5LQKA

Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-2,3-dihydroxy-5-[(4-methylphenyl)methyl]benzamide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 80
structure length 216
sequence length 216
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqkA00
2ZCJA 4BP1A 5E9WA 4XCXA 1Y8CA 3HA7A 5JUWA 3OCJA 3KPWA 5BW4A 4RTSA 1NW3A 1JR4A 2P35A 2PGXA 2XYQA 4U7PB 3PLAE 4HRAA 3SMQA 1YFLA 3EGVA 1R8XA 1RJGA 1V39A 2O06A 5DRTA 3G2OA 3UJDA 4PYQA 4OBWA 2CL5A 5C0OE 1ZKDA 3DMGA 4QQNA 2PKWA 4GOND 5LQRA 3LBYA 3P9NA 3FUVA 5HIMA 3HEMA 1XJ5A 2JG3A 4RTQA 3CBGA 2EJTA 2IP2A 3HCDA 3LPMA 1WXXA 4KW7A 3DXYA 2NXCA 4Y2HA 2IBTA 2GS9A 3JWGA 3G5LA 3DLIA 5FCDA 5DM0A 3FPJA 2YXDA 2ZSUA 3CJTA 2AOVA 3VC1A 1X19A 3OPNA 4QVKA 5E2BA 3KQPA 3UFBA 2FK7A 2JHPA 4OA5A 4ER7A 5LQKA 1PRYA 4EKGA 4YV1A 4JXJA 2NXNA 3E8SA 3HP7A 1ZGAA 3ELYA 3GDHA 1P1CA 4AUKA 1O9HA 3I64A 4ISCA 3R9XB 4ATNA 2I9KA 3QOXA 5HFJA 1P91A 4GOOD 1M6YA 5T64A 1NBHA 3UA3A 5CD1A 5M5BA 3TFWA 1JSXA 2OPBA 4R8SA 4QTUB 2ZIEA 1G55A 1X1DA 1O54A 4HGYA 5DRYA 3B3JA 3RIEA 2ADMA 3OFKA 2OBFA 5CIYA 9MHTA 1ZG3A 2ESRA 3GNLA 5KQSA 4E2ZA 2AOTB 3M70A 3FUWA 2P3QA 1YF3A 3M6VA 4DQ0A 1VL5A 4HG2A 2O57A 2ZFUA 1XTPA 3HVKA 1I9GA 3KR2A 3PX3A 3SSNA 3FPHA 5K0GA 5EGSA 5LQUA 1KYWA 5DTQA 3LHDA 5MHTA 5EQJB 4FS8A 5EMLA 3UJ8A 2WA1A 4FZVA 2FYTA 3DH0A 1NW8A 4GC5A 1RI3A 2Y1XA 4BLUA 3AWIA 4OX9Y 1VLMA 3O7WA 1SUIA 4MWZA 5CUQA 2C7PA 2VDUE 3HNRA 3EVZA 3NJRA 3KKZA 1PJZA 1XDUA 3MTIA 4RSRA 3GRUA 2GPYA 3NTVA 1QZZA 4KWCA 5FQOA 3CC8A 2P7IA 3U81A 4DA4A 4MIKA 3GWZA 5BP7A 3KPUA 5H02A 4C03A 4AZWA 1D2HA 3UJ7A 4L7VA 5HIIA 3BGVA 2PX8A 3BGIA 1JQDA 4OBXA 4R6XA 5DWQA 1XDZA 3KR0A 1G60A 3UJAA 5ICGA 3EVGA 1HMYA 5FTWA 2UYCA 2WK1A 3LGAA 2QYOA 5CVDA 3HCAA 2H00A 1VQ1A 3EMDA 3ORHA 8MHTA 3A25A 1ORIA 3FTDA 2C7QA 4XUEA 1QAMA 3B3FA 3EVAA 3FPEA 4AZSA 4LWOA 5JR3A 3LKDA 2PT6A 4PGGA 4EVIA 4HSGA 3ERCA 2VZ9A 3MCZA 5DSXA 1EG2A 3TPZA 4C04A 1SQGA 1RJEA 3THRA 5IH3A 4DF3A 2DPMA 4PIMA 1O9GA 4DMGA 1DCTA 3G2MA 1DL5A 3HA5A 2OZVA 4KIFA 5E8JA 5EMMA 4E32A 4RTKA 3GRZA 2OYRA 1I4WA 2G71A 4X63A 2FHPA 4HTFA 2XVMA 4LWPA 4PCLA 3UWPA 3KR9A 5CCXA 1FP2A 5FWAA 2Z6UA 3E05A 2P3OA 3PS9A 3EVCA 5EEHA 3HVHA 2AR0A 3V8VA 1KPIA 3FRHA 4WVLA 5ERGB 4YV0A 2ONYA 2IIPA 1F38A 2Q41A 2BR3A 3ANXA 2BR4A 2P41A 4PYMA 5DX8A 3TKYA 3KPJA 3SR4A 1MHTA 3EGIA 2EX4A 4M37A 5C9ZA 1P1BA 2ZBRA 2V7EA 4G56A 2UYOA 3TR6A 3HA3A 2VDWA 1XVAA 3BWBA 2ZIGA 3GRRA 1NW7A 3M33A 2V74B 1QYRA 4OA8A 3TOSA 2CWWA 4MTLA 3KQVA 1VBFA 2JHAA 5EKUA 2Z6AA 1G38A 3P71T 4POOA 1Z3CA 5K0LA 2QE6A 3UZUA 1Q0TA 2GH1A 3LDFA 2G70A 3G7UA 3MTEA 3EGEA 3REOA 5GIOE 4RTOA 5GOZA 2PWYA 3A27A 5ICCA 4KDCA 3VYWA 5KVAA 5E9QA 4A6EA 5K0CA 4B17A 5EPEA 2CKDA 3M6WA 2EFJA 3A7DA 2EJUA 2AN3A 1U2ZA 2IDKA 3B3GA 1N2XA 1NW6A 2G72A 4XUDA 3T7SA 4RTMA 1VP9A 3CCFA 5DLYA 4YMHA 1L3IA 3AJDA 5GM1A 5D1HA 5T6BA 3OE4A 2HTEA 3T7RA 1ZGJA 3UJBA 1JG2A 3RW9A 1FP1D 2OB1A 3HCFA 2GAFA 5GP1A 4E2WA 5K01A 3AY0A 5K05A 1RJFA 1UIRA 3AXSA 4GEKA 5CVUA 3VC2A 4RTLA 1D2GA 5DTRA 5GM2A 1ZQ9A 4F86A 4YUYA 5F2OA 4RTPA 4F85A 4RTJA 3ELWA 3T0IA 1RJDA 2HWKA 3DLCA 1R8YA 2BR5A 3PVCA 3HVJA 3IHTA 3IEIA 4PYOA 5F2KA 2IH2A 2IDJA 4E30A 3L8DA 4V0RA 3FUXA 1KR5A 4QPPA 1AV6A 3I5UA 1IXKA 1YZHA 5HEKA 3DXZA 5EOVA 2OY0A 4CKBA 3KU1A 3SM3A 2FRXA 1YUBA 2AN4A 2GLUA 3KQOA 2LD4A 2P1DA 2PVCA 2JJQA 3JWJA 3EVEA 5EKXA 3MERA 2B2CA 1WXWA 3PT9A 2AOUA 1SKMA 3NVMB 2PT9A 3HCCA 3THSA 1WY7A 1I1NA 3V97A 5K09A 2UYQA 2YVLA 4DKJA 3LCUA 1JTEA 2F8LA 5FULA 4CTJA 3LCVB 4CTKA 2B9EA 1WZNA 2B78A 3CVOA 1L9KA 3FZGA 2K4MA 1N7JA 2IFTA 4MQ4A 3LSTA 4RVDA 2BM9A 2BZGA 3M4XA 3OZTA 2AOTA 3CJRA 4FR0A 2ZBPA 1INLA 5EHGA 3TMAA 3Q87B 2IH5A 1F3LA 2ERCA 5E1BA 4YMGA 3LBFA 3P9IA 3LCCA 4EMSA 2PX2A 2PXAA 3FTFA 5EZQA 3HTXA 1JG3A 2AOXA 2UZ4A 4PGHA 5E9JA 4YUXA 2H11A 2NP7A 4K6MA 3DULA 3UJCA 3DTNA 4KIGA 3OZRA 4XUCA 2VS1A 4P7GA 5DM2A 1T43A 3MAGA 1X1AA 2YXLA 5HOQA 2EG5A 4FP9A 1AF7A 5CVVA 3FYDA 3LX6A 4RYLA 3TM4A 2OB2A 4RWZA 4P7KA 2ZULA 1P39A 3FTCA 1VIDA 3LECA 4U7TB 3NMUF 3SSOA 4RVHA 5LSAA 2ZZMA 5EMJA 5DM1A 4GC9A 1R6AA 4C08A 3FYCA 5LQNA 1AQJA 3UA4A 2ZIFA 3R24A 5CVJA 1EJ0A 2N47A 3DUWA 4M7RA 2ZLBA 5T67A 4YUWA 4EKIA 4FT2A 1EIZA 4CKCA 2ORED 4BLWA 1JQ3A 3ME5A 5DPMA 4QPNA 4CWAA 4FGZA 2QRVA 3G88A 1R74A 2QY6A 2BM8A 3EVFA 1YZ3A 1JG4A 1Q0SA 2P40A 1RI1A 2OKCA 3M6XA 3R3HA 1BOOA 5HZMA 3O31A 1VP3A 2AS0A 3BWYA 4KVZA 4R8RA 3PTAA 5D1NA 4LG1A 5DM4A 5FHRA 3C6MA 3NWBA 4RVGA 4CKEA 3BWMA 4AZTA 3C3PA 5EG5A 3TQSA 1M6EX 10MHA 1RI4A 3G89A 1X1CA 3M6UA 3OE5A 3SXJA 5ICEA 4IV0A 5LQAA 3UJ6A 3DP7A 4WXHA 5EIWA 2R6ZA 4HTFB 3F4KA 4ER5A 1XCJA 2O07A 1KP9A 2Z6QA 3KPVA 4ER0A 4Y30A 1ORHA 1QANA 3DR5A 3MQ2A 4OQDA 4OQEA 5EIFA 1G6Q1 3LKZA 3NWEA 4GOLD 4P7JA 3E7PA 4ER3A 3CKKA 3BUSA 4BLVA 2P8JA 2NNWB 3NDJA 2H1RA 4Z2YA 4E2XA 2IPXA 2JHCA 3BXOA 3OU6A 2ONZA 3G2QA 4DCGA 4DCMA 2HR1A 5BW5A 3K0BA 3EVBA 5DXAA 1L1EA 4IKPA 1B42A 5E8RA 1KHHA 3FUUA 2DULA 4QDKA 2JH9A 1R18A 1VE3A 3B5IA 5EC8A 2YX1A 2C7OA 5BXYA 4QQKA 5LQCA 1YFJA 3FPFA 3GXOA 3HCEA 3P2IA 2O05A 3Q7EA 4RTRA 4X1OA 4E31A 1H1DA 1KPHA 3CGGA 4LECA 1IY9A 1SVUA 5HIJA 3FTEA 3D2LA 1R00A 