4WCFA

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfA00
3FNGA 1QR6A 1NHGA 2OL4A 2QG4A 5JAQA 3QRWA 3I52A 4YBZA 4MP3A 1UH5A 1I32A 1MA0A 4TRMA 5B12A 4N7RA 3U4HA 4F3YA 3F3SA 4AJNA 4GAEA 1EQUA 3E9MA 1UXGA 4XWYA 3DBHA 2P68A 2QHXA 4FCCA 4E33A 2C29D 3SVTA 1B2LA 2BFOA 3CMMA 1NYTA 1R37A 2Z1NA 4TRJA 4ZQFA 4YAKA 3W8FA 2FY8A 2ZKLA 1T2CA 1E5LA 3WBFA 1E77A 2E6UX 3ITDA 1NFQA 3TFQA 2G17A 3DOCA 3F4LA 3C85A 1Y1PA 2FR1A 3IC5A 4D7AA 3GZ4A 3E5RA 3U62A 4YAJA 2ZJ0A 2I3AA 1DRUA 3D3EA 1ZFNA 3HFSA 3I1JA 4WLOA 1H94A 1Y8RB 1GADO 4ALNA 1PJSA 1SEPA 2QZZA 4G81A 1C1XA 3GOHA 2HMUA 2QYTA 4XB2A 4BMNA 3RBVA 3EAGA 3DHEA 3ENKA 4I5EA 2HMSA 2YHIA 4IS2A 4DQXA 1HSZA 2D1YA 2O3UA 5DULA 2HK7A 3K8ZA 3EW7A 4RLSA 4UVGA 1U8FO 3IP1A 4DYVA 1AXEA 1P9LA 3KYCB 3H3JA 1EFLA 3K96A 3B70A 1PR9A 3AWDA 4GKBA 4W4TA 3SXPA 1PGQA 1ZK4A 1TA4A 3ADOA 1EK6A 1QYCA 3MJVA 4MJLA 3VH4A 2HK9A 3LLSA 2X5JO 1U5AA 1A27A 4XEHA 3MJSA 4N5MA 3O8QB 1P31A 5BSHA 4EJ6A 1R4NA 3MWEB 4DC0A 1PTJA 3DDNA 2AE2A 4M87A 1ID1A 1GCUA 4AG3A 2BHLA 1ZVMA 5AYVA 4PLTA 3G1UA 1DFGA 2Z95A 5KKAA 4UVDA 3UGKA 1NVGA 4U5QA 2E37A 5COQA 2CD9A 3DMTA 4NK5A 4KWHA 1TT5A 4BO4A 3WMWA 3WTCA 2E48A 3HDHA 2GYYA 3JD4A 2CF6A 4OMUA 1C0LA 1NAHA 5JAMA 4Y6RA 1G6KA 1H0KA 3JYOA 3GF4A 2A35A 2YUTA 3TZQA 4YT2A 5C7IO 5JYEA 3RWBA 2C20A 1U4SA 4BO6A 3ZWAA 1E7QA 4MVJM 1PQWA 5BNFA 5MGBA 1HE5A 3ZGYA 4QSMA 3IDSA 1NPTO 1JTVA 3KRTA 2CY0A 1GZ4A 2ZTVA 3AM3A 1HE4A 3RU9A 3DBLA 4CLEA 3RBXA 4YT4A 1AHHA 4IQ0A 4ZQEA 3PIIA 4IDGA 4CR7A 4W99A 3ZHYA 4YXFA 1D1SA 4TQGA 3TOXA 3UCFA 4ALLA 2H6EA 1FDWA 3VZRA 2WD8A 4FIZA 2OBNA 1I24A 2PKQP 1E3WB 2UVDA 1XGKA 2PGDA 4KTTE 4WPGA 5JE8A 2EG9A 1B3BA 1N5DA 2EJWA 2PNFA 1YB1A 4EZBA 3JYPA 5F5LA 3RJ5A 3OMLA 1QV7A 1NPDA 4KMSA 1H6AA 5IDQA 3A4VA 1HL3A 1J4AA 4TVBA 1R4MA 2HK8A 2YV1A 5EMHA 1WW8A 4IDEA 3HG7A 4E4YA 2O7SA 1LNQA 1WZIA 3EK2A 5TF4A 3FNFA 4D42A 2D8AA 1YH3A 4TSKA 4CL8A 3KZVA 1LDEA 2GPTA 4GI2A 5JO0A 3GPIA 2J5QA 1A7KA 3HB5X 4HFJA 3RUHA 2HO5A 1PEDA 2FN7A 1DIBA 4JCOA 1LLUA 1X0XA 4TMFA 1NASA 3VKUA 2CVQA 1Y5MA 1U1IA 1DEHA 3EZYA 4L73A 2O3SA 1A9YA 2P4QA 4GVXA 4GX2A 4AJOA 1Q0LA 2VUTA 3IOYA 3R0IA 4MDHA 3M2TA 1N2SA 4XYMA 2ZTMA 2BFAA 3LC2O 3EC7A 4JBGA 3BMCB 2B36A 4JK3A 5K9ZA 4P4LA 2XPCA 3PDUA 3WGYA 3U09A 3DAPA 1FXSA 1MX3A 4PG4A 4HWKA 4YT8A 4GMGA 2JD0A 2Q1WA 1GY8A 4DRYA 2GZ1A 4R5MA 4W9NC 4ZN6A 1EE9A 3HWRA 3K92A 2J8ZA 3VDRA 1JW9B 4J3FA 4E5MA 2QRLA 2RH4A 3DL2A 3JCZA 1ADGA 5DN9A 3ZNOA 1T1SA 3ZHZA 3ZV5A 5HS4A 2VZ8A 1SB9A 3OSUA 1HE3A 3EYWA 4QECA 4B4UA 2GZ3A 4OXNA 1LDYA 3PJEA 4KZPA 1GYPA 3ITKA 1E7SA 5FF9A 1SAYA 1GZ6A 1CEQA 4O6VA 2A9FA 4M89A 1HYGA 3V2GA 1E3JA 4GVLA 1XR3A 1KBZA 5CPFA 1NQTA 5L7YA 4CM4A 4ZU3A 1N8KA 3S2IA 2R00A 1QSGA 2OGUA 1SC6A 2DC1A 5A5FA 1EVJA 1ZXBA 3ON5A 5AXCA 2PFGA 3EDMA 4J90A 1BDMA 2CFCA 1WVGA 3ZWCA 3UUWA 2NU8A 1LLDA 2EXXA 4DLBA 4XRRA 1A7AA 5FWNA 3IJRA 1M66A 3KHUA 4CLDA 3OIFA 4BNKA 2ZYDA 3KOUA 1PZHA 2W2LA 1G1AA 2Y67A 1DJNA 2H9IA 4G65A 4MVJI 3UKOA 2DBQA 5FI5A 2GNAA 1YOVB 3IUSA 3GUCA 1GYRA 1UDCA 1LQTA 1E1MA 2I9PA 3TZHA 1ULSA 2CMDA 1J49A 4UEKA 3N58A 4OM8A 1VE9A 4I9NA 3RASA 4CMKA 1YQXA 1M67A 4DWVA 1OC4A 3OJFA 4YCAA 3GVCA 4CM6A 3PHJA 3GK3A 4KQWA 3RQSA 3QVXA 3WICA 1JN0A 1RYEA 4QFDA 4BKRA 5JY1A 3FHLA 1LRJA 3NDJA 5A03A 3JQAA 3DMTC 4FOOA 1K6JA 3BAZA 3PLRA 1ZKMA 4YJDA 1R12A 1NX6A 3K2EA 4XQCA 4NDNE 5AVOA 5L45A 4I5GA 3G3EA 1VSUA 1YDWA 5CEEA 1I2CA 2BGLA 3LSYA 1BSVA 3H9UA 4E31A 1P0CA 4R1TA 4PLCA 4E2ZA 1I2ZA 2AQ8A 2C2XA 4IIUA 5HS6A 1ULUA 3GRPA 3PQDA 4R16A 5L4LA 4ILKA 1E6WA 1BW9B 1DB3A 2VRCA 3ZNNA 4HFMA 1A5ZA 1OMOA 4LCEA 2B69A 1QYDA 2WWRA 1XQ6A 3W6ZA 1KVUA 1ZEMA 2FP4A 4D79A 3LT0A 1DC6A 1R0SA 4NU5A 3FF4A 3OEYA 3JQFA 4RVDA 4BNXA 2GLXA 3K6JA 4BO5A 2OP1A 3KSDO 2BRUA 2WTBA 3UXYA 3DZBA 4NMHA 1U3WA 1Y8QB 4KUEA 1ZW1A 2W2KB 4XIJA 5A04A 3AK4A 2D2IA 3FTNA 4BIIA 4FSHA 1TEHA 4TKMA 4PZCA 2CNBA 1FDSA 2ZIZA 3TFOA 4Z0TA 4EUFA 1TLTA 4JJGA 2UUOA 1TVEA 4XQ9A 4CM3A 2NACA 2C59A 2QRKA 3HUDA 1H6BA 1VJ1A 3VHRA 4IPTA 1HSOA 2HKIA 4ND4A 1PQPA 2I99A 3O4RA 3CH6A 1BXGA 3NV9A 4FJ2A 1OI7A 3RIHA 1U5CA 4PFJA 4WKGA 3BMQA 3V2HA 5KVQA 3WMXA 3ZWOA 3H9JA 3K31A 1RM5A 1OZAA 1NPYA 6ADHA 3ZV3A 3O26A 2B4RO 3M1AA 5BQFA 1SBYA 4CV1A 3T4XA 4J43A 3SLKA 3P2YA 4NHEA 5TNXA 3MEQA 5IG2A 1Q2XA 1ISGA 2NV6A 4CQMA 1E1NA 4WUVA 1XCBA 4OL9A 2VYNA 4QX6A 1M6WA 4CM7A 1FMCA 2GZ2A 4BL5A 3A06A 3AUSA 4DIFA 3H5AA 4BHTA 1TB4A 3GPDG 4YJFB 4MKXA 3I3OA 4IQGA 4R69A 2Q4BA 2EW8A 3G79A 4CLHA 1PS9A 3RROA 3FN4A 5F5NA 1Z75A 4ALKA 4PLGA 5CEFA 3ZHXA 2WDZA 4L4XA 1PR3A 3BMOA 1NFRA 4JQCA 5GMOA 4A26A 2VWGA 3GVIA 3PGXA 1MLDA 1PJ2A 3OJEA 4NBRA 5JXWA 3I5MA 2R00C 3GGPA 4YT5A 4B7UA 5DCYA 1PJCA 5KJEA 4K1LA 3WS7A 4U0JA 4XX0A 3GG2A 1NP3A 1U3VA 4YQYA 1UJMA 2VTDA 4E2WA 1DIGA 3DWFA 3G0OA 4Q3DA 4U7WA 3WQQA 1ADFA 1O95A 2PY6A 5DDIP 5JLAA 1VPDA 2OHXA 3OIDA 2EWMA 3NJ4A 4YWJA 3VVCA 3K73O 1V9LA 3ROKA 2X23A 2D4AA 1LTHR 2QRJA 2B4TO 2X58A 4K9DA 4WCFA 1ZJZA 4J6FA 3PGJA 4I1IA 1FDTA 2HCTA 1X15A 2IZ1A 5B1YA 1UP6A 2NVUA 1IHXA 2JCYA 3FBTA 4OQZA 5B4UA 5LDGA 4CPDA 5KOIA 4WEOA 3S8MA 3DBRB 4IY1A 4CUJA 1MG5A 4RPKA 