1IHPA

Structure of phosphomonoesterase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
438
structure length
434
Chain Sequence
SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHYTASE
publication title Crystal structure of phytase from Aspergillus ficuum at 2.5 A resolution.
pubmed doi rcsb
molecule tags Phosphomonoesterase
total genus 149
structure length 434
sequence length 438
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1997-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ihpA01
2BIFA 1V37A 2IKQA 3K4QA 2HPAA 3PGMA 4ODIA 1FZTA 1YJXA 3IT3A 4HBZA 3KKKA 4JOBA 1TIPA 3FDZA 4FDTA 4IJ6A 3O0TA 4JOCA 3R7AA 1SK8A 2P9FA 1T8PA 3E9EA 1RIIA 2DWPA 2HIAA 2P78A 2WNIA 1QHFA 3D8HA 3GW8A 3K4PA 3HJGA 1ND6A 1BIFA 3GP5A 4AROA 1SKAA 3FDZB 4FDUA 4EO9A 5CU7A 5AJWA 3QPUA 4QIHA 3LL4A 2YN2A 1DKQA 1QFXA 2YN0A 3MBKA 2F90A 5AJVB 5CX4A 3QPVA 5AJZA 4D4MA 4PGMA 2PA0A 1E59A 3C7TA 3IT0A 1DKMA 1DKPA 1BQ3A 4E3WA 2P30A 3IT2A 2OWEA 2P75A 1C80A 2H52A 3QPWA 1UJCA 2EKZA 2P6OA 3LG2A 3EZNA 3BIFA 3F3KA 3DCYA 4ARSA 2EKBA 2WNHA 1E58A 2H4XA 2I1VB 2P9ZA 3ZHCA 2WU0A 3LNTA 4ARVA 2H4ZA 1C7ZA 3F2IA 4PZ9A 1ND5A 2P77A 5CDHA 3DB1A 4D4JA 3FJYA 4MA4A 4D4LA 1QWOA 5AK0A 4ARUA 1BQ4A 1V7QA 1XQ9A 4IJ5A 1SKBA 5HTKA 3EOZA 5PGMA 1EBBA 2ENWA 3GP3A 4GPIB 3IT1A 3NFYA 2ENUA 4PZAA 1RPAA 2EOAA 1DKOA 3E9CA 3D6AA 2P2YA 5AJYA 3MXOA 1DKNA 4GPZA 2HHJA 1SK9A 2P9YA 1DKLA 2QNIA 1YFKA 3OI7A 1UJBA 4JODA 1IHPA 2P6MA 4EMBA 1RPTA 2P2ZA 2A6PA 2RFLA 3NTLA 4D4KA 2AXNA 3E9DA 2OWDA 2P79A 1FBTA 1H2EA 1K6MA 1NT4A 1C81A 2GFIA 2H0QA 5HR5A 3D4IA 5AJXA 1CVIA 2DWOA 4TSRA 1H2FA 2A9JA
chains in the Genus database with same CATH superfamily
2IW1A 3CZ4A 3NBMA 4GDMA 1FK8A 3AV3A 5EUCA 4E2XA 1K3FA 3CNLA 1J2EA 2BZ0A 1Z35A 1NVAA 2FP4B 4UQOA 1GPNA 3CKKA 3ESCA 4LCEA 1C0EA 2A3NA 2QUHA 3OCXA 4FMBB 4B3TB 2YJNA 4D9GA 1E1MA 3OURA 3T99A 3VR6A 1RXWA 2GCEA 2N1MA 3T9BA 4OXIA 1DIHA 5K20A 3OD5A 4HDSA 2IBMA 1WLYA 3BE8A 3L6DA 2GJAA 3IA7A 1AKEA 2GI4A 2GPTA 3FNGA 1E2IA 3W3AA 2PR2A 4ON9A 3HDYA 4JYBA 3C41J 4PLTA 4UUNA 2O8NA 1GTJ1 5B1YA 4LKRA 3GN1A 2OD2A 4Q9AA 3UYKA 4R3UC 1SQ6A 2H5IA 2ZUVA 1SIUA 4LMRA 1AMNA 1QLJA 4Z9AA 5C7YA 3NC0C 2QVGA 3OEEA 1WZEA 3BWBA 1P2BA 3CEPB 3PHHA 4DJDC 1O96B 4D3YA 4E03A 1Y1LA 3SHVA 2CB9A 2DBRA 4M4SA 2JLUA 3GJ0A 2B8WA 4ZKEA 2D54A 4KJXA 4YGXB 1KYXA 5CCDA 4QO7A 5H83A 1P9OA 2HRZA 3A26A 3E23A 2Y1WA 2QTAA 4DWVA 4KB5A 4I9FA 4BAZA 1NFRA 4M0PA 4M36A 1TW2A 1YS2X 4DJAA 5FEUA 5DSTA 2HKIA 2JJ2A 3GJ4A 1DUVG 3L07A 4M7RA 2EBHX 1ODJA 3SQNA 1O6ZA 4AJNA 1Z33A 3O5AA 3BQ9A 5A71A 4LTMA 2BKLA 2QMEA 5TPZA 1PR0A 1E7QA 5BSGA 1QX4A 3FHCB 4DDKA 1G60A 1NNUA 4LOIA 1S8FA 3RT9A 4MI6A 2WPDA 2XOKD 4WN3A 1ZWKA 1YQDA 1LLUA 1GGVA 2VG8A 4Q9JA 3DDHA 5CIYA 4REOA 3U7QA 1ZEJA 1RC0A 2WABA 4B34A 1BE1A 5EUQB 3WNQA 2H1FA 3OQIB 3KKPA 3Q1KA 5DLPA 2VLBA 4C07A 2VF2A 4QJBA 4FHGA 4K26A 4C4SA 4LY6A 3QF4B 3AVUA 1PTJC 2ZIXB 1GNRA 3I53A 4LQLA 2QD5A 4E46A 3P32A 2BTEA 1K5DA 2FRDC 1EBBA 1QGDA 3S3TA 4K6MA 3WGHA 5B64A 4EF5A 2YV3A 5JS2A 1HR0B 2YFKA 3TZBA 4TWBA 1NJGA 1JWBB 4WNAB 1RM0A 4R9VA 421PA 1Q0LA 3NUQA 5L53A 3JWHA 3WIOA 