4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
3V1YA 3NGLA 4HUJA 4CLXA 4UEOA 1M66A 4CODB 2HMTA 4YACA 1A9YA 4YRBA 1B3RA 5DCYA 1ENPA 3QWIA 1UAGA 4J49A 4OJNA 1GV1A 3ETDA 4HP8A 4DIOA 4N5LA 2PZKA 3NTRA 2V7PA 4JBIA 3O8QB 3I52A 1PGJA 2W2LA 1ENZA 2NU7A 4IZIA 4IBOA 4BV8A 3MCVA 4PLZA 5AXDA 1EK6A 3B1FA 2JAPA 3V2HA 4XGKA 2HK7A 4XGIA 2PD6A 5HBRA 3WS7A 2E82A 1NQOA 3L07A 3BHMA 4Q3NA 4BMNA 1AUPA 3I9NA 4QEDA 5KCZA 4BO3A 5JDCA 3FNEA 1JWBB 3D5QA 1ZSVA 1FF9A 1HE3A 3GH3A 3G79A 1ZIDA 4FC6A 4PLCA 1MA0A 4N7RA 3DAGA 4ND5A 1GADO 1R4NB 1TEHA 3RD5A 3HFGA 1ISJA 3IP1A 3EVTA 2JL1A 2WE8A 2CVQA 3GPIA 4FJ1A 3ZW8A 4RF2A 2H5LA 2X0IA 4M49A 1K3TA 3DOOA 5EJ2A 4ND2A 1ZZEA 2ZIZA 4NIMA 5AOVA 3ULKA 4IQ8A 4Y9DA 2GR9A 2I66A 5KJCA 2C54A 2XAAA 4BO0A 3GRKA 3K73O 2FR8A 3ROKA 3UXYA 1U8FO 1MB4A 2ZQZA 5B4VA 4R01A 4CM9D 2JD0A 1H0KA 2R2GA 2G17A 4EJ0A 4JN6B 2I6TA 1LDEA 2IODA 2A4KA 3RUDA 1KYQA 1AE1A 4CUKA 4TQGA 1XDWA 1IB6A 3RBVA 2OHXA 4B4WA 1H93A 4ILKA 1LX6A 1W73A 4WOKA 3GVHA 1GQ2A 4L73A 5L4SA 1Y9AA 5T64A 2AHRA 2EG9A 1JDJA 2GN6A 4IIUA 5KJ1A 4D42A 3JQAD 4IGEA 4P22A 4I5GA 3WTBA 3K31A 2C2YA 2P9GA 4DA9A 3DZGA 2BRUA 4J7CA 4OKIA 1FMCA 4R3WA 1NQTA 1Y8RA 3NDJA 4RDIA 2P5YA 3JQ8A 4DIBA 3GNQA 3OA2A 1NHGA 4RL6A 1PR9A 3EVNA 3O26A 5ICMA 5IDWA 3NT2A 3UICA 2J3KA 5DCUA 4BNJA 4CV0A 5JNLA 5ITWA 2O3TA 2Q1TA 4HY3A 2B37A 1E7SA 1R15A 2EXXA 2VZ0A 2FWMX 2O4UX 3IS3A 1LXCA 3RUAA 1NTOA 1O9BA 1RJWA 3BZUA 1H6DA 3QW2A 4WPGA 1LRKA 3VH1A 1N1GA 4QT0A 1LDMA 3INRA 4F6CA 1KEVA 1VRWA 1DC5A 5COBA 5IZ4A 3RUIA 3UUWA 4OXNA 5CEJA 4YJHA 2VUSA 1M2WA 1UZNA 4CUJA 4KQWA 4NFHA 4OXYA 4BNKA 3HJAA 2FPIA 1I2ZA 1PJ4A 3VKUA 3RJ9A 5HM8A 2GUGA 2Q2QA 4CV2A 3JQBA 3F5SA 4WK6A 3IDSA 2RCYA 3PRJA 2O7QA 5EQFA 4IMPA 4R3NA 1NQAO 4L4RA 3NTQA 5DOZA 3GAFA 2IYOA 1GUYA 3TQHA 1QMGA 1WMAA 4ALJA 4CUZA 1V3VA 4IXWA 1ZJYA 2FMUA 3GHHA 3FWNA 1PGOA 3GFBA 4NHEA 1RPNA 3HFSA 1QSGA 3AFMA 7ADHA 3G1UA 3FNFA 2ZJ0A 4E2WA 3B1KA 1XR3A 2PD4A 2QG4A 3A14A 3HDHA 2PZMA 3KEQA 3PVZA 4FB5A 3FPCA 1MXFA 2FPGA 4DLAA 5EQDA 4ZQEA 1UXJA 1A7KA 2YFQA 2YV2A 4ID9A 5JO9A 3I6IA 1XELA 5A02A 1PWXA 3A28A 3TZCA 2FN7A 3CMCO 2O50A 1YXMA 4D43A 4TRMA 2HRBA 1X7GA 5TX7A 4XYMA 2Z1MA 3O38A 3Q1LA 4FPXA 3H3JA 3RAJA 4WUVA 1T2FA 2WYWA 2HK9A 3ZNNA 4XRRA 2Y66A 1DAPA 2AQHA 4J4BA 1ENOA 1T1SA 2BFPA 3EY4A 4OOEA 5A3VA 1JU9A 3IJPA 3Q9UA 5JYDA 1C0LA 4S3MA 1MUUA 4PLVA 3RVDA 1WMBA 4G5HA 3VVBA 3ZWMA 4BNWA 4ALMA 1ZSYA 3MJSA 1UP6A 3AK4A 3FNHA 3WJ7A 3DEYX 5BNTA 2WD7A 3X2EA 2Y1GA 4BKRA 5DCWA 4D0RA 1T2DA 3UF0A 2WD8A 3E9MA 5A06A 3GDGA 1XQ6A 2B69A 1QYWA 3U62A 3G17A 1F8GA 4AVYA 1UXGA 4ND4A 4NBWA 3ADOA 4U0JA 1Z74A 3GT0A 1UXHA 1GZ6A 2IDZA 3MJVA 1E5QA 2PKRA 3W8EA 3LT0A 3OEWA 1RYEA 4W82A 3AWDA 1LSOA 1LEHA 1WP4A 4PLPA 4CM3A 1UDCA 1N9GA 4NZ9A 4BNMA 4YAKA 2Z95A 5GZ3A 2AEMA 3WSVA 4RDHA 2Z1NA 3SX2A 1GEEA 3GGGA 4J0FA 4MIOA 4W9NA 2EP7A 4BO2A 3VH2A 1OZAA 3QSGA 5EESA 3EMKA 4RLSA 4BNVA 2EIHA 2J3HA 3UVEA 3VVCA 1E3SA 1GYQA 2OFPA 3P19A 4DBVO 2Y0CA 1F14A 3GRPA 3T4EA 3U0BA 5EERA 3CH6A 4MDHA 3F5QA 3GFGA 3HHPA 3UCEA 1K0UA 5JDIA 5T67A 2H63A 4MIYA 3ASVA 1E1LA 2W98A 5IN5A 1NFQA 4A7PA 3ZCXA 4IDDA 4E30A 3W6UA 2GN4A 1ZFNA 4YAEA 1Y8RB 3JQ8B 1I8TA 1PJBA 4U8GA 4KZPA 1E5LA 3AUSA 2UVDA 4WNIA 3E03A 4WJZA 4KUGA 3BYZA 5JPIA 4FQ8A 4Z0HO 2VRBA 3OHSX 4INAA 2EGGA 5KOIA 1GD1O 3M2TA 5THQA 1JLLA 3QVWA 4J2HA 4LVCA 4Z0TA 4AJ4A 1T2AA 1PJCA 1XEAA 1N8KA 1WNTA 2X0RA 3I9KA 4R9RA 3FTPA 1CERA 3GGPA 2EW8A 5C5IA 4CQMA 3CUKA 4Y8VA 1ADCA 1HEUA 1P1KA 3ZDFA 4AJIA 3PJGA 3QE3A 4B79A 1F0YA 4JXKA 1OC2A 5I9NA 4CLRA 1KVTA 1KVUA 1QYVA 2WM3A 4TVBA 3HN7A 4BGIA 3TF5A 5GY7A 1RM5A 3C1AA 2HK8A 2QHXA 2R00C 4HADA 2PGLA 3R1IA 4YBZA 2FRDA 3KYDA 2TMDA 4BGEA 4IDEA 3TN7A 1NAIA 5TIIA 2OL4A 5AXCA 1EZ4A 2Q2WA 3GVCA 1CF2O 4NU6A 5CG2A 3R3JA 4AJHA 2GCGA 3Q2KA 3RC9A 1GEGA 1ZH8A 4XJTA 5G0TA 2G0TA 4BNYA 3DQPA 1I3LA 2B4TO 1EQ2A 4J1QA 3P2OA 2V6BA 3F9IA 2CVOA 1OFGA 5U4QA 1IPEA 4XDZA 4Z9FA 1YDWA 2VRCA 4JX8A 2P5UA 1U2DA 3ZHXA 3VZRA 3JQ9C 3K2BA 3S1LA 4EBFA 2BELA 2WYVA 5B1YA 4M54A 3FHLA 1G0OA 2J5KA 4BO8A 2EEZA 4JJIA 4CMEA 1QYCA 2B0JA 4MJLA 5IDXA 1XA0A 1P9LA 1J6UA 4Z0PA 1UXKA 3L0DA 4DREA 3AM5A 3LF2A 3QY9A 4DRYA 4HWKA 2D5AA 4WLOA 1WLYA 4K9DA 1KC3A 1Q0QA 2B36A 2VYNA 4XYEA 2PLAA 4OL9A 5BNIA 1DSSG 4FFNA 2WD7B 5JCJA 2VZ9A 4DL9A 3S8MA 4KDEA 3M1AA 4CM7A 1NR7A 1LLQA 1VJ1A 2IRWA 4PG6A 4HFMA 3STHA 5JAIA 3GVPA 4NJMA 3OBBA 3F6YA 2HKIA 1PGQA 2I67A 1GR0A 2W4QA 3FD8A 4UUPA 3VH4A 3DMTA 2DTDA 3D5TA 3JQFA 1N9GB 2P68A 1ONOA 4FJ2A 1WVGA 3PP8A 3AOEA 5K0ZA 4A0SA 4WGGA 3JTMA 5TQVA 3HE3A 4AJNA 3EGOA 3OSUA 5GMOA 1VKOA 3GR6A 4PZEA 4CMCA 1R16A 1PL8A 4MP8A 4IM7A 1QV7A 2VHZA 4WCFA 1YRLA 1ISIA 2Q50A 3OM9A 5JBIA 2WEKA 2QQ5A 3CXRA 2GLXA 1LI4A 1QLJA 2OGUA 5I9MA 5K9ZA 3H9JA 3TZHA 3H5RA 3PHIA 1EE2A 3TRIA 4NPCA 2YHUA 2NV6A 4CV3A 1YDEA 5L45A 1E1NA 4HX5A 4IQ0A 1P74A 2B35A 3ORFA 1ULUA 1LDGA 1TB4A 4BNTA 4ZQBA 1XCBA 4K1LA 4IIVA 4XYGA 2Y1CA 2PH5A 4F46A 4NFSA 3GA0A 3DHYA 2O3UA 1QYXA 5CDYA 4DTIA 4IJVA 4GSLA 1E77A 2C20A 2NQTA 1HZZA 3BMNA 3DDNA 4D7AA 5CDSA 2VUUA 4S1VA 4ESOA 1EVIA 5AYVA 3HADA 3LVFO 