4KOAA 4PG5A 4EW6A 1YO6A 2PGLA 2X9VA 1HDXA 3PHLA 3RC9A 3ZHBA 1GZ3A 4MVJE 4BO1A 1E3IA 1IHYA 1ENOA 1D1TA 3NDIA 5EESA 1LI4A 3OHSX 1GTMA 1PJTA 5AQ1A 4WLUA 1KC1A 2VQ3A 3WJ7A 1ZO8A 4BNIA 1JKJA 5A9SB 2IE0A 3T7CA 4RQTA 2AEFA 2NTVA 1IE3A 5B4TA 3QV1A 2DTEA 4M54A 3W4KA 2YHUA 3JV7A 5C7OO 4CM8A 2P5UA 1HKUA 1GQ2A 3FNEA 2YW9A 4LRTB 1GR0A 4CQLA 3PHIA 3MOGA 3ZWNA 1EK5A 3QVOA 2YDYA 3JQAD 4OO3A 4NJMB 3DAFA 1GPDG 4NBUA 3L6OO 3ZWVA 4CUZA 3IS3A 5TC4A 3KBOA 2ZK7A 3O9ZA 3JQFC 3SLGA 2YJZA 1JDJA 4ONEA 4YRBA 3OFSA 2WYWA 1C0KA 3PWSA 2O3QA 1ONPA 4FJ1A 3C1TA 4RDIA 2BMAA 4BNZA 3HZZA 1ZCJA 5COAA 1ZK3A 3MJEA 5BNTA 2GRAA 4M86A 5TGDA 5L4SA 4XDZA 3CPSA 3Q9UA 4PG6A 1NTOA 1E3EA 4BO2A 1D8AA 2HQ1A 3VVBA 1DAPA 5C37A 1UAGA 5GZ3A 5TX7A 4XYLA 2D59A 4K6CA 4Z9YA 4AFNA 4MVJH 3N7UA 5DZSA 2W8ZA 2Q50A 4LRSB 1QXSA 2CVOA 2J3KA 4IDFA 4J9UE 2X5KO 4B7CA 3DHYA 2HMVA 2IXBA 5ENDA 4EDFA 4ZGWA 3LU1A 3LDHA 1P1RA 4Q3EA 3RKRA 3RJ9A 3D3WB 3VH2A 2DFDA 4IJKA 3MCVA 2I3GA 2OUIA 5TT1A 2NU6A 4R3NA 4EGFA 3OQ1A 5BR7A 5L3ZA 2EKPA 2AXQA 3DFUA 2IRWA 3F9IA 3IIEA 3OICA 5A9RA 1ISIA 4OGWA 4D3DA 1PIWA 2XF8A 4B4OA 4DTIA 5L53A 1W6UA 5H82A 1ORRA 4OSOA 3ZU4A 1XLTA 3H6KA 3GAZA 1TI7A 3L4BA 2FMUA 3FNHA 1E3SA 3ICPA 3LT2A 3GA0A 1E7RA 3BHMA 3OECA 3Q11A 1MP0A 1K0UA 2FZWA 2DTDA 4IXTA 4RVHA 5HWSA 5U4QA 4RZHA 3I9LA 2VHWA 3I9KA 1CIVA 4D41A 3NTRA 2VHZA 1DC3A 3ANLA 2VHYA 5CAEA 5JFOA 4OKNA 3R3SA 3JYNA 4FGSA 4DL9A 4TRNA 3V8BA 2F00A 3KYDB 1HYHA 1SB8A 4CQMD 1KEUA 2VRBA 4XDYA 2VYND 1JAXA 1Q7GA 2VOEA 3NUGA 4R3WA 2Q2VA 1IPEA 3ZI0A 4JNKA 4CMJA 2TMDA 4BKOA 2Q1UA 3JQ8B 4OIMA 2UUPA 5EQFA 3INGA 1L1FA 1CWUA 1DFHA 3K2BA 1DIAA 5G0WA 4F6LA 1QKIA 1UZMA 2ZTLA 1IB6A 1VKOA 4O59O 2XAAA 4R41A 1SCUA 1P77A 2Q4EA 4Y6SA 1YL7A 4DREA 3PXXA 3DZJA 3E48A 5BT9A 3OF2A 4PLWA 1KVSA 2JD1A 2VT3A 1U28A 1P1JA 4Q3NA 4XB1A 1ZMOA 1TT7A 5I9NA 4WCFC 3D64A 4YA6A 1DDOA 1GL3A 4I8XA 1I2BA 4YRDA 2OFPA 4O1MA 4AJLA 3VPXA 5IDXA 1XEAA 5JYDA 3L6DA 4KUGA 2Y1EA 4DC1A 3DZKA 3AU8A 4J4HA 4DMLA 2CF5A 4B7XA 2DBRA 5DOVA 1BVRA 1LRKA 5BNIA 1VI2A 4L74A 3Q2KA 3FTPA 2WYVA 2BF7A 3MWDB 4D45A 3C7CB 3LT4A 5CPBA 4XIYA 1JKIA 5G0UA 1LSSA 1H9BA 3QWAA 2P9GA 3I4CA 5DBGA 4GKVA 5DBIA 4CJXA 1CRWG 1E3WA 4YJGB 5DOZA 4M55A 5I7VA 3JQEA 5AXAA 3E82A 3C3XA 3ZW9A 1C1DB 1MUUA 1LDBA 4MP8A 3H2SA 4FC6A 1SOVA 5CFZA 4JP3A 1F8FA 1V6AA 2EP7A 4INAA 2V6GA 4YTEA 3JD1A 4WJZA 3JQCA 1C3VA 3HN7A 1NFFA 1KY4A 5JBIA 1WMAA 1Q7CA 5G4LA 2AE1A 4NJOA 3GNTA 4ZQBA 2LDXA 2XXJA 2ILTA 3PQEA 4W7IA 1N92A 1I36A 3CZRA 4P4GA 1YL5A 3I6QA 4IINA 1BXZA 1UXHA 3UCEA 3I9OA 4IDCA 3N74A 4HFNA 1YONA 3HE3A 3ORFA 3WGHA 3K9QO 3Q6IA 1CERA 4QUKA 2POQX 1SO8A 4EUEA 3AM5A 3U5TA 2Q1SA 1ISJA 5T67A 3L07A 3ZWXA 1UDAA 3GHYA 5FI3A 3NYWA 1C0PA 2VUUA 3PPIA 1NM5A 3AI1A 5CP8A 5TRTA 1P44A 4EJMA 4D43A 1PGNA 4FFOA 1DC5A 3TJRA 3U0BA 3H3FA 5JY6A 2H1SA 4B4WA 4GMFA 4YAIA 5L95A 3SEFA 4Y6PA 3H8VA 1IY8A 1PJ3A 2GR9A 1YKFA 2WD7A 3X2EA 3UH1A 4FOSA 5JMWA 1EFKA 4GQAA 4CMBA 2GSDA 4BMSA 3ZWPA 1LDMA 3OJ0A 1EEHA 1T4DA 1H6CA 3HHPA 4TWRA 3PWKA 2DFVA 1JU9A 3HB4X 3GN2A 5F21A 1O8CA 3KO8A 1B7GO 1DFIA 2ZTUA 2JL1A 3L9XA 3E03A 4AJEA 1ZSNA 4BUCA 1YJ8A 3P7MA 1RM3A 1X0VA 1EDOA 3E6AA 5JC8A 2AA3A 2P91A 3VPFA 4UUOA 2GN8A 2IXAA 4CL3A 2O50A 1M76A 3L4BC 2NSDA 3TF5A 2BGMA 1T25A 1AXGA 3E5MA 2B0JA 2I66A 3HJAA 4CMAA 3KVOA 1F17A 4DUPA 4YDRA 3GMDA 5KVVA 3BMNB 1HYEA 3NGLA 1J5PA 1IYZA 1OC2A 4Y8VA 5G0VA 1NR1A 3BTUA 4DPLA 3MTJA 1DSSG 2Y0DA 4CMEA 2WM3A 3GR6A 4AJ2A 4RDHA 3AY3A 1LJ8A 2D3TA 2FPGA 1ENPA 3PZRA 4OXYA 4QT0A 1NVMB 4HFRA 4U0KA 5JMPA 3RC1A 2ZB4A 3ENNA 4AL4A 5KCZA 4Q3BA 2C54A 3KYBA 4Z9XA 1HF3A 4KTVE 3GG9A 4NBTA 4WGGA 2P4HX 3TPCA 7MDHA 4NK4A 2G82A 3L4SO 3BZUA 3PJGA 5JDIA 2SCUA 4RZIA 1U3TA 2PK3A 3KSUA 4IJUA 4RF5A 2HJRA 1IZ0A 4HXYA 2J3JA 1PWXA 2Q2WA 2QZ9A 4ZRMA 3CIFA 4BNTA 1A72A 3CKYA 3DBHB 4E0BA 1FDVA 1T26A 2OO5A 4ND5A 3LQFA 4WK6A 3QSGA 4XQEA 3BYZA 1R0LA 4NBVA 1K89A 2A94A 4FFPA 3I9MA 1LDGA 3GVHA 3IL2A 2CDBA 3PFWO 1RM4A 2J3HA 1U7TA 4D0SA 1BW9A 1OAAA 2JJYA 2YYYA 3ZU3A 3A9WA 3T4EA 3ZWYA 1I3LA 3NT4A 4GLLA 2GN6A 1NWCA 3D4OA 4R51A 3JQ7B 4OKIA 6LDHA 3E9QA 1GUZA 1DIHA 1WLYA 4GH5A 1B3RA 3LF2A 4Y98A 2JFGA 3U49A 2D5AA 1O9BA 2I67A 1KC3A 2DAPA 5CDGA 4L75A 1Y8QA 3JSAA 1KYQA 3ASVA 2FSSA 4FJ0A 4AJ4A 4RVSA 1B26A 2P2SA 2Y1OA 4NU6A 5JNLA 3VOSA 5A02A 2QW8A 2X4GA 5C7LO 5F1OA 2IYPA 1QMGA 4XYGA 3GDOA 5KNLA 4XA8A 2GGSA 3F1KA 4A27A 4RO0A 2O4CA 4E5KA 2J6IA 2JFHA 4HUJA 1VC2A 2GN4A 3GHHA 1YL6A 3GFGA 1HTBA 2IZ0A 5A3JA 2JCXA 4L0QA 2DLDA 5C5IA 3FSRA 4RF4A 2C07A 5EQDA 5TSDA 3ETDA 3S2GA 1E6EA 1LDNA 1U2GA 2NU9A 3RCBA 3B20A 2BFPA 5T5QA 4BVAA 4YAGA 4IMPA 4K6FA 4JXKA 4GLOA 1YDEA 3BA1A 2JHFA 4A10A 2AG8A 2BELA 4BS9A 4L4RA 1A71A 4PN3A 3WGOA 4BNNA 1LLCA 1OFGA 4DYDA 2GN9A 2HU2A 3DO5A 4MVJD 4YJFA 1P1FA 3BXXA 2Y1DA 1K2WA 3QY9A 2FPPA 4YJHB 2P5YA 3Q0EA 4FDAA 4JIGA 4F6CA 3EMKA 2CDCA 2DQ4A 2OMEA 4WLFA 1D4FA 1O89A 4TROA 1BMDA 1MG0A 4J2HA 1LA2A 3CSDA 2VT2A 1Y6JA 2IODA 1K3TA 3BTOA 3FCOA 3FWNA 1LSJA 2NQ8A 3BIOA 1LC3A 4R1SA 4RF2A 1V8BA 5G4KB 3ROPA 4BB6A 1WDLA 3CXRA 3DZIA 1QYVA 1KEPA 3LLVA 2NTJA 1WMBA 1M6HA 