5LQKA

Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-2,3-dihydroxy-5-[(4-methylphenyl)methyl]benzamide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 80
structure length 216
sequence length 216
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqkA00
4YUXA 1XDSA 3P97A 4XCXA 5CVVA 5EGSA 4RVFA 2IPXA 1R74A 3BKXA 2JG3A 2JH9A 4C08A 4E33A 3OE5A 3UFBA 4PONA 2HR1A 2GAFA 5K0JA 3BWBA 3VSEA 2PBFA 2ZCJA 2UZ4A 3TLJA 1NW7A 1V39A 2YXLA 3OU7A 4HGYA 3ER8A 1XJ5A 1EAMA 2P41A 3A7EA 1IXKA 4OBXA 2AZTA 3NTVA 5E1OA 3B7PA 4KIFA 4QQNA 2R3SA 2ZIGA 2JJQA 3CCFA 3F4KA 3SVZA 5CVDA 1NW3A 3ORHA 3UA4A 5K8VA 4CTKA 4M37A 3SGLA 2QRVA 3HCDA 1XDUA 3GU3A 5EIFA 3SSMA 3LSTA 3R0QA 3EGIA 2AOVA 3G2MA 2FCAA 3VYWA 4BP3A 5K0GA 3I5UA 2OPBA 5EZSA 4CKCA 1RI3A 3M6XA 5CIYA 4RTSA 2CKDA 2G72A 3LDFA 2ZZNA 2ZWAA 3HTXA 4L7VA 4Z2YA 2P7HA 1JTFA 5K01A 1G60A 1JR4A 2IDJA 2JHPA 1BHJA 4RTMA 1Q0TA 2IIPA 3UWPA 2ONZA 1YF3A 3P2EA 4ER7A 2HTEA 1JG1A 4LG1A 3SMQA 4ER5A 2XVMA 1N7IA 3OCJA 2PX4A 4KIGA 4BLUA 4F86A 3HNRA 3CKKA 2PSSA 4PYLA 2BM8A 2BR5A 2GS9A 3B5IA 3ELYA 1BC5A 1TW3A 3CJQA 5E8JA 3THSA 9MHTA 3BZBA 3P9IA 1JQDA 2NXNA 3GO4A 3OPNA 3R24A 1JTEA 5LQCA 4RTRA 5FUBA 4ATNA 4RTOA 3TPZA 2B25A 2ZVJA 3WSTA 5P8WA 3MGGA 1JQ3A 2A14A 4IKPA 3MTEA 5DRYA 3FUWA 1VP9A 1EIZA 3LHDA 1P39A 4MHTA 2ZULA 3B3FA 2VDWA 3TMAA 4E31A 3BWCA 4OX9Y 3BWMA 4V0RA 4OA8A 4PYJA 2AOUA 2NP7A 4AZVA 2P3LA 2OKCA 1ORHA 2H1RA 3LCUA 3ME5A 2FRXA 1R8YA 1NW5A 4RV9A 2UYQA 5E9JA 1XDZA 4FS8A 2JHCA 3O4FA 1TW2A 2I7CA 3IEIA 3LDUA 4RX1A 3H2BA 3AXTA 2O07A 2F8LA 3G5LA 3KQOA 5GM2A 2XYRA 4X63A 3A7DA 2P35A 2PY6A 2XYQA 3CVOA 3EVDA 4DA4A 5DX8A 4YMGA 1RJEA 1KXZA 3TOSA 5EEGA 1WXXA 1XXLA 4GOMD 4FSXA 3VC1A 3EVZA 1EJ6A 3PLAE 3LBFA 2I62A 3LL7A 4ISCA 4DM3A 3P71T 2AOUB 3HCEA 3SR4A 2YXDA 3FZGA 4PCAA 2YX1A 5JUWA 4KDCA 1EG2A 3SSOA 1WG8A 3EVBA 4FSDA 4ZTBA 3UJBA 4F84A 3KPJA 5EKUA 1QAMA 4GOLD 3UJCA 2BM9A 5GIPE 2C7OA 1XTPA 5HZMA 3VC2A 4X61A 5HIKA 1VLMA 3RODA 1VQ1A 5DXJA 3MHTA 1T43A 4DZRA 3UJAA 2I6GA 5K03A 4FT2A 2BR3A 3BGIA 3EGEA 3FPEA 3IHTA 5CVUA 4C06A 3QOWA 5BW5A 4AX8A 3PS9A 4QVKA 2NXJA 3B3GA 5EHIA 5LQRA 5EHGA 3BGVA 1G38A 2PT6A 3NDIA 4DMGA 5LR6A 5EMLA 3OFJA 1P1CA 2UYOA 5LQJA 5EIWA 1ZGAA 3IYLW 3MTIA 3KQSA 2ESRA 1I1NA 2V74B 3FYCA 3R6TA 4LECA 3DUWA 5FHRA 2FK8A 3L8DA 4QVGA 3HVIA 5FWAA 4DF3A 3A27A 3HA7A 3EVCA 1D2CA 3TM5A 4IV8A 2PJDA 4E2XA 2G71A 3GRZA 1MJFA 1NE2A 3GNLA 3A4TA 3A25A 2AOTB 3PFHA 1ZQ9A 4RWZA 3LCVB 5K0NA 3V8VA 4ER6A 3IV6A 5BP7A 3NVKI 3MERA 4HRAA 4GOND 2Z6AA 3EGVA 4C04A 4V0QA 2PGXA 3MAGA 4X1OA 3T7RA 1JG4A 1RJDA 1P91A 2NNWB 2NXCA 2P3OA 2PWPA 4RVDA 3BKWA 4E2WA 4LWOA 3ERCA 5DWQA 5HEKA 2XBMA 4CKBA 1D2GA 4M7RA 2G1PA 4HTFB 1N7JA 4X60A 5E8RA 3M33A 4JXJA 5DX0A 1I9GA 3ELUA 2C7PA 3TKYA 5JR3A 2AOWA 3HVJA 5DX1A 3O7WA 2IDKA 1BKYA 2PT9A 3LX6A 2P8JA 4GOOD 2AOXA 3NWEA 3PX3A 3TFWA 1F3LA 2OBFA 5C1IA 5E1MA 3RW9A 2AVNA 5DRTA 1NV8A 2ZW9A 5K09A 1AQIA 5ERGB 3FPJA 3GXOA 3MCZA 4PYNA 4FT4A 1ZGJA 4RVGA 1X1BA 1X1AA 4PCLA 3OE4A 1KHHA 3DR5A 2AN3A 3CC8A 2ONYA 3UBTA 3KQYA 3OZRA 4OA5A 1AF7A 2ZBQA 1YFJA 1SQFA 3BGDA 3TR6A 4DCGA 3FUUA 2GA9A 3BT7A 1VL5A 4G56A 3JWGA 2QY6A 1O54A 3AY0A 1R18A 3CJRA 3DLIA 3DXZA 3OU2A 4WXHA 2B2CA 2WK1A 2OYRA 1NBHA 1QANA 3GDHA 2VS1A 2ZFUA 3HVHA 4YMHA 3KQWA 3S68A 2HMYB 5LQKA 1NV9A 1FPQA 3KKZA 4EMSA 3KQQA 4E2YA 1XCJA 2K4MA 3SM3A 4OQDA 5FA5A 3DTNA 3Q87B 1M0EA 3JWIA 5EEHA 2EFJA 4RTQA 5ICEA 5EMKA 4HSGA 1DL5A 1SKMA 2UYHA 1YB2A 3CGGA 1G55A 2NP6A 5F2KA 4RTKA 3QOXA 4DKJA 3NW9A 1RI5A 4O29A 4XUEA 2IBTA 2PXXA 4YUVA 1HNNA 3FTDA 2GH1A 2ZZKA 3O31A 1MHTA 3NWBA 4PNEA 1VIDA 4KWCA 1YZ3A 3OZTA 3G8BA 3P9CA 3C6MA 1IY9A 4R8RA 5M5BA 2O57A 5FWDA 4EK9A 1L3IA 1L3CA 3I58A 5T6BA 2CWWA 1ZG3A 4CWAA 2Y1WA 1SG9A 3B89A 3C3YA 3QV2A 5U4XA 3BUSA 2HNKA 4QTUB 3HM2A 4RTPA 3G2PA 2XYVA 5EVJA 1NT2A 4PYMA 5H02A 1WS6A 2VP3A 3KQTA 5BW4A 5DTMA 3HCCA 3FPFA 3PVCA 2LD4A 4PYKA 4HG2A 4RTLA 3A26A 3ER9A 1UWVA 3REOA 2EX4A 2DPMA 3FTCA 3K0BA 5HIIA 5ICCA 3ELDA 3D2LA 3T7SA 2EG5A 3P2KA 4IWNA 4A6EA 1HMYA 1UIRA 3DULA 3G7UA 5GOZA 3T0IA 1RI4A 3GCZA 5C0OE 4MIKA 5EMMA 3NJRA 2CL5A 3THRA 3ELWA 4RVHA 4YUYA 4P7FA 3HP7A 1INLA 1KYWA 3V97A 2DULA 2PKWA 4GBED 3KPUA 5DPMA 4Y2HA 1U2ZA 1VPTA 3FTFA 3GWZA 3MCTA 3HVKA 5DSXA 3UJ8A 4U7TB 2AN5A 4FR0A 1JG3A 4MQ4A 2BR4A 3EMBA 4GEKA 5EOVA 3X0DA 3DH0A 1NW6A 3E7PA 4Y30A 1D2HA 4BY9E 1G8SA 2JHAA 3JWJA 4KRGA 3G8AA 2ZZMA 1F38A 1X1CA 2P7IA 4X41A 5BXYA 5LQAA 1VP3A 1FP1D 5DM2A 2UYCA 3MQ2A 1O9GA 2ZIEA 4YUWA 2OO3A 2YR0A 3LECA 4YUZA 2PWYA 3AWIA 3UJDA 2ZTHA 2CMHA 5DTQA 2N47A 4DCMA 1JG2A 2ZSUA 3KPWA 5KQRA 2BH2A 4QDKA 1FBNA 2C7QA 2AS0A 4OQEA 4XUDA 4PGHA 3LCCA 4DQ0A 2H11A 10MHA 1JSZA 1Y8CA 4K6MA 4HC4A 4C4AA 2ZBPA 1YZHA 3AXSA 3EVFA 4PGGA 2VDVE 3LKDA 4H0NA 3CBGA 3EPPA 3PFGA 4PWYA 1G8AA 3E8SA 5CUQA 5F2OA 2ZWVA 4AZSA 2IH2A 1ZKDA 1ORIA 2G70A 5D1HA 1FJXA 3HCAA 4RSRA 4HGZA 1NW8A 2PV0A 1DUSA 5LSAA 5CCBA 2O06A 3EEOA 5DM0A 4EKGA 1DCTA 1FP2A 1KPHA 4ER3A 2IGTA 3P2IA 1R6AA 5HIJA 5FADA 4AUKA 1SUSA 3EVAA 5E2BA 1PRYA 4PIPA 1B42A 3DLCA 5LQNA 2B9EA 5EKXA 5E9WA 5LQUA 2R6ZA 4FZVA 2IFTA 2B3TA 2FYTA 1P1BA 