4B7CA 4ZGWA 2E49A 5DBIA 1HDRA 1SZJG 2DT5A 4J6FA 4RF4A 1CQJA 2YDXA 4D79A 4OOFA 3WYBA 4CQMB 5JY1A 3NRCA 4B7UA 4FGWA 1UR5A 3NKLA 4KWHA 2JFGA 3L4BA 1U8XX 4HNHA 4CLRB 5G0UA 3WGIA 2DBRA 3B20A 1K2WA 1IYZA 3BA1A 4KQXA 3WMWA 2VYVD 5MDHA 1SEPA 3D7LA 3QVOA 1R0SA 4DPMA 1TXGA 3FBTA 3KYDB 4ROSA 4YT8A 3ZV6A 4R1SA 1S6YA 4PLWA 1JA9A 3OIDA 2ZYAA 3Q6IA 4OH1A 3GUCA 1P1HA 4LK3A 1YB5A 2NU6A 1TI7A 2QRJA 1MP0A 3BMQA 1X13A 4LISA 4DVJA 1IUKA 4HFRA 2VTEA 4HKTA 4BMSA 2YUTA 3GQVA 3Q3CA 2ZB3A 1SCUA 1U7TA 2GN9A 5TC4A 4HFNA 3BHIA 3K30A 5KKAA 2O23A 3MTJA 3NTOA 3LSYA 3I9JA 4EGFA 4RZHA 4RPLA 1U2GA 4TWRA 3ZU2A 4YT5A 5KWEA 1PGPA 3ZNOA 1DC3A 1KVQA 4DYVA 3LZ6A 1Q1NA 3KV3O 4RVHA 1NBOA 4W6ZA 1DLIA 5L4LA 4GGPA 2C7GA 5A03A 4IPTA 4Q9NA 1CDOA 3WGYA 5JMWA 1CJCA 3ST7A 4MOWA 3AM4A 1UJMA 2SCUA 3HG7A 4M55A 2YV3A 3WDSA 3ZZNA 3PHHA 4EITA 4FFLA 3JYLA 4G65A 5IJZA 2NVUA 1A5ZA 4Y67A 4RPHA 1DIHA 5BSHA 1TLTA 1NPTO 1Y1PA 1YGYA 3WX0A 3OEYA 4XQCA 3OQ1A 2D8AA 1DHTA 4YQYA 4N18A 2VN8A 3QRWA 3KB6A 2X23A 4YQZA 3PYMA 4IDCA 4WOJA 2LDBA 3C24A 4ZD6A 4KOAA 4E12A 1KEWA 4TMFA 4N5NA 1EUZA 4C4OA 3QLJA 1GFSA 4XB1A 3E48A 4GQAA 1ID1A 2OO5A 3DZBA 3OA0A 2EV9A 1ZW1A 3DONA 3KZVA 1UUFA 3NT4A 2QZ9A 1BXGA 1WW8A 4H16A 3D1LA 5C37A 3C1OA 4OXKA 4ZJUA 3JQGB 4GH5A 4DPKA 3W8FA 2DTXA 2G1UA 1LBEA 4JJGA 1Z73A 4B7XA 1JWAB 4Q3CA 1GZ3A 5G0VA 1B7GO 1GQQA 3JQ6A 2O4CA 4NDNE 3P7MA 1H2BA 4BNFA 1B3BA 2RHRA 2YYYA 1YH3A 2I76A 4C7KA 3F4LA 1A27A 1A72A 2AQIA 4WCFB 4CR8A 1DFHA 2DU8A 3DZJA 3JQAA 3QP9A 4PRLA 4B3IA 2XPCA 3KHUA 4NBVA 3GOHA 4Q3AA 2GZ3A 3K9QO 1FDVA 4L74A 3DZKA 2NQ8A 2W90A 1XU7A 3ETGA 4IDFA 3RU9A 2PH3A 2PR2A 4IZHA 1ISGA 1B16A 4TKLA 3FSRA 3ZWAA 5C3MA 3AUTA 1ZBQA 4DC1A 1AHHA 1ZMTA 2AG8A 4WNCA 4A26A 5F21A 3ASUA 5JAMA 3NAQA 1B26A 4RVDA 1KY5A 3LT1A 5LCXA 4XJSA 1ZK1A 3DHNA 4AJ2A 2Q1SA 3VPGA 3BMNB 1NVMB 3FI9A 2ILTA 3OJLA 1AHIA 1VL6A 5IF3A 2JCXA 3DFUA 4C7JA 3PFWO 4IQGA 3BIOA 4NI5A 4J91A 4EUHA 2QW8A 1ZK0A 1HDCA 2UUOA 3O9ZA 1CYDA 2X5OA 4GKVA 4BHTA 4CV1A 3ZWYA 3G1TA 5LDHA 1GV0A 2D3TA 2Y68A 1E0DA 5TNXA 4F3YA 3H3FA 1H6CA 5F5LA 1ZK3A 4R4JA 2BF7A 3V8BA 1TA4A 3WIDA 4RPJA 3M1LA 2OOSA 3K92A 1XLTA 4PN3A 3NT5A 3WBFA 5G4LA 4GLOA 1T4DA 4DXHA 5DBGA 4DMMA 4YJDA 5L9AA 5BT9A 4I5EA 1ZVMA 4IS2A 1DFIA 1D1SA 2FP4A 2HDHA 3BMQB 3W4IA 4UVDA 3GN2A 3SC4A 5HTOA 3CKYA 4CMJA 1P1RA 4OYRA 3ZV4A 1KEUA 1J4AA 1H6AA 3S2GA 1TVEA 2NACA 1KETA 3QQPA 5TF4A 3ZU3A 3QVTA 4E5YA 5I7FA 4D44A 1D3AA 2GPTA 4YTEA 3AW9A 1NHWA 3C7AA 3DZIA 3U49A 2P4HX 4PG4A 1IL0A 3MZ0A 1LDBA 4RORA 5H81A 2VT2A 1CQIA 4QUKA 2E4AA 4PFJA 2NVUB 2JFHA 2CY0A 3PK0A 5L4NA 4O63O 2HJSA 1O8CA 3DBRB 1BVUA 3VZSA 3S55A 2EJWA 4YYZA 4E31A 4E2XA 3G3EA 1I3KA 4Z9YA 4K6FA 2ZTVA 5BR7A 5L51A 4RQTA 2X9VA 3V5NA 1G1AA 2AG5A 2GNAA 3VPXA 1VE9A 1YL5A 3U4IA 4WLNA 9LDTA 3B1JA 1C0IA 1Y6JA 2DUWA 3UH1A 1E3IA 4IXTA 2NTVA 1UZLA 3AI1A 3IL2A 1Q7CA 1HDGO 1U3WA 3B6ZA 4YVFA 2XF8A 3PYXA 4II2A 2Z5LA 2JD2A 2HJRA 3C85A 3G49A 1LLUA 5DULA 2QX7A 1W4ZA 1BXGB 4CLEA 1HDXA 4FOSA 1PGNA 2P9CA 4QQRA 2HLPA 1U3UA 5JC8A 1LQUA 1LDYA 1DC6A 1UP7A 1ZK2A 3HN2A 1HYEA 4KTVE 2RH8A 4IJWA 1VPDA 4GX0A 1ZK4A 1U5AA 1ZMOA 3AM3A 3DBLA 2GGSA 2H9IA 3SJ7A 1ZO8A 5DN9A 3HZZA 3VZQA 2X5JO 4F6LA 1GDHA 3A9WA 4PVCA 1NQ5A 2ZYDA 3PYLA 4EUFA 3LC1O 2VTDA 5L95A 1HSZA 1DIBA 3JQAB 4QO8A 4E5NA 1T4BA 1PTJA 4HNGA 4IINA 4J1SA 2DBVO 5COQA 4OKNA 3SVTA 1C1DA 1M6WA 1PZHA 5L7YA 3ITDA 3E5RA 3LU1A 3DBVO 1U7HA 3I83A 3IQDB 1MV8A 2I65A 4MVJH 4B4VA 4DWVA 2B5VA 1LSSA 2YQ5A 4MKZA 5I7EA 3RJ5A 3HWRA 5JMPA 3GNSA 1E3WA 1GZ4A 5ICSA 3PWKA 1R4MA 2IE0A 3OP4A 3KXDA 1QLHA 4NBUA 7MDHA 4YAGA 1U1IA 1ZXBA 2YW9A 3WR5A 1BDMA 2UUPA 4JBGA 5H82A 3ZH2A 4HV4A 3GN1A 4B8WA 3JCZA 4TROA 1SNYA 4CLDA 1NFRA 3L77A 1PJSA 3RROA 3KYCA 3GAZA 1EUCA 3WNQA 2PA3A 1PL6A 3IOYA 5DDIP 3IP3A 2D4AA 3MJ4A 4D0SA 2E48A 4CM4A 1EVYA 3E82A 4FR5A 2DTEA 1VJTA 4YB8A 5A04A 5IXSA 2JFFA 2Y05A 4AL4A 1B8PA 1SOVA 1YB4A 4KUHA 2EJVA 2VOEA 4A73A 1MC5A 4OSOA 4XEHA 1SPXA 2VHYA 2O2YA 4FN4A 1DDOA 1N2SA 1UP4A 4BUCA 1ISFA 4ZQHA 1X0XA 4MVJG 4NG5A 1JW9B 3VDQA 4R5MA 2PKQP 4GBJA 1MX3A 3PDUA 1UH5A 3NJ8A 2Y1EA 3UCXA 4XD2A 3WYCA 4NMHA 2BFMA 3RC1A 4YA6A 2UAGA 4JCOA 1K89A 3GLQA 3OJOA 5KVVA 3GMDA 1Y8QA 1E7RA 5ENDA 2PNFA 4LW8A 3VOSA 3D3EA 1LC0A 5TRTA 3JD3A 5B4TA 4J16A 1PJ3A 4TKMA 1XYGA 1JVSA 2CNBA 1EK5A 1H9AA 1P1IA 2V6GA 4P38A 2RBEA 5L7TA 4MVJM 5JAZA 5I8ZA 4MP6A 2O3QA 3OECA 2ZQYA 3HDQA 4WECA 1QG6A 3JQEA 3CINA 3M6IA 5CAEA 4BL5A 2HMUA 4ZN6A 1E6UA 5IG2A 1VL8A 4IMRA 2ZYGA 4E0BA 2DC1A 1ADFA 1BTOA 1VSUA 2PZJA 5T8KC 4LRSB 4MKRA 1EEHA 4B8ZA 2BGLA 3CEAA 3E5MA 3IC5A 2FR0A 3HB4X 4K26A 1A4IA 2ZTUA 1ADBA 2I3AA 5CPFA 5A9SA 4L4SA 3O4RA 3LLSA 3KEOA 3KBOA 4L0QA 3AI3A 4UVHA 1KS9A 4YR9A 1I01A 3AY6A 3BMOA 4ALIA 3EAGA 4R68A 3FF4A 3R0IA 1E3JA 3W4KA 1YB1A 4FBGA 3V1TC 1I2CA 1LSJA 5IAAA 3FTNA 3DL2A 4BO4A 1RKXA 1RM0A 5GZ1A 3L6EA 2ZKLA 1EVZA 3W8DA 3PPIA 4ZQFA 3ZHZA 4XIYA 3ZV5A 1LDNA 3H8VA 2QIOA 4ZVVA 2QRLA 2DKNA 4DBZA 5DNAA 3WSWA 4K6CA 3E6AA 4TRNA 1PJLA 4E5PA 2OORA 1U3TA 1CETA 5U1PA 5KJFA 3ANNA 1OOEA 6LDHA 1SMKA 1WAMA 1GL3A 1PS8A 1H94A 3AOGA 1H5QA 