5GIPE 5DTMA 5EZSA 3DXXA 1FBNA 4PYKA 5B1SA 3IV6A 4C05A 4MHTA 1NV8A 5E2AA 5KYGA 1G8AA 1RI2A 1KIAA 3A7EA 3SSMA 3NVKI 4YUVA 3EEOA 2JH8A 2ZZNA 1EAMA 3GIWA 1WG8A 3OU2A 5FWDA 4X61A 5K0BA 2WA2A 3UBTA 3ER9A 3OU7A 4QTTB 5E1OA 3O4FA 5IKMA 2NP6A 1KYZA 1OR8A 3WSTA 4HGZA 2XBMA 3EPPA 5KQRA 2PX4A 2AVDA 5LR6A 2PSSA 3BKWA 3KQQA 4KDRA 3I58A 4PINA 5FHQA 5K0NA 3SX0A 3FPGA 3UJ9A 4AX8A 2YQZA 4ER6A 1ZHFA 3P2EA 5P8WA 3MB5A 1NBIA 5DX1A 5FA5A 3EEYA 3JWHA 4HH4A 5EEGA 4E33A 2FK8A 3I9FA 2ZTHA 2YUIA 2NXJA 3BWCA 3KHKA 3P8ZA 3A26A 5E1MA 3KQSA 4P58A 4ZTBA 3RODA 1TW2A 4C4AA 4R6WA 3R6TA 3TLJA 5FADA 3JWIA 2PY6A 2NXEA 5FUBA 5LQJA 3G8BA 1FJXA 3SGLA 4GOMD 1NE2A 1NKVA 1WS6A 2QM3A 3EVDA 4IWNA 4M38A 2OXTA 4DM3A 4PWYA 3MHTA 3BT7A 4DZRA 2GA9A 3GGDA 4GBED 2FCAA 3SVZA 5DX0A 4A6DA 1KXZA 2P3LA 5EVJA 2YXEA 3HCBA 2AOUB 2PLWA 2ZZKA 3QOWA 5K8VA 4F84A 1JG1A 2A14A 3B89A 4RX1A 3AXTA 2BH2A 3C6KA 2NYUA 5U4XA 2VDVE 3BGDA 2ZBQA 4M36A 3GJYA 2B25A 2VP3A 3PB3A 5FA8A 3QV2A 4PYLA 3LL7A 4KRGA 5GWXA 4C07A 2PJDA 5FQNA 2C7RA 5CCBA 1QAQA 4UOEA 2ZVJA 3PX2A 3GCZA 4YV2A 2XVAA 1MJFA 4RTNA 3DOUA 1AQIA 4PYIA 3K6RA 3ID6C 1SUSA 1VPTA 1G8SA 4GF5A 5K0EA 1QAOA 3G8AA 4PONA 3GO4A 2IBSA 3HVIA 3PFHA 1D2CA 3A4TA 5HILA 1TPYA 2YTZA 4HC4A 4C06A 3KQMA 2O0LA 2PXCA 3NDIA 2HNKA 4GUAA 4X60A 4EQZA 2E5WA 3S68A 3VSEA 5F2NA 1YB2A 2XYRA 1KPGA 1JTFA 3T7TA 3P97A 7MHTA 2OO3A 3H2BA 4YUZA 2XYVA 4PIPA 3DMHA 4FSXA 4PYNA 3NW9A 2P7HA 5K0JA 3GRYA 3OFJA 1NV9A 4V0QA 3GU3A 2PBFA 5DXJA 2I62A 1XXLA 3MGGA 4FT4A 5CM2Z 1NT2A 3HM2A 4RVFA 4PYJA 1XDSA 2AVNA 2I6GA 2ZW9A 3EMBA 2AN5A 4NECA 5EHIA 4PNEA 1BC5A 2B3TA 1JSZA 4O29A 5KS2A 2GB4A 1TW3A 4RV9A 3OZSA 3FRIA 3GRVA 1RI5A 4BP3A 1XCLA 2YR0A 3R0QA 3TM5A 5K03A 4X41A 3KPYA 1EJ6A 3ELDA 2HMYB 3ELUA 2QRVB 1X1BA 3BZBA 4FSDA 4E70A 1BKYA 4E2YA 4QVGA 2PWPA 3KQWA 3B7PA 2PV0A 2PXXA 2ZWVA 5G02A 5DT2A 2R3SA 3P9CA 2KW5A 5CVEA 1L3BA 1SQFA 2FPOA 3I53A 1JQEA 4QDJA 3G2PA 3MCTA 5C1IA 3TKAA 3LDGA 4EK9A 2HV9A 5GINE 1M0EA 2AOWA 4H0NA 5EMKA 3X0DA 2ZWAA 3CJQA 1HNNA 5ICFA 3ER8A 4PCAA 1L3CA 2G8NA 3C0KA 3E23A 4AZVA 5E1DA 1UFKA 3TRKA 4P7FA 1SG9A 3KR1A 3P9KA 2IH4A 4GQBA 4BY9E 2G1PA 3BKXA 3G5TA 3FUTA 1DUSA 3KQTA 2PX5A 1IM8A 4IV8A 2AZTA 2CMHA 2IGTA 1FPQA 2Y1WA 1EQAA 3P2KA 1UWVA 3IYLW 3C3YA 5HIKA 2UYHA 1NW5A 2I7CA 2CMGA 3DMFA 3LDUA 5DSTA 5K0FA 3KQYA 4CXMA 1BHJA 4R05A 3PFGA 1N7IA
chains in the Genus database with same CATH superfamily
2X4DA 4I6EA 1EB8A 4YRAA 4HDKA 1H2FA 3DWGA 4B1FA 4YYEA 1FZQA 2Q0SA 1NW3A 3AT1A 4WGFA 2C5FA 3KZ1E 2QUBA 4JUCA 3JZFA 1JX6A 3Q15C 3QLTA 4FDTA 4DAEA 1XYYA 1R8XA 2EX0A 2X14A 4B6EA 3ZD7A 1NYQA 4EZIA 4AJPA 4PZEA 1GGHA 3G9QA 1NOIA 3CF2A 5KQLA 3WAGA 3IVMA 4I5GA 1ND6A 2BMAA 4GOND 4HH0A 2PA0A 4BO2A 1LSOA 3JQAD 3D5TA 4R7TA 4X00A 5HFAA 4A1OA 4FMBB 3RPEA 4G4JA 3ZNOA 2JG3A 2EJTA 2VHEA 4W5JA 2B35A 1VL1A 1GUAA 2XA1A 2XCLA 3GFQA 2VVTA 3LPMA 2IBTA 1ISRA 1Q0PA 3GLHE 3TH5A 5K8IA 2GJKA 4V1CA 3BE6A 5AW1A 3L4JA 5C5CA 1TM2A 3AEKB 1TLTA 2GNPA 5K4AA 3LBAA 2OK7A 3AR7A 1AKWA 3AR4A 3GUVA 2CNWD 5CT9A 2QLFA 1X9IA 1KIFA 1E1LA 2WT9A 3NHMA 4QYTA 4ONEA 4EYQA 2G36A 1GADO 1PS8A 4I7EA 4HUTA 2WEKA 3CXRA 2ZB3A 4IXWA 3AK4A 4X66B 4EKDA 2GNAA 1NQWA 5FYDA 3ETJA 5F1PA 4L8WB 2GLXA 3PRKE 1T2UA 1RYEA 1MX5A 2AIRA 5KOYA 5CD1A 2ZQZA 3DZDA 2K7ZA 4MR7A 4I36A 2V65A 4HGYA 4QDOA 1U5AA 3BRWD 1ZJZA 4ESHA 3C48A 5DYYA 2F55A 9ATCA 4XOIA 3FJ1A 4PFJA 2AOTB 2ZB8A 1NYTA 2P3QA 2QZPA 3KJHA 3KR2A 4M6WA 1I9GA 1E9CA 3T7EA 5G0WA 2BFNA 1BCRA 4YAGA 4O4LA 3W34A 3B8EA 3ZVNA 2XA2A 2TS1A 4KXWA 4WBXC 2VAVA 1XRPA 4BFZA 2BEWA 5JADA 2VTBA 3UG6A 4I1IA 1CETA 1DWUA 2ZYTX 1QCZA 1NIPA 5D5PA 5LA6A 4EIWA 1SUIA 2C7PA 4WA8A 1FLDA 2VDUE 4IDDA 4WKPA 2Y4NA 1Y8AA 4ZD6A 3B38A 4AKTA 3W5CA 3WP0A 3OCVA 5DOZA 4BEVA 5B4VA 3IBCA 1M1XB 4Q1BA 2F3UA 3MLBA 3KYBA 3U4GA 3W9SA 4C0KA 1A5ZA 2YHUA 2GAAA 2OLEA 5A71A 2DECA 1GSHA 3OBIA 3UJ7A 4Z2AA 4GP7A 4P93A 5GAJA 2C5LA 3BGIA 3CZRA 4OBXA 2H5IA 5FNZA 4MPRA 2HH9A 1M7BA 2JVIA 2HY7A 1S96A 1KOFA 2EFYA 1RPNA 2VZ8A 1PHPA 4G85A 4UE2A 2QRQA 1E3WB 3AUAA 2H8KA 1MZPA 2PL1A 2H4WA 1DWOA 2XLBA 3NNDA 2XXJA 3FPEA 5JR3A 1ZIPA 2FW9A 3OOSA 4I5IA 4M2LA 4F12A 4OATA 1F2UB 3QLUA 3MCZA 4QQRA 3U13A 1B26A 1PG0A 1QLWA 3A9SA 1RJEA 3KTAA 5HYVA 3V7WA 5JXGA 2RD2A 1GAEO 5E95A 1R12A 4BWVA 5EMMA 2AYYA 4WNAB 3GRZA 4NFSA 3QBVA 2X1VA 2GXAA 4RQTA 4W82A 2IF0A 4U2EA 5IXJA 4W1SA 1UJNA 1W85A 4F96A 3AGQA 1RHUA 4YCLA 3JTMA 1GUDA 3UKOA 2OO5C 1TT5B 4W9NA 3EVCA 2OHHA 5CFPA 4RMJA 3L0CA 1CRWG 3T7DA 3I6YA 4CIXA 3TLGB 1JIVA 5GPBA 4BC0A 1A8PA 2D06A 1KDYA 1GPJA 3OG9A 4UEQA 3X1WA 4NE7A 3OPQA 3GA0A 2ZSHA 3MRTA 4H17A 4BP8A 2VYQA 4LMPA 2PR2A 2I65A 1T2DA 2Y1FA 1ECGA 2Q29A 1AY0A 5K5EA 2X7JA 3H5LA 2CGEA 3L7CA 3U3ZA 3VR6A 4H77A 2YWHA 1GG9A 3B1WA 1QQ6A 1OI3A 4X3PA 4QX6A 1RTTA 3HWSA 3OEHA 1T4MA 3P71T 3LUDA 4BBAA 4NQZA 5DNYB 3G7UA 5A6SB 2RHRA 4EF5A 4TTSA 2OGWA 1WKVA 3GP5A 4XSHA 3HWX1 2QTFA 3G9ZA 4RY8A 4B17A 5JAIA 5B6IA 3V4SA 3OF5A 3V7YA 4JI2B 2E1PA 4MGIR 4CL8A 2AN3A 1U2ZA 2GEJA 9GPBA 2G72A 1J5XA 1SG0A 1MXHA 3T1HB 4U8GA 4Y6PA 1DKPA 4MYHA 4I4TF 1WSWA 4QXOA 3QEBZ 4TMWA 4FYPA 3SNKA 1GRVA 4IH1A 3EQZA 