4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
1U7HA 4NQZA 2ZB4A 1I5RA 4J91A 5TNXA 2EIHA 3DBHB 1B2LA 4IZHA 4NU6A 3TFQA 3I23A 4YWJA 1A5ZA 1N9GB 1PJBA 4KTTE 4MVJE 3ZWMA 1ZCJA 4TZKA 1I3MA 1DO8A 3VDRA 3L4BC 5G4KB 2CZCA 5DF1A 1NM5A 1Q7BA 4PLHA 1NR1A 2E6UX 2FSVA 4FFNA 1OC4A 3SC4A 3GZNB 2GDZA 1EBFA 4LN1A 1I0ZA 3U09A 2VTDA 2G5CA 1LDGA 4LCEA 4RZIA 4ZD6A 1GL3A 2GN9A 5AQ1A 4PLPA 4XD2A 5FWNA 4FS3A 5C3MA 5AXDA 4RLSA 2FZWA 3GHHA 1LSJA 2NADA 1GTMA 3Q0EA 2G17A 3LF2A 1W4ZA 4DPKA 5HM8A 3HDYA 3GUYA 1ZSNA 4N5LA 4GQAA 5MDHA 3DZHA 3ZU3A 4Q9NA 4RDIA 5KVQA 4B7UA 4CLOB 4D0SA 4R51A 1LLUA 3ZHBA 3HWRA 4YJDA 5TSDA 4NBTA 1Z82A 4NBVA 5IN5A 4B8ZA 1JLLA 3BMQA 5I7FA 1N92A 1T2AA 4NG5A 3A9WA 1HE3A 1U2GA 2VRCD 1BGVA 1OOEA 1GR0A 3SXPA 5GZ3A 3S2FA 3G79A 3AUUA 2NVWA 3JQGB 3IP3A 4MIEA 4J43A 3OECA 1YJQA 3DQPA 4BNVA 1I32A 1IPEA 4QECA 3T4EA 1XA0A 1MG5A 1DBVO 2O2SA 1HYHA 1LU9A 1ENZA 5FI5A 4AJKA 2CSUA 5DZSA 1PL6A 4HNGA 4CM8A 1YO6A 2RH8A 1FDVA 4ZRNA 2NWQA 2PNFA 5TQVA 3HB4X 1XYGA 3FBGA 2ZYGA 4KTVE 4XGKA 3A14A 1QR6A 2CDAA 4M86A 1EQ2A 2HKIA 5C5IA 3CPSA 1NX6A 3X2FA 1WMAA 1UAYA 3FD8A 3BTSA 3G1TA 1DEHA 3QVWA 4OSOA 2X9NA 2BFOA 3DBRB 4PFJA 2JFHA 2VZ0A 2W2KB 2OGUA 3LC2O 1UUFA 1NFQA 1BTOA 4R16A 3D0OA 2PKQP 4FOOA 1TB4A 2ZQZA 3DEYX 1DC3A 3HJAA 1LXCA 4RVGA 1EVIA 2DTDA 4AG3A 5CFZA 1XELA 2BI7A 2H63A 3BXXA 3F1LA 5JC1A 3IC5A 1H5QA 2NUAA 3RJ9A 2NQTA 5DP2A 1GY8A 2JAHA 2WD7A 1CJCA 1BHSA 3PYXA 2CMDA 1B15A 3G49A 3A06A 1ZXBA 3Q3CA 1H6DA 4FGWA 1Y1PA 4E12A 4RORA 2WJPA 3CH6A 2I3GA 4ZA2A 4BNLA 1MLDA 4BNNA 1EE9A 4OXYA 4J4TA 5BQFA 3DC2A 3IIEA 4OM8A 2HJSA 1B0AA 3E5RA 4TWRA 4ALKA 1WAMA 3LT1A 5B4TA 5F5LA 1ML3A 3DHEA 1ZZEA 3L77A 1C3VA 3RWBA 1DLIA 3E9MA 5DP1A 4EZBA 1NR7A 1Z75A 4W7HA 1AHHA 1ZNQO 3GN1A 2DM6A 2IXBA 3Q1LA 5KCZA 3WBFA 4CM9D 3PP8A 4OL9A 1VRWA 1RYDA 3ZNOA 4MVJM 1Y9EA 2HCTA 1P1FA 4PG8A 7MDHA 1KEWA 1NHWA 4FR5A 3UGKA 5JNLA 2VHVA 4YAKA 5IDXA 1QYXA 4R1SA 4WLNA 1JKJA 1K89A 4IS3A 4XGNA 3KOUA 1D3AA 4XYMA 3PFFA 3O26A 2NU7A 3BMCB 4LW8A 4XKJA 3CINA 3OA2A 4QO8A 3DBVO 5AOVA 3LLVA 4U8GA 4NI5A 4YJGB 1H0KA 2FSSA 2R00C 1PWZA 3TOXA 3ENNA 3OBBA 1YKFA 2BH9A 2QRLA 3F5QA 2DT5A 4KMSA 5GZ1A 5L51A 1XU9A 2X22A 3AU8A 3ZV5A 3L9WA 4PLTA 5A5FA 3C7DB 1GAEO 2PD4A 4K26A 4LCJA 1WDKA 3B1KA 3OFSA 3RASA 2P5YA 4DC0A 1M75A 1F14A 2WYWA 3C3XA 3NTQA 2PK3A 4NK4A 4S1VA 1LDBA 1YVEI 1P9LA 3JYNA 3KYBA 1PGOA 2CF6A 5C37A 2OORA 4R5HA 5EIOA 2J5KA 1PL7A 3GDFA 3FRJA 4DMLA 3FHLA 4L73A 3ZWAA 1ISGA 2PH3A 2YHIA 3DAGA 1LSOA 4DQXA 3RUIA 2ZCUA 5AXCA 1VLLA 1ZVMA 3Q6IA 1YH3A 1J49A 5CDUA 1Z7BA 3AW9A 3QQPA 2HAEA 3WSWA 3WOHA 4CQMB 3DXFA 1WPQA 1K6XA 2C59A 2JAPA 3GNSA 4YDRA 3VH3A 3C8MA 3A4VA 4CR8A 3GF4A 3LVFO 4B3JA 4LMPA 3A1NA 2BFMA 5JCJD 2RAFA 1Z73A 4GX0A 3C1TA 4PRLA 3GLQA 3WGQA 4CLHA 3BMQB 1BXKA 2B5WA 1VE9A 4CM9A 1YE3A 5DNAA 2VCYA 3QJ5A 4Q3AA 3H5AA 1KVUA 4GH5A 3VZPA 5L40A 3AM4A 2UUOA 2CVQA 3VH4A 2H5LA 3UXYA 1NVGA 3KSDO 3OF2A 2EP7A 4RVHA 4RVUA 4DLAA 1O89A 2HRBA 4QQRA 1ENYA 4H7PA 1K6IA 2BGMA 2SCUA 3KETA 2EKPA 4CM8B 2WD8A 4EITA 4BO4A 3NX4A 1U3VA 4Z3DA 1MA0A 3B70A 3HADA 2CD9A 1I24A 3BTVA 4IQ0A 5THKA 5L9AA 3HN7A 3DOCA 3KO8A 3KEOA 3KRTA 2BMAA 1R6DA 1A27A 2YDXA 1QLHA 1VL0A 4UULA 5B4UA 1ZK0A 1U1IA 1TVEA 4IINA 3AY3A 1VM6A 4CUJA 4A2CA 3UUWA 2O2YA 4F46A 2HK7A 3PWZA 4M1QA 4BNMA 3M2PA 3MJCA 2B4QA 2GSDA 1UZLA 2PGJA 4J16A 4JJFA 4NK5A 3MJTA 3PK0A 5ENDA 3UCFA 4Z3KA 1SMKA 3ANMA 3H9JA 1GZ3A 3LDHA 3FNGA 2BI8A 4LISA 1K5HA 4FFMA 1MG0A 4UVHA 3PIDA 5FYDA 1NHGA 2VT3A 3LU1A 4W7IA 3P19A 4R9RA 2GNAA 1DJNA 4ZQBA 3TNLA 2ZYDA 3MOGA 4OQYA 3WFIA 4MJLA 1UR5A 1ZEMA 4RQTA 3BZUA 1PSDA 3ZI0A 3KLMX 2J3HA 3FR8A 3LC1O 4PLWA 3WQSB 2X9VA 5AVOA 4EEZA 2JL1A 4ND1A 3KBOA 1SO8A 4RVSA 5ILGA 3JYQA 1T4BA 3IMFA 1HSOA 4J3FA 1GCOA 1ISHA 3JQ7A 5EESA 2AA3A 2Y67A 5A3VA 3AOEC 4BL5A 5KTKA 3PHLA 5DULA 4CM7A 3QY9A 3K73O 2HRZA 4JP2A 3ONEA 3H2SA 4BKOA 2NNLD 2X0JA 4EUHA 4YVFA 4I5FA 4L75A 4OIMA 5JMPA 3GEGA 4IMPA 3VPFA 1WVGA 1IL0A 1P1KA 4B79A 2D5AA 4CLRA 3ITDA 2PFGA 3ADOA 5HTOA 2OMEA 4BNZA 3OICA 3ZU5A 1E6WA 1JU9A 3KYDA 4K1LA 4D3DA 1HKUA 2EGGA 1QG6A 3DTYA 3FBTA 3RU9A 1P31A 1I01A 1CRWG 3WGGA 2VNSA 2XF8A 1CERA 3STHA 2O7QA 3E1KA 3CZMA 1J4AA 3ZW8A 1U3UA 1X7GA 4CMAA 3SEFA 4R1TA 4NBRA 1Q0LA 1KVTA 5JAIA 4WCDA 4EJMA 1F8FA 1R16A 4UVEA 5JO0A 1LDEA 3COSA 4IPTA 4TKLA 3PHGA 3ZWOA 4I8XA 2UDPA 3QV1A 3RUFA 3GMSA 1OI7A 1Y9AA 4IM7A 4ALMA 5F1OA 2R2GA 1I2CA 3TWOA 2YV2A 2YHIB 2IEBA 2ZJ1A 3MOIA 1YB4A 4GWKA 3V1UA 2VNAA 1HZZA 3EY4A 4YCAA 5U1PA 5IXYA 1P1RA 4F3YA 1GYPA 4AJNA 1YBMA 3GRKA 4N5MA 4U5QA 3WNQA 3S2EA 4ZJUA 2O50A 1VL8A 2ZCVA 1DXYA 2VWGA 3C85A 2DPGA 3UH1A 2O3SA 3OJOA 3WDSA 3JQAA 1O0SA 1VI2A 4JXKA 3H3JA 4BNIA 5L4NA 2Y99A 1IPFA 2NV6A 4XR9A 3ZWVA 1ISMA 4E6PA 3NKLA 5DDIP 1DJQA 1Y7TA 2HO5A 4WOJA 3NV9A 4TVBA 3HDHA 2EKQA 3AOGA 2BGKA 4TRMA 5T67A 1NPDA 3OMLA 4WNCA 2V65A 3BAZA 4JBHA 4E2YA 4BO5A 2OOSA 1MFPA 4MVJF 4RPLA 2JHFA 4OKIA 2NVUA 2P2SA 1LEHA 3ENKA 3HDQA 1DC4A 3GGOA 3RCBA 5FI3A 4G5HA 1P77A 1XCBA 3NAQA 4EW6A 3W6ZA 3ZWNA 4A0SA 3TZHA 1E6UA 3E8XA 5L3ZA 2B83A 2Y0EA 4XX0A 4CMEC 1JAYA 