4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
2POQX 2DUUA 4DPKA 5A4DA 5KJ1A 3TFOA 3PJDA 3PWSA 4UREA 3CZRA 3PZBA 2OHXA 4Z3KA 5U9CA 3UICA 2TMGA 3TRIA 1R15A 1E7QA 5JDIC 1B3RA 2VRCD 4N5NA 2BF7A 2GN4A 5A5FA 2C20A 3GEMA 3JQBA 2WTBA 3IOYA 5A9TA 1SB9A 3DO5A 2IRWA 3ZH2A 3WYCA 2CZCA 1ZO8A 3JQ8B 2YFHA 1ZSNA 1ISGA 3AY6A 1IZ9A 1IUKA 1K6IA 2I67A 3JYOA 3RSHA 1NXQA 4ESOA 1PSDA 1R4NB 2PA3A 3Q0EA 1T4DA 1U8XX 2PZLA 3RC2A 1FDVA 5IJZA 1T1RA 1YONA 1E6UA 3KLPX 1Q0QA 3HFSA 2WDZA 1AN9A 4EITA 4PN3A 4Z9YA 2P5UA 4BNTA 3AI2A 4EJ6A 1FJHA 3GPDG 5A05A 4B8ZA 3U09A 1X7GA 3OMLA 3PWKA 3CMMA 4LVCA 2IZ0A 3F3SA 1IL0A 1T2DA 1XDWA 4TRMA 3UCFA 4HFMA 4L75A 2X9NA 1R4NA 2IE0A 1YQXA 3DZKA 2Y0DA 3WQQA 2NQ8A 4B7XA 3QIVA 5BT9A 4DQXA 1JWBB 4Z0TA 5EJ2A 1XLTA 2Y0CA 4M1QA 3BZUA 2VUUA 2OBYA 1DPGA 4NJMB 5L9AA 4I9NA 2VHWA 5B12A 1A4UA 2WD7B 1LLCA 3PFFA 3PYLA 4EDFA 1FDUA 3ZCXA 4DC1A 3C7AA 1VE9A 1DAPA 1DRVA 4D45A 1ZNQO 4MKRA 4CQMD 1KS9A 2X0RA 5FI5A 1X1TA 3AM3A 4UVDA 3IJRA 4A0SA 1Y81A 3MTGA 1R4MA 2O2YA 1H94A 4L8VA 4YT2A 5IDWA 4NBUA 1Z73A 1BSVA 1PL6A 3A06A 4YBZA 3X2FA 4A2CA 1NWCA 2VHVA 1WAMA 3EHEA 3BA1A 3L9XA 4GSLA 3W1VA 4KTTE 3OQBA 1P1KA 1QORA 3GEDA 1GYRA 1Q0HA 2DKNA 2DU8A 3SEFA 1H93A 2DBZA 3EY4A 4CM9D 2ILTA 5DCYA 5T8KA 3AUUA 2G0TA 4O63O 5G0WA 1B7GO 2GASA 3KYCB 3QVSA 3CIFA 4YXFA 3DZFA 4IDBA 1D3AA 3B70A 3MTJA 4CUJA 3QLJA 3QW2A 2JFFA 1GYPA 2WD7A 3WDSA 3BMCB 4R16A 3HDYA 2A92A 4R51A 2LDBA 3F47A 1E92A 4XEHA 5DN9A 3I6IA 3C85A 4W99A 5TS3A 3CEAA 4CLHA 2BRUA 2XOXA 1I5RA 1TXGA 5AOVA 3VTFA 1ZK2A 2CY0A 1XYGA 4FSHA 4OH1A 4Q3NA 3EC7A 4NFSA 4I08A 4KUEA 1VSVA 2AQHA 5JLAA 5K6AC 3U0BA 2W90A 1NR1A 2YDYA 1A7KA 2YY7A 4ZHSA 4AJPA 2BGKA 5AVOA 2R6JA 5H81A 2BI7A 4BV8A 3L6DA 5HM8A 1DFGA 2ZATA 4FCCA 1PR9A 4PLPA 3WR5A 2Y99A 1HTBA 1O89A 1M2WA 4RDHA 5F3RA 2BH9A 3V8BA 5A9SB 1DJNA 2QQ5A 5CPFA 3HZZA 3ZW9A 4CM6A 1HYGA 3FTNA 4K28A 5A9SA 4DPLA 1LDMA 2FN7A 4E2YA 4LMRA 2Y1OA 2EGGA 4NQZA 4WLOA 2DBVO 3WS7A 3BTVA 4ALMA 3UW3A 4XYLA 4UVHA 1FK8A 3I9MA 1U4SA 3U62A 4GX2A 2HKIA 4NU6A 2WMDA 4IDEA 2FY8A 4MOWA 4ALLA 5IN5A 3WGHA 4CLRB 4W82A 3UF0A 3RQSA 4AJJA 1YDEA 3T7EA 3UXYA 4O1MA 3ICPA 3R3JA 5JO0A 3UCEA 3MJVA 1EUDA 1LDEA 5IDXA 4DMMA 1UUFA 2DPHA 4TKMA 5KKAA 5T67A 1BXGA 3NJ8A 4D43A 5TJHA 2W8ZA 3VKVA 1UP6A 3SC4A 2QRJA 3ZWVA 1UXGA 3DBLA 4KDFA 4NIMA 5KVQA 1HE5A 1P1HA 4N5LA 1A27A 4FFOA 5BSFA 1U7TA 4CV2A 4FFMA 3I9KA 5JY6A 5HS6A 2UV8A 5HTOA 4RF5A 4W6ZA 3ONEA 2HQ1A 5JCJD 3DZJA 1PGPA 2O4CA 3WQSB 3OJEA 3H9JA 1IPFA 1PQUA 3CE6A 4J0FA 4FFPA 3UHAA 1WLYA 2Y1CA 4LRSB 4O59O 3Q11A 5GZ6A 2GZ2A 3AI1A 3HN2A 1NBOA 3NGXA 4PG4A 3MJTA 4HADA 2NTJA 1V3TA 4NHEA 5F1OA 1Q1NA 4H3VA 1EUZA 1BXZA 1ORRA 4YCAA 4F6CA 3IJPA 3AUAA 1L7EA 2X86A 1W6UA 3DMTC 4IBOA 4WEQA 4A7PA 4DYDA 3RUAA 3EVTA 1NTOA 2PZJA 2UUOA 1GCOA 1YVEI 2X23A 3CPSA 1GZ4A 4BUCA 2C59A 3NT4A 2H1SA 5K9ZA 5IZCC 1E3LA 3N74A 4IMRA 1H5QA 2GERA 2ZTLA 4BO0A 4CV1A 2EWMA 1QV6A 3AK4A 1TEHA 3VKUA 1O5IA 4FIZA 4XB1A 3SJ7A 1GEEA 3AY3A 2FPPA 3KV3O 3Q2IA 5C7IO 3ROQA 1XWFA 4IXTA 3HG7A 1Y8RB 1N5DA 3FRJA 5JCJA 3S2EA 1E3SA 3M2PA 1BRMA 2X9GA 4NDNE 5JDCC 2H63A 3EMKA 3JQ6A 1E7YA 4EGFA 4RF2A 3U4IA 3B6ZA 2FRDA 1GQ2A 5FEUA 1TVEA 1LRLA 3HWRA 5BNFA 1ZSYA 1E3EA 3ASVA 3ZGYA 4BMSA 2X58A 3GA0A 2NLOA 4AJOA 4EEXA 3JQ8A 2YQ5A 4DIBA 5GZ1A 2RIRA 4HY3A 1B15A 5L95A 1SMKA 1YL5A 4JCOA 4ND4A 2CVOA 3GNTA 3IMFA 3X2EA 5IG2A 3RJ9A 3TDKA 5JYEA 1KEPA 3NJ4A 1KBZA 3AWDA 2JHGA 4E32A 1PGNA 3VPGA 3A14A 3ANMA 1QMGA 3DAPA 1QP8A 2EP5A 1WMAA 3E8XA 4ZVVA 3UAGA 4NBVA 4F45A 5CDSA 2AW5A 4UVIA 1VI2A 2LDXA 1CF2O 3FNHA 3OIFA 4RCVA 5G0SA 3JD0A 2DQ4A 4MVJP 4QUKA 2HJSA 3ABIA 1LDYA 3PHJA 1I3LA 2VYVD 1J5PA 4LGVA 2HMWA 2X0JA 4DXHA 2BELA 1P0CA 4NI5A 5FWNA 3FF4A 5DNAA 3S55A 1ULUA 3G0OA 1T1SA 4U5QA 1TT7A 3PRJA 1BGVA 2I76A 2P91A 2B4RO 1ADGA 4FS3A 2ZB3A 3C24A 4J1SA 1JW9B 1M6HA 1ZEMA 5G0TA 4G2NA 3CINA 3ZNOA 3S1LA 3F6YA 4DREA 2EEZA 4UAGA 5JXWA 1GDHA 5L7TA 3S8MA 2ZB7A 1JU9A 1GU7A 2QHXA 3GVCA 4BQPA 3QRWA 2JHFA 2G76A 3ZU5A 1JLLA 3D5QA 4GSKA 4BNVA 1P1JA 4U8GA 4CM3A 4KWIA 1ZXBA 3T7CA 1B8VA 4BKUA 1HWYA 3K6JA 1I33A 3TZKA 1I8TA 5CG2A 2OMEA 4R69A 4HFRA 5KKCA 1ADCA 4CLRA 1B14A 1A71A 1ZK0A 1TB4A 3INRA 1JAXA 3VZRA 4GPD1 4XYEA 4MVJD 5TLSA 4XYMA 3ROKA 4GL4A 5ENDA 5AXAA 4PZEA 4DIOA 2YHIA 1QSGA 3WOHA 3UFXA 2G82A 1DAOA 1MP0A 3P7MA 1EVYA 1GV1A 4Q39A 4O6VA 3PDJA 4E2ZA 3DOOA 1PU2A 4W9NC 4R9SA 3Q9UA 3IUSA 5JCXA 4B4VA 3NDJA 1I10A 1ENYA 4CM4A 4XQ9A 1EVJA 4TRJA 1KVUA 1HEUA 3HQ4O 4GGPA 4J4HA 1JA9A 1U2DA 3O4RA 1R0SA 3OJ0A 2DTEA 4UULA 2Y93A 3NKLA 4J2OA 1G0NA 2WYWA 1LBEA 1PJQA 2AE1A 3VPXA 1TLTA 1ISMA 4TZTA 4FJ0A 2AEMA 2FR0A 5ILOA 2NU6A 2NADA 4DUPA 4BO8A 1ARZA 1BHSA 5JY1A 4TMFA 1AUPA 3NEPX 1SEPA 8LDHA 1WWKA 1YBMA 4JBHA 4WLVA 4OQYA 4XWYA 1UH5A 1PQPA 2BMAA 2Q2WA 1WDMA 2PH5A 4YJHA 3F46A 3LVFO 3HFGA 3IL2A 4CQMA 3VH4A 2ZCUA 2YYYA 3E5MA 1M76A 1QYDA 3ZHXA 2OGUA 5CEJA 2NNLD 2AQIA 1L7DA 3QWIA 3I1JA 2BGLA 4ZGWA 4L4XA 1VKNA 3S2IA 3LF2A 1H6DA 1UJMA 3VH1A 3QJ5A 2J3HA 4DTIA 3DMYA 4RQTA 4DBZA 1ISIA 4XB2A 4CMIA 4CM9A 1X0XA 3VDRA 1E1KA 4OMUA 1N7HA 1U9JA 2EXXA 5HRUA 