5HJ5A

Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
266
structure length
266
Chain Sequence
MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAADHPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIMILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucosamine-6-phosphate deaminase
publication title Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from Vibrio cholerae with BETA-D-GLUCOSE-6-PHOSPHATE and FRUCTOSE -6-PHOSPHATE
rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
total genus 103
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hj5A00
1DEAA 1FSFA 4R7TA 4L51A 1UJ6A 3HHEA 1HOTA 1CD5A 1HORA 4L5JA 1KS2A 4L4ZA 1LK7A 3E7FA 1FQOA 3U7JA 3UW1A 1FS6A 3EFBA 1PBTA 1VL1A 5HJ5A 4TM7A 2RI0A 1NE7A 3E15A 3CSSA 3BXHA 4L5IA 4X84A 3TX2A 4OQQA 4IO1A 2R5FA 4TM8A 1XTZA 3ICOA 1FRZA 1FS5A 2GNPA 3KWMA 2WU1A 3EB9A 3ENWA 2O0MA 3KV1A 4NMLA 3LWDA 3IXQA 3NWPA 2F8MA 1M0SA 2OKGA 2BKXA 2RI1A 3BXEA 1LK5A 1Y89A 4OQPA 1O8BA 3L7OA 4GMKA 3ENQA 3LHIA 4R9NA 1JT9A 1LKZA 2W48A 3BXFA 3BXGA 2J0EA 4GO1A 1UJ4A 3HN6A 4L50A 3OC6A 2BKVA 4M8LA 4L4YA 3CH7A 3ENVA 3NZEA 1UJ5A
chains in the Genus database with same CATH superfamily
2QTNA 2VT3A 3GDGA 4KN8A 2B36A 2PRIA 3QEMB 4ONEA 2GRJA 2EBHX 5IAJA 2J9YB 1A7JA 1KI6A 2PFSA 1EBFA 5TR9A 1MH1A 1WDLA 4MA5A 1Z4JA 2ZT8A 3L93A 4PGGA 1ZLXA 1LS1A 5KVSA 5DBGA 3EZLA 3EODA 3NXKA 4RJKA 4DG8A 3IAM1 4C30A 1WZEA 5CVTA 4MQBA 4L15A 3HDTA 5ALXA 5AM2A 2P2GA 1Q7RA 3URMA 1LA2A 2CK3D 1BMQA 1AK9A 1DRJA 2VTVA 4IDQA 1LBIA 2ZRIA 3UIEA 4P7KA 4Q7JB 4RK7A 4REQB 5TB5A 1KAHA 4EWLA 4HRVA 2DBZA 4HZIA 3FMVA 1JZTA 1A2KC 3LDGA 4AB1A 1P0CA 4RZXA 1GD1O 2BT4A 3AJAA 3IKJA 4M54A 5EXXA 4C05A 2VTBB 3AF5A 3KPJA 5AKLA 3BG5A 4RENA 3VPSA 4C0QC 1SCBA 3K1ZA 3RSSA 3ZJ5A 2EKQA 4B75A 1PP4A 5EXDA 4FK8A 1UBKS 4R69A 1JI0A 4OHCA 1Z82A 5FOQA 3W5DA 3PC6A 1ZNXA 3VUEA 4D9IA 1J1UA 4PZEA 2DBVO 1XLVA 2EARA 5EESA 3CZRA 5JUWA 1X9HA 3WAGA 4FIDA 3IELA 4JQZA 1K0FA 2ZOSA 3K31A 4EB6B 5TX7A 3O8CA 1C3JA 3BBPA 5JSFA 2W2PA 1E3LA 4I1IA 5BOSB 1K5DA 2HXSA 4KR6A 1NASA 3GT4A 3GFFA 3U26A 3WMGA 5AVRA 2R84A 5KHOC 2QTAA 4WASA 1MZPA 5TNXA 1KSHA 3HB7A 1C0EA 4DR1B 2IPLA 1CWUA 4JYBA 1JNYA 3H0CA 3BMNB 2A9QA 3SC4A 1AS0A 3ILYA 1DHTA 4MKIA 5A3JA 2PZGA 3GGSA 5JY6A 2WOJA 1KC1A 5HRUA 4BLVA 1UFQA 2AG5A 4RC9A 1P9NA 4DQXA 3NWPA 4IKEA 1OXUA 5IAAA 4BV2A 1AV6A 1DC6A 3CWZA 3N2LA 2XMSA 2BZSA 1K7FB 5JLAA 2HK7A 4OMFG 1EG2A 3IVGA 5EP1A 4KQKA 4UQLA 2X7JA 1NF9A 1E1MA 2Q9BA 3BVPA 1NG1A 3L18A 3QOXA 1OASA 3CR3C 4H1VA 3VJLA 2GVDC 4BX3A 4FEAA 2G67A 3MJHA 1V5GA 4W8HA 2XF2A 2LKCA 1RW4A 2UUPA 1U6JA 2LXNA 2YJ4A 3I2FA 3NBXX 3DCNA 1YTLA 1NXSA 1L3IA 3EGVA 4NXMB 3VU3A 2I3GA 4PX2A 4UUBA 4PZDA 3UUGA 3CYFA 1WVIA 3CCBA 4DG5A 5KQGA 4QQFA 4JQCA 5DYTA 1CNEA 3PENA 4UPEA 1N36B 1GGKA 3OZEA 4EA9A 2GPYA 2GESA 3U3KA 3MS4A 5IDQA 3QU2A 2QX9A 4MVJD 4O4HB 4ZCIA 4WH0A 3QMVA 1QZUA 4TQUS 3PB3A 3T0GA 1E79A 5HGXA 2FEKA 3GNQA 1UK9A 1W85B 1A9OA 1SIOA 2NZJA 3IVXA 3K0FB 1KO4A 3L8HA 3OTQA 3QSGA 4UVHA 5BV2P 1IATA 2PO7A 3G0DA 4QFBA 1TDJA 1RPJA 2GPWA 2PXAA 1DHRA 2R1TA 3IBYA 4ZQHA 5EWJA 5J3JA 1PFUA 1TCBA 5BOVA 1EESA 1UDBA 3OMLA 1CFJA 3C4JA 4AM8A 1R4NB 2QJWA 5C8XA 1JSLA 2W90A 3OFVA 2H2IA 4L9SA 3NATA 5JS1A 2WU0A 1AD2A 4O4LF 3R3WA 2IELA 1DU4A 2C59A 3DSRA 2JDIA 2IQ5A 1LCIA 1Z0UA 3IP7A 4MGYR 4Q47A 4Q6BA 2D1YA 3WA7A 1IL0A 1P7CA 1B8PA 4E2ZA 4Y67A 1P31A 2V6GA 2DULA 2VLIA 4UBJA 3UMJA 1BHJA 4ECAA 5CAEA 1UMCB 4RH3A 1J5PA 2BWJA 4ZRDA 3SLKA 1SRRA 3TQQA 2HHLA 2XB9A 3QUBA 3ZHSA 3W34A 1M1NB 2NV6A 4DM3A 3E4DA 4ZVUA 4XA8A 4QJ5A 5D51S 5IYZF 5K0NA 4CCYB 2EKDA 4FD2A 5C8VA 3U60B 4JJ7A 5DGTA 3EWIA 5J1TB 4PVCA 4G3XA 1ECJA 1VFPA 1GPJA 4RK5A 3BCRA 5JS7A 3KT3A 4YI3A 5IVDA 4EG7A 3LOUA 1T6NA 3DYIA 4X24A 3IJ5A 4YFVA 4KODA 1KDVA 4KWTA 1ISRA 4OHKA 4QYSA 4JKIA 1U5BA 2G77B 4LXXA 5DIZA 3WJ1A 3RYCB 3JQGB 1HY3A 1QPGA 1XCPA 2GDJA 3FTEA 4C87A 3EYWA 2FFJA 2PS9A 1B6SA 1M6VB 2JI8A 3HKEA 1ZK2A 1GLGA 1CUJA 3RFXA 1FFXA 1C9YA 2XMQA 2E37A 3AF3A 3ESDA 1HRKA 3IR7A 1DRUA 4JN6B 4PZZA 1CZOA 5DEOA 4YRGA 1ODJA 1TA9A 1UOOA 3HMQA 1JG4A 3VOTA 3T9CA 1TQ6A 3ZZTA 1VDMA 3QW2A 2R1UA 2BC9A 1VJ0A 4LKOA 2WWGA 4WUVA 3RFUA 1CULC 3GVHA 3TX6A 3R09A 5K0GA 1JDUA 1V7QA 4Z7NB 3EAQA 2QT1A 2V8BA 3OAAA 4XVHA 3HA5A 4J0EA 4O0MA 4HWKA 5C1IA 4FYYA 4HAWA 4Q3DA 2DPXA 1N6NA 4W6ZA 1HNWB 4GKJB 2NP7A 2Q4OA 4BMPB 4ALJA 5F35A 5I45A 1JAXA 5L4SA 5TV2A 1D1PA 3WDMA 4E1AA 1RZRA 4W63A 5F1YA 4D82A 2JI9A 1O8CA 1AHNA 3DFMA 3TL3A 3V4OA 3NBKA 4DSNA 2BM0A 3GFSA 3M1IA 4YCNA 1RFGE 1BTOA 4IJMA 3NGMA 4KQCA 2VUIB 3OUUA 3EZ6A 1NOJA 1E2LA 1NT2A 2CXNA 1RYMA 3E8XA 5C1BA 5HUHA 3H0KA 2PCLA 2X2OA 3LKVA 2JLQA 5IJAA 5J23A 3BWEA 4LOAA 4A82A 2PANA 4X85A 4OXQA 3A6LA 3W2EA 2OPHA 2CJWA 3IJEB 1Z5UA 3FWKA 3O8DA 4XQ0A 2D2VA 1YF3A 1K8RA 3WK9A 3GUCA 2PLFA 5FLXA 1KDOA 1U3TA 3ZK7A 1LRLA 2Q0XA 3IE2A 4CMJA 2VJQA 3KPUA 2V7WA 1T43A 3B5IA 4NCKA 3BMCA 4N8DA 3K73O 3C8HA 2RGEA 3GL9A 2BZGA 1SBNE 1BO6A 1HDIA 1WABA 1KDRA 4YRCA 5H59A 1OF1A 3ZU3A 2FSFA 4CKBA 4Z49A 5ITZB 1UEXC 1BJTA 2FMHA 3ADKA 4CL0A 1JH9A 2PYDA 4IHJB 2OZEA 2BGJA 5SYNA 4OI2A 4IFTA 5HBGA 1C9KA 1FU4A 1KRWA 3JQAD 3E5MA 