5HJ5A

Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
266
structure length
266
Chain Sequence
MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAADHPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIMILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from Vibrio cholerae with BETA-D-GLUCOSE-6-PHOSPHATE and FRUCTOSE -6-PHOSPHATE
rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Hydrolase
molecule keywords Glucosamine-6-phosphate deaminase
total genus 103
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hj5A00
4GMKA 4L5IA 4L50A 2J0EA 3U7JA 3LWDA 2RI1A 1LK7A 2BKXA 3E15A 3EB9A 1KS2A 3ENVA 3HN6A 1FQOA 3CSSA 1HOTA 1DEAA 1FRZA 3OC6A 4NMLA 1LKZA 4OQQA 3NZEA 2BKVA 2W48A 3CH7A 3TX2A 1CD5A 2O0MA 1O8BA 4TM7A 2R5FA 4GO1A 1JT9A 4L4YA 3IXQA 2WU1A 3LHIA 4L51A 3KWMA 1VL1A 1NE7A 1UJ4A 2GNPA 2RI0A 1XTZA 1HORA 3BXGA 3EFBA 3HHEA 3BXFA 1FSFA 1UJ6A 1FS5A 3ICOA 4IO1A 3ENQA 1FS6A 4M8LA 4TM8A 3L7OA 2OKGA 3UW1A 5HJ5A 3KV1A 3NWPA 4R7TA 4OQPA 1UJ5A 3E7FA 1M0SA 1LK5A 3BXHA 3ENWA 4L5JA 4L4ZA 4R9NA 2F8MA 4X84A 3BXEA 1PBTA 1Y89A
chains in the Genus database with same CATH superfamily
2GA9A 4UARA 3OEHA 2SNIE 3MVEA 3W7AA 4ZFNA 3UAVA 1ACJA 2IPNA 4PE5B 3JZDA 3ZK8A 4CM4A 2VYNA 3CZAA 3F2IA 5E6SA 4R2LA 3CVJA 3T3NA 1LNSA 2RGNA 4GLBA 3H6HA 3HCCA 3WS7A 3LVRE 3A3KA 1ISSA 2YV5A 5E1DA 2QQ5A 2RIPA 1P7CA 4C20A 3JALA 1KJQA 3JWHA 1S7CA 1Z4IA 2OVBA 2WP8J 3QU2A 4ID3A 3EC1A 4GOKA 1D4FA 4G8BA 4Z6KA 1KY5A 1FUIA 1D1TA 2NG1A 8LDHA 4R68A 5TQ2A 5L8VA 2VQ3A 3K70C 2PPLA 1ZN9A 4G9GA 4U7GA 1ZK1A 4BO7A 3IUSA 4DLBA 1VMAA 3OFNA 2A9OA 5C5CA 4F3TA 5TQ0B 4G0OA 3RJ5A 4QFBA 3PQ6A 1T5HX 3LUAA 4QOHA 4R1QA 4MVJI 2DUUA 2HA4A 2YFYA 1DJLA 2EKZA 1PWYE 3H4IA 1SUBA 5LUBA 5C7YA 2XZDA 2DULA 1UM9A 4GR4A 1A0OA 3U9TA 4LCJA 3W7BA 5F98A 1L6IA 1ZD8A 5A4FS 4D4MA 3M8KA 1AHNA 3FHLA 4B7CA 5CNJA 3WQBA 2IZZA 2WTMA 4NFYA 1J33A 2QW8A 3LFHA 2QRPA 4F60A 2XCQA 2RH5A 3HJFA 1SBCA 1RYZA 2Q9BA 5J4VA 1FTSA 5DV9A 3BTSA 4B8YA 4LOLA 1JHDA 1XZHA 1TW3A 3KTDA 2QAGB 3U56A 2XW6A 4PYLA 1KZYC 2GEKA 1OMOA 3A8TA 4HCJA 3LCJA 4C4TA 2RMKA 5A7GA 3BCSA 4L5YA 4RESA 1ILWA 3DEAA 3AETA 2I91A 2HK9A 3NJ4A 4IVQA 2DEUA 3ZGVA 2Z08A 4FKZA 1RKVA 1ZXLA 4J0GA 3RRFA 4YRBA 5KPDA 4DB4A 3CZ5A 3FOWA 4GZLA 1FMLA 1O95A 5A3QA 5EIEA 1OA1A 3VNQA 10MHA 4LS3A 3DE2X 2EBUA 4B3TB 2RC5A 1CUHA 3ZBTA 1MX3A 2IU6A 4YRCA 3LYLA 5KJEA 3RVSA 4JYCA 1ZNYA 2B1IA 5LBUA 5A5EA 1UOPA 2Q6TA 1BTOA 2R6CA 3Q11A 2WQ6A 2QXYA 5BO5A 4I81A 5B2FA 3R3JA 2C9ZA 3VHXB 2OXRA 2BEJA 1C8KA 2H5EA 3CZQA 5H3CA 3JPYA 3L77A 3PR3A 3TW4A 4C0QC 5HVNA 2O57A 1PNOA 3T6KA 1T2UA 2OUIA 1DIGA 1QVVA 3CR7A 1DQRA 4N82A 4O0LA 2X0JA 2ZVDA 3AM3A 4OHWA 1T3TA 2CYBA 3EVAA 3QFFA 1VA5A 4MWBA 1UBKS 3GRKA 4P22A 1K86A 2IUEA 1NZFA 4DLNA 4D0SA 1DQPA 4DWJA 3EOBI 3K72B 3RC7A 3O8OB 3G2LA 3KAKA 4IH9A 5B1HA 3I39X 3WLHA 4OLAA 1C0KA 1Z17A 3RANA 4WXYB 1X1QA 3R6DA 1JR3A 4GPBA 2QJOA 3ES9A 4JLNA 2HRBA 1QCZA 3NC1C 3SEAA 3WLIA 4KQIA 4WLNA 2D1RA 3UNXA 2IXGA 2P90A 2OPHA 5BSUA 4WLEA 4RWEA 4PPFA 3IMGA 4FDVA 3HI6A 4X64B 2P79A 3IQEA 2R8RA 5I9LA 4Z7QB 4X65B 2XUQA 5DN9A 3ELWA 5KNDD 2B94A 1JRLA 1JVSA 3E03A 3BX1A 3H1FA 2G6BA 4MRMB 4TLCA 5K0TA 4MW0A 1ZN7A 1ZOOA 1KE1A 3U1VA 2C2ZA 1Q74A 2JVIA 2NU7B 3HV0A 1E2HA 4ETWA 1IUKA 2GAAA 2Y0DA 4ZHQF 3OPXA 4KH0A 1KJNA 1QRDA 3AR8A 3KKLA 1RJGA 1K27A 1ZC4A 2FWPA 2FSFA 2VCYA 3LVQE 2G5CA 1AB6A 3TTTA 1MB3A 1XCLA 2IYWA 2VSNA 2YXBA 5E4JA 3QVGA 1CS0B 2H00A 2EWMA 3P4XA 4G8JA 1UJMA 3R3SA 4LOKA 3FAKA 5JWRA 4D9FA 5HMLA 3A37A 5DNDA 1ZN8A 5F7ZA 1H8HD 3GLHE 2GF2A 2OB2A 2WF8A 1WE2A 3T1NA 2R25B 2XE7A 3I23A 1Z4OA 4EHNA 9MHTA 2BC9A 3T8YA 1UK7A 1YDGA 2PKQP 1XZAA 2NPFA 2EFGA 1T6BY 3ORHA 4UAVA 7REQB 5IF3A 1EESA 3Q1KA 5AVXA 5K6TA 3S3TA 1KC1A 2WSMA 2CMHA 3ETJA 4UZEA 2C4TA 1LI4A 4BO8A 3TTYA 4Q00A 3DCNA 3V4VB 1ZBQA 4COOA 2PZGA 3FFBA 3L6CA 4MQFA 4RJ2A 4TWAA 2J0UB 3E3LA 3IVRA 3W34A 2OZLA 4MMZB 2PD6A 2HK8A 2Z9CA 3FYUC 5FKJA 1WU7A 1CBUA 3KZNA 2QTHA 2C95A 3EUEA 5LZ2A 5FI3A 2WUVA 4NV3A 2ZP1A 1J97A 2GYYA 1IM8A 4G6ZA 4L6AA 2X2FA 2I99A 1E98A 3RRXA 5HSGA 1PLLA 4NZYA 1DT5A 3SZRA 4PAWA 4A03A 3LHDA 1S2LA 3CX7A 3A11A 1R18A 2W6ZA 3IDAA 1UKYA 3ADKA 4FI3F 2FDRA 2WSYB 4PIPA 2PUAA 1GSIA 3ZKWA 4AMVA 5LFAA 1FVXA 3KXPA 2Y05A 4IUYA 4RF2A 3X1YA 3V8EA 1TEHA 1JEYB 1M7BA 1ZBDA 3K6JA 3MRXA 1XT6A 2NU6A 1HYGA 2YC2C 2ZIXA 4R1UA 1E9EA 1SXIA 3MBOA 1N7JA 2O3TA 1E4EA 5D3QA 4BNHA 4AJNA 3U1BA 4PZUA 1KVQA 2IGBA 2LE0A 3OQVA 2C9YA 3VPCA 4MUNA 4EF6A 2HIGA 4OVKA 2H2FA 4ZTUB 3KYDA 1L7OA 3H0EA 3H5AA 1FFXB 3K31A 1QH1B 4FMCB 4Y30A 1T8PA 2AFIA 5EJMA 2J7KA 2SKDA 2GOYA 3N2GA 3UICA 1I7DA 4HEA1 5JHHB 1CERA 3ESRA 3QOWA 4YJ3A 1WSAA 2O2JA 4RLFA 1XBTA 3DOJA 3UMSA 3WYNA 2ZYTX 3ANXA 3RYTC 1FS5A 2JK0A 4CHTA 5I6DA 1GRQA 2QPTA 5DKFA 1YJCA 1EZZA 3H6KA 3LPMA 3AIOA 1YTUA 5JNVA 1OLSA 4IF4A 4EMTA 3H16A 3IE1A 1B3RA 4JBHA 2LNDA 4IQ8A 3TXAA 2GRJA 4AMZA 4KTVE 1OGJA 2XBUA 5CLQA 3KT3A 3NIGB 1TCUA 5DHUA 2ZJZA 2HQRA 1UPCA 3I2FA 3RKSA 2V65A 5A5FA 5LB2A 3K8QA 4CL2A 4B48A 4I4LA 4ZOEA 2L42A 5DGIA 3RS4A 1GG2A 3PKZA 2O3QA 2FFQA 1BO6A 2G1JA 1KEWA 4F2PA 3LH5A 1XD9A 1PT8A 3I1FA 2EFHB 3D6TB 4LOAA 4MKGA 