1J1IA

Crystal structure of a his-tagged serine hydrolase involved in the carbazole degradation (carc enzyme)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
258
Chain Sequence
AYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta cleavage compound hydrolase
publication title Crystal structure of a histidine-tagged serine hydrolase involved in the carbazole degradation (CarC enzyme).
pubmed doi rcsb
source organism Janthinobacterium
molecule tags Hydrolase
total genus 87
structure length 258
sequence length 268
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j1iA00
2XT0A 2WHPB 1MX5A 3WK9A 2WIJA 4EZIA 3FOBA 4N8EA 2RIPA 3ZWQA 5A62A 1AQLA 2G4LA 4M0MA 5E4YA 2WQZA 5T4BA 2PBLA 3C6XA 4Y2SA 2DCMA 2VT7A 4QDTA 5LKAA 3QPCA 3PDCA 2BCEA 5AOCA 4OB8A 1U65A 3FYUA 2QUAA 3RK4A 3DKRA 1F0NA 3FVTA 1XRPA 3FYTA 3CN9A 3ESAA 3O4GA 4DIUA 1EI9A 2WM2A 3IIIA 1CEXA 3CCCA 4FWBA 5DWDA 4OU4A 2Y1KA 4QDXA 4C88A 3O4JA 4YX9A 1XZMA 1XQWA 4RNCA 4CIBA 1QIGA 1CUZA 4PSCA 1MO2A 3VVLA 4BAZA 3I2FA 4H77A 2V9ZA 1BU8A 1LGYA 4WCVA 2WILA 3D2AA 3VKFA 1FFDA 4W1QA 4Q05A 3AUKA 2GZSA 4Z49A 2DR0A 1UWCA 5H3HA 1LBTA 4KE6A 1N8SA 4W1RA 2DHEA 5CW2A 1QIKA 5JD6A 5AKKA 3A6ZA 3WA6A 3R3UA 4TGLA 4MYDA 3ICVA 4BE9A 2DSNA 3CXUA 1E8DA 1MAHA 4OB6A 1VLQA 5DTIA 5FKJA 3QH4A 5AI9A 4J3JA 3ZV7A 2CUTA 1QIEA 1Q0RA 1FSSA 1EB9A 1E3QA 1E89A 3V1LA 4AXBA 1UOPA 4U2FA 4FBMA 5ALPA 3R3ZA 4HRXA 2PM8A 3H18A 1VA4A 1LPPA 1HDEA 4X97A 3I2JA 3IB3A 5AI6A 2EDCA 1L7RA 4KJXA 3D7RA 5JATA 4M0FA 3ZLVA 4P93A 2PL5A 2B20A 2HU5A 3DD5A 4UBLA 1E5TA 5AK4A 1XZJA 5ALSA 3F97A 4DYHA 4X6YA 4H7KA 4X00A 1QE3A 1VE7A 4U2CA 5EIAA 3WQHA 1E8NA 5HQ3A 5LKRA 4X90A 4X94A 4G8BA 1NU8A 4Q3OA 4Y2TA 3R41A 4WFJA 4B85A 1LPSA 2JEZA 5DYYA 2PU7A 2W22A 4EY4A 4HS9A 5AIAA 2X76A 6YASA 2R11A 1VE6A 2VEOA 2JBWA 5AH0A 3WZMA 3FVRA 5JARA 5J3JA 5AHXA 3WA7A 1HLGA 3JWEA 3QPAA 3GA7A 2C0PA 4BRSA 3I1YA 3HSSA 3C5WP 2ZJFA 1BROA 2XMGA 3BL8A 2Z3ZA 3K6KA 3WWPA 2XMBA 4C01A 3B3QA 2QZPA 5AJHA 2Z8XA 1XRQA 3OM8A 4MEAA 1YB6A 3KSRA 1AURA 1HBJA 1SCIA 2WHPA 5A71A 2WG1A 5K3DA 5CXXA 5KWIA 3IBTA 3DCNA 1TCAA 5KWJA 4FFVA 5FDFA 3MGAA 3AILA 2ROQA 1VA5A 2G5PA 1XZDA 2AJ8A 2Y2VA 3BF8A 4ZWNA 3S8YA 5C8VA 4B81A 3IURA 4H7JA 4DNOA 3WK8A 4KE7A 3NWOA 5LLSA 1GPLA 2V97A 5K3CA 4B84A 1XQVA 4EY8A 2CBGA 4G4GA 4H7FA 1CUDA 3KDAA 4U2GA 1CPYA 4TVKA 3G02A 3H04A 4UHBA 2WFZA 5JASA 3BIXA 4BP8A 1DQZA 3MUNA 1U8EA 1ISPA 5HFAA 4QE3A 1J2EA 2C5FA 1UOQA 4J0CA 4N5HX 1J1IA 3HYSA 5AK6A 3FCXA 1XROA 5ALYA 2ZSHA 2J3DA 1XZBA 4INZA 4E11A 2XMSA 1EA5A 3EF3A 5JD5A 3G7NA 3VJKA 1WB5A 2WHQA 1TCBA 1THGA 5IKXA 1MX1A 1QFSA 4K6KA 2IIVA 2BGRA 4L72A 2PX6A 4P92A 5FRDA 3SX4A 2PSHA 4F21A 4OU5A 3E0XA 2K2QB 3I2GA 3EQ7A 5LP1A 4KR0A 5AK5A 1KU6A 1UFOA 3T52A 4PF1A 3ANTA 1T2NA 7YASA 3NGMA 3O4IA 4UPDA 3N0TA 3LP5A 4EHBA 5AKXA 2VJAA 1H2ZA 5EGNA 3WI7A 1M33A 2XUHA 3D2CA 3RLIA 4QZVA 4DGQA 1HPLA 4UFOA 2PKYX 2WIFA 4F5ZA 1IUOA 3C87A 1D07A 4JEIA 5ALQA 3SK0A 4Y2JA 3VJMA 3QVMA 1K63A 2AJCA 2JGKA 1MAAA 4HXFB 5JZ9A 5AK3A 2ZYRA 1BS9A 4C4ZA 5HCUA 3C8DA 4OPMA 4C4XA 5A6VA 1O6FA 4QLAA 2FUKA 1FFBA 1ZJ5A 1WPRA 3ESBA 3QITA 3WYNA 1G4HA 2OAEA 2HU8A 1DU4A 1EDEA 4X93A 4B9AA 1GT6A 1WPXA 4X3CA 4QWMA 4I4CA 3G9ZA 4P08A 3H2KA 2IX9A 4WJLA 5HK9A 1GPKA 1AC5A 5AKGA 5ALUA 5K3AA 5DLPA 1YS1X 2VJBA 1IZ8A 2PPLA 1MU0A 1RYYA 3I28A 5ESRA 4BZZA 1XLWA 1JJIA 4AO8A 1EXWA 4K5QA 3WWCA 2HHAA 4W1SA 2GBFA 3D59A 2H1IA 4HRYA 2VATA 1BN6A 3BJMA 4RE6A 5FXMA 3WLAA 3FLBA 5JAPA 1G42A 1RP1A 2OQIA 2OQVA 4YASA 4UBMA 4UHEA 1TIBA 4BCCA 3OURA 4WDRA 5BV7A 4AN1A 3STVA 3V1NA 3TEJA 4YPVA 3MUOA 3AIOA 3HRHA 4G9GA 1CUVA 2WIKA 3E4DA 2WJ4A 1CUBA 1TKRA 4BVLA 3X3HA 1XZKA 1LZLA 3LCRA 1ZI9A 4X85A 1FFEA 1NX9A 1CUFA 1MNAA 4JYPA 4S0XA 2G63A 2XI4A 3G8YA 2XUDA 4DLNA 2WG0A 3DNMA 4AZ0A 3D3NA 3WK6A 4B80A 1FFAA 4LHEA 2D0DA 4I3FA 1GKKA 1XRRA 2WU3A 4U2EA 2ORYA 2XMDA 4DM7A 5EHZA 4AZ3A 1QONA 1AZWA 5HF6A 1EVQA 5I7UA 2QS9A 4FNMA 2QTBA 2GBCA 1R3DA 4DTCA 2QJRA 1AX9A 3VISA 4PSDA 1QLWA 4BTVA 3LS2A 4KRYA 3DYIA 1XZAA 2OAGA 3A2LA 2C0QA 3R0VA 4BTLA 5EHXA 3C6BA 4CFSA 4EB0A 1K5PA 3A70A 2HA7A 1THTA 5AICA 1JI3A 2BGNA 1XFDA 3P2MA 1MT3A 4M0EA 3IUQA 4XX1A 3FCYA 3WWEA 1A8SA 4G4JA 4Q3LA 3PFBA 4I19A 1VZ3A 4JYMA 3YASA 4A16A 2O7RA 2BUCA 3U1TA 1UK6A 3HEAA 3H1AA 3WKEA 3R3WA 1XRMA 3C45A 2R8BA 1DTEA 3BE8A 1A88A 1YCDA 1ZI8A 4UHHA 3PICA 5FOQA 5K3EA 4A5SA 1AGYA 3H2JA 1LPMA 4WDQA 1CLEA 2XMCA 5EFZA 2V98A 1MN6A 4BP9A 4L3WA 5K3BA 3HI4A 3GELA 1TK3A 3VJLA 1OILA 2ZJ7A 4G9EA 1QJ4A 1CUEA 1CIJA 2QJWA 4G8CA 5DTJA 1JT2A 3ANSA 4U2DA 1LLFA 4ZI5A 1XZCA 1A8UA 5FPPA 3OTQA 1EHYA 1H2XA 5IVKA 5D6OA 4E14A 2EDAA 4KAJA 5BOVA 4XIIA 3DKKA 3EIOA 3FWHA 5C8ZA 5JIBA 1ZIYA 3PFCA 1CUAA 1DT5A 4CG2A 4J0DA 1LBSA 4EY5A 1L7QA 3TRDA 1A8QA 4QNNA 5AOAA 1R9MA 3NUZA 5ALIA 4ZXFA 1Q83A 3AZQA 5ALJA 4KYVA 1R88A 2OGSA 4D9JA 3M81A 4GEGA 4HAIA 3WZLA 2YH2A 3A2MA 3I6ZA 4UHFA 1QOZA 1GGVA 2XUAA 4QWWA 3ZLUA 3RKSA 2C58A 2PSDA 2FJ0A 4OD0A 2I03A 4FBLA 3W05A 2XUPA 1SCQA 5LZ9A 2QXTA 3WK5A 5IVIA 3WYDA 5E4TA 4E46A 3BIWA 1BEZA 1TCCA 4OB7A 3GZJA 5AM0A 4Y2YA 4AMYA 2HIHA 2JGMA 3ESCA 3HXKA 1ODCA 5SYMA 4IH4A 2HDWA 4WFKA 2OCIA 3QM1A 