4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
1Y5MA 3QWIA 3WFJA 4Z0HO 1E0DA 5JSFA 3ZH2A 3HUDA 1B26A 3ICPA 5JCJA 4DMLA 1I32A 3ZWPA 1O9BA 3QSGA 5F1OA 2DBZA 1FDUA 2NVWA 4MKZA 3RFXA 3VAZA 2VRBA 1GPJA 3WGYA 1PJQA 1ZW1A 2ZTUA 3I6IA 5A02A 1Q1NA 1YQXA 3NT4A 2NWQA 5BSHA 3F3SA 2ZQYA 4ID9A 4NFYA 2O3JA 5AYVA 1KETA 4EJ0A 4ILKA 1VKNA 4O63O 1UR5A 3I3OA 3ROMA 2EW2A 1KIFA 4GLOA 3WSVA 1NQTA 2JFHA 3LLVA 2J3JA 3V2GA 3LU1A 2D59A 3ENNA 3U62A 2DT5A 3FPCA 1GFSA 1LNQA 3V8BA 4CUZA 3S8MA 5JCXA 3PIDA 1HSZA 4WCFB 4JBIA 4BNJA 1YONA 5C7OO 3RQSA 1B16A 4CMBA 1KC3A 4H16A 5JXWA 1ZMTA 3OFSA 1UP4A 4BV9A 1FF9A 3H9EO 4IDDA 2ZKLA 3VKVA 1HYHA 1H6AA 4QO7A 3GVIA 2X0JA 3A14A 1QYCA 5HWSA 1UP6A 1SEVA 4BB5A 5BQFA 4CM7A 3ZU5A 3KO8A 2HMWA 2IEBA 1DRVA 1T25A 3BMOB 4YJGA 2VZ8A 4II2A 3TZQA 4NI5A 2BRUA 3MJVA 4NBRA 1WMAA 2P68A 3W8DA 2XAAA 3DZFA 3E5RA 5H81A 3S2GA 5EL0A 4D3FA 3MWEB 4LVUA 5A4DA 2E48A 2I76A 4WK6A 4GKBA 1HE4A 3FSRA 1BXZA 1F0YA 1WLYA 3PGJA 1QLHA 5DP2A 5KJ1A 2YZ7A 2UDPA 2VHVA 1EBUA 3W8FA 3DBHA 1WZIA 1VL8A 2BI7A 3KBOA 4UEOA 1A5ZA 2NACA 4XKJA 3F5QA 4BNNA 1E1LA 1LI4A 1UZMA 1W6UA 3V1UA 2AHRA 3NRCA 1UDAA 3VOSA 4JK3A 1J49A 4Y6PA 2VHXA 4OSOA 4DBZA 2WD8A 4RPHA 3VZQA 4XIJA 3A06A 2BD0A 4NIMA 1JKJA 1E7MA 2QQ5A 4RDIA 4IS3A 1P77A 4NU6A 2CDBA 1T1RA 1J5PA 5COQA 3ADOA 3DEYX 4Y67A 9LDTA 1VRWA 4GX5A 4HXYA 4TVBA 5F21A 3F1KA 3L77A 3L4BC 4NQZA 4XDYA 2OXIA 3C24A 1SOVA 2P9EA 4CL3A 4IJKA 2PFGA 4XRRA 1HL3A 3JYPA 4GL4A 3C3XA 3NGLA 1E3IA 1PJLA 2EF1A 4IMRA 1MFZA 3P2YA 5HTOA 1CYDA 2E6UX 3QP9A 1LLQA 1PJCA 1WMBA 4FD3A 2QW8A 4IDBA 4RZHA 4EGFA 3QW2A 2PZLA 1PWZA 1J6UA 3U9LA 1HXHA 1ZCJA 4J90A 4R1NA 3PGXA 4LSWA 2YDXA 3AOEC 1K6JA 3PDUA 2PV7A 4R16A 2OMEA 1TT5A 1LC0A 3CINA 4KQXA 3K73O 2CVZA 1KOLA 4RPKA 2Q4BA 4CV1A 3CZRA 1DSSG 2VUUA 4QECA 4I08A 3LT1A 2C7GA 3OJEA 5B4UA 2AW5A 2PY6A 2CUKA 1W4ZA 3KYCA 1ADGA 1DIHA 3GN2A 3GA0A 3GFBA 4FIZA 3KM0A 1HZZA 4J1TA 2HMVA 1FK8A 4Y9DA 3ZGYA 4NH4A 3PJGA 4YT8A 4GX0A 5KKAA 4CJXA 3U4IA 2O3QA 3ST7A 2C82A 4OO3A 1P31A 4ND3A 1F06A 3SC6A 4TRNA 3ZWYA 3ZW9A 3JQAA 4BKOA 4KP7A 3JD0A 4KMSA 4BB6A 2W2LD 1XA0A 4WKGA 3OEWA 1W0CA 2HMTA 1WNTA 2EJVA 1G1AA 1NR1A 4GSKA 1ZJZA 2Y93A 4BS9A 4NFSA 1PQPA 3MJEA 2EP7A 4XIYA 4AJLA 2VUSA 1DO8A 3KLPX 3KRTA 3OJFA 2W2KA 5A05A 3H65A 4G65A 2FPGA 1E6WA 2B4RO 4BNMA 4RO0A 2Q2VA 4EEXA 1VC2A 2E4AA 1QR6A 2FMUA 3JQBC 2HU2A 3CEAA 3R1IA 3ZN2A 4HV4A 3C85A 4BO3A 3GF4A 1N1EA 3PHJA 1PGOA 3WGTA 3GUYA 4ZD6A 3JQFC 3D0OA 3GNSA 1XELA 1A7AA 4CUJA 5G0WA 4XEHA 5L7YA 4CMGA 2FZEA 5DT9A 5KVCA 3COSA 1P1HA 2O4UX 4J49A 4W9NA 3Q2KA 3TDKA 3UW3A 1WW8A 2Q1SA 5A9RA 2UAGA 3Q11A 1H94A 4CLHA 1B7GO 2ZJ1A 5I7SA 1BSVA 2BGLA 3H4VA 4R69A 3VZRA 1NQOA 3WWZA 3WIEA 3ZHYA 2IDZA 1Y8QA 1I2ZA 1X13A 2YY7A 2X0RA 4IJVA 4YAJA 3TOXA 3SEFA 1KBZA 2Y1FA 3RUAA 4RLHA 3E82A 2HMSA 3DO5A 4MVJE 4BHTA 1GY8A 1BW9A 4EDFA 4TQGA 1QG6A 2Q1UA 1PJTA 3GRPA 4PIVA 5FI5A 3FN4A 1Y7TA 5DN9A 2DPHA 3DAFA 3DONA 3S55A 2I99A 1JDJA 5GY7A 3LC7O 5CP8A 3TL3A 4BNYA 1KEPA 4PZDA 3RUEA 1D1TA 4J91A 2VTEA 1LA2A 4BNTA 2FSVA 1TLTA 1YJ8A 4K1LA 3OJLA 3VHRA 3MJSA 4ZICA 2V7PA 2HCTA 1E3WA 1T2FA 4J0EA 4PZCA 1YKFA 3DC2A 3L9XA 2Y67A 4PG4A 2DTXA 4DC1A 3ITKA 1WPQA 4DMMA 1YL5A 2G17A 4NR0A 1H93A 4OMUA 3TOZA 4B3JA 3TFQA 1GPDG 1DIAA 1H9AA 1YVEI 5BSEA 1ADCA 2RH8A 3DWFA 1E3EA 3AY6A 1NX6A 4M49A 5DBIA 5FFFA 3LF2A 3E48A 5CDYA 2HSDA 2NQ8A 1VI2A 2I3GA 3SC4A 2X5KO 1I5RA 2G0TA 4IGFA 3TSCA 1IYZA 2C0CA 2OUIA 1Q0QA 4TSKA 4E2XA 4YCAA 3OJOA 3AUAA 4ND5A 5IN4A 2QRKA 4H3VA 3IP1A 4LMRA 1GZ4A 2X23A 4YACA 2X0IA 4BGVA 1D3AA 1KS9A 3RI3A 3I9JA 1NPYA 4XJTA 4MIEA 4OIMA 3MTGA 1B0AA 1PJBA 4YJGB 4E12A 2FPPA 2JJYA 4J0FA 5CG1A 4GBJA 1XWFA 3QIVA 4RLSA 4EUHA 4O0LA 3VZSA 1LBEA 3EW7A 5A1TA 2P9GA 3ZV5A 4JCOA 1MA0A 2PZMA 3JYOA 4J7UA 4L73A 5DZSA 5BSGA 4YAGA 2NTNA 1H5QA 5L53A 3BTVA 5B12A 3KYBA 1OOEA 4NDNE 5L3ZA 3PHIA 4O6VA 5IDQA 4GWKA 4UEJA 3RU7A 4F45A 1ZEMA 1KYQA 2JAPA 2QHXA 4UVEA 4XWYA 4A10A 4DWVA 4RVSA 1ZH8A 5TLSA 1DBVO 5L51A 1NQ5A 2QIOA 1UH5A 4P22A 3NX4A 3WGGA 2Q2WA 1EVIA 3WGHA 4F3YA 4LVCA 1GUFA 1O0SA 2A35A 5L7TA 1K6IA 4J3FA 4BKQA 4NJMA 3ZHZA 1I0ZA 1HE2A 3PZRA 4XGIA 1QYWA 1NVMB 4OL9A 2D5CA 4I9NA 3L9WA 2AEJA 5I8WA 2CVOA 3U4DA 1R0LA 4CQLA 4GGOA 5EQFA 4E6PA 1A9ZA 1VPDA 4D3SA 2JD2A 3JYLA 1U3WA 4O59O 4R51A 1T4DA 2J6IA 2WE7A 3AU9A 4ALNA 4BMNA 3EZLA 2RH4A 5BSFA 3C1OA 1CRWG 4M87A 2Z95A 1GQ2A 3FNHA 2HK8A 3GC6A 1EDOA 4J7CA 2QZZA 4FQ8A 3JQEA 2D5AA 2CNBA 3OM9A 1MUUA 4DGSA 4OGWA 3I83A 5L95A 1YL7A 2IXAA 3Q6IA 1ML3A 4L8VA 4EI2A 2GUGA 3OMLA 5A9SA 1PZFA 5KTKA 3AK4A 3DR3A 3U0BA 4Z0PA 4RJTA 4KUGA 4CR8A 3QVWA 1CJCA 1DC6A 4U8GA 4W7HA 4WOJA 5B4TA 5K6AA 3LLSA 3WGQA 3PI7A 4YRDA 2JD1A 4CV2A 3ZU4A 1P3DA 2ZATA 2F1KA 1BVRA 5A9SB 4H15A 5H83A 5MGBA 5EQDA 4D44A 1NTOA 4GQAA 1V0JA 4JJFA 1JVBA 3LT2A 4Q3AA 1PU2A 1B3RA 3B20A 3GDGA 3R3SA 1NAIA 4FW8A 4DQVA 3PZBA 3RD5A 1C0IA 3PQDA 3TWOA 1Y8RB 2AQ8A 5CDGA 3VPFA 1M6WA 4R54A 4M1QA 3IUPA 4M89A 4WEQA 1U2DA 1U9JA 3KETA 2J5KA 1O94A 3MEQA 2NTJA 2C2YA 3VZPA 1HKUA 4YJFB 2PWZA 2R00A 5JYEA 2I3AA 2WYWA 4XQCA 3UHAA 4AJJA 2GN8A 3FPLA 