1J1IA

Crystal structure of a his-tagged serine hydrolase involved in the carbazole degradation (carc enzyme)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
258
Chain Sequence
AYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a histidine-tagged serine hydrolase involved in the carbazole degradation (CarC enzyme).
pubmed doi rcsb
source organism Janthinobacterium
molecule tags Hydrolase
molecule keywords meta cleavage compound hydrolase
total genus 87
structure length 258
sequence length 268
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j1iA00
1I6WA 1L7AA 3W2TA 3EBLA 4CIBA 2GYWA 3A70A 4ARBA 1ORVA 2CMFA 1J1IA 5E4YA 4UUQA 3O9VA 2C0QA 3FVTA 2XMQA 1AMNA 2OCIA 3NOXA 3R3ZA 2XI4A 3FNBA 1VE7A 3ZI7A 2AJCA 2GYVA 2JGLA 2K2QB 4BRZA 3WWDA 4ZGBA 2ZYIA 1MT3A 3AILA 3WK6A 1QFSA 2C7BA 1CIJA 3G9XA 5K3DA 4B80A 3I2JA 1MPXA 4UBIA 5AI5A 5CH8A 2IIVA 4UBJA 5DTIA 3WIOA 5FLKA 1MAHA 3TJMA 2DR0A 3ZLVA 3EQ7A 1CLEA 3ZLTA 1GZ7A 5ALKA 2W22A 1N5MA 3VJMA 3WA7A 3P2MA 3WQHA 3DL4A 4IH9A 1ZICA 1CUGA 2CB9A 2RHWA 2DQZA 3H2IA 3BF8A 2WILA 3B12A 2EDCA 4U2GA 2CBGA 4UHCA 1EVEA 4P93A 3MUOA 1EDDA 4QLAA 1RYYA 4FDMA 3VVLA 4LHEA 1J06A 4HAIA 2WG1A 3ZLUA 1UOPA 5ESRA 5FV4A 3V1KA 3C6ZA 4KE6A 3PE6A 3OC0A 4YASA 5JYCA 3STUA 1CR6A 1JI3A 2JGIA 1BEEA 4E11A 4YK7A 3BJMA 2BAGA 5AO9A 3AIKA 4K2AA 5D6OA 1CUUA 1XZFA 3FCYA 1UK6A 3I1YA 1ODSA 3IULA 1IZ7A 3T4UA 2BUCA 1Z68A 5DYWA 2J4FA 4AX4A 2WSLA 3ZPXA 2QXUA 4ETWA 1QONA 3BIXA 4HRYA 4U2EA 5YASA 4C01A 4L3WA 4MWTA 4PO3X 5AKHA 3IBTA 2XQKA 4NVRA 5T4FA 4P9NA 4MWSA 2PUHA 3AJAA 4H7JA 2OCGA 4X6UA 2I3DA 3HC7A 2HA7A 5HKBA 3VJKA 4INZA 3RK4A 3G02A 2Y2UA 4Y2YA 4A5SA 4BAUA 4F60A 4H35A 4G4IA 4BYMA 2ORYA 5AKGA 1THTA 3ESDA 5ALVA 3QZUA 5ALHA 4V2IA 4UHBA 5HFNA 4N5IX 3F9CA 3WL6A 3FLBA 5CT6A 4CG3A 1ZD4A 2XMCA 3FVRA 1USWA 4XWGA 1K5PA 1VA5A 2WIDA 1XZIA 2BGNA 5JIBA 5DYYA 4MEBA 2LIPA 2HA6A 4FLFA 3K2IA 5A71A 4H18A 4UFPA 3QPAA 5ALIA 3BE8A 3C8DA 3MUNA 2I03A 4N5HX 4DNFA 5K3FB 5E2IA 1XZAA 5DNVA 1MTZA 2G63A 2JF0A 1IVYA 4HRXA 1FSSA 4MEAA 3GELA 4UFNA 4Y7DA 1C7JA 1U65A 4DTCA 1EXWA 3BXPA 1QIHA 4FLMA 3DYIA 2HFJA 4B9AA 2VF2A 4BE4A 3V1LA 3WK5A 4MQLA 2ZJ6A 2HU8A 1LZLA 1DWPA 2C58A 3D0KA 5J3JA 1IUPA 4G8BA 3HRHA 4OYLA 3YASA 1N1MA 3D59A 2ECFA 1QIEA 3IA2A 2E3JA 2OAEA 5ALYA 2HRRA 1EVQA 5ALUA 3WWEA 2J4CA 1EB9A 2G5TA 5JATA 2C4HA 1SFRA 2HFKA 1NU8A 3H17A 3N2ZB 2YASA 3WKEA 2W6CX 1R50A 4C88A 5HKAA 1EI9A 2XQGA 5LP1A 4UHEA 2WG0A 5LZ2A 4UPDA 3H2KA 3PFBA 1XRPA 3C5WP 1GKKA 1K63A 1EA5A 5EI5A 1CUFA 2WG2A 4CFSA 2VJDA 3NGMA 1FFDA 2XQFA 4OB7A 3WWOA 1EB8A 2XMZA 3QPCA 3GROA 1UK9A 5JASA 3OPMA 2BGRA 1ZI9A 4YX9A 5CXUA 1P0MA 2YYSA 3R3VA 4EY7A 1S8OA 2D5LA 2VT6A 4CG2A 4X3CA 5C8XA 5EHZA 3GFFA 5T4BA 3BWXA 4W9RA 3STYA 4QLOA 2OQVA 5AIAA 2ZYHA 1TCBA 2HU7A 1J07A 3GUUA 1E89A 3WKBA 4WY8A 5CH3A 2O2GA 5FP0A 4NS4A 4Y2JA 5CT8A 2HA4A 1XROA 3M81A 2QOEA 2WJ4A 2OCLA 5LZ7A 2B9VA 1XZKA 3I2KA 5LIPA 2WHQA 1UK7A 3O4GA 3CN9A 5BWCA 3R3UA 5A2GA 1YA4A 2B61A 1KEZA 3MGAA 4GDMA 1BCRA 3AZQA 4CI9A 1QE3A 1P0QA 2DQYA 2PPLA 1W52X 4MJ3A 1UKAA 3GA7A 4U2FA 2AJ8A 1YSCA 4BZWA 4J0DA 2WU4A 1GQRA 4AN1A 1G4HA 2H7YA 3W05A 5CBKA 2CZQA 1QJ4A 5BOVA 4H7IA 3WJ1A 1HLGA 4M0MA 3QPDA 2XMGA 2WHRA 1EK1A 4G5XA 5ALRA 1ZGCA 1MNQA 1VJ5A 2DSNA 1QO9A 1SCIA 3GZJA 3PF8A 3B3QA 1GT6A 4XX1A 4G9GA 1IUOA 3ILSA 1HBJA 5JARA 1XLVA 5JZ9A 4ZI5A 5ALEA 3R0VA 4PSDA 1RP1A 5DWDA 3HACA 3EF3A 4X00A 1WOMA 1EDBA 4HXFB 4GEGA 5KWIA 1R1DA 5SYNA 4P92A 4QE3A 1XZCA 4KAAA 2O7VA 3WJ2A 2XUAA 1TKRA 3OM8A 3NWOA 4BAZA 4EY8A 4KYVA 1WPXA 4MXDA 3D2AA 4L72A 2WIKA 1HKHA 5AIBA 5JAPA 4ZWNA 2QRUA 4WJLA 1DTEA 5AKYA 1UOOA 5HFAA 3G0DA 1B41A 1QFMA 5A6VA 4RGYA 1EDEA 4MQMA 4N8SA 1GQSA 1UWCA 5AK4A 1ZI6A 4GW3A 5HF8A 5EHNA 1IZ8A 4L9AA 3ESBA 3QMVA 4Y2RA 3H19A 1ACLA 3B5EA 3H1BA 3K6KA 1Q0RA 1A8UA 4X97A 3AIMA 1XKTA 4WCVA 4U2BA 4JNCA 1DQZA 3V1MA 4FKBA 2HADA 3F8SA 3OURA 4AXBA 1T2NA 4N8DA 3AZPA 4J0GA 2G4LA 1P0PA 2WU3A 4OU5A 5LKAA 2BCEA 4Q82A 4C89A 4PV7A 3ED1A 3DCNA 4XVCA 1C7IA 1ZD5A 4Y2QA 5HK9A 3WWCA 5JADA 2FX5A 1YAJA 3AINA 4KRYA 1E8NA 4X7BA 4WFJA 3DS8A 3H2HA 5AK3A 2H7CA 1FFCA 1ZI8A 4QA9A 3STTA 1CUIA 4QDXA 3HI4A 5CMLA 3H2JA 1E8DA 4JYPA 1L7QA 2QUBA 1UK8A 2I78A 3QYJA 1BCSA 2HA5A 5K3BA 3E0XA 2DHEA 2Z8XA 3MVEA 5FKJA 3G9TA 1ZD2P 3C43A 2UZ0A 3CCBA 1CUEA 5I9IA 1H23A 5AKEA 1E66A 3D4LA 2GBCA 2ZJFA 1ZJ4A 2R8BA 2HU5A 2C5GA 1DX6A 1J2EA 4DMCA 4EY4A 4FBLA 4AZ0A 4KAJA 4HZGA 5JANA 1JT2A 2D0DA 4OB8A 2HA0A 3W9BA 3WKCA 1CUDA 2PKYX 1M33A 5T4EA 4OPMA 3ZV7A 3PUHA 3O4JA 2PL5A 3LLCA 1CUBA 4GXNA 1AC5A 5HF9A 1GPKA 5DLPA 2Y1KA 2GBIA 2Z5GA 1BU8A 1YCDA 2Q0XA 1GXSA 1JMKC 4AMYA 2VA9A 5DYTA 1KU6A 2IITA 1G5FA 4B84A 1YS2X 3QMWA 3WL7A 1EINA 5D3KA 3WZMA 2J3QA 1GKLA 1DT3A 4ZREA 4DMFA 2XUQA 2WIJA 3R40A 2JGFA 4EA6A 1VZ3A 3WMRA 3C6XA 4BDTA 3F96A 2ES4A 1EHYA 5AKXA 5LZ5A 3IDAA 4KE8A 2PSHA 4B6GA 2AJBA 5CXXA 2OQIA 4QEKA 3G0BA 1JKMA 3D3NA 4FFVA 2FJPA 3WWPA 3HEAA 3EQ9A 3F67A 4HS9A 5AM4A 2BUAA 4BP8A 1X2EA 3R3YA 5ISMA 6YASA 4BATA 4TVKA 2C5FA 2HIHA 4K5QA 5AI8A 3WK7A 1CQZA 4UFOA 2PBLA 5AM5A 4IHAA 4B81A 4FOLA 4BB0A 2VQ6A 2CJPA 3LCRA 5IVIA 3ESAA 2BFNA 2Z3ZA 2IX9A 3E4DA 