5THKA 4M89A 4CMAA 2H6EA 2ZJ1A 4YJHB 5G0WA 3DBLB 3VPSA 3QWBA 4E32A 3PHLA 4OHUA 1HL3A 3NYWA 3VDRA 1KIFA 3H2ZA 4URFA 5G2OA 5L3ZA 4EJMA 3JV7A 3GC6A 2HSDA 4ALNA 4GX1A 4TZKA 3C1TA 4Q3DA 1ONNA 1QORA 2G5CA 4IJUA 4J4HA 4RPGA 3S2FA 4KP7A 1B8UA 1R66A 1HT0A 3TZQA 4RQUA 3PJEA 3MOGA 1C1DB 1VL0A 1DLJA 2NNLD 4KWIA 2R00A 3QV1A 5FFFA 2DPHA 3PQFA 4RVFA 4FSHA 3DAFA 3PQDA 3PLNA 3GZNA 4MVJE 3I5MA 1FDTA 3AU9A 3H9UA 2RAFA 2EWMA 1E3WB 1DAOA 2CZCA 1R4MB 2QYSA 5JS6A 3ROMA 4ZQGA 2VNAA 2OUIA 4PLFA 1MFPA 4UUNA 1U3VA 3ZWCA 1GYRA 4KMSA 4R9SA 1AGNA 4NQZA 1N7GA 1T2CA 1WDLA 1I10A 2O7SA 1MG0A 1HLPA 3E1KA 1VM6A 4EDFA 3KYCB 4MVJF 3RKRA 4Y6RA 4QFCA 1YJQA 2NUAA 4XDYA 1ZEMA 2GASA 4RJTA 4W4TA 2VYVA 1V3TA 4BQRA 4CM4B 4WKGA 1D8AA 4JK3A 4FD3A 3JQ9A 5L40A 2J3JA 5B4UA 1ONPA 3TL2A 3GG2A 1PIWA 1WZIA 4U0KA 5CEEA 2JKVA 1HXHA 4BKQA 3DWFA 1NWHA 1PR3A 4E5MA 3SXPA 2Q1WA 1GCUA 1ULSA 4GWGA 1QXSA 3IMFA 4XA8A 1I0ZA 5IZCC 2OBYA 1V9LA 4YT4A 3NX4A 5CDUA 4P8RA 4GAEA 2NVWA 4FFOA 4I9UA 1KY4A 4A27A 2PGDA 4I1IA 5AVOA 2RHCA 2C2XA 1X7DA 1E7YA 3PWZA 4MINA 1HSOA 1X7HA 5G0SA 4AJJA 4YJGA 1Y8QB 3H6KA 4ND1A 2VT3A 1FDWA 4N5MA 4AICA 2LDXA 3ZWPA 3OJ0A 2EF1A 4MVJD 1GU7A 3GEGA 3EC7A 3H2SA 4E3ZA 6ADHA 4BOYA 3EUWA 3WFJA 2CFCA 2PY6A 1BG6A 4BB5A 4EEZA 1PL7A 4GGOA 1E6EA 3HB5X 1P3DA 3MJCA 3JQ7A 4PCVA 1DRUA 4DLBA 1NPDA 2Q4BA 3WGQA 1EFLA 2NTNA 3UFXA 1P45A 3DTTA 2C07A 3MTGA 4AJKA 1IULA 1G0NA 1DFGA 1NFFA 4AJPA 3U9LA 1YJ8A 3WGZA 3FN4A 1XSEA 3TNLA 1IZ0A 1DO8A 4PVDA 1NX6A 4ZICA 5A9SB 4M86A 1H6BA 3RIHA 4DPLA 4CQMD 1HDOA 1S7CA 3Q2IA 4W99A 1X1EA 5KNLA 2Q2VA 2ZB4A 5F1OA 3ENNA 3BMOB 3PZRA 5COAA 5ER9A 3TOZA 3VPHA 1P0FA 1Q0HA 1V35A 3H5NA 2Y1DA 5F5NA 1UZMA 2YDYA 2ZTMA 3NEPX 4XIJA 2J8ZA 4EJ6A 2YY7A 4WASA 5U9CA 4YPOA 3I1JA 4FW8A 4P4GA 1I5RA 4R16A 3AUUA 4II3A 2EERA 4QECA 1P1JA 3OFSA 3MWEB 3R6DA 3ZW9A 5I9LA 4LCJA 1I2BA 2GN8A 1YS4A 4IUYA 1OMOA 1P77A 4GSKA 1GUFA 5EN4A 3IUPA 5IXYA 2EGHA 2JCYA 3WG9A 3I4CA 2NWQA 2EKPA 3TFQA 4X54A 1VI2A 2Q3EA 4BNHA 1HYHA 5L53A 2EKLA 1XIVA 3WGHA 3I9MA 4CPDA 4XQGA 4BV9A 3QJ5A 1X1TA 1GPJA 3ONDA 1DC4A 3O8QA 4PGFA 2D5CA 1I33A 1U28A 4ALLA 1GCOA 3WWYA 3AFNA 4CMGA 1CWUA 3RUHA 3DZHA 2C82A 4CR7A 3ETEA 1IZ9A 5TJHA 3T4XA 2AMFA 4R1UA 4J90A 5BNFA 1NYTA 2J5RA 2GYYA 4AJ1A 5T5QA 5AXBA 3WMXA 2WTBA 2VZ8A 4UVEA 3TPCA 1HYGA 1ZCJA 2GZ2A 2NSDA 4UVIA 4BKOA 5JYEA 2A9FA 2NLOA 1YKFA 2OZPA 4GWKA 4Z6KA 1A4UA 4BO1A 1DIGA 5FI5A 4H7PA 2BLLA 3UHAA 1I30A 3JD2A 2YHIA 3ZNQA 2BI7A 2W8ZA 2PV7A 4M87A 3GZNB 3BHJA 1DBVO 4J0EA 3U09A 1R4NA 3IAHA 3OJFA 1M76A 4EUEA 3I9LA 1JAYA 3IKVA 4LGVA 2Y93A 3WNVA 3F1KA 1KVRA 1RWBA 1CEQA 4J4TA 5JCJD 1LRLA 1PQUA 4WEOA 5BQFA 1TT5A 2TMGA 3DOJA 3EK2A 3UGKA 2NVBA 1LLDA 2NADA 4JBHA 4EEXA 3UW3A 4PLYA 2ZB7A 2AEJA 2GO1A 1SC6A 3FWZA 4Z9XA 4O5OA 4I5FA 3INTA 1BXKA 3ZN2A 2YZ7A 4I08A 2Q49A 2B83A 1UAYA 2DAPA 3PFFA 3ZWNA 3ONEA 1LA2A 5CFZA 1RM4A 1XU9A 2I3GA 3U3XA 3LT4A 1EMDA 3OQBA 1FXSA 2O2SA 2P91A 5HS6A 5KTKA 2YFHA 2Y0EA 1DJQA 3Q0EA 3ZGYA 1PU2A 3QIVA 4U6QA 3GMSA 3NUGA 4D45A 1C0PA 2IXBA 1IPFA 1N5DA 3PXXA 4O1MA 3W6ZA 2NU9A 1FJHA 1MLDA 4JLWA 3HDJA 3I9OA 4TSKA 4DIFA 3ANLA 1UDBA 4A10A 3C3XA 4E4YA 1QR6A 3RKUA 1PQPA 2DBZA 3T7CA 2X4GA 3EDMA 1OAAA 4NJMB 5CDGA 2OP0A 1NP3A 2A94A 1Y9EA 3FR7A 1ZEJA 4FIZA 4CM9A 1JKFA 4YJGB 1NPYA 5GZ6A 3VZPA 2X6TA 1E7QA 3A06A 4WEQA 2NTJA 1KEPA 1VKNA 5JLAA 5C7IO 4XX0A 1AN9A 3PGJA 4MVJI 1HDYA 3VHRA 1C14A 1E3EA 2C5EA 1NASA 2BHLA 2H1SA 4IS3A 4LRTB 3RQSA 4BO9A 1JKJA 3JD0A 3BXXA 4YDRA 2D59A 4ZU3A 5H83A 2AE1A 1IHYA 4U6SA 4WCDA 2ZCUA 3JQ7B 2UDPA 1ORRA 5JFOA 1DJNA 1K6XA 2W2KA 5MGBA 3L4SO 1NXQA 3PHGA 3AJRA 4R54A 3ONFA 2Q45A 3RU7A 1WZEA 3ZHYA 2VWQA 1NR1A 3ANMA 2FSSA 4D3FA 4IY1A 1GPDG 4FS3A 1H2HA 1LQTA 1Y5MA 1T2EA 3FPLA 5DBFA 1U4SA 1ZJZA 4NU5A 1IOLA 1DEHA 3CZRA 3N7UA 3U4CA 4AJLA 2R6JA 1R6DA 3QVXA 1PZGA 1Y7TA 2AXQA 4XYLA 3ZNPA 3WQRA 1P44A 4CLOA 3ZWBA 5TT1A 2CF5A 4JNKA 1CIVA 4UEJA 4GI2A 5HA5A 1ZXLA 2VWPA 3GG9A 5EPOA 1T26A 3PIIA 1D4FA 3KSUA 1YQXA 3MWDB 3RC2A 4FOOA 3D4OA 1SO8A 4J3FA 5FYDA 3GF4A 1MGOA 3CPSA 1C1XA 2CSUA 4GL4A 4WE3A 3TFOA 1YBVA 1ML3A 3IUSA 3LLVA 4H15A 1W6UA 5ER6A 1XQ1A 3INGA 2HMSA 1B8VA 4CM8A 2X58A 3GZ4A 2OXIA 1VC2A 4FFMA 3CTMA 3KLMX 4ND3A 5TSDA 3R3SA 2D0IA 4J1NA 5JDCC 1MXHA 2XOXA 4YAJA 1IE3A 4I8XA 4CL8A 4R5HA 4OSPA 4WLFA 3RI3A 3ZU5A 1SAYA 4L8VA 3FNGA 4PG7A 2FZWA 2CVZA 5DOVA 4NR0A 4RF3A 3K8ZA 3WGOA 2UYYA 5F3RA 2JJYA 2FOIA 2RIRA 4U7WA 3ZWXA 3EYWA 3NV9A 1DRWA 3I23A 4QX6A 3TZKA 1R0LA 2E6UX 5HWSA 4I5DA 5EMHA 1L1FA 3TZ6A 2YHIB 5CHEA 3LC2O 1DHRA 1GQYA 4RVSA 3EW7A 5DP1A 5A05A 4BQPA 3D4NA 1D7OA 1J0XO 3RFVA 2I5PO 1V3UA 4EZBA 4WLUA 3V1UA 3WQQA 1A7AA 5I7SA 4J1TA 2PFGA 3HQ4O 5F1PA 3K2EA 1TT5B 3L6DA 4U5QA 4CMIA 1BHSA 1PZFA 4YJFA 3RFXA 1GY8A 4HBGA 3VAZA 3TDKA 1F8FA 1BSVA 4A5OA 3IIEA 4NH4A 4QXMA 1GYPA 3DB2A 1PS9A 2C0CA 1EFKA 3LK7A 2WDZA 4PLGA 1Z6ZA 3PTZA 1J5PA 1L7DA 4DQXA 1JKIA 1AXGA 1JVBA 4LN1A 1LRJA 3RCBA 4ZA2A 1TT7A 2DM6A 1EDZA 2HCTA 4GVLA 4NK4A 3KETA 3JQDA 5HS4A 4XYBA 4GPD1 1SB8A 2C5AA 1ADGA 2J6IA 2PGJA 1U5CA 3E8XA 2OMEA 4XZ3A 2Q1UA 4Q39A 2CDCA 3ZI0A 1UXIA 2FHSA 