3ILSA 5AKXA 2OG1A 3WK5A 4H0CA 1QTRA 5LZ8A 5K3AA 5KBYA 4BATA 1UK6A 3KWJA 5AIAA 3BF8A 1BCSA 4WJLA 3STUA 1KU6A 1IUNA 1G5FA 4OU5A 3E3AA 2JGIA 3OG9A 4GBGA 1MPXA 3QYJA 4QA9A 4QDTA 5BV7A 2RHWA 2D0DA 4Q05A 3AIMA 2JEZA 4BRSA 3M81A 1CUXA 4CI9A 2OXEA 1JJFA 1XLWA 2BCEA 1X2BA 4PNZA 1CUSA 2ZYRA 1QIKA 3FVTA 1R4ZA 1CVLA 3QZUA 5ALNA 4FWBA 4B7ZA 2NW6A 2QUAA 4H7EA 5C8VA 1PJAA 5A2GA 1T4MA 4H7IA 1DT3A 1ACLA 4ETWA 3UMJA 3R0VA 4FLMA 1XQVA 5JZSA 2XE4A 1XQXA 2R8BA 1XZBA 1QGED 4AX4A 2JGEA 1AURA 3H04A 3WI7A 2WILA 1XKLA 4DNOA 2DFPA 4MYSA 4K2AA 1XFDA 1B6GA 4E15A 1TCCA 4OB8A 3CCCA 1BROA 4BYMA 1G42A 2GBGA 1P0PA 3RLIA 4ZI5A 1GPNA 4H35A 3DD5A 4C4XA 5K3EA 4E14A 1GQSA 3A2MA 4HXEB 4LHEA 4INZA 1ISPA 2O7VA 1WCYA 3TEJA 5ALSA 5AKLA 2PUHA 3WQHA 2RHTA 1LPMA 1XZMA 2OCGA 1FFBA 1BN7A 1JMKC 4JUIA 4B84A 1VE7A 3W9UA 2H7CA 6YASA 5AKIA 1UFOA 4OYYA 1QIEA 4BP8A 2QTBA 4L3WA 4IHAA 3WK4A 4MJ3A 3KSRA 2JGLA 1MNAA 2Y2VA 4Y9SA 1MAHA 3PI6A 5ALEA 1H2ZA 3H1AA 1BRTA 3PE6A 4BC1A 4E11A 4OB7A 5EHXA 3HZOA 1J06A 1HL7A 5HFNA 5AK6A 1S8OA 3G8YA 5AI6A 1TIBA 3R3UA 1CUWA 4J0KA 1THTA 5YASA 3V1MA 4OUKX 1H2XA 1CEXA 4PSUA 5LLSA 2VJBA 5JADA 3FNBA 1CUIA 4UHHA 3U1TA 1K63A 5IVKA 4BE4A 4UUQA 2Z3ZA 2C0PA 1QIJA 5CBKA 4MXDA 5A71A 2B61A 3ZV7A 4XX1A 5D3ZA 3KWFA 4U2CA 5IVHA 3G9XA 5CMLA 5DYWA 1LBSA 5DYTA 1E89A 4FTWA 4BTVA 1E8NA 5CT9A 3DNMA 2V97A 4AZ3A 4KE9A 5J3JA 4C6HA 1GKLA 2PU7A 1GKKA 4WY5A 3VKFA 3QITA 3HEAA 3V1NA 3STTA 4ZV7A 3EBLA 5HKAA 3NGMA 3G02A 4L9AA 5AI5A 3IBTA 4G5XA 4WCVA 5E2IA 1BEEA 2OQIA 3SK0A 4U2FA 1CR6A 3WKAA 4E46A 4GECA 4UBKA 2WG0A 1E5TA 4UFNA 4CIAA 5T4FA 4KRXA 4F0JA 3PICA 4TVKA 3QH4A 4GLBA 1L7AA 1EI9A 2BUCA 5ALFA 5EHNA 1H22A 1C7IA 4QZVA 3ESAA 5K3DA 1ZICA 3EQ8A 2FUKA 4ARBA 5ALHA 5AKKA 1ZD2P 3VJLA 3OURA 3DL7A 5AI9A 1RYYA 3ESCA 3CXUA 4J03A 4RE5A 3LIPA 2WFZA 3BJRA 1F6WA 1ZJ5A 5FP0A 1XROA 1QIMA 4AO7A 3X3HA 3AILA 5AKZA 2VATA 1JU4A 5HF6A 1WHTA 3BE8A 3I28A 3WLAA 3QVMA 2IIVA 2EDCA 1ZD5A 3HRHA 1EHYA 1FFAA 1UWCA 3WWPA 4DYHA 2C58A 5EIEA 4MQMA 4GDMA 3WMRA 2HA7A 5FLKA 4UPDA 1HBJA 5K3BA 4BZZA 2Z8XA 3D2AA 4AMYA 4DMKA 3OC0A 3FCYA 5ESRA 3U0VA 4B0OA 3WKCA 3I1YA 5AK3A 2OCKA 1XZJA 4UBNA 1CUBA 2HU7A 4LXIA 1EDBA 3ZLVA 3P2MA 3BWXA 4C88A 3ICWA 1SC9A 3G9TA 1ACJA 3I2JA 4Q34A 3E0XA 1ORVA 2WG2A 1E3QA 3WL7A 1DU4A 4EY6A 1U4NA 2W22A 1ODCA 3A6ZA 1GGVA 2HA2A 5FRDA 3IUNA 5AIBA 5CXUA 3AIOA 4DNFA 5JIBA 1U8EA 2GZSA 5C8XA 4X6YA 2XUIA 1CUUA 4IO0A 4DNPA 1CUVA 4X3CA 4U2GA 2BUAA 2VQ6A 1C4XA 3BL8A 3O9VA 1MJ5A 3HSSA 3RARA 3IB3A 4C87A 4XJVA 3RM3A 3C5WP 5HK8A 4Y2SA 2C4HA 1DQYA 2K2QB 2BJHA 4EBBA 4OU4A 3DL4A 4J0JA 3HACA 4AO8A 3FSGA 5EI5A 1HLGA 3MVEA 1UK8A 3IDAA 3WYNA 5KWIA 3R3VA 2XUHA 2ONCA 1XRRA 2EEPA 4FMPA 2OLEA 3R3WA 2G5PA 4IH4A 3PF9A 4G4JA 4IH9A 1F0PA 3D59A 3C6ZA 1HDEA 4GW3A 1U65A 2V9ZA 4U2BA 4X94A 1XLVA 3A2LA 1EA5A 1XLUA 3L1JA 2XLBA 2QXTA 2YASA 1JJBA 2XQKA 3PFCA 4GI1A 3SX4A 3LCRA 1AX9A 4FBLA 4OD0A 3PDCA 3C6YA 2V96A 4G8DA 4AN1A 2JGFA 4HTAA 1M33A 3AFIA 2WHQA 3C8DA 4PQEA 1C7JA 5JARA 2HL6A 4Q82A 1MX1A 3D3NA 2XLCA 4W1PA 2CKMA 5CH3A 4X6XA 1A8UA 1ZIYA 4N8DA 5K5EA 1ZIXA 4X97A 3F67A 2I03A 3KDAA 1GZ7A 2WHPA 2B4KA 5AI0A 1BEZA 1CUDA 1R9NA 1TRHA 5LKRA 2ES4A 5CT8A 3ESBA 1EX9A 3I2HA 4DMCA 2GYVA 2B9VA 4UBLA 4YASA 4CCYA 4KRYA 4BCBA 2VJCA 5EIAA 1QO9A 3I6MA 4BVLA 1SCQA 3E4DA 3FBWA 5ALLA 1LPAB 5JD6A 5I7UA 1XZAA 4LYDA 4HRXA 3ICVA 2VAXA 2XUPA 1Q0ZA 1BU8A 2BFNA 2XUOA 4OYLA 5ALQA 4B0PA 2HHAA 4J0CA 3C5VA 5HFAA 2I78A 3F96A 1IMJA 3B12A 3G0CA 3GA7A 3KXPA 2DHCA 2ECFA 3M82A 3MUNA 2ACKA 3GFFA 5HKBA 1VLQA 1H23A 1USWA 2WUGA 1SCIA 1QLWA 4DMHA 1R50A 1HKHA 4Y2VA 4Q3OA 3AINA 4B80A 4A23A 1Z68A 2WIKA 1A8QA 1MX5A 1ODTC 1NX9A 5LP1A 1CRLA 3WK7A 2ZVDA 4FLEA 4NS4A 5ALJA 4CCWA 3F8SA 2JF0A 5F4ZA 2WUFA 4ZRDA 1DX4A 2PU5A 5EHQA 2GBCA 2OGSA 5ALXA 5A7HA 3IVMA 3EQ9A 1XRNA 5AOCA 3K2IA 3BF7A 2PSFA 3WIBA 5CT4A 1CUCA 3BDIA 1ZD4A 2X76A 3RK4A 5JZ9A 1MNQA 2WUDA 4UBMA 3R3YA 4OCZA 2E3JA 4F21A 3WWDA 3F98A 2HU8A 3UUEA 5AP9A 4HXGA 2O2HA 1GXSA 5FDFA 4BP9A 3WWCA 4EB0A 3VDXA 1QIIA 2WIGA 5JYCA 2WJ6A 3CN9A 2HA6A 5HF5A 4BDSA 2I3DA 3I2FA 1IUOA 1EB8A 5IH7A 1N5MA 2ROQA 2XI4A 2VF2A 1EVQA 2VAVA 4DMFA 4P9NA 4C89A 4TGLA 3LS2A 3ANSA 3STVA 1K4YA 4P08A 1P0QA 4N5IX 2C5FA 3BIWA 4HS9A 1VZ2A 2VT7A 3BXPA 5JD5A 3WKDA 5DTIA 4IQ4A 3ZWQA 4HRYA 2DQZA 3W9BA 4PW0A 4EUSA 5HF9A 4MWTA 2FJPA 3IUQA 4L72A 3WA6A 4BE9A 1W6RA 1FSSA 4U2EA 2HA4A 3IUMA 2WHRA 3O9MA 2HA3A 5AM1A 3H0CA 3WK9A 1UKAA 3MUOA 2OAEA 2WHPB 4BVKA 5D7BA 1LBTA 3H2HA 4DGQA 4P93A 2FJ0A 2OGZA 2O2IA 1XZLA 