4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
4ZJUA 1DJQA 1EFLA 4XQ9A 3WS7A 1CQJA 3G17A 1BXZA 1C0LA 4TQGA 5U9CA 2YDYA 3D4NA 3K2EA 1JU9A 2WSBA 1E7YA 4CLDA 4CV0A 4JBHA 2YYYA 4CM8A 2J3JA 1F8GA 3N7UA 4OMUA 1T4BA 3IAHA 4Q3CA 5A5FA 1X0XA 4EUHA 4RZHA 5COQA 5CEEA 1NYTA 2VHXA 4J7XA 3VTFA 1KEPA 2V6BA 4MVJI 3QE3A 4I5DA 1HXHA 2Q3EA 1T2FA 4DIBA 5I7VA 4CR8A 4B3HA 1N2SA 2O48X 4CLOB 5F1PA 4W7IA 5CDYA 3GN2A 4BIIA 3DBVO 3FWNA 3VKVA 2BHLA 3TDKA 3L4SO 4NJMB 4CR7A 2X7HA 5ER6A 2Y1FA 2J5KA 4XR4A 4YTEA 4F45A 2X9GA 2B36A 4E4YA 3I9KA 5CP8A 1NVTA 3Q3CA 1UDAA 3RU9A 3JD1A 4I9HA 2GNAA 4BNTA 2CDAA 1P1JA 3ZDFA 3QWAA 4HFNA 1PJ2A 1YB5A 4YJHA 3ICCA 3WB9A 2C07A 4A0SA 1Q2XA 3ETEA 4RVGA 4OSPA 3WSVA 4WUVA 2W8ZA 2PZJA 5F3RA 1NAIA 1JA9A 4KP7A 4L8VA 2QG4A 3LT0A 4RF5A 4PLHA 1PU2A 1ISFA 5F21A 3RFVA 1NFFA 3ZWMA 1E3SA 4BO4A 3KETA 2X4GA 1MXHA 1U7TA 4WLVA 3WTCA 1XYGA 4ZICA 2QRLA 1GPDG 5JAQA 4FIZA 4ZN6A 3K30A 3BMNA 1NVGA 2PFGA 3PDJA 1DRVA 2O23A 5JCJD 2NVWA 1PX0A 3NGLA 2EJWA 4CMGA 3ST7A 1GUFA 2NU8A 4U8GA 5T57A 2IRWA 4WLUA 5TC4A 1ENZA 4Q39A 4XGNA 1MX3A 4R54A 4UREA 4CM5A 2WJPA 3AUSA 1I01A 1GCUA 2PNFA 3PIIA 1Y8QB 3BTVA 1CERA 1W73A 2OBYA 1BSVA 1GDHA 4DRYA 4NJOA 2CY0A 2ZJ0A 2EW8A 7ADHA 2B4TO 2G5CA 2F1KA 3GAFA 1IUKA 1DAPA 4R1TA 4YT5A 3INRA 4B3IA 2W90A 3CZMA 3HHPA 4N5LA 1F12A 4AJ2A 5HRUA 3LF2A 3IKTA 1RYDA 1Y9EA 1O5IA 3IS3A 4GSKA 2NQ8A 2X9VA 4ILKA 4PRLA 4BNUA 1WLYA 3DMTC 5GZ3A 3RUFA 3VZRA 5IFLA 1EMDA 2JJYA 3DDNA 4K28A 4DYDA 3SEFA 4NZ9A 4R51A 2RH8A 4FS3A 1WDLA 4L4XA 1ZUD1 3PRJA 1UH5A 2AE2A 3H8VA 3L6EA 3QVOA 2OP0A 1Z75A 4CUKA 5THKA 4J43A 1BGVA 1ARZA 4E32A 5BQFA 4AL4A 1E1KA 3HN7A 4E3ZA 5BSFA 5A1TA 2VHZA 2FR1A 4U0JA 1L7DA 1LA2A 3E9NA 1LLDA 3AUUA 4CV1A 3TL3A 4ZRNA 4U0KA 3PJGA 2DLDA 5I9NA 5JYDA 1LRJA 3H5RA 4LW8A 1N5DA 2AA3A 3H9QA 3D4PA 3GVHA 1WXDA 3JQ7B 2P9GA 3A4VA 1H5QA 3WGYA 2C59A 1K89A 3I23A 4HFRA 3TWOA 2V6MA 3ROMA 4Z0PA 1NPYA 3FCOA 4MO2A 2TMDA 1RWBA 3Q1LA 2EXXA 2Y1DA 1EEHA 1FMCA 4IJVA 3MJTA 3IIEA 3ABIA 5K0ZA 1H6BA 2BGKA 3W6ZA 4LRSB 1N1EA 5G0TA 4U6QA 4FFOA 4NBUA 2AG8A 3MZ0A 2PKQP 4RVUA 3T4XA 3BHIA 3C7AA 4J4TA 3VH3A 1SAYA 2XOXA 4EW6A 5JYEA 4CM9D 5KKAA 5DDIP 3VPHA 3KXDA 1DFGA 2Q4BA 3UAGA 4O6VA 3GHYA 2PZMA 1TT5B 3IUPA 4MVJF 4R5MA 5TRTA 3WTBA 4NHEA 5I8ZA 5IXSA 4PLZA 3RSHA 4TMFA 3U5TA 1MUUA 3RASA 3OHSX 2BFOA 3BAZA 1KVRA 1ZZEA 2DPHA 3PWKA 1UDBA 2NVBA 1YBVA 4W99A 1ZMTA 3RJ9A 5BSGA 4RF3A 5JY1A 3K96A 1KOLA 1ZSNA 3T7EA 3ONEA 1YGYA 2YV1A 3SJUA 2HO5A 3W4JA 1FF9A 4ALLA 1B16A 3VH2A 1YWGO 3I4FA 5I7EA 4BNHA 5FF9A 2OGUA 1R0KA 1CWUA 1NAHA 4BO8A 4DC1A 2X9NA 4YJFA 2QW8A 5B12A 3GVPA 1YQDA 4GX0A 4D44A 1ZK3A 1MGOA 3RFXA 1WZEA 2I76A 2P4HX 2RHCA 4HKTA 2P2SA 3GN1A 5G4KA 1K3TA 4YR9A 1FDTA 3NT2A 4YT8A 1OBFO 4MOWA 1NQAO 2GO1A 3SC4A 3VOSA 4CLRA 4BVAA 2BI8A 1MXFA 2QZZA 4XIJA 4D3DA 3I9LA 3VH4A 1AHHA 2OHXA 1VM6A 1E7QA 3ZU2A 1L7EA 4II2A 3GZNB 5IDYA 1U1IA 2DTEA 2X22A 2FP4A 4NMHA 1E0DA 1DHRA 3O26A 3D3WB 3LT1A 3JYOA 5B4UA 3LT2A 3M2TA 5DOVA 3WQRA 4B4UA 4BQRA 4NJMA 2IZZA 2CDCA 4E5KA 1TLTA 5JDIA 3GQVA 4GI2A 5AQ1A 5L4LA 5HTOA 1LXCA 3KO8A 3OSUA 4B4VA 3OP4A 2PY6A 1DRWA 2EHDA 2EKPA 1I3NA 2FSSA 3IUSA 4GVXA 1K6IA 4IMPA 4DLLA 2JL1A 1SB9A 3AWDA 1HTBA 4AJKA 5JW6A 5C7OO 3FWZA 4CR6A 1P45A 4CUZA 3RKRA 2E82A 2WD7A 2IXBA 5A05A 2OXIA 4A27A 5KTKA 1HDYA 3PJFA 2AHRA 4BO3A 1LRLA 2X6TA 1T2AA 5BNTA 1RYEA 1B8UA 2AQ8A 1G1AA 1ZJZA 3CMCO 5JPIA 5I9MA 1ADCA 4K26A 2W2LD 2NUAA 2XF8A 2AG5A 4QECA 3O8QB 4GWGA 4EDFA 2VN8A 3DBLA 5LC1A 5J23A 3QW2A 2OFPA 5KNLA 3DTTA 1E6UA 3H2SA 2B83A 4R1SA 1ZK0A 3H9JA 1LRKA 1R4NA 3JQCA 3L9WA 2FZEA 1A4IA 1E3WA 1P0CA 4ONEA 3K6JA 3PEFA 1KETA 2WMDA 1U28A 1WMAA 2D2IA 3E5MA 1M75A 4EYEA 4B4WA 2J8ZA 4E2ZA 3JYNA 5FFFA 4BGVA 1UZMA 1LBEA 4IDFA 2HMUA 1Z6ZA 3VVCA 4EJMA 2WD8A 4TROA 2TMGA 1YL6A 4DIFA 3PHHA 3O9ZA 4J9UE 3DZHA 4PLVA 3ROQA 5EL0A 2PV7A 1UXJA 1ZVMA 3VHRA 4RPGA 1VSUA 2C2XA 3GOHA 3V2GA 4CUJA 4OJNA 4IQ0A 2G1UA 3R3JA 1FXSA 1H6CA 4I1IA 5AXDA 2HMSA 3DC2A 1Q0HA 2EIHA 2ZCUA 5IN4A 3U09A 4Q3AA 4FD3A 2P68A 4XB2A 2RCYA 3CSDA 5ICMA 1EE2A 1I33A 3KB6A 1B0AA 3F47A 4RVHA 2NM0A 1YDWA 2J3KA 3AI1A 3I4CA 4W82A 1X7GA 1DRUA 4RQUA 4G81A 1ZK1A 1MP0A 1WNTA 3U4HA 4PZDA 1I10A 2HKIA 1E7MA 2W2KB 1SZJG 1MA0A 3DAPA 2VCYA 1M2WA 4R1NA 4ND5A 2P9CA 3BMQB 4BGEA 1M76A 3INGA 4AJJA 4J49A 4CMHA 4CQLA 3OJOA 4BO7A 1EVIA 4OKNA 3ZU4A 4FFNA 4N18A 4OSOA 5ITWA 3JQ7A 1PS0A 3H5AA 3IP1A 1LQUA 3IJRA 3MTGA 1EK5A 2O50A 1Y8QA 5A9TA 2GN9A 5IZCA 4IDAA 3OJEA 3TZ6A 5C5IA 4RCVA 2JD2A 2DTDA 3KLPX 1RJWA 1M6WA 5JNLA 5JS6A 3OECA 5KJ1A 3FTNA 4HXYA 4WNCA 4GGPA 4EI2A 2VYNA 3ANMA 3GDGA 3OIFA 3GAZA 4FQ8A 1CRWG 2PD6A 4NBTA 1YB4A 3RQSA 4CV3A 4ZQGA 5CEFA 5JDCA 5KJEA 2EKQA 3GC6A 5B37A 4TZKA 1JAXA 2X1HA 3I6QA 1R15A 2J5RA 5T5QA 1Q7CA 4FJ0A 3HB5X 3GG2A 2Q46A 1H0KA 2C54A 4W4TA 4LSWA 1PTJA 3L4BA 4YBZA 4PZEA 2PLAA 4J6FA 2VZ0A 4BO2A 4NDNE 1QLHA 2NVUB 3SLGA 4LVUA 5GMOA 4M86A 1TB4A 3TZHA 1NFQA 3FNHA 4QXMA 1IYZA 4PFJA 5I8WA 3OFSA 3QVTA 4YAJA 1QG6A 3GEGA 3NTQA 4NBRA 3VC7A 3ZW9A 4J7UA 1B8VA 1E6EA 3UKOA 1DHTA 4JP3A 4F6CA 1MFPA 4MVJA 2BF7A 4J16A 4LSMA 