2I3ZA 1BEZA 4LYEA 2QTBA 1F6WA 5I8PA 5AH0A 3OG9A 1NU6A 4IQ4A 3OOSA 5AHXA 1T4MA 2QJRA 1JU4A 4XIIA 5HK8A 2CEKA 2ZSIA 1UKBA 3TEJA 5DNUA 1VOTA 2X8BA 4BCBA 1GPNA 1BRTA 3VXKA 4DMKA 3FAKA 1WHTA 2QR5A 4FMPA 5K3FA 2CKMA 4BZZA 2HA3A 4O08A 3I6YA 4C4YA 4OYYA 5DNWA 4OUKX 1ISPA 5AK6A 1W4LA 1JU3A 1OCEA 4IH1A 2PU5A 2WKWA 4RNCA 3H2GA 5K3EA 1YAHA 1DINA 4ZV9A 2DCMA 2WIGA 3A2NA 1PFQA 1LPBB 3WL5A 1ETHA 4H7KA 4DSAA 5AKZA 1MX1A 2ACKA 1LPSA 2RIPA 4BP9A 3SWWA 2WUEA 3C6YA 4J0CA 3KWJA 2GZSA 2ZVDA 3BF7A 3ESCA 3A6ZA 4PSCA 4RE5A 5JZBA 3V48A 3UUEA 1HQDA 3KXPA 3D2CA 4I4CA 2VATA 2V96A 3U0VA 1XZGA 5KREA 5EGNA 1WPRA 1TAHA 3HSSA 2FJ0A 4J7AA 3DYVA 2WJ6A 2XB6A 1LLFA 1N5RA 3KWFA 3I1IA 2WFZA 1W75A 1AKNA 1QOZA 4C4ZA 2PSFA 5EIAA 1L7RA 4EZIA 3D7RA 3LIIA 2Y6UA 3LP5A 1SCQA 3RM3A 2EEPA 4LXIA 4CCWA 1R4ZA 5I7UA 3FSGA 3W06A 5LLSA 2YH2A 3Q8WA 4PSUA 4KR0A 1DX4A 4BBZA 1R9MA 1UZAA 3F98A 1XZDA 3L1IA 1TRHA 2QS9A 3W04A 5AKLA 5EIHA 3ICWA 2HHAA 4H0CA 2QMQA 2OAGA 4TGLA 2WM2A 3HJUA 1VXOA 1AX9A 1BN6A 2WFLA 5AI0A 3WYNA 4Y2PA 3G7NA 3WIBA 1CPYA 2XUHA 5ALPA 3E1GA 3W9UA 3ZWQA 1VXRA 3HZOA 3FCXA 5EHXA 4GWLA 4BTVA 1GPLA 2V97A 3H18A 4AN0A 4B82A 1QIIA 1TCAA 1PJAA 4EBBA 4H7HA 4FFWA 1XRRA 1QIMA 1UFOA 3DL7A 3ANTA 1W6RA 1DT5A 5CURA 2BUBA 2VTVA 2RI6A 5A7HA 4C6HA 3SK0A 1Y7IA 2HRQA 3O0DA 1LZKA 2VEOA 1QTIA 2WFMA 1ZD3A 4UBMA 5BWBA 1DU4A 2QVBA 1FFAA 4Z49A 1ORWA 5FOQA 4LXGA 1UOQA 5A7FA 3H1AA 3HXKA 1AUOA 1AGYA 1CUAA 1CEXA 4F5ZA 2VJAA 3BL8A 1VA4A 4HXEB 2XUJA 4I19A 2ZYSA 5IVDA 5AP9A 5ALXA 4ITVA 2RAUA 2XLBA 2JGJA 5ALFA 1QIDA 4Y2VA 1G66A 4BVJA 4X91A 4E14A 3VDXA 2JEYA 1MN6A 4PW0A 2Y6VA 4BCCA 3WLAA 2GYUA 2WHPA 4Q3KA 2XUKA 4BDSA 3UUFA 3WI7A 3DEAA 4B0PA 1XRQA 3WK4A 1A8SA 5FUMA 1QO7A 4A23A 3KDAA 4ZRDA 4K6GA 2XLCA 4Q05A 5JD6A 4JUIA 4LXHA 5D3ZA 3FSGD 1ODCA 3DJYA 4H77A 3UMJA 4KACA 2V98A 1CUXA 3NUZA 4FBMA 4G9EA 3WZLA 1QTRA 5AK5A 2PM8A 4EY5A 1CUWA 5LKRA 4J0HA 3E3AA 3HABA 2JGEA 1X2BA 3PFCA 1SCKA 5AOAA 2HM7A 1IMJA 4BRSA 3S2ZA 1O6FA 3G9UA 1B6GA 4QDZA 1EX9A 2XQIA 3SX4A 5LYYA 5HF5A 4F21A 3WYDA 3C70A 4NMWA 4EUSA 3QVMA 4BVLA 1JJIA 3I6MA 4IO0A 1UT6A 1XKLA 4BE9A 2O7RA 5AJHA 4HVTA 2VAVA 1QIKA 3I2FA 4E15A 1R9NA 2GZRA 4G1FA 4UHHA 4C87A 2WUDA 4QWWA 2FUKA 3JWEA 4X6XA 1XRMA 2X76A 5CRIA 3KSRA 4HXGA 1MU0A 3PDCA 4UBNA 3H04A 2AXEA 4LKOA 2VJCA 4W1SA 2QM0A 2P8SA 1BROA 4DM7A 4Y2UA 3CN7A 5C7YA 4Q3OA 3F97A 2B4KA 1CRLA 2XMRA 4BCDA 1MO2A 3RARA 5HCUA 4QWMA 2WUGA 3QH4A 1WB4A 4X95A 4HTAA 2Z8ZA 3STXA 1N8SA 2JBWA 4DYHA 5IKXA 1H2XA 1HDEA 3QITA 4WFIA 3BJRA 3ICVA 4W1QA 2PSDA 5FXMA 3IUQA 3O4HA 3BDVA 3OTQA 5A62A 1ZIYA 4X90A 4X85A 1MJ5A 1YB7A 1K6EA 3LIPA 4TPKA 1BE0A 2OLEA 2XMSA 4UHDA 1K8QA 3IB3A 1CV2A 1Y37A 2WJ3A 2XMBA 4OD0A 1TCCA 1XFDA 4WY5A 5SYMA 5ALMA 5BV7A 2XDWA 2VSQA 1LNSA 5LZ8A 5E4TA 5AKIA 1MX9A 2JEZA 1CUYA 3D2BA 1ZIXA 5AICA 2VJBA 2XUIA 4MYSA 4I3FA 4BC0A 2Z3WA 1F8UA 1XZEA 3PI6A 4K6KA 1Y7HA 4J0IA 5H3HA 4C4XA 4H7DA 4X93A 3FOBA 1JFRA 3DOIA 5EIEA 3IUJA 1OXMA 1VKHA 4G4JA 1A7UA 3K9BA 4JH0A 4ROTA 4CIAA 1QZ3A 4W1PA 1ZOIA 4K6HA 5JAUA 3O9MA 1HL7A 4M0EA 4QDTA 1XZBA 2WQZA 2O2IA 3L1HA 2OG1A 5D7BA 4BVKA 3DLTA 2XT0A 3FYUB 5C8ZA 5ALNA 1SC9A 4J03A 5E4JA 3WKAA 1OILA 5AKJA 2ZJ7A 3D5EA 3S8YA 1H2YA 4WDQA 5JAOA 3TRDA 4UHFA 4GBGA 2QJWA 4XJVA 4QZVA 4FNGA 4B0OA 3KD2A 4W63A 4G8CA 1FFBA 5JALA 1VZ2A 5ALQA 1CVLA 1Q0ZA 1WB6A 3V1NA 4G8DA 4G4GA 5ALGA 1K4YA 4B85A 2RHTA 5ALLA 4YPVA 5JZSA 3BDIA 5ALZA 4FTWA 3WK8A 5ALTA 3JYHA 3FLEA 1TIBA 1WM1A 4DIUA 4Y2SA 3CCCA 1F0NA 5ALOA 4BAGA 4EHBA 4JEIA 3TGLA 1ZGBA 3PICA 3HYSA 1H22A 3IURA 4GECA 5ALSA 4J0KA 2C0PA 4RE6A 2JGKA 2V9ZA 2R11A 3IIIA 5AKKA 2EDAA 5IVHA 3AFIA 1XZHA 1TQHA 5FPPA 2HL6A 1CQWA 1XZMA 1YA8A 1WB5A 4N8EA 3HLKA 4UBKA 4LYDA 4J0JA 1CUSA 5CW2A 4AQDA 4MYDA 4CG1A 2G5PA 4F0JA 4Y9SA 4E46A 5HZGA 1Q83A 1BN7A 2QXTA 1GGVA 1WCYA 3EQ8A 1LGYA 1EK2A 1XQWA 3PUIA 1AURA 4OCZA 1WHSA 1A88A 1XQYA 1YS1X 2HDWA 1LBTA 3A2MA 3KOOA 5AM0A 4B7ZA 1XRLA 3IUMA 5FRDA 3N0TA 2DHDA 3JW8A 5C81A 4UBLA 5A7GA 1CUCA 4BTLA 4KEAA 2XUGA 5KWJA 2BKLA 1LPNA 4OB6A 7YASA 4AO8A 4UBOA 1RWQA 3DDUA 4PNZA 5FDFA 4FLEA 5AOBA 1QIFA 4DNQA 2H7XA 3G8YA 4RPCA 5JD5A 1AZWA 2PSJA 5LZ9A 3C8HA 3DKRA 1XQXA 1U2EA 4QDOA 4ZXFA 1EH5A 4ZV7A 3I28A 2DFPA 3C6BA 4GLBA 4X92A 5ALDA 3IUNA 1BS9A 5ALWA 4Y2TA 1D07A 5ALJA 2ACEA 5LZ4A 4WFKA 1UKCA 3AIOA 3QM1A 4CCYB 2PSEA 1THGA 4QDUA 3T52A 2RONA 5AOCA 4Y2XA 3WL8A 3AUKA 4U2CA 3RLIA 2NW6A 2BJHA 4GI1A 2WIFA 1FFEA 5JAHA 1ACJA 2OGZA 5AM3A 4OSEA 2YXPX 2WFLB 1IUNA 4JYMA 1PV1A 2QKYA 2PVSA 5C8VA 5HQ3A 2OGTA 4H7EA 2HA2A 1A8QA 1QLWA 1XLWA 4AMZA 2QZPA 2XUPA 3M82A 2PU7A 1LBSA 2OXEA 3X3HA 4FHZA 1E5TA 5K5EA 1CUHA 1P0IA 1X70A 3FBWA 4S0XA 1ZJ5A 2ZSHA 1KU0A 4DNOA 5K3AA 4B9EA 1CFJA 1E3QA 2VAXA 1H2WA 3R41A 1SOMA 2AJLI 1Q84A 3H0CA 2XUFA 1MAAA 2H1IA 3G0IA 4WDRA 5K3CA 2WTMA 3V9AA 1MX5A 3M83A 4AZ3A 4PQEA 2XQJA 1O6GA 4DSZA 1R88A 3DNMA 4BC1A 2J3DA 1JMYA 2ONCA 3FYUC 5AM1A 2JGMA 2WUFA 3CXUA 1LPMA 5T4HA 4W1RA 1LPOA 4NZZA 3A2LA 4CCYA 2XE4A 2XMDA 4X6YA 1QIGA 3O4IA 3EIOA 5CH5A 4Q3LA 2OGSA 5EFZA 3G9ZA 1TK3A 4P08A 1G42A 3STVA 2QT9A 1JJBA 4U2DA 4M0FA 1CUVA 2ZYRA 3LS2A 4J3JA 3FWHA 1F0PA 3DQZA 2JIDA 1U8EA 3GBSA 