5LQKA

Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-2,3-dihydroxy-5-[(4-methylphenyl)methyl]benzamide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
total genus 80
structure length 216
sequence length 216
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqkA00
1L3BA 2JH9A 2ZWAA 5EZSA 5U4XA 1NV9A 1OR8A 2NP6A 4QTUB 4HSGA 2R6ZA 4RTPA 1ZGAA 3NMUF 2HTEA 2XVAA 1AV6A 3LBFA 5FADA 1R8XA 2AZTA 3TR6A 2VZ9A 3FPFA 1VPTA 3PX3A 2OZVA 4RTSA 2DULA 4FP9A 5E1OA 5FTWA 1NW7A 1X19A 3IHTA 2IPXA 3UJAA 5EKXA 4C05A 3PS9A 2FYTA 3ANXA 5EEHA 5CVUA 1G55A 1G8SA 1KR5A 2FPOA 4BLUA 5ICEA 4PYJA 3IYLW 4DCGA 4E31A 4ER5A 4YUXA 3E8SA 4RTJA 4GOLD 4M38A 5GM1A 5HIMA 2IGTA 3SSOA 2ONYA 3DMGA 1Q0SA 3B7PA 3MERA 4PCAA 1UIRA 5E9JA 1JQ3A 4DCMA 3FTDA 4X60A 2ZIEA 2PWPA 3GRUA 3R3HA 4A6EA 2EG5A 2ONZA 2PY6A 3KR1A 3LGAA 4M7RA 3TOSA 5CUQA 3UJ9A 5IKMA 3UA4A 5FQOA 1NW6A 1DCTA 1RJGA 1D2CA 5EPEA 4HC4A 4PONA 3HCBA 2OB1A 3TKAA 3CKKA 3B3JA 2I7CA 5HFJA 4PYKA 3V97A 4E2XA 5MHTA 4BY9E 2AN4A 3P9CA 3NTVA 5JR3A 4DF3A 1L1EA 2ZBPA 3I58A 3ORHA 5BW5A 5DTMA 3OU7A 4E2WA 3FUWA 4RX1A 3UJBA 1P1BA 2C7PA 2Y1WA 5GINE 2UYHA 3ER9A 4QVKA 3S68A 5BW4A 1RI3A 2OKCA 3VC2A 3T7SA 3I53A 3DULA 3HCFA 1SUIA 2O07A 2B9EA 3DMFA 3KKZA 1IY9A 2VDWA 3DLIA 3OFJA 5KVAA 4PCLA 2XYRA 3JWHA 3M6VA 1HNNA 1D2HA 4KIGA 2ZSUA 2AOVA 1WZNA 3EMDA 4GEKA 5DT2A 4FGZA 4PNEA 5EIWA 4XUDA 5ICGA 2NYUA 3EGIA 3C6MA 1QZZA 3C6KA 5K0BA 5KS2A 1BKYA 3HA3A 2P3OA 5DM4A 2NP7A 2PJDA 4RTMA 3MAGA 4CTKA 3PFHA 2G72A 5DM2A 2ZZMA 4HGYA 5EC8A 3AJDA 2BZGA 3AY0A 3DOUA 2GPYA 2GH1A 4RVDA 4YUYA 2O0LA 2HMYB 4BP3A 3A7EA 2PVCA 3NWEA 2AR0A 3GU3A 1YUBA 2G71A 4P7GA 4MHTA 4KVZA 3CBGA 3QOXA 1VBFA 4CKEA 3P2IA 4HTFA 3BT7A 5K09A 1RJEA 2ORED 2ZTHA 3LL7A 3M6XA 4QTTB 1XTPA 2K4MA 3PFGA 4FT2A 3GWZA 3DR5A 4HTFB 1WXXA 3AXSA 4E33A 2B3TA 3KQYA 3LCCA 2BM9A 3ELYA 2ERCA 3PB3A 1Q0TA 3FPEA 4HG2A 3PTAA 1JG2A 3KPJA 4CKCA 4ER6A 3EVEA 3K0BA 3G2PA 5CVEA 5E1BA 1M0EA 4DQ0A 3HCCA 3OPNA 2PWYA 5C9ZA 2AN5A 1FP1D 5FWAA 4R8SA 3LDUA 5EMLA 3HCEA 3MGGA 3EVZA 4V0QA 4QPPA 2C7OA 1IM8A 3G5LA 3FPJA 5T67A 2YVLA 4A6DA 1KP9A 3CGGA 4AX8A 4PYLA 2GAFA 3GO4A 3LBYA 3GXOA 1XDZA 3BWBA 2VS1A 3GGDA 4JXJA 5EQJB 3QOWA 4YMHA 2P3QA 1AQJA 3G2MA 3P2EA 4C08A 1SUSA 4E2YA 2BR4A 3EGVA 3IEIA 3BWMA 3EVDA 2P40A 4GC9A 5EMKA 4P58A 3SVZA 3NWBA 3B3GA 1N7JA 5M5BA 3CVOA 2PT9A 2BM8A 1SKMA 1G38A 3O7WA 5BXYA 4QDJA 1KYWA 4GUAA 3X0DA 5H02A 3LX6A 4GF5A 5K0NA 3TM4A 4OBXA 4R05A 5ERGB 5DX0A 3BWYA 2XVMA 1X1AA 3A27A 5T6BA 4RTOA 4ATNA 4G56A 4YUWA 3TM5A 1FPQA 3ELDA 1P91A 1PJZA 2Z6QA 3HP7A 2ZFUA 3SMQA 5EKUA 1F3LA 1RI4A 1IXKA 2ZZNA 5HILA 1SG9A 3A26A 4LG1A 2OXTA 2YQZA 2OB2A 1JTEA 1JR4A 2AOWA 5K0FA 2JG3A 3C0KA 4GOOD 3RODA 1N7IA 2PXAA 4PGHA 1JG3A 3EVAA 3HM2A 5EEGA 3EVCA 5DX8A 3DMHA 1N2XA 4K6MA 4F86A 3EEOA 1QANA 4DKJA 4PGGA 1H1DA 2N47A 4QQNA 2WA1A 5P8WA 5KQSA 1VL5A 3SR4A 3T0IA 3FPGA 2BR3A 5CVVA 2ZIFA 4WXHA 3B5IA 3NJRA 3NDJA 4L7VA 5DTRA 4EKGA 3Q87B 4MIKA 1EJ0A 1M6EX 4F85A 3SGLA 2JJQA 3FTCA 3P8ZA 4RTKA 3HVKA 5FUBA 1F38A 1VLMA 2O06A 3DP7A 1RI5A 3FUXA 10MHA 3UA3A 4X63A 2R3SA 1ZG3A 4Y2HA 2IP2A 2QM3A 4PWYA 2EJUA 3GCZA 3EVGA 2OYRA 5EVJA 3E05A 4CKBA 5C1IA 2P35A 5E1MA 2G70A 4CXMA 1QAQA 1L9KA 2NXEA 5LQNA 4RWZA 5GIPE 3LKZA 3DXZA 3LCVB 5T64A 3THSA 4BP1A 3JWGA 3R24A 4GOMD 4U7TB 4PYQA 2P3LA 2PXXA 4P7FA 3GJYA 4YUVA 4POOA 2XBMA 2NXNA 1UWVA 1T43A 2ZW9A 1VE3A 1FJXA 4CTJA 4AZTA 4O29A 5DTQA 1NW5A 1XVAA 5DSTA 4UOEA 1RI1A 1WS6A 5HIIA 4AZSA 3EVFA 3KQVA 4XUEA 1SVUA 3M70A 2AOXA 3LCUA 5EMMA 3QV2A 3UFBA 4FSDA 9MHTA 2A14A 4YMGA 1EAMA 5F2KA 4CWAA 4E70A 5K01A 1WY7A 3KPUA 5LR6A 4MTLA 3HVHA 5GP1A 1NBHA 4GOND 1FBNA 1EIZA 5LQAA 2IH4A 2ESRA 2AVNA 2YXLA 3REOA 3FUVA 3GRRA 1QAOA 2FRXA 1XJ5A 4C04A 4ER7A 2XYQA 3G8BA 3G88A 3ELWA 2YUIA 2Z6UA 2FHPA 8MHTA 3MTIA 3NW9A 2ZBRA 4DA4A 3KPVA 2H00A 4GQBA 4AZVA 1BHJA 5CCBA 3HTXA 1XCJA 5K03A 1SQFA 3PT9A 2VP3A 2PX5A 3EVBA 5LQJA 3B3FA 3U81A 2V74B 1XDSA 3P2KA 2ZZKA 2UYOA 3FZGA 2PGXA 3KPYA 2GLUA 3SSNA 4R6XA 3ME5A 4PIMA 4FT4A 1R8YA 2NXJA 5F2OA 3TRKA 1V39A 4B17A 2Y1XA 1KPHA 4YV0A 3HVJA 5DM0A 3VYWA 1X1BA 2P41A 5DX1A 5GOZA 1G60A 3TFWA 3KHKA 3DH0A 2WK1A 1MJFA 1WXWA 1U2ZA 2ZULA 4QPNA 2OY0A 2ZBQA 3M4XA 2PBFA 3ELUA 1ZGJA 2YXDA 2B78A 4E32A 1NV8A 4RTQA 2NNWB 3BZBA 4GBED 3G7UA 2EFJA 3AXTA 1JSZA 4RTLA 2G1PA 1G8AA 3BGDA 1RI2A 1YB2A 2PKWA 3BGVA 3UJ6A 4PIPA 3NVKI 5DRYA 4Y30A 4LECA 3BGIA 3MQ2A 3KPWA 5GWXA 2IBSA 2PSSA 1P39A 2IDJA 3FRIA 2IH2A 3THRA 3FUTA 5EHGA 5FHQA 3FTEA 3KR0A 3PLAE 1ORIA 2BR5A 1VQ1A 2PV0A 4PYMA 3SM3A 3GRYA 4P7KA 4NECA 2I6GA 2IIPA 5LQRA 3BXOA 4FSXA 2CMHA 2UYQA 1ZQ9A 4IKPA 2OO3A 1R18A 4IV0A 3JWJA 5LQCA 3NDIA 4U7PB 4FS8A 3KQPA 1R74A 4QDKA 3UJ7A 4RSRA 4RVGA 3MB5A 3VSEA 3SSMA 3UJ8A 4OA8A 1I9GA 3OCJA 4OQDA 5K8VA 4ER3A 3EPPA 4C4AA 2PX2A 2Z6AA 1L3CA 2DPMA 4RTRA 1R6AA 2PX4A 2IBTA 5FA8A 5LQKA 3L8DA 3GNLA 4BLVA 4BLWA 1YZHA 3PVCA 3KR2A 1JSXA 2I62A 3P9NA 2B2CA 5E9QA 3TMAA 2CL5A 3H2BA 3O31A 4HRAA 4KIFA 4R8RA 5FQNA 3WSTA 4AZWA 5LSAA 2O05A 5EZQA 1AF7A 5DRTA 3Q7EA 1KHHA 5GIOE 1JQDA 4OQEA 3JWIA 1AQIA 1P1CA 1XXLA 1JG1A 2VDVE 4V0RA 5EGSA 5HIJA 