1PJ4A 2F43B 4G36A 4TV8A 5C1OA 4JL6A 1KU6A 1JH8A 2YY5A 2VDKB 2K7FA 2PUAA 4B71A 3NKFA 3DEKA 2C4WA 2PGIA 4HYTA 4WLOA 5KDOA 1QP0A 2ZSJA 3ZWKA 1CQPA 1Z6QA 2P9YA 5K05A 3LFUA 1QSGA 5CP8A 5CNIA 1JN0A 1WIWA 4RVHA 2EW2A 3WYCA 1ADBA 2ZRFA 2BGUA 2GI4A 1XTQA 2V97A 3R6GA 2ZU0C 5ESXA 3R6LA 2XXAB 2CLIB 2NAFA 1M1UA 3KTAB 3SC2A 2FJ0A 4IIBA 4Q34A 1DUVG 2YW2A 1N5DA 1PVVA 4DNOA 1E6LA 4WOPA 3ZLJA 4B2YA 4MWCA 1LZKA 1GRQA 2W6IA 5CU7A 1QQBA 1TQHA 2OCXA 2YN4A 5EQFA 5B1DA 3TM4A 3A6ZA 3L7YA 1KAGA 4AURA 1OH6A 2J3IA 4GU5A 2MSKA 1M0TA 4UQPA 2Z04A 3VSBA 4CMEC 3ZGOA 2QLJA 4F6CA 3E27A 2QKYA 5HZGA 2J5XA 4URZR 1WCV1 1G5HA 1ECGA 2FFRA 1U7XA 5FBQB 1IY2A 4DCUA 5KQRA 1R0XA 2ZG6A 3CN7A 4CEHB 1JALA 1CKEA 1IB0A 5IUKC 3CHYA 1N4DA 2AXEA 3KG2A 1L4MA 1PV2A 2EYUA 2W70A 2DM6A 4HGRA 1UBUS 2IEGA 4X6LA 1P61B 3PE6A 2X1HA 2FF5A 3G2NA 3KZMA 1U02A 1D6NA 1F2DA 4KQ1A 4XVCA 2SHKA 5JCJA 3KE8A 1KR5A 3LSTA 4JNKA 2AR9A 1B2LA 2ZJAA 1NR5A 2JF0A 3MTJA 1PR0A 1PDVA 3V6MA 3CWCA 1E6KA 5HMMA 3ZIDA 1F3LA 2VK1A 4OKNA 2Y6UA 3AQIA 4D8TA 1UKYA 1IYZA 1LI5A 4GMKA 3U9SA 2OBXA 4BC1A 3EISA 2QW1A 4BV9A 1NOKA 1ZOPA 1WVMA 4KIWA 4YMGA 4RZQA 1N0UA 2CWWA 3KKPA 1PGPA 1W0KA 3B20A 3I73A 4QT0A 3VISA 1IY8A 1S96A 3WLEA 2PT7A 2X8JA 1MIOB 2XMDA 5EJEA 4KHPB 4DYVA 1IU9A 2FW8A 2Y0CA 1BX1A 4ICIA 4MCJA 4AJLA 2QRGA 5BSGA 2Q9AA 1U9JA 3ICWA 3V4FA 3NEJA 2C9BA 2UKDA 1I4DD 3B1KA 4R01A 4O5AA 3D2AA 4JJKA 4EG4A 3DZ8A 2DWQA 2GA8A 2ZJ3A 3MAGA 4CIYA 2HRCA 1NQOA 2HLHA 5FA8A 1OXMA 1NMXA 2Q5JA 2Q5LA 1XMIA 2M2IA 2QIPA 2QIOA 3FWZA 4PLTA 4DADA 2BN4A 5IXJA 3AB8A 1U8ZA 4OUDB 2X4GA 4DCJA 3FW1A 3BORA 1HDRA 3QTBA 1C8LA 4LMPA 3HB9A 4MVJF 4MVJM 4JLKA 4KV9A 5FYDA 3RT1A 3TUJC 3CZCA 1Y4AE 4FPXA 4LZAA 2QTVB 1CS4C 3HFRA 2I2WA 3C3JA 3B89A 3WY9A 3KQHA 1LRKA 4JLSA 3COJA 5MGNA 3G7SA 4G0MA 4MZXA 1BJKA 4CTJA 3HI4A 1ISHA 4IOKA 3A26A 1IXSB 4HUTA 2B0JA 1NUTA 2H2WA 4GKVA 1EI9A 4YCMA 2QL7A 5BPHA 4X3OA 3PUIA 1G8JA 1QAOA 4UNRA 3A6FA 4RDCA 4Z9XA 5MFPA 3X44A 5A71A 1AKNA 4RY2A 3DZBA 1U3VA 1SCUB 3LHDA 4LYAA 4UU0A 4QEZA 2DTXA 2NUAA 4QNNA 4WKPA 2WWFA 1CCWA 2EV9A 4TKLA 2B1IA 4NZMA 4YCLA 4AKGA 4EHAA 1VXOA 5AXDA 2GF9A 3M0EA 3ZHTA 2IDJA 1RYNA 4B32A 2X2EA 2YJGA 5GONA 2FJPA 4BBZA 3JASB 4FHCA 2NAPA 1Z8HA 1J20A 1G18A 1CETA 1HLDA 5BSKA 1MAHA 3B36A 1ZWLA 3BE5A 1T0UA 2G1AA 3DDNA 1FEZA 4QOJA 4Y2RA 1T6XA 3KVYA 4KKXB 1C80A 4A2QA 2WJPA 3HBNA 3GPBA 4YRPA 5EEGA 4K0RA 3GRRA 4KZKA 2MSEB 3W90A 1RRPA 4L02A 4RH1A 1E3IA 1VZ3A 1RE0A 5TQ0B 2AJCA 4XUGB 3OIDA 4X20A 4NJEA 1OKKA 2CHEA 2H0RA 3AERA 4PYKA 5FR2A 4A6EA 4BASA 3KWMA 1SXJB 4ZGGA 1W4AA 4HGZA 5CUQA 1D0IA 4R5MA 3R7FA 2BFFB 5C3MA 2I87A 4UXHA 3PGLA 1EFDN 1MX3A 3V1LA 1YFJA 1G5PA 5D3KA 5KYYA 1VYVA 1L3CA 1DEKA 4WADA 2VG8A 2WKWA 2IYOA 4EA8A 1GZVA 1T9CA 4PONA 4C5CA 4WWHA 3I2GA 1TB4A 4MDFA 2OV4A 1NNUA 3R74A 2AQHA 4LRWA 4N82A 3GRCA 3LCVB 5B55A 2LBPA 1VGRA 2V7GA 3EQ7A 4LHWA 4CF3A 2REQA 2YJTD 1Q15A 2ZUCA 1GHTA 5IULC 3EGEA 1IZ7A 1U0NA 2QI9F 2GKSA 3N5CA 3ZBUA 4JI0B 1A9YA 5J58A 4B7UA 3II6X 2WNSA 3ZCVA 2YQZA 3JAKA 3KR9A 5BUCA 5LP6F 2AE2A 5AKHA 1JKXA 3NBZC 3VYRB 3EMDA 1QHFA 1DV2A 2OWDA 4TRJA 1VDZA 2QTWB 4K3UA 1EE2A 1V3QE 3TQCA 4RHXA 5HM6A 2DLNA 4WCFB 1OBHA 4HNQA 3OF5A 5LZ9A 1A50B 4ZYVA 2IHBA 5FDFA 1LC0A 1XDWA 4FC6A 3SZRA 3F97A 1HURA 1JDBC 1F17A 1RD4A 3BS4A 3DFUA 2AN1A 3MJCA 3OLVA 2PLAA 1ZUIA 3PQFA 4AROA 4LHSA 1VLZA 2PBFA 3T94A 4A1OA 2QG6A 2KYRA 5IN5A 4CMEA 1OT3A 5TMBA 3ZWBA 2VYND 3NCTA 4FFDA 2BMJA 1NJGA 2GT1A 5K3SA 5IKEA 1BWQA 1LBSA 2X40A 5IWCA 3Q6NA 3ROKA 1LPSA 1R6AA 2ID9A 3B13B 4IUYA 4QTTB 2JFNA 3IP8A 2R65A 4HH0A 1CLEA 5TDHA 2XA9A 3G1TA 1KMHA 5FV4A 4RDHA 2CV1A 4DWOA 4YMUA 2I33A 3ULKA 2HCFA 3MJRA 2ODTX 4MUNA 3D3EA 2B8TA 1IG3A 3D6FA 1EFAA 3EDYA 4BRUA 1PGJA 2FV8A 4TWJA 2ZBVA 1P8AA 4IQ8A 3LK7A 1UXGA 1YDHA 2DAPA 2J87A 4S1TA 2WNIA 1V8DA 1THTA 3NM4A 3OQ1A 5FD8A 2YWJA 3WKEA 5AJVB 1ZVVA 3R0QA 5CT9A 1VIAA 4O4IF 3PL1A 5CFNA 2PT6A 1WS6A 4IDAA 5D2CA 5HK8A 1JX6A 3QELA 2ZWIA 3EVZA 3IKLA 3SJAA 1I4OA 2XZDA 5GVRA 4KPFC 1UDXA 3ZVNA 1W36B 3HA2A 2X1LA 1K9VF 1SCDA 3O0DA 2DR0A 2VBIA 3DDSA 4G6ZA 1C9JA 3SJUA 1G8GA 2JGDB 2LNDA 1J4AA 1XRRA 1QIMA 4YGXB 5FORA 4A8HA 2G25A 2X3UA 5SZKB 1EFLA 3DE5X 1U5CA 3MCUA 3VAZA 2IU3A 4LCBA 4QYTA 4TT3D 1QFSA 4E4RA 1FFAA 3NBAA 4PLHA 1NP6A 4EKDA 1OH8A 1T2AA 1U1DA 3LO8A 3VBCA 4PYQA 3RNOA 3VYSB 3L2OB 2O52A 4X54A 3I62A 1MJHA 4QYIA 1XK7A 4UNPA 4AWBA 1OGJA 4KUGA 4NBWA 1COWD 2PFKA 4KEAA 4U4AA 4M1ZA 3H4TA 2ZK7A 3FCYA 2XDQB 3DFIA 4WTOA 2ZSHA 4R0VA 2RGWA 3KALA 5LZ7A 1AKMA 2PL5A 2PRJA 1R9GA 4S0ZA 1GN8A 5HGJA 1YR8A 3NXSA 4Q6WA 3R4CA 5CEJA 4QE3A 1RAEA 2RIPA 1ZCBA 5HTKA 4KR3A 2IBTA 2JASA 3LSYA 3FLMA 2R85A 4O4JA 1KVUA 1L4HA 3JWHA 5K3BA 2A33A 1SVNA 1L7PA 2JEYA 3IVAA 4BB0A 4BMNA 2HSWA 3B2EA 2RGDA 5ALKA 3BXOA 5EVCA 2XSZD 3TI9A 4YRMA 3LCUA 3MWGA 5HIMA 2ANBA 4CM9A 3RWBA 4N7RA 2FPOA 2Q2QA 1E6WA 4C4AA 1QLJA 4QBKA 5B1YA 1R4AA 2F1HA 4RDIA 4ND2A 2DG2A 1TVCA 5ALUA 1NPDA 1N5RA 1SCJA 1VCMA 3UWDA 4ZMSA 4X00A 5G0TA 3GOHA 3K8QA 3Q7EA 4EYOA 1IRIA 1MOPA 3J7AC 2GZSA 3VNAA 4DJFC 3DBHB 1FP4B 3E9RA 1ECBA 3EMBA 4BOYA 4QUDA 2OZVA 4I9GA 4P9NA 5H3LA 3KHUA 3THWA 1E18A 4KK3A 3OWXA 1V47A 4NFLA 4R9UC 3UT5B 