2D0DA 4LVUA 1XD2A 1WUHS 2DFTA 1Z3IX 2WTEA 3EGDA 2VQDA 4TVOA 3JQGB 3DP7A 4KSCA 2P2CA 1KJNA 3VVMA 2GA9A 1LA2A 2VAXA 1AXRA 1DUIA 3VUFA 1IBMB 2GAAA 3OLQA 1U8UA 1ISHA 3FCAA 2H8GA 4NAUA 1JQLB 2H2GA 5CVJA 1KDVA 3T5BA 2PUBA 3A04A 1WU7A 3RADC 2I99A 4P35A 1FDUA 1U0EA 2XH8A 2Y92A 4UHHA 4ZYLA 5JJ5A 3IUBA 1RPTA 2QJWA 3FUXA 1JDVA 2OXIA 1E1RA 4K9PA 3W7AA 4O5AA 4Q48A 4Y18A 5GGXA 3V80A 4OB7A 3E2IA 4LHEA 5A4IS 1DLJA 1MGPA 4MW1A 5DBOA 3SC2A 2XCQA 2XT0A 2REQB 4BJ5A 3V55A 2EKQA 4WLFA 4BGUA 4E07A 1HE5A 3EEFA 3QSYA 1H42A 1T34A 3FYUB 4I50A 1SGWA 2C7VA 3EDRA 5JS7A 2WI8A 2PX4A 3EXHC 1A8SA 4LK2A 3DMGA 3DM5A 5C52B 3CMCO 4ODIA 3RSLA 3T4EA 1KI3A 3A70A 4GOLD 4TS9A 4DYVA 4ZT3A 1IVYA 2BD0A 2JIRA 2TS1A 2XAUA 3FKQA 1R0KA 3KUXA 1RYDA 1WQ4A 2WFAA 3PHBE 1YDGA 1Y7LA 3ESZA 5J4KA 1RAHA 2AZDA 4D9KA 1EM8B 2D13A 3NP7A 2X5OA 5KYYB 3PNQA 2KYRA 3BCHA 3H2GA 1M33A 4F5EA 3DSRA 2RK4A 5B30A 1CDEA 3DAGA 1UKEA 2D2VA 1FMFA 4XDHA 1G1AA 3RO7A 1WXQA 2HEIA 2XMQA 3UVEA 1PZFA 2ZUWA 3INNA 1HNXB 3ONWA 3SC4A 3FPFA 3C4VA 4JA0A 1ECGA 3KXIA 3Q5EA 1TM4E 3I01A 3MOIA 3CRMA 2QPTA 3H9CA 4PYQA 221PA 4ADSG 3FZYA 3OPYB 5HZKA 2LD4A 1SHZA 3O26A 1BXKA 1I2CA 1NW4A 2AGVA 2JFWA 2ZDHA 4DMCA 4TUYB 1MNQA 4CKWA 2OD9A 3NVDA 2GZ3A 2D00A 2WC1A 2WSMA 4L08A 4PIMA 3WMRA 3IXLA 3U3XA 3RGGA 4RY0A 4JL6A 5AM1A 1PF7E 1YI8A 2RGEA 4QO8A 1BDIA 3JQAB 2VHYA 4CLHA 4DM4A 1Z56C 1ZNZA 1BTOA 4ND7A 2RI0A 2WZQA 2RGUA 3HO8A 2QT0A 3ENNA 5BV8A 5GZ3A 1YU9A 4QDUA 1PFGA 4RD2A 5DBIA 1JIVA 2WKPA 2EQ5A 3KTOA 2ZM5A 4ZAZA 3C6KA 1C8KA 3E9YA 5E2BA 4KO2S 3TNLA 1GGKA 2OAP1 4WN9A 5EE9A 3AQ4A 3ZDYB 2IZ1A 4S0ZA 1L5RA 3I01M 4PGAA 1RLIA 3NT4A 1QRUA 3DDWA 5IABA 2J41A 2DY0A 3LX6A 3BH7A 3HCRA 4K86A 2O5CA 3PGLA 3MT7A 4X1IA 1UM9B 1PJ4A 3RSOA 2GPBA 3U3JA 1RZUA 3A4IA 5EE5B 5HDQA 5ULLA 2ORYA 3BRWD 2IDMA 1VBKA 3NWOA 4UVGA 4N5LA 2K2QB 4MV4A 4F6CA 2O4UX 3PB3A 1N1DA 4DUYB 2QJRA 3BDVA 1TF5A 2VHZA 5LN1A 4QBHA 4C6HA 2AG8A 1YQQA 4PQRA 2I4TA 3H16A 1DEOA 2XSZA 5ALJA 1I32A 1NM5C 1U1EA 2WKQA 5AK5A 4B2LA 1KOGA 3L1IA 1SK9A 2O50A 4WXMA 2C5BA 4KN8A 2CNOA 4JT2A 3E1GA 1UPAA 2GM4A 1CYEA 1CUCA 1SM4A 3A1WA 4K3UA 1MBZA 3GLTA 5AI8A 2AOUB 4U6QA 2GEJA 1YKFA 2YWXA 4BXOB 1A1SA 2CXTA 1GGNA 5IUKC 3AEQB 1SA0B 2WA1A 2WT9A 3IELA 5ALOA 4EW6A 4F85A 4KQ1A 5FLYA 3FFWA 4MWTA 3TTYA 4P5PA 3TLZA 2WUDA 2Y76A 4PQEA 4AWBA 1OTHA 1ECJA 3QITA 1SXJE 1GGFA 2C2ZA 2CK3D 3ZDEA 1XVTA 1IYZA 1TJPB 5E0KB 1MB4A 5SICE 1I30A 2ZJ6A 1SXIA 2VUSA 2W00A 1T8TA 2XUGA 3TOVA 5AW4A 1TCVA 4O3MA 4QUJA 3JQFA 3HYTA 1I0ZA 3OPNA 5F98A 3IR6A 3AVPA 3DBHB 4B3CA 2ZE6A 4OYHA 3L92A 3G2NA 4ALJA 2O2ZA 4U7GA 2IZ5A 1RC8A 5KNBA 4ZZ3A 1E2JA 1GG8A 4UHDA 4BOYA 4BO7A 2LP4Y 1N0VC 3DVRX 3L5KA 3OMLA 2ZYGA 5LWQA 4ZC8A 1LXCA 4WV3A 1WS6A 3O9ZA 3H65A 3OFNA 4QQNA 2ZR7A 3PQCA 4TS4A 2ZPTX 5D3KA 1XFDA 2UYHA 3P9PA 3NAZA 3KJNA 1ODKA 5LYJA 4ZI3A 1UWCA 3THRA 1YB5A 3LGXA 4GR9A 4CVNA 3N2YA 4G5GA 4MUEA 4MWEA 1Q0UA 4UVEA 1MIOB 2PWYA 1DAEA 3BXZA 3HQ4O 3KBOA 2WJAA 4XEHA 2JIZD 3B3GA 3NONA 4KQ6A 3G2JA 1G8GA 1GDDA 3W5JA 5BSFA 5AVVA 3UPTA 2IPLA 4MR8A 1PW7A 1C29B 4MIEA 3TLJA 3WKBA 1A50B 4ZHQB 4QU9A 2AMVA 1B8OA 1JLSA 2V6IA 3OTGA 1EVQA 