3FBGA 3UGKA 4RDIA 1E3WB 1U7HA 1UP4A 3ZWCA 3PEFA 3H9EO 3NYWA 1HDCA 3PLRA 4GWGA 3N7UA 3R1IA 4WGGA 2Y68A 4BO4A 1C1DB 1EFKA 4CLDA 1MUUA 4WJZA 3F9IA 1YB1A 4CM7A 1NWHA 5L7WA 3V2HA 1D8AA 2VWHA 1T4BA 4RPLA 1P1RA 1NFFA 3I3OA 2J8ZA 2O3TA 4I1IA 4GH5A 4RF3A 3W4IA 1YS4A 4QTZA 5ITWA 2NV6A 2DBRA 3PQFA 1EE9A 1G1AA 3G79A 2PWZA 2ZJ0A 3I9OA 3GRKA 4Y98A 4AJ4A 3ZWYA 4HWKA 1JVBA 3OP4A 4PRKA 5JE8A 1NVTA 5JPIA 1W4ZA 3RFXA 1GTMA 1T2EA 2HDHA 2GF2A 1AHHA 1LDBA 1M66A 4DYVA 3G1TA 5K0ZA 4W7IA 4CR7A 3WTBA 1P0FA 1K6XA 1QG6A 3IKVA 5JNLA 5DULA 5B37A 1NVGA 4OGWA 1P44A 3W6UA 4AJHA 1ZUD1 4BGIA 2B37A 1CERA 5TT1A 2GN9A 2C5EA 3GMSA 1JTVA 1B26A 3ZNNA 1HKUA 3JYQA 3WMWA 3NUGA 2CDCA 4JP2A 2W98A 4K6CA 5G4KA 4U6QA 4CMIB 5DCWA 4G81A 5C7OO 3JYPA 5LC1A 1R4MB 3M1AA 3PDUA 4EBFA 4YAIA 4OXNA 4A5OA 3I4CA 3DQPA 4RZIA 3WGQA 2NWQA 1NQOA 2NTVA 1NQ5A 2PTGA 3KLMX 4J1QA 1ONNA 3KUXA 2X9VA 5IXSA 1VL8A 1D1TA 3GLQA 1C1XA 2PD6A 5L4LA 2GZ1A 1IPEA 2GSDA 3LT4A 1P33A 4IS3A 1PJLA 4HX5A 4O0LA 4KP7A 4PZDA 2PKRA 3MZ0A 2GPTA 4AVYA 2QRKA 4IQGA 4KTVE 1LDGA 1NP3A 1S7CA 5TGDA 5JMPA 5L45A 4HKTA 3M1LA 4W4TA 3H3JA 2CD9A 1Z45A 3VC7A 3RKRA 2O48X 4R9RA 3W8DA 1CETA 5DBGA 4CR8A 2B5VA 4PZCA 4AFNA 2JL1A 3KYBA 2C5AA 2PNFA 4Q3BA 2ZK7A 2PZKA 4QECA 1IY8A 1EK5A 2ZYDA 4XD2A 2EV9A 1E3IA 2J3JA 1LLUA 4MVJE 1XU7A 4RGBA 1VJTA 3UOGA 4DRYA 5JAZA 4IZHA 4I5DA 5JSFA 3WQRA 4LISA 3JD1A 2PKQP 4AJNA 4DC0A 1LLQA 5EL0A 4JJFA 4XRGA 1F0YA 5B4UA 1PWZA 4YB8A 1ONOA 3RUDA 3BAZA 5KNLA 5L51A 3G17A 2Q1WA 3HHPA 3AW9A 1QYXA 1XKQA 3P2OA 4E5MA 3L6EA 3L0DA 1YBVA 2I66A 5C7LO 3IS3A 4LCJA 5CDUA 2EG9A 3NTOA 4UUMA 5A03A 3RFTA 1LA2A 4YPOA 1LSSA 2FP4A 1Y8QA 2Z95A 4AJ1A 1I2BA 3D1LA 4IDDA 3V1UA 3KYDA 3ZV6A 5IF3A 1X7DA 1LXCA 1R6DA 3GZ4A 3JV7A 1MC5A 1QKIA 3K5PA 2D1YA 1F06A 2P9GA 1X15A 2AQ8A 3E18A 1U3VA 3H8VA 1K5HA 1UDBA 4YT8A 2OBNA 1LQTA 2C0CA 3L4SO 3OHSX 3U9LA 3OM9A 4JROA 3IKTA 3WFIA 2EGHA 1DHRA 2RCYA 2RH4A 1V3VA 2JD0A 3BMOA 4MO2A 3AY7A 4CL8A 1NHGA 4NFHA 3W8FA 4QT0A 1E7WA 1HYHA 5DCUA 2B4TO 4ALNA 5TF4A 4HBGA 4IDFA 3BMQB 4QFCA 5KVVA 3E9NA 2OUIA 1DOHA 3ADPA 2FZWA 4J7XA 3K9QO 1PJBA 4LRTB 1UXJA 2JCVA 2J5KA 1OC4A 4AJEA 3GNSA 1CRWG 2DBQA 5HA5A 3UVEA 1Q7CA 1O0SA 4CJXA 5T6BA 2C29D 3IP3A 3U49A 1DIAA 3DHYA 1SB8A 3G3EA 4WLUA 1L1FA 3ZWAA 5KVSA 3PHGA 5DBIA 2PLAA 3GQVA 4PLWA 6ADHA 1MV8A 3NAQA 4CMEC 4Q9NA 3LT1A 3DMTA 4MJLA 4RPHA 1SPXA 4BIIA 3D3WB 5KIAA 1NR7A 4GBJA 2O23A 4WECA 4B4WA 5BSHA 1ZK3A 1B0AA 1XSEA 2O2SA 3OEWA 4GMGA 4YJFA 3GN1A 5T5QA 5G4LA 3NT5A 3I6QA 3L07A 4E6PA 1HDYA 3RUCA 4FN4A 4FB5A 4ZD6A 3L9WA 4PVDA 3L6OO 4RVSA 4A27A 3K30A 1F12A 4FFRA 4L0QA 1EBUA 3RIHA 2P68A 4WCFB 1E5QA 2EJWA 3EZYA 4MVJA 2GR9A 1G0OA 2V7PA 2C07A 2VYNA 4Z6KA 5F21A 1K3TA 2V6MA 4J49A 3VHRA 3O03A 3OICA 1DLIA 4ALIA 1GQYA 1DB3A 3PJEA 4DIFA 1GD1O 3ZZNA 4XR9A 4EJ0A 1E7SA 4BNXA 3VZPA 2FSSA 5TQVA 2CDBA 3EZLA 2HMVA 4IM7A 3DBVO 3C1TA 3OF2A 4R5MA 1JVSA 2B83A 3A9WA 4K9DA 3LZ6A 2NU9A 3TNLA 4P22A 4EW6A 3L4BA 1KEWA 4Y67A 1T26A 4QO7A 3NDIA 3PI7A 5ITVA 1YB5A 2DFVA 3JQBC 1U3UA 3D3EA 4MVJF 4QO8A 5TJ9A 3BMQA 4D7AA 5CDYA 5KOIA 1RKXA 4E2XA 5A3JA 3RVDA 2NVUA 3AU9A 5CAEA 4I9UA 3FSRA 1J49A 3DBRB 3GDGA 4BGEA 3PYXA 4EUEA 4NMHA 2OOSA 1A4IA 1YJQA 2IODA 3GY0A 2NTNA 1DSSG 4CLEA 1KY5A 3H5AA 1LUAA 1NYTA 3KYDB 4QXMA 1GY8A 4F46A 1NQAO 3CTMA 4XYBA 2WEKA 3BTOA 1NAIA 1B2LA 1ENZA 1QV7A 2Y1GA 3C1OA 1PGQA 4L9RA 2Y1DA 3B1JA 4OOEA 4TVBA 4Y9DA 1R12A 8ADHA 3ITDA 1WXDA 3JQEA 3K8ZA 1O95A 1LSJA 4PIVA 3ROPA 1N1EA 2GN8A 4PLTA 2FSVA 3ENKA 3NRCA 1ENOA 1R0KA 2CMDA 3RC7A 3RD5A 2Y66A 1YOVA 3WNQA 1V6AA 4DA9A 2IEDA 3WGTA 4DMLA 1HDZA 3C8MA 4XDZA 2J5RA 4WUVA 2JD2A 2GN6A 4HUJA 2BHLA 1JAYA 4ZRMA 2YFQA 2VHZA 4UEJA 3VPHA 1YH3A 3OH8A 3NGLA 4MVJI 4BO6A 2P4QA 1LEHA 2QZ9A 3ZN2A 4KDEA 1TT5B 1IHYA 4NG5A 2DTDA 2ET6A 1GV0A 3RJ5A 3ZHBA 4RL6A 3F5QA 4E5YA 1P1IA 1YE3A 1C0LA 2VZ9A 2CFCA 2I6TA 3H2SA 4N5MA 4R5HA 5JAQA 5GZ3A 5ICMA 1T2FA 3LC1O 3ZU2A 4Y6SA 2PD3A 2CSUA 3K31A 4YVFA 5JC1A 1NPTO 3DAGA 4BNZA 4TROA 4RVHA 2WM3A 3JCZA 4GGOA 4N7RA 4OQZA 4Y6RA 3VZSA 1LSUA 4W7HA 5F5NA 3ZHYA 1WZEA 4IDGA 1PR3A 1ENPA 4II3A 4CL3A 1YQGA 2GYYA 3ZWWA 4BL5A 1BXGB 4EUHA 5EN4A 4ZJUA 4MIYA 2DLDA 2JFHA 3GK3A 3TZ6A 3O8QA 3PLNA 1B8PA 1Y5MA 2FPIA 2RH8A 1ZK4A 1PX0A 3NTQA 2JD1A 4HV4A 1VSUA 4OIMA 2HMUA 3WX0A 1KVRA 2G5CA 1N2SA 3NTRA 2DUWA 2D4AA 3EAGA 4PG6A 3PVZA 4B8WA 4XKJA 4DLLA 1F14A 3MWEB 3IP1A 1JKIA 4K26A 2Q4BA 1YDWA 1WVGA 4JLWA 1PZFA 3VZQA 4A10A 3DDNA 3PXXA 3MJSA 4M87A 4BO2A 4XQCA 2O7SA 4BKPA 4H16A 2VTEA 5EESA 4UVEA 4FOOA 4A26A 4J9VA 2UVDA 2Z5LA 1O94A 4KQXA 4RZHA 1NASA 5IXYA 3NX4A 4NK5A 3FPLA 3W4KA 2PV7A 2ZJ1A 3LC7O 1BW9A 2Q99A 3JQ9C 3E9MA 3RASA 1MC4A 1PZEA 3GVHA 1G6KA 1JQBA 1U8FO 3GGOA 5KTKA 4RORA 3JQCA 5L40A 1PTJA 3WJAA 1JN0A 1OZAA 2D5CA 3WGOA 4P38A 1PJTA 2PGLA 3DTYA 3O8QB 4GVLA 3WGGA 1M6WA 1IYZA 3LC2O 1KIFA 1IULA 4Q3DA 3GFGA 2VYVA 1MG0A 4BVAA 4RPJA 1HE4A 1VLLA 1MXFA 1X0VA 4FW8A 2OORA 4D79A 5I9NA 2Q4EA 4GX0A 4XQEA 1EDOA 4IIUA 3GNQA 1BWSA 1QYWA 2P2SA 1XCBA 3ONDA 4TWRA 1A72A 3CZMA 3PJGA 4YJFB 4XYGA 2HAEA 1N9GA 1UDCA 2GCGA 3TOXA 1ZFNA 3DWFA 