1J1IA

Crystal structure of a his-tagged serine hydrolase involved in the carbazole degradation (carc enzyme)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
258
Chain Sequence
b'AYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta cleavage compound hydrolase
publication title Crystal structure of a histidine-tagged serine hydrolase involved in the carbazole degradation (CarC enzyme).
pubmed doi rcsb
source organism Janthinobacterium
molecule tags Hydrolase
total genus 87
structure length 258
sequence length 268
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j1iA00
1IZ7A 1DT5A 3WL8A 3QYJA 3G0BA 1DX4A 1Q0RA 3AUKA 3NUZA 4NMWA 1RWQA 5KWJA 4OCZA 1EB8A 3FOBA 2V97A 3G7NA 5LZ2A 2WUGA 4H0CA 3O4HA 4AX4A 4JYPA 3B12A 3QPCA 1FFAA 5FP0A 5A6VA 2WIDA 2WG1A 2RHTA 1XRLA 5ALLA 2WG0A 2ROQA 3DL4A 4TVKA 4H7IA 2WHPA 2HHAA 5HKAA 3H1AA 3WK8A 3BF7A 1GKLA 1L7QA 2VEOA 5A7FA 3ESCA 2XLCA 1G66A 3I1IA 3I2FA 2V9ZA 4X97A 1C4XA 3I2GA 1CUUA 4E11A 3PUIA 5HF5A 2PSFA 1BU8A 1ZI9A 2PM8A 3FVTA 4UBIA 4G8BA 5DWDA 2GBCA 4B7ZA 1VA5A 1YASA 5D7BA 3R40A 3HXKA 5LZ7A 4AN0A 4QA9A 3FLAA 5CW2A 1XZDA 1LBTA 4AMYA 3F96A 3G0DA 3I2HA 4BAUA 3B3QA 1VE6A 4OYLA 1EDEA 2R11A 1K4YA 3QMMA 1DWOA 4DTCA 3H17A 1ZI8A 3JYHA 3BWXA 1GPNA 3WYDA 2QKYA 1IZ8A 3RKSA 5JALA 4MWSA 3V9AA 5E4TA 3M3DA 2ZYRA 5LKRA 2XMDA 4DSZA 4DM7A 2QTBA 1TCCA 4DNQA 2VAXA 4B85A 2WLSA 4BVLA 2E3JA 3VVLA 4KR0A 3FLEA 4X91A 1CUHA 4B0PA 5JAOA 5AO9A 4BC0A 3WKAA 5ALGA 3IUNA 2HA7A 3WA6A 1G42A 2B20A 1MTZA 1W1IA 4QLAA 4U2CA 2VTVA 5HF8A 4M0MA 1T4MA 5CH3A 5AIAA 3QITA 3BIXA 1E3QA 4AO6A 1CUGA 1MU0A 1P0QA 2IIVA 3F8SA 3HI4A 4DNOA 1CVLA 2Y6UA 3VJLA 1ISPA 4QEKA 3WK5A 4K6KA 2HA2A 2ECFA 4UHFA 1Y7IA 5AK4A 4P93A 3S2ZA 5AI0A 2ZSIA 1JI3A 5AKEA 1EB9A 1GXSA 1QE3A 1JT2A 1Q84A 5FKJA 4HRXA 4A5SA 1SCQA 5YASA 2C0PA 1QTRA 1WOMA 5A2GA 2H7YA 4C88A 1FFCA 1YAHA 1XRMA 4AXBA 1K8QA 5DYWA 3D5EA 5IVIA 4CI9A 2CB9A 4JH0A 3ZLTA 1IMJA 2WFZA 3D2AA 2H9YA 1XQXA 5C81A 1XZHA 2J3QA 3DYIA 2XUOA 4UBOA 3IDAA 1CUSA 1NX9A 1FFBA 1O6GA 2V96A 2WHRA 5ALYA 2G5TA 4EBBA 2XUKA 4QNNA 3I2JA 4FOLA 4M0FA 2VA9A 3D2CA 1TQHA 1B6GA 3STXA 3H2IA 5AOAA 1QOZA 2J3DA 1QLWA 3KOOA 3LIPA 4BZZA 4ZWNA 3F98A 3W06A 4W1PA 3KD2A 3UUEA 3WKEA 2DHCA 5JZSA 1BEEA 1EDBA 3WWDA 2XMSA 4GBGA 2I3DA 2WHQA 1XZMA 2OG1A 2ONCA 3D3NA 4BYMA 3FWHA 5IVKA 3M82A 3DJYA 3OM8A 5CH5A 1R1DA 5ALQA 5ALHA 5HCUA 4EB0A 3EF3A 2WTMA 3DL7A 1U2EA 2OPHA 3AIMA 4U2BA 3PUHA 2AJCA 4BVKA 4K6HA 1UK9A 4OB7A 4E46A 4CCWA 2DQYA 3R3VA 4KE9A 4Q05A 3HSSA 5C7YA 5HQ3A 3R3ZA 5HF6A 1A8UA 2DFPA 3G0IA 4CG3A 1XQVA 2BJHA 3C8DA 4QLOA 4L0CA 1UOPA 1DTEA 2XI4A 1UOOA 1A7UA 4J3JA 1BS9A 3L1JA 1XQWA 2Z8XA 5LLSA 2OCIA 1CUWA 2ORYA 5JAUA 2XUIA 3HEAA 2C5FA 2BGNA 4C4YA 4Y9SA 3ZLVA 5I9IA 4EHBA 1JJBA 2HIHA 4PV7A 1ZI6A 4A23A 1XRQA 2I3ZA 3RLIA 1ZGCA 4IHAA 2ZYHA 4BVJA 4YASA 5AICA 3CN7A 1OXMA 3GBSA 5T4FA 3GELA 4S0XA 3WA7A 1LLFA 3FAKA 3V1MA 4UFPA 3AJAA 1CUAA 4QZVA 2QT9A 7YASA 4FBMA 1DQYA 3K9BA 2YXPX 1LNSA 5AH0A 2G63A 1DINA 1ZIYA 2HM7A 3WKCA 1H2WA 4QE3A 2LIPA 4DLNA 5HK8A 3A2NA 4ZXFA 3I28A 5ISMA 5CURA 5JD4A 3FBWA 2DHEA 3SC2A 1EI9A 5IVHA 3OC0A 3OTQA 5A71A 1SC9A 1W4LA 5AI4A 4L9AA 4DSAA 3W9BA 4WDRA 1J2EA 4B84A 5K3AA 1TAHA 3WMRA 4WFJA 2PKYX 5KWIA 4BAGA 2CEKA 5I7UA 2Z3WA 1BROA 1WCYA 3DKKA 3QM1A 5AI5A 3LIIA 2HL6A 2ZYSA 4UFNA 2OGTA 4AZ3A 5J3JA 2PSHA 3G8YA 5JARA 1JU4A 4AO8A 3WKBA 1NU8A 1SFRA 1U8EA 2PVSA 4HTAA 4G1FA 4X6YA 1D07A 3ILSA 4F5ZA 2XE4A 1ACJA 3DS8A 4MQLA 3BDIA 4GLBA 3WIOA 3WJ1A 2H7CA 2JGJA 1BCSA 4HZGA 3R41A 5CH8A 2Y2VA 1K5PA 3WLAA 1EX9A 3WZMA 4G5XA 3IUMA 4P92A 1TRHA 2BUBA 2XDWA 5HFAA 2HDWA 1CUBA 1QIEA 1YS1X 2PU7A 4H18A 4YX9A 2O7RA 1GT6A 1DX6A 1XZCA 1E8MA 2JGEA 3C5VA 5C8ZA 3WKDA 4X93A 3E0XA 4Q82A 2C58A 3RM3A 5CRIA 3WWCA 1EH5A 2Q0XA 2XT0A 3E4DA 4X7BA 1DT3A 2CMFA 1UZAA 5HZGA 1UKAA 2WJ6A 1Q83A 3SWWA 3IUJA 3Q0TA 4J7AA 1A88A 1USWA 3FYTA 3LLCA 5BWBA 5DYYA 2FJPA 1EINA 1QIFA 4K5QA 3PDCA 2QJWA 5LKAA 1ORVA 4J0DA 4P08A 4Z49A 3GUUA 4BRZA 4QDOA 1JJIA 2B4KA 3KDAA 1XRRA 1HPLA 1DU4A 1BN6A 1WB4A 4EY4A 1QTIA 4CCYB 1WHSA 4LXHA 1MPXA 2QUAA 2WQZA 4EUSA 1N8SA 5HF9A 4BC1A 3V48A 3BXPA 5T4BA 4EY8A 3W04A 4G8DA 3IB3A 5BOVA 4X95A 2WTNA 4NZZA 1EK1A 1EVEA 4ETWA 1W6RA 3PICA 4X92A 2QZPA 2YASA 3WK4A 5AI6A 3HACA 5EHNA 1Q0ZA 2JGLA 5ALVA 1IUNA 1JMYA 2JEZA 4FMPA 2XUDA 3PF9A 5K5EA 3RK4A 2ZVDA 2XLBA 4Q3OA 2WM2A 1VZ3A 1QJ4A 1YB6A 1XLWA 2OCKA 1BN7A 3Q8WA 1TIBA 3GFFA 4HVTA 1S8OA 1EHYA 4ZV7A 5SYNA 2O2GA 1JMKC 3WIBA 1W75A 4DNPA 1ODCA 4OSEA 3NWOA 5E4JA 2BGRA 4G9EA 2VJAA 2R8BA 3CCCA 3CCBA 2RIPA 2HADA 1ZICA 5FDFA 4N8SA 4HRYA 4F0JA 5AKYA 4BDTA 3FCXA 4MQMA 1JKMA 5CXUA 4NS4A 5CBKA 1R50A 5AM3A 4H7EA 5K3FA 2EDCA 3STTA 2XMQA 4C89A 4Y2VA 2BKLA 3G02A 1UK6A 2PSJA 4D9JA 1HLGA 3O95A 1B41A 1IVYA 1I6WA 4PSUA 2I03A 2IITA 4GECA 1CQWA 4BTLA 4PSCA 1ZD3A 3T52A 2WFLB 2VAVA 3C6XA 5AM5A 1UKBA 3W9UA 3QH4A 1HQDA 4DMHA 1YA4A 3GROA 4PF1A 4DIUA 2GBFA 3RARA 1MN6A 3DEAA 1H2YA 4G9GA 1P0IA 1QZ3A 5ALIA 5DJ5A 3IBTA 1TK3A 3WZLA 2ACEA 2Y1KA 2XQJA 5ALXA 1XZKA 3MGAA 3E3AA 1OCEA 4C01A 3IUQA 1MJ5A 1UT6A 4FLMA 1XKTA 3FNBA 4DNFA 5AKGA 3DOIA 1KU0A 3G9UA 2GZRA 4FBLA 5LIPA 