3G9XA

Structure of haloalkane dehalogenase dhaa14 mutant i135f from rhodococcus rhodochrous
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
total genus 107
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9xA00
4OPMA 2ONCA 2H7CA 5I8PA 3A2LA 3ESCA 1SCQA 1J2EA 3GFFA 3OURA 1ZD4A 2WIDA 3P2MA 1KU6A 3WLAA 4WDQA 2PSFA 3AZQA 2CB9A 4EY4A 1DWPA 3R3YA 3ZPXA 1CUEA 5CMLA 3O4IA 2OCLA 4UFPA 1JJIA 3I1IA 3F98A 4N8DA 1CRLA 4DYHA 3DKKA 3GUUA 4C01A 4K5QA 1P0MA 3B5EA 4G9GA 3DCNA 4AQDA 2QRUA 1C4XA 3R3ZA 1K5PA 1M33A 4GBGA 5K3AA 1VLQA 1MO2A 2VJCA 3AIKA 1X70A 1UK6A 4CCYA 1SOMA 2HA5A 2WHQA 4W1RA 2VA9A 2FJPA 1PV1A 4HXFB 1BE0A 4BCBA 2X76A 5EFZA 1DWOA 5AOBA 1VZ3A 2JBWA 2VAVA 4OB6A 4QWWA 5IVHA 4JNCA 1D07A 4U2EA 1R50A 1XLVA 2QM0A 2ECFA 3I2FA 1CUBA 3SWWA 2JGIA 5C7YA 2WUEA 3GROA 1LPBB 5A7HA 1LPPA 1N1MA 4UHCA 2CJPA 1W76A 3PUHA 5AICA 2HRQA 4Q3KA 4KAAA 3FLEA 1MNAA 1R9NA 4J3JA 1CUDA 1QFMA 2H7XA 1OXMA 2XUOA 5K3DA 2QUAA 3L1HA 2CMFA 2HA4A 3B12A 2VTVA 2WTNA 4UHHA 1CUXA 2BUAA 4Y2TA 5ALLA 2ZSIA 2PKYX 4QLAA 4UHEA 2VT7A 5JANA 5CBKA 4FWBA 4AZ3A 4PV7A 2R8BA 1TCAA 1QIFA 3WWPA 1UKBA 1E3QA 3R3UA 1I6WA 4FLMA 5A71A 3ED1A 1MT3A 5CT5A 3VVLA 1HQDA 3AZOA 4NS4A 4Q05A 3ZLUA 4HVTA 3TEJA 2DQZA 1XRPA 2OQIA 4EUSA 2XMBA 5JD4A 4IH4A 3SC2A 3HXKA 5T4HA 3IUNA 4J0CA 2J4FA 3DJYA 5AKJA 4BAZA 3E0XA 2GBFA 2WHPA 2HA6A 5C81A 2G5TA 4MQLA 1MX5A 4AO6A 1RP1A 5HF8A 4KACA 5BV7A 4QE3A 3AIOA 3WIOA 2AJLI 1XZCA 1BN7A 1H2XA 2JEYA 1Q0RA 2OG1A 3ESBA 1CPYA 4DSAA 4BC1A 1JU3A 1BROA 3V9AA 3W9UA 4IH9A 3VVMA 1E66A 3JWEA 3I2GA 4LYDA 1CUUA 1U2EA 2WJ6A 4M0FA 3FYUB 4BYMA 4KJXA 4G8DA 3IBTA 5ALKA 4OCZA 3G7NA 4QWMA 3H2HA 1XQVA 1AUOA 1CEXA 5EI5A 2YH2A 5J3JA 1GPNA 4ETWA 4B83A 3BIXA 4KEAA 4KE7A 2OGSA 5D3KA 1WHTA 5F4ZA 1ZI9A 1ACJA 4TGLA 4BVKA 2BUCA 4W63A 2I3DA 2OCGA 4Y2JA 1XZIA 5EHQA 3D3NA 4CG1A 1FFCA 4AO7A 1EDEA 5AHXA 1USWA 4OU4A 2AJ8A 4X71A 5AKKA 1IUOA 4I4CA 2V96A 4JYPA 5AI0A 3WWOA 2VQ6A 4P9NA 3ZV7A 1WB5A 1IMJA 3R3XA 3QBJA 2PBLA 3EIOA 4FNGA 4F0JA 2B4KA 2C0PA 1L7RA 1QIEA 3KSRA 3D2CA 2HFKA 1HDEA 4KE6A 3FOBA 2QMQA 1JMKC 2PPLA 3HABA 2ES4A 3FWHA 1CVLA 4BBZA 3CXUA 2I3ZA 5ALTA 5JAPA 2XUQA 4AZ0A 5K3BA 2XUGA 4X93A 5HCUA 2RHWA 1YB6A 4X95A 1MX9A 4X7BA 3FAKA 5CT9A 3RM3A 1VXRA 1JI3A 4RGYA 1H23A 2OLEA 1K8QA 4Q3LA 4W1PA 5AM3A 3D7RA 3NOXA 2NW6A 3DD5A 4W1QA 1ORVA 2G63A 2XMSA 2GBCA 1QIIA 4B80A 1U65A 3QMMA 6YASA 5AK6A 1THGA 1ZGCA 4F21A 3G0IA 4UBNA 2BGNA 2WFLB 3FSGD 3FVRA 3ANSA 1FFDA 4W9RA 4BATA 5JYCA 4WY5A 2WG0A 4WFKA 2QTBA 2RAUA 2AJBA 1LGYA 4W1SA 5JD5A 2XMRA 1BCSA 3KDAA 4DIUA 3H18A 2ORYA 2H7YA 2JGFA 5ALHA 4BVJA 3G8YA 2PSHA 3STWA 1OCEA 3E3AA 4C4ZA 1JT2A 1QE3A 4JEIA 4BP8A 4QEKA 3VDXA 4UBIA 3T52A 1XKLA 4A16A 1Z68A 5HQ3A 1N5MA 4XJVA 2GZSA 4BDTA 3WWCA 3HSSA 2GBGA 2EDAA 5AIAA 2VT6A 5AOAA 4O08A 3V1NA 1W52X 3ZWQA 5AKIA 5AM2A 1MU0A 3C6XA 4LKOA 3IUQA 2WFMA 3R3VA 4B7ZA 4ZWNA 3AIMA 4NZZA 1EH5A 5ALSA 3EF3A 5T4EA 1VA5A 4QNNA 1A8QA 1HLGA 1LPMA 4KE8A 2XQFA 2DCMA 2BKLA 4J0KA 1EHYA 4G4IA 1U4NA 1Y7HA 1G5FA 3L1JA 5LZ8A 2XUKA 3D59A 4FFVA 4X6XA 2JGKA 2XUFA 4EB0A 5A6VA 2B61A 5T4BA 4FFWA 1CUZA 4Y2SA 3LCRA 3PDCA 1MPXA 1EA5A 4G8CA 4QDOA 4BCCA 3VKFA 3W05A 4EBBA 4U2CA 2O7VA 1IUPA 1LPSA 2WKWA 4PQEA 1CUWA 3AILA 4B82A 3DL4A 2IITA 4LIPD 2RIPA 3BJRA 2E3JA 3HLKA 4RE5A 3WQHA 3ANTA 2QVBA 5JAHA 5JATA 2Z5GA 1GPKA 1JKMA 4YASA 1XZEA 4Q1VA 2J4CA 3D0KA 3GZJA 2V9ZA 5IVIA 1RYYA 1EDDA 5JD6A 3C45A 4J0GA 4YPVA 2XUPA 1CUGA 3VJMA 2JGLA 4UHBA 4FLEA 1P0IA 2C4HA 5K3CA 1QJ4A 3X3HA 3I6MA 1K4YA 1PJAA 1YS1X 2JF0A 2C7BA 5DNWA 2QJWA 3PF8A 2VF2A 2VJAA 2WILA 4DM7A 1GGVA 2XLBA 5FXMA 3O4HA 2QXTA 1A8SA 3HRHA 2HHAA 4FDMA 4DMHA 4MWTA 3WYNA 1WHSA 4WY8A 3BXPA 4RNCA 4UBMA 4B9AA 1QIJA 3BJMA 4QZVA 2DHEA 5LZ9A 2VJBA 2XMCA 4X92A 2QR5A 3NGMA 3STTA 2VSQA 3STVA 4XIIA 4WFIA 5EHZA 4QDUA 3G0DA 4I19A 4ZI5A 3RKSA 1GKLA 1YSCA 1TCCA 2BGRA 2XB6A 5JZSA 3JYHA 2H9YA 2ZYSA 4QDTA 4CIBA 1A7UA 1UOPA 2ZSHA 1VA4A 1PFQA 1JJFA 1L7AA 3DOHA 4JYMA 4U2DA 4N5HX 4XWGA 4NMWA 2XI4A 1RWQA 4A5SA 3PE6A 3V48A 1UK8A 4KAFA 4UBKA 3H0CA 5FP0A 5ALYA 1WCYA 5EIEA 1MTZA 3A6ZA 3WYDA 1ORWA 3B3QA 4FHZA 3DL7A 2C58A 1YB7A 1T2NA 3UMJA 1YR2A 5EGNA 1ZD5A 4IQ4A 2HM7A 4DMFA 2CUTA 1WOMA 3O4JA 4F60A 1OILA 1O6GA 1VOTA 4HRYA 5LZ2A 4PSCA 4B0OA 2DSNA 5HK9A 3I2IA 5JAUA 5ALXA 5FV4A 2PVSA 4MQMA 1GQSA 2IIVA 1XZBA 5AKYA 1CV2A 2XE4A 4YK7A 4BC0A 1IZ8A 3Q0TA 1XLWA 3WWEA 1EVEA 3OPMA 4OUKX 1H2ZA 7YASA 3FCXA 4UFOA 4UHDA 2LIPA 5K5EA 1DT3A 3LP5A 4MEBA 3I2KA 4WDRA 1YA4A 1T4MA 2WM2A 3A2MA 3HZOA 4PF1A 1DQZA 1LNSA 3CN7A 4QDXA 1P0PA 2OGTA 4F5ZA 4ARAA 3BL8A 4XVCA 1W1IA 1AKNA 5BWBA 3M81A 2RONA 1XFDA 4X85A 1GT6A 3QVMA 5CXXA 5ALFA 3C5WP 2PM8A 3AUKA 1TIBA 4Y2QA 3STUA 1DX6A 2BFNA 5LZ5A 5K3FB 4MYSA 1CQZA 4X94A 1DTEA 4G4JA 1SFRA 1THTA 5ALQA 2GYUA 5BWCA 3EQ8A 1WPRA 4G4GA 2RGUA 3H1BA 1R88A 5FRDA 1XQXA 3G0CA 3D2AA 1FFBA 2YASA 5DTIA 3OM8A 4BZWA 4EY8A 2FJ0A 1LZKA 1R1DA 1GZ7A 2VATA 1LLFA 2XMZA 4FOLA 4ZRDA 4J0HA 3IIIA 1R4ZA 3H2JA 4N8SA 5HZGA 3CCCA 1XQWA 3D5EA 1H22A 4PW0A 1ZD3A 2QT9A 4WCVA 3ZI7A 4BVLA 2OAGA 3WJ1A 3F97A 3QPDA 2O7RA 3HC7A 2CBGA 2ZJ6A 3G9XA 