4ZYTA 1JXMA 1P3DA 7AT1A 3N58A 2YC4C 1PUIA 2GUWA 2A9QA 2Z09A 4MP6A 1G2QA 3AH8A 4KE7A 5ALQA 1YMVA 4PO8A 3C7DB 3CG0A 3LYAA 4FMBB 4HFRA 2JC3A 3PPVA 5LZ5A 3W2EA 2EJUA 3ZVLA 1L4UA 4U2DA 4CDNA 2BEUA 3P9CA 1U2PA 3TOZA 1H2HA 1DBRA 1TUGA 3FPGA 4N0PA 3TZEA 3VRHA 5CDYA 2I8AA 3FPEA 1QBGA 3V46A 4I1UA 4AW9A 3VHXA 1NRWA 1H1LA 1TVCA 1O95D 2Q8PA 1CS0A 3MRTA 1S5PA 4EPXA 1IK6A 5JPDA 5BW4A 2NNWB 4W9NC 1T29A 2HUNA 3EH1A 4KC0A 1FP7A 1HKUA 3EAFA 2IZ5A 2LBPA 1OGYA 2YQ5A 2Q62A 2DHEA 3FVTA 3H2HA 4J0CA 4MUEA 4XGRA 2AE1A 3ZJVA 1AH2A 3MAGA 4BDSA 2E4UA 3H2GA 4AJHA 2WB2A 1R0ZA 1BQ4A 3T3PB 2W6JD 5KTRA 1I2DA 2TMKA 4V1CA 3V5NA 3Q5GA 2YUIA 3S99A 1ZCAA 4QJ5A 2GPYA 4V0SA 4RFSA 2B0JA 4P0TA 3PIDA 3OOEA 4AY2A 5EFOA 1D1PA 1MC4A 4HZGA 4WCFA 1GGMA 5FR1A 1IYZA 5BR4A 4JQSA 1HT1E 2FPGB 3G0GA 2PXAA 2QA5A 4LSGA 4YAFA 3VPGA 1KJWA 3THSA 1PI3A 4JT8A 2VHQA 2OGSA 4YFYA 2ZRGA 1TMYA 2A6PA 4HGQA 2HXGA 3ND8A 4QNRA 3TCKA 3BIXA 5B4UA 2GJ4A 1LH0A 3PA6A 3ADPA 4D97A 1TC2A 3RSHA 5AW2A 3KKKA 3D4PA 3KYIB 1QCCA 4V3CA 1QHHB 1VC2A 2OAGA 5AW1A 3ZI4A 4DEVA 3NBMA 1YC5A 4DY6A 2XWSA 3M3PA 1I2MA 1Q1ZA 4WZAE 2ASVA 2P5YA 5DTIA 3MHPA 3C7CB 4OCZA 3AKYA 4LJ6A 1GPKA 1O0SA 2F8MA 3C41J 3MWDB 5JSUA 2QUAA 4FDUA 1P0MA 2Q99A 1KDTA 2ZEJA 3SYKA 2PFKA 3WP0A 1VIAA 4LJ5A 4C6HA 4QOSA 4LBVA 4PS1A 2QBYB 3LDFA 1UT5A 4WXHA 1RQGA 1QYCA 1V7ZA 1WXXA 1JN0A 3C5CA 2O06A 3IBCA 3OQBA 3EIUA 1GV1A 3LBHA 4HMOA 1E3WB 3T4EA 621PA 4BLPA 4XIGS 3LRPA 3NGMA 4JVMA 1N5IA 1CZUA 2A78A 2V3CC 1RJDA 1BWSA 3D7SA 1FSPA 1A2QA 3LC2O 3LHIA 2Z3ZA 4IQ0A 5LP6C 3U62A 4UFPA 2QM7A 4ZI7A 1X9IA 1QQTA 1SWWA 5AHRA 4K6CA 3VR4A 3D3WB 2IHBA 3RAPR 3S2UA 2CB0A 4PRZA 4EYKA 1L4FA 4K87A 1W5EA 2HOQA 4D6YA 4TXJA 3C16C 3KFVA 3LXUX 3BJRA 1E1CA 3I76A 1EP3B 1P1FA 2RBGA 2RFLA 3FJ1A 4UPVA 3K70B 1NIPA 3GZJA 1V5WA 2R1TB 3JD0A 3DOUA 4OF4A 5ALLA 3SXUB 2ANBA 1OFHA 2H54A 1VLLA 1V5EA 3U60B 3W04A 3RC2A 3WDKA 2XQJA 3HZOA 4IXDA 4EGFA 2X8LA 3TCNA 4D9CA 3EXEB 2OORA 4RHCA 1LW6E 4CQLA 4Y9DA 1BH2A 1YRHA 1YBVA 2OESA 1QS0B 4U6QA 1YNSA 3RSOA 4KXVA 3H9EO 3SJAA 1QKIA 1E64A 3ZE8A 2QD3A 1IPEA 5DIZA 2DWPA 3GN2A 4F71A 1KK3A 3D2CA 4HGRA 4NICA 4TROA 2C4VA 3HFSA 3QX8A 4QXQA 4X8OA 5AJZA 3UB4A 5TMPA 4NBKA 4MJLA 4PZ9A 3JQ9A 3UK0A 2PE5A 3A3NA 4GXRA 4IIFA 3W2HA 3D0OA 4BJHB 4RY8A 1NATA 3BBPA 4PSKA 2C9DA 4DADA 4CQNA 3S2FA 1OXXK 2HT1A 4IH4A 1EWVA 3SC2A 1QXSA 3QELA 3UK7A 2OCXA 3ETLA 4XGKA 1W4RA 1UIMA 1QDLB 1FUUA 1QHSA 3SX4A 3KSUA 4A6XA 3WGQA 2NO0A 4B7XA 4HLNA 4N7JA 1JI3A 1GLVA 1U2ZA 5ITSA 2QJRA 3AP2A 3MIZA 3V48A 5G0WA 1Y7HA 1GRRA 2QE6A 1KNXA 3C4QA 3QU9A 2NU8B 1Y34E 2H5JA 2VSQA 1PYOA 1KI7A 3TUJC 3CRW1 4TTSA 2HREA 2K2WA 1DBQA 2YMLA 3FBGA 2BAGA 4CF7A 4LRQA 5AJVB 2F1JA 4M76B 3RKUA 4GEGA 4TV9B 1IJBA 4RHYA 2J7PD 2M1XA 1CYDA 3RVRA 3P94A 2CNOA 1U5BA 2NNLD 4ETMA 5I7UA 3S1AA 4GR9A 4MGKR 1Z62A 3KZCA 1XRQA 3U9LA 1XZCA 2DSTA 3BTVA 4X95A 1UMKA 4BU0A 3IUNA 4XI9A 2A5DA 3HCAA 1Z5GA 3FFAA 1GNTA 3BOSA 1FYVA 1VMKA 1WJGA 2AVNA 2WV7A 3G1TA 3GPDG 4OOEA 4PEVA 3LKBA 5G02A 1TPZA 3V1YA 2OYRA 1SCNE 3AHCA 4OHYA 1B7GO 4OXRA 5C35A 2PL5A 4AD8A 5GZ1A 3ER6A 2JL1A 4LSMA 4TQUS 3X2SA 5AW8A 1BXZA 2GBFA 4BGVA 4BLWA 2WBLC 3NAQA 2WVJA 1DXYA 2VG8A 2MJLA 2MT9A 2ODAA 1XEXB 4L50A 4DMCA 1OYYA 2JI9A 4RH0A 1EQ2A 1IY8A 1IIRA 4FWIB 4G5YA 4B2IA 2EBWA 3QXSA 3U9SA 1F0KA 4NK4A 2CE7A 2C5FA 4HDCA 4A5OA 4YV0A 4ZT2A 2XT9A 3WNVA 1U1FA 1SD1A 2Q1TA 4X1KB 3PX7A 4RVCA 1TK9A 2H48A 2XXBA 4UBLA 4DIDA 1P62B 2EFYA 1SK9A 3HN7A 4KFSA 1AGPA 5LL6P 1NPDA 3ITEA 2VWQA 4O4JB 4UVIA 3ONNA 2P2NA 3GD7A 1XZMA 1BD4A 1CB7A 4AP5A 2G17A 5CXSA 1Y7IA 5B37A 3C24A 3TIFA 1QKJA 4P3NA 3WYBA 1UK6A 4GRDA 2FLWA 4C7OB 1G0OA 2Q6KA 5G41A 1D9XA 3DTVA 5HQ3A 1TTPB 2HFKA 5JYEA 1J2YA 1RR6A 4A8JB 3LCCA 3VYRB 3JRWA 3NDPA 3RUFA 4IFIA 1E1QD 2JGDB 2VIIA 3T9EA 4I1VA 1N8NA 1R64A 4BFUA 3B20A 2EZTA 2I67A 1PCXA 4X7PA 4BE9A 3GJRA 4AM8A 4XSHA 3PTLA 4Z5XA 3VZRA 2E37A 3F98A 1Q0LA 3JWIA 5DW0A 4ZZ1A 5EIOA 1CUJA 1JNYA 3TMAA 1T8TA 3SGLA 1BCRB 1T8RA 2D74A 2WG1A 1NL3A 4KUHA 1ZP6A 4N6OA 1LBTA 1M0WA 1F4PA 1F2TA 2WVHA 2FAXA 3OZIA 3N0WA 3OE5A 2XNCA 4R41A 2CBXA 2OY0A 3T4XA 1LGYA 1J06A 4ARBA 1G3RA 1KZ1A 3IAS6 3L6UA 4PINA 1Z07A 3AUXA 2YWJA 3HLYA 1L7XA 4YAGA 3ORSA 1IOWA 1GTMA 1JXOA 2OMKA 3NOOA 3A6EA 1TECE 5KOHB 3D6MA 3RU2A 2ZAIA 2NUTB 4EW6A 5DBIA 3DEZA 4F38A 3LM8A 4NZMA 1TVEA 2G1KA 3H2ZA 3P71T 5K0ZA 4LUCA 5BRJA 1DC5A 4PR0A 3VZBA 1IWOA 2Q5EA 3RRZA 3C3PA 3ABSB 4DLKA 4Q4HB 4KG7A 3GNLA 5CD9A 4D2IA 1G8YA 2QVBA 3GGOA 4X61A 5SZIA 4AZ3B 1NM5A 2ZI6A 4FW8A 3C3XA 1M6HA 2WJYA 3QEMA 5JD4A 2C8VA 1D8AA 2WTXA 4ZAYA 5IH7A 4Y67A 1SCDA 2VS1A 3EEQA 1Z0IA 2ZXEA 4J0KA 2GCIA 3V7WA 1IH8A 4OXYA 1GUYA 4NBVA 1Z6QA 2Q2OA 1JFVA 5KTTA 5M04A 1U0BB 1QCYA 1TCAA 4BO2A 5IM4F 1JDNA 5CB4F 3CH7A 3HBJA 4HPXB 4CT0A 1NU8A 2COUA 2AFVA 4P93A 3KC2A 2X13A 1VJ0A 4MIKA 3B12A 1ZRSA 2ZDHA 2WJ6A 4R5MA 1IAQA 3DVLA 3HU2A 3T61A 1RMTA 1BKDR 5LQSA 1Q3KA 4BZXA 4CKWB 1PJRA 3KLOA 2QM0A 2JIRA 4NATA 4W6ZA 2IWRA 2TECE 1JIIA 1JWAB 3HBAA 3U7EB 1GCOA 2FUKA 4EJ2A 1XZLA 2QUJA 3DVAB 3R3YA 1V4BA 1Y9AA 2VTVA 1AMOA 2ZSJA 1NGSA 4E0BA 4HT3B 2E5LB 3L6OO 1CR2A 1T34A 1WEHA 1CRWG 4CR6A 4O2LA 3V8NA 4YT4A 4DMKA 1L5WA 