1PSDA 2FRDA 2GR9A 4YJFB 5HWSA 3PZBA 5DN9A 1BXKA 1Y5RA 2CVOA 2WD7B 5CAEA 5GZ6A 5DCWA 1XGKA 2NTJA 1YL7A 3GMDA 5H83A 2JFFA 1AXEA 5CDUA 4YAIA 4BMNA 2C7GA 1DIBA 3QJ5A 4IXTA 1QYVA 2PGLA 5KVVA 4AJLA 3ROPA 3GG9A 2OORA 4CMEC 3LVFO 3D5TA 4RJTA 1K2WA 1WPQA 1CJCA 2OP1A 3KSZO 1T26A 4Q3NA 3ZNPA 3I9OA 4N5MA 1UZNA 2A94A 3BXXA 4H16A 1QSGA 3G49A 1J49A 3S2GA 2H63A 2D59A 2BGLA 2CUKA 2VYVD 3R3SA 4M87A 4TRMA 5CDSA 1JLLA 3CUKA 3PDUA 4KUHA 2GN4A 1J5PA 3UOGA 2VTEA 2ZB7A 3S2EA 5BSHA 4IUYA 3FBGA 1X13A 3D64A 4BL5A 1VKOA 2ZYDA 1ZEJA 3H9GA 4A7PA 1C1DA 2VUTA 2CNBA 3AI3A 1N7HA 2O3JA 4LK3A 5A4DA 4FB5A 4D0RA 2CF6A 1KYQA 4U5QA 2FSVA 3GH3A 3GNSA 3ORFA 2B5WA 4YJDA 1H9BA 2O3SA 2X5KO 4QFDA 4FN4A 5JSFA 3IMFA 2FMUA 5G0UA 1DC6A 3E9QA 1ZXLA 4MVJM 1HSOA 1I8TA 3X2FA 4OOFA 1HSZA 1J6UA 4Z3DA 2PD3A 1A72A 4BGIA 3GRKA 1AXGA 3ZWVA 4RQTA 4E2XA 5FI5A 4NI5A 1NQTA 4CMBA 4YXFA 4XB1A 1EBUA 4XCVA 1B3RA 1WAMA 5DP2A 3D1LA 3JQ9A 3EY4A 3LLVA 3MJSA 3ROKA 5L53A 2E48A 4IQGA 4MKXA 1EDOA 4XKJA 2JCXA 3I52A 2Y67A 3PYMA 3VPGA 4DPMA 1UR5A 1DFIA 3RC2A 4CM8B 1UP7A 1TT5A 4TRRA 2DT5A 1BG6A 4ND1A 5LDHA 2EV9A 2P9EA 3CMMA 2OO5A 1BDMA 3OMLA 3WQSB 4IQ8A 4J4HA 2DFDA 2VNAA 3QVXA 2JFHA 3FBTA 1PJLA 1DEHA 3IOYA 4R68A 3DB2A 5IXYA 4E5MA 1DO8A 1UJMA 2JAHA 4NNJA 5L3ZA 3JQGB 3GRPA 1K0UA 2GCGA 2R6JA 1HE4A 1X1EA 4BHTA 2PA3A 5TJ9A 1VI2A 5CG1A 1DBVO 1EQUA 1NM5A 4FFLA 4P4NA 3TQHA 2FZWA 1DIHA 4BV8A 1U5CA 1HYEA 1HL3A 1HDXA 4MVJD 4YB8A 1RM4A 2VWGA 4FGWA 4BO6A 1OFGA 4URFA 4Z6KA 3KYCA 3OA2A 4YWJA 1PGOA 1EBFA 1MG0A 1QKIA 5DCUA 2C5EA 4IGFA 3KSUA 3CE6A 3NJ4A 4ALIA 2PH5A 1GYQA 1O95A 4BNLA 4CLXA 2IEBA 1U4SA 1IY8A 4CMCA 2JHGA 3WWZA 4HWKA 3JQBC 4KOAA 1AGNA 2VNSA 4L74A 4Y6RA 5L45A 3NV9A 1E92A 4R41A 4G2NA 1ZK4A 3O8QA 4EGFA 2W98A 1UAGA 4JROA 2ZQZA 5DT9A 1SNYA 1IE3A 3MOIA 4DPLA 4IJKA 3AUAA 1IZ0A 3OIDA 4D46A 3EZLA 1PIWA 2VWPA 4J2HA 3AK4A 2I67A 4UEKA 5TNXA 2VWHA 1GADO 1VE9A 3DHEA 4HP8A 2HU2A 3TZKA 1UP6A 3E18A 4LN1A 4BNIA 1DLIA 5EN4A 1DOHA 2VOEA 3GGGA 3JYLA 2O4CA 4EUEA 5JAIA 3NDIA 4BNFA 4J1TA 4RPKA 5JMWA 2J5QA 1KVQA 3F1LA 4XIYA 1A9YA 1PJ3A 1U2DA 2HK9A 2LDXA 3DZIA 2Y1EA 5BSEA 2VYVA 4E21A 3E03A 4B8WA 1LUAA 3OQBA 1C0IA 2FY8A 3INTA 1AHIA 1ZCJA 5DP1A 1Y5MA 2NQTA 4O5OA 1DC4A 4WECA 5JE8A 1R6DA 2P91A 4MVJG 1SO8A 2OL4A 3JQFA 4GH5A 5FEUA 1CYDA 3RC9A 3JQ8B 1PEDA 2CZCA 3A06A 2NU9A 3ONDA 1ISMA 4DUPA 1B3BA 1KIFA 1PWXA 1TEHA 1VC2A 1UAYA 3RUDA 4B79A 5A03A 1MFZA 1DXYA 4BNGA 1CDOA 3OF2A 2W4QA 1YRLA 1PWZA 1H6DA 1T2EA 3PHIA 5CFZA 1P1FA 2HMWA 1C1DB 1GYPA 3BHMA 4XRRA 4WNIA 1P1KA 1ZIDA 4AJ1A 3M1AA 2VWQA 2Z1NA 4BO5A 1YE3A 2E4AA 4OH1A 4RF2A 2Q2WA 2EJVA 5T6BA 2X86A 2NADA 4YEDA 4DMMA 1ONNA 2I6TA 1JVSA 2FHSA 1T1SA 1IPEA 4WASA 2Z5LA 2NLOA 4P8RA 1ZNQO 4EBFA 3WYEA 1OAAA 2B69A 3PHJA 2QYSA 1G0NA 1SOWA 3I3OA 4NFYA 4XDZA 4BO0A 3ZV3A 1KY5A 4IDBA 2UUPA 4JX8A 1ZXBA 5ICSA 4PG4A 4KWIA 3ANLA 1GQYA 4JNKA 1XQ6A 4AJEA 1JKFA 2GSDA 3QWFA 1JKJA 3GMSA 3QRWA 5ER9A 1HDOA 4DQXA 3KUXA 5BNFA 1CF2O 4YQZA 2X0NA 4UEOA 4XWYA 2DBZA 4NIMA 4G65A 2DC1A 3IQDB 4L0QA 1ZSYA 1MLDA 2GASA 3IL2A 4MP8A 5EINA 1ZFNA 1QYWA 2Y66A 4BNJA 4J3FA 1LDGA 4BMSA 5IF3A 1HKUA 5IZ4A 5JC8A 3K8ZA 3STHA 2BGMA 1IL0A 1Z45A 4CL3A 3OBBA 1Q7BA 4WCFA 3WJAA 1X14A 4WLOA 3C8MA 4DYVA 4R1UA 3C1TA 2E49A 2Q45A 3RWBA 2YFQA 5IJZA 3ZNQA 4RPHA 1E5QA 3BYZA 4CM6A 4XYMA 3B70A 3EK2A 5G0VA 3KRTA 5KWEA 6LDHA 1TT7A 3PGXA 1GV0A 1U3VA 3BA1A 4O1MA 3CTMA 2PWZA 3BHJA 3BTUA 3DZFA 3EUWA 3S1LA 3FR7A 4YRAA 2CDBA 2I3AA 2LDBA 5L4NA 3DBRA 1GEEA 1SOVA 4JQCA 3ZWCA 2QQ5A 2Q2VA 3WDSA 3RBXA 2PZLA 4Z3KA 3NYWA 3UFXA 3KYCB 5F1KA 3CPSA 1Q1NA 4RDIA 1O89A 3KYBA 1WVGA 1UXIA 4C7JA 1GZ3A 3E1KA 5IAAA 1BHSA 1KY4A 1S6YA 2EWMA 2YUTA 5AVOA 3ICPA 3RBVA 4FFRA 4D42A 1BXGA 1Q0QA 2HJSA 2WWRA 4CMIB 3FNEA 3HQ4O 1C1XA 2SCUA 3W8EA 2HK7A 3CKYA 2Q2QA 5F5NA 1H2BA 4C4OA 1N92A 4M89A 4XRGA 1R4NB 2H9IA 4JJIA 2AE1A 3KLMX 1N9GA 3RUIA 3HB4X 1MG5A 3ADOA 2BI7A 1KC3A 2NVUA 2Z95A 3C3XA 4IDCA 5A04A 3WGIA 4BNYA 1EVZA 4IMRA 5EPOA 3UICA 3OJ0A 4AJPA 3AOEA 4I9UA 1KEUA 2UVDA 3EZYA 3AOGA 3QP9A 1P1HA 3AY3A 1G6KA 2YQ5A 4OO3A 4PCVA 1V0JA 3UCFA 3VZPA 1NBOA 4WOJA 1D1TA 3V1UA 1FDVA 3G0OA 3A1NA 3O38A 3OICA 4GX5A 4J1SA 3RAJA 1C14A 3UCEA 4PVDA 1JAYA 1SPXA 3FD8A 3PHGA 3ENKA 1WMBA 3QWBA 4ZU3A 4B7CA 5ADHA 3ZN2A 4IDDA 4TRJA 1UZLA 1B7GO 3V2UA 3DMYA 2VQ3A 4XA8A 1SC6A 2ZK7A 3NRCA 3WQQA 3C7CB 4I8XA 2AQHA 2QRJA 2DKNA 4IXWA 3HWRA 3UVEA 2DM6A 4I5EA 1LDBA 2GZ1A 1PZFA 3L77A 1FDWA 1LNQA 1DLJA 1X7HA 3L4BC 3P19A 4XYGA 3WBFA 5G4LA 5L4SA 2DU8A 2PH3A 2EP7A 4E2YA 5B1YA 4JP2A 4J0FA 1UXKA 4FOSA 3WGOA 1PZHA 3K92A 1WWKA 1A4UA 4IBOA 2RAFA 3NKLA 1E77A 1XWFA 1Q0LA 2DBVO 3HDHA 1GEGA 3CIFA 3VDRA 3GZNA 2IE0A 4GKVA 4J7CA 3QVWA 5CDGA 5I9LA 1OI7A 3N74A 1E5LA 4Y9DA 4TKLA 4BNZA 3HFSA 4R4JA 3SJ7A 1ENOA 5THQA 2BLLA 2IDZA 3EC7A 1N9GB 3DAGA 1R16A 3NUGA 3F6YA 3Q2KA 3QVSA 3RIHA 1XG5A 3UF0A 5HM8A 3ZHXA 2IXAA 3W4IA 2GERA 5JLAA 3EVNA 4J0EA 1Y7TA 4ZGWA 3NT4A 4IS2A 3PQFA 4CMEA 3KTDA 4BS9A 2O3UA 3E9MA 3ZU5A 4JIGA 4D45A 2JD1A 1I2ZA 3ZNOA 1GL3A 2HMTA 2YZ7A 3B1JA 4BNWA 4DA9A 4QSMA 1NP3A 4MPDA 4MP3A 5C7IO 