1CFJA 3QBJA 5JZBA 4N8DA 1IUPA 4UBLA 3VXKA 5CT6A 2DR0A 2Y6VA 4AO7A 2GBGA 3WL7A 2CZQA 3HRHA 1MAAA 4N5HX 2PL5A 1CV2A 2YYSA 3WL5A 5D3ZA 5K3CA 4U2DA 2OQVA 5ALOA 4LHEA 1KU6A 2VQ6A 3CXUA 3KWJA 5HKBA 2BCEA 4LIPD 3O0DA 4OUKX 5AKZA 2JGKA 4XVCA 1N1MA 4KEAA 3I6MA 4ZV9A 3WYNA 5CMLA 4H7JA 3M81A 4KJXA 1CPYA 1UFOA 5FRDA 3H19A 3WK6A 1SCKA 5ALEA 2DHDA 3H0CA 3D7RA 3VJMA 3TRDA 4Y2QA 4IH9A 1F8UA 4F21A 1U4NA 4ZRDA 1HKHA 2X8BA 4EZIA 1K6EA 4X00A 1XZJA 2C5GA 2HU5A 3HABA 3L1IA 1AX9A 5A7GA 4B80A 5ALNA 2XQIA 2XUGA 3ED1A 3P2MA 4B82A 1GGVA 5LZ9A 1R88A 1JJFA 4BZWA 4W1RA 2VJBA 1CUFA 4OU5A 1LPMA 2XB6A 1WPRA 1W76A 3IURA 3PI6A 1ODTC 4UHBA 3JW8A 3FYUB 1VA4A 5F4ZA 3ICVA 4OB8A 1QFMA 3A2MA 5ALFA 1KEZA 4ITVA 5IVDA 5T4HA 4KE8A 1E66A 2I78A 4MEBA 1CUVA 4BRSA 2VJCA 1XQYA 4Q1VA 1E5TA 4B6GA 2OXEA 3H04A 1CEXA 2XMGA 1ZJ5A 3W2TA 5HFNA 3VDXA 1J07A 1XZEA 1AGYA 5JADA 5AM1A 3PF8A 3OG9A 4M0EA 1ZD2P 5EIEA 3VISA 1XZIA 4FHZA 5JZ9A 4DMFA 4KAFA 1XLUA 5DNUA 4H7DA 4GDMA 5AP9A 4UHCA 1J1IA 4X3CA 2OLEA 3BIWA 1YCDA 5CT5A 4FFVA 3X3HA 3VKFA 3LCRA 3PFBA 4KAAA 5ALKA 4J03A 1X2EA 1RP1A 4PQEA 1H22A 2AJLI 2WIKA 5D3KA 3C87A 3H1BA 2WG2A 5ALJA 2D0DA 5D6OA 5FPQA 4J0HA 4G8CA 1XZBA 2V98A 4BCBA 5FPPA 3BL8A 3R0VA 3O9VA 1RYYA 5ALTA 1F0PA 3D0KA 5EHXA 5AJHA 4U2FA 2HFJA 1MT3A 4WDQA 2HA3A 5AI9A 4CFSA 2CKMA 1AMNA 5ALRA 1MNQA 1VZ2A 4BDSA 1GPLA 3STYA 5ALMA 2XUPA 4FWBA 4J0GA 4KACA 5AM2A 3STVA 3R3WA 3A2LA 4GW3A 3U0VA 5C8XA 4XJVA 1XRNA 1YS2X 1G5FA 2PSEA 3CN9A 1CLEA 3V1KA 4B9AA 4FNMA 5T4EA 5JYCA 1WB6A 3EBLA 2Z3ZA 3QPDA 2P8SA 5K3DA 3ZWQA 4ROTA 1LGYA 2JGFA 4KAJA 4UHDA 5DTJA 2HA0A 4MEAA 2EEPA 4Y2UA 2QJRA 1LZKA 4KE6A 3QVMA 1JU3A 1G4HA 4LYEA 4FLEA 3UMJA 2Y2UA 4C4ZA 4J0CA 4X94A 1LPAB 2JEYA 4Y2TA 4PW0A 1UKCA 4ZGBA 2XUAA 4J0KA 1FFEA 4W1SA 1H2ZA 2G5PA 1TCBA 1ZD4A 3N2ZB 2HU8A 5K3EA 2VATA 5FOQA 4CIBA 1YR2A 4HS9A 4LXGA 1XRPA 3EQ7A 2XUFA 5JAPA 2HA4A 3FYUC 4PO3X 5LYYA 1QIGA 5K3BA 2QVBA 2UZ0A 5HQ3B 4FLFA 2OCLA 1QIKA 5ALDA 1ZJ4A 1DWPA 3FLBA 2QUBA 4F60A 2JF0A 3NGMA 2ZJ6A 2VJDA 3SK0A 2K2QB 1CIJA 5JD6A 3C45A 4DMKA 4GEGA 3DOHA 3TJMA 2QMQA 3G9XA 3DNMA 3L1HA 2XQFA 4MYDA 5AKKA 2HA6A 2WFMA 2B61A 2PPLA 4AN1A 4BP8A 4DMCA 3V1NA 1ZIXA 4U2GA 1CR6A 1EA5A 4OU4A 3S8YA 5AOCA 1XFDA 2PX6A 2J4FA 1WPXA 2XMCA 3KXPA 3C6YA 2WUFA 1Y37A 4GHWA 4BATA 2GBIA 2JBWA 1J06A 1H2XA 1GZ7A 5EI5A 4E14A 1XROA 1GPKA 2QXTA 2ZJFA 3G0GA 1Y7HA 3C43A 1E8DA 1UK7A 4G4IA 4X71A 3A6ZA 4O08A 4YK7A 3F67A 3K2IA 2CJPA 2GZSA 5ALSA 5LZ5A 5DNWA 3YASA 3G0CA 5ALWA 1HDEA 4QDZA 3ANSA 2JGMA 2RI6A 3G9TA 4KE7A 5AKJA 3WL6A 4IO0A 2ZYIA 3R3YA 5DYTA 3D59A 1C7IA 2QOEA 1X70A 4JNCA 5LZ8A 4MYSA 2XUHA 1YSCA 3C6BA 2J4CA 1L7AA 3WWPA 4B9EA 1XZGA 4MWTA 1AURA 2Z8ZA 4GXNA 2C7BA 4Q34A 1A8QA 3QPAA 4N8EA 3KSRA 3QZUA 3GA7A 3AFIA 3U1TA 2B9VA 2O7VA 2PBLA 5JAHA 1CUYA 4X85A 2XMZA 1XZLA 1UOQA 2CUTA 2QR5A 4Y2SA 4OD0A 3ICWA 4BE9A 3G9ZA 1EDDA 5FXMA 3I2KA 4IH4A 5HK9A 4LKOA 4CG1A 1LPPA 3AZPA 1CUDA 4QDXA 4RE6A 1A8SA 5LP1A 1DWQA 3ZPXA 3UUFA 3IIIA 2EDAA 1CQZA 3OOSA 3DKRA 1QFSA 3ZLUA 1THGA 1MAHA 1MX5A 2AXEA 3AIOA 4EY7A 3OPMA 3D4LA 3C8HA 4BAZA 1TCAA 5EGNA 4LYDA 2OAGA 1CUJA 2OCGA 2C4HA 1AKNA 2HRRA 4HXFB 4JEIA 4N5IX 3ANTA 2O2HA 1CUZA 3K6KA 4BB0A 5ALUA 4EY5A 3H18A 1U65A 1BEZA 1VXOA 5AOBA 2OAEA 3R3XA 4CG2A 2AJ8A 1GKKA 3A70A 5I8PA 1QO7A 4RPCA 5CT8A 2CBGA 2WU3A 2BUCA 1R9MA 3I1YA 3LP5A 5DNVA 3DD5A 3VVMA 2X76A 1HL7A 2QXUA 1QIMA 3AINA 1EK2A 3JWEA 1GQSA 4AMZA 1LPNA 3FVRA 1LBSA 2ZJ7A 1JFRA 5KBYA 1QIHA 2XQKA 4UUQA 2H7XA 1YA8A 3WWOA 3FYUA 1AZWA 2HFKA 2VT7A 3O4GA 2PUHA 4HXGA 2PU5A 3FCYA 2AJDA 1FSSA 5AM0A 2VSQA 3BJMA 4ARAA 1YB7A 3O4IA 3VJKA 4UHEA 1W52X 5AHXA 1AQLA 2RAUA 1MO2A 2XUQA 1EVQA 4AB1A 3TEJA 2FUKA 2WHPB 3WK9A 3WQHA 1F0NA 4A16A 3QMWA 4QWMA 4OYYA 5AK3A 3GZJA 4UFOA 3MUOA 5K3FB 5AKXA 1R9NA 4Y2JA 4QDUA 5JIBA 3O9MA 1Z68A 3BDVA 1WHTA 3V1LA 4C6HA 1PJAA 3IULA 5CXXA 4CIAA 4Y2PA 4AZ0A 4Y2YA 1QO9A 1PFQA 1SOMA 1N5RA 2IX9A 6YASA 1QIDA 4J0IA 3R3UA 2WKWA 5AK5A 1YAJA 4DGQA 2W6CX 1C7JA 4Q3KA 2HRQA 4H77A 3LS2A 1CUIA 4W1QA 4J0JA 4BP9A 1PV1A 3EIOA 4FDMA 1LZLA 1VJ5A 5DTIA 3AZOA 3SX4A 2XMBA 5H3HA 3I2IA 1CUCA 1GQRA 1FJ2A 1THTA 5FLKA 4X6UA 1VE7A 3QMVA 1ZGBA 5AKIA 1MX9A 4QDTA 1ZOIA 3B5EA 1R3DA 2BAGA 2D5LA 4TGLA 5C8VA 1QGED 4UHHA 1MNAA 2BFNA 2QRUA 2DQZA 3F97A 2H1IA 4UBKA 5JASA 4UBNA 4GI1A 5IKXA 4WFKA 1QONA 5AKLA 1P0MA 4XX1A 4YPVA 4PNZA 3O4JA 5ALPA 5EFZA 2FJ0A 2XMRA 4H7HA 1WM1A 1MX1A 3H2JA 2RGUA 4RE5A 4K2AA 5ESRA 5BV7A 2DSNA 3DCNA 3MUNA 1ACLA 2ACKA 3FSGD 3HYSA 4W63A 3DDUA 1FFDA 1R4ZA 3HZOA 4XWGA 3HC7A 3PFCA 3H2GA 4BTVA 5CTAA 3OURA 2JIDA 1F6WA 4ZREA 4WJLA 1VKHA 3AZQA 2PSDA 1XZAA 1CUXA 5EHQA 5JD5A 4U2EA 1P0PA 1LPOA 5AIBA 4E15A 1TKRA 5EIHA 4Y2XA 5E2IA 1O6FA 2OGZA 5IH7A 2Z5GA 3C5WP 1BRTA 2WJ3A 4INZA 4W9RA 2HA5A 1E89A 4I4CA 1XKLA 2HU7A 4G4GA 4XIIA 1SCIA 4Q3LA 3T4UA 1UK8A 5FUMA 1WB5A 1XZFA 2WIGA 4KRYA 3IA2A 4IQ4A 1AUOA 3MVEA 3WI7A 4BCDA 2OGSA 4NVRA 2XUJA 3IVMA 4BCCA 3EQ9A 1CUEA 2NW6A 1UWCA 4C4XA 3I6YA 4KYVA 2ES4A 1BE0A 4X90A 4RNCA 1T2NA 1UXOA 3ESBA 3WWEA 1ORWA 4FKBA 1M33A 1VXRA 4X6XA 3W05A 3STUA 4L72A 3WJ2A 1QIJA 5DLPA 4WFIA 2PUJA 4I3FA 2XQGA 3M83A 5AK6A 4CCYA 1K63A 4AQDA 4C87A 