4WOBA 7REQA 2XHEA 2VNIA 2F1RA 2I2AA 5FUWA 4INZA 1SIOA 1WUJS 5D1HA 1WCWA 4E6PA 2GN6A 3KWMA 2C94A 2Y93A 2HUPA 5EWLA 3PC2A 4HFNA 4IMPA 3SR0A 2OGUA 1XTRA 2J0UA 2XDYA 5CLHA 4JDUA 3E1GA 2HIAA 4Q4DA 3AY0A 3RK0A 4HEHA 2C78A 2IUSA 4GPD1 3BWMA 4LTDA 4ME6A 5AI6A 3L92A 3MTBA 2WIKA 4CT4B 2OCAA 2A1UB 2BDTA 5CIQA 2G8NA 2NU8A 1AKWA 3RCBA 3UXHA 5FEUA 1Y5RA 1SRQA 3OZBA 5CXUA 5IXYA 5LA6B 5ILQA 1UFQA 3TTWA 3CLUC 1ZN2A 3OIVA 5BYKA 4EL5A 2ZT7A 4BMOB 1NXPA 3IJ5A 2XMBA 3WK8A 4XAQA 3AFMA 1DOAA 4Y0AA 1CJMA 2R6FA 4PPNA 3KOOA 4H6PA 4OL0A 4B6FA 1W0KD 4JODA 1S9HA 1NAHA 1U9IC 2AGVA 2QU8A 1P0CA 1YA4A 1SU6A 2VYND 3AP3A 4IVNA 1A8QA 3SR3A 3EIQA 1IN1A 1ZK3A 2AFRA 4U2CA 2UUBB 1U81A 2WP0A 1IMOA 4D9BA 1EWRA 3AOEC 1LJLA 2FMHA 2PLNA 1HRKA 2KE5A 3D4BA 3QEAZ 1OKKA 3O03A 2Q4EA 3VPHA 1XUOA 5TPWA 3TLXA 4FLFA 1KOFA 3N9IA 2P6NA 5HM8A 2NAPA 2FJUA 2HHAA 2A9PA 4LV6A 3DULA 1FUEA 4MWZA 1HFKA 2QNRA 4PLZA 4BEJA 3GP8A 4JBNA 3K05A 2FLVA 1GA1A 2V7BA 3KZOA 3TECE 3SR4A 1AKQA 4WOJA 1E9CA 3QXXA 4KHPB 1ZCFA 4DEYA 1VHTA 2I4OA 3FNGA 4KQEA 1X13A 3S6JA 1MGPA 2OUKA 2YW9A 3V6LA 1E77A 1OI2A 2O2IA 4HXEB 3TNFA 4MR8B 1EUYA 1QRRA 2GGSA 2FGKA 3N1UA 3AF0A 1WRBA 2HA5A 3FW1A 4ZCSA 2BHSA 5LDHA 1HXHA 2UXBB 1W85B 5GVRA 4M46A 4B3BA 1L7VC 4G0UA 1VPWA 1TPYA 3D8UA 2Y2VA 1GZHB 4FXPA 4G4IA 1QB8A 3EGEA 2JIQA 3OZFA 3UWPA 1Z38A 1N6IA 2ACWA 3QBVA 1AHPA 3C74A 3P2MA 1KH2A 4KPGA 1PJCA 4BO1A 1TFUA 1JX6A 3TPZA 2F17A 4IRXA 1P4HA 3BK1A 3CG4A 5E2IA 4G0WA 1PG0A 4L8VA 4B81A 4EP1A 3I01M 4RNDB 1MENA 3FKSA 3OOYA 1VFNA 1XKQA 4OGFA 3FHCB 3GZTB 4FFLA 3V8QA 4DUGA 4TV9F 1AV7A 1DCKA 2PBLA 1N5LA 1XTIA 2A9JA 1LC3A 4I1SA 5DXFA 3HR4A 4Q02A 1U8AA 1UK9A 1YULA 3ANTA 4ZP1A 5L45A 3V1UA 1P5ZB 3MG9A 4F6RB 5PNTA 5A4KA 4IV5A 1A7AA 1G9TA 1UWVA 2W2MA 1ISHA 3ZOKA 3W2GA 1DQZA 4DYHA 1JG4A 3VJRA 3TTUA 4E5SA 2XD4A 1CSEE 2OXFA 5HMMA 5DTJA 1GTZA 2AOTA 2EXXA 5IDVA 3UJ7A 5LQRA 3DQZA 4LQCA 1F7UA 1A5ZA 1Y63A 3H7IA 2HL6A 3PIRA 3C6MA 4E1AA 2VP0A 3MOIA 4N18A 1U2RA 3R9XA 4NEGA 3UEOA 2VQ6A 1W4BA 4IDDA 2XTAA 5K3CA 2GKGA 1TJ4A 2V7EA 1FRNA 2D62A 4KQKA 2B3TA 4K6FA 1NVDA 4DJTA 1NF3A 3DHNA 2DPGA 1R6TA 5AWFC 1W8IA 1YRYE 4NCKA 3PPXA 4MVCA 3RBXA 4TWJA 2E3JA 1ZA2A 2UZ1A 3FETA 5LJIA 1TXGA 3QKRB 3QE4A 1G4AE 4E03A 2FSVA 2ERXA 5CB0A 3D5EA 3SQMA 2W2NA 1LY1A 3ZVRA 1M8JA 4S0ZA 3ROXA 4RTNA 5C18A 4PHCA 1N9KA 4U02A 4GX5A 4ZREA 4FNGA 3GARA 4U2KA 4UXJA 3FCOA 3GNSA 1AUQA 4I3GA 3O3NB 2XRFA 1RWQA 4ZO9A 3NLLA 3O73A 3W5DA 2GZMA 2W2KB 3QHPA 4L3VA 1E3IA 4RJLA 3KT6A 5GM1A 3O38A 4QREA 5CJPA 3VR4D 3PF8A 3Q8XB 1HMYA 2O52A 3DNPA 4G37A 2KBEA 2X1VA 4KFCA 1NIJA 4XB6B 2P8SA 5EXDA 4PWYA 3U48A 2W6PA 1WXEA 3D43A 3NT4A 3QOFA 2HRQA 2NTEA 1P39A 1U2DC 4Q34A 3TIXB 3PT9A 4B7ZA 3DXYA 4JU8A 4V2UA 2GQ0A 4BUZA 1Q1NA 2LKDA 3UYLA 4AKHA 3SU8A 3FJOA 5ALSA 4OX9Y 4ZN6A 1Q92A 1QRAA 3KZKA 3OT5A 4C43A 1M2KA 4ZQFA 3ZDCA 3B7WA 1RPZA 2ECPA 5AK6A 3TH5A 2WMNB 1U2SA 1HEYA 4PFQA 1VLQA 4ZI2A 2VHTA 1SUDA 1UCFA 2YKGA 1LK0A 3GFSA 3I4FA 3U16A 3B3JA 1E1CB 3NYQA 1JJBA 4I14A 4RQBA 1HDZA 2ERYA 5CIWA 5H70A 1Q14A 3GFGA 5E3JA 1RXWA 1QPZA 4TVSA 3A6JA 1XZJA 4RIIA 5FORA 1CEQA 4KQMA 5IJ9A 3RYFB 2PLAA 4NXNB 2COKA 4KAFA 3ZY2A 1C3VA 3CMMA 4TGLA 5AM1A 3RKRA 4KXFB 2H4JA 1D2MA 3IJRA 2XZPA 1QUFA 2HCFA 3PR2B 2VJMB 1PGPA 1QX3A 3FVVA 1YASA 3BWDD 3OM9A 4PZ0A 4CLOB 1S4MA 4X7MA 3ZQUA 1MXFA 5IABA 2AVDA 3E9RA 4LX0A 1BROA 2ZT5A 4ZVNA 5CP8A 5AM2A 4RTRA 1ADBA 3IT3A 1C80A 3F49S 4RDIA 5EA2A 221PA 4TZ0A 2BISA 3FBTA 4QX6A 2B37A 1ISMA 2KM1A 3AESA 3KDSE 3UHAA 2CCJA 4AUKA 4C2BA 3JQPA 5EJFA 2Q46A 2GJSA 3OLCX 5A9TA 1ONBA 1LSOA 1Y42X 2QD1A 4C5CA 4Q9NA 4ZV4A 1F06A 1U8FO 1E9AA 4XWGA 1TO1E 3GDOA 1KEVA 4TMVA 3REQB 4UU8A 3WKCA 5JCXA 3DE1X 1IBSA 1VYVA 2WWRA 5BUZA 4HAWA 3F6PA 2P9BA 4L76A 1K3FA 3H2BA 1SQ5A 1EBUA 2O3SA 3FN4A 4M0UA 1UDAA 3ZBQA 3CKKA 3DDZX 3M4XA 4JENA 4ZCIA 4C2UA 1JDPA 3OT1A 3WO1A 4R01A 3QMVA 2VK1A 1XZIA 1KETA 2XH8A 1JNXX 4UM8B 3OC0A 3FOFC 1RADA 2VZEA 3KTFA 3SICE 3MINA 1M7GA 4QJIA 3GPBA 5E7JA 1USGA 3I5AA 1H9BA 4KIWA 1QIEA 1YIDA 4Q9LA 4EVIA 3IP3A 2IBSA 4RHUA 3OMXA 1YK1A 1XDZA 1WZEA 5DNVA 5HHTA 1KI6A 1JE0A 4ITVA 2VNSA 4N49A 4OV6B 5IZCC 4C29A 1HPLA 1E1MA 2NADA 3A6DA 4H0NA 4CFYA 3DLBA 1P33A 1Z2NX 1SUFA 1XELA 5LMZA 2VNKA 1S9DA 3EF1A 2ZVJA 4KITB 1FF9A 3PSAA 3GJ7A 1VL5A 3OUZA 3QLTA 4YQEA 1G7RA 3FYTA 3KXIA 1EXMA 1P9RA 3SC4A 2YICA 2F3RA 4XSGA 3RSLA 3NFRA 5GOTA 1ICEA 2IHTA 4OIMA 5HF6A 4D9EA 1N5MA 4F72A 3VR6D 4F85A 3HP7A 1VI2A 1L5HB 3PR1A 4XQ0A 2QLMA 3MLEA 3VZCA 3TGPA 3PC8C 4UFOA 3T1VA 3NBQA 1ZVQA 3PWZA 3LY8A 5JLAA 2ZS9A 4Y2UA 4I4CA 1FRFS 1T9GR 1ZD3A 2DQZA 1IEVA 2X19A 3AU9A 4CKBB 1KVSA 2XMRA 2AV6A 3E4CA 3T5PA 4I4TA 2NMVA 4AYTA 1Y3FE 2VJDA 1JG2A 2JIDA 3GU3A 2LRHA 1PNVA 3NT2A 4BMYA 4MHTA 1T25A 2ZRIA 4LFBB 1E4VA 3OPVA 4DSTA 2O0MA 1U0HC 4MKIA 3DD1A 3MMXA 4TS9A 2YWFA 2C7GA 3FUVA 3NBYC 1QHNA 5TVKA 1QP8A 1LJUA 1DV2A 1OAOC 2C31A 1RLIA 3GJSA 5EXPA 3B36A 5T4HA 3FJYA 1VG0B 3ZV3A 1Z5VA 2HQBA 3CWZA 5K0CA 1HLGA 1VZ3A 1Q17A 1CB0A 1KL7A 2A9VA 4J1TC 4A8PA 3HDJA 4C0HA 4IDQA 3RHSA 2YVUA 3K9NA 3HXQA 2X1LA 5H3HA 4U7JA 1U5AA 1PBTA 3R7DA 5D2CA 3U13A 2V1XA 1SIBE 3U7QA 1Q6ZA 1SEVA 4DE5A 3IEKA 3NEJA 2BI4A 