1I1NA 4DMGA 5ICFA 2P7HA 2P8JA 4QVGA 3G8AA 1RJFA 5K0GA 2IH5A 4X1OA 4EQZA 4MWZA 3UBTA 2YXEA 2YX1A 3AWIA 4RYLA 3TPZA 2WA2A 1NW8A 3BKWA 3KQQA 1M6YA 1X1CA 3D2LA 1DUSA 4PYOA 3R6TA 3DXXA 4WVLA 3HNRA 5CCXA 4LWPA 5K0EA 1ORHA 2CKDA 3K6RA 3P9KA 4RVHA 2C7RA 5CD1A 3M6UA 1TPYA 5E2BA 5D1HA 3FUUA 3UWPA 1FP2A 3LDFA 4F84A 3HCDA 3KQSA 2LD4A 1KIAA 1RJDA 3OU6A 5E9WA 3OZRA 4LWOA 1VIDA 1ZKDA 2F8LA 2ZCJA 5LQUA 2CWWA 5B1SA 3RIEA 3M33A 3R0QA 2B25A 5ICCA 3FTFA 3EGEA 2YTZA 2C7QA 2FK7A 2PXCA 1KPGA 1NBIA 2Q41A 4ISCA 3LPMA 1PRYA 3GDHA 5K05A 1YFJA 5HZMA 4EK9A 3ER8A 3CC8A 3IV6A 1Y8CA 4M36A 2HWKA 1NT2A 4FR0A 2HNKA 5DM1A 2PLWA 5HIKA 1R00A 1D2GA 1JQEA 2QYOA 5E8JA 5CM2Z 1KPIA 3A7DA 3EEYA 3MCTA 1WG8A 4H0NA 5DXAA 5E2AA 1KXZA 3G2QA 3LDGA 4OX9Y 5CVDA 3GIWA 1O9HA 3G5TA 3LSTA 5HEKA 4RV9A 4R6WA 3VC1A 2XYVA 5HOQA 2JHAA 1EG2A 2GB4A 2ZLBA 1G6Q1 2OBFA 1ZHFA 4PYIA 3ERCA 1O9GA 5FWDA 7MHTA 2ADMA 4QQKA 1L3IA 2ZIGA 4HH4A 4EKIA 4X61A 5JUWA 2QE6A 2AN3A 4PYNA 5FULA 1NE2A 2NXCA 3HVIA 3UJCA 4FZVA 3TKYA 1SQGA 3C3YA 3BKXA 5K0LA 2O57A 3EMBA 3UZUA 5K0CA 3I9FA 4C03A 5BP7A 3FYDA 3CJRA 4KWCA 2HV9A 3R9XB 1BC5A 2H1RA 2AVDA 3B89A 3MTEA 5DWQA 3TLJA 3I5UA 5DPMA 3UJDA 3KQWA 4KW7A 5F2NA 3KQMA 2UZ4A 2OPBA 3PX2A 1DL5A 3T7TA 2P1DA 3G89A 2G8NA 4P7JA 3RW9A 2P7IA 2CMGA 1MHTA 5C0OE 3NVMB 3FYCA 3HEMA 3P71T 3CCFA 1TW3A 3LKDA 3OFKA 3OU2A 5CVJA 5IH3A 5CIYA 1XCLA 1YZ3A 2AOUA 3DUWA 4M37A 4OBWA 5E8RA 2E5WA 3OE5A 4Z2YA 3SX0A 3SXJA 2UYCA 3KR9A 2PX8A 2V7EA 2AOUB 3F4KA 4DM3A 2I9KA 4IV8A 5DSXA 3T7RA 5EOVA 1JTFA 1QYRA 3A4TA 1KYZA 2EJTA 3FPHA 1VP9A 3BWCA 5FCDA 4HGZA 4IWNA 4X41A 5EG5A 1TW2A 3DLCA 3OZTA 5EMJA 4YV1A 3O4FA 5KQRA 2HR1A 3HCAA 3OE4A 4PINA 1HMYA 1VP3A 2JHCA 3M6WA 3OZSA 5EHIA 3FRHA 3DTNA 4DZRA 2ZVJA 3GRZA 4RTNA 5DLYA 2BH2A 4E2ZA 2AOTA 5GM2A 2YR0A 4KRGA 3BUSA 4AUKA 3MHTA 1EQAA 1NW3A 1QAMA 3CJQA 4GC5A 4XUCA 2IDKA 2EX4A 3E23A 2AOTB 2JH8A 5DXJA 5EIFA 2IFTA 1INLA 3E7PA 3LHDA 4C06A 2KW5A 5E1DA 4MQ4A 3I64A 4ZTBA 5FHRA 5G02A 1YF3A 3CJTA 1JG4A 2QRVA 3HA5A 4KDRA 5FA5A 4EVIA 5K0JA 5KYGA 4ER0A 3GRVA 2FK8A 4C07A 3MCZA 2QRVB 1O54A 1NKVA 1EJ6A 4XCXA 3ID6C 3HA7A 3KQTA 2JHPA 3KU1A 3LECA 3A25A 4RVFA 4EMSA 1BOOA 1XDUA 3V8VA 1B42A 2GS9A 3P9IA 4E30A 4YUZA 3P97A 2ZWVA 2VDUE 2GA9A 2PT6A 4OA5A 3G2OA 1X1DA 3C3PA 5D1NA 1UFKA 2H11A 4YV2A 1Z3CA 3TQSA 2FCAA 2AS0A 2QY6A 1YFLA 4KDCA 3DXYA 1I4WA 3KQOA
chains in the Genus database with same CATH superfamily
1P7YA 3B6ZA 2QP4A 1ML3A 2J3MA 3BH0A 5FR1A 2VAVA 4E51A 4AULA 5BN3B 3TPFA 2L19A 4RTPA 2Q3EA 3COWA 3N28A 4H15A 4EHLA 5IAEA 4EP1A 2QD1A 4FYXA 3OHMA 2IF0A 4Q18A 4C7KA 5H68A 2JAQA 4IUYA 4LYFA 4QYXA 4XB1A 4QO7A 4F45A 2ZROA 3D8HA 4WGGA 3BB3A 3L02A 1IXZA 4G65A 3OZCA 1KQOA 2IOHA 5CH5A 5FYDA 3B1KA 2X9GA 1REQB 1LBQA 2JEYA 3EQ8A 3HO8A 4C14A 4UASA 3MIZA 1C4WA 2PGIA 4RTJA 1Z8HA 2HA5A 4HI0E 3RM3A 3W6ZA 3F3KA 2ONYA 1WUJS 4I5IA 3WL4A 5KHAA 2WKRA 3IBCA 3B1ZA 1MXHA 1SWWA 2HEGA 2ODQA 2QK4A 3LGAA 4K9DA 1TZ2A 4OXQA 2JLVA 2HU7A 4Z86A 3TCKA 1OJ7A 2HDHA 3AMVA 1YHZA 4DSAA 5IKMA 1DCTA 1BFKA 1Y7TA 4Z9XA 1GTMA 1MDBA 1H4SA 4QJ5A 1JSLA 4B8ZA 2DR3A 4IGKA 1CW2B 1YZLA 1I6MA 5TS3A 2C8JA 1QGZA 2FRDA 1UT8A 3HRHA 5TF0A 4DLKA 1FZQA 1PZHA 1KJWA 3I58A 3HKBB 3ICCA 2A57A 4KK4A 5DO9A 4BNIA 1RHQA 3E5NA 4Y3UA 1NYTA 1UDBA 5A6SB 2Y1EA 4AXXA 3UWOA 4Q4CA 5C3MA 1G66A 4E2WA 3RC1A 2PRYA 1N5IA 3LWBA 3OG9A 3UJBA 4RLHA 5A04A 3GJ0A 2QD5A 3HDGA 3TRIA 2B4YA 4BO1A 4FMCF 1FA9A 1I3CA 1A2BA 1MCZA 4HEJA 3HCFA 3FPBA 1O58A 3NRCA 4PU0A 3OCUA 3DMFA 4Q9JA 4BU1A 2VDWA 3NBZC 2IVFA 4PE5B 1GUFA 2O7RA 4I5DA 5KVAA 2OHIA 1EFTA 1XELA 2Z5FA 5LMNB 3CF0A 4KDFA 4RU1A 2XNDA 1P1IA 1DCMA 1OLUB 2UVPA 4UNQA 4NU5A 4ZRMA 4DSZA 3TDNA 1JH9A 3FR7A 4O4HF 5ICGA 3AONB 1ZXXA 3C6KA 3T9FA 3N2LA 3BEOA 1XZFA 4MIEA 4QNMA 3A6JA 1W34A 4LF4B 5CA0B 3G2LA 3VGPA 3EUEA 4F71A 2VXCA 1K8ZB 3G13A 3PUWA 1KAOA 3O4VA 1LPPA 4BQPA 3W77A 4ESEA 1CK4A 3GPLA 4F60A 4YUYA 5G4KB 1FDWA 2ZBUA 1U04A 4AS2A 3H1AA 1E4EA 1ETUA 1MJGM 1GP2A 3DNFA 1GZDA 4TXHA 4BGIA 5KOIA 3HDQA 3RTBA 4P7GA 3VMFA 5KNBD 2ZTMA 1VSVA 1ZMTA 3D6NB 4K9KA 5EA2A 2X3FA 4D9NA 3RU7A 4J3JA 2ZTHA 2PH7A 1VPEA 1DCKA 1WM1A 1ZJ4A 2D2EA 2VG8A 3CQ9A 1BYIA 4NDAA 1WXXA 2GFHA 1OU0A 4CW7A 1XZJA 3BC1A 4V03A 3PTAA 4PLCA 2ZP1A 3KPJA 3VR4A 3KETA 1XX6A 5JLAA 3FCOA 3JD3A 4TTVA 1SZJG 3RAGA 3M81A 3H9JA 4S04A 1YR7A 1WABA 3G2PA 3N86A 1Z33A 4JY7A 4UKDA 5E1BA 4ZC1A 3S2FA 4R0VA 3CF6R 5KOHB 3HN6A 1EWQA 2PYIA 2JFOA 1B6GA 2M6KA 1DX6A 3OY7A 4IIBA 1OLOA 1MO3A 2BP7A 2NGRA 3IX7A 4MS3A 4PFSA 2C7OA 3QF4B 7AT1A 1Y89A 3X1KA 2XGMA 5FOTA 5NLLA 3LVRE 4KBGA 3AVQA 2QZ9A 4YMHA 3EXIB 2JCXA 3EIFA 3D8SA 3HY3A 5AO9A 3AF5A 3AKZA 2O59A 4BNDA 1R5OA 3JD1A 4KHZA 1PLKA 2CXHA 3D31A 421PA 4YY3B 3W7BA 1DQRA 1RWMA 5IT5A 1N33B 1U80A 1SXJB 4PGMA 4NE7A 4RPKA 4CF7A 4LTNA 3ITKA 2QTAA 3FYSA 4DE5A 1E6UA 1JLMA 1NXPA 3AINA 3I42A 1JIQA 3D6JA 4UBOA 1KU0A 3KZKA 2WKWA 4GX1A 3FE2A 1XZKA 4WCDA 4MV3A 5A1JA 3ZNQA 5HNKA 3PIIA 1JXOA 4URFA 3PFIA 1OB5A 2VQSA 3GRFA 3SLKA 1WTCA 1I0IA 4QTYA 4A03A 1AQLA 1FPQA 5FOUA 5FNVA 4GDFA 2A1IA 3KAQA 4TRJA 2PR7A 1EVZA 2HRBA 2J4CA 2XDWA 2UKDA 4X91A 4A91A 2J30A 1F3LA 