2RONA 4B0OA 3FSGA 2WU4A 3D2BA 4PSDA 5LZ4A 3AILA 3TGLA 2GYVA 4K6GA 2VT6A 4BE4A 2YH2A 4EY6A 4BBZA 4I19A 4LXIA 4H7KA 4G4JA 1N5MA 5BWCA 5FV4A 3HJUA 5AM4A 4DYHA 2QS9A 2AJBA 2BUAA 1QIIA 4JUIA 4Y7DA 2WIFA 3NOXA 4FNGA 4P9NA 2O2IA 4FTWA 1VOTA 2QM0A 1IUOA 2WUDA 3H2HA 4RGYA 4B83A 3C6ZA 4H7FA 4ARBA 4IH1A 2WUEA 1LPBB 5KREA 2JGIA 1NU6A 1H23A 4MXDA 5JATA 3AIKA 1LPSA 4FFWA 5ALZA 4HXEB 2C0QA 4WCVA 3N0TA 3E1GA 3EQ8A 1X2BA 4V2IA 1E8NA 5SYMA 1HBJA 2GYWA 2FX5A 4WY5A 1ZD5A 3ZI7A 2RHWA 1L7RA 4UBJA 4UPDA 5JANA 4QWWA 3H2KA 2G4LA 3BE8A 3HLKA 2X5XA 4H35A 2WSLA 3DLTA 2GYUA 3DQZA 4OPMA 2W22A 3I6ZA 4OB6A 3BJRA 2WIJA 2WILA 4JYMA 4Y2RA 5EHZA 3BF8A 5EIAA 1XLVA 2WFLA 4TPKA 3DYVA 4ZI5A 1EXWA 4HAIA 1BCRA 5A62A 3F9CA 3C70A 5CT9A 4L3WA 1ETHA 2ZSHA 1VLQA 5AI8A 1ODSA 4MJ3A 3WK7A 2DCMA 1DQZA 3ZV7A 4EA6A 4GWLA 4UBMA 4WY8A 5CT4A 3KWFA 3PE6A 4B81A 5A7HA 3ESDA 4KRXA 1CRLA 2WJ4A 3STWA 3ESAA 5E4YA 2OQIA 2VF2A 1OILA 5AKHA 1AC5A
chains in the Genus database with same CATH superfamily
1DRJA 1Q0UA 1ZNZA 3ZHZA 3EE6A 1ESZA 3IKJA 1UXKA 3EUAA 5J4LA 3B1XA 1SD1A 3WL8A 3QYJA 4QXPA 3EOBI 1YA6A 4E5UA 5CEJA 1YZHA 4L8WB 3KQVA 2ZT8A 3KTFA 4WUTA 5FFFA 3T0IA 5JS8A 1BC5A 1FXWA 1V96A 2FDXA 4HL6A 4MQEB 5CUQA 1U8ZA 3DQPA 2V97A 4MW4A 1AVTA 3GYBA 3G7NA 4HK4A 1V25A 1R5OA 4I1SA 3E5RA 5EP1A 2ICAA 3MJDA 1FXUA 4LJ5A 1YHYA 3FNHA 4H0CA 4AJ1A 1DG3A 4BKRA 2ZRQA 1T26A 3PTLA 2VXYA 4AX4A 3BG5A 3B12A 5DULA 4EJSC 4HQ6A 3B1WA 4CTMA 3VI4B 4OI0A 1JPVA 5A6VA 1HOTA 2IZ0A 4IXWA 5CLQA 3QX3A 2EQBA 1X7XA 4MVJI 4XRRA 4HNUA 5CA1B 5AHOA 1XCGB 3UH1A 2QGFA 2G0TA 1KO1A 2XGJA 2RHTA 1XRLA 3E9MA 2X41A 3D7MA 3M1IA 5T8KA 1P2TA 1UBEA 3FVQA 4F86A 2BR3A 1RWBA 4GI2A 1YDEA 4OHKA 4H7IA 2WHPA 1WXHA 1L7EA 2G88A 1K27A 3UHOA 4DLYA 2A4KA 2IPLA 1FDVA 1YIOA 2X2OA 5H5JA 2PKEA 5U4QA 3MPOA 3WNDA 3KD3A 4QYSA 4CKCB 1GYQA 4CM4B 1XD2B 3B2QA 1GKLA 2XF2A 2PT9A 1EUDB 3OCCA 3L06A 3Q3GE 3UK1A 4MCIA 1LH0A 1G66A 1S7CA 4GPZA 4R2WA 4UJ5A 3R1IA 3RF7A 4YROA 2PJRA 4OLFA 3NVAA 2OO5C 3ZS9A 3RTBA 4ZJPA 4JD5A 3PUIA 3AI3A 2J7PD 3SHOA 1WVIA 1O9GA 3H9UA 4JCOA 2ZDHA 4IDBA 2QEQA 2YCBA 2OVFA 1XTJA 1BU8A 2BKVA 4MR9A 5KVVA 3V4LA 4EW1A 2P11A 3T1TA 4DR4B 1ZI9A 1UCFA 3FVTA 3EMKA 3Q8XB 1JHMA 3RSSA 3ZHRA 2JCXA 3GRUA 5DWDA 3QVGA 4Y0NA 1L5HA 1JFTA 2VTDA 3V97A 2NSDA 4DN6A 2OP1A 5HUHA 1NW5A 5JO0A 3WSTA 1MIOB 1ISJA 4M8LA 4PPYA 4H4CA 2BOVA 2I7CA 4OGFA 5EMKA 3WNQA 1PWEA 3ANYB 2R4UA 3JCZA 3OZAA 2CMDA 1PL8A 4GF5A 2RJOA 3UICA 3W6UA 2RE8A 2C42A 1EFVB 2VAMA 1W4ZA 3NBMA 3WIDA 4C7XA 3JR3A 3S27A 3F96A 1ST2A 5LA6F 2QQ5A 3ROQA 3LUKA 1HT3A 4L6IA 3RS8A 1SH7A 2WWIA 3B82A 2O6HA 3UMMA 3HCFA 1J4AA 2Q3MA 3D8SA 3U4AA 1DWOA 3LRTA 4BNNA 3K9WA 4BJ1A 1V8FA 1POWA 4I55A 1W0JD 3TLKA 4V0OA 2MR5A 1T5SA 1KS9A 2GX6A 2QKYA 4R05A 3DPUA 4YJDA 2XZPA 3GCWA 3QKSB 3QV1A 3EVNA 3L40A 4YCLA 3IHKA 4N5DA 1RJ9B 1ZJYA 5BRNA 3V9AA 4Y18A 2RH9B 1WEKA 4ZVOA 2NXEA 5A0VA 1UWVA 3WGLA 4C1BA 1E6KA 2GD0A 2ZYRA 2J48A 2NTJA 4N7BA 3RODA 5AOVA 6ABPA 4DSZA 1KFCB 1NA5A 1MFPA 4I4IA 4Q12A 3CVYA 4DNQA 4WEOA 2VAXA 3ZE9A 3CX4A 3MTQA 4B85A 4P3YA 5TQ2B 1JLRA 1L7MA 4BPRA 4HPWA 1XPRA 1NF8A 5CJ2A 3B2NA 1QYWA 4JLWA 2REQA 4DR1B 2CHFA 5EN4A 4HEHA 5EJEA 2QQEA 4P4SA 1KPHA 1Z2DA 1RKXA 2CXHA 3EA0A 5D84A 3QEKA 4BC0A 1MOQA 4PZZA 4EQ6A 1G55A 2AKYA 3ZD9A 2V4ZA 4DIEA 1ZK2A 2AFVA 5B6PA 3WA6A 5BSVA 2BGGA 1DOZA 3SQDA 3BD6A 4KSCA 4WK2B 2R6CA 3IP7A 3PFIA 3IIMA 3WV4A 2HNAA 4IINA 5DTRA 4V38A 1GZSA 1X8LA 1JVBA 1C3VA 2AB0A 2YUTA 3P2EA 1KBOA 1Z6YA 2UVQA 3PDUA 4QLAA 4U2CA 1Q0TA 2XE7A 2Y76A 2YYYA 4PYIA 5KTYA 2GN9A 4ZDIA 2VTVA 3I5XA 3SS7X 3M2PA 2A9PA 3AKEA 2JGDA 3KPYA 4R3NA 1XNJA 2FMFA 1II8B 3KR0A 5K05A 1EWKA 5CH3A 5CEFA 1HYHA 1WNTA 5TQ0A 1BD4A 3BULA 3N5KA 4CHTA 3T4PA 2N47A 3MT9A 4NE2A 3BIXA 2MYPA 5BR7A 1E3QA 3IVRA 4FS8A 5TJ9A 3ZDXB 4AO6A 4ER6A 5TY0A 2QN9A 1VQ1A 2A33A 1VB3A 3OLZA 3S70A 4D96A 5E1MA 2R6GA 1ONBA 2JHCA 1CJTC 4YFYA 1DAFA 1MU0A 3O1HB 2IJGX 1RBYA 2I99A 3AB7A 3HR7A 1E2FA 2PSSA 1VPTA 1MB3A 1NDUA 2Z2XA 1MAWA 1KJWA 3VPCA 1ISPA 4ZVPA 3ZDEA 1CVIA 1VJCA 2OC4A 2ONKA 5FPHA 3KYIB 2HA2A 4TS9A 1KYIA 1SD2A 5I9TA 2O0MA 4K0KB 2FP4B 1U9JA 3A3KA 5EEGA 2XOKA 3RNOA 3VKWA 3WGYA 4V0NA 1XNHA 2FF5A 4I9FA 2DFLA 1N5LA 2WU1A 2O0HA 1FJGB 1GGFA 3V33A 1YOBA 2IWRA 1JXQA 5K0EA 4I36A 5KTPA 3CLVA 1D2RA 2C7PA 4NYIQ 5ED4A 2GAIA 2N0SA 3DKIA 1Y5IA 3E7XA 1NUUA 1NVKA 3MOSA 2CY0A 2PQ0A 4EARA 2BDEA 3U1BA 2GFHA 2OL4A 1N6PA 4EPRA 4M0KA 4REOA 2YFYA 1JT2A 1Q84A 5FKJA 2OFFA 2B1GA 4P8RA 1LX6A 1RWKA 2R6DA 1XCOA 2ZUUA 3VZPA 3E5MA 1G63A 3H75A 1PS9A 2X8LA 3QFFA 3IHWA 4HRXA 4KO1S 2WTXA 2A0YA 5YASA 4HDSA 2BM8A 2GH1A 3P1JA 1CY1A 4FHGA 4NV1A 4DR3B 4ACAA 1DO2A 5F5NA 1PJTA 3A4NA 2CHQA 3CTMA 3HCNA 3O2QB 2GF2A 4L50A 3I1JA 4V1CB 5EJ2A 1YJ5A 5KQGA 3O1JC 1B00A 3EDCA 3CF2A 4YP7A 5A2GA 2HJGA 3E9EA 2HF2A 1BXRA 1EP2B 2AFHA 3D3WA 4BEJA 1J2YA 3UFXB 4E51A 2ERCA 3IE1A 1IU9A 2Q27A 2QJOA 2ZI4A 1H2EA 2ZB7A 3S44A 1QCDA 2R7AA 2OZEA 2W6JA 3EGWA 5IVIA 3DZDA 4YNBA 1IMJA 3WLSA 3D2AA 3T7EA 1RAAA 2HQOA 4MPRA 2ZI3A 4YI3A 1W1WA 3KL2A 1DBQA 3RSCA 3VMFA 1J0EA 1Q1AA 2VP0A 4M3NA 5C81A 1JFFB 3QEMA 3ZK9A 1XZHA 4PNPA 2AQKA 2VEDA 2XUOA 3WMWA 2AVDA 3BWYA 1NX9A 