3L0DA 4HNGA 3TOXA 5FYDA 2YY7A 4XEHA 1LLUA 3H4VA 1ADGA 4XZ3A 3QY9A 3NJ8A 1V8BA 1NR1A 1UXGA 2DTXA 3ZNNA 2WE7A 1A5ZA 2HDHA 1WZIA 4F3YA 1UDCA 1X7DA 3GR6A 1JWBB 1GU7A 2Y1OA 1JWAB 3A9WA 4YQYA 5EESA 2P5YA 4E5YA 3SVTA 2ILTA 2ZTMA 2C2YA 1JQBA 2CD9A 4BNVA 1NXQA 1YOVB 3EGOA 5TX7A 1LEHA 1VRWA 1ISIA 3AOEC 4UVGA 2B5VA 2Q4EA 3WOHA 1H93A 4DREA 3TSCA 1Z7BA 2I99A 4CODB 3AM5A 3V5NA 1KEWA 4E13A 3W4KA 1F17A 3I83A 1GAEO 4WLEA 4YCAA 1N7GA 4KQXA 4J91A 2YDXA 1XCBA 3UHAA 2DQ4A 1GUZA 4EEXA 5K6AA 1W8DA 1E7WA 4GGOA 1YKFA 3GFGA 3JQ9C 4AJIA 5L51A 9LDBA 1E3LA 4PG8A 4ZRMA 3AW9A 1ID1A 2UUOA 4LCJA 2VUSA 1HYGA 4HY3A 3WGQA 3HADA 5DULA 3D0OA 4XQCA 3KV3O 3GT0A 4TVBA 4NG5A 1BXGB 1BRMA 3DHNA 4CMAA 1NASA 1PJBA 3RUHA 4OM8A 1K5HA 1E1NA 4E30A 2BH9A 4Y98A 5JCJA 5C7LO 2WE8A 4Z9YA 4YACA 2NU7A 2ZTUA 3O03A 4QO7A 1I32A 1XA0A 4PIVA 1ZO8A 3PIDA 1XR3A 1XKQA 1ADBA 4IZIA 2POQX 4W6ZA 4CM7A 4Z9XA 5T8KC 3G1TA 3RVDA 4L76A 5JMPA 2Q1WA 3GPDG 1P74A 2ZKLA 4RPLA 2DBRA 4BO9A 1EUCA 2W2KA 1I30A 5KCZA 2RH4A 1X15A 4JGBA 2X58A 3HZZA 3GPIA 3NT5A 1I36A 3DQPA 3JQEA 1RM0A 3TFOA 1A71A 3WGZA 3PJDA 2F00A 3LC1O 2WYWA 4X54A 5C37A 2NTVA 4HFMA 3ITDA 1W0CA 2D1YA 1E1LA 2BFAA 2CMDA 1HYHA 3GDOA 1Y6JA 4S1VA 7MDHA 3MTJA 3G3EA 3DO5A 1YDEA 4PVCA 2NSDA 3VPFA 1DC5A 1K6JA 4MVJH 4FFPA 3RUEA 3E8XA 4IZHA 5TJHA 4Z0TA 1NPDA 5A3VA 1JKIA 4ND2A 5L7TA 1O6ZA 2G0TA 4OXKA 2WDZA 1E7RA 1LI4A 3IKVA 4J1NA 4MIOA 4OKIA 4CQMD 3W6UA 3OETA 4YPOA 2FWMX 4EEZA 1HEUA 2A92A 1LLQA 1V3TA 3I5MA 3GY0A 2HSDA 4IS3A 1V3VA 5ES3A 5KIAA 4L75A 2CVZA 5JDIC 2NWQA 1BW9B 3PK0A 1GZ4A 1ZJYA 2O3TA 2HRBA 1LDYA 4QQRA 3MWDB 1LSJA 3WIEA 2Q1UA 1PR9A 2J3IA 1PGQA 2EEZA 1LTHR 4CLHA 3HDYA 1X1TA 2Y93A 2PGJA 1EVYA 2X23A 3AU9A 3ZHZA 4CM9A 4R3WA 3LZ6A 4NFHA 4WCFB 2B4RO 2V6GA 1T2CA 1I2BA 5MDHA 4FOOA 4FGSA 4G5HA 1U3TA 2J3HA 1PJQA 3C1AA 4LCEA 2YV2A 4OOEA 1ZEMA 1VL6A 3WR5A 3TPCA 4E2WA 4M49A 4GL4A 3NDRA 5AXAA 1LU9A 4TKMA 2DPGA 1T24A 1XQ1A 4ZD6A 3U4CA 4PG5A 1Y8RA 4WK6A 4YT2A 2ZJ1A 2YHUA 3M2PA 3MEQA 4FJ2A 5KJFA 1GV1A 1LDEA 1M66A 4BNXA 3U4IA 3C85A 1P31A 3JQBA 3H65A 4YRDA 3VKUA 1HZZA 3COSA 5EIOA 5T8KA 5ILGA 2J6IA 2IODA 5JFOA 5JXWA 5EQFA 3LYLA 1HRDA 5CPBA 5TQVA 4I5FA 4R3NA 5DCYA 4XGIA 3GNQA 4DC0A 1Y81A 4NBWA 3NX4A 1P77A 3VZSA 3SBOA 1J0XO 2X5JO 1KBZA 3D3WA 1NHGA 2PR2A 3AFNA 4IM7A 3F1KA 3BTOA 4CM4B 2PTGA 2PK3A 1M6HA 3PHLA 2UDPA 3FI9A 3R6DA 1P33A 2GUGA 3KM0A 3JQ6A 1JVBA 2FPGA 3TOZA 3U0BA 2DAPA 4F46A 3PP8A 1IULA 2JKVA 1HDRA 1GUYA 1SEVA 1GQQA 4ID9A 4ND4A 4QO8A 4XJTA 4UUMA 3ZWYA 3ZWXA 4CMKA 4HADA 4S3MA 1EK6A 2HJRA 4UAGA 1IOLA 1G0OA 3F4BA 3ON5A 3D4OA 3QWIA 4LMRA 4RF4A 1U9JA 3CZRA 3W8FA 3ZWAA 2VHVA 4B8ZA 3I9NA 2A35A 4UUNA 3RUAA 2PD4A 1VJ1A 2Y0CA 3EHEA 2I3GA 1AE1A 4ZQBA 3JQFC 3DAFA 3RC1A 3RD5A 2QX7A 1ADFA 1Z82A 4IIVA 1PR3A 5TS3A 4K1LA 3V1TC 4BKPA 3TJRA 3PGJA 3ZHYA 3M1LA 2VUUA 3BTSA 5T67A 3TF5A 2JCVA 4R69A 4WLFA 1XELA 1L1FA 3DOOA 1PJCA 4P38A 4JJGA 2FR0A 2O4UX 4N7RA 5TIIA 4RZIA 4WOKA 2RHRA 3WYBA 4RL6A 4WJZA 3ASUA 4D3FA 2G82A 2VHYA 3OQ1A 1OC2A 1QLJA 3OH8A 5F5LA 4WGGA 3WMXA 3BMQA 4OXNA 3S2IA 2BD0A 4EITA 1O8CA 3TFQA 3L07A 4BKRA 3EW7A 2CSUA 4JBGA 5IDQA 3PVZA 4YYZA 2V6FA 3ZZNA 3D3EA 4HUJA 2DVMA 4IGEA 2PZKA 3RKUA 5A9SA 2QZ9A 1B26A 1OMOA 4JXKA 2ZYGA 1F06A 4H3VA 4QUKA 1SBYA 2CVQA 5JDCC 4AG3A 3NTRA 1K6XA 4GLLA 1I3MA 1PQWA 1U3UA 3AFMA 3U9LA 1EQ2A 1LX6A 4OAQA 3FNGA 3RU7A 1C0PA 3ZWWA 1IB6A 4ALMA 3MJ4A 2BRUA 4K6CA 1ZMOA 4M1QA 2EG9A 4OQZA 3DZKA 2X0JA 4FCCA 4EJ6A 1O94A 3QA9A 3VH1A 1YB1A 4KUEA 3P7MA 4FBGA 3C24A 5JCXA 3GVXA 2WYUA 1DIGA 3MJVA 1XHLA 3WLEA 4D7AA 3MOGA 4NK5A 4BNMA 3NAQA 1DIAA 2EF1A 3ONFA 4RO0A 4FW8A 5COAA 4GAEA 1N8KA 3GGPA 4HV4A 3WICA 3P2OA 5B4TA 4E33A 4FDAA 4IJWA 3GA0A 4MVJE 1D7OA 3HE3A 1KEVA 1P9LA 2D0IA 4NQZA 2D8AA 2GN6A 1MC4A 2I66A 4BQPA 5IN5A 2GZ2A 1YL5A 1WDKA 4I08A 3VDQA 1QV6A 2AEMA 4XYBA 4KMSA 2P4QA 3EMKA 5TF4A 4HBGA 3JD3A 5JY6A 3FTPA 3DZBA 3BMCB 3LLSA 3H3FA 3GUYA 1CQIA 4NR0A 4L73A 3WYCA 1WDMA 2B4QA 3ULKA 1TA4A 4CM1A 3HSKA 3JQDA 1BW9A 4ALNA 3GFBA 4MKRA 1XLTA 4PN3A 2NACA 4W9NA 5DZSA 3HDQA 1YJQA 1I2CA 2GD1O 4QTZA 4P4LA 2YQ4A 2DFVA 3JD0A 4OIMA 1SMKA 2HAEA 2JAPA 4DMLA 2Q49A 3RJ5A 5L95A 2YHIA 3ETDA 4R5HA 3WFJA 3T4EA 3TZCA 3K73O 2Y1CA 4GBJA 1B2LA 3DR3A 2O3QA 3HN2A 4OXYA 2QRKA 1XU9A 4BO1A 3AI2A 3L6DA 3K5PA 1PGPA 1QORA 2D5CA 4HFJA 5G2OA 2VRCD 3D5QA 4I5GA 1TI7A 5G0SA 3HDJA 1I24A 1NR7A 2H5LA 3LF1A 3UH1A 3TRIA 4JN6B 2JCYA 5U1PA 3OJLA 4DLAA 2HQ1A 4PGFA 5GY7A 3X2EA 4JCOA 1R37A 3SXPA 2ZB3A 2AQKA 1B15A 2GLXA 3UN1A 3OQ6A 2HUNA 1D3AA 1FJHA 1HDCA 3VZQA 2H1SA 1GZ6A 3CXRA 1VKNA 4BNKA 3I6IA 2NTNA 1YBAA 4DGSA 3DZJA 2EW2A 3DBHA 3KSDO 4WCDA 5AXCA 4KUGA 2GYYA 4YJGA 4KDEA 1YOVA 1O0SA 2I65A 5FWNA 5KOIA 4A10A 5A9RA 4U7WA 2YJZA 1HDZA 1C3VA 1GQ2A 1R66A 4YT4A 2Y0DA 3ZU3A 4CMJA 4W7HA 3GUCA 3H9UA 3IC5A 2A9FA 2Q1TA 1PGNA 1VJ0A 1QP8A 2D5AA 2UAGA 3BMNB 4A26A 4DIOA 2Q50A 3GLQA 4KQWA 4PLCA 3VPSA 2B37A 1CEQA 1FDUA 4B3JA 2G17A 4WEQA 1Y9AA 3H2ZA 4Q3DA 1PQPA 3TNLA 4LRTB 3I9JA 5I7SA 5A9SB 1U2GA 5HS6A 5BT9A 4U6SA 3ZV4A 1NFRA 4AICA 1B8PA 3GVCA 3I1JA 2XXJA 5KVSA 2Y05A 2Y99A 3WBBA 