1EZ4A 4FFNA 1FF9A 2FZEA 3GZNB 3M1LA 1R4MB 1ZSYA 2Y1FA 2Z1MA 4FBGA 2I5PO 4RPHA 3UVEA 2I65A 1E1LA 3DOJA 1NNUA 3DTYA 4PZEA 1S6YA 1X7DA 2IEBA 1WAMA 2VZ9A 3WYCA 1EVZA 4BNVA 4FD3A 1GYQA 1P1KA 1DJQA 2QYSA 1I3MA 3P2OA 4CMEC 3JTMA 4DQUA 3U9LA 2CZCA 3KUXA 3RUAA 2ZCVA 2JAHA 4H7PA 1BWSA 3WG9A 1Z6ZA 3OM9A 3VZQA 4UVEA 2GCGA 1NR7A 4IM7A 1X7GA 4IDBA 3SJUA 4WOJA 3DBRA 4UEJA 4MKZA 4WLNA 1X14A 2FSVA 4NI5A 2JCVA 3RUCA 1AN9A 3C1OA 5JDIC 1N9GA 3F6YA 4J91A 3VC7A 5HBRA 4WEQA 1NQOA 4CLRB 2VUSA 3K5PA 4PRKA 4XGIA 3W8DA 4PGFA 2O3JA 4I9HA 1K5HA 4IGFA 3HFGA 3ZH2A 4CMHA 5CG1A 3ZNQA 1QP8A 4QO7A 3F4BA 4RORA 4FPXA 4FN4A 3RUFA 1YS4A 1U9JA 3FR8A 4J0FA 2X9NA 2Y0CA 2GF2A 1KS9A 1LLQA 3UFXA 5F1PA 4O5OA 3GDGA 1P0FA 4XYBA 1QG6A 4CM4B 1ZJYA 4RCVA 3DQPA 4Z6KA 5AXDA 1TXGA 2PZMA 3FWZA 2I76A 2X0NA 4J1SA 3KLPX 4WASA 2VHVA 4ZVVA 3RC7A 4YVFA 1Y7TA 3ADPA 3ZV6A 5BSEA 3T7EA 4BNLA 3GNQA 1GDHA 1Z45A 1JAYA 3DAGA 1VJ0A 1YBAA 4NJMA 4B3JA 1V3TA 1B8UA 1QV6A 3VTFA 4GX1A 5JAZA 1U2DA 2DTXA 3MOIA 4IBOA 3WXBA 3AI3A 4KQXA 1EE2A 2Y68A 3ZWMA 3ZW8A 3PVZA 4LVUA 4BKUA 1LUAA 4E5YA 3LYLA 3VAZA 2PH3A 1HDCA 3I6IA 1ML3A 2DVMA 1WXDA 2CUKA 4YB8A 1LEHA 3C8MA 5ER6A 3IKTA 4LVCA 4E3ZA 4C7KA 5B37A 1MFPA 2WEKA 3DC2A 4B79A 1LSUA 4NPCA 5IFLA 2FRDA 1PWZA 1W0CA 4M8SA 2Y99A 4HNGA 1K6IA 3JD3A 1HZJA 5COBA 4C4OA 3E1KA 4RV9A 3R1IA 4QFCA 1CJCA 1N1GA 1I10A 2VYVA 4EI2A 1KETA 5IN5A 4II3A 4CV0A 4DMMA 5IZCA 3RD5A 1P33A 3WGQA 3D3WA 3LC7O 2BH9A 4UVHA 1PS0A 1Q7BA 2Y93A 3JQAB 3QP9A 2FHSA 5GZ6A 4DPMA 2NWQA 3DEYX 2V65A 3PK0A 4OAQA 4BNJA 2VHXA 1E5QA 3WR5A 2J5RA 3WIDA 2HMTA 1P3DA 5LCXA 1O6ZA 4MVJG 3DONA 1YB4A 2HUNA 4WNIA 4XYEA 2BGKA 3MJTA 1BTOA 2YV3A 2C82A 3GFBA 2H5LA 3QIVA 3GGGA 4CM9A 4E2XA 2Y1GA 2VN8A 5F1KA 1DXYA 4EJ0A 4OOEA 4IS3A 3PLNA 1XU9A 4GWGA 3ZWBA 2PV7A 4J4TA 1BRMA 1SNYA 3LVFO 2Y05A 4UREA 5KJ1A 4A2CA 1NWHA 1VL0A 1PZGA 4XQGA 4P8RA 2JFFA 4HADA 3BTVA 4NQZA 3WGIA 1YJQA 3JD0A 2QQ5A 3KYDA 5T57A 3ZWWA 1LU9A 1B16A 3F47A 3VKVA 5EN4A 4IJWA 1ZIDA 3KTDA 1BDBA 4LMPA 1H9AA 3QA9A 2AQKA 4PLVA 4TZTA 3RC2A 4BOYA 1I5RA 4PIVA 2X6TA 2DKNA 3UN1A 3H5NA 5U9CA 1UXJA 4Q3AA 2PZKA 3QQPA 4J2OA 1CF2O 3DTTA 1HDRA 1HE2A 4DA9A 1EBFA 4QO8A 5HTOA 4FGWA 4L76A 3WIEA 2FR0A 1X1EA 3WWZA 3TZKA 1BXGB 4NIMA 2NTNA 3H5RA 5BSFA 2NVWA 3GEMA 3PQFA 3RUDA 4CV3A 3P5SA 5THQA 3IQDB 2B37A 3EVNA 3W4IA 2XOXA 3DHNA 3PDJA 3QWFA 4B8ZA 3C7AA 3GUYA 5HRUA 3QVWA 4A03A 3BMQB 4YAEA 1EQ2A 1FDUA 1VL8A 1U7HA 1XA0A 1GEGA 3NT2A 3OETA 4KP7A 2O4UX 1ZNQO 2Y0EA 3PTZA 3WB9A 2YFQA 1HDGO 1YE3A 5CDYA 2ZYGA 4I9UA 5L51A 1GUFA 1Q0QA 2YQ5A 4E6PA 1HLPA 5TT0A 1PJQA 5ITVA 3VH1A 4W6ZA 3CZMA 4BGIA 1UAYA 1VM6A 1DHRA 1ONOA 4DVJA 1UR5A 2RAFA 1GQYA 1ZK1A 1PL6A 1QRRA 1DPGA 1KY5A 2EGGA 1N7GA 3D5QA 3A14A 3NJ8A 3P19A 4FFMA 3AW9A 4YJGA 1D7OA 1GU7A 3QE3A 4CODB 5FEUA 5DF1A 2V7PA 5A05A 3WJAA 3BMOB 4WLEA 3ROQA 1C1DA 3GVPA 2I6TA 2VWQA 3H9GA 4YACA 1P1IA 2IZZA 4WECA 2AHRA 1KEWA 2G5CA 3NTQA 5I7EA 2C7GA 1L7DA 1UDBA 1DC4A 1MV8A 4L4SA 1HDYA 2Y1CA 2NU7A 4MINA 1YBVA 2DPGA 1PX0A 1HZZA 1KOLA 3NDRA 3WTBA 5KWEA 2PZJA 3DMYA 1L7EA 3JD2A 2UAGA 5CHEA 3VPGA 3EHEA 3B1FA 4TRRA 3C7DB 3GEGA 1I0ZA 4XGKA 5EPOA 4TZKA 5MDHA 1O5IA 3QWIA 3M6IA 1Y8RA 4GL4A 4HBGA 3GT0A 1Y81A 4LW8A 3TRIA 5I9LA 3KETA 4BQRA 3BHIA 4YYZA 4J1NA 4NR0A 4E30A 2VNSA 1RKXA 1Y9AA 2RH8A 3F1LA 4HKTA 4R54A 3KYCA 3MTGA 2FWMX 1QORA 3U4IA 2AQHA 4LMRA 2NVUB 2VWHA 2YV2A 2OORA 5FFFA 1UZLA 4S3MA 4NZ9A 4BGEA 2GDZA 3E8XA 3OQ6A 3OBBA 5JCXA 4PCVA 3AOGA 8ADHA 4DBVO 3O8QA 4NG5A 5IZCC 3W4JA 3PYMA 2X7HA 3B1KA 3GMSA 4HV4A 4F46A 1ZEJA 4CMIB 1XSEA 2X1HA 2YFHA 3ZCXA 2G0TA 3KEQA 4S1VA 1JWAB 4J4BA 3JQGB 2Q1TA 2CDAA 3VZSA 2VOJA 4U6QA 4PG7A 5HM8A 1S7CA 4J1TA 1PS8A 3UW3A 4EITA 3AOEA 4GGOA 1JVBA 1IL0A 3PWZA 2VYVD 3PFFA 5A06A 3OJLA 2DU8A 4ZHSA 4J49A 1EMDA 4LCJA 5JC1A 3U4DA 4BNHA 3TL2A 1B8PA 5T64A 3TOZA 1GPJA 3SBOA 2F1KA 1G0NA 9LDBA 5KJCA 1WDMA 1ONNA 3H2ZA 3DXFA 3DR3A 3WNVA 2R2GA 1E3LA 1PQUA 3M2PA 5DCUA 1YRLA 2FR8A 3GGOA 2PKRA 2PTGA 3ETGA 4IJVA 2Z5LA 4IZIA 2FOIA 3GQVA 4N54A 5H83A 1UXKA 3UF0A 1I30A 4ALMA 5CG2A 1BVUA 3WOHA 3MJCA 4CM9D 1Z74A 1QLHA 2O7QA 4FR5A 5JO9A 4RPGA 1EUCA 3GVXA 4J7XA 2TMGA 5JPIA 3H65A 5JS6A 3EY4A 2PA3A 4PRLA 4PVDA 3KM0A 3OA2A 3FRJA 5K0ZA 2J5KA 4D0RA 2UV8A 4P38A 3SC6A 2DUUA 2OBYA 4NH4A 2HLPA 4AICA 1CYDA 4R5HA 1Q0HA 1VLLA 3CEAA 4Y67A 3U4CA 5KVCA 4J7UA 5ITWA 3V5NA 2O3RA 3ONFA 1BXKA 3DBVO 3EZLA 4OYRA 1VSVA 3B6ZA 4MVJA 1ZMTA 3S2EA 1PL8A 2V6BA 3QWBA 3JQ9A 4FS3A 1J6UA 4MVJP 2A4KA 4A0SA 1T4BA 4ND3A 3LC1O 1C14A 4J1QA 3QWHA 2PZLA 2QX7A 3BMCA 4CUKA 2PWZA 3NTOA 4FQ8A 1IZ9A 3C24A 2ZB7A 2O23A 1CQJA 2W4QA 3NAQA 2OXIA 3TQHA 5J23A 3OQBA 3R6DA 3JQ7A 3ZDFA 4DIOA 1E7MA 1HXHA 1ZSVA 4DXHA 1ADCA 4MIEA 2XXBA 2E49A 1M75A 1VRWA 1RWBA 3INRA 4D3SA 1SPXA 3GNSA 2ZYAA 5I7SA 5DBFA 1CDOA 4MIOA 3DOOA 1PGOA 3I9JA 4IXWA 2Y66A 4J9VA 1MFZA 3Q2IA 1AE1A 3H4VA 4YRAA 3RAJA 2VCYA 2W90A 4F45A 3D1LA 3HDJA 4PG8A 1JKFA 3NEPX 4ZQGA 3CE6A 5THKA 1KVTA 2P9CA 1UUFA 4OXKA 1R66A 4BNMA 4E13A 1NVTA 2VNAA 2ZCUA 1ZXLA 2BLLA 3AFNA 3GY0A 3WYBA 3ZNPA 3GRKA 2E4AA 2C5AA 4TVOA 4UEOA 1UP7A 2EGHA 