1J1IA

Crystal structure of a his-tagged serine hydrolase involved in the carbazole degradation (carc enzyme)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
258
Chain Sequence
AYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a histidine-tagged serine hydrolase involved in the carbazole degradation (CarC enzyme).
pubmed doi rcsb
source organism Janthinobacterium
molecule tags Hydrolase
molecule keywords meta cleavage compound hydrolase
total genus 87
structure length 258
sequence length 268
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j1iA00
5JYCA 4U2GA 5ALRA 5FPPA 3Q8WA 3PDCA 5K3DA 4QDXA 1E3QA 2BKLA 3IULA 5CT9A 3WYNA 4BCCA 4HVTA 2J3QA 3ICWA 1EH5A 1XZCA 3E1GA 1AUOA 3D59A 5C81A 1XZJA 4AQDA 2ZSIA 2JGKA 1LPPA 4DLNA 3I2HA 4H7JA 3FVTA 2C4HA 3MVEA 3C5WP 2WIJA 1Z68A 1E8DA 3HABA 3A2MA 2B4KA 4HXEB 4U2DA 4PNZA 3FLBA 1WB4A 3STXA 3W04A 4G8BA 2OAGA 3H1BA 4CFSA 3H04A 2FJPA 1MX1A 4HS9A 4Y2RA 5AKXA 2ORYA 2WTMA 1JJFA 5ESRA 1XFDA 1A8SA 1JJBA 4IO0A 1MPXA 4MEBA 3WWDA 2QRUA 2XLCA 1E89A 4UBNA 2XUPA 4X6UA 2R8BA 2XLBA 5ALDA 2H7XA 3HLKA 3RLIA 4UHBA 4KACA 1SCQA 3O9MA 3YASA 5I7UA 4LXGA 3M3DA 1WCYA 3STWA 3ANTA 3I2GA 1MX9A 4H7HA 4DMHA 2JGJA 1JMKC 4UHEA 1CUWA 1VJ5A 5ALVA 3WL5A 1BN6A 1ZICA 2WG1A 5HF6A 1DWPA 2B9VA 4UBLA 5IVDA 5DJ5A 5CT4A 4AMZA 3HEAA 1UK7A 3CN9A 3DOIA 3AZOA 1A88A 1CUYA 4XX1A 3SWWA 1Q0ZA 2G5TA 2W22A 4QEKA 5LP1A 4JYPA 1Q0RA 4BP8A 1N5RA 3WWOA 4DMFA 4E11A 4EB0A 3AINA 5EFZA 3IVMA 5AKJA 1DWOA 1EINA 4CG2A 5LKRA 4E15A 2WIGA 3B5EA 4IQ4A 3O4JA 2BGNA 3CCBA 2QXUA 1MAAA 1X70A 3F9CA 2WSLA 4Y2SA 4AO7A 2G63A 4CG3A 3GELA 3IUJA 2QTBA 2VQ6A 1YAJA 2Z5GA 2VT6A 4FNMA 1KEZA 4KEAA 3VDXA 4AMYA 1O6FA 1TCBA 4U2FA 4C88A 1S8OA 3STYA 4JEIA 1SOMA 5AHXA 5AM5A 4MQMA 3EQ8A 5BV7A 2PUJA 3I2FA 1CUBA 1BEEA 3K9BA 1ZI8A 1MJ5A 5CH8A 4W9RA 4X6XA 5T4FA 2JGEA 4IHAA 5A62A 1ZGBA 3MUOA 2PL5A 1ODCA 4NMWA 1QO9A 1DX4A 1YS2X 5AI6A 2ROQA 1EVEA 4BRSA 1FSSA 5EI5A 5E4YA 3A70A 4F0JA 2XUIA 1EDBA 4UFNA 1LGYA 4P93A 2CZQA 2FJ0A 2O2HA 4BAUA 1CUGA 1PFQA 1UKBA 5E4TA 4E46A 4AB1A 5JARA 3AUKA 3DD5A 1YASA 3WL7A 4D9JA 1CUIA 1ZGCA 3ZI7A 4EA6A 4G8DA 3QPDA 3O4IA 1AZWA 2JGMA 3PE6A 2HA7A 3WJ1A 2PSEA 5LZ9A 2X76A 3KWFA 3V1MA 3ZWQA 4BAZA 2GZSA 2C5GA 4FMPA 3R3XA 5K3AA 1LLFA 3KOOA 2WU3A 2BFNA 3O95A 4Y7DA 2HRRA 5JZ9A 5ALQA 3KWJA 5C8XA 5E4JA 3KDAA 3VKFA 3TJMA 3LCRA 4OUKX 4DIUA 4DNQA 3DCNA 2Y2UA 3IB3A 4U2BA 5CH5A 3H2KA 4MJ3A 3D0KA 5E2IA 1LPSA 3QMWA 5AK5A 3AZPA 4N5HX 3M83A 1CR6A 4QLAA 1CVLA 2EDCA 5AKLA 5HFNA 1MT3A 3I2IA 4GEGA 1JT2A 4Q34A 1FFBA 2B20A 1BRTA 1CUXA 1C7IA 1QIEA 5A7HA 5KREA 4J3JA 3G9XA 3A2LA 4KRXA 4LIPD 4ZXFA 4K2AA 1N5MA 1THGA 4G4IA 5IVKA 2OGTA 2JEZA 1H2XA 3GUUA 1ORWA 3W06A 3W9BA 2WTNA 5AK3A 2QR5A 1YS1X 1XLVA 3KSRA 2I3ZA 1R9NA 4QDOA 3N0TA 2XMCA 4JUIA 3WZLA 2WUDA 2W6CX 1EDDA 2XUFA 2H7YA 2GYUA 4X90A 5AP9A 5FOQA 1EXWA 1EK1A 3WL6A 1J1IA 3HC7A 5EGNA 5EHQA 4BCDA 3O0DA 1HLGA 2RIPA 3WA7A 3L1IA 2WUFA 2H1IA 3G0DA 4HXGA 2C0PA 4HRYA 2J4FA 4BC0A 1FFCA 1MX5A 3BIXA 2ZJ7A 3KXPA 1HL7A 1CUJA 1XKLA 4N5IX 5AI4A 4BYMA 5IVHA 1WHSA 4BAGA 1UK9A 1EB8A 2VAVA 1GPLA 4L9AA 3I2JA 1DQYA 4M0FA 1VZ2A 3D5EA 1IVYA 3PFCA 2WFZA 5JD6A 4ARBA 2G4LA 5ALUA 2ZYSA 5JADA 4W63A 3NWOA 3VJLA 2DQZA 1WB6A 1TKRA 3WK4A 1GKKA 5KWIA 2C58A 3QH4A 5LLSA 4JYMA 5AKIA 5HZGA 1EVQA 3ILSA 2WJ4A 1QE3A 5F4ZA 3WK5A 4DNFA 3P2MA 4V2IA 1JU3A 3BJRA 2JBWA 4XJVA 5JAPA 1AMNA 4P08A 4X97A 4Y2JA 3G8YA 4B83A 2PX6A 3C5VA 3H2HA 4U2EA 4EY7A 2VTVA 3DJYA 3SX4A 4B9AA 1DTEA 3B12A 5CMLA 2HA0A 3C8DA 3LIIA 4H7FA 4H18A 3ZLTA 4UBMA 1GXSA 2QOEA 3JW8A 5AI5A 2C0QA 5HF9A 1VE6A 1QIMA 3ESAA 5A7GA 1I6WA 4DSAA 2HA4A 4KE8A 2QUBA 3WWEA 3G0CA 3QPCA 1J07A 5EIEA 5ALJA 4Y9SA 3WIOA 1T2NA 2AJBA 5DNUA 4P92A 5ALMA 1VXRA 3WL8A 2VJDA 3G9ZA 3G02A 4WY5A 1E8MA 1UOQA 2DHEA 5HK8A 2DCMA 1QIHA 3HZOA 2PKYX 4DYHA 4CCYA 4J0HA 3PF8A 5FKJA 4X93A 1U65A 1W4LA 4A23A 4GBGA 5HK9A 1F6WA 5CURA 4FLEA 1Q83A 4G9EA 4L3WA 2CKMA 4INZA 4Y2QA 4DSZA 4Y2TA 1K63A 2WFMA 4J0KA 1VZ3A 1CQWA 3OPMA 1JFRA 1ODTC 2O7RA 3BE8A 5CH3A 3CCCA 4QNNA 3JYHA 3C6ZA 2PVSA 3A6ZA 4FKBA 5CRIA 5AKZA 4N8DA 4OD0A 2OAEA 1H22A 4C01A 1EB9A 5DTIA 1XQYA 2UZ0A 5LYYA 4RPCA 3EQ9A 1IZ8A 2OCIA 5CXXA 5JATA 4DNOA 2OG1A 3NUZA 1ISPA 1CUSA 4ZREA 1NU8A 2Y2VA 5ALYA 2O2GA 3ESBA 2WG0A 3OC0A 3RARA 4Y2PA 4DM7A 2Y6VA 3RKSA 3K6KA 2I78A 3STUA 3V1KA 5T4EA 1F0PA 4FFVA 6YASA 3H2GA 1QIDA 3R0VA 4H35A 1GZ7A 2C5FA 3DOHA 2VJBA 5BWCA 1FJ2A 2XQJA 1EK2A 4JNCA 4TGLA 4B6GA 3PUHA 5C8ZA 5CBKA 3FLAA 2V98A 5AKEA 2E3JA 2J4CA 5JD4A 1FFEA 1GQSA 5EIAA 5CT6A 5ALIA 4OYYA 4AN1A 4H7IA 1CEXA 2XUKA 3WI7A 3C6XA 5ALXA 2WIKA 1UKAA 2AJDA 1ODSA 2X5XA 4X91A 5FUMA 1VKHA 4F60A 3A2NA 2IIVA 3DDUA 5DYTA 1G5FA 2ONCA 2WM2A 2HM7A 3F96A 1MNQA 2OQIA 5AKKA 4KAFA 5K3FA 4B85A 1ORVA 4WFJA 4A16A 5AKYA 4L72A 4PSDA 1GGVA 3BJMA 5IVIA 2DHCA 4AO6A 1QIJA 3G7NA 2OXEA 3VXKA 2PPLA 1LPNA 5HF5A 4J0DA 1CUFA 3TEJA 2XE4A 3C6BA 3UMJA 3X3HA 3R3UA 1H2ZA 1OILA 1QIIA 3VVMA 3OOSA 4G4GA 1QOZA 5A7FA 1QJ4A 3DL4A 3DNMA 3WKEA 5K5EA 4HAIA 4AZ0A 1LBTA 2ECFA 4LHEA 3VJMA 2QVBA 3STVA 2HFJA 2OLEA 4RE6A 5AM3A 2V96A 4X94A 1SCIA 2CB9A 4ARAA 1CUCA 1XZDA 2WHPB 4MYSA 