4EHJA 3DTVB 3VPGA 1JG2A 1LVGA 3HR8A 5GP1A 3RW9A 1OBCA 4TGLA 1JYFA 2DY1A 2VZ0A 3V8PA 4F1KA 4A15A 2AJLI 1XQVA 4GKJB 1U8AA 3WGLA 2PG3A 2UUOA 3Q6MA 1G7TA 2OGZA 4TL6A 2VRNA 4UBOA 4JLAA 2Y2UA 4KKVA 5EUMA 2NTEA 3UJNA 3HN2A 5DNDA 4Z3KA 1UP6A 3PVCA 3C87A 2GM4A 3AEKA 3CV3A 2IH2A 2HQRA 3KRTA 4E30A 1M2WA 2IDZA 1ADJA 4MYTA 1R27A 3IP8A 1SZCA 1U3CA 5EL0A 1BD3A 1CE8B 4K6CA 5D51S 4KR9A 2ODTX 2TECE 2QN1A 3AL3A 5AW7A 5GZ1A 4P0PB 1EFLA 1O6CA 3GEPA 1O6GA 4QFMA 2QG4A 3QPVA 1P0IA 1CQXA 4WY5A 2FRXA 5D3MB 5KNCH 3PQ5A 2CNBA 3Q0EA 4OF4A 1PNTA 2BN4A 4P31A 2HPAA 4WW0A 5EKXA 1YB4A 1JILA 1QKIA 5HX7A 2Z3WA 2AOUA 2OK8A 4PICA 5B4TA 1SAYA 1T8RA 1AS3A 1NJ1A 1KTVA 1PJAA 2KSQA 3O5AA 3CSUA 4IDEA 3OPXA 3LCUA 1IXZA 2PX6A 4TXJA 1WZNA 2PRYA 1J8FA 1YI8A 2QTMA 3CURA 4S0ZA 5AHKA 4QLOA 5FOWA 4ZV4A 3ZVMA 3D7RA 1WY5A 2JGLA 2VP6A 4RVDA 2BZGA 3GGGA 2AOTA 4O4JF 3GRKA 3L0PA 4OGWA 3BIWA 2R8ZA 4KXMA 2E18A 4K6KA 2O7VA 3NUGA 3N58A 3DMRA 3V7UA 4D9EA 1V3VA 2ZBUA 3ND6A 2NU6B 2IRWA 4TRRA 1RLMA 2G09A 3OY2A 2V55B 4K5QA 2B34A 4H15A 3KZOA 3LXUX 3DNMA 4QPCA 4DYVA 4Y9DA 1D1SA 3L06A 1HDZA 3UOGA 4YUXA 2RHDA 1RXSA 4ZJYA 1WVMA 1TL7C 2VRWA 4UW9A 3DTNA 3IXMA 4XIJA 4K9OA 3EZLA 1J07A 2B2NA 1LDBA 2ZBFA 721PA 4C0WA 3VNRA 3QNWA 5ALIA 4V3CA 4FNMA 5KX5B 2YJ5A 4FE4A 2PZEA 2REBA 3C8UA 4H6XA 2GO7A 4W63A 4DBZA 1TAUA 3DXFA 3TM4A 3GVIA 4JLOA 4BFTA 1BMQA 2OB2A 5IJ0B 3UTCA 2ZUDA 3AVVA 4IVPA 3D6MA 1W36B 4MITA 2LR0A 5CH8A 2HA2A 1R6AA 3D4BA 3P9XA 1A2OA 1G3MA 1N25A 5JS7A 1TM1E 1ESMA 2QP3A 1DJQA 1PQUA 4HWSA 4CMCA 4DJDC 1X13A 4TS4A 4EHFA 2JIQA 5BWOA 5BVGB 5C18A 1GCAA 1WTAA 3K1ZA 3TBFA 5IZCC 5H8WA 4GZ6A 4AJNA 3L7MA 1U7TA 2G9QA 4ARAA 4MJ7A 3WLMA 4C2TA 3QHAA 4G8BA 4ECAA 1P1JA 3SNHA 5B30A 5AW6A 4C7OB 2QVBA 1JIUA 1TOAA 2R5WA 3Q3CA 2P40A 1Q0SA 3ZDYB 3SHVA 1QHIA 1G41A 3DKVA 2ZRQA 2WMNB 4I6GA 4W8GA 1B1CA 1C9EA 2R97A 5DGHA 1VPWA 4IQ0A 4TKUA 4DQDA 1IEVA 4NENA 1GZHB 3LPCA 3R3WA 4TKVA 2ACEA 3P7MA 3SP1A 3LV8A 3NDBB 5AJYA 1P62B 3OOHA 4M88A 3IR5A 1Z0ZA 5JSZB 2QQGA 4K7JA 1NUUA 3AF5A 1K6XA 2P9HA 2YMPA 3EA4A 4OQPA 2KB0A 3EXAA 3RRNA 1TEHA 4FYIA 2GTHA 5ANRB 4Q9DA 1P3Y1 1PR0A 4NHEA 2ROQA 1QVZA 3EMKA 2EP8A 3JYQA 1Q6ZA 3LH5A 1UFOA 4O0MA 4IXNA 1HK7A 4OUDB 3KPVA 5BOVA 4MJXA 1ORHA 5J4VA 3OQ1A 1S9HA 1LPPA 5EIFA 5JCOC 1GITA 3IQFA 2VBCA 4AD8A 2EP7A 4LY0A 5LD2C 2IOFA 5KWEA 3DGFC 1JNXX 1G0NA 5ENVA 1XNHA 2ZRMA 1BN7A 5HDQA 3UAYA 3ND8A 4UUPA 1G98A 3AUUA 3OOJA 1GVHA 4FZ3A 4N54A 3EA0A 3OIFA 4OD0A 2PPLA 3SJZA 3IUJA 3B2QA 3D6TB 1I3MA 4ND4A 1PT8A 4Z1MD 1EGQA 7GPBA 5A6SA 1SO8A 1ONNA 5CG1A 4RABA 3GXOA 2DKOA 4PG6A 4BEWA 3ODGA 2D1FA 3HDJA 1XU9A 1DDGA 3CNNA 3FN4A 1TF7A 4KQ9A 4X1OA 4A73A 4ALNA 4BO5A 5L4NA 1D6SA 3DT8A 1DAFA 2VQ3A 3RS0A 3SS7X 5BNWA 3K20A 2ZRGA 2WJGA 1YKFA 4HWRA 5LLTA 1CS0A 1TJPB 1E2NA 1M7HA 1RWQA 2LRHA 2QDKA 2XKAA 3JRNA 5E2AA 4Z51A 1RI2A 3P0EA 2XT6A 3DTVA 3BH6A 1JDUA 1CDEA 4XVUA 5BVHB 3M6AA 3A10A 2IS1A 1ZMRA 3QA9A 2VP4A 1J23A 1I1QB 2XR1A 1F2DA 4YJ2A 4W5WA 1TZ2A 3ER9A 1EUCB 1KVUA 2HMWA 3UICA 2BTQB 1KYZA 2H65A 3DOJA 3RO7A 3LK7A 3ZWVA 4GHWA 3TDMA 3T41A 1RJWA 3T3IA 3CLRD 4PZ9A 2H2WA 2H07A 3KELA 4KDRA 2WI8A 3WLRA 1LVUA 4A0RA 3FR7A 3A8TA 3GVCA 4KRFA 4OMCA 3ISJA 3PC6A 1QGED 3INTA 2HEGA 3QE4A 2YZKA 1DFIA 1CE8A 3Q98A 4O4LF 4K6HA 1C81A 1KEEA 1WMBA 2I54A 1LPSA 1DBRA 3N2KB 4Y0NA 1LX7A 4C2UA 3RODA 5B5SA 1I6LA 3M3DA 5LA6F 3QLVC 5FADA 2GWRA 1FVHA 2FP4B 5BSEA 5CDSA 2CCGA 4QBTA 4N41A 1ZVMA 3ENQA 1ACLA 4M38A 2AHRA 5CIWA 1A0OA 3K0SA 3I39X 3MWJA 2R1UA 4KQGA 2F1RA 1BD4A 2GOYA 2CXPA 3TVYA 1I36A 5BV1A 1EWTA 2ZDGA 4F84A 1MG0A 3S2GA 5B58C 3O3MB 2R6AA 3AXTA 3ROKA 2RGCA 2GN2A 2VP2A 2P5SA 3BGDA 2EDCA 4BZZA 3RASA 2AXNA 1A9QA 1SZDA 3MUNA 3RRYA 4YDHB 4GGPA 2YRFA 3O9MA 1APBA 4MUYA 3B7GA 1ORRA 3FX2A 1ZK0A 1H6DA 3Q12A 1SQ0A 1GRCA 1OJLA 4AU1A 4WX2B 2HI0A 3KXKA 1SUSA 4G1MB 1AKVA 2VK8A 1MB9A 2WIJA 4EI9A 5C8XA 1L7DA 2XDAA 3GVHA 1GTG1 3TIFA 4DWOA 4CEHB 4HC4A 3GDOA 3N5KA 4KOAA 1XX6A 2XF8A 4WH0A 4C3ZA 4F1JA 4EENA 3HI6A 1EG7A 3QOYA 1UT6A 4JU8A 3DO5A 1Z0JA 1QH8B 3FKSD 1CLUA 1ZMXA 2YFHA 4IF6A 4PU0A 2WJJA 4PYNA 3KQHA 5MFPA 3ACBA 5BN5B 1DO8A 2YINC 1TADA 1DCMA 1XXLA 1AKQA 1G2IA 1SB8A 1T4CA 1R0KA 1TB4A 2NYVA 3IQHX 1KOGA 1JEQA 3Q1LA 1AZWA 3SBDA 2I6GA 3V8MA 2V7XA 1H6BA 2O8VA 4JLSA 2PKEA 1AF4A 2D5IA 3KZVA 4KMRA 4LYAA 4RJTA 2IZZA 3G82C 2C7BA 2BDEA 3CR7A 4MRAA 3W5UA 1A1SA 5JNRA 1NQVA 4HZUB 3KUCA 1R9MA 2IIVA 4MW0A 1E6LA 2DTDA 2F7SA 3IVAA 1Q1ZA 1FS4A 2A0KA 3Q9UA 3ZWWA 3H7IA 2BP7B 4Q18A 3V4OA 2GN4A 4QE3A 3KWMA 2B4QA 1XRJA 3D3NA 1BJKA 4PZCA 4F9TA 5C3MA 2R8EA 4CCAA 1R4MA 2WPNA 2YMLA 4L2IA 4DIBA 2H17A 2NU7B 3ZTWA 5GGXA 1SBIA 4TQ9A 1G6OA 4O4IB 4D0NA 2CDNA 3KFVA 4QA9A 5C1IA 1I4DD 3SZLA 2YBEA 1RAGA 1ZK3A 1Z0AA 4G9GA 3PFFA 1D0VA 2PS0A 4MEJA 3WRYC 4IIBA 4X20A 1HNNA 1X6VA 3EY4A 3HUEA 3E23A 4F3YA 1AC5A 3JRWA 1TTHA 1TA0A 3AHGA 4HFMA 3K70C 1TMOA 1HFJA 2WLTA 2EWVA 4WTOA 1L7NA 2R60A 3G5TA 4C4RA 4AT1A 1LF5A 1WOYA 2IXAA 2VDWB 4XX0A 3N74A 2Y1WA 1FPQA 1T4DA 2GM5A 2UYHA 5I4IA 4L28A 5BY2A 2E49A 1SWVA 2I7CA 4KHZA 4MB0A 1G7CA 5DSTA 1NIJA 2SNIE 4B7AA 1MENA 1W0KD 2Y2VA 3CNLA 3SDSA 1E3EA 3NOOA 5ALPA 