3WJ7A 4XCVA 3B20A 5G2OA 3D1LA 3D5TA 3WMXA 4GI2A 4R1UA 3ZHYA 1WWKA 3C1AA 5G0VA 3H9EO 4G2NA 1VSUA 3W4KA 2JD1A 2VHYA 4E5NA 3GEDA 1L7DA 2GZ1A 1EVZA 4Z9FA 4EJ6A 2WM3A 5KWEA 3DMYA 2QX7A 3E9QA 3H5RA 3QP9A 3TDKA 2LDXA 3ICCA 5CPBA 4KP7A 1DRVA 5I8ZA 4BB5A 3HZZA 1D8AA 3ROQA 3R3JA 1NAHA 3D7LA 1I3LA 1H9AA 1N7GA 3E6AA 3JV7A 1FK8A 2VYND 3GFBA 4PZCA 1ISJA 4TZTA 1IULA 1GUFA 2Y1EA 5IN4A 2WMDA 4TSKA 3ROPA 5CAEA 1YS4A 2DLDA 2BRUA 5ER9A 3DAPA 2NQ8A 1X14A 3WYCA 1J6UA 4JP3A 3V8BA 2NLOA 5CPFA 1SAYA 1U4OA 1PZEA 3GN2A 2P9CA 3JQ7B 4J9UE 4FFPA 1B8UA 4OAQA 4A26A 3DO5A 3P7MA 3VPGA 4B4UA 1A9ZA 1LLCA 4U6SA 1R4NA 2LDBA 2HK9A 4D42A 3GG2A 4NBWA 2DPHA 2O3QA 2DKNA 3EW7A 4DIFA 3E03A 3V2GA 3NT5A 3NDRA 4QXMA 1BVRA 2D2IA 2Y1OA 3ETEA 3GOHA 4BHTA 2Q1UA 4YRDA 4E4YA 3D3WA 2Y1FA 4IJWA 1A7AA 1UJMA 4WKGA 3I9MA 4CM1A 5CDSA 3AY7A 3H8VA 1TA4A 3U4DA 5JAMA 1HDCA 2BFPA 3AM3A 3HFSA 3KYDB 3NDIA 4JCOA 4JNKA 2FR1A 1KVQA 2V6MA 3K9QO 3GGGA 4EJ0A 1NQOA 2PGLA 3PPIA 4YAIA 2EW8A 3S2GA 2G1UA 3VHRA 2Q3EA 3QIVA 4GX1A 4XR4A 3ON5A 3GMDA 3BTUA 1GEEA 2YW9A 3I5MA 1EVYA 1O5IA 1WZEA 5DCWA 3TZCA 1NASA 1B3BA 1HDYA 4MOWA 4Z0HO 1CQIA 4O5OA 3WTBA 1EE2A 1IE3A 3JQFA 4YRBA 3CZRA 3MWDB 1UZNA 4AJ2A 4TRNA 3OA0A 1E1KA 1T2EA 4DMMA 3ZGYA 2VQ3A 1VJ0A 3IJPA 2Q4BA 4MVJI 1KEVA 2VYNA 1DIGA 3WGYA 4NIMA 2AE1A 1KIFA 3EK2A 4DYVA 4B7XA 2Q49A 1R0SA 4B4WA 3ZWPA 1E6EA 4XA8A 3SVTA 1U5CA 3QVTA 2QQ5A 3AI1A 1PEDA 1TXGA 4HUJA 4RPHA 1KC1A 3I6IA 4OQZA 4D7AA 2RBEA 1I3NA 3JQAB 4G81A 4MVJP 3I4FA 4I5DA 1P1HA 2ZYAA 4AJEA 4J7UA 1LX6A 2VT2A 3GA0A 1YONA 3AK4A 4BVAA 4RPKA 3S8MA 3HQ4O 4XJSA 4D43A 2V6FA 2YFQA 2E37A 4MDHA 2GUGA 2I3AA 2PGDA 5DBFA 2ZB7A 4CUZA 3DAFA 5G4LA 2EJWA 4GKBA 3VH1A 2G82A 2ZTVA 4GVLA 4PIVA 5JSFA 4HADA 4U0KA 2NVUB 5JDCA 3QLJA 3RKRA 1IOLA 2JFFA 3UW3A 1T26A 3PTZA 1YWGO 1V3UA 1QYWA 5A02A 1FJHA 3I9LA 4MP3A 3Q9UA 4YQYA 5AXAA 3PJFA 1F06A 5EMHA 1SCUA 3PXXA 3TL3A 1FF9A 1HE5A 1OMOA 5G0WA 3W8FA 2GN4A 2P4QA 3JD4A 3OJEA 3WFJA 2JKVA 5F21A 1E1MA 4Y6PA 3LYLA 4YT8A 2VHXA 4DLBA 4G65A 2I66A 1IZ9A 3E82A 4K6CA 1ZEJA 3AI2A 4B3HA 5TT1A 1DB3A 1I3KA 1ARZA 4BO9A 1PJLA 1X1EA 3WYEA 5JAQA 5K6AA 1KC3A 2VWQA 1HDRA 1W0CA 4XJTA 3TL2A 4U7WA 1Z6ZA 3T7CA 2F00A 4M8SA 1FDWA 4Y6RA 4LVUA 4MKXA 3VC7A 3K6JA 2WYVA 4NPCA 3F3SA 4RVDA 5L4SA 1X7HA 3QHAA 4IXTA 3U4CA 1T2FA 1YQXA 1MX3A 8LDHA 1LRJA 1UDAA 1NPYA 1P1IA 1WW8A 1I2BA 2IODA 2ZB3A 1E92A 3RBZA 5IF3A 3KVOA 1R4NB 4YQZA 1EDZA 1GQQA 3DZBA 3ANLA 4GMGA 4WLEA 1D7OA 4F45A 2CY0A 4BNWA 4YAGA 4MINA 5B4VA 3NJ8A 3PLRA 4LGVA 3VPHA 2PZLA 3HSKA 4PG7A 4CUKA 4NDNE 3B1FA 1U4SA 2J6IA 3JTMA 1NQ5A 1X0XA 4E2ZA 3QWIA 4NHEA 4MVJH 4AJIA 1C1DA 1JWBB 4WK6A 2XOXA 2PZMA 3EAGA 2ILTA 3C24A 4A10A 3D3EA 1B7GO 1QLJA 1XR3A 4YRAA 2IZZA 3UFXA 4QFCA 1H93A 2OUIA 2A94A 1SOWA 3ADPA 5CHEA 1E1LA 3I9JA 1Q7GA 4EEXA 3BIOA 5JO9A 4XB2A 1F8GA 2QRJA 1UXJA 3KYCA 2BKAA 3EUWA 2D59A 4L4RA 3RFXA 1SB8A 1DAPA 1TEHA 2AHRA 2ZTUA 3GVHA 3PQFA 5H82A 4D45A 5FEUA 4BKRA 1R0KA 4NFYA 4IDBA 1CWUA 5TJHA 4ONEA 4Z0PA 1ISFA 1JW9B 1M6WA 4Y67A 3WQQA 2VWPA 2ZQYA 3BA1A 4CMCA 4YXFA 5TS3A 1JVSA 1UDBA 2RHRA 1VKOA 1Y81A 4YT4A 4M54A 4GL4A 2X0NA 2QYSA 3GAFA 4AJLA 4CL3A 1YOVA 1FDUA 3QA9A 1JQBA 2X5JO 2RIRA 2WE8A 2GGSA 2QW8A 5BSFA 9LDTA 4JJGA 2C29D 4W82A 2J8ZA 4Z9XA 1NTOA 4TQGA 4O59O 5T5QA 4I5EA 2VYVA 5ICMA 3N58A 4WCFA 2EKLA 3GT0A 5EQDA 4XZ3A 1KYQA 4XIJA 4FPXA 4OOFA 1K3TA 3FCOA 1X7DA 1A4IA 4P4GA 1PGPA 1RM3A 1KY4A 3MTJA 4QT0A 1ADBA 1ZJYA 4KDEA 3FNEA 1AGNA 4MIYA 1HZJA 2V7PA 4NU5A 4LRTB 5IDYA 5DOVA 4YJHA 1ORRA 3GGPA 2FHSA 3OJ0A 2I67A 3H65A 2Q99A 3DTTA 4CV0A 1AUPA 3JYOA 5ITVA 4I08A 5JY6A 4D3FA 4FD3A 4J7XA 3DDNA 4OOEA 5JYDA 1HEUA 4RF2A 4N54A 2NM0A 1V6AA 3CEAA 1HTBA 4BO7A 3CUKA 3UKOA 1XKQA 4JROA 3WG9A 2HUNA 2Q1TA 4J1TA 5EJ2A 3VTZA 5THQA 3DOJA 1E7SA 3MWEB 5L53A 2DBVO 2DAPA 3SJ7A 1QXSA 5EN4A 4HBGA 3DONA 3IKVA 3NTOA 4NNJA 3VZQA 3KHUA 3ZNNA 4OXKA 3WQRA 1EEHA 1Z45A 3PYLA 4IDEA 1M6HA 2J3JA 3CMCO 1V8BA 3C7CB 4IQGA 1EQUA 5JLAA 2DFDA 3GHYA 3WXBA 3DL2A 3MEQA 3QWFA 3VVCA 1YRLA 4GLLA 3WIDA 4WLUA 2PR2A 1PZHA 1QYVA 2IYPA 1ULUA 1B8VA 4FIZA 4IJUA 1I10A 3NDJA 5I9MA 4PVCA 3L0DA 3NT2A 1NPTO 4R54A 4E5YA 3GUCA 2DBZA 3LK7A 1FXSA 2X4GA 2Q46A 1PQPA 5I9NA 3BHMA 1ENOA 1A9YA 2JJYA 3ETDA 4GGPA 4RF4A 1M2WA 2GO1A 5F1PA 1XHLA 1EDOA 1V0JA 4KWHA 1BDMA 3QVSA 2C54A 2HMSA 5KVVA 1WDLA 2BD0A 1JDJA 4H16A 2EGHA 4NH4A 1MFZA 1PJTA 1UAGA 2ZB8A 4PLVA 1ZH8A 2C7VA 3AI3A 3U49A 5TRTA 1QRRA 4AJOA 5TF4A 4KZPA 3ZHXA 4CM5A 3IAHA 8ADHA 2POQX 3FPCA 4UAGA 1H6AA 3RKUA 2O7SA 3ICPA 4FGSA 4IDDA 5A05A 2VHWA 4JQCA 3RSHA 4ZGWA 2C07A 2VWHA 5IDQA 2Q45A 3JD1A 1XIVA 4DPLA 1B8PA 5BT9A 3F4BA 4DIBA 1C1DB 1ONPA 2YY7A 1EZ4A 3O9ZA 3UCEA 3K96A 5ILOA 2P4HX 3DZJA 4L9RA 1IB6A 2A35A 4URFA 4CLXA 2VUTA 4J2OA 3WWZA 2C5EA 4FB5A 1O6ZA 3BHIA 3L4SO 3GAZA 1X1TA 2Y05A 1KVSA 3DHNA 3QSGA 4BGIA 4DWVA 1I33A 3F5SA 3GNQA 4N5NA 3KYCB 1KETA 2GZ2A 1HXHA 1AE1A 3KB6A 2VZ9A 5A4DA 2X0IA 3WGHA 4A5OA 2B35A 2I76A 2X58A 5ICSA 1E3JA 1DIRA 1JVBA 2HU2A 4B4OA 3ZWBA 3SLGA 1PGJA 1E7WA 4HFRA 1ZMTA 2EHDA 4DGSA 2CUKA 4TROA 1KEPA 4UUNA 4UVDA 3QRWA 2WD7B 2DC1A 