2HMVA 1U4OA 5H81A 4GPD1 2W2LA 4JJFA 3HUDA 3P2YA 2V65A 4KDFA 3QHAA 5COBA 4A2CA 5KVCA 3PFFA 3PTZA 4OQYA 2UYYA 3GK3A 1UP4A 4XDYA 2FOIA 4W9NC 1EFKA 2Y1GA 1KC1A 1YQGA 3H5NA 3S2FA 1NQ5A 1T1RA 3PQEA 1JDJA 4GMFA 5L40A 3Q6IA 2VHWA 1A27A 1U8FO 3FF4A 3OA0A 2ZQYA 5IDXA 4RDHA 1ZK2A 4IINA 1KVSA 3SX2A 1P3DA 3RUCA 1P44A 3ETGA 1VLLA 3PYLA 2Y68A 3W8DA 3FRJA 3VVBA 1E1MA 5JO9A 4XQEA 1PS8A 4YJGB 1GYRA 3LDHA 4CLOA 5K6AC 1U8XX 1IZ9A 1HETA 4B4OA 3A28A 3WLFA 3OEYA 3K9QO 3NEPX 4IDEA 1FDSA 4MVJP 1EVJA 1F0YA 4NH4A 4K9DA 3DEYX 4A5OA 2WEKA 2X0RA 4RVDA 3RCBA 4K6FA 4O59O 1DJNA 1GCOA 5JBIA 4DQUA 4DLBA 5DF1A 3KZVA 1BWSA 1XDWA 1QYCA 3BIOA 3GDFA 1KERA 1PL7A 4XGKA 2WYVA 3AJRA 4O63O 4PLFA 5CDTA 3F3SA 1E6WA 1KS9A 3QLJA 4RLHA 1I3LA 1VL8A 4FPXA 5IDWA 1M67A 2HLPA 1JTVA 1GTMA 1PS9A 3BMOA 2HRZA 3HFGA 5JAZA 2VT2A 1NNUA 3AY7A 3GEDA 1WP4A 1HWYA 2IZ0A 1LJ8A 2VT3A 3GF4A 3NTOA 3OIGA 3RBZA 1CETA 1D1SA 1W6UA 2YHIB 3ASVA 3HJAA 4QT0A 5EERA 1YJ8A 1WW8A 1ZSVA 2BELA 2VYND 3PLRA 2VRCA 2C29D 4WPGA 4L4RA 2NU6A 1GFSA 3C7DB 1T2DA 4UVIA 3CINA 3RROA 1DB3A 3Q9NA 3VPXA 2CFCA 4AJ4A 3JD2A 1QYDA 1YXMA 2RIRA 3FR8A 3PQDA 4J9VA 4UVEA 4PG6A 3H7AA 4CQLB 1V6AA 2JHFA 1I0ZA 3EDMA 3F5SA 4FC6A 5FI3A 4LMPA 4GMGA 2WTBA 3DTYA 1LSUA 4DVJA 4EZBA 4UVDA 3WWYA 5EQDA 5TGDA 4Y67A 1IHYA 1P1RA 5HBRA 4J2OA 1QXSA 4QX6A 2O7QA 1NHWA 3LQFA 4A73A 1H9AA 1MV8A 3ZWPA 5ENVA 5TLSA 1ONOA 4IPTA 2BMAA 2AEJA 3H6KA 4O0LA 3DHYA 3DXFA 4NU6A 4AFNA 3VAZA 3AM3A 4J90A 4DWVA 3DBLB 1MC5A 4XYEA 3GZ4A 1EUZA 3V1YA 3AUTA 2C5AA 3O4RA 4GLOA 3D7LA 4GWKA 4P4GA 3Q0EA 2O2SA 3WNVA 4GKBA 2FN7A 4DQVA 2YFHA 3E48A 5CHEA 4NK4A 3LC2O 4ZQEA 5K9ZA 5L7YA 2AEFA 4XQGA 1PJTA 4B7XA 3KYDB 4UEJA 4D41A 2HK8A 3Q9UA 1F14A 9LDTA 3SLKA 2JFGA 5EMHA 4R16A 1ZKMA 3KHUA 4RV9A 2EP5A 1B14A 3PZRA 1HZJA 5DBFA 1SB8A 5F1OA 1RM3A 4OL9A 5U4QA 3OEWA 1ORRA 3PWZA 2C0CA 4J4BA 4RGBA 5A02A 2Z1MA 1EZ4A 3ZH2A 2YW9A 2XXBA 3KEOA 5DOZA 1PQUA 4ROSA 4UULA 4EUFA 1D8AA 3JQAB 4MKZA 3L6OO 3TL2A 3U62A 4II3A 4QEDA 4OHUA 3AM4A 2D3TA 4Q3BA 3GEMA 5IZCC 2D4AA 3JD4A 5KKCA 2X8LA 2I9PA 4MDHA 4TZTA 4YAGA 1R12A 2XAAA 3OM9A 1RKXA 5MGBA 4CL8A 4GQAA 1PGJA 3IJPA 4DXHA 1UXHA 2I5PO 2ZATA 5TT1A 5KVQA 4OGWA 1SEPA 1I5RA 1MB4A 4PLYA 5AYVA 1PL6A 3DZGA 3B6ZA 3A14A 1C1XB 4PRKA 4AVYA 5L7WA 4OYRA 1ML3A 1HE2A 2H6EA 2P5UA 2ZTLA 1R4MA 3UCXA 4PLGA 3RC7A 1E3WB 3MJCA 4DTIA 1NTOA 4YVFA 1LC3A 2ZTVA 2IYOA 3ENNA 1CIVA 5H82A 3JV7A 3TZQA 4AJNA 2VOJA 1ISJA 3FPLA 4MINA 4R01A 3WXBA 4E12A 4AJOA 4XYLA 2IEDA 3JYPA 4QFCA 4ZQFA 1KVTA 3K2BA 5CEJA 3ZCXA 5T64A 2XPCA 2EGGA 4TVOA 1LC0A 2Q1SA 4GX2A 2BKAA 3CH6A 3ZGYA 1QMGA 3DFUA 3DOCA 3ANNA 3DWFA 1V3UA 1LSSA 4NPCA 3TN7A 4RLSA 1YO6A 4XD2A 4RPJA 1C0KA 2GN8A 5G4KB 3WFIA 2O2YA 4LVCA 1ONPA 3G79A 2E6UX 3LT4A 5I7FA 4CLRB 1DDOA 3JQ8A 1EE9A 2QHXA 2OZPA 4B7UA 5BR7A 1BVRA 1BTOA 2OBNA 3K31A 4MIYA 2GDZA 4HNHA 5L9AA 4ND3A 4CMIA 4A03A 3U4DA 1Z7EA 2GRAA 3DBHB 1EDZA 4L4SA 1NX6A 2BFMA 2YV3A 3GGOA 4M55A 3ZV6A 3WJ7A 3DMTA 3KBOA 2ZB4A 3W1VA 1GY8A 2NV6A 1Z73A 2AQIA 2PKRA 3SC6A 4PLWA 4C7KA 4CQMB 2DBQA 1U3WA 1RPNA 3EVTA 1KVUA 2UV8A 4Y6PA 4YDRA 4KTVE 1U7HA 3PFWO 1PL8A 3UW3A 2IYPA 3AU8A 1JN0A 3PXXA 1GPJA 4YA6A 1Y8RB 5KJCA 1ISGA 1NQOA 3ZI0A 1DIRA 2QYTA 6ADHA 1LQTA 1P0FA 3JQAA 2ZYAA 3DOJA 1E3JA 1H94A 4RVFA 3MJEA 2OUIA 1AN9A 1W4ZA 4BKQA 4D43A 5ILOA 3EYWA 4NU5A 3QSGA 1ZBQA 1PZEA 2DUUA 4HX5A 4XR9A 5A06A 1A7KA 1P1IA 4D79A 1YH3A 5KJ6A 1J4AA 3S8MA 4CM3A 1LDNA 1VJTA 3BZUA 4BB6A 5A5EA 1V9LA 4IDGA 5BNIA 8LDHA 3U49A 3LC7O 2VTDA 3T7CA 3UUWA 4FSHA 3F4LA 4JK3A 5GZ1A 1BDBA 4CV2A 3KYDA 3DONA 4DPKA 3CEAA 4PG7A 2GF2A 4E6PA 1N1GA 1T25A 2AW5A 3WIDA 3N58A 4AJHA 2EGHA 1A7AA 4E5PA 1HF3A 1NWCA 2ET6A 2X0IA 4Y8VA 4ZVVA 1BMDA 4R9RA 3UXYA 5ITVA 3E5RA 4P22A 4BGUA 3JQGA 1H2HA 2A4KA 2ZB8A 1VSVA 3QIVA 1DPGA 2IZ1A 3PYXA 3WGGA 2R00C 1AUPA 4CPDA 2WM3A 1U5AA 2Y0EA 1DSSG 3E6AA 3FSRA 4PZCA 4EJ0A 4WE3A 4IY1A 3IDSA 5B4VA 3C1OA 3FN4A 2B35A 4DBZA 3ZWNA 4DL9A 1O9BA 2EERA 2GZ3A 3FHLA 1HLDA 3WGHA 2FPIA 3LU1A 4XJSA 3ZHBA 4FJ1A 3QWHA 2QIOA 4BNNA 3B1FA 5DBGA 1OOEA 4BV9A 1FK8A 4ZHSA 1VL0A 4KZPA 2DUWA 1Q7GA 5HS4A 1HE5A 3F46A 3DFZA 4DBVO 2ZCVA 4IJUA 4L9RA 4PLPA 4ALKA 3R0IA 2R2GA 2AMFA 4E31A 1D4FA 2PGDA 3L9XA 1I3KA 8ADHA 1DAOA 3QV1A 4LGVA 3Q2IA 4H15A 4F6LA 4TSKA 4YAKA 1E3EA 4CJXA 4KWHA 1QYXA 1LSOA 2EKLA 4N5NA 5HA5A 2X5OA 3WSWA 3WMWA 4D3SA 5LCXA 4CM4A 1YVEI 4BOYA 4Z9FA 4JLWA 3JYQA 3WGTA 1GR0A 4KTTE 2BFPA 1A9ZA 4GVLA 1X0VA 4RVSA 2V7PA 5JO0A 1VPDA 3RFTA 2O7SA 4BUCA 5AOVA 1Y1PA 4ITUA 4H7PA 4J1QA 4NFSA 1PJ4A 3ZW8A 1HLPA 3FNFA 3MCVA 4E0BA 3HG7A 4TRNA 4GSLA 1OZAA 1HT0A 3AY6A 3GNTA 3IP3A 4MIEA 4ZQHA 4INAA 1QV7A 4ZA2A 1ULUA 4YAEA 3NGXA 1V35A 3FPCA 3JTMA 3PLNA 4UUPA 2RBEA 3U3XA 1PZGA 1ZW1A 4LISA 1RM5A 4YJHB 3H3JA 2FR8A 1XEAA 3M6IA 3JQAD 4R9SA 4Q9NA 3JSAA 4MP6A 4JBIA 5IG2A 1R4MB 1DC3A 1IHXA 1QRRA 5ENDA 5TT0A 4BKUA 1EUDA 2C20A 3JCZA 1XSEA 4XX0A 3OJFA 2R00A 3MWEB 2OOSA 2AXQA 1E3IA 4E5NA 4I9NA 1TVEA 4UUOA 3LSYA 1E7SA 4WLNA 4FC7A 3Q11A 2Q99A 3GVIA 1ZH8A 3ZV5A 2GGSA 3PJEA 3GHHA 4PLTA 5JAMA 3UGKA 5G0WA 1NWHA 2FPPA 3G1UA 3DBRB 1IPFA 5EJ2A 