1WOMA 4FLEA 1BEEA 4DSZA 4NVRA 4FHZA 2WFMA 5AKEA 4O08A 5IVDA 2C7BA 1E66A 3DLTA 1IUNA 5CH3A 1WHTA 5HF9A 3WKCA 1CUHA 4N8SA 5AI8A 2RHWA 3HZOA 5AI5A 2V96A 5E2IA 5ALZA 5JZSA 4K2AA 4LXGA 5ALWA 3STUA 2XUJA 3R3XA 3PF8A 2XB6A 5C8XA 5HF5A 3QPDA 4PW0A 2WUFA 1W4LA 4W63A 3KWFA 4GECA 4X92A 4Q82A 2GZRA 4HZGA 3I6MA 3H2HA 1Q0ZA 1XKTA 5DYTA 4HXEB 1XZHA 4DMKA 5HFNA 2RONA 4BCBA 1BN7A 1CUIA 1BRTA 3HACA 3L1IA 1XZGA 2AJLI 4OYLA 4V2IA 4EY6A 1XZFA 3G0BA 1UT6A 5K5EA 5LZ5A 2VT6A 4IH1A 3GFFA 3H1BA 3IUNA 4CCWA 1EH5A 1ZIXA 3HC7A 4BCDA 4K6GA 1X70A 1VXOA 5CT9A 2O7VA 1CQZA 5JADA 4J0KA 2WLSA 3WK7A 3WWDA 2JF0A 1YAJA 1QFMA 4EBBA 4FLFA 1Y7IA 5AKLA 1N5MA 3IULA 2CMFA 2PSFA 1DWOA 1UK9A 4FMPA 5ALHA 3IUMA 4B0OA 1PV1A 4XWGA 3B5EA 5LZ7A 4UUQA 5JD4A 1VKHA 3DEAA 1CFJA 1DWPA 3H17A 2WSLA 4XVCA 4G4IA 5CT4A 3TGLA 5DYWA 2QM0A 1KU0A 2VJCA 3AFIA 4UBIA 2ZYHA 2JIDA 4X6XA 1VOTA 1F0PA 1YR2A 4GI1A 1HKHA 4Y2VA 1LPBB 3C5VA 3DS8A 2XUIA 5AOBA 1R9NA 5F4ZA 1I6WA 5JALA 4HVTA 4BBZA 4X95A 2BUBA 1QTRA 2ACEA 1ZD4A 4LXIA 5BWBA 3VXKA 4DNQA 3H2IA 1CV2A 4AN0A 4IHAA 3Q8WA 2OLEA 1WHSA 3DOIA 4QDUA 5AKZA 5HK8A 3W06A 1Y37A 4LYDA 1UKBA 3STYA 2BJHA 4QLOA 3AZPA 1CUSA 2XLCA 4MQLA 4ZV7A 5EI5A 1W6RA 4UFNA 5ALTA 4WY8A 1XQYA 3WKBA 1H2WA 1CQWA 5JAUA 2Z5GA 3SWWA 2O2GA 2CEKA 1CUWA 4Y2PA 1C7JA 3KD2A 1IVYA 4FLMA 2YYSA 2ZSIA 1XZEA 4UBKA 4N5IX 4CCYB 3STTA 4MYSA 5AM4A 2Y6VA 3G9XA 2VSQA 2WTNA 1IZ7A 3C43A 4BB0A 2PU5A 5T4HA 3I6YA 2G5TA 4CIAA 3F98A 2DQZA 1U2EA 4Y7DA 2XQGA 1QO9A 3DL7A 3VVMA 4PSUA 4BDSA 2RAUA 4AMZA 5AKYA 5LZ4A 2AXEA 4AO7A 3LIPA 2VTVA 2RI6A 3R3VA 4FOLA 3AINA 2WIDA 3WJ1A 5AM5A 1UZAA 1EDDA 2FX5A 2DHCA 3WIBA 5YASA 5HZGA 4AX4A 1S8OA 2OGTA 2XLBA 5HF8A 1IMJA 1QIMA 3GBSA 4W9RA 3CN7A 5CXUA 5ALXA 3I1IA 3G0CA 1AMNA 1R1DA 3FLEA 3E1GA 2BKLA 5I8PA 3IVMA 4ROTA 1O6GA 3UUEA 4KE9A 4UBOA 1LZKA 3OC0A 4LXHA 2VAXA 4FFWA 1CUGA 2HM7A 4PNZA 2QT9A 5LZ8A 1W52X 1G66A 2OGZA 2XUOA 4L0CA 5ALRA 3TJMA 4DMHA 2I3ZA 2IITA 1VZ2A 2BAGA 4P9NA 2XQFA 4PO3X 1EX9A 1WM1A 2WJ3A 1KEZA 1DINA 2J4CA 2XMQA 1G5FA 1CUYA 2BFNA 3WJ2A 3B12A 1OCEA 1ODSA 4AB1A 4EA6A 1GKLA 3O9VA 1QIIA 2WKWA 4Y2XA 4H7DA 1LNSA 4RE5A 1K6EA 5AM2A 4KAAA 2CJPA 2WFLB 5DJ5A 3D2BA 1QIHA 2XUGA 3QMMA 5T4EA 1OXMA 1XZLA 3JW8A 2WUDA 3ILSA 4MJ3A 4C4YA 1B41A 3BDVA 3F8SA 5HKBA 1ORVA 1NU6A 2CZQA 2GYWA 4JUIA 4G8DA 5DNUA 3EBLA 4Q3KA 4H7EA 2XMRA 4LIPD 3L1HA 3SC2A 5IVHA 2HADA 3IUJA 5E4JA 4HXGA 2GYVA 3K9BA 5JAHA 1BE0A 5ALVA 3G9TA 4DMFA 5C7YA 1ZD2P 3I2KA 2RHTA 3KXPA 4Y9SA 1ZGBA 3QMVA 5A2GA 1CUXA 4ZV9A 3W9BA 2O2IA 3W9UA 3DQZA 5FPQA 2WHRA 4J0GA 3OPMA 3T4UA 1JU3A 1Y7HA 4W1PA 2YASA 4WY5A 4IH9A 4ARAA 4H7HA 3HLKA 4X6UA 1H23A 5LIPA 1QO7A 3ESDA 2OCKA 1SC9A 1MPXA 4Q34A 1Z68A 4H0CA 3QBJA 5ALDA 1ZD5A 3STXA 5AKJA 2XDWA 1BCSA 3UUFA 4CCYA 5JYCA 2OCLA 2HRQA 3BXPA 4NZZA 5CURA 2ZJ6A 1ACJA 2XE4A 2HA0A 3WKDA 4L9AA 3F9CA 3PUIA 5HKAA 4MQMA 1X2EA 5LZ2A 2QR5A 1XRNA 1Q84A 2Y2UA 4MWSA 1EINA 5CT8A 2CKMA 5A7GA 4FNGA 4KACA 3JYHA 4QDZA 1MJ5A 1PJAA 4UHDA 3FSGD 5C81A 5KREA 1AUOA 1JJBA 1UOOA 4KEAA 1QIJA 2QUBA 1GQSA 2NW6A 5AI4A 1YA4A 3WIOA 5IH7A 4ZREA 1XRLA 4FTWA 3I2IA 5JAOA 5EIEA 2Y6UA 4B9EA 2PUJA 1JMKC 1YSCA 3GROA 1SOMA 5AI0A 1SCKA 1W1IA 2WJ6A 5JANA 4BATA 4DSAA 1YA8A 1K4YA 3BWXA 4EUSA 4IO0A 5T4FA 3LLCA 3G0DA 2QOEA 3S2ZA 3V9AA 2HA5A 3QYJA 5JZBA 5EIHA 3K2IA 1UK7A 1B6GA 3F67A 1X2BA 2HA6A 1QGED 2PSJA 1P0MA 4DNPA 3PE6A 1QIFA 4X71A 3A2NA 2I78A 1ODTC 4C87A 3HJUA 3O0DA 2PSEA 2P8SA 1J06A 2AJDA 2B9VA 2VQ6A 1GQRA 5K3FB 5AKHA 3MVEA 4J7AA 3R40A 3N2ZB 1T4MA 1DT3A 3BJRA 2HU7A 1MX9A 4C6HA 3DJYA 4GWLA 3E3AA 1F6WA 4EY7A 4B0PA 1EK2A 4OCZA 2XMZA 4ITVA 2QKYA 1EK1A 5ALOA 3C6ZA 4F0JA 3W2TA 2WFLA 1UKCA 3PI6A 1ZICA 1FJ2A 3PF9A 1YS2X 5AM3A 3PUHA 1DX4A 1QTIA 4OUKX 4MWTA 1N1MA 3V1KA 3ED1A 2YXPX 4J03A 4BZWA 4BC0A 3EQ9A 4BAGA 1ZGCA 5AIBA 2DFPA 3FAKA 1R50A 3FSGA 3KWJA 1H2YA 3C6YA 3OG9A 3AJAA 2HRRA 2EEPA 4BAUA 2C5GA 4A23A 1XQXA 3I2HA 5CH8A 5DNVA 2JGJA 2VAVA 3AZOA 2VF2A 1N5RA 1UXOA 2HL6A 4Y2UA 3ICWA 1WB4A 2JGIA 3O4HA 1ZOIA 5A7HA 1R4ZA 2XUFA 4F60A 1WCYA 4RGYA 4BC1A 1VXRA 4LKOA 1F8UA 2X5XA 2H9YA 2W6CX 3EQ8A 4B82A 3QZUA 2OPHA 4BE4A 2HA4A 3AIKA 3Q0TA 3CCBA 3M3DA 5I9IA 3GUUA 3V1MA 4X7BA 1VJ5A 3C8HA 2HFJA 4FDMA 2DQYA 4DMCA 4X91A 2H7CA 1CR6A 2J4FA 2XQIA 4OSEA 1DWQA 5D3ZA 1W75A 1YASA 4PV7A 5CH5A 1WB6A 1YAHA 3UMJA 4QEKA 5ALLA 2XUKA 1ETHA 2ZYIA 2UZ0A 5SYNA 1J07A 5BWCA 4Q1VA 1P0PA 4B83A 3WL6A 3O9MA 3W04A 4KE8A 2WG2A 4ZRDA 4GLBA 3HABA 1XLVA 3H19A 4BVJA 4NMWA 3BDIA 4QA9A 1EDBA 1FFCA 4B7ZA 4CG1A 1TAHA 1BCRA 1XKLA 3H0CA 1GXSA 5CTAA 1SFRA 5D3KA 1P0QA 3G9UA 2AJBA 1MNQA 2XQKA 1QIDA 2ONCA 2QVBA 5D7BA 2WU4A 3F96A 3FBWA 1C4XA 2JGEA 4JNCA 3QMWA 2Q0XA 3WL5A 4RPCA 2ECFA 2QMQA 5KBYA 3U0VA 5CBKA 1CUUA 5ALMA 1DX6A 1XZIA 2XUQA 2QRUA 2Z3WA 3WWOA 4OYYA 5ALNA 4J0IA 5ALEA 2HA2A 5FP0A 2WIGA 2FJPA 4GBGA 2ZVDA 4Y2QA 1TQHA 3G0IA 1CVLA 2PVSA 3DL4A 4UBNA 1JMYA 3BF7A 1EVEA 3D4LA 2Z8ZA 5ALKA 1P0IA 3M82A 4CG3A 4UFPA 2HA3A 2OG1A 2B4KA 2PUHA 2XQJA 3FYUB 4IQ4A 1U4NA 3FLAA 3LIIA 5AM1A 3IA2A 3WMRA 4GW3A 4J0HA 2ZYSA 4BDTA 5K3FA 4QDOA 5AP9A 1HL7A 3D5EA 2ACKA 3FNBA 2B61A 5FUMA 4H35A 4G5XA 2BUAA 2LIPA 4U2BA 2WUGA 2H7YA 2DHDA 