1CLEA 5CXXA 4RPCA 4CG1A 3WIOA 1YASA 4G1FA 2PSDA 4CCYB 2JGMA 1R3DA 1MU0A 2RONA 1UZAA 4G8CA 1QIDA 3HJUA 3C6BA 1CFJA 3OOSA 3GELA 4PO3X 2VSQA 2HIHA 3HC7A 5C81A 1UKCA 1QIFA 1ORWA 1U2EA 1T2NA 2G63A 3OPMA 4KE6A 2Y1KA 3B5EA 4C4ZA 2H7XA 5DLPA 2PM8A 4W63A 1G66A 1YCDA 3K6KA 2PSEA 2Z8ZA 1XZDA 1ZOIA 3K9BA 4FFVA 2XUDA 4MQLA 5ALRA 2JGKA 1CIJA 3S2ZA 1MAAA 5LZ4A 3IURA 5AI4A 1CPYA 1F8UA 2VJDA 3D0KA 3C70A 2ZSIA 3OTQA 4QDOA 4W1QA 5ALYA 3WK8A 4BAGA 2PVSA 5JAPA 1CUZA 3GROA 1K8QA 3BJMA 4L0CA 5JD4A 1A88A 2CEKA 1JFRA 4KJXA 5BWCA 3WJ1A 5FV4A 4QEKA 1ETHA 4GWLA 2VT6A 5HQ3A 4A5SA 4UHFA 5SYMA 3DJYA 2HA0A 2Z3WA 1WM1A 5AJHA 1XZIA 2PBLA 3D4LA 3G9ZA 5CT6A 1JU3A 1QTIA 4K6KA 2XQIA 2QT9A 2CJPA 3NUZA 1TCBA 1XKTA 3FLBA 1UK9A 1TK3A 1LNSA 4QE3A 2WIJA 4BCCA 1XZGA 3SC2A 2H9YA 3CN7A 3QPAA 4JEIA 5ALVA 1EVEA 5D6OA 1MTZA 4PF1A 4C01A 4KR0A 4C4YA 5AM2A 1JMYA 2DSNA 5CH8A 3DOHA 3NWOA 2QVBA 4LIPD 2BGRA 4GHWA 1TQHA 3HI4A 5AM3A 4Y2UA 5AK4A 1W75A 5A7FA 2WU3A 5EFZA 4ZWNA 2XUFA 3H2GA 1K5PA 3H2IA 1YS2X 2HRRA 5KREA 3O4GA 5DTJA 2Y6VA 3DOIA 1SFRA 4EA6A 3WZMA 4HZGA 1CUFA 1KEZA 2XMRA 4W9RA 1ODSA 4PV7A 4KE7A 3VVLA 4KEAA 3I1IA 3VXKA 4EY7A 4UFOA 5IKXA 4AQDA 3T52A 3FYUA 1THGA 2Q0XA 1DQZA 3H17A 5ALOA 5LZ7A 1VOTA 5I8PA 1XZEA 3HABA 4UFPA 2RGUA 2G4LA 3FSGD 5ALIA 4P92A 4BVJA 1FFCA 3O0DA 4B9AA 1B41A 2ZSHA 4H77A 5JANA 3ZLUA 1J2EA 3WWEA 1CV2A 1VJ5A 5D3KA 3A2NA 5E4YA 4X7BA 1QIGA 2HFJA 1W76A 2WM2A 2ZYSA 1BE0A 1TAHA 1KU0A 2PX6A 2WG1A 5DJ5A 2WJ3A 2WJ4A 5CW2A 3I2GA 4UHBA 5DNVA 1UOPA 5HCUA 1Y7HA 2ZYIA 1Y7IA 3D2CA 4ZREA 5A6VA 4RNCA 1LLFA 1QONA 2CMFA 1SOMA 3EQ7A 1MT3A 1UOQA 3PUIA 1WPRA 4Y2TA 1YAHA 3FLEA 1P0MA 1IZ7A 1MN6A 1TKRA 1UOOA 5AKGA
chains in the Genus database with same CATH superfamily
1F51E 3CB4A 2VUIB 1RC8A 1RRCA 1DWPA 3FWHA 1KFJB 3M3DA 3ZU5A 4W5RA 1PLKA 1EYZA 2ODNA 5F9MA 4HH1A 1M6YA 3O2QB 1QG4A 3KSMA 1DQPA 4LJ8A 4LYAA 1T9HA 3NTVA 4US0R 4ZI7B 4I19A 2BRUA 3DFUA 2QMHA 1UT6A 3D6AA 4AK9A 4JGBA 1NBIA 1IUKA 4OXQA 1DLJA 3QF4A 3ZVNA 4TUYB 2FUG6 5BR1A 2ODEA 1LPBB 4LSWA 5DYYA 4WY8A 3IQHX 4MV8A 2YOGA 4HQFA 2IXGA 4UPVA 5A4DA 2R60A 4F9EA 5FXMA 5FUMA 1EB9A 1PKEA 3QIAA 3MRXA 1EINA 4JOBA 4KDCA 2JEYA 4F1WA 2FDCA 2W2LD 1SQ0A 3H65A 3ODGA 4ZVTA 1T36A 1R6TA 4FFBA 2ZK7A 3AHCA 4KPUB 3U5TA 3KX2A 4D2IA 1OHHA 1Y4DE 2GBFA 2HJGA 2HLDA 3P9RA 4KQCA 3OX3A 3LT1A 2EGHA 3K4HA 4G9BA 4XGIA 4DB2A 1J42A 4WBNB 2GSDA 3A10A 3OLQA 1T8YA 4OOFA 4KQ2A 3MWDA 3QKTA 1QQ5A 4LW8A 1DIOB 1CQIA 1RQ2A 3JALB 4KYVA 4Q3LA 3LHFA 4RZIA 2UXBB 5KAMA 4YIKA 4K3UA 2DCMA 4YECA 1FPMA 3QBVA 1JX6A 1Q84A 1BKDR 1S4QA 2X14A 2X8LA 3R23A 2YJ3A 4F85A 4QUKA 2XBMA 1FW8A 3ZW8A 3ESXA 4UEQA 3SDSA 2R4QA 2RAUA 4UBJA 1JHUA 1EE1A 1P5RA 2NUPA 4YGXB 3TQCA 2J5RA 1BO6A 3KIPA 3ZQKA 2XKJE 1L5OA 1WV1A 2C2ZA 2IEBA 3BRWA 4TTIA 5CH5A 2XE8A 4C4OA 5LWHA 2DCUA 1CSEE 3M4YA 3KPVA 2I4TA 1WOMA 1AS0A 5K3CA 3QU5A 1QGYA 1XELA 2HFKA 4WHMA 1QH1B 5CXQA 4LJRA 4AZ0B 3ADDA 1N1MA 2I6QA 5FBQB 3PEUA 2FZCA 4F96A 2HN9A 3TINA 2YXPX 1S8NA 4KQEA 3CO5A 1FUKA 3NX4A 3OSUA 4V0KA 4X93A 4NOJA 1BDIA 4IDHA 2QM3A 1MVNA 4BKMA 1WF3A 3EDMA 3A26A 4K2HA 1G5PA 5HILA 1N2CA 1Z07A 2ZCJA 1L7PA 4IDBA 3BMCB 4ZV9A 1CR1A 3DEJA 4YI5A 1DS6A 3ZGVA 1QFSA 5A3VA 2IUFA 4FHZA 1T10A 2AXEA 4IS2A 1PJ4A 2V0CA 4D0NA 2X4IA 5HZGA 1OPRA 5G0UA 2NU6A 3UV7A 4PU0A 1SUSA 1ZONA 2X5XA 3B1VA 1YV9A 4JHXA 2VTKA 5KOHA 3DBOB 3UW1A 1W5AA 3EZ2A 4F1JA 3KK0A 1J4AA 1PBNA 3C7KA 1A71A 1MA3A 2BGUA 2YCBA 2GHIA 5KJ6A 3TYXA 1UQTA 3WBKA 2XTNA 5FOUA 2WR8A 3DLAA 5IZCC 2P5TB 2K4MA 1C9JA 1X19A 1GG8A 4BTEA 1E2BA 4OPMA 2OWDA 4R6WA 1VRCA 4ZIRB 1PYDA 4RZSA 3AR6A 1EG2A 2CNLA 1LPOA 4UU8A 5CURA 3CGWA 4RVGA 1FJ2A 1ZBQA 1A8SA 1UWKA 1D6SA 3AW9A 2AJCA 4UUPA 1S2IA 4HUQB 4BMXA 3FVRA 3A9TA 2P2DA 2OCPA 4I9NA 3A9SA 3UPDA 5FUBA 3GZTB 1JT2A 1YZTA 3GUUA 3QTBA 2PKQP 1OX6A 3ML1A 1RBQA 1ODKA 1JG2A 1O03A 1Y4AE 2A9RA 3FMVA 4KIFA 4HLUC 1P2SA 2G28A 3KDPA 2A92A 3ZK7A 2G25A 3FCXA 4D25A 1RXCA 5JBQA 1XVIA 2WIDA 5AXDA 5T3YA 3D7NA 3FCSB 1ZH8A 3JAWA 4MW1A 5E7IA 5E2BA 4TYNA 8ABPA 1RXWA 1VJCA 1GPAA 2L42A 1XHLA 2I4LA 4XIJA 5DSTA 3NPMA 3KKOA 3WX0A 4NE2A 4FSXA 2XYRA 2NT3A 4X44A 4ZCPA 3AZQA 5AFSA 4GMHA 4PINA 1AKRA 5EHZA 3IAS6 3HI6A 4FFRA 2HU5A 4QYIA 5FNVB 2QD5A 4X1OA 1KJZA 3PV0A 4N0MA 1UPAA 1M5RA 4DSUA 3A6EA 3LBNA 5JJKA 4NAHA 1M5UA 2JLYA 1ML4A 4G85A 2QLFA 2XUKA 1YTUA 2V58A 1GZ4A 4PSDA 2FWBA 4J90A 1KP9A 1DDGA 1J1UA 2GBLC 1E7WA 2F3UA 4M0EA 3ZIDA 4C5BA 1T0BA 3E22A 1VSUA 1HE3A 1M7HA 4Q4DA 3T7JA 3BZWA 1IB0A 3MLEA 3NIDB 1HF3A 1CUHA 3ZPXA 2VZ9A 2WU4A 