3DKKA 1R3DA 4B83A 3FYUA 1XQVA 1YB6A 3AZOA 4FWBA 4KE7A 2XUOA 2DHCA 3Q0TA 5AI9A 1HPLA 2WTNA 3C87A 1DQYA 4OU4A 5CTAA 3BIWA 5IVKA 3VVMA 1C4XA 5EHQA 5AI6A 3WA6A 4KRXA 2OPHA 1QGED 2PX6A 1VLQA 4EB0A 5CT5A 1CUZA 2CUTA 2X5XA 4KJXA 4Q1VA 3C45A 1XLUA 4D9JA 4AO7A 3R3XA 5KBYA 1DWQA 1H2ZA 3WK9A 4DGQA 1LPPA 1CUJA 1W76A 1FJ2A 2ROQA 1DWOA 2PUJA 3ANSA 3IVMA 1AQLA 4L0CA 4QNNA 1UXOA 1YR2A 2B20A 1E8MA 5IH7A 3FYTA 4GHWA 3DD5A 3VJLA 4IH4A 2GBGA 3VKFA 4DNPA 3I2GA 3L1JA 2H9YA 1XZLA 3SC2A 1YASA 3R3WA 2XUDA 4KE9A 5AI4A 2GBFA 4X71A 3WKDA 3STWA 1LPAB 1QIJA 2Y2VA 4DMHA 5JD4A 2AJDA 4LIPD 3I2HA 1ODTC 3G0CA 3QBJA 4H7FA 3RKSA 5AM2A 2RGUA 5CT4A 2OCKA 2WLSA 3PF9A 3I6ZA 1VE6A 4EY6A 4A16A 3G0GA 1W1IA 3DOHA 4Q34A 4AB1A 1JJFA 4FNMA 2O2HA 5DTJA 4DLNA 5HQ3B 1XRNA 4AO6A 3U1TA 5FPQA 4X94A 3QMMA 3I2IA 5HF6A 2QUAA 3M3DA 4PF1A 1XZJA 4KAFA 3O95A 5DJ5A 5CT9A 2WHPB 4ARAA 3C5VA 1MNAA 1U4NA 2VT7A 3FLAA 3VISA 5F4ZA 1NX9A
chains in the Genus database with same CATH superfamily
1E79D 2BM8A 4QFBA 2JH3A 3W2TA 1ZMOA 5IJ0B 3SLRA 1ZVJA 3GJ0A 2BFFB 3MQFA 3KUUA 2PKEA 2BIFA 3VPDA 1T6YA 1J1IA 3OEYA 3O9VA 2C0QA 4L50A 5GGXA 3NI2A 3L2OB 1YQDA 2XA9A 1LF0A 2OCIA 1NC3A 3IAS6 4NYIQ 4DY4A 4IWXA 4ZCMA 3CLTC 3AEKB 4MICA 4JIMA 1TCVA 3QFFA 1WMAA 4WI1A 2I7CA 2BONA 5EZ6B 1GL9B 1E5XA 5KS2A 2HWWA 3RYCA 1K0UA 4B31A 2X9GA 4K81B 1NYTA 1SXIA 2GYVA 4OL9A 1S2DA 4NPCA 3S2IA 3UK0A 5JBQA 3I61A 5IMBA 5JT1A 4UUAA 1OT3A 3V2IA 2NU7B 3K6SB 1CJTC 3NU1A 4A9AA 3WK6A 5GGYA 5JDIC 4PC2A 2R0QC 2C7BA 3AONB 3UMBA 2AW5A 1SEPA 3DFKA 5CTJA 1PK9A 4B34A 1Y9JA 1JQBA 4IZHA 1U9ZA 2AYYA 2IFTA 3GMIA 5KAMA 3JTMA 1A9TA 3PHGA 3RVRA 4BNYA 1SZJG 3AOEC 4JHXA 4Q7EA 1PT5A 2DUWA 2R86A 4S2UA 3I53A 1L3CA 3MLEA 4UBIA 4BGUA 1M76A 2M6RA 3NAMA 3LY5A 1D2HA 1XMVA 2IDZA 1TMGE 3EODA 3NYQA 2VT3A 3P9YA 1W0KA 5FLKA 3LYAA 3PQCA 5TS3A 5I7OA 3LF1A 4TLLB 3D1JA 3ZLTA 2CZGA 4P80A 3AVYA 4ZCQA 3EZFA 5L9AA 1UXGA 3LHFA 5ALKA 1YV9A 3L07A 1KMMA 1NUQA 3MPOA 4RGVA 1N5MA 4RL6A 4W7HA 2NO6A 3JPYA 1UDBA 1Q1BA 4JLUA 1NW6A 2WABA 4M87A 4A6XA 3AKDA 3P2MA 3GJ3A 3TLGB 4IIJF 1TK2A 2OV4A 3Q12A 4N3NA 4RK0A 4IH9A 4PPQA 1ZICA 4BV3A 2I1WA 2CB9A 4BKPA 3LUFA 2UV8A 1J49A 3RRXA 1L5WA 3HM2A 3BF8A 1XKQA 3IP8A 3A6EA 3MUFA 3H86A 4JOQA 4PLHA 2WEKA 3OHMA 1NUTA 1Z0AA 5BUCA 2IXAA 3OJOA 1GKYA 621PA 1IOZA 2EDCA 3UAYA 4BQIA 1C41A 2RHBA 2CBGA 1K8XB 3I12A 4MO9A 4UMFA 4CMAA 2P67A 5F51A 2X0DA 5TMBA 4S1NA 4EGJA 4XSHA 3PUVA 3E2MA 1GPMA 1WSDA 4KGDA 1YK1A 1WHTB 3G6KA 4P93A 1XVUA 5DCLA 3U3ZA 1KORA 2BLLA 1J24A 3SU8A 2OO5C 1NLZA 1W88B 2XTJA 1CJMA 4QLAA 1EFKA 2QU7A 3NM5A 4CV3A 2ONZA 1ZGJA 1Z2CA 2YNMC 3OEED 4UEOA 3RYFB 1SMKA 4BNNA 2M6KA 3RS7A 3V4VB 3FPCA 3RUHA 2XV1A 3VVLA 3Q7QA 2ZAOA 4HAIA 4JB3A 3X44A 2FZEA 4Q0MA 2DFNA 1O08A 1LVHA 1BHQ1 1QQ7A 3SKVA 3IMCA 4A0RA 3HZZA 4K7JA 4BZXA 4YT4A 5C51B 4I14A 1A9XB 4IDFA 3TPZA 5JROA 10MHA 1I7LA 4BWYA 5DF1A 1H2EA 3PE6A 5JCJA 2ZSBA 5ARCA 5FBKA 1R0ZA 3A7EA 4GS5A 4YASA 5AXBA 5A5EA 1OJLA 2X0JA 1Y4ZA 1Z63A 1JI3A 4GFDA 3TVDA 2IH2A 1BEEA 1YBVA 2PD4A 4E11A 3KBOA 1ZW1A 2J5KA 3FJYA 3P1JA 4UDXX 4OLBA 1EGHA 5C4IA 2AA3A 4CODB 4J76A 1FOEB 5CNKA 3VPCA 1E6EA 4HCJA 3L49A 5AESA 2AXNA 2HWYA 3I1YA 1K88A 1ODSA 2IZ5A 3PDWA 2J33A 1M1XB 4O2LA 1IZ7A 4RSRA 2AG0A 2BUCA 1E9BA 2ZITA 4LPSA 4NX2A 5HUHA 1QZTA 1ZOOA 1CB7A 3LCJA 4IAOA 3OEHA 1T4GA 2NU9A 4Y1FA 2VQ3A 4YP7A 3HSYA 1P1RA 5CYGA 5LYJF 2GJ9A 4PCLA 3BGSA 3NHLA 1UBOS 2WSLA 3GGDA 4ZHQF 4XYGA 2YYAA 4YDHB 2ZKIA 4K6CA 3R5TA 3HG7A 5JAMA 2XB8A 1M9NA 4BJ6A 1FU4A 1QONA 2HXSA 2ZR9A 3OCJA 2D4AA 3KG2A 2FF7A 4RAOA 2F9FA 1PL6A 2YXBA 4HRYA 4U2EA 4BNWA 1X8JA 4L3WA 4PO3X 5J2UB 1X0VA 2RDMA 3BAZA 1ZJZA 1RQRA 3RR2A 3FMGA 3LYLA 2KB0A 3N6XA 2EGHA 4J6EA 3TDMA 1FDIA 1TEZA 2QYSA 3BGOS 1E9RA 1X1EA 1CNFA 3SFZA 2XYQA 4YAUA 2V6GA 1U8AA 1ZUHA 3JQAD 3FKQA 2W0SA 2PUGA 2NZ2A 3RYFA 3ODPA 3DUFB 5CHYA 3HC7A 3AVPA 3VJKA 1PFGA 3F6EX 4INZA 3KEMA 1GZ3A 3RK4A 4HV4A 1YS7A 3E9NA 1I1QB 2QUZA 1N33B 4JL6A 1WHSB 3T3OA 2Y2UA 4HB2A 1KH1A 2CNKA 2ZIXB 3H75A 2D59A 2FDRA 2I62A 4CLDA 4V1CA 3KHTA 1GUZA 1GTRA 4B82A 3QPVA 4F4HA 4MH0R 4YJFA 3IL2A 4KWIA 2MOKA 3SQMA 1BS1A 2NVBA 3AY3A 2E4ZA 2WYVA 5KU7A 3BIOA 3LDHA 4FMCB 1VJCA 1JHOA 2AFRA 1RZUA 1ZINA 3KZCA 5ALHA 1N3YA 1OYYA 4AWXA 1S1MA 4IIJB 4XKJA 3DT6A 1WDTA 1O2DA 2KLHA 4D8WA 5DHQA 2ZUSA 1GZ4A 4WTOA 2QPTA 1PGNA 3F9CA 3P5BA 4Q24A 1OGIA 1UQRA 3T5CA 1RXIA 1VQ1A 4PANA 1HZZC 2WR8A 3NNDA 4LYAA 5C80A 3WISA 4DY6A 2QN9A 5BR1A 3G7SA 3FVRA 3O7WA 2WD8A 2R1VA 1B0PA 5E6RB 2OM2A 1JA0A 3NM4A 2RJNA 3CRW1 4GI5A 4A5OA 2VNJA 1II0A 3GUHA 2B8NA 4IKOA 1VA5A 5K01A 3V32A 1SKMA 3V6MA 1CFZA 2BGNA 3FPKA 3PSAA 5EGSA 4M1MA 4ZJPA 5JIBA 2IUUA 3RC2A 1QE5A 2F4VB 2PMDA 2ZRIA 1YZKA 1LY1A 4AKIA 1KGSA 3G2NA 4WT7A 3NTXA 3U3XA 5A71A 5FUVA 1ZX1A 3WO0A 5LP6C 3R76A 1E9CA 4CUKA 3QPAA 1KMQA 4GOLD 1P0CA 3CKLA 5FADA 1QHGA 2G36A 3KOZA 2W58A 1LC3A 1NBAA 1JZTA 2I03A 3LNCA 3N6VA 3LW7A 1RYEA 1YI8A 1MENA 3ZY3A 4XDZA 1NATA 1Y1RA 5K3FB 4CLRB 5PNTA 1XZAA 2J30A 5DNVA 1EFVB 4RZ3A 2GO7A 4PGFA 4CUJA 1GG9A 4R84A 2PWPA 4KPFC 1IQRA 2OHHA 4Y7DA 1C7JA 1Y9DA 3PXEA 2HLHA 3UW3A 3WHIA 2NOAA 4DTCA 1E5DA 4LZJA 2WVHA 1V8BA 1U9IC 2GDJA 3RDPA 2JCBA 