3ABZA 4F8JA 4P5PA 1BU8A 1NL3A 1WDKA 3I76A 821PA 2ECKA 2O7QA 3IRVA 4PC7A 3WDKA 1N78A 2YXBA 3L79A 3OT1A 4EDFA 4R68A 4RIFA 3RUDA 1VIYA 1Z5UA 1V2GA 1KJ8A 4ZALA 4Z0HO 3K31A 2O06A 1E79D 2D5AA 4HDNB 3UH0A 2J45A 1EP9A 1SZPA 3O82A 2F1KA 4OBWA 2WWYA 3OCZA 4IFIA 3UPDA 1V1MB 4MJ3A 5HKKA 2ST1A 4BEJA 2BSXA 3FUVA 3LLCA 3KAQA 4EW1A 3KVVA 4GI2A 3IAFA 1SD1A 2ZRIA 2PDAA 3EIXA 1BJTA 3EXG2 4FPXA 4LJ4A 4LRTB 4RJJA 3RAPR 3TIXB 4HNVA 5JCPA 3ZZTA 2J7PA 1NURA 2WOOA 3ZH9B 2XHZA 2CFCA 4YC7A 3Q2KA 1ZGBA 4MWOA 2O2CA 5GONA 3K70D 1E69A 2XH8A 1S4QA 2ZSUA 5LMZA 3SEFA 2J46A 4PLYA 1GKKA 4GMDA 5FL7A 5FOQA 4H16A 1W4AA 1FRVA 1ZQ1A 1P1HA 2Y0PA 3HEAA 3EUAA 4L57A 3REFA 1PWYE 3UB3A 4AUNA 1VLLA 4MWEA 1K7FB 3AVOA 2NXNA 3VR4A 3FNHA 4BN0A 4BNYA 2IP4A 3OIDA 3ET5A 4REMA 4RKEA 2FQQA 2FTKE 2OD9A 3RYIB 2IU3A 1CG6A 4OHZA 3DYIA 4B8YA 4DQUA 5AM2A 5AVSA 4P4SB 2HLHA 2Q9UA 4P22A 1A5SB 4FILA 5IWAB 1JDBB 3RYHA 4ZI5A 2F6RA 1SUAA 1O54A 3VR3D 3B3JA 4O1HA 2OBFA 1LNZA 2B20A 2QW8A 1E96A 3WWZA 5DOVA 1HT1E 2C1EA 3PGMA 2W90A 3SPXA 5A2GA 4NYIR 4TXLA 3WRYA 2J9ZB 4FBGA 2CFSA 1NHGA 4DCSA 2O57A 3SSNA 5K0GA 4AKGA 2XQJA 1P74A 3OTHA 1CEYA 2AYZA 2VDMB 5EGSA 4Z9BA 1FP4B 3BULA 4C4YA 3ND7A 2VI5A 3WOVA 1SOAA 3B52X 3N7AA 1SUWA 1Z68A 1VKNA 4LOJA 5EMLA 2DWPA 2WJ3A 1WEKA 2YJZA 5KNDD 4WBSA 2P2GA 1W75A 1T4BA 1VLMA 1U31A 3B2NA 4DA6A 2CL7X 4G5YA 4JV5B 2J09A 1XDUA 2X8JB 2JLWA 4M99A 2E4VA 1C8BA 3OAAA 5EXEA 5LJLA 4JP3A 1DC8A 4BO0A 1U2PA 2FXIA 3DHVA 3K8QA 1OWNA 2GJ8A 2WD7A 2Z5LA 4KWCA 4RU1A 3WKCA 3PYLA 3LCMA 3PKJA 2IW3A 5DYNA 4B5LA 2BHTA 2CCJA 1EA5A 3G23A 3QX7A 1XDZA 1N1GA 1VI5A 1NBWB 3VR1A 1H5NA 4OPMA 3ZCUA 4DCTA 3R76A 1LSSA 2VF8A 3FJYA 3HCAA 4LSGA 1U7ZA 4NCNA 1QGUB 2JHGA 4Q39A 3PC8A 4JITA 1L2TA 1ISMA 4EBBA 3KZMA 3PSHA 4TV9A 2JB9A 4EVIA 2EQ5A 2IQIA 2FPIA 4TYMA 3FCYA 1SQGA 1TYBE 1Y63A 2C2GA 2KI5A 3ACCA 5AICA 3PUWA 5ISMA 1SHJA 3CH4B 4AN0A 1WSBA 1E8MA 3K3PA 3L7AA 2ZUBA 4G37A 3A6EA 4INOA 4RJ2A 3FUCA 1GGNA 1XZFA 5LPNA 3JTEA 1V4VA 1RDFA 1GNQA 2A9OA 2BP7A 2GAOA 3A6FA 4MIEA 5BYJA 2OYRA 3TIGA 2QM0A 3M2TA 4OJMX 4F3KA 4A0SA 4FB5A 5FWYA 1U0BB 2E7ZA 3VHXA 1VSBA 2XBUA 4JBWA 4EMBA 2NU7A 1T9CA 2FUCA 4O4IA 3W1EA 2BFDA 3EB9A 2WSBA 3MJTA 4PHGA 1QWSA 2JFPA 5EEHA 3OZAA 3CVYA 1P1FA 2HJWA 5G4KB 3F67A 2JBAA 2E4ZA 1E9AA 2RK6A 2XV1A 4DJFC 1LNSA 2RHWA 1KZHA 2RGRA 3ESYA 5JVDA 5D6OA 3E5NA 3KXIA 5TPZA 3UH1A 1R0SA 2J9XB 5L6LB 5D5HA 3Q2OA 4G56A 5PGMA 4EGCB 1B3BA 1N9ZA 5CLLA 5HW0A 2VDWA 4F60A 2ZIGA 1G8HA 4QICA 4KO1S 4U5XA 2H63A 2OQ2A 1U9JA 4Z3DA 1CLEA 3NWPA 2GNOA 1AXEA 4YJ2F 4OK3A 4PTZA 3LOUA 1JE0A 3LRTA 3K6JA 3PXBA 4LRWA 1T8WA 2D2XA 4XD7A 1W4RA 2ATCA 3UZUA 4XWOA 4O63O 2CBZA 3REOA 4F21A 3ESBA 4YDSA 2GKOA 4QELA 2C9OA 2P27A 3ZK7A 5J58A 4CNBA 3FVQA 2HK8A 1I4LD 4A6EA 3ZWKA 1YQXA 2C5GA 4BVKA 3OZ7A 1DQNA 3B9RA 1KEWA 3M5WA 3N9IA 1K98A 1J09A 1ABFA 2WTXA 4MA4A 3DKIA 1O95A 3R5SA 1L1QA 2BSQA 2A7QA 1YASA 4HDNA 2W6QA 1DNPA 1NJGA 5HQJA 3CNBA 3A58B 4NESA 1PFUA 4F5DA 5JDIC 4ASUA 5ALYA 1AUOA 3H65A 1E1YA 2VWQA 3KBOA 4KN8A 3DBLB 4JR1A 3VFDA 1FFAA 1CKEA 5EY5B 5CBPA 4D5EA 2CXNA 1UIRA 2ATXA 1O1YA 3A6KA 2ZROA 3AXSA 4IOLA 4MQUA 4QBFA 5CVUA 4JI5B 1QO0D 1C4KA 4B4VA 5C1DA 3LCJA 3FVRA 2JLYA 1ZJ4A 3L4BC 3B53X 3SYMA 5THQA 2X4LA 4QGSA 1Z12A 1KAOA 1LPAB 1SN7A 2IDJA 4IQ8A 4WA7A 5CPFA 5AJUA 1V8DA 4TLLB 5U1PA 3C41J 3NALA 3ZIAD 3BSSA 3IKTA 5GJBA 3U4AA 1PR5A 1HDRA 1YZHA 1AHIA 4M0EA 2JKZA 3CZ5A 1NSFA 1Q3KA 2IPMA 1TAGA 4UKDA 3BA1A 4D3SA 4CUZA 3LG2A 4DUZB 1EFUA 1F8GA 3OM9A 4JI8B 4XIFA 4IH4A 1ULTA 3VUFA 5GADl 1L7AA 2UUAB 2J0UB 5DIZA 2VJKA 3THSA 1GZ4A 5A7FA 1KJIA 3NHWA 4O25A 4XGIA 4CR7A 5IHXA 2JGDB 3M3HA 4CTJA 5FXMA 4OB8A 2J0SA 1VSVA 3JY6A 3UV6A 2WF5A 3NETA 5KX5F 2K4MA 5F9MA 4ZCLA 1XXHB 4ZVNA 2I6TA 2OHIA 1Y6ZA 1NY5A 2V4ZA 3DFZA 1A9XA 1Z2DA 3GZTB 4ADSG 4O8CA 3Q3JB 3I01M 3PEYA 1RP1A 1B6SA 5ETJA 3PQEA 4OU5A 5LQSA 4DCVA 4FYMA 4KK3A 3H18A 1F3LA 3PUVA 3H4TA 1FP4A 1ZIDA 3KEOA 4GX1A 4Q9KA 1U0GA 3A36A 4P4UA 4EMSA 1CUZA 5AKKA 1GIAA 2FZGA 4ZANA 4EJFA 4F8YA 5AW2A 1YKGA 3FXAA 2FWIA 2HXYA 3ASVA 5EZQA 2C2HA 3U3OA 1ADYA 5EHNA 4D96A 5JZ9A 4PGHA 4PG7A 2FPRA 3IDFA 4U6SA 4TYYA 3V4FA 2EGGA 1W93A 4LWQA 2X8JA 3R74A 3RNOA 3K2IA 3ROZA 4MO2A 1U28A 5BRNA 1WWKA 4KJXA 2FP3A 3A1CA 3ICCA 3X2EA 4BVAA 4BLQA 3SI7A 3DWFA 3AV3A 2A5YB 3IQIX 4RESA 4FFNA 3U37A 4HZIA 1W29A 2NUPB 2ZULA 3GVXA 2YMQA 1K5HA 1BA2A 5AOCA 4RHXA 4ZZ3A 3UKJA 3BFKA 3FYCA 1UK7A 3WLAA 1H9CA 2O6LA 5JARA 5LQNA 5G41A 2REQB 3D59A 1ZUWA 4YGYA 3KQUA 4MKGA 1EJ0A 3M6MD 4RQUA 3DHYA 4M86A 1TVMA 3RJZA 4URVR 4M9UA 3N75A 1ONPA 3BGWA 3AF3A 3RV4A 1RRCA 5DPMA 1WXIA 1CUGA 2AQHA 1GAXA 4KYUA 2CNNA 3K8ZA 4AMGA 3ZWBA 2XMZA 3DZKA 3FDIA 3FYUC 2O5CA 4ZODA 4M1KA 4NU0A 3DCJA 3USCS 3P4XA 1SUBA 4WN3A 3CLTC 4UTZA 1LSUA 4D82A 3OZBA 4R8RA 4TZ0A 3AI2A 1UEXC 3CPJB 4G41A 4Q4AB 2YRWA 3RHTA 3IPXA 3RRXA 3FPCA 3IMEA 4XLLA 3EZYA 5KKNB 2XGOA 1JT9A 4CKEA 1N5JA 3IKJA 3ZVRA 1ZL0A 1UJBA 5CXQA 4NCAA 4EJSC 2O8EA 2D1TA 1M5RA 1YOBA 1JR3D 5KU7A 4HAIA 4Y9RA 3OURA 3V42A 3EXFB 2CCKA 3NT5A 3R3SA 2XWSA 1G8FA 2OYSA 3OHSX 2Z8YA 3E9NA 5E7MA 1C7IA 1O8BA 4D4IA 5C7OO 4PO8A 3ANLA 1N4DA 