3ZS8A 4RKYA 4BRWA 1QGOA 2JD1A 2B82A 3T1YB 1OX5A 4Y2QA 2Z6UA 4N3CA 1BFKA 3SBDA 3HXMA 1SA0A 2C4KA 1H9AA 4HWTA 1GNRA 2ZVQX 3AXSA 4DSZA 4Z1MD 1LQTA 1TCBA 4C1NA 2WVAA 3ZD9A 4M53A 2NXWA 1XL0A 4N5LA 4ZJZA 5AP9A 3NG1A 1EDOA 5I3ZA 4LFCB 4TWBA 1WUKS 5KBYA 2ZBGA 4WXPA 1P6QA 4KN5A 1P6XA 5FFMA 1QFMA 1RPNA 3RVDA 2P9HA 1BXKA 4OJNA 2C1XA 1N3IA 1VXOA 3BQNB 3UV6A 4O0MA 4A0QA 1MA3A 5JQGB 1BNCA 1MH1A 3DONA 4RD4A 3T3HA 2PV0A 3TQRA 1XXHE 3DUFA 3W5IA 1XMXA 5FULA 4E12A 1HNZB 2DTEA 2ZWVA 1JHVA 3NIDB 3KDAA 3OP4A 2B36A 3QG1A 1RRVA 3ENNA 4CVNA 3THXA 2XEXA 1PNTA 5A62A 4BCDA 2PJDA 3W8FA 2P3OA 1E5LA 4ZEWA 2HNKA 3TEJA 1UP7A 1ZNWA 3K2IA 5I9TA 5I9SA 1KJJA 1CY4A 1T5LA 4Q82A 2P2SA 2CUNA 1ZR2A 1GQQA 4M9ZA 4ZD6A 5JQGF 2X86A 1FMJA 1NY5A 3L1IA 3ZWKA 4LJ9A 4RTPA 3ANYB 2J9XB 2PQ6A 4DJFC 4BGUA 3QEOA 3HWX1 1PGQA 4FJ2A 1UPFA 4HZUB 5I51A 4QTZA 1JLLB 2Z2XA 2KB0A 4Z8XA 5MN6A 1XN4A 3QNUA 1OIWA 4HMQA 1V1RB 1ZGZA 3H11B 4LXIA 1NVBA 5BXYA 4GBGA 5FPQA 1R9MA 1Z4MA 4OG2A 4ABTA 1QJ4A 2JLWA 3MINB 1NNEA 1D2EA 3F6SA 4LC9A 1PRYA 5AI8A 3LZDA 3X2FA 1GZ6A 3STXA 3UO8B 3WK6A 2R8BA 4YP1A 1F5NA 3IKLA 2A3RA 1XQXA 5CITA 4YY3B 4B9AA 2WIAA 3UH0A 2B3DA 2PYIA 1IHOA 4GX2A 4RFVA 1GAEO 2VUTA 5A5VA 4BY9E 3DEIA 4RE6A 4CF4A 3DE7X 3JQFA 3LO5A 4GMFA 5GY7A 1J7JA 1U11A 4CNQA 2H63A 5HPYB 1F8XA 2ZR9A 4UUAA 1OXMA 3BMQB 1LV7A 1Z0AA 1S2NA 1DOZA 1G8SA 5DM4A 2GX6A 1X70A 1E5DA 4B3RB 4Q9KA 1O0CA 1U2TA 3I9LA 1JBKA 2ZE5A 1B00A 2HM7A 2Q8NA 2QUKA 3ZDDA 3WMGA 3TZBA 1GSOA 5EJ9A 5EE3A 1S4QA 3TZHA 4C0LA 1LEHA 5IEJA 4IJKA 2BMDA 1B6GA 3FZGA 1W44A 2PSFA 4NYMQ 4OFZA 2VHJA 4YAEA 1D4AA 4DDUA 1GHTA 1XGKA 2QM8A 3GYGA 3QBDA 4ZMRA 4JQCA 3Q3HA 4ID9A 1TI7A 4X3PA 5EZYA 3ZZ1A 4JI1B 5IVHA 4FR2A 1H42A 1ZLYA 2A92A 3PKIA 2BPOA 1PSWA 2I0FA 2RGEA 3GEIA 3IVCA 3O3OB 3S8MA 2H59A 4XIJA 1U8XX 4XUEA 3SE7A 5A1TA 3EXFA 3ESBA 3G9QA 1ZXXA 3PFKA 5DIFA 1B6SA 4MQBA 3C6KA 4QDUA 5IULC 4V38A 3TZ6A 3BE6A 1YBHA 1ZU4A 3JWJA 3GA0A 3C1OA 3O4RA 5FPYA 2QSUA 3WGYA 3ERCA 1FJHA 3LK6A 3ZLVA 3MCUA 5LMUB 4Z7OB 2X6QA 2ATCA 3S40A 2YRXA 3B3FA 4XEHA 5IYZB 2HD4A 4EB6A 3ZHVA 4EABA 1SXJA 1RI2A 3UJ8A 5CLFA 2I62A 2JI8A 1H0SA 3TW6A 2QRHA 2P2DA 2ZGVA 3EIFA 1QAMA 1WDMA 1SXJD 1E2JA 1U02A 1VL6A 1KORA 2RHLA 4LV8B 4MR9B 4X7RA 2ECOA 1SUCA 4O5AA 2O1SA 4NBTA 3HJUA 3P2IA 1EE9A 4QPZA 1ODFA 4QDZA 4EECA 3KQLA 4FGSA 1R4MB 1X7ZA 5AJYA 2PH5A 5CA1A 4GOOD 3BGSA 1GRVA 1DO0A 1XMJA 2PKWA 3FUUA 3K1ZA 5KYWB 2DWOA 2WPDA 1K7XB 3JVEA 2GTHA 5EEGA 1I6LA 3F6YA 3K53A 4M0PA 5FUXA 2QTMA 1BVHA 4E07A 5FQOA 4ZYYA 4UCQA 2CKDA 3H5NA 2A30A 2C2WA 3IIIA 4R9UC 5BN3A 5HKAA 1AF7A 1ZGCA 3EGWA 4QG7A 4GZ3A 1PZXA 1M6YA 3UPDA 2I4LA 4ER7A 4TMYA 5JI3E 2WUWE 4HFJA 3EPKA 3L7IA 3HNPA 1QQ7A 4I4NA 1TIKA 3EXIA 3ZW8A 1C1HA 3VO8A 5BV8A 3KVRA 1MO4A 4KDEA 4XOIA 4XCVA 3R5JA 1IZYA 5ENVA 1RHKA 4MR7A 2EWWA 3MWDA 1QB7A 4GX0A 4RHFA 3C8ZA 1DXOA 1BVUA 3I1JA 5DP2A 4AP6A 5E1OA 1U3WA 4ATNA 1ZGHA 4MMYB 3N2NA 2ZXFA 4WBXC 4ZU6X 3RVJA 2R4UA 1WOYA 2CN1A 1SN7A 3D6AA 3C3KA 3ACBA 1WCXA 2FFRA 2HR1A 3PD7A 4QRIA 1KK2A 2GD6A 4ZDJA 1XK7A 1G66A 2WWFA 1IRXA 1T8YA 2H4ZA 4F3RA 3O8LA 1W75A 3FR8A 5D01A 1ZQ9A 2ID4A 4EVQA 4QARA 2GYVA 4QUJA 4G0MA 5I4BA 2QLFA 3ZZNA 2QLJA 3EQ7A 2MSKA 3X1KA 3CF2A 2GM5A 1EWYA 4IIGA 1XSEA 1PR6A 4TPKA 3AG6A 3H8SA 3JQ7A 5CGZA 3WGOA 4FNMA 1TM5E 1S2MA 2PGAA 3HWSA 3P20A 4MWSA 1X7YA 3RC8A 3OZRA 4WUTA 5BWBA 3F8WA 1EZ4A 2ZG6A 3MJCA 4F2HA 1BA2A 2PT5A 3T7DA 4FN4A 5IWCA 1FW6A 3OT1B 4NDZA 4LDRA 4DREA 1GL7A 1SVUA 2NLOA 2EJBA 2FYTA 3VVCA 3GD5A 3SZGA 1FYDA 1OLSB 4NU5A 4HYEA 2ZUFA 4RLHA 5FNVB 3WAGA 2FPPB 1KY4A 4KP7A 4EY8A 2JLVA 2PHZA 5DM2A 4BQPA 2F48A 4C04A 1BH6A 4MS3B 3WBFA 2TMDA 2G72A 1WMDA 3ODGA 3AR3A 2C59A 1JFSA 4QA9A 3UKDA 4OGWA 2VT3A 1LPNA 1OC4A 3D8BA 2DE0X 3BQMB 4KR0A 3M6FA 1I24A 1PUXA 1EM6A 2GBLA 2QQFA 2Z5GA 3SFZA 2C58A 2D2EA 2FUNB 2VOJA 1QMPA 2QX4A 2IH4A 3ISVA 1GG8A 5I7VA 1O0BA 4TV9A 4Z49A 4QUHA 3TR0A 2RGRA 4LRYA 1RE0A 4K9RA 3NGXA 3RC3A 1JQKA 4BFZA 1A88A 2XUOA 3OOWA 1GRNA 2O3UA 4XE5A 1PR9A 4S05A 1ND6A 1T0IA 3YASA 2Q3EA 2ZIWB 3GFPA 3IERA 2GESA 2W70A 2RHCA 1I6MA 4RQAA 1WVMA 2ADMA 4NS1A 4MJ7A 4S24A 3ZWPA 4C2AA 1EVJA 1NPYA 3A05A 4BX3A 5MDHA 5F3DA 3MWEA 2PNJA 5I9IA 4S1WA 3HQ4O 1UKVY 2ZDQA 4CM1A 1GTG1 4E2ZA 1JLKA 2YXEA 4N3AA 2EFJA 1Y6GA 2IYVA 3OIYA 5K4AA 3SIWA 2HMYB 1ETUA 1ZWKA 3DDOA 1YIAA 3DGEC 1KVTA 3K09C 1PO7A 3OPYI 1C7IA 2K4MA 1UZNA 3Q2OA 4R8SA 2ZUWA 3RRYA 2WWYA 2TRSB 1Y81A 2W93A 5IKMA 3GLFE 2YIMA 3VPXA 1DIBA 4N3NA 3PC8A 1ZESA 3T5MA 1E1QA 4WNAB 3TR6A 2IHJA 3AIKA 4KR3A 4X3CA 3ENZA 1G21E 3THWB 2H1FA 3REFA 3H5WA 1ZH0A 3N3AC 5HOEA 1L4YA 1NBHA 2EU8A 3RH0A 4B3DA 1K7YA 1LVGA 1PT9A 1Y5NA 3PJGA 3A6KA 5JD5A 1H5NA 3GJYA 4G0YA 5JJ5A 4YC7A 4PLVA 4JX8A 2V3VA 3DR5A 3ZVNA 2CMKA 3PDHA 1STOA 4NFLA 5FWAA 4AJOA 2ONYA 1PEAA 2DWQA 3O21A 1XE3A 2BV3A 3FTQA 3CNQS 1U1DA 4QBFA 4O02B 2X9VA 2R6AA 3FDFA 3JQBC 1XZ8A 5IK2D 1XCJA 3AR2A 4WCDA 4M6WA 1BCSB 4XX0A 3QUTA 5J58A 3AESB 3D31A 3MLAA 2IUYA 2JHAA 1AQNA 3HKCB 1FBTA 4JJAA 3OIUA 4P38A 5EXEA 5F51A 1WMFA 2Y1WA 2G9QA 2OTCA 5BR7A 3AF4A 4LMPA 4CPDA 2C97A 2SKCA 4ESOA 4MCIA 2BKEA 7MDHA 3PE6A 3UAYA 1R4AA 1AKMA 5CA0A 4ILEA 4RSGA 3H84A 3JATA 1NE2A 