4BWVA 2JBAB 3RQIA 4LOKA 5FXMA 5I9LA 3V48A 4C6TB 2HFKA 5CCDA 2C9ZA 4KI7A 4B2IA 4D9MA 2QTTA 4QTUB 3ZHXA 2HCRA 1I2AA 2QN6A 1KI9A 3O5AA 1VJRA 3IQZA 4EIWA 3IOMA 1XA0A 3QOYA 3SSNA 3WNDA 1OGYA 1RWBA 5E1DA 1VKJA 1WOMA 1Z2NX 2QRLA 4C06A 5IEJA 5L4NA 3TZBA 2NVBA 2PEYA 4Y9UA 1AJEA 1FFCA 1EFVA 1FYEA 1XTTA 3OSUA 4YRSA 1TU0A 4DKXA 1TMYA 4HNGA 1BOOA 1YHYA 2Q8PA 1FFWA 2B8NA 4LWPA 4OSPA 1M1XB 3MRTA 4OF4A 1HA3A 3RUDA 1G19A 4J0CA 4M0PA 2UUOA 4F04A 1RU3A 3MFQA 2XMPA 1EWTA 3IT3A 4XVRA 3O8QB 4UBMA 1NU8A 1NI4B 2X0KA 3PLRA 3OMXA 3BWXA 5EP3A 1J33A 3ZZ1A 3G23A 3L8FA 1XD2A 3ZPXA 4BB9A 1IBLB 3M6MD 1FDOA 1JBQA 1MQ8B 3A9TA 1O5IA 2BMFA 2GXAA 2NO5A 4MLDA 4A23A 4N7MA 3CVXA 2ZR9A 3WIBA 4GOMD 3EAGA 3FTNA 4QRIA 3P0RA 4GE0A 1M34E 1IG0A 4AZ0B 2C2YA 1HDOA 1Q77A 3T54A 1BRMA 1E9CA 1D4OA 1XN4A 4H0NA 1SZJG 3CTMA 3LKZA 2ZYIA 4MPDA 3QENA 4I4IA 3PL5A 3WMXA 5GGXA 1I3KA 2CLKB 4IQFA 5JH7F 4OAQA 2OCDA 1WW8A 1UWLA 3U4MA 2DR3A 4RU1A 5JI2E 5D5QA 1Z74A 4D97A 5JXGA 1FTSA 1RYHA 4FT2A 4KLCA 4LTMA 2H0AA 3IJPA 5E3HA 4XRGA 5JS8A 2OFWA 1RPZA 1BE0A 1B93A 4Y2PA 3C87A 4N03A 4WEOA 4N5MA 5IVHA 2HHCA 5KNCD 4RMJA 5KWJA 2P6MA 1E32A 1FRZA 2ZSKA 2IEZA 5AKIA 1K3TA 1VM6A 1UWKA 3VR6A 1R10A 4A0HA 4BU0A 1NIPA 3RAJA 1W9HA 2NTNA 3TLAA 3AIOA 1GPUA 1C9NA 4UOQA 4YRDA 3NQ41 2PD6A 1XJQA 2AOWA 3C48A 2H59A 4LCJA 4FINA 3WLFA 1F3OA 2NU8B 4DTIA 2PZFA 4IEEA 3BTVA 3KV1A 4EG0A 1VPWA 3TEJA 1P9RA 4N5HX 1TOAA 2BCEA 4CMCA 2XLCA 4XB2A 1MFPA 1Z12A 3CX3A 2B69A 1K08A 5AOVA 3LX4A 2QRPA 2XCLA 3EUWA 2Y92A 5EHNA 2FWPA 1Q17A 3AIIA 1L7EA 2QXYA 4RKQA 4B6RA 3KOXA 5JBQA 1H9CA 2Y1DA 1Y4DE 4Y6OA 3R8XA 4ZIRB 5JSZB 1CZUA 1KRXA 4CDNA 2OTCA 3UJ9A 5F76A 4HH3C 2PCJA 3OKCA 2QMZA 3PNBA 2G9UA 2I99A 3GJSA 4JKYA 1SC9A 1X3LA 1TZBA 2GGSA 4LOLA 5C1DA 3P9XA 4FW8A 1UPUA 1Z7EA 2B4KA 2HCJB 3PRJA 1MXFA 2W6QA 4JUDX 2JFWA 1N5LA 2OGZA 2P4UA 2VZLA 1MR3F 3IEIA 3PQ6A 4GYWA 4KBFA 2FX2A 4O2AA 4PINA 5KX5B 3Q8MA 4OHRA 1VHTA 4FE7A 3L4EA 2B5VA 4QUBA 1OQAA 1PBNA 2JGMA 1IN5A 3AUJB 2BHLA 2PY6A 3AESA 3IP5A 3V8RA 1CUVA 2VXOA 1IUKA 1GTZA 2G1PA 2IUTA 2Z2XA 4I19A 4OGFA 1MZVA 3HCOA 3IUEA 4ZRNA 3FHCB 2JGLA 3AHDA 4I9UA 1TTPB 1HXHA 4AG6A 1NNI1 3QMMA 4YJHB 4YAGA 3W5CA 3UFBA 2H08A 1ZZGA 3BGIA 3COPA 3B6MA 5CLJA 1CY8A 1OREA 2PZBA 3O92A 1NJFA 2V6FA 3D31A 1YASA 3IUYA 3L6OO 4S24A 1NX6A 4TTSA 4Y1EA 5E3JA 4BNMA 1MN6A 4XXHA 4DPKA 1MGPA 4NJMB 4DT1B 3KKOA 4XPIA 2G6BA 1K7XB 2JRCA 1AH2A 4KXUA 5U1PA 3PNPA 2B20A 3OIGA 4D45A 4PLWA 5IKXA 2V74B 1KBQA 3BCSA 3R44A 2CF5A 4NHOA 1GTL1 2AIRA 4YJ2F 2FG5A 4H4CA 3NU1A 4DV0B 4EMTA 1M66A 3DLHA 5AVTA 4M99A 4CIAA 3E2PA 4HGPA 5KOHA 2F3UA 1TL7C 2D0OB 4W6QA 4MB0A 4ARUA 2ZYVX 2FOIA 5CGZA 9LDTA 2GSWA 2FYTA 2BKEA 3NIGB 5KOYA 2EQBA 2PX8A 2VKTA 3GP3A 2AI3A 4Q05A 3AOEA 2VNSA 2R1VA 3GR6A 4M1YA 4O08A 4NCNA 4YRBA 2DPLA 1SU6A 4G67A 1C3VA 4JXJA 2PBZA 4Q9HA 1DWQA 1I2CA 1WB5A 3EXAA 3M5WA 3O6VA 4B4OA 4Z3KA 4NAUA 1DFGA 3UOAB 3P2EA 2OYSA 2W6CX 4OHUA 2OBYA 4DA4A 5FUQA 1FSPA 1R6TA 4UAVA 1VHWA 4GRIA 3AVYA 2HSJA 4R2XA 4MVJH 5C53B 4KRXA 5AKYA 1YS2X 3DEFA 3A06A 3L6RA 2GEKA 2IBMA 1VI6A 1NQAO 2EBUA 2BFNA 1RWPA 3LE8A 3STTA 4CQLB 5TQ2B 1T8SA 4M88A 1BW9A 1YHZA 4C78A 4DRXA 3FUTA 3ZUPA 1ISPA 2QRQA 3FDXA 3REOA 3COWA 3RYIB 4KH0A 4AJHA 5F2NA 4Y2GA 4ZAYA 4LRYA 3LBYA 5LQSA 3VR2A 3QHQA 5J4YA 2XOXA 4NTZA 1FDVA 3FSEA 1R15A 1T2UA 1CTQA 3E6AA 4BE9A 3HV2A 3GNTA 2Q2NA 1YZGA 5BSWA 1YTUA 3RYTC 2VI5A 2RK3A 4M9SA 5JALA 2NVOA 3PXUA 3ZGZA 1ZK0A 4HDKB 4MUMA 4WGFA 1UBEA 4XM2A 5A7HA 4F1WA 3WDLA 1REQA 3OQIA 2A9KA 1JG2A 1Z6ZA 2B7CA 1OU0A 4LQ4A 4B4VA 2PR2A 3MCAA 2AFIB 3FF4A 2J46A 3ZQUA 1X7YA 1BMFD 3RC3A 1S8FA 4KLZA 3K70D 3C14C 2DRIA 5BN4A 2JI7A 1X1CA 2YYSA 2WJZB 5IH7A 2FDCA 4QM6A 2Q99A 2HJ9A 4QC2A 4F4DA 3DV0A 2MU1A 1MVOA 2B2XA 4BQIA 3BWMA 4ARVA 5KSWB 1JRLA 1UAAA 3WP0A 3NOOA 1Y3FE 3JTEA 4FYMA 2GM3A 4Q4AA 4AN1A 2JGIA 5AW1A 5LDDC 1UK7A 4F8JA 2ZUBA 3KWLA 3O9VA 1XZDA 1CF4A 2FE4A 4LI3X 4MEBA 5H70A 1OZ0A 2C95A 2CF6A 3DNPA 2P6NA 1WHSB 3LUGA 2JBWA 2RH8A 4J1NA 3IDFA 1HWYA 1NP3A 1KTVA 3K6JA 3RH0A 1I4EB 3I2HA 1I3OA 3M89A 4INOA 4HDNA 4I50B 5EJGA 4CKCA 4RESA 4PAQA 5K0FA 1V1JA 3EXHB 3N2KB 1JLLA 5G4KA 1HTWA 1QE3A 2DFTA 1G7RA 1PYOA 4NYMR 1IZ0A 4UTPA 5LLTA 1SD5A 1RYFA 2MOKA 4KQJA 5JJCA 4K9MA 3R7DA 4MYCA 4W1QA 1T0BA 5EJ7A 5C51B 1W73A 2AZXA 4EBFA 1G55A 1IM8A 1MGOA 5LBIA 1Q0QA 3DV2A 5EXPA 4IH9A 5I8WA 2O5CA 4LJLA 2IYLD 1YZUA 3K09C 1Q1BA 4LJ4A 1ADFA 2W6ZA 2P78A 1O9HA 5TGZA 2R6FA 3BB1A 3HH8A 4HAVA 2EJWA 3AEKA 3NTXA 4MUJA 1UC8A 3WRWA 4WVFA 4S3MA 1ZO8A 2HSGA 2X22A 2XZTA 4GXRA 4C0JA 2G4LA 2Y99A 5HSGA 4UE2A 5A4AA 2YC4C 3ODPA 3MRVA 4PGAA 3N8IA 5AI0A 5BVHB 3DZDA 3H9JA 4II3A 4D3SA 3SQXA 1YBFA 5AVYA 4R8VA 4WK2B 4IM7A 1YS9A 1EFTA 3DOCA 4PLVA 4TXNA 5JEDA 3MHPA 3CISA 1FYWA 2IZOA 4TYNA 1J8VA 1CDDA 1WUKS 2P9FA 4TN5A 3JSXA 4L4UA 5I51A 3KTDA 2Z4TA 5LA6B 2IUSA 1WU8A 2XYRA 4S1VA 5T5QA 2OXCA 5B3JC 4RA6A 1MTZA 3QWFA 3ROFA 5K99A 1TT5B 1L7XA 1ONSA 3HR7A 1UZNA 1TUEA 3SIPA 4GICA 3ZS9A 3ICOA 3KJIA 3JZDA 3FB4A 5A5FA 2NTYC 4D9FA 2AOUB 1H42A 3H8JA 3KK0A 3G49A 3HYLA 1UODA 1XOIA 2ETVA 3NOQA 2VAPA 4WZBE 1IY0A 3MQ2A 4EBBA 1GOTA 1VBFA 2NSHA 1KYZA 3MMPA 2PUJA 3HM2A 3SX2A 1FYXA 