1EFLA 4D0RA 3RSHA 4YRBA 3EYWA 4ND1A 1T2EA 3GY0A 4D79A 2P2SA 4S1VA 5JNLA 1V35A 6ADHA 4FN4A 2ZYDA 5CEEA 4W9NC 4ONEA 1RM0A 4L4XA 3TNLA 3GGOA 1T2AA 4YT5A 1J4AA 1CWUA 2WYVA 5T8KA 3DZJA 4WE3A 4YJDA 3IP3A 3RUDA 1NVGA 5K9ZA 3CPSA 4URFA 5LDHA 2EKQA 1VJTA 5JDIC 3H9QA 1BTOA 1PIWA 3LC1O 3SVTA 1DAOA 3L0DA 2FN7A 1YWGO 3FHLA 3TPCA 4MVJD 4J2OA 3D7LA 1R15A 1N7GA 3V2HA 1N9GB 4LCJA 4KQWA 2P5YA 4CM9A 1QMGA 1IPEA 4B79A 1DFGA 4TVOA 1NWCA 3WTBA 4A7PA 3WOHA 1A71A 1NXQA 3DQPA 1W73A 4W6ZA 4JP3A 4O5OA 3E8XA 4CM8B 4M86A 4CMAA 3IJPA 1ISGA 2C29D 3GNTA 3TZKA 4BO9A 3P2OA 4WOKA 5ITVA 2DTDA 5EJ2A 5ITWA 1DIBA 4BO6A 2AMFA 3OEYA 3P7MA 1LTHR 1Q7GA 3RIHA 1JTVA 4DL9A 3WB9A 3QWHA 1T26A 1A7KA 5FI3A 1HDXA 3K8ZA 3G79A 3W4KA 3W8EA 4RF2A 1VSUA 3EHEA 1R0KA 4CODB 2V6FA 3L4SO 1DXYA 4IXTA 1I2CA 4B4VA 2X22A 3DHEA 3KZVA 5CDUA 2FR1A 2Z1NA 1I8TA 4IM7A 2AG8A 4P4GA 3VH1A 4AJHA 2RHRA 5U4QA 3LF1A 3RC1A 5A06A 1U8XX 2GYYA 3IQDB 3QRWA 4OYRA 4MVJA 1E3WB 1NBOA 4ZA2A 2V6GA 4B3HA 1GCUA 2VOJA 2P91A 1Q0HA 2YUTA 1E6UA 2BELA 1IZ0A 2EW8A 3QVXA 4ZN6A 4XYGA 4BO1A 1AE1A 4GWGA 1UJMA 5HS4A 1F8GA 3ZW8A 1G0OA 3T4XA 1DC4A 5HRUA 1JW9B 1OC2A 2NADA 2YHIB 4ZQEA 5EERA 4B7UA 1YE3A 1ZK0A 2EIHA 3RCBA 3GDOA 3AM5A 1R4NB 3AI3A 3LK7A 3MTJA 1G0NA 4FDAA 4IJWA 5GZ6A 3ZWBA 3LVFO 3ZWAA 2JAHA 2JFGA 4B4UA 2BGKA 3IAHA 2OORA 3WQRA 3AUTA 2VWHA 2VHZA 3VTZA 4MKRA 1CF2O 2YFHA 1YL6A 2V6MA 4DIOA 2VHYA 2GZ3A 4W99A 5DOVA 5TIIA 3IL2A 3AWDA 5MDHA 2VYNA 5EIOA 1GUYA 1P0FA 5G0VA 1U3UA 2X4GA 3H7AA 4D7AA 3L6OO 1IOLA 3DBRB 1WDMA 4LRSB 1U4OA 2AQHA 2B4TO 3K30A 5ES3A 3U4CA 4RPJA 2IZZA 1Y81A 4MVJG 1MP0A 1IUKA 3K5PA 1GTMA 4YAEA 4ND4A 3PP8A 2O7QA 5AXAA 1JWBB 5DCUA 3QHAA 3HB5X 5F1KA 4BNIA 5ER9A 1KY5A 3RBZA 3A9WA 3EAGA 1MFPA 3NJ4A 4WLFA 3E18A 4A27A 3INGA 4CPDA 1B15A 4N54A 4OOEA 4RDHA 5FYDA 1GADO 4IDEA 1SEPA 2Y05A 4IPTA 4PVCA 3INRA 4QUKA 2OOSA 4EW6A 3O38A 2NVBA 3GFGA 1WAMA 3RWBA 1L1FA 3HHPA 1PGPA 3DBLB 2XF8A 5G4LA 3NTOA 1HSOA 4M8SA 4GH5A 4UUMA 3PXXA 1IHXA 5K6AC 4B4WA 1ONPA 2B35A 2NVUA 1O89A 2JKVA 3QE3A 3BMCB 4WJZA 4J4BA 5A3JA 3MCVA 4DXHA 1DRWA 2Q1WA 3BIOA 4CM6A 4XGKA 1Q7CA 2BFOA 2NU7A 4BNGA 1Z82A 2HK7A 1HE3A 1BDBA 1P74A 4WCFC 1PX0A 4MIYA 4MVJH 2PD3A 2O3RA 4GLLA 4PLTA 3ASVA 1UXGA 3TZHA 3I4CA 2ZYGA 4UVGA 4YVFA 2R00C 3S1LA 2UVDA 4M55A 1LQTA 2DAPA 2PH3A 2IZ0A 4OKIA 3EDMA 1GAEO 1X7GA 2Q45A 1HT0A 3GN1A 1EZ4A 1M2WA 3G1UA 3UKOA 4B8ZA 2X6TA 4HUJA 2Q2QA 4R9SA 5CG2A 3H8VA 3VPXA 3DAPA 4GKVA 4R1UA 3HWRA 4D41A 5IAAA 5T8KC 2VYVA 4IBOA 4C7JA 4FOOA 1AN9A 1M76A 4TWRA 3Q2IA 3WGIA 5ICMA 2DVMA 2PGDA 2LDBA 1I01A 1PS9A 4Y6RA 3ZWCA 5T64A 4EZBA 4CLEA 2ZB7A 1PZGA 1ZK3A 4CL8A 3ONEA 4W82A 3IKVA 1MV8A 5TC4A 1HLPA 1GZ3A 1SBYA 1XU9A 2PK3A 4IY1A 3U4HA 5TF4A 1DDOA 4PLZA 3H3JA 4CR6A 3BHMA 3UF0A 3KVOA 4JJIA 2GZ2A 4LK3A 1UXKA 3FWNA 3I9MA 3PHGA 4Z3DA 3X2EA 4D45A 3EGOA 4YXFA 1NAHA 3JCZA 4XDZA 2FP4A 1NFFA 1LC3A 3GVHA 1EE9A 1WVGA 3ANMA 1G6KA 1PS8A 3K6JA 4JQCA 4YEDA 3ZWNA 2Z1MA 3B6ZA 1GQYA 3JQ9A 4JBHA 2O2YA 5L4SA 2GLXA 4Z0TA 1N2SA 2I5PO 3L6DA 4OQYA 4E31A 5JW6A 3MWDB 1KEVA 4LGVA 1HETA 1WXDA 4J4TA 3LC2O 1C0KA 4LCEA 4WLEA 2QRLA 3JD4A 4WLOA 1YH3A 5I8ZA 3K92A 4R3NA 3E6AA 3ROQA 3S2EA 5CAEA 5TGDA 1PL6A 5GZ1A 4K28A 1H6BA 4E5YA 1NFRA 2VRCD 1R66A 3GK3A 4XD2A 1E92A 1M6HA 2EEZA 3BMNA 2IYOA 3F9IA 3H5AA 4RF3A 4JX8A 1HLDA 3B1FA 5G0UA 1Z6ZA 4OXKA 3WLFA 1YGYA 2X9GA 1BVUA 3WBFA 4R3WA 2C54A 2Y1EA 1B2LA 1GYQA 2JCXA 4I5DA 4QFCA 1E7RA 5JDCA 5JAQA 3WJAA 3JQ6A 4CMIB 3GEGA 1X7HA 5A9TA 2DFVA 3GAFA 4XR4A 2IXBA 2DUUA 3GVPA 4CMEA 1FDWA 5JAIA 1QLJA 1T2CA 1W8DA 3C7DB 4MPDA 2IRWA 4BO5A 2BFPA 3FCOA 2HDHA 1K0UA 1NWHA 1IL0A 4Q9NA 5EPOA 3AOGA 2J8ZA 3D5QA 3AW9A 4E32A 4ALJA 1VJ1A 2VCYA 3ULKA 4ALMA 4BKUA 2DBRA 3QLJA 2PTGA 4Z6KA 4K9DA 3C7AA 3WIDA 4ALIA 3WX0A 3HB4X 1VE9A 2Y68A 3PFFA 3PYXA 1VJ0A 4BQPA 3D3EA 3UGKA 4UEKA 3DZBA 3EC7A 5L4NA 1E7YA 3QWAA 3M1AA 1V3TA 1I3LA 5HBRA 2DBQA 4UULA 2UUOA 2OP0A 3VVBA 5JC1A 1LX6A 4DLAA 4TROA 3A4VA 3ZV6A 1HDRA 1GUZA 4A26A 1A4UA 3I9KA 4J1NA 3UCXA 4BL5A 3HFGA 3G0OA 5I9MA 1MB4A 4KDEA 2JCYA 4AJPA 1X7DA 4MVJF 4BOYA 3ENKA 2GO1A 5B1YA 3GMSA 4IDCA 1Y8RA 1DC3A 1NPTO 1PS0A 2OGUA 3C8MA 1B8VA 1SCUA 3ZDFA 4YDRA 4DPMA 4YR9A 2PD6A 3PQFA 2AG5A 2B83A 3TF5A 1EK6A 4YJFA 4HWKA 4MINA 3K2EA 1V9LA 5ENVA 3T7EA 5HM8A 4ND2A 4HFJA 3JQGB 3LT0A 5DNAA 1QKIA 1ZK4A 3BTUA 4YQYA 1B14A 1I33A 4R41A 5DOZA 1B8UA 4UAGA 5CDTA 1MXHA 1KVRA 3BHIA 1X14A 1BMDA 2JFFA 1SAYA 4BO2A 4I1IA 4DIFA 2I66A 3H5NA 3ANNA 1R4MB 4CLXA 1ZO8A 2QYSA 3PJDA 4DREA 4DTIA 4I9UA 1TA4A 2B5VA 1YQGA 4W4TA 3GZNB 5BNTA 4XQGA 1SO8A 3T4EA 1B8PA 3CMMA 2IE0A 2IODA 4GSLA 2EWMA 4RVUA 4AJ4A 3CKYA 4BUCA 2VNAA 1N9GA 2Y1OA 4GMFA 3NDJA 4HY3A 2Y0DA 4GGPA 3LYLA 5T67A 2FWMX 3RU9A 1C3VA 2EHDA 3DOJA 4PLVA 4GAEA 4NJOA 2W2LA 3PHLA 4CM8A 4L4RA 3IIEA 3H2SA 1SZJG 3DMTA 1LDNA 5CFZA 3O9ZA 1O5IA 1EUCA 1O8CA 3QWBA 1PL7A 1U8FO 1F8FA 2VT3A 4U0KA 3GUCA 2NVUB 3UH1A 3O8QA 3RUCA 3KHUA 1E5QA 1LUAA 3PWSA 3VTFA 1YBAA 4DA9A 2O48X 1IHYA 4P8RA 3K2BA 1LLUA 3E5MA 3GRKA 4RQTA 4MOWA 3CH6A 2GERA 2X8LA 3BMQB 3KYDA 1SNYA 3NDIA 4EBFA 3NTQA 2IYPA 3WGZA 5JC8A 