2OPBA 3BB3A 4RHTA 3RS8A 3HSKA 5I51A 4KHPB 1KC3A 4FLMA 4A36A 3WBJA 2GAIA 1T3SA 3DYIA 4JLDA 2C7PA 2HFJA 3QI2A 2CLCX 4XVRA 1L7NA 1MDFA 3JR3A 3L84A 4I0WB 3MTAA 3V1LA 4Z9YA 4RHXA 3FNFA 2QX6A 2QYTA 2LTAA 3C3DA 3C74A 3MPUA 5CHEA 3TQTA 3VUEA 5LWHA 3U7GA 2O59A 4CMHA 2HU8A 4MNTA 4L76A 1LZLA 5IKOA 4I9GA 2RD2A 1DWPA 1JH8A 3D5TA 3L0DA 3NG1A 5JSQA 1FTGA 5IM4F 2C58A 1G6OA 1T5TA 1V0JA 1NVUQ 1OGJA 1GEGA 3G2IA 5B6PA 1FW6A 2PMCA 1CIPA 4QSMA 3KQNA 3ONVA 3SGLA 2DOKA 1KI3A 5AKEA 3BM5A 4BBJA 1IUPA 2DGDA 1CU1A 1DFGA 3H87A 1Z17A 1E32A 2W2OA 1RADA 3EOZA 3RRYA 3VAAA 5BVHA 5BWLA 3OP1A 1JDUA 3DHVA 4AS2A 5DHRA 2IOFK 4YCLA 2OAEA 5ALYA 5IN4A 5AW7A 3LT2A 4IG4A 1BZYA 1N5OX 4UULA 2AOUA 1EVQA 2QQEA 2QRNA 5ALUA 2NU8B 4ID3A 2R96A 3VOSA 3WWEA 4DR1B 1ESMA 3L7KA 3TZEA 1W4AA 4LVCA 2A58A 3SZUA 1SFRA 2AG6A 4WJKB 1MVOA 5CIYA 2YASA 3E48A 5AUPB 1V2HE 1H4QA 3OZXA 2J5QA 3K4PA 1J97A 4ZQBA 4CL3A 2W6CX 2QVCA 4QX6A 3A9WA 3PKJA 4UNRA 4F38A 2ON6A 3FETA 3PXCX 3TSYA 2Q5OA 5K8CA 3ICEA 2PMBA 2ZTSA 5TX7A 4AECA 2C4UA 2HH9A 3G17A 5F9HA 4UHEA 2XCQA 2DPMA 4PY2A 4BNZA 4BV2A 2JJ1A 3KJFA 4N01A 3ZHYA 1KJZA 4YLEA 4LMRA 3ZU5A 3MGKA 1CYEA 3LBIA 4IZOA 4K87A 1U1EA 4HEQA 1SXHA 2EG5A 4OGGA 4RPKA 5FR2A 2J9FB 3V3TA 3ZXXA 1GTG1 5H8WA 2ZB2A 4CQMB 1FFDA 2BEVB 1M2OA 3L6BA 3PEUA 1K97A 1OF1A 4WZAA 4JC8A 4ZANA 1WCXA 2DLNA 4HLNA 4BO0A 1E9AA 3CF4G 2XMZA 5DVZA 3QFCA 3S5UA 3W5UA 3K1AB 1DAIA 5IDVA 4AN4A 1JDNA 2OC4A 4Q7KA 4II2A 3FE2A 4XDHA 2XY4A 3RC3A 5JASA 1YUNA 1V37A 4UCWA 1IC6A 2IU4A 2QZZA 5G0WA 3NGXA 3MS7A 4NZMA 2EKQA 3Q5GA 1W7AA 3ACBA 1MB9A 1SKYB 3WBKA 1FBTA 2PL9A 2BBWA 3HUTA 5K20A 5KKAA 4FE4A 4C4RA 2VBFA 1XHEA 5J1SB 4D98A 3OC6A 4GLFA 4NICA 2QJTA 4TXHA 4ZARA 1TO2E 3AJRA 4QEDA 4TQGA 4GMFA 1JYFA 2GARA 4F92B 2M1XA 5C8XA 5EHZA 3WGOA 5A5GA 3A1FA 3DQPA 1UBEA 2UYCA 4CT0A 1W85B 2Q3HA 4I66A 2QR2A 3RTDA 1HV8A 4AJOA 1K2WA 3IAHA 3HVIA 4EABA 4IIXA 2WOJA 4EFDA 1DOAA 1L5QA 1G20B 2GA9A 1E1MA 2ZJ2A 3GRRA 4ND4A 4DJAA 2O3RA 3F7NA 4KO2S 3CM0A 3NHSA 5AIAA 4JN6B 4YRSA 4EI7A 1EFCA 2QVZX 4MQUA 4CMGA 1UBGA 3EVFA 4S04A 1R4MA 3L0CA 1J07A 2X0RA 1G21A 5TMEA 4AZWA 1Q2XA 4D43A 1PNRA 1WTAA 1GV1A 2JIPA 3I83A 3PHIA 2BTOA 5EP1A 1SOWA 1AQYA 2QM3A 4GAEA 3MQ2A 5CT8A 3K0FB 5ERGB 3CH5A 1J70A 3Q6MA 2GZHA 1HFJA 1YO6A 2F3SA 3KALA 2Y4NA 3L8MA 3AUJB 1DG9A 3FWNA 1IY1A 5GINE 1XQ9A 1P3Y1 4PRKA 1U4OA 1KFCB 2UYOA 5LZ7A 2BFCB 4ZI2A 2AOUB 1D3AA 2FLKA 1NQWA 1XZKA 3I2KA 3RVLA 1I2ZA 2VWQA 5DBOA 3A6PC 5LQMA 3FN4A 3O4GA 4EZBA 1DEOA 4DANA 4P33A 3B52X 5FYQA 3R3UA 3RTEA 2HZ7A 4E3WA 1FVOA 1I4LD 1YVEI 1SWVA 2B61A 3N8DA 3REFA 4ENTA 3UXHA 3CO5A 5I45A 1QGAA 1TQ4A 1XQ6A 3MGAA 2AMVA 4W82A 5LBTA 4RD4A 1PV2A 3AZQA 2BMVA 2HQ1A 4CI9A 3W1VA 4GMHA 1KTVA 1K27A 1W52X 4OJQA 4R7ZA 4RV5A 4MJ3A 3RU3A 1UKAA 1PR2A 5BSEA 5DCWA 2AJ8A 3UH0A 3V7FA 3DMTC 4HN9A 3ZW8A 4CNBA 2WU4A 4RK4A 4AN1A 1NXWA 1XG5A 2I8AA 1OBOA 4XXHA 4HBZA 3GGOA 4QXRA 2AKEA 1E94E 2WA1A 2VJLA 3ZHTA 2W7TA 2LBPA 4MS3A 4XTRA 3BGDA 4U6SA 1JI0A 3DXXA 4KTVE 3PGA1 4NHOA 5DM2A 4YCSA 4JHLA 1BW9B 3WJ1A 5CA1A 4BJ5A 1DC5A 3OHSX 5BSMA 5LUAA 1WP9A 3C8MA 3AETA 5SZHB 1V6SA 1E3TA 3PLNA 3M6MD 4RVUA 4MMYB 2VOEA 4GX0A 1NDQA 5LJLA 5ALRA 4CLRA 1YZ3A 1VE5A 5F52A 1QUFA 1ZZEA 3OD5A 1QU3A 1SRRA 4Y98A 4IO1A 4O4IA 5CIWA 5ITWA 3A6DA 1RRFA 1WW8A 1SQFA 3LKZA 3PF8A 4B5KA 2P9TA 3MJFA 3B3QA 2IODA 1Y4SA 1NMSA 1GT6A 4Q02A 4XX1A 1JFSA 2ZTMA 2ONYA 3LFUA 2OO3A 2FWNA 4NOMA 5B3AA 2VHZA 3ILSA 4Z0NA 1U5BA 2ATCA 2NTEA 1C0PA 3P2EA 2OA0A 3Q3CA 2I8CA 4QPZA 4KVFA 2H65A 5AYVA 5EWLB 3OETA 5JZ9A 2XXJA 1PT7A 4B5LA 4ZI5A 4BKQA 2HX1A 1MABA 1FSGA 4WOCA 3DAHA 5CB6A 4H4EA 3VU3A 4YJ2A 3MHTA 3M3HA 1AKUA 3T7DA 3IHWA 4GPBA 1M1YB 4KZKA 4F46A 4TUYA 4Z53A 3M70A 5TVGA 1LSSA 3KUKA 3KR9A 3RTAA 2V4UA 3WLJA 4X00A 1WOMA 2JD1A 5A1JA 3IDZA 5I6DA 1EDBA 1E1NA 3RT7A 3O4RA 3MGBA 1J9ZA 4U8HA 2VTDA 4I50B 4YFYA 5EXDA 3SHWA 4OIMA 3HKDB 3T5DA 3QE9Y 4YCJA 3E7PA 3EWAA 3AIIA 3QVTA 1Y42X 1IN4A 3KNZA 4CT4B 4JBHA 1E7SA 4K6FA 1XNRB 4K9SA 3A1EA 4FYKA 1OLSB 2BGIA 2JCSA 2QAIA 4PLFA 4RZSA 4XLTA 2N1MA 1Q1NA 2EOAA 3EMKA 4HD8A 2JLRA 4KDFA 1Y9ZA 4N5DA 5DGIA 4DXDA 4Q1EA 1F8FA 4EW6A 2IF2A 1Y9AA 5CITA 5BWOA 3IDQA 4G24A 2F8TA 2FN8A 1RWVA 4CVNA 4NENA 4LBZA 4NCIA 1EJBA 1CIVA 2XYHA 3H1EA 1Q0TA 3PEFA 5EIBC 4KYVA 1PJCA 3CU5A 5DLYA 4DXHA 3PC7A 2WIBA 3EVEA 1UBJS 2ORVA 3G79A 4JBLA 2ZB7A 2Q7DA 4DA0A 3H9BA 2P2GA 4HVCA 2OHVA 2VCHA 2Z83A 3VU9A 2WIKA 2GM5A 3U1BA 4R31A 4A2PA 4YMVA 1I5EA 1AS3A 1P6UA 2R00C 4MV5A 1V9CA 4ZHQA 4MS1B 2P3LA 3CZ4A 1TIKA 5DGCA 4Z1MA 4WZ6A 3S3TA 4ARVA 3IT0A 2DVMA 4N9QA 2XDAA 2YRWA 4YWHA 1WE2A 1RLJA 2IS2A 4LNAA 4A2CA 4GPD1 2DH6A 2H4HA 5LQDA 4B6QA 5JS8A 2UYQA 2H1SA 2FSGA 3FNGA 1A5TA 2VVTA 1UWCA 4WWHA 5AK4A 5TPWA 1ZI6A 1NQAO 1PZEA 1EP2B 2GKSA 1SQ6A 2PANA 4GW3A 3C3CA 4PZ9A 4XLLA 5EAIA 5EHNA 5HF8A 3TK1A 3ESBA 3GCWA 3DPIA 2PX3A 4HDRB 2C20A 4LXQA 4Y2RA 4TTIA 4C4SA 3LTEA 3H1BA 3B5EA 1H6DA 5BPFA 4G0UA 3OWXA 4JLPA 2VOJA 1AG9A 1RWMA 1P4JA 3C3KA 2DQSA 3FB1A 4L5IA 3RSHA 1U02A 4X1YA 2HRZA 5L3ZA 2BTQA 5LQKA 1C2TA 4JV5B 1W49A 1GITA 2CJXA 2SICE 4HO1X 4DRXA 3TLZA 4P22A 3OURA 1Z45A 1I4OA 3B6KA 3DOFA 2JI9A 4JBYA 1V4BA 4PBSA 5AHWA 5J59A 