4R1UA 1EQ2A 3RU7A 3E1KA 1BDMA 1MGOA 4PLVA 5K6AA 1HZZA 1Z7EA 4WLFA 1WNTA 4ZRNA 2HCTA 4CPDA 5H83A 2TMDA 1PGJA 3QVXA 3ASUA 3S2FA 2HK7A 2A4KA 4XGIA 4UUPA 1JDJA 4YAGA 1EK6A 2VT3A 2H9IA 1DO8A 1Y7TA 4BNGA 1DC4A 5BSEA 4XQGA 4RLHA 1D1SA 1ZKMA 4A73A 2CVQA 1U28A 1EFLA 3DOCA 3F4BA 4FFLA 1C14A 1I36A 3JQGA 3VDQA 4R01A 3WBFA 4ONEA 4J90A 5IAAA 5KVCA 1ZCJA 4HNHA 4WASA 3LDHA 5IZ4A 5G4KB 3SLGA 1RYDA 4GVXA 1BG6A 4IGEA 2RBEA 2F00A 3Q6IA 4E5PA 1VL6A 3VOSA 3CSDA 3RU9A 1QRRA 5TC4A 1QR6A 4PLZA 4URFA 5KJCA 3HB4X 2W4QA 4GLLA 4JN6B 3BYZA 1YKFA 3JYNA 4DLAA 4E33A 3AOEA 4TKLA 4LSMA 4L76A 5G0VA 4CMHA 5ENVA 2WE8A 3WTCA 3DBHB 3UCXA 3DEYX 5KJFA 4XIJA 2ZCVA 3K2BA 2VWQA 4F3YA 1KVTA 1XA0A 3OETA 4ZQHA 4GAEA 3MCVA 4OXYA 2B36A 3EK2A 3I9LA 4XCVA 3HDJA 3ROMA 4LW8A 1O9BA 1O8CA 1ULSA 4PLHA 4H7PA 2NVUB 3GF4A 5GY7A 2HSDA 4BNIA 4C4OA 1XHLA 4NJOA 2VRCA 3H9QA 4RPGA 2R2GA 1H9AA 4JGBA 3ZWOA 4EJMA 1AXGA 4B79A 4OL9A 3LT0A 4AICA 2WJPA 5L53A 3P19A 2HK9A 4J1TA 4CUZA 3I9JA 2E37A 1I2ZA 3ONFA 4ND1A 3DZHA 1C3VA 2VRBA 3EVNA 2UDPA 3LK7A 3WBBA 4BNNA 4AJIA 2IYPA 4DWVA 3QWBA 3NV9A 4M8SA 1EZ4A 3JSAA 1XEAA 3KVOA 5L4NA 2Z1MA 5DP1A 4EI2A 1RM5A 3ADOA 2J6IA 2O50A 2X4GA 2VOEA 2I9PA 5DOVA 3TZCA 3RBZA 2BLLA 2WWRA 3RUHA 3H4VA 4D3DA 1Z75A 2X0IA 4Z3DA 1I32A 1DC5A 4FFNA 4BO1A 1HDOA 1E0DA 1LC3A 2PY6A 2Q1TA 3KOUA 1DIRA 3GUYA 4PLYA 4UEOA 3F5SA 4U6SA 1Y9AA 3H6KA 1I30A 4WLNA 5IN4A 1WPQA 1IZ0A 1JKJA 4YWJA 4FOSA 3COSA 4IXWA 4Z9XA 5A3VA 1E1NA 1OMOA 1T2CA 4AJ2A 3MJCA 5A04A 1D7OA 2EJVA 3WLFA 4OYRA 2PK3A 1ISJA 1P77A 3ZWNA 1FDWA 2VZ8A 4CMBA 1N8KA 1EDZA 2HJRA 2Q2QA 4C7JA 1XELA 5ES3A 1GR0A 1RM0A 4K1LA 4FGWA 2DVMA 4E21A 4D3FA 5U1PA 3SX2A 1GUFA 1KY4A 3ANLA 3HUDA 1A7AA 4NH4A 1GUZA 1GPDG 3TPCA 5JBIA 1GFSA 1RM3A 4IQ0A 4RVGA 1YXMA 2VOJA 3GZNA 3ANNA 5A02A 3TWOA 4CLOA 4WNIA 2QRLA 3HDHA 1LLDA 7MDHA 3O26A 5JO9A 1OFGA 1PZHA 2BGMA 2C7GA 4FQ8A 1YL6A 4YACA 3K92A 1A9YA 4J2HA 2IXAA 1E1MA 2HO5A 2QZZA 4J9UE 5JS6A 4CMEA 3OIGA 4YDRA 3SJUA 1GZ3A 4RO0A 4UVGA 1T25A 2X5OA 5I9LA 3O38A 4MP6A 2NVBA 2VUTA 4ILKA 1E3WA 2XPCA 4GX1A 2AA3A 3SC6A 1V9LA 1MB4A 3ZV5A 1EVIA 3AUSA 1AXEA 4RQUA 1YOVB 5KWEA 2WYVA 1UDAA 4MIEA 3P2YA 4YT5A 5ILGA 3BHJA 1HDXA 5BNTA 2GZ3A 3WNVA 3PWZA 4Q3CA 1GEGA 5CEFA 1PJCA 2VNAA 5A06A 1PS0A 3WWYA 2AEFA 3LYLA 4WE3A 1F8GA 3WWZA 1B8UA 1NFQA 2V6GA 4CMKA 3TQHA 1X13A 1YJ8A 2AMFA 3B1FA 5B1YA 1HE3A 1KEUA 4BNKA 4OO3A 5EIOA 1ZJYA 3ITKA 4FJ1A 4PG8A 3VPSA 1OC2A 2X5KO 1NFRA 2OL4A 3BHIA 1B3BA 1I3NA 3V2GA 1P3DA 1JWAB 4J3FA 4KUGA 4NK4A 5BNIA 3KZVA 1HXHA 2ZB4A 3OJFA 3KRTA 1Y9EA 5ADHA 3I5MA 2OXIA 4OKIA 4WNCA 3ETEA 4J4BA 4M49A 2W2LA 5CG1A 1DRWA 5H82A 4BNLA 3AI3A 4MVJH 3STHA 4B4OA 4AG3A 5JYDA 4ZN6A 3VTZA 4FDAA 4J7UA 4R3NA 5T64A 4ND5A 1AE1A 4HP8A 1CQIA 3FWZA 1BDBA 5L4SA 2HRBA 4CR6A 3A4VA 3JQDA 1XR3A 3QSGA 3GN2A 1R16A 4ROSA 3ETDA 3WFJA 1HETA 3M2TA 5DT9A 2CNBA 1P74A 3DC2A 4I5EA 4NBRA 2Y0EA 4CQLB 3S2GA 2ZYGA 2VWPA 4H15A 5THQA 4JBGA 2YV1A 3FBTA 3OA2A 4IQ8A 2GD1O 2Q3EA 3AM4A 4FPXA 4CMAA 2E48A 2BFAA 3JQFA 4ND3A 1PJ4A 1ZXLA 3DBHA 4BKQA 1YWGO 2D3TA 4WCFC 1PL7A 3F1LA 1KC3A 5A1TA 5IDQA 2X1HA 4L4RA 4U0KA 4WCFA 3RBXA 3BXXA 3JQAA 2ZQYA 2AXQA 3PTZA 4PG7A 4OM8A 3JD3A 1LJ8A 1LDNA 1DIBA 1CEQA 4B7UA 3IUPA 5A9RA 1EVZA 2W2LD 5LDHA 1FF9A 1SEVA 1E77A 4PLGA 4R1SA 4WOJA 1I3KA 4BQRA 2H6EA 3QV1A 5U4QA 4Z9FA 2Y67A 4CM4B 4E3ZA 2HU2A 3KO8A 1HLPA 2PZMA 1ONPA 3PHHA 3GR6A 1XIVA 4G5HA 3V5NA 3F4LA 1MX3A 4ZQEA 3RCBA 4JBIA 1DC3A 4JJGA 5I7VA 4Y6PA 4OSPA 1GL3A 4MKXA 2B4QA 3FNGA 2X22A 4ID9A 2C2XA 3W8EA 2X0NA 2D59A 2NU7A 4YQZA 1UXIA 5IFLA 2NM0A 4E30A 4WCDA 1PIWA 3PP8A 3JQ7A 1Z7BA 3GFBA 5BSGA 3U4DA 1Z82A 3PIIA 3V2UA 1BMDA 3TOZA 1OAAA 3WSVA 3FNEA 4NZ9A 4CM5A 1E6WA 4XGKA 1OI7A 4BKOA 3U4CA 5ICSA 1DIHA 4BNYA 1GQQA 1VM6A 3IIEA 2DPGA 3PK0A 3H9UA 3C3XA 3M6IA 4BNHA 2Q50A 4BHTA 4PGFA 1FDSA 5THKA 1P9LA 3CH6A 3WGYA 1FDTA 1D4FA 3PJFA 4Q3AA 4B3IA 3KSUA 2EP7A 5B4TA 2JCXA 4GWKA 1QXSA 4YQYA 5DZSA 1OBFO 4LVUA 1QYVA 3HJAA 1E1LA 5DDIP 3JQAB 3D5TA 2EW2A 2I99A 1CJCA 3FR7A 3KEQA 1LRKA 2EIHA 4P4GA 1GZ6A 1YO6A 2BFMA 4RVFA 2RHRA 2BI8A 3OFSA 4G65A 3RWBA 5CFZA 1HYEA 4LN1A 5HBRA 4PRLA 3ZNPA 2D0IA 3JYLA 2PFGA 4WLEA 1H6CA 3N58A 5BR7A 3D4PA 3GUCA 3QWHA 1ZW1A 2WD8A 4I9HA 2NQTA 4UUOA 4TQGA 4DPMA 4YJDA 3PFWO 4KWHA 3BHMA 1LTHR 1DXYA 3IDSA 3AU8A 1RWBA 3DXFA 4IJWA 2H5LA 1UAYA 4NJMA 2HMSA 4WOKA 1Z6ZA 4WKGA 1HRDA 2DFDA 1WP4A 3GZNB 5I7FA 4IJVA 3DB2A 3C7DB 1FMCA 3TL3A 2A35A 4QFDA 1WMBA 2O7QA 2AG5A 2OP1A 4KMSA 1H6BA 1H2HA 2C54A 2D2IA 3WYEA 3Q3CA 1DEHA 2P9CA 4CQMB 1SCUA 1X7HA 2QYSA 1U3WA 3W4JA 1DHTA 1V8BA 1SOWA 4ITUA 1QLHA 5DOZA 4CUKA 1XQ6A 2YW9A 3DZBA 3PGXA 4B7CA 5CEEA 5MDHA 1BXKA 3JD2A 4PCVA 2CDAA 1XQ1A 1FXSA 1E7RA 3FCOA 2HUNA 1YBAA 3OSUA 1LC0A 1SBYA 1Q7GA 3IQDB 3W6ZA 1IHXA 3GHHA 1DIGA 3RFVA 3ICCA 2UAGA 2FZEA 1R37A 4QX6A 1N92A 3CXRA 4MKZA 2O3RA 3IAHA 3AJRA 1Z74A 1KEVA 1ZIDA 3AFMA 4YR9A 3GG9A 2I3GA 4N18A 2GGSA 3VH2A 4NFYA 3ZI0A 3KBOA 3KTDA 4MVJM 4X54A 4XR4A 1DRUA 3TSCA 1ZBQA 2GO1A 5EQFA 1ZVMA 3FR8A 1GUYA 2GUGA 2IZ1A 4R68A 1I3MA 1MFPA 2EF1A 1H2BA 2J3IA 4D0RA 5COQA 5TIIA 3KHUA 