1U28A 1BG6A 1HDOA 2DPGA 2Y99A 3DMYA 1DHRA 2NLOA 3U5TA 2HUNA 1YO6A 1EQUA 4BGEA 5ENDA 2FHSA 3WBBA 1TXGA 2I9PA 3UUWA 3BTOA 1H0KA 1EBFA 1PR3A 2FR0A 3ROPA 4HNHA 3ZWWA 2YHIA 1DLIA 4FFRA 1ISJA 5LDGA 2B37A 1DIGA 4KTTE 3HN2A 1FJHA 4R9RA 1R4NA 2CFCA 3NUGA 1RM4A 1ZVMA 3F1LA 4CLRB 2QX7A 1EQ2A 1E77A 4Z9YA 1NP3A 3H5RA 1LEHA 2QG4A 2BMAA 3KLMX 2NSDA 3SJUA 1AHHA 4FFNA 3HE3A 4HFRA 1ZXBA 4RGBA 5IN5A 2EV9A 4DBVO 3JSAA 1IPFA 1ZSVA 2X7HA 1XQ6A 3FR8A 4E13A 1YBMA 1NASA 4ESOA 1U7HA 2PGLA 3HDYA 3DHNA 2E37A 4AJEA 3ZHBA 1X1EA 4PLHA 3PLRA 1NQAO 5F1PA 1QORA 2YQ4A 1XYGA 3I6QA 3OA2A 2X5JO 4CM4B 4INAA 3DBRA 3E9MA 4EEZA 3TFOA 1KEUA 4E5MA 5FEUA 3WG9A 5L9AA 1EVYA 5JDCC 3W6ZA 2X9NA 1M75A 1QSGA 1OFGA 3GLQA 2WM3A 2O3SA 3DZKA 4HADA 4OM8A 5U1PA 3TN7A 2D8AA 4CMEC 4E2ZA 1GZ6A 1JN0A 3FD8A 1Z7EA 5B37A 2BKAA 3HDQA 3OBBA 3JTMA 2VZ9A 4WNCA 4NBTA 5FWNA 3BMNB 1P1KA 2RCYA 4E3ZA 1FDSA 3ANLA 2Y0EA 3M2PA 3I4FA 2J3HA 4F6LA 1QRRA 3D4PA 5ADHA 1GEEA 4JNKA 1AUPA 1ZXLA 4WLVA 2YJZA 4FGWA 2Q1TA 1UAGA 4YAKA 5JFOA 2GPTA 5KJCA 3DBLA 4AJ1A 4J1QA 5U9CA 4IDAA 3O03A 3M2TA 2ZTLA 5JAMA 1HE5A 3FWZA 4PLFA 3GHHA 3JQCA 3FBTA 4NBUA 4CV3A 1OBFO 4MVJP 3B1JA 1UUFA 3GVXA 4W7IA 3PWKA 4MO2A 4NU5A 1EE2A 4AG3A 1S6YA 3PVZA 3U49A 2GGSA 2G1UA 1E3LA 3BMCA 1OZAA 2B69A 1R16A 2X1HA 3MOGA 3G49A 1H2BA 3D4NA 3UXYA 4HP8A 2YHUA 2VWPA 2VNSA 1CQJA 4RCVA 3UVEA 3KEOA 2CDCA 3ZWVA 4BNUA 1QYDA 4S3MA 2HLPA 5IDYA 4YRAA 4PG8A 2P4HX 3VPGA 4CQMD 2CSUA 1PJ4A 4LRTB 1HDYA 4J2HA 1ID1A 4DQUA 4IGEA 2FRDA 4TKLA 1N5DA 4U0JA 3I1JA 1ZNQO 4Q3CA 2C20A 4BNZA 1EMDA 1O6ZA 4NHEA 4ZQFA 1XU7A 1V6AA 2OZPA 4TZKA 4AJNA 3GVCA 4U7WA 4QSMA 4Z9FA 1D1SA 5I9NA 1EVJA 4FJ0A 4RVGA 2GR9A 3WYEA 1MXFA 4D42A 4YT4A 3C1TA 3MJCA 4CM3A 4Q39A 3F4BA 2FR8A 2ZYAA 3NEPX 5KVQA 3DZHA 3HSKA 3RUIA 3ONFA 2GN6A 3WDSA 1C1XB 4A2CA 5GZ3A 8LDHA 1HYEA 1X0XA 2Y66A 3JD1A 1C1DB 3FRJA 3OJ0A 3PJFA 1M66A 4EUFA 4AJKA 1P45A 3H9GA 3WSWA 1A9YA 3P19A 4I8XA 3JQ7A 1EDZA 1K6XA 1PL8A 1ZK1A 3AJRA 4NNJA 1K2WA 4KOAA 3FF4A 4PLGA 3FNEA 4IDGA 5IG2A 3JQ8B 2EGHA 3IUSA 4DLBA 2C5AA 1S7CA 1VL0A 2YDYA 4DUPA 5J23A 4CMKA 1R0SA 1PWXA 3JV7A 3PYMA 2H9IA 3K96A 4WASA 3F6YA 1GU7A 2PNFA 4ALKA 4XQEA 2PKQP 4RZIA 3VH3A 3PWZA 3V2UA 3VPSA 5HA5A 3ON5A 3AM3A 3F47A 1N1GA 2GASA 4TRJA 5T6BA 4PGFA 4XB1A 1I36A 3CSDA 1E3SA 3HDHA 1V8BA 2G5CA 5AXBA 4BO8A 3KV3O 2D4AA 4HNGA 4EITA 3VKUA 4N5MA 1TI7A 2DC1A 2VUTA 2HRBA 2ZTMA 3ABIA 3GR6A 3SX2A 3UAGA 3T7CA 2C7VA 3GOHA 1FDTA 3DTYA 3H2ZA 4YJHB 3ETDA 1YXMA 2EP5A 1LRJA 1WWKA 2WDZA 4AICA 3O8QB 5JY6A 5JMPA 4OOFA 4RVHA 2ZK7A 4YPOA 1RKXA 1BGVA 4OKNA 4BGUA 4F6CA 5C37A 4CMIA 4BQRA 4PG6A 1KVQA 1CIVA 4YA6A 3QA9A 2B36A 3OQ6A 4YBZA 2PGJA 3KYDB 3WGOA 4DPLA 1JA9A 1U4SA 4D0SA 4ALLA 2A94A 2RHCA 2W4QA 3OSUA 1ENZA 2HKIA 4ZGWA 4QO8A 1DAPA 2VT2A 1GQQA 1CQIA 1JAYA 2FOIA 5CEJA 2VWGA 3ZNQA 3WMXA 3CE6A 1H6DA 1N8KA 4IXWA 1ZFNA 3P5SA 4JLWA 4IJUA 3I5MA 2AA3A 1LSUA 1YB5A 5EN4A 4IINA 2I67A 4WLUA 3M6IA 1SB8A 4E5PA 1U5AA 3IC5A 5KOIA 2CF6A 1I2BA 1LSJA 4ZRNA 3FR7A 3FNFA 5JO0A 3HFSA 5TT1A 4J9VA 4B4OA 1CEQA 1OMOA 3GGPA 4RF4A 5DULA 4BNWA 2FSSA 3STHA 4BIIA 1LDMA 5A04A 3N74A 4FR5A 4Z9XA 3AUSA 3L4BA 2TMGA 3NJ8A 1XSEA 3PQEA 1K89A 5CHEA 2WSBA 2P5UA 3VVCA 4BVAA 4DPKA 1LLDA 4P4LA 3ZWOA 3JQGA 3KTDA 1PQWA 3HNPA 4PLWA 4E4YA 5IZ4A 1VM6A 3G1TA 1NYTA 1U7TA 3W4IA 1E3JA 3PDJA 1RJWA 3EUWA 1PQUA 1MGOA 4E2YA 1KVUA 4E30A 3IJRA 3OQBA 3ZU2A 1N7HA 1R4MA 3NKLA 2CD9A 3PFWO 4RORA 3UN1A 4DC0A 1QV7A 2OP1A 1XQ1A 3GZNA 3ZV4A 5F5LA 1RPNA 2HK9A 1ENOA 3LSYA 2NNLD 4J9UE 3PJEA 3DZGA 5IJZA 1EFKA 2AEFA 5F5NA 1HEUA 2EJWA 2AXQA 3AFNA 4CMJA 4CM5A 2WE8A 1DJQA 4JN6B 4FSHA 4K6CA 3ROKA 5JCJD 2RAFA 3KSDO 3ITDA 1ONNA 2BFAA 4HFMA 2CZCA 3R3JA 1Y9EA 1EVZA 2O3TA 1E7QA 2X58A 2Q50A 1GD1O 2WJPA 1NFQA 1ZJYA 4YT2A 4TZTA 4J4HA 3AM4A 1WDKA 1HZJA 4IQ0A 4C4OA 5EESA 3EVTA 2QRJA 3WWYA 4GMGA 4NZ9A 3CXRA 2V6BA 1WP4A 4ITUA 1J0XO 3PEFA 4GVXA 4PLPA 4JBGA 4WECA 3BMQA 2BI8A 3DZIA 2VN8A 4K6FA 1TT7A 4FFMA 2NTVA 4XR9A 3E9QA 7MDHA 1LRLA 4EYEA 5JY1A 4PG5A 4A73A 3VDQA 4NPCA 5DBGA 4Z3KA 4Q3NA 1E1KA 1KEWA 3D4OA 3B1KA 5HS6A 1Z75A 3DDNA 2EGGA 4B3IA 5KVVA 2JHFA 2BFMA 2WMDA 4YQZA 3W6UA 5CEFA 4PRLA 3JQFA 4TMFA 3GHYA 4BMSA 3RKUA 1LDYA 3CIFA 2FY8A 4RVDA 2DU8A 2UUPA 3UICA 3GEMA 4YTEA 1Y1PA 4Q3EA 4LN1A 1XEAA 2R6JA 1HTBA 1LJ8A 3KSZO 4CM1A 3D1LA 4JGBA 4A0SA 1BXKA 1QXSA 4KUHA 3B70A 4MKXA 3GG9A 4N18A 3DOOA 1YJQA 4NFHA 4J16A 3QVOA 3D3WA 4CLRA 3ZV3A 3JQ7B 2ZCVA 4KZPA 5DCWA 4D46A 3OIGA 4MJLA 3ZCXA 3FNGA 1A72A 1LRKA 3HQ4O 3IMFA 3DFUA 1BHSA 2P9CA 4KDFA 4QXMA 3WICA 4B7XA 4BO7A 5JYDA 3BAZA 4KWIA 1Z74A 4QT0A 3QWFA 2HMUA 5JLAA 3S2IA 3TZ6A 4CQMB 4WNIA 3WLEA 3RFTA 3OIDA 3LDHA 4MVJM 1JWAB 3WTCA 1ZMOA 1ULUA 3PRJA 3I9LA 4MIOA 4CM4A 4OAQA 1WZEA 2ET6A 2J3KA 3JQDA 3QVTA 3OHSX 1QV6A 3LQFA 4R1TA 1K3TA 3EK2A 1UXJA 5IFLA 4KTVE 3BZUA 4ZQGA 2XPCA 4XYLA 1IY8A 2R2GA 2OL4A 3RJ9A 2NM0A 2HJRA 4LW8A 2B0JA 5K0ZA 4NBVA 5IF3A 4FBGA 1ZUD1 1GV0A 3GPIA 4PG7A 3RKRA 4PN3A 3S2FA 4E0BA 2I6TA 1HDZA 4XA8A 1I24A 1HDCA 3ZI0A 1RM5A 1DOHA 1FDVA 4DVJA 1KY4A 4JJGA 1LSSA 3WMWA 3CZMA 3RBVA 4IIUA 1T4BA 2CY0A 