1NLYA 1SA0A 2WKQA 4PPYA 1NE2A 1AKWA 2QSJA 1QP7A 4OHZA 3WLIA 3MBIA 4DBLC 5I9LA 1E2PA 5JDCA 3AR8A 1P8JA 3CF0A 2IY8A 2BCEA 3BS4A 1C80A 1RAFA 1RKQA 2HPZA 4V3CA 4Y6OA 4KIFA 2Q4EA 1YH3A 4PV7A 4RENA 1W85A 2CXXA 4G25A 4TLAA 3QA9A 4YBRA 3WHPA 3X43A 3KL2A 3GFPA 2X5NA 4FZVA 3LJKA 1C9JA 1M2JA 1YRQA 3SEQA 1IBKB 3QU7A 4CW7A 2H1OA 3J7AC 2DECA 4R8VA 4N3AA 3E4CA 3ZWXA 1C7IA 3RRFA 1ZD5A 1C2YA 1AY0A 4Y2QA 1TTPB 3JAWB 3U3MA 3WWCA 4PCUA 4OXQA 3RSLA 2ZRFA 4UVDA 1MA3A 1VIVA 2C5BA 2YW2A 1E8NA 2ZAYA 3OLWA 5FFFA 4YYZA 2PIAA 2GN9A 2HSWA 2VUHB 1N6HA 3GD7A 1PFWA 2Q6LA 2B4RO 1G8GA 1XDUA 4W8OA 4WFJA 4K40A 3RS3A 2GN2A 4EATA 5BT8A 5JH7F 1Y0BA 2UYHA 4YBZA 1VMKA 1HMYA 5HEKA 1NVMB 2ZUTA 4URFA 1JS1X 3EG9A 3FHJA 5CB4B 4YMGA 1Z0ZA 1USUA 5ERXA 2VSXA 1M75A 3I3OA 1JR6A 4P7GA 1FFCA 1V39A 1SXJC 3ICOA 5ITZB 5TV2A 1KI9A 4YCCA 1V7PC 4QA9A 5J2UF 5A5FA 4C7OA 1CUIA 1ORHA 2KMLA 2EKLA 5CMLA 2RGAA 5BP7A 3EYAA 4JYPA 4EVSA 1L7QA 4GI2A 1L4EA 5I7RA 1UK8A 5KYWB 2BBSA 3QYJA 2H1WA 2C5HA 3CLVA 2Y1OA 1FJXA 2EQ5A 5EJGA 2H2WA 16PKA 4JCCA 1JX6A 2DHEA 2UZ1B 3MVEA 1YMQA 4G1CA 2XNKA 2ANCA 1RYFA 2J85A 2FUCA 3KPVA 5D3MA 1OC2A 2QTZA 1RWBA 5LA6A 2EERA 2Q41A 4D46A 2R87A 4D9CA 4DA8A 3OZSA 5AHOA 3IQGX 1KPGA 1CUEA 4I9NA 1DBVO 3UWOA 4RPJA 2ACVA 5M29A 3LUHA 2Z9BA 1CY0A 3NOQA 4OFBA 4QQ8A 1DMRA 1HF3A 4NFLA 5KVSA 1N5DA 4DMCA 3T7AA 4MW9A 4JDUA 4FDUA 3U4CA 5JEDA 2XTNA 3BMXA 4IIFA 1R0KA 1TZJA 4NCKA 2XBUA 3L02A 4RNDB 2VJMA 3PTZA 3TBHA 2PXCA 1VLLA 4G1BA 1Z5VA 4YY3B 1C1XB 4WADA 2O23A 4DB4A 3HB0A 4PFSA 4WECA 1KQFA 4OB8A 1NVTA 2HA0A 1C9NA 1L4BA 2P77A 1A8HA 1X3LA 3UC5A 1TVKA 3WQRA 1QORA 3I58A 1VG8A 2QP9X 4HDQB 1XTUA 5JFGA 3KT0A 3OCCA 1KYTA 2HLNA 2FPWA 4N7JA 2OXTA 3OZRA 2C2YA 3C3WA 3PNBA 4MI3A 2Z57A 5EJ2A 4PRYA 3ZV7A 3SS9X 4F7WA 3QE3A 1PSZA 2GAOA 3SC2B 4D0GA 4I6GA 4R41A 1ZP6A 4W6ZA 3N8GA 5GZ1A 3TMKA 4MR7A 4JT8A 2PL5A 5KTOA 5K2OA 2FPGB 2NN3C 2OBFA 3HKEA 1W4BA 1U2QA 1VI5A 4X1IB 5ES4B 3MINB 4EKEA 3L8YA 4AKEA 4BNMA 5JQGF 1GLNA 2AHRA 2ZUUA 1H1DA 3H1FA 2WY2D 1RZRA 1IBCA 3W7BA 1IHYA 3IDFA 3EGIA 1CUBA 1UKZA 4UARA 3W79A 1M34E 5HF9A 1CJKC 3EISA 2FRVA 5DLPA 2Y1KA 3AOEA 4JBWA 1M66A 2EG9A 4DBVO 4NMMA 3G8DA 5E6SB 4G5SA 2Z5GA 2G5GX 1PJ2A 3CMMA 2G4VA 4XX0B 5FHQA 2IPMA 1YCDA 4Z3DA 1GXSA 4DMLA 5A2QA 3U60B 2WD9A 2GSDA 5DYTA 1U8ZA 4NTZA 1SRQA 3BFPA 1YF3A 4LK3A 2GPWA 1QCCA 2IITA 1G5FA 2OHXA 1NUHA 1YHNA 1YS2X 2IXTA 2Q29A 4E5NA 1TC1A 3WL7A 1EINA 1I3CA 2J7KA 1CX9B 3OFVA 3GEMA 4IICA 4QUIA 4IMRA 3M6AA 4YHBA 4AMGA 2XEXA 3WZMA 5BQFA 2VSNA 4Y1EA 3ELYA 3UWSA 4A0GA 1DT3A 4UASA 4ZREA 4DMFA 5JXJA 3W8DA 1C8KA 3OPVA 3A37A 4H1VA 3HO6A 1JDVA 3OJEA 4HRVA 4BUJA 1GSOA 2WIJA 4F96A 2O19A 2DU8A 3R40A 4PGMA 4V3BA 4GX5A 4G5YA 5JPCA 1N8TA 2VUIB 3FVVA 3ME5A 1T8PA 1VZ3A 4JVOA 2RJ3A 4TSKA 2I6TA 5JQWA 4XQ0A 2QRPA 2QMEA 1IQPA 4RA6A 5LVAA 1UBKS 2F3UA 3QXCA 4R69A 5EA2A 4MHTA 3IIKA 1RJGA 3BL5A 2VA8A 4B09A 5KKCA 1KYXA 3O47A 2Y71A 3RYIA 3UTDA 3P2YA 3QF4A 3LPCA 4CDRA 5HJ2A 4KQ1A 3ZBTA 4XJTA 2ES4A 2V55B 5F21A 3G1UA 2ZCVA 1UL1X 3COWA 3CE6A 4LZNA 3ZU2A 3CVXA 2QLJA 4JOBA 1FJHA 4TLCA 2W6ZA 4H1UA 4MUIA 4UVEA 4KQCA 3W2EA 3WLFA 2BSAA 4PTYA 5H3LA 3AERB 4EHNA 4KE8A 1GA6A 3EULA 1S3FA 2D5IA 2RC6A 2Z2IA 1TU0A 1WXQA 4MPRA 4PXYA 2Z6AA 1PDVA 2MMCA 1QYWA 4QRHA 1FX1A 1UMDA 2C8VA 1JPNA 2OQIA 1KBZA 1CVRA 3KETA 1RE0A 2TYSB 4DV3B 1JKMA 1X13A 3IGFA 2QPOA 1YWGO 4FFVA 4TXNA 1KQPA 2L19A 3A9VA 1FYFA 4MI1A 4X20A 4RSHA 1DAEA 4EJSC 5JY6A 2HU2A 3QOXA 1XD8A 3QFTA 4R2WA 3LU1A 1FU8A 2YJ3A 2P6UA 2QWXA 4B3IA 1NONA 4L2IA 3QNWA 3MGCA 5IUNC 3AM5A 3NATA 1NM5C 3P0FA 2JASA 3TKAA 1Z4JA 3GWGA 2HIHA 4QO7A 4WPGA 1UPBA 2JPDA 3PWZA 4TVOA 5AWFC 5F7JA 4CR8A 4MQBA 4JITA 3C3EA 1BWQA 2BGMA 4OQYA 5LBIA 4LDRA 3WK7A 1OX4B 4CF4A 1G2QA 5HUQA 4P31A 1B76A 5EUMA 4PG8A 1F14A 5GV8A 5JE8A 5T3YA 1FFGA 3CLRC 4UVIA 1EXMA 4UFOA 1ZK2A 3ND7A 5AM5A 1OBFO 2DB3A 4IHAA 3ZE8A 3K32A 3TIIA 1JHQA 1XWIA 3Q11A 1VGQA 5K1ZA 5FI1B 2BFCA 4DV1B 2VQ6A 1KBQA 2CJPA 3FYCA 3GLFA 1RI2A 2O0MA 3G5MA 3LUAA 3O8DA 5EKTA 2CNBA 2R4TA 3ZVRA 1X7DA 1Z82A 3GLHB 2H1HA 1K5GA 4L8VA 4XJXA 4PU0A 1ADFA 1VIMA 1I7PA 2H4FA 2OEPA 4FM9A 3CZQA 3ESAA 3GV0A 3NXSA 4QJBA 3HPQA 2Z3ZA 5JYBA 1H2BA 2VXCA 1IG0A 2IX9A 2XJ4A 1TJ4A 1QWOA 3E4DA 4TS1A 2J45A 4JLVA 2I3ZA 5EHIA 3GJ5A 4RSGA 4NYJQ 1PYDA 2YR0A 3JATB 1L8QA 4YJ3A 2AXPA 2R8ZA 1II8B 2XCSB 1T4CB 2BMJA 4ZOCA 1QGUA 2RCYA 2ZE5A 3UMSA 3FFTA 1JXAA 3K09C 5K8LA 2VEDA 1WIWA 1NU6A 3JQ8B 2V7WA 3OOSA 4JBXA 5F5XA 3TI9A 4OX9B 5IHXA 1FYEA 2F62A 2I6FA 1Z88A 2II6A 3MIZA 2A5FA 2QJRA 4GLLA 2PKCA 3ZH9B 4CN9A 4JXXA 3BT7A 4EH1A 1GUYA 3ORSA 1GRRA 1ZH4A 1A4RA 2CEKA 4FS3A 2BV3A 3WGZA 3K9QO 4QFCA 1Q1GA 4RZXA 3WSTA 2G88A 1WV0A 5IK2A 4OA8A 4YUYA 1AXEA 2DTXA 3R0QA 1AXRA 1KYVA 4WA8A 1OLXA 3B9QA 4ZI7B 2NYUA 3IAM6 3IPLA 4JJ4A 4UAGA 2PBFA 1CY2A 4GKAA 4M3NA 4A8PA 1YGYA 2A94A 3UJNA 1WHTA 4BNDA 1L6IA 2GGSA 2VT2A 4XQ9A 4BZZA 3S28A 1TIPA 4I81A 3GBPA 3EPRA 3M6WA 4DZRA 2YWXA 4EA9A 2GAJA 2JI6A 4HB3A 1YKSA 1V95A 1NWHA 1E9VA 2H2IA 2H8GA 3NP7A 1D09A 3QELA 1K89A 4OUKX 4OYYA 1NRWA 2QUJA 4MGZR 5DNWA 1ISPA 3V4RA 1F8YA 3VKGA 5AK6A 1SBTA 3AG6A 4NH0A 2XNHA 3VH1A 2PU5A 2WKWA 1RHRA 2JCXA 1VLMA 