3NEPX 4WOKA 4J1NA 2WEKA 1EMDA 3WS7A 3ASUA 4PZDA 4XYBA 3TFOA 1XU7A 1ISIA 3G0OA 3I9KA 4GVXA 4JBIA 4AVYA 1YOVB 3UICA 4EI2A 3GZ4A 2P68A 4N18A 1OBFO 1YL6A 4Q3NA 1RM5A 3WNVA 4DA9A 5U4QA 3A28A 1A71A 1ID1A 4HY3A 4I9UA 1UP4A 3HG7A 1C14A 4L0QA 2YQ4A 4XIYA 3F9IA 2DVMA 4Q3DA 3GY0A 5BSEA 4HP8A 2GLXA 1LDYA 3TPCA 4ZN6A 3CXRA 4FQ8A 4WCFB 2GN6A 3JQAD 3GRPA 4R01A 3F1KA 4O63O 4QSMA 4B7CA 4DYDA 1O9BA 2PZJA 4BKUA 4E2WA 4YR9A 2ZATA 1SBYA 5KVSA 1CDOA 3FSRA 1O95A 4BO6A 1QP8A 1SC6A 2X7HA 2I99A 4IUYA 1LQTA 4ZU3A 1C0LA 2O3RA 2DFVA 4YJHB 3ANNA 3L6DA 4FJ2A 4CV2A 1MP0A 3M2TA 4J0EA 1JAXA 1TT7A 4BB6A 4AJ1A 3O38A 2X6TA 4MPDA 2AG8A 4D44A 4BO8A 4PRKA 3PZRA 4XQEA 3WTCA 1DLJA 4FFRA 4J7CA 4IGEA 4E2XA 4E3ZA 2Y68A 5KOIA 4LMRA 1LRKA 1U2DA 1LC3A 3R0IA 3M1AA 4PLGA 4FN4A 4IIUA 3Q2IA 4DQVA 1QKIA 2CDCA 2UYYA 3GG9A 3RAJA 4IY1A 1EK5A 1DHRA 3ZWYA 4YTEA 1SZJG 4FW8A 1D1TA 4HWKA 4AJJA 3GDOA 4BNFA 1V9LA 1IZ0A 4RF3A 3ZV6A 2ZTLA 2AXQA 4M55A 3RUCA 4U0JA 3KSZO 4PVDA 3EMKA 2O3TA 4BNTA 4OHUA 4CJXA 4NFHA 5LDHA 4CV1A 4ZQGA 4Y8VA 4R9SA 4UREA 3ZW9A 5EINA 2H9IA 3LF1A 4GBJA 2CF5A 4AFNA 4EDFA 3GQVA 4GPD1 3S55A 1X0VA 4C7KA 3DOOA 3OSUA 1PGNA 3GEMA 2IE0A 1E3WA 3HB5X 1JA9A 3K8ZA 3ZHZA 1ONOA 3AM5A 4YJFA 5CEFA 3IUPA 2FRDA 1PJCA 1X13A 1XQ1A 3R3SA 2A4KA 4XDYA 4Q3EA 1X15A 4RV9A 1G1AA 1XDWA 1YXMA 4XDZA 1OZAA 3RC1A 3IKTA 4HXYA 1YQGA 4EUEA 3TF5A 4RLHA 4JIGA 4BNHA 1SEPA 1T2DA 2FPIA 1HRDA 5JYEA 1JKFA 2VRBA 4W9NA 3FR7A 3ZWCA 4II3A 1YBVA 4XB1A 3QWBA 2GN8A 4ZQHA 1SNYA 1HYEA 4RVFA 3TQHA 5C7IO 3NUGA 4GSKA 2QRKA 4K6FA 4DBVO 1F12A 4OKNA 3CSDA 3PZBA 1R0LA 5KJ6A 3G17A 1MC4A 4XRGA 1UP7A 1DC5A 5FF9A 3E5MA 1HE4A 1GZ4A 3JQ9A 3ETGA 3VAZA 2VOJA 2GR9A 1VL6A 3PHJA 3ZDFA 5LDGA 4Q39A 4P22A 5JXWA 4J1QA 3U4IA 3AFMA 4CODB 1ZKMA 1NNUA 3ABIA 2EERA 3BMNA 4QTZA 5EERA 3O4RA 4W4TA 2TMGA 4TKMA 3T4XA 2B0JA 1SB9A 3VPXA 3WB9A 1D1SA 5T57A 4MKZA 3RC7A 1J5PA 2W98A 3QE3A 4XRRA 3VPSA 3CTMA 1U8FO 1MV8A 3NYWA 2Q2WA 5T6BA 4ALJA 2HSDA 4UVIA 1Y8QA 3EHEA 2C2XA 1PS8A 1RM4A 3E48A 3OHSX 4CR7A 2GRAA 4Z6KA 4BMNA 3B6ZA 5GY7A 4RQUA 1PJQA 5COBA 4OGWA 3H3FA 4AJHA 4F6LA 4CPDA 3K2BA 1G6KA 3JQFC 4KUGA 4BO1A 1T24A 1R12A 5EQFA 5JE8A 4DL9A 3RBXA 2D3TA 1W6UA 4MVJD 3I4CA 2IZ1A 4MP8A 1SEVA 2D8AA 3RC2A 2Q1SA 4K28A 1PS9A 1UZMA 1Q0QA 4INAA 4CV3A 4DVJA 5JDIC 4FBGA 1A72A 2YDYA 5B1YA 3HE3A 1GQ2A 1QV7A 2JCXA 3F4LA 3V1TC 3VKUA 2P9EA 4ND4A 3ZV3A 2RH4A 4L74A 3WGZA 5H81A 3V1YA 4A7PA 4ESOA 5GMOA 1P3DA 1XSEA 1WP4A 2W2LD 4KQWA 1V35A 1P0CA 4JLWA 2BGLA 4PG6A 5ES3A 3PHIA 3L9XA 5C7LO 4CLRB 1ZSVA 4I9HA 3BMOA 5I7SA 4GX5A 3OETA 5ADHA 5AXBA 1PJ4A 1A7KA 3GPDG 4MIOA 3U0BA 1CIVA 1AHIA 1E1NA 4D46A 2PZKA 4IDFA 5BNFA 1R4MA 1ZMOA 3AY6A 4YT5A 3QWAA 3ST7A 5CEJA 3I83A 2JHGA 1Q2XA 2XXJA 1M66A 3WR5A 2YV1A 4OMUA 5JDCC 1DC6A 1GPJA 4WPGA 3PFWO 2EW2A 4R3WA 2QHXA 3T7EA 5BSGA 2J5RA 2Z1MA 4WE3A 3ROMA 3PYMA 3C1OA 4X54A 3NJ4A 1BDBA 3TN7A 1B14A 4E5PA 3DMTC 4BNKA 3KV3O 4WEQA 5IAAA 3B1JA 1DAOA 1ZXLA 2UVDA 4PLCA 2DBRA 4YYZA 1EUDA 2AMFA 1YDEA 3VH2A 1PQUA 1PL8A 4DIOA 5A9SA 3FN4A 5JDIA 1GYQA 2Y66A 4YPOA 1LQUA 2X5KO 4MKRA 4UUPA 3KM0A 4YEDA 5IZCA 2CDBA 4FCCA 4BGEA 4FDAA 3PIIA 4MVJA 1S7CA 4B3IA 1E3WB 2YHUA 4UVGA 3UHAA 4TRRA 4BNGA 5K6AC 2OHXA 3PDJA 3U62A 4YJFB 3PJEA 2QYTA 3EVTA 3S1LA 1PJSA 5B37A 4TRJA 1U9JA 3ZWXA 5L4LA 1Q1NA 2Y0CA 1E5QA 3S2IA 4BNJA 4R68A 3OIFA 1UP6A 4TMFA 2V6BA 4MP6A 3W4JA 4WLFA 1F17A 3TOZA 1DSSG 3WJAA 1GADO 1A4UA 2PY6A 4I1IA 5LC1A 5FFFA 2W2LA 2OO5A 4E21A 3RFVA 3PGJA 3PWSA 4J4HA 3VZSA 3WLEA 1RWBA 3DHYA 1H2BA 4Q3BA 2XXBA 5JC8A 3ZCXA 1GYRA 1EFLA 1XGKA 4ZRMA 3I3OA 1V3VA 1EUZA 4IGFA 3SJUA 4YB8A 2X5OA 4HV4A 1HT0A 1LBEA 2O3JA 4IJKA 1KERA 4QEDA 1VC2A 4Y6SA 1E3IA 1SOVA 3H4VA 3KUXA 3DMTA 4DRYA 3I52A 4WLVA 5BR7A 3K31A 6LDHA 1H2HA 1Z7EA 2PLAA 1RPNA 1GDHA 3BMNB 2A9FA 4JX8A 1BVUA 2Q2QA 4QUKA 2OP1A 4HFNA 3RUAA 2B37A 5COQA 3BMCA 3DZGA 3O8QA 1KS9A 4RF5A 2E4AA 1U7TA 3LC7O 2P9GA 3QW2A 2Q1WA 4DPMA 3I6QA 1Y8QB 4KDFA 3DZFA 3W6UA 3G1UA 1DIBA 2E82A 5BNIA 1YJ8A 1XLTA 2FY8A 1DFHA 4GWGA 4RGBA 1HYGA 1LNQA 4ALLA 3KTDA 1O8CA 4UUOA 1T4DA 4W99A 3BHJA 4AJ4A 1KBZA 1NWCA 2QZ9A 5T8KA 5A9RA 2D5CA 3F6YA 1WXDA 4KWIA 3RVDA 1EVJA 1VJTA 4UEJA 3MTGA 2AEMA 4PCVA 2GZ3A 4H3VA 1YL5A 3TZQA 1R37A 3JYPA 3W1VA 4ILKA 4BOYA 2C0CA 2B5VA 2DUUA 3OJFA 4D79A 4P4NA 1PJ2A 3KLPX 4IS2A 3TSCA 3HUDA 4CMHA 4TVOA 2H6EA 3HNPA 4WJZA 3VZRA 1NXQA 2VYVD 1C0PA 1ONNA 4O1MA 4OXNA 3OIGA 1LJ8A 2ET6A 3JQCA 4JBGA 1HSZA 2HK8A 1DPGA 4CQMA 2W90A 4CM6A 4BO2A 1ENPA 5JS6A 3EVNA 1FDSA 3JYLA 3MJSA 4BNYA 2W4QA 4JK3A 1H6CA 4C4OA 2UAGA 4HNHA 4J2HA 4CR6A 3JD2A 3D3WB 5KJCA 2EXXA 3IJRA 4ND3A 4OJNA 4WCFC 3NGXA 4NBUA 1ZIDA 3WICA 1U8XX 2DTXA 3NRCA 3BMOB 3L6EA 2JD2A 3LLSA 2TMDA 1KVRA 1LDMA 4EGFA 5I7VA 4O0LA 3WWYA 2BLLA 2R6JA 4EYEA 3P2OA 1R4MB 3DBLA 1HDXA 2JCVA 4JJIA 5DT9A 2B69A 1ULSA 3ONDA 5JMWA 3DZKA 1WDMA 3D4OA 1IY8A 4J49A 2RCYA 1KOLA 2VTEA 1MXFA 4BV9A 2XAAA 3JQDA 4BUCA 4M87A 2AQ8A 4R3NA 3V2UA 5KJ1A 3K2EA 1HL3A 5TX7A 2IRWA 3L4BA 1VSVA 2FZEA 1GUZA 2OL4A 2QG4A 5J23A 2AQKA 1P45A 3M6IA 5COAA 4DXHA 5L7YA 1NWHA 4OYRA 3BTOA 1GQYA 5HA5A 4JGBA 