4FFPA 4ZRMA 3WS7A 4NBWA 2DBVO 3GDFA 4FC7A 1HDGO 1IULA 1CERA 3CMCO 2GNAA 3DXFA 3N58A 5TX7A 1A27A 5JBIA 1QYVA 3AFMA 4XYBA 3SLKA 3NT2A 3EVNA 5TJ9A 4R01A 1I10A 1Z45A 4UUOA 2PLAA 1FXSA 3ZWMA 3KOUA 3GPDG 3GAZA 2NU6A 3NV9A 1ULSA 1ZK2A 4JXKA 3Q1LA 5AVOA 4LSMA 3KSUA 1KERA 4ZQHA 2WD7A 4BNFA 4YAIA 3JD3A 1KVSA 3Q9NA 4JP2A 2BGMA 4I5FA 1RM3A 2O7SA 3GEDA 3Q0EA 5ER6A 4R1SA 4IMPA 5I7EA 4I5GA 3VPHA 3ZU3A 1R6DA 4PCVA 5I9LA 2O2SA 1FMCA 3JQAD 3HADA 1ISFA 1Q2XA 1JKIA 2YYYA 4B8WA 3DTTA 4H7PA 2B5WA 2VRCA 1MC5A 5IDWA 5A03A 2WEKA 3AI2A 3H6KA 3R6DA 2VHWA 4MP3A 4DRYA 5LCXA 2I65A 3WFIA 4BGIA 3PPIA 2X9VA 2EG9A 5A3VA 1Y6JA 1P1IA 1I3KA 3R0IA 4BO4A 4GVLA 3MZ0A 4OHUA 1ADBA 1C1XA 4FCCA 1EUZA 2ZB4A 1JAXA 1LDEA 5G4KB 3RUHA 1C1DA 1UDBA 2NQTA 2ZB3A 1DFHA 3OICA 1D4FA 1Z7BA 3V1TC 4BNXA 1F17A 4GX1A 4UUPA 1ZEJA 3O4RA 1ARZA 3H3FA 2AQIA 3WYBA 1PGNA 4NK5A 1EUDA 4R5MA 4MP6A 3JQ8A 2ZIZA 1U5CA 2A92A 2A9FA 4AL4A 4XJSA 1PJSA 1YBVA 2XXBA 1JQBA 4E5KA 1UZLA 4UUNA 4M54A 1XIVA 5TNXA 3W1VA 1CETA 2OBNA 4FC6A 1KVTA 1LQUA 1PZHA 3JD2A 4IIVA 1D8AA 4Y98A 4K26A 3K31A 2DKNA 3D5TA 2Y0CA 2EXXA 3TJRA 1P44A 1DJNA 1ZBQA 3CTMA 5GMOA 2JHGA 3L6EA 2TMDA 4EUEA 5KIAA 1MX3A 4QEDA 5BNIA 2W98A 4PZEA 1Q0LA 2X0NA 1M67A 1XLTA 1YOVB 3SBOA 4TRRA 1PGJA 2XOXA 4KWHA 4U6SA 4HBGA 4Q3DA 2NV6A 1N92A 1X1TA 1JLLA 1ZKMA 1T2DA 5G0SA 1OAAA 1YB1A 1MG0A 1QYXA 4YJHA 3RJ5A 4A03A 4J7XA 2GN4A 3OQ1A 3DFZA 5C7IO 3KB6A 4RPGA 3I52A 3GMDA 1HRDA 1DIRA 2W90A 1C14A 4FS3A 1I30A 2FPIA 3IOYA 5TQVA 5H82A 3PIIA 2CVQA 4UVIA 5BNFA 4CLOA 3QY9A 1MLDA 3GGGA 4FJ1A 2G76A 1I3MA 4LISA 4RV9A 4G5HA 3RC2A 2BHLA 1ENYA 5AQ1A 4G81A 9LDBA 1R37A 4RL6A 3HDJA 3ZNNA 3CUKA 3A28A 4XB2A 2O3UA 1NR7A 3ZNPA 2ILTA 3D64A 4B7CA 2WYUA 2RBEA 3LZ6A 5JDIA 1DEHA 5C5IA 2VWQA 4HFNA 1XCBA 1YB4A 2POQX 3F4LA 4EJ6A 1NHWA 2O50A 1PJ2A 2NUAA 2W8ZA 3TL2A 2PKQO 2O4CA 3RASA 3QVSA 4F46A 1XDWA 3ADPA 3G17A 5KJ6A 2PH5A 1NPDA 4FPXA 2H1SA 5KKCA 4PLCA 4QTZA 3DBVO 3WNVA 3JQ9C 1C0LA 4TRMA 2VZ0A 1BXGA 3OA0A 3EY4A 1ZIDA 4NG5A 1XR3A 3UCFA 5I7VA 1Z73A 4NMHA 2H63A 4FFLA 4YB8A 4C7KA 1I3NA 3D3WB 3GNQA 4DIBA 5TS3A 2Y1CA 5IZCA 1LXCA 1O95A 1DB3A 1UAYA 4KUEA 5KNLA 3VDRA 1L7EA 3X2FA 4IZHA 3WR5A 2H6EA 2HQ1A 4WUVA 4D3DA 3BHJA 2H5LA 5AOVA 3HZZA 4IS2A 1UZNA 2C2XA 2D2IA 2D3TA 1H2HA 2SCUA 2D0IA 3EZYA 3FTNA 4G2NA 1RYEA 3UCEA 4PRKA 4PLYA 5DF1A 1BWSA 5TT0A 3V5NA 2GCGA 4WLNA 5I7FA 2BF7A 4ZJUA 5KCZA 1T24A 4R5HA 2JCVA 5TRTA 3SJ7A 1PEDA 4Y6SA 2X5OA 1E1NA 3I23A 2ZQZA 1ADFA 4U6QA 2HAEA 4RVFA 1R12A 2G82A 4QQRA 2RIRA 1P9LA 5ILOA 1AXEA 2PZJA 3BA1A 4L0QA 2ZTVA 4BKPA 4ZHSA 2HRZA 5COAA 4WPGA 4YYZA 1PZEA 4BO0A 3JYNA 1GV1A 1UXHA 2OO5A 4BNLA 4IQGA 1U3VA 4L4SA 3WYCA 4DYDA 3DOCA 2X86A 1AHIA 2UYYA 1E5LA 1LSOA 2YW9A 3GG2A 3NTRA 2VTDA 1C0PA 3WNQA 1JVSA 4E5NA 4L76A 3DBHB 3IS3A 1NNUA 1TEHA 5THKA 1Y9AA 5BT9A 5LC1A 4AVYA 5KJFA 3QQPA 3UFXA 3JYQA 1D7OA 3VH4A 3IKTA 1MG5A 4OSPA 1IE3A 4TKMA 2B4QA 2WD7B 5EINA 2JD0A 2GN9A 5COBA 4AFNA 2WWRA 3M1LA 4IZIA 2YV1A 4FFOA 2E49A 3NYWA 3QV1A 3VH2A 1ISHA 4ROSA 4O1MA 4BNVA 5IXSA 4Y8VA 5G2OA 4E2WA 4R4JA 1GL3A 2PA3A 2OFPA 3LT4A 2PKRA 4N5NA 4AJ2A 5DDIP 3KXDA 3EMKA 2HJSA 1YDWA 7ADHA 3PK0A 1ONOA 3G3EA 1JKFA 1UXIA 2ZB8A 1ENPA 5ILGA 1P1JA 2HO5A 4L9RA 4JIGA 2D1YA 3RC9A 4FOSA 3NDRA 1K5HA 2AEMA 3O26A 2GF2A 3NAQA 4U5QA 2QZ9A 1VLLA 2ZJ0A 5DBFA 5KJEA 4DYVA 5CDSA 4OJNA 3DAGA 2OBYA 1TT5B 2XXJA 1E7SA 4OXNA 2Y1GA 3WXBA 3I9NA 3ZHXA 2OHXA 2ZCUA 3SXPA 2Q46A 3HJAA 5JPIA 3RROA 3MJ4A 1V3VA 3FBGA 1NVTA 3E1KA 2A4KA 2DTEA 3KYCB 2J5RA 4P4NA 1LU9A 4I9HA 5CPBA 1ORRA 1EK5A 2EERA 1GCOA 4BV8A 1OC4A 1SB9A 2BLLA 2JL1A 5THQA 1WDLA 2FZWA 1YS4A 4MDHA 3ORFA 4EJMA 1DRUA 1OI7A 4CMHA 4CUKA 1P0CA 2PD4A 2Q3EA 1DFIA 3OP4A 4CM9D 3AU8A 4CQMA 5EMHA 4WCFA 2GZ1A 5AXDA 3JQAB 1Q7BA 3MJTA 4WGGA 3DMTC 4CMCA 5G0TA 3C7CB 1RWBA 4GX2A 3ETGA 3RFVA 4PVDA 4CLDA 3ZZNA 4ZU3A 3ZNOA 3PLNA 1EEHA 5JO9A 3RC7A 4GPD1 2Q49A 4D43A 4FJ2A 1XGKA 3ICCA 1IZ9A 2W2KB 2VQ3A 3I9OA 3AUUA 3MOIA 3Q3CA 3H9JA 2CF5A 3QJ5A 1HWYA 2VOEA 3BMOA 1P1RA 3U09A 1Y5RA 3AY3A 3OETA 1P1FA 3TQHA 4AJOA 1SC6A 1U3TA 3F46A 2Z5LA 4RQUA 2YV2A 5KVSA 1XG5A 1X15A 2C59A 5JMWA 4UVDA 4FB5A 1P33A 2LDXA 1E6EA 1ZSNA 1HYGA 4OH1A 4E21A 2IZ1A 5ICSA 4ZQBA 4XRGA 2E82A 3F5SA 3BYZA 4CLOB 3FTPA 5DCYA 1AXGA 2IEDA 1TB4A 5JE8A 3ETEA 1H6CA 1XKQA 5T57A 2Y1DA 4XZ3A 4HX5A 3PTZA 4XX0A 4GI2A 1X0VA 4L74A 3N7UA 1GYRA 1PJ3A 3UOGA 1Y8QB 2EKLA 4X54A 3KEQA 3ZWXA 2AE1A 4BNKA 3RUFA 1LDBA 3AI1A 5IZCC 1UDCA 4BNHA 1F14A 2O23A 4XQ9A 1BW9B 1JU9A 2F00A 2NU9A 2YQ5A 4FGSA 1NHGA 1ZZEA 1DC5A 4JROA 5BR7A 2PZKA 5FF9A 4OXYA 3RBXA 4J6FA 2Q4EA 2VYND 3OF2A 5C3MA 1GDHA 4UREA 3E03A 2J5QA 1U2GA 3L07A 2CDAA 5L45A 3HG7A 3W4JA 5TSDA 1SOWA 1BXGB 1T1SA 1E7WA 1ISIA 3OH8A 8ADHA 1MC4A 2DUWA 1YRLA 4DQXA 4WEOA 1IB6A 1H9BA 5C7LO 4L75A 4PFJA 2CMDA 3RVDA 3OIFA 1VKOA 5G4KA 3U3XA 1U1IA 5T5QA 2C5EA 4XYMA 3TRIA 1LDGA 1PGQA 2EKPA 1CDOA 4NK4A 1DHTA 1E1MA 1V3UA 4A5OA 2PR2A 4AJIA 4CR7A 4WCDA 2V65A 1AGNA 4CV0A 1VL6A 2YV3A 3PHHA 4MP8A 4RPLA 4R68A 5B4VA 3H9UA 4N7RA 5L7WA 4BMVA 1UP7A 3K9QO 3AOEA 1DLJA 2GRAA 3KUXA 2Q99A 3FI9A 