2CDBA 2H31A 1J8YF 3NXSA 4IDGA 4PG5A 2ZYHA 2Q5QA 2FQQA 4M60A 5B57C 4K1XA 2CCJA 3HP7A 4PLHA 1E6CA 1M0SA 1JH9A 5JSUA 3SYRA 2B0CA 1SZPA 4LZNA 5IAJA 3D6UA 1LPSA 2ENUA 3FGPA 2YRWA 4Y2YA 1ODJA 1Z47A 3ZKWA 2VP6A 4D92A 3N2NA 2OD2A 5BXYA 4OGWA 1IXSB 2W4IA 2AE1A 4GLJA 3CUUA 2HLPA 2ORYA 1W4LA 5EJ2A 4DPMA 4MHTA 3TLXA 1JG6A 4M8IA 4CG2A 5JAOA 4KRFA 2XKAA 5CLQA 3OOYA 4LQ4A 3AQIA 4UUAA 4QREA 3CPJB 3DAYA 4MSUA 5C3UA 4JAVC 1A7JA 1BGXT 4N6GA 4A0GA 1ZGAA 2GFQA 1WB6A 3KLMX 3RUIA 3FJ1A 5IBRA 3ZV5A 2MIIA 4N6NA 4HAIA 4QTXA 1ENYA 3CLRD 3ZLBA 4A2WA 3SPXA 5BWBA 1J22A 2C8JA 2YJZA 3CYFA 3SX2A 2P41A 4KPYA 2QY9A 3LQYA 3MTQA 1C7QA 3QWBA 1JQ3A 5AW5A 2PX2A 4Y0VA 5TX7A 4MUMA 4JP2A 3TNDA 3PQ4A 2GILA 3ZGNA 4D3ZA 3KB8A 4WLOA 1M67A 5EQDA 3NVDA 4MS4A 2O8FB 1VIDA 1W5FA 2IIPA 1ZVQA 2WPDA 4E5SA 5K8CA 2H1OA 1O77A 2Z9DA 5FFFA 2LKDA 4JCCA 3GZ4A 3Q5EA 3VNRA 5KYUB 1Y80A 5K09A 4MIEA 1X7YA 2VNAA 2ZVPX 4HDOB 3MWLA 4UU1A 3S6JA 1QFYA 3WLJA 1YWGO 3ROQA 3JQ6A 3RGGA 3WWOA 2H3HA 3HLKA 3ROEA 1XCJA 2EXXA 1UC5B 1W2HA 1J39A 1QSGA 4MZXA 4AS3A 5BUQA 2OKCA 4RTPA 3PQCA 1JJIA 2O57A 5AVOA 5BQXA 3LTNC 1VE3A 3C45A 3SIXA 2X2EA 2Z30A 1HEIA 5IMBA 5GONA 1PQWA 4G0NA 1OH5A 1ZGBA 2C8KA 4QOJA 1NNLA 1SD2A 2HMVA 1ARZA 2PUTA 2VIIA 3W1WA 4DTCA 4S2UA 3RR2A 1XOIA 4IVPA 4UTOA 5T4BA 3RVSA 5FOWA 2H0RA 2LP4Y 3CH5A 3VR0A 2VFAA 4MV1A 4WA8A 3S2YA 5EIWA 5LWQA 2PFKA 2X9LA 3LT2A 2PUBA 4IMPA 3AUYA 2FSSA 5JAUA 2Y4NA 3FROA 1W1IA 4Y1RA 2GLTA 3INYA 5KVAA 3RHTA 5FPSA 3IAXA 3RO7A 2CUNA 5LC1A 4M87A 1WZIA 3GJZA 1II8A 1W52X 3RT7A 4ZCRA 1QLHA 1Z4QA 2CFOA 4PFJA 4WLFA 2X7HA 4TKZA 4RUKA 1FL9A 3ED5A 4NK5A 2GPTA 3QYFA 1R15A 3MGAA 5LQDA 1US8A 2FW9A 3EK2A 1A7UA 5ERXA 2XXJA 3OZFA 3KTDA 2Q3LA 5DDIP 1BN6A 3DWGA 1ONNA 1Y3HA 4EMUA 3H1EA 3Q3IA 4IEFB 2GEJA 4J4TA 4ENRA 2O2CA 5CA0F 5CA1F 1M1XB 4FMDF 4TTPA 1DKUA 2XMPA 3FFWA 4A16A 3BTUA 3DOUA 1BMTA 1M7BA 3HXKA 5AOAA 1KYWA 1EXDA 2MYTA 5JCPA 4H3HB 3MFYA 2J3LA 3L8HA 4BNKA 3ZHYA 2XUQA 3K8ZA 2A5LA 3IKVA 1V8ZA 2G4CA 2PJZA 2NZJA 2QT0A 3NS7A 5IUJC 2XZLA 1JG4A 1QAQA 2JIRA 5D5HA 1Y48E 4LXQA 4RKRA 3FVQA 1E1YA 1ZL0A 4G86A 3T1QA 2H2GA 3U3ZA 1T8RA 3L06A 1WMSA 3VR3D 1JWBB 3SHTA 3CGGA 1YDHA 1ZGCA 1DAPA 2DTDA 3ZWPA 2OV6A 3V6LA 1Q0QA 2IITA 2FZEA 2PGXA 4WFKA 4WACA 5E6UB 2G09A 3QUQA 4RKQA 4YRSA 5LLDA 1M3SA 5AVRA 3TM5A 2BBOA 2IEYA 1XDUA 3VI4B 2A9FA 1I9GA 3IBCA 4YFVA 4LZJA 4GE3A 3QBTA 4RDXA 3ERCA 2F8MA 4R5HA 3QLUC 3AJAA 4CM4B 1WEHA 4AXBA 3FE2A 4M0FA 2IXBA 4RCZA 1IMOA 3GJSA 3QBJA 1OREA 4PYLA 3RAPR 2VYCA 3RSOA 1Q91A 3LWZA 1XEWX 2FP4B 2QL6A 3GJ7A 1GCAA 1LC3A 1JR3E 1P61B 2O2GA 4BXOA 5FEMA 2WQ6A 4S35A 1VMEA 2GX6A 3GLUA 4Q1VA 1LNQA 5AK5A 1X7DA 4JR0A 4M55A 1YKGA 1NW7A 2Q1XA 3PDWA 3W5JA 1V16A 1W1WA 1YQGA 2ZOSA 3FDZB 4K6CA 4MWSA 2LCIA 3NHYA 4JD5A 1JTFA 3PHHA 4DNXA 2X0IA 1TEHA 1FBTA 7MDHA 1ENOA 1ISHA 5DHSA 3GD5A 5B1DA 3N6RA 1GNLA 1O8CA 1VRWA 2QMEA 3L8FA 4RC9A 4HVAA 2IOFK 3ZY6A 1VE6A 3QKUA 2Y0DA 3VJMA 1P0FA 1GRVA 1PL6A 3GVPA 1TQ8A 1XJWA 2YWJA 4C20A 2OL4A 3S29A 2GZDA 1H1LA 1DT5A 5ALTA 1USGA 3VVMA 1N5LA 3DXXA 3PD7A 5F64A 4BRUA 3ILXA 2WWYA 1QB8A 5TQ2B 2IPNA 5JNWA 5A62A 3DULA 3VH1A 4RY9A 2PYDA 4B3IA 4GXQA 3INGA 2PRYA 2XT0A 1C1XA 3OLCX 4JB0A 4ARZB 4BP1A 3RFVA 3VU0A 1YBMA 3WZLA 2QB5A 2ZI6A 3S1SA 1F0KA 4DABA 1ZAKA 2X41A 1IZYA 2ERYA 1NVVR 3ABQB 4KAFA 4RHXA 1QR2A 3CCFA 1NMEA 1R0WA 4HGOA 4I9FA 4IIFA 1F0YA 4Q6WA 3DVAB 5DCYA 4RPJA 5EMNA 1LPNA 4BGEA 3TE7A 4CT0A 4CEJB 2G36A 1KSJA 1PCXA 2NZVG 3ONFA 4L27A 3WQRA 2O8EB 3U16A 1YZGA 3ZJ4A 1ULTA 2ECKA 4EYSA 1Z28A 2W5UA 1ISMA 2IGTA 3E81A 1SG0A 4QNNA 4DL9A 5JNTA 3QOWA 1RP7A 4N3GA 3IE0A 4Z1MD 3BEOA 3N2GB 2E9SA 1R88A 3EIOA 2BZ0A 3RJZA 2XQFA 4LRWA 2OVBA 1WIWA 5D00A 5FPKA 4KHPB 1J8QA 3NRJA 1TCAA 1AMUA 2IYUA 3CUSA 4D1YA 2LDBA 4DYVA 2ZE6A 1XQYA 3KPJA 2E89A 4IG9A 2OCXA 5LIPA 3PHJA 1FDWA 2XNCA 3I9FA 4LOIA 4D26A 2BLNA 2OOSA 4I3GA 5EA2A 3MUFA 4BTLA 2CHFA 2ERCA 4MDFA 4JH0A 3VJKA 2PZ8A 1NR5A 1GY8A 2ZE8A 4U6NA 3SAJA 4MWCA 1XZKA 1E61A 2RJOA 1BHSA 1Z5GA 3HU3A 3PX2A 3ZJ5A 4V2IA 4BFLA 1A4IA 1NIJA 4XA8A 1VJ1A 4GOOD 4M0LA 4DBLE 3OIWA 3W5DA 3V8PA 2QMOA 3KQTA 2ZIUB 3O3OB 4XQCA 3RIXA 1LF0A 3ZW9A 2OVFA 2Q6OA 4CYMA 3GH3A 2LRHA 2RHLA 221PA 3FXAA 3VYTB 1A9SA 1QGDA 1Z0FA 2HOQA 1YIAA 1IM8A 1L4NA 3FRHA 3WLKX 3VSAA 3BSYA 1T0IA 2MWMA 1Q0LA 3PZBA 2BE7A 2CXQA 2Z0MA 2V7PA 1E60A 1YU9A 2GUWA 1W48A 3TBFA 3V33A 3ZDZB 4D8XA 3T95A 4BV8A 4Y2JA 4ENWA 1C30A 1THZA 2C2MA 3E9EA 4AZ3B 2PKEA 2Z5GA 3UUFA 3WL8A 5EWJA 3SC4A 1TT5A 2O6HA 3BT7A 2RIRA 3R5SA 1QYDA 3ACCA 3JRXA 1COWA 3AEXA 