3FDZA 2F9FA 1YASA 3GVIA 3P94A 3IB6A 4LKRA 2GX6A 5J58A 3ED5A 1FXUA 1QIFA 3AVTA 4R8VA 4H1UA 5AKJA 5E4YA 1PJTA 4M0FA 1CSEE 1XMIA 2JLSA 4D4KA 5K0FA 2PIAA 3BF7A 1JYEA 2CDAA 4N1AA 1JMYA 5SICE 5HXAA 3QUAA 4RD0A 2X22A 3TN7A 5DX8A 1RM4A 3TLAA 3VNQA 2GZAA 3K70B 1H1LB 3GAZA 4HGRA 1RXIA 2OAQ1 4RA9A 3C4VA 3LVBA 2IK8A 5DHFA 3B7WA 3WGZA 2MINA 4NP6A 2IS6A 5H83A 4RZ3A 1TM3E 2ZJFA 1G4AE 2B1QA 1QIHA 2XMBA 2FXIA 3COSA 1TKAA 2HLDD 3HPRA 2K6GA 4JX9A 4L7VA 4NICA 3Q87B 2QRNA 1BE8A 2BJWA 4A16A 3ZY3A 3QXGA 5IABA 4MDYA 5G0VA 1ZRSA 3VU9B 2GM3A 4AMVA 1BW9A 5KSPA 3EIWA 3AEZA 1TTTA 5EYPB 1QCYA 4UUMA 5AVOA 1CIPA 5ALWA 1RJ9B 2BCGY 3D02A 3DVAA 1U11A 4WWHA 2CZQA 1RWNA 5A0FA 4CNBA 3BERA 1JJIA 5JQGA 2IV2X 1QQ7A 3RGWS 2LBPA 1N5KA 2X8AA 4MO9A 2JEOA 2MHCA 4OHFA 1Z6XA 1YC2A 1DTWA 5T64A 2Z5GA 2EKDA 3THSA 4IGEA 4AL4A 2OO7A 4RESA 1T43A 3JQEA 5BNZA 1HM5A 1A82A 1XYVA 2V7VA 4AMGA 5ALJA 4IBOA 4PR0A 4NAUA 3Q10A 5HRUA 4LF6B 5KTNA 3IJ5A 4L8WB 1KI2A 1KJNA 1V8BA 3U2QA 1E7YA 4TLDA 1RBQA 4K8RB 2C07A 1RAHA 4QHYA 3SS7X 3BZUA 3LQFA 4IOLA 2R79A 2WDPA 3IAS6 4EGJA 2NYRA 4PFJA 4CWAA 1QHHA 2ZQ5A 2O8BB 3QU4A 1CUDA 2H4ZA 3BE4A 3TIXB 5GP1A 2HYIC 1FDRA 1XHEA 1K5DA 2ZCVA 3DGEC 3I2FA 3IAFA 3REOA 3OJEA 1LX6A 2OV1A 4B34A 5K9ZA 1Z13A 4CIDA 1LBHA 1M1XB 1TAGA 2CUNA 4L74A 3G88A 4YCMA 3H65A 3L0YA 3PHHA 4JC8A 1BHSA 5EE3A 4NYJQ 1S8OA 3ISJA 5H7XA 5DNUA 3SY8A 2JW5A 1L1RA 5KCZA 3NW9A 1QOZA 1M2HA 2JGNA 2PTGA 3LUKA 3HTXA 2XD4A 3V46A 1NNSA 3MJRA 2O3SA 2YWRA 4EHJA 1C7QA 1TTPB 2Y0EA 4HWKA 1PUIA 3Q6NA 3TTXA 5DBIA 3PUXA 4TN5A 1OROA 1GTL1 1LDBA 4I08A 3K2QA 5EJGA 1MUUA 1CULC 2FSIA 3F2IA 3O3CA 3NG1A 1SBYA 4F4UA 2BHSA 4Y18A 1A5ZA 1AH2A 2OP0A 3C14C 3DBIA 1PJAA 4BGUA 5D5HA 3WMXA 1HE2A 4O4JB 3ZJVA 1MJFA 1H4TA 1NX6A 2WHYA 4O2BF 4AP6A 2MOKA 4V1CB 4BZQA 1HUQA 1FNDA 4CQMA 3RREA 3O4IA 1P2UA 3RC8A 3ZTTA 4BNJA 5IUJC 1A3CA 3B2EA 2O7VA 5AJVB 1P45A 1OWNA 1LV8A 3RI3A 2XXBA 2HR1A 3KE9A 4RC9A 1U8CB 3AGQA 3BGDA 1YB2A 2PKWA 3WKEA 5HRAA 2PUGA 4MXDA 4QAQA 3LP6A 1R6XA 1EK2A 1SQ5A 3V9PA 4J0IA 3ANLA 5C8YB 5BQ3A 2HT1A 5IUNC 3U40A 1P39A 2IDJA 4FNGA 3S4YA 2PV7A 2XA2A 3FRIA 2LWIA 4MUHA 3UMMA 2BGMA 3M7IA 4FILA 4EHHA 4D5EA 1ORIA 3QLVC 1Z16A 3DKKA 2PV0A 2RDMA 1M6VA 3G68A 1J21A 1PFQA 1YC5A 2VKTA 3OZAA 4GNRA 4MEAA 5JQWA 4FSXA 1W5AA 1JMKC 3K92A 4WK2B 2PO5A 3H5LA 5H9VA 3NS7A 4HDSA 1LX7A 3MLEA 4IV0A 5LZ5A 4YMLA 4MPRA 1QQ6A 1HFEL 1Z88A 4M1KA 1KBOA 4L5AA 4NYIQ 3S7TA 1RLOA 4OA8A 2NU9A 2CHFA 1RM0A 5FBHA 3AKDA 1NWHA 1U5CA 3P9SA 5J4LA 4OYYA 4EVRA 1A2KC 3FNRA 1HMPA 4BIIA 2D5CA 3NHKA 3DVRX 4X7PA 2PZGA 2QNBA 1JKIA 1PKEA 1XZBA 4PBTA 4BVHA 2F4NA 1KYIA 2AEMA 2DWQA 2H52A 4PZDA 2C9BA 4ZQEA 1URPA 3HLKA 4FB5A 1YS1X 2V0NA 2BSQA 2Q50A 4FW9A 4WBNA 1E5QA 1BCRB 1QE0A 2JF0A 3I2IA 4YRKA 1TC1A 2Q21A 3HWX1 2H16A 1HRKA 4C0AC 2WWYA 1KFJB 1EEHA 3AWIA 4MQEB 3KQQA 4JI0B 3CLHA 3C41J 2OGWA 3CZAA 4DFDA 1K6JA 1Y1TA 3VYUB 3U9LA 5EPUA 3LW7A 4JXKA 3IEVA 1K3TA 1AN9A 1NVTA 1U6JA 3W05A 1ORHA 1NBAA 3M4JA 5K0EA 1QFZA 1ZBDA 4IV5A 3JYPA 3E8MA 4GW3A 4XWTA 2V4MA 1T2NA 3PL1A 2QL9A 3TK1A 5ITZB 3E6AA 3A3OA 5G41A 5C7IO 1UP4A 2CVQA 4HLDA 1FSZA 1JA9A 1QORA 1TCVA 2FN3A 2XQGA 4X3CA 1ZKDA 2F8LA 3E8XA 1U9IC 3QA9A 5LQUA 4HDNB 4AIIA 2D0IA 4U2BA 4YAFA 1M8FA 1IUKA 3QK7A 4BO5A 4FHFA 1NSTA 1RS0A 3GDHA 2WT8A 3ER8A 5CIWA 3BJZA 4KYIB 3UW3A 1ZP6A 4FVTA 1A9ZA 2YS6A 1NT2A 1H5QA 1UBTS 4ZOEA 4WESB 4FEAA 5MN4A 4LFCB 3FPLA 2QYOA 1NOIA 2VBIA 2XCLA 1FP7A 3W5JA 4E0BA 2HO5A 1NUHA 1E3JA 1U3WA 1AMUA 3U80A 1G7SA 3BMOA 3EW9A 3NAGA 2IHTA 3GX1A 2AC2A 1LI4A 4RQBA 2J31A 1THGA 1VB5A 3REGA 2EJBA 4M1EA 4ARAA 1DJNA 2HUNA 2PMFA 2V6GA 1Q57A 4FUTA 2I2FA 4QFDA 3RKRA 1EG2A 3ZKWB 4R2IA 2G3YA 2OBFA 4NZMA 3B2NA 3FMOB 1NJSA 3I5MA 5LB2A 2QTVB 1GKIA 3IGFA 4G4SP 2PKQP 2CLCX 2ZIGA 4RH0A 5KSWB 2N1BA 3I1FA 2QE6A 3JARA 4LV8B 3G2IA 4Q66C 1EDBA 2TMDA 4ENWA 5JFTA 4KN6A 1NN3A 2PH3A 1RRMA 3CX6A 3IP7A 4INZA 4W7SA 1NN1A 5ULLA 3R9XB 2GZDA 1WHSA 5FTMA 1W5SA 2G76A 2CXSA 3TR0A 3LUGA 3PPXA 5EZYF 2P2CA 2GHRA 2OV2A 5CM9C 4NBVA 1LDGA 2OZKA 4MQBA 2J45A 2X0FA 1WP4A 2GGSA 2PU7A 4RPGA 4H3HB 4Y2UA 4OQLA 4FFOA 5IH3A 3B51X 2PLAA 1XJCA 1DRWA 2ZQYA 1Z08A 4Z2YA 1VLJA 1KETA 2QG6A 2XWSA 5DMHA 3ZDDA 4A8JA 4ND8B 4UHCA 1W5EA 2AOUB 3PUVA 4FGUA 3H8WA 5DNCA 5KKAA 1FP4B 4IV8A 5DLDA 3HKCA 1QYRA 4NG5A 1CB0A 1E2GA 3OOEA 4RJIA 3DLTA 1CYDA 1NNLA 1YDGA 2DZDA 3NETA 5DCWA 1ZNXA 2Q29A 1JJVA 4TT3D 1VE1A 4YPVA 1FU4A 1VLQA 1YRLA 4B4OA 1X0VA 2I29A 5B55A 4QOIA 1EFCA 4F92B 1MIHA 4MRSA 4DLWA 3R7DA 3CR8A 3FRHA 2YMLA 3QVXA 3C39A 2VPWA 1U99A 4L4RA 3QVGB 4FE4A 4Z3OA 1B1CA 2BFAA 2VHJA 3PHLA 2OL4A 4TQAA 3WIUA 4KGZA 5TRTA 3SDSA 1XCPA 1NE7A 4ZO6A 4INJA 2YR0A 1KY5A 3JQ8B 3CJQA 1QAMA 3BTUA 3ND5A 4DRZA 4ZVPA 2IL1A 2JH8A 4LF5B 4KPUB 2XXAA 1INLA 3TTTA 1VFNA 3TJRA 3CSUA 5TJ9A 2P6UA 1AHPA 1FQJA 2JKZA 2RC5A 2W2KA 3HYTA 5G02A 2V4UA 5BSMA 2PH1A 1PQPA 2JIOA 3K16A 1W35A 4TWJA 2C97A 1E2HA 2HC9A 1TX4B 2QV0A 2ZIUB 3I6QA 3H3FA 4MR7B 5TT1A 5TR9A 2CCKA 2FEAA 3HA7A 1Q1NA 4OXIA 1LBSA 3OZGA 1A7UA 2Q9AA 1U4NA 3JD4A 1E92A 1KGDA 4K6KA 1AKNA 1I7PA 1WVGA 2R8OA 2UUCB 3UUEA 4EIWA 1A1VA 3IUJA 4NAVA 1A0OA 1UEIA 