4LYEA 4FMPA 3M3DA 4DNQA 3LLCA 1QIHA 2ZYHA 5ALMA 1F8UA 2Z8XA 1VZ2A 4H77A 4HRXA 5AK3A 1XRLA 4HAIA 3TJMA 2QOEA 2PU7A 5FOQA 3WK6A 3PF9A 1GKKA 5ALUA 5IH7A 3WA6A 1FJ2A 5KBYA 1B6GA 4AMYA 1QIMA 3SX4A 4C87A 3STYA 4QA9A 4PSUA 2VJDA 1J1IA 2HU8A 1ISPA 4AX4A 4H35A 2JGJA 3OG9A 4Y2YA 3WA7A 2PX6A 5ALWA 2EEPA 3BDIA 4LHEA 2JGEA 3G9ZA 1YA8A 5I9IA 1H2WA 3SK0A 3WI7A 2QUBA 3QPAA 5KWJA 3FYUC 2QZPA 5D3ZA 4P08A 4X91A 4MYDA 4BDSA 4KAJA 2UZ0A 2D5LA 2WIGA 2ZYRA 1ETHA 2Z3WA 3EQ7A 3OOSA 1JJBA 3D2BA 3DEAA 1YAHA 1A8UA 1VXOA 5IKXA 5A62A 4GXNA 1CR6A 1UXOA 3RLIA 3W9BA 2V97A 5FDFA 1B41A 4DNFA 4CG2A 1XRNA 1VKHA 1NX9A 3IUMA 4AN0A 5FPPA 1YS2X 1IZ7A 1Q83A 4IH1A 3HI4A 3KXPA 4X3CA 4C88A 1BU8A 4K6HA 3K9BA 2Y1KA 1LZLA 4ZV7A 3H17A 2VAXA 5EIHA 2B9VA 1Q84A 5CH5A 3F9CA 4H7JA 4X00A 1JU4A 3H04A 3YASA 1C7IA 1QIKA 4HS9A 4AN1A 5DTJA 3ESDA 3DQZA 4GI1A 4H18A 1BS9A 3H1AA 5CT6A 4AB1A 2ROQA 5JZ9A 1XZKA 3WZLA 5E4YA 4UBJA 3I6ZA 3DDUA 2WLSA 4B6GA 5ALRA 1Y7IA 3DS8A 4EA6A 5LYYA 2GYWA 1EK1A 3BE8A 1E8MA 2WIJA 4Z49A 3C43A 4B84A 2ACEA 4EY6A 3FYUA 2AJDA 4NVRA 4MXDA 2P8SA 1WM1A 1X2BA 3H2IA 5CH8A 5AH0A 5AI8A 3I1YA 2HADA 3Q8WA 1TAHA 3MVEA 1FSSA 3VJKA 3VJLA 4GHWA 4K6KA 3K6KA 1CIJA 5DLPA 1XKTA 1AGYA 2XUIA 1GQRA 3WKAA 2G4LA 5AIBA 1SC9A 1G4HA 4CFSA 3R3WA 3V1LA 3EQ9A 4I3FA 1P0QA 4J0IA 2J3DA 3KWFA 3IVMA 1QO9A 3C6BA 3F96A 4DLNA 1QIDA 5D6OA 2WU3A 1QGED 3QMWA 1MAHA 4J0JA 3G9UA 4GDMA 4Y2RA 2X8BA 2HDWA 1W4LA 3IURA 2K2QB 1XZGA 3E4DA 2HA7A 2WSLA 5HKAA 4LXHA 2XUDA 4FLFA 3G02A 1R3DA 4L9AA 4B0PA 1VJ5A 1WPXA 4GEGA 5ALNA 1XROA 5FKJA 5HFAA 2J3QA 3TRDA 2W6CX 5ISMA 3IUJA 4JH0A 1J06A 4MEAA 1HL7A 1E89A 4CCYB 5DYTA 2QJRA 3PI6A 2QKYA 3O9MA 1S8OA 1XQYA 3N0TA 2ZJFA 2HL6A 5CH3A 4UHFA 5ESRA 3QZUA 3KD2A 1EXWA 3W06A 2Y6UA 1XRMA 3KWJA 2YXPX 2XT0A 3G0GA 4PO3X 4JUIA 1FFEA 4U2GA 2HU5A 2XUAA 3QYJA 1UOQA 1MNQA 4H7FA 1EX9A 5CT4A 1WB6A 4U2FA 4BAUA 3FLAA 2WG1A 5I7UA 1ZICA 2QS9A 4HXGA 1CLEA 1SCKA 1N8SA 1DT5A 4H7KA 5HK8A 2AXEA 5C8ZA 4EY5A 5AO9A 1F0NA 3GA7A 5A7FA 5JALA 1DINA 2WJ4A 2B20A 3FNBA 5JASA 4KR0A 1TRHA 3WL8A 3WWDA 1CUAA 2Y2UA 3A2NA 1Q0ZA 3R41A 3E1GA 1NU6A 3OTQA 4Y2UA 3WK7A 4BCDA 4N8EA 3C8HA 1UK9A 4M0MA 1XRQA 2R11A 5IVKA 4MWSA 5HFNA 3K2IA 3S2ZA 1AC5A 3WL7A 1C7JA 3NWOA 5JAOA 4ITVA 1LBSA 3VISA 1NU8A 2OCIA 4OB7A 1IVYA 5AKXA 5JADA 3C87A 1VE7A 4UPDA 3V1KA 1DWQA 1XZMA 2WHPB 5DJ5A 1QIGA 1UOOA 5ALVA 5E2IA 2Z8ZA 4E14A 4BZZA 2WIFA 2WJ3A 4G9EA 1ZJ5A 5BOVA 1GPLA 1Y37A 5AI6A 3MUNA 1ODSA 5AI5A 1A88A 1QO7A 3WZMA 5AKZA 2OAEA 5DWDA 4WFJA 3FBWA 5AK5A 1ODCA 1R9MA 4BE9A 4BTLA 4LXGA 4OB8A 3M82A 4WJLA 5ALEA 4P93A 4HTAA 3ESAA 2YYSA 1E5TA 1W6RA 2EDCA 3HYSA 4PNZA 3W2TA 2BCEA 4X97A 4L72A 1CUHA 4ZV9A 4BAGA 3QM1A 2XLCA 1J07A 3IA2A 5LZ4A 4RPCA 2FX5A 4TVKA 4UBLA 3IULA 2Y6VA 1ZIXA 4B9EA 4YX9A 4DNOA 3WK8A 3QH4A 1EB9A 1DQYA 5AM1A 1ZD2P 4K2AA 2XMDA 2VEOA 4H7DA 3BIWA 4OSEA 1CUYA 1MX1A 3IDAA 1QONA 5T4FA 1UFOA 1LPAB 3LIPA 2ACKA 3ILSA 3S8YA 1HKHA 1UK7A 2WFZA 1TQHA 4IO0A 4N5IX 4OD0A 2O2GA 2G5PA 4C6HA 2RI6A 5AI4A 3M83A 4Q82A 5C8XA 3FVTA 3BWXA 4KRYA 2HA2A 5CURA 5CXUA 3O9VA 3I28A 2PSDA 5ALZA 2ZVDA 5LLSA 2OQVA 1BEEA 5ALJA 2CKMA 3H19A 4C4YA 4D9JA 4V2IA 1FFAA 5SYNA 4S0XA 5E4TA 4E46A 2HU7A 1EI9A 2DR0A 3AINA 1MAAA 3PFBA 4UFNA 5ALGA 1LPOA 4FBMA 5C8VA 4GWLA 5LKRA 1QFSA 4DMKA 4ZXFA 4XX1A 1XRRA 3C8DA 3F8SA 5HKBA 2Z3ZA 4EY7A 3C5VA 2WUGA 4Q3OA 4H7HA 3PICA 4Y2VA 1MN6A 3BDVA 5ALDA 4AMZA 1O6FA 3UUEA 5KWIA 4AXBA 2WTMA 2PUHA 5FLKA 1JFRA 3WL5A 4FNMA 3H2GA 1ODTC 4J0DA 3TGLA 1QZ3A 5LP1A 1X2EA 2WG2A 3FSGA 4OYLA 3O0DA 5K3EA 5EHNA 5H3HA 3LS2A 5ALOA 2PL5A 3FLBA 2BUBA 5HQ3B 4CI9A 3QPCA 4J03A 5HF5A 1CQWA 5CTAA 1ZOIA 2XQIA 5AM4A 1TKRA 4J7AA 2XMGA 1F6WA 3DOIA 4ARBA 2DFPA 2HFJA 1ZI8A 3C6ZA 4H7IA 4X6UA 1HPLA 4Y9SA 3WMRA 3AFIA 5AM5A 1LPNA 2HRRA 2JEZA 3DYIA 3WKDA 3EBLA 2DQYA 3ZLTA 5E4JA 5D7BA 2ZJ7A 5JIBA 1UT6A 1K63A 4QLOA 2DHCA 2BJHA 3OC0A 4ZGBA 4AO8A 4B81A 1EVQA 3ICVA 2CZQA 2OCKA 1CFJA 1WB4A 3JW8A 3O95A 2WIKA 4M0EA 1E8NA 1XZFA 4BE4A 4DMCA 2IX9A 4DGQA 2OXEA 5K3FA 1VE6A 4C4XA 5JZBA 4H7EA 3VXKA 1YASA 3QMVA 1CUFA 1AZWA 2XQGA 4EHBA 5A2GA 3R0VA 1QLWA 5AM0A 4KRXA 3DNMA 4P92A 5DYWA 1AURA 5CW2A 3FCYA 4FKBA 4E11A 3KOOA 3CCBA 4ROTA 4DTCA 3ZLVA 3WK9A 5EHXA 1QTIA 1BEZA 3STXA 5HF6A 3BF8A 1XLUA 3DKRA 4QDZA 3GBSA 3CN9A 5CRIA 3HACA 1CUSA 1CUJA 4ZREA 1UKAA 3L1IA 3HJUA 1N5RA 3I2JA 2D0DA 1GXSA 5AP9A 3NUZA 4Y2XA 3G0BA 5LZ7A 2FUKA 4L3WA 3RK4A 4U2BA 5HF9A 4UUQA 1F0PA 4G8BA 4RE6A 1AMNA 5DNVA 3V1MA 1CUIA 1LBTA 3D4LA 3WK4A 1AQLA 1QOZA 1EINA 5JARA 2XQKA 3WK5A 2AJCA 2HA0A 5AKHA 2HA3A 4CCWA 2PSEA 4GW3A 4X6YA 2CEKA 4INZA 3LIIA 1SCIA 2DHDA 2C5GA 2RHTA 2H1IA 1XZDA 1ZGBA 5ALPA 4OYYA 5SYMA 2JIDA 3C70A 1TCBA 2X5XA 2WHRA 2PU5A 3O4GA 5EIAA 2I03A 2GBIA 5AKGA 5IVDA 4BRSA 5LIPA 1MJ5A 3MGAA 2XUJA 5AKEA 2I78A 4H0CA 3I6YA 4IHAA 1KU0A 1BCRA 4C89A 1CUVA 2ZYIA 3R40A 2W22A 4PSDA 4BB0A 3H2KA 1JMYA 5ALIA 3BF7A 3WIBA 4KE9A 4UBOA 3MUOA 1U8EA 3A70A 4DSZA 4K6GA 1UKCA 4BTVA 1EK2A 3F67A 1K6EA 1XZLA 3HEAA 3ICWA 4Y2PA 1AX9A 2XQJA 2WUFA 2O2HA 4CG3A 3AZPA 3IB3A 4MJ3A 2Q0XA 2QXUA 5FPQA 5YASA 3DYVA 4BRZA 1UWCA 5KREA 5CT8A 4X90A 4FBLA 1W75A 5AI9A 3U1TA 3W04A 2XMQA 4G1FA 2PSJA 1ZI6A 1L7QA 2Y2VA 3WKCA 2XDWA 1G66A 1YAJA 4GLBA 3WJ2A 3DLTA 1XZJA 1HBJA 1ZJ4A 1E8DA 2C0QA 4KYVA 1DX4A 3WKBA 5AK4A 1ZIYA 3C6YA 1DU4A 4FTWA 2HIHA 3WKEA 1BN6A 3T4UA 5LKAA 3GELA 1TK3A 5DYYA 3U0VA 3G9TA 2PUJA 1QTRA 3N2ZB 2WFLA 5FUMA 3UUFA 1XZHA 4OU5A 4BP9A 4Y7DA 2GZRA 2OPHA 3RARA 2GYVA 4G5XA 4Q34A 3PUIA 4TPKA 1IUNA 5AJHA 4CIAA 2WUDA 4GECA 2V98A 3WL6A 1ACLA 1EB8A 3AJAA 3PFCA 1BRTA 1KEZA 5DNUA 4B85A 4HXEB 2OGZA 3FYTA 1G42A 3I2HA 2WU4A 2BAGA 2O2IA 1H2YA 1CUCA 4L0CA 4A23A 4LXIA 2JGMA 1XZAA 5A7GA 2XUHA 5AOCA 4EZIA 1EDBA 2C5FA 4HZGA 3QITA 1YCDA 1UZAA 4E15A 5AKLA 4DNPA 2WQZA