3I9FA 3PT9A 4R05A 1L9KA 5FCDA 2VZ9A 7MHTA 2PX2A 5GP1A 4YV0A 4R6WA 1N2XA 2GPYA 3EVEA 5HIMA 1JSXA 3PTAA 1JQEA 5CD1A 2FHPA 1NKVA 2EJUA 3KQMA 5MHTA 4PINA 1KPIA 3KR9A 2YQZA 1SUIA 5CVJA 5DTRA 3TRKA 4C05A 3I53A 3GRRA 5HOQA 3FRIA 4HH4A 3M70A 5CM2Z 5E1DA 1QAOA 2PVCA 1Q0SA 3Q7EA 4M36A 2G8NA 5KS2A 1UFKA 4QPNA 5E1BA 2ZBRA 2OZVA 3EVGA 5DM1A 4M38A 4AZTA 4YV1A 1SQGA 2YXEA 5CCXA 3JWHA 1WXWA 2JH8A 2CMGA 3DXXA 4P7GA 5B1SA 4RYLA 2NYUA 5K0CA 1XVAA 2ORED 2ZIFA 4CXMA 4MTLA 4BLWA 3M4XA 4BP1A 4MWZA 1X1DA 1M6YA 1R8XA 1RI1A 3HCFA 1EJ0A 1YUBA 4E2ZA 3KR0A 3BWYA 4E32A 2GB4A 3OU6A 4P7JA 1Z3CA 4FP9A 5DXAA 4ER0A 2GLUA 1BOOA 4C07A 4P7KA 5F2NA 1SVUA 3GJYA 1VE3A 3FPHA 2KW5A 2P3QA 1KYZA 4PIMA 3NVMB 1KPGA 3BXOA 2FK7A 2QM3A 5EG5A 2ZLBA 4EVIA 1QYRA 2YTZA 3C6KA 4CKEA 4GUAA 5K05A 1XCLA 3T7TA 2PXAA 3P9NA 5KQSA 5IH3A 3M6UA 3U81A 4POOA 3G5TA 3DOUA 3NDJA 1AQJA 2OB1A 5E2AA 4AZWA 3FUXA 3LPMA 5FQOA 5EC8A 5GINE 1RI2A 4GC9A 1G6Q1 2P40A 1WY7A 3EMDA 3G2OA 5T67A 3KPVA 4A6DA 8MHTA 4FGZA 1KR5A 2FPOA 2B78A 3AJDA 3G88A 2OXTA 3TQSA 4B17A 2I9KA 1YFLA 2IH4A 4KVZA 1KP9A 2V7EA 1L3BA 5FA8A 2BZGA 4GF5A 4IV0A 5E9QA 3GIWA 3FPGA 1M6EX 3KU1A 5HFJA 4WVLA 3KR1A 5D1NA 3ANXA 4E30A 2Z6QA 3FTEA 2YVLA 3G89A 3UJ6A 4QQKA 5ICGA 3PX2A 4XUCA 5DM4A 2VDUE 3FYDA 3I64A 5FULA 4QTTB 2QRVB 5GWXA 3EEYA 3FRHA 1TPYA 4F85A 2WA2A 3HA5A 3ID6C 2C7RA 2IH5A 5FHQA 5ICFA 3NMUF 2QYOA 3UZUA 3E23A 5HILA 5EPEA 4P58A 3G2QA 2NXEA 1KIAA 4LWPA 5DSTA 3UJ9A 2O0LA 4GC5A 3DMHA 2HWKA 4KDRA 3UJ7A 1QZZA 4PYQA 4UOEA 2AOTA 3GGDA 3GRYA 4HTFA 2H00A 5GM1A 5K0BA 2Z6UA 2PX8A 3DMFA 3TM4A 1WZNA 3B3JA 1QAQA 4KW7A 3KR2A 1AV6A 4YV2A 4RTNA 3TKAA 2IP2A 3GRUA 3KPYA 3PB3A 5C9ZA 4EQZA 4PYOA 1EQAA 3HA3A 1O9HA 5EQJB 4OBWA 5GIOE 2HV9A 1H1DA 3UA3A 3LDGA 3OFKA 2O05A 3P9KA 1RJGA 2PLWA 5FQNA 2ADMA 3FUTA 2Y1XA 1PJZA 3P8ZA 5IKMA 3HCBA 3LGAA 2E5WA 3CJTA 2IBSA 2AR0A 2ERCA 3SX0A 5K0LA 4C03A 1L1EA 3DXYA 4CTJA 1VBFA 5K0FA 3C0KA 4RTJA 5T64A 1NBIA 4PYIA 3SXJA 4QPPA 2PXCA 1RJFA 4U7PB 3C3PA 5DT2A 3RIEA 5G02A 3DP7A 3MB5A 1I4WA 3M6WA 3E05A 5FTWA 4BLVA 3SSNA 3R9XB 2AN4A 2XVAA 3M6VA 1OR8A 1ZHFA 3LKZA 3GRVA 4QDJA 4R8SA 4EKIA 3FUVA 4NECA 3OZSA 4E70A 2EJTA 3KQPA 1IM8A 3DMGA 3KQVA 2P1DA 5KYGA 2QE6A 2YUIA 4R6XA 3LBYA 5DLYA 5EMJA 2AVDA 3K6RA 4GQBA 5K0EA 2OB2A 2WA1A 5KVAA 1R00A 3KHKA 2OY0A 2PX5A 3HEMA 1X19A 5EZQA 5CVEA 2Q41A 3R3HA
chains in the Genus database with same CATH superfamily
4YUXA 5TDHA 3IQDB 2VDOB 4XCXA 3W8DA 2VJCA 1C9KA 1Y6ZA 4LVOA 4ZEVA 2QNRA 1NP3A 4BO1A 2VTVA 3VSEA 4CIAA 2B8EA 4PG8A 1A4RA 3I5AA 2YXLA 4HX2A 4X62B 1RABA 4BNXA 1BWSA 1AGXA 1T1JA 3SQDA 3AR3A 3QRWA 2CT8A 2JI7A 2IEIA 3O0TA 2WF6A 4L2IB 3W9YA 2IUYA 5HP4A 4KO3S 4R7TA 1P6UA 4YRQA 4E03A 3GVHA 2O3JA 3N70A 1OX5A 2C59A 4LXHA 2X0DA 5EE9A 2AUTA 1Q7EA 3RT1A 2ZQZA 4JC4A 2XQKA 2AOVA 2VSOA 1IOWA 3VYWA 5B64A 2NUTA 1OX6A 4FGJA 4X1IB 2CVOA 2ZBVA 5AHRA 1Z0AA 2QSJA 4L7VA 1W44A 1J9ZA 1TYEB 2NO0A 2WKQA 1UMDB 1Y5MA 2B8TA 2ID7A 1NN1A 1V6AA 3UKJA 5ITZA 2ONZA 2R9VA 4O4LB 3UW1A 4LZJA 1KC3A 4IQFA 4M54A 1QP0A 3WFJA 1R0YA 2FWAA 3W6PA 1XCMA 1DHRA 3HEBA 4RK0A 3TXYA 2XVMA 1N7IA 3S1AA 1PG0A 4B1FA 1JLLB 2GARA 2IODA 4F86A 3IOBA 4H7HA 3W2GA 2BM8A 4FMBB 1K4KA 5CYOA 1K4MA 1TW3A 2XE8A 3IAM6 4MW4A 3SF8B 3THSA 5KB3A 2F4VB 2GWHA 4MW5A 4L8WB 4ATNA 2QP4A 2B25A 3TPZA 4YCCA 3L05A 4G2NA 2ID4A 4INZA 4KAJA 4LYAA 2A59A 3C3AA 2H07A 4ZJPA 4W5HA 3TZ6A 1V4BA 4B76A 2J3QA 1NAHA 4KLNA 4EG8A 5M7EA 3PA8A 3PQ7A 3ZWYA 3W5CA 4D0GA 1G59A 1SC3A 4YV7A 3GEHA 4KI0A 2FFQA 4KNVA 4WEOA 5H82A 1JFVA 1Q6ZA 1XA3A 2M6RA 1I0IA 4RV9A 2Q1TA 3RV4A 1DKQA 2WE8A 4YR7A 3RUCA 2ZJ2A 1BCSB 3MWJA 2C29D 4G65A 3AG6A 1YT5A 1ZH8A 4RETA 2JIOA 4B81A 4R71A 4CQMD 2C77A 2NX2A 1IDN1 2YUTA 3GJZA 4KNWA 2ZUTA 4PC1A 4FB5A 3A7DA 1OH7A 3BJZA 2OCXA 4KWTA 3UJ3X 4OHZA 3FWYA 2RFLA 4B4UA 4MGIR 3T3GA 3FTQA 2YMLA 5GJWC 3QUQA 5T5QA 4BVEA 3C5WP 3L8HA 2YYSA 3M1IA 2I2BA 3DFKA 3KVRA 1J8MF 4GYWA 4MVXA 5IN5A 5AFSA 3B9RA 2QVLA 1I2BA 4Q1FA 5CJPA 4W1SA 4QLBA 4F84A 1QM5A 3K70B 2B37A 4KRYA 3HVUA 2F64A 3SKVA 3SYMA 3EC1A 3DYVA 2V58A 4V3CA 3U7RA 1GGJA 3IEXA 3QBDA 1VMKA 4K6GA 3MWEB 4K9LA 2WJZB 5DHQA 1JTVA 3H3XA 1T43A 9ABPA 1GKUB 3H6KA 4Q16A 3IHTA 4EL0A 2QRGA 5AUPB 1E69A 1XVTA 2X8WA 3PUWA 4KO1S 4OIMA 3CUSA 1V71A 3CX7A 3DOOA 3B3GA 1XKQA 1MGOA 2R751 3G02A 1CUDA 3L7IA 4TS4A 5HM6A 4U5QA 3OZVA 2RI0A 4U2BA 2VJMB 1A76A 3KSUA 2JD0A 4F9FA 1T13A 2IKQA 2CC2A 1OT5A 4HN2A 4JBNA 4LHXA 3NPAA 3DDCA 2VJNA 3HA7A 2FFAA 5K45A 1D2CA 1YOVB 2C83A 2R4UA 2H2GA 2AEJA 3BXZA 3IE0A 1QDLB 5KNLA 5JV5A 1MPXA 5K6AA 1RCTE 2LKCA 1XRLA 1I0LA 3VU9B 4KLRA 3NDPA 3VSAA 4V0LA 3B6KA 4LJ4A 4S24A 5L4SA 2WVJA 3AKDA 4GOND 3VR0A 3JQ7B 4OXQA 4RGBA 4RZSA 1Z6QA 4PAWA 4RVDA 3ILSA 3FHCB 4E2WA 4EITA 2E1RA 1DQYA 4UTRA 1K89A 1G98A 3HN6A 3E3NA 4D0LB 5LIRA 3HM9A 1B76A 5IHPA 2Y0PA 2Z08A 1P29A 1VJ0A 2DOKA 3ZZ0A 1EINA 3ZE9A 2PLNA 4X60A 2GBFA 2F3SA 2YV1A 2JI8A 2TMGA 1LDNA 3EUEA 3U80A 1T3TA 4N7RA 3THXB 4EH1A 4BASA 1BWPA 1FFDA 2XB8A 2A8YA 5UKDA 2WWXA 1RD4A 5EZYB 3F7OA 2W2LD 4LMRA 4L22A 4UTXA 3WJ7A 2P8JA 3HKDB 4CT0A 1R4AA 1YJ5A 2GZMA 3ZUPA 5H68A 7YASA 5I7EA 2OBFA 4ZOLF 