3EYWA 1ZJZA 1HSOA 1SO8A 2R00A 3FHLA 2C82A 1N1GA 4BNWA 9LDTA 3VAZA 4YA6A 4CMJA 4D3SA 3Q1LA 5KJ6A 3E03A 3QVWA 1LI4A 2D5AA 2VZ0A 3OECA 3MJ4A 3GVXA 2Q1SA 5AXCA 4DVJA 5HWSA 2B5WA 1PJ2A 1YGYA 5EERA 4J4TA 1C0IA 1WDKA 3AOGA 4GKVA 3QQPA 4CLOB 1GCUA 4J91A 1KYQA 4IY1A 4R54A 1H9BA 1I24A 2YV2A 3H7AA 4Z0PA 4XA8A 4IDAA 1CIVA 1PJSA 2Q1UA 4JNKA 4B3HA 5JFOA 1WZIA 3WLEA 1NQTA 2P5YA 1PGOA 3DL2A 3TN7A 3WIDA 4CODB 4ZQBA 3B1KA 4CV3A 2V65A 4BNJA 3DFZA 4BKRA 4WK6A 4EZBA 4FD3A 4XRRA 4CM8B 4OKNA 5B4VA 5KCZA 3D64A 3KB6A 1KC1A 4I5GA 4D41A 4OOFA 1C1XB 3FD8A 2DAPA 2OO5A 3HE3A 4FC7A 3DZIA 3ZWMA 1GADO 1KVQA 3ZWPA 2XXJA 1V35A 2VHXA 1ADFA 3D7LA 4YAKA 3GAFA 3JD4A 2WYUA 3WICA 7ADHA 3GMDA 4B4UA 2F1KA 3ORFA 3KSDO 2Y1EA 1LNQA 1M75A 1K89A 3GPIA 4YT4A 4L74A 5JDIA 3DONA 5J23A 3R3SA 3PHLA 3KETA 1DBVO 1W0CA 2YQ4A 4M55A 4XZ3A 1B16A 1ISFA 4BO9A 9LDBA 3GHYA 5FFFA 3VH3A 2B35A 3F1KA 3I52A 1A5ZA 2IEBA 3MWDB 4J6FA 1I2CA 1NHWA 4LSWA 3LLVA 1V0JA 2YHUA 1EUCA 4OJNA 4XJSA 1U1IA 1LU9A 3CUKA 1HDGO 3HSKA 3FTPA 4FC6A 4IMPA 3I23A 4JK3A 1VJ0A 2Z1NA 2VTDA 1ZEJA 4OSOA 5DF1A 2PGDA 4J7CA 4KQWA 1E7MA 1U4OA 1YB4A 1I0ZA 2J3KA 3U4HA 1EMDA 2DM6A 1SOVA 3Q2KA 3PPIA 3KM0A 4LCEA 1BTOA 1UXHA 5IZCA 1WW8A 3DFUA 4FR5A 1CWUA 3WMXA 4BS9A 3T4EA 5FF9A 3ST7A 3KXDA 2G17A 2Q49A 1ML3A 3GEGA 1SZJG 3PQEA 3E5RA 5IDYA 3QHAA 3RUFA 3BMCA 3OQ1A 2P4HX 4J1NA 1V3UA 2HK8A 2VWGA 1C1DA 2FMUA 3R6DA 4FJ2A 4BO7A 5EQDA 3RC1A 5C3MA 3SXPA 5CDGA 4E13A 2Q46A 5JW6A 1EE2A 1DDOA 2P9EA 5EMHA 4RF4A 5AXBA 2YZ7A 4EEZA 3MEQA 4ALKA 1P1FA 1ZMTA 2E49A 3SVTA 1WDLA 3OJLA 3EUWA 2VUSA 1LSOA 1TA4A 2E6UX 4E5NA 1YL7A 5F1PA 2AHRA 4LK3A 3JTMA 3A28A 3AUTA 3E82A 3DOJA 1IE3A 3GOHA 4JP3A 1HT0A 4BV9A 3DHEA 1GAEO 4J0EA 5T57A 4YRDA 3T4XA 3ZHZA 4BGVA 1AGNA 4CLXA 2BD0A 4F6LA 1K6JA 3C1AA 5KJEA 1R0LA 1J0XO 2Y05A 2O3QA 3C7CB 1JKFA 3HDQA 1IOLA 4BO3A 2XF8A 2JFGA 3JQFC 4BNUA 1T2AA 3Q9NA 1EBFA 1YQDA 4BNFA 3JQAD 4YJHB 2I3AA 4Q3EA 4E4YA 3MOIA 3RROA 3WSWA 3HADA 2QG4A 5CPBA 3K73O 2C7VA 4M89A 4ZA2A 3WJ7A 4KOAA 5AXDA 4E0BA 1MA0A 1E5LA 3D4NA 3GDFA 5CHEA 1TI7A 2Y1FA 4INAA 4D0SA 2DT5A 2WSBA 4RJTA 3ZDFA 3ZW8A 3OJOA 4BOYA 3E9QA 2EKPA 4JQCA 3H9GA 3I4FA 1DFHA 1PL8A 4YRAA 2NU8A 2IZZA 5LCXA 3NT2A 1YRLA 2PGJA 1NVMB 2GDZA 3TFQA 1C0PA 4TSKA 3SBOA 3BMNA 4BB5A 4WEOA 2X6TA 1UZNA 2CUKA 3WXBA 4P8RA 2UUPA 3HNPA 3UH1A 5TSDA 1NAHA 2EHDA 3G1UA 5C37A 4YJGB 3OEYA 3INTA 5CP8A 5FI3A 4J16A 1U5AA 5JAMA 4D42A 3NDRA 1E6EA 1T24A 3D0OA 3LLSA 1CDOA 1GYQA 3B20A 2ZIZA 3VVBA 2DTXA 1F8FA 3GG2A 4NBTA 2EKQA 3UN1A 4PG5A 2EERA 5DP2A 3RKUA 4TRNA 4TZKA 1SC6A 4I5FA 4GKBA 3LF1A 4S3MA 4R1NA 2VYND 3PYMA 4NNJA 3QVTA 2A9FA 1M67A 4CQLA 4IJUA 2C2YA 1N7GA 2AQKA 4GX5A 4AL4A 3FWNA 4MP3A 4DBVO 4PVCA 1HDRA 5MGBA 1MG5A 2YJZA 1LX6A 2EW8A 2A94A 1CYDA 2ZTMA 1ZSVA 2BFPA 4U7WA 5I8ZA 2JJYA 3PHIA 3LT2A 3MJEA 3ON5A 3GRPA 3HB5X 3V1TC 4ZQFA 2W2KB 4NBWA 3EW7A 3HN7A 6LDHA 4IGFA 1NNUA 1SNYA 2FWMX 4YTEA 4Y8VA 2JKVA 4DQUA 1W8DA 5JC8A 1XG5A 2FR1A 1H6AA 1U3TA 2VHYA 3DZGA 2D8AA 1VKOA 3EGOA 3GAZA 2B0JA 4PFJA 4S1VA 2IXBA 4CV0A 4RV9A 2YDXA 4O5OA 3TF5A 5DBFA 4A03A 2QW8A 3RI3A 5I9MA 4XIYA 4WPGA 3CMCO 3WGIA 4YAJA 1E3JA 1Y8RA 2NUAA 4HXYA 3WG9A 4R4JA 5FYDA 3RBVA 3OA0A 5I7SA 2O3SA 4E2WA 3D3WA 2ZKLA 4YRBA 2OFPA 5GMOA 4YAEA 2FHSA 5AQ1A 2JAPA 4XDYA 3K2EA 1U2GA 2VNSA 1VPDA 5ER6A 2GNAA 2CF6A 4CM1A 2PH3A 1Y1PA 4FGSA 2VN8A 3GGGA 5EINA 2FR8A 4BGUA 2W2KA 2QYTA 1NX6A 4LMPA 3JQ7B 3GT0A 2X7HA 1PEDA 4M86A 5ER9A 4II2A 4PLFA 3DBRA 3AFNA 1TT5A 4ZICA 1RYEA 2VQ3A 3ULKA 4KUHA 1O6ZA 3FPCA 4HNGA 4NPCA 5F5LA 4MINA 4EUFA 5L7YA 5LDGA 3JQGB 1NPYA 5TT0A 3ZU4A 3I9NA 3JQ9A 3QP9A 3GGPA 1UAGA 1BVUA 1DJQA 1VJ1A 3AOEC 2ZQZA 1X14A 3G49A 2PKQO 5T8KC 1KVSA 4OAQA 2X8LA 3EDMA 2OZPA 5CDTA 1W73A 1Q7BA 1Y6JA 3ENNA 2FOIA 4L4SA 1UZMA 3VVCA 4IS2A 3UUWA 5JDCA 5COBA 3ZV3A 3U5TA 2SCUA 4ALJA 2Q2VA 1KETA 2I5PO 1RPNA 1ZMOA 2JAHA 3KEOA 4IJKA 4JJIA 2ZB8A 2EKLA 1UP7A 4IPTA 4XJTA 3LU1A 4UUNA 3RAJA 5TRTA 3WIEA 1PJ3A 4BMVA 4QSMA 5F1KA 3ZU3A 1CQJA 1PWXA 4UEKA 2PD4A 3KYCA 3DTTA 3PIDA 1HZJA 3H5RA 4DGSA 3VPFA 3H3FA 4QEDA 4MIOA 3TZHA 4EYEA 2X5JO 3SLKA 2DC1A 2O3UA 3E48A 3ZWXA 4XGNA 4E31A 4BB6A 1NM5A 2O4UX 4R1TA 3OIDA 1BVRA 1R66A 3BTSA 1KOLA 2Q45A 4AJLA 3TZQA 3ZV4A 5I7EA 2E82A 4L73A 2NVWA 1MFZA 4RVUA 3PQDA 4MDHA 5G0UA 1BW9B 1VRWA 3U3XA 3WYBA 3D4OA 3AM5A 4I8XA 2HRZA 3QY9A 1UR5A 1K2WA 1ID1A 1RM4A 4NR0A 1EEHA 2BKAA 1SAYA 3QWAA 4J43A 4M54A 4YYZA 4GMFA 4HFJA 5JMWA 3CKYA 1IB6A 4JXKA 2ZTVA 1U5CA 1XU9A 1HLDA 1UXKA 3BMOB 3V1YA 2O3JA 1ZK1A 1HE2A 3DAFA 3DR3A 3K96A 4HFNA 1ADBA 4ZQGA 2HLPA 3PZRA 1EQUA 1ISHA 2FPGA 4DQVA 2NACA 2CVZA 4YJGA 3ZNQA 4GQAA 1VC2A 4BMNA 2BFOA 2JCYA 2VT2A 3GVPA 4YEDA 4E12A 2QX7A 4ZU3A 2IYOA 4CMGA 5C5IA 3GVIA 3GC6A 3QWFA 4U0JA 2V6BA 4P4LA 4IIVA 3BMNB 3RUIA 4DL9A 4DLBA 3DBLB 3OBBA 3O9ZA 3QE3A 3R0IA 1A9ZA 2YUTA 2ZYAA 2RHCA 4IUYA 4B3JA 5TX7A 5BQFA 3TL2A 2XAAA 2WE7A 4TVOA 4C7KA 4D44A 2AG8A 5JAIA 2J5QA 4RPKA 3BIOA 1PQWA 4ND2A 2R00C 1DFIA 4RVDA 3ETGA 5I8WA 4MP8A 3KSZO 4XX0A 4BO5A 2E4AA 2GRAA 3QA9A 1UZLA 1VL0A 4KZPA 2G1UA 3OQ6A 2YHIB 1Q2XA 4CMCA 4IDCA 1DC6A 