4BO3A 3IMFA 3A1NA 2PD3A 4BV9A 2WE7A 3LF1A 2A92A 4I5DA 4RVUA 3MZ0A 4J0EA 3NRCA 1YOVA 2X8LA 2O2YA 4O0LA 3WBBA 4BNGA 3BHJA 3ABIA 4CLOB 4CV2A 4RVGA 4FFLA 3D7LA 4E12A 5A5EA 3O38A 3GLQA 4JLWA 4A5OA 4JBIA 2VTEA 4HY3A 5EJ2A 1HT0A 3V1YA 1B14A 3B1JA 3DZFA 2GUGA 3ST7A 1T2EA 2EIHA 1E7YA 4YJHA 1I3KA 1XDWA 4E32A 2B5WA 4D44A 4Q3CA 3RU7A 3D4NA 3AY6A 1AUPA 1VKNA 3I9NA 2ZB8A 1DOHA 4LK3A 1YXMA 3IP3A 3OA0A 4JGBA 1YB5A 3ZZNA 3ONEA 4GSKA 2EEZA 2DBZA 1T24A 3WX0A 5G4KA 4DBZA 1U8XX 4GBJA 4XR4A 1GEEA 3L6EA 1GFSA 3QVSA 5IDWA 1EUDA 3AOEC 4R9SA 4WE3A 4AJHA 1GCOA 1HETA 2LDBA 3VH3A 3GZNA 5JW6A 4IDDA 3ONDA 4WNCA 5IDYA 4BKQA 4IMRA 3WSVA 4CMCA 4E5NA 2G76A 2NQTA 4GPD1 3RSHA 1XYGA 4UVIA 4XGNA 3SX2A 4RQUA 1E6UA 1PGJA 4BGUA 2BD0A 5ER9A 5A3VA 1FJHA 3ZU5A 3D4PA 4ROSA 4UUPA 2WSBA 1PJ4A 1C1XB 5JSFA 3IJPA 4URFA 2YHIB 1GUYA 3RVDA 3WFIA 2W2KA 3AUAA 2JKVA 5JAIA 1V0JA 5DT9A 3SJ7A 3OH8A 4JJIA 1JWBB 1RM0A 1ENZA 2UYYA 3PP8A 3DB2A 5I8ZA 4B8WA 1RYDA 4BO9A 4H16A 4CLRA 2PR2A 3G49A 3JYQA 3LT1A 4N5LA 1IUKA 2WD7B 4R4JA 2Q2QA 5KJFA 3KXDA 4LN1A 1F8GA 1R4NB 1X1TA 3IAHA 2PD6A 1ZK0A 3NKLA 3KEOA 1JQBA 3HADA 4J16A 3JQ9C 4OQYA 1JVSA 1EDZA 1W73A 3DFZA 2D0IA 2WJPA 4G2NA 1TT5B 1PL7A 4RPJA 2JAPA 1XU7A 1PZFA 2FPIA 5G2OA 4EEZA 1LQUA 2EV9A 2HJSA 3UHAA 2ZQZA 1BHSA 2BKAA 4OOFA 1YWGO 3RUEA 5CDSA 5I8WA 1NHWA 1ZZEA 2C5EA 3JQ6A 4YPOA 1YVEI 2BFMA 3UAGA 3LZ6A 3VDQA 4XD2A 1WDKA 4FFRA 4ITUA 3DBLB 1OOEA 3QJ5A 5FYDA 3D0OA 5T6BA 4LGVA 1WZEA 3IKVA 3RFTA 2IEDA 1KERA 2HDHA 2EERA 2ZB3A 1I3NA 3AM4A 2ZQYA 1MXHA 4JP2A 1ISHA 2GERA 1AGNA 5ADHA 2IDZA 2X0JA 1Y5RA 3QVTA 2B5VA 2C0CA 3G1TA 2B4QA 1ZH8A 2G1UA 4PLPA 3SC4A 1GAEO 2PD4A 2YDXA 4BNUA 3Q9NA 2DBVO 4DIBA 4C7JA 4LSWA 2EP5A 4BNYA 1VL6A 2OZPA 5JCJA 1SMKA 2AW5A 2PGJA 4XZ3A 4ALIA 1HLDA 1JA9A 1X13A 4YR9A 1Z7EA 3Q1LA 4IGEA 4RF3A 2Q46A 5L7WA 1O94A 4P4NA 2CVZA 3WGGA 4CR8A 4CR6A 1VJTA 3OJOA 1C0IA 1V35A 4R68A 4U6SA 4DGSA 2V6FA 5TIIA 4CM1A 1HDOA 1PGPA 4OHUA 3ZV4A 2DPHA 5L9AA 2EKQA 3FPLA 4D3FA 2EKLA 3QW2A 4AJIA 4IIVA 1I01A 3JQBA 2ZJ1A 1Z7BA 3L9WA 1HDZA 1R0KA 2JD2A 2X0IA 2NADA 4JJFA 2WMDA 5DP2A 3TN7A 3WNQA 5LDHA 2NM0A 2B83A 2EF1A 3CUKA 4QXMA 3ROMA 3UICA 2ET6A 1F14A 4II2A 2YY7A 1HRDA 4KUHA 1PZEA 5EINA 4UAGA 3MJ4A 5IJZA 1YQDA 4KDFA 1KIFA 1WNTA 4XJTA 1Q1NA 3Q3CA 1Y9EA 1H2BA 4PLFA 5EL0A 3O03A 5LC1A 3VPSA 1DBVO 4M49A 3PJDA 3TSCA 1MB4A 3DZHA 4RL6A 3W8EA 5A4DA 3HDQA 4DLAA 4NBWA 3AJRA 3F5SA 5AXBA 1ISFA 5A9SA 5KTKA 4B3IA 3HSKA 4XKJA 4MOWA 2Q99A 3GAFA 4WOKA 5EERA 3WWYA 4AJKA 4BQPA 4L9RA 2X5OA 4K28A 5TLSA 4RVFA 2P9EA 3RKUA 4E2YA 2O2SA 4IQ8A 3TDKA 1H2HA 1W4ZA 3FBGA 3OIGA 4GX5A 4CLXA 4PZDA 5K6AA 2RBEA 1EVYA 4OH1A 1XQ1A 1KEVA 2O3TA 3KLMX 1IPFA 1P74A 4FC7A 7ADHA 3TZCA 1RPNA 4NFYA 3WYEA 3RFXA 4J7CA 5B4VA 5KJ6A 1QYXA 1QLJA 1BGVA 4ZD6A 2RHRA 3FR7A 1E7WA 4XCVA 4ND2A 2B35A 5EIOA 3F46A 1F06A 5TJHA 1CQIA 2AEJA 1ISMA 1P45A 4WLVA 3IUPA 1PJBA 1UP4A 2VZ0A 5JDCA 3GC6A 5L40A 1GV1A 2IYOA 3PJFA 3OEWA 3WQSB 4L8VA 4QQRA 4OJNA 4U8GA 2E82A 4E21A 1V3VA 2OP0A 3GH3A 2PLAA 4ZA2A 2VWPA 4NNJA 1QYWA 1NQAO 8LDHA 3S1LA 3COSA 3FI9A 4ZICA 5KVSA 3KSZO 4EBFA 2GASA 1A4IA 1T2AA 4H15A 1N1EA 1W8DA 1LSOA 3ETEA 1H93A 3I83A 3DZGA 1F0YA 1G0OA 2Q3EA 4AJPA 3L0DA 5HA5A 5L4NA 1O0SA 3QLJA 4BNFA 2X22A 2V6MA 3PHGA 4DQVA 1LC0A 4EEXA 4M1QA 3FPCA 2AEMA 4E5PA 1XIVA 2DT5A 2RCYA 2RIRA 3GEDA 3PIDA 4X54A 3HQ4O 4JROA 4PVCA 2RHCA 1R6DA 1NQ5A 3LK7A 1WWKA 4MKRA 4AJJA 1OBFO 3GDFA 4PLHA 4OSPA 3X2FA 4H3VA 3KB6A 5T8KA 4BMVA 3WFJA 3RBZA 4I08A 1SZJG 1Z73A 1R16A 3S55A 4B3HA 5ILOA 3CTMA 3PZBA 2NVBA 3EUWA 2ZATA 4Q9NA 2DUWA 3NX4A 3F5QA 5ICSA 4QEDA 1ZUD1 1B15A 1YQGA 3I23A 4HNHA 4WCDA 2X0RA 5G0SA 2EW2A 4R1NA 1B0AA 2WE8A 4PLYA 3TWOA 3WSWA 2CSUA 4BO0A 2D5CA 3VTZA 1PSDA 4AJ1A 4N18A 1DAOA 2HRBA 5KKCA 4FW8A 4Y9DA 3ULKA 3JQ8A 3W1VA 3EGOA 2W2LD 1GV0A 3ICCA 4A7PA 1P1HA 1N9GB 4MPDA 4RGBA 1DRWA 1LBEA 5CDTA 2EHDA 2OOSA 2EJVA 3PHHA 4CMIA 1GQQA 4BO8A 4DPKA 2Q49A 1LRLA 1NXQA 3JQGA 1CETA 3HDYA 3L77A 2AQIA 4KDEA 5IXYA 1T1RA 3E18A 4Z0PA 1WPQA 5DP1A 3PYXA 3AU9A 3JQDA 4ND1A 5JCJD 1HEUA 3JQBC 1YBMA 3E9NA 3NGXA 1BG6A 4R1UA 4R01A 2BI8A 4Q39A 5TJ9A 3TNLA 5TS3A 5IF3A 2PKQO 4RPLA 4MP6A 4LSMA 1ZBQA 1YGYA 2GO1A 1DO8A 1PJLA 3ANMA 1A9ZA 3ZN2A 2X9GA 3G17A 1EBUA 4CQMB 1EVIA 1ENYA 3PRJA 4FB5A 4XRGA 3HN2A 3STHA 3PYLA 1XELA 4LISA 3HNPA 4JBHA 5ENVA 4MVJF 5IXSA 3BTSA 1XWFA 1UXIA 4I5FA 4Z3DA 5CEJA 4Z0HO 4NFSA 9LDTA 5AOVA 3NT5A 1X7HA 2H63A 3FD8A 2NUAA 3GN1A 5DNAA 4UUMA 5A9TA 5C3MA 5I7FA 3U3XA 4UULA 3QHAA 1DLJA 1MC4A 2BI7A 2VRCD 1E92A 4JX8A 1E1KA 1Z82A 4GX0A 4P22A 4ZJUA 3PI7A 1EUZA 1SOWA 5G0TA 2HAEA 2YZ7A 3ZU2A 5IAAA 5F3RA 5GZ1A 1DIRA 2W98A 3AUUA 1ZK2A 3S2FA 3VZPA 4HP8A 4O63O 4BO7A 4NFHA 4GSLA 5K6AC 3WGZA 4K26A 1RJWA 4KWIA 2HMWA 4BNWA 5KIAA 1MC5A 1XHLA 3RFVA 3AFMA 1T2FA 1XKQA 1T2DA 4JN6B 3CMCO 5GY7A 1M2WA 4IZHA 1XG5A 3INTA 4BKPA 3UCXA 3OP4A 3R3JA 4CM5A 4GWKA 2O48X 4MIYA 2JHGA 3TL3A 1DRVA 4PLZA 4XR9A 4B4VA 4BGVA 4QTZA 2AMFA 4XJSA 2NNLD 4BV8A 5CDUA 4EUHA 1F12A 4WCFB 3V2UA 4D46A 5JDCC 1U4OA 2Q45A 3WGTA 5A1TA 1NBOA 4Z3KA 2C2YA 4G5HA 1ARZA 1NAIA 1K6XA 