chains in the Genus database with same CATH superfamily
3IS3A 1PZGA 5AXAA 2O48X 1XTTA 3VAZA 5D01A 4B4WA 3L43A 2XDQA 5K0LA 3RCBA 4BMCA 4D4MA 2DFTA 4EUHA 3K0AA 3ONDA 2Y71A 1YL5A 1COZA 1ZD8A 3F3KA 2QYOA 4YJFA 2PBRA 5JSQA 3OURA 421PA 4O4JA 5FI0B 4BFSA 1LF5A 4CLHA 3G17A 4F4FA 1ZD4A 1G98A 2XCUA 3FYCA 3FOAA 1AVTA 2YJNA 2WMOB 4FE3A 5KVSA 3GCDA 1DO0A 5CDHA 1QF7A 2HC9A 4DC9A 2YIMA 3B7GA 3PPIA 4P31A 4WKPA 5F1PA 2ZB2A 3V8EA 1TFRA 2A9JA 2O8FA 1A04A 1FVHA 2D1YA 3AWDA 2I9PA 3JYPA 2O1XA 1LK7A 2A6PA 4JBNA 2W83A 3QNUA 1P45A 4EI8A 2F8SA 3HRIA 3OEHA 3KTOA 1J99A 5FOWA 2ZUBA 4C78A 4IIEA 2BBSA 3HYLA 3RG2A 1KRHA 3OIYA 4DLPA 1X8KA 2D06A 2QPLA 4DADA 1ZAYA 1JEEA 2O2SA 3PJFA 5CMLA 3RFVA 1LBQA 2XHZA 3MJ4A 1N25A 3AQIA 4D98A 1MOPA 5B3LA 5P21A 4R8LA 4MP3A 5GONF 3I6QA 2J3KA 3L0YA 3DXXA 1JWBB 3LOPA 5H83A 5HGJA 2O7NA 4JJEA 1L4KA 1PYGA 2QD5A 4MWOA 2EG5A 1P0MA 2R68A 5GJBA 5KNDD 2OV4A 1IQRA 5F77A 4AQDA 4IIJA 2NADA 3C1OA 4RANA 5B3AA 3ZIAA 4BNFA 4BO4A 4QDKA 1E2PA 4HGRA 3L4BA 1D4ZA 1K5PA 3EIQA 4J4TA 4RPJA 3PNKA 4EPRA 3AI3A 1KI1A 3EGDB 1GTL1 4GBGA 5PNTA 2ZW9A 4HGNA 4Y1RB 2HT6A 1KIAA 3DB1A 1P3Y1 1X70A 3SMVA 1DC3A 2D7DA 2HI0A 1ZYUA 5I9BA 4M3NA 3RF6A 1W19A 4F4JA 1W2HA 1SOMA 2O2JA 4HYEA 4R54A 2FK7A 3GT3A 3PXAA 4YFVA 1N7GA 2YHBA 3QUSA 1FP2A 3IKLA 2AN3A 4R7TA 4ITRC 2B21A 2Q8PA 3ON5A 3TRFA 3LPCA 2HXYA 3H9QA 4PAGA 4P3KA 1H42A 3ACDA 1H8ED 1BE0A 1T3GA 4P54A 2ZRPA 1UBRS 2M2IA 4G24A 2EFEB 4JYBA 4LMRA 1KZYC 4X8HA 5KHAA 3HHEA 2YVKA 5ADUS 3AKYA 1KYXA 4LE0A 4UMDA 2X3FA 3N2KB 4O4JF 2E6UX 3JQPA 2H16A 1FP1D 1NI4A 4FE4A 2FR8C 3V55A 4F3YA 4OB6A 3U4DA 5IVHA 4BX3A 4DEXA 2YMMA 2XNKA 1KI3A 2VXYA 3IUYA 3WNCA 2PLAA 1D3AA 1X1QA 5DFAA 2QM0A 4DJDC 1PFVA 4CL3A 1CUBA 5KTKA 1XCLA 2NUAB 3I5UA 3F3MA 3SWWA 3U3RA 5K99A 4AXXA 3GA5A 5KINB 4II7A 2FWJA 1DKRA 4G67A 2O5RA 1U8UA 2SKCA 4G81A 4CKEB 3GROA 1O9BA 1QV7A 5C7YA 1WSAA 2WVHA 5A7HA 1ZY2A 2L82A 2MSKA 3JZDA 4MW5A 3QK7A 4UHCA 2CJPA 4KGXA 4Q1DA 4XH9B 3QMPA 4X60A 3SM9A 1JIKA 1U98A 1E5LA 1BC5A 2DUWA 2EF0A 3PJDA 5AICA 5AQEA 4C06A 3AWIA 3PWSA 2PGAA 3CRMA 2EIXA 1MNAA 4BGIA 1SG6A 1R9NA 2AXQA 2Q29A 4W9MC 2HRDA 1S7CA 1XMIA 1CUDA 4M98A 1IB6A 2JATA 2ZJZA 1XD8A 5G41A 5A2QA 2XUOA 4AT1A 2H1CA 3L1HA 1Z5UA 5G1PA 4PLYA 2WTNA 1T9GR 5H70A 2C1ZA 1CW2B 3C15C 1G7SA 3PEUA 3TRHA 5HW0A 2O8VA 2R1VB 2R6ZA 3MOIA 3SQNA 3HI6A 4Y2TA 4NCBA 3MRXA 4NCHA 3OJFA 2I4LA 2AEEA 1PLKA 4O33A 3I5YA 2BP7B 4IIJF 1CYEA 4R9NA 5JANA 1XMJA 1G6KA 3NVAA 4P38A 1NXWA 3L7AA 2YKGA 2PKWA 2HCBA 2R8BA 3JQBC 2I3AA 1R0RE 1QIFA 1W46A 2QNBA 1MVOA 4MW1A 2JIZA 3HBNA 5FBWB 3ZHCA 1PS8A 2HPVA 4P5DA 4WVFA 1WUIS 4F5WA 1TZ2A 3DVAB 4L08A 5BORA 1XU9A 3K0FB 2G88A 1T5SA 3MB5A 3KLOA 4KSBA 4V0RA 4M0KA 1ES9A 1SK8A 2HNBA 3H86A 4MZXA 4MLCA 2FPWA 3KXLA 4RFSA 2XADA 5D85A 1HT0A 3VVLA 3BERA 2H4HA 2IYTA 2B37A 4GYJA 1WU8A 4OQFA 4X1KA 3LV8A 5GVSA 3FR8A 3VVCA 1OY1A 5C5CA 4J4BA 3ZDBA 4Q05A 3T5GA 3S40A 4OP3A 1C2TA 1T24A 1WU7A 4K86A 2C2ZA 3TEJA 5AW2A 2GAAA 3GJQA 3ZWMA 3RS2A 4IIHA 1X1EA 2J1LA 3AO0B 2E4AA 3AR2A 4K9OA 1N32B 1HEUA 4G5RA 2OQIA 2Y66A 2QEQA 4HOYA 3OQMA 4TKZA 4A3SA 4YCLA 1IWOA 1BU5A 2WRZA 2ZPTX 3BWVA 3RUEA 3DJYA 1MJNA 4PVCA 4OQDA 5AKJA 2J48A 1THMA 1FLNA 2OSBA 1GYPA 4BAZA 3E0XA 4XJSA 5IJ0B 3I34X 3R5XA 2WHPA 1ZUD1 2CSUA 2HA6A 4INOA 5REQB 2G5TA 3PPYA 4UPVA 4YCMA 1YMQA 1HWYA 1MX5A 2P6UA 1GPBA 1OC2A 2J07A 3P0IA 4PFQA 3RTDA 3D8SA 5LQJA 1D1QA 1HRKA 3BD8A 5I7AA 3BXFA 4C7BA 3UFXB 1Z4LA 5HF8A 3UUWA 3GJ7A 2Q4DA 2ZIGA 2ZANA 3D8NA 4WERA 5JO9A 4ZK2A 4FMCB 2VHQA 1RYDA 5BV7A 3WIOA 3PC2A 2AJLI 2C9OA 3K6SA 1E1DA 3G3EA 3K0BA 5JS7A 1BN7A 4OHWA 4BN0A 2QN8A 4W5HA 1L5LA 3FJYA 1DEHA 3ZY3A 5C1DA 4Y8VA 1Q0RA 1I14A 1R0YA 2NZ8A 2OG1A 3ESBA 5AJUA 3UV3A 4R5HA 3GXOA 2HO4A 1N5IA 4QUGA 4PPQA 1J23A 3V9AA 1U28A 3VDNB 4E08A 1VFNA 3W3AD 4K9DA 4MROA 4PM4A 4BV9A 3NKLA 5AVTA 1KO8A 4D4KA 3QE9Y 3M49A 1JKFA 2I3BA 4ZMRA 1H3EA 1NTRA 5KAPA 4N01A 1CY4A 1E66A 2C95A 2D2VA 4J2HA 5HILA 1CUUA 2A8YA 2OCPA 4MI9A 1P2DA 2JVKA 4WNCA 3CT6A 3TYXA 3C1AA 5L6LB 4UD6A 2QGFA 3UIEA 4LFAB 1E94E 4BYMA 5C8YB 4U9UA 2P67A 2DH6A 2VUSA 1TA0A 1O2DA 5ALKA 2ONKA 4JQOA 1L9XA 4NK4A 2OXFA 4KC0A 3UTCA 4H6WA 1H94A 2HXSA 4LDPA 4RL4A 3FUWA 4MB6A 5EJ2A 4O02B 1PSZA 3TTTA 2HLDA 4OL0A 4CQMA 4E88A 3E4CA 3F4BA 2VSXA 1C7FA 5T8KC 2QLFA 1ZMXA 1TZBA 3EZNA 2PK3A 2BR5A 3ONWA 4ETWA 3R5KA 4N5LA 3VM6A 1WPQA 4TL7A 1RWNA 1S96A 3T5DA 4A6EA 3MCUA 4D4IA 3TUIC 2JI8A 2O0KA 3HZHA 3AVPA 3I5AA 