4OHFA 2QR2A 5ADVA 1T4CA 2KMLA 4LZOA 4OLBA 4IDPA 4RM3A 4CLRA 4ZVKA 4G85A 3UYLA 4ZOQI 3I9LA 3ND9A 5CA0B 1E4YA 2O7SA 3M3DA 4QJIA 1RQRA 2IJGX 3LT0A 5MFPA 4F3TA 1PVOA 3E7XA 1T2AA 2DF8A 3DWIA 4EG5A 5A62A 1Q3HA 1OE0A 5KINB 2E4AA 3C1AA 3OCZA 4MRMA 1ZD9A 2PJRA 2GM4A 1RQ2A 2WP8J 3DPUA 2GO7A 3AF6A 3GEGA 1RW4A 4I4TF 1VLHA 1XQ9A 3IPCA 3SYKA 4YX9A 1E92A 3GPDG 3K8YA 2W6MA 3MINB 3RR2A 3WB9A 1UBMS 3GEEA 4OOFA 3RTAA 4MS3A 1VSVA 5EMKA 5TQ0A 4DEVA 2DHRA 3NBMA 3CGGA 1OI3A 4A16A 1Z4IA 1G55A 2ZROA 3Q8MA 3UV7A 3JR3A 2VBGA 3NW9A 4Z7NB 1DDOA 1NOKA 1R12A 1WMSA 4JT2A 5LOVA 1OWLA 4MRVA 3TLAA 3WQSB 1E0DA 1JDJA 1MJGM 1WMDA 3QKTA 3AFHA 1ZOOA 4U2FA 5A3VA 4MVJG 3UENA 4CG1A 4CL8A 5LNK6 4B74A 1ZBQA 4XZ3A 1L3CA 1GTJ1 3IEKA 2CFOA 2F3QA 4WXEA 3P4YA 5CH5A 2QI9F 1HK7A 5KYUA 4ARVA 2D1RA 3SSAA 3HM2A 5BPFA 3AVXA 2JLQA 4GQAA 1JXQA 3HY4A 1N8SA 3KE9A 3OCUA 1OTYA 4IDEA 5TMBA 1VDZA 2C54A 2LE0A 3HCCA 3FMIA 5T41A 3TW0A 5JECA 2WJWA 1R16A 3ZV4A 4QYTA 1K3TA 5FUWA 1FJGB 2YVKA 1A77A 3CZCA 2I34A 1L8OA 2QUJA 1NVWQ 3CIOA 1IXRC 3IE2A 3K0BA 4O0MA 2CJFA 3RF7A 3GJSA 2M9MA 3SD7A 4DQUA 3IJEB 3LZCA 2ACKA 3KFXA 4DSOA 2ZYUX 1ZUWA 5FOWA 4GZ6A 4WN9A 1MH9A 3IDQA 3CHYA 4F71A 1JMKC 2WM9B 2IIBA 3PPYA 4MR7A 4TL8A 4U2EA 3E0XA 4QE3A 2HT1A 4HV4A 5DPMA 5M04A 1C29B 1U2ZA 3FTFA 2XVZA 1SBTA 1XDBA 3PQ8A 2GAJA 1E3MA 1AN9A 3GN2A 4AICA 5L8VA 4DR2B 3OECA 5ER9A 2ORIA 1YDWA 2Q4BA 2QVGA 5KTSA 1FW6A 4ZYUA 2PU5A 3IESA 3JWJA 3WGUA 1W1IA 2GM9A 1NAIA 3PC6A 2P7IA 3PVZA 3O2NA 1TC1A 1JEEA 3A04A 3ZCTA 1VHTA 3DTVB 3OOEA 3A6KA 3TZKA 4XJTA 4ZO7A 3NALA 3CCCA 1ULBA 6PFKA 1TZCA 1U28C 3O4GA 1MENA 1VG8A 2YR0A 4S2UA 3VO1A 2PWYA 3AWIA 2ZJ7A 2ZEJA 4LDZA 1LSSA 3EQZA 5B1HA 2ZI3A 4BX3A 4GVXA 1FP7A 4YVFA 3AUFA 1D6JA 1ZUIA 5FP0A 2J7PA 2ZRNA 2FG5A 2ZSUA 3VOBA 2QTAA 3U4AA 1GV1A 5HKAA 4DCNA 4Q3LA 3WIUA 2RGBA 3G0HA 2J6IA 4Q18A 1KI4A 4QECA 2OZLA 3GPIA 1JSZA 2P6UA 2PZ8A 4NENA 1N2BA 4KTTE 1VIAA 2Q3JA 4ZMSA 1JNXX 2JLYA 1WZ2A 2YZMA 5F2OA 1XSEA 1USWA 3PUVA 1TT5A 5DH9A 3ZNQA 4Y9TA 3LUGA 3DLBA 1P9RA 1SVKA 2Z30A 3GRKA 1CQIA 1D0SA 4M0KA 2OWEA 1LLDA 5HS6A 4DIOA 4F04A 1V41E 3UHPA 2PMFA 1SG0A 1SUDA 4H6XA 4N7BA 4KQWA 4Y18A 1OH8A 4BYMA 1J0BA 1Q0LA 3QI7A 4TSFA 1KP2A 2ZRGA 1UQTA 3RYCB 3AF2A 4PIPA 4QNNA 3VH1A 5LQNA 2B9EA 1E5LA 2QWXA 5GMOA 3HBNA 2V59A 3A4VA 4JS0A 2OLEA 3SBEA 3S5UA 3VPFA 4KR7A 1P1BA 3K35A 1DC6A 9GPBA 1LBEA 3C14C 3DZJA 4ZANA 4ETMA 3U7QB 3UMJA 1IZ7A 5BV8A 4DV4B 3UV3A 1KI7A 7ADHA 1PJCA 2OAP1 2A4KA 3B60A 3DBLB 4JCOA 3ZLUA 5IX8A 3BDIA 3C43A 4DM4A 5L6MB 2GTIA 3BRSA 5JJCA 4ZQCB 1B8UA 4D3SA 3GRRA 4HH4A 4PFSA 1MAWA 1IEXA 2ZRJA 5CM2Z 5MDHA 4P93A 5F7OA 1FTSA 1ODJA 4KN6A 4RPCA 4A2WA 2OP0A 1OAOA 2IELA 2REOA 1YBMA 2XXJA 1BNCA 1H65A 2HXGA 4GPD1 4F3YA 2JJ2D 2ASVA 1EWQA 3CZQA 1OC2A 4X3CA 4M38A 4EGQA 1RRMA 5JMOA 5JS6A 5JFOA 4CCYA 2V9PA 5B3JC 1TM2A 2C1EA 2IS1A 2O2HA 3TK1A 1U80A 1WZEA 3RGGA 2ZJZA 4TV9F 2O4CA 4MLPA 1YFZA 4Q3KA 3HE3A 1R8XA 1AURA 2C58A 4IGFA 4TS3A 4G37A 4EG7A 2VWGA 4YMVA 4G5OA 2VPZA 1Y4SA 4P81A 4Q4AA 3UMMA 4OXRA 5EMHA 1QDUA 2IBMA 2JCSA 4CGZA 1H8EA 3I01A 5T4HA 1GU1A 1E20A 1FMCA 1J23A 3FPKA 4G8JA 3RVQA 5A7FA 5C51B 2A9PA 3HQ4O 2HCJB 2WDPA 4JGIA 1DIBA 1OROA 4QGAA 3OUUA 4O63O 2O1WA 5K4AA 1YOBA 5EG5A 4MO2A 2WV9A 3SR3A 3T7TA 3AHIA 3P9NA 3R5TA 4G81A 1RADA 3VR1A 1K9SA 1KMMA 1NLFA 1UBKS 1RCFA 3X1KA 1PGQA 2RI6A 1LJLA 2REXB 1IPHA 1L4LA 2O1SA 4J07A 5CITA 5FWYA 2ODWA 4FWTA 1QPBA 5JCPA 1RMQA 4B6QA 5AVUA 1FZQA 2OMEA 2CNWA 1NSFA 3U0VA 2Y99A 3QKUA 1N34B 4KR2A 1KR5A 2Z5LA 4B17A 5K99A 5DIZA 2JLZA 1XTQA 1DBSA 1U8UA 2P2YA 2XNDD 2YXBA 1I2ZA 3BTSA 3JYQA 4YP0A 3WLQA 1AQYA 4RVUA 1NNLA 2P69A 4BMCA 5EA2A 3LX4A 3RQSA 3GIWA 5EE0A 4BQQA 4D9HA 4QULA 421PA 4GU5A 1ISMA 1RHUA 5AK0A 2BFEA 2ARKA 1P60A 5FJIA 4B3IA 5JSYA 2FW0A 3O4RA 3X1WA 1W581 3FWHA 1GKKA 3KQNA 3DEFA 4UM5A 4L73A 2GM5A 4MGZR 5KOJA 4HADA 4QUKA 2GNPA 5G4LA 5KSOA 3VYVA 3CVYA 3E23A 1NQOA 4EB6B 1F51E 3BVPA 1GA4A 3ESAA 4RD6A 3TNLA 3KNZA 3E8MA 2XODA 1GFWA 1W59A 1N7HA 2OV6A 3A9WA 4I5IA 4PC7A 2IL1A 5DI9A 1QFJA 1I8TA 3MJRA 4XVCA 5CB8A 5CK4A 3LF1A 5KYUB 3GGDA 2UUPA 3GRYA 4HTFA 4Z9XA 2C2GA 1TVEA 5FPSA 3M6IA 5L3QA 3MGAA 3U17A 1KR2A 1FYXA 4PVCA 4Y0VA 3MBIA 5T57A 5MGBA 4NL4H 4DIEA 2VJAA 3TKAA 5BMOA 1JZTA 1CUEA 1OU0A 2RBGA 3NS7A 2DECA 3L3BA 1E3DA 1VYVA 5JAOA 1AGNA 3V7YA 3CRNA 3MD9A 1RJGA 1FFCA 4TN1A 2FWRA 1EVJA 4TWIA 1JLMA 3KETA 5TIIA 4IJQA 2GQ0A 2WWHA 3QBJA 2OCGA 5M2QA 3QE2A 1XGKA 1A8QA 5TQ0B 4ZO4A 1KEKA 3IX7A 2ZUWA 2JAPA 2NVBA 4TN5A 4Y1FA 1RYHA 2P27A 1GLGA 2FEPA 1DZ3A 2OAQ1 3BMNB 1FFHA 2P62A 2W6ID 4IF6A 4QPPA 4ZAYA 3WZLA 2P30A 3MB5A 4GLLA 4MGKR 4NZYA 2D3WA 4GMGA 4RS3A 4MIYA 4P3OA 4QAJA 4C0KA 3NR2A 4R8SA 3WWYA 2YYYA 3BWVA 1P2SA 2I3AA 1I3NA 1GGVA 3GRAA 1XXHA 2VHTA 2EJTA 1SUEA 3HA2A 3OZSA 4FVTA 4WFQA 5E4TA 1I24A 2XCLA 2WJIA 3QLUC 2C2BA 4NATA 1X1RA 3LW8A 1IDOA 4DV7B 4CMEA 3CLHA 1BG6A 3KOWA 3QVMA 4FYMA 4NYMQ 3UUGA 2C2MA 2XIJA 1ZXLA 3AOEC 3D0OA 4HX5A 5GOZA 5JAUA 2ZANA 4OBEA 4ZOLA 1XDSA 2OV1A 1H0RA 3HKDA 4LDJA 3UJNA 3EXFA 1V43A 1V3QE 3GLHA 3K2QA 4KQIA 3LWZA 4MR8A 4MHOA 5DOVA 1FFSA 2NN3C 4UTNA 3HXQA 2PBFA 5D00A 