4G0MA 1EJBA 3LT1A 2V96A 5H9VA 1UBHS 2VHVA 4RK4A 2AYXA 4IQ8A 1NRXA 1SVOA 2N46A 3DJFA 3ZXYA 1XI2A 1OKKD 4L5IA 4L74A 4QNNA 4YJFB 2V58A 2QVZX 1Z74A 5LA6B 4G0UA 4FOLA 3HKEB 5FI1B 3KQYA 3VQTA 3CJTA 2QN3A 2PGLA 4A27A 4B7XA 4KXYA 4U7PB 1JSRA 1OUMA 3BAFA 4GR5A 3HY4A 3MS7A 4MVJM 4DZRA 1NJ8A 4ZDJA 1KK0A 3BXOA 2XTNA 3DFZA 3UGJA 2JKYA 1T2VA 3STXA 1RIFA 3MFQA 1OX6A 2X1MA 1QKIA 4L8VA 1DG1G 1KVSA 5AOAA 5L4SA 4C22A 1QLWA 3VR2A 1HNXB 3N2KB 2JFVA 1ENZA 4GWGA 1YFKA 4PGFA 4UD6A 4ZWNA 2IRWA 3TLZA 3W06A 5I7AA 3UUEA 2PX0A 1BEEA 1URPA 3LHFA 2G40A 2HR1A 4W7HA 3TMAA 1BJTA 2OZVA 5BW5A 3GLIB 3UHJA 5JSZA 1FE8A 2Z56A 1XZMA 2OG1A 1PT7A 3KSZO 5KTSA 3F2IA 3RF6A 1V8BA 3TQSA 4KK4A 5IVKA 4NMMA 1JLKA 1QH8A 3ZV3A 2W37A 2EKLA 3M6VA 1P73A 4XYLA 1NTRA 5TVGA 4NEQA 1DBVO 2LGJA 3GLTA 1DIHA 3G2LA 1M2VA 1R1DA 3QI2A 3G6WA 1NFRA 2FQQA 2HF9A 1N6IA 3SPXA 4F8YA 5I7SA 4CT0A 2WWVD 3DHVA 2P4HX 5JH7A 2C96A 1E7RA 3FHOA 4FYYA 4E32A 2V3CC 1KY4A 2WEKA 3ND8A 2OPHA 1VPDA 4PO9A 4D56A 4HYEA 1KMHB 1OQAA 3DB2A 3IJRA 1S9HA 4REMA 3WGMA 4IJQA 3II6X 3CONA 1KYWA 1FUIA 3JQGB 4U2BA 2ECPA 4H9GA 4NKRA 5TS3A 3TRJA 3FDZB 2V55B 4WLFA 2ZTLA 2VRWA 2CN1A 1R4AA 1SXJC 1PGQA 3GUHA 4OB7A 4ZDKA 5ECGC 3AHFA 5CA0A 1VG8A 2B1JA 1OXUA 4AZ0B 3PHBE 1T2AA 2HH9A 3VYUB 3MRTA 5TEVA 4FW9A 2OFOA 4KQHA 4EYOA 4XYMA 1BYIA 5JI2E 3X1YA 3MK31 1ZEMA 1TJ3A 3BK7A 4DBLE 4P2BA 3QE2A 1LBQA 2HAEA 4BFTA 3UWMA 4CFZA 3T7IA 4OK5A 5C7YA 4OHYA 2CC2A 5B3AA 2C2OA 1X1RA 4DC1A 2QZ9A 2VP5A 4IHJB 1V6AA 1RM4A 1T8SA 3I01A 3JQQA 3P97A 4DHWA 2W2OA 2YJGA 2D2FA 3C8DA 3B89A 3CLTC 4L0CA 1E7QA 1L5GB 4MPPA 5JC1A 5J58A 2O6LA 1XELA 2OV4A 4KWHA 1UOOA 2LXNA 2RGBA 4BRWA 4GICA 4N5MA 1WUHS 2R1VA 3S5UA 1FSPA 1A7UA 3B20A 3BHIA 1V1RB 4D4JA 2Y8EA 5IAAA 4MB6A 5ER6A 2M6LA 3EVTA 3IQHX 2F3RA 2QRNA 2J8ZA 1PHPA 2JANA 4M0CA 4M83A 1CUWA 2JCBA 3VZQA 3RVKA 4YIHA 1GZ5A 2ID4A 1XTKA 5DGCA 2XUIA 2C7RA 1CJVC 2P9QA 4FSXA 4GQBA 2C5FA 3KAKA 4R1TA 5E8RA 4C4YA 2PY6A 4NX2A 4GVXA 4YREA 2C2GA 3E9DA 1TYBE 2BZ0A 4A23A 1ZI6A 2O1EA 3G7SA 3G0OA 4YTEA 3NP9A 5E7MA 1CERA 4PX5A 2FCRA 4QT4A 3IXQA 2PBZA 2TMGA 1ZGCA 3GVIA 3HHEA 5MN6A 4Y67A 3M6AA 3FPCA 4RJKA 1DOHA 2ZYHA 1P6QA 2IOQA 1HX7A 2QBYA 1MCZA 1FDRA 1NP6A 3EH1A 4PLZA 3EEBA 4L4YA 4WJKB 1P5HA 4NJEB 5DX8A 2NUAB 4XTRA 1R0YA 2O2SA 2WTBA 3T61A 4LY6A 4TMYA 4EYGA 3ZUGA 1TUEA 2ZUFA 1D6SA 2IHBA 2BI8A 2O07A 3LY7A 3FAKA 4M2LA 3VH4A 3D8HA 1JBQA 4HH1A 4F5EA 4ZT2A 1WCIA 3DT6A 3A4IA 4UFPA 4MKRA 3RR2A 3D8TA 1CS4C 2C9YA 2QT9A 1F2TB 2ZIFA 3LX8A 3QXCA 5F2EA 3PHHA 3MJTA 4EDFA 5MFPA 2CT8A 3SKXA 4EUFA 2HRZA 2EIHA 1D4ZA 1ADFA 1IBRA 1LW6E 5C37A 3SSAA 1OXBB 2A57A 2AI1A 3IQFA 3OQJA 5AH0A 2QN7A 2QVYX 1Z2OX 5JJLA 2QU7A 2YBEA 1M1YE 3BWMA 5EPOA 1DINA 1FVOA 3LUHA 5JE8A 1VMDA 3A9TA 3HQ4O 3AP3A 2ZRFA 4L76A 1XYYA 3FJ1A 1NQOA 4FSHA 3NMUF 2YZGA 3QKWA 3B6EA 2CXRA 2QAGC 1SB8A 2ZJ4A 5HK8A 4DV5B 3OD1A 1TC2A 2BKXA 2Q29A 5FTNA 4MGYR 4LV5B 1JQAA 5FBVB 1R6DA 1CQIB 1W4BA 1J56A 1ZK4A 1I1QB 2W4MA 3LPNA 2AF3C 3K70D 1VJ1A 3K32A 2NM0A 5AUNB 3TR0A 3D8RA 3GGDA 2PZEA 2WU8A 1VGRA 2F48A 3FBWA 3LOUA 1I2AA 4XVUA 1TD9A 3OTQA 2G9NA 3AW8A 2P75A 4YXWD 2H2WA 3NGXA 2CEAA 1R6TA 1Y8RB 2C94A 3BTUA 5A71A 1Q2UA 3G82C 1NAIA 2ZB3A 5E0KB 1JFLA 5DGHA 1NG1A 4OV6B 4DQUA 3ZWBA 2UXDB 3N6RA 4L9AA 4NOLA 1OE0A 1Y1QA 2CE2X 1ECPA 4L0DA 4WDRA 4B84A 4CZ2A 1AHIA 4R2IA 3R7LA 9LDTA 1KY5A 1R4NA 5AVVA 1OFUA 4JB8A 2PQ6A 2GVNA 3PGA1 5EIWA 1G98A 4DAOA 4L07A 1F5SA 1EX7A 1BIFA 3A58B 3VNQA 4ND6A 3EGIA 2PH1A 4MS4B 4K9KA 4G9BA 4EFKA 3VNBA 5DSTA 4EPVA 4WLOA 4XGQA 4F4FA 3CLRD 1GL3A 4QOSA 2DLCX 3OIYA 2J5BA 2VUHB 1UFVA 3AETA 3NU1A 4ZRNA 1WCYA 2O20A 4HZUB 4HQ0A 5CB4B 3LIIA 2YXBA 3DDWA 2DULA 3IXLA 4XCQA 3OOWA 4A0SA 4A36A 2YFHA 3GCDA 1NQTA 5ESWA 4JI3B 2PSHA 2RI0A 2YVKA 1H1DA 5JARA 1LS1A 2GKOA 3L77A 1XO1A 2C95A 4M76B 4S0ZA 3WBFA 3GBVA 3NNNA 3WKBA 3FH0A 4DADA 1MB0A 4UM9B 5IEJA 4G37A 5K20A 3R74A 5AUPB 2H1FA 2HZBA 2NLOA 3GN1A 3BHNA 1J0BA 2VTKA 2Q3JA 4D3YA 1T6NA 4WASA 2P3LA 4HTAA 4LK2A 5AJUA 4YRJA 1I1NA 3L3BA 3D4BA 4L27A 4G5QA 5KU1A 3AR4A 1MDFA 3IE0A 3PDIB 3WJ1A 4TYYA 3PUXA 1O5OA 5L45A 5HGXA 4G36A 4FQ5A 1JQ3A 1HMPA 4AS1A 3B9PA 5CH8A 4TKVA 2Y2VA 3A10A 3IRUA 4GSYA 1G6KA 1GL9B 1TJNA 3N0RA 4PHTA 3AQIA 2F3TA 3BMQA 2WF9A 3OX1A 2XNDA 5KOHB 3CZAA 3DO5A 1K7EB 4IKEA 4IJUA 1B0PA 4R68A 5JRZA 2A1UB 4JK3A 3PYLA 1B26A 4E3ZA 1L5KA 3HUEA 4YX9A 4H18A 1YZQA 1GG2A 3DTVB 4R1NA 4R3UC 4HGQA 3VYRB 1U0NA 3UGTA 2Q5JA 4PU0A 4XGIA 2O3TA 1XZCA 4MW6A 3AY6A 3QHQA 4ZGWA 5BMVA 1CZHA 5CA1A 2XOXA 3ZE0B 3OECA 3FI9A 2YCLA 4UNSA 5C1PA 2C58A 5IYZA 4OYHA 2BONA 1VSQA 2CFRA 3VU8A 3TOSA 3WWCA 3RNLA 2WIAA 2GD1O 1QG2A 1YCGA 3HL0A 3PXBA 4DVJA 5FNVB 1GSOA 1W1UA 2XT0A 4X7BA 2ZWVA 5DFAA 1RAGA 2CMFA 2GCEA 4HG2A 2AS0A 5THKA 4EJ0A 2WJ6A 3P2IA 2RBEA 2WOOA 3I12A 5KWVA 3NOOA 2XTJA 3Q0TA 4J7AA 1XD2A 4XYGA 3TTTA 1VTKA 1EUDA 3KOZA 3QXJA 3FGPA 3FYTA 3LLCA 2VJLA 3NYIA 5REQA 5BWBA 2OGUA 4TUYB 4LNAA 3W9YA 5FA8A 2ZUEA 1WY5A 1D5CA 2GPSA 4B3TB 1L0BA 1F20A 1BA3A 4H17A 1B7GO 3BXHA 4J49A 2R6R1 1H0HA 1UMCA 2QJWA 4D3FA 2IW1A 4OHBA 4J0DA 1B6TA 4P08A 5DI3B 5CLGA 4N39A 3HTXA 3WQQA 3FCEA 4MKFA 1G8KA 5HP4A 1AT1A 3O83A 1JJIA 2B4KA 1AXGA 