5HJ5A

Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
266
structure length
266
Chain Sequence
MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAADHPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIMILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine-6-phosphate deaminase
publication title Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from Vibrio cholerae with BETA-D-GLUCOSE-6-PHOSPHATE and FRUCTOSE -6-PHOSPHATE
rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Hydrolase
total genus 103
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hj5A00
3NWPA 4L4ZA 1LK5A 3HN6A 3L7OA 1VL1A 2J0EA 4L50A 4L51A 3U7JA 4L4YA 1PBTA 2BKXA 1KS2A 4GO1A 1O8BA 3BXHA 1FS6A 2OKGA 1HORA 3NZEA 3HHEA 4L5JA 1CD5A 1FQOA 3ICOA 4R9NA 3BXGA 4OQPA 3ENVA 3CH7A 2RI0A 3OC6A 3KWMA 4M8LA 3E15A 2RI1A 3E7FA 2F8MA 1UJ5A 1Y89A 2WU1A 3BXEA 2GNPA 2W48A 3LHIA 1M0SA 3BXFA 3CSSA 4OQQA 4NMLA 1UJ6A 1DEAA 3ENQA 4TM8A 1JT9A 4TM7A 1FRZA 3UW1A 3IXQA 2R5FA 1UJ4A 4IO1A 1LK7A 2BKVA 2O0MA 3EB9A 3KV1A 1HOTA 3EFBA 3LWDA 1XTZA 1NE7A 4GMKA 4R7TA 1FSFA 4L5IA 1FS5A 5HJ5A 3ENWA 4X84A 1LKZA 3TX2A
chains in the Genus database with same CATH superfamily
5KWIA 4JIGA 3U7RA 2KBEA 1FYXA 3JYLA 1CF2O 5CB4A 2ZUUA 1OKKA 4DLTA 3MMPA 1WV1A 2YJ4A 3ASZA 4LKRA 1OW3B 4MKRA 5KAPA 4HTFA 5MGBA 4PYMA 5TQJA 5GPBA 4BO9A 3LU1A 3B3GA 3OPYI 3IXLA 1TU0A 1ZFNA 2Z4TA 2VSQA 3A4LA 1NU8A 4K3VA 4L9AA 2G9ZA 2DHQA 1UEXC 3O9MA 4BB6A 4NIMA 2R44A 1GKKA 2W11A 2BW0A 4KNWA 4DY6A 1HYGA 3E0QA 3T35A 1P6QA 3O4FA 3WXMA 3KJEA 5F9MA 5U4QA 5LJIA 2AMYA 2FZKA 4LECA 1NF3A 1U4NA 5AVOA 2ATEA 1G41A 4H4EA 4DT1B 1I7QB 1BXRA 5IVIA 1T3SA 2BTQB 3ANYB 3AP3A 4M98A 4QICA 3RJZA 1G66A 3A0RB 3K5PA 3QUCA 3LYAA 1BXGA 4MGHA 1PFUA 3GUVA 2OHXA 1D8TA 3Q88A 5BO5A 3BE5A 4OFWA 3LT0A 4J9UE 1I6LA 2GK3A 2COEA 3E23A 4XWWA 5E4FA 3BXXA 3H86A 1G7SA 3NOVA 3DS8A 1XMSA 1R5JA 3H8VA 4Q4HB 4RE6A 3RREA 5KNCH 1EFTA 3CJRA 1P5RA 3I2YX 2IX3A 9MHTA 1DCFA 1P2FA 3HKDA 2DC1A 4I1IA 4QU5A 4YCAA 2XB6A 3AV3A 5TF4A 1CC1S 3IKTA 5DP1A 4TL9A 4HRAA 3GJZA 1N2GA 4NDZA 4ID9A 3OBIA 1ZDMA 3LSTA 3LF1A 3PNOA 2QW1A 5A1TA 2X22A 2WU0A 3ILHA 3OIDA 3FB1A 2IH4A 3DE6X 2C0PA 4FS3A 4WWHA 2F59A 4M1KA 3DL7A 3BXEA 5DFAA 4OGLA 5LZ7A 4BQOA 4GI7A 2PL1A 1Q1AA 2XGOA 4IHJB 1YHYA 4EFLA 1XA3A 4BTVA 3CO0S 1K3UB 1GG8A 3RUHA 4MGIR 3DZCA 2GRAA 1SOMA 4UOEA 5AW2A 4BMYA 1N2OA 2GBCA 1U3FA 2NZVG 2GKOA 1QIHA 4LYDA 3LMKA 3C1OA 4I3GA 4Y2GA 4OIFA 1PFYA 5AJVB 3DF9A 3W9UA 2JAPA 1M72A 2JH3A 3RC2A 1UBCA 1RW4A 3PITA 4OHOA 3E2MA 3CLVA 4V0ME 1QRRA 1WXGA 4F84A 4QOSA 3NVKI 4XX1A 4J49A 4MITA 2GN2A 2X86A 4GRIA 1W0JA 4GKJB 3DMYA 1FFWA 5GJCA 2C84A 4B5KA 3FNHA 4YUXA 2CT8A 2XOKA 3SIPA 4Y9RA 4AN1A 1IN7A 3QY0A 4H0NA 5KOHB 1Q15A 2D5BA 2Z9BA 4GWGA 4WCFB 1WVIA 3WR5A 5KHOC 1T9CA 1RM4A 3GGDA 3A04A 4PLCA 5BOVA 1PR6A 4NOJA 1U9ZA 1YL7A 5DM1A 4CMGA 5C32A 2DBRA 5TVGA 3NUQA 5HTOA 2RGGA 1TKBA 3C41J 5E6RA 4OHXA 1Z22A 3ZE9A 4ONEA 2NUPB 2C7RA 3ZBQA 2IPXA 3PD7A 3AUYA 4Z7JA 5IN5A 3THYB 1NW7A 2BFFA 3WAGA 3FNRA 4G36A 3NR2A 1A9PA 1Z62A 2B35A 5FQOA 2W2OA 3M6UA 1GPDG 1B1CA 2Y92A 3KT6A 1CUZA 4EX7A 1RZUA 3CUKA 4NG5A 3E4CA 2OCDA 1Y3HA 3Q0EA 1E61A 3K9WA 1BCSB 1QR6A 2GHRA 5HEKA 1TK2A 4ZDIA 2WP8J 5EKDA 3ZCRA 1U0OC 3FCEA 1E79A 2Q49A 3ZWOA 4D5GA 4XOIA 4Z4IA 1N6OA 3UFXA 1TTTA 3IMKA 5JJ5A 3U7JA 1NN5A 1BWRA 5LQSA 4ZAWA 2F8LA 4PX2A 1GRCA 1OLOA 2ZIXA 1Y33E 3EQZA 2XQGA 1EFDN 1TM1E 1YS6A 2C4UA 4B76A 5HBRA 4BP3A 3G5LA 2ZM5A 2ZJ0A 2X5OA 3RASA 3HWSA 2DBZA 3X1KA 1WF6A 2HCRA 4ASUA 2WWGA 4J0JA 3KG2A 3JZIA 5DOZA 3FPBA 1G6OA 1VZ2A 4PZZA 1CRZA 1KKLA 2W2KA 4DJJA 2O48X 3K2IA 1JIKA 1K6JA 2X5KO 3L6OO 1AK9A 3OM0A 4NZPA 1NVXQ 2FPPA 3IJRA 3BULA 1DKQA 2WZBA 1NMEA 1Y4SA 3N53A 4P3XA 4BEJA 2WF6A 3LI2A 1DG9A 3SHTA 4B4OA 2V0GA 1Z2NX 1C3OA 3TRIA 3GDGA 3ERCA 1DKLA 3REGA 1WNTA 4UHFA 5HE9A 4I9HA 2C29D 4WN9B 3IERA 3QE9Y 1QZ3A 4L15A 1T8WA 4RF4A 5BVHB 3OPQA 2QL5A 1A3CA 3MTAA 3KJNA 1T4GA 5TC4A 4CLHA 1ZYUA 5KSOA 1HR0B 1GTSA 3INRA 1WXXA 3OQIA 1KQGA 3VHXB 4ZOCA 2HZBA 5A6VA 2EGGA 4EYOA 3HO1A 2O4UX 4RZQA 1XMQB 4R9RA 1MMFB 4YI5A 5JALA 3W1WA 1EWTA 4L0QA 1KQ3A 2FE4A 3OZEA 4BU0A 5TR9A 1XK6A 1SZPA 4PQGA 1P0QA 4ACBA 1Z4KA 2I76A 4QG3A 2D1SA 4DV0B 2BM1A 3OD1A 4Q7EA 5AHWA 4L78A 3K9QO 4TL7A 4B8YA 2EATA 1I4OA 2QL6A 3CSSA 2BGRA 3F90A 4FC7A 3WWEA 1JDBB 2D54A 1DAMA 3N2YA 2Z58A 3PV0A 5KNBH 5LQAA 3AHHA 1VLVA 1U1GA 5CA0F 2FMUA 1Y6RA 4U7JA 1YBHA 3JVVA 4RD6A 4CT4B 3K30A 1ARZA 4P7FA 1P73A 3F6YA 1WTCA 3TWOA 3WNVA 4B3GA 2GKGA 1E77A 1PJTA 1RAHA 2IIPA 4R3NA 5DHSA 1M6WA 4ETWA 4FWTA 1OXKB 1UDWA 5L3VA 2P7HA 2ZUWA 3RRFA 2B78A 1LZLA 4MOWA 1QGYA 4MKGA 2NTVA 1BN6A 5TNXA 2YFKA 4HH0A 4TLAA 1I3MA 3CT4A 3VR4D 2G36A 3WFZA 1EG2A 4BCDA 2X42A 1E1RD 4YCCA 2XMDA 1V95A 4UZFA 3TX6A 4IS3A 3SKVA 1GZSA 1Z3IX 3P2YA 1RQ2A 5COBA 3TIXB 5CM8B 4HNRA 3STWA 4XDGA 4AMUA 1H05A 3NRJA 2Y6UA 1LRKA 1XRJA 1GADO 1PLLA 3AHCA 3AZOA 4WHMA 3DOEA 4ALNA 2C4MA 1GGKA 3D4PA 2QRNA 1A5TA 2RGEA 4MA0A 3T3DA 3CVWA 2BM0A 2VHVA 1N6KA 4NE9A 1NTRA 2W2NA 3KVOA 4KIFA 1WW3A 3CCFA 4G9GA 3LQ4A 4GLLA 3H11A 3W9YA 3FCSB 3V34A 2O5VA 3NS7A 4CLEA 1DRUA 1AJEA 5GQSA 4IYRA 4CV3A 2DBVO 