4PGMA 1AZLA 4EVQA 3F74A 3ANNA 4C88A 3N2YA 2I3GA 4KIFA 1GGFA 3GLUA 3CMMA 2B4TO 3DL2A 1YAJA 2BVNA 4MA5A 3LC2O 3MXTA 2CD7A 3B8EA 1NF9A 1DWQA 2VBIA 4F6RA 2IHVA 3QELB 4L72A 4P4GA 3E4DA 3P1JA 2VC2B 3N07A 4GI5A 3N59A 2V8BA 2JGRA 3CWCA 1YI8A 1YS2X 3O26A 1FTQA 3T4EA 3KBOA 3LSTA 3RAPR 3DBRB 3T7JA 4KR6A 1P9OA 2PGLA 3EJ6A 2V97A 5IDVA 4ALIA 5CIYA 4FMCB 4I50A 3OKAA 2W2PA 2X40A 1C0IA 2QT9A 3M9XA 2ZWAA 1P1RA 1A7UA 1L5WA 1RM4A 2RGNA 3MWKA 5CNIA 4AAYA 1ZXBA 3AP1A 4IGEA 1U3DA 2VR1A 3A70A 4KE8A 4Y6OA 1VYHA 5B1DA 2P5UA 1PTJA 3R23A 1XLVA 3SQOA 1MX3A 2C4HA 2WFZA 1UP7A 1KF0A 3CKLA 3URKA 2HNBA 3X1JA 4A2PA 3ZIDA 1A2OA 4IHAA 2YDYA 4IXWA 5CURA 5I3CA 1IOLA 5JE8A 4FMCF 4IOMA 5C31A 2QMUA 3HNRA 2QSYA 4MS4B 2BR5A 1L5OA 4OEHA 1EVEA 3DDHA 1Q17A 5CCDA 5CXXA 3NBAA 4IDCA 4QTYA 3RTCA 1FYFA 1FNNA 2G83A 4XARA 4WEQA 5DISB 4AG6A 2FWPA 1IRXA 3HYSA 3V48A 2GN1A 2EIXA 1L5HA 4LX0A 2UZIR 3CLSC 2OC4A 5TPZD 4KG7A 3V1KA 1BW9A 1UT5A 3CZ9A 2RH9B 4ZVUA 5CEFA 2BJVA 1A27A 4Z86A 3BWMA 5D3KA 1JLLA 3E5MA 3OJOA 1MO5A 1ES9A 1JU3A 1U98A 2NT3A 3F49S 1GWNA 1W4CA 2RHJA 4XGIA 2CUZA 1V7PC 5H83A 1G8MA 4A2QA 3ZCUA 3O84A 1A9ZA 3KSRA 2JCXA 4JNCA 1NW5A 3FGOA 4EI9A 3KZXA 1L7PA 1MORA 1YL5A 2Q45A 4K6KA 2O4UX 3N0VA 5E9JA 3UXHA 4Z1MD 2I7DA 1GQOA 4S05A 1WL8A 4LNUB 1TW2A 2HF8A 2QMYA 3I39X 3LDUA 3W6OA 3UOAB 3G5LA 1ZUD1 4X1IA 3H8VA 4U0KA 4W5QA 2P35A 4OX9B 2HA6A 3ZXYA 5JH7F 1MEEA 3ZV5A 1G21A 1PJ4A 4HY3A 3QENA 3V2IA 5EEGA 5EXPA 2XMPA 4ILKA 3ZK8A 2FSFA 3RFXA 1VE1A 4KEAA 3OQVA 1JQAA 2XRFA 2HIMA 2RCYA 2RGXA 2PBRA 4HWTA 1YB7A 4PCAA 5LUBA 3ZU2A 5KNDH 5A03A 1SB9A 4PEVA 1WB5A 1UJ2A 4FSDA 1DAKA 1PS0A 2EWMA 3B6MA 4ND1A 3PPVA 1XTPA 2HCTA 5FBZA 3ZG6A 1RM0A 4GZ5A 1PGJA 3WL7A 3WMFA 1I1OA 5FNVA 1AZTA 3FPEA 1KQNA 2YNMD 4MUEA 2W2KA 4G0UA 1M34A 3HWRA 4IM7A 3W5UA 3PS9A 3TF5A 4OHVA 4DQLA 3DO8A 4C14A 4DJTA 2OESA 3NTQA 2UYOA 4O8ZA 1JXMA 1MN6A 2GEFA 2ESRA 2CXHA 2AX4A 1GJRA 3VPBA 1K8YB 5JJIA 1UMCA 3HVIA 2D2VA 3D3WB 3JW8A 4P35A 4QWWA 4UREA 4DRXB 3EPKA 2FMXA 4HNAB 4X92A 4EPVA 4G89A 1UKYA 2X8JB 4G1BA 5JMPA 1JDPA 4QJBA 4BWYA 3QWIA 3L84A 5F4ZA 3TTWA 5JSZA 1HQDA 1R9MA 1M34E 3NH6A 3UJPA 1I5OA 3ZW8A 2WZDA 1L4YA 2BHLA 3LCVB 3IH5A 2XE6A 2GERA 2GAIA 1G291 4H18A 1OFHA 3GLGA 4ZDIA 2RKBA 3VNVA 3RDPA 4QAQA 3T7RA 4QYSA 1JEJA 2PWPA 1II8A 2M6SA 4ICIA 4R40A 5HEKA 1K0FA 1V7ZA 3NYQA 4IIDA 1O0BA 4R2WA 1F5NA 4KPFC 1QRDA 4LSGA 1N32B 3AESA 1T9BA 1RT9A 5BY2A 1EK6A 3WBKA 4TTIA 1XAHA 1XZPA 2A2ZA 2WP0A 1F6DA 3EPRA 3PU6A 3N58A 3FDXA 4KSBA 5DX0A 2NSYA 5ICSA 4Y9SA 1YA6A 4I9GA 2BFFA 1PL8A 3CF4G 4P33A 4R9RA 4JB3A 5EWLB 4TPKA 3P96A 4ERXA 5F76A 2AOXA 4LF8B 5JQGB 2BGKA 5FTMA 3FKSD 3I05A 1F3LA 5NLLA 3UIEA 2Q6KA 4CQLB 3WMGA 1GZ3A 4JI5B 1KAOA 2LXNA 5JAZA 3GXOA 2JFWA 3AC0A 2WHXA 2YQ4A 4B2IA 4PYRA 3ZHCA 3PXBA 5CT4A 2BKUA 1T5OA 5CX4A 4KNYA 1A9PA 1P4SA 4HDCA 4P92A 4UAVA 2VFAA 2QRNA 1SQFA 1UPFA 4Q00A 4ZU3A 3A1CA 3V8RA 2R11A 3I2FA 3DMRA 3BT7A 3VRHA 5FBQB 1BXKA 2R7NA 1U0OC 3BTOA 2VXBA 4MLDA 1ZDMA 4FJ2A 3DWGA 5AJTA 5HCUA 3REFA 1F5SA 3GDHA 2D1QA 3K0FA 1G6OA 2Y3IA 4EG1A 2QTLA 4ON9A 4RSHA 5C8YA 3HUDA 3ORQA 1OKKD 3S70A 1UWKA 2CJWB 2P9BA 2YWRA 1N9ZA 3K72B 4Y67A 721PA 1UPUA 1IQPA 1Z75A 3N74A 1TD9A 3BD8A 3Q9UA 1DL5A 2QTNA 3FA2A 3KDPA 3VR6H 3PDIA 1CZUA 2PZLA 1WR8A 3SZMA 3AP2A 4OJKA 3CVJA 3O90A 4FU0A 4FM9A 2VI5A 3V9AA 3KLNA 4DCPA 2HNAA 3KT3A 4O1HA 4EHJA 4WKOA 4WJZA 3ROZA 2HIGA 1D09A 4QBIA 2BCJQ 3Q41A 1J2RA 4D57A 1AUQA 3M9WA 1JT2A 1SIWA 4JYPA 5TE9A 2CMFA 3ZU4A 4PCVA 2O57A 2VP5A 4CHGA 3KM0A 3MTJA 4ERNA 3SQLA 3U4IA 2B7BA 1NONA 4MSUA 4V1CA 3BICA 3GCDA 1TK2A 1FS6A 5DGDA 2VXOA 4NCIA 5LQDA 3QXXA 4ZRMA 1JR3E 4PVDA 1C3EA 1II9A 5EVJA 4ZI5A 1VHWA 1N9GB 4QEKA 5DTMA 2E6KA 3KYBA 4NWIA 4GO1A 1IWPB 3U7GA 1P74A 1AQNA 5CTAA 4HG2A 1KGDA 3F7NA 4YFVA 2Q6TA 4AK9A 3RFCA 1UMBB 4Z1OA 4CQJA 2I5PO 3FTCA 3IT3A 1M0SA 4BVFA 2IWRA 3R6GA 1CY6A 3C74A 5M3BA 1GQSA 1RPTA 3I6IA 4LGCA 2YW2A 3HUEA 4QOHA 4ZDKA 4W6ZA 2OA0A 2OZKA 2CW5A 3JSAA 4X8HA 4ZRNA 1AZSC 4AD8A 4OGFA 4OSOA 3ZKAA 1IRIA 4MV9A 2DULA 2PKWA 3H5LA 3AK4A 2BISA 5ULLA 3MJSA 4JYMA 5IDQA 4B3GA 3OP1A 4F38A 4DUZB 3QE0A 1E2EA 1XPJA 1ZJZA 2J31A 4TMVA 5IYZF 4HPWA 4DLKA 4Y30A 3IBGA 3WDSA 4U6NA 3EDCA 4F72A 3EGXB 1QX4A 1XK7A 4KRGA 2ECKA 1VIVA 5L3SA 4FX5A 3PTLA 3DOEA 4PZPA 4G4GA 3BXEA 3OE7A 2A0KA 4RESA 3TG8A 1KTIA 2P9CA 3QP9A 1T34A 4JNKA 4I9NA 4XGQA 5JXIA 3R0ZA 4NV3A 1J21A 2I2DA 4H31A 2BELA 1ZL0A 4Q9NA 5B1EA 5B4TA 4GBJA 5B36A 4YT8A 4HEA1 1Y5NA 1H4TA 4FFSA 2IUSA 4DIKA 1T29A 2HDNB 1Q74A 4BV9A 2JFFA 5ARBA 4QDKA 1ZSYA 2AS0A 1RBYA 1NIPA 2VOJA 3RU7A 4K2HA 4OSPA 2ZM5A 1JWAB 4TV8B 3N8DA 1Y8CA 2VPIA 4XCQA 1O5IA 1IK4A 3LQ2A 4G67A 4RDXA 1T9DA 2D13A 1XTJA 3D3NA 1R4MA 2GVDC 1FSSA 5CUQA 1TM3E 3F5DA 3E48A 3FFXA 3AM4A 2ZWVA 3N05A 5D1HA 2NSHA 1J2UA 1UK6A 1S8AA 1X9HA 2UUAB 4IJ6A 3EOBI 5C18A 1X77A 4TTVA 1KJYA 1OT3A 3H8SA 4OMFG 3L4JA 2R8ZA 2HX1A 3KB2A 4XW2A 2DTEA 1AUXA 4TXLA 5F9FA 1QYWA 4YJ3F 5E2BA 4PSUA 3PFIA 4BMOB 2QAIA 3SP1A 1A5ZA 3N0WA 2POQX 2X0IA 1RAAA 4JT9A 4I4IA 4BS9A 1NM5A 5C32A 1CPYA 3L6DA 2PT5A 2XUFA 3GYGA 3LVFO 1D2NA 3M9LA 1Q7GA 5IK2A 3I9FA 1OC4A 4O59O 8GPBA 