1F8YA 2CV1A 3DHNA 1BDMA 1NVGA 1H4VB 2X1HA 3I72A 2CXNA 4FYYA 4ZVQA 1E9CA 2J7KA 5K2MA 2VBGA 3RJMA 1UKCA 3PPYA 1UM8A 1T2AA 4BWYA 4EAQA 4UCFA 1X7HA 1NV9A 4FD3A 1KH3A 1Z5NA 3DW1X 2B5VA 3EIXA 1MA3A 2H06A 3OX3A 3AFIA 3A0UA 1XLVA 3U3KA 1UBFA 3KCQA 2R60A 1JHZA 4JOCA 3WG9A 4HV4A 2RHBA 4KPFC 1T8RA 1N9ZA 1QO9A 1E9FA 4ERNA 3ONDA 3V33A 1SUWA 2RI1A 4EB3A 4GRIA 1UQTA 1OXUA 4WPGA 1DTSA 3ONEA 5E6UA 3UAGA 1ACJA 1CY6A 4YMUA 4Z7JA 2GRUA 4M38A 1D04A 2A5LA 2WUVA 5BY2A 4YRQA 3IO3A 3JQPA 5EXPA 1NULA 4RKWA 5EY5B 1U0SY 3CVVA 2QR5A 2BHTA 4RFLA 2JCYA 3GDOA 1NJFA 3JY6A 5IDQA 5DN6A 4J07A 2YZKA 4F2PA 1APBA 3PQ2A 2PSDA 4AROA 1ZNYA 2Q2VA 4FFSA 2X6RA 2GF2A 5I8ZA 1L5VA 2O5CA 2IEDA 4JL5A 2CMDA 4BXOB 4PYKA 1FDUA 3JTEA 2PE5A 3TGWA 3BXZA 1JEYA 3ORHA 4UM9B 5HFAA 5FBLB 4A0RA 2Q6OA 4II2A 2HMTA 3LD9A 5LN1A 4KAXA 1E7SA 1EA5A 5GINE 1H6CA 2VYVD 1GR1A 4K6CA 3IP5A 3NKLA 5K2OA 3QJYA 2JNWA 1DIRA 3WB9A 1IJBA 4QRIA 1EP9A 4D6XA 1JHXA 1TEHA 2H1IA 2P8SA 3DD5A 5T3UA 5A4DA 4RVSA 3Q15C 1N1GA 4DDWA 3D8BA 1WUKS 5DKFA 4BBZA 4D8TA 1Z7GA 2CLIB 1MTOA 1QPZA 2VJMB 1UKVY 5I9SA 3KIPA 4WOBA 3CLTD 1RQLA 1E2FA 1Z74A 2AZDA 5BNFA 1E32A 2QGZA 1MAUA 1XFAA 2JJ1A 3CBQA 3FPAA 4ZV7A 3V1NA 1QC5B 3W4KA 4EAAA 5BT8A 1HR0B 1K75A 5BUQA 2XD9A 1Y80A 1WF3A 3PTLA 4M8SA 1YL6A 2GPYA 4AYTA 2WSYB 1SMKA 1AMOA 5JD6A 3H3XA 4N4AA 2GF9A 3B8EA 5C4GB 3NWEA 3R74A 3NYRA 3JQBC 1HI9A 2AR0A 2R7LA 3CXUA 2F8TA 3U49A 1I2DA 2WD7B 4E1BA 2PN1A 4MHTA 3CBGA 4RM3A 2XOXA 4MYDA 2PZJA 3PE4A 1IHPA 5UKDA 4G0YA 4O4LB 3CZ5A 3IUSA 1U7OA 3PFGA 4LRYA 3GFQA 2Z9DA 5L7WA 1KEPA 3HN7A 4IH1A 3ELYA 5I5GA 1X6VA 2GJ9A 5L3VA 4RMJA 3FOZA 1RHUA 3A28A 4RLSA 1Q20A 2VP4A 3AVPA 2OV8A 5EZ6B 1ULAA 2EF0A 1DWOA 2XRYA 1TA0A 1GNLA 2QRGA 2ZXFA 3EQ7A 4MYSA 3L4JA 1O95A 2BM1A 4CUKA 2VRCD 1OI3A 2Z9BA 3ZHUA 2QX6A 5KC8A 2PGAA 3DQQA 1XMXA 1EBBA 5LDHA 1SO8A 2JBAB 3VV2A 1A69A 3GO4A 3JQAB 3PNBA 5CD9A 2VS1A 1OI7A 3THOA 3ZHXA 2AMJA 2IIQA 3R0ZA 5H3LA 2VDRB 3NWJA 2JGKA 3CX4A 1AUPA 3N0WA 1H3FA 1NOKA 1TVKA 3KEMA 1YZQA 5CFMA 2I6TA 4GC9A 2E4UA 4EJMA 3MWDA 2ZYSA 4PNZA 2HJRA 1VJ1A 4DLSA 2B3DA 1G38A 3OZFA 2JLBA 2B0JA 3AETA 4MX8A 5AUPB 2ZSHA 2I55A 3AUKA 4H7PA 4ASUA 3J7AC 3K1AA 1YCFA 3DZKA 4GF5A 3UAYA 2HZ7A 3E4DA 4EJSA 2RKBA 2ZRIA 3D2BA 1XTRA 2CVHA 3H16A 2J3IA 2KBEA 1J23A 1XMVA 4ATNA 3B3AA 5DCLA 5DHUA 3SXUB 1VHDA 3RU2A 1YJCA 2A9RA 2OZPA 1JBKA 3TINA 1PJZA 2XKKA 4ON9A 2I1LA 3G9UA 3VR5H 1Y42X 4ZCQA 4YACA 3RUPA 3WO0A 4U7GA 1XV5A 2YFKA 2AOWA 3IPRA 3IT1A 1MOPA 4BMPB 2JG3A 5CNIA 3RYHB 2B69A 4PY2A 1FYDA 4Y0NA 1VMIA 3K20A 2IZ1A 4UHHA 4AF8A 4UHJA 2VUSA 2BJVA 2G8LA 1YR1A 2EHJA 3N2ZB 2R87A 1T36B 4RK5A 2BZ0A 4I9HA 4HX5A 2NIPA 3O4JA 2X7JA 1ACLA 4PGFA 4GO1A 4GVLA 4PLFA 1I5OA 4N47A 5CTJA 1YDHA 1CJSA 5CCEA 4XGKA 3QNMA 5BR8B 2FWAA 4K1XA 2I4LA 4BV3A 3Q8KA 3BPSA 1DOHA 1IQ0A 4EQ6A 2IYLD 2DQSA 2ZE7A 4LS3A 4PQGA 4ZCPA 4BO0A 1TLFA 3H9EO 4UUPA 3KQKA 4RWZA 4FB4A 1YVUA 2OQRA 2RJ3A 3EJWA 3L8EA 4BEJA 2O4CA 1G0NA 1XSEA 3PPVA 1CP3A 5TS2A 1XVAA 3OQIB 1U63A 2XVZA 1DC3A 5HIIA 5ISMA 4TS9A 3W6OA 4ZHQB 2H31A 5LCXA 3HL4A 4I3GA 4U2CA 2O7QA 4JR2A 5J5CA 4PHHA 4WLEA 2B4KA 4J7AA 1EESA 4E70A 1P9OA 3C3JA 3WBKA 2DJIA 5IM5A 3RHFA 3INRA 5T6MA 3F8WA 1TJ4A 2DQYA 2EDCA 2FRXA 4ZODA 1EBUA 3ZVNA 1AQYA 1PWYE 4R41A 1RYEA 4BNHA 2NU7A 3TCXB 2CBGA 4Y2GA 4EUSA 2EZUA 3MVEA 4WXYB 3RRJA 3BGSA 3HQ4O 3MTIA 4AP5A 4BTEA 4MAMA 4AKGA 2X40A 2ZRBA 3W8EA 5FRDA 4PPFA 4RIGA 3UK1A 2RE8A 3C8MA 3RUHA 4ZDJA 5BVGB 5EIBD 2C7BA 3I4CA 1C7ZA 2DQZA 1V8OA 3EVBA 4HK4A 5LLSA 4ESOA 2V74B 3B85A 4FD2A 4HZIA 4JC4A 4X6YA 1U1EA 5IFLA 1H05A 3TB4A 3RIHA 3HG7A 3FZGA 3NGMA 1Q2UA 4FYHA 2OLJA 2VK2A 4K9RA 5ECDA 2ZYHA 3FCEA 1BQ4A 3UF0A 2GYYA 3R3WA 4IMRA 1FBTA 3PCRB 2WVHA 3OMXA 1PR5A 4FE7A 1AMNA 1M8JA 1COWD 1W1UA 1Z47A 3B9QA 4WLOA 4LY0A 521PA 2QMZA 5A1TA 3AF6A 3H84A 3U16A 2JI6A 3MJCA 4MNTA 5BOSB 3IP9A 5IF9A 5HMMA 3TZ6A 5JANA 4XIJA 4XJSA 1VIYA 3RKSA 3THXB 4COKA 6PFKA 2C8VA 2EW1A 3AYXB 5FTJA 1NI4B 1GLNA 3D81A 2OBXA 1NYLA 1YR2A 3QXCA 4RW0A 4YGXB 3NHRA 3EMKA 4B3SB 3LAWA 3VX3A 2ON6A 4LHSA 2LTAA 4IILA 3V1UA 2PGDA 3DFKA 1CE8B 1JFRA 4YYZA 5EJFA 2HLPA 3A9CA 2XUJA 5C7YA 2QBYA 3NOXA 2NUAB 4HAXA 2FX2A 3NH9A 3R4CA 2BBTA 2AG0A 1N5MA 2W6CX 2JZCA 3E9NA 1Z4KA 3CFYA 3Q9LA 4KIUA 4R71A 2QSZA 4P4SA 1TF2A 3JYOA 4KNVA 2GARA 5K3OA 1WX1A 3ICWA 3KQPA 1R74A 2O0MA 1E2PA 3AR7A 5ESXA 3SBDA 3V2HA 3AP1A 1FLNA 1I9GA 4DPKA 2W7TA 4IMIB 3F67A 5AHKA 3KOWA 1RT9A 4V0MA 4KDEA 2QLLA 3GNLA 2H1WA 1E2UA 3DTVD 5THXA 3SICE 4BLWA 4CV2A 5IKEA 3QMWA 3NPAA 5EE5B 1FX0B 1A9QA 4YJDA 4J0GA 5KDOA 3PFWO 2BPOA 1XGKA 4U2FA 1KA9H 3QU5A 4FDTA 5A3JA 3LWDA 1M2OB 2B8EA 1K5GA 3JWIA 2ANCA 1AVTA 4OVKA 4HLQB 4O5OA 4II3A 5EXDA 4HB0A 4GQIA 2NVOA 4QVGA 1NXOA 4P3PA 4RJJA 5SZIA 2V9CA 1HRDA 5IULC 4ZEXA 3CNQS 3TTUA 1JGTA 5C1PA 3ROEA 5KOJA 4LBWA 1Z2OX 1NT4A 1NMQA 2PQ6A 3VVCA 1ZNZA 1E7QA 3A4VA 4OM7A 4ALMA 4K0KB 2X8LA 3NEJA 4DUGD 1N9GA 2OHJA 1TT7A 3EYWA 3VSAA 4B31A 2B6HA 1TJYA 3D3WB 3TNLA 4AFNA 3E84A 1XAJA 2HA6A 1MQSA 1Z0JA 1T8TA 3MFQA 4XVQA 1FP2A 2CEAA 4TKUA 3BXXA 2BHLA 2LR0A 4E09A 3BFJA 5B1HA 3IUYA 3DB2A 3T5PA 4QUHA 2J9XB 3DOOA 3ETDA 