5KCMA 3WFZA 2KX7A 3QMPA 4FVTA 1I2CA 3MWDA 3MRXA 4D43A 1Q22A 2WWGA 3BUSA 2BMVA 4GX0A 1R0BA 5HM6A 2ZYRA 2R4QA 4HYEA 3QMVA 1OI7A 4ZYLA 5C34B 3AERB 3OU6A 1RTKA 3G2QA 4JROA 4N3CA 2RJNA 5E9AA 3SFTA 4B48A 1JKJB 1XMIA 4NTZA 4DIFA 4YMWA 4J29A 4KLNA 1XWIA 2AK2A 2FWAA 2DULA 1J9EA 1QRTA 1TKAA 3FB1A 3KSUA 3KV1A 1E2DA 3L8YA 1DAIA 4KO4S 5KWIA 4E1BA 4XGNA 1DJOA 3ZWMA 5HJ7A 1NI5A 1TUEA 1UQRA 4IJQA 1GZDA 2NPIA 4LXUA 4Q9NA 4X6XA 4BO7A 4F2WA 1DXOA 1GTJ1 2IU0A 1Q0RA 3IP3A 4DS3A 2X8AA 4HNSA 1IYZA 3VNQA 3VYTB 1EAMA 3VNAA 3OU2A 2BTOA 3FSJX 1YTUA 3WZLA 5E4JA 4DZZA 2O0JA 4E13A 2FW1A 4B76A 2NT3A 3UBTA 4D9JA 2JDID 3GN1A 3LYHA 2BI4A 4QYMA 4QXMA 2P9BA 4TTRA 5K7SA 3PSAA 4YWJA 2VHZA 3CVXA 4MUIA 4X84A 1CJTC 4JBLA 1RQRA 1OHHA 3A3NA 3OOWA 2C3YA 4DLNA 1K92A 2Q2QA 4O2AA 2AJCA 1OH8A 3ZGXA 2H4FA 5DX1A 3TL6A 3EEYA 3M81A 1XTVA 4E33A 4FM9A 4M49A 1M6VB 1UZUA 1Q5PA 2HSEA 3KHKA 5LQDA 1JHDA 1G5RA 1DBWA 3L0DA 3VZCA 1G7RA 2JZOA 4M60A 3S7TA 3R6TA 1YBFA 3GLIA 3UHOA 2J0UA 4Q24A 4IWNA 4RHYA 4BATA 2HXSA 1NBMA 1E32A 4EATA 1KOJA 1BXRB 2PN1A 4DHWA 3GGDA 2JGDA 1H94A 5FNVB 2PFKA 3TCXB 4UJ5A 2XB8A 1N0WA 3GLUA 5JSHA 4WFIA 2I3AA 4G8DA 5E7JA 4ZT2A 4ZV7A 3OTWA 3PXGA 3W6ZA 1JPVA 2INGX 3ZDCA 1JQKA 2HBYA 3OM1A 4CF6A 5EZ5A 3ASZA 4RMIA 1Y8ZA 1HEYA 5K3AA 5KTKA 5CX1B 5JZVA 1JH9A 5JC1A 2ACWA 1KEPA 1SXIA 2FRVA 2GCEA 2N1MA 3NASA 4KFRA 3MUFA 1MRZA 4Z54A 1G21A 4Q6WA 3ZJUA 1SUEA 1KNXA 1QG2A 2Y66A 2FN3A 4RD3A 1L0BA 3ID6C 4LYFA 1CHDA 3DJFA 4DWVA 5EJGA 3E3OA 4M0UA 1YRYE 4UM9D 5HILA 1JI0A 3WC4A 3GLFA 5CXUA 5IBRA 2CD9A 1CSEE 3GVPA 2HWYA 3VM6A 2OV4A 5JMTA 3DKRA 3T7TA 1OFIA 4BMZA 4LXGA 2OO3A 2NUPA 1PJTA 4ESVA 4CLDA 1SCDA 2FY8A 2PGOA 5GQSA 1N6NA 4QSHA 3N0WA 3IX7A 3LOPA 3BMNA 3BD6A 2O1WA 4L15A 4N3NA 1SM4A 5CT5A 3NKFA 1UPBA 4O4IF 3SG0A 5JZMA 1WVGA 1WZEA 2JGIA 4MRMA 4GQAA 4D5GA 1A4XA 5BR7A 3ONEA 1W2WB 3DEFA 5DHQA 1L5RA 3SJBA 2O23A 3WLTA 3WLSA 4B7UA 4RYDA 3F1LA 3JAKA 2J30A 3HJBA 3NONA 5AJZA 5JVDF 3JPWA 3PD1A 3PEWA 1Y1LA 3WWCA 2JFVA 3EC7A 1X15A 2V7QA 2PH5A 4PC6A 1NR7A 2HIGA 4Y0VA 1OA1A 1PR6A 2JAXA 2WDZA 1FFEA 2Y1LA 3E0XA 3RIHA 1I30A 3TLYA 5A4AA 4J7AA 2X0FA 1XTTA 1HETA 3EGDB 3PHHA 1RACA 1FMCA 3GMTA 3E9YA 2B4AA 4ZVVA 2MCFA 2X42A 5CB4B 3KOUA 4UOQA 1L5FA 1VGQA 2V7BA 1E1CB 4UFPA 1SQFA 2Q5LA 2X8BA 4G5GA 5FOXA 1QC5B 3MTAA 4FGSA 1B2LA 3EULA 2XEDA 3K9WA 4BCBA 1KAMA 3Q0TA 3EZNA 2DP4E 5D6NA 1DPFA 1A2KC 2NVOA 2ZWAA 4FGWA 4OU4A 3UN1A 1GKYA 1TUBA 1H05A 5BURA 2HIHA 1TQ2A 1K8XB 3FVWA 4J7CA 1C1XB 4JNKA 5E1DA 4PG8A 5J4YA 4BBPA 4YV7A 3OZCA 3EX7C 1D0SA 3AF2A 2IH4A 1SG6A 4K0RA 4RHUA 1NMZA 2VBIA 3EIHA 2NVUB 4URZR 1CQZA 3F9CA 4XD2A 4ZAGA 2UVPB 2IIQA 1T15A 3PHCA 4MUGA 4Y8VA 2JLUA 3T38A 2NUAA 3PUXA 5BQFA 4H4CA 3WAJA 3PBKA 2DFPA 3H3FA 3OOYA 3SJ7A 2C42A 2FDCA 2PS9A 3QWIA 5EAIA 2EIXA 1MVNA 3E27A 5IVHA 3FNEA 5JD6A 3U9LA 1U8UA 2IHKA 4J0DA 1Z2AA 4MS1A 4ACBA 4W5OA 3BERA 1LBEA 4DREA 3K7EA 2P35A 3H5TA 1ZD3A 4I4CA 2PM8A 4JLKA 3ZJ4A 4A6XA 4EDHA 4F06A 2XOEA 5D5QA 1XTZA 5EIEA 4H7HA 3VR6D 4YJHA 3KLNA 3O8LA 4FXPA 2EAUA 4XRRA 1L4NA 3OJLA 3F74A 1YA8A 4RH1A 2LIVA 3KTOA 3QXJA 2XNSA 3H5NA 3LBYA 3P9NA 5K3EA 2QAIA 3FY4A 1VMKA 4GM1A 1PGOA 2VT2A 1CJMA 3JQQA 5KU1A 5B1HA 1E1DA 3HCDA 1V4BA 1P9LA 2Q4TA 3CR3C 1CUFA 1DTEA 3DXYA 4KW7A 3RSZA 1UBSB 3IELA 1XNRB 1YVPA 1J22A 4RY0A 5DVZA 5FCDA 1YCDA 1L5MA 1XL1A 4D4KA 3D8NA 3Q7QA 2GEDA 5JOQA 2PH7A 4QVKA 1JQLB 3LW7A 3HG7A 3OHPA 4PPQA 3DJYA 2I4MA 3PPVA 4R81A 4XWGA 5BORA 4QG3A 5CCDA 3A2KA 4ZCPA 1W1IA 2F3TA 4PBTA 1FSFA 1LQ2A 1PS0A 3IQXA 4MQ5A 4PEVA 2JEOA 4AJLA 5CGQB 1F14A 1NBHA 3BCSA 3AKYA 4P4GA 1H0KA 4Q48A 1O03A 2AXPA 4MRPA 4UBIA 4BASA 2KLHA 4CCYA 4DLLA 3W5IA 5LOVA 2NZ2A 4RD2A 1B23P 1NNLA 4NEGA 3DV2A 2BY4A 3H4MA 5FNVA 1V5GA 4LXTA 4M1EA 1UMDB 4QIHA 4IWYA 1IZ0A 1Z4JA 5DM70 4IXDA 4Q7QA 4BFXA 3I72A 4EJ2A 2A2ZA 5AK5A 5LQUA 2BLNA 4HQNA 1E4EB 1JF8A 4UHHA 4CBVA 2OVFA 1THTA 5LYJB 1HE1C 2B1QA 4ZO6A 2IUUA 4EW3A 5CX1A 2PZAA 4ALMA 4MDEA 3PQ6A 4U00A 5DSZA 1NU6A 5TVKA 3FETA 3WNCA 4UU1A 4EG8A 1PTJC 4CFYA 4ZV9A 1S2OA 5ALGA 4EARA 3EUEA 3AM5A 3ENWA 4LVNA 4G23A 4RSRA 1PJZA 4HB0A 4A36A 3S1SA 3WNQA 2GM9A 4Y0AA 1KSHA 1FNCA 3E03A 3LY9A 5FPTA 5IT9A 3I5MA 3L6OO 5L3SA 2R8XA 2PZ8A 2V3WA 3BL6A 3ETCA 3FCXA 4OH7A 1DOAA 1RPTA 2DU8A 4PLWA 4S0XA 4WEQA 3TTYA 3CN9A 2VP9A 4I1UA 1VYUA 5JG7A 2XMBA 4U2CA 3URKA 3THYB 2VTKA 4MUFA 3TTTA 2PX8A 2WF7A 1ZRHA 4ZT3A 1NAIA 5CEJA 1QR2A 4WY2A 3UJAA 4DEXA 3J81A 5FUXA 1WCXA 5FTWA 1H2YA 3IHKA 3ZWOA 4AG5A 1MC4A 3SEQA 3CLSD 1MABB 3LFHA 2AB0A 3H3XA 3UAGA 2CZCA 3FMOB 3U60B 4XGKA 4W99A 1Z0UA 4YRJA 2J3LA 5AW5A 3ND5A 4B46A 4NFHA 3UF0A 3Q7IA 4BKPA 4N7MA 1E89A 2O8CB 3C3WA 5FFMA 4XZ3A 3VPAA 1SVWA 4R01A 3THRA 5I4KA 4C87A 1BE1A 2JL1A 1Y3HA 3U2QA 4EUFA 2IHNA 2VHXA 4Q7EA 4RMHA 4DUYB 3VPSA 2I2AA 1KAGA 1JPJA 4W5NA 1K7XB 1VJDA 3D7LA 4YONB 4MVJG 1TRKA 5JWHA 3P9ZA 2K5UA 3AWDA 7ADHA 1GPBA 4EG5A 3D3QA 1LDMA 4XWAA 4NOLA 1RHRA 4PCLA 2PUDA 1V95A 2ZU0C 1KZ1A 3IVRA 2RGNA 1FL9A 5KI6A 1P2FA 3D0KA 3EDRA 5HWSA 1S8FA 2O3QA 2VYCA 3AH8A 2AR0A 3T3EA 3IPLA 1KPIA 1FQKA 4R2WA 1L5YA 4UNIA 4RKRA 2O9JA 5DULA 3TSAA 3UK1A 3CONA 3EWAA 4C3UA 4B3GA 