3KL2A 2QRUA 4GOND 3M2PA 4EA6A 4J16C 3CE9A 3E3MA 3ZCXA 5JEDA 1IZ7A 2P4HX 1MIHA 4NMMA 4PG5A 2Q9BA 1YJBA 1RU3A 1TD1A 3F3KA 4R8KA 2Z4TA 1HK7A 2WG2A 2CJWA 1TCCA 2QTVB 1OASA 3CT4A 2Q29A 4I4LA 1Y5LA 1FJ2A 3BSFA 2E9SA 4CV1A 1PVDA 3Q8LA 4JX8A 1BEUB 5JNVA 2AE2A 4FMDF 3H04A 3QYFA 4IJQA 4JJGA 3ZE1B 1ISRA 1DBWA 2C61A 1VRWA 2IHBA 3GCGA 2O8DB 2F59A 1M2KA 2AHRA 3BG5A 3O82A 4O4HF 4NH0A 4OJKA 2Q45A 2Q5LA 1XQ1A 4PC2A 4QU8A 3V8QA 4E5KA 4N48A 4OGKA 4PCVA 3UFBA 2QRJA 1AUQA 4B48A 1MMFB 4C9BA 3MTBA 3QLUC 2XVAA 4IOJA 4MS3B 5C34B 4PO3X 3ZD8A 1SIOA 2HZBA 2REXB 1E6LA 4C43A 1VMDA 3BKWA 2QEQA 5IXJA 5BSVA 1FRNA 1TM1E 4QUAA 1X7WA 3FCOA 3I12A 4Q7LA 5BUQA 4HTAA 5A3RA 2PKCA 1CY2A 4ZOLB 3ANNA 3QYAA 4JT4A 2I22A 2M6KA 4CL2A 1Z47A 1PDWA 1XQ6A 3DLTA 5L4LA 3GN2A 5BYBA 4ZYUA 1N25A 3FJOA 1TQ4A 3B36A 3KTFA 4XB1A 5A9TA 3F0TA 1Z5WA 5F2OA 5B6JA 1P6QA 3RS8A 8AT1A 1NVBA 3U4AA 1E98A 2O7RA 4DG9A 3OM9A 3BE5A 4EJSC 4MCIA 1EK5A 2W6OA 2ZSIA 4F4HA 3S0JA 1RW4A 1ZU4A 5AVTA 4FHEA 4KFSA 2WSSD 2ZTSA 4WK4B 4ZTZB 3SFZA 4I5EA 3WA7A 4LDQA 1CSEE 5DM70 1W36C 4KR9A 3E3OA 4OGLA 3WL5A 4P4TA 2PXXA 4MUKA 5AKKA 5DSZA 1TZJA 2GVNA 1MG0A 1L6IA 1UIMA 2FSGA 3E81A 1I4WA 4ZO6A 5A7GA 5K8IA 1C9JA 2XIQA 3L4EA 1SUCA 2H7YA 5E0OA 1BMDA 3ONDA 3TSAA 3LXUX 3VZQA 4CM8B 4EITA 4BNMA 3ZI0A 4QE3A 2B61A 3ROXA 4MS1B 3ZWNA 5IJ9B 3DOFA 3IQFA 4KMSA 1M7BA 3T5TA 3H2ZA 3H8WA 4QXPA 1JHVA 4FQ5A 1YH3A 1WA5A 4Q4JB 2WJGA 3PTAA 1EINA 2CNNA 1TPZA 2AMFA 1DAPA 2P0EA 3IUEA 3NBYC 1WRBA 1V4VA 3RS5A 2NXCA 3RDPA 2O0JA 5FTNA 3IPYA 1GY8A 5K7SA 4JEMA 1FUYB 1SCDA 3EDMA 4H18A 3SZLA 3EXAA 3IP6A 3MVEA 1ORRA 1R16A 3JWIA 4HEQA 4X63A 4LF6B 3V7WA 4KHPB 2PXAA 2OXRA 3MSXA 1S8AA 3WO0A 4JXXA 2G77B 1V47A 2DPXA 5ITZB 1W4RA 3A2LA 1YJ5A 3HHEA 4NPHA 4IDNA 1AC5A 1OPRA 2HA5A 3FBGA 4YJFB 3UJ6A 1E7MA 3CLSC 4LZPA 5K0NA 3OJOA 4E09A 3CJTA 3SDSA 4MR7A 3GBVA 5E38A 1F17A 2PH7A 3I32A 3AOEA 2A94A 4Y2SA 1Y9DA 2XGMA 3MUOA 1H4VB 3JX9A 3R76A 4KLAA 5CMLA 2ABWA 1NZDA 1XJQA 2WIJA 3DAOA 4IP0A 1C7ZA 2IV2X 5WRFA 3RVPA 3ZGLA 5KX5A 3TJRA 1GQOA 1NHWA 1TC1A 1YACA 5CA0B 3I0ZA 4CLRA 3QLJA 3PKIA 1NNEA 3MD9A 2ZAGA 4Z1MD 3UANA 2DLCX 1QMPA 1PL7A 1I8TA 4Y9DA 2X40A 3IKJA 4P7FA 2GZ2A 1HA3A 1ZUNA 4YAIA 4ZI2A 2GD6A 4AKGA 3RYTC 2B3DA 3IVCA 3GEDA 4Q3AA 4S1WA 1CZRA 1UEXC 4FR5A 1Y8RA 2ERYA 4M1OA 4R8RA 4NCHA 2WWYA 3WQHA 1ONSA 3JQ6A 5CFPA 2W6JA 3ZLJA 5F33A 3HP4A 4ZJYA 2XBLA 2RGCA 5KYUB 1G16A 3AP3A 3UICA 4EM6A 1G20A 2NN3C 1PYDA 1VBMA 1R88A 2WP8J 1O6GA 4B2IA 3CSUA 5BMVA 1EWQA 4WJZA 3KAPA 2XCRB 3TTSA 3GK3A 3M5WA 5A05A 1ZMRA 4RJIA 4DQVA 2GCOA 1YMQA 2G0TA 3ZK8A 3RYCB 4I55B 2P9YA 2B5VA 5HQJA 2CNKA 3WWCA 1I94B 2RCNA 3ESDA 4ZGGA 1BXGB 2OGUA 3LVFO 3DTVD 4FCVA 1XWFA 4C6TB 1LUAA 3E0XA 2HSWA 4Y3UA 3W8RA 1V5IA 2ZAYA 4NYJQ 2G40A 3ZQ6A 1V2GA 3R20A 2F9FA 2PZJA 2A0UA 5E7QA 4OG2A 1I51A 1VHTA 1QO0D 1FFCA 3RS4A 1WZCA 1E3LA 1A2BA 4Q34A 4Q05A 1Y8QA 2JJMA 3ME5A 4CLXA 3VU8A 2JGIA 2WLSA 1L8QA 2QXUA 4MI9A 3AWIA 4C2AA 5C2JB 5DHPA 5BV0A 3OWOA 4IO1A 1CTQA 3BL8A 1IM8A 3CLKA 4RQTA 3U49A 2I5PO 2NP7A 4H15A 3H3FA 5ADVA 2QM7A 3STHA 4LJ6A 1K4KA 4YJ3B 1FNSA 5I9TA 1T6ZA 3FUWA 3GLSA 1FB5A 4WKCA 1CJBA 4CNQA 