3NETA 4Z7JA 2QRUA 1Z2AA 4MV1A 1E3QA 4GRAA 3QY0A 1ZU4A 1Y1PA 3ANSA 3BPSA 5DTRA 1XLTC 2PVSA 1Q0TA 4EO7A 1TW3A 2BMDA 1JSXA 3A14A 3AHCA 4D3DA 1PTKA 2AJBA 2FG7C 4KGVA 4KVZA 4NIMA 2AFHB 3S68A 3OH8A 3TMAA 3VVLA 4XX1A 1UKCA 5TF0A 9LDBA 1GZ5A 4KO8A 4X8MA 2F7SA 5IF9A 4NF2A 1H3EA 5DWDA 5FBRB 5K8JB 5DM0A 3A31A 5IX8A 2WFLB 3RJ9A 1WMDA 2X77A 5CVEA 2FG6C 4X3PA 1XMPA 1DC5A 1CYDA 1M2OB 1P4JA 3AFNA 4KMMA 4WOJA 4XWOA 2EATA 4UEWA 4J3FA 3V7YA 5C7OO 4J9UE 3R0JA 3GFGA 5DYWA 4UDOA 3SS7X 4F96A 3Q98A 4UATA 4B33A 1WCXA 4N0MA 2J0EA 1VG9B 2OBFA 3RS9A 2VF7A 4HDSA 1O94C 4FIZA 2P2SA 4M1WA 5FRDA 4HQLA 1TYZA 2JLBA 4D1YA 3OZDA 1FNCA 2D3WA 2J6BA 3BAZA 1OZFA 5FFMA 4XGKA 5CFOA 5K8TA 2P9TA 4QDXA 1MNAA 2NACA 3EFHA 4YBRA 5TGDA 3WYGA 3IMFA 4L4YA 1CRZA 4MQ4A 5DKFA 3ROGA 4CWAA 4NY1A 2X0DA 2OHIA 3NZEA 2CSXA 2GAJA 1V1MA 5KTOA 4CLRA 4QWWA 4ZOLF 3B53X 1I9GA 1RRMA 2EFCB 2YUTA 1WZCA 3P71T 3DBIA 4AMGA 2I4TA 3GELA 2WQ7A 1DG3A 1F6BA 1UFOA 3TIVA 1QOZA 3BL5A 4MWTA 2IYQA 4TL9A 2BF4A 2PGOA 2BFCA 4LY3A 4RZIA 3WLLA 1PSZA 4ACBA 1THMA 1WXIA 1Y8QA 1W0CA 1XTUA 3OLYA 3EOBI 3H5VA 4IDCA 4UJ5A 1NXQA 1T4CB 5CB4F 4GM0A 3RBAA 4HK4A 1K8XB 5B37A 1XDSA 2Z8ZA 5L53A 3TQIA 5DBFA 4KYTA 2O2GA 4B44A 5HX7A 4FR2A 4OH7A 2CNWD 3A7DA 1XZAA 4LNHA 4C0KA 5TVGA 4M1SA 3AO0B 3COZA 2O07A 2D6FA 1TLFA 1PZNA 1MNQA 4BTVA 2QM0A 2EFHB 2UZ0A 3G2LA 4IJQA 1RJ9B 3AFMA 4DBLE 4MS1A 3OLWA 4V39A 4WLEA 3V8PA 1PV4A 3U44B 4XIJA 3WKCA 4HWTA 1K75A 3LXRA 4MQ6A 2CV2A 5A6VA 3W5SA 1FL9A 3R9XA 1C1XB 1NSTA 1XNHA 2DSNA 1L5WA 1PR6A 3EGXA 4KQXA 4YEDA 3RYFA 2IHNA 4CL2A 3E9YA 1RIIA 5CA0A 1KEEA 4ZVTA 5DLDA 1YA4A 2D1FA 2QTZA 4F21A 4ZJYA 4GLOA 1B0UA 1JFSA 1O6CA 2GEDA 3LPCA 1K4MA 4TMYA 4ZT6A 3TBFA 3UK6A 2FHSA 4UXIA 4WA8A 1RQLA 4IX1A 1VHQA 3EZFA 3EG9A 3WSTA 3H4IA 5REQB 3INNA 2DSTA 4QG7A 3HCPA 3VZDA 1DDIA 3FKSD 5BSHA 5KSZA 4GMDA 4QGAA 1F8XA 1G7SA 2C83A 5BSUA 2JLSA 5CIQA 4CIBA 5EJ2A 3K9BA 3PQ8A 3AJDA 3O0TA 4U9UA 3IAS1 3ELUA 1TC2A 2Q6KA 1M74A 3M2TA 3NT4A 5FOTA 3UA3A 2C20A 2DFKB 2GBFA 3ICCA 4OL0A 5DHRA 1L5YA 4D57A 2BBTA 2FOXA 2I3AA 3DE7X 1V6AA 3FJYA 3ND7A 4XGQA 2ZS8A 1S2GA 2PGLA 4RTQA 3C3KA 4S12A 3R2JA 1NX9A 3VPFA 2EF1A 3FD8A 2GERA 1N9KA 3D6VA 1LSUA 3CR8A 2DH5A 2YVQA 3M7IA 4O2LA 5DWVA 1A9RA 3RTGA 4BYMA 3QKUA 3WB9A 4PTYA 5ULLA 5AIBA 2XRZA 4G0WA 4NAHA 3SBEA 3F78A 4E5SA 1VBMA 4HVAA 3T6KA 1ZH4A 2IUYA 4NV0A 1W87A 4R1SA 2SECE 2GK3A 3MJVA 3RHZA 4S05A 3PDJA 2D13A 1KY2A 4JI2B 2P4EA 3V1UA 2Y0DA 4IJWA 3TNFA 4KL8S 1QIHA 4C0WA 3W8FA 1PJSA 3TG8A 1GPYA 4EEKA 2XI4A 3HUDA 1XQ1A 3GP8A 3CPSA 1U7ZA 3AK4A 3UFXB 2QSYA 4HFRA 8AT1A 5TT1A 2R7AA 2OK8A 2EFGA 4EB8A 2HLPA 2QENA 3C3AA 1V0JA 3B5EA 3DBLA 4RIEA 1QQ6A 5B3JA 1KO5A 3PFBA 421PA 3DPUA 3T5PA 3GD5A 1RHKA 2D74A 3MPUA 4PZUA 3VHXA 5A9RA 4ZYTA 2IP2A 5BMVA 2CFSA 2X0RA 3HUTA 4DUYB 3R5TA 4OQMA 1ZAYA 2DTEA 1Y1SA 1ZNWA 3CEPB 1H4VB 3OBBA 1G66A 2MJLA 4FDUA 4OLJA 4UCXA 4W7IA 5ALVA 3ZU4A 4E4YA 1IOZA 1ISFA 1R6BX 2A88A 1XCGB 2J5RA 2ZE5A 4KFSA 4L16A 3VVCA 4DB2A 4RXUA 4WK4B 1QIGA 1L5LA 1XLTA 4JITA 2FZEA 3FPHA 4FBGA 1AGXA 1EVLA 1DAFA 2NP6A 1XXHB 1P0QA 3CO0S 2AA3A 1XEXA 1L5SA 3PNQA 1UXKA 1KETA 1ZA1A 2QAGB 4JFRA 1KI3A 1YFKA 5CDHA 1C7RA 1NLZA 2OCAA 2G9ZA 2VSYA 1CP3A 1E58A 3I12A 4M0EA 3ZI0A 4BJ5A 1TM2A 4KI0A 3EQ2A 4NBLA 2XVAA 1U2SA 3BGDA 5EKTA 3DJYA 1ENYA 3HE3A 2CHQA 4JOQA 4NDNE 4DJ5X 4R2LA 1FJXA 3UW3A 3GPLA 4Q7KA 4N6OA 2O7VA 4OFWA 4EJFA 4DUZB 3U1VA 4JYAB 1O94A 2WQZA 3BMQB 4G9GA 5TQVA 5CA1F 2Z3ZA 1KQGA 3GLIA 3CA8A 4N3NA 3G0BA 2EP8A 1Y4ZA 2NXCA 2QQEA 4MRVA 4N7BA 4BDTA 5BUSA 5J4LA 4F4FA 1RTKA 1DPFA 4H3KB 3CEAA 4NONA 4P83A 5L3RA 4M46A 5LKAA 3ZWDA 4DZTA 4K81B 2K7ZA 2P9EA 3BE4A 1KKMA 3WVNA 5TMPA 3LXMA 5L3VA 3TF5A 1XTZA 3CEMA 5AVWA 3LA6A 1V5IA 1UOPA 5FTMA 4BMSA 3LP6A 3TOVA 1KH1A 2CWDA 1G8PA 3KBOA 3PUWA 3JVIA 4GM4A 3W4KA 4EG3A 3MUOA 1I1NA 1B8UA 3LCMA 3LW8A 1I7DA 1OROA 4AUKA 3C8ZA 2VRCA 1WZIA 3OEHD 5T6MA 1WE2A 5DF1A 4H6XA 4I55A 3SC6A 3S29A 1YCGA 2C5GA 5HIAA 4Z3OA 1KZYC 4QFDA 3OJXA 5IYZB 2NT4A 1N2HA 3DOUA 1Z0KA 3LKBA 4BTEA 1U2QA 1DBVO 2HAEA 1O0CA 3HWWA 5E0OA 4YLGA 5EUMA 1FLVA 3VJRA 4D8UA 1C3OB 4OQPA 4EL5A 3G9QA 4Y2QA 2YXDA 2O05A 3V8EA 4R1LA 3QTLA 3MT8A 1E2KA 3OP4A 4Q39A 3NG1A 3IB3A 3C4QA 1I32A 3QGMA 4Q16A 1M72A 5HZKA 4DV6B 3AUSA 1OLXB 1X3SA 2X15A 3GRZA 1Y80A 1E7YA 3CRMA 3LD9A 4RMHA 4AWXA 3DZGA 4MW0A 1L5QA 1E3JA 2DYKA 2XB2A 4EUHA 3RK4A 3NNDA 4GLBA 4KOAA 4Q4LA 1HQDA 4GOXA 2WYUA 1JJ7A 3FMGA 4X64B 1PEAA 2IYRA 1QPZA 2PMKA 4PAWA 4EHFA 1RP1A 4JYPA 1ZGZA 3TJZA 5ILGA 1J39A 2YXNA 1U3FA 4BJ3A 4IXTA 1XZJA 2ZIFA 3W6PA 1F7UA 1JEQA 4U7DA 4RIHA 4Q7LA 4IDFA 4INAA 3PHBE 1TEZA 4FNMA 1UMBB 1PNOA 1MT0A 2QUKA 1YVEI 3GGJA 5AKXA 5FOUA 1DCTA 4GZ3A 1QH0A 2EEZA 4QULA 1P0MA 2QLLA 2WIFA 2G9NA 1ZN7A 1L5MA 3D3JA 4WVLA 2PZAA 2YVUA 3SF0A 4EZBA 3AH8A 1JDNA 3UKOA 1NFQA 3VDMA 1XNQB 4FHGA 2B6HA 2DERA 5CNKA 2BSXA 1IDN1 3AB3A 4KV7A 3NIBA 2HK9A 2XGMA 2XUFA 4D0LB 1QR6A 3L8ZA 2Y67A 3IL2A 2NPIA 4WCDA 4CM4B 2MINB 2XYVA 1EUZA 1D2RA 4D3XA 3N53A 3P2JA 1FVXA 2RD2A 1PQ4A 1SHUX 5IAEA 5JFOA 3PDIA 1ZIPA 1TU4A 3L77A 3N8GA 3HU3A 2WSLA 5M5BA 1NWCA 1YU9A 1A8IA 1A95A 2OT3B 2WF5A 1ZGAA 4KR9A 1UWCA 4DW8A 4AVYA 4ZKEA 