4H0FA 5TJHA 2GJAA 3EA0A 3QOFA 2M6KA 3LRPA 4KJZA 4RA6B 3AEUA 3N7AA 1W2GA 2FMKA 4B4VA 2ETXA 1LI4A 4L9AA 5GGYA 2IDZA 1U1DA 5CD1A 2HBQA 4DV6B 4EI8A 5KAMA 3K0AB 3ZE6A 3KTAB 2CXRA 5DTRA 5JCJA 2FSVC 1T10A 2YOFA 3PGMA 4GAEA 4IMPA 5B1IA 1NY6A 1QFXA 2AFVA 1U1FA 1AIPA 1HRDA 3CTPA 4XM0A 4YMSA 1DIRA 1C3LA 4F5YA 2XB2A 4I55A 2GEDA 2O2EA 2ZIXB 1RC1A 1SQ6A 4YMIA 5F78A 2BEWB 2PAFA 3I2KA 4N5LA 4EW6A 3ZGXA 1NI3A 1DQRA 3NIBA 3HKBA 3L8ZA 3RFUA 5I4IA 5K0CA 5A0TA 2CNNA 4R1UA 4BLQA 2R1TA 4CV2A 1MAAA 3UK7A 1GSIA 1HNXB 4KREA 4E5SA 1CUFA 3H5AA 7GPBA 1QK3A 4MV8A 2PAAA 4Q15A 2O5CA 1WZIA 4IQ8A 4MPTA 4B6RA 2EU8A 2HDHA 3HFGA 5KSPA 3RHZA 3EZNA 4S2EA 2HJVA 4P7KA 5KIAA 1X87A 2XV1A 1KH3A 1ULZA 1XZJA 5CPBA 1V1RB 2FEKA 2CV0A 1LF0A 2V7VA 3BEDA 1EM8A 3MPOA 4MCIA 1RKQA 4P98A 3VR5A 1UBEA 2QMHA 5M34A 4OAOA 5IC4A 3IIMA 5JWHA 1XE3A 3WGOA 2QLTA 3RRZA 5L53A 2EOAA 1Z22A 3IVGA 1JKIA 3IMFA 3IAM1 3M6UA 2G82A 3CW9A 4L75A 4BQNA 3EAFA 4D9EA 2J3HA 1AQJA 4AUMA 3I9OA 4TL9A 5GINE 1GZDA 1USVA 5DXFA 4BNJA 4E3WA 3CH4B 3E22B 2XF8A 1GUZA 1PN3A 1EGHA 1O77A 3KKOA 2CHGA 4KVZA 3OPMA 2M98A 2V7EA 3LH5A 2EFGA 3ZDYB 1NJ8A 2F2TA 2IYEA 2P9EA 2BEKA 1J99A 3G2IA 1VXRA 4NK4A 3GEBA 4AUNA 2X0FA 4F2DA 1NL3A 2JI9A 3BXGA 1BH6A 3FTEA 1DJMA 3CH6A 3OQMA 3HO8A 3PX2A 1MG0A 3FYDA 4RPGA 4US0R 1E3WA 1JFFA 3QPDA 5IDYA 4Q82A 2IH5A 2HJ9A 4OOEA 3TZEA 4CI9A 1K2VN 1WBJB 3F90A 1L6IA 2QMQA 2UVDA 2IZ6A 5AMXA 3UZUA 3ZU3A 3BWEA 4JIMA 4LWPA 3G0DA 1RZVA 3FJYA 3PHHA 4M0DA 5AHWA 2HLDA 3DMHA 4YCMA 4DY4A 2P5SA 3S4YA 1W0KD 3KZ1E 3VAAA 2BZSA 3WGQA 3HUTA 1HNWB 5HBGA 1L5NA 3CLRC 1L7NA 5T7BA 1LTHR 5KJ6A 2HB6A 3P5BA 4B31A 4YV2A 3N75A 1LDMA 1AV6A 1NI4B 3KPYA 5EKSA 3D6VA 2GD1O 3OQOA 3AM1A 2L42A 3TJRA 5K3SA 1RP7A 3H99A 4OBWA 5GIOE 5H4HA 4NAHA 1H9CA 1L1QA 4INPA 3U3OA 1UJBA 1L5LA 2D7CA 3AF1A 1XU9A 1ACMA 3RTGA 1D5CA 4ND6A 4JEHA 4RDIA 3JARB 4AIIA 1KMHB 2JBAA 4UQOA 3ICCA 4RMGA 4WWHA 4JX9A 4RHXA 4E0BA 2YZKA 1SXJC 4CTJA 2K2WA 2ZS9A 5FLYA 3PRHA 4DRYA 5BNTA 4RC9A 2JAOA 2EFDB 4MKIA 3SXJA 5E6RB 4IL5A 2ZWOA 4ZOBA 1SAYA 1BFKA 2WU4A 1ZHHA 3FUCA 2GFHA 2BF4A 2E48A 3SKYA 2XZOA 4E1BA 1IBKB 3PC8C 2VF8A 1VPVA 1DEXA 2QUAA 3AVYA 3ANTA 5JOQA 4QDJA 4AIRA 3BCSA 3NUGA 3KXIA 5L3RA 3KQVA 3ZTWA 1EK5A 4DBLE 3QFHA 2ZSAA 3WLMA 6CHYA 5K0EA 1MFZA 3F78A 4JB8A 1HR0B 4LF9B 2GD6A 4G8DA 1U2GC 1C80A 2UKDA 2OBYA 2I6XA 3LGSA 4BMSA 3WV5A 4E4RA 2VA8A 1XDDA 3OZBA 4R2MA 1XZMA 3BKXA 5ICMA 2JG3A 5BMVA 2CHQA 4OI4A 1P2GA 4WKCA 2ZIUB 5EHQA 1S4QA 3WK5A 4Q3AA 3I12A 2Q5LA 2HXYA 1QVZA 1Z33A 4YRNA 5LMUB 1E60A 2ZI9A 5TEVA 3MMZA 3HXLA 4K0KB 3SJBA 1DARA 1IEQA 4M8IA 1LPBB 1IXKA 1OZAA 2BEVA 2BFBA 3R41A 4QBKA 4GZMA 4BVAA 3KL2A 3F4KA 4K05A 2IX3A 1QHSA 3VR4H 1AKRA 1XA4A 3B9QA 3BQNB 2D8AA 3IMEA 5AI0A 3ZE7A 3I4FA 1YK0A 2QP9X 3NWJA 1I3OA 4P4UA 1T8SA 2AF4C 3AR9A 5HVNA 1DU4A 1SKAA 3CIFA 3E3MA 2VJMA 3M7IA 4PLZA 3U4DA 1PZEA 2Z83A 5F35A 2EF1A 3OX2A 1KKLA 3WG9A 4C9BA 1EGVB 5IHXA 1PWXA 4HMOA 2D62A 4I1RA 3A32A 1QB8A 3HPRA 4BCCA 4CKCA 4YRKA 5KNBA 3LDFA 3TIVA 2F4NA 1WMBA 2RG7A 1BU5A 2V5AA 3B51X 5GAJA 3W90A 2VG8A 1RC8A 3H2KA 4MIOA 4RKYA 3ET4A 4J4HA 1TAQA 4O4IA 1M2FA 3CV3A 1LCIA 1PZNA 4UHCA 5CGZA 3RSCA 2RKWA 1EFVA 1VCIA 4DT1A 4OMUA 1G2IA 2AC4A 1R15A 2GZ2A 1IB0A 2H18A 4CIDA 2Q27A 3Q7PA 5BVHA 2L17A 3SMQA 4EGCB 2P2ZA 2PX4A 2P11A 1OX4A 1QH0A 2FEAA 3KSDO 3PZRA 4KIGA 3IJRA 4NCBA 3R1IA 4MUBA 1G3IA 4Z9AA 4M0MA 1R6BX 5B6IA 2EG9A 5HUJA 1W5EA 1QOZA 4GGOA 3CJQA 4D3XA 2QV7A 4QVIA 4BV2A 2OO7A 5IT4A 3OJ0A 1U4NA 1L7VC 2AFIA 3SIRA 2DHQA 3L46A 5IRCD 1PLKA 3ZZNA 5ETJA 1W0KA 4P08A 2C5SA 3ZWOA 4BKOA 1Z88A 5JCOC 1H93A 3MBOA 4OGKA 3FYUC 3QVVA 1UT8A 3H0EA 1CNFA 3BWCA 1R4NB 4G8BA 1YJ8A 3HMKA 4BRUA 1WOMA 3PWSA 4K9DA 4FLEA 5AKZA 4QGSA 4D96A 5CB4F 4B7ZA 1GL6A 4OI0A 2I2FA 2ZAIA 3SF0A 1WW8A 1U0HC 3IPRA 3ME5A 3JQEA 1VA4A 5EQTA 1WXIA 4HJRA 4FIZA 4BE9A 1L0BA 1DRKA 3WWDA 3PFBA 4RPJA 1TUEA 1NHGA 4M1YA 3PRYA 2HO4A 3EA4A 2DQYA 4AROA 4ND8A 3GLRA 3GLQA 4L8LA 2XUOA 1AU9A 1OASA 1EHCA 1D1SA 1GAWA 2W0MA 3HACA 1C81A 3C6XA 4FYWA 2LGJA 4M21A 1A9OA 2Z9DA 3Q7SA 4DMRA 1GY8A 1KZ6A 3FYUA 2V6JA 4QODA 3HXPA 2DPHA 3UWOA 3ZE0B 2WAXA 1P4AA 2GUGA 3EVBA 2CZQA 3AY7A 4QPDA 3UJBA 1RYEA 5EKUA 1QAMA 3UJCA 2ZXFA 1HE2A 2HPVA 2IHNA 4ZAXA 1Z2OX 1LDGA 3WRWA 2GMWA 4QM6A 2NUPB 4TTTS 3CRQA 1VLMA 1VCHA 1ZRMA 2DEUA 2GGSA 4ESOA 4C29A 4XDYA 3DOFA 2QBYA 3DLHA 1XZLA 1S02A 4FE3A 3SY8A 2FDCA 1TVMA 4CFYA 3FDJA 4TKVB 4KGXA 5LQRA 5FT9A 1LLFA 3UAXA 1G38A 5A2QA 2VJLA 3L0YA 2DHDA 2IYZA 3K53A 1X13A 2GN2A 4BV8A 5CFZA 2NU6B 4RNDB 3WO0A 3DVLA 1C0KA 1Y4AE 3WLIA 4DF3A 4KQEA 3H5OA 2FQ1A 2Z2ZA 3RNLA 4MA4A 4RULA 2ODTX 2PJDA 3C41J 3DF9A 4Q9AA 1KEZA 1Y8RB 3L40A 1BS9A 5CFMA 1M1NB 1I7PA 2Q5CA 3HYTA 4PV7A 2FDRA 1F17A 3NNDA 3Q3EA 2O2ZA 1EEHA 4HX9A 4XCVA 3H4MA 5EZ6B 5AKIA 4ID9A 4LX8A 1M76A 1UP6A 2F1HA 2PO7A 2Z2KA 1U0SY 1DLJA 2WSMA 4YRGA 3O9MA 4KYTA 3OQ1A 2CCKA 1DCMA 3Q8LA 2NO7A 1C9MA 1E3QA 5EAIA 1N7JA 1SUCA 4GI3A 3FOZA 3MRXA 4CV1A 4PLGA 3BA6A 4P0QB 1KQOA 1I9GA 5AUNB 3ZE8A 1T1EA 3TKYA 1VECA 2HCFA 3VZQA 4FDMA 5JR3A 1NQWA 4R81A 5FNZA 2UZAA 3EAQA 3PICA 1R0ZA 5JSFA 4F91B 3NRBA 2MYNA 1DT3A 4XB1A 