3LX8A 3QEOA 2HLHA 4FDMA 3SK0A 4BJ1A 5KINB 3OD5A 3QFHA 4YFYA 1EE1A 2YIVX 3C4JA 4YAEA 4PQEA 4O1HA 4R98A 3RYCA 2P79A 5F2KA 2GSDA 3ECCA 2WSSD 1DPFA 3E61A 4HFNA 1TVCA 3LPMA 4OKNA 1ZFNA 5ALGA 4DY6A 4BRZA 1OZGA 4CMCA 3E2PA 4O8ZA 4R9RA 4XIGS 2W6JD 1TADA 1X7XB 3V1TC 2C5LA 3AOEA 2O6LA 4I46A 1M34E 5DJ5A 2VKQA 5SZKB 3U0VA 1KPIA 2JFYA 4A73A 1Q0LA 1FDSA 3G2QA 4EFDA 4ZZIA 2G5TA 1DQZA 1ODKA 1J33A 5KTYA 4UTVA 2VHWA 3GIWA 3WFIA 2PL9A 2GM5A 5DNAA 3WYCA 1C3XA 3QTLA 3DBRB 5ALPA 4WK4B 4MMZB 3RT9A 1XNGA 4WECA 3VC1A 4NH0A 2XYVA 3OUZA 4RCYA 5LP6C 3UXHA 4AMYA 2RIPA 2PSHA 3FTQA 3WKCA 2EJCA 1WBJB 2YN0A 3QLEA 1L3IA 4MCHA 4Z1MA 5IFKA 4C43A 4WXPA 1WWKA 4HN2A 5JS2A 4CN8A 4QJ3A 4ENSA 1K68A 1GSHA 4M7OA 5DASA 1DQSA 1U2TA 4M21A 4BX8A 4DBVO 4KSYA 3UZUA 1KI6A 2P2YA 4DNQA 2IQIA 4CEIB 1EUQA 3B89A 2OVFA 1Z63A 4KTTE 1UZNA 3RUEA 1UBSB 4B45A 1O6BA 2BI4A 2Z8ZA 3G5AA 5KNLA 1D7AA 2VT6A 2G8NA 1CV2A 4XX0A 4ENVA 1W47A 2XZOA 5C0OE 2ECQA 3DL0A 5HW0A 1ZUNB 3LKDA 1BEEA 1W8DA 2B37A 3PGMA 5CVJA 4BEVA 3JSAA 1ZEMA 3HZRA 4LQLA 4N0DA 3S1SA 5BMVF 3KAKA 1A9SA 4A2CA 1NXSA 4CCYA 1YIDA 2CHUA 3IBFA 1Y4UA 1X3LA 3DDUA 5DSXA 5KB3A 5DBEX 3O8RA 1THMA 1TT5A 1SVWA 2IYSA 2VSOA 4GM0A 4PX5A 2NU8B 2IT1A 3VHQA 4EWLA 1JFTA 2V3WA 2YY5A 3RC9A 1KMMA 2EBHX 2INGX 3KC2A 1GU1A 3TWOA 1W36D 3IA2A 3IDQA 1YBAA 3ENKA 5KQRA 3QJ5A 4LJ5A 5GONB 2EGUA 4UTRA 3ZXUB 1AC5A 4E88A 5MGNA 5TNXA 1DKUA 1UBLS 2Q1WA 1QYXA 2D7CA 2ECOA 1PJ4A 1YJ5A 2RB5A 2ZVJA 2ZYWX 1BX1A 3BIFA 4JYCA 1MGOA 1O96A 1JEJA 2GXSA 4K9NA 4XYGA 5ABPA 3E3OA 2HOQA 2J4DA 2ZRFA 1EFAA 1AKYA 3RHZA 4KE9A 3WQBA 1QHIA 2XUOA 5EIFA 3ZHCA 1VC2A 7GPBA 3DZBA 1RM3A 2RHRA 3TQCA 3CX7A 1IUNA 3R6WA 5FDFA 1OGJA 1JBQA 4KQ1A 2UVQA 1Y3BE 3I45A 1JG4A 5FHRA 2W98A 2WZBA 5K0JA 3EEOA 5TGDA 4CM8B 1E2IA 4R9NA 3AJ9A 3F5SA 4Q1FA 4Y1GA 3A25A 1RE1A 3T7DA 5EJAA 2YOGA 1L8OA 4F93B 3QEAZ 2O2IA 3CUVA 4WLFA 4X97A 2HJVA 4E30A 1P0PA 1VA4A 3OLVA 4LMAA 2BGJA 1AJEA 5JTTA 2NUTB 2ACVA 2J3JA 4J1TA 1UFKA 3E5MA 4YLEA 2GCNA 1N2BA 1ZOSA 3RUDA 3EAQA 3P4UA 4HDAA 4M0EA 1X2EA 1OX6A 4IUDS 2NAFA 1L8LA 2JH9A 3EUAA 4K6GA 4W1RA 4E5VA 4ILEA 5LL6P 2R2AA 4HSGA 3FFBA 4G8CA 1A98A 2DR0A 2RCYA 3LPDA 3RVDA 3KWJA 2IKQA 2NG1A 5FADA 4WOJA 5A5FA 2F1JA 3QELA 4WNAB 5J2UF 4QQFA 5DHTA 4YJFA 5DYIA 4M87A 4G8BA 3RG8A 4RTSA 1QG4A 3UJNA 2MSEB 3ILYA 1RP7A 5MFPA 5EKXA 1QYVA 1NTOA 4N5MA 4P32A 2ZRJA 4G0QA 5FLEX 5JZVA 2AFIA 2AEFA 5B6PA 3F5FA 1Y48E 4BLUA 3QWHA 4BQQA 4FQ5A 2BZSA 4ZANA 2VFAA 1L5LA 2WHQA 1DKOA 4PLGA 3SSOA 4IUBS 4G2TA 3VNBA 2GNOA 3ZX5A 3AFNA 4KMOA 1JQ3A 4DCMA 2JLRA 2Y66A 3ZX4A 3HGQA 3GRUA 4C4PA 2OFOA 1DJOA 1OWLA 4YJ3F 2OWEA 4M7RA 4RPCA 4DRXB 5EWLB 4QLBA 5AR1A 1Z4LA 3PXGA 4EHBA 4MP8A 4WY2A 2EG9A 4HDCA 2GF0A 3GJZA 1SCNE 4HY3A 2C4VA 2YVUA 3K1JA 3DAFA 5KYWB 3WNQA 1TD9A 1TZMA 4I55A 1GL6A 2BKXA 1BE1A 3P2OA 2AJTA 3GEPA 5ILGA 3UHOA 4JBWA 2ATIA 1VYHA 4HB2A 4DF3A 5JMWA 2WJ4A 5KKNB 3TQHA 3H8VA 5BRJA 5DOVA 4BLSA 4F4FA 1SU6A 3CRZA 3ZZ0A 5AVQA 2E5LB 4GZ6A 3QXJA 4P2BA 2JJ8A 2HBYA 5BW4A 4FFWA 4ZVUA 1KO8A 2B9EA 3ZHRA 1XQWA 3H42B 3OE1A 1F12A 3NP9A 1UP7A 1Q12A 1TCAA 1WB4A 1XZCA 1NSYA 2YJ4A 3DLPX 2JEZA 3O83A 4IIFA 3WLLA 2WPDA 1W0JD 3EC1A 2IE8A 4KRYA 2E18A 1ONPA 4P0TA 2HBQA 3AK4A 2ZI9A 1QHEA 5ICSA 4MWCA 2O2GA 4UDXX 4BUZA 5LKAA 5FBKA 2RGGA 1P9NA 4ONEA 2V7QA 4MUFA 3F7MA 3WLQA 5A2QA 2P9YA 4GI1A 4CTKA 3AT1A 3CWCA 3PFHA 5HJEA 4M98A 1O89A 3ROQA 1WV1A 3T1HB 1LDEA 2OHOA 5IP5A 3EA0A 1ZS9A 1L1FA 3EYAA 4HDRA 3ZGZA 1CY7A 5F7ZA 5AKLA 2YWJA 3DOFA 5F33A 1CERA 3H6KA 2IP4A 1WZEA 4C3UA 3UGJA 2ZVQX 2PD6A 1N6RA 2Q9CA 2G06A 1UCFA 2ZPTX 3OKPA 5JXIA 4N82A 4NU0A 3P2IA 5JH7A 5K4GA 5JDIC 3OX2A 4OFBA 3PUKA 4G84A 1JU4A 1G63A 1ZM3A 3U4HA 4ZO9A 3LXMA 3FWYA 3V4VB 1RVV1 3LY5A 2R96A 4XH9B 3IDFA 5JVDB 4D0LB 3TE6A 1YTUA 3NFRA 2YVKA 4BP8A 1QV9A 4BNFA 5KHLB 2VH1A 5JJIA 4KREA 3QBTA 3NM6B 1BH2A 1U7TA 1H8EA 2C4NA 3KL2A 4ZVKA 2GWHA 4JNKA 5CVEA 2XCOA 3OQJA 1U0FA 3Q7SA 1DIBA 2DWUA 3A1FA 4H1TA 5CEEA 1X8KA 3KSBC 1W9HA 2GEJA 3VX4A 2Z58A 4CR7A 2RGNC 4B35A 5AM3A 1ZVQA 4PG5A 1YB5A 1JFFB 1EHYA 4US2R 3GLGA 4X00A 3E5RA 4KKXB 1N2JA 2AWOA 1Y82A 1OKKD 1XVUA 3NDBB 4CMAA 1SUSA 2V7UA 3M6IA 3PFBA 4P7BA 4PZLA 1XTJA 1YVDA 4TV9A 5AI0A 4E2YA 2FLWA 1M73E 1C3LA 3OC6A 4ECAA 1M10A 2O1XA 1Z6TA 2R8XA 2AK3A 5KNDH 2R1TA 4D8WA 5JNSA 4PC1A 3KQHA 2IC5A 1PT5A 3R0XA 2JI8A 3ZVMA 3ZDAA 2G25A 5LIPA 1QXSA 3G1UA 3U4IA 3RDPA 1T9GS 4P4GA 2C2YA 5IJXA 1HE4A 5TY0A 1IXRC 4PG6A 3ZGVA 1MX1A 5DTJA 4D74A 3A6HA 1DSSG 3UKOA 2WQ7A 1J2UA 1DKPA 3W1VA 3ELDA 1Q0ZA 5FPPA 1FXSA 1L4LA 5TJHA 4V0ME 1CS4C 2ZFUA 4HLCA 3TOVA 3WGJA 3HXQA 5LJLA 5HF9A 4RA6B 5FL3A 1JHVA 2GBGA 1D9ZA 2R5WA 4FCWA 3LHKA 4JYMA 5DISB 3UCFA 3DDCA 3PNKA 1YQDA 3JQFC 3N6VA 3T52A 3USZA 5JT1A 4B6EA 1QTIA 4G2NA 2PXAA 3WZ2A 3QE3A 1SIOA 4C6TB 2K5UA 1P0QA 3O8NA 3R7AA 4A92A 4U7HA 2IQ5A 1JQAA 1NJ8A 4R1UA 4KN5A 4TN1A 3ZWDA 3HBAA 4AD8A 4DKJA 4IZOA 2D7JA 4ROTA 4HS9A 1HE1C 4UU1A 1SB8A 1EU1A 1WXDA 5HF6A 4B4DA 4D9BA 2PSFA 4HP8A 3SC2B 4ZC8A 3A4IA 2G0AA 3KRTA 4MIKA 4WA7A 3ND9A 1ZN9A 2JAHA 1Y5NA 3F5MA 2R4QA 1TM1E 3MN1A 3NUQA 4X84A 1U28A 4ADSG 5KPDA 1F5SA 2CYCA 4KMRA 3JPWA 10MHA 