4P9NA 3I2KA 5AI8A 3DKRA 5JAUA 1AGYA 3WZMA 1MN6A 4X7BA 5EHNA 1KU6A 2BUBA 1IUPA 3C6YA 2PSFA 1F0NA 4BC1A 3G0GA 5AOBA 3BF8A 3I1IA 4F21A 2OCKA 3O4GA 1E5TA 2V9ZA 4G4JA 4UHFA 1J2EA 5JALA 1YSCA 3NGMA 4LYEA 2HHAA 2XUHA 5EHZA 1TQHA 2OPHA 1K8QA 1GPNA 3K2IA 4C4ZA 3N2ZB 1QFMA 3F97A 1QLWA 4GLBA 4J0GA 4FLFA 4WFKA 4UFOA 2WUEA 4MYDA 5ALFA 1JU4A 3H2JA 1K5PA 2XMSA 4BVKA 5AH0A 1X2BA 4J0JA 1UT6A 1W76A 3V1LA 4Q1VA 4G5XA 1UOOA 2BUCA 2XUGA 4PSUA 3FLEA 1H2YA 2OCLA 1XRNA 3HI4A 4WDQA 2EDAA 4M0EA 1E8NA 2RHTA 4OB7A 4FWBA 3ZPXA 1BCSA 3DEAA 5AK4A 4EY5A 4J0IA 2CEKA 2VA9A 3DQZA 1YB6A 3QM1A 2ZYIA 2XQIA 5HCUA 2ZSHA 4B80A 1UKCA 2HFKA 2YXPX 1IUNA 4AN0A 3ZLUA 2H7CA 2HL6A 4RE5A 2XQFA 1LZLA 1XZKA 1THTA 2V97A 1VLQA 1VOTA 5CT5A 3FSGD 2HDWA 4BP9A 3I1YA 4GXNA 4C4XA 3IUMA 3FYUC 3G0BA 5LZ7A 3W05A 2VF2A 2XUOA 4PF1A 3QZUA 5YASA 1GT6A 1SFRA 1TRHA 2RI6A 3R3WA 3UUEA 2VJCA 4Q3KA 4NS4A 5AM0A 3FYUA 4UBOA 5LZ8A 3TRDA 1U8EA 1ETHA 3QITA 1G4HA 1VA5A 3W2TA 4ROTA 3H0CA 2ZYRA 2Z3ZA 3IIIA 1E66A 1CFJA 1EX9A 1XZLA 4FNGA 5ALOA 3MUNA 2QS9A 2ZJ6A 2ES4A 3NOXA 3Q0TA 5D6OA 4YASA 2XMBA 2XB6A 2D5LA 5HQ3B 1JMYA 4E14A 2HA5A 1KU0A 4OU5A 4B0PA 4QWMA 4X95A 4CIBA 4QLOA 2D0DA 1FFDA 1XLUA 4UBKA 4KAJA 5IH7A 4EY8A 4H7DA 2CMFA 4IH1A 2Y6UA 2BJHA 1LPAB 3ED1A 1T4MA 4LXHA 3D3NA 2WHPA 5HKAA 3FNBA 2RHWA 4IH9A 3IURA 2WU4A 1QONA 3E0XA 3IDAA 3QMVA 4EBBA 2J3DA 7YASA 4BRZA 1YA4A 5J3JA 4I19A 4ITVA 1A8UA 4KJXA 4H77A 4W1QA 4BVJA 1AQLA 4A5SA 4GWLA 4QDTA 3GROA 3R3VA 2HA3A 1IZ7A 3WK8A 3ZV7A 2PSDA 1PV1A 3WYDA 2BGRA 4EHBA 2NW6A 2DQYA 4UFPA 1OXMA 3W9UA 5A71A 5ALPA 1WB5A 3GA7A 1XROA 4RGYA 4YK7A 1BEZA 4EUSA 1QO7A 1MO2A 1XRMA 5AIBA 1U4NA 1DX6A 3WK7A 3ZLVA 5K3FB 3BXPA 1JKMA 3HSSA 2IX9A 4B84A 1BS9A 3G9UA 3LS2A 5AICA 2PU7A 3R3ZA 5K3BA 1XZBA 3S8YA 5LIPA 3H1AA 3WKDA 1C4XA 3FAKA 4HZGA 4WJLA 1CLEA 5CW2A 4FHZA 2XUQA 5JIBA 2DSNA 3DLTA 4NZZA 4QWWA 4UBIA 4YPVA 1RWQA 3S2ZA 1LPMA 3ICVA 1TK3A 2GBFA 3WKCA 4Z49A 5ISMA 4MQLA 2WHQA 4XIIA 3WWCA 3RM3A 3WWPA 1UK8A 4CIAA 3V9AA 1QIGA 5HQ3A 3MGAA 1TAHA 5AOAA 1GPKA 1ZD3A 1YB7A 2CUTA 4M0MA 2AJCA 5K3EA 1B6GA 1EI9A 1WPXA 1JJIA 1BCRA 4EZIA 3PF9A 4B81A 3WQHA 4K6GA 1P0QA 1XZGA 4Y2UA 5EIHA 5DLPA 3QMMA 1CRLA 5LZ2A 3WMRA 5BWBA 1ZD4A 4ZV7A 3DL7A 4DMCA 4BTVA 1MNAA 1UWCA 4C87A 4FTWA 1CUVA 2WLSA 4B9EA 3WLAA 1K6EA 5D7BA 2WUGA 4YX9A 5HKBA 1Y7IA 3SC2A 2WFLA 1XRRA 3AJAA 4TPKA 3OM8A 3EQ7A 1UZAA 4HRXA 3IUQA 5AK6A 5FLKA 4X6YA 4LYDA 4BATA 5DNWA 2I03A 1WOMA 4JH0A 4C4YA 1H2WA 4FFWA 1XZAA 4UUQA 2HRQA 4F5ZA 2Q0XA 4IH4A 2XMZA 1MU0A 1N1MA 5ALTA 3PFBA 1VA4A 1MTZA 3BDIA 2XMRA 4BTLA 4KAAA 1BN7A 5C8VA 2LIPA 4BBZA 1XQVA 2GYWA 5JD5A 2XT0A 3ESDA 3IA2A 4ZWNA 2WG2A 4J03A 1XZFA 2PU5A 4PV7A 3B3QA 1XLWA 1XQXA 3OURA 4K6HA 2C7BA 3TGLA 4HTAA 3OG9A 3BL8A 1Y37A 4WFIA 1A8QA 1DT5A 2GZRA 2GBIA 5ALLA 4FOLA 2WIFA 2P8SA 4PW0A 1XZMA 5FV4A 3EIOA 4KE9A 4MWSA 1UK6A 4ZI5A 1CIJA 4OCZA 2HIHA 5LZ5A 2Z8ZA 2B61A 3FYUB 1CUZA 2GBCA 1P0MA 4XWGA 2DR0A 2VATA 1CPYA 2AJ8A 3ESCA 1X2EA 4WY8A 4QDZA 1YA8A 1ZJ5A 3C45A 4WCVA 2WJ3A 3FCXA 1N8SA 4OB6A 4PQEA 4BDSA 1WM1A 4AXBA 3SK0A 1HQDA 5ALKA 2XUJA 4Q82A 1BE0A 3QBJA 2HU7A 3R3YA 1IUOA 4DMKA 4FDMA 4KR0A 1WHTA 2XDWA 1BU8A 5JZBA 4KYVA 2GBGA 4Q05A 2QMQA 5EHXA 3STTA 1XZEA 5A6VA 1QIKA 2JGLA 1ZJ4A 2CJPA 2VAXA 4ZGBA 2BCEA 1RYYA 1JI3A 3FBWA 1SC9A 1LPBB 4C89A 1USWA 2BUAA 2WFLB 4K6KA 4EY4A 3M81A 2CBGA 1UXOA 2XI4A 3BF7A 4UHDA 4LXIA 4Q3LA 5SYMA 5BOVA 3AIKA 2DHDA 2AJLI 2YH2A 1L7QA 3EBLA 4DTCA 3GBSA 1L7AA 3LIPA 5AI0A 4ZV9A 3BIWA 1DQZA 1G66A 1RP1A 1QFSA 5H3HA 4X71A 4NVRA 2JEYA 3L1HA 2VT7A 2ZVDA 5KWJA 5JZSA 1SCKA 3WKBA 2O2IA 3D2BA 1R88A 1L7RA 3PUIA 1F8UA 4ETWA 4H7KA 4X00A 1GKLA 2QM0A 1QTRA 4UPDA 1LNSA 2WILA 3C70A 3O9VA 2OQVA 3UUFA 3QPAA 5ALNA 4GDMA 3E3AA 2OGSA 3HXKA 1HKHA 2HU8A 1A7UA 5AM4A 3BWXA 2ACEA 1QGED 4BCBA 1W1IA 2JIDA 3R40A 1HPLA 3VJKA 3F67A 4QDUA 5I9IA 3EF3A 1AURA 2WJ6A 1Y7HA 2G5PA 3D2AA 3D2CA 3PICA 1R3DA 5DTJA 4MEAA 1QZ3A 3BDVA 2DFPA 4GW3A 1AX9A 1DINA 3U1TA 4PO3X 3C43A 3HRHA 5AOCA 4G8CA 5A2GA 1CQZA 1LBSA 1CUHA 1MAHA 1R9MA 2WKWA 4W1SA 1XKTA 2BAGA 2RONA 4QZVA 1EDEA 2XMQA 5JAHA 4LKOA 1G42A 5CT8A 1TCAA 1W52X 1CUDA 1P0IA 5AIAA 4O08A 3JWEA 4OU4A 3PI6A 5HF8A 4DNPA 1ACJA 2OGZA 4FBLA 1XQWA 1H23A 1ZI6A 1UOPA 1TIBA 4K5QA 1XRLA 2PM8A 3DYVA 1XZHA 2QUAA 2RAUA 5AKHA 3I6MA 5FRDA 3HYSA 2XMDA 5JAOA 4UBJA 4H0CA 1WPRA 2VEOA 2Z3WA 5AI9A 2QKYA 3AILA 4HXFB 1EHYA 5DNVA 1ZIYA 4X85A 1HBJA 2OCGA 3V48A 1YR2A 2XMGA 2X8BA 5AJHA 3WK6A 3WA6A 1CUUA 3AZQA 3HACA 5IKXA 5ALSA 3H17A 1C7JA 4I4CA 2FUKA 4B7ZA 2ACKA 2I3DA 4GI1A 2O7VA 1P0PA 1CV2A 5DYYA 4BZWA 1HDEA 4CCYB 1XRPA 5LKAA 4G1FA 4B82A 4CG1A 5JASA 3OTQA 5ALWA 1OCEA 1Q84A 2ZJFA 1W75A 2XUDA 3E4DA 3LLCA 4UHCA 5ALEA 1VXOA 3CXUA 3I28A 1K4YA 1YCDA 3H2IA 1B41A 4H7EA 1ZIXA 5ALGA 5DWDA 3C87A 4OYLA 4J7AA 4KE7A 4OB8A 4C6HA 3IBTA 3L1JA 4X92A 4Y2YA 3CN7A 4BVLA 4ZRDA 5DYWA 2GYVA 3LP5A 3WKAA 1YAHA 4OSEA 3FSGA 1ZD2P 3WK9A 1DT3A 4GECA 4AZ3A 5FXMA 1XZIA 4BE4A 2QJRA 2HU5A 3O4HA 4KE6A 1DWQA 5AM1A 5T4HA 4FBMA 4J0CA 4PSCA 4BZZA 2XQGA 2R11A 1R4ZA 1TCCA 4QE3A 5CXUA 2EEPA 1R50A 1QTIA 4KRYA 4WDRA 2WHRA 2QZPA 3DKKA 3H18A 2JGFA 2WIDA 4MXDA 1ZD5A 5ALZA 