1TT5A 3LSYA 5A9SB 1YQDA 4ITUA 1GFSA 4GAEA 1Y5MA 3PHHA 5ER6A 5IFLA 1TLTA 3Q2KA 1UXHA 4FJ0A 3JQ8A 4IQ8A 1LUAA 5ITWA 4CM4A 2ZK7A 3CKYA 3NGLA 4IIVA 2EWMA 1PR9A 1C0KA 2GPTA 3H2ZA 5JFOA 2J3IA 2C7GA 4DQUA 4ZQEA 1QYCA 1GV0A 3TZ6A 1M67A 4GSLA 4MO2A 2P5UA 2GCGA 3INRA 3P2YA 4Q3CA 4RCVA 2NU8A 1UDCA 1HLDA 1E3SA 4E31A 3HDJA 4AICA 2X0RA 1QMGA 5KIAA 3RIHA 3HFGA 4DC1A 5HRUA 2PWZA 4P4LA 1D4FA 4LRSB 3AJRA 3ASVA 1ZUD1 1N8KA 2EF1A 1E3LA 2ZKLA 3W4IA 4Z0TA 4BNUA 1Y6JA 2VRCA 3H5NA 4MVJG 4R1NA 4UEKA 5L95A 5CDTA 5TIIA 1LSUA 4HFMA 3QWHA 4BO3A 2IYOA 4CL8A 1PGQA 4F6CA 2I9PA 3OH8A 3R1IA 1Y8RA 1HLPA 5KKAA 4BNXA 2J5QA 4RZHA 3OQ1A 5ENVA 5CG1A 1DIAA 3RC9A 5C7OO 5BNTA 2CNBA 2CFCA 1P33A 2NTJA 1MUUA 3CMMA 4Y9DA 3GVPA 3OEYA 1KY5A 1UXIA 3O8QB 3D4NA 1AN9A 3OP4A 3SX2A 4CLEA 3L07A 2PD3A 5DN9A 1HDZA 3D4PA 3H9UA 2GYYA 1YL7A 3M1LA 3WLFA 2J3KA 2X9GA 3GNTA 1B16A 4IMRA 3IDSA 3SC6A 3R6DA 4DBZA 2B36A 4RPJA 4N7RA 3N7UA 4WECA 5LCXA 1H94A 2BFAA 4OSPA 1XWFA 2HMWA 3DB2A 3F46A 3EYWA 5T64A 4QFDA 1V3TA 4P38A 4IXWA 3ZV4A 1UXKA 4WLOA 1BSVA 1DFIA 3AWDA 3RFTA 4BMSA 3WGTA 4XGIA 3GH3A 3GVIA 4XEHA 2HMUA 3ZU4A 4AL4A 1DHTA 3CIFA 3OM9A 1N7HA 2WE7A 1J0XO 4E30A 3ULKA 1L7EA 2IEDA 1NP3A 2NU6A 1PU2A 2C82A 5CG2A 1GCUA 3U9LA 3GPIA 4E0BA 3P5SA 1Z74A 3GFGA 2YYYA 3NT4A 1RYEA 3OQ6A 5KKCA 5U9CA 5JPIA 3O03A 4NR0A 4ND2A 1XQ6A 2WYUA 7ADHA 3DWFA 4XWYA 3DFUA 3ZNQA 2CVZA 2NTVA 2VN8A 3MJVA 4RL6A 1U5AA 4UEOA 5KNLA 4I9NA 4NJMA 1E7YA 2HJRA 2HMVA 5GZ6A 1G0NA 2AW5A 1K6JA 4J90A 3L6OO 2PD6A 3DBLB 2FN7A 3RUHA 4NMHA 2GERA 2R00A 2Q50A 1CYDA 4CMIA 4GX2A 4CQLA 2VUSA 3KSUA 3BYZA 2NU9A 4E5KA 1PX0A 2PTGA 1E0DA 3RI3A 1GUYA 5DCUA 1P44A 2F1KA 2FOIA 2Z95A 1R15A 4WEOA 1LI4A 1QSGA 1AXEA 1PTJA 2WSBA 1T1RA 1R66A 3C7AA 1ZJZA 1LLDA 5B12A 4KUEA 1GZ6A 1CQJA 1N2SA 2HMTA 5CDGA 3GVXA 1I2ZA 2Y1DA 4ZHSA 3PDUA 5CP8A 3PQEA 2NVBA 3OJLA 3OEWA 1TT5B 5A06A 5G0UA 3TRIA 4D3SA 2YZ7A 3KZVA 2XPCA 3I9NA 2B4RO 3FWNA 3INGA 1WMBA 4II2A 3U4HA 2PV7A 4GKVA 3LQFA 3JQ8B 1ZBQA 4PLYA 4EUFA 3LT0A 3PLNA 4KOAA 3D64A 4PG4A 5IDWA 2D0IA 4CM4B 2PKRA 2H1SA 1UXGA 2VUUA 2Y1GA 3FF4A 3RBVA 4E33A 2CVOA 1PZGA 1PJ3A 3N74A 5HBRA 1E7MA 4IZIA 1FMCA 5G0TA 1O94A 2JD0A 3H6KA 1UH5A 2NSDA 3Q11A 3RROA 4A73A 5I9LA 2YV3A 4WGGA 4ZICA 3ZU2A 6ADHA 4B4VA 2NACA 3G3EA 1ADCA 4RPGA 4ROSA 2FR0A 1YGYA 3GVCA 4IBOA 4P8RA 4S3MA 2FR8A 2UUPA 4B8WA 1RM0A 5JCJA 4NZ9A 3W8DA 5F5NA 5L7WA 4L4XA 3GC6A 2GD1O 1N1EA 2EP5A 3E18A 3JCZA 2OP0A 4HKTA 3KEQA 4IDCA 2HLPA 2YFHA 1VKNA 1M76A 1LA2A 3PQDA 1CF2O 3F47A 4W9NC 4W6ZA 1TI7A 1ZFNA 2DU8A 2B4TO 2EV9A 1Y8RB 1S6YA 4BIIA 4KQXA 1BXZA 9LDBA 4LK3A 5KJEA 1DDOA 1E5LA 1ZW1A 5A1TA 2FMUA 4XYLA 4YAEA 4BKPA 4NJOA 3Q9NA 3RD5A 3JQ9C 4WNIA 2NTNA 5F1KA 2X86A 1BW9A 3K5PA 1DOHA 4BGUA 5MGBA 1DFGA 2EJVA 2I5PO 1MGOA 4ND5A 3ZNPA 4BKQA 2AQHA 4OO3A 4E32A 2P91A 5EL0A 4K9DA 1ZK3A 2I65A 4LSWA 2Q2VA 2RHCA 2JFGA 4DTIA 1YDWA 3I9OA 4BO0A 5JBIA 1ZSYA 3E9NA 4M89A 1Q0HA 4R4JA 1JN0A 3EDMA 1Q7CA 1C1XA 3ITKA 1VJ1A 1IHXA 3PEFA 2WWRA 2OBYA 2IDZA 2HQ1A 4IDGA 3WGIA 3IQDB 1I36A 2I6TA 1EUCA 5TT0A 2BELA 3WBBA 4GLOA 5DBIA 4BQPA 1L1FA 1T1SA 3PJDA 1GPDG 1HE2A 1PQWA 2G76A 4RDHA 1MXHA 3PRJA 2IXAA 4R41A 2VZ8A 3EZLA 5TLSA 2D1YA 5A04A 4UUMA 3X2EA 3AOEA 3RUEA 5JY1A 4FSHA 2GASA 5I8WA 1JTVA 5CDYA 1H9BA 2OBNA 3ZWWA 1ZK4A 1BXGA 4PG5A 2YQ5A 4PGFA 3JQ6A 3PI7A 2C5AA 2FP4A 1I30A 3JD0A 4NJMB 4YT2A 4CLDA 1T2CA 4IJVA 5TGDA 5IG2A 3SBOA 2VHZA 1RJWA 4XYEA 4WUVA 3HN2A 5EPOA 2BF7A 3GK3A 3AUAA 1W73A 4CMIB 3JQBC 4CQLB 3VDQA 1OC2A 5H83A 2V6GA 3EGOA 2O4CA 3EZYA 2DBQA 1CEQA 3FNFA 3MJEA 4ALIA 4EBFA 4DREA 1IUKA 1E77A 3CE6A 2AQIA 2O48X 1HDGO 1K0UA 4DUPA 4J9VA 3IS3A 5L45A 3H7AA 4XQCA 4BMVA 2ZJ0A 4PN3A 1DRWA 2Z5LA 2IZ0A 1VPDA 4RJTA 3PVZA 4D0RA 3DFZA 1LC0A 5AYVA 1HETA 2EG9A 5KVCA 2C20A 3WIEA 2BHLA 3SLKA 2VOEA 3V2HA 3PGXA 4J4BA 3ONFA 4YACA 2OZPA 1PWXA 2QIOA 5F3RA 3DBHA 1GU7A 4YAJA 3QVOA 3JD3A 2Z1NA 4YA6A 4WASA 1N9GA 2O3UA 1SPXA 3RJ5A 2O23A 3DR3A 3UAGA 5G4KA 1QYDA 3U3XA 3WSVA 1T25A 3LZ6A 2W8ZA 2D4AA 3ZH2A 3WMWA 3UF0A 3FTNA 3K30A 3FWZA 3AUSA 5CEEA 5K9ZA 3VTFA 3GZNA 3JQEA 1E7RA 2WTBA 1PS0A 2Y93A 2ZIZA 4CMKA 5L7TA 1MC5A 4GGOA 3H9QA 4QO7A 2PH5A 3UOGA 4HFJA 2QZZA 3LT4A 2E49A 3IUSA 1WZIA 4FC7A 5IZCC 3EC7A 3INTA 5TC4A 1ZO8A 4AJPA 3OIDA 3QVXA 4BGVA 5HWSA 3ZN2A 1U3WA 4FFOA 4DLLA 1ADFA 4CLOA 3IOYA 4YBZA 5I7EA 1EBUA 3JQBA 4BQRA 4J1SA 3WGOA 4BV8A 1P74A 4FOSA 4L4SA 4BS9A 3VKVA 4J0FA 4LSMA 4U6QA 4A27A 2FPPA 1GV1A 1KEUA 3ORFA 1N1GA 1DIHA 1FDTA 5DBGA 3GR6A 1ADGA 3FI9A 4CMGA 1F0YA 4FJ1A 5G0SA 1LSSA 5A3JA 3JQGA 1CETA 1IHYA 2HDHA 1NFFA 5HS6A 2WDZA 1NAIA 5JW6A 1BWSA 3UN1A 1HF3A 1JKIA 1OAAA 4JN6B 2OXIA 3UCXA 4CMBA 1LTHR 1BG6A 2A92A 1RKXA 4CMEA 1NVTA 4XQ9A 1PIWA 4A03A 1JWAB 2JCYA 4KUHA 4L76A 1BW9B 3RQSA 2Y1CA 1U3TA 5IXSA 1NQTA 4ID9A 5JCXA 2FPGA 1NQAO 1U28A 1QV6A 1HWYA 4R5MA 1E3EA 1Y5RA 1QORA 4M49A 4FFLA 1P0FA 2DQ4A 5KJFA 3VOSA 4PLZA 4E13A 2DTEA 4PZEA 3ROKA 3FNHA 4H15A 3DBRA 1G0OA 1LLQA 4ZQFA 2OFPA 2W2KA 4RO0A 2PKQO 3FPLA 2C2YA 4J6FA 1ZK2A 3PJGA 1AXGA 2YUTA 3UVEA 4I5GA 3WX0A 1C1XB 4D41A 3AUTA 4ZVVA 3TJRA 3GDGA 