1JKMA 1ORWA 4N8DA 4AO6A 4UHCA 2I3DA 2O2HA 5CT6A 1CRLA 4ARBA 2ES4A 1CUJA 1EB8A 4MXDA 4PQEA 4GXNA 2GBIA 5ALGA 5CT5A 3G0GA 4H7IA 4K6HA 1ZD3A 4FKBA 2RGUA 1MTZA 1GPNA 3STWA 1E8MA 1C7IA 1LPOA 1W76A 1UKAA 2E3JA 5A7FA 1UK8A 3D0KA 4JH0A 1QZ3A 4ETWA 3H2GA 3L1JA 1YB7A 2JEYA 4ZGBA 2C4HA 5FV4A 1H22A 1L7AA 3DYVA 4G1FA 1CUCA 4BRZA 5AO9A 5EHNA 3WKAA 2OCGA 4DNFA 2GBGA 1A7UA 3V48A 4B6GA 1USWA 4CI9A 1ACLA 3WK4A 4KAFA 3ZI7A 5EHQA 4H18A 1IUPA 1K8QA 2H7XA 2J3QA 3DOHA 3M83A 3ZPXA 1XLUA 1DQYA 4Y2RA 5DNWA 2QXUA 5HQ3B 5ALFA 3RARA 1ZJ4A 3C70A 1GZ7A 2OXEA 2WTMA 4HTAA 1RWQA 2HFKA 3DDUA 1TRHA 4MEBA 5CRIA 3WL8A 4GDMA 2CB9A 4WFIA 4NS4A 5AKIA 2D5LA 4BYMA 4AQDA 3RM3A 4XJVA 1HQDA 3AIMA 4E15A 2X8BA 3OOSA 1AKNA 1LPAB 1PFQA 5CMLA 3R3YA 2GYUA 1ZI6A 4C89A 4YK7A 1LPNA 5LYYA 4TPKA 4GHWA 2WUEA 5FLKA 2VJDA 2VA9A 1JFRA 3O95A 3VDXA 3NOXA 3ZLTA 3IDAA 3WL7A 2JGLA 2JGFA 3FYUC 4LYEA 4UBJA 4KRXA 3KOOA 1JJFA 1JU4A 4BVKA 5ISMA 4J0JA
chains in the Genus database with same CATH superfamily
3T9CA 4CLOB 4DARA 2NXWA 5EL0A 3BGDA 1I30A 4YAOA 5KYUA 2WI8A 1J21A 4MUIA 1PUIA 3DLHA 2FLVA 3MB5A 4N4AA 4HB2A 2V7PA 4N7JA 1C3LA 3FTFA 4NXMB 1P1KA 2NVUA 2VNJA 1SD5A 3PITA 1MX5A 4YRJA 3VV2A 3SQXA 1QRAA 3LSYA 2O8NA 3UGKA 1JSLA 3WK9A 2P9QA 1NI4B 4RHTA 2FZWA 4YAFA 2MR5A 3SJCA 4EZIA 4N8EA 4YUWA 2H1RA 3ELUA 3KJGA 4CMJA 2QBYA 2L2QA 1L5NA 2B3DA 4WBNF 3AVYA 4YJKA 4IXNA 4BMVA 5A62A 4LWPA 4HAUA 2G4LA 3CISA 4UPVA 4K40A 3KAKA 2R6JA 4XPIA 1DKLA 4E13A 3FOCA 5KSWB 2V55B 3D8RA 2PBLA 3R3JA 3DXXA 4QNMA 1SC4A 3M1AA 3PDCA 2Q27A 1Z5ZA 2BHRA 4MK4A 1RAEA 3HJCA 4NHEA 4TROA 1HT3A 2OZKA 4OP3A 3WRVA 1QH1B 2X0KA 3GARA 3MD0A 4L1KA 1N6LA 1OY1A 1IU9A 1QHHA 3L9XA 2XPCA 5KJ1A 1OBOA 4OB8A 1JBKA 1GG9A 1U8XX 1UBOS 3D54D 4FYJA 3A32A 5JMTA 1N2CB 5BP7A 4YDRA 1LA2A 3TN7A 3ND7A 4MUMA 5CIWA 2FP4B 4IEEA 1DQNA 1E5VA 1FX0B 1UMDB 1F0NA 1XNGA 4QVGA 4R7GA 3ROXA 3VPGA 4RD1A 5KHOC 4PG5A 4PO1A 3FYTA 2CVQA 3UAWA 2XTZA 3CN9A 1CEQA 5AFSA 3REQB 3LH5A 3O4GA 3ESRA 1E9RA 1DC3A 1POXA 1VRCA 1EI9A 1NSTA 1US8B 3ISTA 4TL7A 1TF5A 3EXAA 2HLNA 4OVKA 3CCCA 4TZTA 4DRXB 4ZOAA 2FLWA 4OU4A 2A86A 2Y1KA 1YR9A 4OFWA 4P38A 4Y18A 3RYHA 3U4MA 4KR9A 1TW3A 3D7LA 4LF6B 4G09A 1QIGA 1CUZA 4PSCA 3L7OA 1RRMA 5J63A 3L7YA 1SOWA 4DLBA 4U6QA 2B4TO 3PJDA 4EGAA 2QN8A 3CR7A 4F8JA 2W00A 3VVLA 1ZUNA 2A1TR 3A6GA 2C77A 4RBNA 1P2SA 3A3YA 4U1RA 1LGYA 2FPIB 4L5CA 4RIFA 1HT2E 5EWJB 5KOHB 2FMTA 2OXTA 4YXWA 1JMVA 1HFJA 3Q15C 2I1WA 4D0SA 1AKRA 1OLUA 3PC8C 5IEBA 3TRJA 2I99A 5HP4A 1XPOA 3K15A 3CR8A 2I6UA 1GLGA 2C94A 2JJQA 2VPTA 3F8WA 3TOCA 1AOXA 4E2ZA 2BP7A 5CA0A 4AYTA 2CXRA 2OZEA 3AUKA 4UZFA 6GPBA 3PUKA 4EI8A 1V8DA 1WHSB 1ZCZA 1UWCA 3VDRA 3KKOA 4QXRA 1L5MA 1PYOA 3NXKA 3UXMA 1IXZA 3MUFA 1WDLA 5G41A 2H52A 5EHGA 5K4AA 2C1EA 4DCPA 4MVJF 3IBFA 1Y63A 3AI1A 4G1MB 2GBLC 3RBAA 5CW2A 1E6LA 1QZZA 4E5DA 5CIYA 2HXGA 1LCIA 4GKBA 5KO2A 5CR9A 1LDEA 5KTRA 4BE9A 1DQPA 2DSNA 3B89A 3UENA 3CXUA 3C4VA 1BC5A 1S1MA 1FTQA 5FL3A 1SBTA 1KMNA 2UYHA 3QF4A 1ABFA 3R7BA 2HW8A 4RF2A 4ZCQA 1ULHA 1U81A 3AR2A 3C7AA 3LYUA 3PNVA 2POQX 3TOSA 3VO9A 3ZVRA 5KNLA 1YVRA 4GI2A 1DO8A 1NSYA 4J3JA 3TZCA 4BEWA 1VECA 1Y80A 1E4YA 3CRZA 2JFFA 3ZV7A 1VB5A 2CUTA 1FS4A 1UPTA 1V8FA 4MDHA 1ZRMA 1JW9B 2OWDA 1BQEA 3MJEA 3GLIA 1C8VB 1EGQA 5ICCA 1TUGA 3W3AA 4OHFA 1UOPA 3AOEC 1OLXB 2I9PA 4FBMA 4FMDF 4YFVA 3RSLA 2X2EA 1JAHA 3OX3A 4C4SA 1M3SA 3ZZUA 4MRAA 2QVZX 1QG4A 5KSYA 1N2XA 1HDEA 2J08A 1T6BY 2LV8A 2QENA 2VT3A 3I2JA 2ETVA 2H8GA 2NO5A 1OXVA 5I7EA 2WD9A 1L7RA 2C2MA 1X13A 4EKIA 3AF2A 1JDZA 3D7RA 2HNAA 3IJPA 2O5CA 1S02A 3ZLVA 3O7WA 2Z8YM 2E87A 3K1JA 1GL6A 2B20A 2AUTA 2HU5A 3DD5A 4OAPA 1M2NA 2ECQA 3WYCA 5LBIA 3ZZNA 4WCFC 5HM8A 4UBLA 1E5TA 2YQ4A 2YRFA 4AKHA 5PGMA 3ISVA 4FOPA 1WE2A 1FU4A 1ZY2A 3U5TA 1P33A 3F97A 4HYQA 4JDPA 1K86A 4ZMSA 4X00A 4MVJE 1C3OB 3GW8A 3A6PC 4U63A 3NOVA 1OI7A 2FW9A 1VJTA 2GEBA 4ZC1A 1UP6A 3PUZA 1TB4A 2G7MC 2NU6B 2H92A 3EDQA 1NJFA 3ZJ5A 4B87A 3L6RA 1VE7A 3IHWA 5FNZA 4W9NC 1URPA 1W9HA 1EGHA 5ERXA 1ENPA 3WQHA 1DO0A 5B4TA 3ZDBA 2OBLA 1UBNA 4JJFA 1BJTA 4X94A 3DTYA 2YN0A 1TC1A 5L3VA 4Q3OA 4V0OA 5CPFA 2O2JA 4A2WA 1F0KA 2JFYA 3G79A 3R41A 4WFJA 4B3DA 2CFTA 2NZXA 2OZPA 3IQEA 4HD8A 5CUQA 1TVKA 2JEZA 3V42A 4DIEA 1E61A 1EFKA 2X0JA 1ZQ9A 3KB6A 4EY4A 1QGDA 4OM7A 1YS4A 3PX3A 5UKDA 1EDZA 4QJBA 2ATEA 3DZCA 4YRBA 4H15A 2FTKE 4WVLA 2LTAA 1FXSA 2EQAA 1NA5A 4OF4A 3T5BA 4C03A 4D9BA 3V8MA 2JKVA 2P2DA 3PYLA 2FVYA 4MYCA 2X76A 2VPQA 3SICE 1KERA 3HV2A 4TLMB 5H9WA 4RADA 1USGA 5AH0A 1B73A 4HY3A 4JNKA 1IQRA 2JD1A 2DVMA 3FH0A 3HPRA 4Q3DA 4KPFC 2O6HA 3N2KB 2FEOA 1Z5GA 4R51A 2PEZA 4OK3A 1GV0A 4BO3A 3V4PB 1Y8QB 1FBNA 2ZRBA 1KEVA 1RI3A 2C0PA 3LDAA 4P7GA 5LQJA 2NPIA 3I5XA 4EJSC 3QK7A 1E79D 1UFQA 2JGRA 4H59A 4HEHA 3B1JA 4NZOA 3RC1A 3VTAA 2WZDA 3RC2A 3NOQA 3R0QA 3JQ8B 2XMGA 3HR4A 3M70A 5EP4A 3T7RA 1GHTA 2P1RA 4HNRA 3E7DA 2JAQA 3IBCA 3HYNA 2P91A 2OXRA 2FF7A 4YV0A 4EFKA 3OQMA 4QBIA 3WWPA 4GIBA 1N3YA 2QPAA 3PQ2A 2I6GA 3OLVA 4EGJA 3B3QA 3BH7A 4AM8A 1Z0IA 3NQ41 1ISFA 4JKIA 3V80A 1NJ5A 5DTRA 2JK1A 3UO8B 2QZPA 4TQ9A 4C0KA 4D0NA 2PFGA 1JLSA 1I9GA 1QBKC 4BMDA 2BIFA 2GZ1A 3HJHA 3WO0A 4JR0A 5CDYA 5IN5A 