4ESOA 1QR6A 1H6AA 1YBMA 4FFMA 2VZ8A 2OMEA 1ISHA 1LDMA 1YQXA 5JC1A 3S55A 4UVHA 4Z0HO 3PWSA 3KVOA 3BMOB 5AXBA 3KOUA 2NNLD 3KEQA 4D0SA 4Y6SA 2B0JA 4BB5A 2C82A 2O3RA 4WKGA 1DFHA 3I9MA 5DNAA 4M8SA 3F5QA 3ZWOA 1HE3A 1OC4A 1PJSA 2HCTA 2CF5A 3DL2A 3WG9A 3QQPA 2GPTA 4IIUA 4CQMA 4NBVA 1BVUA 1LLCA 3WNQA 1NPTO 1F8FA 3H9EO 3VTZA 1XU7A 4MJLA 4TWRA 4CLEA 1SCUA 1ULSA 2ZIZA 5C3MA 3V2HA 1ENPA 1R0LA 4N54A 3RI3A 1S7CA 4RORA 1UUFA 5DBIA 3PPIA 4YRBA 2VZ9A 2VRBA 1ENYA 3PI7A 4BMVA 1HDGO 4M54A 5TSDA 2E37A 4FR5A 5A3JA 4WCFC 3NDJA 5CG2A 2G76A 1NVMB 1T4DA 3P5SA 3R1IA 1GD1O 3B20A 3EAGA 5LDGA 4Q3EA 1R0SA 2C7VA 1XIVA 3WX0A 2JD0A 3V8BA 3F9IA 5CPFA 3ZWBA 1Z74A 3LK7A 1JW9B 1YONA 2PKQO 3BMCA 4BKOA 3E82A 3ADPA 1TXGA 3HNPA 1YS4A 3B1KA 3ITKA 4ALJA 4WEOA 4GX1A
chains in the Genus database with same CATH superfamily
4OX9Y 5C32A 5H80A 3RRXA 1N2EA 3NATA 4UNRA 3G17A 3KVVA 1BXZA 1YZUA 1XCJA 2TRSB 2NO0A 2EG5A 3D4NA 3T5DA 1JU9A 3TW8B 1M0SA 1P7PA 5AK4A 1AKVA 1Q17A 3RFCA 3N2ZB 4YCLA 3FRHA 4MWBA 4LOKA 4TTPA 3VMFA 2I4NA 5I7OA 4X44A 1P5JA 2AD1A 2ZSIA 1E1QD 1X0XA 3H05A 1J7JA 1VG8A 4RZHA 1MT0A 3LCCA 4YAWA 2VHXA 3R7WB 3VTFA 2NX2A 5M34A 1KEPA 2V6BA 4DHWA 4MVJI 2HM7A 1SVNA 3F7MA 1MO3A 3O1HB 5SY4A 5THXA 3TLJA 2Q3EA 3L8FA 4REOA 5I9IA 2RGXA 4FE7A 1T2FA 5I7VA 1L1QA 4Q66C 4B3HA 3AB3A 4CLOB 1JZTA 5F1PA 3PUKA 3DEIA 5CDYA 4Q4AB 3U7HB 1WQ4A 3C8UA 3ER8A 3F78A 3B78A 4MAFA 1KHHA 2EL7A 3F71A 4NJMB 4G5GA 1OX6A 1SXJA 1EXWA 1U1EA 1J5XA 5EC8A 2YR0A 4O4HA 1PEAA 3HO6A 4YTEA 5EZYF 2GBIA 3T3DA 4DV2B 4E4YA 4UXJA 3GRAA 5CVCA 3THWA 2WZBA 3LRXA 1BDHA 4FHZA 1AK9A 2F3PA 5KDLA 3B52X 1UDAA 1YAHA 4NAVA 4P0PB 4B73A 2H06A 3HV2A 1WKCA 3RDPA 5FWYA 5KTRA 5F77A 1CNFA 2G09A 1MU0A 4JJ8A 5H1YA 1G2QA 4HFNA 3KSBC 1S8FA 1PJ2A 5KREA 2RHBA 1JNXX 3RVNA 1RYZA 2GCPA 4I55F 3COJA 4RKFA 5FBHA 3WB9A 2C07A 2WICA 1M34A 4DGQA 1T9HA 4RGQA 2I6FA 1Q2XA 4B44A 4DJFC 2ACKA 1KK3A 1K7XB 1FFGA 2W8ZA 1VIYA 5IPFA 3M89A 3PUVA 4KP7A 3H17A 4L8VA 5FQOA 5H59A 3C6YA 5KOYA 3KETA 2G8LA 4UNSA 1E3SA 2QXYA 3HLKA 5BO5A 3NOOA 5AUOB 4KFUA 5KMGA 1DBPA 3P0JA 2YINC 2H5EA 2WMOB 3Q3HA 3MAAC 2NAPA 1I4TD 2P41A 4L6AA 4RABA 1QF9A 4FIZA 3DOFA 4R2HA 1W0KD 3K30A 4H31A 1P0PA 2ZYWX 3A2LA 1N6PA 2XRFA 1CQZA 1U8CB 4L2IA 3KFVA 1GUFA 3LUJA 2G80A 4NRDA 2NU8A 5LDDC 4B45A 5LUAA 5T57A 4WLUA 4Q39A 3M6UA 4DMCA 5KDDA 4PYRA 3KZKA 5IVPA 3AUSA 1P19A 1U8TA 3JWEA 1Y8QB 4Z86A 3ICQB 1FRZA 1VCIA 3MQ4A 1BSVA 1GDHA 3BGIA 3OTGA 5AM0A 5GV7A 5C8YA 4DCGA 4IXNA 2CY0A 4NJOA 2L2QA 2B4TO 4UJ5A 1X8LA 4XQ0A 1E3DA 4CDMA 3K35A 5I48A 1FE8A 2FGJA 5ALMA 3BD9A 1IUKA 4ZI5A 2HPZA 1T6ZA 4B3IA 1XEXA 2W90A 1KH1A 2FW1A 1QFZA 3HHPA 3KKKA 1F12A 3KQOA 4HGNA 3AF1A 5HRUA 3MHPA 2GESA 1SIBE 1Y9EA 3HVJA 4DUZB 3BT7A 3HO8A 3ER6A 2P9ZA 1FLAA 4WA8A 4O4HF 4DSOA 2NQ8A 2X9VA 3D8BA 4ILKA 3UNXA 3U56A 3N8KA 3R6WA 5DWQA 2V7GA 4M53A 3CR3C 1WLYA 4BYMA 2CE2X 4YLYA 3RUFA 4BMXA 5GZ3A 5IFLA 3A6PC 2PRKA 2XQIA 4HATA 2BFCB 3KAPA 4PSAA 1TGVA 4L4XA 3T7KA 1UH5A 2AE2A 3WRYC 1RWMA 4KYVA 1O2DA 4CUKA 3UGJA 4LI3X 3MWFA 1K0FA 1GQFA 1TUEA 2IOQA 2PSFA 721PA 1TLLA 3ANYB 2HQOA 3GBSA 4AL4A 5BQFA 4GVPA 3HN7A 4E3ZA 4J0KA 4NENA 5HKKA 3T9FA 2YMQA 4TUYA 3P9YA 5IC5A 3I61A 5D3QA 1L7DA 1NVBA 3AUUA 3IAFA 1CY2A 3TL3A 3DT8A 3HTXA 1HK7A 4I9GA 4U0KA 4INJA 1B1CA 2GM3A 3PJGA 1MO6A 3TRJA 4Q34A 3H5RA 4FWBA 4LW8A 3QUCA 4A0RA 1BROA 3LX8A 3ZWKA 1BDIA 5SYAA 1TK3A 2R1VA 3I12A 4B0OA 5KNCA 1J56A 4RY9A 2LKCA 5AMXA 3SKYA 1WXDA 1IQ0A 4ERXA 3I23A 2OZLA 1M72A 2RGEA 3Q0TA 4KGVA 4FQ5A 1D6NA 3QVJA 1PI3A 4X62B 3H9CA 4Z0PA 4F3RA 4MO2A 3QFFA 1V5FA 5CT4A 4ZI3A 1ZD5A 1RWBA 2EXXA 1VE1A 1EEHA 1Z5WA 1GPBA 3PGVA 4Y0NA 2FDXA 2ZRIA 3HZOA 3IIEA 1COWA 1UKVY 5K0ZA 1H6BA 2RHLA 2QS9A 1QU3A 1NP6A 3FGOA 2ZWIA 3DLBA 2PKQP 3TQTA 4RVUA 3OPMA 4F4CA 5JYEA 1M7HA 2IIVA 4CIWA 3VPHA 2W6JA 3PXGA 3KXDA 3OESA 4O6VA 3SHOA 3PF9A 4C4SA 5AVXA 3U7QB 2JJ8A 2FEOA 4FS8A 4MVJF 4RFVA 4ZT7A 2BZSA 5FL7A 4F1JA 1AG9A 4W5RA 1Q92A 3CLHA 3OF5A 4YMSA 5I8ZA 3ZD8A 1J1UA 2PGIA 4PLZA 5D01A 5JAUA 3W2GA 2JZNA 4A92A 1J9EA 3C4QA 3DTVA 2PU5A 3AJ9A 4BATA 3G8BA 3AR5A 2NVBA 4O4IB 4CEIA 3G6WA 1XZNA 4IF4A 4KRXA 1GLGA 2BH2A 4HWTA 3WL4A 5BSGA 5DNYB 3AUKA 2ZBEA 4BFWA 1NULA 3K96A 4MLDA 2DULA 2PQ2A 4NXNB 1HLFA 4HGQA 6AT1A 2YV1A 3Q3GE 5JFTA 5ADUS 1ULHA 1KDOA 1FF9A 3EXHB 2XADA 5AWFC 4PFSA 3HXLA 4D74A 3VH2A 3WLMA 2QTVA 3ELUA 1UQUA 1WCIA 2I7XA 5I7EA 1NIJA 3BPSA 3X1ZA 4BNHA 4ZYTA 1ZJJA 4JB8A 2OGUA 1CUXA 1R0KA 1XVUA 1NAHA 4NEQA 1OROA 2I87A 3IXMA 4YJFA 2VJBA 1EUQA 5B12A 1SKYE 2HXYA 4NBLA 5LBUA 5FDFA 1ZK3A 1Z12A 3RFXA 2BE9A 1TAQA 2C5BA 2AVDA 2I76A 2RHCA 2H51A 3CLTC 3N0RA 4HKTA 2AX4A 5H9VA 4CW7A 2P2SA 4DM4A 1VI5A 5G4KA 1K3TA 3E4DA 2QQFA 1D1PA 4YT8A 4MOWA 5AVWA 5KCMA 1HFEL 2DFNA 2P6PA 3IVGA 3ORHA 1X7ZB 3GEEA 4H0FA 5DXAA 4CHTA 1DXQA 2VPWA 2QZZA 5J4KA 1Z6QA 4D3DA 4KODA 2N0SA 2WJZB 3OSZA 4N49A 4OUKX 2J3LA 3USES 3THYB 1VM6A 1E7QA 3ZU2A 1RLJA 4S1TA 5AOAA 2IXTA 2P2CA 4C0SA 2IS4A 1L7EA 1SQSA 2H48A 4U7DA 4A91A 5IDYA 2WHYA 3JAWB 3EUAA 2OSBA 3KJQA 1E0DA 4HGOA 3R7SA 1DP4A 3D3WB 3SBXA 3JYOA 4FU0A 4RWEA 2HFJA 2VAPA 1IRXA 