3IAXA 3GJQA 4MJ3A 1Y7LA 4XM0A 3A2KA 2ASEA 1U0SY 3LIIA 1P2FA 2RI0A 4IXWA 1II0A 2JFVA 1YE8A 2R96A 4Y2XA 1IIBA 4LMAA 4FCCA 4TROA 4YRTA 5LBTA 5H9WA 4IJ6A 1N1EA 1PHPA 3RVKA 3FDZB 3DULA 2ZB8A 3M3PA 3CBQA 3PPVA 2H29A 2G9VA 2XMBA 1XNJA 3HI6A 4LYEA 4RD1A 2J7KA 5AYVA 4ND8A 5E6RB 2QDXA 2X41A 4F2DA 1H5UA 2WYVA 1E3WA 5E7QA 3RG2A 3GO4A 1SEPA 1DWUA 2I4OA 2ECPA 1UWVA 2ZVDA 3QVGA 4Q3OA 2WW8A 1FUIA 3RYHA 5HPYB 3UMSA 3GA0A 5JJIA 1N2CB 4DANA 2FW0A 2XQGA 4EKNB 2R7NA 5JOQA 4FR5A 3LZ6A 1UM9A 1PVDA 4TKVB 4ZI2A 3ZDAA 3OZTA 3L7NA 1CE8A 1G17A 1H93A 3DPIA 2ACVA 3EZYA 2I76A 4XOIA 1M5RA 1U9CA 5D3MA 3BKWA 5ETJA 1KVQA 1KAOA 2NQ2C 5HTOA 3D1LA 1Z88A 2WK1A 4C1BA 1UP4A 4OXRA 3WZMA 5K8VA 4QXAA 1ZFNA 2EW1A 1T3GA 2E2WA 3OQ6A 4LHXA 4NQZA 2QLFA 5A03A 5F98A 1EH5A 4EZIA 1IK6A 4Q18A 5D6NA 1XG5A 4N0DA 4WOCA 1DRKA 3QBJA 1SUEA 1K8QA 2IDZA 2MTBA 4IR7A 4UHBA 5AW0A 1GQRA 3FSRA 4PG6A 3I23A 1AGPA 2H11A 3LLCA 2R25B 2GCNA 4L57A 4UUPA 1H9BA 3BXFA 2ZRGA 2E6KA 4X45A 3ZXIA 4UAGA 1PQPA 1C81A 3OPMA 2WLTA 2L69A 4EI7A 1GSIA 2JJ1D 2WMYA 3DE4X 3VR0A 4Y18A 5INTA 2HA7A 2V6IA 3QH4A 5LB2A 1GPDG 2REBA 4KQIA 1PGOA 2Q3MA 1R4MB 4P2GA 3M5PA 3PEEA 2UVPA 1AK1A 4NE9A 1V11B 2EJVA 2X4IA 2WM9B 2JAHA 2QJTA 3QVTA 4DDVA 5AVXA 4NPCA 2QX6A 4JJIA 2YHIA 4L0CA 5KNCH 4K2AA 3FMOB 4PZ9A 3B8EA 1FSFA 2ARKA 5CJJA 4LEIA 1V7ZA 2W2MA 4GQAA 4R7TA 4RULA 1TEXA 1UZLA 3MRXA 3PXEA 4ILEA 4KN6A 4OBWA 3TAXA 3AY3A 4EF5A 2NO7A 3A7EA 2OHFA 3PNLA 4RJTA 1IJBA 5AUOB 1GZ3A 2BGGA 1TF5A 4HDRB 3A4IA 1Z2OX 2G1JA 1CG6A 2C00A 2P27A 2ZXFA 5AXAA 5IXYA 3DLIA 1BROA 1TXGA 1ZIXA 1JFLA 2FPKA 3HVJA 4R2WA 1VLQA 4F2HA 1HYGA 1ZVKA 4TSFA 1VPLA 8OHMA 1LF5A 5C8YF 3HRKA 4BNDA 1HEYA 3DV9A 2JK1A 5CIWA 3X1KA 4BKQA 1MAWA 1R5JA 1WDMA 2PKYX 2VQSA 3PI7A 4G9BA 4K6HA 4KTVE 4TM7A 4UCWA 4KDCA 2R2GA 1K89A 1V5FA 5K5EA 1NDQA 3QV1A 3GLHA 1DOHA 3D3WB 1CY0A 3LVFO 4OBBA 2D06A 4CMGA 1HMYA 4GGMX 4E1BA 2I1VB 2XYGA 2QF7A 3T0IA 4UW9A 2P62A 4G4SO 4K86A 4MUFA 2IHKA 5A1JA 4MJ7A 4EY8A 3Q3JB 4QPZA 4JX9A 1LNQA 3WKDA 4TLCA 2QTHA 1Q3TA 1L4KA 4MVXA 5J5AA 3T7JA 1IY1A 3E84A 3EYAA 1LJUA 3ZIAA 3AUKA 5CW2A 2HQRA 3QEKA 2O20A 3L43A 2LCQA 4J75A 4BNZA 3FBWA 1P2BA 2A0FA 1GPMA 4HBGA 4E46A 4R3WA 2YWHA 4AUNA 5I7EA 3ZE1B 4YRFA 4TMTA 4G84A 5A1TA 2JGFA 5A9TA 4Q3LA 4EL0A 3SXUA 1CQIB 2X76A 1KY4A 1U7HA 1GA4A 1ZJYA 4WJZA 5DPMA 4A6DA 4Y0AA 4ZOAA 1TQ4A 4KXXA 1IOLA 3H11A 2XUOA 1H4SA 1F38A 4IDOA 1JKJB 3OA0A 1E9FA 4QODA 4LC9A 1F1JA 5CPBA 1NW4A 4XM1A 1G8AA 1OH7A 2WJIA 4P4SA 3SMQA 1JEYB 2GXSA 1G3QA 3P20A 3F9IA 2FFAA 3PUZA 4E2WA 3LGSA 5JBIA 1T9GR 4HZUA 1DBPA 2GDZA 1Z0AA 5AH0A 1N57A 2WD7A 3GIWA 4PYMA 5ARCA 5IHPA 2WM8A 3Q5DA 1QBGA 3QW4B 4HDMB 5E2IA 3U7RA 2ZZNA 2Z3VA 4H3VA 4HMOA 4B6EA 4KWCA 2EL7A 4ESHA 1YKGA 1ZZEA 3KEMA 1EZZA 3G6WA 4BNFA 3IC5A 4RVNA 3ZE2B 4ZVVA 1IWBB 1FP1D 1GQFA 2AXNA 2RGAA 1NAIA 3OESA 1S3IA 3ORYA 3CZ4A 3QUCA 3UAVA 3UGTA 2HIMA 4CLOB 2R44A 1XEWY 2XMGA 3AWDA 4RZHA 2H5IA 2AFVA 4FR0A 4HI0E 2OHVA 5EIFA 1E9EA 1Q0HA 1GGHA 2RHDA 2ZTMA 1JR4A 4P7BA 2RH5A 2EGGA 5D5PA 5TS2A 1S3FA 3ROTA 3C3YA 4Z1OA 2GM5A 3LUPA 4MR8A 5TJ9A 3EE6A 3OX2A 2YJ3A 4LHZA 4RTMA 1J9ZA 2CLMB 4KPGA 3Q1LA 4RMGA 5ERGB 5LP6B 5B1HA 3DDOA 1AA6A 4AK9A 1QQ7A 3SHFA 1D4AA 1SXJE 3GW8A 3FFTA 5BYJA 2WR8A 2VAMA 1YA6A 3TXYA 4FUQA 2B1QA 1GQ2A 1KK3A 4RD6A 4PSUA 4F91B 3DHVA 3LQRA 3KKQA 1XCMA 3OCJA 4MKZA 4US1R 4C0HA 4G9EA 4MP6A 2AJLI 2BEVA 3TSAA 5DU2A 3TUZC 2WT8A 1TCUA 5C4GB 4OMCA 3ZH9B 3F74A 2Q3JA 1JT2A 2Q28A 4WMLA 4YJFA 1ABBA 4RLSA 3W06A 1E20A 4RE5A 3S5UA 3GLKA 1DC7A 1SGWA 2HCBA 4EHIA 3TVYA 2PX3A 1NC1A 5JAOA 5JQGF 2H07A 1PQWA 5C2JB 3ZWAA 3WI7A 1DP4A 1NJ5A 3QEMA 1IULA 1JXAA 1O9BA 3QVXA 4BB5A 4TUYB 5EJIA 1JKIA 2Y1OA 3UB2A 2O1XA 3IE0A 1R7RA 3KB1A 4WKGA 5CITA 3L40A 1BOFA 1LTKA 1EIWA 2QHXA 3IURA 4IDBA 2F1KA 4NDZA 4DCOA 4BNNA 4AIRA 3AXSA 1CUSA 3B1YA 3RRBA 1W88B 1K8YB 1EUDB 1QG6A 4BQPA 4DVGA 4W5HA 2WZQA 3PFCA 1KOFA 3WZLA 4QAQA 1N1DA 5FOXA 2WTXA 5K6TA 2P41A 1DKNA 2WNHA 2BHNA 4YR9A 5F23A 2FF7A 1PNRA 5EHXA 1TO1E 4PVDA 1U0FA 1CBUA 4O4IB 5T67A 4CQJA 5CDYA 2VTBA 2IBSA 3W0LB 2AK3A 2NXEA 1TKCA 3L4BC 5T8KC 4P3YA 2Y93A 4CIVA 1XZPA 4GR5A 1B3RA 2IH2A 4EMBA 1YR9A 5C8DA 1R6UA 2D1QA 3T7AA 3TZHA 1RM3A 1XVIA 1YBHA 5EJAA 3CIFA 3EQZA 3JQAB 3JZMA 3PXGA 1GVHA 1G4UR 3LQ4A 3TIXB 5KBYA 3MWJA 3KR2A 5E9QA 1PJQA 3H0EA 5BWLA 4GLJA 2WABA 3SJBA 5DYYA 3PNSA 3SFVA 2D1SA 4A6XA 2OKGA 3CKMA 4EB6A 4EHHA 1P1HA 3TWOA 3CT4A 1JQDA 1MAAA 4FOLA 4OYYA 3BTSA 4C7KA 5DK4A 4MLPA 5A7GA 5BOSA 4Q3CA 4REOA 1NVXQ 1HFKA 1PE0A 2B4AA 4MW4A 4A2PA 3T5AA 3QE3A 3AVTA 2IYSA 1G59A 3O2NA 3VR5A 4QPCA 1VE1A 1OJLA 3DQQA 4I1RA 3Q3GE 1DJLA 1QH8B 1UJCA 1V8PA 3BMNA 3NBUA 4I2VA 1GAWA 2BRUC 3T38A 1Z6AA 4RBNA 3DT6A 2DQKA 1BD4A 4DVJA 1SG6A 1J2EA 3VDXA 1P5RA 2OD9A 2YDYA 2EXXA 4MIEA 5BQXA 1V7CA 3EOAI 4MMYB 3WLSA 3FH0A 1LDMA 3E82A 4JEMA 1VE7A 2RONA 1B16A 2GZ1A 4HATA 4OU5A 3SHQA 1AO0A 1BQ3A 3FE2A 2MYTA 2O8FB 2Q0QA 4J1QA 5IARA 3R5FA 4FHEA 3B51X 5IVIA 1XMJA 3HVUA 1KI4A 1VJGA 1YDEA 2Q4BA 3TW8B 1WCYA 1XAIA 2XYPA 3PJFA 4MS4B 1C7QA 2HMTA 1PWZA 2I4MA 2FW7A 5AHRA 1VMIA 4X60A 3QXCA 1CIVA 3LCJA 4KNVA 4E7PA 2J9XB 1BKDR 5JI3E 2OLKA 3LPNA 2G1KA 2XNKA 3HM9A 2WPNA 