3JD4A 1WXDA 2V6MA 4XQ9A 1SBYA 3LC7O 5ES3A 4R69A 2A35A 4BNNA 5J23A 5A5EA 4Q3BA 1I36A 3WOHA 2ZTLA 3GEMA 3H9QA 3EZLA 1F06A 3JD1A 1FDSA 1KOLA 2VHVA 3FRJA 4UULA 1ISMA 5IDYA 2P4QA 3AI2A 3RUFA 4GMGA 2Y67A 3GEDA 3ITKA 3F47A 4LVUA 3RC7A 3PI7A 1YL7A 4J9UE 1QRRA 1X15A 2VNSA 4XB2A 1LNQA 2W2KB 3DC2A 1UDAA 3Q9NA 4AJEA 3C7CB 1PZEA 1Z75A 1EBUA 2W2LD 4CL3A 4R1TA 5I7VA 1CRWG 2NU8A 2VQ3A 5JSFA 2JD1A 3E18A 3JQBC 4P4NA 1IHXA 4QTZA 3PHJA 1YL6A 1MFZA 4JJFA 1K6JA 1MG5A 3OETA 3PZBA 1D1TA 1SOWA 3LQFA 4FJ0A 1PJQA 3H5AA 2X9NA 3C8MA 2BKAA 3GY0A 3UAGA 2F1KA 4MP3A 4QFDA 5ENVA 2DBQA 2EHDA 5KJ6A 4CLOB 2DFDA 3H7AA 2X8LA 4Z3DA 5DP2A 3L9XA 4RO0A 2PZLA 5F1KA 2C59A 2JHGA 3CZMA 3TWOA 5TGDA 3MOIA 1FK8A 2V6FA 5DT9A 4MIEA 4IDGA 3GHYA 4NJOA 1EVJA 4E13A 1C1XB 3M2PA 4UREA 2AQKA 3PGXA 3LF1A 3I6QA 4MO2A 3NGXA 1XG5A 3S2IA 2DPGA 5JAQA 4FC7A 1BVRA 2VCYA 3JYNA 4I9HA 3TJRA 1U9JA 4CM8B 1A9ZA 1PSDA 4YAIA 4G2NA 5A5FA 3UN1A 1HWYA 1PWZA 1K6IA 2A92A 2EP5A 1YOVA 2GRAA 2JHFA 3EHEA 1R37A 4HXYA 3PWSA 4AFNA 5DZSA 3RSHA 4YXFA 3MJTA 4NFYA 3WIEA 1YBAA 4BVAA 1VLLA 3FCOA 3RUEA 2HQ1A 3N58A 3CIFA 3VH3A 5I8WA 3Q11A 3WBBA 5FWNA 5CG1A 2X5KO 4O59O 2BD0A 3ZV3A 8LDHA 4JROA 4CM5A 2OP1A 2B5WA 3SBOA 4BKPA 1A71A 2ZATA 2VWHA 1ZSNA 1WWKA 1I24A 4YCAA 1B15A 4IJKA 1NVGA 4PZDA 4M8SA 2JAHA 4RV9A 1OBFO 4UUMA 3S2EA 3JYQA 4W9NC 5CDTA 4RF5A 3IJRA 1B0AA 1DRVA 1WDMA 3RASA 4CMIB 3PQEA 4ZRNA 4XR9A 1DOHA 2O48X 4JGBA 4BO5A 3OQ6A 4YJFB 4EW6A 3UOGA 3FBGA 4D3DA 2HRZA 5LC1A 4CQLA 4B4UA 4G81A 2B4RO 2EW2A 1HDZA 1HRDA 3AUAA 3NDRA 5LDGA 3DR3A 3KO8A 1QYDA 4IDBA 2DFVA 4JP3A 5B37A 1DB3A 5T8KA 4OMUA 5JDIC 4W7IA 1H9BA 3H9EO 5AXAA 3VKVA 4BGVA 2QZZA 1C0KA 1LSUA 3PIDA 2DUUA 1BGVA 1R12A 2O3JA 3HNPA 4UUOA 5IN4A 2BI8A 4R1NA 3ROQA 1F12A 1T25A 4FDAA 5JO0A 5G4KA 3JQCA 3KVOA 1K5HA 4NBRA 3DOCA 2HMWA 4KTTE 1HZJA 4NBTA 4CMHA 4XGNA 3WGTA 4TVOA 3H65A 4A2CA 2WYUA 4MVJA 1PJTA 5A3JA 4JQCA 4FFPA 1BMDA 1LUAA 2IEDA 5DF1A 2Y1OA 1RM3A 2RH4A 1X14A 4O0LA 2AE2A 2CDAA 3I3OA 3OICA 4AG3A 3WXBA 4LMPA 4Y6SA 1E92A 1N1EA 2AW5A 3UCFA 1XWFA 3I4FA 4LSWA 2IEBA 4BNUA 1M75A 3GDFA 1JQBA 5FI3A 1WPQA 3AY7A 1E7MA 1N92A 2HO5A 4H3VA 3F1LA 2CUKA 4L76A 3DAPA 4CLHA 4OAQA 4EI2A 1GUZA 3D0OA 4B4OA 3SEFA 4J2OA 3DMYA 3OJEA 4FGSA 1RYDA 1P0CA 3ZHBA 4B3JA 1V6AA 3QWHA 3SLGA 4ALKA 4MVJP 3D3WA 2PKQO 4TZTA 1KBZA 1PEDA 1ZKMA 2CD9A 3GDOA 2HUNA 1BW9A 3KLPX 3W4JA 5JC1A 5EINA 4RVGA 1OI7A 3E9QA 3OF2A 1N7HA 2VHXA 2XXJA 5L7WA 1P33A 1B14A 2Q46A 1HTBA 1PX0A 3AU8A 3K96A 3NJ4A 1Z82A 2AEFA 3QVSA 3C7DB 3DFZA 1EUDA 4PG8A 2GDZA 4RPKA 4D46A 3ZWVA 4DUPA 3UKOA 5KIAA 3F46A 1BRMA 5BSGA 3OIFA 1YQGA 1B2LA 1LTHR 3COSA 2EKQA 5KJEA 1DXYA 1HE2A 5JY6A 1L7EA 2YV1A 1Q7BA 1XKQA 1Y5RA 3KSZO 2ET6A 4OO3A 4Y98A 5ADHA 1F17A 4GX5A 3AY3A 1E1MA 3P2YA 3LYLA 3RUCA 4BNZA 2VWGA 3HUDA 4DC0A 1J49A 2PTGA 3SC6A 1NVTA 4XKJA 4CMEC 2XXBA 3ICPA 4J43A 3VTFA 2G82A 4FCCA 3K6JA 3WYEA 5TT0A 1BWSA 4OM8A 1W8DA 2F00A 2HMVA 3DHEA 1Z7EA 3HSKA 3L6OO 5ILGA 4TRJA 3G0OA 4BO6A 1YOVB 5JW6A 4J7UA 2PWZA 4ITUA 3O03A 5HRUA 1X0VA 3H9GA 4BKUA 3A1NA 5FEUA 4XR4A 3DTYA 2X0NA 1PQWA 4HFJA 3EZYA 2X9GA 4FFRA 5BSFA 1SEVA 1M6HA 2X22A 2I9PA 2PK3A 4Q3EA 4F45A 5IZCA 1V0JA 1YVEI 2I99A 1ARZA 4LSMA 1YQDA 2PD3A 3ROPA 1QKIA 2WSBA 1GTMA 3DMTC 4PZCA 3GNTA 3JQFC 5CP8A 1G6KA 3AOEC 4NK5A 1P31A 4Z3KA 3PJFA 3H4VA 2VHWA 4W7HA 2HAEA 4RZIA 1DIRA 4YRAA 2AA3A 2X86A 4WLEA 4MPDA 3QWAA 5T6BA 1YWGO 4Y6PA 2Y99A 3F4BA 8ADHA 5EIOA 4YWJA 4WCFC 3JQGA 3X2FA 5ILOA 4CJXA 3FR8A 1W0CA 3KTDA 4M1QA 3DBHA 4RGBA 4CQLB 1I3MA 2GF2A 1U4OA 1Q0LA 3B70A 2IZ1A 3BMCA 5AQ1A 3WLFA 3DO5A 2D1YA 3GUYA 4CR6A 3JYOA 4AJOA 1PJ2A 2BGKA 3WB9A 5BSEA 2Q99A 3QHAA 3PJDA 3WWZA 4BNLA 3CE6A 5KKCA 4RLHA 3SLKA 2BFOA 5TJ9A 4CM6A 1Y81A 2YQ4A 2IYPA 4YT2A 1O89A 1YONA 1HETA 3QWFA 4E5KA 4DGSA 3DXFA 2O3RA 2D2IA 2ZK7A 4K28A 4YEDA 3V2UA 2QRKA 4P4LA 2VOJA 4I9NA 5G4KB 1EBFA 3ZWWA 4E6PA 2HU2A 4GX2A 5A9RA 4XCVA 1O0SA 3BTVA 4B3HA 3ON5A 1NNUA 1JN0A 2C29D 1GAEO 3GK3A 4BO7A 3F3SA 1WDKA 4J9VA 3LT2A 1XGKA 4LCEA 1O94A 4JIGA 2O3SA 4O6VA 3TOXA 2IZ0A 3RBXA 5A4DA 2FZEA 4KUEA 3SJUA 4TRRA 1OC4A 4BMVA 1ENYA 1KERA 1JTVA 2VUTA 3L4BC 1C3VA 1LC3A 2Y1FA 3KM0A 4N54A 4PLHA 5CEFA 1HKUA 3ZWOA 3N74A 1XHLA 4J7XA 1LLCA 4OGWA 2VRCD 4DYDA 2CMDA 2FPPA 3QA9A 4GLLA 4UEKA 3D3WB 4XQEA 2X0JA 3VTZA 1BW9B 3GGOA 4MKXA 1HE4A 3NDIA 2NM0A 4BIIA 1LJ8A 4L9RA 2Y0DA 5JE8A 3JYPA 2QYTA 3WGGA 1BDBA 3U4DA 4DLLA 4E33A 3ZU4A 4ZHSA 1ZNQO 4UAGA 3T7EA 2VYND 1QP8A 2WMDA 3E9NA 4IDAA 5A1TA 1ISHA 1O5IA 1YE3A 4PIVA 5JXWA 1O95A 1DIAA 1V8BA 4A03A 5C7OO 3D4PA 1M67A 4OQZA 2GZ1A 4L75A 3TSCA 3RWBA 2POQX 3WLEA 4WLVA 2ZCVA 2YJZA 1EQUA 4ONEA 3WQSB 2DVMA 5KVCA 5KVSA 4RCVA 3CSDA 4PRKA 3GVIA 2AQ8A 1BXZA 2GERA 1SB9A 2WWRA 1Z45A 4JP2A 3BAZA 4XWYA 2Q4EA 3KRTA 1VSVA 2B4QA 1T1RA 3ENKA 3RFTA 1R0KA 2X7HA 3KYBA 5TS3A 1YO6A 1KVSA 4OQYA 4PG5A 5ITVA 3GVXA 4L4XA 2G76A 1E7WA 1O6ZA 1ZUD1 2V65A 3PLRA 3TL3A 3VPFA 2DLDA 1Q2XA 4YRDA 5A9TA 3W1VA 4E2ZA 2IZZA 1Z7BA 1DPGA 3IKTA 1I3NA 3ADPA 4R41A 4BB6A 4IGFA 2BMAA 3DBRA 4GMFA 4R51A 5IDQA 4E21A 1E6WA 3OH8A 4EYEA 4LMRA 1HF3A 2CF6A 4DQVA 