4DDVA 4OP3A 1RKVA 4EJSC 1FP7A 1UC8A 2CDCA 2HJ9A 3FDXA 3W1EA 4BFYA 3QI2A 3ZUGA 1ILWA 5JDIA 5KOHA 5FOVA 4KPEC 3PC8C 4GGMX 5CTJA 3GMIA 2O7RA 1LJLA 1LXCA 4QUAA 1MH1A 5K4GA 4GPIB 2R25B 1DRWA 3G2LA 5KKNB 2FSSA 4N4AA 3R76A 5IW8A 2BEVB 3UMVA 4DR1B 1G1MA 2VKTA 1GUBA 4QJBA 5C7OO 3D6HA 4MAAA 1P45A 1J8DA 3TNYA 1YR7A 3SIRA 3RKRA 5CAEB 1PR5A 2IXBA 2OXIA 4C30A 2ZIGA 5KTKA 1HDYA 1KK0A 1Q77A 2AHRA 2IQ5A 3HM9A 1DX6A 3HR7A 121PA 3ICOA 2X6TA 1T2AA 3KJIA 4B8YA 2BBTA 4KAJA 4OHRA 1HR0B 3WLQA 2LZ0A 3CMCO 2W48A 5JPIA 3DE2X 3EIXA 4HGPA 4R8RA 3P8ZA 1NQWA 2WWFA 4JSTA 4KLRA 2X0FA 5DWDA 2W2LD 4X97A 1M34E 3L6RA 2NUAA 3C15C 1UMBB 3DUWA 2CMHA 2R97A 3VTAA 2E4UA 2HBYA 2W6QA 4FE4A 2R2AA 4WOBA 4CF3A 4K0KB 2JZOA 5DM2A 1W30A 2OFPA 1GNSA 3A1EA 3A27A 3DTTA 4YGXB 3LDGA 1UPBA 4H3SA 1E60A 1QRAA 4Q7LA 4R1SA 5DTEA 1ZK0A 2DBYA 3H9JA 2VJPA 1LRKA 4QGHA 5KTOA 2Z6UA 1A9XA 3O8BA 1XBTA 3UH0A 1BQ3A 2JDID 3FETA 5JEEA 2E2WA 2FUCA 4IIDA 1KETA 2BFDA 2EP8A 2WMDA 3HPQA 4QYXA 1K8RA 2DPLA 3I01A 3ODGA 1M75A 2W11A 3INYA 4B4WA 1O57A 4D3YA 3JPWA 4E2ZA 1M2OA 1YJCA 4I50F 5FFFA 1EINA 3LRPA 1QHNA 3EA5A 3RREA 1LBEA 3A6DA 4KREA 1MCZA 4X1KB 2C4MA 2B9VA 3VVCA 3DG9A 3O31A 4TMKA 4BP3A 1TKBA 2QN9A 2WINI 4P4SB 4DM7A 5J2TB 1BOFA 2DX7A 1IXKA 3RF6A 2P4SA 3ROQA 2PV7A 4I1RA 4LYFA 5HJ5A 4J0CA 4BJ5A 2R8PA 1QO7A 3CF6R 4L9AA 2C2XA 4X8LA 1AX9A 5FOSA 5TEWA 3T7IA 2JLXA 1T4CA 1UC4B 2PS9A 3FZQA 3MM4A 2VSQA 2F3RA 4I14A 5JI2E 3HVIA 4EQ6A 3RU3A 2AVNA 2HLNA 2VHJA 2DFKB 4GICA 2HMSA 1WS6A 3KHTA 1OFVA 1LTKA 1Q0HA 2EIHA 3MBKA 4KKVA 3WOVA 4CVNA 5IN4A 3KQSA 3U09A 4S04A 3J80A 4MDEA 3AQ4A 2KB0A 521PA 1BXRA 5LQDA 1WV1A 2ZWOA 5ENZA 4Y2YA 4Z53A 1EE2A 3U13A 1V47A 1YDWA 2J3KA 3AI1A 3RR2A 2PPLA 4W82A 3A2NA 3W77A 1MHPA 1W9MA 2Z30A 4EJSA 1MP0A 4U2FA 4FIDA 4ROTA 5AK0A 1GPH1 3EVGA 1I2AA 3EMDA 4TS4A 3L93A 4F1KA 1MA0A 1M10A 2H2WA 4WACA 1NW9B 5EMMA 3WWEA 1ISRA 3OWXA 1DBRA 4F86A 4BO7A 3OCJA 4IR7A 5DU2A 4F8JA 3V2IA 1ECPA 1K7CA 2QQEA 1C30A 5IUKC 4N18A 3RSLA 4OSOA 5ITWA 3OE7A 4KRGA 3P9ZA 3CV3A 1CU1A 2B6HA 4OQNA 4ZZ1A 3A26A 3M3PA 1EK5A 1Y8QA 1OWLA 4JVSB 4YO8A 1T8TA 1RXSA 2GN9A 4X6LA 1OGYA 1V5WA 1NXPA 2OSVA 3T7DA 3VYWA 2JD2A 3KLPX 1RJWA 4RTJA 5DHSA 3EGVA 1VZ2A 4PW0A 5JS6A 5JRDS 2CC2A 3BXGA 2R6GA 4ZQCB 5BYBA 1II8B 1J1ZA 4KI0A 1C0EA 3SFVA 3FTNA 3PR2B 6CHYA 5WRFA 1N2IA 2VEOA 2VPIA 3NNDA 4EI2A 3FA2A 1F5NA 3P2KA 3D2AA 1G60A 2XTZA 4ZGBA 4D96A 5K0TA 1OH5A 3ANMA 3GAZA 1G7SA 3OBIA 2YXEA 4FYVA 1OE0A 1YB4A 3TW8A 4EDHA 2OFOA 5ELXA 3BQMB 5CD9A 1OHHD 2XWJI 5EJ4A 5JDCA 1TX4B 2ADFA 5KJEA 4XM2A 1DG9A 2WIJA 4RHCA 2FE4A 2BSAA 3G0BA 1QP4A 5C2JB 3HABA 2J5RA 3I6QA 3OURA 1Q7CA 5DGDA 5T5QA 2NP7A 1NF9A 1FCJA 4TVSA 1STOA 2Q46A 4W4TA 1RZRD 3RLIA 1B6SA 2ZZMA 1QHYA 4HQ0A 1YDFA 1JQJC 4QWMA 5EI5A 3WK5A 4LZAA 4NDNE 1QLHA 4BO2A 5KNDA 4F4HA 1RXWA 1KXZA 4XWTA 4LVUA 2G0NA 1NV8A 3ZPXA 2V4MA 4KGXA 4ZDWA 3SWWA 2A0XA 3FNHA 4PFJA 2MHCA 4QBIA 2QR2A 3OFSA 2CXPA 3LS2A 5HQTA 4NBRA 4XEUA 4M22A 4MJXA 3FKSD 4W9RA 1JHRA 3ZOZA 1CRPA 4HVCA 3PPYA 3HJRA 1EFPA 4H6VA 4JP3A 1BE8A 1KY2A 4NAHA 1Z5ZA 5C8YB 1H66A 1PSDA 2CZGA 4YJFB 3FUTA 3FSGD 3IPCA 4HQKA 1XTJA 4Q6WA 5HWSA 1DPFA 2V03A 1XX6A 2VDPB 5IM4F 1JH8A 3C6KA 2E4XA 2CGEA 3MD9A 4ER0A 2CVOA 2WD7B 2HT1A 2NTJA 3RK0A 2FB9A 2O2HA 1U1FA 1IAQA 3VSBA 1AXEA 3OZGA 4PAGA 1E79D 1ZQ9A 4BMNA 5A6SB 2R66A 1A8PA 1KFJB 3QJ5A 4RACA 1KDRA 2OORA 2WSMA 1U04A 2DRIA 3DUFB 3KOZA 4FZ5A 5AVRA 4EKIA 3IT2A 1QHHB 2PBZA 3GCZA 5HKKD 1CJCA 1J2RA 1XF1A 4O2AF 2OKCA 3EZ6A 1Y9JA 3M0EA 4L3OA 3G49A 4YCBA 1WD5A 4JB2A 2WYHA 3G8YA 3S2GA 1YA6A 5LQNA 2BGLA 2WHEA 3B2QA 1NBHA 3R3SA 5CDSA 1UBKS 1BD4A 1CS0A 4KCGA 1YR1A 1N5IA 4R0NA 1ZY2A 2MSCB 2I3DA 2XMGA 3CT6A 4ZK2A 2VTEA 2QJWA 3W2TA 2N9UA 4CN9A 4D9CA 3TQIA 4BL5A 3W9YA 1VKOA 4AWBA 4RTPA 4DKXA 4DR6B 3LBIA 1ZEJA 3H9GA 1M8PA 3HR8A 4QWWA 3AI3A 1VG1A 4IQFA 4LK3A 3W5SA 4LOHA 4FB5A 2CF6A 3PA8A 5UKDA 2GEUA 4QBHA 4U5QA 1QKKA 3B7PA 3GH3A 5HCNA 3ORFA 2N75A 2CT8A 2QD5A 5ERYA 1X7YA 1X9GA 2BC9A 2XYPA 3W1WA 4AS1A 1XJ5A 4YJDA 3IMCA 4FN4A 3SDBA 2GBGA 2C8VA 4I0WB 5JSFA 2FMUA 2CCKA 3TSOA 3C87A 2AXNA 2V3WA 4V38A 3SSAA 4OOFA 1SXJB 2FW9A 2WFMA 2AXEA 4DTCA 3K5HA 4C5BA 1DMSA 4BGIA 2OPHA 3GRKA 1AXGA 2OGZA 2HYIC 5LP6A 2XYVA 2O2DA 3FMVA 4F12A 4G01B 1SU6A 4NI5A 1T3SA 4CMBA 4XB1A 4I6JA 1E99A 4ZREA 3R5JA 4XCVA 1B3RA 2AXPA 2CK3A 3S99A 3U4GA 4CEJA 4Q7EA 2XB2A 2XQJA 3SF8B 4YMTA 1Q1ZA 4LZZA 3FOFC 2XKKA 2IYTA 2IPMA 3TBFA 3ROKA 2EARA 2OGTA 4G9BA 4KE7A 5JJLA 2QY9A 1GTJ1 1QCYA 5AI0A 1EDOA 1QOQB 3MHTA 3I52A 1RADA 2Y67A 5EKTA 1FFCA 5LSAA 2O6LA 5E38A 1GNVA 2HBZA 1TEZA 1DFIA 4Q4LA 3N8IA 3K9FC 2IPLA 4KQGA 3T0FA 3NXSA 5SZJA 4TRRA 1HE1C 4K81B 1R8XA 1TF2A 3AHCA 4CG3A 5I7HA 1T6NA 1V7ZA 3BL6A 2EV9A 1A9OA 4PICA 3TAUA 3ZH9B 4BTLA 4O2AA 3MINA 3ZGLA 4AURA 3GRCA 1AMUA 1SXQA 1MA3A 3BL8A 4J75A 3EFOA 4HDOB 2JFHA 2R7AA 5CITA 2XLCA 2A5DA 1T43A 4NWIA 4AWXA 3FTFA 4I6GA 3TTUA 1GZ5A 2WNSA 4R68A 5IXYA 1DO8A 1NOKA 1SBQA 2JAHA 4FKMA 2JFUA 2ZP1A 2KBFA 4KV7A 3K0AA 3GRPA 1TJYA 3NEYA 4F2WA 3HVRA 1Q2UA 1NC3A 1EHCA 1XEWX 1XZLA 2R6JA 2R1ZA 3BIJA 3QVVA 3L8EA 