1TUBA 5T5QA 2DX7A 3QUSA 1M2EA 2IP2A 2HU2A 1D3AA 5LZ9A 1XRSB 4F3YA 2OV4A 4JYBA 2FG5A 5E1MA 5LMUB 1UMCB 4NOMA 3FYUA 1E1LA 1UZUA 5LQNA 4F4HA 3H2YA 1DC7A 2VHYA 3AB8A 4PYQA 2PXXA 1YHNA 5HQ3A 5KJFA 2ZM5A 3FAKA 1E63A 2JAUA 1SCJA 1GTJ1 1UDWA 1YU6A 2Q27A 4KJZA 3ZU2A 5K8UA 5HHTA 1VDMA 1XEAA 2YS7A 3V8EA 5HPYB 2XEXA 3M70A 1DJLA 1I2ZA 2ZAGA 2XDQB 3H8SA 3L7AA 5HA5A 4I3FA 5FFFA 2R5NA 4N3CA 1HDCA 1R6BX 3HWRA 1FB5A 3KB6A 3N7AA 3PC2A 1UDXA 3GUCA 3K0CC 2GPSA 3FVWA 2Q3HA 3DZHA 4UMDA 1P44A 4E46A 4CM6A 5L45A 4P0PB 1ZJWA 5TQVA 3UNXA 1C3OB 3ETEA 5FIUA 4CLEA 3I5YA 2QN8A 5TDHA 1LPBB 3PEEA 5F1YA 3UWKA 7REQA 3ROTA 1IQPA 3TVTA 3W2HA 4MKHA 2AN9A 1JHMA 4AUNA 2YWXA 1KOLA 2ZE6A 3KVYA 4OBEA 1SKQA 4GQBA 3NFYA 4C0XA 1U8XX 3RRXA 4UNIA 3U09A 1SU7A 3WYBA 1JDVA 5F1OA 2AQKA 5FFNA 2BFDB 1J25A 2FFHA 1C9YA 2FUG1 2HM7A 3RR2A 4RKRA 1UJ5A 3BMNB 5ADVA 3LLSA 5C53B 5ALYA 4B40A 2IEYA 1K98A 2DRIA 2HMAA 4Z54A 4MGHA 4MS1A 1QH1B 4TZ0A 1DQYA 3ESBA 4H3VA 4QZVA 3D0KA 2REQB 3C3XA 3DYBA 1DDOA 3M4XA 3OZIA 4YMSA 4GI7A 4JIMA 4NHOA 1PT8A 4U6NA 1NNUA 4MRMB 4EHDA 1SHZA 3SS8A 1VSQA 3OLCX 5DP1A 3RQIA 3SIWA 1IZ9A 4F6RB 5BUCA 3FGZA 3Q7RA 3H2IA 2HT6A 2G1PA 1KEVA 3OTGA 4FGLA 4HNAA 2R47A 5CDSA 5ALQA 4YJ2B 3BGIA 3V9AA 2FWJA 4KQMA 2QN3A 3A6DA 4D44A 4CG2A 3RADC 3GEBA 3RIYA 1QVAA 4DARA 5KEIA 8AT1A 5HOEA 2BR5A 3MK31 2DFNA 4DLBA 4U0KA 4M7WA 2KLHA 3BAFA 2AF3C 2QYTA 3BE5A 1RXCA 1L5WA 5JYEA 1GUBA 1RZVA 2GLXA 1WOMA 2GN9A 3GMIA 4OA5A 5F9MA 1TNDA 3R0JA 4WFQA 4ZT4A 3WK7A 5JRZA 3OAAA 2IZZA 4IF4A 4DL9A 1BEZA 1NUPA 1S96A 1TGVA 2XXAB 5JH7F 3HB5X 2HHAA 5DFAA 4Q3CA 5FLXA 4C4AA 2X5NA 2ZSKA 4QRDA 3BCSA 1L3CA 1T9DA 2FA9A 4AJ1A 3AJRA 1KTIA 4HQ0A 4C21A 3A1WA 4L5BA 4O2BA 3UXMA 2XNDD 1TYEB 4ZT2A 2DGDA 1RXUA 2FR8C 4Y6RA 3RT1A 1AF7A 1VTKA 3NVAA 3Q7EA 4A2QA 5B6JA 2YHAA 4H4CA 1NG9A 2IPLA 1AQIA 1P1CA 1ZIYA 5K45A 4JUCA 1SPBS 3L4SO 3WISA 1LQ2A 3ZUPA 4C76A 1RJFA 3NPMA 1OFUA 4MWZA 2YXEA 4HWTA 5ICEA 2H7VA 4WBSA 3TLYA 1PDWA 3DBHA 4L5YA 1I30A 5E6RB 4RQAA 1CQWA 2JGRA 4FK8A 2J6IA 3K6RA 3HBLA 3KTFA 1GZSA 2GI4A 4YLYA 4GPEA 4MUKA 1UT5A 3RBZA 5JW6A 2QM0A 3DHYA 3LX5A 3N0VA 2GCOA 3KM0A 3CIOA 2Z2YA 3O9ZA 4MGZR 4JJEA 4ZDWA 1P8JA 2PVSA 3SN6A 3SR0A 4MPDA 1P6UA 3IXQA 4MW5A 2Y6UA 3VR4D 4XWGA 3M33A 3FTFA 2IF2A 2H59A 2WHPB 1M2WA 2FQYA 1PJ2A 1RXWA 2EZ4A 1I10A 1U2PA 3RVLA 4PCUA 2Q41A 2OHFA 3WWZA 3ZHYA 3VZBA 5K05A 3U1VA 3O2JA 1VJGA 4M1TA 2WWRA 3QLTA 3LTNC 4RF2A 1STOA 3TTSA 1KHTA 4O6VA 2IPOA 3ONWA 5HIKA 3ZI0A 3I6IA 4IIUA 3WTCA 3CRMA 5ITWA 4W82A 5G3YA 5LB4A 1OPRA 1M34B 3MNFA 1KYYA 1WDTA 4OX9Y 1P0MA 4M6WB 1Y3DE 5JS8A 2YV3A 3FMPB 5KC9A 1NU8A 4G81A 3T6KA 4ND1A 4XYLA 3E70C 1U9ZA 4BIMA 3I83A 3KJGA 1DBWA 4Q9IA 1HORA 2ZUUA 1SCAA 1IHDA 4IUCS 1T4CB 4ZAYA 3AR5A 1LRLA 5GTDA 4NCXA 1PR6A 3QU2A 3SFZA 3ZWKA 3L7BA 5JUWA 2SKDA 3HDYA 2I78A 1UODA 3GMSA 3EE6A 3GARA 1WMAA 4TXMA 4HDMA 3EMBA 5J40A 1EVLA 1YJQA 1R9GA 4BMOB 2TECE 1SOMA 5AVRA 2QUBA 3MPUA 3A4MA 3I5UA 3UT6A 4F9EA 4MW2A 3TW6A 2Y0BA 4QPZA 4Q3EA 1TU4A 4MV8A 5BUZA 4LCEA 1PO7A 3IKLA 1P3DA 1K5PA 3R0IA 3UV6A 4KXLA 1T0UA 2SCUA 1U2DC 2LP4Y 4P35A 1FRVA 4XPIA 3EIEA 4C06A 4BE7B 2L17A 1G9XA 3WE7A 4G5YA 3OE5A 4WFKA 3HU3A 3M2PA 3AEUA 2UYCA 1DIOB 1NXTA 4BKRA 1G16A 4QFBA 3F6CA 4C29A 5E95A 1KORA 1ZA2A 2QP9X 3UICA 4Y2SA 4B82A 3HUTA 3ZR4B 3S1LA 1GZHB 3CH7A 4C6HA 2HRZA 4LJKA 2IY9A 2GEFA 2JIQA 5IMSA 3S2UA 3DSRA 1BG6A 1JIVA 3DLCA 1DEOA 1ICIA 4QHSA 2MYTA 1HYHA 1LRJA 2ODNA 3E58A 3K0AB 4RADA 4YV1A 3SVTA 3C8DA 1U9JA 3ZK7A 2XADA 4DIMA 3C2QA 3N07A 3NHYA 3PG5A 1OBCA 2EIHA 3GJ7A 2AR7A 2BKVA 2FVYA 4E6PA 3ED1A 1NPDA 2X5XA 1V1JA 2WICA 2A7XA 3UFXA 4R1OA 4O4IA 6REQB 1XPUA 3WO1A 5JATA 4CIAA 1YJAA 4YP9A 1JLLA 1O9BA 1F2UB 5LQDA 1E64A 5EWJA 3HZOA 3K09A 4CMEC 4IFBA 4RGQA 1LJUA 4E5UA 2FPIA 3UM9A 2PUVA 2QGFA 2KW5A 4MK4A 1N2OA 2CYBA 3CRNA 3KLMX 4JB0A 3ASYA 3CJTA 4LGVA 4K9QA 4X7MA 1XEWY 4IFIA 3GLGE 1UMBA 1ZO8A 1P8AA 1OY1A 3K32A 3OBIA 1QRDA 1O54A 2FEKA 1JNXX 2X8WA 2HPAA 5FWYB 4RFSA 1WUIS 4BC1A 5JAIA 3FWPA 1CZOA 3CUSA 3QXHA 3NBQA 1CUAA 3QX8A 2GS9A 2DTDA 3K5PA 1LCIA 3NOVA 4TRMA 4C1BA 3OLZA 3HBJA 4BASA 5CYOA 3KE8A 3P2MA 4MB2A 4PVCA 3U39A 3PWKA 2A2ZA 3HC7A 4ARVA 3WLPA 4LGCA 5DH9A 5BV7A 1KMHA 1XYGA 3F8TA 3FJOA 1OR8A 4JS0A 4MS4B 3G59A 2HMWA 3U3DA 1V2HE 3IS3A 2HTEA 5KSYA 4WA8A 2AI3A 1ZZGA 3FCSB 3A9VA 4NSNA 4K81B 1IVNA 1YOVB 5JJBA 3PDHA 4FFDA 1KNQA 2OD2A 4EYKA 2PNFA 1Q0HA 2L0XA 3P9PA 4E15A 5ITVA 3U1BA 2YWBA 2GSWA 1U7DA 3HY6A 3F73A 1JYFA 1H66A 1QIDA 1W4RA 5JAMA 3VNVA 1Y98A 2FW0A 5KYXB 4DCGA 3H1TA 4ER5A 1VIAA 2R6CA 1EGMB 3MCUA 2YV1A 4R1LA 1QX3A 1C1XB 4UAUA 4ZJYA 1CR1A 4IFEA 5GMOA 1QGUB 3I01A 4YRFA 2CZGA 1JQKA 3G6KA 1C8BA 4TMVA 4NBWA 5E9JA 4X60A 4N12A 3QUTA 1NRWA 2OA0A 4BJ5A 1NRXA 2NSDA 5KYGA 1JQ5A 4LWZA 1EWRA 5AHXA 1Q3HA 4DA9A 3VPAA 3N5CA 3GNQA 1QG0A 4XFDA 2I8AA 2DY1A 3HCBA 1JZSA 1EDDA 2OB1A 2PA3A 3BRSA 2AC7A 3PJFA 4QDTA 4L9RA 1BDHA 1WXHA 1NLYA 2F2TA 4ZD6A 1GXSA 1CPYA 4WE3A 1KOFA 4ZOLF 3GLSA 3UCEA 2Q3FA 3V97A 5DV9A 1PT7A 2AN4A 3NBFA 3A8TA 1OT5A 1DO0A 1ZCZA 1KSHA 3ESCA 3K0FA 3KLPX 4I2VA 4LAFA 1E9DA 2OCAA 4WD3A 4DMRA 2CV0A 4CFYA 3GUVA 4TQGA 3ABRB 