3IP1A 1P1JA 5A5EA 1K2WA 5TJ9A 2E48A 3KXDA 1NFRA 3AU9A 4LVCA 4NFSA 1NYTA 2GF2A 3D5QA 1GD1O 3OQBA 3V5NA 3NTRA 5JAZA 3K92A 4Z9YA 5T8KC 3H9GA 1H6BA 1I8TA 1XEAA 1LDNA 2UV8A 2Q4EA 3TZKA 3LT2A 5IZ4A 4R69A 4ALNA 1LRLA 1MB4A 1N5DA 1GEGA 2ZTMA 2AEFA 4C7JA 4CQMD 3FTPA 1NVMB 2X8LA 3MJ4A 3PWKA 3ZZNA 1W8DA 5HS4A 4E5MA 2Y0DA 1PR3A 1BXGB 3I1JA 2G0TA 3DZIA 3W8EA 1YBAA 3HHPA 3AFNA 1ZK1A 5DOZA 4XQGA 2X23A 4IDAA 5K0ZA 2YJZA 1PZFA 2AEJA 3VVBA 1YB5A 2X1HA 2PA3A 4FC6A 4PLFA 5BSHA 3WYBA 1NBOA 1WLYA 1B26A 1BRMA 1YB1A 3MCVA 3RUDA 3IL2A 4CMJA 2O4UX 4HX5A 1OFGA 4QX6A 5IJZA 4OH1A 4GMFA 3JSAA 1IYZA 5DCYA 1BMDA 2DUWA 1HDOA 2FWMX 1EFKA 3U5TA 1XG5A 3MZ0A 4CM3A 4L8VA 1EK6A 4Y98A 2AG5A 2EEZA 1E7QA 4O6VA 2AE2A 1C0IA 5A9TA 1WNTA 4XYGA 5A03A 4YJGA 1DRUA 1B3RA 3RU7A
chains in the Genus database with same CATH superfamily
4Z51A 5ITWA 4GBGA 4NQZA 5H8WA 2HSGA 3WRVA 4GGMX 4J0QA 2G4VA 3FBWA 5LVAA 4C6TB 1N5IA 1Q20A 1B2LA 4IZHA 1ID8A 4NU6A 3TFQA 3O9MA 3VR6H 1A5ZA 4I99A 1CRQA 2FSPA 3A3YA 1FSZA 2OGZA 1PJBA 3EFOB 4KTTE 1RAGA 1GTJ1 1I3MA 1DO8A 1ZP6A 1Z5GA 2GD0A 4KNWA 4YRMA 5B7PA 5M34A 4A36A 1NM5A 1U2RA 1Q6ZA 5BPHA 4B74A 4MWTA 4Q3KA 5TQJA 1HEYA 4URZR 1SD1A 4C21A 5E6UA 1NR1A 1EFPB 4UBNA 4R3UC 4UM8B 2PJDA 1PYGA 4J0IA 1YK1A 1JR2A 5K3CA 1NIJA 1XTBA 2VJAA 2OD9A 3BF7A 3G2KA 4YDSA 1EWQA 2G5CA 4LCEA 4ZD6A 1MGPA 1GL3A 1BOFA 4PSUA 3HEMA 3MGBA 2X1LA 1VIAA 5F2OA 4FS3A 2X2FA 4RAOA 4ENWA 5AXDA 3NOQA 1G5TA 5C3MA 2BN4A 1L4BA 1N0IA 1H4TA 3W3ZB 1GTMA 1Q3HA 3AIMA 3PA8A 2IEIA 1IY9A 1ZM2A 3QKTA 4H35A 4EZIA 1W4ZA 5HM8A 1OGJA 1K9VF 2QX4A 2VP5A 1ACLA 3GUYA 4WJLA 1RPAA 3BBLA 1YK0A 3I53A 3K5WA 4UMFA 4RDIA 5FADA 3A9CA 3F5DA 1BMTA 3HBJA 3ZU3A 3HSYA 1ESZA 5J2TF 1NDUA 3HWRA 2R1UA 3SJCA 2M1XA 5AVQA 1MOZA 1P8AA 3EGXA 1JLLA 2IOHA 3AG6A 1NMZA 3BMQA 2WWYA 2ZDHA 3A9WA 2QU7A 2VRCD 3U1TA 3SXPA 1V1RB 5FL7D 1TAGA 3S2FA 4AUKA 4YREA 4MGHA 2NVWA 3OO1A 3IP3A 5SYNA 3KLNA 4R7TA 2C04A 3C6KA 1UMBB 4TUYB 3CFYA 3KC2A 4BU1A 3UJ7A 4XSVA 1L4MA 3UA3A 1O0BA 4BXOA 4QECA 4R2IA 4XVRA 2R68A 3IT0A 3M33A 4QICA 3VI4B 3W6NA 4EDHA 1C8KA 1HYHA 1LU9A 4AJKA 2H2GA 2CSUA 4DCJA 1ECCA 4QTYA 3AESA 4F3RA 3NAGA 4HN9A 3IELA 4R9UC 3EXIA 5LQDA 2NWQA 5TQVA 2OCAA 3G82C 3PNSA 3JWGA 5EJ8A 2ZYGA 4KTVE 3GLIB 2CDAA 3I6YA 1U1GA 5K03A 3RAGA 2P67A 2M9MA 3QIAA 4CT4B 3SKYA 1E1CB 1UAYA 4RTPA 3WWEA 4QGGA 5AK4A 1DEHA 3D8BA 3QVWA 4RK1A 1JPJA 5AVUA 2X9NA 3TLJA 2BFOA 3D8SA 6AT1A 3IEXA 1DKUA 3RYTC 4UNRA 5DLYA 1ZLYA 2W2KB 4TL8A 2OK7A 4N82A 1KOJA 3O7MA 1R8JA 2NO9A 2WA1A 4BASA 5AJTA 4CBVA 1G8JA 1PHRA 1GG8A 2IXFA 2UZAA 3OTOB 1RJFA 4O4JA 4A91A 5KWSA 1U1DA 1T4CA 3KSRA 2CUTA 3QLEA 4HR7A 2CC2A 1JG7A 1KJIA 1TU3A 1ZNWA 3BXXA 3HLKA 1NJ2A 1Y3HA 1YV9A 4GI1A 5HQ3B 1WXEA 2CMHA 3KT6A 3LY8A 2FG7C 4QNRA 2DSTA 4N6NA 4EO9A 1GY8A 3W5CA 5D7BA 3W5HA 3EZ2A 3R0XA 5AJUA 3LA8A 4KG7A 3DLPX 5J2UF 1BHSA 3RAEC 3PYXA 1W7AA 4JMPA 2CMDA 3F7MA 1LPOA 5CGZA 2BUCA 2EL9A 4Y1GA 3CH6A 3DAOA 4LHVA 2ZXUA 5DWDA 1MLDA 3L84A 1F0KA 4HH0A 4BNNA 3ZY4A 3N2YA 4OXYA 2P9TA 1X8XA 4JI5B 5C51B 2FMHA 3CXUA 1F7UA 3Q15C 2R6DA 3CU5A 4LRYA 4TWRA 3QVVA 5F5LA 5I4KA 2FEPA 1DQYA 3LX6A 1U7PA 3SIWA 3L77A 1PT5A 3E9MA 3WL3A 4LGYA 4UOZA 1M8JA 3HKBA 2A86A 1Y5LA 1Z75A 2G63A 5JBNA 4W7HA 1AHHA 2PBRA 1GG9A 4DSZA 5EWJB 4TGLA 3D8RA 1OIWA 4LE0A 2HBZA 2GTPA 1N4DA 1Y9ZA 4J0CA 4EELA 4EQ6A 4OL9A 3T5PA 1RYDA 4NFLA 4XM1A 1KXJA 4OUDA 3RJMA 3ZNOA 3ZTYA 4C3OB 3I2KA 1IVYA 1KI6A 1RTTA 1D2GA 4IFEA 4NBKA 4PG8A 1RLOA 2JGAA 3THXA 2DGDA 2QVXX 1C1YA 1Y3CE 3NC4A 3SYNA 2QM8A 4A5SA 1NVXQ 3X1ZA 1H1DA 2JGFA 3S2ZA 5CM8B 2OBLA 4XGNA 4XAQA 1WL8A 3A27A 3PFFA 3O26A 4XKJA 2X0DA 4YMHA 4Y1FA 4LJ4A 4GDMA 3JASA 4U8GA 2Q3MA 4CCSA 3UHJA 1H0KA 1F5NA 3PIRA 3KB2A 1PWZA 4KSCA 3ZLTA 4D3XA 3M8KA 4D4JA 4EYQA 1GDDA 3IHWA 3R74A 2DT5A 4ZCPA 5EJEA 3E70C 1PBNA 1F4PA 3GFSA 3I8OA 4MO9A 1NI4B 2PX3A 3A1EA 2G9UA 4EKGA 2ZW9A 5HTKA 5B1HA 1GAEO 2PD4A 4EVQA 4M53A 4KFTA 3A04A 3B1KA 4DQ0A 1JVNA 3UT5B 1PTJC 2ODAA 1D04A 2EOAA 2P5YA 3QU4A 4GLBA 5FPSA 4DC0A 4F8JA 2HBRA 2GN0A 4WBNA 2WAOA 2WYWA 3C3XA 3NTQA 2R60A 1GZDA 4NK4A 2OYRA 4DMCA 1LDBA 3DCIA 3RS7A 3TXYA 4DNOA 2UXDB 1TMGE 2OORA 3O7WA 3OPYA 4ZIRB 5JJBA 4CG0A 3FUVA 4DNFA 1KDTA 3DDWA 5EHGA 3FHLA 1Z4PX 4IYRA 1IG0A 5I9BA 3CT4A 3SIRA 1W94A 1ISGA 2YHIA 4EY6A 3DAGA 1LSOA 1BS2A 1YVPA 1FQOA 3PFHA 4NENA 2ZCUA 5CW1A 5AXCA 1ZR4A 1OWPA 1ZVMA 3E81A 4BPBA 5IKXA 5CDUA 1XA3A 3INNA 3KIPA 5FCDA 5CJPA 3FLMA 3RGGA 3WSWA 1BFDA 3WOHA 2LBPA 4CQMB 1TD1A 1TUBA 3DT6A 1K6XA 2VTKA 2W2OA 4OUKX 5CXXA 3AERA 3NKVA 2MTBA 3LPMA 3PXCX 5DHUA 2O8FA 1XZPA 1RWQA 4DY4A 1BE1A 4RHTA 3TTWA 1FXWF 3FCYA 2HT1A 4QLAA 1E4EA 4AZ0A 4CLHA 3GLQA 4OJQA 5CVCA 1BXKA 4YUWA 2B5WA 2D3WA 3GLSA 5DNAA 1GN9A 4DUGA 1W0JA 2C8LA 5H3LA 3KB1A 3SDSA 4GH5A 3GLHA 1TM7E 4Y2YA 1JYFA 1CUIA 2FR8C 2H5LA 4FGZA 4HO1X 1D09A 3UXYA 1ORDA 3CLTC 4RVUA 1HGXA 1ODSA 4DLAA 1EQAA 4CZ2A 3DE2X 4WKOA 2XNDA 2HRBA 3KEMA 4QQRA 2WVJA 5BUSA 1EE1A 5JFTA 1SCIA 1OREA 1DS6A 2OSVA 4ZT2A 3KETA 2J6BA 2PAFA 4EHIA 3N86A 4DB2A 2RI1A 4U9IS 1OHHA 4F5YA 2NT4A 5CIWA 1QMPA 1WM1A 3IP7A 3P9QA 1U3VA 4GD3Q 3UH0A 