4FR0A 2ZYGA 1AMUA 2D6FA 2J3JA 4DCTA 5NULA 4Q7KA 3IDQA 3I28A 3QIVA 3LRXA 1MNQA 3FIUA 5HCIA 3B2NA 4AZWA 4LXGA 3QVOA 1AA6A 4UBOA 1U0JA 1I4DD 4N8SA 5CVVA 4MRPA 4BKUA 3HABA 3EDOA 1GA4A 3FYCA 3I6QA 2A0UA 4QT4A 2HYIC 1CQJB 1UXHA 1J5PA 2AKYA 1MV5A 1WCIA 5H4HA 2GEFA 3RTCA 3TG8A 4YBZA 3RTBA 5JPIA 4URFA 2HGSA 4EPRA 1F8GA 3KD3A 3EIXA 3LC0A 3BAFA 3SQLA 2IF2A 4XRGA 3AVQA 4LWPA 1J0XO 1Q95A 1DS6A 5E4YA 4HYQA 1KAQA 1YCGA 2WK1A 3E3NA 1QFXA 2D54A 1HMPA 2W37A 1U7WA 1FNNA 3Q12A 3C15C 3L4EA 2AOUA 2DBQA 3O5AA 5JSKA 4BNWA 4ZGBA 3CLSC 1X9GA 3CR3C 2IPOA 3N6XA 1E2LA 1YZQA 4JBYA 3C70A 4KFRA 1G2IA 4P54A 1KEKA 1HUQA 1BW9B 3R7WB 1BXGA 4JLKA 2H9AA 1NT4A 3MUNA 2NUTA 3RV3A 1ULUA 1GN8A 4UEKA 3WHLA 3DLPX 1E7MA 1U9YA 5GIPE 5JBQA 3I4CA 5DMXA 1AZLA 5EXSA 4O8ZA 1PR5A 2HSZA 1ZOPA 1M3SA 3WOVA 1E3JA 3LRTA 3WKBA 2CV0A 4AY3A 4YRFA 3N0XA 1AZSC 2Q5LA 2YYAA 2YN4A 4JL6A 8ABPA 3HU3A 1XA4A 3MHTA 2PSJA 3GMIA 4YCSA 3PNQA 2M1ZA 5BUQA 4YUWA 4YCDA 1J23A 1NE7A 2VDMB 3L7LA 2B6HA 4BNGA 1XX6A 1W5BA 1Z2CA 1CJKC 4YI5A 2XHZA 3E3AA 1VRCA 3KB6A 4QXOA 4NI5A 5EE5B 3I42A 4L5JA 3LW8A 3IP5A 3T7JA 5JDCA 1QFJA 3RVQA 5KWJA 1B0AA 4MKRA 1VPDA 3FSGA 4EI8A 3DAPA 5BSMA 4CL0A 2EG9A 4BNUA 3Q0IA 1V8BA 4A8HA 4A8JA 3N3BC 3GX1A 3KOYA 3OU2A 1YJ8A 1I6KA 4AJKA 1V8PA 5EQJB 4K6HA 2Q3CA 3MSXA 1EJ0A 1GL6A 1DEOA 2P9TA 1U3CA 4H7DA 4JKOA 2PVPA 4KSBA 1ZLXA 4IOJA 1NSYA 4Y6PA 3AVOA 2VDRB 4K9PA 3STTA 2EYQA 2RH4A 1XF9A 2ZAYA 1L5YA 4HDMA 1CDEA 1QE0A 1FFGA 1KQPA 2G77B 2PK3A 3CZ4A 3F9RA 4ZU3A 3WJ1A 1GPJA 2W2LD 3GMTA 3H5LA 5BP7A 2TS1A 2I54A 2Z9BA 1JFLA 3KJNA 5J63A 1H4SA 4U2BA 4G24A 2YHIA 3PG5A 2BUCA 4LI3X 5C8YA 3T7CA 3WO0A 4JQOA 1FFDA 5ALFA 4QU9A 1CW2B 4D9MA 4DRXB 5C7LO 4YCLA 3S27A 1GPNA 4QJ4A 3W8DA 5FAKA 4AQYB 2MU1A 3V42A 3CQ9A 1HZJA 1XR3A 4FCWA 3H8JA 4CKCB 1K88A 3IBYA 3H87A 3GLFA 2R6DA 3L7YA 2KX7A 4YJFA 3AVUA 1RQ7A 5IS2A 5P8WA 3HZRA 3PFNA 4CM7A 5HGXA 2FG6C 1PTJA 2XTJA 1JVNA 3SLGA 5I7WA 1HY3A 2YZGA 3PF9A 1O94C 1UF9A 2ZCVA 4Y6GB 5TGDA 3TZCA 4AG5A 5J2TB 2C1EA 2Z2IA 3CB2A 4FU0A 4Z4FA 1RQPA 2H2HA 4DDWA 1DRWA 1XJWA 1U90A 2C8KA 3DH0A 3RTGA 4BNMA 2ZWOA 2OSBA 3Q7TA 1SBQA 4AZTA 2W71A 3DAFA 4NZNA 3INRA 4ZMSA 1NN0A 2GN8A 2REXB 5EUMA 4DOMA 5KTMA 5I7EA 2CVOA 3Q6MA 5HF8A 5C8VA 3IIKA 4FS3A 3UGJA 3A6GA 2R7KA 1NG1A 3BIFA 2VDNB 1YONA 2FUEA 2LP4Y 2OFWA 1OLUA 1IONA 3SZUA 3T9FA 4DV5B 2XI4A 5TQ2B 4QASA 3D8RA 4NR0A 1GCUA 4O4IB 1R5OA 3DEJA 3FDIA 1SGWA 4OHPA 1ZAKA 3FHOA 4W5WA 4RVGA 3TMYA 4QNNA 1N2XA 4HSEA 5HDQA 4ENPA 4QWWA 4G9BA 5KVVA 1L0BA 4EG0A 1X1CA 4H59A 3VYSB 3W4IA 3B2EA 4F5YA 4F4UA 1Y48E 5CA0F 1AO0A 1PV4A 4FDMA 4KLNA 4ND8A 1QG6A 1YQUA 5B55A 2NVOA 2VF8A 4OJMX 3T54A 4BVKA 4ZAVA 1R0RE 2NVBA 3AX6A 4DZRA 1P7PA 1DCFA 1B0UA 4URWR 2JDID 4RELA 2I9KA 4XWTA 2XQGA 1JW9B 1TMGE 1ZA1A 4YIKA 2R8OA 3DZKA 2CDAA 4G97A 4JA2A 3P45A 4P5EA 3KIPA 4BNZA 1VBMA 5HE8A 1MIOA 3UW3A 4I8IA 1T5SA 3GLSA 2PS9A 4KO2S 4MRRA 2UVQA 4NSNA 4OP1A 5DNEA 3RDPA 3WWPA 1JJAA 4ZT4A 3VSCA 1OXBB 1OROA 3Q9SA 3C14C 4JI4B 1LCIA 2F9MA 3E2PA 4C03A 2CDNA 4RIHA 3CVYA 1OA0A 2D0OB 2D0IA 3O84A 4Y7CA 1DKPA 1G3MA 3WGIA 1L5LA 1JJ7A 2I2DA 2WHXA 3C5WP 3ROPA 3PYXA 4NEQA 1RAIA 4LTMA 2PUGA 2V9CA 2VZ8A 2R4QA 3EFOB 1TA9A 3IQFA 4JUAA 4KCGA 5BURA 5JVDA 2OV4A 3X3HA 2Q4TA 3JTEA 1EEHA 1N7IA 1F2UB 1NVVR 3CKYA 4YQFA 3CUSA 1M6VB 4R7GA 3KHUA 1ODIA 3RHZA 1YHNA 3LZCA 2D5AA 2R85A 1FFEA 2YTZA 3V1LA 3QU5A 5DX8A 5GOZA 1ADGA 1M2WA 1LKZA 2X1MA 4F46A 1K92A 2GCGA 3P4UA 4UVDA 4HVLA 2D2VA 3ZNQA 1JEEA 4U6SA 4BGDA 3TIIA 3K9QO 1E2FA 1SXPA 1VLZA 3EZLA 1IUPA 4KWCA 1TA0A 5DT9A 4GMHA 3HY4A 4Q5IA 4F56A 1H5QA 5E9AA 2ZPUA 3CTMA 2RAUA 1PHRA 1VBKA 3GB9A 4XPIA 4Q4LA 3ZYZA 4KLCA 2HJ9A 3O8OA 1XK6A 1QP0A 1WTAA 1ZOIA 5EMHA 4F4IA 2V5VA 3MTGA 1WL8A 3TAXA 2RGUA 3GNTA 1ULBA 2VDWB 2P9ZA 1P1CA 2DHCA 3KS9A 3NIFB 1Z12A 4Q1BA 1RBQA 1RIFA 2JAWA 2W83A 2J08A 2BF4A 1ACLA 2EW2A 1IPHA 1LDBA 2ZI4A 3QUCA 4QO8A 4IDHA 3RB8A 4E22A 2OSVA 2FK7A 3BMCA 2JZCA 3C39A 3MW8A 1L1FA 3T9CA 2EEPA 2OZLB 2VAWA 3UMJA 5DGTA 3IUEA 2YX1A 3BUSA 3NEAA 1I14A 4LSZA 2HWUA 5T4FA 5K3FB 3SYMA 2P1DA 1NULA 3LKVA 5DYTA 1UBFA 3DNMA 1Z5WA 3U0VA 3B3AA 1IHPA 3BD8A 3W9SA 4WFIA 3AB3A 2HPHA 4AECA 3ANSA 5IVPA 2XCOA 5I47A 3NWJA 4FN5A 4ZCTA 2UYGA 2AZXA 1LRKA 2B8EA 1NASA 3QW4B 3UTCA 1N1MA 2LUOA 3VZDA 4D6PA 2BR3A 1I3MA 2PJUA 4MI6A 4QDKA 3REGA 5JBIA 2J9YB 5ALXA 2DQYA 1HG1A 4MYCA 3L1UA 5GZ6A 3SOZA 3WZMA 2PWZA 1PFWA 1TYEB 3H65A 4TMKA 1OIVA 1YGYA 4TKVB 2XUHA 3DFUA 1XEAA 2I2WA 1G55A 1RHUA 2PWBA 4UVHA 5B36A 4KK3A 4NZZA 4BXOB 2EW1A 1DC4A 2IS4A 3N5KA 1A98A 2J1LA 4J6EA 1K8QA 5ADWA 2DR3A 4Q3CA 3AFHA 2B2NA 5AQ1A 2VNHA 1QX4A 3H42B 1EE1A 3KNZA 2DQKA 2YWBA 3EEBA 1KEPA 4Z9XA 3ZXYA 2FWNA 2JS7A 1YS7A 2OCGA 3DMYA 1SVKA 4W1SA 5IDYA 1TMKA 3MTDA 2ZU6A 4RD2A 4U1RA 5GP1A 2HV9A 1G8HA 2LKCA 3NNNA 5E2AA 2VOEA 5G0TA 4ASUD 4YGYA 2ZSUA 4JOBA 3UJPA 3KQUA 1ABEA 3T3OA 4ENTA 3MRVA 4BAZA 3GT7A 4U2FA 3C8DA 3F5MA 4CTNA 3U7RA 1OKKD 3DMHA 3A3YA 3UMRA 1D9ZA 3MTJA 3ZNOA 1PDOA 1JIVA 5IN5A 1UKAA 1WNFA 4W7IA 2AG1A 3GRPA 4MR8A 3R9KA 5AW7A 1P5RA 4RDHA 1WPXA 4Q1VA 1IG0A 2Q5JA 2Y1LA 5M3BA 3KR0A 3U17A 1EA7A 3RYIB 2D2FA 4URZR 2GJ8A 3SIPA 3TNYA 5ICEA 5LP6F 