2ZE7A 1JQLB 4UASA 5TRTA 2CXSA 4ZCPA 4C4YA 4KQFA 4QAJA 2XBMA 3THXB 5FTJA 3GNSA 4BO5A 2PBLA 2ZKIA 4Q66C 4ZOCA 1JAYA 3NBQA 3LT1A 4W5QA 2DUNA 1UP6A 4UHHA 1VB3A 3AGPA 1YRAA 3MT0A 1ES9A 4B17A 3Q8WA 4V3CA 3N6RA 4Y6QA 4Q9JA 5JJ5A 6LDHA 4O4HA 5DHAA 5T64A 4DCGA 5K0BA 3NVKI 3KAKA 4JMLA 3N0RA 4UNSA 3GAFA 3S70A 3ZCTA 2KWIA 2XRFA 2C5EA 1W85A 4J9VA 3IMCA 3K0FA 1Z7GA 2BEKA 2PX0A 1II8B 1S7CA 3W1VA 4J7AA 1HK7A 4QPJC 2CFOA 4YDQA 1M73E 2V1XA 1Y0BA 1ZGBA 3L7LA 2VQEB 3JAWB 4WECA 4JUBA 1NT4A 2EAUA 3REGA 1R4NA 3KFLA 3FX2A 5DOZA 2J09A 3NO4A 3A1VA 4P35A 2C3OA 2ZYTX 4G81A 3L4SO 1OBCA 1N6IA 1GQQA 4P0PB 3BDVA 5E6UB 5FBWB 1SBZA 3OHSX 3EC7A 2AVNA 3ORFA 3PICA 1G6OA 1BD3A 3RW9A 4BRSA 3CNQS 1QNLA 2E55A 1T1IA 2B37A 5AQEA 4N76A 4DARA 5B5SA 3H9BA 1H2HA 3FETA 1UMCA 1T3LA 1NN5A 3NHMA 4LRQA 4Z1MA 3SGLA 4B3JA 3CLVA 4M83A 2O2HA 2Q1UA 1B26A 1M1NA 1JIVA 3E9EA 4LC0A 4LBVA 1TM7E 3LT4A 4YUVA 4CCYA 1NBEA 4BL5A 3OCCA 4XYEA 2WWYA 3ORHA 4DUGA 3BM5A 4DAEA 2B34A 1K8ZB 1RKBA 1WP4A 1WPRA 1QP8A 2RAPA 3MQFA 4JA2A 2NPFA 3QLEA 1BZYA 3KC2A 1L9XA 1J06A 1SCAA 4WK6A 2PQMA 2ODBA 5JH7B 1VFNA 2BISA 3ADBA 3O7MA 4Z4QA 4F60A 1HDEA 4RE6A 4ZREA 5EXSA 4OX9Y 2OUIA 1ATIA 1LI7A 3PHCA 2FH5B 2V9CA 3VU9B 5IBCA 2XLBA 3C1TA 3JQGA 5KYUB 5LQAA 3RYCA 4E70A 3P8ZA 4MUHA 2Q1YA 3DR5A 4Y0VA 1Y8AA 1M6VA 4I1YA 1JR3A 4F5YA 3BEOA 4YRAA 1Z4IA 3GUUA 1NF2A 2J5KA 1TA0A 2VPWA 4FJ1A 4LDJA 5JAUA 2QQ5A 1O97C 2JKYA 4HCJA 3OHPA 3RVMA 2JZOA 3UHAA 1QB8A 3Q0TA 4QASA 3S2EA 2YXEA 1UJ4A 4P33A 5DN6A 4Q4CA 1TTTA 4U6QA 1YDGA 2EFJA 2Q3DA 3DLPX 3ICVA 3G9XA 4QU8A 4UHKA 2DPMA 3A6HA 5KINB 2IU0A 2OL4A 1YACA 3O1IC 5C31A 5KNDD 3U7FB 2GFQA 1UIMA 3NUGA 3CR7A 3UHPA 1ECPA 4OHOA 2IA5A 5E9JA 2ZYUX 3LLSA 4XIYA 3CS3A 3PRKE 2V7UA 3DBRB 4NU0A 5KVVA 4D6XA 3ZN2A 4DMFA 4BEWA 5LOVF 2R6JA 3L4BA 4TLEA 1DQZA 5T8KA 2H1OA 2EWWA 1X1QA 1APBA 3F6RA 1RYDA 3JQ8B 1VPTA 3DLCA 4CFYA 3R3HA 4AMBA 2BUAA 3K9NA 4XD7D 2W5UA 4PPQA 5KTTA 4G86A 2PJRA 3DO6A 4OA5A 4YRJA 1VRVA 4MRNA 3UMMA 4L5JA 4C3ZA 4Z4GA 4J0KA 1KS2A 1P1RA 3D5QA 1VE9A 3BK7A 3I09A 4OJTA 4UE6A 4OI0A 3BE8A 4ZPJA 1M9NA 1C4XA 3DXFA 4TTAA 2AL7A 1ZBDA 2CBXA 1I3MA 1Z38A 2EDCA 3EZNA 3PUHA 1JJBA 2FRXA 2QYSA 2ZR7A 3DP7A 3QK7A 4ZVNA 2I54A 3D7RA 1PO7A 4TYMA 2WHXA 4D4HA 3JD0A 4PZAA 1ODFA 1JBKA 3VYTB 4YT2A 4M3NA 1L7VC 4P36A 3DM9B 1KEVA 4G0ZA 4U39A 1EA5A 1QO9A 1SXJC 1OTYA 4PYIA 4AX8A 3M4JA 2QGNA 4RAOA 2BRUA 3ZK9A 1IRXA 2O1SA 2QRKA 3FNRA 3TD9A 3UMFA 2XF8A 3D02A 5ITZA 3A4NA 2GBIA 4HJXA 4QECA 1CNMA 3SP1A 5F9HA 2GEUA 1HRDA 1W9MA 4IHJA 1O95A 1XI2A 3MQ4A 3P9NA 2FW1A 3FHLA 3PC3A 4AECA 2F43A 4ND5A 5JMTA 5ADUS 4DDWA 4KR7A 3PWSA 2WYHA 2O1WA 4KO3S 1BGWA 2VF2A 4HDQB 4I4TF 1ZI6A 1MOZA 3HFJA 5IBQA 1PW5A 2XZOA 4M0CA 1BDBA 1PJTA 3LDUA 2XBLA 3CLUC 2WAOA 5GZ6A 1NXTA 2REXB 3I92A 1Z29A 4Z8YA 4C7VA 3TSOA 2XWBF 4IFIA 4IWXA 5U4XA 3DMTC 1EM8B 3K35A 2PE5A 2IIQA 3M70A 1W94A 4FD3A 1MOSA 2XXAA 5ALWA 2JHAA 2Q6VA 3KTAA 3ZWOA 5CFZA 4WCFC 3CUEF 1HPLA 1A88A 3GBPA 4Q4HB 1AB6A 1WOYA 1ZVMA 3CC8A 3ORSA 3QPBA 2ZIUB 3P9CA 2FPIB 4IHQA 4X1OA 5CBPB 2B7BA 3KPWA 1TZ2A 3RRYA 1FPMA 1RR6A 2AH5A 1RYEA 1JB1A 3K9LA 4F5WA 1XN1A 1U1FA 1ZC4A 1DX6A 2H00A 2NUTB 4FEGA 4UJ3A 5DSXA 4W5RA 1YZYA 3RSLA 5ELMA 1JTVA 5K51A 2OXEA 5GJBA 3H8WA 4BVLA 2DUJA 5HIKA 2CNOA 4B4UA 1U5AA 3LU1A 2A6PA 1C7IA 4S2EA 4CEHA 4HUJA 1A9XB 3INTA 3GDFA 1VJDA 1DJPA 5EMMA 3LVBA 4BGUA 4YHBA 2D0PB 2D3TA 3D4PA 3VX4A 3KQPA 4RS4A 1BJRE 4JLWA 4I08A 3V5NA 2ENUA 1AQJA 4MW1A 4WA7A 2CYCA 1BDJA 1GPLA 4HMPA 2VATA 3TTXA 1B6RA 2IPMA 3H6GA 3I9KA 2Q1XA 4OYHA 2YRWA 5A5GA 4K26A 3BWVA 1SVIA 2EFYA 3G9TA 3WBKA 1ZD9A 4YI5A 3UZUA 1ZXLA 3OZFA 2GRUA 4PX5A 4U6SA 4RPKA 5G41A 2VJMB 1CV2A 3JVVA 5FUMA 1D6JA 3CZ9A 4HS9A 4XLLA 4FWTA 1DAEA 2W43A 3HYCA 1QONA 3N75A 1TADA 4I66A 3KJHA 3NI2A 3R5JA 1CZNA 4OP3A 4YCCA 3D6MA 2J7PA 3RVDA 1MIOA 4EY5A 5JTUA 1NRXA 1DJOA 1ZA2A 3O4VA 5FPSA 1EFUA 2Y05A 1ZBQA 3KWFA 3PIIA 1R6XA 4FTWA 5DTQA 2ERXA 3N2EA 3UH0A 1T0PA 3FUWA 4QPPA 2L42A 1AZTA 3W6NA 4CT0A 3WQBA 2C31A 5A4DA 3SXPA 1WMAA 3JARB 1KYVA 3SHTA 1MCZA 4CIWA 2IPOA 4RFSB 1A0OA 1OBVA 2XPCA 4UZFA 5JATA 4RMNA 4L22A 2WF9A 3S8EA 4GUDA 3C7KA 3NV9A 3ZX5A 4P5PA 1YO6A 121PA 1GUAA 1NUPA 3L1HA 4LRSB 3V3KA 4YHHB 5ALNA 4OUDA 1TVEA 1E1RD 1RBZA 2BDEA 2YRXA 2AFIE 2VQDA 4RVCA 3GT3A 2VWHA 4JUCA 2MMGA 2PH7A 4F6LA 1ZRMA 1J8YF 2BVNA 2VJPA 4QGSA 2O8CB 2XW6A 2B1GA 2G36A 2QTVA 821PA 4C20A 1VZ2A 1UBJS 3PKIA 3QE2A 1FP7A 4M8IA 4J3NA 2VPYA 3LP8A 3RC9A 1KIFA 2ZPTX 1NVKA 4IBOA 5I4CA 1UPXA 3I04M 5I7RA 1OILA 2NQTA 4YP7A 2AHRA 2C8JA 4JBIA 4WGGA 2QD2A 2DFDA 3TLXA 1BIFA 1FUUA 4FHDA 4PAGA 4YAEA 1SCUA 3WFIA 2W8BB 1WSAA 5CYOA 3AR5A 4BWYA 1P44A 5AM4A 3AVQA 4M55A 4EJMA 4UBIA 4TMWA 2QUBA 5LU8A 1MO6A 3D59A 2XKBA 1E79D 1S2IA 2B61A 2HDHA 1K4YA 2VDMB 3FHJA 3NPAA 3G6KA 4RKWA 5JADA 3MS2A 3JASA 3WGYA 2CE2X 4HAOA 2FZKA 1N1GA 2GASA 1TJ5A 3GP5A 5EY5B 2YICA 3QEAZ 3T1VA 4B09A 3SSMA 1CERA 1LB1B 2PL1A 5E4JA 3U37A 1H85A 5L9AA 2BGIA 4Z0NA 2QVZX 1DT5A 2FK8A 3FVWA 5IC5A 3VTAA 4TTJA 4DCSA 4EB3A 2GK4A 1P4HA 3GLQA 4NMHA 2AF4C 4PCLA 1JEEA 1X87A 2HU2A 4IS3A 2G82A 1A8HA 1NSFA 4R9RA 4ES6A 4PS1A 5TQ0A 3EWNA 2JDID 5K3EA 4DWVA 1NVVQ 4M76B 1OMOA 