5L7TA 2WYUA 3A28A 1ADBA 5I9MA 4YQZA 3KV3O 3V1UA 2GD1O 4CMGA 2QIOA 3ANNA 4W82A 1MGOA 4DLLA 1A4UA 3RI3A 3RUIA 3C1AA 1J0XO 1IULA 1I8TA 4IDAA 3WDSA 2DM6A 3D5TA 3I4FA 4BB5A 2AG5A 4ID9A 3K30A 3WLFA 4RJTA 4N5NA 5IN4A 5TQVA 1JLLA 3PEFA 4ESOA 4W7HA 1H6DA 2YQ4A 3AI2A 3EVTA 1GD1O 5DCWA 4YEDA 5IZ4A 1LX6A 1PU2A 1E0DA 1SEVA 4AVYA 4ALJA 4CM8B 4RLHA 3H7AA 4A73A 2PH5A 1KVQA 1LXCA 4UUNA 4R9RA 1V3UA 1N7HA 4MO2A 5ES3A 4ZQHA 5U1PA 4CQLB 1B8VA 5T8KC 4IUYA 1FK8A 1U3UA 5BSGA 3UOGA 2J3IA 2R6JA 3BMNA 3V1TC 3JYLA 4ZRNA 2C7VA 4GGPA 1AHIA 3H9EO 3ASUA 1HWYA 4Z9FA 5ICMA 3WLEA 2HSDA 3VPHA 3W6UA 1D3AA 1I33A 1UZNA 4CLOA 1IOLA 4HX5A 3H9QA 2NLOA 3CINA 5H81A 3TZ6A 1WP4A 1DHTA 2UDPA 1MXFA 2HRZA 2X86A 4TKLA 1DLIA 4EYEA 4W9NA 1R15A 1H5QA 1KVRA 3WQRA 3AUTA 3AY7A 5ILGA
chains in the Genus database with same CATH superfamily
4IIYA 1QR6A 2GZSA 2OL4A 4J0QA 3H99A 3KT8A 4RULA 3T7KA 3AKEA 4UAJA 4ZHQB 4ZV7A 1QHGA 1C4WA 3D5EA 3DXZA 1KRXA 3U4HA 5CNJA 4B33A 3K8OE 3CKLA 2IZ7A 4X9XA 2OILA 2P68A 4EF4A 1CNMA 1AMUA 2AT1A 2QLNA 4E33A 1O9GA 3SZOA 1MOQA 1QPGA 4UXJA 4ERNA 1U0NA 3UK6A 4HDQB 3L02A 3EWIA 4ZI3A 4RTMA 5T41A 1JX6A 3AINA 2Z1NA 1DGQA 1AM4D 5K0FA 3W34A 1O5OA 2OK8A 2PRJA 4ZQFA 5ELLA 4C7XA 2P11A 1THTA 4O1IA 4BV3A 5KOHB 4LZWA 1PAUA 1KGSA 4QNNA 1E5LA 1DKOA 2GS9A 3RSGA 4M38A 3WBFA 2IYZA 5LQSA 1ZJ5A 3Q72A 2HWWA 3LH5A 2GZRA 2JIZA 3TFQA 3DOCA 3KZ1E 1KYIA 1T5HX 3C85A 3BZWA 3GZ4A 5EXSA 4BLOA 1YQWA 1IN1A 3IP8A 1ULAA 2V59A 4EB3A 2IZOA 5FOVA 1GADO 3M6VA 4QJ4A 3QKUA 1PJSA 5BXYA 3O7WA 3AESB 1KR5A 1ZD9A 2AR0A 2QZZA 3FOFC 3GOHA 1RXYA 3VYSB 4OBWA 2UYHA 1EYZA 2VYQA 4DQKA 3GJ0A 3RBVA 3R5TA 2J30A 1SGWA 3ILXA 1RRVA 2YHIA 3FFTA 4IS2A 5CAEB 1HSZA 1R3UA 4D0GA 5JH7A 1E79A 2D1YA 2F1IA 4MO9A 3B3AA 2W70A 4UVGA 3G5TA 3CA8A 3F4KA 4DYVA 2GYUA 1YE5A 3H3JA 4LECA 4MX8A 1NKVA 3B70A 3C3EA 4EK9A 4RTRA 2GPJA 2P9BA 4J0CA 4W4TA 3SS7X 3V46A 4NCIA 1QAMA 4RZQA 3ADOA 1QYCA 3MJVA 3HCNA 5CMLA 5EMKA 4UM9B 3FFXA 4PRYA 2OG1A 4WERA 2ZRMA 5D3MB 4XEHA 2UYGA 1E2UA 5NULA 5KSOA 2B9EA 3M4XA 4ZZIA 1P31A 5JXJA 4KXQA 4BBAA 2C1EA 1E99A 2A0KA 4WUTA 5CNIA 4QTYA 1HTWA 2GO7A 3CLVA 3IBSA 3ZE8A 5AYVA 5KQLA 1R9MA 3LQ1A 1VKJA 2IELA 5EJMA 1Q74A 1CF9A 3VO9A 5IHXA 3HBJA 4HRVA 1EB8A 4ANFA 2BGJA 2OCLA 5COQA 2E37A 2LBPA 3K94A 4BUJA 3BBPA 5A6VA 3ETCA 5TQ2B 2ZIXA 5P8WA 1S2MA 1ONSA 4YROA 1XMIA 1C0LA 2WPNA 4C2BA 4D0NA 3G6WA 2YUTA 3N3BC 4Q12A 3Q7QA 2B21A 4BO6A 5C0OE 4P32A 5HX7A 2LIPA 1EJ0A 2XYQA 3BPSA 1JTVA 2ZSJA 4OFBA 1VQ1A 2YWHA 1NC1A 2J9FA 2ZTVA 1YQQA 5C1OA 4MRAA 3CEHA 3V9PA 3FYUB 4IQ0A 1A0OA 1P9RA 2J08A 4CR7A 5CB8A 2X2PA 2OCYC 1X1DA 2OZEA 3TOXA 1CB0A 1DELA 4DJTA 4GBMA 1Z3CA 2IX9A 2P1ZA 1Q11A 4DLUA 5AVVA 2WD8A 4AS3A 5HHTA 4DV0B 3WA7A 4PHGA 2OBNA 1HQCA 2PGDA 3CVWA 4G6ZA 4WPGA 1CJKC 2EJWA 3KKMA 3N9IA 2BHRA 1PJ8A 1ILWA 2ZSKA 3AJEA 3JYPA 4HYQA 5F5LA 3G8AA 1K0FA 4L4UA 2IY7A 1QIMA 4GP6A 4KMSA 5IDQA 3A4VA 3F78A 2GAJA 4Q21A 4O25A 4YH1A 3C2QA 3NHWA 1DDGA 2DR0A 3QHQA 1VPWA 1PK9A 1YRBA 2YV1A 1S8FA 4K9MA 5EMHA 2WQ7A 3SXUB 2JEOA 2O7SA 3CZ4A 1NRWA 1TO2E 3NNSA 4NPAA 1BE0A 1TKCA 1YH3A 4CL8A 3KZVA 5EE1A 2GPTA 1KZYC 2C7BA 3RM3A 1VBFA 2J5QA 2O8BA 4HFJA 4WXYB 4M36A 3MQ2A 3M6XA 2HNKA 2J4CA 4KIGA 1TQ4A 1ZGCA 1DIBA 2ZYWX 3QBTA 5C3UA 3F6RA 3A1EA 1NASA 2QTLA 2LNDA 4TXJA 2ZR0A 4MKGA 3VKUA 3SIPA 1FSZA 1O57A 4FLFA 5E8RA 3ZCTA 3G0GA 7AT1A 3UGQA 2O3SA 3SC2B 4PYQA 1M1XB 3IT3A 4AJOA 3MWKA 3R0IA 5KREA 1KEZA 2V7BA 2IH2A 1M2OA 2BFAA 2V58A 5CIQA 2R8BA 2XMZA 4OB7A 1TCCA 3F3KA 3PDUA 1CJMA 1YUMA 2ZAMA 3IV6A 3PQ7A 1FSSA 2XB8A 4JUDX 2RK6A 4PG4A 3IA2A 1MX3A 5CGZA 5CXSA 4YT8A 1CR0A 2Q1WA 2AF3C 4R5MA 1DXHA 2H2IA 4WXMA 4HXFB 1GLNA 1J20A 1T2NA 1FW8A 3C74A 1JW9B 3OOSA 1DQSA 1J39A 3MTIA 5DN9A 3WMEA 4X41A 4TYPA 3RSOA 1CC1S 4RWZA 521PA 1T6XA 4A6EA 4DTCA 2O8DB 1Z13A 1L5QA 3WK6A 5HS4A 4RZ3A 4Z51A 3EYWA 4QECA 4WTOA 1M6VA 3ZCVA 2GJ4A 2REQA 2Q9BA 5HCIA 2O54A 1GXSB 4RD4A 3O84A 1E6LA 1GYPA 3N6XA 2ZXUA 1Q44A 2JGMA 1EX1A 4YJ2B 1UPFA 3RK1A 1UCFA 3ORYA 1S3FA 5KYKA 2IV2X 1USIA 5BW6B 2JBAA 2QTRA 3FFWA 3CT6A 3ZCSA 4MAMA 2K7FA 3EUAA 5CD9A 5HTKA 4W6QA 4GVLA 1XR3A 4MHOA 5L7YA 3ZJ5A 3LCJA 4EPYA 4OJMX 1N8KA 2L19A 3CBGA 3S2IA 1ZM4A 2IU6A 2OHGA 4JI8B 4CU5A 1ZNXA 4FMCF 3AERB 3RRYA 4F56A 1SC6A 2DC1A 5JU6A 3HVUA 3KTFA 2FLKA 1SVNA 5FPPA 2ODPA 3PPVA 1CUBA 2O2HA 4RK0A 2OTCA 2VAPA 3AEQA 3PC4A 4QXQA 3ZVKA 1LLDA 1YA8A 3M49A 2NZ8A 3LHIA 4I3GA 3CLKA 2MSNA 4XRRA 1RAGA 5FWYB 3LLUA 4E46A 4YQEA 1BGWA 3K72B 4CLDA 2DEUA 3X1KA 1VPEA 1PZHA 2QYOA 1QX3A 4UBMA 3GYBA 1JNYA 1MRNA 1LH0A 2PMWB 4H60A 4DRXA 2O0KA 3UKOA 4IMJB 3TDMA 3KQHA 1ACMA 3AHHA 2GJSA 1DL5A 2GNAA 1B41A 3IUSA 3WVNA 3D6AA 4LJKA 1KYXA 4NC9A 3UKJA 1FFWA 3OFVA 4PWZA 4XOIA 1J2YA 1RLMA 1IZ7A 1WCV1 2PRYA 4MQ5A 4YFVA 3V7YA 2FMTA 2JIZD 4REQB 1FLDA 4DSZA 4NCKA 5GIPE 4K9RA 3LFHA 4RQBA 2FWJA 2HA6A 1P6UA 2QJRA 2Z58A 2CMDA 3RAPR 4B4VA 3IP6A 3AF0A 5DJ5A 3T4PA 3VUEA 1L8XA 1UT6A 2Z6VA 4HXGA 4C1BA 1MDBA 4JFAA 4D8XA 2JI8A 5J2TA 1BN6A 1BX3A 1VB3A 3IELA 2Z5VA 4JSRA 5LOVF 4JGIA 4KNWA 4DWVA 3IEMA 1SXJE 5BR1A 2X7JA 2RE8A 3PHJA 1JIQA 4KXWA 3QU9A 4R1QA 