2FSIA 2OQ2A 4N3AA 2HHAA 3NTQA 3W0LB 3OE4A 5MGNA 4EGSA 3ESAA 1EB8A 1V11B 2HMSA 2WV9A 1M8GA 2VP9A 1GR0A 3OO1A 3RS0A 1KARA 2VJOA 2PUFA 3G89A 3H3XA 3CVWA 1NXSA 1FSGA 5DYNA 2X2FA 3PJRA 3IQGX 5IMSA 5G3ZA 3IURA 1DIBA 4BVKA 3IAEA 1JG1A 1W46A 1C4OA 1KZYC 2OG2A 2ISQA 3N5KA 5BW6B 1N92A 2NYRA 5LFAA 4R1NA 1TCBA 2OHIA 3TX6A 2B30A 3TYXA 1A5ZA 2NYVA 2R2AA 3AEUB 2A9OA 4XI9A 3AR2A 1U99A 2W2MA 4LWOA 3CW2A 1EDEA 3K15A 3H87A 4H1WA 1E92A 4C4TA 5IP5A 4L4SA 1IHUA 1H0RA 1Q14A 3F7MA 3HXOA 1DRWA 4ZJUA 3NDBB 1OXMA 3A27A 5EPUA 2UUBB 1GU0A 1J0AA 5F77A 4WI1A 5K3AA 4BVJA 2ZI7A 2JLRA 1G3RA 3L01A 4PLFA 2R8EA 2B9VA 3T3IA 3HXTA 4I5IA 4YO8A 5DGHA 3ZYCA 5KQPA 4EHDA 2PZGA 3DE7X 4GD3Q 1LPOA 2Q1YA 3G9QA 2PZEA 1QM5A 2XYRA 3W1VA 4BUCA 2QTBA 1QFSA 1V3QE 3IP7A 1POWA 1S2IA 2JK1A 1ZM4A 2XWQA 4TWAA 4JBHA 4JKOA 3BBPA 2HSDA 3GEMA 2W6IA 4IQ8A 1YS7A 2DFPA 2BKUA 5HJEA 1HZZC 1QQBA 3F7NA 4Q7MB 4Q4DA 1ZMTA 1WF3A 3IP1A 4OP1A 3SJCA 3BC1A 3O73A 2Y1EA 2O54A 1Z16A 3ND6A 4ND8A 1A2OA 1N0WA 2AX4A 3EWIA 4RWZA 4AJ4A 5J63A 3V8PA 1EQUA 1V9LA 1XZEA 2F1IA 1TYDE 2ZTLA 3VSDA 3ANXA 3N07A 3C6BA 3RG2A 2RARA 5CB6A 4PQYA 3VR5H 1YE3A 1PSWA 4O0MA 4CMHA 1XZBA 5A1TA 1H3FA 2C4UA 2TMGA 3M6MD 4IZOA 4NTZA 3SYNA 3UH1A 4EPYA 4MUAA 1ZD5A 5EP2A 3NC1C 4TKVA 5JR3A 5BP7A 4BQPA 5BN3B 1P5ZB 2KS6A 2MU1A 4I1OA 3VU9A 4DR1B 1JA0A 1R0ZA 1H94A 1EZ1A 1XTKA 2JFNA 1IC6A 2LPMA 4GVXA 3PJEA 4UUPA 3WOHA 4RXUA 1SOMA 3KTDA 2B20A 2H3HA 3OY7A 2AZTA 3PQFA 1WB4A 4R71A 4QVKA 5FL3A 5FBVB 2EYQA 1Y7TA 3IODA 3IX7A 3C6MA 3K53A 1OUMA 1ZGAA 1BJTA 1TKCA 4BNDA 1O8CA 5CBPA 1YNSA 3U7EB 2AXNA 5ERYA 4NNPA 1UDBA 4FYVA 4MO2A 4MICA 3T0FA 4C5AA 3HXPA 4M7OA 4EW3A 2G6TA 3QYPA 3TUJC 1JDBC 1OI7A 1QDUA 2QZ4A 1M3SA 1UBMS 3EXG2 2JAUA 3HKCA 3I42A 4KTVE 4L1KA 1H2FA 5L3SB 4EGFA 1ZVMA 4HT3B 2OGWA 3ROZA 3UA3A 1EFPB 4F92B 1XKLA 4NCBA 2D06A 4JFAA 3UBMA 2JVIA 4NCXA 2V96A 2XTNA 2O7QA 5EERA 1PZNA 3ITKA 4RGQA 3KVOA 3EIQA 3OJ0A 4QWMA 1RJFA 1MH1A 1ST2A 3AUXA 1ZH4A 1R74A 4UQLA 4FLMA 1HI9A 2FDCA 3U40A 1XNHA 1QVAA 2QT1A 1JPVA 5JSKA 2QY6A 4DYDA 2QN3A 4G4IA 3V4ZA 3EAQA 2J31A 3DCIA 2ODTX 4JS0A 4YN3A 1ZMOA 5LA6A 2OYCA 2AYXA 4QIHA 4Y6SA 2HU7A 3OZTA 4MWSA 4LNUA 3GNSA 3Q41A 3RFTA 2YVQA 3CONA 5ALSA 4MYCA 4OQNA 2C2YA 4KCGA 4D0LB 4UDOA 4XM1A 2ODBA 3TWOA 5BUSA 2QQGA 3LBAA 4YRFA 1MRNA 3ABRB 4YDRA 1ONNA 4YBRA 4Z0PA 3TG8A 2JFPA 1T4BA 1P9LA 2P9JA 2J30A 4UOEA 1VLZA 4YJHB 4C0QC 2DX7A 4NBKA 3AJEA 3Q7EA 4DUGA 1KP9A 2XUDA 1NBIA 4KDFA 2AOTA 4LE2A 2WDPA 2XHZA 3EVTA 2WTAA 3VPXA 2C9YA 1KRHA 3BB4A 3EIEA 3GIWA 3U1TA 2IW3A 4I36A 1DIRA 2Q8PA 5GP1A 1AN0A 2JHPA 2RKWA 2P8JA 5FR1A 4YGYA 5BW8A 1UOOA 1ZJ4A 4ZP1A 2XMPA 4ETWA 2XGOA 4RDCA 3SE0A 2IE0A 3E1KA 4LXHA 3W78A 1BCRA 2PN1A 3ET4A 1IQPA 4D79A 3B5EA 4CIYA 4KIUA 3QHPA 4UMEA 2IXEA 2TRSB 4ZA2A 1U3VA 5AD1A 1RWQA 3OD1A 2C4VA 3E0QA 3PUHA 4QX6A 5K0GA 4I5GA 1Y4AE 1QYRA 1W4LA 3LT5A 3BMCA 2LDXA 4H7EA 1UJ5A 2OGTA 3ADCA 2CLDX 3CGWA 1T3ZA 4EX6A 3DB2A 1KYWA 2VKQA 5IKPA 1XCPA 3PUWA 5AVKA 3ASYA 3DVQX 3GF4A 5AKJA 2IOFK 1J33A 1K3UB 2AE1A 4XSGA 3UGTA 3KQHA 3DEFA 3CB2A 5BWBA 3M33A 4D1YA 4D02A 1DKNA 4IZHA 2EW8A 3T38A 3D6UA 1OTYA 1T2EA 3UMGA 