4RTKA 4HQ0A 1XN1A 2VHUA 4CGZA 1X86B 3CUUA 4FZRA 1WLYA 3BB3A 3UUGA 1NKTA 4Y6LA 1K8RA 3QWHA 1XDWA 5G40A 2QI9C 2VF4X 1TEZA 3PB3A 3WDLA 3ITKA 2BSAA 2X58A 1ZHFA 1SZCA 1CVIA 2H7CA 4K46A 1QC5A 1OD6A 1OE0A 4E4YA 1V1JA 5CK4A 3V97A 1UFVA 3E9NA 1NONA 5F2NA 4TRNA 3LX5A 5E8RA 2VSXA 2YYZA 5H82A 2RB4A 4U5XA 3RS2A 4S1VA 1TE2A 4HG2A 4GZ5A 2GLXA 4H7PA 4WVLA 1I51A 4FR5A 2CD9A 2QR3A 4UU7A 3W2FA 2UVDA 3R7FA 1KYWA 5BXQC 1J25A 3QLVC 4LVUA 5TC4A 4KO4S 1FYFA 5AKIA 2ZYDA 1N36B 4PNPA 1A77A 4L15A 5JT1A 4LNUA 3J81A 5KOJB 5E38A 1Z2EA 1RQ2A 3BRCA 2ZJFA 2PEZA 1MIOB 1Z73A 1WA5A 3DYIA 5EJ7A 4CMEC 2E5WA 2YHAA 1R5NA 3R20A 1WQ1R 2XWBF 4JEHA 4M2LA 3RBVA 2AN3A 3WA6A 1ZNQO 2NU6B 2ZIXB 3UHOA 2YXNA 5DBEX 1RYNA 2ZB4A 4UEOA 3R3UA 5J4YA 2FE4A 1ZRHA 3EZ2A 3OJEA 1T3SA 1EVQA 1SK8A 4NHOA 2BI8A 1UM9B 4MDHA 4JKYA 1FSSA 3UJAA 4EVRA 1CUAA 3NRBA 2DCUA 5B64A 1T5IA 5JVDB 2P41A 1AGXA 1QGUA 3GFRA 3IX7A 3E84A 3QVJA 4GPIB 5DSZA 5GJWC 3PQ4A 1PZMA 2HMUA 1REQB 4IIHA 1Q6YA 2C7BA 4HH1A 2NTYC 4Z1MA 1DUIA 4OQ4A 5CB8A 1NJGA 4ZT6A 4A16A 1RCTE 4L8LA 2BJWA 4FUTA 5MHTA 4G25A 4JJIA 5LNK1 3IXQA 4GSKA 1SBIA 2N46A 2DOKA 2A35A 4FMDB 2X6RA 3ROMA 4Z53A 5KQRA 3AJEA 4CMEA 3LUJA 4PHGA 5ARCA 4ROSA 3ISTA 3TAHA 1RBMA 2PD4A 2YFHA 1W52X 4D8WA 3HBFA 2E5FA 4KGXA 1TYDE 1O1YA 2HTEA 1QGYA 2K87A 1NQOA 1FLVA 4M1MA 2HWXA 4GMDA 4HB4A 4B3CA 3L07A 2LWIA 3D1JA 3JQGA 2JIMA 4FHZA 4IDOA 1SU7A 2H11A 2FMKA 4X6YA 1K9SA 5EYPB 1D2GA 2G80A 5E4TA 1K4KA 4NYIR 2BEWB 2CXUA 3CIFA 4YJHA 2A5LA 3QSYA 5CA0B 3SNKA 4E5KA 3BRWD 4UPDA 2JAQA 2VUUA 2J67A 1NKSA 2GTPA 3REQA 5LXTA 2R0QC 4UMDA 3E2IA 3INTA 1XKLA 3DE4X 3LLVA 1J09A 2WD9A 3N8KA 1WB5A 4YO7A 3RRMA 1HEIA 3AMVA 2BTQB 3PFHA 4H4DA 3R4VA 4ZV7A 5C3UA 3WL5A 1J2UA 4NJEA 1ISIA 2IHKA 5I9BA 4RJJA 3H4MA 2JEZA 3ADOA 4G36A 2O1EA 3R5KA 3U4DA 1E8DA 1GGVA 5DGCA 1FUKA 1O96B 4G81A 2DFTA 4ZJYA 1Y7PA 4RS4A 4L5BA 3QFSA 1WZ2A 1XCBA 1C7JA 4Q48A 4Y9RA 2VZLA 4CLRB 3ZDAA 2PMFA 3M83A 4XARA 3PXEA 3PD1A 4AX8A 3SQOA 4X41A 5CYFA 5JQGA 3DJFA 1P7WA 2ZVPX 3DTNA 4OBXA 2KJQA 3X1WA 2VCEA 4CM9A 4IGFA 4EGSA 5L95A 1O9HA 1TA4A 3O4FA 3Q0EA 3LCRA 4I3FA 1FTGA 5LB4A 4KZPA 3HB1A 3HYRA 1VDMA 3PPYA 1AIPA 2CXXA 5GPBA 1Q0UA 5ALDA 4LWZA 1PGNA 2FSUA 4IJ5A 5AICA 3WICA 1ECCA 1QTQA 3E8MA 1OU4A 4LZPA 4O6VA 5H68A 4EW1A 4XUCA 2IHYA 3B5IA 4X20B 5TQVA 2UZ0A 2G7MC 3JY6A 5EUBA 2YJTD 2HHCA 4CZ2A 4W5HA 1Q0TA 2N0SA 1SU4A 3BL8A 4RY0A 1ONPA 2E4YA 3TIGA 3ESCA 4PSDA 2XE6A 4X71A 1HTBA 3KWJA 2VHXA 4PZYA 4U3JA 2K5UA 1N5OX 3BB1A 1JV2B 3HKDA 1DBSA 1QZ3A 2B61A 2JCBA 4GPEA 2XB6A 1U7HA 3D0QA 2IP4A 1QYWA 1UJ6A 3BMQA 3LIIA 2PZJA 1QIMA 3OQIB 1SIWA 2GM3A 1JR4A 3M6LA 2JA1A 5KYNA 4J0DA 3M6UA 1FVHA 1KMQA 1L5FA 1Z4QA 1T4DA 4D92A 3N28A 1JHZA 1MGOA 1MDFA 2PSSA 3COPA 2PCLA 4G1MB 2OLJA 4GKAA 4KYUA 4OQLA 5AKZA 1NVTA 3V8BA 4AJLA 4ZPXA 4DKJA 4ESHA 1KXJA 4FYHA 1QE5A 2Q29A 4QWMA 3RFVA 2JJQA 3OICA 1TVKB 2HSWA 3TB6A 1K08A 4IMIB 1YRLA 2BFFA 4DPLA 2IC5A 4XFDA 4BGIA 4RTJA 4FX5A 1CR4A 2QLLA 3MD9A 2R7LA 3TOCA 3A06A 2JGIA 1U0RA 2A59A 4KAXA 3ZTYA 3OLZA 3Q88A 3KZ1E 4BTLA 3AONB 4NOKA 5KYXB 2Q1SA 3D4OA 1PWHA 3Q1LA 3L1HA 3RARA 1PF7E 1YMUA 2B4YA 2Z5FA 4RIFA 1C9YA 1QF7A 4EPTA 2EW8A 3KJEA 1G8JA 4EHIA 5JOQA 1VM6A 1KGDA 3INYA 4BO9A 3E18A 2A5YB 1HFJA 2PGXA 5CDGA 1PJZA 2KBFA 3DZBA 5TEVA 2KLHA 2YJ4A 2BOVA 4HX9A 2OCDA 3H5VA 4R2JA 3VPBA 1E2DA 1PWXA 3S29A 5JLJA 4OIFA 1TRKA 1WSBA 1H0HA 5DBHX 2QVCA 2PGJA 5C4IA 3NVKI 1ONSA 2PRJA 2WU8A 4DC0A 2Y4NA 5T4BA 2FOXA 3EZNA 4RK6A 4X62B 5KAPA 4QQKA 2AMJA 3GQBB 4AJ1A 3NKLA 4BKRA 1OUMA 4AZ0B 4O4LF 2AG5A 3HSSA 4X94A 3T95A 2IYNA 4AQ7A 4Z0NA 5HK9A 1QAOA 5DYIA 4F3YA 1W1IA 2ZLBA 3BD7A 4UFNA 1Q83A 3D0KA 2BHRA 4MQUA 4IIJA 1NW4A 3K9HA 4K9SA 3PENA 4KVAA 2N75A 4NL4H 3U3XA 4HWOA 5JAHA 3IAM1 3RIXA 3V2GA 4MULA 4PGAA 1F17A 5HFAA 4FTWA 4BS9A 3DO8A 5F7JA 3COSA 1E58A 4X7BA 1DIAA 2BFWA 4IDFA 4XB1A 1B8VA 3I32A 2RG7A 4FNAA 1M2VA 2JRCA 2VN8A 3G5AA 4D0NA 3NDRA 4FKBA 1KF0A 3AHIA 4I0WB 3DT6A 4MQLA 4PCAA 5AJUA 2WVGA 4F21A 4R6WA 1UC8A 2HQ1A 1J0BA 2J6CA 4EY6A 2BSQA 2GRAA 2KSQA 2FSGA 3M1LA 4PZLA 1I3KA 1W36B 1RZRD 3HL4A 3RC1A 3JD4A 3MWGA 4OREX 3AW8A 3LWZA 3VR4H 3T41A 2HMWA 3I0ZA 4HLDA 2F00A 3VTFA 2VXBA 1X77A 2QGNA 1VLMA 1C2YA 13PKA 1A4XA 2QKYA 4H77A 2C2KA 1T2CA 2FY8A 5DXAA 2JW5A 2B7LA 2X41A 3LV8A 3HWRA 5HIJA 3U3RA 9ABPA 5GIOE 2P0EA 5E9JA 4X1YA 1W2HA 4EPVA 4NULA 3AEUA 3FCAA 3RTEA 3RUHA 1WNTA 4PC6A 3PQDA 3MYYA 4QOIA 3SN6A 5B7GA 3SVLA 4K9LA 4RDCA 5EYPA 3WQRA 2FJ0A 2QMYA 2WUEA 4C14A 1DAIA 1GQOA 2WJ4A 3C7TA 3QPVA 3WIDA 1E9BA 2IFTA 1OBFO 1CRPA 3HB9A 5JXHA 1P2BA 3AM4A 3EIEA 3QE0A 3NETA 3LNCA 1N75A 1ZKMA 2HJHA 3OY2A 4OATA 3D3QA 1BEEA 3OEEA 4C4YA 1OH5A 3GVIA 3K4HA 4H31A 4I2VA 4K05A 4MV1A 5EZ5A 5CVTA 1HRDA 5IXJA 2CWWA 3H9BA 1ZCJA 2QTAA 1YQQA 3C3EA 3H5RA 4LXXA 3TQHA 2GZ3A 1AXRA 4Q9AA 4DLUA 2VR1A 2ZQYA 3EZYA 1EBFA 3DDUA 3R2JA 1MPTA 1VB3A 1JYFA 1TVMA 2VSYA 1LPOA 3PUYA 3E5NA 4MKHA 2RC6A 1PQUA 4LGMA 5REQA 1VKOA 2ZZNA 5AVVA 1N3YA 1QHYA 1CDDA 4RNCA 2AC7A 1SELA 2ZOSA 1U6JA 2YXLA 4OHOA 4RJIA 4RZSA 4TL6A 4BO3A 1CDOA 1SKBA 3OJWA 2RDMA 2VL7A 3V7FA 1KY2A 3LDAA 4HDSB 1PTJC 5ED0A 5E8JA 5L40A 2UYCA 3O82A 2AZTA 5HA5A 3A31A 1GT6A 