4ASUD 4EA7A 1AK2A 4B6SA 2ZM6B 4W63A 4CV3A 1XTIA 3LUJA 3S6JA 3TAUA 4R5HA 5IWCA 3UUFA 3TD6A 3OH8A 2CNOA 4WBSA 5ERGB 3TOVA 4KZPA 4XDZA 4DQKA 1RU3A 4I1OA 5BSKA 2IKSA 5EJGA 4MVCA 5A05A 3VBEA 5HUHA 2WG0A 1QNLA 3CC8A 3OLQA 2PUGA 2GNAA 4JD5A 3ZHTA 1X8JA 3H42B 4JLNA 2IHJA 1A04A 1ESMA 3P4XA 3JQ8B 3HADA 5IC5A 2YC2C 4E46A 1UANA 1V5EA 1R0SA 3ETNA 4R2XA 4QT0A 3WIBA 3GJ3A 3WOHA 4CG2A 1IY2A 3ABZA 1P7ZA 2ZFUA 1AHIA 3ZWCA 1T6NA 1CRLA 4IO0A 2P2GA 4FBGA 2DE0X 1E2JA 3HSYA 3I04M 5E2IA 4MI1A 4CM3A 4OQDA 6GPBA 3TQCA 4BB6A 1U63A 4J0GA 3FPBA 4NOMA 5FO0A 2JB9A 1ZK2A 2LP4Y 3AI7A 1VSTA 3ONDA 4RZQA 3R3XA 1GQYA 2V98A 2HSDA 5A6VA 1N8KA 4F2WA 5DWDA 1LI7A 4HN4B 2I7VA 3QOXA 4MQLA 2NP6A 3DL7A 3EHDA 3QX3A 3T95A 1QU3A 2BP7B 3T52A 1HNNA 3UMCA 2MYPA 2QRUA 4IR7A 5AI8A 1NXOA 3IJ5A 3X1MA 1XUOA 1EFRA 2Y71A 5BPHA 5JROA 3I1FA 2JLSA 2C7GA 2V7PA 3CY6A 3OLWA 1YQ9A 5HZKA 2C00A 1CNEA 4ZVPA 3EGDA 3C6MA 3EQ9A 4MTCA 3TWOA 2VTEA 1J2TA 1V25A 2NXWA 3LQ1A 4IV5A 5J2TB 2P4UA 3R74A 5FV4A 2NU8B 5ELMA 4WRRA 1NUHA 2OCLA 3TFQA 4BAUA 2GRUA 2IU6A 4WZAB 1QHYA 3UXEA 2JLVA 1T0BA 5KWVA 3GYBA 2Z9CA 3A1SA 1PYDA 4D8XA 4CU5A 1YO6A 4E4YA 4F9EA 4MP8A 5BSEA 1E2BA 4TV8F 3WLAA 3DO6A 1ARZA 2QQ0A 1P5RA 2GRJA 2HAEA 1XWFA 5DNVA 1ZVVA 4M88A 4NCHA 4F7DA 1FRQA 3W7BA 3QSYA 3G68A 3IVXA 5KYKA 4DDKA 3D2LA 3OCYA 1WCIB 2AXNA 2EG5A 3KZKA 5TT1A 4Q66C 3T1OA 3IA2A 1D6MA 2VHYA 3RRYA 3WGZA 1SU6A 3IERA 5AM4A 4MRPA 4ACBA 3TQTA 5EMMA 4W1QA 4BNLA 4M9UA 5C3UA 1KEWA 1MRNA 2IHUA 2ZRHA 4EQ6A 4NRDA 4QU8A 3ZGVA 3RIGA 3DVAA 1POXA 2CEKA 1IWBB 1VKZA 2BP7A 4FNGA 4CRWB 1K27A 4KB5A 1K5DA 1QO9A 2IT1A 3E7DA 3S2YA 2IF2A 1LLQA 4NTZA 3LY8A 1L8AA 5EESA 5I8WA 2DR3A 1RWVA 5IAAA 2IEYA 1NW4A 1MVLA 3AOEA 1T9CA 3PQ3A 2GVZC 4MV7A 4DSZA 1X1CA 5GPBA 2ZS7A 2I22A 2MTBA 4OBBA 4E6PA 3JQ9C 4ZD6A 1Y1KE 3FMFA 4NBSA 1T9GR 3UWKA 4FFNA 4LF6B 2R8EA 5I9SA 1EP3B 2W2MA 4RL4A 4LOJA 1EM8B 1AT1A 2B36A 2BTEA 3F98A 5E6SA 3COYA 4RQBA 4LFCB 5EJ9A 3KXKA 2B1JA 3DVRX 2ZTHA 5FDFA 3HJTA 2ZU6A 4RMJA 4YRLA 3JQ8A 3GVIA 4IRMA 1Q0UA 3T35A 2CSXA 4EHKA 3PJDA 2HWUA 4X20A 3I3SR 1Q92A 4AN1A 4XUDA 4XJVA 3F2VA 1HEYA 3O4VA 4UUOA 5I01A 5IUJC 3NASA 2FY8A 4UZSA 3HKBB 1UBSB 1V8PA 2IYYA 4RKWA 3CISA 4PX2A 4G5FA 4NU5A 1GU7A 1SVMA 4U2DA 1CZNA 1QX3A 4BO6A 1J97A 1A9QA 4KXMA 3WLHA 3ZWDA 2BHTA 3DV2A 3DV9A 3TB6A 3JWPA 3I61A 3L7MA 3BERA 1IZ8A 1I3KA 1PVVA 5LCXA 3R3UA 2EYQA 2XUPA 2H1IA 3GQVA 4ZVTA 2R6ZA 3AFIA 2NYRA 1M66A 4NJMB 1J20A 1EP2B 2B3TA 2O6LA 5D6NA 4P2BA 4LSMA 4UMVA 4OHPA 5K0TA 4EF6A 3WY9A 4IIHA 1B3RA 2PKQO 3HB4X 1CE8B 1LBIA 1MQ9A 2C94A 2HWYA 3L8MA 3R0VA 4DCSA 4PRYA 4ZARA 3KSMA 3RI3A 1Z5ZA 1OFUA 2OE2A 3EVEA 1ZD4A 2EEZA 1YRHA 2ENWA 4BJ5A 5IKOA 4IJWA 1M1NA 1CVRA 3WB1A 3A9SA 3SOPA 3AZPA 5CVJA 2YVQA 3KX2A 4QOEA 4IUYA 4X20B 1RZRD 1ZEMA 1A98A 3ZWKA 4DHWA 1XYVA 5ECWA 3SYTA 4DJFC 3U44B 1DIGA 4A27A 2CNDA 3K30A 1Z5NA 1LTQA 4MNTA 1GAXA 4YHHB 1SQSA 3NBYC 1NBME 2CXXA 4Q4AB 2F3RA 3SR0A 2FLKA 3EMKA 1QHEA 2XQFA 4LJYA 5H7XA 5IULC 3DOIA 5EP4A 3V32A 3K70D 4DPMA 3LY9A 1T4BA 4MRNA 3BWXA 2AUMA 1P2UA 3EXG2 3AVTA 2O3TA 1GUFA 2ZIFA 4RLSA 3AM5A 3T3HA 4HNTA 3MS7A 3EEFA 1BTOA 1NLUA 4HAYA 2E2WA 6AT1A 1YUBA 1LSJA 3LVRE 5J2UB 2WJGA 1QGAA 1IBCA 4M9RA 4IUCS 1UXJA 1VKJA 2FG7C 3SLRA 5EP3A 2OK8A 1BOOA 3WYCA 2YNMA 4P0PB 5JPDA 3L92A 3LBNA 3ZHUA 1Y1SA 1ZNQO 4V38A 1X92A 2EW2A 2V7TA 1S1MA 1YULA 2XWPA 3HB9A 1RDFA 4NQZA 4OAPA 2G77B 3UAZA 3ZLTA 1MX1A 1XEXA 1P0QA 2DWUA 1KMNA 2BH9A 2WU3A 3EXG1 4N3CA 3QU5A 3TJMA 2VF7A 2FPIA 3IXMA 3WKDA 1KMQA 4LDPA 2F67A 2ZBEA 1XRJA 4JJEA 3EXFB 1Z2DA 1BROA 1F06A 1GUAA 1HFWA 3NHAA 4C2TA 4RHCA 1I6MA 4C76A 3IODA 4JODA 2D5AA 3W78A 1ISPA 4LJSA 2OECA 2B78A 3TQSA 5JSHA 4MKGA 5CYFA 4NDAA 2WF7A 5F4BA 2ES4A 4MPDA 2ISCA 1C2TA 2YJZA 3E9DA 5LU9A 2JFYA 3H9QA 4G9GA 3MK31 2IIVA 2N9UA 3OI7A 3FE2A 4Q02A 5A3QA 2JLRA 5ABPA 3Q4GA 4OP2A 3Q8XB 3IUSA 2JNWA 3FCXA 5FULA 1JYEA 3EEYA 2FPGB 4HQ0A 5KX5B 1RQ7A 3IIIA 1SHKA 3DFUA 3DFIA 4IO1A 1Z17A 5A1JA 2YIVX 4EMBA 3AV0B 3DVQX 3HXKA 1TM1E 1MLDA 1GV0A 4KDRA 3IAEA 3TR5A 5KWJA 3F6RA 1I2CA 1RFLA 3O3NB 4ROSA 4JP3A 5G1PA 4XPIA 3RYHB 1XMPA 1WSAA 2W48A 2NW6A 2VUUA 4DT1B 3BRWD 4ZYYA 2B0CA 3C70A 3N0XA 5BQXA 1XTTA 1W5TA 3DTVD 2CCGA 2J5QA 3UA3A 5KYYA 4LY9A 1PR5A 1Z63A 4DA6A 3OOWA 1M1YA 3QNMA 2YJTD 2BDTA 4TXMA 3WP0A 3VR6A 3EISA 2FN9A 5H4GA 1NVBA 2IBSA 1MAHA 1H3NA 1CJBA 3H4VA 4LHWA 2FUG1 5DHRA 5K0FA 4PRKA 2VWQA 5AVYA 1H2ZA 2QTVB 2IPAB 5T64A 1NBIA 4RJIA 3ROEA 4BQSA 4EY8A 2J59A 3BA1A 4M1OA 2YJGA 3QTBA 4KK4A 3RTEA 3C3PA 1RTKA 3B9BA 4BLPA 5FTWA 2JGDB 4L5IA 4QUAA 2O9JA 4ZQBA 3UH1A 2AN4A 4XJXA 5AKHA 4YRZA 3ICEA 5THXA 5GV7A 2C5EA 3SJZA 4CQMA 4KFRA 2EJWA 3LQKA 4EO7A 3HABA 1WXFA 4IGAA 4NECA 1PLJA 5BN4A 1MFPA 1JJIA 4IZOA 5L3VA 1R9JA 1GZ7A 2WSIA 3BMQA 4B3BA 2P1DA 4QDOA 1SUWA 1Z2PX 5IF3A 1QZ3A 2PANA 2WAOA 2YV3A 5DLYA 1KEEA 1EUYA 2QVXX 2VH1A 4KE9A 2DM6A 2C0PA 4GDMA 2PX5A 2O7NA 3WGLA 1X19A 3QPVA 1P3JA 1TYZA 5JRDS 3NKLA 3KDAA 3AHFA 4TRJA 2R6GA 1SHUX 3AGQA 3HJAA 1FDWA 1DQPA 1FXSA 1KO1A 2H92A 2VUHB 3C45A 1KRHA 3GF4A 1NUTA 1Z34A 1FFWA 3LWBA 5DBHX 4BFZA 1WKCA 5M29A 1NRWA 3MLEA 3F47A 3I52A 1SRQA 