4QFDA 2C07A 5DP1A 3TZCA 1GEGA 3GH3A 4IQ8A 2GSDA 5A5FA 1L7DA 3WQSB 5IDXA 1LLCA 5F3RA 4IUYA 4ZVVA 3VC7A 1PSDA 1ZSYA 1RYDA 3NGXA 3IDSA 2DFDA 5JS6A 4UVHA 2YFQA 1BRMA 1HF3A 2DLDA 3PYLA 2WTBA 5L4LA 3OECA 3Q9UA 1DPGA 4IDFA 1YOVA 3E9NA 1A4IA 2P4QA 3BXXA 3V1YA 3A1NA 3GQVA 3AY7A 2GDZA 2AQKA 1SPXA 1KC1A 4YWJA 1XHLA 2UV8A 5KWEA 3BTSA 5A5EA 4N5LA 3NT5A 1YQDA 4J43A 4HKTA 2NU8A 5CPFA 4XGNA 2DM6A 4P38A 4BKRA 3ASUA 3GZ4A 2J3IA 2BH9A 4OQZA 3C1AA 1B3BA 4NJMB 3DB2A 1BDMA 3SLGA 1QP8A 1GYPA 3DL2A 1PR9A 3GT0A 6LDHA 1ISMA 4LMPA 1TVEA 4QX6A 2QYTA 2VYVD 1YDEA 4II3A 3HN7A 4XYEA 2DQ4A 4E33A 5L40A 4Q3BA 4CQLB 5JAZA 5AXCA 3WJ7A 4RF5A 2GD1O 3JQBA 3ONDA 4J1SA 3RAJA 1F12A 3INTA 1VSVA 1SMKA 3DHYA 2AE2A 5TJHA 1NM5A 4I5EA 4MVJI 3WQQA 4XCVA 1PTJA 1GR0A 5IXYA 4DLLA
chains in the Genus database with same CATH superfamily
3RTDA 1Y5MA 4EO4A 1JV2B 4P3PA 5K3BA 1VXOA 1J8DA 4EI7A 3HKDB 1XQWA 3A6PC 3QSGA 1PKEA 2DBZA 2HMYB 2VXYA 3WGYA 1MABB 1QRAA 2CHFA 3PU6A 4G8DA 4PQYA 2ZTUA 3I6IA 4KDCA 4TV8F 1FNCA 3Q2OA 3AIIA 4ZKEA 1UDRA 4L0MA 1XZPA 3QPWA 5HGJA 5BSHA 3F3SA 2N3ZA 2ZQYA 4ID9A 4NFYA 4A6EA 4B9AA 1KETA 4RIEA 3R9IA 1MQSA 1AK2A 4O63O 5AKIA 2Q6KA 3QBTA 3MTIA 1P73A 1KIFA 2PXXA 2J9YB 3EBPA 3OLQA 4QNRA 5ALEA 2WWFA 3WSVA 1DJMA 3LLVA 1EK1A 4C04A 5I5GA 4RPCA 1K4YA 1Q83A 2FRXA 3AHIA 3OCZA 3GRCA 2Q5EA 3V8BA 5IC6A 3S8MA 2VTKA 3KE8A 4JSTA 4MUKA 4C4YA 4OQNA 2BMWA 1NUQA 4KVGA 4Q16A 3PUZA 4EPTA 2QRVB 5BWLA 2YRWA 3DD5A 3H5LA 1ZAKA 3T3PB 3AV0B 5LBTA 1XEWX 4H16A 4BE9A 1ZMTA 3A31A 3UTDA 3KQPA 5JXWA 4KZKA 2FZCA 1FF9A 3QG5A 4JKYA 2R8RA 3AFOA 1YK0A 2ZKLA 3S2UA 3ZYZA 4ZO9A 3IT0A 1F5NA 3EQ7A 1PUXA 3I2KA 1HYHA 3T54A 1H6AA 3DM9B 3LCUA 1JQ5A 4OU5A 4ZYUA 1QC5A 1QQBA 3HKEA 4CTOA 3MINA 1U8TA 2X0JA 1Y3BE 5BYKA 1YUNA 4M7WA 5HWSA 5FADA 1M9NA 1SEVA 3FPHA 3KU1A 3KQVA 1QKJA 5D6NA 3TB4A 3CRRA 5JS7A 2HMWA 1FP4B 1V71A 3BMOB 4E7OA 3A11A 4QULA 3T5TA 4H4DA 3U7QB 3TZQA 2C98A 2DFNA 3QLUA 4HAIA 2L69A 4LA4A 4AZ0B 2PRIA 2P6PA 3V8VA 3ZHOA 1G3MA 2IBMA 2ZJ4A 4EI8A 2GK7A 1WMAA 3RRXA 2J3EA 2OOKA 3DZFA 1IM8A 1KP3A 1RS0A 5EL0A 4KXQA 2PSEA 4C4RA 5A4DA 4HGYA 1L4KA 2E48A 2SKEA 2YC4C 3JR7A 2Q5CA 5JVDA 3ZXIA 2WDPA 1F0YA 1NJ8A 3FPSA 4QDTA 4A2WA 1WLYA 1L8AA 4U7DA 1RXVA 4I1VA 5KJ1A 2YZ7A 3B3QA 1XXHA 3LOQA 4HQ0A 1EBUA 2NN3C 1Q0ZA 3FLAA 2OZLA 4YXWD 1RYHA 4N12A 2BI7A 3FM9A 5EHQA 1HLGA 1A5ZA 2QRGA 1NZJA 5F64A 5K03A 3GLGB 3F5QA 2O9JA 1P3JA 2QMEA 2UZAA 2MSLA 3ZHVA 4Z4EA 2AHRA 3NRCA 4JJAA 4Q93A 2GAOA 2Y2VA 1QFZA 1U0NA 3VOSA 1WBJB 2RKWA 4BIMA 2CMFA 4HAZA 4OSOA 4Y6PA 4DBZA 1HNNA 4EDFA 2WD8A 3VZQA 1U98A 1UJBA 1X1SA 1Y7PA 1JKJA 3JRWA 4QDJA 3ZXYA 3W5DA 3DEFA 4NU6A 2YRXA 4GZMA 2XDAA 2CDBA 4BBAA 1DWOA 4LF9B 3W9YA 2J4DA 1A8IA 1JUDA 5FR2A 1OFUX 1VRWA 2OSVA 5FH9A 5F21A 1XEFA 2H2FA 3F1KA 1RLUA 3L77A 4L9WA 2BE7A 4NQZA 4QHYA 4EQZA 1SOVA 3IUNA 3U40A 4B5LA 5K0BA 1F51E 3C3PA 4U5XA 4K05A 3RAGA 4UBMA 3VYRB 1HL3A 1I2MA 4X97A 1BH6A 5EZQA 4QNNA 2VIIA 1IEVA 2CL7X 2GZAA 4DF3A 5BN4A 1GO2A 4A4DA 4CIAA 1E3IA 1PJLA 2EF1A 4IMRA 1MFZA 2XGOA 3P2YA 4F06A 3AQIA 2DUMA 2E6UX 3QP9A 4RWZA 5KHAA 1VHWA 5EE9A 3TI9A 2Z57A 2F55A 3PUKA 1NW8A 2N47A 4IDBA 4IH1A 4C4TA 2FV8A 3DT9A 3QW2A 4X8LA 1J6UA 1QP7A 1QH9A 3DV0A 3QE4A 1XJCA 2WKPA 2OHOA 3PGXA 2WTEA 3WQBA 3ZLVA 4HGOA 1ODIA 2FFAA 3VC3A 1R74A 2DBYA 5J2UA 3A4IA 1TT5A 4KQXA 4LXTA 3U7JA 5YASA 3VC2A 4EB8A 4FZ5A 3AF5A 4RPKA 2Q4BA 4CV1A 1JU4A 1MN6A 3M6AA 4I08A 4QECA 1W0KD 2ZJ2A 3IDOA 3OEEA 1Z15A 4DWVA 3H11A 4F2HA 4IIJA 2UUAB 1JALA 1FTYA 3CW9A 1PR6A 1UMCA 3HI4A 3IO3A 4MV8A 2JJQA 1OU0A 3GFBA 1K7XB 2YXNA 4FGJA 3KM0A 1XCOA 1HZZA 3E22B 3EE6A 1SKYB 4FIZA 4XLZA 5EIWA 4BP8A 4IFIA 2J67A 5EJ7A 5GADl 3FI0A 1UOEA 2ZSBA 3GFOA 1H8EA 1MR3F 4LY3A 2VVTA 4D9FA 2GBLA 5KKAA 2PQ6A 1XNGA 1K8XB 3Q7IA 1JZQA 1G4HA 3AEZA 4UKDA 1YVPA 4NV0A 1SVIA 1MRZA 2LIVA 1F06A 4Q4HB 1QBGA 1XTZA 3HV0A 4EB6B 2BFNA 4H08A 3WMRA 3MMPA 4C3OB 3OEWA 2HMTA 2L17A 1Z6YA 2EJVA 1MOPA 4O4JF 2GM4A 1DKMA 2MIIA 5D5QA 3IBFA 2WAXA 2XF2A 1PTKA 4QT4A 5J3JA 4MXDA 1ECCA 5J2TF 2AN9A 3MJEA 3P9IA 4BXOB 1U2EA 2W2KA 4ZP1A 3H65A 4G65A 3ZU6A 5JMOA 2OV2A 3FFTA 4C7OA 4XCXA 3KZNA 3ZTWA 1TUEA 2J9FA 3HEBA 3LYUA 3FHTA 2HA2A 1OXUA 5IH7A 4RO0A 1NBAA 1RJ9A 2QJOA 3D6MA 4UHCA 5JWHA 3JQRA 3TR5A 2R6CA 2QR5A 4CU5A 3RAPR 1Z56C 4I81A 2QE7D 3C85A 1R6XA 4PS0A 2X2OA 1D6MA 1NM5C 1OLXB 2YVAA 3QXXA 3H83A 2O7NA 3BVPA 3SOPA 1ZIXA 2ZKIA 3IAM1 4ACBA 3IOMA 3P52A 4RUKA 4CCYA 3NASA 2ZI7A 1EAYA 4GM1A 4Y0AA 2XTNA 3WHLA 2Z56A 4CMGA 5DT9A 5BUQA 2VJYA 1ZHHA 4GUAA 3CH7A 2FSHA 5H16A 3ABSB 3H4TA 2BM1A 3K20A 2FUNB 4W9NA 3VSAA 3Q2KA 4BFCA 2JFNA 2GAIA 1XMOB 1TW3A 4B6RA 2EFDB 1S02A 5KC8A 5CIWA 1KIMA 2ZJ1A 1ZL0A 2WWGA 2ZBDA 4G97A 5FPTA 5EKDA 3DTVD 3VZRA 4E15A 2IH2A 4MQUA 2YNMC 2IDZA 4J7AA 1RIFA 3PV0A 1I2ZA 1X42A 4KPUB 3UPDA 5CFQA 2FLKA 2GF0A 2CFTA 1VG0B 2Y1FA 4NCAA 3GX1A 3ROZA 3R5XA 5AI6A 4C7MA 3DO5A 1C9EA 4Q7EA 2OCXA 3BQNB 5C4IA 2YJ5A 2NXWA 4H17A 3VYUB 3TNYA 4G0VA 5KPJA 3JYHA 1JFFA 3GRPA 3KJIA 3FN4A 3VYWA 1SXGA 3LV8A 3DONA 4KNWA 3S55A 3FZNA 2I99A 5EYPA 4BNYA 3MCUA 2ZAIA 4BGDA 1X19A 1D1TA 1EX1A 2GNOA 