4HLQB 2PA3A 4BVJA 4U1RA 4JA0A 3EDYA 3VJLA 1DBVO 2REBA 5IVDA 4YV2A 5HOQA 2JIZD 4ZEVA 3L92A 3MMPA 2FZWA 1DIHA 5EQTA 1U0JA 2DCMA 1U5CA 5TPZA 4CTJA 3MAJA 1PN3A 4EX7A 1HYEA 1L5ZA 2YVLA 3I5YA 4KO8A 1V2HE 2JW5A 4GI1A 1RM4A 2Q8PA 1BA2A 1V16A 3D3NA 3RJMA 3A37A 4Q05A 4F2HA 1OFGA 4LQDA 3DDSA 2HSEA 3P0RA 1SHUX 5GM1A 4G41A 3PR1A 1EBFA 4WZBA 5GWXA 3W5VA 2BGWA 2FFJA 4X5OA 4IGFA 3KSUA 3CE6A 3EZNA 5ICFA 4ACAA 1GYQA 3EH1A 4L85A 4CMCA 4J3JA 5HDBB 1IY8A 1PBNA 5IBCA 5LP6F 2BJVA 3EFEA 3V1KA 4R41A 1FSFA 4EHNA 1G5PA 5IEJA 4G2NA 1KI1A 4EGFA 2W98A 4JROA 2V5AA 3R7DA 5KTMA 2ZQZA 1JBEA 2WWXA 5DT9A 5IARA 2XNDA 1G21A 3OEEA 4YI5A 1JHXA 4Y9UA 4B3CA 4BMZA 4IJKA 2G9QA 3HCDA 3OIDA 4US1R 2XMPA 2C3MA 3EZLA 3BQNB 3OX4A 2B1JA 1CUEA 4FMCB 3TYXA 5JWRA 2GYVA 3IDFA 2P30A 3DF7A 2H4XA 4ZV9A 3L8MA 2V7TA 5TNXA 3T1QA 4M9UA 5GP1A 3JASB 4CF6A 3AIOA 1G20A 3WNDA 1UP6A 3VR4A 1HFJA 2Q5FA 4G8DA 2VOEA 2VP0A 2O4CA 2GK4A 2QTLA 5K3SA 3SZGA 5JAIA 4M2LA 3NWEA 8AT1A 3VAAA 2XLBA 4J1TA 4RPKA 4WKPA 2W6MA 2AN1A 3H5WA 1W25A 2J5QA 5DFAA 1J06A 1KVQA 2IDJA 2XAUA 3F1LA 4RANA 3E58A 4G24A 5TVGA 1A9YA 1QC5A 1J7KA 5J40A 2O7NA 3N8DA 1Q0TA 2VYVA 3QKTA 4E21A 3E03A 1TCAA 1LUAA 3H84A 2FJUA 5IH3A 3AH8A 3CF4G 3V4SA 5JVDB 1QE5A 4Y30A 1ACLA 3ELBA 3VJKA 3GEPA 4R6WA 5GJCA 4MX8A 1NOIA 3A1TA 1WMSA 4AU1A 1JR3A 4GH5A 4KQMA 4X64B 2PUBA 3X1YA 4MR8A 3RC9A 3JQ8B 1XMXA 4LC0A 2XCSB 3A06A 3KSMA 3IQWA 3ONDA 4L3WA 2P0EA 3U7IA 5HIMA 4JXZA 4XM0A 1FFDA 3FWYA 1D6SA 1UBMS 3WSTA 3FDZB 4BNGA 1PDVA 5K8LA 3IA7A 1W52X 2H1IA 4PXSA 3EY9A 1PWZA 1T2EA 2Q5LA 1P2VA 4B4KA 4Z4IA 1C1DB 3MUEA 3CJTA 3OOSA 3HDGA 3OTWA 4WNIA 3N2GA 1X2EA 1OJLA 1P1KA 3EGWA 3R40A 5D1NA 3M1AA 1GJRA 1YE3A 2ERCA 3E5HA 4TTRA 5AOBA 4C2TA 4AKHA 2Q2WA 4C6RA 3ZGNA 3TE6A 3I28A 4YEDA 1QK5A 2PLRA 3LX4A 1N8TA 4TLEA 4AYXA 2WT4A 1EM8B 2GPAA 2FHSA 4X92A 1T1SA 1QVAA 1UKEA 2JI7A 2Z5LA 1CP2A 3KOYA 3AVUA 1SG0A 3C2QA 1JFFA 1NYRA 3W5HA 1S1CA 4NZOA 2QYSA 2P5TB 3IP9A 2AC7A 2PT7A 3SDSA 3ZZMA 1N78A 4BO0A 3U44B 2FQYA 2UUPA 5E0KB 1ZXBA 3QPAA 4JNKA 2PYDA 2CB9A 3AL2A 3M5PA 3S2YA 4E1AA 2C4NA 2Z04A 1WZUA 1YZQA 3V7NA 2GSDA 2ST1A 1D2MA 3SYNA 3B5IA 3ZZUA 4DQXA 1WVIA 2J33A 4RUKA 3OUTA 5JV5A 4C3VA 1RCUA 4XWYA 2DBZA 5IFKA 4G65A 3IAAA 4JLSA 1E3TA 2F8MA 4JI4B 1M2VA 1NW8A 2C9OA 2QRUA 2EATA 2XB4A 1U8YA 1MLDA 1T15A 1FDIA 1Z0UA 2YASA 4XX1A 5E6UB 5EINA 4H1WA 5ULLA 2C04A 3VKGA 1AQUA 1KTVA 4XVQA 1R9GA 3R8XA 3DDCA 4BMSA 1VDZA 2FNAA 1HKUA 1V1RA 1L7XA 3CXUA 1H9CA 5JC8A 2WIKA 3FRIA 1BMTA 1UFVA 1UQRA 2ZAIA 3KEFA 4JU8A 5BN3B 1O94C 1XEFA 2Q27A 3RV3A 1LBSA 1REQB 4WLOA 3S6JA 3TIFA 2JBWA 2UXCB 1KI3A 4R1UA 2XWSA 2GCEA 3M4NA 3C1TA 4FX2A 3KFLA 5AR1A 5IJZA 5LQCA 3HRHA 1NF8A 4RPHA 1E5QA 3LGAA 1QIEA 1UDWA 3IR7A 3UG6A 2QRVA 4IVQA 3D0KA 3AX6A 5ELLA 3EK2A 1OFHA 1G9XA 3IBYA 5JSQA 1E2LA 1IWBB 4EGSA 1XRNA 3MMSA 4BZZA 4Z7OB 6LDHA 1NLZA 1GV0A 3IBCA 1FU4A 1HTWA 1L5RA 3LQKA 3NWPA 3PGXA 4KN6A 4O1MA 2HBQA 5DRYA 5L4NA 2I7CA 2LDBA 3PGMA 3TCNA 1FVHA 1GTZA 1H2RS 1WXEA 4LDPA 3LG2A 4PO1A 5ALTA 3EZGA 2PZBA 3IMEA 4E5YA 3A4LA 1KRHA 2QQ5A 1VKRA 3ELYA 3WDSA 4QXAA 2Q5HA 3QU5A 1DBQA 4KN5A 2QXTA 2IS6A 1ZCFA 3K1YA 1WSDA 1EP3B 2O1EA 3R5HA 1K97A 4NECA 5DGXA 4ETMA 5F1KA 4Z3KA 3CPSA 2DKFA 5JANA 2CLKB 4DLUA 2WTUA 1XWIA 3EF3A 3G7NA 3FCUB 1UXIA 1L6IA 1NLYA 3E1KA 3KXIA 2E1RA 1KY4A 2ZE6A 3OHMA 4OHKA 5HBGA 5IAAA 2B78A 1T5BA 5E9WA 2XGJA 3E9CA 3H6GA 5ALOA 4RMJA 2HJSA 5BN1A 2WWRA 4FT2A 4HQOA 3FNEA 3SSOA 1L5QA 3KKNA 4ZI7B 2WA2A 2SCUA 4TPKA 5FTNA 3A1FA 3LOUA 5LZ2A 4C4OA 1KO8A 1D0VA 1OQAA 2P6OA 1PWYE 3L1JA 4M89A 3W5DA 3WLSA 2Q4OA 2PUDA 4CCAA 2NPIA 3R3YA 3WLAA 4CIBA 5JS7A 4ZHQB 3T7SA 4JSYA 5FTWA 2OAQ1 1EP1B 3VR6H 3AV0B 4PSVA 1ORWA 2FI1A 2GDJA 3E3LA 1L4HA 5LKAA 2SKCA 4YALA 1P17A 3WGIA 1PVVA 4EFKA 1EVZA 5EPOA 3S1AB 3ZVNA 1T5OA 4PZLA 4C0HA 1EFRA 3UICA 5EIBD 3AOEA 3ORYA 4QNMA 3VNVA 1KEUA 2UVDA 4HSGA 2UXDB 3QP9A 1P1HA 3AY3A 4FOPA 3KJXA 4UHDA 1J2UA 3SKXA 1QRSA 1V41E 1CHNA 4LOAA 3UCFA 3OT5A 4WOJA 4QVIA 4Q16A 4CKEB 2P62A 3O38A 4DJEC 1AGXA 1QDLB 3M9WA 1KZ7B 1RHMA 2ATIA 1SPXA 1UFKA 4PVDA 1R5NA 4INOA 4WK2B 4UZSA 5CU7A 2BPOA 3PT9A 4ZU3A 3NBUA 4A8TA 5EYPA 5AW1A 2H54A 4A8JB 4LXUA 4FBLA 5KNDH 1XI2A 1TCCA 1O6CA 1UZLA 1B7GO 2CHEA 2F3UA 4N9QA 1U2TA 1CUZA 4L50A 4XA8A 2PLFA 4U7HA 5DW0A 4UUQA 3R24A 4EGCB 2G4VA 3L7BA 3ZVLA 3IAM6 2IYWA 4EA6A 4AYTA 3VR2A 4OGKA 1DLJA 1IB0A 2R44A 1ZGHA 2QRGA 3IAEA 3PDCA 1N5RA 3O8LA 4JJZA 5L4SA 1PR6A 2PH3A 3D8RA 2EP7A 1AZTA 3L7JA 3VKWA 2PIAA 3RT9A 4W5OA 4JP2A 3ZY2A 1U7UA 4EO4A 2CNWA 3K92A 2B1GA 3WZ2A 5KTYA 1XWFA 2HW8A 4LNHA 1Q0LA 4PAMA 1UFRA 1Z68A 3CIFA 2P6NA 4NYMR 5IXJA 2O8FA 1BE1A 1N36B 3VUEA 3VYRB 1CEYA 2IE0A 3T95A 2LIVA 2VA9A 4Q1CA 1R1DA 1E2EA 2QYHA 1J2JA 1OI7A 1XNHA 5REQA 5CDGA 3Q5DA 1A69A 3J81A 3WNBA 4R4JA 2R8RA 2XD4A 2BLLA 1A3CA 3EC7A 1N9GB 4HPJB 1U02A 1MQ9A 3UJBA 2YHSA 1VJCA 3UUEA 4MYUA 4JSRA 3T4PA 1XG5A 3O3MB 4FDMA 1FFHA 2OBBA 2IV3A 3W4IA 1HL7A 1O5OA 2CDNA 2GERA 4PGAA 5DM1A 3M6MD 1I7PA 4J0EA 4IS2A 2PX5A 1J8MF 5KYWB 2ATXA 1R0ZA 2Q21A 4JIGA 4ITRC 4XVUA 4AKSA 5ALVA 3VNUA 2BCJQ 3ZNOA 2YMLA 1NMXA 1X1BA 