1X7ZB 3JQBC 1SXJA 4KYUA 2VYVA 2FSPA 3D1VA 2DY0A 4ZC8A 5IDYA 2ZSFA 2BFFA 1JWBB 3QKIA 2HOQA 2HZBA 3K6RA 3OPVA 4CKXA 3BAFA 3E7DA 5J2UF 2ZAYA 1Z15A 2EW8A 2IYEA 4AU1A 4D3ZA 1XKQA 4EECA 1EAMA 2NV0A 5HKKD 4R83A 2BJHA 4E6EA 3DDCA 1WETA 2HT1A 1Z4MA 3ZI4A 4JJFA 2HTEA 4J8PA 2X0FA 2XGGA 221PA 4BX9A 4PBSA 4OQNA 4KYIB 5E4YA 5KC9A 1G291 2Y1WA 4JI1B 5IG2A 1XZLA 2IRWA 5B1IA 4D80A 1OYWA 3M2PA 4CHTA 1OVGA 2H2HA 4LGMA 5T4EA 3LHSA 3KX2A 1PX0A 3ILHA 4LJ8A 4Y6LA 3GQBA 4J2OA 2QVYX 4WCFA 1CUEA 1GCIA 2ECOA 2QL9A 3HEBA 3IS3A 1BE8A 5EQJB 2GAIA 3RARA 2KE5A 3E03A 1FUKA 2BM8A 2DT8A 2ZQ5A 2OHJA 4O02B 1SUCA 4GDMA 1BHSA 4TN1A 4TV9F 4BVBA 4CV2A 4HLQB 1N5OX 3D5TA 3ZZUA 1VKZA 1AURA 3OUZA 4JT8A 4F38A 2ASVA 4TL6A 2AYXA 4NESA 4EFDA 4YJ3B 1AXGA 5JNLA 2H48A 2QPLA 3F5FA 1ONBA 3N3AC 2AFHE 3AKEA 1XZFA 1QOQB 3AR2A 3IKTA 2C3UA 3EOZA 3B3JA 4QJIA 2HWXA 2H5LA 4F9EA 3U4QB 3BSSA 3KQOA 4JT4A 3BRCA 3K6KA 3N0VA 2HW8A 3OAAD 1N8NA 5D85A 3O9ZA 1SA0B 1LY1A 3L0CA 5G1NA 1ONNA 1A5TA 4HLUC 4WY5A 5KTPA 1OXTA 1D3AA 4AICA 3N2NA 2HA2A 1RMYA 3ICQB 1I6LA 1LQUA 3BXHA 2E5LB 3GX1A 3H5LA 3NDJA 3T4XA 3SAJA 3SHVA 1OWLA 1WULS 4EHBA 5BNZA 4CF7A 4R9VA 4ZI3A 5EJ6A 1GYPA 1SM4A 4XLZA 4C2TA 2I1WA 5BN5A 3RDPA 1QGED 3O8NA 2C42A 3AM3A 4O1IA 3SDZA 4TZ0A 1DLJA 4XJSA 3ZD7A 1IQRA 2EZ8A 1XV5A 2CMFA 3CRZA 3K9WA 4MYHA 4RD3A 3VR1A 5LMCA 4AF6A 5IT9A 1UXJA 1AKEA 1U0OC 1HETA 1GLVA 1VSBA 1YHNA 2AD5A 1L5HB 2Y8EA 3ADPA 3BB3A 3H5RA 4LQCA 4MQFA 4NEGA 5FAKA 2FN9A 1NFFA 2IT1A 3H05A 4B3FX 2BH2A 4HWOA 4NZOA 1W1IA 2RMKA 4B3MB 5EHQA 3GRVA 4B6JA 1XJ5A 2N9UA 5I9MA 4WI1A 4GEGA 3A4VA 3F98A 2JGDA 1QX4A 4XZ3A 4A1FA 3HP1A 1F4PA 4C3VA 4R7GA 2XZPA 2F2TA 1JKMA 5JNRA 1CHNA 4FSXA 4EO4A 3CF6R 1NVDA 3EBLA 3H1GA 2ACWA 2HLDA 3R3JA 1BEZA 2Y68A 7ADHA 2R5WA 2ZUDA 2FZWA 3PTAA 2PMWB 4HKTA 2DCUA 5DJ5A 1V5WA 2V6BA 2J30A 3OE7D 4GMFA 4LECA 4Z9BA 3HU5A 4D9NA 4MUIA 1A4UA 3WHPA 3JY6A 2DR2A 1NRIA 2YWRA 2XDQA 1OI3A 2JIZA 2W48A 5EMNA 4DS3A 3SC2B 3O26A 2NW6A 2BFAA 2OOSA 5DP2A 5GWXA 3ESCA 3ZDYB 3HBFA 3IV9A 3FPFA 4NCJA 3NH9A 5EYPB 3PHJA 1DKUA 3N86A 2Z2YA 5ALOA 1B76A 3W2IA 1S8AA 5C35A 2BMEA 4LPKA 3LOPA 4BV3A 3QU7A 4JROA 4E1VA 1IAQA 1L8AA 2AZMA 4S1NA 2W6ID 3AJEA 2Q3EA 8ABPA 1USUA 2ZATA 3Q3IA 4M7PA 4TRNA 2WSBA 3TPCA 3DTVB 3CONA 1MJNA 5I3ZA 2XX3A 4Z2AA 1EK6A 4F1KA 1WKVA 3T1TA 1SKAA 3EPLA 2RHCA 1JPVA 2AT1A 4PRYA 2OMKA 5EXEA 3V2IA 4BFXA 3SCZA 2ZWPA 1X9IA 1T5DX 3TGWA 3DBHA 2AEEA 1FP4A 1SNYA 3MERA 1JSCA 1NDHA 2VJKA 2IC5A 2ZW9A 4DCTA 2N75A 3KAJA 1EFPB 3P32A 3UT5A 3WADA 2JBAA 1X92A 3HZOA 3CBGA 3E8MA 4G5GA 4HSEA 5AP9A 1J5EB 3HA3A 2N42A 3TGPA 4C6TA 3V8VA 1JXOA 1ZMRA 3FHTA 4UHFA 3GLFB 1ID8A 3TRFA 1OX4B 3K70B 1UJBA 4AF8A 2OSVA 4KDEA 1MJGA 2W2QA 4FSHA 4FYVA 3BF7A 4ADSG 3KVNA 3MVEA 4F2GA 1PCXA 3GEBA 3JQBA 2JFOA 5G3ZA 4Y6SA 1XYGA 2JHCA 4RX1A 3MWDB 3SSOA 5AUQA 2RHLA 4ODIA 3VKHA 4KXLA 3JRXA 3UJDA 4RO0A 4BZWA 1LS6A 5BRNA 3DCIA 2JNWA 5FUBA 5BSEA 1W0KD 4QBHA 3ZDXB 3UWOA 3GEMA 2X0NA 3WNQA 5CYGA 3BBLA 3O8QA 1P6QA 4FN5A 4QBGB 1NI4A 3D8BA 1DVRA 1EGVB 1XAGA 4B3DA 1E5LA 1PSWA 3WLQA 1ZM2A 3GYBA 1ONPA 3ESQA 4BEBA 2FUG6 3C8DA 1P8JA 1V2GA 4QEKA 1DQPA 1WXQA 2D2FA 4XWGA 3CJTA 3A04A 4IIGA 1YNSA 5BWBA 3RUHA 1OAOA 3RRFA 1R0WA 4AZ0A 4AUEA 2P7HA 1JG7A 2FRDC 1KHHA 3WQSB 4FE3A 1KVSA 1UC5B 3TK1A 2MR6A 2NT3A 1K4KA 3WK8A 2OHHA 1B1AA 3WL8A 2WTNA 5KO2A 3EVDA 4L0MA 3DE6X 1E1CB 2POQX 1WUJS 4OB7A 4X1YB 4EVIA 2PT9A 2FSIA 5CG1A 2O8EB 2R6DA 2C4NA 2J3HA 4CI0B 4CV1A 5KVAA 1GTRA 2VP3A 4C2BA 4WV3A 1MO5A 2XXBA 1FVHA 4GYYA 1IZZA 5D1HA 4J90A 3O1JC 3K0CC 4AZ3B 2G17A 1P29A 3A3NA 1XJCA 1PK8A 4GR9A 5C34B 4H6PA 1HKUA 3IUJA 3DKPA 3M8KA 2C2KA 1QO0A 2ZITA 3TB4A 1W25A 1K6XA 4A0SA 1NULA 3P97A 1T2CA 3EXHC 3QX7A 4RVGA 1U7OA 1VMDA 3DMNA 1T13A 1O0BA 4TXJA 2P68A 4M9CA 4GDFA 1X74A 2P8SA 4HLUA 5E38A 4RF5A 2SCUB 3CKYA 4TTQA 1VSUA 2IU6A 2NU8A 4I5DA 5IT4A 3OD1A 1HO3A 4B6FA 2C5SA 5EP2A 3RM3A 1XZ8A 2ZBUA 1RHMA 2QBYB 2DEUA 1LDYA 2OCKA 3PNMA 1RQGA 1H0KA 2IF0A 4LFCB 1O54A 5L6MB 3IQXA 3C5WP 3DVAB 3F6EX 3RSCA 4ZIRA 5JSZA 3D1JA 4GVLA 3PWZA 4MW9A 4U2KA 1EWVA 4XWWA 1AZWA 4R1NA 4TZ6A 3HVRA 3FZEA 1DO0A 2ISCA 1T4BA 4AYWA 2NUBA 3N39C 1PHRA 3JR3A 5KX5A 3M1AA 2XEDA 4B80A 1N2JA 1G9XA 4BCBA 4EKIA 3F71A 1BQEA 3UK7A 2RI6A 1OKKD 4H18A 2VNIA 1T2EA 1HORA 3IE1A 2HBYA 1PZHA 3FUXA 4QYWA 5E2AA 3X1DA 2IP1A 2Q8QA 2P69A 4I2NA 4E22A 4K3VA 3JQQA 4D99A 3FNFA 2WICA 1I14A 1FFBA 1GG8A 4O5OA 3WBFA 3ZHYA 2IODA 2A0XA 2AEFA 3PPYA 4YJHA 3ID6C 4XQGA 4ZYXA 1Q0PA 1E2GA 3IV6A 4EYGA 3B1XA 1I2MA 3RS7A 4LV6A 4PLPA 3IVCA 2ZVJA 1JHMA 2OAP1 3DHWC 4HB3A 3MMXA 4BN0A 3GFQA 1P74A 1N8TA 1NN0A 3KEQA 3B1ZA 5CBKA 2P6RA 3JQ7B 3MLAA 2HREA 2G6TA 3MIZA 1GUZA 4NJMA 3NJ4A 4B5KA 4DT1A 3DD5A 4EOGA 5TLSA 3CTPA 6GPBA 2KM1A 3OJEA 4BO2A 2WINI 2F1IA 3ECCA 5JQWA 2PD3A 4YUYA 1W36C 1GRRA 3CZQA 1FMFA 1ZHHA 1KVRA 1LUAA 1EVQA 2G63A 3QUAA 3CE9A 1N5IA 1CB7A 5BNWA 5I7HA 5JWOA 1HZZC 3OJFA 1AKTA 1MU0A 4EEZA 3BTUA 4CU2A 1FXWA 2H31A 3D0RA 3QVMA 3NHUA 4GLLA 3K6SB 1YNOA 2Z9DA 1TMKA 1XUOA 1H2EA 1OC2A 1NQVA 5JJLA 2HV9A 1ORWA 1V2HE 3RBXA 3JW8A 4M1TA 4BKRA 2W6JD 3DUWA 2JFFA 2EYQA 1YBMA 4DKJA 1FDSA 1RQRA 2ECQA 2Y6VA 1UQRA 1SULA 4XQEA 