1J06A 1GQRA 1O6GA 2QJWA 3I6YA 1FFAA 1IMJA 3ANSA 3QVMA 1PJAA 1QIFA 3H19A 4RNCA 4GHWA 3GZJA 3DYIA 3FVRA 3V1NA 2QT9A 5KBYA 1ZOIA 3VVLA 3M82A 4QA9A 4BB0A 3IUNA 2WQZA 5SYNA 3QYJA 3I6ZA 1U2EA 2FX5A 4I3FA 1CUAA 2QXTA 1W6RA 3D7RA 5T4BA 4N8SA 4U2CA 5FPQA 5AO9A 2Z8XA 1BROA 1UFOA 1EA5A 4AO8A 2H9YA 2HA2A 3R41A 2VJAA 4L0CA 1LPOA 5K3CA 5JANA 3G0IA 4W1PA 1NX9A 2VSQA 4XVCA 5CTAA 4CI9A 3G9TA 4BE9A 1AKNA 5HFAA 1ZI9A 1ACLA 2YYSA 4Y2XA 4DGQA 3FYTA 5LZ4A 3AIMA 4AX4A 4G9GA 2PBLA 2Y1KA 2AXEA 4Y2VA 3GFFA 1LZKA 2XUAA 4W1RA 5I8PA 4TVKA 3F98A 3RK4A 3U0VA 3C8HA 2RGUA 1XRQA 2PSJA 5ALHA 3DS8A 3AFIA 3WJ2A 5C7YA 4EY6A 2IITA 3VISA 4FLMA 5D3KA 1DU4A 1CUEA 1D07A 3KD2A 5D3ZA 3WIBA 2HADA 1VE7A 3HJUA 2PUHA 4BDTA 5FDFA 3T4UA 5FP0A 4Q3OA 3FWHA 1AC5A 4N8EA 3FOBA 1NU6A 2YASA 3FCYA 2JF0A 4B0OA 2JGIA 4CCWA 2HA6A 1M33A 2K2QB 3D4LA 2PSHA 4UHHA 1R1DA 5AM2A 4MWTA 4S0XA 5AKGA 3F8SA 3AIOA 2ZYHA 4OPMA 4X3CA 3T52A 2XQKA
chains in the Genus database with same CATH superfamily
2PKQO 1P2FA 2HREA 2WJWA 2CDNA 1DBRA 2FUEA 2BFEA 3I73A 1WMSA 3L7CA 1EK0A 4I2VA 4I99A 1KKUA 4RZUA 1PZFA 2I62A 5ALRA 2Z56A 1Y1TA 2EBFX 3D7KA 4ACAA 4RD3A 1E6MA 3PCRB 5CA1F 1L7BA 1Q21A 3Q8WA 3HV0A 3PDCA 4TKUA 4HDAA 4COKA 2HRCA 4MWZA 3PNMA 4ZZ3A 4BCCA 3RJ9A 3GVCA 2CC2A 2RKWA 5AW4A 3WP0A 1KXJA 1VPEA 3WYGA 5BWLA 2CB0A 2IZ7A 1C50A 4IDQA 4NBWA 4NQZA 4WZZA 1X86B 2QTWB 2Z4TA 4G5QA 3ACBA 4HN9A 16PKA 1Y34E 2BFDB 1C30B 2H31A 2QD5A 4I55F 4PCVA 3DDOA 1SB8A 5AJWA 1P6UA 1GNSA 4W8GA 1YR7A 2P6OA 3EOBI 2VPWA 3EHDA 4P32A 3V8MA 1LDBA 4DLNA 4YXWA 4H7JA 2A84A 2BR3A 4BO9A 1I4DD 4YXWD 4D9HA 5KHLB 3MVEA 2RD2A 2HU2A 4M9CA 3C98A 3SQLA 3VPHA 1W8DA 5FWDA 5REQA 1NVVR 3I61A 4A36A 3OJWA 1PR6A 2WIJA 3FYCA 1CNEA 2B35A 1Z5ZA 4JS0A 2JK0A 4MB6A 3T3PB 2F6RA 3W4JA 3A1EA 1Z68A 1E8DA 3F6BX 5LM3A 1V6SA 3H5OA 5AW5A 1NR1A 3OZIA 4KOEC 2QAJA 4U2DA 2FPIB 5LYJA 1N4DA 1TOAA 1EFAA 4DUGD 5U1PA 1F51E 1L8OA 2IV7A 1KPIA 3W04A 2P6MA 4G8BA 5E0KB 3WYBA 4A8JB 3LFTA 4N5NA 3KBBA 2XA1A 3HWSA 3JAMA 3HUFA 2C8LA 3PE3A 4PBTA 5GVSA 1FLVA 1MX1A 3NM4A 4ZT7A 2FMHA 2YDYA 4E33A 2Q0QA 4C76A 1DEOA 1QHXA 2MR5A 4DA9A 4AS2A 4KWIA 4QKQA 2Z6UA 4Y2RA 2ORYA 2WTMA 4H0NA 4IM7A 2FWRA 1M7BA 3L7IA 4MGZR 3WX0A 1R9JA 1JJFA 1ZKDA 3D43A 3MMSA 5HFJA 3SJCA 3VVBA 1XFDA 2NLOA 1JJBA 4ZHSA 1YBMA 1U8XX 3EW9A 3UXYA 4DV4B 3Q72A 1R0YA 3Q41A 1H42A 1LQTA 1NUAA 2RC5A 3H75A 4N0MA 3QVLA 3WV5A 4UBNA 2JAUA 2P27A 4HDMA 3MA0A 4DQDA 4DR4B 3BWMA 4IFEA 5I8WA 2AD1A 2CKDA 3AR7A 5EE9A 4HADA 2H7XA 3JRWA 4FFDA 3DBRA 1K66A 3QF7A 2P2DA 3PZRA 4JL5A 4P81A 1FU8A 2JJQA 4PX9A 1RFLA 1ODIA 1VDMA 2ZU0C 3O9MA 4QICA 4WZ6A 2QTGA 2RHLA 5TF4A 4LXGA 1M83A 5DIZA 3FPHA 4YEDA 2VP0A 1HSOA 4RVFA 5J9FA 3S1AA 2NUTB 3RFTA 2CUZA 1QAQA 3KJQA 4R7ZA 1Y8RA 1I2ZA 3QFHA 4B34A 5AVTA 1MX9A 1SXJD 2JCGA 2WP0A 3B8EA 1V7ZA 2VHWA 1H2BA 4UHEA 2BFBA 2YRXA 2V1XA 3HKBB 3CGGA 2D54A 4W9NC 3UJ9A 5IX8A 3L6DA 1BN6A 1EFRD 1FP4B 1PR5A 2G9ZA 2WG1A 2ZRLA 2YOGA 3DT9A 5FOWA 2DLNA 1PGJA 2QIPA 3GFTA 1BQEA 3GQBB 2PR7A 2XGSA 3GLTA 2B9VA 4RKEA 2NPFA 3U3OA 1RLOA 4RPGA 2XZLA 2ASVA 4X1IB 4YFVA 4CHTA 2BBOA 3L0CA 4RZQA 5IVDA 3FRIA 2GVDC 2ORIA 4EPWA 2P1DA 1CB0A 3UAVA 1R0CA 1KDVA 4D96A 1FZQA 2EATA 3HEAA 3HDTA 4KMRA 2F7SA 5EUCA 1Z5GA 4XX1A 3SWWA 3PBKA 2BTOA 2XWJI 2G5TA 3P9IA 2CNOA 3IQDB 3DMRA 2QD3A 2QX8A 4KK4A 4QEKA 2W2TA 3HGTA 3TZEA 4ZJUA 1TM4E 2BGGA 1G5IA 3HDYA 1C7EA 4P2GA 1Q0RA 3HCOA 1N5RA 2OFOA 1T1EA 3W8NA 3WWOA 4EB0A 4LOLA 1GGFA 1FU4A 2VYNA 3SIXA 4HRAA 1LFDB 1XIVA 3IVMA 3G2NA 1J5EB 2E4YA 1LDEA 4BLRA 4DJAA 2QGFA 4CG2A 2E4UA 4E15A 3ZBTA 3ZGOA 4LF7B 3EZXA 3MB5A 3OE7A 4GXTA 1XCMA 4G5YA 1P91A 1JAZA 2VAPA 4Y2GA 1E2JA 2ORVA 1YDWA 5ICSA 4FE7A 4UXHA 4R0VA 1KSFX 1G5QA 2Y27A 4IYRA 5FBLB 4BN5A 2BGNA 3FW1A 3JD1A 1THMA 3Q11A 4WKGA 3COPA 2QXUA 4QJ4A 5KC8A 4O4LF 3RH0A 3RT9A 4CGZA 1PL0A 1K8XB 1A97A 3FJ1A 3VYSB 2GEDA 2QRVB 1NZDA 4TWIA 4J2TA 3RIHA 1F48A 1K0FA 1WXEA 1JDSA 3QP9A 4XDHA 1A9YA 5CVUA 4CV1A 1A9XB 2RGNC 1YQDA 3NIFB 4U9UA 4YO8A 3RS7A 3VPCA 3NP7A 3ZR4B 5AW7A 4AMYA 1OXXK 3AR2A 1JE0A 2BGTA 4GPTA 4V1CB 1ZNQO 3STYA 3QU9A 3AVTA 3TH5A 1ZOLA 1PJ2A 4MR9B 2BFCB 4QU5A 2QN9A 3TCNA 1F06A 2P40A 3NX4A 1L5SA 4G97A 5EE5B 4I9HA 1OBOA 2ILTA 2XD4A 4B31A 3SQXA 1P1RA 2R1TB 3R6TA 1CUBA 1XDZA 3HG7A 3MS2A 3PQEA 3EIQA 4V0LA 3KQVA 5A5EA 1VJCA 3IOBA 4LJ4A 4R2XA 3RYIB 1MJ5A 1XMVA 2CXQA 2JFQA 3T95A 4A8JA 2ZT8A 1R0SA 2KQUA 1AY0A 3D3KA 3LQYA 4W9RA 1TUIA 3LVQE 2QQEA 4IJVA 4LJLA 2OHGA 3SC6A 4AD8A 3CSDA 5CFPA 2MSLA 5IAGA 2PUDA 1HXHA 3OO1A 5T4FA 1GNRA 1DXQA 3M6MD 5IP5A 1YV9A 2A9VA 4HNQA 2EG5A 1NJ2A 2G70A 4PAOA 5CYGA 3MUEA 5CIYA 3UHPA 1W36D 4LFBB 4BVAA 4BN4A 2CNKA 5CCDA 1ODCA 2XF8A 4NMWA 4DUPA 3JQBA 1QCYA 1X92A 4IHJF 4MPJA 1T8TA 3WZ2A 4Q15A 3INNA 4NCJA 2QRMA 1FRQA 1EVEA 2ROQA 3QXCA 4KK3A 2PT7A 2QDXA 1OA1A 1A2BA 2IFTA 3E1SA 4JLWA 3DVQX 1T6YA 4M8LA 1OBCA 3LTNC 5IASA 1LGYA 3UBMA 2O2HA 4BV8A 3AUUA 1A4XA 5D85A 4ZQGA 1XMIA 1UBEA 2H4WA 3EF0A 4LNAA 1CW2B 1XCLA 1JWAB 2B9EA 2GJKA 3LT1A 2EAUA 3EVAA 2WVHA 5E4TA 1NSYA 3UMGA 4GOMD 4DLVA 2O8BB 3O6VA 2I6GA 1YTUA 4IVPA 3DD5A 1J2JA 1T29A 2E85A 3FAZA 2HJWA 2R5WA 1OZAA 2WIAA 3HCPA 3NBQA 3OUTA 4IGAA 3CZ9A 5DISB 