3WICA 3ABIA 1MC4A 4ZRMA 5K6AC 3DZFA 4DMLA 2OBNA 3WJAA 1IY8A 9LDBA 3ICCA 1E3LA 1LU9A 2JCVA 4PLTA 4RVUA 4BNIA 3LDHA 1P1FA 4GVXA 4CMKA 3KSDO 3RBZA 3WFIA 2DQ4A 3GPDG 2WJPA 1YBMA 4BNXA 2FSVA 5IFLA 4GKBA 3BTSA 5CPBA 4BS9A 3U4HA 4NNJA 5K6AA 3PEFA 4KDFA 3KOUA 1NAHA 2UV8A 5TLSA 1KC1A 1VJ0A 1QV6A 2ZB8A 1I32A 4DQUA 1HLDA 3DBHB 3HDYA 5B12A 3VC7A 3MEQA 3P5SA 3JSAA 4OIMA 2BFAA 2BH9A 2E37A 3BMCB 3BTUA 3BTOA 1NM5A 2IXAA 3A4VA 4D3SA 2P9EA 1EDOA 1E1KA 1FDUA 5JCXA 1T24A 4CM1A 1PS0A 2BGMA 2CDBA 2FR1A 3KUXA 5EL0A 5KVQA 5C7LO 2WE7A 4XRGA 1EE9A 4QSMA 3K5PA 3OMLA 2J3IA 2P2SA 1AXEA 4UVGA 1HE5A 3OIGA 2J5QA 4D41A 1NWCA 2FY8A 4QO7A 3WTCA 3D64A 2C7VA 3MJEA 3PDJA 5T57A 2GSDA 5FF9A 2GD1O 4CMBA 1JAXA 1Q7GA 3CMMA 3U5TA 2X1HA 4BNGA 3L9WA 3V2GA 4BGUA 4E2YA
chains in the Genus database with same CATH superfamily
1WEKA 3Q9LA 1I1QB 4GWLA 4HUJA 3LQKA 4PSUA 1NULA 5BYJA 3GP3A 3QELB 4YACA 4UAJA 4QASA 2Z8YA 4Z51A 1NVKA 1CQZA 2QN6A 2OAP1 1VBMA 1GV1A 4J49A 4OJNA 2JRLA 4N5LA 2PZKA 3RUPA 4DLPA 2J4FA 1S8AA 3DEAA 4RA6B 4JBIA 2HRRA 3SNKA 4R0VA 2RH9B 3HTXA 3K0KA 1PGJA 1EWTA 3BRSA 1ENZA 2NU7A 1GJRA 1TQ2A 3JASA 4X44A 4ZAXA 2JIQA 4F3RA 1X9IA 4RL4A 4QKQA 1MX1A 4AJ9A 3MCVA 5KTNA 1PUXA 5LQCA 3URKA 4PLZA 1J1UA 2R8RA 3CX3A 3HB1A 1E2HA 2H2AA 4XGKA 2D4HA 3AHHA 3WLMA 1ZUNB 2NN3C 4XGIA 1KHHA 2C0QA 2AWOA 1NQOA 3BRWA 1WPRA 3CRVA 3L07A 1AUPA 3Q7RA 4EYSA 3WK7A 4YECA 5CT8A 1WL8A 1ZSVA 3W3AA 4IRMA 4LOJA 1FF9A 5T3UA 4B33A 3G79A 2R6DA 4TM7A 4F4IA 1UODA 1TEHA 1R4NB 3GFTA 2CHUA 4ND5A 2O5VA 1IM5A 1P2FA 1ISJA 1VDMA 1G8GA 1CLUA 1Z5WA 2JL1A 3D81A 2FSPA 2CVQA 3GPIA 3QBVA 2GZSA 4RF2A 4ZCLA 2H5LA 2CL7X 3EG9B 4HK4A 3ZW8A 4B85A 4FMDF 4RHFA 1OYYA 2QM0A 5BSKA 5EXDA 1AMOA 3QXCA 3HYTA 2EDAA 5AJVB 2ZIZA 1LGYA 1UEXC 3K1AB 1MDBA 3E9YA 3ULKA 4GS5A 2DUNA 2I66A 2AYXA 4BO0A 4QTXA 4H7DA 2VDMB 3H2KA 4O2BB 1ZL2A 3VR5H 2QTVA 5DBEX 2J3QA 2SBTA 1PEYA 3A6PC 2XUJA 2GXQA 1G20E 4HAXA 4A8JB 1UQUA 2JD0A 4G26A 3RIMA 1H0KA 1DT3A 3KR2A 1TM7E 4NLLA 4ZQCB 1W88B 4I50F 2C8KA 4EJ0A 3A0UA 3TEFA 1LDEA 5ERYA 3BK2A 5JHHB 2AF4C 1KOFA 3JZIA 4FHCA 1WHSA 3KQYA 1E4OA 1XDWA 5KPDA 1H0SA 3LUHA 1P62B 1QZ3A 2OHXA 4B4WA 1EWYA 4WOKA 4PCLA 3T54A 3NCHA 2R65A 3TNJA 3VYWA 2R6CA 4B48A 1VHJA 4QQKA 1B43A 1Z33A 2EFDB 5CB6A 4N9WA 1KJWA 2CXTA 5TGTA 1Z0DA 5EHNA 4L73A 3RS2A 5AW3A 2IDMA 5CITA 1C3JA 1XRMA 1PJZA 2EWWA 3A3NA 1XZDA 3E84A 1EDEA 4OTZA 2W93A 4D42A 2VI5A 2VP5A 3HB7A 4HG2A 4IGEA 4R7ZA 3K31A 1NY5A 2P9GA 4M8LA 4DIUA 5BP7A 5TMPA 3STXA 3IAS1 5AM5A 1FMCA 2QRVA 4F96A 1TEXA 1NQTA 1PR1A 3DOHA 4RS3A 3NDJA 4RDIA 5JS7A 2P5YA 4RKRA 2EFJA 4JT8A 4DIBA 4EATA 2VBCA 2IHJA 5LD2C 4OXIA 1E4EB 5HZGA 5CD1A 5ICMA 1QP0A 3NT2A 4C0XA 4B6OA 5AW0A 1NI3A 1S0UA 4WI1A 3CT6A 2PVCA 1FRZA 5HJEA 1G7RA 4HY3A 2B37A 1ZD4A 4M1TA 3GFVA 1RPAA 3KKZA 1F3LA 5DSTA 5IAJA 3K09C 2YWBA 2Q3LA 5JNRA 2WI8A 1EE1A 3A6HA 2HGSA 4TWIA 1U2EA 4ANFA 4DLZA 1P91A 1O9BA 1K5GA 1RJWA 2OG1A 4NAHA 5IJ9B 3PHCA 5MN6A 3VH1A 4RK6A 1N1GA 3T7SA 3TLBA 3INRA 1X7WA 4LHEA 1AKUA 4U2BA 1NVXQ 3KD2A 5COBA 3LCRA 1HGXA 1TZMA 2GZAA 4OXNA 4YJHA 2VUSA 1M2WA 1UZNA 2BVNA 2Z2YA 3LZCA 4MV9A 4OMFG 3W77A 2PEYA 4DV1B 3ZD8A 4E03A 3QW4B 1M1NA 4KQWA 1JL3A 2C2HA 1PNVA 3S28A 1V5FA 3K35A 3ETLA 4RAOA 3KQHA 2GD0A 3MJHA 1ORVA 5IABA 1MJFA 1P1CA 1I2ZA 2QG6A 4HH3C 4RZQA 4L72A 3RJ9A 4F2HA 5HM8A 3TRFA 4FLMA 2IU4A 4GM4A 3MBKA 5A6SA 4CV2A 4EM6A 3VR6A 3IPLA 2I80A 3IDSA 3PRJA 5JSUA 3HM9A 2JCBA 5JROA 5KYWA 3NTQA 4HDRB 5JVDF 3IHKA 4IZ6A 1W29A 1R64A 2IYOA 4GXTA 3REGA 1QMGA 1WMAA 2V7TA 5C8ZA 4HZUB 2ZANA 3CEMA 4IXWA 1ZJYA 2ZRHA 3GHHA 3LYAA 1XZHA 4EGQA 5LYYA 6GPBA 3GFBA 4RADA 3TE7A 4WQMA 2VNKA 3HFSA 2PR7A 3AFMA 3P9QA 4NHEA 5KI6A 3WRWA 7ADHA 3MHTA 1BHO1 4A36A 1QGUB 2XB4A 2ZJ0A 2QD3A 3KEQA 2PD4A 3A14A 4AYXA 3HYSA 3E9EA 1ZI9A 4WZBB 4AF8A 3WB2A 3D3QA 1G4AE 1IAVA 1MXFA 2PMDA 1UMDB 2R9VA 3CZ4A 3FPCA 5AKJA 2CJXA 4PC2A 5GOTA 2XGOA 2YFQA 4ID9A 2YV2A 4X7RA 3NHKA 3I6IA 5KOYA 1RQPA 5TMBA 4L1KA 3U1BA 4Q9DA 5A02A 2XSZD 4HB4A 2ZAGA 3UG6A 1KEEB 3A28A 4OHBA 2FN7A 1XZ8A 4TRMA 5DM0A 5HQJA 5M34A 1RAFA 2OFWA 3NETA 4I19A 3HCEA 2BMFA 2Z1MA 3O38A 2ZJYA 1J25A 3X1KA 4FPXA 3H3JA 5BQ5A 3Q0IA 5K4GA 4BCBA 4D4MA 5ADVA 5LXTA 1VIMA 5ALQA 2QV7A 3SDSA 2FGKA 3R4VA 4Y2UA 4XRRA 5C46F 3QEMA 2F3QA 1DAPA 3OE5A 1T1SA 5H3LA 3DEHA 1C0LA 1RQNA 2QN2A 4I55A 1PNQA 2JDID 3ZWMA 5J2TF 2GMWA 1ZSYA 1S1MA 3IA7A 4HUTA 3WJ7A 1V96A 3VC2A 2XE6A 4ZZ1A 2J4DA 4EJFA 3S5JA 3T1YB 3X2EA 3QEAZ 4F8YA 1UBFA 5ALLA 2ISQA 3V8NA 4BKRA 1G8HA 5B2FA 2PO5A 2CVPA 1GGJA 3DFFA 1VPWA 1TJYA 4K03A 4ITVA 1WMFA 1N0IA 1ZG3A 3E9MA 1WDTA 1N32B 4V24A 3HN6A 3T7KA 1R7RA 2IPMA 5ECYA 4NBWA 1T0UA 3ADOA 3ASYA 4QJBA 4DYHA 1UXHA 3PXBA 1PR6A 3IBCA 4CQJA 6LDHA 3H87A 2WW8A 3OEWA 1O97D 3W8EA 4BC0A 1VQ1A 5I4BA 4K9OA 3R2JA 5MGNA 5EIXA 1LEHA 4RJ2A 5FHQA 4CM3A 3C8ZA 3GLTA 2QVZX 4NZ9A 4X63A 4BNMA 1W9HA 5FBZA 1G3QA 2GZMA 1EXNA 4TMVA 1C2TA 4YK7A 2OV3A 2VJMB 4JJEA 3FNRA 4FZ5A 1TGYA 3H2YA 4C29A 2HF8A 4ACAA 2R8PA 3PQ5A 4EFLA 3EMKA 3A6LA 4X8HA 1SQGA 1YULA 1BE6A 2EIHA 5G41A 3VVCA 3P0IA 2IEGA 1BA2A 2BM9A 2OFPA 4X24A 1Y63A 