3D59A 1KJ9A 1WHSB 2Z2YA 2PKEA 2CLIB 3PRYA 3MILA 4MUXA 5HP4A 3R6WA 3OBBA 5EINA 3KT8A 2ID9A 4HDAA 1ULTA 5G2OA 5HQTA 1M1YB 1JILA 4RD6A 4O2AA 1XWFA 5IWAB 3QQPA 1WDKA 3F74A 4M9QA 1SXJB 4DLSA 4MPJA 1T4GA 4M86A 5DCWA 1YFZA 2A58A 4IEIA 1ODCA 1J2TA 2R7MA 1EFUA 2IZ6A 4UHFA 3Q7PA 3RVOA 5FTLA 3A9TA 1HOTA 2FPXA 4ENUA 2FFAA 4ZHSA 3QX3A 5D6OA 2DJIA 2W6CX 2WJAA 3OE7A 1C1XB 4JI6B 4EHHA 4GG1A 2PX5A 3G2QA 5L7TA 3JAKB 3UIEA 3ZWWA 1JEAA 1GKIA 2BLNA 2EEZA 2PRKA 4XD7A 3WIVA 3UWDA 3OLQA 4D44A 3CVUA 1ZH6A 2HRDA 2TSYB 5CUQA 3DQPA 5IAJA 1OFIA 3H8VA 4XVCA 2EZ9A 2R97A 1B6RA 1OZGA 3BGOS 3KPUA 4NWIA 2GVNA 1L5OA 2A1TS 4MW1A 2F64A 4RKQA 4A0HA 3T1TA 5TMBA 3DOFA 3BIJA 1DEHA 3FPFA 2PQ0A 2ETVA 4FUQA 5KHAA 1RHRA 3HSYA 4MVYA 1Y3BE 3M0EA 1F1JA 4QUAA 3TJRA 3G7NA 1KYVA 2XBMA 1AK2A 1SQ6A 1DRKA 1KFBB 4J1QA 4DGSA 4E30A 1Z6AA 1X80A 1PU2A 2X2OA 4PX3A 2ORYA 2PYDA 4A2CA 1SOVA 4J7UA 1ZGJA 1Y9DA 3DKPA 1RLUA 3FCUB 4MI1A 2CLMB 4UUNA 3SEFA 5JXJA 2C7PA 3ABQB 4TTIA 2O8BB 4FHCA 4TM8A 1BOFA 4NJMA 2OBBA 4RACA 2JCVA 3IQWA 3UAOA 4FFBB 3ZUGA 2G9VA 4IHQA 3OQMA 5DTRA 4OAOA 3LX4A 4TKUA 1IHUA 5C2JB 4RL6A 2ZBFA 3B6JA 1DX6A 4UTPA 1GWNA 3E53A 1P60A 3QOXA 2OL4A 4RXMA 4BWVA 1I1OA 3K92A 4EHFA 4HD8A 4BE4A 1MO2A 1EEXB 4WV3A 1YZFA 1ZH8A 4HKTA 4IDEA 2P2LA 4KBYA 3M89A 1WF6A 4U39A 4INPA 5KU7A 1MAAA 2L18A 1EUCA 3OZUA 4QDOA 1UOQA 1T4CB 2B98A 3QTBA 1OX6A 4L74A 4YMSA 1I1QB 3WWYA 4AZ0A 2BGTA 4NE9A 1XP8A 4L08A 4O4IF 5K3BA 4K6KA 2DBVO 1TIPA 1QR2A 3QX7A 4KU4A 1FFHA 4MYHA 4BL5A 3VPAA 3ZWNA 4LMRA 4PLGA 1QIIA 2B4QA 4ALNA 2G4VA 5ALVA 3HDHA 4QUIA 3ACDA 3BH6A 4CCSA 4NBLA 3A0UA 4PVCA 1EE2A 1ZIXA 3ICVA 3EBOA 1NV9A 5GONB 4ZICA 1Q2UA 3QYJA 3VH1A 2QTTA 4Q18A 1HTTA 2I22A 3E82A 2R9VA 3GN1A 2R6R1 1E99A 4P8RA 4RZQA 3UFBA 3D1LA 4EHAA 1WPRA 2IZOA 3DGFC 4Q93A 1AKRA 1EUZA 2PX0A 1SNYA 2WOOA 1JHAA 2P5TB 1NBME 4RZIA 1WM1A 1IQRA 2GBCA 4QD3A 1WBJB 4QE3A 1L5NA 1Y7LA 1PG2A 4C30A 1VE3A 3AJDA 1JG6A 2QROA 4KNWA 2HSJA 5DVZA 1JSZA 4OQQA 1E2IA 2YHBA 3OFND 1EGVB 1CWUA 2QTCA 4LAFA 8ATCA 4K2AA 2HFJA 4L4YA 1SXQA 4UUBA 4XM2A 2RGYA 1HWYA 3TRHA 1JDUA 3VR5D 1FSFA 1JYSA 4YXWD 2QSJA 4CXMA 1H65A 1DAOA 1CQPA 1V9SA 2EV9A 1H1DA 1GZ5A 1OFGA 3AKEA 3FKSD 3FMOB 3O8QB 3SS7X 3EJ6A 3VC2A 5FR2A 1ZMXA 2G8LA 3WK7A 1GPBA 1KJIA 3VAZA 4L9SA 3PGLA 4YAUA 1NXOA 1K4YA 4OBEA 2OCLA 2JDIA 2R8ZA 1G1AA 2CBZA 1JHOA 2DAPA 4DM7A 4UCFA 3H2IA 3CF4G 2PL9A 4KJZA 3OECA 4KKXB 4ZO4A 5KDDA 2JLBA 3DBHB 5LCXA 4A4DA 1XZFA 1JH9A 1CFZA 3BICA 2FZVA 1FYXA 3I1YA 5KYUA 3HA2A 3VJLA 1QIKA 1RP7A 3HDGA 4M8NE 3GLIE 1BEUB 2JGJA 3GUVA 4P4GA 4RFLA 4JS0A 3E05A 3JZAA 3TQOA 2IHUA 3UWOA 2QVZX 3UK2A 2XX3A 5A4JA 1ESMA 4NAVA 3TRIA 3NHRA 4DLWA 4OMUA 3NTOA 1XRRA 3SHWA 2BP7A 2QQ0A 2OBNA 2GO1A 1HL7A 2KQUA 5E6RB 4B4WA 5JXWA 1Z6XA 1RRCA 1T9ZA 1TO2E 3MBIA 3TB4A 2Y1OA 1PX2A 1Z06A 1H8ED 3A27A 1PV2A 2RBEA 4P7FA 3V32A 2YINC 3JQQA 1J70A 3EMVA 1E4OA 1FY2A 3LXXA 3UCEA 3JQ8B 3CUKA 4YCJA 5KHLB 4D26A 4RENA 5EMNA 1MAUA 3CEMA 1MAVA 2VDQB 3GRAA 3TOXA 2V7UA 5EG5A 4ES6A 3VKUA 4AL4A 4P2GA 5IEBA 3EGCA 3GLHA 1M6WA 2CUZA 2HU2A 4C4SA 2FEMA 2XV1A 3JVDA 1FFYA 3P2EA 2PWPA 1ML3A 2IZ1A 1VG8A 4OBBA 3FLEA 4ERXA 4IVRA 4XLLA 3OI7A 2EQAA 3CUVA 1S0UA 2Q3FA 1II9A 2I80A 2OHFA 2DWUA 1D2AA 4F84A 1KS2A 5BQ5A 4JT2A 4L57A 1NLFA 3K20A 3LLMA 5HKKA 2WDZA 1KQGA 1CX9B 1B73A 3LKZA 3FH0A 3K71B 4DV4B 1KFCB 1B74A 3GGPA 1R0CA 1R5JA 3PIIA 1Y1QA 1FTWA 4L1KA 3M6AA 3V3KA 1KRHA 4TRJA 2SCUB 5LXTB 2GBLC 1ULHA 3U4AA 3Q7SA 2DPYA 3SD7A 1PBNA 3LXRA 3NALA 5KUTA 1UDWA 2O1XA 1WULS 4GXTA 3TW8B 1NMXA 3EWNA 3TLMA 5ICMA 2RJNA 4GOXA 4J2TA 4YMGA 1Y3AA 5BMVB 2N42A 1MA0A 3V33A 2AI3A 2H29A 2PN1A 4O08A 3WGGA 4I1PA 3AF1A 3EVCA 4EMUA 1PJ4A 3RSSA 3UHFA 2JA2A 3HCDA 4MO2A 3S0JA 3W9YA 1F2VA 1CDZA 1L7PA 1O03A 2DHDA 1LK7A 2GK3A 2RHDA 3BCRA 4QYSA 4HDKA 3BAZA 4PQYA 4CN8A 5KDOA 2FQ1A 1SR8A 1D03A 3DE5X 2YY5A 3FDZB 2WMDA 3EXG2 3WKDA 1JLMA 2AQIA 3QPBA 4FSXA 3WJ7A 4EFLA 3DUWA 1OYVA 4N4AA 3OLWA 1Q7CA 3WGVA 2YOFA 1RQRA 3DSRA 2DFLA 2ODPA 3EN0A 3H2YA 3LP6A 2E55A 3PHIA 3VBEA 1C2TA 4QT0A 3VR3A 3EHDA 2YZ7A 1MRZA 3UMMA 3P9NA 2DP4E 5ERXA 2IDMA 2W6MA 3F67A 2R3SA 4NZPA 5HKOA 4JFAA 4HN2A 4KYTA 1BCSA 1F3OA 3DHVA 2I1LA 1DG1G 1FFXA 1S7GA 2QTLA 5LQDA 1XDBA 3IGFA 3L8MA 1AKUA 1MUUA 3WIEA 4F12A 3LXMA 1U0FA 3VSBA 2V7TA 1XXHB 3OETA 3RYHA 4WKCA 2YHUA 2IT1A 3ABRB 2P67A 3TM4A 3ELDA 5JBNA 4DR4B 4GUDA 2QZ4A 2JFFA 4E3ZA 4LY3A 4BNVA 1JQDA 2RAVA 3HACA 2FMUA 4ZEXA 4PU0A 5KVQA 1FLDA 1IXYA 5JZBA 4RV5A 1N5RA 1NBMA 3T35A 4YJGB 1WKCA 4V0RA 2AR0A 1PEKE 4P84A 3EARA 4N5IX 2Q6LA 5EHZA 4HDQB 5EP1A 4DSOA 1E5TA 2IDJA 3G88A 2YDXA 3QQ5A 4G8DA 2JVKA 2H92A 4GYJA 2CJFA 3ML1A 3T5CA 3FGNA 5CFMA 5LKRA 3R9XB 1N9GA 2IX3A 5E3IA 3DMFA 5D84A 3AF2A 3JQAA 1ZJWA 1YU6A 2VZ0A 3KOWA 4KQXA 1TK2A 4Q24A 4CV1A 4N54A 3EEIA 1T1IA 4G0PA 4PYIA 4JA0A 3EGIA 1UQTA 2FEKA 2JFXA 1USWA 1GPMA 5K0JA 1IZ0A 3DL7A 5I5GA 4E4TA 1TAUA 2X5NA 3TUIC 1YH3A 5CH8A 1XEWY 2P11A 1E94E 2OXCA 2XUFA 3NYWA 4YK7A 5FT9A 2AQ8A 3G2MA 3D3EA 3DYVA 3ND6A 5F3RA 3R3ZA 4FGJA 4MI9A 4ONEA 4CKZA 4A2QA 3OG9A 1WDWB 5JAUA 1M2OB 3TLYA 5JMWA 3KOZA 4LKOA 4ENWA 3HCPA 2XRMA 2FEAA 1KYTA 3ICPA 3KKZA 1DBIA 3L8DA 3F9CA 4HVTA 