4GM1A 4L95C 3AEUB 3QJGA 3R7WA 3VYWA 4AZ0B 3ZHQA 1XF1A 1NOJA 4PBRA 3I0NA 4RXMA 3ZV4A 4DR7B 4QUGA 1I8TA 2P2ZA 4WK0B 3QLVA 4WAUA 2AGVA 4GVPA 4MMZB 4ZV9A 2CYAA 2DCMA 2GEUA 2X3FA 3P9XA 4CL0A 4NEQA 1FA9A 1W96A 4OVKA 2WIGA 4DZZA 3A2NA 3C3AA 5HJ5A 1PFQA 5EWMB 5HOEA 1LPBB 3WL5A 4IMIB 2GEJA 4B79A 4DBZA 3Q1LA 5FUWA 3CZ9A 3W5HA 2C29D 4O25A 5E1OA 3N7AA 1EVLA 5JJBA 1RRCA 1KMHA 1LPSA 2RIPA 1RLUA 5CYFA 1XTQA 1M0SA 3WYCA 1UWKA 4AZTA 3CURA 1RI4A 3C6YA 4OFZA 1EVYA 1FMJA 3COJA 1UFVA 1NXQA 4QG7A 3Q85A 4Y6QA 5LPNA 4EYKA 2ZVDA 1WS6A 4V38A 4WOBA 2DFVA 4PZZA 3V00A 1DE0A 2G83A 3A6ZA 3K16A 3N5CA 2FPLA 4BIMA 4KXFB 4O8ZA 4HVAA 1CRQA 1KJJA 2YJ6A 2OV2A 3KXPA 4AQ7A 1ESEA 4UNQA 5K51A 2O0KA 1OU0A 2WNSA 3HJGA 3OCWA 2PGLA 3DB2A 1LDBA 3USES 4MPPA 1HYHA 2I0FA 4HWTA 4QOIA 2V96A 4BNTA 1XZGA 2HW8A 4JBGA 5EGNA 5GWXA 4YMWA 3COZA 4GM4A 2CNLA 3BYZA 4YRAA 3HSSA 2K7FA 2FJ0A 1EFVA 2RMKA 1GEEA 3EFHA 3GXBA 1NBME 1D5CA 5E8RA 2NPFA 2EV9A 1DBRA 1WW3A 5IUJC 2PUEA 2C2GA 4CM7A 5A3QA 1OLUB 3KWFA 1XELA 3LHDA 1AD2A 1K7SN 2AH5A 4G56A 3GEPA 4G5OA 4IUBS 4PLZA 3KQUA 1QHIA 2I2XB 2I8LA 4MIYA 1AKNA 1W93A 3MTBA 4X84A 4DG5A 1KKLA 1OX6A 3ZN2A 1C8BA 4QELA 5EIAA 5EP2A 3D7RA 4BWGA 3LIIA 1G291 3FAZA 2D54A 1U94A 2YWJA 5ES3A 4QIHA 1ZSNA 3BK1A 4FCVA 5I8WA 3D8HA 4MB2A 1JF8A 1ZA1A 3X0DA 2PUAA 3BH7A 1OZ0A 3W3AD 1X94A 2PX0A 5EXSA 3TFQA 2ZI9A 3ZNQA 4LXIA 4CCWA 5IKMA 4HFRA 2CV0A 5F23A 3H4IA 4CF5A 3W3ZB 4L5AA 1I3MA 2A0UA 2D5CA 3FTDA 1QNFA 1Q3TA 3LF2A 3PVCA 2NTVA 4PPFA 5LLSA 5AW3A 4BPBA 2UUAB 2YH2A 2WF7A 2YHIA 1J56A 1BIFA 1VB5A 1KXZA 2PNFA 4B44A 2IEZA 4WA7A 1EXDA 4P7BA 1BHJA 1RXSA 1R9MA 2P6MA 3F98A 1PQUA 1XZDA 2W2MA 5BQOA 3CC8A 1I1OA 1SD2A 1TRHA 3LUJA 3EW7A 5JJIA 5I7VA 3SZRA 2A3NA 3W5DA 4MGEA 3ICWA 2BJWA 5CK5A 4C4TA 1VSBA 2LKDA 4H0CA 2MIIA 2OBBA 2BH2A 2XWPA 3MUEA 4M36A 4Q39A 3MLBA 5GONF 2J3KA 4BWVA 1J23A 1NN0A 2ODPA 3A1SA 3NT4A 5G0UA 2XTZA 1IHOA 2ZYGA 2PRSA 3CW8X 3ETEA 4NJMA 5IP5A 3CW2A 1VXOA 2XUZA 2ZRKA 2I1QA 3CVOA 4DMGA 4YT8A 3EXFB 5BT9A 2C8KA 2VHXA 2WFLA 3IH5A 1EZZA 5AI0A 4A03A 4FX5A 4O3MA 4Y2PA 2FDXA 3EG5A 4YIHA 2DERA 3ERCA 2WDPA 3DWFA 1PVVA 3DPUA 1ZGZA 3GA0A 4IG9A 4RTJA 5ALPA 3E1GA 4OI2A 1P2BA 2HDNB 4LDAA 4MP8A 1MA0A 3VHRA 3ZWQA 1N77A 4MDYA 3WYAA 4AWAA 1OBCA 1QK4A 3FCXA 5EHXA 1RPAA 2E37A 2ZUCA 3FTPA 3BZWA 3HBLA 2HXYA 2V97A 4ND2A 4PAGA 2CNNA 4WLNA 2AOTB 4K3VA 1GPYA 2QUKA 2ZYTX 1Z0UA 1ODLA 2IZ1A 4RANA 2Y0PA 1GN9A 1F2UA 3V7WA 1LX6A 1MF7A 5HHTA 1H85A 1IZ0A 3GN1A 4EBBA 4LHYA 5EXXA 3TM5A 4BECA 5CCEA 5JVDA 5J4YA 4PYMA 1BKDR 5HBGA 3GEDA 5JZOA 2HAEA 3B1KA 1AKYA 1RAAA 3DJFA 4JENA 1VG0B 3VFDA 3ANTA 2VZEA 1MRZA 3HJRA 1A5ZA 1G18A 4LGYA 1DO8A 3TE7A 1T9BA 3MT8A 1C3JA 1C1DA 4AJIA 2QTMA 4IUDS 3NJRA 4KX5A 4PG4A 1N5JA 4X6LA 1U6KA 2JCGA 2VTVA 2RI6A 2WPNA 3ZEAA 1QV6A 1AO0A 4MLZA 1Y8ZA 3KQKA 2Y76A 4K9LA 1P7VA 5DE3A 3V1YA 1PWEA 1RAIA 1Y7IA 2ADFA 4OM7A 3ZZMA 4KN8A 2H0QA 2G9RA 3L8CA 3UOAB 2VEOA 3ZKWB 1CHNA 4IDCA 4MVJD 3SJCA 5F77A 2JDIA 2JIBA 5BMVB 3P0IA 2H92A 2EX1A 4RTPA 1E0DA 3ISVA 1N75A 2VNSA 4XPIA 4NULA 4AZSA 4F6RA 4B3TB 4TRJA 4WE3A 2IHVA 3B70A 3GEGA 1NW8A 4IV5A 3VPFA 3ZK9A 2A6PA 4Z4HA 3K6SA 3EE6A 1WDWB 3BQNB 3K8OE 4CI0B 4MR8B 2WWTA 3NORA 2V58A 4DIMA 4FJ2A 1DHTA 2O1WA 2TECE 1AGYA 3MOIA 3OOJA 1E7WA 1CUAA 1WW2A 1UBTS 3JYPA 4RJKA 3E5HA 1P81A 1A5BB 3QRWA 4JLKA 2WWWA 1T2CA 1W0KD 3PQ5A 1ZIPA 3S1AB 2VJAA 3U62A 4D9BA 5L7WA 3BL8A 3H7IA 4A0QA 1H6CA 2WU8A 4IBOA 4I19A 2DKOA 4I9FA 3ZV5A 5FBHA 2V6FA 3E81A 3NZEA 5A05A 1P60A 5AP9A 4GZLA 2O48X 1ACMA 1EZ4A 1Z4LA 3OZVA 1PT6A 3ON5A 3ZVNA 2AQ8A 3CSSA 3WHLA 2BHNA 4UTVA 2GPSA 1NUAA 4DDVA 2ZRJA 1Z28A 3FOCA 3OCYA 2JFFA 1IM2A 1KFEB 2G7ZA 2VRNA 4DWOA 1ZN7A 1QRDA 2FP3A 3CHYA 2QN2A 2B2CA 2CLDX 1F5SA 1FUKA 3I30X 3SZMA 3M2PA 5ENZA 4JVNA 1XTSA 1KOLA 1U7HA 2FQXA 3RS0A 4ALIA 3L92A 4P3YA 1RLTA 3ZHSA 4YUXA 2R47A 2JLUA 3DFUA 4RPHA 1HDZA 2JLAA 4LOKA 5DO9A 3VSCA 5GJBA 4FC6A 1U8XX 1V1JA 3ONNA 3CW9A 3ILXA 3WI7A 5EVCA 3WK4A 5FUMA 5HIIA 1QO7A 1TJ5A 4OK5A 5C7LO 1F7VA 4G63A 3UBTA 3KPJA 3OM9A 1Z16A 4KO3S 2AMFA 1OI7A 2XLCA 5JD6A 1L9XA 1IJKA 4CGYA 5U1PA 1D0SA 4LXHA 2NZ8A 2BYTA 2VN8A 2WRZA 5D3ZA 1Y4UA 2HGSA 4HNQA 1LEHA 1WZUA 3ZBQA 1QV9A 2JBHA 3LQ1A 4X7MA 5G41A 1NYQA 1ODCA 5JNVA 1O94A 2Q3MA 2M2IA 1AGNA 2M6LA 3UMJA 1ISSA 1C7EA 3CZAA 4XCVA 3ILHA 5COBA 1YDMA 3NUZA 4D2IA 1SEVA 3S70A 3W9YA 4II7A 1Y9EA 4G9EA 1DKPA 1UBNA 1QF9A 3WZLA 1JNXX 1Y1SA 1I6KA 3O82A 4B7UA 1YIDA 3SQXA 3I04M 3OX2A 4D9KA 4EY5A 4QC2A 5LKRA 3N2LA 3PWSA 4GBMA 2IE8A 2EW8A 4J0HA 3T95A 4R2HA 2WAOA 2JGEA 2JCYA 3MMPA 4F9FA 4B2YA 3W90A 1ZLXA 1GL7A 3T4EA 4AY3A 5FL7D 2PO5A 1JFVA 3IYLW 4RCYA 4MOWA 5CW1A 9MHTA 3RVPA 1NG9A 3H11B 1OXBB 2VTKA 5A3RA 2FOXA 3JQGA 1Q91A 1M8JA 1VDMA 4QDZA 1IOLA 2B34A 2XQIA 5LYYA 1UUFA 1F0YA 2QGNA 5KDDA 2VIIA 3Q98A 1W25A 3GLIE 3I42A 3CGGA 4IGAA 5KNCD 3C70A 2MSDB 2AB0A 2JIMA 1JBKA 2EFJA 3DZBA 3QVMA 3QYAA 4G4SP 1BFUA 4I50A 1VHDA 3I6MA 4IO0A 3W4JA 1UT6A 1XKLA 2JG3A 1OXKB 3LUDA 1EGAA 2IP1A 3WG9A 4MVJM 4BE9A 3L8ZA 5AJHA 5A06A 1AVTA 3MWDB 1U8UA 1PWZA 3E18A 4HBGA 5DOZA 3HKDA 4EQ6B 3PTAA 4HS4A 1QIKA 1VKOA 2XHZA 4OQFA 3GUVA 1ISRA 1FUUA 1IATA 1HDCA 2CNDA 2XR1A 1O97D 