4PNHA 1M1XB 1QO0D 3IVXA 3EC7A 3O8BA 3QU5A 3JYLA 1YB6A 1EVKA 2QN7A 4IIBA 2O8VA 5U4XA 2VHEA 4KV9A 4B6SA 2QW0X 4CLOA 1XJCA 3LUCA 1J22A 2OTCA 1Z15A 3DO8A 5G0UA 3HH8A 3NDJA 4LMPA 3OQ1A 2CNWA 3HU2A 3N8NA 4WZBB 4DOMA 4ZTUB 2HSEA 5KWIA 1WLYA 1WR8A 3U31A 3BULA 4F4CA 3A1SA 4IGFA 3T3OA 1NI4A 1B16A 1E1QD 3NPAA 4D44A 1FNDA 4PANA 1OLOA 5FDFA 1EG2A 1EU1A 1BMFD 1W2WB 1DXYA 4KQIA 1Q57A 3U81A 1XTSA 3AILA 5LA6F 5C32A 4TSFA 1W48A 2EG5A 4PC7A 3H65A 3NONA 1DDOA 5CCXA 3HKEA 1QFXA 1YR7A 2YKGA 3BF8A 3S8YA 1W35A 5ES4B 3UJNA 4H4EA 2QMUA 1E0KA 1LSSA 4WK6A 2QJFA 4H7JA 1JIVA 1SKQA 1AGPA 1MABB 4G65A 3Q72A 3ZWDA 1QH1A 1O94D 1DUSA 2R5NA 4KQ1A 4O2RA 2C0CA 5F52A 1G6KA 2DT8A 3ZCUA 3OCVA 4XJTA 2V97A 2ZRMA 4N03A 1TKBA 2YJ6A 3MK31 4OXNA 1JN0A 1N2CA 3HZHA 1P7YA 4U2GA 4RKEA 2PZBA 1I6KA 4Q21A 1FX0A 1CPYA 1P17A 5HA5A 3B7PA 3GLHE 2D5IA 5E6RB 1M2FA 3HA3A 3Q11A 3N07A 3OZFA 1F2DA 3REQA 1FFYA 2DY1A 1LV7A 2IZ0A 1US8A 3C1UA 1RPNA 2QG9A 1XTTA 2FPXA 3K16A 3EMBA 1PZFA 4Q66C 4YLEA 3F3KA 5JASA 4BQNA 1QRUA 3V7YA 5CJJA 1GP2A 4YRTA 3KWLA 4DRXA 2FEPA 4KRGA 3DLCA 4FD3A 2O4CA 4GM0A 4C0HA 1B0PA 1ISPA 2DOKA 1VJ0A 1WDMA 1JH8A 3ESZA 2CNDA 4BOYA 1J2EA 2GCGA 2WYIA 3D6NB 3E1SA 2X0EA 4D56A 4GH5A 4MYRA 4OX9Y 1R12A 4PIMA 1YRQA 1ISSA 4P93A 5IMBA 5AVKA 3IS3A 2Q3HA 4TTVA 4TXLA 3HYSA 2FPIA 3BIFA 5EWJA 2IPNA 5IUKC 4WXRA 2EC5A 1N6KA 1B6SA 3N3AC 2DFTA 3PE3A 3TKAA 5ALYA 1QKJA 3TINA 3SIXA 1A97A 4D42A 3TF5A 1Q0LA 1BAPA 3TNFA 3MJVA 1U8UA 3O90A 4U6SA 2VTEA 4HGPA 2IH5A 3ORFA 3VOAA 2O0HA 2PBZA 4A8JB 3GEEA 1POWA 1W36B 3LWNA 1BDHA 3VJKA 4KPGA 1P2UA 1THGA 3ZX5A 2J07A 4MMXB 3UTCA 4MJLA 3NTRA 2ZE8A 3JQPA 2Z2KA 3QKSB 1R2QA 1DOHA 3FFXA 4JC5A 5DDIP 3RIMA 1JJAA 3LOQA 1L3CA 3KAPA 2GOYA 3JATB 1A9ZA 1ZVKA 4QFMA 2CXUA 2XE8A 1TA4A 3VGJA 4LHYA 2P4SA 5FBWB 2QL7A 4BMPB 2K2QB 4WGFA 5GY7A 3RIEA 3RRXA 1IM5A 1FJHA 1TW2A 4KR0A 1AE1A 3C1OA 1KU6A 2VZLA 4MQFB 5AK5A 4AMUA 5H5JA 1H3FA 4M89A 4ZIRB 3KQVA 1Y6GA 1U0HC 4ZQEA 1E79A 5B2ZA 1N0HA 3BMCB 3SVLA 4ALIA 1LLUA 1BVRA 2BR5A 2EZ4A 1T2NA 4KBGA 1AS2A 1OROA 4WLEA 3T1VA 4IXMA 3THWB 3GT0A 3ZWPA 1P5JA 3NGMA 3Q7SA 2XWJI 2E6UX 3IE0A 4IHJB 4W7SA 4K87A 4M3NA 3QU9A 1M2GA 3PKJA 3CCFA 3ZUGA 5JOQA 3OFND 2OHXA 3C98A 3Q6IA 4UPDA 1OLXA 3V8QA 2H0AA 3M5CA 1KOFA 4LRWA 3K1YA 3TIIA 4B3GA 3EZ6A 2XNKA 3KKKA 1JTFA 2ZR8A 2QZSA 5ENZA 5EGNA 2P79A 2QN6A 4PE5B 1M33A 4M1ZA 3D2CA 5EWMB 2VT2A 3CINA 1HTWA 1X87A 3ZU2A 5CP8A 4UZEA 1E7QA 1E1KA 4C5CA 1XD9A 3DOJA 4RANA 5B3LA 2VVTA 1UUFA 2R6HA 1U02A 3HFSA 3L0PA 2HU2A 2WIFA 3WADA 2VQEB 1E1QA 3T3IA 1J8QA 1XU7A 1BMFA 1I3NA 4X3OA 1C3OA 1D07A 2HPHA 3M6LA 3SK0A 1RYZA 1KK0A 1MEJA 1K63A 1QAQA 2AJCA 2XNDA 3QVMA 4YALA 1MAAA 3V7FA 4HXFB 3ESYA 4BLTA 1NVBA 3NT5A 4EHDA 1G8HA 4EYEA 5B1HA 2I29A 4MB2A 4S0ZA 3UJ6A 2GB4A 1E2FA 1Z88A 2Q28A 1YIOA 1VLJA 2G3YA 2I80A 1QAMA 2CLHB 3PTZA 4EHKA 3EFBA 1CKEA 4AD8A 1QDEA 4FCCA 1O94A 2AJTA 1FQJA 4MCHA 2GZ2A 5LP6F 1PUXA 2ZU6A 4QLAA 2OGUA 2P4QA 4D4HA 3PUXA 3EVDA 1YI1A 2EQ5A 3R9IA 3RHFA 2FUKA 2M9MA 4O2AB 4JJGA 1X8KA 1R6DA 3SHOA 5HMLA 3WIEA 3G59A 4AUMA 2GERA 5LQNA 1W36D 2YV1A 2W4QA 3S5UA 4R2MA 4DTIA 2R44A 3QITA 2QE7A 1COWD 1F1JA 2YWFA 3NV9A 3IDOA 3T5TA 4KITB 1OT5A 1C30B 2JIZA 1YQ9A 4BQEA 1QK5A 1SKYE 2RH4A 4X93A 1XT6A 1D4OA 1WSDA 1F4LA 1GAQA 3NWEA 3FCCA 1P61B 4IIEA 4LV5B 5LQMA 4TLDA 3DL0A 1YKSA 2H4FA 1SXIA 4MI6A 3D02A 4TS4A 2IX9A 4QICA 1PEAA 3IMGA 3R7LA 4GYWA 1XC7A 3IAAA 3N2KA 1AC5A 2R3SA 3BZWA 3NALA 4BMZA 2YRWA 1Y8QA 3P9XA 4HGNA 3SS8A 1M8FA 1UIMA 3LW8A 3NEJA 1IZ8A 4NE2A 2PPLA 1XTZA 5L45A 3JQ8A 3JQ6A 5DHRA 3C4QA 1ZNYA 1SNYA 4WINA 1XLWA 5MFPA 2ZZMA 4KREA 2CUNA 1X8LA 1P8JA 1BTOA 1BOOA 3G68A 3P0IA 4B2LA 4KH0A 1OWOA 3W5DA 2G88A 4R1NA 3T12A 5FPTA 5CM9C 3U5ZB 3EC1A 5BUZA 1P0FA 1QR6A 3B7GA 4U3JB 5L4SA 3FGPA 3ZQUA 1P9LA 1FZQA 3CONA 3PNSA 4RH3A 5EZYF 1D8AA 1MGOA 4NECA 1R0CA 1WA5A 3O47A 3WSTA 1BN6A 1ACMA 1NBME 3I9MA 3PHIA 4EYQA 1KY2A 4F91B 1I4DD 1YQTA 1TEHA 4ILKA 2R25B 3QLJA 3DCJA 2ILVA 1EUZA 3ONDA 3U3ZA 3CX6A 1AO0A 1G42A 5L8VA 2PMBA 4WZBA 1BRMA 5J1TB 3DLAA 5MGNA 4RVHA 4RDCA 1RWXA 4HH3C 2IWRA 4WOPA 3ZYCA 1NF2A 4MR9B 1AGRA 3ZE9A 1TIBA 5IUNC 1WXDA 2WE7A 4J0QA 4P5DA 5JR3A 2HCJB 5PNTA 3RNOA 2QU8A 4TUYB 2A0WA 3SLGA 2X6TA 4RHFA 4Z4EA 1SXJC 2FEKA 1A5BB 4O1HA 4P8RA 1IEWA 4HQFA 4Q7LA 3S7ZA 2GNPA 4YPVA 2GEKA 5L6LB 4Y6SA 4UM5A 2A0KA 2G67A 1XMQB 4OK5A 2G5CA 1YB5A 5DMXA 2YDXA 2DP4E 3ADPA 4J7UA 1GWNA 5FA5A 1CUBA 3O5AA 2BTEA 1MABA 2DYKA 1H85A 3TQIA 1U5AA 5AVQA 3PGKA 1PK9A 4J16C 4EYKA 4LECA 3OFNA 2LUOA 4X85A 4RKRA 2WJVA 4AQYB 4M55A 1TF7A 1U7ZA 4S0XA 3EFHA 4IIDA 2X8WA 1UM9B 2HJVA 3WLMA 3LSTA 4XZ3A 2NP7A 1Y42X 2LBPA 1YD7A 4GR5A 1O96B 1SKBA 2RI0A 4N76A 5E6RA 4ARCA 2Z2ZA 1ZGZA 3NXSA 3CYFA 4ZHQF 1UJ4A 4DJTA 3T9FA 4IDCA 3VR1A 3COSA 4C0BA 4Z9XA 3LDGA 4MYTA 1E7RA 4NENA 3SMVA 3OZ7A 3SF8A 1WF3A 4DXAA 4LHEA 4RZXA 4OSOA 4KXYA 1EZZA 3P0JA 2R6GA 1ZH0A 4TV8B 3RDPA 1LEHA 1DJLA 2ZRLA 5B7GA 5CLIA 2XNSA 3FY4A 1L9KA 4CMIA 1U3UA 4ZYYA 2TMDA 1KQFA 1LSJA 1L1RA 2F4NA 2JI7A 3P2YA 4QJ5A 4ENQA 2V9PA 3H3FA 4ZCPA 2I87A 4TYYA 2FFAA 2L19A 3A58B 1B00A 3QVWA 2BFBB 4N12A 1M6WA 3EIFA 1T4GA 2FWMX 3WWYA 1U0TA 3KQYA 4V3CA 4F4DA 