4OHUA 2HMTA 3FNFA 1HL3A 4MVJG 3LQFA 1S6YA 4IZIA 3A1NA 5AYVA 1PZGA 2UYYA 3GH3A 4IINA 1Y8QB 2AE2A 5G2OA 4W9NA 3FN4A 1ZH8A 5A5EA 2CF5A 4FBGA 4AJKA 4K6FA 4JX8A 3LSYA 1Y5RA 4N54A 2XXBA 4QQRA 1P31A 3BTUA 1I01A 4RLSA 1KERA 1J6UA 1RJWA 3L4BC 1HF3A 5TNXA 3L77A 1ZZEA 3IC5A 4MPDA 4JIGA 3TJRA 1N9GB 1F17A 3RC9A 1AHIA 2OP0A 5L3ZA 1GPJA 1K0UA 4E5KA 3H2ZA 4R3WA 5HS4A 1PS9A 3DHNA 3E6AA 4TRRA 3FI9A 5COAA 3GDOA 4GLOA 1X1EA 4D46A 1OOEA 2GLXA 4OXKA 3P5SA 2IDZA 3I83A 2YV3A 4PLCA 5EPOA 1DLJA 2RAFA 1QLJA 2VCYA 3H5NA 3QVOA 3ZWBA 1QYCA 2QIOA 3MOGA 4CM8A 3WB9A 2ZTUA 3WGZA 4P4NA 1LQUA 1J4AA 1LRJA 3RUEA 1Q0LA 3PGJA 4R41A 4GI2A 2AEJA 4BNMA 4Z0HO 4NU5A 1MLDA 1HSZA 3UKOA 2I65A 2NSDA 3H65A 3INGA 2B69A 1PS8A 1MXHA 2V6FA 1XGKA 2PR2A 1P45A 1NPDA 1H0KA 1C0KA
chains in the Genus database with same CATH superfamily
3UAXA 5A4DA 3BGIA 3ILYA 1JQ3A 5IMBA 1TTHA 4N8EA 3ES9A 2OZVA 4S1WA 1RJGA 1W52X 1R15A 1AQ6A 3B53X 4TQ9A 5JSZA 2I9KA 2OLJA 1E7QA 1IXZA 4AUMA 5ALJA 4LHYA 1B3RA 2XIQA 2BF7A 4JBLA 2F8TA 2C20A 1VTKA 1C4WA 3CCBA 4J0CA 2H7XA 3IOYA 1DJPA 2AYZA 2G9VA 3LBNA 4ZT2A 4QARA 3WOVA 2QTHA 1YU6A 4EI8A 4UBJA 3T12A 1YNSA 2CJWB 3HCDA 5JOQA 3VR3D 3COJA 3MINB 2R87A 1BS2A 3DMRA 2PA3A 4WZZA 1U8XX 2BT4A 1NI4B 4BEBA 2V6IA 3WLOA 2BDUA 3VZDA 4OAOA 3RC2A 4Q00A 5EKDA 2Z08A 2GN0A 1W1WA 1T1RA 3FCSB 1VI6A 4KJZA 1E6UA 5F12A 1A88A 1G9SA 2HPHA 3CBGA 3KLPX 2QM3A 4R2IA 2NW6A 2FPUA 4K0RA 3KTAB 1F2VA 2ERYA 2RFLA 3CZCA 1A5BB 3H0EA 4QYIA 4BNTA 5J1SB 4LY9A 3U56A 5A05A 1WTAA 4LSZA 4B8ZA 3U09A 3WFZA 4BRSA 4KR0A 4WVFA 1DCKA 3U39A 3F3SA 3N3AC 1IL0A 1T2DA 1WG8A 3S99A 3OE4A 4A9AA 1TJ3A 2X19A 3JATA 4TRMA 4HFMA 2X9NA 4LNUB 3Q98A 4L2IB 5ICEA 5KPDA 5KREA 3D6UA 4X62B 4K6MA 1Q20A 1YQXA 3BSFA 3WQQA 2ERXA 2Z6UA 2JJ1D 4FLEA 5BT9A 3U5ZB 2I4IA 1JWBB 1LV7A 1YDMA 2ZJZA 1H0RA 2Y0CA 1H69A 3U81A 2VUUA 4P33A 1CFJA 2Y1KA 1Q11A 3QJYA 3PQ4A 3V32A 5B6JA 1DPGA 1ZWKA 1YRBA 1LZKA 3TH5A 1Y3BE 2Y1LA 3PYLA 4GM4A 1LPNA 3K2IA 4IXDA 3ZHTA 4OYHA 4OI0A 4EDFA 3ZCXA 3U7EB 1VE9A 4QUIA 1FL9A 1A97A 1DXHA 4LYGA 1E4YA 4MKRA 5B58T 4C6TA 1QRSA 3AO0B 3TQCA 2X0RA 3BX1A 5I6DA 4BC1A 1X1TA 1Y7HA 2RC6A 3UJ6A 1WB6A 2XKBA 3K94A 4F4DA 1JZQA 2Y6UA 3V9PA 2WW8A 1CUAA 4XSVA 5DPMA 4XFKA 3X2FA 1NWCA 1T6YA 3O1JC 4Y6QA 3OTOB 1WAMA 3EHEA 1JIVA 1SQ0A 3QKUA 5ECWA 4BQNA 5EIFA 2AD1A 2HU5A 5DHPA 1HFEL 4D3ZA 3OQNA 4KTTE 3AF6A 1P1KA 3UT5B 4AULA 4X1IA 3B13B 1GYRA 2BFDB 2P2GA 3ZG6A 1BDHA 2DKNA 1D9XA 2DU8A 1ZHFA 1H93A 4W8HA 2DBZA 4XVHA 4DFDA 7YASA 1ONSA 3JAKA 1YHNA 1OXVA 5DCYA 3V34A 2JLRA 1A96A 3IKMB 1U2RA 1CUCA 2G0TA 3NBUA 4O63O 4PC3A 5IJ0A 3KYCB 3SS8A 4MA0A 5AW4A 2TSYB 4IDBA 1P5RA 2HA3A 3BB4A 3H5TA 5B7PA 1T4MA 1PK8A 3DV9A 4CUJA 1U2SA 3QLJA 4N01A 3QW2A 1JR2A 2DY0A 3RVLA 4ZMSA 1TM2A 1BN7A 3M9WA 2ZWOA 3HDYA 3F47A 1E92A 5BWLA 4X20B 1NULA 2AVNA 1KJ8A 5TS3A 2JC3A 3F8SA 1G60A 1ODSA 2ZPTX 3B8EA 4JYMA 4OVKA 3WLTA 1LS6A 3H1EA 4D6YA 5BN3B 4X8MA 2BP7A 2FV8A 1ZK2A 2RAPA 1WXWA 2VDRB 5HK8A 2CY0A 2WWHA 1XYGA 4M4SA 1GAWA 3FTFA 1XFDA 4KU4A 1LLFA 1VSVA 1MORA 2AQHA 3AR5A 1WB9A 5IULC 2PDAA 1E3MA 4KODA 4ZHSA 2BGKA 5AVOA 3O73A 1G20B 1YR9A 4D3YA 4ENPA 4UQOA 2QRMA 4UQLA 1E1CB 3OTWA 2ZI4A 3JWEA 1DFGA 2QE7D 2ZATA 3QKRA 2FRXA 1PJRA 1ADYA 1HTBA 2Y99A 3AR6A 4RTSA 4LJKA 1VMEA 5A9SB 3RU2A 1H65A 2WFAA 3L84A 3EZ2A 4UCQA 3G2QA 5JZMA 3G8YA 4CM6A 1SELA 1UFKA 1HYGA 4D9JA 3JARB 2P6OA 2B94A 4A6XA 1GUDA 4KIJA 1CP2A 4U5XA 3DBOB 2FN7A 1SZPA 5TPZA 4LMRA 3RREA 4E2YA 4O2RA 2W93A 2DPMA 4UOZA 2Z8YA 3QF7A 5CLQA 2V7XA 4WLOA 2DBVO 5HDQA 3G68A 5IK2D 3BWYA 2CCGA 4MDFA 3V1NA 1Y6ZA 1H23A 2ZTSA 3Q85A 4Y18A 1FK8A 3UBTA 1A4RA 4GMXA 2G25A 1ZUNB 2OAP1 3Q0TA 2PHZA 4RKFA 1RBMA 2FY8A 4MOWA 4NYJQ 4OFZA 2H3EA 2PMEA 1SBIA 3IDOA 3EVCA 4RIEA 1AF7A 4CLRB 5CBPA 5HKBA 2HJHA 3E4DA 4AUKA 2Q6KA 2XX3A 4AJJA 4MCIA 1Y42X 4IFEA 1WJGA 2DUMA 2QN7A 1DAKA 5C1BA 1F7VA 4F60A 1JPVA 1MCZA 2BGGA 5CLIA 4UDOA 2NUAB 1UUFA 4TKMA 2XE4A 1QVVA 2I2BA 2QG6A 3R3YA 4RSMA 5DXJA 4A6PA 4DV5B 3AUXA 4Q5IA 3IQXA 4L8GA 2A1UA 2CC2A 5BO5A 3ZQKA 1JPJA 4NE9A 1MOZA 1UXGA 3DBLA 4KDFA 4B3GA 1H05A 1P1CA 2WHQA 1ZPDA 5BSFA 3ZBUA 1QU2A 2OGTA 4FFMA 3KEGA 4IGAA 3OZGA 3ZLTA 1JR3D 3GQBB 1LBSA 1CS4C 2EDAA 2QMOA 4JP8A 5JSKA 4B3RB 4W6ZA 5HQ3B 3PT5A 2RHOA 3EVGA 4KQ1A 2HQ1A 2RBGA 1PGPA 3DZJA 5DGHA 1AJEA 2FN9A 2ZUBA 3CZPA 3F5DA 3UO8B 3HVHA 4J0FA 2IQIA 5AW8A 4A15A 3DWEX 3FAZA 1JSCA 2YJ4A 4JEHA 2DQSA 5LBTA 4F8EA 2F62A 4LRSB 4UCWA 1TZBA 3RGWS 3FOWA 5IUNC 3LWBA 3HN2A 1NBOA 3E7DA 4F5DA 3E3LA 4HADA 2ENUA 5DVZA 3VFDA 3GP3A 4RWEA 5HILA 5LQSA 2UZ3A 1RYNA 5B1HA 4S35A 5AFSA 4LF7B 3VHXB 1O0CA 2AOTA 5D5PA 3C5WP 5CB0A 3F0TA 3MLBA 5C3UA 4EZEA 1KU0A 2GPYA 4YCAA 1PQYA 4F6CA 3KTFA 4QL3A 2OQ2A 3IJPA 2AJ8A 3AUAA 2VXYA 3RS7A 2V0NA 1W6UA 3BE5A 2EARA 3LAWA 4HLDA 3H5OA 3HCPA 4IBOA 2CXQA 5E1OA 1UJ6A 1UWLA 3RUAA 2XLCA 1NTOA 1YCGA 2UUOA 3EVTA 4EX6A 1Z2AA 1R0ZA 3W9BA 2P5TB 5EJ4A 1G9TA 2C2ZA 2YNMD 3HU1A 4FNAA 2C59A 4UOEA 4YUAA 1E3LA 3ND7A 1KZGB 4I3HA 3N74A 1EH5A 1DE0A 4OBEA 4DSZA 3P97A 4MS4B 5C1DA 1E5XA 4CV1A 3AK4A 4I2VA 1TEHA 3EIWA 3SJ7A 3ZDYB 3AY3A 2FPPA 1TTQB 3UV7A 