4G4GA 4JFRA 3FM9A 4IHJA 1A5TA 1KJJA 1XKTA 2C03A 2K6GA 3O93A 4WN9B 5LBUA 2B7LA 4CTNA 1IH8A 1DV1A 2V1XA 4IQ0A 3AR8A 3HA7A 3D02A 2UUAB 1D2NA 5CK5A 2OAEA 4HDSB 2QF7A 4BVLA 3TW0A 2C94A 4UULA 2P77A 1ZK0A 4TQAA 4PTZA 1TVEA 3AY3A 1AMOA 1GGMA 4X90A 4KREA 4X84A 3DVLA 4WT7A 1N25A 4O02B 4LVNA 1QGYA 2HK7A 3PWZA 4K0KB 3MJCA 4LRUA 3LNTA 5LKRA 1UZLA 1PZMA 2W93A 3JZMA 3UV3A 4NK5A 5ENDA 5AIBA 1RBQA 3UCFA 4EEKA 1K66A 2OESA 3A11A 1BCRA 3EUAA 1Z6GA 4MAAA 4KMRA 2QD5A 2G40A 3NXSA 3TVDA 2XKAA 2J5BA 4ZV9A 1S2LA 4TYPA 3MIZA 3VHXA 3EEYA 1H3EA 3FNGA 4LISA 5KOJA 1CEEA 1K5HA 2W71A 2WIBA 3AF6A 4FFMA 3T7KA 5FQOA 5AW8A 3M4XA 4UVHA 5FYDA 2ID9A 5DGTA 1POWA 1N3BA 1D4OA 4ZAGA 1VLVA 3FDFA 2FEWB 1HI9A 3IOCA 4R9RA 4W7IA 1KTIA 2GNAA 2GSWA 3NDPA 1DJNA 4OGGA 1VSTA 3Q98A 2CCJA 4ZALA 3FZEA 4HXEB 4LDRA 2ZUEA 1N2CE 3WFIA 4A0GA 1PQ4A 1FP7A 3V46A 1V7PC 2JFZA 2I4RA 3B3QA 4UTNA 2AD5A 1TJ5A 2W6QA 3ISVA 2GXSA 4L5JA 3WQSB 4E2FA 2JF0A 4MLZA 5EIBD 2XTNA 4ND8A 1TW3A 4Y2PA 4D8TA 1UMDA 3DG9A 4D4KA 5ILGA 1WY5A 3KTAA 3AVUA 1HSOA 3S44A 1QQ6A 1BAPA 4RUKA 4KBFA 1XNHA 2I29A 3EDYA 1V25A 2OVFA 5IAOA 3C6XA 4Q66C 1NGSA 2I2CA 3OM1A 1C4KA 3PHLA 4LX0A 2GYUA 4Z99A 3RAPR 4CM7A 4E15A 3K73O 1Z6AA 3GLUA 3PDIB 1U3FA 1K7FB 3QJGA 2H65A 3DFKA 5K1ZA 4YONB 3CA8A 3S2UA 1J22A 3ILSA 1Z56C 4L75A 1RFGE 3GRYA 5E95A 3Q7QA 3D6MA 2IW1A 3WBBA 4M0LA 2QMUA 5JQGF 2PS0A 2W2QA 4IMPA 1WVGA 2WYHA 4RM2A 4B79A 2W4MA 4HN2A 4CLRA 4B3RB 3A58B 4Q02A 3E23A 2IEGA 3G8CA 5EXSA 1EXMA 2J30A 1ZR2A 4R31A 3WGLA 3BWBA 2R6HA 4K1LA 1HKUA 2PS3A 5E9JA 1ESDA 3FBTA 1SBQA 1I01A 3WGGA 2VNSA 2XF8A 1RABA 3WBKA 2Z2IA 1CERA 2X41A 4ZHQB 2O7QA 4Q0MA 5DW0A 4D0NA 3HV2A 3EFHA 4OQPA 4JYAB 3SEFA 4NBRA 1Q0LA 2H2AA 4Q1AA 1Y4SA 3RYFA 4WCDA 5JAIA 1FQWA 4UVEA 5JV5A 1Y6QA 2RAVA 5C8XA 1E99A 1X9HA 2G77B 3ZWOA 4AF8A 4BFSA 4C0HA 2JGMA 4K9OA 3N28A 5SY6A 4RA6A 3ZVMA 4J0KA 4B46A 1NVVQ 4RVOA 2PUBA 1OI7A 2G8LA 2Y2VA 2R2GA 3EXHC 1EGAA 1G21E 1I2CA 4KL8S 4DR5B 4HVTA 4PHGA 2ZJ1A 4RHEA 3MOIA 1HZZA 3RK4A 2ZVQX 2ZIXB 3O2SB 2CLKB 1P1RA 3QXSA 2A5FA 2JEOA 3P2JA 5EJFA 1R18A 2N75A 1HDEA 2QNRA 3OD1A 3GRKA 4FKZA 4N5MA 2W11A 5H7XA 1E0KA 2CXXA 2WKQA 3HU5A 4ZC1A 3WKCA 3ZHQA 4KXMA 3FKQA 1NYLA 3WYGA 5JD6A 3TDNA 1CS0A 3S4YA 4UHHA 4AN1A 5B6IA 5IM4A 3FVTA 1NONA 5K8TA 1XZMA 4JT8A 3E58A 2GRUA 3OJOA 1O0SA 3RHFA 4DV2B 4JCCA 1U7WA 3L46A 1RKVA 3IKJA 3NUQA 3OCVA 4IIGA 3RIYA 5IANA 4PS1A 4AWBA 1U0HC 3IAXA 3PPVA 4N7BA 2E3JA 3V4VB 3ZY5A 4HYQA 2NV6A 3DOFA 5HIKA 5BN3B 4GQIA 2XMBA 3OE7A 4V3CA 5F7JA 4JUIA 4LHEA 3KVVA 1Y7TA 3GBSA 4ADSG 3NV9A 3R9XB 3KBBA 2O2IA 1K1EA 3WB0A 2B6HA 3EJ6A 3A4TA 3MMZA 3JALA 2QOEA 1ZZGA 2BGRA 4QUIA 4ZOLB 1FQKA 5T67A 4TRMA 3UJ8A 4P4SB 1AGPA 2C2GA 1HNNA 1JHUA 1PEKE 4WNCA 4I0WB 4ZV4A 3K70B 2AWOA 1U0OC 2YJTD 3B1WA 1GIAA 3T94A 2NVUA 3RTBA 3N59A 4N5HX 1GCAA 2ADMA 3QK7A 2FFRA 4F4CA 2XUQA 3GGOA 4OA5A 1RXYA 3SEQA 4WQMA 4PFSA 1Y1TA 1EHYA 4MW1A 4QHSA 3ZJVA 3NAQA 4RC9A 3EISA 1V5IA 1TC2A 2ZJZA 3HYSA 3TZHA 1YZYA 4O2AF 2RGBA 3N07A 4XCVA 3WJ7A 1WABA 1JR6A 5I7AA 3D1LA 3D5TA 1TIKA 1NXOA 3WMXA 3EWSA 2D2EA 5FWYB 5JXHA 3ND9A 1CLEA 4ER6A 1WWKA 3K09A 3IHLA 4N1AA 4DLXA 1RTKA 1IN5A 1UPTA 3VYSB 3H9EO 2ZZNA 1B76A 2JIZA 2VHYA 3UK0A 5CXQA 2GZ1A 3WWDA 3GGDA 3IE2A 1B8NA 2IOQA 3K0SA 4IKPA 3WK6A 5I8ZA 1H8ED 1HK7A 1M2EA 5C4GB 4G67A 3SS7X 3IAM6 1S3GA 1NAHA 9ATCA 4HDRA 1LBTA 2VNKA 3RV3A 3OZIA 4Q7LA 1Z4IA 2GK4A 3E6AA 2Z98A 1E98A 2EKBA 3D31A 4ENTA 2VYND 3GFBA 5EIWA 1O6BA 2R7LA 4RYLA 1JQDA 1GUFA 4NCIA 3K1TA 4D3ZA 4C88A 5EE5B 4YCBA 4KR9A 5CAEA 3MT0A 1BDIA 5ER9A 2YWCA 3DAPA 3B2EA 1X14A 2GA8A 5FBVB 1J6UA 4LDAA 3IUJA 3V8BA 3PCTA 4JOCA 3H2GA 5CPFA 1U4OA 1PNOA 2R85A 3GN2A 1AHPA 1FFEA 4A26A 1B8UA 5LOVB 3P7MA 3VPGA 1G7CA 2CL0X 3NWOA 1JE1A 4U6SA 1ZRSA 2RCNA 2PIDA 4D42A 2ZR9A 3AHIA 2CLOB 1PNRA 2DKNA 3RREA 3JZAA 1MEEA 2AMJA 3E03A 3FROA 3L49A 3NT5A 3V2GA 3D4IA 4AZVA 2NQ2C 4PF1A 3PX7A 1BVRA 2D2IA 2Y1OA 3EF1A 4YRDA 2PLRA 3L8GA 4LYYA 3T5CA 4YRIA 1BCSB 2IUUA 3W7VA 3K9WA 3KOXA 2ORED 1WZNA 2IYRA 2C7BA 2JZCA 2N0SA 3I9MA 4CM1A 4I1PA 1Z4MA 4ARZA 2W2MA 3AY7A 1S2OA 3VKGA 3H8VA 4TLBA 1TAUA 1MHPA 1HDCA 2BFPA 3AM3A 3HFSA 3KYDB 3QOYA 2CLHB 1N8NA 1SK8A 2CNDA 2XA2A 3BXFA 4DJ5X 2B78A 3IR7A 1XQXA 5CA1B 2FF7A 3PPIA 1SHKA 2AXPA 5I45A 2EW8A 1TKCA 3HJFA 2Q3EA 2LIPA 2AZDA 2XADA 4J6EA 1ILWA 1LV8A 3CRRA 3HCPA 3ON5A 1KH1A 1Y8AA 2HFJA 5AKXA 5AHKA 4QBIA 4OK3A 2IY7A 3U4QA 3I0NA 3E9DA 4L95C 4OBBA 3TZCA 5GOZA 5LMCA 2EAUA 2VT6A 1N0HA 1M2VB 2PSDA 1NASA 1E0AA 1ELOA 3WTBA 2ZSJA 4DLUA 4YRBA 3MWDB 4DIDA 4ID3A 1VJDA 1TTPB 2N3ZA 4U2KA 5CT9A 4DMMA 4QVIA 1T5LA 1VJ0A 1WPGA 3MGCA 1QZUA 1WMDA 2MSEB 2Q4BA 2TMYA 1FLAA 3QLTA 4YPFA 4UOEA 3ZDAA 4DJFC 3WLSA 5KNBH 2AE1A 3EH1A 4M98A 2OM2A 3RJTA 4Y0AA 1JS1X 4B09A 2AC7A 4GYJA 5H02A 1A9XB 4I4TA 4EA9A 2Z1DA 1CZRA 3AYZB 4MYUA 3CJTA 3I01A 5JMTA 4DMKA 2AJBA 1X7XA 2WICA 4A8HA 1KQGA 5AVSA 4MUXA 2QQ5A 2VT7A 3I6IA 3MT8A 4OQZA 5FPKA 2RBEA 3DC7A 3QA3E 1IBKB 2JBHA 1P7VA 2X13A 3EBOA 1G18A 3I4FA 4I5DA 1BA3A 2G9QA 2QSZA 2ZYAA 3TSAA 1W48A 1Z33A 2HB6A 2HNAA 4J7UA 5KMGA 1GZ7A 1N9ZA 1W35A 1RHJA 