3PQEA 1KJ8A 1AZWA 1K8YB 1U3WA 2DU8A 3GJXC 3VOTA 1ISRA 1EVQA 1O5TA 1LTHR 3G2MA 4GOND 5I4CA 2H5IA 5I7UA 2DHQA 4DV4B 1ATIA 1Q7CA 1PFGA 3E35A 5EXTA 3TL2A 4FVTA 3CKYA 3W9SA 5A3RA 5B7NA 3LUKA 3V4RA 1L7DA 3VH4A 2ZUFA 1OU4A 1MTOA 3C14C 1RZUA 2A2ZA 2NZYA 2QL5A 2YWHA 3FTQA 4QU5A 1J20A 4IF4A 5H80A 4BTVA 4CYMA 1PS8A 3F5MA 4BN0A 4Z6KA 2BSXA 2GD1O 3GLFB 4YMLA 1BDMA 2FN7A 3DYIA 3CLUD 3QA9A 2OAGA 4P5PA 1W47A 3LCMA 1G8PA 4A8JA 1HYHA 2C0QA 3ZDRA 3RAGA 2JJMA 2FUCA 2WJGA 3P8ZA 1COWA 1P73A 4UTXA 4BTLA 7MHTA 4FGLA 3I9OA 4ENWA 2H85A 2NSYA 2PV7A 3LDFA 1D0IA 2AG0A 1JEYB 3QKSA 1AKVA 2QTAA 4J49A 4CKYA 3DKPA 1FU8A 1ZRSA 3GGSA 4WJZA 2QRZA 3ABOB 2GHTA 3JATA 1CERA 4EK9A 2J3LA 3PEYA 3AI2A 3DMGA 3K4QA 2DUWA 4MQFA 3OX2A 5JUWA 2VFAA 4JI7B 4JBWA 1U9YA 4KFSA 2FWNA 5EC8A 4M0EA 5A6SB 4ZIRA 3IUQA 4DCCA 4DDHA 3FFWA 5T5QA 3QJYA 3HCDA 5IDYA 1A8SA 1KOGA 2X0RA 3BMCA 2CJXA 3TW4A 2FSIA 3LHFA 3WQBA 1SQ0A 3CXRA 2ZYVX 3UKDA 2WHXA 1AMOA 1MOPA 1WF6A 3M4XA 3THWA 3WNCA 3RWMB 2ID7A 4HFNA 4IHJA 2HPZA 4KX3A 3PU6A 4IP0A 1W8IA 1ESDA 1DTEA 3ASYA 1SPBS 1YCDA 3QSGA 2UZ1B 2HBQA 4OFBA 2C61A 5FOQA 1GCOA 1PJLA 1VHWA 3EDMA 3MRTA 1HE8B 1PLJA 1W44A 4OIMA 2FR1A 4YCAA 4LZWA 1AGYA 4PCUA 4L0DA 4AXXA 4DKJA 4IKEA 4GGOA 1WBJB 3O91A 1NYLA 3EASA 5L3RA 2XMCA 5EFZA 3W9YA 2GKSA 3IQDB 1ODIA 3ZE1B 1K1EA 5EWMA 2FQYA 4ZOLF 3BSSA 3PGLA 4IDAA 5I01A 3ZGXA 3IELA 4MI3A 4RTRA 5K3BA 3G7SA 4D43A 1QF6A 1TK3A 3UXHA 1PNVA 3VJLA 1L4MA 1OILA 3GWZA 3LO5A 4FN5A 3RFXA 3JQ7B 4JROA 4NMXB 3UQZA 1XCOA 2F3UA 4W5OA 3TLEA 4TTIA 4ZCRA 3KBOA 4IVPA 1CF2O 5FUBA 1CUEA 3FVQA 1HEIA 5KPDA 2BE7A 1UEJA 1S8FA 2C8LA 1CY8A 1LK0A 2QJWA 3M1IA 4R81A 4D79A 2AG1A 4PZZA 4OQQA 1ZW6A 1LLFA 5IG2A 1KAGA 1MRZA 4ZTBA 5IHPA 1SZPA 1L5QA 4PHFA 4U7DA 3IUEA 1D1PA 1KOJA 1RC1A 3UAVA 1G5TA 3GDGA 3RRMA 4EF4A 2GASA 4L4UA 4S24A 3WLSA 2WVHA 1IBLB 4F56A 4CM5A 5KQMA 1LBIA 4ZT6A 4RVGA 1W581 1X9GA 3A11A 4D6YA 3OTQA 3ZKWA 4DCJA 3ILHA 4FFMA 1G7RA 4MKXA 4HGQA 3W8RA 2P3SA 5IVKA 4I4TF 2ENWA 2LKDA 2CWWA 1OW3B 2W2XA 5EYPA 4A92A 4PRYA 5JXWA 4BBAA 1YL7A 3PR2B 4US1R 4O2AA 2R5FA 2YQZA 3ZWBA 4EY3A 4JU9A 4Q9LA 1WXFA 2X1HA 3TB4A 5JIBA 1HTBA 1ZIYA 2ODTX 3PFCA 4RELA 5JY1A 3MG9A 1C30A 3CUVA 2WWRA 1DT5A 2B2NA 2IUYA 1PO7A 2Q21A 2WU1A 3GMIA 3HDJA 4QFBA 4MB6A 1NYQA 2X2OA 4BASA 4CG2A 3U7HB 2QTVB 4DC1A 4FE7A 4DQVA 1NJGA 4BNTA 3Q8MA 1VC2A 1G41A 1N8NA 4NNJA 5ALIA 4KLZA 1Q83A 1SELA 3I92A 1K3TA 3N8IA 4S1PA 1HX7A 2BISA 1GSIA 2A5FA 2HSZA 2PRSA 5KWEA 1TMYA 1U3DA 1J0EA 1HY3A 3WMXA 4NYIQ 1PR1A 4E5KA 4HGYA 2D2IA 3HGQA 2P7HA 1GADO 1XK7A 3B9QA 5JDIA 4ND5A 3SLKA 1ORTA 3I6ZA 5HR5A 3DMDA 3PD7A 4CT5A 3QOXA 3WZ2A 1SCAA 3HKBB 1R0SA 3ZLUA 2DR2A 1GFIA 2ZR9A 1JL3A 4MINA 4OD0A 4YAJA 1HI9A 1WV1A 1GGFA 1WXHA 2P62A 3BSWA 1KEEB 3K3PA 4XVQA 5EN4A 3TSYA 2X8AA 3B6KA 2XUPA 2VHWA 1NR1A 1GY8A 3F46A 3ND9A 4U3JA 2YWBA 4Q9NA 3WYDA 5AVWA 3I04A 2ALJA 4P4NA 2FZLA 2JVIA 2Y0PA 5I5GA 4YREA 2OK7A 4IICA 5B6JA 3QVTA 3ZCXA 2ORWA 1MRNA 3LT4A 2MINB 3IR6A 1PLLA 2IYXA 3DPUA 2XYVA 5COBA 3UBTA 2NAFA 4GLLA 3UK0A 1T5LA 1OJ7A 2WP8J 3DAOA 3SQDA 1TEVA 3V8PA 3CSDA 3UHJA 4UUMA 2PWAA 2HIHA 3ESCA 2OB1A 3IQGX 2HEIA 4PTZA 2OO5A 3OBBA 4G0PA 3UMFA 4CM1A 1E3DA 5SYMA 4MR9A 4TVBA 2NLOA 2XEDA 3PXUA 3MELA 3MOIA 3TTXA 2YW9A 2HDWA 3NM4A 1BKYA 3A1VA 3KSAC 3VHQA 1W0JA 3AR7A 1Q95A 1ZHHA 2PV0A 4TUYA 3K9QO 1QAOA 4OY3A 3COZA 3ITNA 5TR9A 2SBTA 1H5NA 1Z2NX 3GLIE 2XYRA 1Y5RA 1DBWA 2PMCA 4DSZA 4BJ1A 1RP7A 4HLNA 1L4FA 3I0NA 4NVRA 5COAA 3BXZA 5AUQA 5FAXA 3PSHA 3OIGA 1GTJ1 3NHRA 4FHZA 3IMKA 3WMGA 4KR6A 5ICSA 2HUPA 2P9TA 3A26A 3FTPA 4NZ9A 5A9SB 2EL7A 1E66A 1V5IA 1ZP6A 1UXHA 3CA8A 3C3AA 3DLTA 3PA8A 3ZHUA 4NBLA 4EMBA 5J2TB 4EH1A 2WEKA 4R8KA 2F2TA 3EZYA 5CH3A 1PZXA 4YRCA 4KMMA 5FTJA 5BWMA 1LS6A 2VXCA 3HXOA 3D5QA 1FNMA 3Q2IA 3TUIC 1UM9A 1N2BA 2HK6A 5FI1B 3DTTA 4NARA 4IJ6A 4DVJA 1BQ4A 4IRMA 4PTLA 2JH8A 3QWHA 1O96A 4H7PA 4HDOB 4WZAB 1KDVA 3SSMA 3HXMA 2IE8A 1CIVA 3V00A 4K2AA 4LZJA 1TU0A 4E7PA 2JFNA 2EBFX 5I9SA 2J3MA 3ZY6A 3BHJA 3EE6A 3R3XA 4GM1A 1G63A 2RJ3A 1JS1X 1KDTA 5DHUA 5C8XA 5HF5A 3P4XA 4JOQA 1P1JA 3QPDA 1LBEA 4GU5A 1PSDA 3PFIA 2WW8A 4LDRA 4TV8A 2BYTA 3AY0A 1ZKMA 3HCBA 3K2QA 2WUFA 2JA1A 4W63A 4LC9A 1ML3A 3BREA 3N28A 4ZYVA 5AW3A 4G5RA 4Q82A 2QX6A 3T1TA 3FE2A 2FDCA 3I6MA 2BFBA 1D1TA 3DR3A 3H2HA 3C7DB 4HGRA 2QF7A 5K0FA 1XKTA 2Z57A 4BS9A 4DILA 5EJ8A 1L5RA 1GN8A 2GA9A 3P9CA 3WGYA 3GFRA 4HXEB 1S0UA 3D4BA 3OLYA 4JCOA 3TECE 1DIOB 4ZCSA 4YS6A 3TQSA 1T9ZA 4I7EA 1XF9A 3F7NA 2NUTB 4P35A 2RONA 2P2NA 2UYOA 4ZDIA 3E84A 1J2TA 4DUZB 4BCBA 1BN7A 2R96A 5EJ6A 3B70A 3PGA1 3L1IA 3COWA 4RSRA 4ENSA 5CVTA 5KYYB 3EQZA 1XZ8A 1Z28A 4LG1A 2EF1A 2QP3A 5EJMA 3GLFA 4EY6A 1JT9A 1D6SA 1STOA 2UU9B 3RVBA 3G0BA 3O8QB 2P6NA 2Q45A 5M3BA 5AJXA 3QQPA 1Z16A 4GOKA 1Y1TA 2WM9B 4IH1A 1U4OA 2IYQA 4ZOCA 3UPTA 4AKSA 3SOPA 3R7SA 3Q3GE 2C9MA 2F55A 1JEYA 3UJDA 5SY6A 1M2JA 3ND6A 4NTZA 3F9IA 4HNSA 5EA2A 4B3FX 2Z1MA 2H4HA 2HQOA 3GYBA 2KHZA 3H1BA 1HE1C 3G2HA 1ABBA 4CCWA 1JUDA 4M37A 2I6TA 3RSOA 2V7VA 2OFFA 3P32A 3NV7A 1PV4A 5JJLA 2FWPA 4BGIA 3FLMA 4HK4A 1X70A 5CT9A 1U2DA 2AE2A 3MXOA 4BNKA 3NHJA 2CD9A 4HJXA 3OQPA 5JNVA 4DIFA 4XVUA 4BVFA 1KZ1A 