1WZ2A 2HWWA 2QRPA 3ASUA 2BBTA 1LDBA 1Z8DA 1HDRA 3H9QA 1KMHB 2DT8A 3MIZA 4INAA 3RK1A 3ADBA 3UMYA 1J42A 3AM3A 3R5TA 3VM6A 4QQRA 2PRJA 2LKCA 4DLWA 5BVGB 4BMSA 5DNDA 4UUBA 3CNOA 3X3HA 3KFVA 2OBBA 1JHPA 3EPRA 3DZIA 3BHMA 2Q28A 4J07A 1ONBA 2JD0A 1GL7A 2GFIA 3VZDA 4CYMA 1C4WA 1XXLA 1FUUA 1N2JA 2C8KA 1JNXX 4ENRA 3CIFA 2WOJA 2FOIA 3E7DA 4PCAA 2PUGA 3GEIA 1VM6A 2CCGA 1C3VA 1XRRA 2WDZA 4S35A 1SC6A 4KGVA 1E3DA 3X1MA 2YVUA 1AUPA 5BNWA 4CETA 4UHEA 1WXGA 2JEZA 3FWKA 3VR4A 2OOKA 3IP5A 1OROA 2VHUA 3ADOA 3EF0A 4B4WA 5CCEA 2CXNA 4ZN6A 2BE9A 4N1AA 3LUCA 1HYGA 4TVKA 3GVXA 1PGNA 2Y4OA 3NIGB 3I61A 3AFMA 1WCWA 1RKVA 2H65A 2YV1A 4D26A 5J2TB 1LY1A 3W8NA 1L4FA 3PVCA 3TLGA 1MJFA 4LZAA 3D6JA 4X92A 1QR2A 4DVJA 2HDHA 3HJGA 4YRLA 2JLYA 3FMVA 4JGBA 4KQKA 3GRCA 1XOIA 1K68A 4G5SA 3VPGA 4BBJA 1KIFA 1YVPA 2Q7XA 3G2QA 4F3RA 1X42A 2YASA 4BNFA 4EVSA 4B3DA 1Z2NX 4LRYA 2XE4A 3PSHA 4GX5A 4QSHA 3NW9A 3WKDA 5KVCA 3IDZA 1Z7GA 1FLDA 1GZ6A 1UZUA 1LPSA 2AXQA 1NMEA 5IFLA 1OE0A 5E9JA 3DDCA 5JXHA 3U5TA 2JIDA 2YL2A 4ZYZA 2C2OA 3C45A 3FFXA 4R0VA 4C2BA 5EWJA 1VE5A 4V0RA 2YWGA 3H99A 1A77A 1F3LA 4WY5A 3T15A 2C7QA 3P9SA 2HNAA 3CKLA 4WIAA 1MX3A 2RC6A 4BVFA 4DZTA 3V5NA 3S7ZA 5HYVA 4Z3KA 2CWWA 3PEUA 4K8OA 4JD5A 2XY4A 3LNTA 3P2YA 1ZEMA 3SJZA 1M1YE 5U4XA 3ZQ4A 5KCZA 3DWIA 2VWPA 1W25A 4IVRA 4RA9B 4TZTA 5JSQA 1CUDA 3L0SA 1KJIA 1EVJA 3F9IA 4EAQA 2CSXA 2ET6A 4FE3A 4CCWA 4NOLA 1OIVA 2QJTA 5CEJA 4IVNA 1DAIA 4O8CA 5BMVF 4BCCA 4MWZA 3QIVA 1V5WA 1UBRS 1XWIA 4RD4A 4HCJA 4NHEA 2FEWB 3G8BA 5IVHA 3QU5A 4M9UA 5TVGA 3RIGA 1U98A 4IIHA 3NC4A 1N5OX 2W2OA 2YJ4A 4JASB 1R9NA 4ROSA 1CRLA 2FWAA 3BD8A 1DJMA 1KRWA 3VJRA 5CNJA 4GUAA 2LXNA 4DIFA 3VVBA 1N57A 4IVPA 1AV6A 3K5IA 3D1JA 4RFLA 1VFNA 3MOGA 4X24A 2R48A 5DXAA 3O2SB 4DBLE 4GPAA 4Z3DA 5AW1A 4IF6A 4LSZA 1GCGA 3HPRA 2JK0A 3GJ5A 2W93A 3O03A 4ZVSA 5LQRA 2JJYA 3VOBA 5B3LA 1JR3D 3JALB 3NOVA 1SG6A 9LDTA 2C77A 2VXBA 3K9CA 2W9XA 1IHYA 4JVOA 1UAGA 2VUUA 3F3YA 1R6TA 3TFQA 3FUTA 4F1JA 4FLEA 1QPZA 2Q8QA 1AD2A 3CSSA 3INRA 4C4OA 3D8BA 3Q6IA 4DIKA 2FWBA 1Q91A 4FZJA 4D45A 3GGDA 3W6ZA 5GJVC 2XDWA 3HB9A 1Z5ZA 1G21B 2O3SA 4GOKA 4MTLA 4QTYA 3OCVA 4OF4A 4BQFA 1HT2E 2CHUA 1GXSB 1RI5A 3T06B 4IMRA 5A4FS 4ARIA 4IIEA 1JQKA 3OIVA 1OXBB 4LJSA 1T9GS 3LUDA 3I9NA 2BKVA 4HGYA 1SCUB 1U4SA 4JMLA 2X2OA 1NWCA 1ISGA 2GHQA 2FDXA 2KE5A 1LNZA 2QN1A 1E1CB 3FPSA 3PGMA 4YDSA 4PR0A 3DGEC 1BU5A 1OH5A 3RV3A 1BDJA 2NO9A 4HRXA 4KIWA 4UD2A 3MWEB 4DL9A 1DINA 3WLAA 1G8SA 4DA9A 4LF9B 3I9V6 3WNCA 2I6TA 3S44A 2CVOA 2VF4X 3M89A 1GNLA 4PWYA 1J99A 3PL1A 2D5LA 3R0IA 2RHOA 4FDVA 2J07A 3R3XA 4JP1A 4U8HA 4D25A 4YECA 3WAJA 3JSAA 5T3YA 1SEPA 1NVVR 2ZQ5A 3BAZA 4YP6A 2FUKA 4I5DA 5AFSA 1U0GA 1DBIA 2TSYB 3CXUA 1CE8A 3AERB 1HEUA 4GKAA 1DAGA 4P80A 4D97A 3U6BA 1MEEA 1H2XA 2WB4A 3CPEA 4V1CA 1J8YF 4GI5A 3SYMA 1MW8X 2HJVA 1ZIXA 2QM3A 2XOKA 5EN4A 3K4HA 4PGMA 4K9KA 4K87A 3NHRA 4QUGA 2ZRCA 5FDFA 3F6RA 4CG3A 1Z6QA 3RHFA 4ZMBA 1GL3A 1GDTA 5KJEA 1RYEA 3K0CA 4ZVQA 3M6LA 2K5UA 2YZKA 4DNPA 3BPSA 4QYIA 5HCNA 1E2NA 5KYNA 4UCFA 2FDRA 2DFLA 5B3KA 1J2JA 1I7LA 2GRAA 4GBED 1GTZA 3HEAA 1I4OA 2N46A 4HDKB 2SHKA 