1X70A 4RA6B 2WM8A 3HB5X 4YCDA 3NBYC 3QXCA 3W5VA 4DIKA 2RB5A 4HT3B 3L82B 4RWEA 1PEKE 1LJLA 3OESA 3NHBA 3WYFA 4URUR 2JVKA 4X8OA 1HFKA 3O3OB 3BWBA 1H4QA 3NEPX 1ES9A 2V74B 3TOSA 4L6CA 1G4AE 4KNVA 4MUAA 4OKSA 2JJ1D 1LLCA 4IDCA 2FLVA 4HEQA 2HA6A 4OQLA 1G0OA 3Q9LA 5GVRA 3VJRA 1R88A 3G1UA 4C1NA 3UWOA 4RADA 3ZN2A 5C52B 2K2QB 4KP7A 3VNSA 2JPDA 5AW8A 2H57A 1TIBA 4R1OA 1V16B 4D9HA 1B8NA 1N33B 3MMSA 2WFAA 5EJAA 1P80A 2K2WA 4O2AF 2H59A 2KYRA 1ZINA 2ZYSA 1TT7A 1IM2A 1W94A 4PFSA 4LXQA 2FX5A 5E6SA 1DELA 3BXXA 5TT1A 4YTEA 4MYUA 3ESRA 2HTEA 4L6IA 3NBMA 4I9HA 2OB1A 3IAM6 2TMGA 4LF4B 4HX9A 3G2LA 3L6EA 1E77A 4K3UA 4OXKA 1XRLA 1XP5A 2X9VA 1E98A 2ZJYA 3W8EA 2AFIB 4YUYA 4RTPA 1UL1X 1P9NA 1EYZA 2EV9A 1Q57A 3WQSB 3KSRA 2H9IA 1XD2B 2YZMA 3ZJTA 1T2EA 3L43A 2XWQA 2VUHB 2ZI5A 1TO6A 2BFBA 2QD2A 4DUPA 4BTEA 4AI6A 4NI5A 3AR3A 3NEYA 1I6KA 2YWFA 4J7UA 4QPPA 4R3WA 1X8XA 1YMUA 2F90A 3A3OA 4C88A 1SVKA 1AMOA 5DB4A 2ZIUB 1ZWLA 4D8UA 1YUBA 2Z4SA 1OXXK 2BFFA 2M2IA 3KQOA 2P1DA 1XMOB 3JWJA 3IV9A 1FJHA 5FOVA 1KAHA 2IBMA 3HXLA 1A7UA 2XUIA 2CW5A 4IWXA 3FJOA 4LGMA 3SOPA 1E0JA 4ZARA 3VZDA 2B9EA 2FR0A 4PZPA 2DF8A 1QTQA 1L9KA 3VDRA 1JDTA 2WE7A 1EK5A 3HB1A 1NM5A 1GQSA 1ULSA 1VFNA 1P0FA 2EKDA 2QW0X 4N5HX 5WRFA 2ZR7A 1PCXA 2HMSA 2O5EA 4HDMA 1GGVA 3VPBA 4PLHA 4ZOLA 2VUSA 2H1WA 3P9IA 4IY1A 2BPOA 5FO0A 1XD9A 3FSRA 2R7LA 2CUKA 4OYLA 1VA5A 3RKUA 1E58A 1YB1A 2C78A 2FUEA 1P61B 3LVQE 1QP0A 4DLYA 2G9VA 4K6MA 4WN9B 3IBTA 3WYEA 4N0PA 3O1JC 3PR3A 4IDOA 1Y82A 1QIKA 3WLHA 4JXKA 3SY8A 1OV6A 1PR4A 3RADC 1R0LA 1SWWA 4KITB 4LBZA 1N7HA 3N07A 3KT8A 3LECA 2O8BA 1U0FA 3SSOA 4I9UA 1FNBA 4HQ6A 5DM1A 4LZJA 1WZUA 1JWBB 1NBAA 1GAWA 2H92A 2VP5A 4L78A 5ITZA 3O74A 2WUWE 4JMLA 7YASA 4B0OA 2G9RA 4G1FA 3TL2A 2EQAA 3R0ZA 2FMXA 3ZCXA 4RA9B 5A4MS 1GPH1 3AEZA 1N5KA 4MO9A 4IV5A 5FBZA 1PR9A 5L53A 4FT2A 4LJ6A 2CJWB 1DBVO 1EIZA 1XJCA 1K27A 2DT5A 4Q1EA 3UMCA 3ZG6A 3QVLA 5TPWB 4DE5A 2G9UA 2QRVA 1VCNA 3ZE7A 1TU0A 4A2QA 4R1QA 2XUQA 2O8CA 4U9HS 1Z6TA 3QBTA 1ZOIA 1CJUC 1KI6B 5ARCA 2R1VA 1C7RA 3DOEA 2Q62A 2V7PA 3F6RA 3FSEA 5TNXA 2RBEA 2MSNA 3WGHA 5HZMA 1J9GA 5CEFA 5JAMA 3O8QB 4CQLA 4NLLA 3VI4B 1HPLA 3OCXA 2DCUA 1IZ8A 4XKJA 1VJRA 4KAAA 5L3VA 1O5IA 1VKOA 1T9GS 1CJCA 2I29A 4MA5A 1J8YF 4LOHA 5AI8A 3OE5A 1NFQA 3JARB 3ONNA 2WIDA 1UOPA 2H3HA 3G8DA 1QRDA 5FORA 1ZD9A 2K7FA 3VO1A 1P0QA 2VJPA 2O0HA 1G6Q1 4EHDA 3IIMA 3DCIA 2BGTA 1DWQA 4QRIA 4TSFA 5HDBB 4BLVA 1QIIA 1B73A 3NTOA 4YMIA 5BR1A 1VL2A 4LAFA 1TUGA 3NDJA 2FVYA 3I6BA 1UAGA 2TMDA 3Q3GE 3WZ2A 4IEEA 5JJLA 2J5RA 1QFZA 4DCMA 3CM0A 3NTRA 4U7WA 4PPGA 5BSRA 5BW5A 3GT7A 4I1VA 3WK5A 5KMGA 4DR2B 4YALA 2Y1OA 1LD3A 2R87A 1L5GB 3OUTA 4JGIA 1IWBB 3WLLA 4QDKA 2GCPA 3AUTA 4JZYA 1EP2B 4MR9B 4RFSA 5J2UB 3RB8A 3HN7A 1P31A 1Z4MA 3DF9A 3DEAA 2ZR9A 3QX8A 4BN5A 3IERA 1GQOA 1PK9A 1SHLA 1KR2A 1NLZA 3TNJA 4G9EA 4ND2A 1DKMA 3L8EA 1TDJA 3GLIE 1EFPA 4IMJB 1GCGA 4ZT5A 3RANA 4A7PA 3T4PA 1MJ5A 2CUTA 4FB4A 1U9IC 4EEZA 2QTVA 1NBME 4BCCA 1UBFA 1KI1A 4C05A 3KZXA 5LOVF 5ED4A 5DISB 2J3MA 1LDNA 2HA3A 2PBLA 4LISA 3HLYA 4OFZA 1XMJA 4M53A 1XXHE 4H7IA 3X2SA 5AVYA 4FIZA 1IULA 3KQNA 2FFQA 1LPOA 2W11A 3G0OA 4Z99A 1JBEA 1PTKA 3JATB 2UZ1A 4HQFA 1GU1A 3CZQA 3VV2A 1Q1AA 2GCIA 5FNVF 5AUNB 2R751 4HGZA 4KPUA 1MC1A 4FJ2A 3SC4A 1FNNA 5DGIA 5DK6A 3VYSB 3WJ2A 3FDZA 1GQYA 3MTBA 4E1VA 3BKWA 4QD3A 5HKKD 1R6XA 1G21E 2G88A 5EJIA 4WNCA 2ZT6A 4N3AA 1SVLA 4QT0A 4BFWA 3K9FC 1H66A 4N3BA 2ZUTA 3CTPA 4HH4A 3WWYA 1IOVA 3JZMA 3OX2A 3I8SA 4MKRA 4BX0A 3QMWA 2XMSA 1HDXA 3KQSA 1OKKD 3D3JA 2J7PD 3HFJA 3HHEA 1JPNA 4UMEA 4YFYA 3S8YA 1L5ZA 4RKWA 2HZ7A 4YS6A 1XK7A 2O2YA 2ZP1A 4GOMD 4GVPA 1UAYA 4JA0A 5CA0B 1SVNA 5FL7D 5T5QA 2OXIA 3ZWPA 2GPNA 2ZUVA 4MVCA 4EAQA 4C4XA 2Q1YA 4F04A 5J5AA 3K5IA 1JB9A 1A76A 3ZNNA 3TBKA 4GG1A 1M2EA 2VDVE 1NRXA 1N2OA 4L9AA 4LHEA 4H7JA 5EE1A 3V80A 1XMXA 1ZM9A 2QJRA 3TOXA 4C07A 4EB6B 1V48A 4JT9A 3WK9A 4DXAA 4C9BA 3GJ0A 4ZVMA 3TMYA 1VOTA 1L5NA 3AY7A 1YFZA 1ND5A 1SUFA 2I8LA 2R68A 2Z6VA 4MV9A 5LZ5A 3QE3A 3GO4A 1UBHS 5TB5A 5D00A 4JP2A 1DRKA 1V47A 2J5QA 2W8ZA 3A4TA 3QKRB 2QL5A 2BONA 1W7AA 2C3PA 2O59A 1UP7A 4KV7A 5K3OA 1I4OA 2ZTSA 3FBGA 3MC1A 4HP8A 4WI1A 3ISVA 1D1TA 4MVYA 4UDOA 1EBUA 1QYXA 2R44A 3NXSA 4PHTA 5H9VA 1M2HA 2NT4A 3ZBQA 4KPYA 4MMXB 1QZTA 1SA0B 2VWGA 4FSXA 4D6XA 1EFRA 1OPRA 3OFJA 5T4FA 1ODIA 3CNHA 4Q34A 2IPAB 3TK1A 2PBFA 4BP9A 3D02A 1ZL2A 1NT2A 3OAAD 2ZI4A 3SHFA 4RAOA 2GETA 1D5WA 2Q6TA 3DFMA 3KOWA 1YIDA 3L8HA 3EMBA 4BFUA 1MVOA 4ANFA 3TWOA 2OVBA 4PSKA 4O29A 1JJBA 4H4DA 621PA 2I9PA 2XTNA 3AEXA 3ETHA 4KFTA 4FHEA 4EVSA 1POXA 3QPWA 3WQBA 1KY5A 1VE1A 1TPZA 4L6AA 4L73A 3KPYA 1R6DA 3CPEA 4X7MA 1MT3A 3BZBA 4RGQA 1RT9A 3WDSA 2GK4A 1GL9B 4BQQA 5CMLA 3NHKA 1IN7A 3HLTA 4ZKDA 3ED5A 1MO4A 2PV0A 2PXXA 2Z3VA 2PD6A 2ZJ1A 4UZSA 3USZA 1DV1A 2R3SA 2BMWA 2HJ9A 1O77A 3VVLA 1IFXA 3I53A 3FF1A 4JZKA 4IMPA 2I3DA 5CIQA 1J33A 1JJVA 3FR8A 4NV3A 4YJKA 5AUOB 1XAGA 2N0SA 3QXXA 2IEAA 3C1UA 4LQ4A 1ATZA 2VHCA 4N4AA 4U8HA 3LWZA 3U31A 3X1JA 4AVYA 4UZFA 2ZUFA 3CJQA 1B8UA 4L75A 4P6VF 4KUHA 3MCAA 2FQ1A 4JODA 3T4UA 1Z36A 5J4HA 5K51A 3R41A 5HJEA 2VJCA 