3K8YA 2EWWA 5DHAA 3BK1A 1O57A 3B9PA 4P22A 1FDUA 4UMEA 1GRRA 4KE7A 2H8GA 3KXDA 4E03A 1A27A 4RU1A 2IYLD 3COPA 3F6CA 4F4HA 3SBEA 5TY0A 1PK8A 3TB6A 3W4IA 2D00A 2WA2A 4YI3A 4ZTZB 1IXZA 3H6HA 4BVKA 2OHIA 4GVPA 1DAMA 4R2HA 4U63A 3FOZA 3CRNA 4MCAA 5BV8A 3ADKA 2I3DA 2E37A 2R8RA 2ZTMA 3SP1A 1E4VA 1KQGA 4XDZA 1Z7YA 1H1DA 5KTYA 1KFBB 1P0FA 1M8GA 1SC4A 1U8FO 3LC2O 4QELA 2FF5A 2PMKA 1W2GA 4RO0A 2F64A 2NVUB 2FX3A 5EJ6A 4CG1A 4BQQA 1K66A 4JI3B 3UM9A 1FFCA 3OE4A 2ODBA 1K9VF 3U9LA 5J4VA 5E38A 4YMUA 5LA6A 4O2RA 1ELOA 4GKJB 3A1TA 2AG1A 3GNTA 3TXAA 2J0EA 4Y9RA 1IBMB 4KBFA 4MWGA 3UW3A 3DH0A 3PFHA 4JWTA 4JYPA 1RABA 4LXXA 5AI0A 3WWOA 2VQ6A 3ZV7A 1QKIA 2AUTA 3HCEA 2GN2A 3OEYA 4JVLA 4GBJA 1WB5A 5B1SA 1HQCA 3MBOA 2LCIA 3ZJ4A 2JRCA 3AYZB 3OIGA 4OQNA 1L7VC 2XTJA 1AOXA 6REQB 4F7DA 2IOFK 4JITA 4JVSB 1HE8B 4UVIA 5K09A 1AUVA 2YHSA 1QIEA 4R0NA 2CFSA 1U0NA 4OMCA 1QPZA 1HFJA 2DPHA 1HDEA 2ENUA 2W0SA 5GPBA 3HR7A 5IWCA 5KOHB 5JCPA 5ES4B 1I4DD 4Q4JA 5DGDA 1G20A 3VOSA 4GOKA 2AR9A 1QGUB 2PPLA 2FFQA 4MR9B 1X7GA 3VYTB 2A5YB 3FNEA 4FB5A 1HNNA 3EAQA 3FWHA 3KR1A 3MB8A 1CVLA 1T15A 5FI1B 1QQ6A 3RVRA 1Y5IA 3CRZA 2IF0A 4QUJA 4F72A 2P40A 1Z7BA 4XX0B 2GERA 4IZOA 2I3ZA 4ZXPA 1I4TD 1K9SA 3JZMA 2BHTA 3PDIB 4E07A 1RQXA 2I7DA 3FUXA 4DEYA 5JAPA 4DQUA 2ZUCA 4BJ1A 1BFKA 2NO6A 3CNLA 2J7KA 2XUGA 4X93A 1C4WA 4XSGA 1T2DA 2P2NA 3UB4A 1FL9A 4U6NA 1TFUA 3TB4A 4HQOA 2KLBA 3N05A 5HEKA 3UK1A 2QUJA 4DM4A 1SELA 2MSDB 5U4QA 1A4XA 1FRFS 1BX1A 4NJMB 4D6XA 4C14A 4TLAA 2WK1A 1UBUS 3OCVA 1G18A 1MP0A 2C31A 4EZEA 4X84A 2P4UA 4CMIB 4E5MA 2C57A 5GY7A 4R0MA 1KDZA 1H23A 2B3DA 2GN8A 2OLEA 4L5JA 1K8QA 3BMNA 2JD2A 3L7CA 2A1IA 4IFEA 1ZR4A 1F48A 2HCFA 2NW6A 4GXRA 4BN5A 3HKEA 1NC3A 3UAVA 2JK0A 4MJ7A 3UWPA 3G8BA 2NZJA 4DY4A 4CTMA 1ORVA 2HEIA 4WLUA 2ZRKA 5LQUA 1MOSA 1Z7WA 1ISGA 4RLFA 2XMSA 4YREA 4D0GA 1OJLA 4PO1A 1ENPA 2FPPB 3VHQA 4REQA 1G4UR 2FTKE 3L8FA 4UASA 3K7EA 3V97A 3ZCVA 2YJGA 3TQHA 2P2CA 4RW0A 1JALA 1T3LA 2JI9A 5EQTA 3OT4A 4YCSA 2Z2ZA 3LUAA 3R6LA 3KD3A 2NU6A 2OHVA 1CK4A 2ZQ5A 4FS3A 3EBPA 2SHKA 4R98A 2BKUA 1DEXA 1E0DA 1YKGA 4ZPXA 3ZW9A 4YJ2B 3A3OA 4NBSA 4JLMA 4X44A 2MMCA 4F46A 1LRKA 3SF0A 3CFYA 1QH0A 4DLRA 1SHTX 3FVRA 4FNAA 1SC3A 4DLWA 5E6RB 3EDRA 4TTSA 1DCFA 3TX6A 5FNVA 1CJTC 3EZFA 4DDTA 2OFXA 4AX8A 2ANBA 2AJBA 1A69A 3HDJA 4Q4AA 5SICE 4DF3A 1OIVA 1LGYA 4JHLA 1N33B 1OI4A 4BECA 1H1TA 1JIQA 2QVXX 5GINE 2FVYA 2Q3JA 2IV7A 3PEFA 5JVDF 4GUDA 3U49A 1TVKA 2B0CA 4FDAA 4DIUA 4IVRA 2H7YA 1EUCB 5ALHA 4Z86A 2NXEA 3LNCA 3UEOA 4IAOA 1KO5A 1LBIA 1UODA 4JC8A 3I9FA 2P9FA 4LFCB 3T41A 1BO6A 3L6BA 1F3OA 5BURA 1DC6A 3PC3A 5FWDA 1WB9A 3ZCXA 4XYEA 3KYCB 2WAMA 4OGFA 4EARA 2Z8YA 4DSUA 4A4DA 4QFMA 3DV0B 4QVIA 1JT2A 3HP4A 3MT7A 4Q93A 4YHHB 4DV4B 1A1SA 2VHCA 4ZRMA 2RCNA 4JEIA 2FQQA 4MWDA 5FUVA 3HE3A 3GLHB 1AS3A 4UBIA 2M6KA 2B99A 3DT6A 4DV5B 1RJGA 1O7JA 3DR5A 1II8A 1E2IA 1YZNA 1Z68A 1C81A 2J3EA 3GK3A 5HQ3A 1AK9A 3R77A 2C7GA 4XJVA 3RHFA 4AY5A 2FNAA 4BDTA 3WHLA 3KAJA 3DOFA 1HUQA 1X39A 4LECA 3HSSA 5GJVC 1PVDA 4DABA 1KARA 2EDAA 3L46A 5AOAA 2G1AA 4GOMD 5AKIA 3T3PB 1CS0B 2O2EA 3AU8A 3B5JA 3C6XA 3R7NA 1ML4A 1ZH0A 2ZG6A 2WFMA 4CQLB 2N46A 1PR6A 3AIMA 2IYSA 1TIPA 1UMBB 5AVKA 3BGWA 5G0UA 1WF3A 3SJ7A 2BMAA 3DE7X 3TE7A 5ALSA 3AJ9A 1UKEA 3PSAA 3KLNA 1E1KA 2R79A 5CG2A 4DR2B 4Z53A 4IDDA 4J2OA 4XDHA 3N2LA 1RI4A 2YDXA 1XTVA 3Q7TA 2JHGA 1XZQA 2X0NA 1VA5A 3EMDA 4FN5A 4NMHA 4NYIQ 4N3BA 4YPOA 1R4NA 2EJCA 2X1VA 3PIDA 3H4IA 2F48A 2QG4A 2XQFA 2OM6A 4KE8A 4B45A 4B7UA 2I6GA 1BJKA 3DAYA 1IJFA 2QY9A 1ADYA 3RC7A 2YZ7A 3IQEA 3KQHA 3U48A 1KHHA 2L69A 4J0KA 5K6TA 2JAUA 2QRZA 2NO0A 5FNVF 4EW1A 4TQAA 4RTMA 1J20A 3ZQKA 2P5YA 4H7PA 2HTFA 4UCFA 3ZLBA 4Y6RA 2ISCA 2PR2A 3BCSA 4Y1FA 3SMQA 4BP3A 3MRVA 4WCFA 1GG2A 4F8YA 5FX2A 4D4GA 4NBLA 2G67A 3D59A 3M8KA 1W85A 1G5RA 4YEDA 2XUFA 3MGBA 5ENZA 1NC1A 5A6VA 1CKEA 3TDNA 2B61A 1YZUA 2AZMA 2TMKA 4Y2SA 3LCRA 4MH0R 1A9ZA 1HDZA 3LRPA 4BNIA 4XYLA 4G8CA 5BSWA 2OCDA 1FYWA 3X1MA 4DSNA 4BCCA 3VKFA 2ZLBA 1MGOA 1RZ3A 4QRDA 4BEVA 4JXXA 2G1PA 4U2CA 3Q3CA 1SBCA 1X1BA 2I6QA 2JD0A 2KBEA 3L02A 1SUIA 4V3BA 2XNDA 3C1UA 3OZXA 3ULKA 3V3KA 1EP1B 1GRNA 1LPSA 1RRMA 1VB3A 4LI0A 3O8BA 4ZQIA 1CUWA 3GLIE 2XA9A 3LHIA 2ZUWA 4B82A 1SHJA 2WKRA 1UC8A 2EWMA 5CVVA 4OFZA 1OB5A 2YMLA 3WQHA 4MA0A 5DYGA 3AM3A 5GOTA 1NDQA 5B2FA 1LVUA 4HO1X 4B3SB 2QVBA 2AQHA 4HDSB 2Z5GA 1ZCFA 5DBGA 4U5XA 4N40A 5J40A 3QW4B 1LRLA 1KL7A 5E7QA 1FPMA 1VMDA 4COOA 4Z51A 3SEZA 5A3VA 1LDEA 1XFAA 4OAQA 4ZKDA 1ONBA 1X13A 3GNQA 3RAPR 1C9MA 2WABA 2YXEA 4R69A 4CM4B 2X3UA 1J33A 3BWDD 3TTSA 1EDDA 2YZGA 3I9OA 4GI3A 1RPAA 1Z4NA 3MTIA 1H5UA 4US0R 5DWVA 3GEEA 4MUFA 2QSJA 1K7YA 3J7AC 4NQRA 4RGBA 3OKAA 4UHBA 1P0IA 1M2FA 3NALA 1V1RB 2G9UA 3OCZA 5K3CA 4GMHA 2VF4X 2O9JA 4YXWD 5BN3A 4DMGA 1RZRA 4EJSB 1PJAA 1YS1X 2DE0X 1P91A 2C7BA 4F1WA 1E20A 1XXHB 2OOKA 2IUFA 3D6UA 3PLRA 5C7IO 3GFOA 1U7WA 2X2EA 2P75A 4MI6A 2WYIA 5CM8B 1CZNA 1P60A 4BFCA 4KN5A 4Q1EA 4EA8A 3I6IA 3DPUA 4ML3A 3IHWA 2G72A 3BKWA 5DN6D 5BQOA 3TBHA 5FXMA 1C1XB 4NATA 2QXTA 5JJKA 4DMRA 3A6EA 2QG9A 1W4ZA 2DETA 5JS1A 3AEQB 3TQOA 1U0TA 