5EJGA 3SHOA 4E33A 2H2IA 3K73O 2G63A 4KSBA 1G5RA 5JBIA 4PX3A 3A6HA 3FRIA 5GONB 1VE3A 1Q57A 4DPLA 1FL9A 2FPPA 3EFBA 4M1SA 4QPZA 3PGJA 4BVHA 1GSOA 4G0YA 3CT6A 4ZO7A 3CLRC 2PD3A 3OCJA 1H1DA 2MJLA 2RB5A 3GJTA 3O92A 5BXYA 2BEWA 1CUBA 5AK0A 2PZLA 3MCTA 4DIMA 1ZVKA 4BNGA 1ZKDA 3PWZA 3P71T 1RXYA 2H1IA 1FSFA 1EPUA 2YYYA 3ED5A 2DTDA 3AB7A 3E7WA 1TU0A 2FA9A 3GQBB 2OFPA 3BIOA 1XTTA 3A9VA 1Z4PX 3H1FA 5DLDA 3IT1A 3NHKA 5JJBA 2K6GA 3BJMA 4JKYA 2ZCUA 2AFRA 5ADHA 4Z4GA 3E3NA 4JXJA 2JLBA 1JLLA 2A86A 2A14A 2C98A 4I66A 4WLVA 2XUPA 4M7WA 5JAZA 5FOSA 2HBYA 2GZDA 5LP6A 4BVLA 3WHIA 3GMSA 1A72A 4ZYTA 1H69A 3D2AA 4TL6A 5HIJA 3P2IA 3DOCA 1O94D 5K3EA 4MAFA 3A3OA 3H1BA 5I7UA 1XZPA 2P9TA 4K1LA 3WB2A 3HK2A 4TOIA 4OJMX 5A1JA 5AVWA 2CV0A 1R1DA 3QU9A 4NOKA 1GUAA 4DNXA 4EJFA 3FJ1A 3L9WA 3DF7A 2Q3CA 3AW9A 1KYIA 2EDCA 3AR4A 3NBKA 4MDHA 4ZYWA 1NJ1A 1PT7A 3SIPA 3E9MA 3LHSA 3V8BA 1LWNA 2KSQA 3AX6A 2WIKA 4CEJB 1RYHA 2VSOA 3IKLA 5IF3A 4OEHA 2B25A 1X9GA 1V41E 3EW9A 3CJQA 4IM7A 1JS1X 4EAAA 3H0CA 1ECCA 3EZXA 1PS0A 5JPCA 1CEQA 1TJYA 4IDOA 3U7HB 3A3YA 1CQWA 2FMFA 1VE7A 2VR1A 4HXFB 1Z18A 1UC4B 2CJYA 1AB6A 2C20A 4HGZA 4M1MA 4ZT6A 3FUUA 4ZC1A 5LA6F 5KWSA 4KRYA 3BXOA 4QLAA 4JLNA 4F7WA 5GAJA 1TUIA 5A06A 3I28A 3ZUGA 5KTKA 3LYLA 3TEFA 2OO3A 5CRIA 2FQ1A 1X80B 2ZIGA 1ZN2A 4YMVA 1HRKA 2HK8A 2RIPA 2VCHA 4OHUA 2YC2C 1SVUA 3K2EA 5JYCA 3TGWA 4RAOA 2CYAA 1XU7A 4DLZA 4LWZA 3UT0A 2FG6C 2B8JA 1DLIA 4Z0NA 3ZDCA 1K6IA 1E89A 4TT8A 3UAYA 1FFWA 4JITA 4PPQA 4J3NA 1O5IA 1KR5A 3ZI7A 4KIFA 1P2SA 4A6PA 1C3JA 2KHZA 2IPOA 4UVDA 1RBQA 1A5TA 4OKNA 5BOVA 2HCJB 5BQ3A 3ICQB 3KVYA 4E14A 2G28A 2HU5A 3N53A 1B8PA 4YMTA 1M2OB 2ZJ7A 1EVLA 3WG9A 1FLAA 1U02A 1K9VF 2FGJA 2O1XA 1G8PA 2Z2KA 5H82A 1BE8A 4F4UA 1IZZA 3THXA 1R6XA 4J4TA 2F8MA 4UFOA 1RZ3A 2DSNA 4B7AA 1OHHD 5IK2D 1QU2A 4J0FA 2ATXA 1WPXA 3QEBZ 2BFFA 4JGIA 1XZJA 2WT8A 3OBBA 3HFJA 2GYWA 1Y5MA 2BMWA 2R8BA 4X3PA 1Y6QA 3UK2A 3ZWCA 2BR4A 2C59A 3FZGA 3K1TA 3MGAA 2Z9DA 3OH8A 2JGRA 3QPBA 3HP1A 1BEEA 5I9SA 2PKEA 2BEKA 1UDRA 2BBSA 3BRWA 3NH9A 4UBMA 3NB0A 1L8AA 4XB6B 4BRUA 4ESEA 4QKQA 5CLJA 5IH3A 1GADO 3GFBA 3DOIA 3FSEA 4M1EA 5DF1A 3GZJA 3CF0A 3OQ1A 3AKYA 5DHUA 4EUSA 4DR5B 3NPMA 4IY1A 1D1QA 3OZWA 4E12A 4IOMA 4R3WA 4LBWA 2O6LA 4U5XA 1LSJA 1YE5A 3LUFA 5AW3A 2J0UB 1DC7A 5BN4A 5K0FA 3SG0A 3M3PA 4FNMA 5M2QA 3B60A 2XCSB 2QE7D 2Q0QA 4S24A 1E60A 1J22A 1TAUA 1I2AA 4C4YA 2E37A 2E5FA 4MQMA 2ZT7A 4AY4A 4Z4CA 1HNZB 6AT1A 2YWRA 2RE8A 3B7WA 1DBSA 3G8YA 3V48A 3VYRB 1QP8A 3GDFA 2JFHA 4WKNA 5C4IA 2GJ4A 3UUGA 1MTOA 4Q82A 1S1MA 3ETNA 3SF8B 2NU8B 3QMMA 3ZDQA 3P9ZA 5JD5A 4MW6A 3ROPA 4R2KA 1M8JA 2O5VA 1BWSA 2CK3A 4XTCS 3UFXA 3H75A 3DUFB 4JL8A 2V7WA 1JUDA 1SXGA 1T29A 1O54A 1WX1A 4OLHA 3PVZA 2GJSA 4NE2A 2I1WA 3FH0A 4JDUA 3K6SA 2P6MA 2TYSB 2I76A 3HUEA 4KITB 3MQFA 2XQGA 3KXDA 2ZBEA 4YP1A 5KJCA 1Y1KE 4LJLA 1PKXA 4FCTA 1TO1E 3E9DA 3GY0A 4AJKA 4CKCA 2O14A 1PE0A 1YIDA 2RONA 4M0LA 3HA5A 2H4WA 5EIBD 5ALEA 3COYA 5HIKA 3FOWA 1ZK2A 1XXHA 1V1RB 2PFSA 5FPTA 2AEMA 3UXEA 5JNTA 4L57A 1SUFA 2XCLA 5KOYA 3KZCA 2PO7A 4P8RA 3T54A 2JH3A 2X0KA 2PH5A 5F21A 4YPVA 1PDVA 1XLTA 3CKYA 3IT3A 