1ISJA 2JI9A 4YBRA 2BMAA 3RQSA 2XRFA 3DXFA 3JQPA 3PDIB 3T9AA 2G04A 1OPXA 2VXCA 1YRQA 4LJ7A 5B1EA 2YJ3A 2X1HA 4Y2TA 2AN3A 4BDTA 4DQKA 1N34B 1CS0A 2XWSA 1DI0A 2A1UB 4KN6A 2CXRA 4OM8A 1BRTA 4RESA 1QFSA 1PO7A 1XTKA 5ANRB 2H00A 5ALIA 1R9JA 1NXOA 3EK2A 4HWTA 2DHEA 4B87A 2AMJA 1CIJA 2MWMA 4WXRA 3UN1A 1GRRA 2GXSA 2SCUA 1OYVA 2ZBVA 2ZXEA 4PXSA 4WK0B 1BDHA 4GM4A 2NZUG 1W1UA 2XT9A 4EJSA 4WJKB 3VA7A 1ZJYA 4FOOA 1VB5A 2FN7A 2GN4A 2DLNA 2IU3A 4EHDA 2WM9B 3OESA 1DKNA 2QN1A 1XTTA 4D3SA 1W2WB 4PZUA 3KC2A 3R0IA 4AQ7A 4RABA 4O1IA 1XZEA 2AK3A 4PVDA 2QPLA 4YRCA 1XVTA 4UU0A 3BFJA 4OK6A 4F92B 5K4AA 5DYNA 2YVUA 3K5WA 5ADWA 1AUPA 1VBNA 1KP9A 5KYWA 1KAEA 3LVQE 3BHJA 1T2EA 3F6BX 4HBGA 5A5GA 5IWCA 1U8ZA 2O2YA 2ZYRA 3F6PA 3HGQA 1JX6A 1KMQA 3OKFA 3ELUA 2I71A 5I8ZA 1EFRD 4OFBA 4MB6A 1PV4A 1O54A 2ECPA 3H2GA 1R88A 1Z5UA 3AUFA 4ZYLA 2AX3A 2D4AA 3BWXA 2ZCVA 3ELBA 4NWIA 4BMVA 4YCDA 3KVNA 1V8BA 3CB4A 1ZKMA 3F5DA 3UUWA 3O82A 3GRKA 3PGVA 4FGKA 1IUOA 1KWGA 1YZGA 3HU1A 3NEJA 3M4ZA 3WV5A 1SG6A 4ZEVA 3ECAA 1TO2E 2JFHA 4RS3A 5IDVA 1N0WA 1EQAA 3GDWA 4DLSA 1VMIA 1YJBA 1MFZA 3V4LA 3VKVA 2W48A 1QJ4A 5KJ6A 4LOJA 5F3RA 5I8WA 1E6UA 4PSDA 2JIRA 1XHEA 2HSWA 2YOGA 1COZA 3LG2A 4F56A 2ODAA 4TWZA 3LLSA 3ZY3A 5AKKA 3U62A 1W36D 2R8YA 3NTVA 1BHJA 4MRAA 3SHOA 1Z6YA 4Q6BA 1OYWA 5JEDA 5M7EA 1QC5A 2GK7A 5CX1A 4OM7A 1Z37A 4CMIA 2HRBA 4H6XA 4ZAYA 4ZHQB 3G1UA 3W1EA 3KIPA 3KKKA 4EGAA 5FIUA 3SCZA 1OUMA 4UNSA 2HV9A 3H4MA 3ORRA 2MYTA 1PZHA 2OHGA 2PBRA 4FFNA 4X8LA 1RWWA 1R3UA 1U2QA 3C14C 4ZVQA 1KRXA 1U99A 4YMTA 1ZC4A 5BWLA 5L4LA 2XUKA 4O2AF 4EL0A 5BSKA 4A15A 3ENNA 4KFCA 1Z47A 2M6SA 4IPTA 5HHTA 3E9ZA 5JXIA 1SD2A 2RAVA 1I4DD 4AB1A 1C7QA 3FOCA 1BFUA 4X45A 4G0OA 5EFZA 3IIMA 1JI3A 3IJEB 1XQVA 2Q5HA 1WULS 4YMWA 2OECA 1XTQA 5HM8A 3OVMA 5L53A 3NLLA 2BZ0A 3LY8A 4Q9NA 5AJXA 4DR3B 1S2MA 1T1IA 3OJLA 2H65A 1NDUA 4MULA 4PLZA 3PPIA 3E7WA 2H4YA 3BCSA 5DCLA 3S99A 5HOEA 1EK5A 5AK3A 5K6AA 3W6ZA 1I14A 4KAJA 4ND8A 1RYZA 3QYFA 1WW2A 2BGIA 4MLZA 3MBOA 3S27A 1GFIA 4QYTA 4ZT7A 4UJ3A 5AW6A 3TECE 2PZ8A 3S81A 3ZHUA 2VDJA 1LPNA 2PSFA 3O6VA 3QUQA 3U7GA 2C2WA 3KBBA 1KDOA 1JU4A 1OLSA 2FKAA 3BJIC 3GFSA 3M9WA 4NTZA 3DZIA 3HN6A 4EDHA 1CEYA 4ATNA 5K8JB 1JSRA 1Q0PA 3L93A 2ZLBA 2PWAA 4UARA 2I62A 4MJ3A 4CIAA 2C5EA 4LZNA 5BNZA 5SZKB 3GW8A 3G8YA 3AHIA 1VCOA 1OI2A 4GSYA 4RLFA 4CLDA 3T5AA 2Y1KA 3OFVA 4AZ0A 4BQPA 2VUUA 3AR7A 1G20E 3Q2IA 3G2QA 4ER3A 2OV4A 1N1EA 4ANFA 3UWMA 1BH6A 2REXB 2UAGA 3EEQA 4JP3A 3PEWA 3QEMA 1Z25A 1EHYA 3NIGB 1IY9A 4HLNA 5EIOA 5JSQA 1ZESA 5D51S 1BYUA 5BNIA 1MAUA 3DQQA 3TSOA 4DCNA 2WF8A 1L3CA 3N86A 4IQ8A 8OHMA 4CDNA 2XSZA 4B09A 4R6WA 1DE0A 2HWYA 4E5SA 2IWHA 3I9V1 4QAQA 1USUA 4D4JA 2J6CA 4KPYA 1H6BA 2Y1FA 1UK7A 1VGRA 1QHYA 3R0ZA 3T4XA 1L7DA 3HJRA 1JWBB 2QRZA 4INPA 4WVFA 1JHZA 5I4IA 4U7PB 4C03A 3ZXIA 3A6FA 2VSXA 2EBWA 1NT4A 1Z5WA 2H8KA 2NUAA 4JUFA 3RTBA 2XI4A 2ZQYA 1KEKA 4GI3A 4A92A 2ZE8A 4L76A 4LQ4A 1C0PA 2YIVX 1IAQA 1YFLA 3UPDA 1SCDA 2O2CA 3C7AA 3L8DA 1N8TA 2W6ZA 1RM0A 4OI2A 5AVXA 1Q0RA 4G4GA 2HIAA 5D00A 2HUPA 3ZV6A 5H8WA 2MIIA 1WM1A 1UZLA 2QTZA 1MH1A 2E1RA 3F1KA 4FDMA 4WFIA 3EASA 1VE3A 2ZRMA 1ZGJA 1UJMA 4LMBA 5MFZA 4DRXB 4R3UC 4CHGA 3L0YA 3MERA 5EP4A 2XF8A 3V8BA 5FOVA 1M7GA 1Y3AA 3ZJ5A 5LYYA 3NGXA 2AV6A 3AM4A 5ALPA 5FWDA 5A3QA 1XA4A 4E70A 4KQ6A 3PT9A 4QLOA 1TM5E 1KJIA 2EGHA 4K9PA 4EBFA 4MWSA 1HT3A 2AYZA 3FMIA 3QI2A 3DWIA 1WUIS 2DY0A 2OHHA 2WM3A 1KYYA 4IO1A 4U7GA 4CKEB 4DZRA 4UDOA 1O4VA 2JD2A 1M8FA 3IOBA 3QH4A 4YBZA 3RUFA 1YVEI 1TQ6A 3IQXA 1CG6A 2EZ4A 4ILEA 4N3BA 1CE8A 2E4WA 2MTBA 1XMIA 3FZQA 2YW9A 3HXTA 4GX5A 4KMOA 1C7ZA 4HR7A 1XALA 4IHKA 5CT4A 3UJBA 3UKJA 4CMHA 5JLJA 2AZDA 4AS3A 4D02A 4C4YA 4Q3KA 4R16A 4RMHA 1SNYA 1YZVA 3AY0A 4LHYA 2Z6VA 4TKLA 5DSXA 1VJ5A 3PF9A 4HH3C 5BR8B 1G6HA 3TR5A 2P9FA 1DAOA 4LE0A 5LXTA 4HAXA 4D5EA 3A1VA 3HDTA 4KIJA 4KUHA 1J39A 1DIHA 2ZIEA 4FCVA 4CM9A 4E2ZA 1BDMA 2HM7A 2XNDA 2JI7A 5K8CA 4ZJZA 5BVGB 1JDNA 4JC8A 4MDHA 1N5KA 2B82A 1J2UA 1ACJA 1YUMA 2A4MA 2BP7A 2HLHA 2JASA 2WV7A 3FOAA 3LT5A 3NAZA 3MT9A 4P5DA 1YJXA 2JDID 3DONA 5J9FA 3J80A 4XGQA 3VOBA 1MPTA 5CR9A 1U04A 2WWVD 4EQ6B 1GDTA 5ILQA 1ZW1A 5EL0A 1DX6A 3AETB 3ZDFA 4D6XA 2BGTA 2A58A 4D9BA 2WG1A 3CLHA 4KIWA 5KTRA 1U5CA 2H59A 5TQ2A 4FVTA 1SK8A 2A94A 2V6BA 4RTPA 2BTEA 2ONZA 2RAPA 3DV2A 1XX6A 3F8TA 4OB6A 4UTXA 4XVQA 3E8MA 5C4GB 1OH8A 7YASA 4M49A 2R6JA 3UANA 1P7PA 5B6PA 2BMJA 2V6MA 2Z5FA 4U9IS 4I3HA 1F1BA 2A9PA 4MIOA 5EE5B 5K3CA 4B3BA 5F64A 4ENRA 4DHEA 1E3JA 3MYRA 1UBOS 1C4KA 1F5SA 3EGDB 2OV2A 3L04A 1FXWF 2H9YA 3JQRA 4I4TA 2D00A 4PW0A 5TMEA 2ZWOA 2HIHA 2QUJA 4FKBA 2RHWA 4W9NA 1QIIA 4DABA 1QNFA 1RPNA 4RJLA 4Q01A 1AQJA 2BHSA 2ID8A 3VZBA 1HFJA 4WNYA 3CRW1 3KDPA 3IL2A 2GEJA 3QQPA 5AJUA 3MUFA 3MCVA 3VKHA 5CJPA 2HK8A 4P92A 3UJ9A 2QUAA 3V4RA 1VBFA 3D0QA 2TRSB 3Q2OA 2AQHA 3DMFA 4IEIA 4TWRA 1TUIA 3PNYA 4Z4CA 2P8JA 4PIMA 1UBSB 1Z0AA 4UQPA 1SPXA 1GL7A 2X2EA 1F9EA 4RFSA 3S2YA 3NB0A 2H31A 4B3JA 4DLZA 5HFJA 5HTKA 2IHYA 4QDJA 4ZO8A 2JW5A 4Y6SA 2QR3A 3GUCA 4H4DA 1TL7C 1G18A 4IIJB 2IEIA 1ODSA 4YXWD 2HGSA 2FEWB 3F47A 2B1RA 2PUCA 2HAEA 3E3MA 4PFQA 2EIHA 3I9FA 3OJOA 3RRZA 2QK4A 