2C2MA 2H17A 1L1RA 2WR8A 2PKCA 1W96A 2Z4SA 3OJLA 4QOEA 2VK4A 3MJSA 5ALDA 3STXA 2HBZA 2V7PA 4I9FA 4KK4A 4RFVA 5C9ZA 2DJIA 2QYHA 4H6WA 2OEPA 5EXEA 2VPWA 4UXJA 3DEKA 2G1KA 1JNYA 1AGRA 3WLHA 3K16A 2IL1A 4ASUD 4LOIA 3NOQA 4NZZA 4B3JA 3O6VA 5I9SA 2LCQA 3C41J 1SU8A 3RVPA 1V2GA 5AKXA 3ZWNA 3VSDA 2P3SA 3G2PA 3IQEA 4B73A 4YV0A 3BM5A 2OTCA 5D86A 4COKA 4WBNF 1E3EA 3AY6A 4H27A 4QQNA 2BRUC 1GT91 2DWUA 2J4CA 1DZIA 1X8XA 3MIZA 4HGRA 4LHZA 4M49A 1CZOA 5FFFA 4JYAB 4JJKA 1USIA 1H85A 3SC4A 2HFKA 1NUPA 2AV6A 5LQKA 4DV5B 1VDMA 5D84A 1I5RA 3D8TA 4TSKA 3ZD7A 1Q0QA 2LV8A 5F51A 1SQGA 1YMUA 4EB3A 4YCAA 4YLYA 1E0AA 3AUAA 4LMRA 3IP1A 4LYAA 4DANA 1ZD9A 1AQLA 2B8TA 2X0IA 3I4LA 3PICA 4XQ0A 1KS9A 4P7KA 1H2FA 1O9GA 4P4SB 1T9BA 3U9SA 1MB0A 1N5JA 3KFVA 4YP1A 2YC2C 3NYIA 1PI3A 4FLEA 3HJUA 2PL3A 4RXMA 1QG0A 3K9LA 3MTGA 3LVQE 4E12A 1OHHD 5CG1A 2RK3A 3K1TA 4KQ6A 4AYTA 2V59A 4RLSA 5T4BA 5BNWA 3SF8B 1D2AA 1M1NB 1HE8B 2P75A 4P3YA 3ZV5A 4AQDA 1J23A 1W5EA 1NP6A 3WRXA 1EESA 4YAGA 3KJZA 3AJEA 1H5QA 3L1HA 4TMXA 1DG3A 2ZRDA 2QL9A 4P53A 3UZUA 5B12A 3GLUA 2W2NA 3EJWA 3KYBA 4O1HA 3NLLA 3V1KA 3TMKA 1ZQ1A 3ORSA 3EVCA 1XK7A 1RTKA 2XUAA 4D4GA 5CAEB 2QHXA 4RCZA 1AU9A 3HBJA 5AVSA 4EA6A 5JQWA 5FBHA 3TX2A 4FFBA 3BMXA 3ECCA 5DBHX 1ZH8A 3ROXA 5BRNA 5L51A 3PXUA 2UUBB 3I6YA 2GLTA 4QUIA 5F1YA 4BMYA 1I7QB 4WY2A 3WGGA 2I3DA 3VPAA 4LVCA 1SD1A 1RQPA 1YDHA 2ZWVA 1O0SA 1ST2A 2AX3A 2H0AA 2QG9A 3DL0A 5DB4A 3N75A 4J3FA 5L7TA 3QX3A 3H84A 2VPYA 3O73A 4DV3B 1JIXA 4ZYVA 1TCAA 1HE2A 2IFTA 5E9QA 1Z6AA 3AH8A 3BRWA 1DPFA 2E4VA 2CBXA 2FZ5A 4NICA 2PVCA 4ARVA 1VYTA 5DHRA 3IURA 2CVOA 3U4DA 2GAAA 2QTNA 5LDGA 1R0LA 3UT0A 4CTMA 3CXUA 3IQWA 4PYQA 4BFTA 4I50A 4CQLA 2P77A 1K27A 2QVYX 5EQFA 4E6PA 3MTEA 1G16A 3ANTA 3LUPA 1ZRSA 4IOKA 4YROA 2QLBA 1V16B 4O59O 1EDBA 5AVTA 2P2YA 2GCNA 3NKFA 3OWHA 4LECA 4MQEA 3LQ1A 1OIWA 1KDTA 3N0WA 1VE7A 2Z95A 1GQ2A 1Y3DE 3IMKA 5BYBA 5BVHA 3FNHA 4MEJA 5CTAA 1Z47A 2RK6A 3W5SA 4C4ZA 2D5AA 2CNBA 5AW6A 3LVBA 5KI6A 3WLTA 2WF5A 5L95A 4AY3A 3Q6IA 4MKHA 3HKDA 3DQZA 4GUDA 4L8VA 1KYIA 3OMLA 2YWHA 5KWVA 1PZFA 2XMBA 4YJ2F 3VR4H 5KTKA 3AK4A 5FL3A 1JMVA 3U0BA 5BWOA 4IV5A 1OXBB 3OLXA 5M04A 4ZVRA 4CR8A 2H2WA 2VP9A 4YQFA 1KI3A 3LLSA 1J0DA 5E4JA 1FU4A 2JGFA 3PI7A 5KX5B 1YCGA 4YRDA 1I6WA 4PZ0A 4WBXC 5BV7A 1P3DA 4CF5A 3DYIA 3MUNA 2F1KA 3ND6A 1U2QA 4AX8A 4WOBA 5IJ9B 4X7PA 3O9MA 1C3JA 2Y1XA 4H15A 2EF0A 1DO2A 5KTTA 4D44A 4QBGB 5H80A 1V0JA 3PQCA 2AUNA 4Q3AA 2APJA 2RC6A 4JC5A 2GF9A 1EFCA 1N2OA 3B20A 4EG6A 5C8XA 1FFXB 3A36A 3OIUA 3BE6A 3PQDA 2AQ8A 2DHDA 5I6DA 1CUYA 1UBNA 2FCAA 2QRVA 2R8PA 1XI2A 3ZE6A 1Y6FA 3AB8A 3QHQA 4M89A 4MUYA 2COEA 1U9JA 1MOZA 1UOPA 4HZGA 2ERYA 3TRKA 4MUHA 2PWZA 4LZJA 2HRCA 3ESDA 1N57A 2GM9A 3UHAA 1NNSA 2E9SA 2GN8A 3DWIA 2XRYA 1CJBA 1NYQA 1EFLA 1T9GS 4QUEA 4YRBA 3RSHA 4NNOA 2XYGA 3GY0A 4RKWA 721PA 4BN0A 1H42A 1Q20A 3I2FA 2IVZA 1PD0A 2YXDA 4L4XA 3AKDA 1J2YA 1FP4A 1Q1BA 2XQIA 2RHLA 1CWUA 2WYVA 3A9TA 1ORIA 1NMYA 1T5OA 4DMHA 3HA3A 3MXOA 3P9RA 4RTSA 2FEWB 4WE3A 2E4UA 3RUDA 1GPKA 1RTTA 2FDXA 2WSMA 2OBXA 2WM8A 4URFA 5K9ZA 2QVBA 3O75A 5LDHA 2WMNB 1DO0A 3M3DA 3DE3X 1TM3E 1BTOA 3AEKB 3L0DA 1T1EA 2MSEB 2RG7A 1XZCA 3JWJA 2B1QA 5A4IS 4DSAA 4J2OA 3BH0A 3RSFA 4IGAA 3GXOA 3RS8A 4KQWA 2OB2A 3MAAC 2WYOA 4FD2A 3G8AA 3T7DA 5H02A 2JANA 4B79A 5F78A 3GLGA 3WTBA 3WMGA 3OLWA 3WOHA 1A71A 1NXQA 3WLOA 4XUCA 1BVYF 5E38A 1W73A 2FSVC 4W6ZA 1T34A 3ES9A 1UMKA 2GN2A 2C3OA 5B7NA 1NBIA 4RK1A 4EY8A 1MW8X 2ZBVA 3BN3A 3RK0A 3ZUPA 1FU8A 1LTHR 4EO7A 4DL9A 4LF7B 3IILA 3WB9A 3ECAA 5FUWA 5G1OA 1GTL1 1A7KA 5F4ZA 3P0FA 1HDXA 2DECA 2PXAA 2CJXA 4CGYA 4U2CA 2P0AA 3AFHA 1R0KA 3EHEA 3RSZA 4CODB 2GB4A 2YH2A 3RE1A 3HKBB 4QATA 3K09A 2OAP1 1ZUWA 3DHEA 4UNQA 3ZD8A 1ZHFA 3H2BA 2Z1NA 5KWJA 1QK5A 1KO5A 5U4QA 3BGDA 2QTLA 3LZCA 4JLMA 3K3PA 2LE0A 3U3ZA 4C0QC 4OYRA 1FTWA 3MUOA 3FX2A 1E3WB 4KBYA 3INNA 2Z30A 5A2QA 2J3MA 2V6GA 1VCOA 4B3HA 4PFQA 3E2PA 4QGGA 1ZONA 1Q0HA 2YUTA 4JR2A 1O6BA 4FDUA 4OU4A 5IEBA 3UXEA 1EYZA 1T9AA 1JMKC 3VJMA 4HWSA 5DXFA 2A9RA 1CTQA 3LHKA 1ES9A 1G0OA 1JG2A 2R7MA 4WIAA 2AOWA 3D81A 5HRUA 1WV0A 2XVXA 2RI1A 5ELXA 3MTAA 3E70C 4ZQEA 4BEBA 3GRAA 2A58A 4U7FA 1O6GA 1G21E 4OI0A 4YMHA 2E87A 4JBYA 1FFDA 1YE3A 3O3CA 4KIJA 4FFOA 3E22A 3KSAC 4U1RA 1R4NB 3KTOA 1U6KA 1H3NA 4LYJA 5GZ6A 4LBYA 3SVLA 1O5TA 3QBEA 4LJRA 2XV1A 2XCQA 2JFGA 3P71T 4YRRA 4B4UA 4E1AA 1LTKA 4A6DA 3JAWB 2I2FA 2Q6OA 3RVOA 4Q4HA 3VTZA 3F67A 4RFSA 4RHUA 4EB6A 3ISTA 2WJ3A 2V6MA 4BFWA 2VHYA 1RXUA 3AR8A 4GYJA 2PWPA 4MEBA 3V34A 4B3XA 5CNMA 3PUIA 3AWDA 5MDHA 1N5RA 1HT1E 3MXTA 4FTWA 2A6PA 1ORWA 4HH0A 3K9FC 2QRMA 2BZSA 4XWKA 2X4GA 2VDPB 1UKAA 3L8GA 1L5RA 2JNWA 1IOLA 4ZWNA 1G2PA 3B3FA 4BXOA 2XADA 1WDMA 4QPDA 4LRSB 3WP1B 3CZ5A 1NW3A 4RHFA 4X6UA 1J0EA 2IZZA 3HB0A 1CT9A 1XTTA 1MP0A 3U4AA 2XNDD 3K5PA 1GTMA 2DRIA 4EPWA 1GRRA 1MEJA 3LX6A 1LKZA 2O7QA 5AXAA 4F8JA 1H4TA 4L3OA 4UQOA 3B3JA 2Q3JA 3BT7A 2XXAB 5FL7D 3Q7QA 3QUBA 1KY5A 2C61A 4MGEA 2HPVA 1W19A 1HQKA 2OXCA 3N8KA 1KY3A 2M6SA 3PR2B 5F23A 1AKRA 1OLXA 2J59A 3EAGA 4YIHA 3E18A 4A27A 4CPDA 