3AR6A 2L0XA 5E8RA 3OMWA 2DRIA 1DXOA 1YAJA 1HMPA 1MDBA 4G2NA 1E20A 1T13A 2Q0QA 2Q5CA 1C8LA 2Y1DA 3FOWA 3UMGA 5DRYA 2J6BA 4CMBA 2D2EA 1N5MA 4LRSB 3V7WA 3NUGA 3Q5GA 2OMEA 2J3EA 2UZ1A 4IIUA 3T9AA 4RFLA 1DIBA 1LXCA 1HDXA 3FRJA 1LKZA 4L57A 5HILA 3EVGA 2RHHA 1JFVA 1PTJC 1PV1A 4H6PA 2ZETA 4XSHA 1YKFA 3I45A 1P4RA 5BT9A 1DEAA 2FG7C 2EV9A 1UBGA 1A04A 1V0JA 2FMUA 1PEYA 5H7XA 3H17A 4YLGA 2FWBA 3PFKA 3OY2A 5H68A 4D3XA 1M1YE 3GLTA 5IWCA 3TGLA 1OKKD 4PHHA 2VJCA 2DHRA 1AZTA 5BT8A 4N9QA 4UBIA 3SX0A 3JQ7A 4X6XA 2GK3A 1E3SA 2EX0A 3JAKB 4IO1A 5CEFA 4UNQA 3VPSA 1YR2A 3MNFA 4FUQA 1YIAA 2FFQA 4GI1A 1PT5A 4QQFA 5LBTA 4WOJA 3C5VA 1Y3BE 1IZYA 2XUIA 1R0YA 2IF2A 3L40A 4MITA 1U0JA 1TXGA 4NK5A 4V39A 4WLUA 5F64A 1T1EA 5F4ZA 5JALA 4P3YA 3EEBA 4I5EA 2DWOA 5BNTA 1NF8A 2KW5A 4R8SA 4L0MA 2O8CB 4A4DA 1QTRA 1NC1A 5KSOA 5KYNA 3AL0C 2XVZA 4E5PA 4C22A 1UXGA 3KTFA 2BRUC 4GDFA 4KIWA 3RBVA 3M1YA 5T7BA 3K94A 4ARUA 3BD6A 2PN1A 2RK6A 5A9TA 1L7OA 4JLVA 4DNQA 3CG4A 1KQ3A 4IDFA 4LFBB 2IA5A 3TQOA 4Y9DA 3LFHA 4UU1A 2OLEA 3T7KA 1R9GA 1RW4A 3AGPA 2H1LA 4DMLA 1CDDA 2VPPA 3DPIA 4CTOA 1NOIA 4RETA 3FZNA 5EINA 4Z86A 4HN9A 4C30A 3TFWA 1RE1A 2HQ1A 1EVIA 3CRVA 3OLXA 3TNDA 4YQZA 1UKBA 3STYA 4ME6A 1NAHA 4BO2A 3LPMA 3CNEA 2QTVA 3TZLA 2BGJA 1O95D 2DWCA 4EMSA 1GCIA 1I32A 1R6VA 3QKTA 2EFCB 4WZ6A 1CY1A 1OREA 1X14A 3AR8A 3I5UA 2AG8A 4MQLA 4ZAYA 2VIIA 2ZI3A 1YRBA 3LAWA 4BY9E 3EISA 3PEUA 1EFLA 4XWYA 4UFNA 3T8YA 4IHJF 1RXUA 2W2NA 3TE7A 2IYAA 1SBQA 2XNJA 2JJYA 1TAGA 4G67A 4I50A 3EZFA 3FMOB 2WFAA 3AEYA 1GGKA 1XQYA 2A5LA 2GSDA 1ZXBA 2R5WA 3INRA 2R6AA 4ZO7A 3ZG6A 4WXMA 2H29A 3ZWNA 2O5EA 2WF5A 1CQWA 5D5HA 4AICA 1GAJA 2O2GA 5M34A 1ESCA 5IH3A 2Z1DA 2FG5A 1EXNA 2C2XA 2AR0A 2QSJA 3VNRA 3HKBA 1Z35A 4FSHA 1GGEA 1C7JA 1M1ZA 1L8AA 2W11A 4JOSA 1ZESA 1JGTA 1UH5A 3JYQA 3EXHC 4X8HA 5H16A 5DN9A 3V3TA 4C6TB 3CIFA 4FLMA 2YYSA 1KEEA 1P4HA 4M9RA 4AWBA 1QK3A 5BRJA 2AYYA 1N0IA 1AQUA 1I0LA 1TX4B 4YYEA 2JI9A 2VHZA 4JR2A 3JRWA 1M6NA 1W88B 3BDAA 4GZ6A 1V5GA 4B6JA 4CCYB 5C8YB 2EOAA 5CHEA 2JARA 2MINA 4IOKA 2XOKA 3EUAA 3EGCA 3JQBC 2VNIA 3PNPA 5DSXA 3Q4GA 3KR9A 2B7LA 2XOEA 2BMFA 2ZSAA 4UOQA 2H5LA 1W5AA 1P2GA 1Y6RA 1J39A 2HC9A 2PU5A 3C43A 4OP1A 3BK1A 4DLSA 1PG0A 5T4HA 1IXKA 1CDOA 2HSGA 2I1LA 1DCFA 2G1AA 2GWHA 5ERYA 3WLRA 4D0RA 2HHHB 1UC8A 4XEHA 1IDN1 3ZGVA 4QU0A 2YR0A 4ZO9A 4WADA 3UYKA 1HG1A 3RAEC 1IVSA 1QHYA 3VAYA 5LYJB 3WRXC 4JSYA 2DQZA 1U2EA 4XARA 2ID4A 2XQGA 4Y7DA 3RK1A 1RC0A 4ZZIA 5JMWA 1EYZA 2YWRA 2QPOA 3OIWA 2DCUA 5I9NA 4R9UC 3OIVA 3FMGA 3WTCA 3AHCA 1SY7A 2G6TA 4IQ8A 2V3VA 4R2HA 4ZO4A 1LJ8A 5F77A 1Y1QA 1JLMA 4BMCA 5CLFA 2F1JA 1XTVA 1W5SA 4RCYA 4AC9A 4O2AF 3IFSA 5A9SA 2AFRA 2G6BA 4WAUA 4YT4A 2BF7A 4KXFB 3AETB 3O3NB 3FHOA 4G8JA 1T2UA 5J2TA 2FGJA 3DC2A 3ZH2A 3FYDA 2AOXA 4KGVA 4OKSA 4AMZA 5AKYA 1VQ1A 1YRLA 2ZRKA 5BSVA 1P3JA 1X8XA 3LIPA 1Q0HA 4B1FA 4H4CA 2R86A 2RI6A 3Q5EA 3R3VA 1VE3A 4FOLA 5M04A 1HFKA 4JXJA 3PRHA 5HBGA 5HKLA 1NP3A 5FV7A 2COKA 4LCBA 5A05A 1ZDMA 2NZUG 4TMZA 2ISCA 3I01M 3M3HA 4QPPA 4WZAA 2EP5A 1OU0A 1AT1A 2JFHA 2MYPA 3E5NA 4FIZA 1JKXA 5AM5A 1PT7A 5ICEA 2GRUA 1A1SA 1L8OA 2DFDA 2FX5A 1RLMA 5GZ1A 1U5BB 2DHCA 2BSQA 1CJBA 1KIFA 1OKKA 4YRNA 1JFSA 1FS5A 3V32A 4LXTA 3AI3A 3WIBA 3UW3A 4TKVA 1CU1A 4ISCA 1ZIPA 1NZFA 4NIMA 5AVVA 2WF7A 1I36A 3MMZA 1C50A 5BQ5A 3E1KA 1FTWA 2IOYA 2P6RA 1DKMA 3TNLA 2ZBUA 2B3TA 2PGNA 2UVDA 4U8HA 3GBSA 4JD5A 1YONA 3MCAA 4FDAA 1TCUA 4YGXB 5E7JA 1U7OA 5FJJA 1ZVVA 4IJUA 1Q7GA 1UT8A 3HLTA 4J6EA 4GX0A 4D45A 3JQFC 5H81A 5GADl 2FN3A 4MLCA 4FS8A 1R1DA 3EG5A 1UBMS 1KSGA 5CEJA 3IOMA 4TTPA 5DTEA 3CB4A 1G3MA 4KODA 4GFDA 1MW9X 4XWWA 1QRDA 2IVFA 5DM2A 2NUTA 2FQXA 2QW1A 3AKEA 4XD2A 1LVGA 2GD0A 1WSAA 3A25A 2A5JA 2HV9A 3GAFA 3T4XA 4Q0MA 1HYGA 2FWJA 3U4CA 5B57C 3ZVMA 1RWOA 1RHKA 3HJNA 3HRKA 3OC0A 4LXHA 4OQZA 4PXSA 1OPXA 4CE6A 4FFWA 1CUGA 2IC5A 2AW3A 2B8TA 2QUJA 3AUFA 3WNBA 4BFVA 1QM5A 1T1IA 5K0NA 5K4HA 3IMEA 2HM7A 1SK9A 1RJ9B 3ZBTA 4HAZA 2YV5A 1C9DB 5LZ8A 3KCQA 4NAHA 3O8QA 1COZA 3I3OA 1DCTA 1G66A 4JVNA 2FY8A 2XUOA 3AHEA 5EIOA 3NBMA 1A9QA 2XWSA 3LGAA 4DMHA 3LUJA 3TLCA 5LMCA 2CF6A 1RQPA 3PX7A 4D4GA 2BAGA 4P9NA 1BKSB 1O95A 3VPFA 4JOBA 1TMOA 3DV2A 4PO3X 1U7UA 1EX9A 1H42A 4BRUA 2D1SA 4XM2A 3L8MA 3ZCVA 1T8UA 2WUWE 3MJCA 1PNOA 1V25A 2NTEA 3MLAA 4MW1A 3NBYC 1NM5C 4EARA 1C8BA 3VFDA 1G5FA 1LDBA 3E03A 3UHPA 4D1YA 1B8NA 5C51B 5FBKA 5G0VA 1NQ5A 2BFNA 4ISBA 4YRRA 3VR0A 4YHHB 3L06A 1GOTA 3ENWA 4MGIR 1AKTA 1J8YF 3WJ2A 4V0NA 1ODSA 2DTEA 2PD6A 3ZHBA 2AH5A 1WUKS 3M4YA 3TTSA 2WKPA 2HZBA 4R2KA 3TL3A 3D3KA 1UZLA 5C1DA 5DNEA 1CF4A 3Q41A 4HX9A 4I5FA 3QEBZ 3TD2A 1GG8A 1V6AA 2FMXA 1XDWA 1YE3A 3AV3A 3JX9A 4CM3A 1K6EA 4BKUA 5JCZA 5JROA 3E48A 1NV9A 1EFAA 4NZMA 4KAAA 2CJPA 4OG2A 4LFAB 4QOSA 1ISHA 4C4TA 3JTEA 3U7QB 3CEPB 1CJVC 3LYAA 4ZVPA 4TV8F 1ZIDA 3PHBE 4UVHA 3TZ6A 1RFGE 2XUGA 3UXYA 4L6IA 5T4EA 3GDHA 3R7WB 1Y1RA 4KQ6A 2Z9CA 2J0UB 3U80A 4AT1A 1RMTA 1U2SA 4GXQA 4PZEA 3SX2A 3K70C 1N34B 1XZLA 2YJGA 3ILSA 2Q3BA 4MJ3A 1BD4A 1HRKA 3GFGA 4IS2A 5FPYA 5TSDA 1JQAA 3JAKA 3E9EA 2HGSA 2PGLA 1B41A 1TC2A 4LY3A 1WUHS 3MB8A 1U2TA 4H1WA 3WB2A 2JDID 3GH1A 3VDNB 5DF1A 3M4NA 