3JTMA 3C4VA 5F7JA 1U6KA 3OHSX 2NGRA 2BYTA 3G49A 3WYNA 3F90A 2NSHA 2G06A 4EITA 1NUSA 3BXPA 1HR0B 4LJAA 3VKWA 4RX1A 4RNCA 3KHSA 2FKNA 4ZD6A 3GLFE 2X7XA 5JC8A 5KYWB 5LMZA 4L2IB 3EC7A 4IEEA 1T8PA 4HY3A 3TTYA 4XDYA 2WE8A 2NU8B 3IDSA 2O2CA 2Q6OA 4EOGA 1L3BA 3SOZA 1VJTA 4OP2A 1M1YE 2IZ1A 2PKRA 2DH5A 2ZI3A 4I5FA 4KXNA 4WFIA 3N8DA 4MKIA 3AF4A 1JEYB 1Z2DA 4B33A 1FYVA 3BFKA 4HSGA 4HV4A 2ZKLA 4N7MA 1P1BA 3OLYA 4I19A 4J43A 4YJ3A 1I3OA 4ZI5A 1Q22A 4AIIA 4RZUA 3JARA 2GJAA 4N3AA 4Q4CA 3OP4A 3DOJA 2JS7A 1N5DA 1F2DA 2QN3A 1Y3IA 3IDZA 3ZWAA 4DA0A 4DDHA 2QJTA 1ORHA 2REOA 4NRDA 5JDCC 1UOPA 2ZSHA 3AVWA 1VA4A 4ZRNA 5JISA 1H93A 2SCUB 1PFQA 1JJFA 1REQB 1L4NA 4U2DA 1DI0A 1R37A 1SVKA 2Y0CA 3MSXA 2PXAA 4PR3A 5F5NA 1BKSB 4URXR 1A5AB 4UDXX 1N5KA 3TK1A 1B1AA 1T8YA 1ZUNA 3V6LA 3ERCA 1Z82A 3OICA 4GOOD 4LBZA 1VE3A 3PE6A 5C5IA 5DM1A 4KN9S 4DLKA 3V48A 4CLRA 1XNQB 2O8BA 1D9XA 2EYQA 2RBKA 5G0TA 3PQ2A 4JT9A 3A05A 2I65A 2O8CA 5HE8A 4FCCA 3KYDA 5FP0A 3SFVA 1EM8A 3FM9A 4C0BA 8ABPA 3E7XA 2JGNA 2CD7A 4B6OA 4R9SA 4WTOA 4FSDA 3CX7A 4DN6A 3P0FA 3MSCA 4ZOLB 1SUEA 4K9SA 1HSZA 4QULA 3DMHA 3WL7A 2ATCA 1QYDA 1ORWA 1L4BA 1HE2A 2ZI9A 3KXIA 5KUTA 3M7IA 1EHIA 1ZRSA 1NXXA 3HVJA 4UEQA 2H65A 3AB8A 1E9RA 3UMJA 5EGNA 3PUJA 4AMVA 1N1EA 1OWMA 1X80B 2CJFA 3PQEA 3QFFA 3EG5A 3BICA 3QLUA 4IQ4A 4D8VA 1UWVA 4K0KB 5F5LA 5DMXA 3B20A 3L4KA 1BYUA 2CUTA 1EFRD 1J0BA 3UOWA 4D82A 4O3MA 2NSDA 5CA0B 5ITVA 2WWHA 2HQBA 1I0LA 1N0HA 3RD5A 2F59A 1BDBA 1SBNE 1HH4A 4OI4A 5IAJA 3KT3A 1GG5A 5H9WA 2XWJI 3LK6A 5DBHX 1BYIA 5LZ2A 1I32A 3C5EA 1YKFA 1W93A 2AN4A 3C6KA 3JQ7B 4IV5A 1HMPA 3ILYA 4B0OA 1CJCA 3I2IA 4V0LA 2IUUA 4C21A 4RTQA 3PT9A 3NETA 1SH7A 3DWFA 1KH3A 2Q8NA 3MTBA 4MQMA 3V2GA 1T2FA 4GKAA 3RBXA 1WUTA 1DARA 1ZUIA 3COVA 5AKYA 3RVDA 5IZ4A 5KWSA 1S4QA 5D5PA 3PL5A 1LSSA 5LQNA 4EB6B 2FPOA 3Q0TA 4QPDA 3WWEA 4YJ3F 4J07A 3TGWA 2IHBA 4NE9A 1H6DA 3OPMA 3GJTA 4JLPA 2EBUA 8OHMA 3G0HA 4CLEA 1MC5A 2P2GA 1BX3A 4JI2B 4RM3A 3VPSA 4RVHA 4CKBB 2B78A 7YASA 1T9AA 3Q15C 4UHDA 3UJPA 3VSEA 4AKIA 1PZNA 4XB2A 3THWA 2GTHA 4R16A 4ZO7A 3SKVA 2CHGA 1G8GA 2PZAA 1DT3A 3LP5A 4M8SA 9GPBA 3ZEIA 3DZ8A 4MEBA 4G0NA 2VDMB 2ZI6A 2JCXA 3S44A 2DUMA 5H7XA 1R8QA 1PJSA 1QS0A 1QRUA 1EAMA 1RXCA 3HZOA 2HNKA 3BQNB 4IJ6A 2F43B 4DJ5X 1NT4A 2H31A 2JZNA 2YV4A 3SM3A 3KAQA 1VCHA 4EHLA 1PR0A 1LVGA 4HNTA 1ISFA 3F6YA 3G7SA 3KPJA 1EVZA 1XALA 2FGJA 1LNSA 4JR2A 2CV0A 4URFA 4U2KA 5F35A 1FFHA 1PSDA 1Z33A 4QDXA 3PHBE 1UIRA 3K5HA 2LP4Y 1MH1A 1NUHA 5FULA 4KDRA 4WN3A 5TQJA 2XRYA 3I4LA 1RJFA 1W73A 4J1SA 5C53B 1USGA 3BL8A 5KNDH 3DFIA 3KEOA 3RFFA 4E22A 5A5EA 4LF7B 3VSCA 1ADBA 4YV2A 3LSTA 5F23A 5K8LA 2O6HA 1DIRA 2OO5A 4RDCA 4NNJA 2I4IA 3M81A 1GU0A 4MJXA 4QO7A 5F9MA 1U8CB 3IP3A 3WRWA 4WE3A 3SU8A 1FVXA 1QHHB 1E2LA 2PD4A 1MEOA 2VXBA 3R24A 5DXFA 1T2UA 3EVCA 3C5WP 4LGVA 2Q5CA 3EUEA 4HYTA 3NH9A 2PM8A 3AR6A 1G0OA 3ANXA 2O2YA 3OE5A 1PEDA 1FRVA 5J2UA 1HYHA 2WICA 5JCOA 2QMZA 1QG6A 2ZROA 4E21A 2BFNA 1HLDA 4HWTA 4L4UA 2O8DB 1B6SA 4JB2A 4RFLA 2N9UA 4M1MA 5I3ZA 4MYSA 1CQZA 1MVLA 3D4PA 5EVCA 1DTEA 5CXQA 3AYXB 1PJBA 4RMJA 5ALQA 3U13A 4BUCA 1I2ZA 4KSCA 4CMJA 3BDAA 3OJWA 5GV7A 5BRJA 1RPJA 5K0EA 4DB4A 5TV2A 4CCSA 3N1UA 2OHXA 3MFYA 4CKCB 1R88A 1RHMA 1VJRA 2XR1A 5FRDA 1M74A 1RJ9B 3SZLA 1CY7A 1JFFA 3QW2A 2CDCA 3D2AA 5T41A 1PJRA 4AS1A 2O2DA 5FTKA 5DTIA 3O93A 5DMHA 4RIHA 1JLSA 2FJ0A 4KU4A 4LJLA 4RSMA 4ZMBA 3VPFA 1GLGA 4M7OA 1RAEA 4X5OA 4P8RA 1R74A 2G36A 2XODA 1W0JD 1JQJC 3NBYC 1JI0A 3SHOA 4FFOA 3X2SA 2Q5LA 3DFZA 1BNCA 3QIAA 3AVVA 4KUEA 1CIVA 1WY7A 2TS1A 4AY4A 4WBNF 2WUVA 2IXFA 4YDQA 1R4ZA 2AQ8A 5EA2A 2Z57A 4P4TA 1TGYA 1YB5A 4BLWA 4CM8B 3OEHD 4QXMA 4YFYA 4JKIA 5E3IA 4PBTA 4F2DA 4MAAA 4C3VA 2BMVA 1XQWA 3EVFA 1F9AA 3G2HA 3PK0A 3A6JA 2PX3A 3P32A 5DHQA 4ZK6A 5ITSA 4N48A 3RS9A 2BWJA 2OILA 3ENVA 4I36A 1E0AA 1N2CA 2AA3A 4WINA 1NBAA 1HL3A 1Y1LA 2Z95A 3JTEA 3E6AA 4QHYA 5LBTA 1ZD3A 5FLXA 1XAGA 2GSWA 5BPHA 3FMPB 2O14A 1T4CA 1KJ9A 2ASEA 3HB5X 4TKVB 2PWZA 2ZITA 4U7HA 4WCVA 4F8EA 1TPYA 2IOQA 2P6MA 5HRCA 1YVDA 2XGJA 1T9HA 2XX3A 1QBGA 2ALJA 1GXSB 1I3LA 3G85A 2PRIA 3QPDA 1CU1A 1M2JA 3P8ZA 3B6MA 4M0UA 3RVBA 5MDHA 4DQXA 5J2UF 1IPEA 1NBMA 4NOJA 2FSUA 4IDAA 3VR2A 3BZBA 2CBGA 1KZ9A 2HKIA 1AKTA 1HURA 3B1ZA 1JEDA 2FSIA 2V54A 4FHDA 4N03A 4FIDA 4HWGA 2Y0PA 2Z2KA 3TD9A 3UCEA 1W96A 4TMVA 1XB2A 2ZB7A 3A4NA 3PEEA 4BOYA 1N7JA 1X3SA 4PHHA 1AKVA 2ZYHA 4KV9A 1WBJB 2H4ZA 4M9SA 1F8UA 2FLKA 4LVCA 1A95A 3UVEA 4HRXA 4PZCA 3SS8A 5DB4A 3H3JA 1V6CA 1AZLA 3H84A 4KPFC 3E81A 1IULA 4RK6A 2FXIA 1HE5A 4KR9A 3ROFA 1Q91A 5IU6A 1GZ5A 1GKIA 1TUBB 3TJMA 1F2TB 4N5MA 1KO4A 1CF2O 2A1UA 4LZLA 4UAUA 4DM3A 3MTQA 1RAIA 2IL1A 4FYIA 3IQGX 3WK6A 4YLEA 3RREA 1VMIA 1TM2A 5ALUA 1NBOA 2R3SA 3UUGA 2V6BA 4Z4HA 2ZBUA 1IM8A 3RFTA 1Z0KA 4XYBA 4DBZA 1M54A 2IXTA 1M8FA 4XCQA 2LDBA 1UPAA 1LLCA 3ZGLA 1LWOA 4WNAB 3UPDA 2H6EA 4P53A 4W7IA 3WTBA 3PRJA 2HIGA 5DM70 2ZULA 2CNWA 3G9QA 4HYYA 1J1IA 4QSMA 1RQ2A 4UNPA 4AX4A 5JRJA 2AWNA 2PL9A 4B32A 4EGAA 1JDPA 1RVV1 2JFFA 1R64A 1FP7A 2BEUB 2IF2A 4CTNA 3OG9A 2ZCJA 3KTAB 1I5RA 3K5PA 1VKRA 4IUBS 3GA0A 4JLKA 