2Q0QA 4N54A 4DLRA 4RDHA 4C30A 1HLFA 3GAMA 1VHTA 1G5TA 3MIIA 1N3IA 1SEPA 2ISSD 5EFOA 1G19A 1JR3A 3E1GA 5FLKA 3INRA 4HZUB 4BFVA 2OOSA 4EW6A 1GVHA 3ZV7A 4GKKB 4ZDIA 3H05A 1EGMB 1BHQ1 2G06A 1WAMA 2WTXA 4KDRA 3PX2A 4B83A 3SQOA 1GGEA 5FUMA 4Y2JA 1UBGA 1I14A 4PC7A 2XF8A 8GPBA 3NTOA 3C8DA 5HIIA 4KYUA 1HSOA 3FKJA 3IE1A 5JEEA 1IHXA 3KPUA 4L8FA 5K6AC 3C6QA 3HVJA 4XFDA 3X3HA 1BHO1 3OCUA 1WUHS 1RHQA 2NVUA 4MV7A 5T3UA 3FGOA 2BLNA 2M1XA 2X8WA 3OFNA 3QNUA 4KPUA 4LC9A 1TKCA 4OQLA 2HU5A 1OI2A 4MAMA 4WJZA 3FTQA 4YJ3A 3AO0B 2BFOA 4C4SA 3NWEA 4NCNA 4FUQA 4GO1A 4E08A 3QVJA 4L22A 3AHEA 1XZFA 2HK7A 3R5JA 1HE3A 1MC1A 1TDJA 1TQ2A 4WCFC 4MIYA 2GPBA 2VHQA 4D9IA 4GLLA 3MD9A 3D2CA 4MTCA 3ZI7A 1C9YA 2QDKA 1LPMA 3TZHA 4YAWA 3PPVA 1MRSA 5M2QA 3L4JA 3WB2A 4JLSA 3C6ZA 1L4HA 4O3FA 2M32A 5DW3A 5FUVA 2R5NA 3CJRA 5GVSA 3FHCB 4I5IA 1PR1A 1KSGA 3OUUA 4NDAA 3ZK8A 3CLHA 4AU1A 1EZ4A 1M2WA 5ALUA 4YDSA 4B8ZA 1X77A 4RD2A 3K9BA 4K6MA 2ZZKA 1TF5A 4HUJA 2Q7DA 3RW9A 5J40A 3M3HA 2OQVA 3H8VA 5JPDA 1XJQA 1W29A 5AOAA 3AR9A 1O5OA 4IBOA 3SFVA 1Z4MA 1AN9A 4TWRA 4P33A 5BV1A 1L7MA 5ICMA 2O8BB 2OHFA 1HL7A 1TRHA 2LKDA 5AUOB 2PGDA 1UKCA 1Z5UA 2A7XA 4HL6A 2Z2XA 2IUUA 5J4HA 1OFIA 3MT0A 1MBZA 1ZK3A 2VPPA 1LBHA 3PC2A 4A91A 2BVNA 4CL8A 2OILA 4K88A 1LX7A 4H0NA 4W82A 2JIQA 3E23A 4BB0A 1N2EA 4OP2A 4ZFNA 4XIIA 4RDXA 1V39A 2QV7A 2EVWX 5DMXA 4DJDC 5HJ5A 3LDFA 1PK9A 3ESQA 4PLZA 1KZ7B 1RLTA 1DKPA 3H3JA 4CR6A 3ICEA 3FTEA 2I1WA 1BD3A 4JJIA 4OUKX 4ZOBA 4O2AF 4BQOA 2WWTA 5HM6A 2W6QA 1UKZA 3BK2A 4I4TB 3D54D 4C08A 3R3YA 4Z7NB 1KQGA 2NUPB 1LC3A 1WB4A 3SF8A 3K6JA 1PS8A 1M1NA 3EPRA 2Z1MA 4FYMA 1GQYA 4JBHA 4NEHB 2O2YA 5HEKA 2FXIA 5K09A 2HYIC 3HB1A 3KD2A 1N2SA 1GL6A 3SYLA 4BMDA 3AVTA 3VR6A 4LHEA 3LC2O 3D8NA 3L0YA 1JAZA 1SHTX 2NZ2A 2CUNA 3T3IA 1MC8A 4A16A 3A27A 1TEXA 4KR0A 2BUAA 2MSWA 3PEWA 3PEEA 3LUKA 5I8ZA 3K92A 4R3NA 1Y8ZA 1WE2A 2BIFA 1PFUA 3S2EA 3R2JA 3W8NA 5CAEA 2Z09A 3S0JA 4Q9IA 5TGDA 2WJAA 4K28A 1H6BA 1T6XA 2ZYWX 4BTLA 2OXTA 3MG9A 4Z9AA 1NFRA 3IP7A 1NOIA 3V4SA 4TUYF 3C6YA 1M6HA 1HRKA 4RK0A 1U8YA 4ETMA 3H5AA 3RADC 1QYIA 1U0HC 2G25A 1J2EA 1U1EA 4JA2A 4QNMA 1V43A 1ZGAA 2X9GA 5HPYB 3VNQA 2I9KA 3ZCSA 3ML1A 3WBFA 3ZIAD 3FKSA 1Z0IA 2G08A 1B2LA 2Z8XA 2JCXA 1XLWA 3EXHB 4QFCA 3NTXA 4E4TA 2FFHA 4JYZA 4RELA 1XVVA 3ZCQA 5KQSA 4YI3A 3JQ6A 3GEGA 4Y7CA 3RU3A 4JUIA 1C3OB 3LDAA 4RE6A 4XR4A 3O7WA 1YFZA 1U7UA 3KT3A 5AVYA 4H6XA 4BASA 1R50A 4XSHA 3K70B 5FNZA 1QLJA 2Q2OA 2XW6A 1W8DA 4D1YA 3REGA 1V16A 4BO5A 2OGTA 4UTVA 2I2DA 3UGTA 1R8YA 2BM8A 2CL6X 1GN9A 1IL0A 1JT2A 5EPOA 5AK5A 3AOGA 1UWLA 3D5QA 2IXDA 4RSGA 2C9DA 2ZJ3A 2VCYA 3T3NA 1GN8A 3ULKA 2JIBA 4BKUA 1H69A 1ZVVA 4K9DA 3C7AA 4ALIA 4LJ9A 3WX0A 3HB4X 1VE9A 2EQAA 2Y68A 3EG9A 4YLEA 1U1GA 1RAIA 1DJPA 3D3EA 2A5YB 3UGKA 5L4NA 2P4SA 1WTAA 4HLCA 3QWAA 1NVWQ 1I3LA 2HRRA 2UUOA 3ETLA 1FFBA 1KHHA 3LT5A 4K9RA 3VVBA 2PYDA 1NT2A 4PR0A 5CX4A 4GQIA 1TEVA 4AS3A 3K1AB 2ZRBA 3ZV6A 4Q48A 4C4OA 3NTUA 2HEGA 4NRDA 5BY2A 5KX5A 1T0HB 3UCXA 2Y71A 4BQSA 1R2QA 1Q22A 3WIBA 3HFGA 1Y1RA 2ZT7A 1DI0A 3G0OA 4JUAA 2VLIA 3KB1A 5IJ9A 1UEJA 2JCYA 3I39X 4JX9A 4XGRA 1KAMA 2QVXX 3C3KA 4FNOA 3VSCA 1N0IA 5GONF 4MVJF 3ENKA 4Q4CA 1FU7A 4F6RA 3X0DA 3FVQA 1XRMA 2KS6A 2BKXA 4PO8A 3K8OE 4IDCA 2OYRA 4P08A 4DRXB 2OGUA 1B8VA 2A8YA 3L6UA 4M3NA 4MV1A 5M3BA 1SCUA 3E0QA 1F48A 2ZU0C 2C99A 3QMWA 1UPTA 3X1ZA 4YR9A 5ABPA 5LJIA 1OT5A 3FCYA 1CUSA 2AG5A 4XWWA 3NVKI 5EIXA 2NXCA 1P72A 3M4JA 4MINA 1NRJB 5HZKA 1ZOSA 2HZ7A 4V0SA 1C9JA 1MJGA 2IPLA 3WNDA 4FKZA 3T7EA 5ENVA 2R1VB 2HSWA 1ZWLA 3CW2A 2VEOA 3OURA 3TE6A 2AD1A 2B1IA 1JI0A 4JC8A 5EP2A 521PA 3U60B 4DCCA 4BVEA 4UZFA 4ER7A 3S29A 1Z39A 4LYEA 3J81k 1XU4A 3P9YA 1B14A 5DOZA 4UAGA 3VOBA 4DLWA 2JIOA 2JI8A 3SX0A 1Z13A 2CNWD 2HA7A 1NR5A 3S81A 2JFFA 1NLZA 3AG6A 3HN6A 3NAMA 1R1DA 1JLSA 4UBNA 4BO2A 4EY4A 2ES4A 4I1IA 3TQRA 2R47A 1UBRS 2E85A 1SIUA 4HMQA 1QAQA 4HZIA 4TQAA 4JI1B 5TGTA 2I66A 3ZGVA 2QX6A 4DIFA 4B3TB 2Z9CA 1JLMA 4HG2A 3E5NA 4DTIA 2G67A 2HLDD 5CLFA 1II0A 4MA0A 3STWA 2OZVA 2IEAA 1V5FA 1J33A 1LCIA 4XQGA 5CXSA 3WNZA 2GCEA 1B8PA 3AEKA 3PE4A 4M0UA 1PTJC 5CA0B 4Q15A 5AJTA 2II6A 1FFGA 4BUCA 1O87A 1TYDE 1SUSA 3UJ7A 2R79A 4RD1A 4MARA 4PHHA 2H48A 2Y1OA 4MIKA 1AZWA 3MMXA 2XI4A 2Y0DA 4GGPA 1XZHA 4HY3A 2FWMX 4V0LA 3EW9A 4DWWA 2H9AA 4MYTA 3RU9A 4EUSA 5CLJA 2A9KA 3VNSA 2VQEB 2PKYX 5B6PA 4G9GA 5I8PA 1TCCA 1WPGA 4DV0B 4QJ5A 1NJFA 4UM9D 3RT9A 1LDNA 1I7NA 1KNXA 3T5MA 3FSGD 5CA1F 5CFZA 2QG6A 2C4TA 1O8CA 4QG7A 2EAUA 2W2QA 1JFRA 1PL7A 3CW8X 2VT3A 3H7IA 4QSHA 4Q9JA 2WHRA 5CYOA 1Q74A 3RUCA 3KHUA 2VRNA 5DM70 3FPKA 3AIOA 1NBMD 1YBAA 1Y5IA 1W5BA 2A2ZA 3UT6A 4DA9A 4QGSA 3T1VA 3E5MA 3D6JA 2WU3A 3MB5A 4JLAA 4A15A 1J8FA 3OQPA 2PGOA 5FXMA 1JXQA 4ZYTA 3WK4A 2V7XA 3EZ6A 4MOWA 4RQTA 5C1OA 2X8LA 3PGLA 3AUFA 3KYDA 2ZWAA 1SNYA 3HKBA 3NDIA 2Q5LA 2J33A 3HYCA 3I62A 4EBFA 2JA1A 3ITNA 4QOSA 1ZESA 1AO3A 2NPFA 2FP3A 2I7CA 3WYFA 4G4IA 4WXEA 4LJ5A 3N2NA 5JC8A 1R9GA 1GUAA 3TTYA 5F2EA 2NLOA 1TK3A 5EEGA 4BATA 3QTTA 2GVDC 3WV5A 4ND6A 1KHTA 3VPDA 3MWYW 4DSTA 4PW0A 3WBBA 1GFIA 1F8XA 3W90A 