4JI5B 2YHIA 2VEOA 1O6FA 1OOEA 3IXMA 3GH1A 1P7CA 3L3BA 2EX0A 4NZYA 5H3LA 1YB4A 4X63A 5K3SA 1CR2A 2YWXA 4RVFA 5K2MA 3EVEA 3MIIA 1IN6A 2Z1MA 3IJPA 4Y9TA 4YONB 1JDSA 4J2TA 3W5BA 4EL0A 1CUGA 2CFTA 4XPZA 4Q4JB 3VNVA 3MGCA 2JIZA 3JRNA 2IU0A 5I9TA 4B82A 3INRA 3K5HA 2GCNA 1G3RA 4OHKA 3ZD9A 1JKJA 3K2QA 4C9BA 1SRQA 3TLJA 3KZOA 4LEIA 5EMJA 4HH0A 2WJYA 5EE9A 4LY0A 4OB6A 3BB4A 3EG9B 2JCSA 4OKIA 1GTZA 5L40A 5LZ5A 2Q0HA 3KEOA 3AKDA 1KL7A 3T7IA 3BFJA 1CY0A 1USIA 2D8AA 2ONZA 1PG2A 3FHOA 1LX7A 3G5TA 3I6QA 4Z3DA 3C1TA 5FNZA 4B4OA 4P4GA 1T91A 3HWX1 1QV9A 2ZPUA 1JFVA 1RJ9A 3O90A 4ZCSA 3PX7A 5H68A 3NOQA 3AB7A 4BQFA 1CS4C 3L1HA 2GCPA 4B7XA 2GKGA 9ATCA 5HK9A 1LSJA 4RY8A 2W37A 5CA0A 2YH2A 3OEED 4LYJA 3LKDA 5A05A 1CTQA 3I73A 3DE5X 2J6HA 3E05A 4ZQGA 1X7XB 3DFFA 5B36A 1ZDMA 4CLDA 2X8JB 2QU8A 4TPKA 2R4TA 1JIIA 1E3TA 1OWPA 4B9EA 4LSMA 1AQIA 4BC0A 1EM6A 3BTVA 1GAXA 1ZSYA 2Z58A 3CLUC 3IVGA 1A96A 2I3ZA 3QP9A 3QVOA 4WV3A 1HV8A 1JQAA 3T7CA 5K7SA 3KJZA 1KK3A 4W8OA 1FMCA 4AO6A 1GEGA 2ZRHA 3HN6A 4A82A 3OM9A 5C7IO 2IUTA 3K1JA 1MENA 4WKBA 2WFMA 2PXAA 3H9BA 3WRWA 3AVTA 4B35A 5CT5A 3DVLA 5KDLA 3PSAA 1PT7A 4B3GA 1HURA 3K5IA 4FKZA 2I91A 1H2BA 2HXYA 2GBIA 1VA5A 3BHJA 1Z6YA 2AKYA 4AN0A 2VQSA 1LSOA 1E79A 3FLAA 1UDWA 2UV8A 3DZBA 2FDXA 3MYYA 4I6JA 1JKMA 2YHAA 3TRDA 3DZJA 2C5GA 5UKDA 1YE5A 2IYNA 2W7TA 1L7RA 3IUPA 4D9HA 1CR0A 2GK4A 5IAKA 3BB3A 4MKIA 2FR8C 5BNFA 3C3KA 4FC7A 4XCQA 2F1HA 1CB0A 2ORWA 1M10A 1E7MA 3FB1A 4FHFA 4LV5B 5LQSA 3WGQA 2ZZNA 2DHQA 3NH9A 1UAGA 2J6BA 2YFKA 3IALA 3ABSB 3WNBA 1Z9BA 2Y4OA 3UM9A 2BJWA 3SR4A 4L57A 3UAOA 2FFRA 2RD2A 2GO7A 3ONDA 5FTKA 5EWLA 4HDKB 1JDJA 1JNYA 4FYMA 1Q0UA 3JAKA 4HDSA 1YQTA 2C2HA 2IXTA 2QMZA 5H02A 3PXCX 4G0WA 1KBOA 4G4GA 4KFRA 4P82A 3DF9A 1Z6XA 4NBRA 5B1IA 5BY2A 2PRJA 1FDSA 2R8ZA 3R3XA 1K5GA 4G9EA 5HW0A 4A27A 1Y1TA 2HJWA 3Q0TA 2DX7A 3H9CA 1M1YA 1JE1A 5AYVA 3HXMA 2VTVA 1DJLA 4FYJA 1PJ2A 1T9CA 3RU2A 4EJ0A 1C1DA 2WTNA 5E8JA 1D4AA 2C42A 1VSQA 1W6UA 2FMIA 1SHJA 4RXUA 3STXA 4KLCA 1L4LA 3VZBA 1DXHA 3L43A 3F5DA 4EK9A 3PPXA 4J29A 2COUA 1YI8A 4PZ9A 1E3EA 5BMOA 3H2SA 4X91A 2QUBA 2JGDB 1C41A 3PEEA 4J7AA 4UDXX 5I3CA 3U4QB 2CMHA 5E4JA 1OAKA 3GGJA 3QWIA 1PWEA 4LOHA 5EKTA 1XWWA 3ED1A 3MOIA 2HMUA 2VOJA 1E2NA 3W4IA 3CVVA 3E5NA 2KYRA 5I7FA 1P33A 4G4SP 1TCUA 2VHXA 2NACA 4BO2A 3DPUA 3JVEA 4LHZA 4PCAA 1RQNA 3R1IA 3T12A 4LFCB 1VPDA 4B3DA 2AG5A 4TTTS 4DUYB 4FYPA 4BNLA 4NZZA 3EUAA 1U0EA 3STWA 1E9FA 3H2KA 1V6AA 4CG3A 2EGUA 4WCFB 2CUTA 1PX2A 2BM8A 3EZGA 2QAGB 4S0XA 1KAQA 2X15A 4BGUA 2XIJA 4DQVA 1GSOA 3M6WA 1ML3A 3QVSA 1W85B 3QPCA 3REGA 1U7HA 1YC5A 3MWDB 5EJ5A 1XRPA 1F4VA 1JSCA 4MWEA 3VZSA 1I3MA 3VYWA 1VE5A 2OV8A 4ZA2A 1CZKA 1UMDA 4B32A 1GPBA 2P69A 5BURA 5I9IA 1XZQA 3K8YA 4Y1GA 2XRYA 1XXHB 3EGOA 3QQ5A 1OKKA 4MAFA 1TIPA 3V4FA 1GA6A 4U8HA 1WY5A 1ORHA 2AJBA 3H5LA 4QELA 4WK4B 2RKOA 5I9NA 3ZIAA 3TGPA 4I9HA 2QTRA 3LKBA 4BMPB 2I3GA 3MMXA 3C3WA 3W4KA 5DM60 1IM5A 1E2MA 5C5EA 3GXOA 3BS4A 5A2QA 4YCLA 5LQUA 2CNNA 3AEQB 1T8UA 3Q7PA 4BNDA 5IDXA 2VTBB 3LCJA 5EP1A 1N2GA 3KUDA 1Z2NX 5CVEA 1VHQA 1GUZA 3DBHA 2DAPA 2EZ9A 2WAOA 1KYVA 1B74A 3IULA 1X70A 4ENSA 5A4KA 4RL4A 4ZT2A 5LKAA 2V03A 1UBSB 2P4UA 1Q6YA 3PFIA 3EVCA 3OM0A 2XMBA 4B5KA 1U7WA 4EI7A 3T5TA 4RZXA 2BTQA 2C4NA 1P2BA 3NGLA 3AG5A 3GLVA 4I5FA 2W6OA 5CVJA 3BGSA 1XZFA 4NCXA 5ALWA 2J4FA 1NDQA 2E55A 4FHEA 1JPUA 4B47A 5JAHA 1JEQA 3QEMA 1QGAA 5AO9A 1B6TA 3R6DA 3TJRA 1L8AA 2O0HA 3RVLA 2UXDB 1WVIA 4P1ZA 4JLOA 3QEKA 3RC2A 3FJOA 4K81B 4TZKA 5E7JA 1TUBB 4M1KA 5IM4A 2VH1A 1Q83A 2RHCA 4TKMA 2H2AA 4G23A 5DI9A 4F1KA 1E64A 1R0RE 4WT7A 4O2BA 4GVPA 1AUQA 5ENVA 4QOEA 3UJ7A 4EL5A 4MX8A 3GLGE 3WLIA 1WB4A 3ANTA 3I9JA 3ELBA 2WC1A 3GLTA 4MYDA 2WV7A 2WT9A 4WNAB 3FPJA 4CM8A 1JPNA 1GPJA 4G1EB 3ZXSA 4CQLA 5B37A 4UHCA 3H3XA 4OSPA 1UJ6A 4C7MA 4B76A 4CN9A 2WM8A 5AOBA 1DINA 1YONA 3F7NA 3GV0A 4TTVA 3UAXA 3ZVMA 4IQ8A 2IF2A 3F6PA 1UJBA 3EODA 3QG1A 2KWIA 4V0NA 3DYIA 3D3KA 5HS4A 3O4IA 3Q3HA 2IOHA 5HJ2A 1ZN9A 4HQRA 3LDUA 5DX1A 1S2MA 2HUNA 3H4TA 4EYKA 2B8JA 2JKYA 3DKKA 3QEAZ 2ZRLA 3IUSA 3SD7A 1UPFA 1V71A 2VRBA 1OAAA 1TO2E 1HDXA 1QJ4A 1IY9A 1T4GA 1YSCA 3KOUA 5GM1A 4M1EA 1DOHA 4I4NA 4EY8A 2KW5A 2R1VA 3N2YA 3O38A 2OPHA 2A3RA 1RNLA 2PCLA 4HUJA 4KXQA 3M2PA 3VZCA 4RE6A 4B1FA 2WNHA 3HQ4O 3GHYA 2P1DA 1SQGA 1RZ3A 3FYUB 1UDXA 1GSAA 2BKAA 5FHRA 4QHTA 2PIAA 3EMBA 3LT4A 2G0NA 2ZAYA 1U1GA 4QDUA 3T7RA 1M6EX 3GLIA 2IBSA 3FR7A 3DDHA 3DKRA 1Z2DA 4E33A 2R11A 3EAQA 3I6ZA 1IEQA 4OJMX 4KAJA 1RAFA 1Q3TA 5BRJA 1VB5A 