3OD1A 4O2BA 5C7IO 4XLZA 1XWFA 3MF4A 4LYJA 4XXHA 2G71A 1Y8RB 5F2KA 4WA7A 4RETA 4BX8A 1E3SA 4C0SA 1DKOA 1UJBA 5CYOA 2X9GA 2R0QC 1O5TA 4BZXA 5JUWA 1E7YA 1RBZA 3DH0A 4FS8A 3U7QA 2ZZMA 1SBQA 4RF2A 1NW3A 1V9SA 1Y8AA 2P6MA 4CVNA 2PAAA 1G3UA 2RAVA 3BCSA 1DX6A 1AMUA 3WLMA 1B73A 3AINA 2K87A 3KX2A 4MS4A 1SHZA 2NLOA 3ZJUA 3QUAA 5AKYA 4TMTA 4AJOA 2M9MA 2RIRA 2ZPUA 1B15A 1SMKA 1AH2A 1YL5A 2FSUA 3PUKA 4OBWA 3IMFA 4B7AA 3GXBA 4G8CA 5IG2A 3OLXA 1T9BA 1K7CA 1U02A 4P35A 2TMKA 1KEPA 3BRWA 1KBZA 3MMXA 1KI2A 2ESRA 4QDKA 1T6NA 3GH1A 3IERA 4E32A 4QOIA 3BE6A 2J09A 1I7PA 2VATA 2YMPA 3JRXA 4M36A 3R8FA 5T41A 2M1ZA 3DAPA 1XJQA 1CY1A 3E8XA 1TLFA 2OFXA 1RBQA 1VI2A 1CF2O 1JXOA 2LDXA 3OIFA 1G8YA 5CXUA 4YY3B 1XZKA 4RCVA 5D3MA 5ES4B 1NG9A 3WKBA 5FBQB 2V97A 2VP3A 5G0SA 5BWOA 3JD0A 1UINA 3VPCA 2QMEA 3ICWA 4QUKA 2QYOA 5HXAA 1EK1A 2ZRKA 3PHJA 1RZUA 1GITA 1V8DA 2VXBA 2X8AA 3DYBA 4G3XA 2BELA 2IYFA 1PK9A 2OCYC 3BPSA 5THXA 3MWEA 4HC4A 2VHQA 3ZD8A 4FBLA 1L5MA 3CEJA 3SIPA 1XRMA 4U5QA 2O7NA 3PRJA 3DYIA 3OWHA 4A0RA 2ORIA 4D1YA 3EDQA 1AUQA 1TCBA 4QTTB 2P91A 5IYZA 4F2GA 4I50F 3C24A 4J1SA 1M6HA 1ZEMA 4LJ7A 5TF0A 3S1LA 1GVNB 1SUIA 2KE5A 3ET5A 3F6YA 2JLBA 3OZRA 1QQ5A 3ANYB 3CX6A 3I6YA 4UTVA 4ZIRB 4V1CA 1GDHA 1AA6A 4QC2A 1PDOA 4TT3A 1GU7A 5T4BA 2FH5B 4EKNB 2A14A 1NW7A 4AO6A 4IF4A 5TXGA 3C0KA 3W05A 4BQPA 4ARAA 2BBWA 2G76A 1Z38A 1RWXA 4NVRA 1OYWA 3H2YA 3KP1A 3R3WA 4FE4A 4I8DA 3GV0A 4OQLA 5J4VA 2BTEA 4OHXA 4PINA 1SU8A 2JW5A 1ZXBA 1IXSB 2HCJB 2QL7A 3T7CA 1J25A 2FWNA 4BMXA 2AF3C 4H08A 4HLQB 1J56A 3K6JA 3R3ZA 1I33A 4V0QA 1FLDA 2B99A 4CIVA 2IDKA 2JPDA 1DKPA 3TZKA 1RWVA 1U2ZA 1A9XB 1PG2A 3Q3VA 4KDRA 4Q82A 3WGJA 2G5TA 1KZHA 4ES6A 5KKCA 2IPNA 1UEJA 3UK0A 3WK4A 3RRMA 4CTOA 4YMUA 2FWRA 5JJBA 2WOJA 4MVJD 3SHWA 2IXGA 1KSJA 1E6MA 1S8OA 4PX2A 1WPGA 5AXAA 1KXJA 1KKLA 1MIOB 4LMBA 1JA1A 3IT2A 1ML4A 1O57A 5C32A 1XZHA 1RIIA 4PZLA 1X80B 1GTG1 3OESA 3IHLA 2G82A 4ZREA 2W6QA 1N6KA 4Q39A 3EQ2A 3THOA 3PNLA 3TSZA 1JUDA 2Q4DA 2DGDA 4K40A 3NIFB 3LHSA 4G41A 1WBBA 4GDFA 1AT1A 1N8SA 2I29A 5GIPE 1XCPA 2IZ7A 2QW1A 3K1TA 1I1NA 2MTBA 4LJAA 2V7QA 5E9AA 5BSTA 3RQIA 3T6KA 2CSXA 4LJLA 1ENYA 4B6OA 1SVNA 1KVUA 4TRJA 4M0FA 2XE7A 3GCXA 4J4HA 3TE6A 2A9KA 2Q9UA 2C95A 4G8DA 3O4RA 1IHDA 4I1SA 2OK7A 1TM5E 1YK0A 3DMDA 1G0NA 5A6VA 2OCDA 1X9HA 2FZVA 2D06A 3JVEA 3QMVA 3MRSA 4YHHB 1G4HA 2B2NA 4FJ0A 2QAGC 4AWBA 3DVRX 4LBWA 1A9XA 3RTEA 1FUKA 2LIVA 3M5WA 2G4CA 1LFDB 2NADA 2H2GA 5AHKA 1P0PA 4ZV4A 4G36A 3LPDA 5JY1A 1AUPA 3FPFA 3QKRB 1KZ4A 3WGVA 3STUA 3SLRA 1YBMA 2CT8A 1JLRA 1MW9X 1MJGM 4DBLE 1L7XA 1PQPA 1XK6A 2BMAA 2GYWA 2MSLA 1E2FA 1WDMA 2FW7A 4YJHA 4LOJA 5KNCD 1XVVA 3LVFO 5AT1A 3IL2A 3PPWA 1DEOA 5DTEA 2YBDA 2YYYA 1CQPA 2AUTA 2LGJA 3IP8A 4IHQA 1Z6YA 2QZJA 4XEUA 1A2QA 4QXRA 5B3JA 1XZPA 3D3KA 4LPKA 3UM9A 1X39A 2PGAA 4EPVA 4JLKA 4D6PA 2BGLA 3HB0A 4WTOA 2XJ4A 1PD1A 2HLNA 4PR0A 2O06A 4AY2A 1SU7A 4G9GA 1UPCA 3AKZA 3CRMA 2G36A 3FLAA 1KP2A 4G86A 2R79A 5J2TA 2J3HA 1IC6A 4DTIA 3DMYA 1MEJA 4DBZA 4OTZA 3FX2A 1ZKDA 3NR2A 5B1IA 3R74A 4CMIA 4ZOAA 4CM9A 3NHBA 1QLWA 1NN1A 4HNUA 3T41A 5BQXA 2YTZA 1C1HA 1N3LA 1U9JA 2HRQA 2WWWA 4QRHA 4X9XA 5A1JA 2RC5A 3TLGA 2II6A 1NRWA 3GLFE 3DP9A 4TLBA 4JR0A 3WRVA 1I3OA 4TLLB 1U7HA 3HO1A 3HKCB 1XA4A 3H9EO 3NYWA 1LVUA 3NNNA 3O7WA 3USCS 3K0CC 1BE0A 1D4AA 1P6UA 2G83A 4I46A 2B8EA 4REMA 3SG0A 1MO4A 5TVGA 5HUJA 1L8LA 1W93A 1P2VA 2Q5CA 1NLZA 5DNEA 1C1DB 4WJZA 1LNZA 5ICFA 2PSEA 1BS9A 1YB1A 4BLPA 2P6RA 1PDVA 3V2HA 2WUVA 1P1RA 2GXUA 4P81A 3F2VA 3I3OA 1Z33A 2IL1A 3AF4A 2O3TA 1NVAA 4GH5A 3W4IA 1YS4A 1NQWA 4WBSA 2NV6A 2P1RA 4DJJA 4H17A 4WX2B 4JH0A 4EPXA 3K8QA 1GKYA 3FMPB 5FBHA 4D5GA 2P90A 1TYDE 2WJ4A 3GRKA 1KEEA 3TTWA 4AJ4A 1QC5A 3KLNA 2CVFA 4U1RA 4ZAYA 1JSXA 1T3SA 1JVBA 2X8JA 1NVTA 3FNRA 5DHQA 4BIMA 4F4CA 4LFCB 5KYYA 4ZOEA 3RFXA 1GTMA 4PSVA 3CQ9A 4JHXA 4AS3A 4IR7A 2XRMA 2NIPA 1WB4A 2B1QA 5K0ZA 2X6QA 1JDBB 4HYTA 5KYXA 4CR7A 4J0JA 4MQBA 3HJBA 3WTBA 3F5FA 1Z26A 4Y0VA 1IOZA 4L07A 4LNUA 4O02B 5TQJA 5GONA 3E4CA 3IKVA 1VP3A 2FPLA 3L8MA 1KKMA 2AOWA 3ONNA 1J07A 2A0FA 4N76A 4BZQA 4YPFA 5JQGF 2F9MA 1GA1A 4HNQA 1F6DA 5GVRA 1ZUD1 2OXFA 3G5LA 5DI3B 1ZJWA 4JWTA 4CN8A 3KJQA 1SUFA 2GN9A 4EHBA 1GM5A 5AJZA 1FNCA 4DKXA 1JTVA 1JLHA 2I4RA 3KD3A 4JUCA 3A70A 5H9WA 1Q57A 3WMWA 5EZQA 3NUGA 3O4JA 4JP2A 2W98A 4IHJA 3HBFA 3T0IA 1JEYA 1C3JA 5FL3A 4IOJA 4MQEA 4G81A 1Z2PX 4F96A 3C45A 4BV2A 5A6SA 1R4MB 2KJQA 2ZYSA 4YAIA 2BN4A 3HYCA 4GGMX 4NXMB 4RZIA 5ULLA 4XDGA 1T5HX 3H4TA 3LC0A 4INJA 4DW8A 1XVTA 1HQCA 2QJOA 1ZNZA 3KLMX 1ONNA 3KB2A 3ANSA 2XUAA 4UMDA 1JHZA 2X15A 4XD7D 1D1TA 3ZR4B 3WLKX 1M1NB 3TI9A 5ELLA 4TT3D 1I4DD 3K0AB 2V9ZA 2J4FA 1UDRA 3HI4A 3WGLA 1U7PA 2FW0A 2GZ1A 2XDQB 3DT8A 1KARA 3EXHB 1K4MA 4J2TA 4R2MA 5L4LA 3HRIA 4PZDA 3PB3A 5LZ7A 2GT1A 1RLTA 2VYCA 1XCMA 1SHTX 4GLJA 3RH0A 4KTVE 4AXBA 2ZSDA 5CXSA 5J2UF 4BNDA 4PZAA 5A0FA 1LDGA 1S7CA 3Q3IA 4DDMA 5K0TA 4YPVA 4KQIA 4O4HA 4X85A 3CLTC 5JS2A 2BGWA 2PBRA 3N8GA 5JRDS 4B81A 1AVTA 2I2WA 3GJSA 2O48X 2W2PA 2DQYA 1CETA 3IR6A 4YJ3B 3AR4A 3ZCRA 3ZTWA 1KGDA 3U0VA 