2PT5A 5HDBB 2YV2A 4ZYXA 2EQ5A 3N8NA 2W6MA 4AI6A 1XTIA 4FYMA 4FGKA 4LK2A 5KDLA 2AZTA 2PL1A 4LHEA 3TLEA 1PV2A 4LDAA 2IS1A 4KH1A 1HDRA 3LC0A 3NJ8A 1YA8A 3ZGXA 2YNMA 1EDZA 4FMDF 1GZ4A 3ZV3A 3ZDRA 2PZLA 3QPAA 3JSXA 1VDMA 2HB6A 3I4CA 4IUCS 1EWKA 2WBLC 2X8LA 3OO1A 4FOSA 2QZPA 4J1QA 1P3DA 4HB2A 5D3ZA 5ICFA 4CMGA 3ZHBA 1MQ9A 1A4IA 3SE7A 2PKCA 1V4NA 1E96A 1QRSA 4REMA 1AGNA 4MDHA 3IO3A 5FQOA 4BDSA 2BM0A 3HN6A 2XF2A 4RVGA 4NU0A 5CB6A 3KT6A 4LJ7A 2Z3WA 1A8IA 4IMRA 4C0LA 3EQ7A 2HYIC 1GUAA 4CUZA 2XCTB 4P6VF 3Q9UA 1VGQA 1P7PA 4N18A 2BC9A 1GYQA 1SB9A 4GD3Q 2Y0DA 1DG9A 4I8DA 2W2XA 1NW9B 2C07A 5ETJA 1PDWA 2P6OA 1M1NB 2DLNA 2JBAA 2WSSA 2MSCB 3CLKA 5C7LO 1ENZA 1PF7E 4TWJA 1KAHA 2VUUA 3S7TA 4EQ6B 5I01A 4UNRA 2FOIA 4W5RA 1EQAA 1QFXA 3AGQA 3M4YA 4WESB 2VH5R 3DBRB 3W9BA 4W99A 5EXEA 4ZCIA 1UBGA 2X23A 3HFSA 3BX1A 3UKOA 5FH9A 1QC5B 2HMTA 4LXQA 3K0CA 4DT1B 1Y34E 3IT1A 4HAYA 4CLOB 2PRZA 3OSZA 3TTXA 3DKVA 4ZARA 1O94A 4PFJA 4Z4CA 4AN0A 1KI6A 4ZVSA 1YZYA 3PC6A 1NP6A 4MVJI 1HYQA 2FZEA 5FPPA 1WCIA 1KI9A 4CN8A 4C3UA 1Q83A 4KVAA 2QQ5A 2RE8A 4QQKA 1EBFA 2C3OA 1OX4B 5EP3A 3U7FB 3DEYX 1V8BA 5JI3E 4C88A 2LUOA 2ZR7A 5CLFA 3I4FA 1XP8A 2PCLA 4IV0A 1F8FA 1AKWA 1XTZA 4K6HA 5A4IS 2PH5A 1GV0A 3QX9A 1GGNA 2DQKA 1TPZA 1QHIA 5DGIA 4OIFA 1EGHA 3EY4A 4MA4A 1TF5A 1XDZA 1AQJA 4FHGA 3ZVNA 1Q84A 2VQDA 2NPOA 2PRKA 2BMWA 1U1IA 3PYMA 3VMMA 2BKVA 1SPBS 3DBVO 1QHYA 1CZLA 2QTZA 3MWDB 3OF5A 3VR6H 3FDFA 4NFHA 1GUDA 2I9KA 1CC1S 2ISSD 4X65B 1N4DA 3N0RA 1EFAA 3NMUF 3OSUA 1P2SA 3K70D 2FOLA 3MWEA 4AN1A 1HSOA 3EXFA 4WJZA 4H18A 3BCRA 4J1TC 2BEWA 1RM4A 3U16A 2JLXA 3C3DA 2ON6A 2GVDC 2ZBFA 1W36D 1AS2A 2EC5A 4MARA 1NTOA 4IIVA 5JQGB 2Q3BA 4BGUA 4BO0A 3K0SA 4UE6A 2HLDD 3HV2A 3CUTA 4XLZA 3W1WA 2NZXA 2WLSA 4B6GA 2C5AA 2CZCA 2R6JA 3G5UA 1ZFNA 2EBHX 3UGTA 2VWQA 2AKYA 1YDHA 1UT5A 4KIFA 5FPHA 5GONB 4D9MA 1U7UA 1L5ZA 2A59A 5LYYA 2H1WA 1G55A 4TMKA 2GYWA 4CWAA 5CD1A 1EK1A 1XTBA 3OQ6A 2POCA 3CNNA 3COWA 4WFQA 4LISA 5ER9A 3UCXA 1A9XA 1IDN1 3QVLA 5HTOA 2UYYA 3D3WB 4DA8A 5E1BA 2QTAA 1Z5PA 1KP9A 3PD0A 5BXYA 3REQB 2BFDA 4EY6A 1BQEA 3FYUA 1WXIA 3MEQA 2H1VA 4CTJA 3H2YA 4MXDA 1BWPA 2WJZB 2JRLA 4WZAB 3ZK8A 3EOAI 4KXXA 5AI8A 3RS3A 1YD7A 2FW8A 2X4DA 2XWBF 1AKYA 2AV6A 3D6JA 4ODIA 4QAQA 3RHTA 2PIDA 2PV0A 1OWLA 3VPAA 4K6KA 3LXXA 3K6KA 3OPYB 4G84A 4ETMA 2DPXA 1CIJA 2IHUA 5KYUA 3JCZA 2VOJA 1ZN8A 1AGYA 3IEPA 4CKWA 4QUEA 3WKAA 4UAGA 4BMPB 1SC9A 4YAKA 2A7XA 1C1DA 2XDQB 4L85A 3A1FA 4OG2A 1ECFA 1N0WA 1OV4A 3K0AB 4IP0A 4KYTA 2JFZA 3EQ9A 4YJFB 2C4UA 3L5OA 4GC9A 1VSQA 4XSVA 1P0QA 2AFIE 2BF7A 2V59A 4O4JB 4TMTA 1A1VA 4PTLA 2PQMA 1H0SA 1QH8A 1F14A 4I5DA 5LBUA 3K9LA 4EENA 4ZHQA 3A4VA 3OTIA 2JAQA 1IBLB 1VYHA 1Z22A 5TQ0A 5MN5A 1SUWA 1NI3A 3GEHA 2GXSA 3WYFA 4Q3AA 2WU3A 1WVIA 4U9HS 4BWFB 5G1NA 1QGED 5ABPA 2OENG 2CLHB 4DR6B 2YFHA 2BMDA 1RE1A 1D5CA 3D5TA 4Y98A 3ZTWA 1Y8RA 4CETA 4KQCA 3K1YA 5TC4A 3P9ZA 1RM3A 4LMPA 4B09A 3L8HA 3KS9A 3ISTA 1ANKA 5DF1A 4FJ0A 4N6NA 4W5OA 2CNDA 4KMOA 2HJGA 4L07A 1G9SA 4OH7A 3F1LA 2HDWA 1W4LA 3G79A 4QJBA 2OHHA 2LZ0A 1Q12A 1HRDA 1M6YA 2X9VA 1WSBA 2JW5A 2NSJA 4BLVA 1N2XA 5EJ9A 2B6HA 5AXBA 1P1HA 2VTDA 5DH9A 5C37A 4G1CA 3T3HA 2G09A 2QBYA 3MTGA 3E4DA 1IUKA 1D6SA 3NPMA 4LYAA 2A1TS 2J0VA 1I6MA 4DB2A 4QASA 1YDWA 3P97A 3PYXA 4XB1A 1EJ2A 4Z9AA 5KAMA 4C0KA 3GN1A 3OHMA 4FLFA 1JDUA 3KCQA 5ADVA 1KQ3A 4OHRA 4L9AA 3H5RA 5FOUA 3LCJA 5BSUA 2WAYA 4E7OA 5KWVA 3G89A 3L6OO 3FCCA 1VJ5A 4A8JB 1JPJA 1XPOA 2BE7A 3AFNA 3AESA 4IIJB 5ALNA 5A4DA 4X66B 1UFVA 2XPCA 3OJ0A 1Y6QA 5BN3B 2WVGA 3FB4A 4HAUA 1P44A 1I24A 1NQAO 5SZJA 1J0EA 1JS1X 3T9BA 3WNDA 1STOA 1VMKA 2AFVA 3FFBA 3URMA 4OBWA 3SHVA 3EGCA 2G5GX 4LQDA 2ECQA 2B35A 3TRDA 2W6CX 2OZPA 4MEAA 1J06A 1ISIA 2Q7XA 1HL7A 1PCXA 2CCGA 2VJQA 1FX1A 5DYTA 2VSYA 1M6NA 4DPMA 3PI6A 5KJFA 2QKYA 3RRJA 3T15A 4S3MA 1BDIA 4ZO9A 5ESRA 5COQA 4D79A 4ZEMA 1IM2A 4JUAA 3CVJA 4HPWA 4ITUA 2HY7A 3ENWA 3KD2A 1YZKA 1WJGA 3F7OA 3O31A 3L07A 1DBVO 4EKNB 1SA0B 3L93A 2O1WA 3W1VA 2BDEA 1RYHA 1O0BA 3CPHA 3KWJA 2Z56A 5C4MA 4B3TB 4V03A 2RGWA 4PO3X 4CF6A 2FGKA 4BFWA 1FFEA 1DB3A 2VP6A 2X5NA 4KG7A 3ZQ4A 2IVZA 4ZYUA 1M3SA 4NNPA 4XQEA 3IQWA 1MNQA 2R5FA 3W6ZA 4YGYA 2BMEA 1GCAA 5LUAA 2XKAA 2WM8A 1FUKA 2GHRA 4ZVNA 3F7NA 1J8FA 2FZGA 1E9EA 3EIWA 4D46A 4HLDA 2WG1A 4GVLA 4W8GA 4DWOA 2QIPA 1RC1A 1VHJA 4JZYA 3OWXA 2QS9A 5JZVA 2GCNA 2CDAA 4LKRA 3KC2A 2FW0A 2XEDA 1JQLB 3HVIA 4JS0A 4K8RB 4M8LA 4MULA 4MW4A 5EZYA 1N8SA 3E1KA 3KWMA 1QKKA 1A7JA 3SJUA 2IYAA 3PWZA 4H7KA 3QXXA 3B2QA 1KVQA 4G5SA 3W4KA 4P83A 4KR7A 3VPBA 1MXFA 3Q3GE 5AO9A 3C8MA 4QG7A 1RT9A 4H3HB 1KTVA 2R8EA 3E8MA 4K3UA 4BFVA 4DG9A 1E2GA 3RYCA 1D1TA 3A31A 3Q2KA 2WJ4A 4UUPA 1J0DA 4EYEA 1QYCA 1Y7TA 13PKA 1ZJZA 2ZBQA 5TMEA 2BM9A 1GL6A 2I4OA 3FNBA 2JIOA 3RG8A 1USUA 2FZCA 4M9CA 3WWDA 2FZ5A 2JAWA 3PD7A 4GXTA 3ZZ1A 4BO5A 1PWYE 2Y2UA 1DG3A 2Q0HA 4QPJC 3ITKA 1SBQA 1U7ZA 5IAGA 3E1GA 3NBKA 4OM7A 3UQZA 4YB8A 4Y2UA 3WFIA 2YYZA 3VPXA 4AICA 1YJXA 3I1JA 4CI0B 3VU9A 4X8OA 3E7PA 4N8EA 3HUUA 3AI7A 1TLFA 1ONSA 3FN4A 3AV3A 3N6VA 1CZOA 1L5OA 4JBXA 4KO4S 3AHGA 1A8PA 2XXAA 4ARUA 2R11A 