1ZDMA 1DU4A 1QF7A 4UFPA 1WTAA 3R3VA 4MDHA 3R7DA 1TOAA 5EYPB 2VL7A 3F5QA 2BMVA 4D97A 1ZICA 3LQRA 1G64A 1K0UA 1NW9B 1Y7HA 4YLGA 4LECA 4EYQA 1AKEA 4OREX 5EE9A 2DEUA 3ZCXA 2JKZA 2P5TB 4BQIA 5LQDA 4LZOA 4HBZA 4YXWA 3RYHA 1BCRB 1NLZA 3H04A 4D92A 4EVSA 2GN4A 3OJXA 5BQPA 5F78A 3RFFA 3S81A 4DCCA 4PIMA 3VKGA 1I8TA 3VOTA 3B2QA 1QO0D 4FOPA 3M83A 3QU7A 4BLPA 1E5LA 1WZUA 3IQEA 3SY8A 1JALA 4MMZB 2KBFA 2RB5A 1KYXA 3EXIA 4KUGA 4WJZA 5EIFA 5JPIA 821PA 3OHSX 3OX1A 3GYBA 5HKOA 1UMBA 2C9OA 5THQA 1JLLA 3QVWA 2O05A 2X9LA 1CZKA 4K05A 4XOIA 4HYQA 5AW7A 3S6JA 1QVWA 2GK3A 3PX7A 2X0RA 3I9KA 1W5SA 4R9RA 3GLFE 1BA3A 1PYOA 3NC1C 4U39A 3FTPA 2O19A 4L85A 4Q93A 1ATZA 4ENQA 5CBPA 1LQ2A 1PNTA 2CLSA 1DXQA 2EW8A 5EJ4A 1IHPA 2AOXA 2RONA 5BSMA 3D8TA 3IE1A 4WKBA 3LH5A 1ADCA 3IQFA 1Z3CA 1P1KA 2F1OA 2M32A 4B79A 1F0YA 2W6NA 1NE7A 4JXKA 3TTYA 1ZM7A 1OC2A 4LAFA 3RGGA 4EOGA 1KVUA 1QYVA 5EXSA 3HN7A 5FI0B 2VAWA 2VXCA 4Y6LA 3H42B 4YRPA 3S8YA 1GSOA 4F4UA 4ZJPA 1U0EA 2AD1A 3OLWA 1PEKE 4I1SA 2FPIB 2R5FA 1XXHA 5DYNA 3E1GA 3KYDA 1M2VA 2Q0SA 2VIIA 1OWOA 4W7SA 3RSZA 3T0FA 1U0JA 3KJHA 4YAOA 5F7OA 5AVKA 1NAIA 2CLLB 2GBPA 2ZYRA 3O0TA 3MNFA 4NYJQ 3FF1A 3ZHCA 3H5TA 4JI0B 1A9QA 4OH7A 1GL7A 1KI7A 3H5OA 3FCUB 3RS3A 1G8KA 1YE5A 2RK4A 3QMPA 3CLVA 5FWXA 3W9BA 5DHTA 2H9AA 5KX5B 4Y1EA 2P9FA 3NO4A 4HWGA 1NJ6A 4LDAA 2BP7B 4ZZ3A 4EF5A 3OT4A 5C4IA 1EQ2A 2RDMA 2RHWA 4NAVA 4J1QA 4YRGA 2V6BA 4LQ4A 4CL0A 1OFGA 1YZYA 5U4QA 2FPGB 1PW7A 2ZDGA 2ZSAA 3U56A 2L69A 3HHEA 4LXIA 4D8TA 4Z9BA 2Q2OA 2J7PA 4D9MA 2VRCA 2JBAA 3ZHXA 2VK1A 3JQ9C 3VZRA 3IQZA 3IYLW 4BFVA 2BELA 1UJ2A 2WYVA 3VYUB 4CFZA 1V5GA 4DCPA 1H23A 5GIOE 4MI9A 4I81A 3L1JA 4PIPA 3SLRA 1BDHA 1CDEA 3IPCA 3WYAA 3O1IC 3B85A 3W06A 4TUYF 4Y6QA 1SXJE 2B0JA 2VP4A 4PQEA 4EEKA 5I6DA 3EZ9A 2YWHA 1FS4A 4J0JA 1UBSB 2O6LA 1UXKA 4NY1A 2VTBA 2JEZA 3FHJA 3RIGA 3AM5A 3LF2A 4DREA 4DRYA 2FUNB 1MOPA 4CF4A 3L0ZA 2XUGA 2ZUSA 4H7FA 1EVQA 3H4MA 4CXMA 2PV0A 4WZAA 2VYNA 2R44A 1FPQA 2PLAA 1B41A 1YJXA 1CNMA 3CH5A 3FOWA 3LX5A 4O8ZA 1FXUA 2A5GA 5CH5A 1HG1A 3F9RA 1SRQA 2OD2A 3IT2A 3M5CA 1EDBA 2QTHA 2VZ9A 4XCQA 4DL9A 3S8MA 4KDEA 5BORA 1T0BA 1UBHS 3AG5A 4CIBA 1TEZA 5DX8A 3ZD7A 3ZKAA 3TG8A 1CZHA 3F7TA 4PG6A 5LNK1 4Z49A 1QZZA 5DE3A 4CU2A 1NJFA 2BZGA 4LNHA 4YY3B 4HRAA 4R1OA 1Z9BA 2SECE 3PXUA 2H4FA 2V3VA 4H1VA 1NU6A 2NSHA 2XYGA 1LK0A 1R00A 2W4QA 2BEVA 2REOA 4UUPA 3UB2A 3WLIA 5F2EA 2V7VA 4M0PA 1TYAE 3D5TA 3H2HA 2VNJA 4NYIQ 3HUEA 4XDHA 2P68A 4LKRA 3PP8A 2ONYA 3G2JA 1EJ6A 3JY6A 3MB5A 4O1IA 4Q01A 5HKBA 5LP6A 4EGSA 4YGYA 2RK6A 2NP6A 4TQ9A 3HE3A 5EE0A 1NXTA 3R9KA 2FFQA 2ANCA 3O8LA 1F0NA 3WLNA 1R16A 5L51A 3U6BA 4MP8A 5FHRA 2CXXA 3L8HA 1QV7A 2ZBEA 3KELA 5ECDA 3T1NA 1E5DA 1T3ZA 2XYRA 4K0RA 2Z6AA 2FN8A 2JIZA 3LGAA 3OM9A 2QQ5A 4C03A 1V1MA 2XQKA 4RSRA 2PXAA 3K70C 3OZBA 2VK8A 4FD2A 4AO7A 1OGIA 2ZYTX 2QTWB 3TZHA 1FNMA 2FZKA 2ZIUB 4MJ3A 3OLQA 4LDQA 1XQWA 1Z0SA 2YHUA 2IY9A 2NV6A 1YDEA 4MKFA 4DNPA 1E1NA 2I4IA 2BGNA 4CF6A 1SY7A 2B25A 4ZV7A 2EFGA 1R9GA 4JMLA 4KRFA 4CTMA 1UFOA 1SU4A 1ZD9A 2A0UA 5ALJA 2Y1CA 4ZOAA 4W5WA 4DR2B 2H4WA 2JIOA 3IERA 4MQLA 5CGZA 4Q4DA 2AZMA 2DSNA 5LQUA 3AIIA 4GPAA 4JL5A 3PEWA 2N0SA 1S9HA 1EGAA 4DTIA 1HZZA 1QF9A 4NV0A 4KE6A 5CX1A 4QOIA 4UHJA 4ESOA 2P4UA 3G2NA 5AYVA 3KXPA 2HT6A 3FBWA 4F04A 5JZ9A 1JXMA 1SZJG 2DGDA 4RTSA 4EG1A 1PV2A 3HFRA 4JYCA 1SWWA 4I4TA 4LHVA 2HHJA 3HJHA 1CQJA 5C9ZA 4HWPA 3M6AA 4ZT5A 4QU5A 4C7VA 1XNGA 5EZYB 2B3TA 4ZEWA 2PJZA 3FVQA 4PANA 5J5AA 4HH4A 3A70A 1OLOA 3M9XA 4QTUB 3RLIA 3QGMA 5REQA 3RAGA 4RS4A 4CLRB 3K71B 4RTLA 3B20A 1K2WA 1IYZA 3SFZA 3BA1A 3WMWA 1BCSB 1BU8A 2FWBA 1SEPA 3P52A 3DL0A 1J0DA 2QRQA 3IKMB 3KOYA 3O4FA 4GOXA 1RPZA 1Q92A 4I14A 4B6FA 4RESA 1L7OA 2FMKA 2DH6A 3FBTA 4MGEA 2FLVA 2GCNA 1JAZA 1M33A 1RKUA 4TTIA 2V5AA 1ZGCA 4U7HA 1K7YA 4WXRA 4EHAA 5DXFA 4MHSA 3X1MA 3Q6IA 1PSWA 4OH1A 1NX9A 1P1HA 3N0TA 4BFTA 1YB5A 4CKEA 3UV6A 1I0IA 1X39A 4QJIA 1TAGA 3TYXA 2KHZA 4DVJA 4ROTA 4ZOLB 5D85A 2IP1A 4NCIA 4MUGA 3MTQA 2IDJA 2EF0A 5JBIA 2B7LA 3NBYC 1T9AA 3HBAA 3Q3CA 1U7TA 2GN9A 4BWFB 4N76A 1YE8A 3OQIA 2OPBA 2PQ6A 3F4KA 4CIVA 5ULLA 3K30A 4GPEA 4URXR 2O23A 2G6BA 4W5TA 4DM7A 1V7ZA 2LPMA 5ILQA 4JJ4A 1MV5A 4IQ4A 4EMTA 2NT4A 3C3WA 3H9CA 1DC3A 4Q16A 4KCGA 1YZTA 3G5LA 3KV3O 4X1IA 1NBOA 3PNKA 5EPEA 1JI3A 5FNZA 5L4LA 2FSUA 3OEED 1A2QA 1RHMA 4YUVA 1CHNA 3NAMA 2C7GA 5CLGA 4A9AA 4LJAA 1C8LA 3ST7A 2A0KA 4LSGA 4KIJA 1QQ6A 3AL3A 4CCYA 2RE8A 3PHHA 4EITA 2I2CA 3RSLA 3N7TA 3SSNA 3WWDA 4RPHA 1JJAA 5FPYA 4RDXA 3FE2A 1TLTA 3LDGA 4RIHA 2YJGA 3QE4A 1NT2A 4M9UA 1Y6FA 9ATCA 1ZINA 1JEYA 3OEYA 4XQCA 2D8AA 4NESA 1MHPA 3DLHA 4JI7B 2X23A 2ZRJA 5BT8A 5JSZB 2P2YA 4OLFA 4RPIA 4W8HA 4WXPA 4YFYA 5FP0A 2GPBA 4CCAA 1VCIA 1PO7A 2VVTA 5IS2A 1M0EA 2NT3A 3WNDA 1HRKA 1LV7A 4A1OA 3WLOA 1NVUQ 1Z0JA 3QLJA 4PWYA 4ZXFA 3SQOA 1H1TA 4C05A 4B3IA 5JWRA 1P6UA 2NYVA 3E48A 4GQAA 3S99A 3U3OA 2J0SA 4PF1A 2AK2A 2A3RA 3BBLA 3DDOA 3DZBA 3GLRA 3RSQA 5JQGA 2K87A 1H1LA 2AZXA 1WCIA 2BMWA 1HFWA 2QZ9A 4JVOA 3D1LA 3NASA 3WNZA 1T9BA 4B6JA 2QS9A 3OX3A 4GXRA 1UPTA 4D81A 3AEQA 4GH5A 4TWAA 