4G1FA 4WKOA 3RCBA 1O6BA 4KGVA 4QWWA 1CRZA 4DLKA 3SQLA 1XRMA 2G8LA 1T6ZA 1KQ3A 4MLDA 5AOVA 5GMOA 4EI2A 3AESB 2X76A 2OECA 1ZD8A 2EP7A 3X1WA 1RIIA 2WWHA 1AKVA 1C5KA 3PDCA 4UBNA 3R9KA 1RQ2A 4MINA 2F6RA 1T35A 3FPFA 2HF2A 4GEKA 4LKOA 4AF6A 5JEEA 3SR3A 5E6SA 2Q5QA 4BMDA 2FJUA 1DQRA 2Q6KA 2P7HA 4XUEA 1FK8A 1T4DA 3ZE6A 1U90A 2XITA 4IIJA 1OFVA 4Y2UA 1PKEA 1C29B 1OW3B 3HB7A 4WZBA 2J3IA 3GK3A 1I7DA 1TLTA 3F97A 2B4KA 4PSAA 1F17A 2C3MA 4RKEA 1GTJ1 1B2RA 1H3FA 3D6FA 4K6MA 5HFJA 4EY3A 3CXRA 5DHAA 5K0FA 4Q18A 2C7QA 1MJHA 1IBMB 4X1IA 4PIMA 3BK7A 3L9WA 4P1ZA 2FEAA 3PVZA 1EMDA 2YMLA 5EQJB 3RIXA 3RJ9A 2PQ6A 1DOZA 2GPTA 2OORA 1RYHA 2FR8C 2OM6A 1Y5NA 3AI3A 2HBRA 3KQHA 4IDHA 3ZK7A 3ZIAD 5FWDA 3F6CA 2GEFA 1BXKA 1PTJA 3STXA 3N1UA 4PYJA 3QENA 4L78A 4QYSA 1TMKA 1N8SA 3TIFA 1DDGA 4DYHA 1L4GA 3VNVA 2H31A 2EKDA 2IQ5A 2X7XA 4TT8A 4KIJA 1QFXA 3A27A 3CNOA 1IWPB 1E79A 5LA6B 1B6SA 5ECGC 1ECPA 1H2XA 3ELDA 1Z83A 4GPAA 6REQB 5FLXA 3EDMA 1EAYA 2AD1A 3NV7A 1JG2A 2UZ1A 1U1CA 3ICVA 5H4HA 3ZCQA 1X80B 2HIAA 1KERA 3IUQA 1A98A 3QLUA 3SJBA 3T1OA 3ZWMA 2ZWAA 1W581 3O4HA 2E48A 2CJFA 4FGWA 4QUJA 4TSFA 4KFRA 4RHEA 2ATEA 4IJ5A 1MJ5A 1ZWLA 2ZQ5A 4FDLA 3JD1A 4GL2A 1NJFA 3H1TA 3KHKA 2FQ1A 3OF2A 1XWWA 2WJVA 5IPFA 5MN5A 5TLSA 1K5HA 2DPXA 1MRSA 2XMSA 2YWHA 4P7FA 3SHFA 1QTQA 4NCXA 4UHDA 4M38A 4M9ZA 1O77A 1W36B 4IMJB 3PDJA 4QPDA 4CTJA 3H9UA 4FW9A 3UATA 3JZAA 3ZNPA 5FF9A 2D74A 3O75A 1C9DB 3BOSA 1MOSA 2DKFA 2VPPA 5DYNA 3R3JA 5DB4A 5ALMA 2JVKA 4HFJA 3S81A 2XDWA 3PFNA 2FZGA 1UP7A 4E1VA 3CKMA 1WOYA 1DWUA 4PVCA 3GAZA 2JEZA 2YUIA 3EZYA 4RVSA 2YVKA 1PTKA 5C46F 5K4HA 1ZIXA 2I34A 4QNRA 2WPDA 4MULA 5FFMA 3KJIA 3FFAA 4R16A 2V5UA 3MCWA 1R7RA 2R6ZA 4R5MA 3UK2A 3ZBUA 3KXIA 2NXNA 4C4OA 3EIQA 4LTNA 1QHFA 4TT3D 1RRKA 3F8WA 4I3FA 2BELA 2HSDA 1RVDA 2ZRBA 3RK0A 3T3PB 1BC5A 3KELA 3CUUA 2I6XA 2ZJBA 2VZ8A 4OLFA 1UH5A 4DHEA 4EAQA 2H63A 3PFHA 3A3PA 1A96A 1YRAA 3VR2A 3OLZA 2GHQA 1Y7HA 4E09A 4P4SA 2AUNA 3HHEA 1IPEA 2RHJA 5TF4A 4J0IA 5H3HA 3JZIA 4C4XA 4KRFA 2BEVA 4TL6A 4BTEA 4EHIA 5H4GA 3FTQA 2O0HA 1CZHA 4OUDA 3ZVKA 4BFUA 1W36D 3V8VA 4YAKA 4BB6A 4MQ6A 3DOIA 4DIOA 2GTHA 3O7MA 3UGJA 2X8JB 3UAGA 4JH0A 1AT1A 1DTSA 1UANA 4MITA 4CM1A 1LNZA 1QZ3A 2KSQA 1FYVA 2WHXA 3ENKA 1QG0A 3FCEA 2FWMX 3O94A 3PQ6A 3S2SA 3IT1A 1WP4A 2AYXA 4K6HA 4E5VA 1HL7A 5A4AA 3SPXA 1JHZA 2EIXA 4MRSA 3WGNA 3ZD9A 2YWRA 1L1EA 1VSVA 2WQZA 2ZLBA 5D1NA 4EB6B 3WIVA 2H1FA 2WQ6A 4M8KA 2G17A 3VVCA 2OO7A 4JT2A 3DLTA 3TW6A 1LB1B 1K92A 1HDXA 3QWFA 2BZ1A 3PD0A 1HTWA 1XVLA 3EXEA 1KEVA 1RD4A 2BRUC 2J59A 3M7IA 2J9FA 4V0KA 4FZRA 1A9YA 2HK6A 3LT5A 4JR1A 4TV8F 3BGWA 1BMTA 1YACA 5E4JA 2YXNA 4FX2A 3WHKA 3RS4A 4UOQA 3SVLA 3WKAA 1OILA 3HA7A 4Z0PA 1KP2A 3D02A 3VO8A 4M88A 5B3LA 3ET5A 5EWJA 4K0RA 3TWOA 4M6WB 1ZNQO 1Z12A 2QL5A 4B87A 1TT5B 1DAOA 5L4LA 2O2ZA 1S02A 3WMWA 1YBHA 5T67A 5KWEA 1O0BA 2W83A 1QAOA 3AW8A 3LPDA 2JLWA 4CR6A 2QJWA 3TUIC 2C4TA 1XMIA 3K3PA 4C43A 1ZR4A 3IKMB 5I3ZA 4NBSA 4ZVRA 2A5LA 4LDZA 1UBCA 1PIWA 3LV8A 3PX7A 3KD2A 1GNQA 4IHKA 1YZUA 2EW2A 4LX8A 3IHKA 1VZ2A 3AUSA 4Q4JA 4IUYA 2EXXA 4TKLA 4V0ME 5KYXB 5DISB 3NTQA 6PFKA 3W2IA 2RGCA 3W4KA 3GUYA 1WX1A 2D8AA 4QTXA 1LFAA 3V1NA 4JJAA 2TMGA 4MPTA 4M1KA 1Z6GA 4KQXA 1Y1PA 1NXSA 3D4IA 2J09A 4B85A 3QUQA 3R0JA 5KHOC 4X1OA 3G8AA 4LCJA 4ZT7A 3M9LA 1KE2A 5IULC 1Y8CA 2P4SA 4LQDA 4P4UA 2FX2A 3IXQA 4FTWA 3HBNA 1SK9A 3WK8A 4N18A 4Y3UA 1KOGA 4P82A 1NGSA 1LSJA 3HCFA 2OP1A 3UC9A 1WM1A 2QE7A 4X5OA 4CDMA 3NCHA 3MWJA 1EGVB 5K6TA 4CL2A 3AKZA 2PZFA 1L5SA 1EP9A 3NHWA 3B6JA 1X8XA 2V0CA 1J6UA 3BE5A 4BAGA 4EHBA 1SD1A 3B7PA 3WGTA 2OORC 3TGLA 4MSUA 2BTEA 2BI7A 4KDEA 2Z09A 5G0TA 3HRIA 2AZMA 5AK0A 2ZE6A 5ALSA 1AGXA 3OZUA 4KTTE 2C0PA 3RYIB 3P2OA 1LI7A 4REMA 2WKPA 2A1TR 3RAFC 2DUJA 4ZA2A 2YRFA 4W5JA 2X4IA 2V9ZA 3ZZ1A 1PBTA 1MABB 1U80A 2Q3CA 3B48A 4UZEA 4D96A 1TCUA 1G7SA 2DM6A 2VHQA 1PEYA 1QYIA 3BXXA 3Q3JB 3UOGA 2HT1A 3PHJA 3QE4A 2CSUA 1TD9A 5KYNA 1P5HA 5IKPA 2F3PA 1L8AA 2C9MA 4OBEA 4BKUA 5HJEA 4J9UE 1D5WA 3GUCA 1L1RA 1TQHA 2E1PA 5F12A 2VSFA 3N59A 3VR5D 3WBFA 1ZNYA 2PGAA 1CQWA 1FRZA 2BHSA 1NKTA 2VYNA 2Z56A 3EXHC 3I1FA 4I4NA 1YFLA 4DHWA 1MB3A 3HH8A 2P75A 4RD6A 4D82A 4O4IB 1VTKA 1KAQA 1JALA 5AJYA 3BREA 3QV2A 5IJ0A 4FYXA 3NNSA 4LYDA 3M5DA 5IUKC 4YCDA 3DF7A 3D6NB 1DPGA 2XSZD 4Y9SA 2PRZA 2BKEA 4Q6WA 1XCGB 4Y0AA 3TKYA 1GUAA 4GBJA 5KJ6A 3GIDA 5CXSA 2Y66A 2BN4A 2ZJ1A 3DP7A 1E62A 1GVHA 3MJTA 5BQ3A 1R8SA 3KJXA 4X1KB 5B3KA 3EQ8A 2C4WA 4KLNA 1LGYA 1AOXA 2GEKA 3DDNA 1EK2A 1XQWA 1YIOA 1R8YA 1L1QA 1YR7A 1Z34A 3SYMA 3WLPA 1BXRA 4I1OA 4Y1RB 4BFCA 3E5NA 3JAMA 4MARA 2NYVA 1ZJWA 3DLBA 3KKMA 1OU4A 4DCTA 1WHSA 3L7LA 1RM5A 1HG1A 1A5SB 2GKOA 1A88A 1K3TA 1XQYA 4MZXA 3LHKA 3HA3A 5IDWA 1I2BA 1QXSA 3W6ZA 4ZYUA 1GARA 2QBYB 1KAEA 3V7YA 5DX8A 2XQVA 3N0TA 2NZJA 2JLCA 5KMGA 4CG0A 2YV4A 4BFYA 4GSKA 2NVOA 4BTLA 1SVKA 4BLOA 4EBFA 2HBZA 6CHYA 1AHPA 1SZPA 3TGPA 1DTWB 2LD4A 2O14A 1QQTA 3EHDA 1L7XA 1T9AA 1OAOC 4ISBA 3IEIA 4Q1AA 5EWMA 3RREA 1OUMA 4I5IA 2O2XA 4O6VA 3TLYA 4AO8A 4EO7A 1XNQB 1OHHD 5EWJB 1Z26A 4D4HA 4OQ4A 1RWQA 1V3QE 2ZSEA 1COZA 3DDUA 3PQEA 4PNZA 5EJ7A 4BASA 2GRUA 3IBGA 5FDFA 4FLEA 