3EIUA 1G2IA 2X0DA 4GPD1 2PD3A 4IIYA 4DY6A 3EMVA 3FDJA 3K2IA 3MN1A 5IVKA 4RFSB 2HR1A 5LQAA 4B31A 3R7FA 2HW8A 4UJ5A 1AC5A 1Y3AA 2UU9B 4X1KB 2ADFA 1D4OA 2JJ1A 1C7JA 2C9BA 3GC6A 1PL7A 3NU1A 4ITVA 5JAOA 2VC2B 3CU5A 3HY3A 3VISA 1NU8A 2HCRA 4NKRA 3QTTA 4B34A 4J75A 3H1FA 4NBNA 3FCUB 4U8HA 2AT1A 3L8CA 1KXZA 2ZSDA 2OCIA 4KQXA 5FFNA 5JRZA 3GHHA 1ULSA 1D0SA 1KOLA 3KKQA 4U3JA 4BNZA 1XAJA 5HRUA 2W6JA 3C87A 2AR7A 1WAMA 3SCZA 4GQBA 4M1EA 2PWAA 3WQQA 5E2BA 1FMLA 3PGJA 2FMFA 5CFQA 5HUQA 5GZ6A 2II6A 1GWNA 2HUPA 2WHPB 5DJ5A 3IAS1 1JHUA 5E2IA 1I2DA 5HKKA 1NLMA 4X1OA 1SXPA 2EVWX 3ORSA 4NPAA 2XECA 4E14A 3RC8A 3F4LA 2IWHA 1XTSA 3UICA 5EZYF 8ADHA 3TOXA 3WBFA 1ARZA 1U1FA 4ZCLA 2I66A 3AOGA 1US8A 1FXWA 1GG9A 3D6MA 3FZQA 3CR3C 2AQKA 1XXLA 2XXBA 3IE2A 3OY7A 3QKIA 3CX3A 2PTGA 2VP3A 5AI6A 4C08A 1XPJA 2JL1A 3KJFA 1J5XA 4IS2A 4NR0A 1V47A 1SD1A 1QO7A 1KZ6A 4WUVA 1T9BA 3B2EA 5D51S 2YQZA 2IEAA 2ZCUA 3AEKA 4ADSG 2WSYB 2KYRA 3JQ9C 1ZGHA 5EUMA 1SU8A 2RK6A 2B2CA 3VR4A 3FBWA 1HT2E 2NYAA 3KQSA 3MJCA 4EFNA 2HMYB 3BTSA 1CULC 3OY2A 1AXRA 1E9CA 1FS6A 1PG0A 1GNRA 1V95A 3PCXA 2Y1XA 2MINB 4BE9A 5JV5A 4LXGA 1D8AA 3TS1A 3GRPA 4ALNA 4Y2GA 3QFTA 1QE0A 4CMEA 4UHKA 5M3BA 1Q14A 3ADPA 1GZUA 2F9FA 1SKQA 2ZI7A 5ALEA 1ICEA 1WOYA 2VSFA 3UY4A 4E30A 4H1WA 1EZ1A 2I8CA 3G2LA 5TMDA 2BFBA 3BB3A 2O05A 5A5FA 4BS9A 1T9KA 1W6RA 1V5IA 4H16A 2EDCA 3PC7A 4D57A 1E7YA 1D2MA 5BSEA 1PU2A 2W2QA 4CQMB 2R97A 5L3ZA 3V32A 4IDHA 4ATNA 4ZZ3A 5I9LA 4PEVA 3FGOA 5K6AA 4R3UC 3FH0A 4B2YA 2WWFA 4RQTA 1VBMA 3IVCA 4YRMA 1W2WB 2FWRA 2XWSA 3MJFA 1QYWA 4AZSA 2QW0X 3GJ3A 1U3GA 4MW9A 1SHUX 2P4QA 1RIIA 4G5GA 4CKCA 1AUQA 2IU4A 4N39A 3P45A 4XGQA 3EUWA 3KJNA 2V7TA 4BAGA 1U2QA 1IQUA 3AR5A 2WAAA 3O8RA 1C0IA 1AGRA 5C32A 1U81A 3LXUX 3IA2A 3L2OB 2AF3C 2IDJA 3H3XA 3JXEA 3QQ5A 4AQ7A 1W0KA 4QTYA 4JLJA 2FW9A 2QV0A 1IH8A 1KK3A 4ZAWA 2QX7A 2FUG1 1VCIA 2Y6VA 3FJ1A 3PNMA 4U7FA 1YFZA 1ZIXA 1NKTA 2WJJA 4NZPA 4OV6B 2GVZC 2RAVA 4WACA 2ZWMA 3WGLA 1FK8A 3FTFA 4AKGA 4K2AA 3N5CA 5T3YA 1GKYA 5BWMA 3DW1X 4F04A 4II2A 3ZD9A 3I9NA 3AB7A 3RIYA 1VL1A 2Y92A 1U5AA 1KOFA 2CVOA 1JEJA 3B3GA 4IFIA 1ZESA 4MAFA 4WQMA 1FXWF 1T4BA 1OLSA 2PRYA 3A7EA 4XASA 3HZZA 4MAMA 2CUNA 1TQ6A 2BHNA 3DDHA 3EF0A 4HWRA 4US1R 3RBZA 4PLTA 1URPA 4C5AA 4UTVA 4ZICA 2H0AA 1SCDA 3CF2A 3IDAA 4LTMA 1UFOA 3QWIA 4NU6A 3BL6A 4OXRA 4MGHA 2W93A 4J90A 4K9KA 1LPAB 1BJRE 4EATA 2ZAMA 4HX2A 3LIPA 1A2OA 3KFVA 1L4UA 2IPLA 3C3YA 2PH7A 2YXNA 1KZ7B 3KJIA 4V39A 3LA8A 3E5RA 1EFTA 2OG2A 1MIHA 3IKTA 1TMOA 3IKMB 1UK7A 2GZ1A 2Z9BA 1EQ2A 1TQHA 4OD0A 4UQOA 5TPWA 1JHQA 1XX6A 2CVQA 3ET4A 1QFZA 3BN3A 3CJQA 2G5PA 1LDBA 4MEJA 5AOVA 1HZZA 4C6HA 4Q4JB 1G20B 2SKEA 2WF5A 4EKEA 5BSVA 3M83A 3WL3A 4PHGA 2GB4A 1E58A 1U94A 3RQSA 1UT8A 4KI7A 5JVDB 4P4NA 4B6SA 4LSWA 1PZFA 1JN0A 3E2PA 3FPEA 4OI1A 3FVTA 1J49A 3PVSA 2C97A 1UZNA 4OHMA 3R0XA 1VL2A 1FJGB 2LIVA 4IF4A 1H5QA 1BHO1 4ENUA 5KPDA 2H85A 1QHXA 4OHYA 1ECJA 1I51A 2J3HA 1WXQA 3AXSA 3BWXA 3C7TA 3ZV6A 1X86B 1XVLA 2G80A 5CYFA 1OZ0A 5T67A 3N7UA 5KHOC 4A92A 5F1KA 1V48A 1XYGA 5EXDA 1SHLA 4NCXA 1CY8A 5TVGA 4B3DA 4D9FA 3JU3A 1KMCA 1E3TA 2WZCA 3IR7A 1KAGA 2W37A 3OX1A 4ZQFA 3I28A 3KZVA 5HDQA 1OTYA 4HEJA 2PSDA 2CVHA 2GCOA 5F3RA 5AXDA 3IKJA 3ZHYA 1T34A 1AU9A 1L5FA 4WLOA 5ALZA 1ACMA 3BG5A 4PO8A 3TKAA 1CQPA 2G7ZA 1BEEA 1YR3A 2C83A 4DC0A 3UW1A 1UMDA 3QEBZ 3T0GA 3H19A 1L5HA 3EH2A 3HBFA 4CW7A 2LD4A 4C4YA 5T64A 1HTWA 5GJWC 2DMRA 4Q5IA 4C7XA 5CITA 3BMNB 3FOCA 3WB0A 4Q24A 3JYNA 4FZJA 3MILA 4IIUA 4ESHA 4Z1OA 4H60A 1JR2A 3TO5A 3Q8MA 1PAUA 1T8RA 2B1JA 3GEDA 3HKEB 2QT0A 2YC2C 3PTZA 5D8DA 4MI3A 5J59A 3E2IA 4L7QA 1Y5NA 1LV8A 3U3ZA 4UFNA 3OZUA 4E3WA 3AERA 3I61A 3ER6A 2YCLA 1GOTA 1U7DA 1RSZA 3IIKA 2O6LA 1MB2A 1TJ3A 3GLKA 4MMXB 1LDYA 4O3FA 1NQOA 1P17A 4A0QA 3GUYA 2P1ZA 5E0OA 3KL4A 3FPSA 3CTMA 1P2TA 4YVFA 1QFSA 1OV6A 2NU6B 3QXSA 1POWA 4RJJA 4CTKA 1P1KA 4DMKA 2GBLA 4QPCA 1W9MA 4XX1A 2ABWA 1XRRA 3C8DA 5A9TA 4LJ9A 1POXA 1ODKA 4YAIA 5IN5A 4NJOA 4IR7A 1E5QA 3WGGA 3O1IC 5CVEA 1VP3A 2O8NA 2YDYA 2A5DA 4H7HA 2QLJA 3NNDA 1PE0A 4DXDA 3GRFA 4GE0A 4Q7LA 1FLAA 3OFNA 1KNXA 5FNVB 1RYEA 4A0FA 4UQLA 4JJFA 3WRXC 3E9CA 1MN6A 3EMBA 2BGLA 4LZOA 4Q4AB 4TTRA 3ILHA 2QUIA 1XLTC 2V7WA 3K1ZA 4RJLA 4M99A 3RKUA 2YOHA 1I9GA 1U8YA 3ICCA 2VJYA 2XGOA 1SIUA 1Y80A 4DJAA 1ZEJA 3HFJA 1TVKB 3ZX5A 4IV8A 2IP2A 2IT1A 4OJMX 3RTCA 4D96A 2FWIA 4DMUB 2WZQA 3NVDA 1EFCA 2JKVA 4WKOA 4XI9A 1QG4A 2ARKA 4JFAA 3RSHA 5CK4A 1GQ2A 1QZ3A 3BTVA 2IDZA 3N2IA 1NX6A 2RHBA 2QW1A 3W7BA 5FYDA 3K71B 2B3TA 4GWGA 4OYLA 4TS1A 5BYJA 1ZXLA 2X2FA 3L92A 5AUQA 4E3ZA 4IXTA 1GO2A 1EWTA 3V4VB 1KSHA 1YBAA 5G40A 3LVQE 2WPNA 3QPVA 4M54A 1WBDA 4CDNA 1DIOB 2XYPA 1SHZA 1X9IA 4WK4B 1II8B 3LPNA 4QVGA 5CP8A 3RIXA 3CT4A 4CIVA 1YTLA 5HQ3B 1A97A 5H16A 1M7BA 1C7QA 2V7PA 3JWHA 4ZIRA 3RIGA 4NOKA 2EL9A 4YRCA 3CF4G 1PFUA 4BUJA 4EYOA 1JA0A 5EP4A 2IVFA 4W6QA 2BY4A 1CQWA 3M3PA 4RY2A 2RI1A 4K9PA 1FVFA 4J7AA 3TQFA 2C3UA 2NMVA 2VYNA 1JR4A 3GCZA 4DCNA 3L1UA 2I3GA 1SCBA 1LS6A 1YXMA 4JOBA 2HNAA 3PNQA 5CW1A 5I4IA 2HFJA 2JFWA 3M3HA 3N76A 5KVVA 4HWOA 1T0BA 5IABA 4RTNA 1HPLA 3DEJA 