4QXOA 4TYWA 4F7DA 1WXWA 1ZGCA 4YQFA 4EA6A 1MMFB 1PWHA 5L6MB 4N0DA 1AZWA 3OQPA 1K3FA 4G8JA 5AFSA 3GJXC 1WP4A 2C92A 1Z0IA 3PE6A 2FZEA 3G8CA 1FP6A 1QRSA 3T7TA 3SXUB 3A31A 4QXAA 2ERYA 1RJFA 4AZVA 4BU1A 3DEYX 2EEZA 3DKVA 5AUOB 4TTVA 2HQ1A 4CW7A 4WBNF 5JE8A 4J0FA 3V1MA 3ZWQA 3DNFA 2JLXA 1GZVA 4HN4B 3FFWA 3VC1A 1GFWA 1ZYUA 4NPHA 3CM0A 3HDQA 3R3XA 4DIOA 3OC6A 4S1PA 4BB6A 4CG3A 2C94A 3QKRB 1L4YA 3KOOA 2W11A 3D4BA 3O95A 3DDSA 3W9UA 5B6JA 4LGCA 3BL5A 4YPOA 2CVOA 2JFXA 3TW8B 2EJWA 3HNPA 3KSZO 4IRXA 1QVAA 1WL8A 5ESWA 1K4MA 1AKEA 1OXKB 1ESZA 3OLCX 4EF4A 2QX7A 2X6TA 4WZAB 3THXB 2I55A 4B7XA 1G63A 3KDAA 2ZS8A 2ZYDA 2K5UA 1UDCA 2ZJ8A 3M6LA 5HG0A 2Q49A 5FBVB 2VL7A 2HAEA 2PH7A 3CVJA 1MC8A 2FQQA 2NUBA 2PZLA 2XHZA 3R4VA 3JZDA 4XOUA 4DCGA 5JNRA 1ZIPA 1K0UA 2ZZMA 1PL7A 1QKJA 3QYPA 4TS1A 2I6XA 5IKMA 2Y2UA 1SZPA 1B0ZA 1AGXA 1XA3A 4YRZA 2HMTA 5CH5A 2OQ2A 5A5FA 4DF3A 2CXHA 5F33A 4NH0A 1NM5A 4MUXA 1ZEJA 1G3RA 2YN2A 4EELA 4FYVA 2ZYAA 1LPSA 2HMWA 4TQUS 2WY2D 3A1TA 4LMBA 5T7BA 5AK5A 3AZPA 4H2DA 3ISVA 2F55A 1SGWA 3M83A 3B7WA 1W73A 5AKLA 4LF8B 4KCGA 3NYWA 1QANA 1DI0A 1MT3A 2FPOA 1RTTA 3EG5A 1FRFS 1MGOA 3I2IA 3JQ9C 4GEGA 5FBZA 4MKGA 3HXTA 1DGQA 4EGFA 3HB7A 1BWPA 3BXZA 2C4WA 3CF6R 3MQ4A 3ZS8A 4XVRA 1N5JA 4QYWA 1YDMA 3U4AA 4GXQA 1C7IA 3A2LA 1TUBB 4QFCA 2C2WA 4ZXFA 1N0WA 2C8JA 1KQNA 2ZUSA 1GA4A 1HYBA 3QU4A 4G4IA 4Q7MB 3MUFA 1FSFA 3V1YA 1NYTA 4CM8B 4DCNA 4UEQA 5IBCA 2HEIA 2D74A 4L5IA 4AU1A 1QK4A 4V0SA 4JJKA 4C2AA 1E59A 1NJ8A 4OBEA 1D4OA 5CB0A 3K4QA 1TW2A 4U39A 2D2EA 2OGTA 1OC4A 3ZXXA 1H2XA 2FJUA 2FP3A 3GUUA 1CX9B 1P61B 2W0SA 1ORWA 2QT0A 3R0JA 3UJDA 1NXXA 1UMCB 3LPDA 4IJWA 4A2PA 4RK5A 5C31A 5BVGB 3PEWA 3UXHA 2FFQA 3RROA 2QR5A 3OQIB 1B3RA 1OWPA 4JUBA 4QQKA 4WAUA 2NMVA 2OESA 2YY7A 2H51A 1Y5IA 2J6CA 3B20A 3GRRA 3T38A 4WNAA 4CE6A 5K8TA 5LJLA 1WABA 4RLSA 3EAFA 3QVTA 1C4OA 2XH8A 3FCUB 3PI7A 4QDOA 3N0TA 1WVGA 3AVVA 2AEFA 1Y6ZA 2H18A 4EW6A 4NCBA 2CFCA 2ATEA 2C2HA 1EVKA 4KXXA 2GYUA 5FWNA 3KKMA 4M7RA 2GT1A 3DB2A 1XB2A 1PIWA 1Q17A 3DEFA 3NAZA 2W90A 1EXWA 1EK1A 4IIVA 4HWPA 2BFPA 2QG6A 3DFIA 3GGDA 3HC7A 1T8YA 3W8EA 5GJBA 1RHMA 3NP9A 1HLGA 3VR0A 4QTYA 4L85A 1TO2E 5BSHA 2E4WA 7REQB 2WUFA 1Z8DA 1IOZA 1X80B 2H1IA 4ZYUA 4E5YA 2HR1A 4B3SB 4GMFA 2Q2VA 2X1HA 4HRYA 1XMJA 2B4TO 1CQIB 1I14A 4HZUA 4Q6WA 5G0WA 2QY9A 5F7OA 5CNKA 1MX5A 4OOFA 4A26A 3BIXA 1JIKA 2OOSA 4A8PA 4EG7A 4DLAA 3U7JA 3UJ8A 4EMUA 2V4UA 1KMCA 4Y6SA 2E4VA 5AQ1A 1CUJA 4CCAA 3TGPA 3U3XA 2I4TA 3IH5A 3NDBB 3QEKA 3HL0A 3TLXA 2AKEA 2BEJA 5C4MA 3AB8A 5L7TA 3CRNA 4DWVA 3H86A 4D3FA 3BMQB 3KHSA 5BSRA 1D5CA 3I9FA 4ZQFA 1EB8A 1ZOSA 3N6XA 3QJYA 1JJVA 2NO5A 4IDOA 3SQMA 4EKGA 2H59A 4BKOA 1U63A 3A4NA 3VC7A 5K3OA 4I5DA 4M87A 3E03A 4HUQA 3Q3IA 4JB2A 4LKRA 4XWTA 1VZ2A 4BECA 1VG0B 4EY3A 2P3LA 1NBAA 2GPWA 2OSVA 3EEQA 3HJCA 3ANYB 1N6LA 3BMXA 1C3EA 2V0CA 1RI4A 3KPJA 3GAZA 2XODA 1U7UA 1WXGA 2QVZX 5IANA 4JLUA 3VBEA 2Q3LA 4E88A 4KMSA 3TPFA 4BNDB 5JADA 3OX3A 1IN7A 3VJLA 3JWJA 1PEKE 5D51S 4UEKA 1PWZA 3MILA 3W2GA 1K6MA 3RI3A 5BN4A 4HP8A 2YUTA 5KWIA 2R60A 5WRFA 1P7VA 2BDUA 3QH4A 4QXRA 4E30A 4C0QC 1U3GA 4HLUC 2X9NA 2K87A 4X5OA 5JI2E 4PLYA 5AKIA 3S99A 1TEXA 3NMUF 1T9AA 2J1LA 3ILSA 5KSWB 2WJ4A 2HNAA 5HQJA 4CR8A 5EUMA 3MLBA 2Q1YA 3OD5A 1QP0A 3HZRA 3BWYA 3MMXA 4DLWA 4ENQA 2H4HA 3RIEA 2NZVG 4MQFA 4JR0A 3T9DA 4AMVA 3DOEA 1QTQA 1VIAA 4ZI7F 4DNFA 1HLFA 4KQ6A 1EX1A 3MT7A 3SDBA 3WLHA 4CUKA 5CB6A 1Q50A 1SXPA 4XJVA 3B2EA 2IELA 4RHUA 1M6VB 4P08A 5HJ2A 1C1HA 1JKFA 1T9GS 3NH9A 1Z83A 1JJ7A 4Q4HA 4X97A 4BNGA 4B8YA 3C3YA 3EWNA 3N8GA 4Y2JA 3UH0A 1TM7E 4M3NA 1P7YA 3CH7A 1PD1A 5J47A 1RLMA 3S28A 3W5IA 4ZJPA 1CP3A 4Q47A 2WTBA 3X44A 1BVYF 1X7YB 2L19A 3B12A 1GFSA 1PO7A 1ZH2A 4I8XA 2ZIZA 1SIOA 2HA0A 2HIMA 4TRJA 3PQ6A 1SU7A 3OCJA 4JHLA 4MWDA 4OFXA 4JMLA 4PX3A 4F71A 5M04A 2ZI4A 4MQEB 5KB3A 3H9GA 3ABQB 2B1IA 2Q3MA 2BMAA 3KM0A 1SZJG 1E4YA 2J3HA 3TLAA 2M98A 3ZLTA 4FR0A 4PCLA 2I7CA 1KIMA 4FJ2A 2V8OA 4L15A 5ED0A 3Q3GE 1TTQB 2QOEA 2P9BA 3NIBA 2LXNA 3Q8XB 4OO3A 5AI5A 1P2VA 1YTLA 4AROA 2Y1FA 1GL3A 3B78A 3LG2A 3FHCB 3OPXA 4W6ZA 1M9NA 1E7SA 3KX2A 4X8LA 1VE6A 3V8NA 2AOXA 2B2NA 5B2FA 1EWKA 2GAOA 1NX6A 2IUTA 1T4CB 1Q0UA 4NCIA 5A7GA 1NN5A 4J0QA 4MS3B 4XGQA 1XMQB 3K9WA 4C5CA 1X19A 4M53A 1Z6TA 3BQMB 3PGJA 1B3BA 3MJFA 3ZIAD 1EUQA 3UJBA 2HBYA 3WWEA 2F90A 1UJMA 1GG2A 3G0CA 1J07A 2I66A 5ALJA 3LWDA 5JPIA 4RD2A 3Q5DA 2W2OA 1T2NA 3VHXA 3HCNA 5J2UB 1U1IA 3MINA 2CVHA 4QFDA 4PC7A 1OH5A 1XDGA 2B8EA 2ZTLA 1H1LB 1R7RA 1MV8A 1H3EA 3RF6A 2XYPA 2H85A 5ELMA 4XCQA 4O5OA 2WT4A 5IKPA 1EGVB 3DMTC 1RYHA 2PJRA 3CEJA 1S96A 3EC1A 4A0HA 1SM4A 4MWGA 3O2SB 1YQEA 3KOUA 4FKMA 4F3NA 1XZNA 1GN8A 3HYCA 4ECAA 5FD8A 4Y2HA 5CDUA 4ENWA 3BXFA 1GG9A 3OCVA 4ESVA 1IPFA 4JZKA 4HX9A 1GCIA 1DBSA 1ZCJA 1S1MA 4BZQA 3LXXA 3EXG2 3HUEA 2XE7A 2FPXA 2J85A 2P3OA 5AVVA 4DV3B 3HYTA 4YCDA 4FEGA 2V6BA 3QKSB 2BCGY 5FTWA 3OMLA 3SU8A 4TWBA 2DBZA 2OQRA 4Q3EA 4PC3A 2FZCA 3R0QA 2X2PA 4I46A 3AHIA 4INZA 4GZ6A 5TS3A 1YZVA 4NMHA 3KQOA 4DIMA 3DZKA 1SKQA 3UA3A 5HWSA 1PHRA 2QBYA 1ESDA 2B21A 1TNDA 1NI4A 3C6KA 1ZJ6A 3JAKB 4JLOA 4LWPA 4E51A 1DKOA 4MB0A 4O3FA 1L5LA 3SHWA 