2FXVA 3HZZA 4CMJA 2JLAA 2Y1WA 4U8HA 3EODA 3HB9A 1Y9DA 1W2HA 2XGOA 1DKMA 1Y5LA 1ZPDA 3T7EA 2GBLC 1S3IA 4Q1VA 4LRSB 1IHXA 3PEWA 3I6MA 1XTUA 2O07A 4ZI7A 2VCHA 2Q2OA 2C3OA 3WIVA 2XYRA 2H1VA 4S05A 6NULA 5L4LA 2YBEA 4TL6A 3MYRA 1GL3A 3UKDA 1U6KA 2OVBA 1QPBA 4EITA 5E7QA 1DAHA 5ECGC 3WZMA 1QHYA 2G67A 3DBOB 1Y1SA 4HATA 2DHEA 1QZZA 4Q93A 3ZYZA 4CBVA 4LXGA 4ESVA 2BH9A 3VHXA 1P2SA 2A92A 2NP7A 3EA4A 2EV9A 3AR6A 1ECBA 4HJXA 4ID3A 4XPZA 3JASB 5DP2A 3IT0A 4R40A 3O8OA 1MEEA 1NHGA 4FIZA 4B2LA 5D3KA 2NPOA 4ZIRA 3IR7A 4YH1A 4LV5B 1VRCA 1P3JA 2FV8A 3PWSA 4F5YA 1ILEA 4UARA 4JVMA 1M8KA 4K2AA 1RYBA 3A9WA 3H87A 2I4IA 5IKOA 4CKEA 4LRXA 3ODPA 3S8YA 5K09A 1YKGA 3HADA 1J0XO 3QVSA 5LXTB 2W2LA 4AY5A 2TSYB 4HTFB 3WMFA 3NGXA 1GAXA 3ESYA 2Y67A 3TNFA 3KQYA 1D0VA 5CTAA 4Z0HO 4JYAB 2XZPA 3FJYA 2JPDA 4HDQB 4C3ZA 1CR0A 4Q3OA 4TUYA 4QBFA 4BNTA 1XZ8A 2ZGVA 4O33A 3UUFA 3W78A 4C87A 4ER6A 5BMOA 2JLYA 3AUTA 4HNHA 4MVJM 3FLEA 4OI1A 3KBBA 1YIOA 4KCGA 3RYIA 3VU0A 1UK6A 3C3EA 4L8LA 3ZEAA 4EZIA 3NIBA 5K8CA 4R8SA 2N0SA 3EFOA 3DF9A 3N70A 4ZAVA 1W46A 4Y1EA 2JFFA 5AW7A 3SJBA 4WBXC 1OAOA 2YVLA 4LX8A 3U17A 4NESA 3R3YA 2FGKA 4AKHA 1LKZA 3FOAA 3STVA 3SZGA 2NT3A 1SIWA 2GD2A 2LIPA 2YCLA 1XZLA 3GBVA 1DIGA 3IJPA 3FUCA 2V6FA 5TV2A 3CH6A 3GJSA 3CKLA 3OLYA 3DWFA 4XVRA 4MZXA 1JWBB 1ZL2A 4OP2A 3ZQ6A 2IHNA 1X9HA 4KOAA 5EMKA 2C4TA 2QBYB 3ZWNA 1G20A 1XVLA 1ZN8A 2BM8A 2DSNA 2I99A 4QQ8A 4G09A 1YBFA 2DFVA 3DBLB 4WJZA 1KZHA 4BU0A 4CQLA 5KTTA 4QDJA 1XPOA 2ZITA 4U9UA 2CWDA 1PDOA 3OX4A 1J0EA 1TM5E 3ZDQA 3HFSA 1YKFA 1K7YA 3D8RA 1PWEA 1E77A 4KGDA 5F5LA 5KVQA 3FOEC 2VA9A 5DX0A 1QVZA 1E5XA 1X1AA 2OWDA 4EA7A 1T9CA 3C5EA 3TMKA 2X41A 3TM5A 3FCXA 1BX0A 1VL1A 2YICA 4LZJA 2EFCB 2GAOA 4B32A 5I7VA 1EXWA 3HJNA 1ZD8A 3PRHA 4FHGA 1ULTA 5EE1A 3ZE9A 3C1UA 5B3LA 4HPXB 2O8EB 4IIEA 1ILWA 2QT1A 3PHBE 1V5FA 2Z8YA 4LG1A 2OXTA 4BL5A 4HNVA 2R1UA 2DFTA 4WCFA 4D82A 4DV3B 1NF8A 1XTBA 1QF9A 4G86A 5CVCA 3ADKA 5J4KA 4FSHA 2LW7A 4GXTA 1RXEA 1JG3A 3A58B 4JHXA 2J0QA 1YAJA 3DUFA 2TMKA 3Q1KA 2QQ0A 1N2XA 1RWBA 1SJ9A 3JVUA 1QANA 3DWIA 4URWR 3ZDRA 3QHPA 4ZK6A 4F06A 1NXXA 5I7SA 1YCDA 5T4FA 4A5OA 2GXQA 4MEJA 1RLJA 2V8OA 1MPXA 1QGAA 2FDRA 4PBRA 4MW1A 3A1SA 2FGJA 4MQFB 3K6SA 2IGBA 4O8CA 4XEHA 2FHSA 4YA6A 5FUBA 2XE7A 2WFAA 3R9IA 1DCFA 1G5PA 2ID9A 1AZTA 2ZTSA 1WRBA 1WIWA 4W8GA 3L84A 1RAFA 4ZYTA 2B21A 3QMPA 1NKSA 5C1IA 2FPUA 2P35A 1GHTA 1NPYA 2UVDA 3OEHA 3OJWA 3QIVA 4D97A 3IRVA 4DN6A 1JQBA 4D4MA 3NDPA 2IYRA 3VGJA 2VDMB 2BGTA 5CHYA 3ZE8A 1AKWA 1RAAA 3TSOA 1BZYA 5K4AA 1NQUA 1ZINA 2P3LA 1JA1A 2YRXA 2ZJ4A 3GJYA 3QNUA 4MA0A 4P7FA 3R7SA 2NXNA 3RT7A 3VKVA 4E12A 3G7SA 4O3FA 2MYNA 3O1HB 5HS4A 1J99A 4Y1RA 1IN5A 3T8YA 1ONSA 1I01A 4DDMA 2ZAOA 2QM8A 3MW8A 2X5KO 1CG6A 1ZJZA 3MBIA 1BN7A 4I1UA 5LBIA 3SF0A 1F1BA 1KJYA 4XEUA 3DGFC 4YMGA 1AKTA 1RWVA 1SC1A 4NPHA 3T54A 1R4AA 2IH4A 4LYHA 3EPHA 2CBZA 4IOJA 5C8YF 1QFMA 3A1EA 2R44A 5A5GA 1HOTA 1UEJA 2OZEA 5DGCA 5A9TA 4MARA 4D1YA 1ONOA 4FOOA 5NULA 3A6FA 3F3YA 5IHPA 5HZHA 2FHPA 1GLVA 1I33A 4K9LA 2HWYA 5F52A 2WF9A 3HEAA 1HTWA 1QMPA 1D9XA 3E82A 4K9PA 3H5IA 4K87A 4YX9A 1XCJA 1I2MA 5ETJA 3OKFA 1CYEA 1BXGA 2FZ4A 4H3KB 4J49A 1SXGA 3ECAA 3TLBA 2OFFA 2FPSA 1M2NA 2BFEA 2QAGC 2J0VA 4NC9A 3VNUA 5AFSA 4TTAA 3NEYA 3BAZA 1W44A 4YTEA 1V39A 3JQCA 2Y1XA 1O94A 3EISA 4PFQA 1ZH8A 3ROKA 4BNNA 4WFIA 1CUZA 1O87A 5AVKA 4KOEC 4DLPA 2QDXA 4B7XA 2GKSA 2YRFA 3M34A 3B1YA 3ROZA 2G0TA 2A0XA 4JITA 3T9DA 3QXXA 1R88A 3P27A 5BYJA 1ZGBA 4EO7A 1EI9A 4GBED 5TIIA 3VTFA 2WAMA 3DM9B 3EWNA 3PHJA 5E38A 4B7AA 2QRKA 1U2GC 2RJNA 2YNMD 3DE4X 2YIJA 1DG3A 2H4JA 4KL8S 2CJWA 2GVDC 4LECA 2D3WA 4CCWA 1FS5A 1LF5A 4AAYA 5DN6D 5LDGA 1ZOPA 2PEYA 4UD6A 2LXNA 3MTAA 4GPBA 3L41A 4TMTA 3T34A 5IJAA 1QH9A 3C70A 2HIGA 1QRRA 4TVKA 5EHGA 3SS9X 3IAM1 1Z07A 1IM5A 4IW3B 3QPBA 4PWZA 2HHLA 1T8PA 2B7CA 3TBKA 5LQRA 2D1SA 1XTZA 1FMTA 2YYSA 2H1HA 4HB4A 4IKPA 1PNVA 2NO5A 1DMSA 3ETHA 3NDIA 1DPGA 3UH1A 1UBGA 2Z2KA 3LK7A 1QH8A 4Q9NA 1FFBA 2I9PA 1KAMA 3MB5A 4NX2A 5M7EA 1M2VB 4K5QA 5HUJA 3LLMA 1O7JA 3MMPA 1MG0A 3NWOA 2IHKA 3IAXA 5SYAA 4P5DA 3TZEA 9GPBA 3BHJA 4OJTA 1MH1A 4XIIA 3RUAA 1A27A 3T0FA 2ZJBA 4NWIA 5E6SB 3OF5A 4G0XA 1CIJA 5KI6A 2JJ1D 1GV1A 2E6UX 4GZLA 3NP7A 4HCJA 1N6KA 2BF7A 3NC1C 3RNLA 2J9FB 2WM9B 3MD9A 4ND7A 1L4GA 3ZI4A 5C51B 5DF1A 3EG5A 4X1OA 2MWMA 1C7JA 4XJXA 2EKQA 4IKEA 3KZVA 4EI7A 2X9NA 2C59A 4PLHA 2VDPB 3D2LA 4V0OA 3EDYA 2V7XA 5T4HA 3O2QB 3SNKA 1L4BA 2H1LA 1N6IA 4YDRA 1X38A 2Q6IA 3O4RA 1WF6A 3DMRA 2EKPA 3CISA 5LZ7A 5BSVA 1W30A 3FBWA 4TTPA 1HDGO 2Y1DA 3AZQA 2BFBB 3QWBA 2PUCA 4D9GA 2CY0A 1NZFA 4Y2RA 3U0BA 3TNJA 2ECFA 3BMQA 4KE7A 1KS9A 1RPJA 3NM4A 4LWOA 5T4EA 2ZS9A 4TV8F 3JRNA 3F96A 3WA6A 4Y6GB 1NZJA 4HN4B 4AKSA 1EVIA 3C5WP 1E9AA 2A4KA 3GPBA 1U81A 4LJ8A 4LOIA 5H8WA 3PC6A 1GAJA 4BDTA 1O95D 3E1SA 2HIMA 1MENA 2V7GA 2YWEA 4RJLA 1IIBA 3CLUC 2Y9MB 3TXXA 1F8FA 3ZQJA 5AM5A 4U0JA 3Q3HA 4LMBA 1N32B 3V7NA 1JEOA 1IYZA 1U5BA 1JQEA 2X0KA 2CYAA 4HLNA 3ZWAA 4PG4A 4ZOQI 4A4DA 1ULZA 4RL4A 3T41A 3RF7A 3DE3X 1P5RA 1PL7A 2DUNA 4MAFA 1K8RA 3W8NA 2FJUA 4AQDA 1XDBA 1T9HA 4B4WA 3ORQA 4ZQGA 