2G08A 1RWVA 3G9ZA 4FW8A 2PMWB 4RLSA 3H83A 3QF4A 3LIPA 1I13A 4B7ZA 4BV8A 4DCCA 2TMYA 2GBGA 1Q95A 1USVA 3PTLA 3PGXA 1K7FB 3SQXA 2NSHA 3QE4A 2XTNA 1V6AA 4RORA 3QX7A 1G7RA 4J2HA 2UUAB 2HBYA 4BVBA 1LF0A 4B7XA 1F2DA 3DV9A 3TAUA 4N40A 1QZZA 4B2PA 2UZ1A 1TX4B 2X0KA 2UUBB 5DGDA 1W4LA 4PCUA 1FB5A 2PKXA 5I9LA 1R6UA 3K4PA 2J6HA 3KR2A 3CF0A 4R2MA 2H2IA 4ZVVA 2P2NA 3OQHA 1BCRB 4W1PA 3VJRA 5U9CA 1Z07A 3N2KB 4IXDA 1O5IA 2B3DA 2QM7A 2VZLA 3PPXA 5DWDA 1RXWA 1ZIPA 4GL2A 5KTPA 4GGPA 4L16A 4FHEA 1FZQA 2BFAA 2O7SA 1K66A 4L08A 4M54A 1I10A 3LJKA 1XTJA 1E18A 1NYRA 4X84A 2R60A 4CKZA 3NNDA 4MWBA 4B8WA 5HQ3A 2ZBFA 5THKA 1T1RA 2D7JA 3UXYA 3DTNA 4G65A 4WI1A 1WABA 1X7XB 3T7EA 1G3IA 4DCJA 4EHFA 3UH1A 2ZGVA 1A9OA 1DIRA 1LVGA 3C8ZA 4G41A 4HSEA 4X7BA 1LCIA 4EZBA 4NCKA 2G76A 3AEUB 3O2JA 4LZWA 2AF3C 2YHUA 4W9NC 1D2HA 1OAKA 2EKLA 3F74A 4P3YA 4V0KA 4M1TA 4V3BA 3REQB 1OZHA 4MS3B 4UFPA 3QELB 1RCTE 3AR3A 3BKXA 3EWNA 4KMRA 4CM8A 2W58A 4BNVA 4R2WA 9GPBA 4RH3A 3TM5A 3EAGA 4F3KA 4YRIA 1M5RA 4AZSA 1ZJZA 4CIYA 5HMLA 4JMPA 1HDXA 1MCZA 1UK6A 3BWMA 3CUEF 1DQZA 4FLEA 4QPNA 5M29A 5DTQA 5FOTA 3V8VA 1Q3TA 2D8MA 2WRZA 2DH6A 1WMSA 3AUXA 3K15A 3KR9A 4WKPA 3SXJA 3VR1A 4JYCA 4AX4A 1Z4IA 4B3IA 2PPVA 5KTOA 3U1BA 1YF3A 1QG0A 3K20A 4LGMA 4AURA 3OCVA 4UTRA 1SC3A 3QE2A 1K0FA 3M1LA 1P8JA 1NZFA 4MIYA 4WZAA 2GPBA 3VX3A 1E3MA 1XYYA 1A9XB 1OXBB 1WXEA 2VDPB 1SEVA 4IRUB 5GOZA 1IK4A 3IP5A 1OX4B 3OE7A 3DGEC 3K94A 2DWQA 1M6VB 1H2AS 1PYGA 3M6WA 1FVFA 1RIFA 3ELYA 1UH5A 3N58A 1FF9A 5I7AA 4IJWA 4FE3A 1DSSG 3HJUA 3DE3X 4ARAA 4TL6A 4ND4A 4QELA 4F21A 1M8KA 2WZQA 3PQ8A 4CLXA 2DCUA 3DMGA 2O5RA 1XVIA 2YXBA 3CLSD 5PGMA 3I1JA 4PSKA 4AP9A 1FLNA 3AW8A 1R4MB 1NNEA 1Z4QA 3AZPA 1W0KD 5ALEA 4MYHA 2NXWA 5L3SB 4RL4A 2VDVE 4QX6A 1XYGA 2WFAA 1FNSA 4MUYA 3A7EA 4PZDA 2CDAA 1KL7A 2FLWA 3VVBA 5DXFA 4MR7A 2PRSA 4X6YA 3SJUA 4J1TA 4N7JA 4B85A 3PWKA 1FEZA 2IOFA 2VOJA 2X0JA 4JKOA 3C6QA 2PO7A 1WD7A 2G07A 2L2QA 4HLUA 1E6WA 3N6VA 2BY4A 3O93A 3UK1A 5AOVA 4AI6A 1Y7PA 2PUVA 2PZJA 2Q1XA 3R3HA 3H1GA 3H3JA 1L5NA 3F3SA 3QLVA 4QUEA 3AV0B 1RBYA 4LOAA 3UW1A 5DYTA 2R9VA 4ITRC 3WKEA 1CUWA 1MDBA 3GBVA 4N9QA 4TKUA 1O5TA 2JCBA 4BLOA 4XWOA 5LQMA 2JFZA 4DQVA 3K70C 3A10A 2XCUA 1NVFA 3OPMA 4U4AA 1F0YA 3UYKA 1TK9A 2GA9A 1ZXBA 3WMEA 1O9BA 1XNRB 3AMVA 1ZM9A 3DBLB 4KHZA 4NK4A 4PX3A 5H0IA 3ANXA 1E64A 4DCSA 3RIXA 4LZAA 5FA5A 3ZJUA 2OVFA 1GYRA 4X6LA 4ER6A 3KHKA 2AMFA 4BLSA 4OF4A 4QUAA 1RJDA 1Y8CA 2W2LD 4X66B 4RY2A 1FTNA 3P0FA 3HK2A 1DG3A 5C7LO 4K05A 4HNTA 2B5WA 5KJCA 3R4VA 3ZR4B 2DJIA 1E1MA 4Q3OA 4IO0A 5CDFE 5HF8A 3WB1A 2IYAA 4CEHB 3E18A 5D84A 1XVLA 4NQZA 4GZ6A 4Q16A 1HT2E 1QU3A 2VLIA 4TLDA 2J4DA 3L49A 4BWFB 4GBED 4BO6A 5CVTA 2J3MA 3L0IB 1BVRA 1H0RA 3T52A 1JG6A 2VK2A 3OZSA 3CRMA 2PXXA 3EXFA 1KO5A 2GN1A 3QJ5A 2B83A 3IAS1 1VSBA 2ODEA 5BQPA 2XT0A 1LZKA 3TBKA 4AK9A 2G8NA 4KWIA 1E1LA 4NBLA 4URHA 3KPUA 1IYZA 3BCHA 2SICE 3RADC 5FBRB 1LDGA 3G5UA 2WZCA 4LY3A 4XWTA 1YU9A 1U3VA 4KTTE 2J32A 1B16A 3GWZA 4KXXA 3PHHA 5FUWA 2ZR8A 1AKEA 3ZHYA 4AJLA 3A6PC 3L0DA 5DWQA 3WLFA 4ABTA 2E7ZA 2O1WA 4PZCA 4W9MC 4MCAA 2WYWA 2XOEA 1DAHA 4O6VA 3WLPA 1P62B 4YLYA 5MGNA 3Q9NA 3KFXA 3GVCA 1RHUA 3N0TA 5LSAA 2YWGA 3FHTA 1YQEA 3VU0A 4EX6A 2R66A 4HQFA 1L7EA 2C2BA 2ZR9A 2AFHE 2UZ0A 1QANA 3E82A 3UO8B 4J1TC 2G4CA 4CCYA 4FFBB 2FFRA 3O4JA 4GR9A 4RZ2A 3H04A 4B31A 3IP6A 2ZVPX 3VZSA 1K5GA 1DEKA 4TSKA 1SQGA 4ZIRB 4BQQA 2WJ3A 3C2QA 2HU7A 3G2MA 3AJEA 3INYA 3QLTA 4HLUC 3SQLA 1GUZA 1SCKA 5GVSA 3M4JA 2XMGA 4BNDB 4NZMA 3BRCA 2R7AA 2IQIA 4CG1A 5K3BA 3QLVC 1K4YA 1J5XA 3H4TA 2G80A 4K6CA 2QYSA 5JCJA 1PR3A 4HDAA 3RYIB 1MTOA 1KR5A 2AFIB 2Z9CA 1N9GA 1W94A 3QNWA 1OY1A 1H1LA 1V5FA 2VYVA 3MWFA 4U1RA 1AKNA 1ISPA 2YN4A 3AT1A 1IM8A 4FZ5A 4RSMA 4XUCA 3RS5A 1HPLA 2FK7A 4JJFA 1AKRA 2FJ0A 3EVFA 3HPQA 2SKDA 1YZHA 2Z2YA 1R1DA 1SKMA 4A8JC 1IBRA 3TNJA 1NVEA 4NBTA 2CF6A 3TQRA 3WIBA 4BNHA 3ZIAA 1GNRA 1Y37A 3GLGE 2V4MA 2GZHA 3Q41A 4RLHA 3E3LA 4CFYA 3ZE7A 2BAGA 3QU2A 4OLAA 1E7MA 1XYVA 5I3CA 3EVTA 4Y7DA 1THGA 1G9SA 1DIAA 1R0ZA 2IYZA 1WSBA 3EVCA 5EWLB 5JYBA 5AIAA 1CR2A 3TEMA 1TIPA 4ZZ0A 2ZZNA 1RJ9A 1XO1A 3KSMA 4I55B 4TRMA 4KRYA 4IS2A 1R2QA 2P6UA 4DARA 1ORWA 1BWSA 3G23A 2OFWA 3AKCA 3O8NA 4FMDB 1R10A 3LCJA 5JH7B 5EZYB 3BCRA 3Q2KA 1HRDA 4S12A 1C3XA 3SJZA 4GQAA 4JB2A 1M6YA 2BKAA 5IZ4A 5CB6A 1PNTA 4L8GA 2HJWA 4C21A 1XAIA 1ZMOA 1LB1B 1KZ1A 3FKQA 3HZOA 2V5AA 1Z28A 1YDEA 4XQ0A 5ALRA 3WWZA 1JEOA 4DG5A 3OTOB 3BSSA 1NPDA 3NV7A 5D5QA 2OM6A 2OPBA 1XCPA 3AB3A 2IEDA 1TM3E 1QLHA 2QRKA 1H8ED 4FC6A 5JSKA 4JX9A 1CQIB 3WMXA 4QASA 2EX0A 1SC4A 2CMGA 3OP4A 2NW6A 4EUFA 2OAP1 3SLKA 5T3UA 2H57A 2H54A 1K7CA 3V7FA 3W5UA 3EPHA 1H0KA 5KC9A 2MYUA 3BERA 3RANA 4BO8A 3FI9A 1E2HA 1WP4A 4MZDA 3NAGA 2IS2A 1CQJA 3BIWA 3ILXA 4GU5A 2GX6A 4GR4A 2PD4A 1USIA 1QB7A 1C2YA 1Z0DA 4TMYA 4CUZA 1GNSA 1G98A 3MWDB 1NJGA 3WYNA 1QK3A 3GQBA 4UCXA 3OA2A 1OYOA 1BFDA 3LX4A 5BWBA 3DV0B 4KNVA 3UBTA 3AOEC 1TNDA 1OBVA 5T7BA 5A1JA 1PEDA 1KYVA 2YNMD 2OILA 1VPLA 5BQFA 1OFIA 4IQ4A 2C3MA 2G82A 3IHTA 5JTTA 2QVXX 2PUDA 1II8A 2B8JA 2EDCA 4MW6A 2CKMA 4IX1A 4P8RA 4UUBA 5FWNA 5KWJA 2PUBA 5EJIA 4ZTZB 2OESA 3AOGA 