3E61A 3BH7A 5GJWC 3TBKA 2VDNB 3ON5A 4ZOCA 2JLAA 4HTFA 4HNHA 2FQXA 2OXTA 1BNCA 1OWLA 1ODTC 3T4PA 4C7MA 4BWYA 3OPQA 4FGZA 3FR8A 1EAYA 1I5RA 2Y71A 1L6RA 2ZB4A 4OLFA 1U8AA 3PITA 4R9SA 4YCLA 2HUNA 2O3JA 3JYHA 1LVHA 3DEKA 3D3QA 3E9EA 4G1CA 1WU7A 2JIBA 1FJGB 2IS2A 2FR1A 5AJUA 1VB3A 2AQ8A 4RWZA 1SXJB 2O2JA 3L6OO 1FVFA 4OD0A 2OAEA 1PDVA 1QG6A 4OIFA 2ZIEA 1YR9A 4IIFA 3A3YA 1Q7RA 1XQYA 4GP7A 4HB2A 3GGOA 3DV0A 2DY0A 4ZPJA 2FWBA 4XIJA 1DAKA 1B00A 1IHPA 2ZJ2A 4HB0A 4OOEA 2DERA 1P2UA 2VJLA 2C8VA 1MB2A 3KJGA 2GN4A 4DNOA 4E6EA 1HV8A 3N7AA 3ZJ4A 1G2OA 3DFMA 3LJKA 1QDLB 3UAGA 5BRNA 2EF0A 1CUSA 2GPSA 3BFXA 4EGSA 1W85A 1NU8A 2Y2VA 2W43A 2IU0A 1BCRB 4UHKA 1Y7PA 4F9TA 2AOTB 5ALYA 4ALMA 3ZGZA 1YFJA 2YHUA 3N0WA 3AVWA 2WG0A 1C9YA 2CMDA 5HDQA 2B83A 1RFGE 3REFA 4HNUA 1KDPA 3RKSA 2PS9A 3WGLA 1VPVA 4H1HA 4L5JA 4K6FA 1ONOA 3ISJA 1Y48E 1VYVA 2IXFA 3CB4A 2YMLA 2H65A 3HJBA 4I4TF 5HNKA 3ZZ1A 1EPUA 2BWJA 4HFRA 4FP9A 3GCXA 3O1LA 6YASA 2PMWB 4NENB 4FSHA 2VK4A 3LC2O 3U3ZA 3ZE7A 4FB5A 5KIAA 4MRSA 4YJKA 4RTKA 1AQ6A 2CBXA 3HNOA 4PLPA 4R0MA 1BO6A 5DK4A 2C5FA 3DOHA 3OAAD 4WBNA 4TTAA 2F1HA 2VJBA 4QBGB 4Q9JA 1WS6A 4GI3A 5BWCA 4O4JB 2PL1A 4Q21A 3T35A 1K7XB 3A58B 3WDSA 1RRFA 2GVNA 3NDJA 3ZY4A 5LQJA 2XQJA 1PF7E 1T5OA 2FWPA 3JD2A 4I1OA 3T5GA 1E3TA 2HDHA 3RUEA 4NJMA 3PUHA 3P4XA 4HX2A 2XVMA 3PDWA 5HKKA 1XLTA 5FFFA 2NACA 5A4JA 4G86A 5KQGA 1ICEA 4FZ3A 1QVRA 4X1KA 4XYBA 2OV3A 4QAJA 2C20A 4PAQA 1KC3A 3PC8A 1CT9A 3R7SA 2AOWA 1X6VA 1HG1A 2AK2A 2MINA 1JV2B 4K88A 4OJYA 2E5WA 3EC7A 4PIPA 5JG7A 1DIBA 1JEOA 3JVUA 1V35A 1XG5A 2QRHA 4CIDA 1WBBA 3FOZA 2FSGA 4H7IA 3Q3HA 3G2MA 4ND3A 5A0VA 4N0QA 5B1DA 3LHSA 4EB6A 4HQOA 3R7DA 5IULC 2GOYA 1V26A 2CMGA 3RJTA 4BFUA 2BMJA 5JCOA 4F8EA 1ODSA 2ID7A 1ZSVA 3F1KA 1CNMA 3Q9NA 3W2HA 2QRLA 4IEEA 4II3A 4EFLA 2H1RA 1EP3B 3INYA 2ZBRA 4WASA 1T5DX 3DDUA 3E5NA 2QLMA 1Z36A 2VXYA 4X6LA 3AH8A 4F4JA 1DKUA 1R3UA 1TF2A 4XPIB 3ICQB 2C9BA 2AE2A 2WM2A 3F96A 4AJ9A 4A15A 5DHSA 4AY6A 2FF7A 5ENZA 3E81A 3RC9A 3H4TA 3NNDA 1JVSA 3CW2A 3FDIA 3DVRX 2XTJA 1RPNA 2OV2A 4KAFA 3EEFA 3WGGA 1SHKA 3FUXA 4LY9A 4MS4A 4OH7A 1PG5A 4EJSA 3FTFA 1GYPA 5FEMA 4XRRA 3AR9A 1FUYB 1ZVQA 3BEDA 3ER6A 3MOSA 4EKDA 3KLOA 3SBOA 5HXAA 4A16A 1Y9EA 3NJRA 5AKYA 3BTUA 1DC4A 4Q66C 5EJ5A 1QRRA 1T0PA 4LE1A 1E79A 2G5GX 1Z37A 1B2LA 2FFRA 2PMCA 3GLFE 5AXAA 2H16A 4S1NA 3BJMA 4JKOA 2VS1A 4WK4B 1N2BA 2DHCA 5BPFA 1EWRA 2YFQA 1VQ1A 4J49A 1KI2A 5JQGA 4UATA 4D41A 2VG8A 2V1UA 2DPMA 4ZT6A 3LBAA 2ZIVB 5HF5A 1F1JA 3B53X 4J0DA 3VO9A 2VQ3A 3P9QA 4YCCA 1C0EA 4AY4A 3ACDA 2OILA 3R3UA 4MVJM 4CEIB 2SKEA 2X1MA 4LJAA 2RK4A 3AQIA 3PIIA 5ECGC 3FGOA 3FSRA 2GGSA 4Y0NA 1T8PA 2QY6A 1NVEA 1N7HA 3KOMA 1FYFA 1W2HA 1EIZA 3N59A 1WB9A 2M1ZA 2BC9A 3OOSA 1Z7GA 2IXBA 2G7ZA 4LYGA 3VC2A 1A5BB 1OHHA 4X54A 3VX4A 1FP1D 3OIYA 5FI0B 4AY3A 1Z26A 1ST3A 4D4GA 4ZQEA 1QB8A 1Y3IA 4NBKA 3R0XA 3CX7A 1I7SB 4EHLA 1SZDA 3ZY6A 4BO0A 1P4JA 4XSVA 2ECFA 5FT9A 1T34A 2VTEA 3PU6A 1LBIA 2C2BA 3JVDA 5EIFA 1W581 1BXGB 4R1PA 2FEXA 1AGRA 1UMDA 2HFJA 1NV9A 1OLUA 2EKLA 2OLEA 5CYOA 3QLUA 3UB2A 1XAGA 2AQKA 5AM3A 5KOHA 1VECA 3MOGA 4DDVA 1KYTA 5H82A 9LDBA 1KMHB 2HQBA 1FDVA 1YE3A 3U4CA 4Q9KA 4ZHQB 2CHVA 1CUCA 2LV8A 3PWKA 4B87A 1ONNA 2G9VA 2G4VA 4OL9A 4P9NA 1L7NA 5FOTA 3VOSA 2WEKA 3DBLB 1JG7A 4B2YA 3VYWA 1G3IA 1WHTB 3KLPX 3WBKA 5AI8A 4C6TB 4DLLA 5K4AA 1PL8A 3RS5A 3TCXB 3DA8A 3FOEC 4RK0A 5DE3A 4R81A 1HF3A 3C24A 4Q00A 1KEWA 2XOKA 1AO3A 4J91A 3BK7A 1GPUA 5FOXA 2NTNA 1PEDA 3GJYA 4X66B 3HBFA 1I7DA 1UBMS 3AOGA 5T41A 5FBRB 2CK3D 4K9SA 5IDQA 1G3MA 5EJMA 3MN1A 4MJLA 4ZT3A 1V16A 3EBOA 1RI3A 2Q8NA 3GRZA 3HPQA 3PYMA 4DDWA 3F5SA 3KT3A 2YNMA 1ZH8A 2BUBA 4FCCA 3JS5A 3NT4A 5IYZB 2O4UX 2XBUA 2ZBEA 3TMAA 3HMKA 2VZEA 5LLTA 1IUPA 1E3JA 3OU6A 4D4IA 4RTQA 2JHFA 4QREA 3D0OA 1MPTA 3BJZA 3Q7PA 4EG4A 5F3WB 1NXVA 2JBAA 1SOAA 1LBEA 3GRUA 1YDHA 4QSMA 1YZTA 3I1IA 1DG3A 1ESMA 3HBMA 1YQXA 3JTEA 1XEFA 4HYYA 3RABA 1E1YA 4JBGA 4EVRA 3F5MA 1Y1PA 3DZDA 1FZTA 1NHWA 4F21A 1YS4A 3MT9A 3OQBA 4Z8XA 2W2LA 1V8FA 3COJA 2O3SA 1TECE 4NHEA 3CSUA 1KNQA 4GO1A 4WADA 3VPDA 1D1SA 4AVYA 3QX7A 4LJ7A 2OO5C 2A33A 3TQSA 3GLFA 3U4QB 1KL7A 3Q3EA 4RV4A 3BFPA 1C14A 4LYEA 1DO2A 4V2UA 5EPEA 2G1UA 2C42A 2NYUA 4RH1A 3ZHTA 4TMVA 2D7DA 2OPHA 1E2HA 1NYLA 2QNRA 2ZSFA 3PPWA 5FNVB 4BQQA 3N2ZB 3S3TA 4RY8A 1MJGM 2AFHA 2NAFA 2VF8A 1I01A 1YZQA 3F5QA 3I4LA 3SYRA 1HNNA 4DY4A 5BV1A 4RF3A 1GEGA 4WFKA 1JGTA 1TMOA 2KHZA 4FLFA 4KDRA 1PZHA 4D44A 4MYDA 3QF4B 3KV3O 3OU7A 3OTHA 1C1YA 2BGWA 5IK2D 1N2ZA 3OKCA 1DBVO 4GR4A 4BNNA 3TIFA 1M8GA 3A1VA 1UAYA 1UT6A 1XVIA 2TMDA 2BFFB 1XDSA 3EWIA 1RWVA 2NVUB 1UOOA 4PSUA 2BF4A 1YIDA 5ADHA 4NY1A 1MB9A 5IUNC 2ZUFA 2CLOB 3FIUA 3VV2A 5C4IA 4WDQA 2I4LA 3K7EA 2NT3A 3RG8A 1NMYA 1QHIA 1CWUA 2A7XA 2IS1A 4LDQA 2DB3A 2C4TA 3EGOA 3QIAA 1PGOA 4FWBA 4BBAA 2GXQA 4JI4B 3R8CA 4TTQA 3FHLA 1SG9A 3L0OA 4N0PA 1ORIA 5AK4A 3ZXUB 3VI4B 1YUBA 4EY5A 3MWFA 4KDFA 2XNCA 3DXZA 4MVWA 4NYIQ 3W9YA 4RTRA 1E1KA 1JRLA 4YUWA 2OG2A 1P7ZA 4R83A 2QLFA 4AJIA 1HYQA 4FEEA 5DWQA 2G1PA 1YB6A 3NAGA 4L73A 2WHYA 3NKLA 3LYUA 3UMBA 1SBYA 1WXDA 2ECKA 3BWBA 1HLDA 3L7MA 4RKYA 5ES3A 1KQFA 4UM8B 