4ZJUA 5JADA 2PUDA 1XTQA 2DTXA 2G1UA 1DQZA 2PVPA 3QOWA 4MVYA 1E2QA 4ZPJA 2V6JA 4RJLA 3RFCA 3TUJC 4ARCA 2I1QA 1VG8A 3MLEA 4PBRA 4Q3CA 1U8UA 4XIFA 3K4QA 2JANA 3CA8A 1C9KA 3FRHA 3N0WA 2PXHA 1B7GO 3JQ6A 4NDNE 5CXSA 5G0VA 5T3YA 2BEJA 2FMTA 1RTKA 1TQ6A 3P7MA 4BNFA 3D1VA 3Q1KA 4RWEA 1H2XA 2F3UA 1YH3A 2YYYA 4QPCA 1J00A 1A27A 5CDHA 1T1IA 4WCFB 4WY5A 1XTVA 2HCRA 4B5KA 2ICAA 3TL6A 3ZR4B 3W05A 3M6WA 1DFHA 3KQSA 3IILA 5BXYA 2JC3A 2FDCA 4I1YA 4H35A 4YWHA 3CUYA 3OFKA 3ROFA 5H9VA 1CNFA 1A50B 3VO8A 2OMKA 4HD8A 4TV9A 5BMVF 3DZKA 2GARA 3HMQA 4V0SA 3LUDA 5CNIA 2NQ8A 1SFRA 1FE8A 3WGUA 4WOBA 4IZHA 3ZWAA 1PHPA 1ISGA 3C7KA 2VSNA 5C3MA 5KSWB 3AUTA 4YMGA 1DQNA 2M6LA 1R88A 2WUVA 1ZBQA 4PR0A 1TAHA 2P8JA 4H3SA 4J8PA 2XA9A 3IP6A 1FC0A 1OA0A 2ODNA 4HNAA 2HD4A 4RVDA 4JGGA 3RHSA 4KHPB 4YDSA 1UWLA 4IJMA 4EVIA 3KKMA 4XD7D 3KTAB 4QDJA 3ZCPA 1PX2A 4TKUA 1ZK1A 1W2GA 3RRYA 3NNSA 3AF6A 4JKIA 4AJ2A 1NMYA 2Q1SA 5HM6A 4EGAA 3NORA 1NVMB 3FCCA 1QE0A 2F3RA 3GMTA 3OJLA 3WNCA 4IIFA 3TIIA 3VA7A 2MYNA 1K6EA 2ZITA 1C30B 1HE1C 1VL6A 1Y8CA 1FP4A 2AXPA 2GHQA 1G7SA 4FYYA 5DT2A 2EKBA 2FPPB 2N1MA 3O3NB 4GRDA 3B60A 1JPNA 3NU1A 4J3JA 4IQGA 1JDVA 3BIOA 5JAPA 2CCKA 4NI5A 3CUVA 1ESCA 3ZHRA 4F71A 1TCAA 4EUHA 3EPHA 2HEIA 3P94A 2PLFA 1EP1B 2K6GA 3AYZB 4JVMA 2M1ZA 5BMOA 4WBNA 1FZTA 1VLZA 5TVKA 3WK6A 3DNMA 4N0DA 5DX0A 2F59A 2BZSA 2W6JA 4XE5A 5DI3B 5TNXA 4F3YA 2CNOA 5E4YA 2VP6A 2WTEA 1I14A 3IAS6 1OZGA 2HJWA 5F5LA 4NRDA 3V8BA 2ZM5A 1T3LA 3M1LA 1U98A 3AF0A 3KJQA 2VXYA 2W5UA 5ERXA 5G3ZA 4DCMA 4LYAA 4BFCA 4PN3A 3WBFA 1K8YB 3PL1A 2R68A 1C9NA 4KXNA 5IYZF 3E61A 4DXHA 1C8KA 2UXBB 3RS4A 1XPUA 3DD5A 4YJDA 4AMVA 4DMMA 5L9AA 5BNZA 4TMWA 1RLUA 5BT9A 4K9MA 2CJPA 3CLRC 4PNZA 2Q5CA 1ECJA 2A9OA 3HB0A 2IIPA 3L02A 3PDCA 1D1SA 4RMIA 1AZWA 4DCUA 4J1TC 2IX3A 3RNOA 4UVDA 4P4TA 4G2TA 5CB0A 2I2XB 3R44A 2Q2NA 4ZANA 5EI5A 4EPTA 1E4VA 1B4DA 1RD4A 2V3CC 1YU9A 5HTOA 2PUVA 3DDUA 1JHXA 3ZOKA 4PHGA 5E7JA 4KNYA 1H6AA 4YONB 2ODEA 4ERXA 3CR3C 4CBVA 2NACA 2Z5FA 4OK3A 1T9DA 1X7XA 2G63A 2PUJA 3BQNB 3UQZA 4DCNA 4M9SA 3WFZA 3AESA 4X3CA 3P0JA 2PZAA 2CDRA 4D44A 2O8DA 2B20A 2CFIA 2P6OA 2V0NA 4YTEA 4ZALA 3AW9A 1OU0A 3C7AA 1S3GA 1Z17A 4E4RA 2UUAB 3M1IA 1U7UA 2P4HX 4FINA 3I2IA 1XZQA 1KP2A 1XKLA 3MZ0A 3LO8A 4U02A 2VT2A 5H81A 4L5CA 4K9QA 3X2SA 1RWPA 1EP9A 2E4AA 2GCPA 1Z4KA 1K1EA 4PFJA 3S29A 1JJIA 2JDIA 4LMBA 2NVUB 2JFHA 1ZW6A 3JPWA 3PK0A 4MJXA 5L4NA 3R5FA 4JI2B 5HCUA 2DB3A 1O8CA 2BWJA 3C4QA 4O2RA 1EUYA 1SUIA 2AXEA 3DHVA 1QGDA 4BN5A 2YWGA 5BR7A 5JCPA 5CA1A 1QP7A 2PT6A 3WIUA 2AG5A 5AOCA 1O96B 2YJ6A 3I12A 4IH9A 1VE9A 3CH7A 3U4IA 1RAHA 4NOJA 3SZOA 5C8VA 3B1JA 9LDTA 3AUXA 5FTNA 3UH1A 2X4IA 4OEHA 3WLPA 4DNXA 1YASA 4B3TB 3AI1A 1UZLA 1U8AA 1FFEA 3GFRA 2ZJ6A 5EP1A 4BNDA 3IL2A 1BJTA 1BXRA 1HDGO 1QVZA 3IELA 4YVFA 2HFJA 4K0KB 1T1JA 4II2A 1UPXA 2WZCA 5LB4A 2ZUBA 3OWHA 1KQGA 2P3LA 5BVGB 2VFAA 2QORA 2Z5GA 3M6XA 3TIFA 4H7EA 4UZSA 1NC1A 2OD9A 4YUAA 4CLEA 1HDXA 4QQRA 2P9CA 4AY3A 4DAEA 3MINB 1NSTA 2UZAA 2M1XA 5JC8A 1LDYA 1SBNE 1UP7A 4YJ3A 3OG9A 4B2LA 2NO9A 2RGYA 3K0HA 2A5JA 3SEZA 2RH8A 4KSCA 2FYTA 2QWXA 3U48A 1VPDA 2PUHA 1ZK4A 4RLQA 5CD9A 1Y1KE 1U5AA 1JXOA 1ZMOA 1CU1A 3QG1A 4E5VA 4JXZA 3C3AA 2XMSA 3VZQA 4HYYA 3BXPA 1DBQA 4AP5A 4ARZB 2P9BA 2Z6VA 4F5EA 4PVCA 4EKYA 2EJUA 4BMOB 2ZYDA 4NPAA 4WN3A 3OTIA 3WWEA 3F7MA 2JFXA 3LC1O 4L8YA 5L95A 1HSZA 3I64A 3JQAB 3CN7A 3HGQA 1P7CA 2NUTB 4UUBA 2QLJA 3KZ1E 5D3MB 1T4BA 4KGVA 5TR9A 3ZQJA 4LHZA 1NG1A 1W48A 2OAQ1 4HNGA 1JSLA 2MSEB 2WT9A 1O2DA 4J1SA 4MCIA 4OKNA 4QXPA 3VO9A 3ZJ4A 4JKOA 1GVHA 1RP1A 2YHBA 3ZIUA 4OY3A 3TW8B 3TMYA 3E5RA 1EFVB 1NKVA 1UINA 3DBVO 1QO0A 4RVOA 2VPQA 1U7HA 3EFOA 2IV7A 5ITZA 4MVJH 4DWVA 1ZD1A 2VZEA 3ZDYB 3ZXSA 5IRCD 3E9CA 2YQ5A 4DJFC 1V95A 3EEBA 2AG0A 2JCGA 3CJQA 3ECSA 5JMPA 1GZ4A 5ICSA 4Q18A 1E8NA 5JEEA 2FW1A 3VGPA 3THSA 1YIDA 2VP3A 1XMSA 5CA1F 5KNCD 3UGJA 4ZZ0A 2BDTA 2NUBA 3Q8LA 4M46A 4TYPA 4XUCA 3GFOA 3IBTA 1I7PA 1R8JA 3QV2A 4LRQA 2O52A 3HV2A 3WR5A 2V58A 4HV4A 3ZH2A 1UPCA 4Z7OB 1Z4IA 2QTAA 5EIAA 1L7NA 1XMPA 1L3CA 1VRVA 1W1UA 3JCZA 2OY0A 2P30A 4LBVA 4TROA 3LIPA 4LTDA 4TYNA 1NFRA 3L77A 2CXPA 2NV0A 3QXJA 3IKLA 3KVNA 3GAZA 1XNJA 4CN8A 3THXB 3OUZA 1W36D 3IOYA 1XJCA 3KQWA 5DDIP 1OV4A 2E48A 4CM4A 4NZNA 4KR6A 3E82A 2DTEA 3MLBA 4LJYA 5DXAA 4B80A 4BQSA 5IXSA 5BW5A 4BXOB 1B8PA 1SOVA 1YB4A 3GQBB 2AVDA 2QTGA 4KQCA 2WQ6A 1ETUA 1YCFA 4DQKA 1FXWF 4XEHA 1ODKA 1SPXA 1KPHA 2O2YA 3MWYW 5JMTA 4CEJB 4LV8B 4UMFA 4C0LA 1DDOA 3Q6MA 4Q9KA 4BUCA 1DKLA 3D8SA 4RXTA 2W58A 3REQB 4Z7QB 2ZUDA 1X9GA 3JQPA 3KOOA 5D01A 4C7OB 1J0CA 5JNUA 4AIIA 4WZ6A 3VC3A 4GBJA 3F96A 1UH5A 3NJ8A 3TQQA 1O87A 2QL9A 3ANSA 4NMHA 1OWLA 3RC1A 2B7CA 2UAGA 4JCOA 2R47A 3ZZMA 1D8TA 4QRDA 1XNQB 1WO8A 1QO9A 1FYXA 2ZJAA 2EC5A 1FFXB 3P26A 3D3EA 3AR7A 1FFDA 4OJKA 1C7IA 5TRTA 2QD4A 3W5AA 3T99A 2ATIA 1PJ3A 1OQAA 1ZR4A 2W2MA 2D1TA 4LIPD 2ATXA 1QVVA 2V6GA 1DG9A 5EWLA 3RVMA 5I9IA 3KKPA 2QUBA 3VPAA 3U4MA 1GCAA 4MP6A 4R8KA 1GRCA 4WECA 3WKDA 1QG6A 3JQEA 3R0JA 5C7YA 1CC1S 4Q7MB 4R2MA 4YRRA 4JLKA 4H17A 3M81A 5AM0A 3WL5A 2X3YA 