3QMMA 4QOEA 5SZHB 4TTAA 4UHCA 2IEYA 2IWRA 2J9FB 2DJ5A 3HGMA 4FHZA 3MBKA 3FZYA 4ZPJA 1M2HA 3DE0X 2FRDC 3JRXA 4KFTA 5EVJA 2YXEA 4K88A 1E9VA 3NPAA 4Z8XA 5DM0A 3WRXC 1LLDA 3TRHA 1VYUA 1W93A 4NQRA 3V1NA 3UY4A 5JZSA 1SN7A 2P4EA 4BX8A 3IURA 4JI8B 4IDQA 2JVIA 3PXXA 2A0YA 2H6EA 4FGSA 3X1MA 3KAJA 3W4JA 3LP8A 1JFTA 1FTYA 1PJ4A 4F6LA 2O3RA 1E9DA 3A6LA 1P2DA 1N7IA 1AHNA 2OZEA 3WS7A 1F8FA 2OC4A 1RZRA 5TGZA 3U6KA 2HMTA 3IUSA 1AQUA 3HB0A 1MXHA 3THXB 1NW5A 1KU0A 3GZNB 2BT4A 2NLOA 3GLIB 2ENUA 5CU7A 4TKVA 4IJKA 3PC2A 1F60A 1P31A 1NSFA 1SY7A 4EVSA 3JQAA 2GEBA 3OZTA 3G0HA 1E58A 1U2GA 2FPXA 1EWKA 2ZZKA 3IODA 1ABBA 2BZ1A 2OO3A 2A0XA 2JCVA 4ERXA 2L19A 1JKMA 4INAA 5ECYA 1KY5A 1W96A 4EMBA 5JQWA 3A1SA 3L1VA 4HADA 4PLWA 1C30B 5H59A 4AMYA 4CM5A 1VSQA 2IF2A 2HF8A 3OF2A 4P5PA 1AN9A 3BICA 1P5JA 5J4KA 2QX4A 1DQNA 1NRWA 2VK1A 1Q7CA 3ZXYA 3LQKA 2XE8A 5ENZA 3EF3A 3DBRA 4WOPA 4Q05A 2FSUA 1DEOA 5FLKA 1KO8A 1K8ZB 2C42A 2YZ2A 4RZXA 5EOVA 3A27A 4I1OA 4D1YA 2IJGX 1MJHA 3Q9SA 1LD3A 1HYBA 4JB0A 4KZKA 3U31A 1E0KA 4WZ6A 4WUTA 1MAWA 4DM4A 3KTAA 2Z30A 1RMQA 1C7EA 4FOPA 4RVDA 2V7QD 4XCQA 5FR1A 4NJEA 4J0EA 3OETA 1TCCA 5D5HA 2Q1UA 5KDLA 3IKJA 3PTAA 5LP1A 1EVQA 3IUMA 1IXRC 1YBMA 4DKJA 5DSZA 5AKLA 1UZUA 1Z18A 3KKZA 4L8LA 4P4TA 2CB0A 3D8RA 4ZOLF 5LA6B 4LNAA 1DCTA 5FI3A 1M2EA 4LSGA 3NVMB 4MYCA 2NU6A 4YX9A 3ZCUA 2C92A 5KEIA 2PKWA 1ATZA 3UCFA 4EB0A 2NSLA 2O8CA 4KGVA 4DLLA 3PYMA 1NL3A 4PTYA 1IWBB 1FRFS 1FP4B 2FPGA 1LK5A 1YVRA 5CDYA 3M6FA 3DMHA 4JOBA 1LQUA 2GTPA 3DB2A 3VDXA 2QQEA 3IDSA 3VAAA 4F45A 5JNVA 5KO2A 2KSQA 3HY3A 2HJHA 2JFOA 1GUAA 1HQDA 4OLFA 2FPIA 1UXHA 4HAUA 5ALTA 3T61A 3L8MA 3ZZ1A 4EHNA 1SG9A 5DTRA 2I2AA 4BO7A 1IEWA 4WINA 1A1SA 3G5TA 3I8XA 4OOFA 4AJIA 3ROGA 3OUUA 2H2GA 3NQ41 4N49A 2CEAA 4MKZA 4QRIA 3Q0TA 4ITUA 2HRZA 4LW8A 4BBAA 1KVQA 4F4JA 3HNRA 5L7YA 3G89A 2GUWA 1USKA 3NZEA 3D0KA 4J6FA 3D43A 5A0TA 2O8VA 1ZRHA 2VDLB 1X14A 3AFMA 3C3CA 4RFLA 5L4SA 2XADA 1ZINA 3N8KA 4DM3A 3IOEA 4FILA 2QR5A 4QO8A 5FWYB 3C6YA 3KLOA 2GHQA 2PX0A 4QULA 4LBYA 4JXXA 3PC8A 2BHNA 4QECA 4Y1RB 1WEHA 3UK7A 2O05A 4ARZB 3UOAB 1ZHOA 4E4YA 1EJBA 1T9GR 1XDDA 2GJ4A 4QPPA 3OHSX 3PQEA 1X1BA 1WDKA 4FBGA 4GMXA 3LUJA 4J0IA 4YRPA 3CZMA 5ER9A 3E1GA 3ETNA 5K03A 3AO0B 2OZPA 3CLKA 3CLUD 4QUHA 1XFDA 2QTWB 2RH9B 1WMDA 1WQ3A 5REQB 2XDWA 1WUTA 4F6CA 1TKCA 3C7KA 3D2BA 4E5DA 4MR9A 1NR1A 1C7RA 1QGED 4Q4AB 4KQJA 5EE9A 4BLPA 3GELA 3ODGA 1IB6A 3LKVA 1X7WB 3F5QA 4G5OA 1K0UA 5BSRA 2RC5A 1DC7A 4N6NA 5G4KA 5CFNA 2R8RA 4I3FA 2G3YA 3PRYA 2C54A 2X8LA 4YR9A 4OLJA 1J9GA 1U6KA 5BV1A 1DP4A 1DARA 1JG7A 8GPBA 5B1IA 4XEUA 5NLLA 4FYMA 3DE4X 2HA0A 4HUTA 2BI7A 1JLKA 1T3GA 2GCIA 5DNVA 5IW8A 2X15A 3KAKA 4D8XA 2D62A 4KMSA 4LF8B 5EZ6B 2IPMA 4D8TA 4E0BA 1O57A 3U3KA 3PC7A 1XNGA 2JAOA 1KOJA 1L5OA 1EHCA 3L7MA 1BX1A 4HMPA 2D5AA 3W3AH 4F9TA 5KYXB 3MWEB 4JBLA 5IXYA 2B5VA 1AE1A 1THMA 2FE1A 4DC9A 1QE3A 2QTVA 1EXDA 3O7MA 2DBYA 1JTEA 1EP2B 1NUPA 4R2KA 3WG9A 1HOTA 4OMDA 2G1PA 1D1TA 4A0SA 2PD6A 1PJ8A 3L0ZA 4S1NA 1KP3A 3GB9A 3H4IA 4WOBA 4D43A 1RHKA 2V9ZA 2ZUCA 1J07A 1E2PA 4HF7A 4S1OA 2P91A 3IVAA 3ETLA 3O75A 4MRRA 3IGFA 2YBDA 1FNNA 4KKVA 4NZNA 5EGNA 2H1HA 5C34B 2V7GA 1X0XA 3SFVA 4NEHB 2ZRBA 1Y7TA 1Q0UA 2G6BA 3O31A 1F3OA 5EMNA 5IHPA 1O6FA 1GZ6A 2MR6A 3A37A 4PSCA 2VHZA 3QW2A 3P9PA 4H2DA 4F38A 5EHXA 2FU5C 3OZGA 2PH1A 4MW4A 3IT0A 3IR7A 4MIKA 5KAMA 4EB3A 5K3OA 3A2KA 3NCTA 3A1NA 5FO0A 2BMEA 3ZW7A 3ETJA 3PC8C 5LBTA 2GD6A 2WSMA 3OTWA 3GJXC 3HV2A 1XKTA 5F12A 2CW5A 4TN5A 4YRNA 5CLIA 3JYHA 1AD2A 1CR1A 1ZQ9A 1Y80A 1BVYF 1F0NA 1ZN7A 2BEWB 2NSJA 3BB1A 3EFOB 3O94A 4H3VA 4MK4A 1QWSA 1T9GS 3BEDA 1PG0A 4YMSA 3VU8A 1VDMA 2I8AA 2P9QA 2UZ3A 1RNLA 3ESQA 3QE3A 1J5EB 3ZGZA 2QLLA 1UFOA 4A8HA 3KSBC 2ANBA 2R4QA 2DE0X 1ADCA 5KCMA 4YO8A 1B73A 1RZ3A 4KREA 1HQCA 4JOQA 5AI0A 5H1YA 2IYOA 5IJAA 1QIGA 1HXHA 5FBVB 1TM2A 5A05A 3UT6A 3HYCA 5FUVA 3WHLA 3I45A 5K0JA 2VOEA 2I33A 3GROA 2PSSA 1RQGA 1VHTA 2WYVA 2ZBDA 3ZK9A 3HO6A 4CETA 2H7VA 2V59A 3EH1A 3LXUX 2TECE 4TMTA 2E55A 2DG2A 1UZAA 2ZCUA 4KLCA 3SSOA 4YHHB 3QU4A 3W4KA 4LJ8A 4FGLA 3WYFA 3BMCB 3MW8A 4FYVA 1QONA 4E88A 1GPNA 1ICIA 1OMOA 1P1CA 2Z04A 4MYTA 4DB4A 3LTNC 3LT2A 3C1UA 3SZRA 2NUBA 3FSGA 4MQ4A 2RI0A 2WNSA 3AHEA 4P83A 1F9AA 1RXEA 3O83A 1VPVA 5F7ZA 4AYXA 3CLRC 1K6MA 3KLNA 3KZ1E 5F73A 1AK1A 3WLOA 2FW6A 1U5BA 1DKRA 3NDPA 2PKYX 1DAIA 2A8YA 4UNRA 1N7GA 3AM1A 4M6WB 1K75A 1P5HA 3LCVB 4OA5A 4RMNA 3RJMA 1OFGA 2I66A 3EVAA 2FWIA 1VBKA 3AJAA 3IT3A 4H1VA 3VV2A 2EP8A 3GAFA 3I01A 1Y8QA 4IX9A 1PSWA 1O95D 4OXRA 3V32A 4TVSA 2CVOA 4B3MB 4JI7B 2XXAA 4CMCA 2GPWA 4RQBA 2LDXA 3HZRA 4CG2A 3OOWA 2H0AA 3V2GA 1JIIA 3ZVNA 2IW3A 4W1QA 1BG6A 3S4YA 1JEYB 3ZKAA 4GX2A 5I7SA 1FY2A 3N74A 4R41A 3SZOA 3ZLVA 1ZD1A 4BLQA 5FV4A 1Y5NA 5FTMA 3GLHE 4FSXA 5LQCA 1OA1A 3PIIA 3KU4A 1UZMA 3FMFA 4IDCA 3SHVA 2R3SA 3ASUA 4PONA 4AJHA 1RACA 4Z9BA 5CDTA 2GO7A 1B6RA 1R3DA 1F1JA 1OC4A 2I6XA 4KI7A 4REQB 1IWPB 1C1HA 1TADA 2CSXA 1ZH6A 3ED1A 4LRYA 1ZM4A 1NX9A 4HNQA 2V7TA 3ZW8A 4BJ6A 4YRZA 3PGLA 3NHUA 2AJ8A 1MNQA 2QNBA 3QOYA 2QAIA 2XW6A 3R7FA 4C0AC 2MSLA 1N3YA 4I4IA 4K9SA 2WIGA 2I3DA 4HDNB 3TGPA 4ZHQF 5CFLA 3C8MA 1LLUA 