2JCBA 5FV4A 3PC7A 3ONVA 4Q3EA 3O73A 4UEJA 1A98A 4E2FA 3B12A 1Y3IA 2XQFA 1A9ZA 1FDWA 5GV8A 3VU8A 2LVBA 4CG0A 1XTUA 1IDN1 3JVEA 1O9BA 2OBYA 3IT1A 4WZAB 4M0FA 1AO0A 2CV2A 4QGHA 2QZJA 3KQYA 1TQ6A 1HQDA 3KTFA 1V25A 3OICA 4Y1EA 5TPZD 1DC4A 3HZRA 1ISHA 2IITA 2QTRA 3JD3A 4UVGA 4F6RA 4RTSA 3EXHC 1HX7A 2JZNA 4Q7KA 2PGXA 3DDCA 3K2QA 4E46A 2DR3A 3ZWNA 1XPUA 5JS6A 4OX9B 4JNCA 1DXHA 4HEA1 1O2DA 5EWMB 2SBTA 2X8LA 2FSPA 3QSGA 5DCWA 5C0OE 4LFCB 4QQNA 2OSVA 2F9LA 2FJPA 4D8YA 4XD7D 1V3UA 4HH1A 2E9SA 2G5TA 4GLBA 3EBLA 4QQFA 2IV3A 1EZ4A 3MGCA 3NGLA 3BE5A 1NXVA 1TUIA 3MQ4A 5DHRA 1RKUA 5I4CA 1H0HA 3F4BA 1RHMA 4X64B 4BNXA 2FUG6 3T9CA 1G20A 2ZI6A 2EZTA 1O95D 1NXQA 4HOYA 4NOMA 5KOJB 1OFUX 4MVWA 5KVSA 4KR3A 4KQFA 1R0ZA 1XZDA 2FPGB 5FI1B 5E2BA 4AZ3A 4ASUD 1IZYA 2UZ0A 4E11A 4CIBA 1N2SA 5JEEA 2IY9A 1FFDA 1M8FA 2W37A 4HLUC 3FI9A 4ZOLF 3TLCA 4A1FA 2EJVA 3DAFA 3IEPA 4LRUA 4DDMA 4O2BA 1SC9A 4MNTA 1GGEA 2FUKA 4LC0A 4JX8A 1KHTA 2J08A 5CNKA 5KHOC 2QZ4A 1M6YA 5IANA 5L4SA 3I3SR 1KJJA 5CA0A 3QTTA 1CRQA 3NFRA 1JDSA 1R5NA 2CV1A 3HBMA 1HQCA 5IJZA 4K1XA 2BKLA 2ORWA 4J03A 5JAOA 1PUJA 5JH7A 2ESRA 3WK4A 3M70A 5L7WA 1IE3A 4HG2A 5F9HA 4N5LA 3HVKA 2D8MA 4CV2A 4DV6B 4Z9AA 1UBOS 2M6KA 1YU6A 1MRSA 2W6OA 1DE0A 1N5IA 5CCEA 1WOMA 3TO5A 4JOSA 4BCDA 4E14A 2W22A 1A82A 2QT0A 2AW3A 1JA1A 4MW7A 1CUHA 1B15A 3SC2B 2J9GA 5KNBD 3QPCA 3MJHA 3MUOA 3FFBA 4QXRA 1MW8X 2SECE 4JJAA 3OVMA 4PSVA 3QKRA 3MAJA 4E6PA 4TYNA 3H1EA 3GFTA 3R7AA 3B6IA 5BR8B 4C03A 3HYRA 3WA6A 1XP8A 2C3UA 1E2GA 2QR2A 1DEXA 3ECSA 3EYAA 4XDHA 1J2EA 5F73A 2H2IA 3RWBA 3KR0A 3IVXA 3LP6A 1JUDA 4I3FA 4IF4A 3S8EA 1YC2A 2X41A 4DLTA 1UPXA 4MVJP 3ZV5A 5HUHA 1OAOA 4EF6A 2YWGA 3LGAA 3LNTA 3LVFO 3ZHZA 2Q45A 1K4MA 3PPXA 4HLDA 4JQSA 1LWOA 3A70A 4XR9A 1K5DA 3TI9A 2V96A 2C7QA 4CEIA 3HKBA 3K73O 1UBMS 1E3TA 2OILA 4U2DA 4AZSA 4B75A 3FDXA 4UHDA 1D7AA 3H2YA 1C4XA 1MEJA 1QDEA 2ZAMA 4J3JA 3M34A 2QPAA 1YR6A 2JI8A 3HC7A 221PA 5DT9A 3O38A 4B6QA 2P9QA 3P0HA 5LWQA 3PGXA 2FSUA 1WLYA 3ZOZA 4NCJA 3K0AB 3ENNA 4EA6A 1FA9A 1EEHA 1V6AA 3DL0A 1PS9A 1V0JA 2DHDA 1NUAA 2GRJA 2FHPA 3T3PB 5BRJA 5JANA 6ABPA 4LV5B 4JJ8A 1F6DA 4ZEVA 4LC9A 1J42A 4DCOA 3I4LA 2XKJE 2GZHA 1TO2E 3FNBA 4YRIA 3KDAA 4WVLA 1K6JA 4L8GA 4AKEA 1C3OB 1L8XA 4PYMA 5LLSA 1WUYA 4DJEC 1L5HB 2E2WA 2YV3A 4QYSA 3HKDB 4M37A 3A05A 2IUTA 2GK7A 1WXQA 1O94C 1PFGA 1ZIYA 3NNNA 5D7BA 3U49A 2ZIXB 5IKEA 2UYOA 3HH8A 4RD0A 5AKJA 5C2JB 1Z74A 3KTDA 3R5HA 1E2IA 2PSFA 4FC7A 4YLYA 4P3PA 1WCYA 4XJSA 1JZTA 5JNVA 1G38A 1Z8HA 2HRDA 1Y37A 4HF7A 4YDQA 1X8LA 4RY2A 5IVKA 2FG6C 2Y0BA 5E2IA 1YS6A 5F9FA 1JRLA 2O3UA 2GJ4A 4ID9A 5KOHB 3RLFA 1AKRA 1ADGA 1A9YA 1Y8QA 5BR4A 1DJMA 4AWBA 1TGYA 4Q3CA 3FZYA 1N2XA 2DPXA 2I66A 4XUDA 2G80A 4RL6A 4AO7A 2HHHB 2Q1XA 1VCMA 4Q66C 3A6ZA 3QLUC 4GUDA 3FMIA 2AT1A 1LI5A 1NF8A 3ZCTA 1KU6A 4ZKEA 2HHLA 4Y2QA 2OECA 4CKZA 1RJFA 4ZQGA 4LRSB 3WG9A 3V00A 1EZZA 2GYWA 2VSOA 2C54A 3KE9A 4MQLA 1IRIA 4JLBA 4C7KA 1F4VA 3KOYA 5I9MA 4EVQA 1VFPA 4F85A 3COJA 1TCVA 4I0WB 2FMHA 3THXB 2H29A 5IT4A 3PC2A 1P7PA 1ICEA 4IDBA 4ENWA 4OQXA 5TSDA 4XYLA 1LY1A 2GBCA 1P2GA 4I9FA 5AQEA 5G40A 5I47A 3M0EA 4JUBA 2I2XB 3INNA 1FDIA 5HG0A 5T8KA 3FUXA 4I1SA 3W2GA 1XROA 4PC3A 2PTGA 4D57A 4DMMA 1U7WA 1YRLA 1UP4A 4W8OA 5DGDA 1LK5A 1OSNA 1BQ4A 3KU1A 1Y6RA 5ESDA 2BZ0A 4DPLA 4L8YA 5I7UA 4R98A 2V6FA 5C1BA 3S81A 1P3DA 2DLNA 3VR6H 3HNPA 3IAEA 5C7LO 1D2NA 2W2QA 1YIOA 1OHHD 2D1YA 4XPZA 1DJNA 4JJ7A 2VQ6A 1HNZB 1ZBDA 3PXAA 5LP6A 3LOQA 4E51A 2NUTB 4R2IA 1CZHA 2O3RA 3HJRA 4YDRA 5J40A 2H4HA 1E92A 2VPYA 3DT9A 3ETNA 4L4RA 1UFVA 4MAFA 5EVCA 1I3CA 3V5NA 3ZU2A 3SKYA 4YCNA 4IIJB 3CJRA 3KB2A 3PHBE 3IAHA 3N3BC 1CDDA 4J1SA 4K26A 1YQQA 3H8JA 5IM4A 3HKCB 3OZDA 3RRMA 5J23A 1NN1A 2QRKA 3FG9A 4TLDA 4DABA 4ARZB 2AHOA 4DIOA 1C2YA 2CXRA 5IMBA 5HPYB 2CUZA 2MSCB 3OQMA 2RGXA 4GWLA 2WB4A 2BL4A 3ZH2A 2V54A 2Q7OE 6REQB 4ZZIA 4RANA 5IS2A 3OQ6A 5TQJA 4DRYA 5B2EA 2C20A 3KS9A 2NP7A 3TLMA 1ODKA 3C6QA 4KIGA 2YN4A 1SHUX 3KEGA 1XLTA 3BIXA 3OZRA 3AVQA 4P7GA 4DQKA 4QDUA 1NVVQ 2GI4A 4YRPA 4BVFA 3A2LA 1ZFNA 2D00A 3L7YA 4OREX 2ZPUA 3X1MA 1FDTA 1J8MF 4NBWA 1UZNA 5ECDA 1IN1A 2WIAA 2FSVA 1T5DX 1VHJA 2ZJ2A 1O96B 1U4NA 4IOJA 3NMUF 4GZ5A 4ZQFA 3L01A 3IS3A 1U2GA 2IU6A 4TL7A 1NI3A 2EBFX 3LZDA 1YUNA 4OHPA 2IYLD 5AW4A 1WX1A 4D8TA 3DE6X 3MSXA 4IGIA 4JSRA 4KAFA 4D4MA 4LF9B 4RORA 3A6DA 3DUWA 2ONCA 3B2EA 5T67A 1CUVA 3TGLA 2CSXA 1PAUA 4N5IX 2BGKA 3IOEA 5CNJA 3RBXA 3FVVA 3ANTA 3G88A 1Z0SA 3V8BA 2QY6A 1U0NA 4JYCA 2GCOA 3L04A 2XMQA 4EPRA 3QVSA 3QVWA 4TTVA 1ZYUA 3SHWA 5G0UA 1KJZA 5CYPA 5IRCD 1BOOA 5DGCA 4KVZA 4WZ6A 3CH5A 1X7YA 3SYKA 1QHGA 2ECPA 1TKRA 3VU9A 3TRHA 3LL4A 2MDTA 1C8VB 3BWMA 3TQSA 3NIBA 5FTLA 1XVLA 3ZQ6A 4ZAXA 2CNLA 3RDPA 5EHQA 4IYJA 1EWRA 3A9VA 3PNLA 3ZGLA 4RZUA 4ALIA 5AVOA 1XEXB 4O3MA 1OZGA 2R6ZA 3ZX5A 1UK6A 4REQA 4KQIA 2V7QD 2EATA 3L77A 3H05A 3T7KA 1ONBA 4RXMA 1HL3A 1J8DA 1NNI1 1OTXA 1KFBB 2A84A 3TB6A 1J00A 3HKDA 4DNFA 3CX7A 1GNRA 1H6AA 1DC3A 2OCDA 2NSHA 5G53C 1G64A 1TCAA 1ZNQO 3R9XB 4YRQA 2IPXA 1QGOA 1F51E 2V4UA 4UUBA 1ATIA 3EW7A 5CLQA 5IVIA 4Q4LA 1J21A 3MMPA 1RZRA 3K0BA 