1YR7A 3CH4B 2VJKA 1QGDA 2W11A 1T5TA 3DEZA 1E4VA 3PKZA 3R20A 4G81A 4LBZA 4NABA 3SYKA 3QPBA 4BLTA 1DU4A 5HJ5A 1WB4A 1OFUX 4LZAA 4NH0A 4AXXA 5LQDA 5IJWA 4ZOLB 1V7CA 5KTKA 2UZ3A 3A9SA 3REGA 4BS9A 2GNAA 4R1QA 3TLGA 3VJRA 4ITUA 3P4XA 3F5QA 2GMWA 1UM8A 2O05A 3RVOA 3EK2A 1ESMA 5KVCA 1N8SA 1Q11A 1NPYA 5HF9A 4AYTA 3LOQA 1GIAA 5CDFE 1T6XA 2EJCA 2IC5A 2GKGA 3AEQB 3W04A 4UEWA 5IN4A 1DCFA 3MUEA 2WTNA 4X95A 2R47A 3DBLB 3DWIA 1EK1A 4NZZA 1VIAA 4ETWA 1L4HA 2OXCA 4DQVA 2ODAA 4HDOB 1W6RA 1NLFA 2GN2A 3GPBA 3NBKA 2EQ5A 2WJIA 4H4DA 3PQFA 4HEJA 5EHNA 1Q0ZA 3WMXA 1JJ7A 2OCXA 5ALVA 1JTFA 3BMOB 4NDAA 4OA5A 3SS9X 1L9KA 3PHJA 1RRFA 1WR8A 1NPTO 1NN1A 5IT9A 4FMPA 3U5ZB 5K5EA 1E5LA 1SXJA 2A9RA 1RCTE 3HI6A 1ZW6A 5TS2A 2A59A 4W6ZA 1QJ4A 3CUKA 4M6WB 2RAPA 2OCKA 1KJ8A 2LD4A 4B4DA 2AOWA 3IEMA 2GN1A 1SURA 3BQMB 4G8JA 4KR2A 4M8IA 2WJYA 3GFFA 1MENA 2HLNA 1AD2A 2JAHA 1NLYA 1MT0A 4DA7A 2IYQA 5JWRA 1Y0BA 5E1DA 3EPJA 5C5CA 3TLBA 4JI5B 3T3PB 2FFHA 2X0EA 4ZVKA 4CDGA 3CU5A 4DNPA 2JLZA 3OZEA 5KWEA 2BR5A 1WDTA 3WDMA 1ODCA 3RFUA 2Q4RA 4P4NA 1NJ6A 3MQ2A 4IG9A 1ZPDA 1HFEL 1YRWA 2A86A 2FLWA 4TKZA 1E59A 5E4JA 3RVDA 2HK9A 4G0YA 4IV5A 1KTIA 3U4MA 3AR2A 1K97A 3UB3A 2LRHA 4NP6A 5I4BA 5C31A 3CCBA 1IONA 4EKNB 5D5HA 4G1VA 2HADA 2IXDA 4IIJB 3EZ6A 4Y3UA 3IQXA 4B6OA 4CT5A 1F60A 4PWZA 2P3OA 3HCPA 4HRYA 4ZMRA 5B6JA 2KYRA 2HO5A 1COWD 4OFWA 3DV0B 3TTVA 2IZ5A 3B1VA 3JYQA 2DWOA 1CHNA 2BJWA 1P6UA 4BDTA 5TLSA 1F8YA 2Q1XA 2WVGA 1ELOA 2E85A 4NZ9A 1R9GA 1GADO 1GTG1 2XSZD 3VMMA 3FCXA 1RXVA 2BEWB 1M0SA 4RW0A 4E13A 3AEKA 5A05A 2BCJQ 3Q7TA 3H8VA 4QGBA 1T6YA 4F4DA 1Y5MA 4JODA 3R23A 4NCXA 1R50A 2PZMA 4RSRA 2GN8A 2QAJA 3U3XA 1SUDA 1QGOA 2PT7A 1WAMA 2CXNA 2K6GA 3H8SA 4Q01A 3A32A 2X7HA 3DONA 4BNGA 3ELBA 4HH0A 4Z1MA 4Z8YA 4EI2A 5KNBA 3STTA 3RKRA 1TPZA 1XYVA 3ETNA 1U2RA 2GXUA 3OE7A 5A4IS 4MINA 4X24A 2H48A 4QUBA 2C04A 2PSJA 2H00A 4ZO8A 1N6OA 1T36B 4EBFA 5B6IA 2EHDA 3VR3A 4NAUA 1VCHA 2A5DA 4KMMA 3AL2A 1UM9B 1VIMA 4HAUA 1F12A 3UHPA 1IVYA 2FP4A 2RGXA 2WPNA 4KPUA 3RSOA 1I6WA 4OI4A 2VK4A 4K3UA 3E3NA 4PSUA 3F2VA 4FPXA 4G89A 2CYBA 1CQWA 1E6MA 2JHAA 3IVAA 4JP8A 4LHWA 5DWVA 3U3MA 3KFLA 1D6JA 4BTLA 3JQBA 4XPIA 1ZD3A 3A6DA 3RIGA 2I8LA 1PWHA 2DT5A 1CULC 1DRWA 1FU4A 1Q92A 1MC1A 4NBRA 4DMGA 5CVTA 3W9UA 5IASA 1BG6A 1E69A 1Y82A 3A9CA 2I6QA 2QAGA 1YBVA 3P71T 1QTNA 5BOSB 1IXSB 2ODEA 2A0XA 3LU1A 3ZHUA 1XNGA 2JFOA 3R5JA 5G0WA 1OLUA 4Y6PA 3M5PA 3U0BA 3OKFA 3OZWA 2XADA 4HLQB 2W6JD 4KMOA 2OC9A 3IB6A 1UXJA 3JWJA 2Q5HA 4RSGA 1JP7A 4URWR 5LJIA 4JXZA 1OWPA 3G2MA 3WQBA 1NGSA 4Q18A 2ZTSA 1H1LA 4MIYA 5ALIA 1T2UA 1FRFS 3RAPR 5EJ7A 2OSBA 4DYVA 1DE0A 3F9RA 1X8KA 4V1CA 3NTUA 4YHBA 2ACEA 3D7KA 3T6KA 1OFHA 2XQJA 3KJQA 4MULA 4RVUA 4M1KA 4JJGA 5DH9A 4ALLA 4NOMA 1ZM2A 5SY6A 3LFHA 1PJLA 2V65A 2E4UA 2O8NA 1XZKA 4MKZA 3E3AA 1OCEA 1JHVA 1JIUA 3DZIA 1J2UA 2EAUA 4TL9A 4YRRA 3T9AA 2AG0A 2ZRLA 2IYYA 3HU1A 3JD2A 2PGIA 3C3EA 3FNBA 4W8HA 4MR7B 3U56A 3RC1A 1FMLA 1GDDA 2A9OA 3L8GA 1C3JA 3ZV4A 1Y4SA 1KU0A 3RVMA 5K6TA 4MRPA 1K1EA 3KEOA 1O1YA 2XGOA 2SKCA 4HX2A 1NJSA 1YUMA 2F3QA 5LIPA 4K8OA 3GA5A 2G09A 3V2UA 3VR2D 2C2HA 3KQMA 1FW8A 3L4KA 4GLJA 5B1IA 3TGPA 4OQ4A 2FPXA 3TG2A 2UUCB 1L3BA 3MMXA 3R7AA 1IB6A 3ZOZA 4E5PA 3IAUA 2Y6VA 1VL5A 4AO7A 4RMHA 3KQUA 3MTGA 1IWPB 3PQ6A 4OKSA 4YJHB 1OVMA 5JXWA 1ITZA 4B2PA 1M6HA 1KI7A 3HRHA 4FI3F 4UDNA 3TW8A 2AV6A 3EXHB 3I4CA 1U8TA 4IJ6A 1TO2E 5M2QA 2C92A 2PXCA 4HWGA 3OKCA 1R0BA 5CB8A 1XDZA 4HB4A 5D1NA 4I8XA 5AYVA 3HBLA 3TZKA 3PLAE 2VSXA 2WHEA 3H0EA 3T3DA 1QF7A 2ZIVB 3M3HA 5HDBB 5ALOA 3BRQA 3TXXA 3EVBA 4O2LA 5JFTA 4R8VA 1Y8QA 1CNMA 4BKOA 2VQ6A 4CV2A 4NDZA 1BJRE 1BMTA 3WLIA 3KTAA 1DC3A 4GVPA 1C0KA 1DCTA 3TN7A 2IZ7A 3AR3A 4B3BA 1HE8B 2B8TA 3EMVA 2ZI5A 4XVCA 5FWXB 3W5CA 5LFAA 4EA9A 2IOHA 2PUWA 2DRIA 3DUFB 4KEAA 3GT0A 3TLMA 3WL4A 4UU1A 4FHCA 4PGMA 4D9BA 2WYVA 3WYNA 2CNLA 1JXMA 4CKBB 2ZWAA 3ILHA 3WNVA 1M83A 1TFRA 5FRDA 4F2GA 3H19A 3P0FA 4XVRA 3U3OA 4D3XA 1SCKA 3PX3A 4K86A 3OEHD 4RPIA 4Y1FA 5ALEA 4CL8A 3OY7A 1KH2A 3KJZA 4BL5A 3NORA 1IIBA 1BYUA 1YONA 3DBRA 4YAFA 2IHNA 1RCUA 2Z09A 3ASUA 2RMKA 3FDZA 3Q9SA 1TVCA 1KO8A 4IH9A 4INPA 1GGHA 2X9NA 3PITA 3PS9A 4PS0A 8LDHA 3T1QA 2ZRBA 5HBRA 3I5AA 3A9VA 4I1RA 5CBPB 5EMNA 3NXKA 1SY7A 4WADA 4AECA 1U7OA 3ORQA 1WL8A 2YZMA 3JPWA 2QNBA 2YKGA 1FMCA 1R0ZA 2NSYA 3EDOA 4KXNA 4PX3A 4IHJA 1E1CA 2C5GA 2V4MA 3GMDA 2PLNA 2HU5A 3PQ4A 4H15A 4LGYA 5K0BA 3KPJA 1X7DA 1JJAA 1WO8A 3I4LA 3QGMA 3SAJA 2ZKLA 3HJNA 5TB5A 3SNKA 3HKDB 5DX0A 3U9TA 3B52X 4JOSA 4YMUA 1NY5A 2J7KA 2XWJI 1JAIA 3OC6A 1KFKB 2NUPB 1B6SA 2WYWA 3F5SA 3OTIA 1O57A 2IHJA 5GTDA 1Y48E 4FE4A 4H0NA 5BQOA 3MC1A 5LZ9A 5FUXA 3T38A 4F5WA 1JJFA 4BZWA 1VMEA 3TYXA 1PAUA 3EXFB 1CUFA 3LLSA 4W8GA 3TUJC 2HSZA 1Q5PA 2W0MA 4OU5A 4DKXA 1NW7A 3ZOKA 4IDCA 9MHTA 2W58A 4RZ3A 1KOLA 1U3UA 3DGEC 3PT9A 1KWKA 3VR4H 2VDRB 3IURA 4I6GA 4DRZA 3IKVA 4RV9A 2WRZA 1ZCAA 3I05A 2A1TS 1O9BA 4P4UA 2MWMA 4FMCF 4QBGB 3TLCA 5JDCC 3G0HA 4H6VA 5BNFA 1D03A 2IDJA 1NW3A 4EMUA 1IQPA 3A2MA 2GGSA 1WQ1R 4L2IA 2KS6A 2ZSEA 5JHGB 2JJ1A 4JUBA 3PPXA 3DVAB 4YRLA 4D9GA 4GP6A 3FNIA 5DSXA 2IYNA 4KE8A 4NJEA 3WFZA 4DYDA 2I78A 2XKJE 