4CIXA 5FTLA 4ZYZA 2O2HA 2BFBA 1XZDA 5HYVA 2FR0A 3SEQA 3W2FA 4DNXA 2O5VA 3CWQA 1YQTA 4KYIB 3C45A 3I5AA 3AEXA 3QLUC 3I34X 3ZWWA 3IEXA 2CHVA 5CIQA 5JSYA 1I6KA 2I6GA 3R3HA 1ISJA 3WK9A 4GYWA 3NRJA 3DKPA 1RC0A 2XMPA 4KTTE 2YWBA 2NW6A 1BHJA 1R4NA 2IDKA 1JILA 4K9NA 4YMVA 1SY7A 1IUOA 1DQSA 1C80A 1RM4A 1ZVMA 4DM3A 4A92A 1X7YB 2QX7A 3AXTA 4NS4A 3KCNA 3JAWA 3NBMA 3EA0A 3VR5H 3H97A 3R77A 1W49A 3SJUA 1ULAA 1FVOA 3LCVB 1G8GA 4RD6A 3AUYA 1NJ2A 4RGBA 2ZAOA 1LJUA 4DBVO 4CETA 3JSAA 1CFZA 1IN8A 3FR8A 1NASA 4I19A 2G07A 1U7HA 4JL6A 3KSBC 2NO0A 3GJ3A 3ZHBA 4MJ3A 4JLDA 5DIZA 4FGKA 3W5BA 2YQ4A 1A5BB 1VYVA 1XYGA 1AMOA 2A9QA 2X5JO 1NXTA 4UOQA 5H8WA 3HJFA 1RQGA 1ZI9A 3HR4A 3TFOA 3AR7A 3IEMA 3EVBA 3EDOA 3W79A 5E2IA 5LR6A 4S1PA 1VKRA 2CHEA 3WG9A 1C4XA 3G9QA 1REQB 2ACEA 3IBYA 4LV8B 4ATNA 4JB8A 1RYMA 3GLQA 3T06B 3VU0A 1RU3A 2WM3A 4OM8A 4WFIA 4XUGB 2BV3A 1SA0B 1ZCBA 1Y80A 2PGIA 3TN7A 1M7GA 3ZZ0A 4Z3OA 1G3RA 2GJ8A 4OM7A 4K9MA 2P0EA 4MR8B 5B37A 3NR2A 2Y1WA 3JALB 3OBBA 1MEOA 2HDOA 1G7TA 1V4NA 3BJZA 3HH8A 3MT8A 3IPLA 5JOQA 3PE6A 1J9GA 1KGSA 4KR2A 2EYQA 3UWKA 4AKGA 1NVFA 1O58A 4E3ZA 2B3DA 1Z0DA 2B61A 3F6CA 3ND8A 3FYCA 4FUTA 4O1IA 3M2PA 2XKKA 5EGNA 4F6LA 1QRRA 3D4PA 3KQKA 4HZUA 5DISB 1KDOA 3H2YA 2OKGA 1GEEA 4WLVA 2ASVA 2E1RA 4GNKA 2XB2A 3B1YA 4FMCF 1VB3A 2Q1TA 1UAGA 2MTBA 3HBAA 4C2BA 2XA2A 4YAKA 4FM9A 1GDDA 1AK9A 3STVA 3SQLA 3FYUB 2ZTLA 3FWZA 4PLFA 3TD2A 2HHCA 2Y1LA 4CV3A 4EATA 2D1FA 2QF7A 3WJ2A 4ZGBA 2AKAB 5KCMA 2O6LA 3B9RA 4MO2A 4EUNA 4PICA 1C9KA 1S6YA 4L2IA 2FFJA 2GGSA 5TEWA 1ADJA 2OCPA 1UBJS 1DBSA 1HZZC 2X1HA 4FZRA 4K03A 5AUQA 3G49A 3D4NA 4JC4A 1O97C 1CJVC 3TTVA 1NVVR 3MGBA 3NI2A 4JOQA 4H4CA 1TQDA 1FS5A 5AVUA 2GBLC 4X7MA 1P0IA 3DLCA 3C74A 1QYDA 2J7KA 2HLPA 4Y2QA 5IDYA 4YRAA 4WY8A 3VPGA 2E3JA 5HCNA 4CQMD 1PG5A 1PJ4A 2WM9B 4PG8A 6REQA 5MFPA 3E7FA 1N77A 4LFBB 4DQUA 2G1AA 2PS1A 1CS0A 2WF9A 2OMKA 4AZSA 4YP9A 3I1JA 4Q3CA 3WLRA 1XNHA 3TKAA 1QUEA 4JT9A 3VKFA 4KPGA 1GPH1 3JZIA 4S2EA 2IYRA 5DYNA 1EMDA 1O6ZA 4NHEA 4BNZA 2O52A 2OZPA 1V6AA 4ZQFA 2JARA 5CXQA 5MFZA 2XUIA 3Q85A 1VI5A 4TZKA 4AJNA 2DYKA 3NHUA 4Q7JB 4U7WA 1YJAA 5D85A 5DN6A 2BEVB 2IIBA 4QSMA 5J63A 4ARIA 1P8AA 2R8EA 4GP7A 5KOHB 1CJMA 1Q5PA 1RPAA 5B64A 3WYEA 2P6RA 5ALRA 4DLPA 4MYDA 1QHHA 2MJLA 1GKIA 1V48A 2PGXA 1MEEA 2QX4A 3RJMA 1SQ6A 4D42A 4CM3A 5C81A 2FR8A 3IB6A 2ZS8A 3V8MA 1YGPA 3DV2A 4B46A 3NEPX 1GNPA 2JVKA 2VDNB 2GN6A 2YY5A 3RS2A 5KYUB 2O8DB 4K9LA 3CKMA 1PX2A 3CN7A 5CH5A 2A5JA 3H8JA 3JD1A 3V4PB 3BWYA 5ALPA 4C5BA 3HBFA 2O8BA 1G21B 3K0CC 3QXGA 2Z3VA 5JRJA 1L7OA 5SZKB 3VOAA 4IV0A 3QJYA 1B23P 4MMYB 1A9YA 3P19A 3C7TA 1EDZA 3AJRA 3JQ7A 1NBEA 2R1UA 3LW7A 3SQMA 1HE1C 1GGMA 2P1ZA 3AY0A 3HGQA 1Y6ZA 2QN1A 4JMPA 2PSJA 4Q3OA 5JZSA 1PUJA 1F0KA 1PDWA 2ZUWA 5IG2A 4JXXA 2WQ7A 5BXQC 3ZG6A 4IDNA 5E0OA 1VL0A 1SVWA 3D2LA 3GYGA 1NY5A 5C7YA 2GI4A 1PEKE 2CBGA 1PWXA 2PX5A 3PYMA 2H9IA 4WASA 3NYRA 4GW3A 4I4TA 5B53A 1Z4KA 4G5XA 5AOCA 2NUPA 3CBGA 1WY5A 4YUYA 5JSQA 2EFYA 3WP0A 3ZIDA 1JEJA 1WQ3A 3V2UA 3VPSA 2HSJA 4JI6B 3OQOA 4FP9A 4N65A 5JD4A 4AY6A 3BREA 5HF8A 3JAKA 4TRJA 5LM3A 1VL2A 2ASEA 3RVQA 4ETWA 4PGFA 4JLJA 4XB1A 4ZV7A 3CSDA 1KE2A 4DDMA 1Q44A 5AJZA 1PR5A 4BO8A 2O5EA 2E5WA 2D4AA 2WV7A 4E5UA 4RZXA 1H5NA 2GK3A 3VKUA 5BOSB 3E3LA 3THOA 1B8OA 3QITA 5DNYB 1UZUA 2DC1A 3RWMB 2VNIA 2HRBA 1II8B 1AQUA 3ABIA 3PFGA 1U0GA 1O8BA 1NSTA 4D9JA 3GRRA 3NBYC 3G13A 4FX5A 5K1ZA 1GTSA 1ODCA 3D6VA 2BBWA 2VYFA 2G71A 4BLWA 4NYMQ 2QENA 3IVXA 1N0HA 3PFHA 2WKRA 5DTMA 1XCPA 3L49A 1KTVA 2YL2A 1E79A 1ECPA 1M2HA 1XAHA 2GEFA 3KPVA 3MERA 4GSYA 5HQJA 2EW1A 2R8YA 3KEGA 2FPKA 3CZCA 3CT4A 5AI4A 3MFQA 5JSZB 5TMPA 4C7OB 3KHSA 4PG6A 2W6OA 4C6TB 3QA9A 5E9WA 2QY6A 2KE5A 5GM1A 1S96A 1JA9A 4EFLA 5FWXB 2MDTA 2A94A 4MVCA 2RGCA 4NTZA 1ATZA 1II9A 1M73E 4ARCA 4ZGWA 3LQ2A 2NZVG 2FAXA 2RJNA 4CCSA 3H5IA 1WCWA 2OHIA 4KVFA 4NYJR 2FOIA 1JAYA 4MWZA 5HKKD 4GKJB 4X65B 2PSDA 5LDDC 4DBLE 1JH9A 3OX1A 1YRYE 3ZNQA 1IHPA 3OZAA 5IJAA 2AH5A 1H6DA 1RYNA 5T41A 4A36A 3LHIA 2ENUA 4IJUA 3CF0A 4PZAA 5JHGB 4NCJA 2NUAB 3U81A 3LX8A 1YB5A 2C3UA 4F9GA 2HL6A 3ETJA 3OZBA 1SB8A 4PRZA 2NAPA 4X1KB 5FJJA 3TINA 3M4ZA 3CCFA 3K1AA 4OQMA 1X80B 4YRFA 1VG1A 2CF6A 1CZLA 5DU2A 2P1DA 3U7EB 1QPGA 3D7NA 1LTQA 4LMAA 4N39A 1E1RA 3HFSA 4KQ1A 4NATA 3WRXC 1WVIA 2IX9A 1IUNA 3TRDA 4QYXA 5IASA 2C96A 3PFCA 2QRPA 3DA8A 1CZNA 4EY6A 1RBYA 2FSSA 1S1MA 4EYGA 2VKTA 3RK1A 2HA0A 1IN1A 3D7RA 3QU5A 1SHJA 2X6RA 1F9AA 1Z5OA 4L9SA 1DX9A 1NXXA 4OAOA 5A04A 3B3GA 3N74A 4FR5A 2TMGA 3R6TA 5BQOA 5AOBA 1G8JA 3B51X 5CNKA 2P5UA 2HNAA 3BBLA 1J7KA 2ZOSA 3UJNA 2OV4A 3LXXA 3PXGA 4FX2A 1RXSA 3ZTTA 4EKGA 5JNTA 1ZR2A 2DCUA 1KJ9A 1YASA 2JDID 4ZEVA 4MUXA 5IZ4A 2V7VA 1ODFA 3H2HA 3AESA 3BGVA 1FEZA 2O2JA 3G1TA 3KOMA 3OE5A 4FNGA 1T3HA 5E1OA 3SBDA 1XVIA 2PL9A 3AVQA 3PDJA 1ZOOA 5AM3A 2CLCX 5C5EA 3FAKA 2QX9A 5IUNC 1MGOA 4FSXA 4E30A 4MEAA 1QIMA 4V2UA 1YRQA 5I9TA 1P7VA 2KHZA 3HKCB 3ZU2A 2VUIB 1IY1A 4RORA 5FHRA 1NV9A 2VBIA 1OBOA 4DC0A 3U3OA 4UHKA 5A62A 4DR4B 1QV7A 2DPXA 4S1OA 2D0PB 4FI3F 2O0MA 4ML3A 3AGQA 5CHYA 2DH5A 4CBVA