4FWBA 5FWAA 1T5OA 3PHBE 3ESCA 1Q1GA 1Z8DA 2ISSD 1RLMA 3BQNB 3E3MA 3HXPA 4RPKA 2OTCA 1UBLS 4EWLA 2JNWA 2PGDA 3DSRA 1UF9A 3E7WA 3GCZA 4CUZA 3W5BA 2DUJA 5EJIA 2EJWA 2HQSA 3LV8A 1Z88A 4L08A 1YTLA 3QBVA 5AKLA 4B6PA 1M34E 3A0UA 4UU7A 3I04M 3PD7A 2W00A 5JXIA 2DWQA 3GD7A 4ARIA 2PX5A 3QLJA 3QPWA 3RU3A 1VGVA 3G0GA 4FCVA 5BUZA 2W6NA 4ESHA 2WSYB 2B2XA 1FRVA 2H59A 4FEAA 2ZIGA 4MP3A 2GCOB 4MUAA 4MQEA 3TTUA 4E5VA 2NO7A 3Q9UA 4YQYA 5GJVC 2XUDA 4OLAA 3UJNA 5DHTA 5EMHA 3MBOA 1MX1A 1BE8A 3D6AA 3ZHVA 4BMZA 3K9LA 1DOZA 1AXRA 1SCUA 3MWLA 3PXXA 2DFTA 5CFQA 4P1ZA 1MAVA 4TV8A 2WHPB 3CTPA 4FU0A 2F6RA 1KPIA 1OW3B 3W8FA 3ZBPA 9ABPA 1DZIA 1XTKA 2PLFA 4LOAA 3LYLA 4N47A 4YUYA 1QV9A 2VHXA 1G63A 3D7MA 1CCWA 2IOFA 3NTXA 3HP7A 4OHOA 5CIQA 3A4YA 1Z2DA 1AHNA 3B6EA 3VDNB 2GQ0A 2JCBA 4BN4A 2IYNA 2QLNA 1JTEA 4B3HA 1DB3A 1FBNA 1YI1A 4XWOA 1LK7A 4G0XA 1ESEA 2P69A 4CDNA 3T52A 2BR3A 1NRIA 3TIIA 3LHIA 4IDQA 4DG8A 5JAQA 3E7DA 4NECA 1QF9A 4RK0A 5K6AA 2Z2XA 4FSXA 1HDRA 5F1YA 3V8PA 3R7FA 4JJEA 4LKOA 5DYGA 1UJNA 3T7CA 2G25A 5FOSA 4M8SA 3T9DA 1H69A 2ZXEA 2PGAA 3N2NA 5JD5A 1ISPA 3TLEA 4LVUA 4PIPA 1VPWA 2PUAA 1HT2E 3FPAA 5DM0A 4GDFA 4QJBA 1TVKA 5J1SB 2P2ZA 4RY2A 2R1ZA 2XE6A 3GCXA 1MF7A 4H7JA 3GD5A 3UMVA 1YQXA 1T2FA 5LP6F 4ZTBA 5DHRA 5JNVA 1H2XA 3VQTA 2VDJA 3ZE7A 3U48A 5JEEA 4ZYXA 2OFOA 3DHVA 1PT9A 2CZGA 1P62B 4FDUA 5JVDF 1WW8A 2BEWB 4TYNA 1I2BA 3GLGE 4G0NA 1QHHB 3UBTA 2ZB3A 3RBZA 3ABQB 2JA2A 3I3SR 1SKMA 4YRNA 4QVGA 5I8PA 4YBRA 4ZFNA 5DN6A 3T3DA 1UMCB 5DYWA 4COOA 2BFFB 4G1VA 2WP0A 4GMGA 5LL6P 1JWLA 5CFNA 1ZJ5A 1EU1A 4D82A 2IK8A 3LKVA 2OQIA 4RZUA 4RL4A 1BS9A 4C01A 3FMVA 1O1YA 3NJ8A 1MO3A 3PLRA 4OHWA 2NYUA 2YZNA 2QD2A 3EZ7A 4DSUA 1DG3A 4NDNE 1U4SA 1I7LA 1T6NA 1RXEA 3JTMA 5K4AA 1QQTA 2XZLA 5F7OA 4W1SA 3QWIA 5IBCA 4AJIA 3ADKA 3SHOA 1WD5A 3HFJA 4RLQA 3D3EA 3ZGZA 1G8SA 5CNIA 1A88A 3WC4A 3LBYA 1DG9A 1UBUS 13PKA 2CL6X 5CHEA 5KOYA 4AP9A 2JDID 1N6OA 1XTVA 4PE5B 2P3OA 3L0YA 3T34A 2ZSIA 5ED0A 3KOWA 4XB2A 1GNPA 4A8JB 3LP8A 3S6JA 1WUKS 3KYCA 1C3JA 3OAAA 5A4KA 5JS1A 2I54A 1JDPA 1KRXA 2D59A 3LA6A 4TTRA 3GJ4A 1DAPA 1TEHA 2AHRA 4RFLA 2QMQA 1XDSA 2F43B 2XQKA 4F5DA 1RLIA 2B98A 3OPQA 3PQFA 4QXRA 5H82A 5B1EA 2BLNA 1I4LD 1V41E 2QRVA 3ABRB 2IUTA 1GAWA 2GAOA 1ISFA 4J8PA 4O4IB 4FOLA 4W63A 5J5CA 3VUFA 4BNDA 2ZQYA 1B8OA 1W2WB 3BA1A 3WB1A 4A15A 2SKDA 3KR2A 4CMCA 1G5IA 3TUZC 2IZOA 4FFWA 2RHRA 1Y81A 2B8WA 5I01A 2QTBA 4M54A 4ICIA 2QN8A 2X0NA 4CF6A 2QG6A 3BFPA 3GAFA 4AJLA 4S05A 1VHLA 3OHPA 1S89A 1T5DX 3ZD8A 1TRHA 4ERXA 1ZINA 5CW2A 1SG0A 4C5BA 1C9NA 1QCDA 1RMTA 1GSOA 1V8OA 2GGSA 2UZ4A 1UK6A 4CG3A 3I2FA 4N3AA 4U2GA 9LDTA 2JAUA 2EZTA 2C29D 4JJGA 3VO1A 3ZD6A 1R3UA 4HNQA 3M5PA 4Z9XA 3DKIA 2E0IA 2YFYA 4FTWA 3U3RA 1NVBA 3TTVA 1XN1A 1XEXB 4JBXA 4I1SA 5ICMA 2KWIA 5TV2A 4LDQA 3VGPA 3IHTA 4MV3A 4HTAA 2I0FA 5FOVA 1EDEA 1KI2A 2HTFA 1N33B 4FPXA 1Z3IX 1BE6A 4I14A 1OI3A 5MHTA 4ZO7A 4PC2A 4LQCA 4P4GA 3JZDA 2CLFB 4N76A 3DPIA 1QFJA 1RM3A 3ZS9A 3HBAA 1W2GA 4QT0A 3W04A 4D80A 1EFRA 5GJCA 3RARA 3COPA 4OP1A 2XNDD 2YWFA 3P4YA 2XECA 4OHPA 5KOHA 1TZKA 4PNPA 5EZ6B 4V0NA 1IOWA 1PNTA 1QPZA 4UBKA 2OQVA 2GM4A 3OJ0A 1VG0B 2BR4A 2REQB 3CX6A 3GRUA 2O14A 1KFCB 3DTTA 4CV0A 4ZYYA 4ZZ0A 1C50A 1O77A 1AUPA 1QNFA 4YJKA 5AI9A 4DMUB 5DNUA 4OOEA 1AKNA 3CVYA 2B2CA 4N54A 2W5UA 3HGTA 2E1PA 5A0FA 4BO7A 4HRAA 1W0KA 4KFRA 1XKQA 3V6LA 2Q1TA 2WWVD 2RB4A 1RS0A 1DCKA 3G0BA 2DBVO 3KQHA 3SJ7A 4WKPA 2IFTA 3PQ8A 4HBGA 1TEZA 3NTOA 821PA 4S35A 3ILVA 3WQRA 1N6PA 1RYMA 3SMQA 1VE3A 3PYLA 3EWIA 4G23A 1QH1A 1V8BA 3HVRA 3GHYA 2C77A 3VVCA 1RZRA 1OILA 2WHYA 5DGIA 4WLUA 4GP6A 1PZHA 2IYPA 3PQ6A 5FV7A 5AWFC 4B40A 1PNVA 1ULUA 3V9AA 4DABA 2KYRA 2SNIE 4HQOA 1CB7A 5F12A 1SQFA 2RJ3A 3G2QA 3QFSA 5I9MA 3L0DA 4JKOA 3KKKA 3W9UA 5G53C 4JB3A 4RKQA 4DLYA 4U7FA 1RP7A 2WTNA 4RHCA 5TARA 4LI3X 4IUBS 1H8HA 4YMVA 4IL5A 1Z5NA 2Q2OA 3EA0A 3M4JA 5AKKA 1A9YA 2JJYA 3ETDA 3OCYA 4GGPA 1P1CA 2I7DA 2C92A 3JRNA 1DBSA 1GKKA 3Q6MA 3LUAA 2RHDA 4DV7B 2CV1A 2C54A 3PITA 3L7CA 1JHRA 1WDLA 4F6RB 5FOWA 3GP3A 1VL1A 2FETA 2ZB8A 4PLVA 2CLMB 3T5GA 4BBPA 1XVAA 2IYQA 3AI3A 3MSXA 2FN8A 4M1KA 5CH5A 1Q74A 3I0MA 3O95A 3TW8A 2PWAA 4NICA 2W2XA 3FI0A 2OO7A 3NLLA 2BZGA 2FXVA 3W2IA 3D4LA 1U8CB 1Z28A 4FHGA 5IKPA 2POQX 3IUQA 4UAGA 2C3PA 2NX2A 3RKUA 3WB2A 3IALA 5LN1A 5DHFA 3QELA 3GUVA 3ICPA 4FGSA 4IDDA 1EP2B 5EHNA 1PNQA 4XQ0A 4Q1EA 5AQEA 5A05A 3GPCA 3RUPA 3X1MA 3I12A 1QS0A 1X7ZA 3PXDA 4Y2VA 2C07A 5E9WA 5IDQA 1B8PA 1FDIA 1XJCA 3G6WA 3F4BA 3AESB 5BO5A 2CL5A 3MUFA 3OT5A 4M9UA 4DIBA 2YY7A 1EZ4A 4JC5A 2IHUA 2C7RA 3ZH9B 3K96A 4ISCA 1VIVA 4MQMA 4RKWA 5K4HA 3UAVA 4I9GA 1O03A 4NEHB 1FSPA 1ZM9A 2KS6A 2W6ZA 4H60A 4WV3A 3IBSA 1O6ZA 1XV5A 2ZBEA 1N2EA 1DP4A 4YIKA 1X1TA 2C61A 3DHNA 2Y9PB 4NTZA 3WMRA 1I33A 2C2ZA 4ARBA 4QQNA 1AE1A 3GYGA 3BULA 4ZYLA 4U7TB 2X0IA 5A4DA 2Q5OA 5HJEA 1AOXA 1MRNA 1JVBA 4DEXA 4B4OA 2HBYA 5DLPA 4JWTA 1PGJA 1E7WA 2XLCA 2QENA 4LFBB 3BWXA 1K5DA 3FYTA 2CUKA 2HY7A 4TROA 1P4JA 4PBTA 5FOXA 3DXYA 5HGJA 3STYA 4C6SA 4ZGGA 4JSYA 5BPFA 1K06A 5AKYA 4AZSA 1JIXA 1SG6A 1J33A 2XD4A 3QVMA 