3C6BA 1SCJA 3GRCA 1LPAB 1Q3TA 1BGWA 4P3NA 4TL7A 4HGYA 1KY2A 1SURA 2EX0A 4RFVA 1G5FA 3ZY3A 4XRRA 4Z7QB 2EKZA 3B7PA 5EINA 2WG2A 3LA6A 1QK5A 4X5OA 3LBHA 3KAQA 3E15A 2VRCD 3ZOKA 5I7VA 3UA4A 5A9RA 4PR0A 2NO9A 4CTKA 2X19A 1FU4A 3TXXA 3WTCA 3A2KA 1KSHA 1LA2A 1O8BA 2HEIA 1TJNA 2I55A 4O4JA 3QXGA 3GU3A 4QWMA 2VF2A 2YMMA 4Q3CA 5GOTA 5CBPB 2XYPA 2RGWA 3EGIA 1ZO8A 3P27A 5G4KA 4TX1A 3B1FA 1Z4PX 4N9WA 2KB0A 4REOA 1SD5A 3MHPA 1DBVO 1Z4OA 2P67A 4L50A 5IDWA 1EDBA 2Q5IA 2VATA 5I9IA 2P7HA 4MPRA 5K01A 5AM3A 1UOEA 2X8JA 1WUHS 3PJEA 1WDTA 2PRSA 3R7WA 1KSFX 2P90A 4LG1A 1IY8A 2Y6UA 3MM4A 3CCBA 1Q0QA 4RUKA 5JNRA 3LCJA 1I4LD 1Q2UA 2IW3A 4S1TA 1ZMOA 4UHHA 1QVAA 4IG4A 1E8NA 1SRRA 4XOIA 4B8ZA 2C2HA 2VKQA 3EHEA 4JYCA 4AT1A 2D1YA 4DWVA 5CFQA 3LZ6A 5I9TA 2XKBA 1M33A 3VH3A 4K28A 2IYXA 3R24A 4RTOA 1JTEA 1ORRA 1M74A 4YRJA 1ORVA 1GPH1 1WRBA 3MWLA 4KMSA 1H05A 4BNDA 4JB0A 1RQPA 1N2OA 1JPUA 4B44A 1EIZA 1F2UA 2O8VA 3N2NA 2XEDA 1MJNA 2O2YA 2LVBA 4ZCSA 3FCAA 4EIWA 1JA9A 4DTCA 3VHRA 4AF6A 5JSUA 4HH1A 2IEGA 1Q83A 4MW7A 4ZCLA 4AZVA 1EMDA 1IBRA 2J6CA 2JIPA 1OILA 2SKDA 3LU1A 2JVIA 3Q8WA 3S7ZA 3R9WA 4CFSA 4E13A 4UHBA 2J0QA 1YZNA 2HYIC 3KIPA 4MWEA 4O2AA 1NZJA 5CD9A 3PEYA 4B34A 5K4HA 4WOPA 2E49A 1Z47A 1QIGA 1CU1A 2FX5A 4MJLA 3W2IA 3FLAA 4RHEA 2C9CA 1KORA 4D0NA 2JGKA 4B3RB 2WNSA 1A8IA 1WLYA 2B83A 4C3ZA 3FOCA 1E0KA 4AS1A 1U0RA 4GOMD 3SX2A 1H85A 1EJ6A 3FVWA 2DR0A 3W8FA 1G9SA 4I46A 4DM3A 5FTLA 4EYQA 2C78A 5LA6F 3U9SA 2ZJ3A 1AG9A 1SXIA 2E37A 4NFYA 1LW6E 2BOVA 2B21A 3WK4A 5L9AA 4FN5A 1FY2A 4WERA 3B5JA 4IFIA 1W1WA 4GGMX 3VC2A 2GEUA 2Z4RA 3ND6A 4BX2A 3BRQA 3IMKA 2QTHA 3MHTA 1GLVA 2WTXA 4IDFA 5K2MA 3VXKA 4MS3B 3TO5A 3T3PB 4OFBA 1MTZA 5DEOA 5CVUA 4NV0A 4C06A 4G5YA 1YZGA 1B6RA 1U0EA 4JI7B 2HBZA 1BGXT 1EWYA 1QNFA 3WLNA 4LZWA 1VSBA 1CCWA 3KQSA 1KBOA 3FYCA 1NXVA 1FXWA 3RS4A 4ZZIA 2Q0SA 3AI1A 4BKPA 1XRMA 2XDAA 3E03A 3IHLA 4BBAA 3TL3A 4O4IB 4Q1AA 5FPPA 4EF4A 3KZVA 3VC7A 4HEA6 3K6SA 1RIFA 3BWDD 1VL8A 4C7OB 4IXMA 5TQ2B 5F2EA 1G17A 1NP7A 5JLAA 1JB1A 2J0VA 1VJDA 1ZQ9A 2HK8A 3A2MA 1O6ZA 5H3LA 1AHPA 5IBCA 1PJ2A 2A7QA 2NGRA 4AMYA 1FDSA 3T9EA 1DBIA 3EGVA 3PUYA 5AYVA 4Y3UA 8LDHA 2Z6AA 1GUBA 3PXCX 1NWCA 3QKWA 4CT4B 4BTEA 3OEHA 3ERCA 5BSRA 4TKUB 4D4MA 2R84A 1NDUA 5DWQA 1Z5OA 2BEVB 2J5RA 1FQOA 3KOOA 2PPLA 1U65A 2VLIA 3OO1A 4O4HB 5AXBA 4R8KA 3I72A 4IWXA 1OBCA 5LP1A 2VRNA 1OAAA 3AUAA 2AR7A 3QH4A 2IU3A 1AOXA 2Z8XA 3QBEA 3QOYA 3QVGB 5EXEA 2W6JD 3KV1A 2ROQA 5H81A 5TF4A 3CUVA 1OKKA 3WK8A 1V48A 2AOWA 3FFWA 3RTBA 2GRAA 2IYPA 1JDSA 5FWNA 1J49A 4RJTA 2W6JA 4D9NA 4U5XA 4XSGA 3PFKA 2FZWA 3H4TA 2HU5A 3RC9A 5DRTA 3K9BA 5T4EA 2I8LA 3S29A 3H11A 4BO7A 1SBCA 4PYNA 3HYNA 3G82C 2BKAA 5JISA 2ZAGA 3AR8A 3DV0A 3WRXA 3ZE1B 4DUGA 2R60A 2XWSA 1O2DA 3G0IA 2VYCA 1M7HA 3AETA 3BIWA 3KQYA 3FDFA 4X1KA 3RE1A 3LW7A 2J1LA 2Q6LA 1T2FA 1IZYA 3IHWA 2IY9A 4BE7B 1Z6ZA 2XITA 4G56A 1T26A 4R2KA 3UAVA 4Q1CA 5F3WB 4WXHA 2QSZA 3HZHA 4YMHA 3S68A 4OSEA 1PR3A 2GBLC 2OHXA 3KKZA 2FW6A 1B8PA 2JZCA 1FYEA 1KY3A 2ZIZA 3JQBA 1R4ZA 3WMEA 3ENQA 4RGYA 2QL9A 1C50A 3AEQA 1LGYA 1N2EA 3DTNA 2EFJA 5FTJA 3CW8X 4UUNA 2VZ0A 2Y0BA 2B5VA 3ZGLA 3QFCA 1U2DA 1J2JA 5HR5A 4UBKA 1UEJA 1Z74A 4P4TA 4CIWA 4YUVA 5J4YA 2BMAA 5DLEA 1SVNA 1W4BA 4KTVE 3GEDA 1D8TA 1NFQA 3C7CB 3PSAA 1NU8A 5GONA 5LLDA 1IULA 3USCS 2AN1A 4HLUC 2XLBA 3DZHA 1EBFA 2RHCA 3H0KA 4I9HA 4OFWA 5HS4A 1ZI9A 4DMHA 4TXNA 4Z8XA 3FSGA 2EEPA 3FPSA 2BJWA 4RPIA 1M6WA 3J7TA 5KPJA 2WHEA 3LF2A 3PDJA 1NPYA 1TYCA 1YBHA 2WTBA 2QOEA 1WXQA 2PKXA 3PDHA 1KI9A 2EWVA 4J6EA 3Q10A 3ZWPA 1IQUA 1RM3A 3TQQA 2XY4A 2R5NA 3BF7A 5BR7A 1B6GA 1JAHA 1XKTA 2YFHA 4D4IA 1G19A 4WDQA 1ESZA 4N47A 3A26A 2JIQA 1Z25A 2H2DA 2GZHA 2V45A 1C5KA 4NPCA 1QMPA 5MFZA 4E08A 2JCYA 1U0JA 1Y5LA 4A6EA 4B6JA 4RACA 5EHXA 4G63A 4YY3B 2GSWA 3COPA 2XX3A 3O5AA 1XFDA 1NVXQ 2V8OA 1N0WA 1OWMA 1Z18A 3D4NA 4G24A 4RH3A 3THRA 4J76A 5DW0A 2WFMA 1GT6A 1Y42X 4R69A 4IG9A 4R8LA 2EXXA 3FLEA 2NZ8A 1EUDA 2AEFA 2G0NA 4G5RA 3D4PA 1YIDA 4LHEA 3KT0A 3TOZA 2AJCA 4U7TB 2QDKA 4MQ4A 3VTKA 4RMNA 1PV1A 1T15A 3KV3O 4GEKA 4QOSA 3Q40A 3DNPA 5BN3A 2B7CA 3UJHA 2W8ZA 3SPXA 3I2HA 4B4KA 5C81A 3BB1A 3O4JA 1X38A 3HUFA 3GR6A 4N0QA 2DRIA 2FSSA 2W83A 5HDQA 4TYWA 5JPIA 3KUXA 4DLTA 3QMMA 4LYJA 1O9GA 2QTCA 2E4VA 1RXVA 4XFKA 4OLAA 2MJLA 3JQDA 1UBCA 2OVBA 4GT1A 3MOGA 4AG5A 4Q6WA 2NZXA 5IVKA 2ZBFA 3K94A 4BFSA 4XPIB 3X1YA 2FKAA 3OT1B 4QUHA 1I1HA 4RF3A 5TS3A 2XZLA 2ZT7A 5ALEA 1OPRA 5LP6B 4ABTA 3T5CA 4DS3A 1GNTA 2P75A 4IJVA 4H4EA 1HDRA 2FMFA 3B6ZA 4R1MA 4W5NA 4GKBA 4OQPA 1TEZA 2Q1UA 1WD5A 3IDOA 2DB3A 2V6GA 4OI1A 1JIJA 1QB7A 1RLUA 3FN4A 3D3QA 4I55B 3LY5A 5FOTA 2IP1A 5L95A 3GI1A 3HDJA 3C3MA 1Y7LA 1G8PA 5FUYA 2P2DA 1TKBA 4BV3A 1W25A 3DKRA 2APJA 2XUJA 6REQA 1FP2A 1KPHA 1NVDA 3ETLA 1E3SA 4RF4A 4CLDA 1COWA 5C52B 3JQGB 3PHLA 4I4CA 5AUQA 3U62A 3EVAA 4D5EA 2IITA 3VA7A 1PKEA 1VI5A 3LSYA 1VE5A 1XZNA 2RGGA 1OV4A 1YDEA 2PYZA 3AP3A 2IYFA 1D2RA 1NKSA 4JJFA 4MITA 4F3CA 5CH3A 2D5CA 4ZVSA 4O2AB 3IO3A 2CXOA 3ZIAD 4MZXA 4N18A 3PDWA 1U3VA 1W85B 5KNBH 4JR1A 2NZJA 1YQTA 3IRVA 3TPFA 5JALA 4IAOA 3WYGA 1XVVA 2JJYA 2A1TS 