5HZKA 3CXRA 4GEKA 5LYYA 2XWBF 1SJ9A 2YZMA 1JIXA 1QFJA 2HTEA 4LJAA 2YYSA 2F9FA 2C5BA 5AJWA 3W3AH 2H11A 3STYA 1RDFA 2QR5A 2ZQYA 4R9NA 3PXDA 4RXMA 4ZKDA 1EAMA 3L7CA 4I5EA 1JE0A 4BCDA 5CX1B 4B83A 3B3QA 1A2BA 1BGWA 3EARA 3MPUA 3NKVA 4A8JB 4ID9A 2VYQA 2IYZA 3LLVA 4R9SA 1VB3A 4FNGA 2ADOA 2BKLA 3CLSC 3BXZA 1LZKA 2AL7A 1WF6A 1KFEB 1EVJA 2A67A 3OZXA 1GPWB 1DUVG 6Q21A 3BQMB 1JBKA 1TE2A 3FR8A 3KOOA 4H7HA 3FCAA 1YT5A 1VXOA 3UPTA 3FWPA 4KAAA 4OGKA 3GVIA 4K88A 1ZKDA 1CY8A 4AJOA 2Z9CA 4GBMA 5EC8A 3IVRA 3RS5A 3MW8A 3ILSA 4NDAA 4OAQA 2DB3A 2OG1A 2OV4A 3LBHA 2ZT5A 1FSGA 4W7HA 1RYEA 4CKWB 3NBFA 1AS3A 1ZW1A 3OTOB 1NVVQ 3G23A 4HDQB 4U63A 3OOEA 1KI9A 2NZWA 3JQBA 3H2YA 2J3HA 1URPA 3GFBA 1IHPA 1EQUA 4U9IS 5AIAA 5ILOA 5I8ZA 3FSEA 2G9ZA 2H1LA 1BCSA 4CJXA 5JYDA 4DN6A 3ZEAA 4YUXA 1R6VA 1UWVA 3W90A 1Y6GA 1G5FA 3I6BA 2NUAB 4OU5A 2R6GA 2P2GA 2TRSB 3KZNA 3Q8LA 2JGIA 2DR3A 3AX6A 4NENB 3HJAA 3MJVA 4IIJA 1EFHA 4P5PA 4GUDA 4R31A 3QK7A 3VPGA 2W8ZA 1EM8B 4D9MA 5JMTA 1GZVA 3N0WA 4HEQA 2JH3A 1FUEA 3PYMA 1Z4OA 1EGAA 1P7VA 1U3UA 2DULA 3H8JA 4P2BA 3SHOA 3TL2A 3V42A 4BJ6A 4DCOA 2QZ4A 4YRIA 2DFKB 3SZUA 4FUTA 4BRSA 4P58A 3FMFA 1YFJA 2ZSKA 1HQKA 3OWXA 2WF9A 2VUSA 4MVJE 2XWPA 3CZRA 2GWRA 5CIYA 2FWMX 3TQRA 4OXYA 4KB5A 4AY3A 4OL0A 1U9YA 3G79A 4PNZA 1YL7A 4AJPA 2ZYRA 1G55A 3D8UA 2HQ1A 4D42A 1XKQA 1R4ZA 3AYXB 1ZP6A 3F3SA 2JAUA 1QBKC 1JXAA 3HJNA 1U0RA 1QPBA 1R4NA 2VRNA 2W0MA 2YHSA 4EUFA 1P74A 2CLMB 2IS4A 4FWBA 2NW6A 2QUAA 4K8RB 4QRDA 3U61B 1W1UA 2AUMA 3MK31 4IRUB 5D5PA 1PJAA 3EZYA 2V8BA 3OZGA 1T4MA 2MT9A 4NV1A 5LDGA 5IF3A 2BBWA 1GGHA 3OF3A 3ZUGA 3UMJA 4JY7A 4Y1RB 3P26A 5D2CA 1NBAA 4FLMA 1K86A 1XQVA 2DFDA 3DBLA 2D2VA 4EKIA 2IOYA 2CVFA 4QO8A 2XE4A 5EKXA 4BNXA 1XI2A 4IVNA 1PEDA 1PJ8A 3ORYA 4DSOA 1PWXA 1XAJA 4UMDA 2FFHA 4AX4A 2JGEA 2X1MA 1ADGA 4GSLA 3H04A 5DXAA 4ECAA 4EHIA 4TL6A 4P7KA 3W6OA 2V65A 1VQ1A 5KNCA 2DFPA 2GEVA 2XCUA 3IVXA 4C7JA 5MN5A 3UWOA 4JJZA 1A9ZA 3BWCA 1KJQA 4E15A 5IW8A 3HL0A 1TCCA 2XVMA 1JKXA 4PEVA 3H6KA 2Q5HA 3K6JA 5FPYA 4ZTZB 4BWYA 3ND7A 3ZD8A 3AR8A 5TDHA 3N59A 4PRKA 4PGGA 4FFDA 1ZVMA 1R9GA 4BJ1A 3ZWWA 3GT3A 5AUPB 3UICA 2QX4A 5IDYA 1ID1A 3R8XA 3ENNA 4ZI5A 2DPLA 1GPNA 1T24A 2BFMA 3W2HA 2GHRA 4EJSB 3GEGA 4ZPJA 2V0NA 4L76A 1M2EA 1QZZA 2XY4A 3GNQA 3VYUB 5CDYA 2WTEA 5IJAA 5EUQB 4LHEA 3RRMA 4BQNA 2CJWA 1L8XA 3LPAA 3N2LA 4B09A 3HEBA 1ISPA 3HDQA 1TM7E 4CM4A 2FOLA 1OI3A 2NO4A 2VRCA 3O3MB 4JUCA 4RZ3A 4LJ7A 1FMFA 5AKLA 2PUHA 5IF9A 2P6OA 2CMGA 2EFCB 3A1DA 3CBQA 1BN7A 1OX5A 2ZIGA 5AVUA 4NJEB 5IEJA 4OHBA 3ND6A 1KMCA 3D6HA 1RQXA 3F49S 1CJSA 3FAZA 2N75A 3HBJA 3MJEA 3C3DA 3VPDA 4JQZA 1G38A 2KE5A 2XGSA 3AJ9A 3SZOA 4DCVA 1A9PA 3UY4A 3NANA 3W8NA 3W2GA 2AN1A 4YRTA 2RBKA 3DPSA 1UFOA 4HLUA 4X54A 4AG3A 2FR0A 4MWBA 3VPBA 1WXFA 1PGPA 4LMAA 1QIEA 3IPAA 3ABOB 2GDZA 4TMTA 2W90A 4XJTA 4MJ3A 1QHXA 3MD0A 4LVNA 4A0SA 4PLVA 4WVLA 4OI1A 1MNAA 3N07A 1T3SA 2Y2VA 4Y9SA 1MAHA 5FT9A 3N58A 4H1VA 1UXGA 4PXSA 4TROA 4WK0B 4Z2YA 5IX8A 1X7ZB 2YMQA 2CHGA 3LZDA 1P7PA 3MWYW 4RD1A 3ZHOA 1ZHFA 3QOYA 3QVKA 5G1PA 3UENA 3ZDEA 4YHHB 4JX9A 1GYRA 5JNVA 3MELA 3AUJB 4M89A 1JJ7A 1WTAA 5J5CA 3WLEA 5A9SA 1ZUNA 2NYAA 2QM7A 4JEMA 2IHTA 3K7EA 4JMPA 1J06A 1HL7A 4PR0A 5LL6P 4CT4B 4O0LA 4MQ6A 4OQQA 2X0EA 3UO8B 4K28A 3DC7A 3LH5A 1E2KA 1MABA 3U44A 4E51A 1WCV1 1YJAA 3F4LA 2BFWA 3PWSA 3SJUA 3PVZA 4RVCA 1TVKB 4WXRA 1LDYA 5TMBA 2FW0A 4N5DA 1TJ5A 4G01B 5HKKA 4YCAA 1V48A 2VCHA 1ECGA 1Z6ZA 3L7AA 1L4HA 1ZU5A 2P2CA 4MWZA 3KLBA 4LG1A 3LGXA 2IU6A 3OPYB 3RC7A 3HG7A 1G7CA 1GZ5A 2I2AA 4E1BA 3KXDA 3V7WA 3NBYC 2B83A 3K30A 2WTXA 4CG0A 1U8YA 2FYTA 4LBZA 3D43A 2VJBA 3D5QA 2AA3A 1IL0A 4HFNA 4O4JA 1UPUA 2J08A 1VP9A 2GNPA 1D4FA 4UHHA 4NZPA 3TM4A 1K63A 3U1TA 3VZDA 4MUYA 3ADCA 2BR3A 2GCEA 3OZVA 2ZBRA 1G8AA 4IFIA 5FJIA 3RBXA 1QIJA 3ROXA 4L5YA 1RYFA 2GD0A 3WMFA 1VM6A 2K7FA 1SB8A 3K20A 4AL4A 1X6VA 2JAOA 3GAZA 4GZ5A 4L8VA 4D79A 4R68A 4J91A 4NZOA 1R8JA 4XX1A 3FPAA 1QRUA 2J3MA 3BZBA 1PNTA 3A06A 3IT1A 1SMKA 2UYQA 2C2OA 2Q5FA 4W5WA 2ZJ2A 1IHYA 1XTBA 2YMPA 1BA3A 2L69A 3OLZA 3UWDA 2Q28A 2YVQA 3FI9A 1R10A 2BCJQ 5HOQA 2QTZA 3OQVA 3AESA 1J5XA 2ZKLA 2E6KA 4DEXA 1PW7A 1UQUA 1MX3A 1J20A 1S3GA 3DEHA 1J6UA 4GZ3A 5G1OA 3UGTA 3VU3A 2GLUA 1L5HA 5DYTA 1J2UA 1QG6A 1THMA 2D7CA 1G8MA 4FTWA 1E8NA 4BTVA 2Y99A 5BQ5A 1JLLB 2XNDD 3HDJA 2V6MA 1HT3A 3RC9A 4AZ3A 4G56A 4I1SA 1GKLA 5CK4A 1IY8A 2H0AA 3O82A 1NVXQ 1TT5B 2B2CA 5F2EA 5FD8A 2MR6A 3ES9A 1SXJD 4INPA 1K2WA 4ATNA 2UUBB 1RD4A 1OA0A 4ARCA 1ZH0A 5T64A 3QITA 3V1NA 1FU4A 