2IQ5A 3H1TA 2IBMA 3K0CA 2RG7A 1OMOA 4BNIA 3CZCA 3A0UA 2H7CA 2HL6A 2PRKA 3OFJA 4XPZA 5E9JA 1KJ9A 2X86A 1KWKA 2VT3A 2NU8B 4EG8A 2XQFA 1LZLA 1JIIA 1LH0A 2GJ8A 4ZV4A 1XZKA 2QTCA 4QM6A 1B7GO 2IVZA 2YWFA 2VDKB 1EZ1A 4XQEA 2W0MA 3RTCA 2CL5A 5G4KB 4DKXA 1E1RA 4FFLA 4QUEA 3ZHOA 2I6TA 2IXGA 1E4VA 2P69A 2QM8A 3DONA 3OPYA 4TV8A 3THRA 3MTDA 3W90A 2D59A 1NLYA 1ZIOA 4IBOA 3P7MA 5CX4A 1PLLA 1PUJA 2IK8A 2GD6A 1M34B 3OZCA 4X3PA 4RCVA 4BP9A 3L7KA 4OKNA 5JBQA 1KIFA 5DMHA 1GVHA 1BXKA 3P32A 5IZ4A 3QOXA 3LLSA 5JNUA 5KYGA 3A9TA 4ZYZA 3UF0A 1TA0A 2XUOA 4U8HA 1ZMXA 3NV7A 2RAVA 4DTIA 2YWGA 3A7DA 1I1NA 4PF1A 1P2GA 4FW8A 5DTQA 1CBUA 1RQPA 2C00A 3KK0A 4I1IA 4A2WA 4XLLA 2QTFA 2GDJA 5C8YB 4NHOA 2XZDA 3ZHYA 1JX6A 4EPVA 5K8LA 3I5XA 1SFRA 1CG6A 2FCRA 3DAGA 5NLLA 1QSGA 2YN0A 2FSFA 1X42A 2VJCA 2YV3A 3IODA 3E48A 4Q3KA 1DKMA 2GK3A 4NS4A 4WT7A 4M1QA 5TQJA 1L4KA 3P9PA 1V39A 2JCSA 3L6BA 5LZ8A 5T3UA 5LXTA 2AT1A 1QVVA 3U5TA 1GSIA 1HI9A 3I76A 1Z88A 2J67A 5J40A 9GPBA 3CUYA 3DDNA 2PWYA 5KNCH 2GN6A 3OEWA 3QITA 3CX8A 3OQ1A 3KT8A 2DHRA 3ROPA 2ZBPA 4JQSA 1JP7A 5F52A 3ZDZB 5GTDA 3TVTA 2HD4A 2R8OA 5M3BA 4DCPA 3IJRA 1P18A 1KFEB 2QTNA 1PZGA 4FU0A 1JA0A 3CVYA 2EV9A 1KDYA 1RHRA 2WAXA 1HTTA 4JEUA 3GJ8A 5TMPA 4RVUA 1SULA 4FNGA 2CJWB 2HY7A 1SUEA 2GILA 2O57A 2UZ1B 1M1YB 1WCXA 2WD7B 3AR3A 3KQWA 5ALOA 3ROFA 4WRRA 4ALKA 1JFVA 4M0LA 2COKA 3IILA 4TXLA 1QFYA 2Q4TA 1QC5B 5EMKA 3EMKA 1UPUA 4KOAA 3FRJA 5FLEX 3REQB 3JD0A 3U3KA 1TXGA 4G01B 2J0UB 1JBKA 3NOXA 3O9ZA 3Q0TA 4UOQA 1GM5A 3L4BA 4GL4A 1ML4A 1ZCAA 2JJ1A 1X77A 5KVCA 3JR3A 4N6GA 1P39A 4Q3AA 4CNQA 2IHKA 2Q5JA 2D5LA 2O59A 4PRZA 2FX3A 4DLTA 1FXSA 5DFAA 4FJ1A 3UV6A 2RB4A 5FUWA 3S4YA 5A4FS 1HRKA 1UXKA 2HA5A 2ZBDA 4HWGA 2QHXA 5KTPA 4QGBA 1JZQA 4FDLA 1RZUA 2GPYA 1OFTA 2XTZA 3E7XA 1EJ0A 2DM6A 4D02A 4X95A 5EXDA 2FPUA 4QLOA 3V4ZA 4CIBA 5K8IA 4FMDF 1N6RA 2FXVA 1W9HA 3A14A 4DSOA 4NXMB 3DB1A 3IEPA 1C7QA 3K0AA 1CY8A 4OQ4A 5FF9A 2PAFA 3ZCUA 4D9FA 5IH7A 2CMFA 3FN4A 4IH1A 2Y6UA 5IRCD 4PPQA 5IJ0B 2CXPA 2I4NA 3LX4A 3A05A 4OH1A 1BMFA 1XCBA 3V2HA 2RHOA 3D3NA 4Q0MA 4PGFA 1NVWQ 1ELOA 2WHPA 4XD7A 1UZMA 2J31A 2CCGA 1FUKA 4B2IA 3BXEA 3K5WA 4RO0A 2X7JA 4WXPA 4FB4A 3T9CA 5K0EA 1IY8A 2I3AA 2WAMA 3A4TA 2ZROA 4PINA 1XQ6A 2EBUA 4GFDA 4KHPB 3LT5A 1XC7A 3W5SA 4KAXA 7YASA 2I6FA 3NJ8A 5B30A 1YA4A 5JMWA 2C04A 3RVOA 5J3JA 1TJYA 4MKXA 1XXLA 4TL9A 5LJIA 4WVFA 5IG2A 2ZRFA 3DZIA 1JSZA 1X1QA 4AZTA 4IIDA 3VX3A 2VNJA 3KBOA 3PGVA 2FPWA 4PYOA 4H77A 2EX0A 3D5QA 3SHQA 4M99A 3W6UA 3ENQA 5BN3A 1W35A 1E4EA 5E6UB 4BVJA 2KX7A 3A25A 1QVZA 3H3XA 1V4NA 2GZHA 1AXGA 3EULA 3ND9A 1EFUA 4UOEA 3NBMA 3RANA 4IO1A 3DPIA 3UOWA 1XJQA 3GROA 4W9MC 1MOPA 1RC0A 1IZ7A 1EJ6A 3RBZA 1BXRA 1HDXA 1OLSB 1UINA 3HA2A 2CYCA 1NE7A 4ZU3A 5JROA 5JXHA 1JBEA 1GPYA 4GZ3A 2FA9A 1TZCA 1FFHA 2P75A 4ED9A 2C2YA 2CGEA 2BGRA 4PFSA 3ZWYA 5JQGF 2IF0A 2PWPA 2ZJ0A 3UOAB 3E9CA 4UFPA 1E63A 1I3CA 1T3ZA 2N9UA 3LT4A 4L78A 3A9UA 2OE2A 3DTVA 4AJKA 3UJAA 2VDJA 1QCDA 5AXBA 4GGOA 3NWBA 1QH1A 1ZZEA 3AF1A 5LQMA 4RGYA 4YK7A 3GV0A 1J5PA 2XBLA 1RACA 3TJRA 2V55B 3K0FB 3IAM6 4HLQB 4JASB 4TM7A 3MIIA 2XRMA 1PJRA 3H5AA 3O82A 4NC9A 4XQGA 2EL7A 4E2FA 3AHCA 1TK9A 3UG7A 4E0BA 1XAIA 3SSOA 5AIBA 2QTMA 3VU9B 2GRJA 1FRNA 4O8ZA 3RPEA 3COSA 4FN4A 4MYRA 3TDKA 2OHOA 1LVUA 3U31A 3WAJA 4XVUA 3IP5A 3B9QA 2QU8A 4J4BA 1UBJS 2QUIA 5IBRA 2EJCA 1VLVA 1M0TA 1NXSA 2Q21A 2XEDA 2IX9A 1DEKA 5TSDA 1K2WA 2H07A 2CNWD 3R3HA 3G9UA 3QWBA 3PIDA 1J99A 2PU7A 3SLKA 1WZCA 3HKCA 1RLIA 3V8QA 1UCFA 3S8YA 4I08A 4DWJA 1FVOA 5EXSA 1NOIA 5GONB 4BNLA 1P81A 4HDNB 4KQMA 4PPFA 5JO9A 5CK4A 2XD9A 3WKDA 4L0QA 3W7VA 1C4XA 3FAKA 3PQFA 3W2IA 4DLSA 1JQLB 1ULUA 2JIQA 2NO7A 1DADA 1JHYA 1JEQB 1N2CB 1R5OA 2W2QA 4XFJA 1AXEA 5EXTA 5JVDB 1KDZA 3VGPA 3ZCPA 1JAYA 1W4AA 2XUQA 3G2LA 2XY4A 2IC5A 3V4SA 3PFNA 4DEXA 3I5MA 3HA5A 2JJMA 1ORTA 5G0TA 5F4BA 4RQTA 3BPSA 4IS2A 1XVVA 2W8BA 3GLQA 4NZZA 5LP6F 3HU1A 2SCUA 4PGMA 2XWSA 1E6UA 1L4FA 2PJUA 4RA9B 4B3RB 1NOKA 3R2JA 1PUXA 3K9QO 3K70C 5JAIA 4HPJB 1V1RA 3CURA 2XZOA 2IPLA 3CWCA 2FHSA 3QELB 4O25A 1TK3A 3R7WA 2ZTUA 3RHTA 3KE8A 4MQLA 4UXJA 4L9RA 4D81A 4XIIA 5L4LA 4RA9A 3ZYZA 1E0JA 3I1JA 3TKAA 2XV1A 4QOFA 2A14A 2GKOA 1FDIA 1VFNA 2I6UA 2PMKA 4BMYA 1R6TA 5BSFA 2J9GA 1AHIA 2BLNA 1U3FA 3EVBA 3IJEB 3NHFA 4J07A 3R5FA 3KSDO 3I01A 3DYBA 1QH8B 3MGAA 4NLLA 3X2FA 1QU2A 3ZIDA 1II8B 2P62A 4GPAA 4N3AA 1HNZB 2H0QA 4IXTA 2TMGA 2O06A 1AKRA 3AX6A 1QLHA 2D5AA 2Z9DA 2BP7B 5BXYA 1KQOA 2PQMA 4RIHA 3MJTA 4F56A 1XNRB 2R8EA 2LIVA 2PUBA 4XJXA 4DN6A 1KBQA 2HGSA 4K81B 1ZJYA 3KZ1E 1BSVA 2GHIA 3VAAA 2R44A 1MJFA 1U0OC 4JGBA 4ME6A 2O3UA 1K92A 2J30A 1KVTA 4P7GA 1V3VA 4NFSA 1RPZA 4LAFA 3MXOA 4HGYA 2CHFA 1N1EA 2FWJA 2VZ0A 3GHYA 2O8EA 5GONF 1V5WA 3PF9A 2DKNA 3DOOA 2GXUA 1DC3A 1NQAO 1ZN8A 2R7NA 1XKQA 3EXHA 3P27A 4N7BA 2FGKA 2EX1A 3HBNA 3RODA 2AR0A 3F90A 4K6GA 2GPNA 3CLSD 3IUYA 1P0QA 1YD7A 3DVAA 4U7GA 5CK5A 5CTJA 3TCKA 3K8YA 2J7PA 4QELA 4Y6RA 5A2QA 3LAWA 2LUOA 4KB5A 2P2NA 2Q99A 1IPHA 1EM6A 1XP8A 3NCTA 2AMVA 1CY0A 5EIHA 3RVSA 3E53A 4JVOA 4CM9A 3HPRA 4KFSA 5LZ2A 2XDQA 3SHTA 5DSTA 2HNBA 4AN4A 3FPSA 3EDYA 3S2GA 1Q0QA 1NW5A 5H16A 3DZHA 