2O5CA 1XNJA 1N2EA 2ZR0A 4MMYB 2H2HA 3L6UA 4GYYA 2C2OA 1L5RA 1ZM7A 1DCKA 4HNAA 3UT5A 3C5CA 1R4NB 2E4UA 3G2MA 4KPGA 5CNIA 3Q7RA 4PLCA 5IEJA 1KJYA 2P9QA 3GCGA 5E4JA 4YCNA 1RIFA 2RGEA 2D2XA 2ZJ7A 1AJEA 6LDHA 2CFRA 3GJ6A 3OBIA 3SIPA 2XDAA 4AFNA 4MICA 4DIKA 3DAHA 1SIBE 4AJHA 3O5AA 5F12A 3N28A 5DNYB 1UQUA 3QXGA 2QIOA 3O3MB 1T26A 4M0DA 4WCFB 2P0EA 2XCSB 1EVQA 4M9QA 1J1ZA 1VSTA 4EO4A 1W85B 3CX8A 3BXEA 1I33A 1CFJA 3AJRA 2Z43A 3D3QA 4J94A 5FBRB 1P5FA 2IPXA 4M0EA 3ZHUA 5A3JA 4BE4A 1ESNA 1MAVA 2HBQA 1GUBA 1NXSA 2ZI4A 3EVBA 3V8NA 3W8FA 2R87A 2QTVB 4HG2A 3EB9A 4L74A 4TRMA 4G5OA 5KU1A 5B55A 2IXAA 1J22A 3CCFA 3DQPA 5GZ3A 1UL1X 4DFDA 4HTFA 3RDPA 4AJ4A 4XJXA 5IKMA 1VE6A 3GLTA 1WSDA 4C4XA 4QUIA 3F8WA 3SNKA 3CQ9A 2V65A 3SC3A 3BD9A 3QG5A 2B30A 1YASA 2QUKA 1NF3A 1HY3A 3Q7QA 3T9DA 3KLPX 3W5JA 5CFZA 4LPKA 5IM4A 2QE6A 1GDTA 1AZWA 1XL1A 5AD1A 1OAOC 4GNRA 1VBFA 1VIVA 4EHBA 2YIDA 4GI2A 4PX9A 5K0TA 1E1QA 1JUDA 1LB1B 1QCZA 2BMFA 3QPUA 2HAEA 4D97A 1WCXA 5LQRA 3I23A 4K1XA 2B36A 1A72A 3D3JA 4HS4A 4KRXA 2RGAA 1A96A 3C16C 3NHSA 4YQZA 1H9BA 3EJWA 2WTAA 1M7HA 2AF4C 1GU1A 1SXGA 1KXJA 5E8JA 1KAQA 1I5EA 3W77A 3VR5H 5CW2A 2XQVA 2FPGA 2O4UX 2PRJA 3FCYA 1HI9A 3LPDA 4TYQA 4XUGB 5A3QA 4ABTA 4E11A 4IBOA 1EP2B 1R6BX 3CUVA 2F1JA 3IBSA 3KOOA 4OVKA 3CCBA 3ER9A 7GPBA 5EL0A 3MWYW 3EXAA 3SJCA 3U31A 1T5LA 1U9YA 3MCZA 3PVZA 4Q7JB 5JR3A 1WUHS 5TEWA 3WK9A 5FWXA 4Q1BA 2UUPA 2MU1A 1QV6A 4LHWA 4PHFA 2ACVA 1EU1A 2IOFA 4MUKA 1QFJA 1VKJA 1WUJS 2EARA 4OSPA 3STXA 2C2XA 3P9XA 1VSVA 3RNOA 1IY8A 4EL0A 3BF8A 3M5WA 4GLFA 2GD0A 1ORIA 2G8LA 1EK0A 1XELA 4XIFA 3WP1B 4BIIA 3BILA 1J8DA 3PHJA 4J8PA 5I8WA 1DAEA 5JNVA 5KQGA 2OESA 1PR3A 3CN9A 2R6AA 1JSCA 3BWCA 4YP9A 1DBWA 2OZLA 4XVRA 4XR9A 1CUJA 1Y4ZA 5BR4A 3QU7A 1UKAA 4ZREA 5DRTA 3L1IA 5BVGA 1KRWA 3NATA 4PLWA 1VJDA 3HU3A 3IAAA 5AP9A 3K6RA 1EP3B 4M9XA 3CLRD 3BH7A 4YBRA 4XUCA 1GY8A 1NOJA 2VHJA 3ZIDA 4D5EA 2VPWA 2XZPA 3CEHA 2FUKA 2YBEA 4H6XA 2CSXA 1PEYA 4I1OA 5FUWA 2HDNB 2IYOA 3K9WA 2NU7A 3L1VA 3WQSB 2WSIA 4ZVTA 2ZU6A 5AQ1A 3PCTA 1LSOA 4LGCA 4D8XA 1AB6A 1OFGA 1UEJA 4B7CA 2PVCA 4FI3F 1RVDA 4QOFA 3AHDA 4IOJA 3S1LA 3UAZA 5L4LA 3FUUA 3T3IA 5IRCD 3AUSA 5C9ZA 2CNWD 3WYAA 1MZPA 3D4LA 4YJ3B 5IM4F 4IDBA 3GLGE 4LJ5A 3JARB 3DEZA 3VYSB 4P7BA 1X8XA 4GPBA 4NCAA 5FD8A 2G9QA 2XSZD 4KO3S 1RMQA 1DG1G 3OJXA 3WTCA 2H06A 2EW8A 1G8HA 3AOEA 2XE6A 2J5RA 2DR3A 5JNWA 2PSEA 3A28A 3BEDA 4LC9A 4PCAA 4XLTA 1JIIA 3HA5A 1ZUNB 3CR7A 3G5LA 3KZMA 3H65A 1SCIA 2JH3A 4CLRB 2DHDA 2O8BB 5D5HA 2HSZA 2PT7A 4FFNA 4WXYB 1GNSA 1JL3A 3IBCA 1CCWA 1O87A 1RZUA 3JQFC 4BNKA 3OCYA 2O8CB 3VU0A 1PTKA 4OYYA 3C85A 3KYDB 4NTZA 1VHTA 1T2EA 4P2BA 1EM8B 5EIXA 3ASZA 3TUZC 2V5VA 1PNOA 3QFCA 1QRDA 3JQRA 1C0EA 3HCBA 1E3IA 4AAYA 3SKXA 1R15A 5IM5A 4EEXA 4DSTA 1Q7GA 3FZGA 2RJNA 4KMRA 5F51A 2G82A 3EPLA 3NHRA 1WETA 4MQEA 4IRMA 1L6IA 3UHJA 3ZWBA 5M29A 4DAEA 3KSBC 1G3QA 5LWHA 2AHOA 1RWOA 1I4LD 1MJ5A 3RO7A 4QPZA 5AVXA 1DBSA 1NLFA 1DQRA 2J46A 3OD1A 4HUQA 4HWSA 4KZPA 2R7AA 4OYRA 3KZOA 2B8JA 4PRYA 4BWYA 1PNRA 1RRVA 3ZLJA 4CV2A 3PDWA 1EJBA 3OM9A 2I78A 2H5IA 3CNHA 1XMPA 5TB5A 1RFLA 2ZJBA 3ZR4B 3JQEA 1GVNB 2P77A 1AHHA 3K0HA 3Q7IA 4I5GA 4KLRA 2XB8A 3DTTA 3NV7A 2IKSA 2QUZA 2G1UA 4OLAA 4NYMQ 1Q0QA 3U7JA 1LVHA 4FCTA 4TWBA 2D3TA 5JLJA 4XWWA 3VX4A 5EJ8A 3DO8A 1NZJA 1M6VA 1WY5A 2ZUVA 1OT5A 2ANCA 3A7DA 4UE3S 5ALIA 4OHZA 3TBKA 2Q5OA 1UQRA 4UBOA 4XWOA 1H2FA 1UCFA 4JA2A 4K46A 2Q07A 3ICOA 1UKCA 3QEMA 1M66A 5I6DA 3IOCA 1O94D 5HCIA 3D43A 5DM60 1QQ7A 2B94A 2FETA 2P4HX 1K27A 2VF5X 1QR6A 2ZSFA 1MFZA 1XZLA 2ZT6A 3HEAA 1ZNXA 1X1SA 3ICWA 3TLMA 2UZ4A 5IBCA 1TZKA 2JJ2A 1AX9A 2XQJA 1ZN7A 5F3DA 4RQUA 4LC0A 4JP2A 5A3RA 4D02A 1AMUA 3TIGA 3W7AA 2VZLA 2W6OA 2HXGA 3EASA 3THWB 1P7CA 4M38A 1J2JA 3IB3A 3QOXA 4IIDA 4RZXA 2GEJA 2P9ZA 3H9GA 4RH1A 1QH9A 2Q0XA 3K5WA 1B76A 5YASA 4QUBA 5JXHA 3DYVA 2AWOA 3PNYA 2PGDA 2EFHB 3BL5A 1ENOA 4PQFA 3GP5A 4RC9A 5CT8A 5DEIA 1N4AA 3AEYA 3B60A 4DLZA 1QS0B 5CVTA 1KKMA 1Q3KA 2OD7A 2QL6A 4LRUA 3S2GA 4CKZA 1L4LA 2EZUA 4OEHA 3ZGVA 4FBLA 3U62A 9ABPA 2FEMA 2I2WA 2CJWA 3R6GA 5DSXA 3PB3A 3A1NA 8MHTA 3U1TA 2A86A 5EIWA 1DSSG 5LQCA 2XMQA 2QQ0A 2OB1A 2PSJA 3NI2A 1E9FA 2CNLA 4WBNB 3WKCA 5EPOA 5AW1A 2XDWA 3WGKA 6PFKA 1YAJA 3FCSB 3GN2A 2FFJA 4ND8A 4FXPA 2P1DA 2XKKA 2FLWA 4H1UA 4CL2A 1NFFA 1E5DA 3C8ZA 3WJ2A 1LLQA 4DXHA 4WZZA 2ILTA 4KXFB 4DUGA 1ID8A 2L18A 2VWGA 1XZJA 2BISA 4KYVA 2CNNA 1DX4A 1JHOA 3MMSA 1KYTA 2Q3FA 3E70C 3G0OA 2IV3A 4KQHA 4I4TA 3C6MA 3C6YA 3S2YA 1DU4A 4FTWA 3UZUA 2OCXA 3Q72A 2IEDA 2P5UA 3CLSC 1SJ9A 2ZBRA 4QD3A 3GDGA 2H18A 2XCQA 4YP1A 4YV1A 4HDRA 1I13A 2OXRA 1E3EA 3AR9A 1QTRA 3N2ZB 3W8EA 2ZIWB 4JY7A 4PICA 4JQSA 4EUNA 3K4PA 4FYVA 5J2UB 2VZ8A 1SKUA 2QU7A 4Y7DA 3ELBA 3PCRB 2P9JA 2GZRA 3KKOA 2OPHA 1WZUA 3RARA 3AU9A 5B7NA 4LXYA 1KY4A 4YQEA 1G8JA 3FKQA 3PUIA 4TPKA 1P4JA 1H2AS 5TIIA 4Q12A 2PZGA 2G83A 1JDZA 2CEAA 2EQBA 3S81A 4QBHA 2WUDA 3GPIA 4DS3A 1CRWG 3JD0A 4WZBA 3OZBA 4LZZA 3GZNA 1E6KA 1WE2A 2FWNA 4G6ZA 2R5WA 4RV9A 4WOBA 1E7QA 2VF7A 4PYQA 3RE1A 1CR0A 1JVNA 2ZE5A 2XYRA 4U0KA 4XW2A 5F73A 3WGYA 2ZU0C 1KVTA