3GDFA 3GJ4A 4GZ5A 1ZD8A 1CYDA 4IMJB 5JI3E 1B2LA 2C2HA 2XGSA 3C3DA 4GOMD 4XTRA 3GJ0A 4QTYA 5C8YB 3TPCA 1VL0A 1P0FA 2Z8ZA 2R751 4BO0A 1EHIA 1YIOA 1LPSA 4DA4A 3FCXA 4HGRA 4JP8A 1GR1A 4PPQA 4M8SA 4PYQA 1IY1A 2BGMA 1W35A 1Q1QA 4BKMA 3H5WA 3G2PA 2QLFA 4HQ0A 1DS6A 2A88A 1LV8A 1SXJD 2PGXA 3AF0A 2WTBA 2VR1A 3FLBA 5JRDS 3BWYA 5B58C 3BL5A 3V7YA 3W8DA 2YV5A 3DPUA 4R84A 4LV6A 4LC9A 4DAOA 1AX9A 2FSSA 1Z17A 3WMWA 2I78A 3DTVA 2DHRA 3WLIA 3CGWA 4BGUA 2OUKA 4Z2YA 5KKNB 5IM4A 2ZBGA 4U9UA 1MEEA 1VLZA 1ZOPA 3D6NB 4IDPA 4U6SA 2WPDA 3RF6A 4UXHA 3RS3A 5JXHA 4K1XA 1DKUA 1ONSA 2W83A 3QOXA 3DE7X 3TQIA 2Q9UA 2QVYX 3JQBA 3F71A 1LC0A 3K96A 4H7IA 3AILA 5J63A 2WU8A 5LLSA 2PGDA 5CH8A 2YFQA 2UUCB 3EIQA 3MCWA 4BYMA 4N48A 3E7DA 4U3JB 3AJ9A 3OEYA 2ZRJA 3M0EA 3R8FA 4DGQA 2J0VA 4NU0A 4E5MA 5I48A 2ALJA 2PUHA 4Q3LA 3BE6A 1E2JA 1T9HA 1PP4A 3FRHA 1YQQA 5DEOA 3VVLA 1AHPA 4YAEA 2WMDA 4C20A 2FEOA 1UM9A 1RBZA 1K6IA 2FLVA 3AW9A 4TTTS 4UUMA 2JBWA 4BFUA 1E0JA 1S8NA 1TOAA 2X9GA 4D8VA 1ISSA 1Q0ZA 1T2CA 2QMUA 1ZSNA 2YYZA 4KVGA 1SGWA 4XQ9A 4ZRDA 4JMLA 2OZLB 4POAA 4CTKA 5F4BA 1SUSA 4KQHA 3GK3A 2L17A 1IAVA 4QPDA 2HK7A 2JGDA 5B6JA 3TG2A 3M6VA 1M2JA 4PO1A 4R1MA 5BV7A 1AB6A 3KVYA 4DSNA 1CHDA 4GICA 1YZUA 2IXDA 1AU9A 3KL4A 2A0UA 2X5JO 4LCBA 3QNUA 5F1YA 1OXUA 3L7AA 3RYFA 4BMOB 4CL8A 5IKPA 1SD5A 5EXSA 1FRQA 1GPKA 5ALDA 2Z1DA 2ZRGA 4QUJA 1EUCA 4YJGA 5LVAA 2DXIA 1GLNA 4BNNA 3TVYA 1TUBA 4XQEA 2YY7A 5DOVA 4EUSA 2FPSA 3W7BA 2GJAA 3PLRA 2Y27A 5ESRA 3B1JA 1F48A 3MOSA 3V4SA 3ZHCA 3EZ2A 3BTUA 4P82A 3WKAA 2P30A 3EZLA 4Q3NA 4JJKA 1TTHA 2IZ0A 4HNHA 4HYYA 4NZ9A 4O8ZA 2QENA 4Y0VA 3RS2A 4AS1A 4TXMA 1Q3KA 2YZ7A 2FETA 3R7BA 5BXQC 2VTBB 4U8HA 4XD7A 1GAQA 2XNHA 3H9UA 4JLPA 4BNYA 4C7VA 2IHBA 1G8AA 1M5UA 3T7CA 3UJHA 1EFUA 1PVDA 5CB4F 2XVAA 1RXUA 3W2FA 3RWBA 2C7OA 4W8HA 2WINI 1BDIA 3KXLA 3JQBC 2RK4A 3RKRA 4XDYA 2VO1A 2C1EA 4H0FA 1AXEA 3NASA 5K0NA 1OHHD 1W76A 4E4RA 3HKCA 3EDMA 1L5RA 1NBMD 3NT5A 4DOMA 2FR8A 3GFOA 2LE0A 5LP6B 3E9EA 1A0OA 1I24A 4Q3DA 4RA9B 4GT1A 5GONF 1NA5A 4EHKA 2C9MA 4OQXA 2EJWA 4X7MA 2DLCX 3DOJA 3I32A 3N28A 2GVZC 2VT7A 4C05A 5CIYA 3IA7A 1NQWA 2BEUA 2PMDA 4U7TB 3ZCSA 2IZOA 1T26A 2XZTA 4IJUA 2A78A 3OIYA 3DCJA 3R75A 3U3MA 3N5KA 1IRXA 3PHLA 1E59A 1MZPA 2EHDA 3VU9A 5IHXA 4CIBA 2HSGA 1ZM3A 1JV2B 1PFGA 5LD2C 3ZEAA 3SYTA 1LU9A 4JGGA 4Y9SA 5FYQA 3WLRA 1VJ0A 3TMYA 1P44A 1T9ZA 1KJYA 4NV3A 3E9MA 4ER0A 3DQZA 5B3KA 2YZGA 3GGPA 4OHCA 2WDZA 4A0QA 1V8DA 4J07A 4D74A 4YAGA 4AL4A 1MABB 1CUXA 1DLJA 4BUJA 2F43B 3PNBA 2FPWA 3BMQB 4OB8A 2IH2A 2V7BA 5LQNA 1YB7A 5CM2Z 3V8QA 3VVMA 2H1SA 3FVWA 1A9YA 3MD9A 3HUTA 4DA0A 1PL6A 2P1DA 3OCUA 1ECLA 1RFLA 2XVMA 4OYLA 4BOYA 4JLAA 1G1AA 1M1YA 1XF9A 2Q1TA 1UEJA 2HL6A 4L75A 2EQAA 1WS6A 3SYLA 3EC7A 2FWAA 4R2JA 2WNHA 1GZDA 3TSYA 2G0NA 2GA8A 2Z2JA 5KVVA 4ZEWA 4CVNA 2A9RA 2JBHA 2F1KA 1RP1A 1T8YA 3FXAA 1T6XA 3OKCA 5EQFA 2B4KA 3G0CA 2XHZA 1N78A 3LQYA 4BWYA 3GH3A 2TS1A 2ET6A 2Y66A 4QD3A 4YQYA 1EGHA 1QH0A 1IOWA 4X91A 4GPAA 1KE1A 1QAMA 5BWCA 1V5IA 4PYLA 4LQLA 1G5FA 3DFIA 5TF0A 4AZ3A 1N75A 3P9RA 4NENA 2CJWB 5EMMA 1HFWA 1GCAA 4XYBA 3THOA 1VA4A 1KVTA 2LW7A 4P80A 5D6NA 5F52A 3DBVO 1RAGA 3B8HA 1Z15A 2YJ6A 4P38A 1SIOA 3OPVA 3FMGA 4KYUA 3WGHA 1IJBA 1Z0JA 2F9FA 1KDZA 3D8NA 5KYYB 2RGAA 3LLCA 4PAMA 1SCNE 2FR8C 4AUMA 2HPHA 2AVNA 3C43A 1L1RA 4HQOA 4ZOAA 5EFOA 4ETMA 3T06B 2P40A 1IXSB 2VP0A 3TUIC 2JVKA 4J0QA 2HEGA 4N5LA 4X3OA 4BJ5A 4QVIA 2NPFA 1ZZEA 3NATA 4CT5A 1PHRA 3ZCXA 3MGKA 2ZRFA 2JJ8A 5A04A 4CR7A 4BO4A 1N0UA 1KMCA 1I4WA 1BH2A 3ICCA 3VSEA 3WKBA 4HGZA 2IITA 2WFZA 4KTVE 5LLTA 1IIBA 1R8JA 1WDLA 5KSYA 3MLEA 4Z0NA 3WWPA 1WKBA 1UBEA 2HMUA 3N07A 4MQ6A 2JEYA 3G88A 3UT0A 5JZBA 1B74A 2QE7A 2FF5A 4OGWA 1ZRNA 5H3HA 1WY7A 2IZ6A 2A5LA 4B5LA 4LSZA 4LISA 1SXQA 1GCGA 2FQWA 2EWWA 4EI7A 1Y42X 1XF1A 2R25B 2H7CA 3OO1A 4NPCA 3QWFA 3U0VA 3V4FA 1VLHA 3EMDA 4Z7QB 3FZEA 3STVA 1E0DA 4BGIA 2Q6LA 3OLQA 4UUNA 4CMKA 5EHNA 5ESDA 2GRUA 1JVBA 3A25A 1O3YA 1W85B 2BKXA 3L8YA 1KS2A 2X2FA 3CNHA 2Y1EA 3LZ6A 1FYDA 3AZQA 3FTDA 4A26A 4CF3A 5CD9A 3M5CA 4WY2A 5HA5A 5AVUA 4Q34A 1GPYA 3Q15C 3WL6A 1HOXA 4L57A 2BIFA 2CK3D 2JAHA 3ENKA 2C99A 1IBKB 2BR5A 4IDFA 3LUAA 1HORA 3F4LA 3S28A 3R8CA 2VP3A 5CXQA 3T5GA 3FWKA 4P08A 5DCYA 3U3ZA 1CRQA 1TYZA 2LBPA 3HV0A 3KUKA 2XB8A 5IJ0A 3EVBA 2WTUA 3RK0A 2YV2A 4DR6B 3LUPA 2WHRA 4QVKA 4D3XA 4UPVA 1V47A 5KUTA 1PTJC 4F3YA 4O4JA 4C08A 1CZOA 2VDUE 1JKXA 1KDVA 1J8QA 1N2BA 4A3SA 4OQZA 3DHYA 5CH3A 5EWMA 3X2FA 2H85A 5JADA 2Z5LA 4JA2A 5EPEA 1W88B 4KAXA 1U8CB 2WIDA 2G9QA 2ZT8A 3HBFA 3L1IA 3O4HA 2PZLA 3AFOA 1BHQ1 4IOMA 1EGAA 1TUGA 4E33A 1HNXB 4GOXA 3HJGA 2YYSA 3R9IA 2XMZA 2I87A 4BXOB 1L7NA 3HBMA 1IUKA 5C1DA 1GZUA 2YHIA 3RWOA 2Q5IA 2D74A 3HBJA 2VHQA 3GPBA 5E7JA 2QMEA 1GNQA 1WCV1 2LTAA 4LV8B 1QH8B 2XUPA 1KEVA 1C29B 2GK4A 1H2XA 4BWGA 2FX3A 4Z9FA 1LSOA 3LHSA 1B43A 3CRZA 4Y6OA 1QFXA 4MICA 3EXEB 4HZGA 5EPOA 4AN4A 1VRWA 2ZB3A 2V3WA 2LWIA 4YMGA 2IRWA 4O2RA 4J1SA 3OE4A 2UZ4A 5AKGA 4QGFA 3TKYA 4DCPA 5CUQA 4MPJA 4ALKA 4M0PA 5C4MA 1XWWA 4NOKA 4E46A 3DDUA 1YCFA 3LLMA 3PGA1 4GLFA 4J4TA 3PRKE 2W4MA 2CD9A 3DLTA 1QVRA 1H69A 5I7OA 1NYTA 3O3NB 1X9GA 3LQFA 