2YWCA 5FL3A 4MR8B 2PLFA 2WV9A 4IF6A 1BD4A 1Q3KA 3RUDA 4G0VA 1GPDG 1G0OA 2R1UA 3P9PA 1FXWF 5L6LB 3OFVA 3I62A 4KRGA 1Y7LA 2O7NA 4DA6A 5CYOA 4DWOA 1SXPA 4ALMA 3KEQA 3GVXA 3N8NA 1SC6A 3EXEA 3CH6A 1NJFA 3FZNA 5IULC 3QLVA 5AI5A 4YRKA 3ELDA 1C3LA 2QG9A 3U7HB 2OFWA 2VAPA 1OA1A 2DGDA 4BFCA 1XEAA 2C5LA 2JA2A 1G6HA 1E69A 3KZKA 5CPBA 5J5VA 1EUYA 1RLMA 4IHJF 3PFHA 4ADSG 1DC3A 1XUOA 3CZ5A 1MW9X 1BEEA 1C3OB 3VV2A 2ZS7A 2CNDA 3G59A 1MP0A 3SK0A 5EEHA 5SY9A 3D9QX 3TKAA 4U4AA 4ZYTA 3WKAA 5BSFA 2ZM5A 4N82A 4MINA 2R97A 3ON5A 1Q22A 1AZTA 1D0SA 2Z9BA 2ZSDA 1XG5A 3C4JA 4CMBA 1HFKA 4KRXA 5J9FA 3Q10A 2NTVA 3DR3A 1ZINA 3PICA 4BFUA 3GGDA 3GG2A 3I9V6 1L7AA 3PC3A 1EI9A 1TQDA 4P4SA 1NVMB 4D41A 3IQZA 4Q03A 1QHGA 2Q8NA 2VSXA 4BFTA 3HZZA 5I7HA 4YV7A 3HY6A 2C04A 5EHIA 4FW8A 5H83A 2JI6A 1SUDA 5DTQA 3MN1A 2AOXA 5FAXA 4QZVA 5CGZA 1KVQA 1OC2A 4PQYA 4ZCTA 1N7IA 3HKBB 1F2DA 4IWNA 4Z0TA 5CDFA 3ZWMA 1N6RA 5GGYA 4DMRA 1ZD2P 4MS1B 3QVTA 5FWXB 4FM9A 4CKYA 2IHUA 3HJTA 2DUUA 3A9VA 3OAAA 2HK9A 3C98A 1KH3A 2W42A 1RYYA 2WM3A 3OPVA 4DXHA 1QO0D 3PGJA 1PTKA 2HJRA 3DE3X 3LYUA 3ZHCA 1Q0PA 2IPLA 3TLCA 5L3SB 4AQ7A 2WFZA 1YDFA 1SG6A 3PBKA 2ZWMA 4OGLA 3DEYX 4V0QA 5FWNA 1IWBB 1ZJ5A 2Q3JA 4RK6A 5HIIA 3RLFA 4B4DA 3FG9A 3FH0A 1QIMA 5FR2A 2M32A 3K1AA 4LGCA 2JFFA 4BVBA 4IP0A 1Z62A 3PCTA 4EQZA 2X1LA 1T0HB 5BNWA 2PAFA 3R24A 2VZLA 2JH8A 3RJ5A 2R5NA 1R3UA 2VN8A 2ZU0C 3KBOA 5DULA 5L7YA 3RUCA 1O5TA 1WHTA 4CU2A 4HAYA 1FYEA 3ZZNA 4HMQA 5JASA 3BE8A 1OH6A 3JQ9A 3KTFA 3L4BC 4IEIA 4JKYA 1OLXB 2FN7A 3G5UA 2V9CA 3JQ7B 4OLFA 3CEHA 1MJGM 3QVMA 4UJ5A 3SC3A 1Z22A 3CE9A 2QLMA 2DHRA 2EDCA 2XZTA 4JT2A 1ZD5A 3HRHA 4HDMA 2R79A 2VK2A 1UWCA 1GGJA 3T35A 1TX4B 4M0DA 3BC1A 2NM0A 4ZO4A 4YRDA 4YPFA 1Z15A 4E7OA 3PXGA 2AYYA 2CLHB 4IUBS 1VKJA 3WMRA 1BU5A 1FW6A 1MJHA 4F4IA 2GZAA 5ITZB 5B1HA 4DARA 4BVHA 3ISJA 1HBJA 1U3CA 1DUSA 4QFCA 4I4IA 3VR5D 2JGDA 4PQGA 2PRKA 4FFOA 5GZ6A 2FNAA 5DX8A 4DMKA 4N5NA 2GAAA 5ECYA 4W8HA 1II0A 3THSA 1J00A 2H17A 3WKCA 4EH1A 1JIUA 3GRRA 4EGQA 4FFBB 4KPUA 1E94E 3G2QA 4ZAXA 3RFFA 5CD9A 5CEEA 2R1TA 1QHHA 2R9VA 3ZHQA 3O0TA 4HFMA 3NJRA 4MW7A 1TM1E 3LWBA 1G7SA 2QTNA 2WOJA 4LMPA 3TLMA 1T9DA 2W93A 5BV1A 4LXIA 1ODFA 1WAMA 3GNSA 4IQGA 1LBHA 3H16A 1Q7BA 1U02A 3O94A 3HYTA 5DK4A 3ZLVA 1TM2A 4Q9AA 2HBYA 3N7TA 3N5KA 5HE9A 1G2IA 3EXFA 3N2IA 2YHUA 3WNDA 1FX0B 4FZ5A 3HFJA 2ONJA 1F7UA 3PC7A 1SR8A 3I2JA 2O2YA 1ZN2A 4CLOB 1NY6A 2G06A 2J0UA 4Q34A 4AYTA 1T2CA 3BD8A 2QTTA 4YRZA 1UMDB 2FZWA 2HHLA 2HNBA 2ZTHA 2VPWA 4WZBB 4UOZA 1JQLB 3E0XA 4YLYA 5DN9A 4UTNA 1XXHA 4R9VA 4JQOA 2IYSA 3LRXA 1CYDA 1P5HA 4LRYA 4XCXA 1YBHA 2Z4TA 4M3NA 4BFWA 3VKVA 5JE8A 5KTSA 1T26A 4OAPA 1F48A 3T9EA 2J85A 2M1XA 1N3IA 1KO5A 1PS8A 2PNFA 3F46A 2R68A 3DTVA 2BR4A 4B34A 1U4NA 4PTYA 5F5XA 1ODCA 3A6ZA 2VTBA 1MC1A 4C0HA 4FEAA 4PANA 3O8BA 1GWNA 1GGVA 3WNZA 5FRDA 3VH2A 5L3QA 1YA6A 3AIOA 2E6UX 3G2IA 1RADA 3EFEA 4AJEA 3KQPA 1F5NA 4E09A 5C18A 1LSSA 3WS7A 4EJFA 4YAGA 3NAZA 5NLLA 3SQMA 4MULA 1DEAA 1YBAA 1PJLA 2WKRA 1BXRB 4NHOA 4PM4A 1JEQB 2ID8A 3QEMB 5DEIA 4RESA 3L1UA 5L7TA 4Y3UA 5ESWA 4LGMA 1XRSB 2OYRA 2BUAA 3OOJA 1USUA 4L3OA 4MYRA 3UMCA 3WXMA 1P7YA 1EUCB 4Y1FA 4O4HA 3NHSA 3H3FA 3II6X 1E1CB 3BH0A 5CLGA 4FSDA 3E27A 4TTRA 3W7VA 3ZJYA 2R7LA 3HSSA 1Z6GA 4KBGA 2BKUA 1CS0A 3GD7A 1U28A 1NI3A 1X94A 1RR6A 1W93A 3UAYA 3I1JA 5JMOA 2WIBA 3LHDA 2ECQA 1OX4A 3L9XA 4FIDA 5HBGA 1H5QA 2R1ZA 1XF1A 3C3CA 1W44A 5K1ZA 1OXBB 1KSFX 5IDQA 3AP1A 2BHSA 3GJ6A 3W2FA 3NOVA 2WJWA 1VIVA 1IN1A 1DQYA 2XTMA 3UTDA 3ZU4A 2PX4A 5ED0A 1ORDA 1SKQA 2NO6A 4UXIA 4EBBA 1ZJZA 3AY3A 1DC7A 4KTVE 4LRTB 3HLTA 2ASVA 1FRZA 1YRBA 3RYIB 3SYLA 3WY9A 4J0JA 1BMDA 4LTDA 2INGX 4PQFA 2HO4A 2AR0A 3FSGA 5EI5A 4MGZR 2QGNA 3Q7RA 2JD2A 3D6JA 4ZDKA 3UJNA 4WECA 3IEKA 1SOVA 2WF7A 3N6VA 3T61A 2DUMA 1NF3A 2HJVA 2J8ZA 5A4FS 5C8YF 4S05A 1G98A 2FMKA 2G1JA 1QKJA 1OLSB 3LBYA 1SIUA 2A7XA 3PKIA 2SCUB 2XUHA 2LWIA 4P3OA 2XOXA 1ULUA 4ZOAA 4KIJA 3ADPA 3DAHA 2E37A 3GZNB 4FMPA 2IZZA 1TYBE 1CEEA 3OQ1A 2ZBEA 1LCIA 4QAQA 5COBA 2BMWA 3D8RA 3NTXA 2JLAA 1KQPA 4IH9A 2IWRA 1F0PA 1PK7A 4DAOA 3ONVA 3OY7A 1XX6A 4N1AA 3WHPA 4DJFC 3NDIA 4FN5A 1MJNA 4GW3A 3L4EA 4TQGA 1U65A 4MOWA 3OKPA 5CNJA 3E35A 5DX0A 4J9VA 4EG6A 2V9ZA 3DUWA 3IELA 2NXNA 3A4NA 3NALA 4RANA 3GAFA 2ZM6B 5CCXA 1XLUA 1E1NA 3TTUA 4G5SA 5KCZA 3MJCA 2XLBA 1BAPA 2QXTA 2J9RA 3R7FA 4JI2B 1ISGA 3WAJA 2YASA 1JILA 4NOMA 3AEZA 4ZT5A 3QSGA 4J2HA 1Z0UA 1M9NA 1D7AA 3A9CA 1KMHA 4K6OA 4DMGA 2IEAA 2A9KA 4RW0A 4NP6A 3HH8A 5KNDH 3PG5A 3C6YA 