1DRJA 2BMEA 5M04A 1ZGBA 1B0UA 2XZDA 1GFWA 1YRHA 1JI3A 2B8NA 1TVCA 3PG5A 4J0GA 4MUYA 5DNEA 3TOXA 1L5HA 3N70A 1K5GA 4PO3X 2HLHA 3P4XA 4XEHA 5JSUA 3B51X 1O87A 3H4VA 2AUNA 1BCSB 3R6LA 1RPTA 1VRCA 4BRUA 5I47A 4MUEA 1ZI6A 4OQPA 4QDZA 4MUMA 2CJXA 3O3CA 2QTGA 2BEUA 3IR6A 5I9TA 5BRNA 4MQFB 1UAAA 1NR1A 1UXGA 1PNOA 3HDVA 4LNUB 3DVAB 1U0RA 4FHCA 4F3YA 1Q19A 3GR6A 1JWBB 4EL0A 2Y1OA 1TOAA 3JZDA 3A9WA 3KPVA 3AVOA 2ZJ5A 5EESA 4ECAA 2CLEB 2P5YA 1KAOA 2W2QA 1B1AA 2ZTMA 2QKYA 1CULC 2CD9A 1H1TA 2Z09A 5D3MB 1N1DA 1NXQA 1YOVB 3TLAA 4NARA 1VRWA 1PF7E 3ZE6A 1OU0A 1T0PA 2G28A 4UVGA 2Q4EA 1TU3A 1XLUA 3A9RA 3IX7A 4QZVA 1HQKA 2Y2VA 5ICEA 3C14C 2BUCA 5AW8A 4LV5B 4M38A 2ZT7A 2GH1A 3AM5A 2PG3A 2XZPA 1EPUA 1IEVA 3W4KA 1F17A 2EZ4A 4JBNA 7GPBA 3P2MA 4WLEA 4V1CI 1FA9A 4Y1RB 4YXWA 2QRZA 2UZ0A 1JIIA 2EWWA 4PYQA 5LWQA 3MNFA 3BRQA 1QZUA 1DJMA 3CZAA 4AS3A 4P35A 2P2LA 4S1OA 1W87A 4UDXX 3NBYC 3GFGA 3JQ9C 5A1JA 3PNSA 4RWZA 1UPCA 4RHYA 4RM2A 3COVA 1RYYA 3L7KA 1VECA 3IAUA 1P8AA 1BKYA 5AVJA 3AW9A 2PUFA 4UNQA 2VUSA 1C3XA 1RCTE 3HYRA 1WMFA 4J6EA 5HFAA 3P9KA 3HADA 4EYSA 2I6SA 1RE1A 4UBKA 1IJEA 2BDUA 1DX4A 1ZOSA 3LECA 4NS1A 4CMAA 5I3CA 1PJBA 4QUDA 2DF8A 4OM8A 1T8YA 3HC7A 5FPSA 1G17A 4UFNA 1CR1A 2EZUA 3YASA 4AX4A 4D81A 3O93A 4MS1B 4B3RB 5JCJA 4Z9YA 4YACA 5E6SA 2PIDA 2FZ5A 3NYRA 3O03A 2Z1DA 3BGDA 2AR9A 1NUUA 2HXGA 1XR3A 2P9QA 3ZD7A 1ADBA 4W6ZA 3PNKA 2O5CA 4MRRA 4QDTA 9ABPA 3OX2A 4L76A 4JXXA 1I4DD 3ZR4B 1LCIA 2VPZA 3GPDG 5IDVA 4OBWA 2ZKLA 4RPLA 2DBRA 4ARSA 4BO9A 4WRRA 1XP8A 2HNAA 4N48A 5KCZA 1UBSB 2E4WA 4PS0A 3SHVA 1MO4A 2X58A 3HXTA 2ZAMA 3HZZA 2QPLA 3KOXA 3PENA 4G4SO 4JLAA 3UWSA 1G5QA 5CB4B 4QT4A 2GTIA 1RM0A 3JQEA 5FHRA 1ESEA 4AZ3A 2C7RA 4LOJA 4EHIA 1KWKA 1PKXA 5C37A 3TZLA 2NTVA 3E84A 3ITDA 4DLKA 2PX4A 1REQA 1W0CA 3N39C 4GXTA 4UD6A 5AKIA 4DEYA 1B4DA 2CMDA 2J7KA 4CIVA 3R6TA 3T9BA 2G9RA 3MTJA 4QREA 1BMQA 1E2QA 1ODCA 1JEJA 3GFQA 3I2GA 1Q3KA 3CKMA 3I5UA 1N3LA 3L82B 4X20B 4F9FA 5A3QA 3Q9LA 3SIXA 2G36A 1Z7GA 1HEIA 3IT3A 4N7MA 4RJ2A 3RUEA 1ZUHA 3E8XA 4IZHA 2WUGA 5TJHA 1SXGA 3O8OB 1NPDA 3B1XA 4W1SA 3SR3A 1X8XA 4QXQA 1JMKC 3V8RA 1DGQA 5IASA 2AMYA 1LD3A 3DJYA 1B6TA 2G0TA 3O75A 4V1CA 3NDPA 1LI4A 4I5IA 3IKVA 4YCSA 3CSSA 3HJTA 4J1NA 4OKIA 3D2LA 3RFUA 3W6UA 4Z51A 3LP8A 4DVGA 3KDSE 2C97A 4FYIA 3D0QA 1PYGA 1LLQA 1PD1A 3WLTA 2GTHA 2ZSEA 2YJ3A 4IS3A 3GCWA 3FOAA 3QVUA 3N6RA 1RC8A 1H3EA 4L75A 3V8MA 3X1WA 1NVDA 1ESCA 1U7PA 2NWQA 2XNJA 4HDSB 1GZ4A 4EG8A 4PF1A 3N75A 5J2UA 2R6AA 4BDSA 3MWDB 5FX2A 2FMHA 1FVXA 4CKXA 2OLEA 1PR9A 4OA5A 5CJJA 1PGQA 3VPBA 2EEZA 1ZWKA 1MRSA 2IEIA 2Y93A 3RAEC 1NBAA 2A5YB 4LFBB 1EBBA 3DD5A 1YZ3A 3AU9A 4RL4A 2BJHA 4R3WA 1J1IA 4RQBA 1JJ7A 1AJEA 1DAKA 4IIXA 1EM6A 1K9SA 1T6BY 3PKZA 1T2CA 2H29A 3LO5A 5DNVA 3N3AC 5EVCA 1XQ9A 2YN2A 3EFOB 4FGSA 3ROEA 3L6BA 4PV7A 2B3TA 3WR5A 1VL6A 1MAAA 1V4VA 3B2EA 5FBQB 4GL4A 5AXAA 5K0NA 4MQEB 3I0ZA 2FEWB 3C8HA 1SUEA 3ZHOA 2DPGA 4P32A 4UW9A 3ZC3A 2CBZA 3H5OA 4MUBA 3IERA 4NICA 4WK6A 5HGXA 2YHUA 2QAGB 5LYJF 1J2TA 2O6HA 4FYXA 2QT1A 4IJ5A 3MEQA 2QUBA 4HEHA 4RPCA 3SHTA 3LOQA 3SR0A 2Z2IA 1ZLYA 1GV1A 1M66A 2PFSA 3C48A 1IOZA 3JX9A 3NHRA 4I50A 4YRDA 3AJ8A 5EIOA 3KQLA 3WV4A 3DW1X 2J6IA 1KU6A 5JFOA 4D9GA 1TFUA 5B6JA 4Y2PA 5EQFA 1WXIA 3LYLA 1HRDA 1CZOA 1Z0SA 2JI4A 2Z5GA 5DI3B 2OLJA 2WAAA 1JYEA 2AWNA 5C53B 4FWTA 1IJFA 1K7YA 4QUIA 4NBWA 1P77A 4ZAFA 2R8BA 1JZSA 3V8QA 4NY1A 1J0XO 4K2AA 1NQUA 2X5JO 4OHZA 4P34A 4UOQA 1W96A 1JEEA 1ZW6A 3E15A 5DCLA 1ICEA 4ZEWA 5EXSA 4GMDA 3WO0A 5JQGF 4QGGA 1XXLA 3MTIA 3ITEA 4OK5A 3PHLA 4GR4A 2UDPA 4D8XA 3I05A 2FF7A 1W581 3K4PA 3KR9A 4YIKA 1SUSA 2V7XA 1R10A 5DV9A 3KCQA 4HYEA 4WDQA 1IULA 1RLMA 4YRTA 1NBMD 1X1CA 2ERYA 1SEVA 3GJQA 1ICIA 4ID9A 2XZTA 4JLMA 3CRNA 3UIEA 4YASA 4RZUA 2YJNA 2Q41A 2UVQA 3BORA 3CW9A 4IVRA 3ZIUA 4DA8A 4Q9LA 3CRZA 2FOXA 3F4BA 3ON5A 4GU5A 1RHQA 2Z6VA 3QWIA 5FWYB 3CZRA 3W8FA 2V96A 4AK9A 5EKSA 4YV1A 1FPMA 4UUNA 3RUAA 2COEA 4YHHB 2PD4A 3SSNA 4Y2VA 3NZEA 4H59A 2Y0CA 1EVLA 1MOZA 1AE1A 2A14A 2F90A 3VOBA 3GLSA 4KRFA 1QGYA 1XD2A 5CVDA 4OU5A 3AL3A 3DAFA 3N53A 4MR7A 3T1HB 3AEQB 4EARA 2EYUA 5JD3A 1TIKA 2P3SA 1W76A 2QTTA 4RTKA 3MPUA 4NG4A 4WZ6A 2AG1A 2DPYA 4C2BA 2QV0A 4JMLA 3VVMA 4P3OA 3AHHA 3A6JA 4ZT4A 4PNEA 3C5WP 2C03A 1OLUB 2YXBA 4GPEA 2I62A 4R69A 1F38A 2W8BA 1L1RA 1BJTA 3DOOA 4GZMA 4IW3B 5GAJA 1YUBA 1Q6ZA 2FR0A 2JGDA 2FPMA 3QTTA 1VA5A 4N7RA 4G67A 3U9SA 2J9ZB 2YS7A 2VRNA 3CBQA 4RL6A 3GLTA 1XVIA 2ONJA 4CIYA 2FWBA 4NENB 2HSGA 4P83A 4TLMB 4EG4A 1QLJA 5GVSA 3KZOA 1SVWA 5F5LA 3BMQA 3EXIB 4XPIA 5HJEA 4EITA 1O8CA 4BKRA 3KVRA 2CSUA 1VSQA 4JBGA 2MSWA 2AN9A 3EVFA 3OQHA 4JMPA 3FDJA 3T5MA 3RLFA 3Q8WA 4AY4A 4OV6B 3TPZA 2I1LA 1YK0A 4O2BA 2DVMA 3CZ4A 3VR2D 1TJ3A 2PZKA 3RKUA 1OASA 2DWUA 5IK2D 2IH2A 1WTAA 1EXNA 2ZJFA 1GZ7A 4H3VA 4TL8A 1NE7A 4QHTA 3HXPA 3LBAA 3V7UA 1VFPA 1SBYA 4ZPXA 1U9IC 4DMKA 4GOXA 4IIGA 1K6XA 4X7RA 2DPMA 4H0NA 4HVAA 1I3MA 2QDXA 3AEUA 4P4UA 1Y8AA 4Q1EA 3U9LA 3A3OA 3ZWWA 1H65A 1R0WA 2WPNA 1JFLA 2BRUA 5DHTA 1ZMOA 3DA8A 1DQSA 2I3ZA 2Z3ZA 1EAYA 1EGQA 5B53A 4OQZA 5LR6A 1P5HA <