4U0JA 1E1RD 1KJYA 3DDCA 3HYTA 4BWYA 1LI7A 4EMTA 1IHXA 4G8DA 1YBHA 1V9SA 1NBAA 4PTYA 1KKUA 2R87A 4U7JA 2O8CA 3L5OA 1W5FA 3UOGA 2H9AA 2XMRA 5EXDA 1E64A 3L1HA 4GF5A 3N6RA 3G17A 1A7KA 2UYCA 2ZAIA 4TWJA 3EC2A 3SKYA 4EHIA 4B5LA 1OB2A 5T67A 3SQMA 1HLPA 2Q3EA 2HADA 2GPSA 4ZQCB 3IDSA 1X3SA 3L4KA 3X1MA 2HMYB 4IUDS 5JAHA 4BBPA 5ALVA 4RH0A 4EYOA 2REBA 4B4WA 4RLSA 4UAJA 4UTVA 3K8ZA 1I7DA 1T9KA 3MINB 1NASA 4UVIA 4QBHA 4BGVA 5F21A 4J1QA 2IKSA 2F7SA 2RHTA 1GA4A 1YACA 4UAVA 3HXQA 1SQSA 2FV8A 3QMVA 5A2GA 4ZV9A 2QQGA 3W9BA 4LQCA 3FYSA 5EIBD 1QP7A 2WHRA 1A7AA 1R10A 1EWTA 2VSFA 2ZT8A 3T4UA 2CL7X 3OFKA 3QX7A 3UMCA 4B5KA 3QU4A 1RLIA 2PIDA 4P4GA 3RIYA 1KP3A 4WERA 4QDJA 3L6DA 4JN6B 4ARAA 1QWOA 2ZWMA 3UUWA 4BQFA 4Q37A 3KXLA 4UNRA 1JKFA 3M6WA 2HO5A 3A4LA 5JQWA 4ADSG 4X6UA 1V4BA 3N7UA 2YC4C 2G4CA 3OQVA 1H2BA 2QYSA 4FHFA 2Y1EA 3T61A 4B7XA 4B71A 3GH3A 4F6LA 2OC9A 1PKXA 4ZT2A 4FS3A 1AKUA 1II0A 1Q19A 2DBQA 1TOAA 4GPZA 4JLSA 4F4FA 1QVRA 2B34A 1TTQB 2XKKA 5F3WB 4JI6B 5DWVA 3QBJA 5ILGA 2JAPA 2Q1TA 1IH8A 4Q1FA 1C9JA 1ZD5A 4YH1A 3RT1A 1CCWA 5JJ5A 2VG8A 4LVCA 1XA3A 4V03A 4PGMA 3PXXA 4PRKA 4KO8A 5C8YA 4CCYA 2OCLA 1ZC4A 4UNPA 3BXPA 1QP0A 4GP6A 1WVMA 4F72A 4TX1A 1KO8A 1SUCA 3KOZA 3L7NA 1FNNA 1P18A 2BEWB 3ZQ6A 1UODA 4GX5A 3KR1A 1WQ3A 2QW8A 2QI9C 4QEZA 3JARB 3AGQA 4B7CA 1Q22A 4DZTA 4L4ZA 3FROA 1CJMA 3CF0A 3EWNA 4L9AA 5C4MA 4DM4A 4E32A 4BUJA 2Z4RA 1K2WA 3KRTA 2PUGA 2A0FA 2FFBA 1GFZA 1UINA 3OICA 3NZEA 5LYJA 4YAIA 5ICMA 5C1BA 4U7PB 4DQ0A 2UUAB 2CKMA 4GAEA 4URHA 2QGFA 3OZXA 1NXTA 2RK3A 2XVYA 4FZ3A 4NBNA 5EP2A 3T0GA 4AJJA 1MJ5A 2PX0A 4CVNA 1EZ4A 1PJAA 1UIRA 1H6DA 4NH4A 1IAQA 5KAMA 5AQ1A 5KREA 4AL4A 4NABA 3AETA 2V6MA 3ZHTA 5DI9A 3K96A 1TM4E 2OP0A 1UOOA 4YT5A 3FBGA 5KVSA 4PU0A 4FSDA 5GOTA 2QUBA 1GXSB 3QTTA 2NW6A 3HCEA 4YRSA 3NRBA 3WIOA 4BBJA 3PT9A 1E6KA 4N39A 1XRLA 1XQ1A 2IIBA 4IIJA 1NY5A 3ZGNA 5ETJA 2W5UA 2YYAA 3CH4B 4TLBA 5DHSA 3ZD6A 4NYMQ 2CSXA 4J1NA 4NU5A 4DA6A 2WKRA 3FNFA 3OTIA 2VBGA 1W1UA 2CLFB 1ZR4A 4G5GA 4LGCA 3DTVD 1N6HA 3JYOA 1D2NA 1TL7C 4FR5A 4OI1A 4OHUA 3D7SA 1QVWA 3EARA 3KO8A 5AI0A 3TSCA 2PH5A 4CGZA 1GKYA 1AQYA 1SCKA 3NR2A 4GMHA 2ZK7A 1MCZA 5JANA 5L7TA 3EQ6A 1EBBA 3IEXA 1MG0A 5THQA 3WYFA 3SZLA 4JV5B 1YBVA 1WSWA 2JDIA 2YTZA 5T4FA 3LLCA 3A3PA 3G0DA 2QOEA 4Q1EA 3S2ZA 3V9AA 1O6ZA 5DM60 1R0ZA 2HA5A 2BGLA 2RJOA 4FYKA 1TUBB 2K87A 3T4EA 3BFPA 3IUBA 1QRTA 2FQQA 3C41J 2AI3A 1DUIA 1UK7A 1F8YA 3L8GA 2Q1SA 4NBRA 4NE9A 2CFOA 2NZ2A 4FT4A 5HM6A 5LPNA 4E5NA 3H2SA 4I9UA 5GONB 3RVPA 1YJ5A 4ZDJA 4L28A 2OXCA 4BNZA 2VSNA 4NX2A 2C2YA 3OPQA 4E09A 1TO2E 3VZPA 3U9LA 3V6LA 1RJ9A 2QAGB 2VS1A 1LWNA 3B1KA 3CY6A 3PE6A 4O02B 2PPVA 5TQJA 3WMFA 4GGMX 5LB4A 5HRCA 3T1YB 3TR5A 4GQAA 1Z0DA 3I53A 3PSAA 4LPKA 4C87A 1ODTC 4TVSA 3U3RA 5JV5A 2QUZA 3CRMA 4GYKA 3C5EA 3EOAI 1PT8A 4GLOA 2RBKA 3HJUA 1H6BA 1EP2B 4V0KA 3T35A 3CPJB 3IHTA 1T8SA 1C9EA 5LN1A 1U3GA 1KF0A 2PSEA 3N1UA 3ORHA 4ZN6A 4HWKA 2QAIA 1E0JA 1L3BA 2WD7B 3I5MA 3KKQA 1AA6A 2VDWB 1J06A 2AJDA 4B17A 3TGPA 1SXHA 1X0VA 2ZWOA 1JG7A 2V5VA 5JCPA 5AKHA 2F3SA 4C2AA 4J7AA 3N2ZB 4XVRA 3SR3A 1T4MA 1SCBA 2HU7A 5EJEA 2CCKA 4ZU1X 1A8IA 5LJIA 2Q4TA 3LP6A 3QVOA 3DJYA 3OVMA 4JEUA 3HY6A 3AP1A 4TXNA 4IWNA 2K7FA 1FFGA 1WDWB 1IQ0A 2XMZA 1NW4A 3B51X 2NXNA 4LNAA 4RIIA 5EXPA 2VQDA 1IRXA 3SC3A 4XCXA 3U7QA 5AW7A 1EJ6A 2PQ6A 1MQAA 1MRSA 3BFVA 5TRTA 5F33A 1AUPA 1ETUA 2IUFA 4MUAA 2A59A 4YV7A 4JHLA 3R7WA 3PF9A 3BHNA 5AM3A 1BMDA 3G6WA 3PUHA 1ZH6A 4YCSA 1QP8A 2O3TA 2P9FA 4CLXA 3NHLA 4OUKX 3V33A 1ULTA 2BBTA 1T2VA 3FW1A 2E2WA 3BXEA 1YQWA 3HV0A 3KS9A 3FPHA 2BEUB 3FPLA 2E4ZA 1E58A 1Z0KA 3FWYA 4MWTA 3C7KA 5AJYA 3W5SA 3WG9A 3ED1A 1SD2A 1FRQA 1WXQA 3EEQA 3ROTA 2YXPX 2CT8A 2FW7A 4J03A 3KB1A 3JYPA 1O97D 3BMOB 3JD4A 4MWGA 1GPDG 4B6OA 5B1EA 3Q8LA 1ZGCA 4GKKB 4ETNA 1ZMXA 2X9GA 3U3OA 3ZBQA 4GPBA 4WMLA 1ZAYA 1DRWA 4L6AA 1M74A 1R50A 1CHDA 4MVJM 2I76A 2YUTA 2E4YA 3UATA 5DYGA 1RKXA 5G53C 3C6YA 3PV0A 3GLUA 1IZ0A 3LBAA 4JC0A 4JFAA 1X8JA 1M2HA 3AJAA 2HMTA 4LJKA 5B2FA 3O2SB 4OLJA 1KEWA 2NSHA 1Z33A 2XV1A 4GX1A 4Z9BA 3CVWA 2ZJ4A 4HUQB 2JGJA 3UJAA 4KFCA 2ZSUA 2BZ1A 4NJOA 1Q17A 2WPDD 4BNYA 5JBQA 4DJJA 1M5TA 4GZMA 1C0PA 2G04A 4GYJA 4Y2UA 1BHO1 5EKSA 5F1KA 3WLJA 4BLPA 4D96A 3MINA 3O4HA 3VX4A 4O8CA 4ES6A 4RHEA 2Q9UA 1CY6A 1Z6XA 1R4ZA 3DTVA 3GJZA 3GOQA 3I72A 1T25A 4IYRA 2YWEA 3QLVA 4X7PA 3ES9A 2G0NA 1KMHA 1FYVA 3C1TA 1PCXA 2DH5A 5AJUA 2E4WA 3O38A 4ZYZA 1OI4A 2GCPA 2C31A 4DJ5X 3O74A 2J0QA 1GLNA 2M6SA 1ICIA 3MTBA 2H9YA 2HTFA 2W6CX 2Z1NA 3GMDA 2A14A 2XVAA 2X0NA 3UOWA 2HA4A 2TSYB 3QPBA 2MMGA 3EFEA 4CF4A 2OBNA 1X92A 2NADA 4HX2A 3C7CB 2WJZB 5TARA 2HJSA 3L5KA 4RCZA 3Q3JB 5JYBA 5B64A 4JIGA 1Q91A 4WRRA 1PW7A 4XGNA 1SVSA 4LWZA 4XUEA 2IU4A 1RQLA 3LZDA 1AUXA 2OB2A 4DLXA 1G5IA 5DIZA 2DSTA 3GV0A 2J3JA 4D97A 2P4HX 4QO8A 4XWOA 1Z18A 3C8HA 3VJRA 1OTHA 1RIIA 3OOWA 2JFOA 3PIDA 3NVAA 4Q9DA 4RHUA 3KLMX 5F73A 3UICA 1CR6A 3VA7A 2PX8A 3K9WA 3U60B 5B7PA 2ODEA 4PX2A 1GGHA 4CMAA 3KDPA 5LFAA 3HWWA 2Z6AA 3LTEA 5D3ZA 1LI5A 3Q3CA 1G1AA 4P2GA 4RQTA 1V3VA 4PV7A 1H4QA 1WB6A 1VIVA 2BEWA 2DFKB 2XDAA 3EMVA 4XGQA 3UMJA 3ZQ4A 5KVCA 3KC2A 3RIGA 3JARA 2H4JA 