4MVJA 2YRWA 3WL8A 4Y1RA 4W4TA 5C31A 4U7DA 2C98A 1Z34A 1FP6A 5K6AA 3W78A 3GJ0A 2Z98A 3MXTA 3SCZA 3GLIA 1ZRMA 1X1DA 3RC9A 1XTPA 2X9QA 4I55B 1WB9A 1ETHA 1UMBB 3ANMA 4V1CB 4MRNA 1NJ1A 5FYDA 2QP9X 1NBAA 1UQUA 2XOEA 2JKYA 5JSQA 3HB5X 2DPMA 3JD2A 2NU7A 2QZSA 4JLPA 4NBWA 1XHLA 4J1SA 4HDOB 3C4VA 4PTYA 4YJFB 5ES3A 3NVMB 4QGSA 3H5TA 1UQRA 4JB2A 1FA9A 2FH5B 3U80A 1B41A 5DPMA 4M0MA 4P86A 5DN6A 2ZJ3A 3EZ6A 3HB7A 2BP7B 5SZJA 3WLOA 1OLXB 3N8NA 3R8CA 1A9XB 3KUUA 1LSJA 3U81A 4KMOA 5E0KB 5JYBA 2QAGA 2HW8A 1WW8A 2X6TA 2GETA 2OHVA 4M0EA 3GG9A 5BYJA 4AY5A 4GO1A 1M1NA 1AQ6A 1L8OA 4FNOA 3ABZA 4G23A 3BERA 3IPXA 3DZDA 4E15A 3OQ1A 1BU8A 1KMNA 4E3WA 4ISCA 1HDGO 2WWWA 2P1ZA 1CU1A 2W43A 5INTA 3VYWA 3DO6A 4FFNA 1YL6A 4DNQA 4DV6B 1PWEA 4KKVA 8GPBA 2YJ6A 3GA5A 4OHZA 1OIXA 4GWLA 4DMMA 3QW2A 2IGTA 2B30A 3CV3A 2B4RO 3L1VA 3E9QA 3C6YA 4NH4A 1RYHA 5BV7A 1HQCA 1MJNA 1P3Y1 3C48A 2EFEB 4B35A 5E9QA 1O77A 2FZWA 1E1RD 1AKNA 1T9GS 5J1TB 3EPLA 4ZJPA 2DR2A 2P9GA 1DINA 4UHCA 3FKJA 2BMJA 1K7FB 2FN4A 4M38A 1C29B 3F7OA 4FVTA 5HDBB 1VYHA 4PSUA 1L4NA 4TTPA 2O8DB 3IR7A 3IEVA 1Q3TA 1E1YA 1QH8A 4YP5A 3HU5A 3A36A 4GDMA 1VLVA 2X22A 3QU4A 4BLSA 3RUAA 4F6CA 1K7EB 3PC4A 5A04A 4WNYA 3WSTA 3HUTA 2XTZA 3QU7A 3H1EA 3ZKWB 2Q21A 1OR8A 3H9GA 1EFRA 4QELA 3WAJA 4YWHA 4RXUA 3PXXA 4CEIB 3TR5A 1DJQA 4A15A 5FUMA 1H6CA 2GXAA 4K1LA 1KEEA 2BJHA 2RIRA 3U2QA 4WEQA 1RXCA 2FRDA 5HZKA 5IUJC 1NUUA 2PH7A 1P2DA 4RPGA 1X42A 3WL6A 1TF2A 4DTIA 1EX9A 4Q7JB 1PLKA 5B58T 1KMMA 2VWPA 3TQFA 4OSEA 3HUFA 1I3NA 2ODWA 4J7XA 1NBOA 3K32A 3SDBA 1C7QA 2Z1NA 1XL1A 4FW9A 4B2PA 2GHTA 4X6XA 1MFPA 1VGRA 4DR3B 5HUHA 4QYIA 4WKBA 2QTBA 1GKLA 1SCIA 1UJ5A 3O26A 1N9ZA 2CNKA 2E85A 2QYOA 4W5RA 1QC5B 4A82A 1F6WA 2FEPA 3F4KA 3QYAA 5CFQA 1W0CA 1JKXA 4EI2A 1EK5A 2RGDA 1S8AA 2VRWA 1ECFA 4LNAA 2Q0XA 3ZW9A 5A4AA 3BZBA 2H1CA 2NO4A 2E1PA 1YB4A 1ENZA 1ESEA 3W8EA 2XKKA 2GPTA 3ZHYA 3TF5A 2G5TA 1ARZA 2ZJ4A 3UMGA 2G71A 4DA6A 5GTDA 5DNUA 3K0AB 1P31A 5JU6A 1Y4ZA 2F1OA 2HXYA 3QA9A 2HGZA 3G0IA 5FLXA 2ZYVX 2YZNA 3DZGA 5FOWA 1KS9A 2H31A 4CIDA 2FPGA 3A3OA 4HEA6 4Q66C 1SM4A 3WB1A 5ALIA 5F9FA 1W5FA 1N33B 2Q5OA 1LPBB 2WTAA 5BSRA 4RF4A 1WBDA 1U6IA 1ESNA 3H9JA 3JWEA 1JTVA 1HYHA 1CLEA 2B69A 2HRCA 5SY4A 4TWRA 5JH7F 1FB5A 2IKSA 5FWYA 4NBRA 1RWNA 4KV9A 5ARDA 2AR7A 3N86A 4FFRA 4YYZA 4IDCA 2Y3IA 2AUTA 1EFVA 2QENA 4N5HX 4WK2B 3T3GA 1L4GA 3HH8A 4NMWA 1JZSA 4FCVA 1TTTA 1UBGA 2OCIA 3H9CA 1EXWA 3ILYA 5KYVA 2IPXA 5AI4A 1QYIA 1FPMA 4UQOA 4Y2JA 5FOXA 2K7FA 2VXYA 3FNEA 4TN1A 2OD7A 1QKKA 4UEJA 3W8RA 4BATA 1REQA 2CK3D 3O4IA 1MRSA 2JKVA 5A0TA 2VJMA 1U2EA 3WDMA 4BNDA 4F9TA 4V0KA 3TLGA 4BNXA 5JD3A 1M2OA 2JZNA 4H7JA 5ILOA 1CT9A 1MKYA 3BXXA 3L0DA 4NCIA 2VP5A 1IOVA 3OY7A 5BN5A 4II7A 3UMYA 4HQLA 1CNEA 1QV9A 2B6NA 1LLCA 2I1QA 3AUAA 4XYGA 3KB1A 5EZYB 3NW9A 4S04A 4ARIA 1JIQA 3LY7A 2DF8A 2A94A 2FG5A 3MUOA 4I36A 2RK6A 5ERGB 5K3SA 4XDHA 1MW9X 1CV2A 2B8WA 4KV7A 3HG7A 5ABPA 4OM7A 4QM7A 3CM0A 4C2TA 4FM9A 3PUKA 2VDKB 3B85A 4RYDA 3FE2A 3QWIA 2O4UX 1GQFA 1KEUA 2G0AA 3EXIB 3F5DA 1YQWA 2REQB 3ELUA 4L7VA 2DFPA 5D1NA 2R96A 4HAUA 1DZIA 1PN3A 3AR4A 4I3HA 1CQXA 2Z6VA 3KSMA 5I7OA 1IN5A 2VBIA 2Y0CA 2WWIA 4JJFA 5ALKA 1OWLA 5AXCA 3SJZA 4BO5A 3V4OA 2AHOA 2I4NA 1MO5A 1X8XA 4IGKA 5LQNA 1V4NA 3G7UA 4UAUA 3B1XA 2EG5A 1AUOA 3ZDZB 4GM4A 1EBBA 2XUZA 2R48A 3E4DA 1PJAA 4GOMD 1Q0QA 2XNDA 2X0RA 5KI6A 4JT4A 1BS9A 1Z2PX 3QUQA 2BKVA 4G85A 5K01A 1IIBA 2FK8A 2FJPA 2AYZA 3B1KA 3I9V1 3K9CA 3PQ8A 5LR6A 3G6KA 4Y1EA 3FGPA 5ALOA 1JFRA 4OHRA 2K6GA 2OO7A 4RVOA 3AVWA 1P44A 2LW7A 4NQZA 2D00A 4G63A 3X1ZA 3OPQA 4L73A 3IVGA 4CM9D 4AIIA 1B8NA 3UF0A 1QK3A 2R00A 2WYIA 3M4YA 3HUUA 4FJ0A 3QXCA 1AXGA 2AC2A 2J41A 2I6UA 3F47A 3I1IA 3L79A 4K9MA 4MV8A 4RK1A 4X44A 3S28A 5LD2B 4RA9B 2FCRA 1TZMA 4IH1A 1O6ZA 2M6LA 2VH5R 1F20A 3TW0A 1W2GA 1USKA 3B2QA 1P4AA 3L6DA 4KQCA 3BTUA 1I9GA 4CV0A 1DWUA 4RGVA 1KKLA 1ECLA 1KAEA 2GSDA 3DAOA 3E70C 1H1LB 2AX4A 2BM8A 3LCUA 1C4WA 3OMLA 4LF5B 2O54A 3NM4A 4H0CA 1UINA 2F59A 2IYYA 3PFGA 2AN4A 3ONWA 3HLTA 4H08A 5AIAA 5TMEA 4V39A 3VMMA 3NXKA 3WFIA 2WAAA 3EXEA 3RYIA 3K1YA 5AW9A 2X77A 2P2ZA 2NVUA 3UM9A 2IPAB 1C3LA 4P9NA 4XWOA 2QOEA 4WUVA 1E1DA 3CZRA 1JBQA 1B1CA 4G67A 4M1EA 1B43A 1VCNA 1P0IA 2BBSA 4EHKA 2XZOA 1L8AA 4JP3A 1O6CA 3E2MA 3TSYA 3TNDA 3IO5A 3QZUA 2PRSA 2GXQA 1K8YB 2WF7A 2MIIA 4WT7A 5FADA 1JAZA 4P58A 2GZRA 2XITA 2X40A 2W2PA 3W5HA 3CF0A 2A14A 2V7QD 4YAJA 3C5VA 3NKVA 2CFSA 4MA5A 3T0FA 5BN3B 3GPIA 1IY9A 4RMIA 1TJNA 3DWIA 3K15A 4X85A 5FUVA 4EA9A 3Q8LA 3I5MA 2I7CA 1RWOA 2YY7A 4L72A 2Y77A 2DERA 4PQRA 2OEPA 3HYLA 4MIEA 1AXEA 2QYTA 3OPYB 4QATA 3B5EA 2O48X 5ECGC 5EJ4A 3OZDA 2FP4A 3PEUA 4PFKA 3MWJA 2HJSA 2R2GA 5H0IA 2BM0A 4JGIA 1C9KA 1V47A 2EDAA 2NZYA 2QMQA 1N5DA 2XKAA 2Z58A 4MXDA 5DZSA 4PN3A 4A3SA 2FEWB 1RQNA 3VJKA 2Y0PA 3DAHA 2VYVA 4YV1A 3O47A 4WN3A 2H06A 3DVQX 4J90A 4JP5A 1PUJA 1SIUA 1V3TA 2UYQA 4WXRA 5E1MA 5FPPA 1W5TA 5IUKC 3TOVA 3WGLA 1KJZA 4E5PA 5IT9A 1PT6A 3GK3A 1CNMA 4MITA 1SUPA 1ZMTA 2JIBA 1EUDA 4MV5A 2FW6A 4J75A 2QSYA 1B8PA 5CT6A 1GCAA 3G0DA 3SNHA 5JSZA 5ECYA 2Q4DA 3PWTA 4F11A 3Q5DA 3Q7RA 2XWJI 3P2YA 3UZUA 5C8XA 4F92B 3MAJA