1GCIA 3OE1A 1YR9A 5ALLA 3P97A 3K92A 2C8JA 4GFDA 4ZKEA 3WB2A 1Q83A 1FYWA 2LKCA 4L9RA 1QP8A 5JRJA 3CINA 4YDRA 3QKSB 1LFDB 5IDQA 4YJ2B 1S6YA 2R48A 4H15A 4MJ7A 4K2HA 1ZUWA 4LJAA 2Q2WA 5BSFA 3K1ZA 1E6EA 1TLLA 2D8AA 3KJIA 4DA7A 2QAJA 1E8DA 2MINA 3C87A 3O4VA 2I1WA 4K6OA 5GOTA 4HD8A 4OA8A 2X14A 3VH1A 5AO9A 1GRQA 1RAIA 3WV4A 1GGJA 1HYQA 1VTKA 3S8MA 4JJGA 1LWNA 4N8DA 4G56A 1XPJA 2VPWA 4L85A 3K09A 5JANA 3OJCA 2ILVA 1PGQA 3ZXSA 5HZHA 1J00A 3COWA 4EMSA 3BIOA 3A2LA 3K9LA 2B0CA 1M0TA 2XUGA 1JMVA 4RD4A 4XJXA 3B6IA 1OCEA 1PFQA 1SHTX 3C4VA 4WEQA 1ESCA 3RHZA 3TOCA 3VR6H 4DTIA 2QS9A 5EPUA 4R5HA 4EG5A 1ML4A 3DOCA 4KXQA 4BGVA 3HDVA 4EJ6A 1T3LA 3QU9A 2QTTA 4G3XA 4QSMA 3B6EA 3UHOA 3FBTA 3ZDYB 4XRGA 1EX6A 3W4IA 4NBUA 3MJHA 2N3ZA 3AVPA 3QKRA 4YRGA 1A4XA 4NOLA 1PL0A 4HNUA 3EZ6A 2IP4A 4WASA 4DEVA 1FMCA 4DR4B 2PXHA 5K3DA 3MILA 1D2NA 3FRIA 1GO2A 4KO8A 3S7TA 2YS7A 1E3WA 5U4XA 1X8LA 2A5JA 5JSUA 4CHTA 3MMSA 4AIRA 4EO7A 1PJBA 1E5LA 5KCZA 3CO5A 2IPOA 4LDQA 2P75A 3WL5A 3T1YB 1EBFA 1JALA 1GN9A 1UKCA 3I52A 4JEMA 5AHOA 4KFSA 4RF2A 3R3WA 3D2CA 4HPXB 4ZDKA 1TMGE 3MEQA 3BMNA 5YASA 4IMRA 3FPJA 3QSYA 3OIVA 2PZFA 2Q9CA 1TYBE 2ZRAA 1CJKC 5A3RA 4Z5XA 5ICEA 2GAIA 3BZWA 3FGPA 1I4TD 4FYIA 1EG7A 2CSUA 4RIIA 3CPJB 5CVCA 5IK2A 5TS3A 3T94A 4D9NA 1AGRA 3G79A 4JA0A 1GVNB 1YC2A 4UPEA 2G5CA 3N5CA 3CA8A 1BROA 3W05A 1NF9A 4DTCA 5J43A 2VXOA 1W5BA 3AM5A 1L4HA 2WU1A 3O8BA 4JJZA 1Y8ZA 4C3ZA 2GN0A 1PL8A 1VCMA 4R9UC 4ZALA 3SBOA 3FW1A 1XRMA 5I47A 3GMIA 1CPYA 3TB6A 5TGDA 1WU8A 1HDCA 2KE5A 3MN1A 1X1QA 2XH8A 1JKJB 5CLFA 3I5XA 5H82A 3EA4A 1QGUA 2JFQA 3RSLA 4WFKA 1DEAA 2GKSA 3HVUA 2XBUA 1WE2A 2HC9A 4RIGA 3SJ7A 2F3SA 3UXMA 4EHHA 3VR2A 2IPNA 1ZI8A 1F4VA 1DDGA 2ORED 1JSLA 1MV5A 1SUEA 1WMEA 3E22A 3K09C 4H4CA 4S05A 1L7AA 4DR2B 3FTEA 3IH5A 2PX3A 3PEEA 4RHEA 1N3IA 4WEOA 4WGGA 4Q7QA 5AM3A 4R4JA 1O6CA 5I8PA 1D2RA 3I1IA 3MJTA 221PA 3P9YA 1QP7A 1G21B 2BMFA 1TEHA 3GY0A 5J40A 4DV1B 2Q0SA 4EUHA 4MW2A 1H93A 1M7BA 2HGZA 2J6BA 3QTBA 4AY3A 9LDTA 3E0XA 3HUFA 2XQFA 1SA0A 3ROMA 3HP4A 2RHBA 1WOYA 2VSFA 2WLSA 4JVLA 4TZKA 2MMGA 3QTTA 4I55F 2GTIA 4KAFA 4UEKA 3AF1A 1AMOA 5ILOA 4BGEA 3OAAA 2CCKA 3NBFA 5EIBC 2J5KA 2W0MA 1LBIA 2VDQB 2EKQA 1T0JB 3HUDA 2KJQA 1W6UA 1AK2A 3RVRA 1N5OX 3B7GA 1CUVA 4RYLA 1JQDA 3AERB 3Q12A 1QCCA 3QP9A 4EY8A 1WMFA 1OLUA 1R5OA 1G9TA 1V7PC 3TW4A 4J7XA 4LF9B 1JG3A 3EN0A 4K46A 2HCTA 5AW0A 4S0XA 5ALOA 2OXTA 1MC1A 2F9LA 3SC2A 4RCYA 2AYXA 5JS8A 4NBNA 2IHZA 3KXDA 1XHLA 4HZIA 3LGAA 5HGXA 1BQEA 4CKYA 3Q7QA 4NJOA 3B70A 4RO0A 1JN0A 4QDTA 1RLMA 1IHOA 4WCDA 4MQMA 2GRJA 5CRIA 1AMUA 5COAA 1JA1A 3HR4A 4HQRA 3IHWA 4XTCS 4G1EB 5A4IS 5HX7A 1L7MA 1DC5A 2UVPA 4Y7CA 1BEUB 4JT4A 3PPWA 3O9VA 4RENA 2JFWA 5AM0A 3PF8A 4FNOA 1TECE 2EP5A 2J0SA 3H0KA 3U56A 4IWNA 5C52B 4IKPA 4J75A 4MW9A 3T5TA 4QKQA 5KNDA 2BGKA 2R11A 4PZYA 5KMGB 3MLBA 1YB1A 2X3YA 3TIIA 2Q3LA 4BNZA 4QLAA 3UT5A 1QP4A 7ADHA 2XLCA 5J1TB 3ZD9A 2FF7A 5BPHA 4DV7B 3OECA 4KQKA 4MPRA 5EJ5A 4CIXA 4JR2A 2R8EA 3I01M 5PNTA 2P9JA 4KDEA 4MRMB 4Y9TA 3OPYB 1BXRB 1UMCB 1UMBA 1ZO8A 2MT9A 2G4LA 2ZRNA 4QWWA 1Q84A 4D8UA 1BXGB 1IJFA 1IFXA 1W2HA 2QYTA 1ZUIA 2GILA 3H1TA 4J3FA 4DMHA 1N1MA 3DP9A 2VTKA 3TOVA 5DX1A 4RDXA 3HLTA 1MB2A 1NVVR 4PX5A 4N5NA 4Z3DA 2A57A 4JXZA 4LF7B 1NVMB 2NMVA 3QFTA 1OV6A 3LUDA 5BWNA 2EHJA 3PNSA 3L5KA 3SQOA 5TT1A 4ESEA 4O4HA 4PO8A 4A03A 1XP5A 3CUSA 4HB4A 1UPFA 5AVZA 1JLRA 2VNSA 2Q5JA 3NHAA 5K20A 5HQJA 2R62A 3DZBA 4WK2B 4UE2A 3M9LA 1NVWQ 2XMBA 1ISRA 1JPUA 2MSDB 5CJJA 4H31A 1L4LA 3OWOA 4Q7JB 4ZVPA 4PN3A 1W49A 3FMVA 4UHHA 1MRSA 2DR3A 4YRFA 1NAHA 1VXRA 3VC2A 4CM1A 1NBOA 4GMFA 3FUCA 4NYMQ 3AVTA 3PTZA 3PJGA 1RC1A 5JNUA 4JEUA 4GKBA 2ESRA 2AG0A 4RZ3A 2R65A 4TTRA 3KAQA 5LXTF 4FCWA 2H06A 2YWRA 3WNZA 2PAFA 3FR8A 2PA0A 4U39A 1YMUA 3FJOA 4M9RA 1NBIA 1UKBA 3JARA 4B35A 2XPCA 5DI3A 2I6GA 1Z0ZA 1MA3A 1VPWA 2D7DA 3EISA 3NDIA 4PFSA 3Q1LA 2VAWA 3G13A 1RQPA 2HHCA 1E2LA 1GU1A 1V3TA 5C0OE 1NVGA 1RIIA 1AS3A 1Z2PX 2EIXA 2QPAA 2QAGB 3GIWA 2QXYA 2YXNA 1X1EA 3H2IA 4G5XA 4EFMA 2VIIA 1FPMA 4CFZA 4EJ0A 1CZNA 4KLZA 1UWVA 1FCJA 1Z0IA 3AYXB 5EHGA 3U4AA 3UVEA 5CYGA 2C2GA 2ZULA 1IZ0A 2PRKA 2DKOA 3LDFA 3P0RA 4KXMA 4DR5B 3CFYA 4LDZA 5LYJA 3V2HA 1T1GA 3MCUA 3B5IA 2EWVA 3KQMA 4D57A 1MAHA 3L3BA 4HDSA 5E6RB 3OHMA 1ZOLA 4PM4A 1Q92A 2JJ2D 3N1UA 1CUJA 3DH0A 5EWJB 3W8RA 2C4WA 4C4SA 3GLFA 5AJYA 4YP1A 1SIBE 1PZXA 1X42A 4R68A 4K6HA 1WZ2A 4UHBA 3E8SA 3FGZA 5KPJA 4G2NA 2OBFA 1L7RA 4H3SA 5C8DA 1JNXX 2QLMA 2IYQA 4KQEA 1SKUA 5FH9A 2YJGA 1FXUA 3FZNA 3NV9A 1I6WA 3ZD8A 1GSHA 2RK6A 4FPXA 3ZGVA 1GP2A 2V9CA 2D3TA 5CLHA 4RK4A 3UTDA 1AZSC 3OQNA 1TIBA 1D03A 1F6BA 3VISA 4BY9E 3S6JA 2YRXA 3I05A 4Z4FA 1RYHA 2WAMA 4JJ8A 1HLFA 2CLDX 4MVCA 5BSWA 4U2GA 3X2SA 1NJ6A 4DIUA 3A70A 5DB4A 3T54A 5MHTA 1DKPA 1UBNA 2AHRA 2ZIXB 4H7JA 3VC7A 4C07A 4JHLA 2VQFB 4JLDA 4AKTA 1L4YA 4XWAA 3A6HA 1XTBA 1H66A 1N2JA 2O8NA 3QPBA 1F20A 1US8B 5KSWB 4LF6B 2YJTD 2VRCA 5E8JA 4X41A 4BZXA 3GEHA 1ORDA 3I72A 3MMZA 3OTHA 3NBQA 2B8EA 2F8MA 4G07A 1PNQA 2NVUA 5ECWA 4N47A 3VSDA 1EX9A 1JAIA 2GBLA 3UV7A 2P2YA 4O4IB 4R01A 1OZFA 1M7HA 1C3OB 4KQXA 4YJ3B 1Q22A 5JAIA 1JB1A 3DHVA 3WLJA 