1E79D 1KAOA 4QFDA 1G8FA 3DQQA 1ZH2A 2HGZA 2KLBA 3EA0A 3FHLA 3FKJA 2GX6A 1IATA 5DHSA 3KR1A 5A03A 4P4SB 4YJDA 3BAZA 3IAFA 4NICA 1ZKMA 2CYAA 2XDAA 2CN1A 2QPOA 2Z2YA 5L45A 3PNYA 2H8GA 4I5GA 3KKOA 1ODLA 1TEXA 1VSUA 1T43A 5FUBA 1DTWA 1IJBA 2BGLA 3L0PA 3LSYA 1LBIA 2GPSA 3L7CA 3U7RA 4AXXA 3H9UA 3KWLA 3LKDA 5E7IA 4E31A 3AVVA 1I2ZA 4RX1A 5FBZA 1OXSC 2FYTA 2PJUA 3DZCA 4A0GA 5E2IA 5F52A 4IIUA 3MWDA 3IT2A 4BNDB 4B3TB 2FF7A 2C77A 3BULA 1XX6A 3VYVA 3B12A 3GUZA 1J8DA 3ZNNA 1FQWA 4HFMA 5ELXA 1UMCB 3B89A 1TKAA 4ODIA 3ZLTA 1RZ3A 4M2LA 4D79A 3RVLA 1DC6A 1M1YE 1EXDA 3FVTA 2FXVA 4X6UA 1KAMA 1KXJA 4RVDA 1G8HA 1JHUA 2PKXA 2VBFA 2ZB2A 4WNYA 4RESA 4BNXA 5MGNA 3C16C 3GJRA 4IFBA 2BRUA 4NENA 4YRJA 4F7WA 5AW2A 5ICCA 4QQ8A 2WTBA 3UJHA 4HLUC 3DZBA 3HZOA 4L8LA 3FLMA 4I1UA 1ZW1A 4ARZA 1C7ZA 1JV2B 3FTNA 3TLJA 5LQAA 4G5RA 4PZCA 3JARB 5AKJA 2GPWA 3JY6A 1T1GA 4DLWA 5A5GA 2PGAA 4ADSG 3EZNA 4LRUA 2XQFA 4MQLA 4Z0TA 4RDCA 4BLSA 2UUOA 4CM3A 5FEMA 1PCXA 2NACA 4MYUA 3PG5A 2D0PB 3EQ2A 4KLNA 3ET5A 2Q7DA 1PQPA 2I99A 4CG3A 1BXGA 2F8MA 3M4NA 1IWOA 2YBEA 4F8YA 3JAMA 4RA9A 2CJXA 2RJOA 4H1TA 3RIHA 1GVHA 1WJGA 2AN5A 5E1OA 5K3CA 4MQ4A 5FWDA 1J21A 4B84A 1ZM2A 4EYKA 3QEAZ 2YUIA 4ITVA 1P5RA 1XTVA 1GJRA 3E1GA 4HPJB 3BMQA 1YKGA 4MV7A 5DLQC 5F77A 3V2HA 2VATA 1XTJA 4P82A 2HA7A 3ZWOA 2AN9A 3H9JA 1ZDMA 3K31A 2IOFK 4OBBA 1YQUA 1NPYA 2FSUA 1FS6A 1II9A 3IB6A 2MSWA 2I78A 3BL6A 3NXSA 4G0QA 3M1AA 5EPEA 4DZTA 5BQFA 4TV8A 3NNDA 3GBSA 1SBYA 2XGOA 2BFFB 2ZDHA 1FYFA 3I5AA 4LE2A 1GNTA 3P2YA 4O29A 1QHEA 4B75A 1IAQA 1VJ5A 1YULA 2PLRA 2V98A 1UBJS 2GAFA 2QQGA 1Q2XA 1ISGA 3UY4A 2NV6A 4Z53A 3D2LA 1RQPA 1CEEA 4EUKA 4BVLA 3A06A 5GM2A 2P6MA 3WL8A 3ZGLA 4GLJA 4BLPA 4MKXA 2CD7A 5EP4A 1FVXA 1MPXA 1XRLA 2D7JA 2H7VA 4D9NA 4ICIA 2EW8A 4EQ6B 3C6YA 1B0UA 3G79A 1VE6A 1PS9A 2QM0A 4EFNA 3L8ZA 4U2KA 4KFSA 3HLYA 1XZBA 5F5NA 4EY4A 1Z75A 4NX2A 5KWIA 3QLTA 4D9KA 4ZOEA 1F4PA 5CXXA 2XCTB 2ZJFA 5GMOA 3ZVLA 1QFSA 2ZR7A 2XSZA 3BF8A 3C1UA 2VWGA 5JS8A 3HTXA 1TZMA 4UBOA 1PJ2A 3A6LA 4HLQB 3WWDA 4EP1A 1MO2A 1QQTA 2BSAA 4PYIA 3PE4A 5JXWA 3TTWA 3K5WA 4N76A 1I4LD 1QG0A 3B8EA 2QSJA 4Q4HB 4LVNA 4E5VA 3TS1A 4Y1RB 1P8JA 1IH8A 1GP2A 1NP3A 2ICAA 3GG2A 1Q84A 2VTDA 1RP1A 4LX8A 3I12A 4Q3DA 3VM6A 3NWBA 1QK3A 4QUJA 2ZROA 4EMTA 4IZ6A 1VPDA 2FB9A 3K9GA 5JQWA 2VBCA 2F43B 2KYRA 3S81A 2ZIFA 3NDBB 3T9CA 1IBMB 1L6RA 2CHQA 2Z3WA 4YWJA 4GIBA 5EQTA 3ROKA 2I22A 5HUJA 2HIAA 5DKFA 4CW7A 2X13A 3L82B 2D4AA 4WCFA 1IBCA 1ZJZA 4J76A 3PGJA 4EM6A 2IZ1A 2HCTA 1X15A 4RNDB 3O4IA 1K5GA 4PCUA 1O6CA 2Z83A 2NVUA 2GXUA 3FBTA 4OQZA 5B4UA 2WZCA 3OC6A 4DHEA 2WIKA 2ZVQX 2BEJA 3DBRB 4IY1A 3T15A 1MIOB 3VFDA 4KOAA 1K5DA 3M82A 4LOLA 4EW6A 5JWRA 4G67A 5IWAB 2PBFA 3BWXA 2AKYA 3W6NA 3ZHBA 1GZ3A 1H4VB 4KYTA 2OO3A 2VJNA 3CT4A 4NATA 1NTRA 4XEUA 2BJWA 1LI4A 2FFQA 2FG6C 5AM1A 1A04A 4P54A 2PPLA 1CY8A 1D4OA 4WLUA 1CHDA 3LUGA 4BNIA 3SCZA 1A5BB 1QKJA 2PXAA 2IE0A 2R6HA 3FROA 3RSZA 4MQBA 4RQTA 5EHQA 3T7CA 3UBTA 5G41A 3Q8MA 4RDXA 5JROA 5IC5A 3PNBA 2QSYA 1Z6QA 4G3XA 4ZDKA 5B6PA 1U8TA 4H77A 1N0UA 2W2NA 5DYWA 2WUGA 3UMCA 2W48A 1GQ2A 3EIUA 1E89A 1V5EA 3EXG2 1DBPA 3Q3HA 1MX9A 4H08A 4LRTB 4TTIA 5JD3A 4HVCA 4YXWA 1G17A 1TEZA 1E64A 1ZOPA 2IPNA 3FZEA 3HJRA 4ZQCB 1Z8FA 1XD9A 3ZWNA 1RXVA 3K1ZA 1YAHA 3QVOA 1P2SA 4GXNA 3KAQA 4OO3A 2LD4A 3UJ8A 3DAFA 5FL7D 3UWKA 1QIEA 3I9FA 1QGAA 4QELA 3WGLA 3NONA 3KBOA 4C2TA 3O9ZA 2CLOB 3JQFC 1OH7A 1JDJA 4ONEA 5BSTA 1XZEA 1L4NA 4MYRA 1T0IA 2WB4A 1UAAA 4M46A 1Q0UA 1SJ9A 1JE0A 3QE4A 4G5OA 1KDOA 3HZZA 3LQYA 4UJ3A 1CUDA 3UQZA 5BNTA 4AO6A 1Z4PX 3H05A 4KC0A 2JANA 2YHBA 2MCFA 2DMRA 3QBDA 1NRIA 3B36A 3S7TA 3O4VA 3OWXA 3RS9A 4XXHA 4BO2A 2R8ZA 3EGXA 3VVBA 2PL1A 2XNSA 1MHPA 1ZY2A 2FPRA 3RFFA 1OAOC 3GRAA 2I2AA 4K3UA 3LDUA 3MUOA 5KYVA 3TD2A 4E5UA 3C3DA 3CPJB 1XQWA 4Z9YA 4AFNA 1T5DX 2W8ZA 1XRJA 3FPSA 1QXSA 3HLTA 2VPIA 4R1OA 1W8IA 2GM9A 3LUPA 4WKCA 3SX0A 3OAAA 1RWPA 1M73E 3DHYA 4IGKA 1ND5A 1TYEB 2IXBA 1FRNA 3MHPA 4ETMA 2XQIA 3JRWA 2DFTA 3KJZA 1DC8A 2CWDA 2PRSA 2VVTA 2Z8ZA 4Q3EA 2HEIA 3MAGA 4S1NA 1DZ3A 1KZ7B 1WSAA 3HXPA 5FNVA 3RTGA 4ILEA 1QFZA 2PYDA 1QTIA 5E1DA 4C5AA 2OUIA 4JOCA 2V8BA 3GH1A 5TT1A 5ISMA 5KNCH 2PVPA 1YR7A 3HVIA 1M2EA 3SOZA 3DFUA 3HJFA 2ZG6A 2Z2IA 5IBPA 3SY8A 5A9RA 3LMKA 5ARDA 4OGWA 5F7OA 2H1IA 3PUIA 1BC5A 4KPUA 1PIWA 1T36B 2XF8A 3IOMA 3M83A 5H82A 4PX5A 3FKQA 1ORRA 4OSOA 5M3BA 4UEWA 3UWDA 3FNHA 3G9UA 4RA6B 1W93A 2II6A 3LL4A 3FZYA 4L0CA 3LT2A 3BHMA 5HWSA 3OQIB 1JQEA 4IXTA 1VJGA 4RVHA 4YRCA 1NVUQ 1BRTA 5U4QA 2BHTA 3AH8A 5LUAA 3I9LA 1ZJWA 1QMPA 4ZT6A 4G4SO 1CIVA 3SJAA 2VHZA 1DC3A 3LPCA 3TSOA 3OF3A 2JASA 1CQXA 1ZHFA 2W6QA 2OV2A 1Y7LA 2WHRA 4UXHA 4PANA 4PSDA 4Z4IA 1HYHA 1YASA 1Z37A 1QWOA 1HT1E 2C97A 2G9VA 2ZBDA 1PTKA 2VRBA 1J2RA 3NUGA 5I4IA 1H8HD 1DBQA 1UC4B 1F51E 4MWOA 3GRYA 3JQ8B 5K3SA 4B6GA 5CBKA 3HYNA 4OIMA 2QR3A 2UUPA 1V5WA 3CV3A 1L1FA 4H6PA 3VKGA 3U2QA 1AKWA 1DIAA 1MVOA 2GEBA 4F6LA 5AW8A 4ESVA 1WSBA 1Q3HA 3NWPA 6YASA 1ISPA 2UVQA 1S1MA 4F4HA 2Q5HA 2XAAA 4D9GA 4E4RA 1O95C 4JXJA 1IAVA 1ST2A 3BOSA 5DEIA 3TRKA 1DCMA 4MI3A 4QBTA 