3LPDA 2V96A 3L46A 4PICA 4PTLA 1K4MA 4RA9B 4AN1A 2JGFA 2W6JA 3I4CA 4QULA 3OWOA 2WHQA 1GKUB 4YRCA 5D86A 5E8RA 5BORA 1GQYA 1M8JA 3KSDO 1JEAA 3BKWA 5IYZA 1R18A 2OSVA 3D7KA 5H4HA 1NVBA 1SBCA 4BLWA 4Q02A 4Z7OB 2DBYA 2G0TA 1YKSA 1R8YA 4CL3A 3T9DA 2VCYA 2XLCA 4XJXA 4F8EA 4A1FA 1KK1A 1N33B 1IRIA 1K7YA 1LDMA 1MGOA 2J59A 2RGDA 4B3FX 1SVUA 2OQRA 5CH3A 2GPJA 2OYCA 3SZLA 4AWBA 4B17A 1IPHA 3QX3A 1RI2A 4QYTA 5F33A 4X64B 4ZAVA 3AC0A 1ZX1A 3IMCA 4C3VA 2GVZC 3C15C 4JT9A 1T1IA 4ZOLF 3W5UA 5M29A 2V4MA 3I30X 5JZMA 5K5EA 2XEDA 3EGCA 2WHXA 4JYCA 1YFKA 1QQ7A 4X97A 2B25A 5EE5B 4IOJA 2FRXA 2OESA 2WHPA 4BEJA 4EG1A 4MVXA 4R2JA 2HCFA 4EKGA 3KEMA 1KZ6A 2O8FA 2Z2ZA 4NECA 1AGXA 1BMFD 1ZNWA 1PLLA 1WP4A 2TYSB 2ES4A 3DKIA 1IWPB 3FYDA 1T8TA 4DRXB 5ADWA 3RW9A 1EX9A 4IKPA 3I2HA 1TKBA 3GEEA 5JCXA 1KF0A 1B7GO 4QHSA 4UNNA 1SBNE 3VU8A 4WUVA 1V8FA 1U9IA 2B9VA 3ZNPA 4CL2A 3U80A 5P21A 4J76A 4CF7A 4UBLA 5LP6A 5ERGB 2XZOA 4ZVSA 1Z45A 4PC3A 2VG8A 3PUVA 5HNKA 3DYBA 1WLSA 2C7OA 5MHTA 1T4DA 4ER3A 3G2KA 4KQJA 4FOTA 3I6MA 2V5UA 3BHIA 5ICGA 3RVBA 1SCQA 3OE7A 5D84A 5EXXA 3CG4A 3ZHTA 1LPAB 5JD6A 3DPIA 2P27A 4DMLA 5KOIA 8LDHA 1XZAA 4M1QA 1QORA 2W4MA 3EPHA 1VCMA 4ND6A 3ZWXA 3C8MA 1UFRA 4KFTA 4F4CA 5B6PA 4TWJA 2P40A 2VAXA 1MB0A 3L05A 4GFDA 3BMQB 1AZSC 1KP2A 4D4HA 2CFIA 2IHBA 4YEDA 3L77A 5TV2A 2WAMA 5KYWA 1TJYA 2VNJA 4K05A 3DXZA 4KQWA 5L4SA 1QPZA 1L5VA 3A14A 3HFSA 4AF6A 3HUUA 3IPLA 1I8TA 2BELA 2V7GA 1GTMA 2BGIA 4E0BA 3EMKA 4YJ3B 4BMVA 4HT3B 1BX0A 2HZ7A 2ZJ0A 3M34A 1QRRA 2PX8A 2REQB 3K92A 4QICA 4N3BA 3AYZB 1VG1A 2I78A 4LOLA 4WXYB 5I7WA 2BEWB 1E2GA 3BGVA 3B12A 2V7UA 1NLMA 2HPAA 2WB2A 2XXAA 3D4IA 1NQVA 4RTRA 3JQ9C 1R16A 4TXMA 1S5PA 2DHCA 3KHUA 2G9RA 2FEOA 1EWYA 2ECFA 2I8CA 3LI2A 2PH3A 1EFRD 3R7WB 3GFFA 4P3NA 4WGGA 2P4EA 2G5CA 3E84A 4XSVA 4F3CA 1VLQA 1RWVA 1LVHA 5C32A 4M0UA 2WUGA 1S2LA 3EWSA 3WICA 1HNXB 4NJMA 4RD4A 1K3TA 1R50A 3SVTA 2EG9A 4L75A 1Q6ZA 3ZBTA 5G02A 3IMEA 2I33A 2ZPAA 4ISCA 4Y2VA 2C1ZA 4F5WA 1OZGA 2ATIA 2GF9A 1E79D 3KNZA 3K71B 1PGOA 2QU7A 3SJAA 2D1YA 3CY6A 4F7DA 1HOTA 1N9KA 4DEVA 1GR0A 1NVAA 1S02A 2Y1EA 1B93A 5KJFA 4N0PA 1YJ5A 2HT6A 3HCCA 5E0KB 2AKEA 3QNUA 3W5SA 3EUFA 1JSRA 1CJCA 2CXSA 1LF5A 3JYPA 4JP5A 5J43A 1IOLA 1OXVA 2OXIA 3PEYA 1N2HA 4NS4A 4Q4CA 2FPMA 2BHTA 4XB2A 1NYTA 1IWOA 3Q3GE 4RH0A 1V16B 3LOUA 3U2QA 3Q8MA 4FE4A 1FSPA 1V0JA 3THWA 3VMFA 3F8SA 4R2IA 1K7SN 1Q1NA 2D5BA 3ETLA 4QPCA 2NXEA 1IXKA 3GMDA 2CDCA 3DVSX 4CKZA 1A4RA 4PG8A 2ONYA 2Q1SA 2ACWA 4ZO6A 5FBWB 3OZEA 3RG8A 3S3TA 5BT8A 3HYCA 4PRYA 4MUFA 5CUQA 2QZ9A 4G67A 3GJ4A 4YP1A 1WY7A 5FUYA 2OGSA 1VCHA 2WYHA 6ABPA 2WNSA 5A5GA 1AGPA 3A0RB 2UU9B 1GUAA 2GEBA 3EIEA 2JPDA 1EGQA 2IKQA 2V74B 2ZTSA 5AOCA 3ETNA 2PSFA 4L8WB 3WIBA 4PO1A 3T7AA 3DTTA 2VDWA 4ZU1X 3KSBC 5CDSA 3NYWA 2ESRA 3AVPA 4V24A 5D8DA 5G0SA 3DEZA 3NM6B 5KEIA 3EA5A 3FWZA 3RK4A 1I13A 2D0PB 2GKOA 5JZ9A 1HE2A 1VKOA 1CY1A 2QL9A 1C9MA 4IHJA 4JXKA 3UB3A 3Q0EA 5EESA 1ZUNB 4EPWA 3TIXB 1QU2A 5LM3A 4CKXA 4HRAA 3INNA 1FFWA 1X80B 2REXB 2C5EA 2QSZA 1S7CA 3VNAA 2Q1WA 5FJJA 1DE0A 4B45A 1YL6A 4DLVA 2B5OA 4YJ3F 5L3RA 2W00A 3K15A 4AD8A 4F21A 1UXHA 3WWDA 2WT4A 2CNWA 1Q20A 3DZDA 3LRTA 5B3LA 2HU8A 2RARA 2XNDA 1WSAA 2RAVA 1E4YA 3AHDA 3LJKA 3L7JA 4BWFB 2W6MA 1Z63A 2QTVB 2ZBUA 4H31A 3MGGA 3W6PA 3H1FA 4M7WA 4AY5A 3F9IA 4QM7A 4UM5A 1GXSA 2V7XA 3B1KA 5H1YA 1I2BA 1Z0ZA 3HHPA 4EB0A 4LHWA 2R62A 1GZHB 3AO0B 3GHHA 4D8YA 4BQEA 1OWLA 5CAEA 4EGSA 4O4JB 1H3FA 2ZTLA 4MW9A 4N9WA 1KS2A 2O8BB 5EIFA 1O9HA 4JLJA 1G8KA 2HA6A 1KQOA 5BYBA 2PV7A 4OJNA 4HMOA 2VO1A 1L1QA 2P3OA 1PUXA 5BSWA 1T6XA 3TQOA 5IP5A 5LB4A 2RGAA 1MO5A 2WU0A 1FFXB 4QXOA 2PCJA 1E9RA 4OMCA 4PPNA 3NVKI 3LA6A 4NMXB 3DNFA 5CU7A 2GB4A 4EITA 1EVQA 4Z51A 1LKZA 1UMKA 2PKRA 2BFFA 1UPTA 1VLMA 1ICEA 4C89A 4IIHA 4O4HF 4TGLA 4BFXA 5JXWA 3R9WA 3LT5A 1K4YA 1KRWA 4P08A 1UKVY 1P0QA 1XA4A 2H16A 5AT1A 1U11A 5TNXA 1X0XA 1RXEA 4D4MA 5F2KA 3AESB 1UL1X 2YV1A 2YXNA 2I4NA 1N5KA 2FVYA 4JJ7A 2JFYA 2C97A 1EUDB 3HKEB 4YUWA 3I52A 2P4SA 4S0ZA 1W29A 3C1AA 2X6TA 3B52X 4YT8A 4J7CA 2GEKA 1JLLA 4IXDA 4HG2A 5IXYA 1WA5A 2VHEA 3BUSA 3I04M 4BV2A 4BHTA 4HRYA 4ZDIA 1U1CA 2P68A 5A3JA 3IVAA 1WTCA 1G18A 1MV5A 3MMZA 1GV0A 1LDEA 3ZKAA 4BJ3A 5A1JA 2XRMA 3AR4A 3RTCA 3VNUA 1T15A 3P8ZA 1HO3A 4KQMA 2IU3A 4MWTA 3KT0A 2FJPA 4UU0A 1XP8A 3T4EA 2P5YA 3BULA 1O8BA 3BA6A 1GG9A 2IW3A 1UT8A 2HA4A 1S9HA 4Q21A 1E59A 1SXJB 4TL7A 1QHYA 2ZSJA 3O9MA 4CQMD 4FCWA 1L5RA 4FT4A 4TL9A 3WK9A 1EUZA 2NX2A 5FH9A 4LYGA 4PX3A 3VR4A 2GTIA 4EDHA 2HQSA 