4GBJA 3V8PA 4JBWA 1CUVA 3EAGA 1GPJA 1T9HA 3OBBA 1QF6A 1T5BA 4YR7A 3QVSA 4Q7MB 2A9JA 2CCKA 3MWFA 4G0XA 1SZPA 1TGVA 3GJ8A 5L7YA 3ZE8A 1KK2A 1OREA 4H1HA 4N12A 1IPHA 3BMXA 1FSFA 4QJBA 3R8CA 1U02A 3ZWMA 3B48A 3M49A 1QGZA 4HZIA 4HYTA 4R1UA 3K0AB 4TSFA 4LFAB 1GPWB 2B7LA 2QIOA 5K0GA 1ZCJA 1J23A 1NONA 1IG0A 3NIFB 3DM5A 4DWOA 1GG9A 3OFSA 3NRJA 4Y6OA 5DF1A 5E6RA 2KBFA 3LUBA 2JPDA 5AM1A 1NRWA 2ZS9A 5EFOA 5FULA 5JADA 2I2XB 4ZAXA 4GX5A 4TVOA 1LFDB 3CC8A 1R37A 2P5TB 2QQFA 3GB9A 5DBOA 4QBKA 1IZ9A 3NHSA 3NHFA 1Z63A 3BMCB 3JRXA 4LZZA 1VECA 5JLAA 4EUKA 2FQXA 3QLUC 1DKPA 3AHGA 1NW8A 1EHCA 5AJYA 3CSUA 4DQLA 4YT4A 3LSTA 1XZIA 2QWXA 1EZ1A 3AO0B 3DFFA 3GN2A 5AT1A 3WV5A 3ZW7A 3H6KA 3A7DA 1GNPA 1PD0A 3N58A 4BNDB 5A5EA 5JY1A 3OX2A 1XLUA 4LE2A 4H7DA 4AN4A 1O0BA 1NSYA 4UJ3A 1M10A 1B8PA 3LT4A 4TV9B 3RUAA 2R79A 2WNHA 3OLYA 3ZKWB 3TH5A 2G4CA 2F8SA 5J1SB 5EJAA 4AJEA 1PBTA 1Y9EA 4GOXA 2C2MA 3SYRA 4C2UA 1DWUA 2PXAA 3RAEC 1KZ7B 4MUKA 1F1BA 4HPXB 2BEUB 4MR8B 1PDOA 3PFBA 3BXGA 4WK0B 4EJ2A 3N07A 3PYXA 2DBQA 1XXHE 4PQEA 1U90A 4HYYA 5IP5A 1H22A 2WZBA 2FLVA 3ROPA 2FWPA 2EZ8A 3L92A 1ZZEA 2R65A 3EFEA 1P80A 2I2WA 3HXTA 1GNQA 2X0RA 1WMSA 2WV7A 3IO3A 4R9RA 1UMBA 4PHCA 4NLLA 2EX0A 4J0HA 1O8BA 5A3SA 4JUFA 4U7DA 3I34X 2DECA 4RVNA 3LF2A 1MC5A 3PFGA 1GFSA 2GK7A 2P27A 4EB3A 2CFTA 4EMBA 4AURA 1SELA 1RYYA 1VI6A 1OIXA 1XDSA 2XNDD 2YJ5A 3G2PA 1F0PA 3EULA 3L0SA 4B6RA 5DB4A 5JS7A 2AMVA 2ZZKA 4ZO7A 2IYLD 1Z37A 2H8KA 2NZYA 5AJHA 4G5GA 2VYND 2GTHA 1M73E 4A2QA 5K0CA 4Z4GA 1PVDA 2HFJA 3QF4B 1SBIA 1IAVA 4CV0A 1OXXK 2IX3A 4R1OA 1WXFA 3PDIA 3GRFA 3MSCA 4M7RA 1YFJA 3E3LA 4IOJA 5DM4A 1E96A 1P8JA 2QORA 3EXHC 1RQRA 1P7ZA 1AMNA 1MNQA 1VZ2A 1G5TA 1PZNA 4IEEA 4BDSA 1RC1A 1HYQA 4F9FA 4MQBA 3RO7A 2GILA 3STYA 1N2IA 3G5AA 1CIPA 1UJ2A 3FYDA 3TOCA 4WKBA 2OXRA 2FPOA 1RMTA 3R3WA 2A1UA 1TADA 2NYVA 4CTJA 3FF1A 3H3XA 2ZYGA 4PZ0A 6CHYA 3U0VA 3E05A 3KP1A 3R5FA 3H2BA 3WP0A 1JDSA 5C8XA 4RPHA 5EC8A 3BCHA 4B2LA 4BX3A 3RADC 4YJ3B 1DC8A 3HSYA 1IZZA 4ILKA 1XRNA 3IODA 4BO3A 4EG7A 5IT4A 3H2ZA 2LVBA 1OR8A 2GEDA 4TXMA 5MFZA 2BM1A 5KTRA 5A3VA 1ZN9A 4LJ8A 1W46A 1DCKA 4M7OA 3SCZA 3V1KA 4B9AA 2Q8QA 2P4UA 2PYZA 1OIVA 3TIVA 1BDHA 4KVZA 4G4SP 4NYJR 5JDIC 3KS9A 1J49A 2N1BA 4M54A 5JYCA 2QRJA 1KJ9A 3NDBB 4B6SA 4OMCA 4KLCA 3ABQB 3CZ4A 3KC2A 5JS2A 2O57A 4JGIA 5K3DA 4ROTA 1AF4A 1DRKA 2POQX 3VAYA 4UCWA 4UZFA 4I1IA 4EW6A 2I3BA 2JGFA 1JXAA 2QRPA 3KL4A 5ICFA 1OC2A 1FNSA 1OPXA 1DNPA 4L16A 5DP1A 1OPRA 4XDHA 3LY8A 1Z06A 3TNLA 1N8TA 1LK5A 2CK3A 4QGAA 4TT3D 3GF4A 4WCDA 1S1MA 4FC7A 4F3CA 1UZUA 4R81A 4X62B 1XC7A 3CX7A 3MTAA 1HQCA 1NM5A 5FWYB 3V1UA 3GLGA 3JVVA 3Q15C 2J46A 4JROA 1G60A 5K09A 3A14A 2FXVA 3I83A 4LYEA 4IIXA 4FLEA 3UMJA 1SUEA 2Y2UA 4J0CA 1FL9A 1GJRA 3ADOA 3U40A 3H0KA 1LNZA 2C82A 2JEYA 3ONNA 3UAXA 3GJXC 3CZMA 2OP0A 4PW0A 2AOUA 1HNZB 2RHHA 3QTBA 5DHRA 4YRMA 5A4KA 4JEMA 3OOHA 3K15A 1B43A 1SVIA 4O29A 1MVNA 4JLAA 2B8JA 4WNCA 1QG0A 2C9DA 3V1TC 5MHTA 3AOEC 1UC5B 1ZOOA 4FE3A 1ADGA 3RAGA 2IEDA 3AONB 3HBFA 1M6WA 2OB1A 3P8ZA 5ITSA 5KKCA 2UYHA 1IOZA 2VQFB 2BGTA 3MEQA 4LGCA 5CXSA 4BLSA 2Q0HA 2C07A 3INRA 1UADA 3O74A 4C14A 1XRPA 5I4KA 4LOAA 1CEQA 4JS0A 1JBEA 3KNZA 1PFWA 2I6TA 1YS9A 1YUBA 5JSUA 1ESCA 3QPVA 1EFRA 1JWBB 3KXKA 3AUAA 4TKUA 4PO3X 3Q5EA 5LYYA 3QVVA 2VZ0A 4BZPA 3HDHA 4RS3A 4XOIA 1YJAA 1LDMA 4FFNA 2UZ0A 3EGOA 4KU4A 4LE0A 4GPTA 1OYWA 1H1TA 4FN4A 4XVHA 3TQIA 3ZN2A 2RGEA 3IPXA 1QIKA 4CIVA 1GSAA 2JFFA 1ZJ4A 3WB9A 3VO9A 3FLBA 4CIXA 2JF0A 3CLTD 3MPUA 2ZJ6A 1S89A 1Y5LA 4JSTA 3HY3A 4B4VA 2LP4Y 2WT8A 2XGGA 3L0IB 4J1TA 2OV2A 1DXHA 4PONA 4QC2A 1E98A 1NL3A 4O5OA 4R9VA 3TXYA 1C8KA 3WY9A 4QNRA 1J8VA 5JY6A 4A10A 1FYFA 1KI4A 2Q9CA 3L1KA 4HFMA 2ZR7A 1CIJA 2FY8A 4I9HA 1BS2A 1G1AA 3C45A 5ULLA 4TWZA 4ENTA 3EQ2A 1HYBA 1E0AA 1UMDA 4I9UA 1A76A 1E20A 1PJQA 2BJVA 1W85B 4UC0A 5BNWA 1H2RS 1YQWA 3D6MA 1SB9A 2XDQA 2ZANA 4B8ZA 1VG9B 4FEGA 2QMQA 1X92A 3CG4A 3E15A 3OLXA 1Z3CA 3TJZA 2W71A 3UQZA 2KBEA 3WHKA 3DNMA 4CT4B 3KYCA 3ASVA 4MYDA 1XVTA 5LNK1 2HA6A 2IUYA 1J22A 2WFMA 1S1CA 2PPLA 4JLVA 1MRSA 1B3BA 1L7PA 1VRVA 2VWPA 3F8TA 5FBLB 2ZIXA 3VYTB 4DMCA 1HDIA 1M54A 5I9MA 3INYA 2RBKA 4JJEA 3C3AA 1CR6A 4UMVA 4Z1MD 5CG2A 1EA5A 3KLOA 5DHSA 1XDWA 3NT4A 4OJKA 5EMHA 4FIDA 1ZITA 2R96A 3MMSA 3SKYA 2F3SA 2PX6A 2CFCA 4G1EB 3TD9A 2E49A 2J4FA 3W78A 3IDOA 2MSLA 3DV0A 3AR9A 3VHLB 4KJZA 5TEWA 2KSQA 3PT5A 3LQRA 1LLUA 1Y37A 3VR3D 2D7DA 4WEQA 5HUQA 1ZO8A 2BEWA 3AW9A 4HY3A 1N2OA 4CBVA 5JDCA 4PAWA 3D7LA 1VGQA 3NGLA 4JIMA 1E3IA 1O9HA 2BBWA 4MB2A 2EZ4A 2FGKA 4I4TB 3QNWA 1SIOA 1MEEA 4TV8A 4U7GA 3UWDA 2ZS7A 3OIDA 4CQLA 4WINA 2ENWA 3OZVA 2W2NA 4JMLA 2FZ5A 3S2IA 4A1FA 3UXEA 1DIRA 2WY2D 2ZRMA 1XROA 1T1RA 2ZRNA 2WFAA 2QXTA 2CJXA 3OIGA 4UM8B 1BQ4A 1M1YB 1MQAA 2AG5A 2GESA 5CGZA 3M2TA 1XRSB 3EG9A 4HXYA 5EIOA 1GDHA 4FOTA 2PR2A 3HN7A 1WUKS 4G4IA 2BFFB 1JLLB 4U7FA 1QQAA 3A6ZA 4OQFA 2IU3A 4O08A 1AZLA 4YK7A 3CUWA 3VDQA 3FPEA 5JQWA 4ZCTA 1EM8B 3COSA 5BN3A 4BV8A 2CJPA 4ZO9A 4LZNA 1NF9A 1XQ9A 5KCMA 1PHRA 2V6FA 4RY9A 3L05A 1SCBA 2CXOA 4FNOA 4XVQA 1YVPA 1G7SA 1KDTA 4MUMA 4Q4DA 1MQ8B 1TM5E 3N76A 1HDEA 4KQFA 1Z0FA 4R7TA 2QRHA 3RTAA 