2XSZD 5J4VA 4FZ3A 1JGTA 3DZJA 1PK7A 3ITNA 4DCJA 3HPRA 1Q1EA 2VNJA 3GELA 3HYLA 1SCQA 3GLFE 4DM4A 2R47A 4OATA 1ECPA 2Y9PB 1U28A 1RPJA 2B61A 3V97A 5I9NA 4DIUA 4B2LA 2YXNA 4I3HA 1SZDA 1QDUA 4K3VA 4O1MA 3VPXA 4HNTA 4Y1EA 3MG9A 2DY0A 3EVEA 4Z2AA 4EQZA 3E8MA 4V0QA 4DC1A 4J4HA 3TTSA 3GFOA 4A23A 3BT7A 1LPAB 4QFBA 4A15A 5HJ7A 2WYIA 5A4AA 1KJYA 4KQGA 4UZEA 3K32A 4XPIB 2YNMC 2O1WA 3OZGA 4QUGA 4UM8B 2MU1A 3N6RA 2EIXA 2WYVA 3MWDB 1QS0A 3KC2A 2IW3A 3SKYA 4EMUA 5CPBA 3BCHA 4LSGA 5FRDA 1AOXA 3IQHX 4RSHA 3F0TA 5U4XA 4JIMA 4MS3A 1CRWG 4CJXA 5E6SB 1VPLA 4YJGB 4M55A 3SNHA 3DO6A 3ELDA 4KREA 1YJCA 2ZE7A 1A96A 4DJDC 1RWXA 2YZKA 5AHOA 5L3SB 3NW9A 2X8JB 3IEIA 3E82A 5C34B 3C3XA 3V1NA 5FDFA 2ETXA 2JJMA 2O5RA 2OEPA 1Y4AE 3OOHA 1MUUA 1NU8A 1Y82A 2XMPA 4MB0A 3H2SA 3S1AB 3UKDA 1R27A 2OECA 4QDOA 3D7MA 3IT1A 4JP3A 1V6AA 4OA5A 4EZIA 1JAIA 2FK7A 2V6GA 1AKUA 3A3NA 2ZUWA 5LXTB 3P2IA 4WJZA 4C0QC 4YDHB 1KMCA 3BSYA 4OLJA 1KY4A 4OHPA 3GJ8A 1M6YA 3U44A 3Q9SA 4OUKX 1Q7CA 2QNIA 3TLMA 2IYXA 3EDQA 3GNTA 4LJSA 3ZDCA 4D0LB 1LJLA 1N92A 2DB3A 3O74A 4P4GA 3U7EB 3N8KA 3EJWA 1URPA 2J3LA 4IINA 2XCLA 2FPUA 2H1FA 2ZJ2A 3I9OA 3QVVA 3UK7A 1SXJC 1ADYA 2JIMA 2Q6IA 3DF7A 3N74A 1PR2A 3A6HA 3HE3A 2CYBA 3ENVA 3GT7A 4F4DA 3A8TA 4D25A 4ND8A 1Q1ZA 3CLRD 5ICEA 1TD9A 5E4YA 3OTOB 1ISJA 2HPAA 3DV0B 5JVDF 2DPXA 3GHYA 4QUEA 1C0PA 2WJWA 1ZU4A 2VUUA 3DE3X 3AI1A 4LOAA 5CP8A 4YXWD 5ICGA 1JHMA 4KPFC 2UYOA 2VQEB 1P44A 3HRKA 1PGNA 1PT7A 2Q9UA 3CCBA 3GLVA 4UE6A 1XUOA 2JCBA 1U1FA 3H3FA 4H7JA 4K9PA 2I62A 2QMQA 3VUFA 4S1PA 4YAIA 2O5VA 4PN7A 5L95A 4UW9A 4F0JA 5C4GB 4YPVA 3DTVA 4NARA 3SI7A 2QY6A 2XDQB 3TQTA 3REQB 1P4JA 5D87A 1E8MA 1CUEA 1PJ3A 1YKFA 2GR9A 3SZ3A 5A0FA 3UH1A 5C1DA 3FTEA 2OSBA 1QGYA 1EFKA 4GQAA 3EXG1 4DNXA 3A31A 3PKZA 4F9GA 1FZQA 2PQ0A 3B9RA 1FRFS 1VCNA 2PHZA 3OJ0A 2O7RA 1T4DA 4QPNA 4RMIA 4CI0B 3OMWA 2IEGA 2X15A 2C7RA 3W9UA 2A1UA 4HF7A 3R7DA 5IUJC 4NV3A 3HEMA 3A3KA 3RHTA 1VB5A 1W34A 4NFLA 2AVDA 4PGAA 3G8YA 1JZTA 1O8CA 3CN9A 1XNQB 1DFIA 5JV5A 3D4BA 1VXRA 4AM8A 4BUCA 1E2KA 1YJ8A 1RM3A 2XMSA 4N5DA 4TTSA 1SCIA 4UUQA 5FBRB 5JC8A 1OV4A 1XVUA 4QGHA 3VOTA 2GVDC 2IWHA 2PE5A 1T2VA 4UUOA 2IXAA 1OI4A 4L16A 1X42A 2O50A 3L4BC 2NSDA 1COZA 2V74B 3VSAA 2HU8A 4ID3A 3AVYA 5EIEA 4HJRA 5DX1A 4QGGA 1JFFA 2A9PA 1F17A 3KQOA 3KVOA 4YDRA 1Z4LA 4DUPA 2CEKA 5G1NA 4OY3A 3T7IA 1JHPA 3H8JA 3IHKA 3U80A 3DEHA 1WV0A 2XMBA 3IMCA 1FL9A 3HKBA 3NGLA 1J9GA 4N82A 1E1QA 1N0VC 3BD7A 1NR1A 3ACBA 3C6XA 5B64A 2J3DA 3L7OA 4AURA 2Y0DA 3AFOA 3LKBA 4V1CI 1R00A 5ITSA 2IQIA 2FPGA 1CVIA 1GQSA 1Q7TA 1TE2A 2CLSA 1O97D 1A2QA 3VU1A 1WUKS 5CH3A 3OQVA 2XB6A 3EH1A 1FMTA 1YZVA 1ZOSA 3RVBA 3VR5H 5DTRA 4DMUB 3L8YA 3EF0A 3KYBA 4X7MA 1NF8A 2IC5A 3FOWA 3ZJUA 4D96A 1EG7A 2I7DA 2YW2A 3GG9A 4KTVE 5LM3A 3TPCA 1UPBA 2DFNA 1RAAA 4BBJA 4QOFA 4ZOLA 7MDHA 5ESRA 3PJGA 3OUTA 5KQPA 5JDIA 2VDWB 2SCUA 2WA2A 4IJUA 2JBHA 1EHYA 1OBVA 2AD1A 4UD2A 2J3JA 1PWXA 3BJEA 3FPJA 4LQLA 4FHGA 1UMBA 5FUQA 4UAVA 4CG0A 4ZRMA 3LOQA 5DM70 1OB5A 4O4JA 2GCOA 3CKYA 2UXBB 1I5OA 5D6OA 3SS9X 4D74A 4E0BA 1LBTA 3G5LA 4C04A 5A0VA 2OKCA 2WRZA 1T26A 1UKYA 3RVQA 4WK6A 1D4AA 5EHIA 4O4HF 2RBKA 2WA1A 3LWDA 1SHLA 4B35A 4DF3A 2IY9A 3PUWA 1G98A 2HFKA 5LBIA 1FU7A 1N5MA 4ZYWA 3HBMA 2OGWA 3W77A 4CKCB 3N2EA 4PYJA 2FFBA 1BMQA 3MMZA 4OK6A 3W7BA 2CDBA 2R6R1 4HUQB 4MW9A 4N40A 2E5WA 4F38A 10MHA 1OAAA 2P2LA 2JJYA 3IGFA 3L7KA 4ZMRA 1Z83A 1XL0A 4PS1A 1XNRB 1WL8A 1UM9A 2C4HA 4OXIA 2EFHB 2CJWB 2GA8A 3BJZA 4P58A 1D6SA 3SSMA 4C0KA 1WLYA 2VSXA 3LF2A 4PC3A 4R40A 4Y98A 2JFGA 3K71B 4MWCA 2VPWA 3BVPA 2K7ZA 1FJXA 3U7IA 3U3DA 1KC3A 4L75A 5BVGB 3A6JA 1L4LA 1MJFA 3ASVA 1W2GA 1YHYA 3KHSA 4FJ0A 3MWGA 4YMIA 1XF1A 5B1IA 4A0QA 4BVHA 4D9HA 3P2MA 2P2SA 2Y1OA 4TYMA 1YS2X 4Y2SA 5JPCA 5K8JB 2AIRA 3TLGB 3HMKA 4DR5B 3LPNA 4B2YA 2WJAA 1XALA 2QTGA 4KVZA 3SHQA 3OZWA 3F73A 1GILA 2VDPB 4UNNA 5SY9A 4ZZ1A 5M7EA 3T3MB 2L82A 1P0MA 1G3MA 1I5EA 1K66A 1ZPDA 1W35A 2FE4A 2R4UA 4IXDA 3R2JA 3KFLA 2V45A 5BSRA 1U65A 2I0FA 2GJKA 2V4MA 4RD1A 4A27A 5SYNA 1RHRA 4E5KA 2FDCA 2VI5A 2DHRA 4FE7A 2BFEA 3GFTA 2XCRB 4HUJA 1YFKA 1TVCA 1V3QE 3GHHA 4M9ZA 5D5HA 4GBED 3FYTA 2I4LA 1HTBA 1QF7A 2IZ0A 4IZOA 4DHWA 5A3JA 5C5IA 4H7EA 2CLMB 3I76A 4WVLA 3D1JA 3GLIE 1H0SA 1U2GA 2V9PA 2QMUA 4G0PA 5EZSA 1GZSA 2ZIXB 4KZKA 2CNWA 3L6BA 3A1VA 1VSQA 4WMLA 1JG4A 5H80A 1A8QA 1QIJA 2H3HA 4RPIA 4JXKA 4GLOA 4IO0A 4QU5A 4Q9LA 3BA1A 4IJMA 2IOFA 2AG8A 1V1RA 3CO0S 1QK5A 3A7EA 1SURA 4MQEA 3ESYA 4PN3A 5B58T 1CY2A 2IYWA 2MINB 2C9CA 3I92A 4J8PA 2J9FB 4P3PA 3ZLVA 3S68A 3F6BX 4A8JC 1RTKA 5JXGA 5I4BA 4JMPA 4RH1A 1YOBA 2QVLA 2H1CA 4CEHA 4D6XA 5HK9A 2YVKA 3QY9A 2FPPA 3Q0EA 1WCXA 2P41A 5DNWA 3V8RA 3W9BA 4G8CA 4O4IF 3F8SA 3AWIA 3KYJB 1XZAA 2HLDA 2JFWA 3QPWA 1E0SA 4F6CA 4CXMA 1W2HA 5HSGA 4ZV9A 1Y1LA 3V8QA 2C1XA 2B4YA 2JA2A 5JSUA 4C30A 3WJ2A 4E7OA 1QDLB 3AIMA 4A2WA 1EAYA 4WZAE 3CSDA 3GWGA 4X60A 1LSJA 4YV2A 3FZNA 1XLVA 1WDLA 2RCNA 5DLYA 4LRWA 5AJZA 1YKSA 1QE5A 2BZ0A 2WIDA 3L01A 2WJ3A 1QYVA 3HGTA 1FJ2A 1EUDB 4E1AA 3HP4A 4MMXB 4RTJA 1E96A 4QE3A 3DA8A 4ZYVA 1NG9A 1A97A 