1H2WA 2EJUA 3HBMA 2QRLA 1NULA 3JCZA 1ORDA 2XQJA 4FQ7A 4WNYA 3V9PA 3I5YA 2WLTA 4LOHA 4EFNA 5AJZA 3H2YA 1WMEA 1WCXA 3DE1X 9ATCA 1GZ6A 2QENA 4Y98A 5KTKA 4JWTA 3ZHOA 4EDFA 1KXJA 4K9PA 5DM1A 1G63A 3EVGA 3EUWA 4QZVA 2FEMA 1ZK0A 2PGOA 4FEEA 1TUGA 5EJFA 3EG9B 4WCFC 4Q3DA 1O0SA 1P2TA 2Q0XA 3QYPA 1N77A 1ZGCA 1OTHA 3ASZA 3JRXA 4DC1A 4BMZA 1UADA 2O5VA 3DOHA 1GNQA 1RIIA 1DO8A 2GBIA 2ZCVA 5ENVA 4MRAA 5EJ5A 4ZDJA 2O8BA 3E5HA 4A1FA 1TX4B 1MDBA 3MQ4A 4INOA 1GGHA 2IYRA 2OCYC 4PQFA 1BEEA 2VQSA 4UPDA 3VZPA 1ZBDA 2EWWA 4ZVQA 4E3ZA 1YWGO 2RCNA 1VSQA 4HGOA 3UGKA 5LWHA 2GLUA 1H42A 4FR5A 1QV9A 3K0HA 3OFSA 3RM3A 4AQ7A 1E5TA 3U61B 3D5EA 2FXIA 5JNLA 1NNUA 2OFPA 3JQPA 3TDMA 2G07A 2NV6A 1HV8A 1ZVQA 1WE2A 1P7CA 4YRDA 1MBZA 3W4IA 3ZZTA 2C9MA 4AJNA 5FR2A 1GZUA 3CSDA 3DE2X 3L7DA 2B30A 1CDZA 3ET5A 3DOUA 1EDEA 4M9XA 1E2UA 3ZCXA 4X84A 4ZAVA 3UGQA 5JWRA 3ISVA 3NM4A 4X1YA 1RI2A 3EMDA 2P40A 1KY5A 3FNFA 1UJMA 4QPZA 2PK3A 2RAUA 2D5BA 3MSCA 1Y3AA 1LX6A 1P62B 3GFGA 4A6DA 2CV2A 1UOQA 4WJLA 2FPOA 2VAWA 3PWZA 3ZZUA 4UUMA 2C4UA 1KP9A 3SAJA 5B37A 3F1KA 1RWPA 1Y8QA 2BZGA 1TJ3A 3OCVA 5E9QA 1HL3A 1ZIPA 1UBOS 2NTVA 3MF4A 4XD2A 3GCXA 4BKMA 1FW8A 2VJQA 5ICGA 3EPLA 3NIDB 1E1RD 4RABA 3GJ6A 3O95A 3UPUA 2XUHA 4JI8B 1V7CA 2C2XA 4OMCA 4X54A 4FTWA 1JEYA 2EZUA 4TM7A 3KZOA 2CXQA 4B87A 4UVEA 3QXJA 1XZCA 1BH2A 4H6PA 1P5JA 2XE4A 2NXEA 3VPGA 1JLKA 4CKCB 3NNSA 2JC3A 1UAYA 5JT1A 4J9UE 2YS7A 3FD8A 4I8IA 3RVBA 4OLHA 4CKWB 4ZMBA 1MC5A 4ES6A 4RQTA 2BEJA 4C4SA 2LDBA 4HYTA 1T2VA 2OK7A 2PA3A 3TOXA 2XBUA 2YV2A 3QFFA 4O4IF 2CMDA 2R62A 2O5EA 3H2IA 1YRBA 1Z7WA 2XECA 4WLUA 1AX9A 2PQ6A 4QBTA 3P9KA 5GONF 1K7YA 3MGKA 5ERXA 2D74A 3MUEA 3L1KA 1WM1A 3QFRA 4MCJA 5EL0A 3GUYA 3TTTA 4X3OA 3AFGA 2BBOA 5EWJA 2A5JA 3DWEX 1E6UA 1SGWA 1H5UA 2GXQA 4G0OA 3QJYA 1WB9A 3BFPA 3WS7A 1ZL2A 1VBFA 4XQEA 1N4DA 1U0TA 4XWKA 3U1TA 2GK4A 4ZI2A 4PYIA 4G07A 2QX7A 3SDSA 5CDHA 2MT9A 1GSAA 3HCRA 4PX9A 1KKUA 2DCUA 1PQWA 3RVKA 3WDLA 4BAZA 4AYWA 5FPKA 3LKZA 7AT1A 1N6LA 1KMHA 4HFJA 3H5VA 2J3JA 1R50A 2MMCA 4L4UA 5CBKA 2F43B 1EWKA 1Y37A 2H7YA 5IVIA 3V1YA 5BV1A 2IPOA 1Y1QA 2C88A 2CNLA 2IUEA 3GDWA 3SOZA 1HYBA 4Y9DA 1BJKA 1N8NA 3FCYA 3T3MB 3BIXA 2OB2A 1S8NA 4L4YA 3RPEA 2WICA 4B6FA 4ZI3A 5AW1A 5LJLA 1E3JA 1S2NA 2ZPAA 3PFNA 1PE0A 2QTZA 1FSZA 3BILA 4Q19A 4OK3A 5K51A 1HE3A 4MA0A 1ZNXA 5IANA 1WMFA 4HRXA 1R74A 1ZNWA 2ZVDA 3OM1A 2JH9A 5JNVA 1GR1A 4XDHA 3ZD8A 4DYVA 2C8VA 2HR1A 1XD2A 2CXPA 2WU1A 4E5KA 5TNXA 5J2TA 1Z0DA 2PWBA 1JE0A 1EAMA 1NT4A 4OBXA 5G1OA 4FHFA 1ZEJA 4AO6A 1SPBS 2W00A 4HNRA 4ZOAA 4F1JA 3N53A 2KLBA 3UAGA 4YFYA 1W34A 4XIYA 3TRIA 3NGLA 5K8VA 4JUBA 4M37A 2ACVA 5H9WA 1E3WB 4E5PA 5IABA 4ZI7B 1YV9A 3GLGB 3OIWA 1SVLA 3GBVA 5A5EA 2GD0A 3IUNA 3L0PA 1P0CA 2BGTA 2OQIA 3FDZB 3U5ZB 1QIIA 2OGZA 4GPEA 4PZUA 3RS0A 2PUAA 1SC4A 4JJ4A 3SC4A 2V7UA 1QH1B 1KAMA 3I3OA 1FFYA 3UHFA 1DBRA 3C3EA 4W7SA 3VR6D 5LN1A 2JLBA 2CF6A 2WVHA 2OYSA 2IIPA 3RREA 4PZDA 1TZKA 1N0IA 1VLLA 5EWMB 4ER7A 1K5GA 3SNHA 1YDFA 1P5HA 3JQ7A 1WHTB 2FP3A 2QXTA 4J6FA 5AOVA 5G0UA 1FXWF 4ER5A 2X1HA 4K1LA 4J1QA 4TZKA 3L06A 1G3QA 2R00A 2XGGA 2V7WA 3M5DA 1UK8A 4L57A 1MQAA 5KPDA 1GA6A 2D7DA 5K3FB 4FDAA 2TMDA 1BWRA 4YC7A 1J0DA 3WNDA 3LCMA 3BZBA 3DNMA 2P4EA 3FX2A 3JQAA 5FUBA 4MWSA 3V1MA 4DKXA 3DE5X 4PX3A 5AICA 1H4VB 1AXEA 3O9ZA 4MHTA 1AKEA 4YJHB 4E31A 2IXFA 3QUTA 4HN9A 4KAXA 4G8CA 3AI3A 2F8MA 4WKGA 2GLXA 2QPOA 4V0RA 5K2OA 4WPGA 1J0XO 4O5AA 1KZGB 3K05A 3U7FB 3TSWA 2OKCA 3ZD6A 1M1UA 1N1DA 2J46A 3DGEC 1R88A 1KWKA 3UOGA 2I66A 2Z95A 1R6UA 3MJVA 1W5BA 1BW9B 4PF1A 3H2BA 2Y1KA 4IDHA 5GM2A 1UJ5A 4X94A 4DM7A 1Y7PA 3UXMA 1KHTA 3HPQA 4R2LA 2JBHA 5A02A 1ORWA 3EZ6A 4YMGA 2XADA 1NQAO 1SHZA 3RU3A 3WYNA 1XXLA 3F6BX 3VM6A 1G6KA 2C5FA 4JBYA 2GJ8A 5JNWA 3IUQA 3L8YA 2CXUA 1QLWA 1M8PA 2YX1A 2FU5C 1IUNA 4KDCA 3RF6A 3WICA 2I87A 3L7AA 1T35A 4IDAA 1ZM7A 1OJLA 3EXHA 3SJCA 2ZE5A 2ZSEA 1EWTA 4RMHA 3RNOA 1HH4A 3W9SA 3LX5A 1Y5IA 4P3YA 4EG3A 2XCRB 4CCSA 1YNSA 1E2KA 3EEQA 3CLSD 1L7XA 1J4AA 3HKCB 1C8KA 3RRNA 4DG9A 2H1CA 2I6GA 2SCUB 3CN9A 4IDNA 1FTNA 3CEMA 1SU7A 3UB2A 4Z3DA 2Y1GA 2Q3BA 2R48A 3L0ZA 2YIJA 4HO1X 4EA8A 2I1LA 4YLGA 4J2HA 4MQUA 1ZD8A 2NXJA 5EHIA 1VJTA 1T36A 5EHGA 1P1JA 5EXXA 5AK6A 2ATIA 2IVZA 3SF8A 5DBOA 1P1CA 2O1XA 5D85A 2O8FB 4EQ6B 4JQZA 3I62A 2VP2A 4I19A 5FHRA 5ITVA 1TCBA 1XHLA 4E88A 1Z0SA 3EXAA 5IDXA 1YVUA 3K5HA 3NHUA 3A27A 4D6PA 4XB6B 2F9FA 4WDRA 4YRAA 4QFMA 5CLQA 4ZAGA 4NC9A 1XAIA 2PGAA 4MOWA 4ENVA 5HKKD 1NE2A 4UBMA 3GNLA 2G9VA 2FUEA 1Y8ZA 3PFHA 4QTZA 821PA 1XMSA 3TSOA 3WISA 3GDGA 2PL5A 4FWBA 3G1TA 3OMLA 4G25A 5L40A 2FEWB 2V4ZA 2ONKA 4BO8A 1FTWA 4UNPA 2QK4A 3HLKA 4PC2A 3WGVA 1WZUA 1V26A 1NF3A 5COBA 4MZDA 4B2YA 4EOGA 1DC7A 2YY6A 4UVDA 2ZR0A 2IXBA 1C14A 2WJJA 4NICA 3SX4A 3H8JA 1NZFA 1MC4A 1VE7A 2Q6OA 3QLEA 3E1GA 4LY6A 5BSFA 1EK0A 1ZHOA 1K6XA 1OUMA 2Q4DA 1E1QD 3ZDQA 3OZWA 2OCKA 3UWMA 3RS3A 2YNMC 1I80A 5KHOC 4KYIB 5FL7D 4KITB 4LDQA 1RXYA 1I1QB 2I6FA 2X41A 3LXRA 1B93A 4OJNA 3E6AA 4R54A 1N5OX 5EJMA 3R7WB 4D02A 1WZCA 3LX6A 4L8FA 2ZYAA 2VCEA 3BCRA 1OWNA 1T2UA 2IYQA 3D8NA 4LQDA 4JJKA 2C5BA 2P9HA 4HVLA 2CN1