3GCDA 4B9EA 1L6IA 1K6EA 1PFVA 1OLSA 3CY6A 3ZU3A 5FI1B 4F9EA 3HY6A 2WUGA 4YX9A 3I4FA 5HKBA 1JHAA 1Y7IA 5G3YA 4DR3B 2IUUA 1E4OA 1TDJA 5A9TA 1R15A 1U9IA 2HJVA 2OK7A 3I92A 3QEOA 4UULA 1OJLA 4O29A 3SC2A 4CV0A 5I4BA 3VGJA 4D0SA 1E4EB 3A3KA 3DE4X 1U6KA 3DP9A 2A5FA 4YJ3F 1Z5WA 1SU8A 2G06A 3ZHSA 4EGAA 3L79A 2EFCB 3PQ3A 4GXRA 2IIBA 3FZQA 4QRHA 2NO6A 3QIVA 4NBTA 1XD9A 4Y6PA 5FBWB 5UKDA 4AYXA 1E5XA 4NU6A 1RHQA 4A4DA 4KPUB 1L7MA 3QQPA 4REQB 3P9KA 2YVUA 1UODA 4C6SA 2UXCB 5CCEA 1X14A 2BISA 2DVMA 3U19A 3ZHBA 5A3VA 1L7VC 5BWNA 1PJSA 4GKAA 4JH0A 3ROGA 3QFTA 3WFZA 3K8ZA 4FFWA 5JXJA 1SUBA 3SR0A 2CHQA 1USKA 5IJ0A 1MU0A 3TLKA 2OECA 1FSZA 5ALTA 1I7LA 1ZHFA 1VA4A 5AVJA 5IK2A 2VP2A 1MTZA 4EFDA 4BTLA 1A82A 2IYSA 4KAAA 1GPMA 3MCTA 3TX6A 5GIOE 2PYIA 1E2QA 2BTEA 3K70B 1XQVA 2GYWA 4NZYA 4BJ3A 5JD5A 2GDZA 5JZMA 4ZA2A 1XTUA 1RZRA 4PRKA 3IA2A 3MYYA 2HCFA 4HEQA 1E9BA 1ZW1A 5IN5A 2D1SA 1JXAA 4J03A 5HRUA 5DPMA 1XZFA 2RMKA 5K01A 2O8CB 1PCXA 4JDPA 1DIGA 2A7QA 4LBYA 4RSMA 2R84A 3L2OB 4ISCA 5DCYA 5I47A 2O19A 5B58C 2IXAA 5CEEA 1PJTA 3AF6A 3NHWA 3VFDA 4PQGA 1ZK1A 1O0BA 2RHCA 5HTOA 1Y37A 1CHNA 2ODTX 4RORA 5C52B 4WFIA 4D2IA 1AKTA 3IHKA 1GQ2A 3EVFA 4FOLA 4MI6A 5THQA 4JP3A 4INJA 1RBZA 4F2DA 5JJIA 4B4OA 1SKYB 1Q7EA 4RK7A 1T9CA 4XTRA 3T1VA 5SZIA 1KMNA 2P8SA 4LYHA 1U28A 5HUQA 1Q5PA 1IEXA 1X7WA 1XN1A 2VDUE 3OZUA 4FQ8A 4P2BA 1PR3A 5CDSA 1W2WB 2H6EA 1SHLA 3G82C 3PX2A 4MWSA 1J9ZA 1UK6A 3RGWS 2JDID 3RC2A 2V0GA 4L95C 3DUWA 2LCQA 3VC3A 2HIHA 5TEVA 1LJ8A 3R7AA 1S89A 1UWKA 1MF7A 3R7FA 3CONA 3MRTA 4UMDA 4HSGA 1CQPA 1V3TA 1UBLS 2ERXA 5D1HA 4XGNA 3VR5H 2XOEA 4D4KA 1Z13A 1BIFA 2JZOA 5JAQA 3PRJA 4GPBA 4BIIA 2BEVB 3EK2A 2OCXA 2MSDB 1X2EA 3I9V6 4R2KA 4KBYA 4WY8A 1KZ1A 4QDZA 3WYAA 4ZYTA 5D5HA 3HR8A 2VK8A 3KYJB 4MITA 4U6QA 1ZJ5A 1QP7A 3ASUA 4U0JA 4F72A 1PWEA 2QTTA 4RD4A 2DBVO 1TVMA 3Q7IA 4GQBA 5I4KA 4D0RA 3IHTA 1TKAA 3BB1A 1ZRMA 2E89A 3HGMA 5CVCA 5IUKC 1NVXQ 1N8SA 1IBCA 5KYWB 1SOWA 5CB8A 1V7QA 5ALEA 1DVRA 1NP3A 2E4AA 4C29A 1EFDN 2OB2A 3DHNA 4OB6A 5EZYF 2Q07A 3RJMA 4BZPA 4BDSA 1I94B 2OCBA 2HMAA 3VR3A 5BV2P 4CGYA 4RVSA 2BPOA 3RSFA 3E9QA 5B36A 5C8YF 4AXBA 2PBFA 5FUYA 3OQOA 2OGUA 3VTKA 3N0RA 2D5BA 1QYCA 5C32A 1KPHA 1N9GA 2YHIB 4Q82A 1M6NA 5K3SA 1XJ0A 1JXQA 4TYNA 4MVXA 1E1QD 2Z5FA 1H8HA 3QQ5A 4HAXA 2P5TB 2OZLB 3IE2A 1NMZA 1WLSA 2YY5A 3M70A 4CMEA 4DMUB 2HU7A 5CA0B 2IH4A 4EHNA 1YS9A 3KUKA 3UJ7A 3NHMA 5KX5A 2PH3A 1REQA 2VZLA 4J3FA 1IUOA 3E84A 3IMKA 1XMSA 3KZCA 2IYNA 3LNCA 3IAS1 5D00A 4FDMA 4OHVA 5J5VA 1JPNA 2C95A 5CHEA 2CVZA 4MV4A 2YQZA 2XDWA 1XA4A 3CINA 3CLVA 3R6DA 3OIFA 5EXXA 3FKSD 4EO9A 3V7FA 1Q2XA 5I9LA 2WYOA 1DRKA 2DWUA 2ZQ5A 1AJEA 5KDDA 1V3QE 5AVOA 3AI2A 3Q7RA 3STTA 5EHXA 5D5PA 4CEHB 2A9QA 4JI8B 3VYTB 2JLCA 2CJPA 1L5HA 2VAXA 5A4MS 3B1XA 3INGA 3NUGA 4TYPA 5KMGA 5C53B 1FMJA 4IDBA 4RABA 4UQLA 3HHPA 1LI7A 3O75A 3PK0A 1ZVMA 2BFMA 3AMVA 3QHQA 4YAOA 3NNSA 1XCOA 4PYNA 2P2GA 8GPBA 1IFXA 2IPNA 3K8QA 5BNTA 4YRGA 3IP6A 4PSAA 4YAIA 1V45E 1H2AS 3D8SA 1C1XB 3FBWA 3PJDA 2XT9A 2QTRA 1VIYA 1B2RA 1NVFA 2I6QA 3B3JA 1BVRA 2ZK7A 3G6KA 4OQPA 1GL7A 1I3KA 1JS1X 4MW5A 4OQQA 1KHHA 1UXOA 4GBJA 1E20A 2IYOA 2VA8A 2XI4A 4HR7A 4N3BA 2X0KA 3ZWBA 2ZRPA 3JQGB 5EHGA 4PONA 4Q3LA 4CZ2A 3QW4B 4CLXA 3A4VA 1DJNA 3THYB 4QL3A 2WTXA 4UAUA 3MOIA 3CJRA 3KUXA 2XDQB 2YH2A 1C7RA 1ZK2A 5B7NA 1L7QA 1THZA 3WIEA 2DF8A 4DTCA 3O1IC 2IHJA 1I6MA 3GBSA 1G41A 1L7AA 1EWYA 2R48A 3CR7A 3QK7A 4C78A 5AI0A 4OTZA 4YUXA 3LUDA 1COZA 1LWNA 3JARB 4Y0VA 4R8SA 1Y7TA 1HOXA 3TTWA 2L69A 3IPYA 2OO3A 1E0KA 1E2IA 3SOPA 4RETA 3D1VA 4XE5A 3DFZA 2AHRA 5NULA 3MTJA 3HVKA 2VN8A 2I65A 2CLIB 1NXWA 3ITEA 4NVRA 3D3EA 4MI1A 2H1FA 3RYTC 2WDPA 2WKPA 1WXFA 3KTDA 3L1HA 2VT7A 5CVJA 3GZNA 4OXRA 5E7JA 2R6GA 3S2UA 1NF3A 1DIAA 3O8NA 4NCXA 5IBPA 4FILA 5JZSA 5KWJA 1M2NA 4CF5A 1Z0AA 4TRRA 1YZYA 4P3XA 1C0KA 1AZTA 5IC6A 2DZDA 2AUNA 2WZCA 1W19A 4ZO8A 4P0PB 4JI0B 4INPA 4H7KA 4U5XA 3EZYA 3G2PA 4RLQA 5ARDA 4AYWA 1K4KA 3IP3A 2VSNA 3KZKA 5U9CA 1X1EA 1GKLA 4UOZA 4ARIA 1YH3A 2LCIA 4CIYA 3NM5A 1SNYA 4EQZA 3GVPA 2Q2OA 3K1YA 3PP8A 5DF1A 5LIRA 3A04A 2WILA 4J75A 3AFGA 3HEMA 2OQVA 1EVJA 4OQEA 1BMTA 1SEVA 1W25A 3I5YA 4FOSA 3F8TA 2G83A 1MQ9A 2VUUA 3PL1A 4I9UA 4MJ7A 2ODNA 3ELYA 3JQ7A 5EZYB 2BZ0A 1HKHA 3CRVA 4QPZA 2O8DA 2HU8A 4O33A 2PN1A 1A7UA 3BJEA 4RHTA 1G9SA 1J21A 1UC8A 5AM4A 1QGED 2JIOA 4BVGA 1TLTA 2OXFA 3B2QA 1FVXA 4YH1A 1JHZA 2ZYUX 4CM5A 1MDBA 1QJCA 4DG8A 3UZUA 3WC4A 1O8CA 2IYRA 4EG1A 3E05A 4ZARA 2QNBA 3UKOA 3TD2A 2LDXA 1TRKA 3D31A 4KO8A 4LV6A 3RWMB 2I2FA 4LDZA 4QDJA 1YDGA 3HY3A 4QHYA 4NZPA 4GOOD 1NUHA 3JASA 3RTDA 2WM9B 1R3DA 1B6TA 4MEAA 2W2KB 3FCOA 4Q7LA 4LC1A 3BTVA 2V7TA 2DFPA 4LQ4A 4AP5A 4OYRA 1MUUA 2W2MA 4NOKA 5JRJA 3EUWA 4IV5A 3G6WA 3PGXA 4DLUA 4PO3X 1QGOA 2FR8C 3S6JA 2X40A 1BXGA 1QBKC 5DXAA 3THOA 4HDOB 3LXUX 2PMDA 3KHKA 1ZIDA 4Y6LA 5A2GA 3S7ZA 5F5XA 3E7PA 5JVDA 1LBSA 2EW1A 1MAHA 3AJRA 4Q5IA 4G07A 1EJBA 5GGXA 4IRMA 1PVVA 2GF9A 4RVOA 3KC2A 1JHVA 4J1NA 5CVEA 5EWMA 1XKTA 2RONA 5GP1A 4CJXA 4BFTA 4QZVA 2UUBB 1XHFA 1CETA 1EDEA 2J7KA 2XMQA 4MR7B 3CNQS 1ZBDA 4FHEA 3HA7A 3S2EA 3A2KA 3RUPA 3O8CA 4YALA 4A0QA 1C4WA 