3KKKA 3W3AH 4AFNA 1MN6A 2C5AA 5IWAB 1LBQA 2ZK7A 1RIFA 3JX9A 3M89A 5FNZA 2RE8A 1G5PA 4P7GA 2GQ0A 3GL9A 1AC5A 3Q1KA 2QMYA 2EL9A 4IXNA 2EV9A 4MVJE 3A11A 3KE9A 2DHRA 3I1FA 3Q9LA 3WMGA 3FMIA 2Y9MB 3NWBA 1VJTA 2VH2A 5JY6A 2O2GA 5JVDA 1DTWB 3KPUA 4AUNA 4EF4A 4CETA 1RQ2A 4G26A 3WQRA 2XZOA 1U0NA 4RH3A 1IJKA 3O4GA 1P7CA 2P79A 4OQPA 2V7WA 4HEHA 2CMFA 3K9HA 3LY7A 2XUDA 2FDCA 3U6BA 3OPYA 2O2HA 1L7AA 1PWZA 4P4TA 5AVXA 1HORA 1ONOA 4JEIA 4YRGA 2AR7A 4ZPJA 2QE7A 5KNLA 5EMJA 3G17A 4XFJA 5IAEA 1A50B 3QEAZ 5F3WB 2EJCA 1RMQA 2VQDA 3K0FB 1QYXA 4JJAA 4JLDA 1I80A 4XX0B 2HWXA 5AKIA 3RS2A 4M8LA 3L6EA 4E5MA 2MSDB 3N8HA 3D0RA 3QI2A 2NT3A 3OE7D 3R0XA 3KVYA 4ZARA 2F7SA 1GTZA 2A78A 4I3GA 2EG9A 4KR3A 2M98A 3HN6A 2FB9A 7REQA 2GETA 5IEJA 1Y8QA 2F1HA 2Z95A 1I2BA 3PTLA 4TTQA 4AJ1A 3D1LA 1Z4QA 4EHIA 2ZKIA 2Q3HA 3V1UA 2DPLA 1X7DA 1LXCA 1R6DA 3CR3C 3TW0A 1AD2A 3OIWA 4PPFA 4ZZ3A 4UHJA 1Q16A 2HA2A 4DHEA 3VNVA 2D1YA 2P9GA 3B12A 3C48A 4DNOA 1X15A 2O5EA 1M3SA 1B42A 1RWPA 3E18A 4Z9BA 2PGIA 1PEKE 1UDBA 3GIDA 1ZCFA 4N8DA 5KYVA 1Q12A 2OBNA 3T3MB 2DHQA 1JA0A 1SR8A 3L4SO 4KVZA 5AUPB 5KO2A 3OM9A 1Q21A 1PG0A 3NIWA 2EGHA 4IICA 3AVWA 4EPYA 2OV8A 2XRFA 4U4AA 1FMFA 3UMGA 4F2DA 1DKLA 2HA0A 2VPTA 4MV3A 5DHFA 4RAOA 1HMPA 1CUYA 1F38A 2GYVA 3AIIA 3SMVA 4LSGA 2I4MA 4O3FA 1E6CA 4HLCA 4WKPA 1QPGA 5DCUA 2Y3IA 4ALNA 4URWR 2QMZA 2BW0A 1BFDA 1CP3A 3LVQE 5E6SA 4EUSA 2DHDA 3BMQB 4I4IA 3BD6A 4YYEA 3ZX5A 2AG1A 1TM4E 2P4UA 2NZWA 4K6HA 2OUIA 4XWGA 1DOHA 2FZWA 3T35A 1PYOA 3PSAA 1DARA 5KYUB 1EJBA 3IIIA 3DR5A 4OHMA 2C9MA 2DBQA 1O0SA 4CJXA 2XVXA 5T6BA 4HB3A 1ZG3A 2RARA 3WL5A 4HPXB 4NP6A 3U49A 3HWWA 1E8MA 1BYIA 2CNWA 3ESRA 3QNUA 1XT6A 2FP3A 5KQGA 4KN6A 3H3XA 2Y92A 1CSEE 3A9TA 3D4BA 1NU6A 4J0GA 2BBSA 5KSZA 6ADHA 3PUZA 2ZYVX 5EUMA 3LT1A 2R8XA 4FZ3A 4M3NA 4RPHA 3BJEA 3FUUA 4BIIA 4P98A 1E3TA 2R1ZA 3HXLA 1QZTA 3GCDA 2FUEA 3QVMA 1NJ5A 1NR7A 2AXEA 3EIUA 1J0DA 4JA0A 5E3IA 3SC2A 5BUSA 2JI9A 5FCDA 2GPAA 2WU4A 3NS7A 1J39A 1C8KA 1XSEA 2HTEA 2O2SA 4WKOA 3CO0S 5K0NA 5DRTA 4GMGA 3TRHA 5EP3A 2A5LA 2POCA 3BWBA 4GVPA 4NBNA 1YJBA 3B7PA 2BAGA 5T5QA 5KHAA 1IOWA 4EG6A 3L07A 3PKIA 2Y1XA 1HDYA 4GZ5A 4GOKA 3T7RA 1A04A 3WLRA 4C9BA 3ABOB 3L9WA 1KIMA 2BUAA 3Q5GA 4A27A 2PRYA 4HS9A 4AP5A 3IPYA 4FFRA 5G41A 2BI4A 5L3SA 3E8MA 3LOUA 4OHKA 3IEXA 5DM70 5JSQA 2FA9A 1E5QA 2N0SA 3C6XA 3EZYA 3HUTA 3KKMA 4LX0A 4QJ4A 2ES4A 3DOHA 4EIWA 3KQMA 3RS8A 1QIDA 5H3HA 3KOWA 2EFDB 3KKEA 3CX4A 4BAGA 2XVZA 2AYXA 1N8TA 2C07A 3DHVA 2VYNA 4Z6KA 3ZEAA 1JBKA 1ECJA 1K3TA 3UAYA 3VHRA 4N39A 1O0BA 3SZGA 1DQZA 1ZCZA 1KRXA 3KKNA 2BKVA 1W0KA 5CXXA 3SHTA 4IHJF 4UD6A 4XR9A 4EJ0A 4EVRA 1E7SA 3Q8XB 3ZBPA 5KQRA 4BNXA 4BFUA 4HNTA 1KYXA 2LIPA 1FBNA 5BPFA 1IBKB 1NE2A 1XPUA 5FBWB 5DIFA 2QNRA 4R5MA 5ILQA 3OHPA 1V16A 3LK6A 5JAHA 2B83A 3A9WA 2XEDA 3KCQA 4N4AA 3ZJYA 3HBMA 3TNLA 4EW6A 2ETXA 1KEWA 4OXRA 4M0LA 3T52A 4BLWA 4TSFA 3TQQA 3NDIA 4RTNA 2FSHA 4PWZA 4TS1A 1KOGA 1LK7A 4HG2A 4MVJF 4QO8A 4WERA 3PC4A 1OVMA 4AECA 3BMQA 2CMHA 5CDYA 2Q6OA 3HCBA 4RLFA 1RKXA 1VBMA 4E2XA 2NVUA 2VJKA 5IJ9A 4U6NA 3SSAA 5CAEA 4JV5B 1EWVA 1QBKC 3DBRB 3U7GA 2UYQA 1U2QA 3PF9A 4BJ5A 1J5XA 1E1CA 1PCXA 1RTTA 1YJQA 2XNHA 2Z9CA 4PAGA 2WTMA 3FZEA 3GY0A 2NTNA 5AHOA 3ZVRA 4CEHB 5A4IS 1QV9A 3KZXA 1JMKC 3HFJA 3KYDB 2BFEB 4QOSA 5EFZA 4JELA 3L1VA 1LY1A 1NQAO 3CTMA 2WEKA 3QU2A 4MWZA 4XYBA 5F3DA 5K3SA 2IDMA 2EOAA 2H2HA 4DLPA 1BQEA 1G7TA 3F7TA 1B2LA 3M4NA 4ZU6X 2Y1GA 3COWA 3C1OA 5K3EA 4DA4A 4PSDA 4X6LA 5EY5B 3GJ8A 4BPRA 3ZY3A 4OOEA 2R8PA 4XVQA 4TVBA 4Y2SA 5C46F 3W2TA 1R12A 1WXDA 3B6EA 3SIXA 1LSJA 3PQ6A 1IJBA 4LOAA 3ROPA 1FS4A 3H0CA 3QITA 1ZMBA 2FPGB 3ZS8A 1QHXA 2F2TA 2ZIVB 3AJEA 4LQDA 1SKAA 2OC4A 2E1RA 2KHZA 4MV0A 1R0KA 2IHJA 1NQVA 2Y66A 1IM5A 2J3MA 3G85A 1UOEA 1PJAA 3WSWA 1SZCA 2JIQA 1HDZA 4XDZA 5BVHB 1V1MB 2WJWA 2P7HA 3OMXA 3L7JA 1T1IA 5DM1A 2GF0A 4AZVA 2ID7A 5KKNB 3GAAA 1JAYA 1WNFA 2C2HA 2XQFA 4BJ3A 1YH3A 3SFTA 3ZS9A 4R9NA 2AFHA 4BO6A 2DUJA 2JIDA 1LEHA 2P4QA 2QZ9A 5SZHB 2NO9A 2AK3A 3F8WA 5IM5A 5JALA 3OI7A 3DW3X 3RJ5A 4C29A 1G8JA 3FVWA 3HU5A 4G0VA 4PO8A 4AX8A 3U44B 4DCVA 3WHKA 4RL6A 1V5IA 4E5YA 4CQJA 1YE3A 1DTWA 2HJGA 2IYXA 2CFCA 2QXYA 3G9XA 2VZ9A 4GM0A 4R8KA 1TJPB 5AKEA 4QATA 5E0OA 3ZU2A 1THZA 2PD3A 4K9SA 3A6KA 3K31A 5FUVA 3WK8A 5BORA 4YO8A 5F9FA 4EVIA 1S8AA 3L06A 1OY1A 1EXWA 2V7QD 3OJXA 4RVHA 2UZ1A 4GGOA 1PBTA 3EC2A 3QXXA 4N7RA 1KY3A 4OHBA 4ZRDA 2J9ZB 2NUPA 4G0MA 4UM8B 2NZJA 4EKGA 2WIJA 1UODA 1WZEA 4IDGA 1V5WA 1E98A 1ENPA 4KITB 4MB2A 2Y2UA 3CVVA 3RKSA 1FYDA 3GFVA 1R8YA 4OBBA 4LJRA 3KQUA 4EUHA 2KLBA 4PO9A 4TLEA 2PQ0A 2DLDA 1E9CA 3GK3A 3SXUA 3LA8A 3VV3A 4JVOA 1EFCA 3UT6A 4KQKA 1W19A 3PLNA 4X94A 3SHFA 3W5JA 3E7PA 4E11A 2F55A 3FA2A 1PX0A 1IN6A 1O9HA 2QVYX 3A3NA 2JD1A 3WK9A 4HV4A 1VSUA 4UNRA 5HZGA 4RABA 3R4CA 4URUR 1F5NA 1AUVA 1J7JA 4HDSB 1RI3A 2GKOA 3L7LA 2DUWA 2D4AA 4GOXA 1OA0A 3UTCA 3PVZA 4MI6A 4B8WA 4ZKDA 4Q4AB 2HIAA 4GBMA 3SDSA 3DW1X 1JE0A 1JKIA 4MV9A 1XNGA 1HE8B 3FW1A 3BXOA 5CH5A 1YDWA 1WVGA 1FUUA 4JLWA 2DJIA 1Q5PA 5CRIA 3EFOB 4L08A 3VM6A 3LPMA 1KFBB 1RC1A 3DDNA 