5BNWA 4WZBB 5ALUA 3N7TA 5HKAA 1VKNA 1SAYA 1BMFA 4LJ9A 4QRHA 4KVFA 3OH8A 3MTIA 1AQLA 2GSDA 3AJDA 2D2IA 4KUEA 1P0MA 2J85A 2B6HA 1T35A 4PXAA 5DCWA 1GTG1 2BM9A 1Z08A 3ABOB 3JALA 4TQGA 1HLPA 3DVRX 2HOQA 5L3QA 2XTAA 1JT9A 2OK7A 1N9ZA 2GDZA 1N32B 4RTLA 4M7RA 1KIAA 2X3UA 5M3BA 5I4KA 4IBOA 1GQFA 1UCFA 4B2YA 2CYBA 2ZKLA 5BR4A 3EEOA 4EPWA 3GT3A 1RYMA 2VPTA 1SCJA 3D3JA 1XL0A 1AC5A 2CVZA 3A1UA 4PZLA 5P21A 4DR7B 1C5KA 1FMJA 3UMFA 2E48A 2ZAOA 3OLXA 3K0FA 3O4RA 2JPDA 2WE7A 1C50A 3P27A 4CR6A 2FUCA 2GZ2A 4HB3A 1J0XO 3AB8A 1FSSA 1T9KA 2EOAA 4YLEA 1NVUQ 1ODIA 5IKOA 4QBHA 5FPQA 3KEFA 2Z98A 1AMNA 4C1BA 1FDTA 3M33A 3AQ4A 3AVUA 3NXKA 1CR6A 4EVQA 2WOJA 4LDRA 3DOHA 1CUHA 4RDCA 3UAZA 4M9UA 4NHEA 1ULZA 3U9LA 3UFBA 3EWAA 3SJBA 3JATB 2BUAA 2YYAA 3AXSA 1G55A 1PEAA 2PZKA 4Z51A 3BHNA 4ZCQA 3WZMA 4DWVA 4EFNA 4Z7OB 4XVUA 3OEHA 3DJFA 2DZDA 4JQCA 3MGCA 2V58A 3IUYA 3T15A 4R0VA 4OVKA 1FE8A 1ZU5A 2EFDB 4MI3A 2OQ2A 4ZAFA 5KQPA 5LFAA 3F8SA 1P2GA 3PCTA 4RKYA 1YO6A 1DUVG 3B1FA 3DT6A 3NONA 5ENDA 1IUNA 1KARA 1N57A 3RH0A 5DN6D 4E07A 3NUGA 4L51A 3ZCPA 1I01A 4GOND 3H11B 1VMEA 3HL4A 3ELWA 2ID9A 5EGSA 1VHWA 5KHAA 1YR8A 3ZHQA 3AQIA 2QYHA 2DFVA 1QIFA 2Q3FA 2E6UX 3PWSA 1LLFA 4XI9A 4B34A 3NJRA 2R2GA 4LPKA 1JZSA 1P60A 3FNFA 2PLAA 4RK5A 1AGXA 3AY3A 2GBLC 4IP0A 1Z8HA 3QF7A 1UKVY 4RTJA 3HN2A 4LBWA 1SXJE 3A05A 2RHTA 4X8HA 1FS4A 1SUWA 3PUKA 3V6LA 4GPIB 3DFZA 3IQFA 4R69A 3O2NA 3MT8A 2VZ9A 4DLWA 2IS1A 4JB3A 2O8EB 1OT5A 5IKMA 2FI1A 4FEEA 2NOAA 1RHQA 2Y76A 2DB3A 3WO0A 5F23A 5G0SA 3ADBA 4EJSB 3CBQA 2OTCA 2FX2A 4BX3A 4DMLA 1U1FA 1EP3B 1NQ5A 4RUKA 5KX5F 1YZYA 3L4EA 5D86A 3U7QA 3I5YA 1PLKA 3JYNA 1HDZA 3OEED 4C30A 3ETCA 3SEFA 1JVNA 1KAOA 1H4VB 3F9RA 1K4KA 2E37A 5B30A 1PU2A 1E9EA 1GPBA 5BSMA 1EBUA 4ZYXA 1ADBA 1KFCB 2UYQA 4D98A 4OATA 4PR3A 3UMBA 2DX7A 1YVUA 3OX4A 3VPGA 5KYWB 5TVKA 5T4EA 5DXJA 5DNWA 4M0DA 1WD5A 1GRNA 3BDVA 4DB2A 5F21A 4UD6A 3CF4A 2R6ZA 1ESDA 4PYKA 2HJGA 2XDYA 7ABPA 4FQ8A 4Y67A 3BREA 4BIIA 4Z7NB 4WOJA 4B3XA 4LOHA 2LRHA 5IBQA 5DW0A 4GWLA 4CCAA 1U0EA 2ERCA 3PUJA 3BJMA 3ZI0A 4OAOA 2AR7A 3A2NA 1T5OA 1EX1A 4II2A 2IEAA 4W5TA 1YWGO 3KQOA 3LPLA 5K99A 3T3OA 1GIAA 1RPZA 5AK5A 1YH3A 3WWCA 1J49A 1DXHA 2WWXA 4O2BB 4B0PA 2PMCA 4YRMA 3HEAA 5HF5A 5JNTA 1L9KA 2VA8A 4IG9A 4BN0A 4DBVO 1HTWA 5LU9A 5A6SB 3DMDA 1YB6A 1Y4UA 4CMEC 2POQX 1U9IA 2CNBA 3CY6A 4B82A 4V1CI 4YCLA 4U2EA 2NZYA 2P6RA 1BU8A 2XZDA 1YACA 4JLKA 1PL7A 5SICE 3RABA 4AXXA 2JKYA 1EMDA 1K86A 2IHTA 4IGAA 3H18A 5F1OA 4CKBA 1QGAA 4AO8A 1J1ZA 4FHCA 1N8SA 1U3WA 4UUPA 3IS3A 1UP7A 4GMGA 5CX1B 4CM3A 1K2WA 2WAXA 3JQ9C 4WXHA 4EJFA 4NKRA 1J8MF 2QZSA 1LC3A 3IDAA 4YREA 1JBEA 2ZIUB 3ZJVA 1EK6A 2YY5A 4EVRA 4CF7A 3KYBA 4LJRA 4M2LA 3T34A 1XVVA 1B42A 3AHFA 1E94E 1QCDA 3M3PA 1G64A 4JLBA 4B3CA 1LDNA 1LLQA 1ZU4A 4HX5A 4OAPA 1PD0A 3MG9A 3N8IA 3V00A 1J7KA 1V8FA 2IEZA 4OO3A 3BSWA 4S1TA 2PAAA 1PQPA 3I64A 3D4IA 4PRLA 4F9FA 4PQRA 4I9GA 4I0WB 1QGOA 3TUJC 4EM6A 3S5JA 5GJVC 4DQ0A 4HNAA 3THWB 1YFKA 1IUPA 1J99A 2C3UA 2W9XA 2NADA 3BA6A 3RIMA 3VH4A 3DO5A 3D7RA 3T1QA 4F12A 2VBGA 2FUG1 1ISGA 1GPH1 4IH1A 2SKEA 3AX6A 4G8CA 4CJXA 1O6GA 4G5SA 1PNRA 1HQYE 1IEVA 1EZ1A 1Y3CE 4UHJA 4YRQA 1ZISA 5LDGA 4KR3A 5K8VA 1EGVB 3TZEA 1NBME 4GYWA 1TO1E 3K0KA 1O8BA 5B57C 5EI5A 2OWDA 3VUEA 3IEUA 2D5LA 1PWZA 1R66A 2EG5A 2WD9A 1EUYA 3BDIA 4UU1A 3L7IA 1ND6A 2WF5A 2VJDA 1F2UB 1OLSB 1U0NA 3A14A 2K7ZA 2CHVA 3GN1A 4YMIA 5ICFA 4KITB 1E8NA 1GZVA 4LXXA 5J1SB 3CIFA 3MLAA 5K3SA 3M6MD 2VPPA 4XRRA 2EARA 5FTLA 3AUAA 3ET4A 1XU4A 1UBFA 1FSGA 4YV0A 3IV7A 4LZJA 4YI3A 2ZDQA 5F9FA 5BW8A 1RE0A 1C0IA 1FA9A 2VP5A 3PE3A 4YT5A 3F5FA 4F6RB 1KTIA 5FDFA 2JFNA 4EKYA 2C3OA 5IC5A 3WO1A 2JGJA 2VK8A 2QY9A 2BGLA 3D59A 3QW4B 4HS9A 3QPVA 2CUZA 2JC3A 3OIWA 4PLVA 3BRWA 1EPUA 4QG7A 3NKLA 3SVTA 3O8CA 3OM8A 3BE8A 4OK5A 4UAJA 2Q5EA 4YH1A 4UFOA 2WTXA 4I50B 4P33A 4YVFA 1MQ8B 1TO6A 1YBVA 2WFMA 5CA0A 3RU7A 3S68A 3JZAA 3ZZNA 1M33A 3T7IA 2Y93A 4QDOA 4P7KA 4WBSA 4D3FA 3FWYA 1U2PA 2P4UA 4ZI3A 1BVUA 3QBEA 1GPAA 4ZT4A 2OWEA 4K5QA 2QMYA 4WE3A 3W2EA 4BNXA 4DMMA 4M21A 4JWTA 2JGKA 1RRFA 2VDOB 1FTQA 1XJCA 2B9EA 1JA9A 1R4AA 1YHZA 1ZBDA 2HX1A 5AT1A 1N5LA 2FHSA 3AFIA 4DQUA 4TS4A 3EAQA 3LS2A 4PC2A 1JBQA 1ECGA 3IOCA 1PNOA 2GFQA 3KOWA 4D99A 4BMDA 1RXCA 1V6SA 1FL9A 5ELMA 5JY6A 1PZFA 2IHKA 2PDAA 2NV6A 2YOHA 4OSPA 2NO9A 3RBAA 1JJAA 1VIVA 4IVNA 1JLMA 3WGZA 3DLHA 1TCAA 1VMAA 5A4MS 4BZWA 1X38A 1JVSA 5ECDA 2BFBA 1WWKA 3GJTA 4KQIA 3ORSA 1DJLA 3NIFB 4J94A 4KOAA 4JNKA 1Y5RA 1OLXA 3Q7RA 4N5MA 4RXUA 4X0EA 2GI4A 3RVQA 2NTJA 3CVXA 3FB4A 3EWSA 1GY8A 2F67A 4LTNA 3VYTB 4DMUB 1W0JD 3TPZA 4PE5B 1N5MA 3M2TA 3P4UA 3IO5A 2XOKD 1MENA 3LLVA 3RV4A 1UBUS 5CITA 3A4NA 1WTAA 1TW2A 2BKEA 3ANNA 1OV4A 4RY9A 4RFVA 4UU8A 5AICA 6PFKA 2Q50A 3PZRA 3B60A 1PJAA 2X76A 4D0LB 1ZHHA 1D0VA 2B4RO 3HYRA 2VJNA 4BX0A 1CE8B 4ZQIA 1QF7A 3QKUA 3UJPA 4L4ZA 3AL0C 2HA7A 3SHFA 1RADA 2ST1A 1D6MA 1P0CA 3AKYA 4G63A 4Z9AA 4B6RA 3T3HA 3IP7A 4MV4A 4WW0A 2P6OA 1PV1A 1TYEB 2DP4E 4EP1A 4JI4B 1ZG3A 3GEEA 1KJWA 2QVZX 3UBMA 1OB5A 1UANA 4GVPA 1R0BA 4PLYA 1BGVA 3UJ3X 3PICA 4C3UA 1HDRA 2ZAYA 1NT2A 4JDPA 2G09A 1JHVA 1P1RA 3EQ2A 4C22A 2DPMA 