3ZKWB 4O1HA 4AZWA 2DC1A 5CLIA 4DCNA 3NEPX 2NZJA 4WOKA 4A8TA 1EMDA 2XNCA 3LL4A 4XYBA 5ECYA 4WDRA 5FBRB 4AVYA 4JBIA 4HTFA 4URVR 3JATB 4AKIA 3IEIA 2AV6A 5ALPA 5CCEA 3EVCA 3GZ4A 3HYRA 4JELA 4EI2A 4DR3B 1GFIA 3R0ZA 1WETA 1OBFO 3B9QA 4DANA 2CD7A 3UO8B 3A28A 4HY3A 3DM5A 3HWWA 3DE1X 3TPFA 1ADJA 1TYCA 5FBLB 2VJDA 5KYTA 4ZZ1A 4EG6A 3GLHE 4HP8A 4IILA 3EPKA 3FNQA 4ZN6A 4FQ8A 4WCFB 1NBEA 4UBMA 2P2NA 2GN6A 2PUHA 1L5KA 5LU8A 1SGWA 2IDJA 1YRBA 2HA7A 1LJLA 1O95A 4HDMB 4BO6A 4G89A 3VOTA 5EMMA 5KVAA 1KI6B 4P54A 3LUPA 1U9CA 2XMPA 1JR3D 4DVGA 2QTFA 1Q17A 2XB4A 4ZU3A 4QU9A 3PNOA 3ZDDA 2F4VB 1QAQA 4J7AA 5KO2A 1AZLA 3BOSA 5AHRA 4AY3A 3RO7A 4FJ2A 1N6HA 1QHGA 3M2TA 1JAXA 4G1UC 4M7PA 3G5LA 4AJ1A 3RLFA 4N49A 4LZLA 2AG8A 4BO8A 1EX1A 3PZRA 3A2KA 2HLDD 1QX3A 1U9ZA 3BA6A 3FSEA 4L16A 2P35A 4J7CA 4IGEA 3V1LA 4EG8A 5D84A 3TEMA 2XE4A 5KOIA 2XIQA 4ZK6A 3R0IA 4JEHA 4HQKA 1AS3A 3QKUA 1G7SA 4IIUA 4IXDA 4LRQA 3FZQA 1I51A 2FWPA 3Q2IA 1Z18A 4P7BA 5EE9A 4DQVA 3ERCA 2AJ8A 3ZY6A 1EK5A 1H2EA 3I61A 2LUOA 1UBNA 5SZJA 5CX1B 1Q3TA 3PF9A 4FW8A 5A4IS 2IZ6A 1QIMA 4V0LA 2OZKA 4CXMA 4X94A 2Z5FA 3I05A 3GDOA 4FUTA 2D54A 4DAOA 5EJAA 2AXQA 4EECA 3HVJA 2X6RA 4M55A 3RUCA 4U0JA 1OYWA 5K09A 3THWA 1JEYA 2HF2A 5EJ4A 3EMKA 2O3TA 1KIMA 4OHUA 4JHXA 1E94E 1QFXA 2RAPA 4V1CB 4CV1A 3OQNA 4LF5B 1JNXX 4NENB 4X7PA 4Y8VA 5EUQB 2PUWA 2EZ8A 1EB9A 4LZAA 2H9IA 4K2AA 4IIBA 4GIBA 4QNMA 4CCAA 3KQPA 1JEQB 4D9MA 4YCNA 2XY4A 3FX2A 3GQVA 4K9MA 3S55A 4QFBA 4RHUA 3RRNA 2V3WA 5FUWA 4TM8A 1E89A 3LHDA 2WNHA 1H66A 1E3WA 4X93A 3HB5X 1JA9A 3K8ZA 3T8YA 3VDXA 1WIWA 2IV3A 2V7QD 1NN5A 3R3SA 1E6CA 1JLKA 2A4KA 2ZGVA 1T8PA 4XDYA 5EFZA 1E3MA 4KGZA 4MTLA 1GILA 1YXMA 3NOVA 1ZJ4A 4K6GA 1Q21A 1PFUA 1O87A 5JCZA 1XTZA 2RHOA 3HVKA 1Q0SA 1GR1A 4JIGA 1KE1A 3WLOA 4D8YA 1VMDA 3FZYA 4PHCA 1SEPA 1YR3A 1GPUA 3BJZA 1GKYA 1QFSA 2ZYRA 1HRDA 3P9RA 4YMLA 5A62A 5AESA 2VRBA 2MYNA 2E5FA 1PJAA 5EPUA 3WLMA 2PSHA 4DLTA 3LCMA 2YWEA 1YS6A 2ZEJA 1OTYA 3ZWCA 3FDZB 4II3A 1YBVA 2OPBA 5FUBA 4ZQHA 1SNYA 3ORSA 5CYFA 2RKWA 3ONNA 1Q19A 2ZUTA 1JFLA 3SHVA 3TQHA 5C7IO 3CNHA 1DMRA 4DBVO 3LO5A 1F12A 1V5EA 4OKNA 1N3IA 3R7BA 3PZBA 3VU9A 2F1IA 2O8EA 2VHQA 5KJ6A 3DGFC 4QU0A 1IXRC 4XRGA 1TZJA 5T4FA 3F74A 4FZ5A 5ALMA 5CLHA 1PZXA 3G13A 3BREA 3H16A 3VAZA 4POOA 2GT1A 4FM9A 3WNCA 3K35A 3NH6A 4GHWA 1S8AA 4F5EA 1TNDA 1G2QA 1O4VA 2V0CA 4J1QA 1JZTA 2J07A 3L6RA 4X9XA 5IHXA 1K86A 4LHZA 5D7NA 3FAZA 4RU1A 3R6TA 5EERA 2E1RA 5AVJA 1RRCA 3LUBA 3F3YA 4BAZA 1D1SA 4BE7B 5T57A 1JHOA 1EUQA 1NQWA 2C4NA 5FI0B 4D8VA 3RC8A 2NSJA 2XH8A 3VPSA 2J08A 3CTMA 2IIBA 1MV8A 3ZHRA 1WBDA 3EUFA 3SDBA 3PUYA 2VF2A 3QPDA 1A4RA 1KARA 2C2XA 5C8YA 3HGQA 3BIWA 4GR9A 1ST2A 1FTWA 2GRAA 3FVWA 4JLSA 4CR7A 4JLPA 4XWGA 1HX7A 3D4BA 3OIUA 2REOA 2QPTA 3THYB 1RQPA 4KO8A 4MEJA 4OGWA 4KXLA 1CZLA 3PGLA 4Q00A 3IBGA 3KYJB 1D1PA 4BLSA 1G6KA 4KUGA 3OWOA 1YRHA 4QARA 1T24A 4G84A 1AK1A 3RDPA 5JE8A 3RBXA 4DDHA 4FE3A 1W6UA 3T95A 1NVFA 3G68A 5KYVA 2J0VA 2Q1SA 5DCLA 3ND6A 5F51A 3WE7A 4F85A 2PIAA 1UZMA 4INAA 1GPH1 5FTKA 1SC3A 1YJBA 2AR9A 1Z0SA 1L6RA 3FCEA 1GQRA 1T1JA 3P94A 4FBGA 4RMHA 4WZAA 5GP1A 3HE3A 4WL0A 1E6KA 3V7NA 1QV7A 2JCXA 3R5JA 5JC8A 5E6SA 1CP3A 2ZSFA 1WP4A 3BRWA 1VL2A 4KQWA 1V35A 2BGLA 1XTUA 2CEKA 4RNDB 5FFMA 4NDAA 4X91A 4CLRB 3A9TA 4BVJA 3BMOA 4GX5A 5CCXA 2BMJA 1U02A 3OU2A 5IT4A 1A7KA 3GPDG 3ZC3A 3N3BC 1Y42X 2Y4NA 3OUTA 3EWAA 2ZTSA 1S8FA 1JXOA 3V4SA 2PZKA 1V11B 2EKZA 3HKEA 3M4YA 4JL6A 4OHVA 1I9CA 5E4FA 5B6PA 1ZMOA 3AY6A 4YT5A 3QWAA 3ST7A 4OU4A 4EHKA 2PVPA 1Q2XA 3I58A 4OI1A 4N65A 1TX4B 1TKRA 3GUUA 1E79D 4OMUA 1DC6A 3EZXA 4IW3B 4PZPA 2DLNA 1J0EA 2REXB 4R3WA 2QHXA 5BSGA 3QF4A 3BKXA 2ROQA 2J5RA 1XT6A 1XQVA 1IHDA 1QYRA 4YJ3B 3C1OA 2LTAA 1YIOA 4P08A 3NJ4A 1WHTB 3W1EA 2QQGA 1NUTA 3K6KA 2J3DA 3HZOA 2CV2A 3CR8A 2EHJA 2DKOA 1DAOA 4LJYA 2AFVA 2EWWA 2FJUA 3GARA 4TV9F 4DR1B 2AMFA 2GO7A 2V0GA 2EFEB 5T7BA 3KUCA 3FTCA 4IKOA 3WWOA 5JDIA 2E9SA 3NI2A 2JRCA 5EEHA 1RBZA 3AB7A 4OFBA 4YRSA 4YPOA 4Q3LA 5E0OA 3HP1A 3M5CA 1SG9A 1OGIA 1WUTA 4GYYA 4KYUA 4MKRA 4QPCA 3M4NA 3CRVA 4QNNA 2ZFUA 4ZZIA 3AUYA 1I6WA 1GKIA 2HH9A 3LGAA 5HJ2A 1CS0B 1F2TB 4BGEA 4MVJA 1S7CA 4B3IA 2YHUA 5K6AC 4MS1A 4BQOA 2OHXA 1XMPA 3ZIDA 2VIIA 5CDHA 4OIFA 2C7PA 5JAUA 4BTLA 3P4UA 3EVTA 1OXTA 3S1LA 2PRIA 2X8WA 4EPTA 1VP3A 2GRJA 4TRJA 2PPLA 5F3DA 2ZRPA 5B37A 2D5IA 2E4YA 5IYZF 4B3XA 5L4LA 3FOAA 4Z4IA 1Q1NA 1E5QA 1Y4ZA 2ODEA 4Z53A 4R68A 4Z4CA 1F3LA 1OAOA 3TXAA 4DMGA 2V6BA 3OZBA 4CWAA 1O6FA 1V9SA 3AHCA 4XVUA 3M1IA 3HJGA 1DSSG 1YAHA 1OLSA 5A71A 2HCBA 4NZPA 4MJ3A 5LC1A 5JPDA 3SNHA 1E2LA 3SYKA 2W6JD 4AKEA 3IQXA 1F6BA 4O4JF 1J00A 4E21A 3PGJA 3PWSA 3IP9A 4ECEA 2CLIB 3O8OA 5FNVA 3AQIA 3TBFA 3HJUA 1G2OA 3WLEA 1TF7A 1D0IA 1S96A 1YCDA 2PYIA 2QPAA 3NPMA 3L43A 2NO4A 2X14A 3HACA 1Z29A 5ABPA 2WT4A 4FYPA 4ZRMA 1KH3A 1PDOA 1V3VA 1EUZA 3K32A 4DA4A 3SJUA 4LF4B 2X5OA 1J7KA 3N75A 4M99A 1E3TA 4PYKA 4QGBA 1HT0A 3MMXA 1LBEA 1FJGB 4FK8A 4LYDA 1T35A 1VC2A 3IERA 3WGJA 4PAWA 4B73A 4F9FA 3DMTA 1KMMA 1QGDA 3HNRA 4M38A 6LDHA 2JVIA 4IUCS 2FQYA 3CYFA 3CN7A 3MAAC 1ORWA