5CEFA 2RARA 2JHAA 2JGDA 2QRQA 4L16A 4KQHA 5BSTA 5TARA 3S2YA 2DH5A 1YIAA 1A8PA 3KOYA 3UG6A 5AW8A 4LC0A 2C78A 1TQ4A 2PR2A 4IWXA 2FDXA 2O2DA 5BYKA 4M88A 2ZIWB 2FZEA 4I66A 2GK4A 2O8DB 4ZQFA 5CDUA 3C3YA 1E7MA 3STUA 2A3NA 3E7DA 3I9FA 5B1IA 3AERA 1L5SA 2Y99A 3L8ZA 3LP5A 4EOGA 5DCUA 3IA7A 4QELA 2X3YA 4XQEA 5B4VA 1ENPA 3IE0A 4ZCMA 4MYHA 4M3NA 1FNMA 4PBSA 5LYJB 1JBEA 4UREA 3DE0X 1PL0A 5KREA 3MWLA 1XRLA 5BN4B 3AEQB 1O4WA 2YY7A 2FPGA 4OPMA 1F8GA 4P5EA 4DBLE 1GDTA 5IDXA 1M75A 1XCLA 1YZ3A 3SNHA 1A7JA 3SX0A 3FVTA 3JU3A 2B1IA 1JVBA 2ATVA 3GA5A 2RMKA 2NWQA 2V7EA 3PGA1 4OEHA 1E2DA 1V8PA 4ENPA 3I6BA 5CB4A 3PC8C 1QRUA 4MB6A 4L0DA 3F1LA 3EIQA 4H7EA 4G1EB 2AYYA 3FYHA 1GR0A 3PDCA 4MW6A 4URVR 3QTBA 4MH0R 5EMJA 3D4IA 1KP2A 4R3NA 3ZHOA 2UUBB 1DIHA 4JGBA 3HKEB 1K0FA 3IVXA 4MGKR 1SU4A 5JZBA 3WA7A 2WU0A 2FQ1A 1CZHA 2C9OA 3PYMA 4JLJA 1O5TA 4YXFA 2V7BA 2WIDA 1KXJA 1GAWA 4HF7A 5M29A 2BH2A 1Z22A 3PR3A 3AVXA 4GH5A 4AXBA 1W9MA 5LWQA 3OJFA 2B2XA 4H6XA 2IU3A 2WR8A 4KRGA 3MT0A 3KCNA 4DANA 4WASA 2A94A 1OBVA 1CX9B 3WTBA 1GPLA 1P7PA 2IFTA 3L46A 4HTAA 1TLLA 4CFSA 2AL7A 1GCAA 1WO8A 1OI2A 2X4IA 3A9RA 4UAGA 4ZTBA 3ZVRA 3VDMA 4F6CA 1JW9B 4D0SA 3OTOB 2P9GA 1QHNA 4XDGA 5C5IA 3LUHA 4PHFA 4ZAWA 5PGMA 1LLFA 1HFWA 1FSGA 1NKVA 2C82A 4MLCA 4OHZA 3WK8A 1WCIB 2OXIA 3LECA 3WRVA 3QMMA 4G5FA 3HDTA 4JJZA 1CJTC 5AVZA 1PR9A 3V8VA 4JLPA 5BT9A 1G21B 3T5TA 3FM9A 1L5HA 2GA9A 3CZPA 3EDQA 4LI0A 5K8LA 7ADHA 3PD0A 3Q11A 1TQ2A 3SVLA 3E27A 2VTDA 4ANFA 4BCCA 3AHCA 5FPSA 4CG3A 2OORC 1AGRA 4LOLA 4G8JA 5FTLA 4ZZ0A 2GM9A 1DAIA 1GUDA 1N75A 4XGIA 1SD5A 1EFKA 4BV2A 1AV6A 5HK9A 3CKMA 3KVVA 4BN0A 2AZTA 1VFPA 4UE2A 1Y6QA 3FPFA 2RBKA 2PL1A 1LNSA 4WERA 7MDHA 3M4NA 4IHJB 3IEKA 5E1OA 3ABSB 4JXXA 3P0EA 5IM4F 1L5RA 2XR1A 3ET4A 2P62A 5CA0F 4X62B 3UJAA 3GT7A 1B76A 1R1DA 1R12A 1S2OA 2M32A 2NT4A 1NVUQ 3MINB 3LE8A 1KR5A 1XEWX 3PPIA 4GMHA 4ZOAA 3CVYA 4B4VA 1XJWA 2RGDA 1HT3A 1HDEA 1BDBA 4NIMA 3RCBA 1JKJA 1MH9A 2COUA 5CNKA 1NQVA 3K0SA 1G8PA 3AP3A 5JU6A 2RH8A 1UWKA 2QYHA 2ZAYA 2Q9BA 1ZNWA 4NDNE 4DA6A 1Z36A 1J0DA 2TYSB 3LIPA 3FVQA 1EVJA 3R3HA 3ZDYB 4BQOA 1GGJA 4KUGA 1XKQA 5E4TA 1UOQA 2B2NA 1MB4A 2XKBA 3ZV6A 4Q3AA 4FEGA 1JI3A 3OOJA 3CKKA 5CB6A 2C2ZA 3WOVA 3I3OA 1S9DA 2AUTA 2W90A 5ADHA 5AJHA 5JDCA 1TMOA 2R68A 2FZ5A 1WMSA 2DHDA 4O2RA 4XWYA 4AJJA 1VKRA 2FWMX 2ZJ6A 3OQMA 5MHTA 5T4BA 4BY9E 1W8IA 1CDZA 2GPBA 2AUMA 2XNKA 1V2GA 2R1VA 3MJHA 3L7JA 4O4LF 3VSDA 4HFRA 5ALFA 4DZZA 4C01A 3F78A 5DTMA 3SYRA 1KQ3A 1KKLA 2YW2A 4V3BA 1C30A 5CLHA 4KEAA 6AT1A 2BSXA 1P1JA 3WI7A 1P1BA 1X42A 3BH6A 4JB3A 4CM4B 3A3YA 4PRKA 2LGJA 2QLJA 3CW2A 1E0KA 1FS4A 1HL3A 1S3SA 3GFTA 2YFYA 1E5TA 3L0ZA 2YKGA 2JGJA 3CZRA 3OFJA 1C50A 3QU9A 3ISVA 4I6EA 5F77A 5L3ZA 3BSFA 3TKLA 7ABPA 3EULA 2Q4TA 1A8IA 4TXLA 3RABA 3SSAA 5AVXA 1WEHA 1AS2A 5J5AA 1FLVA 3IIKA 4FGZA 3L4KA 4EUFA 2JARA 1QUEA 2ZR7A 5TE9A 4ARBA 4CKWA 1E89A 3M6MD 2PO7A 1E2NA 5DI9A 3EQZA 3WFZA 1UADA 1VJ0A 2ZM6B 1ZCAA 5DM4A 3FX2A 5LA6B 5FH9A 2KMLA 3F74A 2ECKA 1DB3A 2Z56A 1JAIA 1SBHA 4YJ3A 5DIFA 5DM2A 2QMYA 3CW8X 3AJDA 2BZGA 2O0KA 4K9OA 4PG7A 4UXIA 3DOUA 3ZHBA 4BKQA 4AQYB 1BDIA 3Q2OA 3VOSA 1P2VA 1V96A 1WA5A 1YZKA 4ENTA 4JCOA 2PGNA 1TZKA 3W5HA 1XNHA 4CM1A 1FTWA 2Q5OA 4PXYA 3W2GA 2B99A 4PG8A 4KQGA 3WGIA 2J09A 4NFHA 4AMBA 1NDHA 3C8HA 2AB0A 5EVCA 5HTKA 4F12A 1BMDA 2CSXA 3L7IA 4J0QA 4M7PA 3BE6A 2G4VA 3VU8A 1Z45A 3F5QA 2WTAA 3LL7A 4Q6BA 3IIJA 2J4FA 4RDXA 4OTZA 4OP1A 2BMFA 4N5IX 2BM9A 1SBQA 2NADA 1A97A 3SJAA 3A4NA 2AKAB 3LH5A 1WXGA 3M1AA 2EFHB 2GBCA 2O9JA 4KBYA 3EVEA 1D2RA 4JA2A 2CHQA 1J8YF 2IPAB 4EI2A 2ORYA 2D2VA 3OIVA 4N18A 3T1TA 5FWAA 4HLUC 2XWBF 5TEWA 3KAPA 4DMLA 4HEA1 1QS0A 1D1SA 4CDGA 1BYUA 4P92A 1OYYA 3PTZA 3WLJA 3S28A 4GLOA 1F2DA 2C8KA 2OAEA 3NDRA 1NL3A 4CCAA 4EMTA 3HS3A 2TS1A 3GXOA 3RD5A 2HFKA 1KGSA 4ARZB 1ZVJA 2CFCA 2JK1A 4QECA 1OX5A 4WY8A 2XVYA 1JPVA 4QOHA 1SIBE 4A7PA 1ADBA 3QKSA 3N58A 1SHJA 3Q5GA 1HYBA 2F43A 4PQFA 1TJ5A 5JYCA 1Y3HA 3V48A 2LE0A 4V0NA 5SY6A 1FJ2A 2YWHA 3EVDA 4D4GA 2NUPB 1VB3A 2Q49A 3NV7A 5CURA 2PSJA 1QMGA 4FDVA 4RV5A 3SDZA 4MQUA 1OOEA 2HADA 3G5UA 1J09A 2DFPA 3SC4A 3N2EA 1MIOB 3OLWA 1DELA 3C85A 4G07A 1WCV1 3W5VA 4K2HA 1T3LA 4TS1A 3I30X 3HKDA 3FTPA 3TM4A 4R0NA 3C4QA 2GVZC 2GN1A 1J2JA 3BWYA 1GGMA 4D80A 3ZLBA 4G63A 4Z1MD 1TKCA 1EFUA 2V7TA 4G56A 1J8DA 3ND8A 4S0XA 3MJSA 3BREA 2VQ6A 5JRJA 1HE3A 3CNNA 4XI9A 3LFUA 2EHDA 4ZHQF 3R3VA 1Z29A 2PZBA 4RJKA 2QZPA 3MJ4A 4P6VF 1SUPA 1ECJA 1ZN7A 3HYCA 1M2KA 4JVOA 2DSTA 1TK9A 3NALA 5EEGA 5CPFA 1FQWA 4FE3A 2IYOA 4L8FA 1KRXA 2B1JA 1BFUA 2HF2A 3I0MA 3HFJA 3IUQA 3SR4A 3HJAA 3TI9A 2HNBA 4OUDB 3WYEA 5LBUA 3RYTC 1WNFA 1Z26A 4GSLA 3C7KA 2PUFA 4HZGA 1RHJA 3WGOA 3I1JA 3N2GB 3D6MA 3ROXA 4DJDC 2CT8A 4QT0A 3FTCA 3C97A 4RTKA 3W79A 5DNVA 1XVVA 5AVJA 1FSPA 4BB5A 3QVUA 2H9AA 4F8JA 3L9XA 4OXXA 1AURA 2JRCA 3H4VA 1L7DA 1NC1A 1YK0A 3DZDA 1NUSA 2IA5A 4YRMA 2GPWA 2L69A 5AKEA 5AUOB 4LCJA 4D98A 3MG9A 3W7VA 3ZXYA 3SQDA 4QXQA 5K8JB 3R24A 2VDKB 2V6MA 2WV9A 3BIJA 3GPDG 3JYHA 4TYMA 4UU0A 1HYQA 1UXJA 4CMHA 2J5XA 4QO8A 1GITA 3RVNA 5F23A 4G0WA 1T5DX 1X80B 5ESRA 1FJXA 1YE5A