1G8JA 1E79D 3RFVA 2BP7B 4MQEB 1T3ZA 3D31A 1EFPA 2EFEB 2OP0A 3HUUA 2Q28A 4MR8B 3H0CA 2IL1A 3D4BA 3TQTA 3I9NA 4FDTA 4IOLA 3CTMA 5A9SA 4LX8A 4MH0R 1PG2A 5IAGA 3V4ZA 3W5IA 4UZSA 5J4LA 1G8SA 3A6KA 4Q00A 4WLFA 3UXHA 3ZKWA 2FCAA 1BKYA 3F6CA 3SS9X 3U4CA 1S2OA 4B3TB 3DKVA 3I1FA 4FNGA 1FDVA 1JMKC 4FCTA 1OWNA 4QYIB 5TQ2B 3PXCX 2PRIA 4WXEA 3I34X 4XWYA 5B58T 1IU9A 3U1VA 4ASUD 2F6RA 4H1UA 3AVXA 4C4TA 3KZVA 2ZAGA 2QN7A 4CKWA 5JNWA 4HP8A 1B0AA 1DINA 4L8WB 3K6KA 1VL8A 5K3FA 1RLIA 3L46A 4R1OA 2XQVA 1U11A 2J41A 4IF4A 3LM8A 4C01A 1O8CA 1YMVA 2IOHA 4CE6A 1X8JA 3QHQA 1FU4A 4G0PA 4KGZA 3JAKA 4KQ2A 3UJNA 4X62B 1NVKA 1P74A 1QYCA 3IAAA 5C46F 1IJKA 1MQAA 3TQQA 2PUWA 4CXMA 3GLQA 2VAMA 1Z8NA 2YIJA 1T2VA 4HQLA 3OC0A 4K6GA 5FBLB 3UQYS 1ANKA 3U4GA 2PZGA 5HRAA 5HIAA 2AOUB 3EXHB 5CA1F 1MEOA 2YZNA 2LKDA 4PBSA 3S2SA 3IELA 3T7TA 1ZM7A 2DTEA 1HBJA 1KHTA 2BLLA 3QVTA 1YT5A 4BP9A 5IXSA 5KJEA 2VJOA 1WX1A 4J0HA 4BV9A 2BRUA 5FJJA 4L73A 1FRZA 1C9NA 3GC6A 4D4LA 1NFQA 3AVVA 3MJVA 2XKJE 3H5TA 1SUFA 1NMSA 3FE2A 1Y3DE 4GVLA 5BN3A 5BUCA 2Q7DA 2V54A 1DPFA 5FTJA 1NX6A 4RH1A 1SBHA 3OIUA 1Z06A 1JQKA 2OCXA 3A9SA 4RU1A 2B99A 2QTNA 5EZ5A 2JGRA 2W90A 2PT7A 4Y1EA 3W5SA 2Q21A 5LMZA 4RXTA 5AKJA 2VHUA 3D8BA 4BMSA 2X19A 1D7AA 4D0NA 3TLKA 3Q5EA 2NM0A 2I80A 3CNBA 1DZIA 1EK2A 4ILKA 1A82A 4PYJA 4M76B 3MHTA 3WL4A 1I94B 2F1IA 4GMKA 1T43A 1U28C 3NWEA 2VZ0A 1GUYA 2NXJA 3EG9A 4G8JA 4LXUA 4X63A 3GYBA 3N3AC 4FJ2A 1HDGO 3EGOA 3WAJA 3G2OA 4HY3A 1AH2A 3IV9A 1IZ7A 2ZEJA 4UNPA 5F77A 1GT6A 1RWNA 2VLBA 1Q2UA 4OQYA 4ZDJA 4B81A 2UZ1B 4RTSA 1VP3A 2MMCA 1F2TA 2AIRA 3H7AA 1GCOA 1VSUA 2ODTX 4YDHB 4BU1A 4EH1A 2P9CA 2AXNA 4LSMA 4WQMA 4MO2A 4UTPA 1O94A 2NPIA 2QM3A 1E6LA 4C7BA 3IFSA 1IONA 1UEIA 1PZGA 4RJJA 4G4IA 1NULA 2B4QA 3JZMA 4RVFA 4YAOA 4ZOBA 1EWVA 3SR4A 4D2IA 1D1SA 1E98A 1DTSA 4NG4A 3IHLA 4UMFA 4YV7A 5DXAA 2O54A 2EKZA 5HQ3B 1UFVA 4WN3A 4ZODA 3QVSA 3EDCA 4JY7A 1B7GO 2GDJA 5IMBA 1P19A 5JC1A 3SMVA 1TZKA 2CFSA 2D1TA 4UU7A 3OLZA 2ON6A 4PLTA 5AW7A 3NBXX 2CKDA 2QN2A 3ONDA 3ROEA 3C8HA 3I04A 3BWCA 2P68A 2X23A 4DT1A 2P4QA 3FVRA 5H4GA 4CNQA 1C9KA 1MAVA 1SRRA 4IL5A 4MVJH 2EYQA 3DVAA 4JT2A 3ZWBA 2XNJA 4R98A 5KVCA 3HBLA 4Y6LA 1ZCJA 1J5PA 5T64A 1FJHA 1ZS9A 3GEPA 4J0DA 2J67A 4MV8A 2DQSA 4ZAGA 3K0EA 2BEVA 2PLNA 2R97A 3PKJA 2VA9A 4OTZA 4BYGA 3Q7EA 4QM7A 4C4PA 2AJCA 1LW7A 3VMMA 2X8JA 1WNFA 2JGAA 3I2IA 1H6CA 3EDYA 5FORA 3UAGA 3USZA 2QB5A 4XQCA 3SYNA 5FNVF 4CN9A 1UPBA 2IX9A 4JU9A 4MUEA 4QAJA 5DGHA 5CT5A 1GL6A 3ULKA 4WVLA 3ROTA 4QUIA 3RYCA 4JUDX 4P4SA 1DAFA 2Z4RA 3H8WA 3I09A 4M38A 4PN7A 1DT5A 4IQFA 1ADFA 1CNMA 4Z9XA 1I8TA 2JFUA 3R0XA 5C1IA 2Q6KA 2WSSA 5F1KA 5G40A 4C3OB 3VO2A 1I33A 2BEJA 1ONOA 2JEZA 3KJXA 1DRKA 4N12A 5ALQA 1E6MA 1Y34E 1KEEA 2NU9A 4HBZA 4R40A 1XRSB 3VO9A 2YXLA 1A8SA 1BDJA 1I4EB 2NACA 3MWGA 2J07A 1NXPA 1R15A 4EAAA 1Y6GA 3JASA 1EDOA 1Q7GA 5DT2A 1NLMA 1CIVA 2JBAB 1WZIA 2XMPA 4X95A 1COWA 1UKZA 4YONB 2DR0A 4Q3CA 4MR7B 3AHGA 1KFBB 3BH0A 5GIOE 1KMIY 4QFCA 1EUDA 4MVWA 4HNGA 1E9AA 4N0PA 3EPKA 4KUGA 3PGKA 4AY4A 3H9CA 3IB3A 5IZCA 3QXSA 3EGIA 2QX9A 4N9WA 1N8NA 1H2EA 2OBBA 4DLYA 1HEYA 2NYUA 2XNCA 3LX6A 1YZNA 2RHDA 1TF2A 4W5OA 4C0XA 2BN4A 2XTZA 3VPBA 4YYZA 4TKUB 1WO8A 1ZVVA 1SUAA 4HH1A 1T0IA 4MV3A 4DDHA 2XVYA 2Q4DA 1ZP6A 5JEEA 3THWA 2HXYA 4K6FA 1A88A 3X1YA 1JE0A 3ICEA 2E4UA 2JJ1A 4G37A 1R37A 1GTMA 1M2KA 3UA3A 1ZNQO 1WMBA 4JSTA 2P2DA 1L3BA 1XJ0A 4F97A 4GPBA 1P2TA 4AG5A 1R4ZA 1V11A 1Z39A 5JCXA 3SWWA 5LC1A 5T4FA 2WBLC 4OJQA 5DGXA 5T57A 5JFGA 4CU5A 3R5SA 2FMIA 4EKEA 4IMIB 2HJSA 2O57A 5DW3A 4BNWA 4ENPA 3W77A 4L6AA 2W2VA 2ZIAA 1XDUA 3LWZA 4WLOA 3RD5A 3UEOA 1A50B 1OTXA 3F2VA 3ND9A 1Y4AE 5A7GA 3INGA 1FXWA 2YHSA 3U4QB 1Q2XA 1ZUNA 2AQIA 3GIDA 4UEQA 3CEHA 5JD4A 2E6KA 2R47A 1H9CA 4I2NA 1A04A 2EU8A 2BGGA 3EXFB 4ZYUA 3MUOA 4Y18A 2R6AA 3ZU4A 1FMTA 3P2EA 4IDGA 1BS1A 1Z68A 1TVCA 3BORA 3IEMA 5CBPB 1H23A 2WWYA 1XCBA 4UM7A 4KJXA 1EGQA 1LBQA 2G28A 1Q7BA 2Q2VA 4C5BA 5LZ2A 4PZEA 4E12A 5K09A 4RK7A 2ZWIA 4O4LF 3TLYA 4Q7LA 1YVDA 4C3VA 3EEBA 3AIIA 1QHHA 1TVEA 1W0CA 3CNNA 4M8LA 4RD1A 4AAYA 4F1JA 4NZZA 1XRPA 3TZHA 1ZX1A 2XSZD 2AUNA 3IC5A 1YU6A 3VHLB 4CCYB 5HZGA 2QRUA 4U9HS 5P8WA 4N3CA 3OZBA 2F17A 4N4AA 1YR1A 3ILVA 3RODA 5IZCC 3H19A 4PGFA 1UBGA 4I8XA 4XVRA 5TX7A 5HPYB 3AF4A 4FWIB 1X7ZA 1A8HA 1XEFA 2IBMA 1HDIA 4C4RA 4KR2A 4PPYA 5EIEA 4ITVA 5CEFA 3VSBA 1KI6A 2C3YA 2OO5A 4RADA 4ZU1X 3ZW9A 4ZYYA 1M66A 4FHFA 3RSQA 5A5FA 1IB0A 2QVGA 5B4VA 1HSOA 1JR3A 4CTMA 4F4HA 5LWHA 3RIGA 4JYAB 1PTKA 5KDDA 3OU7A 3SLGA 1YZKA 4MR9B 4OHZA 4AD8A 3OQOA 1NQTA 1M0EA 3DEJA 2IELA 1JLLA 1YULA 1FUUA 3CJTA 3HMQA 3WNDA 3TLBA 1WZCA 1JDVA 4H7KA 1C14A 4UVDA 5TEVA 1FFCA 3SKXA 4PG5A 5CFQA 3IAM1 1NG9A 2GXAA 4MWZA 4WFQA 1I2BA 3UB4A 3IO3A 2DT8A 4EHAA 2LNDA 3DE2X 1VHDA 3PJDA 3CW9A 4TKZA 4PTLA 5K8TA 3D64A 1SC9A 1I2CA 1QKIA 2AW3A 4ZO7A 3D3WB 2CJPA 3G5MA 2XAAA 4M3NA 5ICCA 2LR0A 3MQ4A 3WLLA 1E66A 1G20B 3LCCA 2TMGA 2G06A 2REOA 3TUZC 3F1LA 3EGVA 3I23A 2ONCA 3TL2A 4EYQA 2H5EA 1C9MA 4D9JA 2JK0A 5A3SA 2XOXA 3A1FA 4IYJA 3HJTA 4R1PA 1FSFA 2C2XA 4L5IA 1NYQA 3QFHA 4NE7A 2IW1A 4DV2B 1EXNA 4V39A 4XPIA 5CG2A 2I4RA 3B38A 2R7LA