1R27A 3I01A 3MGKA 2PUGA 2PWYA 1TKAA 1QRDA 2FKAA 2PL9A 1ULZA 1NDUA 1TTQB 2W4QA 3ENWA 4TZTA 5CRIA 4DRZA 4JJ6A 3AB7A 4B82A 3IHLA 2PUBA 3UC9A 1P91A 2YBDA 3E5HA 1UFKA 2VF4X 4BQNA 2I67A 4KWEA 4PWYA 5HOQA 2ZXUA 2ZJ2A 5KWIA 3CJQA 4QDTA 4EENA 4PYLA 1V7PC 4WACA 2EHJA 3BXEA 1AGNA 1SVLA 4G2NA 4NATA 5HEKA 5LQMA 2OV8A 4MV3A 4MAMA 2HCTA 3CF4G 4CG1A 1W76A 3DAPA 1I51A 5EIOA 1JQEA 4ENQA 1WW2A 4IGIA 3OE4A 2LE0A 1R9MA 3A1CA 4K28A 4H60A 1T8UA 4GBED 4R9NA 2C99A 3K2BA 4RHTA 5TQ2A 1NVFA 2JA2A 2P2YA 3MOIA 3TAHA 5LXTF 2OCLA 4GZ6A 1VL2A 1Y8ZA 1G2OA 1TCVA 3N2GB 4QXOA 1M2FA 5LR6A 2C5FA 3K1YA 3PRHA 4ME6A 5C32A 1KYQA 2PX6A 4RTLA 2QYHA 1NL3A 3L8EA 4TV8F 4LXIA 1DTWB 1KE1A 4OBXA 1T1JA 5CVUA 3U7EB 1EDBA 5FJIA 5IDWA 2AG6A 1V8ZA 4BMCA 4RTOA 3AL3A 3D8UA 4HDKA 4M9RA 4W7SA 3OVMA 1J1IA 3Q2KA 4R54A 3PBKA 3TZEA 3KOOA 3IAAA 2J9FB 2JIDA 1E98A 5FADA 3HB5X 1POWA 1T5IA 2JD1A 4KVAA 3ZYZA 1MO2A 1N3LA 4HB2A 1ZGHA 3E1KA 4W9MC 1PNQA 1LBQA 2AFIA 1Z47A 4GD3Q 4S1PA 3ME5A 1QC5B 5IM4A 1NY6A 2GJSA 3WK7A 1Q7TA 4QGFA 3FGZA 1EVEA 2TECE 1K86A 3GPDG 4I5FA 4A15A 2F9FA 1DJNA 4P3KA 1I1HA 1RRVA 3T9DA 3P2IA 2G0AA 2HEIA 4UBKA 3K05A 1U28C 3TN7A 1M75A 2ZRCA 3CNLA 3WOVA 2QD5A 3ZVRA 4C6RA 1EKXA 3BFPA 1KI8A 3C97A 1UOEA 3E2IA 1BDIA 1XALA 3CLSD 3GROA 4GZMA 3EWSA 3V3TA 2CUTA 3K0CA 2Z5VA 5FWDA 3RD5A 1WHSA 4AG3A 3WIUA 5KKCA 2I6FA 2GZ2A 1BAPA 4MINA 3GLGB 4I50A 1UMKA 5FKJA 5FNVB 2P6PA 3ZWPA 1V9LA 3KZKA 5A62A 3EXHA 4UKDA 4DSAA 3N2KA 1CR1A 4B83A 1TVKB 3SM3A 2C03A 1UBOS 2HNKA 2I6GA 1Z07A 4CTMA 2IZZA 1GKUB 2CNBA 4IIDA 1SUDA 4EFMA 4IJKA 3R3SA 3LCCA 1H0HA 1RXCA 4QA9A 3ZQ4A 1QAQA 4PLGA 5FHRA 3VM6A 2XNSA 4MW6A 1OBOA 2O3JA 5ADHA 3AVUA 1TQ2A 2WP0A 2RH4A 5ER6A 4PN3A 1S6YA 4IDDA 4UQOA 2WAYA 3WV4A 4YRRA 5KNDH 5SY9A 1TK9A 3H1BA 1IEQA 4N65A 4PHGA 1N75A 3FTCA 1QORA 3N0XA 2YRFA 2P0YA 1DEHA 5I7WA 2ZJ5A 4RV5A 3B1JA 4GPAA 3L9WA 3M4NA 4W1PA 2HRDA 2IXEA 1EFVB 3W2TA 5DDIP 1F2UB 1U9ZA 3VHLB 5BVHA 1K2WA 1A04A 1SQFA 2ZBRA 1U99A 2ATEA 2ZIXB 1S9HA 3A1WA 3B70A 3PDWA 4NZYA 3UB3A 5LJLA 1UDCA 4V0ME 2QD4A 4MA0A 4DGQA 2QUHA 2W37A 2QRVB 2FDRA 4B3BA 1FLAA 1XKLA 3VNBA 4QDKA 3ISJA 4MGHA 4L2IB 3RR2A 3HC7A 2GF2A 3F6YA 1W1UA 4DAOA 4I1VA 3RVOA 1Z56C 3RADC 3FCUB 4QOEA 5LA6A 5M29A 4DNQA 3B8HA 5JRJA 1ND6A 1H5NA 1TT5A 2HMAA 2ICAA 1QK4A 2W2LA 4RADA 4X1KB 4DC1A 5T4FA 2WU4A 4NKRA 2HYIC 1TECE 3U4IA 3EUAA 1MW8X 2AOUA 3BEDA 2WVHA 4FHFA 3KQUA 3S7TA 4N41A 3DMHA 2NLOA 5K2OA 4R3NA 4OQLA 4BP8A 1CUFA 2XWSA 5CT8A 3KUXA 4O2BB 5GIOE 2LPMA 2WF6A 3FUVA 4J29A 4HGNA 4ZEMA 4G1UC 4KXFB 5LUAA 1RWNA 4FFVA 2P4QA 1M0EA 4HX2A 1GNRA 4UFOA 5DM4A 1E2IA 2QN3A 2VPZA 1B0ZA 3UT6A 4GP9A 4MPRA 4D44A 1W59A 2AFHA 2Y66A 1D2NA 1HZZA 3GHYA 4Z9AA 4BN4A 2PH1A 2OBLA 3LDHA 3ITEA 2IYZA 3NEPX 1RRKA 2C2XA 3Q1KA 2EKPA 2I4RA 2KB0A 2XGSA 3R6DA 5HIJA 4F0JA 2WFLA 3GARA 1XELA 2PN1A 5I3CA 2XTMA 2ZU6A 1M2OA 1U8FO 2GO7A 4GLFA 4I0WB 1E6MA 1DXOA 5H7XA 3OZXA 3ZHCA 4AY4A 5C46F 3K3PA 3EEOA 1RPTA 1KC3A 4GOLD 1BDHA 1OY1A 1H1LB 3H13A 3K9HA 3FTFA 5GONF 2JGEA 1DQYA 5HKLA 2Q46A 1J90A 1HEIA 1P73A 4KX3A 1OFVA 2ZIZA 2IUUA 3U3JA 1DWOA 2O2YA 1RYYA 4G2TA 1UDRA 1KEUA 1CD5A 1KERA 3QWHA 3H19A 4PU0A 1GTMA 3KS9A 3CN9A 3W6UA 3ZCPA 3CGWA 4P3NA 4M0LA 1L7NA 5ECGC 2TYSB 1A9ZA 1IFXA 3OEEA 3NKLA 5D3ZA 5AWFC 1QIFA 3WIDA 2YFKA 3M6AA 1RLMA 2AQKA 4HX5A 4E14A 4LZJA 3DQPA 1Y7HA 4UTXA 3D4LA 2A0UA 3GJ7A 3CVWA 3EGCA 4D9CA 1JJIA 4R7ZA 4QFMA 1VL1A 3VR3D 1CY2A 2Z2IA 4YVFA 4V3BA 4B7XA 2CFRA 4PY2A 4F97A 1PT8A 1F8UA 1W4BA 3EXIB 5JZMA 4D26A 3ZW7A 1J5XA 4CV0A 1RXWA 4HGQA 1BYUA 2FSSA 2Y1LA 3EDCA 2B8WA 2XECA 2X5OA 1B41A 4MB6A 3C3CA 1KE2A 3DXXA 1T4CA 2WSSA 4B74A 2QE7A 2QNBA 1UPTA 3PQ3A 4N39A 1WTCA 1S89A 4HAYA 2ISQA 4TTPA 1A76A 1YQDA 3H2JA 5LBUA 3LP5A 3N87A 1OFTA 2GXUA 2YOFA 1FP2A 3BD6A 3PNVA 4BMZA 2RARA 3ZHRA 1WQ4A 4CNQA 1OJ7A 1KARA 2DXIA 1RJ9A 2EJCA 3LDAA 1SIUA 5JQGB 3ROQA 3BREA 3U44A 5J2TB 2GVZC 3FYUC 1M6HA 1YQQA 2FEWB 1C1XA 4YCSA 1DBIA 2AE1A 1U28A 3QUSA 1EVZA 5JASA 3OM8A 2PA3A 2YWCA 3H3JA 1PDOA 4QHYA 2PZLA 3OEYA 2KPOA 4U2DA 1KFKB 3R6WA 4AS2A 2CN1A 2OHGA 3MJTA 2JHGA 3NGLA 3O83A 4KVGA 2P9QA 2W58A 2WP8J 2Z58A 4LUCA 1D1TA 2XXJA 3KBBA 2I78A 1SN7A 2IGBA 2FI1A 3QPDA 4L9AA 5REQA 3ENQA 1TAGA 1R1DA 2R8RA 4X63A 2HJHA 1PTJC 4DR5B 4QGHA 3ZDBA 3QF7A 4W8GA 2QZPA 4IYRA 4LF8B 1ZCZA 2BL4A 3PU6A 4D6YA 3OF3A 2OECA 3BXPA 1RXSA 4A26A 1Y4UA 5LNK6 2P35A 3AU9A 5ALSA 4X6XA 4ALLA 4XTRA 1XYVA 3ASUA 2WFMA 3SR3A 1LW7A 4I4CA 1YL7A 4NYJR 3RVRA 3H5AA 2R8OA 2OQRA 3B1VA 1FQWA 2P6OA 2CUNA 2IOYA 1E9RA 1L5ZA 4QUIA 4ZCSA 3TRIA 2WSYB 1VOTA 1IXYA 5BV7A 4KGZA 4PPNA 3CVOA 2VPPA 4AMUA 4ZOEA 4DFDA 2DKOA 3EMKA 3EIWA 1Z4NA 4AMVA 3AHGA 3O90A 3O47A 1H2XA 4JP8A 4NE7A 5DBOA 3ETLA 4ZEXA 1QZZA 3RT9A 4ARAA 4HNVA 4B3RB 3C6ZA 2XVXA 1A4XA 3MTGA 3ASVA 2YVAA 2XCQA 4B81A 4HXGA 5A4IS 3INRA 2RC5A 2HXGA 1DARA 3OOHA 1BQ4A 1ZS9A 1RI5A 1PZXA 4TXHA 4H6VA 3RUCA 2PKXA 3UFXA 1JLSA 4BMDA 2J3EA 3SY8A 5A02A 4B84A 1FQOA 3FOWA 3IH5A 5CM2Z 1IJKA 3BJIC 4FCWA 4DY6A 4XH9B 1XRLA 3U4DA 5IZ4A 1PEDA 3H8VA 5KAPA 5JD6A 3G2KA 3FZQA 5F7JA 3BWCA 5HYVA 1MDBA 5U4QA 3ZE6A 1CF9A 1EG7A 3QVOA 4NRDA 5IU6A 5FWYB 3IUQA 1T8PA 1XD9A 1PK7A 5JJKA 4W99A 3PWTA