5T4BA 2WABA 1BE8A 1FF9A 2Z1MA 1C3JA 4FBGA 2I5PO 1SHTX 3D02A 1JDNA 3ZQ4A 3UVEA 2I65A 4GOND 1BH2A 1U7ZA 1E1LA 3DTYA 1NNUA 4K05A 4IHQA 1XU4A 1D1QA 3LWNA 5TR9A 4C07A 4WY8A 2BR3A 3CX6A 2IEBA 2ZSAA 3UHFA 4B81A 4M7OA 3P52A 3R8CA 4JUFA 1OBOA 1RJGA 3OWOA 4BNVA 4KR9A 3T7RA 5BW8A 4D8UA 1P1KA 1DJQA 1WV1A 2PJRA 4CGZA 3JTMA 3L7LA 4BQNA 3B6KA 3MS7A 1KFEB 3DBIA 3RUAA 4BP9A 1XZDA 1SUPA 2ZCVA 3AXTA 3OE5A 1Q5PA 1WUJS 2GBPA 3R74A 4M1YA 4ACBA 1KP3A 2CXQA 5ALIA 1M2OB 4UVEA 3SZUA 4D5GA 1CT9A 3KVRA 1RXSA 2PZBA 5K4GA 5HF5A 3F67A 3HVKA 4KRFA 2A6PA 1P6QA 4HK4A 3RUCA 1AHPA 3C4VA 3N3AC 5HKAA 1E1QD 5BMOA 4RE5A 4LGMA 1NQWA 2Y1LA 3DG9A 4L2IB 4ZKDA 1JQAA 2NYAA 5LA6A 4XGIA 3WK5A 1ESMA 4MR7A 4Z1OA 2QRUA 3QEOA 4TTAA 5LDDC 4CMHA 4OA8A 1FRQA 3OHPA 3ZH2A 5BWBA 5CG1A 4EG5A 1PSZA 1RI5A 2YIVX 2NOAA 4QO7A 3ER6A 3RUFA 2GJ8A 1M6VB 5F7XA 2BFBA 121PA 1HTTA 2R7LA 2AMJA 1YDFA 3HCDA 4IDHA 1EZ1A 3PC6A 5EZYF 4I46A 4IIJF 3PR2B 1KS9A 4RMGA 1S4QA 2IV7A 1E20A 1CS4C 2QVBA 5F1PA 3O31A 4O5OA 4US0R 2CLFB 3VAAA 3H8SA 4EHJA 3GUHA 2FPIB 4LC1A 4RCVA 3DQPA 4Z6KA 4B6EA 2I76A 1KI4A 5DO9A 5KTPA 3GEBA 4F86A 3CVJA 1Y7TA 2O5CA 1RXIA 3T7EA 1H1LB 3FLAA 3TCKA 4WBNA 2WW8A 2ANBA 3ETJA 4X95A 3DEKA 1YBAA 2FQYA 4B3JA 4HJXA 2O07A 1B8UA 1NUAA 1QV6A 3AEQB 2QYHA 2F8TA 2OXRA 1L4YA 3NWJA 4IDPA 2YJ5A 4OL0A 1KPHA 2Y68A 4RGQA 3ZWMA 1KTIA 4DS3A 5DTIA 4Y6GB 3RG2A 3VYTB 4QXOA 1KIAA 3SSAA 2PH3A 3N2YA 2JGNA 4YB8A 1WXDA 5F9MA 1LEHA 3DLAA 3DV2A 3EIXA 3BIJA 2DKFA 3CNEA 5IT5A 3WMRA 3DC2A 2DQSA 1YU6A 2AD5A 3TOVA 1NP7A 1WD5A 2R4QA 5IMBA 4N65A 4PBTA 1OWNA 4E08A 5IFLA 4HI0E 2QLJA 2UU9B 2PEZA 2Y99A 4YN3A 4JYMA 1VL2A 4B32A 5EJFA 2Z3VA 4YPFA 4GC9A 4WQMA 2QOEA 4ETNA 1STOA 3R1IA 1G3IA 2VIIA 3PRKE 1N1GA 1XRSB 2NPOA 2CDRA 3G5MA 4QDZA 4EI2A 1ECBA 4BXOA 5DHQA 4OBXA 3A9VA 1T1EA 2HRRA 3IUBA 4CV0A 1FDOA 4DMMA 1NNLA 1M7BA 2IUEA 3B6EA 3KZMA 2KWIA 2JJ1D 3NVDA 3T0GA 1XZLA 3WGQA 2QG9A 1I14A 2FZGA 3LC7O 3KEGA 2IYUA 3KDPA 3H86A 1QIHA 1AG9A 1PS0A 1KDRA 3B7PA 1EIZA 2Y93A 2B7BA 3TD9A 2FHSA 3P8ZA 1EP1B 4DXAA 5GZ6A 4G9EA 1RR6A 1E0KA 2HXGA 3F5MA 1F38A 1P80A 2AFHA 3R7NA 3PK0A 3EAFA 4BNJA 1S01A 2DJIA 2OSVA 3QKSA 3RJMA 3UA4A 3UOWA 1J25A 1DTWB 4GUDA 2VSFA 4M99A 2XA9A 3KR9A 4MVJG 3DONA 3THOA 3W5IA 4D3XA 2F62A 1YB4A 1VHWA 4QM7A 3M5DA 1XB2A 3T5PA 4KWCA 3MJTA 4KI0A 1BTOA 1DAHA 3CZ9A 1EGAA 2R6GA 1EDBA 1HDEA 3GFBA 3QIVA 4CM9A 1A69A 3QTBA 4NEGA 3O8CA 4EBBA 4EJ0A 3GT4A 2BDTA 2HCJB 4IS3A 2P77A 3I6BA 4DIMA 1XU9A 4UCFA 2BTQA 4ZCLA 4GWGA 3D8UA 2Z5GA 2HTEA 2DBYA 3PUKA 3DWEX 4A2CA 1NWHA 3L8HA 3NIDB 2FQXA 4XQGA 4P8RA 2FW1A 4HADA 4KFRA 2B1QA 1NBWB 2VL7A 2FX2A 3G7NA 3I1IA 2C95A 2G63A 3KQSA 1G64A 5C53B 3JD0A 3ZWWA 2Q27A 4EUNA 1FRVA 3ND8A 2VDKB 2ZULA 2SKCA 3VOBA 3K4HA 1A4XA 3T3EA 1XDGA 1BDBA 4LFBB 4LMPA 5DTJA 4TZTA 4PLVA 1KAQA 3E8SA 4BOYA 3JWEA 4D9BA 4PX9A 4MPTA 1ECJA 3BSWA 2F48A 2WG0A 2ZJYA 1UXJA 3BFVA 1GITA 3KB2A 3SZRA 1X86B 1YTLA 5KDOA 8MHTA 2ZWPA 5ITZA 5HVNA 3CNBA 1HDRA 4U7FA 1BU8A 1FX1A 3P9RA 5C8ZA 3C5WP 4US1R 1X1EA 2EARA 4Q1BA 2GH1A 1BXGB 2QBYA 3L1JA 2QVCA 1UK6A 4NIMA 3H5RA 3S2SA 1L5YA 1XKXA 4GZMA 1FYWA 2B37A 3JZFA 4CZ2A 2GETA 3MCUA 3TRFA 1M7GA 2H08A 3C7AA 5HRUA 3BMQB 1GNLA 1IHDA 1NI4A 2UYQA 4YAEA 4L15A 1O0CA 1XA0A 1GEGA 3NT2A 4YALA 2BW0A 4O2BB 1C7EA 1ZNQO 5HBGA 2Y0EA 3GARA 2PUCA 2PANA 2BY4A 1U0FA 2P1DA 3NYIA 3F96A 4I9UA 3BERA 2QWXA 4I6GA 2I55A 1L5KA 1Q0QA 1PDWA 4XH9B 5BV2P 5A0TA 1GKYA 3GYGA 1WUHS 2WJVA 3ILSA 5TT0A 3X1MA 5ITVA 1KHHA 3HY4A 1NC3A 3CZMA 5DK4A 3T0IA 4BGIA 4XWOA 3E3MA 2NG1A 1BXRA 1GQYA 5EQJB 1FFCA 1PL6A 1QRRA 1KY5A 1XQXA 4QYSA 3WLIA 2EGGA 3IIMA 4AO8A 1ZI9A 3D5QA 2I1WA 2IUTA 4G4IA 3AW9A 4H3HB 3PC8C 1D7OA 3QE3A 3WLOA 3NWOA 2ZBEA 1E9AA 4CIAA 1DAKA 3WNCA 3H2BA 4MAFA 5DF1A 3WJAA 3FHTA 1CY4A 3UOAB 1G8SA 1MJ5A 4ZPXA 3GVPA 4QICA 4Y2GA 3MRXA 1MH1A 2I6TA 2H4HA 2HU7A 4JLUA 2RK3A 1AUQA 2ZPTX 4FI3F 1PV1A 1U2RA 4X62B 2B82A 2A58A 5LLTA 2WMNB 1E4EA 2OCKA 4FBMA 5SYAA 4IKPA 4N5IX 4JS0A 1X70A 3IVCA 5TGZA 1RI2A 4U2BA 5E1MA 3PEVA 1CKEA 1UDBA 2ZBGA 4ZAXA 2Y1CA 5LZ2A 4BUZA 5IULC 1L9XA 1XXHE 4OX9B 4MINA 5C2JB 3MW8A 3A6GA 1PX0A 1HZZA 3C8UA 3NDRA 5ALLA 3HCEA 4M0KA 2HXSA 1L7EA 3JD2A 2UAGA 3VPGA 3AEZA 5J2UB 4ENTA 4X5OA 4BVJA 3I2YX 1I0ZA 3PNQA 4LNHA 3HB1A 3X1DA 5JADA 5IVIA 1WXXA 2AN1A 1O5IA 1U4NA 4GL4A 5AW7A 2YBDA 1NQXA 2A0UA 2HX1A 2ZKIA 1ZAYA 2WFLB 2CXSA 3TRIA 1OA0A 2XW6A 1OFUA 4A0HA 4DUGA 4GICA 3C14C 2C99A 3AL2A 2E4XA 3AR9A 1UXOA 2NO1A 2VNSA 4HKTA 4JLDA 4R54A 4HAXA 3TIVA 2WJ4A 2FWMX 1QORA 4LMRA 3CWCA 2NVUB 2H2HA 1CUXA 2EFJA 2OORA 3D59A 3NV7A 5FFFA 1D2GA 1UZLA 5ETJA 4BGEA 3E8XA 1WA5A 4N7MA 1ZJ4A 2IE8A 1R4AA 3E3NA 3QMWA 2YRFA 5DLEA 2ZU0C 3O8QA 1SBNE 1XROA 3B3FA 2G09A 2X2FA 2YS6A 3IAUA 3W4JA 4CCSA 1NNEA 1MH9A 1I1OA 4F46A 3T9BA 4GEKA 4HV4A 4IEIA 2X1HA 2G83A 1S2LA 2AH5A 4CDMA 3MD0A 5J3JA 1K3UB 3OZBA 4GRAA 1JWAB 1BFUA 3OU7A 4J4BA 4DCSA 4YRFA 1ZH0A 3JQGB 1Q15A 3V32A 1CU1A 3RADC 1NMXA 1KK0A 2WYHA 4B3DA 2NZJA 1KAHA 3BICA 4PG7A 2P40A 4J1TA 1PS8A 3UW3A 4EVIA 1E69A 1XDSA 5FKJA 1AMOA 1HFKA 2W6JA 5KEIA 3HSYA 4G5GA 1JVBA 3R7AA 3SM3A 3ZS