1H3NA 3KZOA 2X8AA 1J1UA 4QATA 1EXNA 1KJWA 3IP1A 3MRVA 1NY6A 4LXXA 1S89A 2W37A 3K1YA 1QIFA 4MHSA 5AOBA 4EI8A 4N7RA 2HI0A 3F3YA 4O5AA 4BBAA 3BCHA 4F8YA 5JD5A 2JHAA 1XRJA 1AZWA 2FHPA 2GZ3A 1JHVA 3C8HA 1ID1A 5BMVF 1E96A 1CJSA 3HWX1 1XQXA 1F4PA 1DJNA 1O9BA 3LT4A 5DBHX 2QRKA 4ZXFA 1DEKA 1NYLA 2GJ8A 2VUSA 1EKXA 1OE0A 3T7IA 5KKNB 2QGZA 1LBEA 1YFZA 4Z4EA 1O9HA 1P1CA 2DFPA 4IJKA 2GLXA 3OQBA 1D7AA 2EIHA 2BT4A 3MCAA 4RIIA 1DEAA 1L5FA 5BR4A 3HCDA 4HRAA 3ZY2A 4OGKA 4YRTA 4GLBA 1Y8RA 3N3AC 4ZVOA 4BJ1A 3IUNA 1CCWA 3DH0A 1TPYA 4OXIA 1IN6A 1UAYA 3K7EA 1NW4A 5DU2A 5ALWA 1P80A 1Q6ZA 5TQ2B 2ZJOA 4ZO9A 1D07A 2C3UA 5ALJA 1SVOA 5E9QA 4Z9XA 3N0RA 4RS4A 5IBRA 1UKYA 3IAFA 2YJNA 4WFKA 1H2RS 2V6MA 3GI1A 1JDBB 1N8KA 3AIOA 4RIGA 4HGQA 3ZX4A 2P3OA 3D4BA 3QM1A 3NC4A 2YZ2A 1NPDA 1THGA 1E5VA 4QVGA 4DDKA 1T34A 2FU5C 2ZTHA 2G08A 3QXXA 2CF5A 2WB4A 3GLFB 1I4DD 4ZT6A 3RBVA 1C0LA 1XAJA 4RQAA 4FR2A 4EF5A 3R77A 2J6HA 4MA5A 2G04A 3CSDA 1WL8A 4TS9A 2BJHA 4GI1A 4JQZA 4Z54A 4LF9B 1AGRA 5IYZA 1A9XA 4W9MC 1F0KA 2NP7A 1NMYA 2PL3A 2WDZA 2PXHA 2VHVA 4QJ4A 4RD0A 4CT5A 4RMGA 1NMXA 1SBHA 1UXHA 1D9ZA 5EFOA 1O9GA 4BFWA 4HT3B 3BFJA 1W5TA 2C03A 1RKUA 3DFIA 1JGTA 1NURA 2WMOB 2B2XA 3E9MA 3GCDA 1ZVMA 1ND5A 2O07A 3N2EA 5HIJA 2IU0A 3QTBA 1NQXA 3FH0A 2PUBA 1FJGB 2BSXA 2SBTA 5TGDA 1Q1QA 3GZNA 4DUPA 2XKKA 1N9KA 3THOA 3ROXA 4CCSA 4PLWA 3PRKE 1MO3A 2WV7A 4G86A 2FAXA 1SVWA 4FQ7A 2OV1A 1QE0A 5HQ3A 1F38A 1UIRA 3V7UA 3D6HA 4UUPA 1F4VA 4KBYA 1XLWA 3I9JA 2A7XA 2P2SA 1ZU5A 1S6YA 5TVKA 3FPHA 3QTTA 4AD8A 3SLGA 4GOKA 4QU8A 1YS6A 4HQFA 3X3HA 1EVIA 3WMFA 5K5EA 1NBEA 3S7TA 4JLAA 3ISTA 1N2OA 1G41A 4M54A 1QTNA 3TTVA 3P9NA 1Z0SA 1HQYE 3MAGA 2W2KB 4KQ6A 4ESEA 5KYUA 1U1DA 3JX9A 4S0XA 2GPAA 3ZI4A 3GFSA 3U9LA 1UDAA 2BZGA 2Z4SA 1KU0A 4YQEA 3ZHRA 4IQ0A 3VJRA 4MS4A 2Q07A 2EAUA 3ZIAA 1AK2A 3OLXA 5EMLA 2XCLA 1QYXA 5DHPA 1CFJA 1E3QA 3OJLA 4EB8A 5IT5A 1WEKA 1H2WA 5EJFA 5U9CA 2XWBF 2IY7A 1Y7TA 3QVSA 1FDVA 3H5NA 5DLEA 5F1PA 4JX9A 4ZAYA 3DE1X 4GOOD 3DTNA 3QY0A 2VR1A 3AHFA 4UTZA 3TCXB 4ITRC 2FW8A 5E95A 4AULA 4I55B 2H1IA 5KPDA 3G0IA 4F5YA 2NAFA 1KEPA 3MMZA 1KS9A 4ESHA 4GU5A 1CJUC 4JYBA 1IWOA 4I7EA 1E2MA 2DUNA 1X8LA 1JAZA 2JS7A 3R4VA 4RXUA 4ZOLF 5AVQA 3U44B 1KRWA 4BC1A 4CV1A 2J3DA 1XLTC 1DVRA 3EHEA 1KJIA 4JXZA 4E2FA 1O0SA 4QQKA 1V5FA 2Y0CA 3UANA 1GZVA 4CEIA 5L7YA 4EMBA 2BWJA 3DHNA 3U44A 1G3IA 1K3UB 2XNSA 3MAJA 3PZBA 4UXIA 3GJ4A 4WQMA 1G98A 2R68A 4I1YA 1XD2A 4LWPA 3H0EA 5L8VA 1JIXA 3PGKA 4RA9A 1T5HX 2QRVB 3KAPA 3UA3A 4CCYA 2VQSA 5LQSA 1XL1A 4ES6A 2VRCD 4BB5A 3B3AA 2IVZA 4WN9A 2PQMA 5JFTA 3PJGA 5CH5A 2IZ0A 3TSCA 3V1TC 3W4IA 2PUDA 1X3SA 3RD5A 4ERXA 4RKRA 5CBPA 5KTKA 3H97A 4XGKA 5K0NA 1EG7A 2HZBA 3AHGA 4LV5B 3W0LB 1TM2A 3K8QA 4HUTA 1NPTO 1VG9B 3F5DA 4EJSA 2DLDA 4MP6A 5BSWA 3IXLA 3STVA 2X58A 2HMUA 1I10A 2HMYB 2QT9A 2IXFA 1DRJA 2OHJA 4NP6A 3SBOA 3ZVLA 3K0EA 1GAXA 3H5VA 4U2DA 3BWBA 4M0FA 2F43B 2BM9A 4CV2A 4EIWA 5FAKA 2ZM5A 4AZVA 4Z7QB 2ZB3A 3DTVA 3HU3A 1E9SA 3LS2A 1HNNA 1L8LA 1GTMA 1N25A 3KUCA 1HGXA 5I48A 1T29A 3NASA 3DQZA 1RZ3A 2A9KA 3DTTA 4PNPA 5IXJA 1KJQA 3T1YB 4J90A 2QIOA 3B7WA 2AN1A 3GBSA 3DKKA 4G0QA 4V24A 4M9UA 1R3DA 3B1VA 4O2BB 1PWHA 3NDRA 4E32A 2VJNA 5GADl 3E70C 2OMEA 4X20B 1V7QA 3VZCA 1NRXA 1G19A 3JWHA 1CS0A 1O58A 2E82A 3NEPX 4LJ7A 2X6RA 1X1TA 4KC0A 4NU5A 1LI4A 2YCBA 1FQWA 3BMOA 5FL7A 3G68A 1HPLA 2A0WA 1JDJA 2F64A 2PVPA 3F5SA 4KXYA 4BGIA 3VH3A 3IMKA 2KM1A 3ROFA 3FCCA 4DCOA 3H6GA 1E64A 2Q6IA 3BIWA 3IV9A 2QI9C 4XWYA 1JEAA 1W9MA 4U7DA 1V45E 2YY7A 4GMGA 4JD5A 4LYGA 4BVBA 4NCAA 4OXRA 4RZHA 3ILVA 1LI5A 2G9UA 4KRXA 4Z7OB 2OPHA 4XDGA 1QGED 1DL5A 4L5CA 2GX6A 2LIVA 3L6CA 1SUAA 3DEIA 3U4DA 4H08A 4GWGA 3TQRA 3LC7O 1ORTA 1V4NA 1CUZA 3FPSA 2OYRA 4L3OA 2FFAA 1G8FA 4ACAA 3DM9B 1NN1A 2J3LA 1O95C 1GRQA 1WMDA 1EUDB 2FE4A 2BJVA 3ET4A 4Q1VA 2EX0A 3B1JA 3H5AA 4BQQA 5FQOA 1WETA 1DQNA 2WT8A 2ZUDA 1ZPDA 4N3BA 5GJWC 2D5AA 1MQAA 3LDUA 4O4HF 1ILEA 4LFAB 2VNAA 4KIWA 1XRSB 4AO7A 4H0NA 3R3XA 4RVDA 5DM0A 1DWQA 2MWMA 3PHCA 4KPUB 4PBTA 2IZ6A 1FFXA 2WLTA 1P72A 4O02B 5L53A 3T94A 4DQUA 4DGQA 4HAYA 4WZAE 2P35A 2RGXA 4IIHA 4TYNA 3DLAA 3J7TA 4ZOBA 1G8SA 4A4DA 1G5RA 2ROQA 1XMSA 2PN1A 5C8DA 3I6BA 4MRVA 4AC9A 2CE2X 1DJLA 3COVA 2FQWA 3ANSA 2AW3A 4L0DA 5EJ8A 2I71A 3HXMA 5AFSA 1Z38A 1ZM3A 1UPFA 1I4EB 1AQLA 1RQLA 2WOOA 2HMWA 4L0CA 5JH7B 3OKPA 1KEEB 4YJGA 3SSMA 4IDQA 3WADA 1UXOA 5AW2A 3BBLA 3OQNA 2B20A 1H05A 2H4WA 1E8MA 3D3KA 3DKIA 3PCRB 4N7MA 5IH7A 4U9IS 1YR6A 3AUFA 2CMKA 3AGPA 3PX2A 4ND6A 4OXNA 3TPFA 5AJZA 3TR6A 3W1EA 4YAIA 3IRUA 5KYYB 1AV6A 2GYYA 4TVBA 5JMTA 4LDNA 1Q7GA 2ZT7A 2QQ0A 3VJLA 1RHQA 4EG5A 2JHCA 4BQFA 4KQ9A 3VKFA 1N6OA 3I2GA 3VYRB 4BU1A 1HTTA 5CFLA 2A84A 2PH7A 5E2BA 1UXKA 3CH7A 2YDYA 1G17A 2UZAA 2JEOA 1RS0A 2CHUA 4G1EB 2FSSA 4D8XA 3TUZC 4DR2B 1J25A 1QGZA 1RTKA 2NPOA 3DV0B 4P0QB 1Q16A 2DTDA 3LP6A 3UMVA 3RB8A 1MZPA 1QG4A 2FKAA 4HK4A 4NKRA 1B16A 3SIPA 2XUDA 5AI4A 2GBFA 4J07A 4OQNA 2NADA 4EUFA 1NYRA 1FBNA 2IQIA 3THWA 5GIOE 2M32A 1QIJA 1NVAA 2CDCA 2XAUA 3O83A 4DMHA 2VAWA 1NVBA 3DCJA 1N4DA 3LCMA 3CWCA 4JDPA 3ADCA 1HQCA 2VDQB 1MCZA 5JNLA 3WLHA 2C9DA 4MI9A 4PZYA 3RUPA 2UZ4A