3EA0A 2JIZA 1WM1A 4LJYA 4QXAA 1BYUA 4QHTA 3WK6A 2PQ2A 1DRKA 1ZQ9A 3E2PA 2GUWA 4DM3A 1MCZA 1K2WA 4WSOA 5JDIA 4FUQA 2CXPA 4XWYA 1CP3A 4AUEA 3KVRA 4EHJA 2FR8A 1JJ7A 4P34A 4XFDA 2W83A 5G53C 1ECLA 4M54A 5CLLA 5KCMA 4V02A 3FPCA 2VLIA 2WSBA 1TAQA 4L7QA 2BMAA 2Z43A 5HFNA 4BYMA 3J81A 3JCZA 5TSDA 4YMHA 1U6KA 1UZAA 4JQCA 4EY6A 1FLNA 1G38A 5IJ0B 5AJVB 1WIWA 2O8EA 4B4UA 3OUZA 5IVKA 2CYBA 5ARBA 5DMXA 1LDNA 1WKVA 2CSUA 2FW1A 4LMPA 2OFFA 3QUCA 2CVZA 1RWVA 3AHCA 5HCIA 2XXAB 4MULA 4UMVA 3DNPA 2P90A 1P7WA 5FBQB 5F52A 2AIRA 4N47A 3N3BC 2YHSA 2ZANA 3FBTA 3C6QA 1Z7WA 2ACVA 3EG9B 2E4UA 1NZJA 1OR8A 3QPWA 4R84A 2R1TA 5EQTA 1UMDB 3RC3A 1E0KA 4C03A 2X1HA 5ADWA 1I4EB 1K1EA 3HADA 3LXXA 3A1DA 1G0OA 3TNJA 4IW3B 1WUIS 1GZVA 2F3TA 2VBFA 3MJEA 1QK3A 4HATA 2CJXA 4I6GA 1E8MA 3HJHA 5FBHA 1FQWA 5GY7A 1JR6A 5KNCD 3COPA 3PC8A 3OU6A 1XMSA 5TQ0B 3JAMA 5CTAA 4WBXC 4FMDB 2AF3C 4A26A 4E2WA 2NAPA 1KQ3A 5DNWA 2A0FA 4BO5A 3V4OA 1QCYA 3OVMA 4MW9A 2V0CA 5DGCA 1T26A 1IL0A 3TSWA 2RHWA 1XMOB 1T5IA 2B9EA 2HBQA 4O4LF 1QH8B 3K0AA 4OQEA 3ZOKA 1V95A 1KFEB 4Q5IA 4QXMA 5K3FB 1U11A 2FFBA 3W2EA 4XVQA 3UJPA 3VHQA 3V4RA 5EL0A 4XLLA 2WIFA 4ZAFA 4NFLA 1F0YA 1LV7A 2GXUA 4GWKA 4CG0A 2NSJA 2AVNA 4Q1BA 1FNBA 4D0NA 1EUDA 2A9FA 2VK4A 1Q0ZA 2WSSA 1RRKA 5IW8A 5J4VA 2XNSA 2CXSA 1FDIA 5FAKA 2IPXA 3N2KB 1XRJA 2PIAA 5KTOA 2WF9A 5CB4B 4CMCA 4EIWA 1UKZA 2EAUA 3VR1A 3HB7A 3UMBA 1AMUA 3PR3A 3G1TA 2EJWA 3HYNA 3U3OA 3LGAA 2CMHA 4ZU6X 2IEAA 1VKNA 4B7XA 3R8CA 3JQCA 4UM7A 1TJ5A 3ORSA 4OJYA 4WCFC 4WECA 5JMOA 1UQUA 5L3VA 1TA9A 3GPBA 2DZDA 1YU6A 5EZYA 3PA8A 1KJ9A 1C3EA 3T7TA 4AF7A 2LBPA 1QIEA 2DG2A 4FR2A 3D0QA 3RVQA 1F6DA 2FG7C 1EHCA 2VOEA 4L85A 3KB1A 3FDFA 3EXEB 1O87A 4HEA6 4W5HA 4YP5A 4HDSB 5JO0A 2GAFA 4I8DA 1OF1A 3LF1A 3G7UA 3N87A 1MA3A 4DDUA 1OIWA 3Q0IA 3E84A 3ZW8A 4EVQA 2VPQA 1PJLA 4PXYA 2ZSUA 2C1ZA 2QX4A 4KPEC 2FPIA 2I67A 3D8NA 3I9V1 3WWOA 3SR3A 2FR0A 1OWNA 5F2NA 1O89A 2DBQA 1ZW6A 4QQKA 5ISMA 1SWVA 2GEVA 5JC8A 1DCTA 4RD6A 2AXEA 4WFJA 1E2EA 4U3JA 1EFUA 2DQ4A 4BPRA 4PAMA 3I30X 3QVOA 4LXYA 4DDTA 2PJZA 2ZYDA 2EWVA 4WZ6A 3RVJA 1KTIA 1PZXA 2VT7A 3FZNA 2P5SA 2Y0CA 3DHYA 4MS4B 3KQOA 3MT0A 2J5BA 4IG9A 1X1CA 1JKJA 4OBBA 4U9HS 3TTWA 1R12A 2FUCA 4AROA 4F4JA 7MHTA 4NFSA 1VG9B 2WPNA 3ILVA 1ZD1A 1FP4A 1KQNA 1BGVA 4DCJA 5CXXA 2IGTA 4JP3A 4LZOA 5AKHA 5D87A 3C3WA 1OGIA 4JHLA 1JE1A 2BEJA 3ZGXA 3ZWAA 4H1TA 2VYVD 2R66A 3ERCA 3ZVMA 1ORWA 4QTXA 3VH4A 3SYTA 4YAGA 3GT7A 4Z1MA 5FO1A 4BJHB 4Y2QA 2FUG6 2JZCA 4X41A 2Y9MB 3TLAA 4I3FA 2QL9A 2VPTA 3G5UA 4KFUA 1PX2A 1GU1A 1W96A 3A36A 4NZMA 1V6CA 3B48A 3D2BA 3KU4A 5EUMA 3TQRA 1JH9A 2FLVA 2EP5A 2J59A 1E2FA 5B4VA 2XVZA 4LV6A 1OGJA 3FVWA 4F5WA 4B76A 4YLGA 4CKZA 4BWYA 1KWKA 2DTEA 2PJUA 1OTXA 4JI3B 1U63A 4ICIA 4DR2B 3QBJA 5D85A 1ZC4A 4JBLA 5IASA 4NYIQ 1XZ8A 1XDDA 4DA6A 5JRZA 2PMCA 1WXDA 1OREA 1PYOA 4G25A 5IH7A 1O5TA 4NZPA 4QYXA 2FZKA 5JCZA 5KTPA 4ZVUA 2XTMA 4R8VA 3DTVA 4YREA 4H7FA 3ZWQA 1C7EA 5EMLA 3RS2A 2Y8EA 3W4JA 3T6KA 4MLPA 4B3GA 1T4GA 3AZPA 2BMJA 3C16C 3H8VA 1QO9A 5KSWB 5IC5A 1QO0A 1BX0A 2VT6A 3NGMA 4CDNA 4F86A 4RLFA 1XYVA 4EG7A 4ITUA 2E4XA 2YC4C 4V03A 