1A8IA 3WXMA 3N2NA 5L4NA 2JGMA 2QTVA 4YEDA 3QX9A 1S3GA 3MAAC 4KE7A 5AKJA 2GCIA 4FP9A 3LFTA 1RKBA 1LWOA 3T7TA 1KWGA 1KK1A 1IATA 3QLUA 4KW7A 4P3KA 3UT5B 1OTHA 1Z7EA 1QHYA 2G1UA 2G7ZA 1LFAA 2XYHA 3GAFA 4BKPA 2R6AA 1WKCA 3HDQA 2FPMA 3FPGA 1X70A 1V71A 4N01A 3SX2A 5KC9A 4DG8A 1CP2A 2OM2A 3WLFA 3X1JA 5LOVF 2FXIA 3SHTA 4AFNA 2VJPA 3I3OA 3H83A 3JRNA 3U3ZA 1OGJA 2Z04A 3IR5A 1K6MA 2VPTA 2ZAOA 2D8AA 4ER7A 4YECA 1Y33E 1NW6A 1UZNA 1WDWB 4AZ3B 1FFYA 3DL2A 5JMPA 1M75A 5TNXA 3VNUA 2WJZB 3I9V6 1JR3A 3FZGA 5J43A 4DUYB 1MMFB 4ZYVA 2WZQA 2Z8ZA 1T34A 4Q4CA 3FB1A 1NI4A 4YGYA 4HO1X 5FWNA 1SKUA 4Q34A 4BGUA 2FN9A 2VDOB 3QPAA 4N8EA 1E18A 4XWWA 2NP7A 2JS7A 4R7ZA 1XF1A 3CH6A 5JZMA 3EPKA 4LSGA 3RJMA 3MWLA 5I01A 3BS4A 3RC2A 3GA7A 1S2OA 7ADHA 1HC7A 3JR7A 1N7IA 2A2ZA 3A3YA 4Z3DA 5K0TA 3Q8MA 2H06A 2PD4A 1BCSB 2FPRA 3IMGA 3QHPA 1JQBA 3NLLA 4KO2S 2OKCA 3U1TA 2O7VA 2PRIA 4D57A 4YR9A 4GUDA 2XCOA 2GK6A 2QPTA 3BKWA 3RYFA 4X85A 4G0QA 1YJQA 1PGNA 3EZFA 4Z9FA 4J76A 4KX3A 2XMZA 1HEYA 2J3MA 5LYJA 1YH3A 3DE1X 1TX4B 1J39A 3BFJA 4HAYA 5DPMA 4UEJA 5FFMA 2A1TR 2REBA 7REQB 4BO1A 5IM5A 3ZVLA 1GEEA 3G9ZA 3IVXA 5EJGA 1ENOA 1KK3A 3R8FA 4ZT6A 1EUYA 2YXEA 1PGOA 3I2KA 4MZDA 4OAQA 3FWZA 4Q16A 4F6RB 1TE2A 2OBYA 1OI4A 4LJLA 3LUCA 1NQAO 1LPPA 5L95A 3EXHA 4Q93A 1IJBA 4TYMA 1GAXA 4K26A 1RAHA 4LBYA 2DBYA 2GJKA 1NNEA 1DWQA 4XLZA 2JAXA 1OXVA 4OLBA 4B74A 3IIIA 3PHCA 5BN1A 2EDAA 2R1TB 5DX1A 4PX9A 5C0OE 5BYAA 1EZ4A 1G17A 5IJ9B 2F1JA 3ZLUA 2GHIA 3NNDA 4U8HA 4AY5A 3SQXA 5DVZA 4D99A 1TJPB 2HXGA 1ID1A 1T1JA 1O3YA 3O4RA 1KEEA 1S5PA 1MP0A 4IGKA 3ROFA 3B53X 2QU8A 4I2VA 2AXEA 1U1IA 3QFHA 3AIOA 5HG0A 4EY7A 2P6MA 2XBLA 4TTJA 3D4LA 3LT0A 3ABIA 4BQEA 2IIBA 2JLVA 3DUFA 1Z3IX 2WU0A 3NIWA 4MVXA 1TCAA 3IAXA 4KI7A 1K8XB 4PC1A 3ORFA 2HY7A 2P9JA 3GLKA 4ZJYA 5L40A 3RYCB 3RV4A 3U7QB 2E87A 4IDEA 5F1KA 1VFPA 3NB0A 1NIJA 1CUJA 1GGEA 1YE8A 2OCGA 2P5SA 2Q1WA 4GVLA 1BD3A 4BYGA 5FJJA 3HVHA 2H2HA 4DBLC 1DO0A 1MJFA 1LEHA 1OIWA 1PT8A 2C9ZA 1A2KC 4Z6KA 2VSNA 2WWGA 1AKNA 3JRWA 3L8FA 3DLCA 4K9NA 3ROTA 1H65A 4IDAA 5DT2A 4JEIA 1F8GA 1C3EA 1G7RA 3PUZA 1M5RA 1ZXLA 3K6KA 2FF7A 3KEQA 2EJVA 3FUVA 1AN9A 1DOAA 5D2CA 3TSOA 4EY5A 5DYNA 3U60B 3KAPA 5KX5F 1QRSA 2YS6A 3FCCA 1WPGA 2FQ1A 3C2QA 1VXOA 4R0VA 2C1XA 3LBIA 3EBPA 3P0RA 4MV4A 3ZGOA 1E1YA 1G20E 1Q0SA 1W59A 3E7WA 4ZZ3A 5A4FS 4YWJA 2YC4C 1V47A 4QXOA 4RFSA 3F7NA 1W0CA 1U2PA 4QNMA 3KQNA 1KH3A 4RPCA 3KXIA 3CW8X 4N49A 1XEXA 2XDAA 1FFXB 2O06A 4BJ6A 1M34E 4A0FA 2EKQA 5A4JA 4MHSA 3MWGA 3PK0A 3RSZA 3AWIA 1R5JA 4OJTA 3I1YA 3SYNA 3KETA 3QBDA 2H11A 3LBHA 2J0UA 1E3WA 1Z38A 2QXUA 2VSFA 4N0EA 5EZYF 2R7NA 2ZPUA 5DGXA 3JWEA 3V2HA 5UKDA 3PRJA 4Q1EA 3WGGA 3MJCA 1GQSA 2B7BA 1XCPA 2ET6A 4YP9A 4INJA 1LTHR 5JAQA 3S1LA 3HR4A 1LBSA 5LWQA 1OZFA 2DMRA 3BE5A 4RHYA 4QYTA 1QIHA 3VI3B 3DBVO 2YWGA 4US2R 4O2AA 4RA9A 4AIIA 3ET4A 3AFNA 2FRDA 4TSFD 2I6XA 4O4LA 5C53B 1Y4UA 3WWOA 1A5SB 3AESB 1K5DA 4LCEA 3QI7A 3UKDA 4N0MA 5JZVA 3T5DA 4UAUA 2PU5A 2HJ9A 2BYTA 4I66A 2ATCA 2ID7A 4JI6B 5LDHA 2ZJBA 3N7UA 4FS3A 1CB0A 2A14A 1G18A 2WWTA 3GGSA 3OZCA 4QYIB 1RQLA 4O2RA 1YS4A 5D5QA 3GPCA 4JR2A 1CJBA 1SUFA 1MO4A 3AUUA 4I50B 3TEMA 5JSHA 4TM8A 4DLBA 4YMSA 5BORA 2F3UA 4YJGB 2ILVA 3ADBA 4KCGA 4ISBA 3SR0A 4XCXA 1F17A 2Z9CA 1H85A 3SJZA 4Q9AA 4IX9A 3SXPA 2E82A 3S8MA 5BWNA 3UMCA 3N28A 3K0AA 5EHIA 3OCYA 4CQMB 3HXQA 4Y8VA 2XUQA 2R8YA 1RQPA 2PQ2A 3COVA 3O8DA 5C32A 1CY2A 1FS5A 1NUHA 4FYXA 3TBKA 4B3IA 4GPBA 3WLKX 2ZBGA 1X6VA 3NHLA 2ZB2A 4Z4IA 5BYKA 1Y8ZA 4LBWA 3D6NB 4HDAA 4X8MA 1GG5A 3K1JA 2QX4A 5F1OA 4DLRA 2OT3B 4U7JA 5FOVA 3F6EX 1XN4A 2CV2A 3WQHA 4EG3A 4MUJA 3IXMA 4F4HA 1Y4DE 5DP2A 1EFCA 2GCGA 3NHUA 3QEAZ 3Q3VA 3HCEA 4EGQA 4TZTA 1NRJB 3BMCA 1H4SA 3CKMA 3ENZA 3PPWA 2PLFA 3DW1X 3R0QA 2GD6A 1T2CA 4FEAA 2RH4A 3Q1LA 4MA5A 1CEYA 1PR1A 1W93A 3GY0A 2O2DA 4OYYA 4AJ2A 3K9HA 3ABRB 2V7BA 4OFBA 1R6UA 4PC6A 4LNUA 4GOJA 4S24A 5G0UA 5K3FB 3KVRA 2FPSA 2RGDA 3SHQA 1JNXX 1P7WA 5B37A 3QTLA 1YKGA 3PPVA 1TZ2A 7MHTA 3EWNA 4EZBA 1X1QA 1LTQA 1AGNA 2CHEA 1TB4A 1E77A 2R68A 4ER0A 4TV9A 3V1LA 2UUPA 2COEA 3U61B 4GM0A 4HDRB 2XCUA 4EPWA 2B8NA 2W2XA 4Z5XA 4CRWB 2UYYA 3WGHA 5J4YA 4UM9D 3U7IA 3ZHVA 5FAKA 1VG0B 4N9WA 3K0CC 3HJAA 4L4XA 3ZLTA 3CRRA 4QKQA 4DA4A 1RRMA 2BEUA 5HRAA 5EUMA 3S55A 4L9SA 2NX2A 3PUVA 3HNRA 3P9SA 4KXVA 1IN8A 2EFJA 1VCNA 3BH0A 3QG5A 5FBRB 4LF6B 3UK7A 3AKCA 5GINE 1BWPA 4J2HA 4BVGA 3PNPA 4OYRA 4PLGA 1JYFA 1JUDA 2PNFA 1DBPA 4IG4A 1YBHA 4I3GA 4MRMB 4Q1AA 4TM7A 4DM4A 3R3UA 1CQJA 2ORED 3X43A 4UXJA 4JASB 3BYZA 1ZG3A 4PQYA 5AK5A 4KGDA 4IPTA 4DGQA 3BL6A 3QUQA 1QP8A 4AF7A 3KG2A 4R69A 3UOWA 2G5CA 1SBNE 1T3TA 3COJA 4E03A 4Z4EA 3BE4A 3G2IA 2D0PB 4JGGA 2CMKA 3PTZA 4HNHA 2ZB4A 3T3OA 1T1GA 2DQ4A 4JC8A 4ATNA 4W1QA 4EK9A 3B6JA 4JYBA 4H27A 4BP9A 1RHJA 4JN6B 621PA 1GPAA 3DTVD 3RK0A 5BNTA 2CNNA 1FF9A 3Q9LA 4K3VA 4YDQA 1A5ZA 4G1CA 2O8FB 4OSOA 3EIOA 1Z6XA 2Z4RA 3SEAA 3AZOA 5EVCA 4JXJA 1VIYA 1NBWB 4KZPA 1P4HA 3SD7A 3E9ZA 1M66A 4KXQA 1R7RA 4FNAA 3TUIC 2WWXA 1B2LA 1NR1A 1ZNYA 3A1TA 5J1TB 2CCGA 3ZX4A 2PMCA 2GN6A 4P80A 1XDUA 3FX2A 3Q2OA 4QBFA 4U3JB 1THTA 4PG7A 4DUPA 2YIDA 4X6UA 5L51A 3GVCA 1E4OA 2BHLA 