4RV5A 4IMRA 4W6QA 2YFYA 4G84A 3ILVA 1UK9A 1GITA 1ADFA 1BTOA 1WMDA 2B34A 2DC1A 4RBNA 4Y0AA 4EPWA 3THYA 1YV9A 5JI2E 1E2MA 1B42A 4B8ZA 2NSJA 3HB4X 3L6RA 4JR2A 3WZ2A 2ZTUA 2XNDA 1ADBA 2ODAA 4IO1A 4LJ5A 5CPFA 4L4SA 3O4RA 3PE6A 4B3DA 4N7JA 1IWBB 3AI3A 4YR9A 3G8DA 1J8QA 4C4XA 3UBMA 4R1LA 3T38A 1XLWA 3BIWA 4IRXA 1S4QA 1DP4A 3BMOA 3EAGA 3MMNA 3P1JA 3W4KA 3HY6A 4JZKA 4KXMA 3V1TC 5ABPA 3ACCA 3GIWA 3M34A 3R6GA 4BQQA 4RYLA 1U8ZA 4WDRA 1YK1A 5F35A 3AUFA 5FBRB 2B3DA 2J09A 4RFSA 2QAGA 1RM0A 5GAJA 1XKTA 3UJ8A 3W5SA 1MGPA 3L6EA 1P60A 5B64A 3T9BA 1JH9A 3OUTA 4ZQFA 2BMJA 1OV6A 3ZHZA 5JS8A 3B78A 4EG3A 4P3YA 2PKEA 3ZV5A 2XCRB 2QRLA 1TA0A 2EZTA 4C2TA 3C6BA 2OYSA 1G2PA 2IIQA 3E6AA 3Q8KA 1N5MA 1K88A 3PFBA 2OORA 1RXIA 1Q21A 2E9SA 3GB9A 4IXDA 2VR1A 4DHWA 2O59A 4RKQA 1NVBA 3ANNA 5CXXA 4B2IA 1XQYA 1VE7A 1VHLA 4LQDA 5CT9A 1PS8A 5GADl 1J8DA 1XE3A 1EM6A 2W6QA 1QRSA 4J0GA 4BQNA 3CLSC 3LRXA 4AMBA 2QVCA 5ESXA 4N3NA 4TZ6A 2DHDA 4H4EA 4E32A 3AJDA 4OHUA 4UPEA 2Z4TA 3NYWA 1G5HA 3PA8A 1L4MA 5LMCA 2ZRMA 1X1DA 3STUA 3GC6A 1N4DA 2HSDA 2NSYA 2F3SA 3DTNA 3O4VA 1WW2A 3QLUC 3P9NA 4GX1A 4HJXA 4TZKA 1ONNA 3I3SR 3FLMA 3S27A 4RPGA 3JATA 3EMVA 5K2OA 1HOXA 3CW2A 4HT3B 3IEXA 4HQNA 1B8UA 4PNEA 4FEAA 2AJBA 1MRSA 2I7CA 2OCXA 2G77B 2QE7D 2PMEA 2ONJA 3TZQA 1C1DB 2NNLD 5ALTA 5K3DA 3CVYA 5LNK6 4BN4A 1T5HX 5E6UA 5FFFA 1EWKA 2DPHA 2J59A 3PQFA 3DYVA 3MS4A 3T5BA 1NXPA 2DFNA 3MCWA 4RVFA 3VU3A 2IYTA 2V5VA 3AZQA 3LKVA 3AJAA 3GZNA 1E2UA 2W4IA 3EGXB 4UM8B 5DGXA 4ARSA 3PX3A 1LKZA 4BBPA 2G1JA 1E3WB 4ZYWA 5ADUS 1R4MB 2QYSA 3Q4GA 3W1EA 2FPUA 4DVGA 2Q9UA 4ZQGA 3N2LA 1AQLA 4IFTA 3X1WA 1VCNA 5DYTA 1MFPA 2WHYA 2PSFA 4QUBA 4UUNA 4CWAA 1NF9A 4KMSA 4BB9A 1DBSA 4TMYA 4UHFA 3ZI7A 2AD5A 1QQ7A 1T2CA 5EWMB 5TXGA 3I28A 3WB0A 5IF9A 3AVYA 2V03A 2X14A 2HK6A 3E1KA 3RODA 4F11A 4QG3A 1E1CB 4L5YA 4PYRA 5KYXB 1KXZA 4EDFA 4GF5A 3KYCB 4JBYA 1EUCB 1UJCA 5CTAA 1DJLA 4F06A 3RHZA 3RKRA 3RVBA 1YJQA 1SQ0A 4GZMA 4MTCA 4XDYA 5E6SA 2DPMA 3GEEA 3I2YX 5IAOA 1J7KA 3GLGE 4BQRA 1V3TA 2RGGA 3OM8A 4HGYA 1D8AA 2L42A 3VNBA 3BF7A 3E70C 4MWSA 2IEZA 2J3JA 1XTRA 4YRCA 3T35A 1ONPA 4BFZA 4JB8A 2GQ0A 2H1WA 2HT1A 2JKVA 1BYIA 1HXHA 2A1IA 2QR2A 2WJZB 3DWFA 3QVGA 4HEHA 5SY6A 2JBHA 4F84A 2UU9B 1GCUA 5K0SA 1OI4A 1R5OA 3VNQA 1QRDA 1P18A 5FPQA 1NMZA 4JKYA 4HPJB 4RZ3A 4TX1A 1V9LA 3DDSA 5JHGB 3MWLA 4M2LA 1TLFA 1AKVA 4O2AF 4P8RA 2NVWA 5AJYA 1S8NA 4FFOA 1KY4A 4A27A 4I1IA 3MOSA 1CPYA 1WXFA 1E7YA 1U3GA 4LDZA 3ZQKA 1AV7A 4YJGA 1Z83A 4JI8B 2PFKA 3VSEA 3PNBA 1Y0BA 1Y8QB 1WKVA 3EXEA 1L4HA 4KU4A 5JJCA 3H6KA 4AICA 2PM8A 3DV0A 4O02B 3U44A 1G21B 4OFZA 2I71A 1QB8A 2IPLA 5B1DA 4PC3A 3EC7A 1YZQA 3UUFA 3H2SA 4IF6A 1GILA 1VLJA 2I6GA 2SICE 2CFCA 4OHFA 3WFJA 5ALYA 5JH7F 4UCFA 4DZZA 2F4VB 3LX4A 1KBOA 3MMPA 1C9DB 1FSZA 3B5EA 4GGOA 1FNNA 4LBZA 4QA9A 3OC0A 5IJXA 1ECFA 5CAEB 2LGJA 4PCVA 1NPDA 2PL1A 1KO4A 1L7MA 3LOUA 2QGZA 4DV7B 1NBME 1YQWA 2AK3A 2IELA 2XV1A 3DPUA 3V55A 2OHFA 1A0OA 1YS2X 2Q7XA 1OY1A 2OV4A 4CI0B 2CV0A 3TNLA 1GA1A 2ZSKA 1DO8A 1X8KA 3CW8X 4PVDA 4ZICA 1H6BA 2IVFA 3SE0A 2JFZA 5LBTA 3RBAA 2IE8A 4KK3A 4CQMD 3MG9A 4W99A 1FP2A 4OJMX 3TOZA 2WF7A 4DILA 5GIPE 4Q4JB 4RJIA 3H5NA 1KK3A 4N0MA 2Y1DA 3K0FA 4Z2YA 4M8IA 3G5AA 1E3MA 2MOKA 3NEPX 3DP9A 2OXFA 2J8ZA 1BD4A 4XIJA 4EJ6A 5KQGA 3AB8A 1KTVA 1XF1A 1RQ7A 2FEWB 3L82B 4EYGA 5GVRA 4R16A 1O94C 1JNXX 2PTHA 3EWIA 3PPYA 3QE0A 4XASA 3AI7A 5E2BA 5K8TA 2HTFA 2QIPA 1KQOA 1OAOA 2R6ZA 2VBIA 1KFEB 1P1JA 1YOBA 3MWEB 1QTNA 1XHEA 1I2DA 3AF2A 4JWKA 4KAJA 5AJTA 3ZW9A 7MHTA 4IUYA 3RTDA 3ZC3A 5J3JA 4RUKA 4K46A 4AN4A 1M1YA 1TC2A 1A77A 3K9FC 1GUFA 1GDTA 2WHEA 4GMHA 4L07A 3MWDA 1VL2A 4ZHQB 2JCYA 1IHDA 1FSPA 1GPWB 2VYFA 1LI5A 1TTQB 4PSCA 1HDEA 1BEZA 3TFQA 2G09A 4X54A 2Q3EA 3EGDA 1HYHA 2AWNA 3C6QA 5HIJA 5IAEA 1U5BB 3QJ5A 2ZSFA 2CL0X 1QIKA 4K2HA 2PYZA 1LPAB 4QRHA 5EGNA 3EEOA 1DC4A 1XMOB 2FTKE 3O8QA 4PGFA 3DLBA 4UXIA 1I33A 2FPKA 1M8FA 4JJZA 1SA0A 3K8QA 4R40A 4OB7A 3VNRA 4DBLE 4CMGA 3RUHA 1Y42X 4JC4A 3WNBA 2C82A 3EZ6A 1F9AA 4C0WA 5AVTA 3IAUA 4EYOA 1IZ9A 2CMFA 1FS5A 5TJHA 5BNFA 1NYTA 2J5RA 3K9BA 4O4HB 4L50A 3GIDA 4F3TA 1BS9A 4UVIA 5D7BA 2NGRA 2NSDA 3F5DA 4BKOA 4MARA 4YJ2B 5EP2A 2NLOA 3CZ9A 4MA4A 3O84A 4KO4S 4E22A 1CE8B 3CVUA 3EBLA 3ESDA 2VQEB 4BO1A 1DIGA 1YCHA 1Z6TA 1AZLA 2JLBA 4B2PA 2Q9CA 1RWOA 1IB0A 4GOOD 4DEVA 4DLWA 4CT5A 1I30A 3F7NA 3PWTA 4R2IA 5IVIA 2CL6X 4M87A 3U5ZB 2PV7A 2B1IA 1YNOA 5A62A 2UYOA 3IAHA 4LOLA 4XD7A 1MB0A 4QYTA 4EUEA 2WYIA 1JAYA 1QZTA 1CUDA 4EKEA 3WNVA 1JUDA 2PWBA 3WGNA 3F1KA 1XN4A 1UEIA 3DPIA 5CFMA 1KVRA 2B92A 3HUUA 4BAUA 1T6YA 1H0RA 1TU0A 1NJ2A 1RC1A 2NZXA 2O0MA 3A9RA 3QPWA 2IYYA 1MORA 1ICEA 2XEDA 4D6XA 1LBTA 3IEVA 4LYDA 1CY7A 3OM1A 3DOJA 3EK2A 1M1XB 1FX1A 2NVBA 4I6EA 3AUKA 3UW3A 3A1SA 2ZB7A 1T2UA 2QTTA 3MJRA 1SC6A 2GVZC 3A6JA 4JBLA 3ZN2A 2WYHA 1JYEA 5GGYA 2JS7A 1AB5A 4I08A 5IJ0A 2NUAB 2DQYA 5BY2A 1A1VA 2SKCA 5EIBD 1R50A 2DAPA 3H0KA 1V4BA 1IJFA 3EVFA 1LA2A 3ONEA 1ZH4A 4XPZA 4ZFNA 2QVGA 2RGCA 5LQSA 1X7ZB 5DH9A 3U3XA 3BD9A 3EA0A 1J8MF 4OUKX 5EMNA 5KTKA 5C4MA 4N1AA 3OPYB 5K0EA 4F7