1M1ZA 2FH5B 2Q6IA 1SQ6A 2PMCA 2R8PA 3DM9B 1SB9A 4JVNA 4ZP1A 3T3MB 4TRMA 5HQ3B 3NANA 2X5KO 4KFSA 4KJZA 4MVJM 3QKIA 3D8HA 3NORA 1CUWA 2NO9A 4S1NA 4RE6A 4EHHA 4G5FA 3L0ZA 4YY3B 3E70C 1PVOA 4KPEC 4EYOA 4FHGA 5FOTA 2XADA 2B1RA 1Q15A 1XFDA 3JD1A 4A10A 4ZEOA 4WASA 3RK0A 3URMA 1JWAB 1H2EA 1J90A 3G17A 1PL7A 4AN4A 3QJGA 5DTMA 4A8JA 4O2BF 2WVHA 3REGA 1XGKA 4MDYA 2Q3DA 4KGXA 3A4MA 1RWWA 4IDAA 5FPHA 1N2CB 3EEOA 4XGQA 1S3GA 2ZYUX 2A5LA 1O58A 5CA0F 3BBPA 3T54A 2WHYA 1G8KA 4GFDA 3QLEA 4J94A 3THXA 2XGGA 3W8NA 3IURA 5JH7F 5ICSA 4UM8B 2ZITA 4LQLA 3ROPA 3VSDA 5ADWA 4MINA 1QYDA 2C9BA 2V58A 5FHQA 3SX0A 2A3RA 3MS4A 1A8HA 1L8QA 3PFNA 4KR6A 1R66A 3RBAA 3UGTA 3KAKA 3VYVA 4DR1B 1SPBS 3EASA 1RXUA 4M76B 2ZTHA 2LCFA 3TRFA 4O0LA 3GHYA 5BN3B 4FMCF 3GF4A 1CR0A 5AJHA 1SD5A 1KETA 5TMBA 2OXTA 4DM3A 1P2DA 2XKBA 1Z4PX 2FGJA 5THXA 1R10A 2AG1A 1QCYA 5CNMA 4DMKA 2P3LA 2CLDX 3ADBA 1WCWA 1I9CA 1V2HE 1BA3A 3QJ5A 2YOFA 5JPDA 3N53A 3NAZA 2BDUA 1EWVA 1NTOA 4TZTA 3SQWA 3T61A 5FYQA 3BH0A 2FZ5A 5EWJA 1TCUA 1YRWA 1PBNA 4ARZA 1UQUA 4OEHA 4R1NA 4BGVA 1YQDA 3OQOA 4J8PA 1P2SA 1QJ4A 1ISIA 1N32B 4UU8A 3SYRA 1MC8A 1UUFA 2HCJB 4J16C 2FG7C 2ID4A 3W8FA 3U4QA 4UAGA 1P0CA 3A1EA 1P60A 3MBKA 4X7PA 1DIAA 1RD4A 3RTGA 2VJAA 4DR4B 1MX3A 1BVRA 1ZOPA 2YTZA 2Z95A 3PQCA 4FQ8A 5CDFA 2XBLA 2Q2VA 3AY6A 4D6YA 1DJPA 7MDHA 1G59A 4KGVA 1C30B 2B6NA 5FFFA 2XYRA 1VCHA 4PNZA 4FIDA 1T1GA 3GJ8A 3MWEA 3UT6A 2XYVA 1HYHA 2JGKA 4UMDA 1BWRA 3NW9A 1RLIA 2P7HA 4JEIA 4M1YA 5SY6A 1ZM2A 2P2NA 2D54A 3RVJA 3AR9A 3L1JA 2WF8A 1B7GO 1N8TA 3B6EA 2YV4A 4Q0MA 3MRSA 3Q6IA 3H42B 4M9SA 1UMCA 1T5OA 4ZK6A 4BL5A 1JSZA 4HY3A 5EJ6A 5KS2A 4FFDA 3O8DA 3W6UA 2DEUA 1EJBA 1H1LA 1KC1A 1CQPA 1I2MA 1O7JA 1XCOA 1IK6A 2FETA 4QUDA 3NYIA 4EG7A 4F5WA 2YWXA 1FX0B 1NN0A 3D6VA 4Y9UA 4E0BA 2H4JA 1P1RA 3N2GB 3UC5A 4Q9IA 1ZCFA 3TLEA 1NXWA 1FOEB 1CEQA 1E5XA 3Q11A 3ROGA 4YCSA 2AR7A 4ZEXA 1BIFA 2FMKA 4LRXA 5IYZA 3GEIA 1YXMA 3ZXIA 3CB2A 2ZE6A 1P1KA 3EC1A 1V9CA 3A1TA 4E94A 1EBFA 4MYCA 2FUNB 2JFHA 3O6VA 4RZSA 1F1JA 4RFVA 5DCLA 4B47A 1FU8A 2P9YA 4H0NA 1GFWA 2C04A 3DTYA 4KACA 2D74A 1SU7A 2ZJ3A 4YB8A 5D7NA 3SIRA 1YNSA 3S55A 2IYFA 2NACA 4QHSA 1NP3A 5BSFA 1U7OA 5EJ4A 2G17A 1KO8A 2IYPA 2VHTA 2ZSJA 4LA4A 4QULA 3P9KA 2OD2A 3R5JA 1KI7A 3RSQA 3V4LA 4BUJA 2GYVA 1DUSA 1N3YA 1V11A 3P5SA 4IV8A 1URPA 5I7HA 2VPZA 1W19A 2FN8A 4GPIB 1UWVA 5BV7A 3L4SO 2ZBVA 4QOHA 1QLJA 1OI2A 4UULA 2WKQA 1W36C 3WL8A 2VA9A 1F9EA 2IYOA 2GCNA 3OSZA 4MQEB 3QA3E 4EELA 2PMFA 1ZN7A 2Q1TA 1NMEA 2V7GA 2XYQA 4HRAA 4AJHA 2V0CA 2ZSDA 3UC9A 2C7VA 1GN9A 3ZWQA 2FX3A 1CQJB 5DRTA 4B34A 1ZN9A 3MW8A 1KFKB 2VATA 4IZHA 1XZNA 2QNRA 4PQEA 2VDRB 4RVOA 1NLUA 3ZCPA 3KFLA 2EP5A 1VLQA 1AIPA 1NNEA 2HU7A 4NFLA 3HFRA 2YZGA 5FP0A 3G0DA 4LXXA 1DIGA 1S7CA 4HYYA 3H11B 2A1UA 1PGNA 5JTUA 2OD7A 2BUBA 4G1CA 4JC5A 3UQZA 1EDOA 3FF4A 1NFFA 4G0MA 4Y2HA 5C8YA 5LP6F 3HBNA 2D2IA 2OA0A 3ZQKA 1PL0A 2IZ1A 3JQ7B 4Y7DA 1NQAO 1PKXA 4KWEA 3CX6A 4ZYWA 4OXNA 2HO4A 1XVVA 3QEAZ 5DI3A 1PZEA 1G8MA 3PEVA 2EKPA 3CW8X 3R3VA 4COKA 3ZGZA 1PDWA 2IK8A 2G1KA 4OHXA 1HDGO 5IM4F 4OIFA 1EHCA 4UVDA 3ZBUA 4AYTA 1V5EA 2GZ1A 4TMXA 4LNAA 2YJ4A 1I5OA 2I4TA 3E8SA 3BXHA 1NVGA 1RPJA 2ZOSA 2EJWA 3ZXYA 1P1CA 4TXMA 4X71A 2YYYA 1NUPA 2F3RA 2WP8J 1C0KA 2XCUA 2WD9A 2Z43A 2ZDQA 1CQIA 2PYIA 3F5FA 3GDWA 3GCWA 1B1AA 4M3NA 3TFWA 1KMQA 4HS9A 1JFFB 2AN1A 4Z49A 4B7XA 3U19A 5LKAA 1TM3E 4R4JA 1RFLA 1S1CA 2HOQA 4ZXFA 2R4TA 4EB8A 3RU9A 2MYNA 3E7WA 1JHPA 3BREA 3QPAA 5AI5A 2OUKA 3C3XA 3CVJA 3VU1A 1QIMA 1IHOA 1ANKA 2C2MA 4NC9A 2VTEA 3VKVA 1U4OA 4ZYXA 1QYCA 1XNGA 2ATIA 3D0QA 3OLCX 5KREA 4LMAA 4R2MA 2WJ4A 1CNEA 4H59A 4PRKA 1JFLA 5G0SA 1RI3A 4HX5A 1Z35A 3COYA 4R7GA 1RC1A 4BLRA 5KCZA 2BGMA 2DWCA 3AF1A 3QF4A 4JJIA 3GEHA 5C32A 2FJ0A 2XQVA 3IUQA 3IJRA 1N2EA 1ZEJA 4Q82A 4X97A 1K89A 2O2SA 1WKCA 3OLXA 4NYMR 5H02A 1AH2A 5D86A 1SZJG 1PO7A 1M66A 1FU7A 4DMCA 1C30A 3T3DA 4Y98A 5BSVA 4N7BA 5DM60 2WYHA 4J0HA 2O2ZA 2W2KB 5CW2A 3FI0A 4OP1A 3MQFA 2JLZA 4MDFA 2I7DA 2QMHA 2YIDA 1Z8DA 1VI2A 3EK2A 2WK1A 3LVRE 4MKXA 3VR4H 3L1HA 4ITVA 1UXIA 4ID3A 3QXGA 3OD1A 5KTRA 3EVAA 3GD5A 2NG1A 3PGKA 4LS3A 4TL8A 1V4NA 1XMPA 5ITWA 3COVA 4MK4A 4HSGA 4CM7A 2FFRA 3LHKA 3LO8A 1QIGA 3QI7A 1WF6A 2WFLA 4A16A 1OD6A 4N40A 1PEDA 4WZAE 4LTNA 2Y0DA 4WLEA 3G6KA 1JEJA 1H2BA 2QN7A 3B1XA 2BT4A 1CDOA 1ZRMA 2P78A 1MF7A 2B0CA 4Y6GB 5EPOA 4FFRA 2Q50A 4HAYA 1Z7BA 4QU0A 3P9PA 4YECA 4WWHA 1W2GA 2PYDA 3EYWA 4TWBA 5A0TA 3DYVA 4UDYX 1U5CA 2BFCB 1DEOA 1M34B 1FP2A 2BISA 5DYWA 4JOBA 4HVLA 3B7WA 4HQKA 4JLWA 5KBYA 4BMXA 2Y1EA 1PWEA 4LV6A 2WOJA 3CZMA 4I50A 5KX5A 2BZ1A 1XNJA 1Y1SA 1IG0A 1X1SA 1F2TB 4INAA 2HLDA 2N42A 3UNXA 2WQ7A 3TKYA 3ADCA 4ZCMA 4MIYA 4I5FA 5AQ1A 3QVGA 1SXJD 1DTSA 3H3JA 4KSCA 3NQ41 1AB5A 3SVLA 1E6KA 1P7WA 2ACVA 1XDDA 2J4CA 2FWRA 3NIWA 5HE8A 3N6VA 4AO8A 1PBTA 2YHSA 5LCXA 3O0DA 3F3YA 1XVAA 3O8OA 5K3CA 3RGWS 1NW7A 3M33A 4GYYA 3ZXUB 3CEHA 2VYVD 4P2BA 2XUGA 1I32A 1UANA 3O92A 3IPYA 3OQIA 4S35A 3P9RA 2GH1A 2WFZA 4O4HA 1J5EB 1QUEA 1IOZA 5B12A 3TEFA 4MQEA 5DHTA 4KDCA 5AHOA 1E1RA 3VYWA 1FK8A 2JARA 5E9QA 1XDBA 3JD2A 1RWXA 3V2IA 2BFAA