3E5HA 4I4TF 4A10A 3D8RA 2YWDA 3FYUB 4XQCA 5DI3A 4AD8A 5CW1A 4UVEA 3AF0A 4FKBA 4FEYA 3G5AA 4G89A 4PYNA 1NXXA 2OKCA 1V2GA 2JFPA 4W5RA 1LZLA 1O94A 1OX4A 1OBCA 3BJZA 2FGJA 2NO7A 1YSCA 3F6BX 3I01A 3W4KA 2WAMA 4GMKA 2ZB2A 4UTPA 4D80A 4F04A 3GLIB 1BW9A 4YI3A 4R3UC 2FEAA 1KI8A 4X0EA 3ZZ1A 2ZI5A 1KHTA 3ZOKA 1MC4A 1YQQA 3ETLA 1JQBA 1AV6A 1RWOA 1CZNA 1RABA 1GPMA 1SUEA 1T0PA 1U2PA 1YBHA 2BM9A 2N9UA 2O0MA 2QMUA 5LA6A 3VNQA 5KTKA 4M1MA 1W1UA 1Q84A 4NEQA 4X95A 2F43A 3PVCA 5EQTA 1NW6A 3DTYA 4P38A 1SWVA 2YY5A 3K8YA 1WV1A 4I50B 3JZDA 3MS7A 4Q3DA 2NYUA 4W1SA 4JVNA 4ER6A 4OGGA 1HE4A 2DWCA 4FW8A 3TO5A 2OORA 5BV0A 5AVWA 1Y7IA 4X1OA 1V47A 5I9NA 4GX0A 3C98A 4X92A 1Q6YA 4XQEA 4IIUA 1X7YA 3GWGA 3ONDA 3P0JA 5J2TF 2DQZA 2HHJA 3TBKA 3CZ9A 2UZ1B 3EDRA 1J1UA 4MS3B 1XZDA 1YZTA 1Z37A 3D8SA 1DNPA 2ZUWA 3F74A 4IV5A 4QBIA 3RSGA 3LXMA 4AZ0B 1EQ2A 4B6FA 5LR6A 5CB4B 2OA0A 4BE4A 1Z7EA 1WNTA 5JSFA 4ZRNA 1T5DX 3VAYA 4U9UA 4CEIA 3OPNA 4OXQA 5H83A 2TMDA 4H59A 1PGJA 4PNPA 3QVXA 4LAFA 5FOSA 2ZT6A 4XGIA 2YWCA 1SQ6A 1ZX1A 1JQEA 3EEFA 3DEIA 2ZEJA 1O4WA 4QELA 5FULA 3OX1A 5G3ZA 3TNJA 2FNAA 4G0NA 1EK6A 1Z5GA 2MR6A 4G1FA 3RRZA 4E5UA 3DLHA 2VHTA 3TOSA 4XQGA 2UXBB 2NP6A 5LYJA 3GJ6A 1K75A 1ZM7A 1C8VB 4ZT3A 1A8UA 2BH2A 1Q1EA 4A73A 1FFGA 1G55A 3MFQA 5E3JA 1HDEA 2A0XA 5FUXA 1SIUA 1GGKA 1OLSB 3F4BA 5HKAA 4FFLA 1DJLA 1I36A 5IAAA 2BMDA 1MJHA 1YI1A 2P77A 3QU5A 1FTQA 4LY0A 5AKZA 4WASA 4LYEA 1T5SA 3LDHA 4N6GA 4L5IA 1IIBA 1WXGA 3SLGA 5JCOC 3O3MB 4GVXA 1RQPA 5EP1A 1WCV1 4BGDA 3KZOA 3B3FA 3FNBA 2F00A 2CXSA 2EG5A 5DYNA 5KWVA 3P9PA 4WSOA 4G84A 1NJ8A 1VL6A 2AN5A 2BPOA 3MWYW 4MEJA 1IEWA 3EMVA 3L8CA 3RU9A 1OE0A 4RZQA 1GNTA 4JA2A 4M83A 4UARA 3LW8A 5GTDA 3M6VA 3PE6A 4HVTA 5FORA 1ESEA 2C8VA 5ESRA 1V37A 3S5JA 3I12A 4D9GA 2W4QA 2HWYA 3DVQX 3T3EA 3LKBA 3JYNA 5KTMA 4Q1DA 3AOEA 4TKLA 2JBAA 3GLGE 4A2WA 4CHGA 5EMKA 4PBRA 2F3QA 2RHWA 3FKJA 3FVTA 4N9WA 1VYVA 3H2JA 1UEXC 2J5BA 2CJXA 3JRNA 3KKLA 4XIJA 2SKEA 4XOIA 5LMUB 1HLFA 1ULAA 1KVTA 1XA0A 2OCPA 4IL5A 2GM9A 2B36A 3D6VA 1GG8A 1S2IA 3EK2A 3HDJA 4NYIR 4XCVA 2VQFB 1X6VA 1O8CA 1JBEA 3JZAA 3WJ1A 4OX9Y 2H1RA 3E7WA 2NVUB 1RXYA 2A5FA 5IJ9B 2C7QA 1JIJA 3BWDD 3O21A 2R6AA 4KCGA 3UW1A 2HSDA 4DV1B 3WO0A 1MA3A 1XHLA 3PENA 2YIMA 2L69A 2VEDA 4X6UA 2Q3LA 1HYQA 2R2GA 1H9AA 3ZDRA 3QZUA 5JEEA 4QNMA 4WXRA 4IRMA 3LT0A 4YCDA 4AICA 1AUXA 1E2MA 3EH1A 4ZJZA 4KFRA 1JHOA 5L53A 4YJ2A 4KI0A 3VNRA 2E37A 3V8VA 4LZAA 5LBIA 2ZI9A 2UXCB 5EP2A 1YDHA 5LP6C 3EVNA 2NVOA 1CIJA 2G0AA 4L57A 3WBBA 2Z0MA 4AJIA 1A9TA 3D2CA 4R7GA 4ZVPA 1ZY2A 4KREA 1FU8A 2C7OA 1YKSA 1I2AA 2JANA 4J07A 4QA9A 4TMVA 3QOXA 3EC1A 3CZ5A 5GJCA 2NP7A 3ADOA 1OLSA 2O50A 4R81A 2BLLA 2B7BA 3EN0A 4LF5B 5EIAA 3RUHA 1FYVA 1US8B 1CUFA 3H4VA 4OHWA 4QQ8A 3H86A 4D3DA 4UEWA 2A7XA 2NV2B 1I32A 1TK2A 4NYMQ 3B6IA 2V5UA 2AK2A 4OY3A 1E0DA 1Z2DA 2LWIA 4QQNA 3GUYA 4RM2A 1A3CA 5DNUA 2QAJA 1Z6QA 1K2VN 2ATXA 2BGNA 3ETCA 1T6ZA 3Q88A 3BRSA 4YWJA 2BSAA 4FOSA 1FFHA 2R65A 3OKPA 3Q3GE 4HXFB 1QHYA 5A3VA 3TW6A 5JWHA 4AX4A 3FHTA 5ALIA 1JL3A 2ZWAA 3D9QX 1T2CA 3E5NA 4EAAA 4DR1B 1W5FA 2V9CA 1KDVA 4TYMA 2QD2A 3OX2A 3WLFA 1FVXA 4V03A 1U31A 1J8FA 3ORHA 2PK3A 4NZYA 1ISJA 1O1YA 1OZGA 3LBHA 3N2LA 3NWEA 2GK7A 2AN1A 4TUYF 1N8KA 1D6MA 4C0WA 2HJRA 2JBHA 2Q2QA 4BY9E 3OEED 3I34X 5ES3A 2EL7A 3GRFA 3SBXA 4E5VA 2A67A 4K1LA 4FEGA 4HXGA 3FUCA 2FFBA 5JU6A 5T4EA 4D3FA 3HJHA 4BMDA 5U1PA 3D7MA 1W0JA 1YDFA 1N0UA 2PFSA 2SBTA 2VDWA 3HUDA 4KC0A 3RTBA 3KYJB 4B6PA 5FWDA 2PVCA 3MLEA 1GPDG 2ZJ3A 3KG2A 2YS6A 1R8SA 5ENZA 1YXMA 2VOJA 1K3UB 3ANNA 3WLNA 4CN9A 1U7UA 4FSXA 1CVRA 4CLOA 5F4BA 2OT3B 3F7MA 7MDHA 7ABPA 1KEKA 4OB8A 5ALDA 3WRXA 5DWQA 4KRYA 3HDGA 1KJYA 4J2HA 4KHZA 3ZDAA 2IXAA 3WQHA 1QOQB 1E1MA 2HO5A 1UOOA 3S2YA 2AB0A 1JIIA 1H2WA 1RRKA 2B8JA 4MV7A 1EUCB 3I62A 1RHKA 3A3YA 1J0EA 2MMCA 4LE1A 1IQ0A 1NVUQ 2ZRFA 4MPJA 4UVGA 4TVSA 6AT1A 1D0SA 1NQUA 4AB1A 1ZOPA 4GX1A 4QUDA 4MK4A 3RRXA 5C1PA 5FI1B 5CXQA 2YN4A 3IAFA 3UJDA 3NHWA 4RQUA 1Q77A 1YOVB 4XCXA 5BOVA 3IPRA 1CZLA 3H7IA 5CMLA 1KMHB 1Z6AA 3GMIA 3EFOA 2BMEA 2H1CA 2FPKA 5TQ2B 4HDSA 1WMDA 4EAQA 4ZI7B 1HDXA 5BNTA 2GZ3A 4N0PA 2NXJA 2GZDA 2FZKA 1JFVA 3IHWA 4M8IA 1I1QB 5DISB 1AF4A 4MHTA 1V48A 1T35A 4HMOA 3WWZA 1B8UA 1NFQA 1ST2A 3E1SA 2QR2A 1Y63A 3OC0A 1C4OA 1X13A 1YJ8A 3GGJA 4UHHA 3JALB 3W2GA 1T9GS 1J9GA 1GQOA 2AMJA 3B1FA 3QG5A 3L7CA 4BNKA 3NMUF 1DEXA 3OM1A 2QDXA 3CKMA 3CVJA 3QPBA 4M1SA 1VB3A 4P4SB 2ODNA 5E3HA 4C7MA 4D25A 2RHJA 1NFRA 5ALTA 1H2FA 3MAGA 3TBHA 5BNIA 3I5AA 4J3FA 2O8BA 1QDUA 3A4TA 2VUIB 4UXJA 4C0XA 3OJFA 2IWHA 1FQWA 4C2UA 1WQ1R 2R1TB 4LZPA 5KTYA 3BF7A 5ADHA 1OFIA 1HYBA 2CEAA 5SZIA 4Y1FA 4DLXA 3F6PA 4WADA 3M4XA 1CY2A 5CD1A 3OFND 4D9CA 3DNPA 2D2EA 3GLUA 2OK8A 4KBGA 4E3WA 2OSVA 3EMDA 3LO8A 2JAWA 5H82A 2IZOA 3AI3A 4JSTA 4M1EA 3STHA 4DB4A 1I7SB 4C04A 5A2QA 3WP1B 4I1PA 3VTZA 1LPBB 3BKXA 2EJTA 5BWCA 1XD2B 4GKAA 2YWHA 4J7UA 4R3NA 5TY0A 5T64A 1AE1A 4HP8A 3FWZA 3VO2A 1I5OA 4LV8B 3WAJA 4TS4A 3LCCA 3P45A 2PIAA 3I8OA 2CD7A 2LTAA 3JQDA 4BLQA 1BMFA 3BFKA 2CUTA 4ROSA 2NZUG 3LI2A 2AFHE 4B48A 4DA0A 2AOTB <