4ARUA 3DWIA 5CT8A 4R9UC 2CHGA 4XGIA 4U7PB 5BSTA 4BUCA 1JLMA 4CMJA 3M49A 1EGMB 4E2XA 4O08A 3QBTA 3HXOA 2YCLA 1TTTA 2G1KA 5HF8A 2VWPA 3ZDEA 5IC4A 4ZOLA 1V7CA 4L6IA 2PFGA 4DNPA 1MO4A 2MR6A 5JQGB 1V11A 2ZFUA 2G36A 1KAGA 2Q7XA 4J9UE 3WO0A 4BMOB 2FHPA 2J0EA 1DC7A 2GKSA 2QAGA 3I32A 4HLCA 4TV9B 3K0FA 2I4IA 4I4TA 1XRLA 4K5QA 5DM70 1WQ1R 3N7TA 4TMZA 3HNRA 4ZODA 3UKDA 4RFSB 2EVWX 1GAQA 5J2UF 2NPIA 1TYEB 3QUCA 5AKHA 1EZZA 3HJRA 5FRDA 3UT0A 2XMDA 3DTVB 2G8NA 3OF5A 5B1IA 4Z4HA 5JAOA 4UBJA 4AG6A 2K2WA 1V4VA 5FWXA 2VEOA 2GEBA 2HI0A 1U2QA 2R6FA 3R6WA 4C04A 5HR5A 1P8AA 2GB4A 3L5KA 4LG1A 2QKYA 1NVDA 3JWPA 2PK3A 4MWBA 5AI9A 4DJDC 4BY9E 2O6HA 3IAUA 4ND2A 1BXRB 1UBFA 3QWHA 2QPAA 2BM0A 2WBLC 4RY9A 2IV3A 4IJUA 3GGGA 1E77A 1Y81A 4PHHA 4X85A 2E5FA 4DMGA 2VQSA 3S2FA 1HBJA 4U7FA 3CCFA 2YWEA 1J9GA 4RYLA 3MMPA 5E6UA 4LRXA 4WACA 1BS1A 4O4LA 1VJDA 2NU9A 1GTRA 4JYAB 3O7MA 3P96A 2R8YA 4KZKA 3WA6A 3G5MA 2VTBA 1HMYA 3NQ41 2HXYA 3VUEA 1GKIA 3VI3B 2YICA 1S0UA 3ZZNA 1USGA 1VMEA 4D4HA 4EB6B 4JT4A 5ALSA 4E7PA 3QVSA 1A0OA 2JAXA 1PT9A 4JY7A 4LRYA 2YVQA 3H17A 1C7JA 1Y5LA 2FW9A 3MS7A 3TYXA 2QN7A 4E4TA 2ACKA 3CB2A 2NUAA 1YB1A 3H05A 4CEJB 4D9KA 1L4UA 1TO1E 3LPLA 4B75A 5FOSA 4YMVA 3PYXA 3ZUGA 1OHHD 3I9OA 3MXTA 3Q2IA 2BFAA 3M0EA 5T5QA 1MFZA 1NNUA 2D2IA 3VSEA 1FNSA 1HFJA 5LCXA 3WSTA 4CCYB 5BUZA 4NMLA 1IIBA 4N3CA 5EJ9A 2NVOA 4B82A 2W93A 1TADA 2Z83A 3K0AB 5AVUA 2AKYA 4D8UA 2ZJFA 3AYXB 5KJCA 1CF4A 4ID9A 1QXSA 1R8XA 2R7LA 4F2GA 1JPVA 3K2QA 2BMFA 1RWMA 5JT1A 1VXOA 4KFRA 5EG5A 2VDOB 4G1EB 1E9SA 1KWGA 3AVQA 4HQNA 1SJ9A 2B4YA 4O4JA 7ABPA 3GRYA 1PFGA 1QGUA 5EP4A 4WBNB 1M5RA 2GN0A 1B41A 4TLEA 2Z9BA 4LMRA 1S1CA 5ALGA 5DWDA 4G1VA 4Q19A 4RHEA 3COVA 3L1VA 3WLOA 5B6PA 3L46A 8ATCA 3VR5A 3HCWA 3D8TA 1IHUA 3REQA 4KE7A 5AHRA 4Z4IA 3IBTA 3L1JA 1M2JA 3E7FA 4PC6A 2H2IA 4B6PA 4RK1A 2GEVA 4C7OB 4Z9YA 2W83A 4Y2YA 4HVCA 2JH9A 3AUAA 1T6XA 1K5HA 2ZBQA 4O2LA 4RH3A 4WFQA 5EPOA 3CEMA 4KXWA 1LEHA 1LX7A 2BF7A 2ZUDA 3W7BA 3VNVA 2D3TA 5K8JB 2X8JB 1P2SA 2CJFA 2Q2NA 3GT0A 1YAHA 3I39X 3P2OA 4KXVA 5TMEA 4D0GA 4D98A 1KAOA 4EYSA 1BGXT 1QZZA 3U7FB 3LL4A 4FIDA 1CR1A 4PQRA 4Z1MA 3WK9A 4XIFA 4A5OA 2QTAA 4O1MA 3WGIA 2ZQYA 3DMHA 1NASA 2D1QA 3BWVA 3EF1A 5LR6A 3L02A 4D5EA 3D8BA 4GNRA 4LRQA 3EUAA 1YOBA 2D13A 2RKOA 3FHJA 2DULA 4IQ8A 2X0FA 1RSZA 4ZO4A 2GN9A 3PHCA 3QE4A 3BDAA 2TMKA 4KE6A 1QQ5A 3ITKA 4XUCA 1BW9A 3TLJA 3IEMA 3DQPA 1RQRA 3GAMA 1UJCA 3GRVA 2NTJA 3AFHA 3EUEA 4YJHB 3ZJ5A 2DR3A 2G3YA 2D6FA 3B7GA 3AUFA 3SZLA 1JDBB 1W4CA 1R4ZA 1TCCA 1GA1A 1AIPA 5CXUA 4YUAA 3KSBC 1XTKA 5ITZA 2PMFA 1J8QA 3W5BA 1EJ2A 1QTIA 1YU6A 4KRYA 1L8XA 2WABA 3IV9A 3WLQA 2ZXUA 1Y6RA 4H1UA 4QJIA 3OIWA 3PFIA 3TAUA 5F35A 1PI3A 4QBHA 2KI5A 2Z57A 4UUMA 1V9SA 2WJZB 5DCLA 1OF1A 3ST7A 4F9GA 1IXYA 1PR0A 1ZD5A 4GLFA 3IAEA 5ALZA 3HK2A 4DDMA 4MGHA 4LJ9A 5EP2A 3JAKA 1CRWG 1S2DA 3Q0IA 1SPXA 4C7XA 2JLYA 1Y8ZA 4CKEA 2GAIA 3I6YA 1ID1A 4XJSA 1NJFA 3K9LA 5EY5B 3G7SA 2FWNA 1PJAA 1BD3A 5F51A 5L51A 4YDRA 4BO5A 5JH7B 2E82A 4AQYB 3W78A 1FYEA 2V3WA 4KXMA 4EEKA 4F85A 2IGTA 1EG2A 3RUDA 4EW1A 2HCTA 2PVCA 2BFOA 1D0SA 2QMEA 4FCWA 3I0NA 2QT9A 5K0BA 2I99A 5KBYA 1OI3A 2WJHA 4HBGA 1W2GA 1UBOS 3DTTA 3NATA 1RQLA 3GEGA 1D4FA 4L7VA 3GVXA 2AUMA 2NTEA 1F2UA 2JHGA 1XEWY 3IAS6 3S68A 4ER6A 4NZ9A 2KLBA 4JJFA 4DUGA 2WQZA 3B1YA 4Z4FA 4DC0A 3ER9A 2DT8A 3O21A 1JIUA 3MW8A 3PUYA 1Z8FA 4MZDA 3I6ZA 4MGKR 3M8KA 3FF1A 1EM8A 1QV7A 1AVTA 1WW2A 2P9GA 4NF2A 3LE8A 4X9XA 1CUAA 1LJUA 5ERXA 3SEQA 1J1UA 4QUBA 2VHYA 2C9OA 3SM3A 4PG6A 5BQOA 2OC9A 3VZBA 2DPLA 3UEOA 3ASZA 3LRPA 3LW8A 2ZUEA 1Y6QA 4U2CA 3Q8LA 1I5OA 1P9RA 1XN4A 2YYAA 1V0JA 3MINB 4PZZA 2G6TA 1GSAA 3L6RA 4ZQHA 3GDWA 5T6MA 3IS3A 4HWOA 3FWYA 1YXMA 3QKUA 2BBSA 4WXRA 5AO9A 1C9JA 1UFOA 3HJTA 2CNLA 3BE5A 5F78A 4BO6A 4B3HA 3WGNA 1M6HA 2A0UA 4YJDA 1IY1A 2I2CA 3C1UA 1DKQA 3R41A 1FDTA 4XCVA 3GEMA 4GC5A 4MS3A 2HN9A 1H05A 4PBSA 3NB0A 4TYMA 4UU7A 1AQNA 4QGAA 3DLIA 3L4KA 1H5NA 1LPOA 3G2IA 4L0CA 3VAZA 3F4BA 5ENVA 3VDRA 3MD9A 3A1NA 1HA3A 5E1BA 5JANA 1RHKA 4WESB 1PWYE 3G0IA 4JT9A 3RQIA 1NX9A 1GLNA 1RW4A 4RV5A 1NC3A 4W99A 4BQOA 4QGFA 5BMOA 1KH1A 2ZPUA 3KKPA 4YUVA 3EZ9A 3QVGA 1ADCA 3GLVA 1NJGA 3K1TA 2AFHB 4S2EA 2CY0A 3ERCA 4UHJA 3VO1A 3WLEA 2JH8A 5A9SB 1BWRA 2DBRA 1KMIY 1AKNA 4CR6A 5HFAA 2HMSA 5FYDA 4LNHA 1KGDA 4P7BA 4IXNA 3HCEA 1YMVA 4M2LA 1NP7A 5HKOA 3OFND 1SURA 2YYSA 1ESCA 2IJGX 4BLWA 4EA9A 5LZ4A 2JPDA 3GLFB 4BXOA 5TE9A 1X39A 4MRVA 3WBBA 1MZVA 1YQUA 4WZBB 1DPGA 4KL8S 1VGRA 1VP9A 4YP7A 1ZQ1A 1OLOA 4B4VA 4POAA 3D6VA 3E18A 4OX9B 1NKSA 1OX6A 5KTNA 1ZGZA 3NVKI 4N9WA 5JS7A 3GFFA 4ZVRA 1LZKA 2GJ4A 2WM3A 5DMXA 4E4RA 1UMBB 4I55B 4DLZA 2A94A 1O89A 1Q20A 1T2DA 3F0TA 4TVKA 3RK4A 1F9EA 3E9RA 3IRVA 4DPKA 5F23A 3PXAA 1JWBB 4QXPA 5FTNA 1OLXA 4YAGA 2JRCA 2HQRA 1KARA 3W2EA 1OTXA 1D1PA 1GCGA 1G7TA 1JECA 4MVJD 1KF0A 2P5UA 5AW8A 5D6NA 5ALHA 3TW4A 3A06A 2Z2YA 3DS8A 3W5VA 1CZOA 3GAFA 3DHEA 1TO6A 2W2XA 3PHBE 3WJ2A 2HCRA 3GDHA 4EY6A 4ENRA 2HRDA 1UWLA 2F43B 4PXSA 4FYHA 4DBLC 1V1JA 3H4IA 4BLUA 3W5DA 1XLTC 4FX2A 1QS0A 1TZ2A 3GLHA 4PHGA 5D3KA 3DQQA 1G7SA 1D7OA 4QAQA 4PZLA 2B37A 3OMWA 2A67A 1CUEA 4NYJQ 3KD2A