4YUYA 1D2CA 2ZW9A 4HGYA 4O4LA 3UHAA 1SCNE 3K70C 1FOEB 2Q5OA 3FPKA 3O6VA 621PA 4BMNA 2KJQA 3GCDA 4N6OA 4C4SA 5A3RA 4F4JA 1OLUB 4PR3A 4IRXA 2CYAA 3NTQA 1QZTA 3DE4X 4UXHA 1JZSA 1SU6A 1YZYA 3AT1A 1QRDA 1X7XA 4FJ1A 4P7GA 3WBBA 4IUDS 3UA4A 2JRCA 3WIOA 2P30A 4YRAA 3U6BA 4O63O 5FWDA 1Y3BE 4A0FA 4IIVA 3AF0A 1TZCA 4AMGA 1TYZA 4NBVA 3KR0A 4G1UC 3DGFC 2QGFA 5LFAA 2F8TA 4J1NA 1KYYA 1JR2A 2Q2WA 1ZH4A 4PG7A 3RTGA 5TLSA 1FXSA 1QIDA 1RMQA 2NQ8A 2YJGA 3X1KA 3MTBA 2GRUA 2O2XA 3OFNA 5AOVA 2XHZA 3N2EA 4PGFA 4Z2AA 4L0QA 5JNLA 2C4WA 1ULHA 4FYVA 4KXNA 1U0BB 2O0LA 4P7JA 3GELA 4MQFA 4YPOA 2FXVA 1PGNA 2OBMA 4R7GA 1YI0A 2HIHA 1HYGA 5F4BA 4IMRA 1DHRA 4NCJA 2C78A 1XTPA 4LZPA 4OUDA 1IY2A 2GCIA 1M0TA 2D59A 1O6ZA 4ROSA 3FWNA 3FMIA 2JANA 3VR6D 1FFGA 1H8EA 1SKYB 2V6GA 3OZWA 4UDOA 3DTVD 5TT1A 2VCEA 3KPWA 3D02A 2G63A 4WD3A 4YYZA 1T3GA 2Y1KA 1BDHA 1RXYA 2OGWA 3QJYA 1BW9B 2BOVA 2LKCA 4C4ZA 1Y9ZA 1LQ2A 1PVOA 3NR2A 3HB7A 4KL8S 3K9CA 4GGPA 4NI5A 2F1IA 1N7HA 3SNKA 4FMCF 5F21A 1YCDA 1NVKA 3MJSA 4MV6A 4UCFA 3T7TA 2D8MA 2PSEA 4HPXB 4ECEA 2ODAA 1XZDA 3HJRA 1MQ8B 4LSGA 5J58A 2DQSA 1KARA 1ECPA 2PHZA 1NW4A 4MVCA 1W19A 2EU8A 4QTYA 3RF6A 3UFBA 1H94A 1X8JA 3MTDA 2HBZA 1K2VN 2XUDA 2I3BA 2Y67A 2FRDA 2C31A 3AF1A 4RJ2A 4IUCS 5IANA 4HCJA 1EE9A 2JGKA 1JJVA 1ST2A 1KNQA 2NPOA 2Z4RA 4MR9A 2PZAA 2VDQB 2JZOA 1IHOA 2JLRA 3GPBA 2VJOA 5BSUA 1FYWA 1M8GA 5JTTA 4GGOA 5LZ4A 1M0EA 2RK4A 1CPYA 1F8UA 4A5OA 4F84A 3EH2A 4JBXA 4OATA 2OAQ1 1JH8A 4GF5A 5FQNA 2FN4A 4OIFA 1OLOA 1LLDA 2L18A 2ON6A 3NHKA 2CLLB 2A1TS 2PLWA 4GVXA 2Q4BA 4WKPA 4NS1A 4YROA 2V7BA 1HYEA 1Z4IA 1S8AA 1E9SA 1H8HD 1NBMD 1Z8HA 3GROA 3QWFA 4HGNA 1K8QA 3DR5A 4YJGA 3SC6A 4CM6A 5MN4A 4ABTA 1EJ6A 3AR2A 2HRDA 4FIZA 4YMVA 3RC8A 3BFKA 5JD4A 1IPFA 2CEKA 5JJ5A 3KWLA 1H0RA 1HNNA 3NTRA 3Q0IA 3DMDA 4NF2A 4CMEA 1YHYA 4HQ0A 4QQRA 1A76A 1ZJWA 1CEYA 3AUAA 3WJ1A 1TF2A 2CFSA 3GPIA 3ND8A 4N4AA 2UVPB 5DW3A 1ETHA 2Z6AA 2XBLA 2YVKA 1DRUA 4R01A 4NYJQ 4A5SA 3TZBA 3X2EA 4BLRA 5T7BA 2GK7A 4CV2A 1WCIA 3E3LA 2JB9A 4RULA 3BXFA 3GLHA 4R8MA 5F3WB 5JNSA 3UJ6A 4BFVA 2NUPB 4PCVA 4ND5A 4EVIA 3AFOA 4MGKR 2VJPA 5IARA 1OB5A 1WM1A 3CLTD 5D1HA 5BW8A 3U7FB 4IV0A 5AVJA 2TS1A 3ZGZA 4L5IA 3CEMA 5ARCA 4CEIB 4NBSA 2XQIA 2B94A 2ZTVA 3SNHA 4B6OA 2QT9A 1DAFA 3BFVA 1PNVA 4DUPA 4ON9A 3TQFA 2F67A 4UMEA 4G0ZA 5AVQA 1DO0A 3OQOA 1TCBA 1BQ4A 3L4SO 4O2BF 3E7FA 3X1WA 2YJNA 3OJLA 3OP1A 3EXG2 4ZVVA 3AF3A 3ID6C 4IJWA 4POOA 1TK3A 8AT1A 4X8LA 2DPMA 3ZV3A 3AVYA 5SY4A 2O5CA 4JT8A 4CLHA 4G24A 3BB1A 2Z8YA 4OXRA 4GLOA 2A35A 3HRIA 1Z0JA 2PGIA 5JD3A 2CMKA 1LVGA 4JEIA 5HMMA 2P9QA 4ZQIA 5BXQC 1Z08A 1L4BA 2RG7A 1KC3A 5L3QB 4Z7JA 3I9OA 4PF1A 4B3JA 3IEVA 1EX1A 4KR0A 4Z4QA 3VTKA 1PF7E 1DAOA 1SCUB 2EYQA 1I3LA 1I0ZA 4ZT6A 5G41A 3TW6A 1JMYA 5AM2A 5CX4A 3KYBA 2JJMA 1GARA 2PJUA 5CH8A 3DOHA 3IL2A 2PS0A 2ZIEA 2DF8A 2QLTA 5SY6A 2RBGA 4U39A 1SVLA 2FQ1A 3HI4A 3UWMA 3NHZA 4CFYA 2B7LA 3S5UA 1RPZA 2JFGA 2WM9B 5AK4A 2B6NA 2CYCA 3EEQA 4F93B 5BR4A 3G2MA 4ZOLA 3B9BA 3TS1A 5EPOA 3FN4A 2D1RA 2GM5A 1UBEA 2G3YA 2XYHA 3OX2A 5LMZA 1SVWA 3PDJA 4J1TC 3K0BA 3H2GA 1OB2A 1JG1A 1G41A 5K0GA 1UMCB 3LPCA 2CVHA 2FK7A 4GQAA 5FO0A 1R6DA 2RJNA 3O4GA 3RBVA 1G6KA 4DC1A 2P9BA 4W6ZA 3COWA 2FWNA 4HZUA 4QJ3A 2XF2A 3DOIA 3TG2A 1P1FA 3PD1A 3H0EA 4HO1X 1E0AA 1YFZA 5JAIA 2AD1A 4JLWA 1VE9A 4R2XA 1KDZA 4GO1A 4HZGA 2JFUA 4YCNA 3WRXC 4EOGA 2VHTA 3PHGA 3DUFB 3OIYA 3NIWA 2ZS8A 2PQ2A 4K9MA 1Q7EA 3ELWA 4PV7A 3RYIA 4KE7A 4J0EA 1IJFA 3I1IA 3GBPA 4COKA 1DAHA 1V47A 4QYIB 1ZLXA 4AQDA 1ZMBA 5BQFA 3T52A 1Z3IX 2GZ2A 2ZB2A 3FYUA 5DRYA 1MF7A 4AP9A 3UAGA 2IZOA 2ZJOA 4LQDA 1I24A 1Z0DA 1MQAA 2J4DA 4ZEXA 5C1IA 3M1LA 1FPQA 1R4MB 3HDYA 4PY2A 3OUTA 4LX8A 1U2SA 1JDBC 3HSKA 3MRTA 1KTIA 4KWHA 3RJ9A 3WNCA 5BSGA 1HFWA 1Z36A 1RCFA 5ALIA 3EVGA 1YNSA 1JLRA 2EVWX 1WQ4A 3JZIA 3TKYA 5CLJA 1M2KA 2ID9A 4P92A 4P5EA 3BXEA 5TT0A 3WIEA 3ZZMA 4ZQHA 3W2IA 1V6SA 2WB4A 4GI3A 2YTZA 4URUR 3WQQA 3PUWA 1QX3A 1W0CA 1NVDA 4DPKA 4KI7A 1DJNA 5CIWA 2XA2A 4RD6A 2HJSA 3MIZA 1NWHA 5F1OA 3CF2A 3GQBA 5KYYA 4UMVA 2X6QA 4YDQA 4WNYA 1Q12A 3P0RA 4BLVA 2Q41A 2C84A 4AXXA 1MXHA 3SX0A 2I1QA 4X8OA 3I5UA 4CI0B 1GVNB 1E5XA 1DTSA 4PO9A 4RTJA 3A2NA 5E4YA 5IHXA 2I4OA 4OIMA 2OAP1 1D2EA 5IM4F 4DLTA 4FXOA 3ETGA 2C82A 2W2KB 3ABZA 4RA9A 4RKFA 3TJZA 5E1BA 4G65A 3KL2A 2QAGC 4ZOEA 8ATCA 1CNMA 2JFHA 1I2ZA 2PL3A 3GI1A 3KOWA 3MSCA 1AHPA 1UJNA 2E4XA 3DMYA 1LI4A 1AVTA 1BE0A 1LTQA 1NQOA 2QM8A 4RHTA 2ETVA 3SSOA 4A26A 1TTQB 2I22A 1QTNA 1LW7A 4NYMQ 4AMVA 4CETA 5DJ5A 1U1IA 4QOSA