1V16A 2P5YA 3FWPA 2JFWA 3M6FA 3PDHA 1DADA 1PQPA 1E64A 2I65A 4YB8A 3F49S 4PFSA 1ZOIA 5IC4A 3Q9UA 3B5EA 3KFXA 3RU2A 5FOSA 2C8JA 3S7ZA 5KX5B 1N0VC 4IHKA 3QG1A 4YJ3A 4TGLA 1RJEA 3CRVA 1ZH0A 2JIQA 3EWAA 2B7CA 4HYQA 5CFMA 3OZRA 3QJGA 3DP7A 3OZDA 4KGZA 4MDYA 4B8YA 1PF7E 1RDFA 1JJVA 2HMTA 4BBZA 4YMGA 1HE2A 2BM9A 3DKPA 1QBGA 3H1GA 4OFXA 3H8JA 3F97A 5HILA 3OU6A 4JU8A 3M70A 5IK2A 3RCBA 4D9NA 1C9MA 2XD4A 3BD8A 3P0HA 4DJEC 4V02A 4UBNA 1PR0A 2ZUDA 4N6GA 5EQDA 4YQEA 1R8XA 3B1YA 4DXHA 2O8CB 5LXTA 1OI3A 2CF6A 2R8XA 3P9NA 1FLVA 5IFKA 2PTGA 2O5EA 4REQB 4BO6A 3NWEA 3N6VA 1F8FA 1P0MA 2PFGA 2IZOA 5AJTA 5AKLA 1CDEA 1YE5A 4E4YA 2ZBDA 3U4QB 4MVWA 2XMRA 2NUTA 4BX0A 4ZHQF 4YUVA 4TLMB 1ZC3A 2O2CA 5DYIA 3UKJA 4EAAA 2DM6A 4TTQA 3A1NA 1WSDA 2PZGA 2WAYA 2LNDA 3GEGA 4E1BA 2BFOA 5T64A 4OQDA 4D3ZA 5DIZA 1U0HC 2VK2A 2G72A 2NPIA 3SIPA 4J0EA 2YXNA 2E21A 3ABOB 2R0QC 3QKUA 1ECFA 2M6RA 3G17A 4OQZA 2D4HA 3CW2A 3DCNA 2H7VA 1H3EA 3SIRA 1R8JA 3UTCA 1BOFA 1D8TA 3Q3IA 3GUZA 3Q2KA 1SOAA 2AOXA 3NALA 3FSGD 4Y1RB 4MWGA 1OC4A 3DE6X 3EGXB 1FFDA 2NPOA 4N7MA 3EARA 2FCAA 4MV0A 3SZMA 4M1ZA 3I39X 1WDKA 5JQGF 3T9FA 3A0UA 4WNYA 4R5HA 1ZN8A 3IJ5A 3RVLA 2GUWA 3S4YA 7MDHA 4M99A 1T3HA 2JIDA 1H05A 5CLLA 4UZEA 3D9QX 4A2CA 3IAEA 1LC3A 3E9YA 5MDHA 1G21E 3AUFA 2NZ2A 2YQ5A 4WUVA 3V80A 1H5QA 4A0GA 1PJSA 1SHLA 3AZQA 1KSFX 4R2JA 3OY2A 4WN9B 4A0HA 2HRCA 4PGGA 2ZWIA 1PCXA 2IYWA 1RKVA 2R6FA 2QLTA 5M29A 3KELA 5T7BA 2IEGA 4OBXA 1YJ8A 4GKAA 1P0PA 2XA2A 3GPLA 4EEXA 3NHZA 4IUYA 3ACCA 3U39A 1U80A 1VKZA 2YQ4A 3L84A 3DHNA 1RSZA 1RXCA 5HCNA 1QV7A 3QMPA 4YAIA 4D0RA 3WB2A 3NBQA 4RTLA 3WYCA 4F84A 3GH1A 4CEHA 3RUIA 1W2GA 1YWGO 1TKRA 5EIHA 3O84A 4M1QA 4H1WA 1HE1C 4YJKA 1GNRA 2CLEB 5FQNA 3ZH2A 5LMZA 4PQRA 3VZRA 1MIHA 3O8LA 3DCJA 3CVWA 1O6FA 5IH7A 4MRVA 2A9KA 1N4AA 2JFQA 5JNLA 4ARIA 1Q16A 3OMLA 3G6KA 1I4WA 2Z5GA 4CIWA 2YMMA 5DN6A 821PA 3ML1A 3U3JA 3BC1A 4QUKA 1AJEA 4FDLA 1L4LA 1GY8A 3OO0A 2J0QA 1E89A 1I7PA 4JQYA 3Q3EA 2PWYA 1KQ3A 4I4CA 4IIDA 1EGHA 1XKLA 1MABB 2HU7A 2VLBA 3CVJA 4X8LA 4Q7EA 4G4GA 1OF1A 4MUGA 4ID9A 3THXB 4I3HA 2QQGA 3EFBA 1X7HA 4E2ZA 1U4OA 1N8KA 3GLFA 2BTEA 1WB5A 3A3NA 3FNRA 1E1DA 4PIVA 2HCBA 4KRYA 5TSDA 4KPFC 3LV8A 4DV0B 5I4IA 3ILYA 3K2QA 5IUJC 4TMFA 4UAGA 3SQWA 4IVPA 3X2FA 4XGNA 3CA8A 3O7WA 1OY1A 1P81A 5K3SA 2C4KA 1H0RA 3PC7A 3MLBA 1IY0A 3C1OA 4OMUA 3WI7A 5EJ5A 1NQVA 1U2TA 2ZU6A 3OPXA 1A04A 3A37A 4BCDA 5AVYA 3S29A 2R86A 4KXXA 1KI3A 2DWQA 2BN4A 2XUJA 5A1TA 3W3AH 4F46A 2HZ7A 4TMZA 5I3CA 4FDUA 4A6EA 3AYZB 4UNQA 2Q1SA 2H1SA 1OHHD 3PXDA 4MLCA 4W4TA 4W99A 1YU9A 2WF6A 1YACA 1YFZA 2YWDA 4UPEA 5KHAA 2QPOA 5JCPA 2TMKA 2H2AA 2P2YA 4I4TA 2V7EA 4LXQA 4FFRA 1EUCA 2ES4A 4MK4A 1P8AA 3CKKA 1MVLA 1W47A 4NPAA 1ZW1A 3UMFA 3FOFC 1T2NA 2Z2IA 2CJWB 2X40A 5U9CA 2PN1A 4KFCA 1COZA 3VPBA 4CQJA 2VDWA 1TCVA 1WUYA 2ASVA 3V42A 1WMEA 4KYIB 3WAGA 3UC5A 3HM2A 5GGXA 1MW9X 4ZPXA 2NSJA 3W05A 2Q9AA 4CL3A 1HMYA 3SJBA 4L0MA 1JLLA 2J07A 4US1R 4TKMA 3CF0A 3HGMA 1IHUA 2C88A 4WFIA 2C5EA 5IVPA 1ZH4A 1EM8A 1M1NA 4CM6A 4IRUB 2H4JA 2QL7A 2XQGA 3M83A 1C30B 3U3DA 4BTEA 3ID6C 5AK6A 3I8SA 4F4UA 4YCNA 1TA0A 3MWYW 1KEPA 1Z6TA 3PGMA 3ER6A 4WSOA 3IEPA 2Q4DA 3CIFA 2ZE6A 3NVDA 4AQDA 1XMOB 2ASEA 3N2YA 4PIMA 2HNKA 5K8UA 3GGOA 1YNOA 1PQYA 4GPAA 3TKYA 2RONA 1RACA 3CVOA 1B76A 5BN5B 3CMCO 5LUBA 1QWOA 2I3GA 2AZXA 3PIIA 2WWRA 3KQWA 3O21A 1HDYA 1NT2A 1GA1A 2I67A 1X19A 1JR3D 2AI2A 4P82A 3CWCA 2WYIA 4WK4B 2VLIA 3AILA 4BO8A 4GMGA 2BFBA 1M8JA 4EY6A 2C1EA 2ATIA 5GOZA 2Q8NA 1YS7A 4PBSA 2IODA 2RHJA 2F55A 5B53A 4HPJB 2A0WA 3AVWA 1I13A 4LG1A 4BWVA 3DZFA 5A03A 2Q9UA 3RAJA 3BIOA 4OHZA 2D1SA 5KJCA 2GN0A 1WPQA 2G76A 2AR9A 3HJUA 3BXEA 1E7YA 1ZMOA 3GWZA 5F76A 1HEUA 3E8MA 2XJ4A 3SDZA 2YVQA 1V8ZA 2WIFA 1XP5A 3J81k 3ZU5A 5IDWA 2B34A 1OLSA 5DE3A 4C7VA 4CMGA 3K0CA 4O4JB 2AF4C 2IWHA 4G85A 2O59A 2O2IA 3AFHA 1PEAA 2ZJ0A 2EBFX 3DVRX 3K9LA 4CKXA 3DE5X 1VOTA 5LUAA 2P4EA 1KBQA 1ZL2A 4YYEA 8ADHA 1ZESA 4IWYA 1MX3A 1QHGA 2WUDA 1PYGA 4RADA 1RYEA 1U3WA 1PFVA 2PGDA 2ZT7A 3C6ZA 2EG9A 4QFDA 4XWTA 4F06A 4YLGA 2WUEA 3A1EA 4DV4B 1KRHA 5SY9A 2ESRA 2D62A 1C50A 1LPBB 4XFKA 1W5EA 3QX7A 5KREA 4KXUA 3RI3A 1TIPA 1TMKA 2W8ZA 4N7RA 3DBOB 3PNLA 4C0HA 1PQWA 5FL7A 3C6KA 5KYKA 2WHYA 4KWEA 1N2ZA 1J70A 2HTFA 5HIKA 2VNKA 2FX2A 1QX4A 1GGNA 2E2WA 2QUIA 4EG0A 5CCEA 3AIKA 1AN0A 2LKCA 3U7RA 2P2ZA 3R76A 4BJ5A 3VM6A 4MJXA 1E2QA 1X1DA 1XTVA 1LJ8A 3KVVA 4IMPA 4JSYA 3VR1A 3GH3A 3N0TA 1AXEA 1Q1NA 3E1GA 3VYSB 4D46A 4Q4JB 1KAQA 1N78A 1G8MA 2X8AA 3EXIA 4A26A 3PD1A 1PR6A 2V74B 4DPLA 3W5UA 1ZD5A 3OSUA 2I1QA 4FYVA 3UJ3X 3ZI7A 3IHTA 1L7RA 3JARB 5EJ9A 4B3GA 4HFJA 1ULAA 2R1TA 4I7EA 2CD7A 4YJ2B 5E3HA 2XXAA 3BJIC 4KR6A 4N4AA 1A2QA 5U4XA 4MMXB 1SOWA 2AG1A 1OYOA 3IBGA 3DXFA 2WSLA 2PZAA 2OFPA 3B60A 4GSLA 4M7PA 3PFFA 5H4HA 3C5CA 3BT7A 5HOEA 1CRWG 2B2NA 2D1YA 4OPMA 3RC7A 2IZ6A 1JDNA 3AVYA 3HY6A 3K72B 4MUYA 3EYAA 3RWMB 2XTMA 2VJOA 1U3FA 3O38A 1AKQA 4GZ5A 5EZ6B 1XMJA 1JN0A 2JATA 2QYHA 3E5HA 2WIJA 4AMGA 3RYCA 1EWQA 1XD9A 4WA7A 3TKAA 1ZVJA 2WUWE 1YI1A 3ZKAA 4YRNA 3BF8A 5EIAA 3VZCA 4CEHB 2X2PA 2WFLA 4TPKA 3NHMA 4RKEA 1JFVA 2PD3A 4MP3A 3KQSA 3OHMA 1G16A 1YQDA