1W8DA 4UQOA 2XUKA 3DWFA 1SUEA 5JS6A 2P68A 2RGGA 2X2PA 2H0QA 4XWTA 4M83A 1CZOA 4GNRA 5SYNA 3KNZA 5K2MA 2OPBA 5C0OE 1W4AA 1Y82A 4NF2A 3TE6A 2I7VA 2P11A 2PL9A 5DNCA 7MDHA 4Q19A 1WUTA 1LTKA 4BQSA 4KDEA 1NONA 4MOWA 3LQKA 1JLRA 4PSVA 1JEAA 1HETA 1QHGA 2CEAA 3HABA 3K0HA 4NMHA 4NMWA 4BVJA 2B69A 1GEGA 1M6YA 3BDIA 4QA9A 4D5EA 2A9OA 2H63A 1RRCA 4F5EA 4MW0A 4LBVA 3KALA 4TTQA 4B7ZA 1OGJA 2ZRDA 4OI4A 5HRUA 4E5YA 5HZMA 1RKBA 3WNDA 1L0BA 3CEHA 4G5HA 1A2KC 5AW6A 1FS6A 4F71A 1XKLA 3KYCB 1NE2A 1QV7A 1K2VN 1RXWA 2IW3A 2WVAA 1IBCA 3IMCA 4OA8A 1GXSA 2FFJA 1PJ4A 4G0WA 5HPYB 1MKYA 3WYBA 5D3KA 3L4BC 3G9UA 3ZDQA 1DIHA 4TMXA 2C42A 3MYYA 1GO2A 5D5PA 3DW3X 4OQNA 3DT9A 2ONCA 1U1GA 2XRZA 1CB7A 5D87A 2JFPA 3PGMA 3RFCA 1U9CA 3LP8A 3PWZA 1Y6JA 1GA6A 3F96A 1JYEA 3M1LA 4R9RA 2DFLA 1FJXA 4MIOA 2X4DA 1K3UB 3JZMA 2ZB3A 1G3IA 2FSHA 2NZ8A 3QMWA 4J1TC 4N7BA 5C18A 3AVXA 1LU9A 4UU0A 4TXMA 1QYVA 4M1EA 1XTUA 3LOUA 1CLUA 3U0VA 5CBKA 2V0GA 3LQYA 3G1WA 3GG2A 2A84A 4F38A 1D3AA 2UXDB 1GR0A 3NM5A 1DX6A 2YJ4A 2R1TB 4NKRA 3SDBA 2IS6A 4RHYA 3SPXA 1WXEA 4Y67A 3L4JA 5K09A 2AEEA 3VVBA 5AJWA 1BS1A 1JA0A 4MHSA 1HZZA 4EVRA 5E9WA 3VO8A 1G7TA 2QRUA 4PPYA 3TVYA 5C8YF 3U3JA 1WRBA 4YVFA 1TUBA 3LZ6A 3EXG1 3TQFA 4K0KB 3QJ5A 2BJVA 4GKAA 1ULBA 3L7JA 4LXXA 4J0IA 5ALEA 1D6NA 1NKVA 4E22A 3LTNC 2HA2A 3QKIA 3Q2OA 5FP0A 4P3NA 2FJPA 2VYFA 4IDQA 3W77A 4RTQA 2CFRA 3B53X 2ZVDA 5AUOB 4PWZA 5KOIA 1KE1A 3WGVA 3LBNA 4LHSA 1N1GA 1CNFA 2QAGA 3PQ5A 1OZHA 1TQHA 4DSOA 1YMVA 1SIBE 3R0JA 4XDHA 2FR8C 4EWLA 1NJ1A 4XWKA 3P9ZA 4IXDA 4TQUS 3E05A 4NJMB 1O94C 3BF7A 2I5PO 3SZGA 1O8BA 3D4LA 4JK3A 4LTDA 1UKVY 2EJVA 4R1SA 3R75A 1RADA 2Z8ZA 4IEIA 5KNBD 4UM9B 1I2MA 2YXBA 1GUZA 4NU8X 2RAFA 4RZ3A 3LCVB 3BRWD 3CUKA 4I81A 2IF0A 3GP5A 1Z45A 2HA3A 2EKBA 3QKWA 4IQ4A 4XYMA 4E2WA 5DIFA 1LNZA 2PVCA 1TJNA 2WWGA 3VU1A 3TDNA 1LFAA 1U4NA 1EGVB 1I0IA 1TO6A 4ED9A 3I0MA 5AM1A 3HXPA 5DGCA 2CSUA 3BD9A 3IA2A 2WD7A 1W19A 4XA8A 3PCXA 5DX8A 2OV6A 4J0HA 2VDWA 1I13A 2ZYSA 1W5EA 2LXNA 2CL0X 3KOXA 3Q3IA 4IILA 3PNMA 1S7CA 3NTUA 3RI3A 5IVPA 2WR8A 3QGMA 3M5WA 2WM8A 3OP4A 1U2GC 4AQ7A 4GWGA 5E3IA 3AX6A 3MTEA 3OKPA 3OH8A 3ABRB 3TCKA 5E0KB 4CIDA 1E4OA 4OHPA 3VR5D 3DBVO 2IPAB 2PKCA 3MJHA 3Q5DA 3GX1A 1RXCA 4EAAA 2IX3A 1UBEA 3PVZA 7AT1A 2G40A 4II3A 2I1VB 4N3NA 1ZCBA 2DWUA 4G5QA 2X7XA 1JH9A 2JHCA 4H35A 1B6RA 3M6IA 4IOMA 2MCFA 1QGYA 4K9DA 4PXAA 5K0GA 2BUAA 4XYEA 1X94A 2JCVA 4H6WA 4JUCA 2R1VB 4ARVA 2OV1A 2WUGA 4EGQA 4KSYA 5IN4A 1SUIA 4AMBA 4MIEA 3FVVA 3FXAA 3U09A 3DLPX 3GDWA 4ZAWA 2NUPB 4FPXA 2NXJA 2WTBA 1S4QA 2JLRA 2ON6A 4H60A 5HXAA 3FF1A 3SFVA 4DZZA 2OBMA 5JWHA 5BR1A 3CTMA 2HT1A 3H5LA 5D7NA 1GDTA 4X7MA 3S27A 1H8ED 1X19A 3H6GA 5CT6A 1ZUIA 4RQUA 2BEUA 2ZRAA 5EUBA 1G18A 1ZD8A 1CULC 3WGZA 2A8YA 3I4LA 1CUJA 1EB8A 2AMYA 3CO0S 2GVZC 1VIYA 4BO7A 5CXQA 3K0SA 2HYIC 1L4UA 2CXOA 3BMOA 3QX8A 1Q7TA 3AJRA 3QU7A 1EAMA 3DEKA 1E9FA 3CUSA 3UB3A 1T2EA 4LHWA 4XR4A 4ZQFA 1P91A 4YRKA 1B76A 3GLIB 4DCVA 1U9JA 2PLNA 2XBLA 3JZAA 3HWRA 4C2UA 4TQGA 5EMHA 5J4YA 1FTGA 3P27A 4XB2A 3RREA 4EEXA 3A9SA 4TMFA 3EYWA 1IBRA 3M6AA 3AFOA 1EA7A 3AYXB 1VPEA 2JRLA 4FD2A 5CU7A 5DSTA 1EHCA 2O05A 5EJAA 4N1AA 5CDTA 4UU8A 2JHGA 2P40A 1TQ2A 4IM7A 1RJFA 3O3CA 4HUQA 3C1AA 4QYWA 1UKAA 1QUEA 1SBIA 2H2IA 4NPHA 3ZVKA 4B9EA 3UA4A 1GCUA 2JD0A 4N5NA 5AQEA 3AM4A 1OXXK 3L1JA 1Z2DA 1N0VC 3NHBA 4D9MA 3AG6A 3L05A 4I1IA 1VTKA 2WVJA 1KSFX 2HHCA 4MO9A 5DW3A 2PANA 1CX9B 3OJWA 1A77A 3BQNB 3MBKA 4UM9D 4LHVA 4ZGBA 1YUBA 5FV4A 3DYVA 4TOIA 3ETJA 4G1FA 3AUAA 1V1MB 3D6FA 3GN2A 2EX1A 2VK2A 1UJCA 3ORQA 4M76B 3CX8A 4NRDA 4CQLB 1ZMRA 4HNGA 4KNWA 5C7OO 4L8YA 3J81A 2CLKB 2BM0A 2A3NA 3L1KA 2OEPA 4JWTA 3TDKA 1A7UA 3G7UA 2QTLA 5AR1A 3IP8A 3HY3A 2QM3A 4J7XA 1W5TA 1GYRA 4L5BA 4B6GA 4L8WB 4GO1A 4PZLA 4F1JA 1KVRA 3GRCA 2PE5A 2DKOA 4QJ4A 4P34A 3PNQA 3CKMA 4AY5A 4H3KB 1WDKA 4RWZA 3ZI7A 1BX1A 5EHQA 3KVNA 4YMUA 2J4DA 4KCGA 3D7MA 3O26A 4W6ZA 2X77A 2VYQA 1HOXA 5IT0A 2CDAA 3VM6A 4BL5A 1F14A 3A1CA 3DE5X 1G19A 4C7MA 5EGSA 3ZPXA 1DQYA 1C0KA 2P9JA 1Q1NA 4LOIA 5KZMB 1FYFA 1SBYA 1HL3A 2N75A 2GTPA 4BLUA 2QXUA 4DUPA 4L6CA 2DKNA 1VE5A 1G5QA 3OFJA 4I9FA 2D5AA 4HBZA 5HKOA 1AQNA 4Z4IA 3KYJB 3SC4A 1J24A 3CEJA 1SMKA 3CF6R 1RYBA 3FB4A 5CX4A 1KVTA 4X65B 1Z7WA 3QTBA 3G2QA 4EW6A 3KM0A 2R00A 3IIEA 1TZ2A 3H86A 2NUAB 4BO1A 3AR5A 5BWLA 2QT1A 3SEFA 2RHRA 3S8EA 3BXFA 2Y8EA 3BRWA 1PD1A 1RWQA 2IOFK 3MAAC 4JT2A 4QASA 1CYEA 2HFKA 2X4LA 3DDUA 3MHPA 4IDPA 4KHZA 4DLYA 4IZIA 1J7JA 4V2UA 2ZI6A 4GDMA 2PLRA 4WBSA 3WL8A 2IBTA 2QXYA 1GRNA 4KFTA 3B1XA 4PHTA 3EZ2A 3MWDB 1GR1A 4QUIA 5AKIA 4FXOA 5HE8A 3RAPR 4BYMA 1QGAA 4F3NA 2GTIA 1KDPA 2ZYTX 2I2AA 5CLLA 5P8WA 1R4NB 2Z09A 5ITWA 3DE3X 1WPQA 2G8NA 2XRFA 4XJVA 1VYUA 3I62A 1RHRA 4Y6PA 3O1LA 1HSZA 2QTNA 4LC1A 2G70A 3PHHA 3VR5A 2Q5LA 4WCFB 3QFHA 4Q9HA 4MDFA 1M0WA 1QNFA 3KKMA 3KQMA 1CFZA 3ZHRA 4FGKA 4UCQA 4YK7A 1BHSA 1UC4B 4TPKA 1YQXA 2AC2A 5CFLA 3MJSA 1WO8A 5IKEA 2PH3A 1DKRA 4GQIA 3MWLA 1Y4DE 4RENA 5IFKA 4RPGA 3H83A 2ORED 2Q5HA 1X1CA 2X5NA 5AMXA 3GIDA 4CMEC 3CZAA 1JFRA 4OSPA 3VDXA 2Z58A 2QD2A 4O4JB 5DP2A 3IKLA 4QNRA 3FYUC 3S2SA 1CRZA 1E5XA 1K6MA 5F12A 3UPUA 3F5FA