4FFPA 1T25A 3TDMA 4UNNA 2ZJZA 4AP6A 1QORA 1ZGZA 3SC2B 1MX5A 4C3UA 4R0MA 3C6YA 1DKLA 4GMFA 3GI1A 2ZP1A 1NV8A 2IZZA 5DLYA 3VKVA 4YMIA 2OXCA 3AHGA 3HG7A 3IAXA 1TFUA 4CLDA 5THXA 1U2SA 1MQ8B 4DJEC 3CVVA 2CHGA 3PTZA 2E4ZA 2IHKA 4I99A 1O9BA 4F9GA 1EZZA 1UBCA 3BK1A 4W99A 1XAGA 1WW3A 2EJCA 4NBLA 4U6SA 4OQMA 4ER0A 1DMRA 4WQMA 1KDTA 3ZC3A 3ZVRA 1ZUD1 2B34A 2WICA 4U1RA 5FF9A 1GUDA 3DPSA 3R74A 4RMJA 3NLLA 4G4SO 2QTZA 4PZLA 3C8ZA 1J7KA 2BGJA 1EFKA 1SUSA 1COWD 1VG8A 3MLAA 4XR9A 3TTVA 3W6PA 3ZQJA 2NVUA 3SEZA 3DG9A 1ZPDA 4H6XA 5ANRB 2NSYA 2C7PA 4O2LA 4XYEA 2WG0A 3L41A 2A88A 4KRXA 4UBOA 3GVIA 2PL9A 2BN4A 3GIDA 2EGUA 3X1JA 1L4YA 3ZR4B 5HUJA 5I01A 4RF2A 3DMFA 1CNFA 2R25B 1NTOA 3PFGA 3Q98A 1TIPA 3IQHX 3MINA 3LT2A 5AM0A 3EDYA 1LPPA 3K31A 4Q47A 5CYPA 3TZHA 3WQBA 3HJAA 3P52A 3TTXA 4BL5A 4PQFA 1NFFA 3JWJA 4KMMA 5E4TA 3NHSA 2OCXA 2OE2A 2W8BA 3ZVNA 3GHYA 4LX0A 2GNPA 4F71A 3UQZA 1YRQA 4ND1A 5A6SA 4IDEA 2H48A 1JJVA 4TYWA 2PGJA 2F3SA 2DUWA 1RKUA 3WI7A 5A0TA 5AHOA 2F90A 1XCOA 5F76A 4WZBA 1YZ3A 2BI8A 3K20A 1RPNA 4LCJA 5ECGC 5IWAB 5IC6A 1W1UA 3C7TA 3D7MA 3C8UA 4I6JA 5GVRA 1QE5A 2R1UA 4MV3A 3S1LA 5MN6A 2I34A 1I1QB 3QEMB 4MGHA 4X8HA 3OM1A 1N6RA 2HAEA 3T3NA 3FCXA 2Q4RA 1C8VB 1K8QA 4RHFA 1OOEA 3UXHA 5KQGA 3GJ6A 2QTNA 4WBNA 4YRPA 1LF0A 3G5TA 3ZS9A 1G8KA 1UPCA 1ZITA 2V97A 4KLZA 4ZANA 1BS2A 3L0CA 4MJXA 4BS9A 3UMRA 4X1IB 5C51B 4M0FA 3LPDA 1X87A 4KP7A 4RKYA 1H2ZA 1XZAA 2P77A 1YGYA 3T7CA 1ZGHA 2FYTA 2OV8A 4AP9A 4BE9A 2IELA 2M2IA 1YB4A 3QXSA 2XQKA 3W5UA 4BAUA 4UTVA 1FA9A 1G19A 1Q95A 3MM4A 1OXXK 3PPVA 2FKNA 4W9NC 3WLLA 3MB8A 4C6RA 1RABA 2ZRBA 5LDGA 3ER9A 3ZPXA 1DAOA 4JSTA 2IP1A 3T1NA 3UT5B 2RGGA 2ZS7A 4WW0A 5FOWA 4PLVA 2NNWB 3KPJA 3UNXA 1AQJA 3ZWKA 2PYDA 3C7CB 3EC1A 5T64A 4EB8A 4BFYA 1J0XO 1GAXA 4U2KA 2R68A 3NM4A 3Q0TA 1L5YA 3HA2A 1TTHA 2QVCA 1IMOA 4ZEXA 3TTUA 1PW5A 2PGAA 3FOCA 3WGIA 4E1AA 3A9RA 4ETNA 1EFVA 1GEGA 4MLZA 1QRRA 4XFKA 4MLCA 1QYCA 1YVEI 3P27A 4N6GA 2XJ9A 4ZOBA 4DC1A 4Z4IA 1YQEA 4BV2A 3IMCA 2I2FA 1WCIB 3KTAA 1NBOA 4AT1A 1U4OA 3FR7A 3IBGA 4B3JA 1QTNA 5IVPA 1M83A 3PUVA 3IE1A 1I7DA 2GRUA 3W4IA 3M49A 4QJ5A 4AKEA 3GLHB 5BRNA 5CFMA 2X3UA 5CM8B 3UUWA 4GM1A 4BFTA 5C8DA 1XHLA 3TKAA 4PFQA 4TGLA 1T15A 1Z6GA 1WPGA 2ZJ3A 4J75A 1PQPA 3MWDA 5ALPA 2IHTA 4D9NA 3ZIDA 1N5JA 1EWRA 1VPEA 3AO0B 3GGGA 3MF4A 3K4QA 2OHFA 2CWDA 2W58A 3HLYA 2GN4A 5EXXA 3BRQA 3IEMA 4L3VA 3RU3A 2CT8A 1B2LA 1NVTA 2H5EA 3MJFA 4GPD1 5AKEA 2JGAA 3UWPA 4BJ1A 3R5FA 3WYGA 4QLOA 5KHAA 4I1UA 2UUPA 3AESA 3LP5A 2O5EA 3HP7A 4FDTA 4K3VA 2X8JA 1JHQA 1OX4A 3PVSA 4JXZA 3M1IA 4FILA 1UP4A 4MRMB 4MR8B 3ANTA 4EBBA 3MHTA 1XMIA 1SBIA 1E3SA 1AF4A 4Y2JA 3W6NA 3U39A 1MTZA 4YNBA 3K5WA 1EDBA 1K06A 4C01A 3L4KA 2IH4A 1IQ0A 1UPXA 2C29D 2GVDC 6GPBA 2ZYTX 4WGFA 1TO2E 3B2NA 2W11A 1NF8A 3EIHA 1C0IA 2WVAA 1K7CA 1NW7A 2XE8A 4NH4A 4YJGA 1VI6A 3KKNA 4NHOA 4UOZA 4NECA 1SBCA 1YZTA 2JGDA 2QW1A 1X7XB 1O7JA 1YDFA 2FPGB 2WWIA 3L8ZA 3KE8A 3T1YB 1B43A 1ZU5A 2YZ2A 4HN2A 1T24A 3QMWA 4EKYA 1AOXA 1QIDA 4ER3A 4ZQHA 3NYWA 3MJRA 4RK6A 2VYND 2QR3A 1QQTA 2OM2A 4U7WA 1Q44A 5LNK6 2H52A 2XLBA 2CF6A 1WUJS 2AR9A 1G2IA 3A4LA 4N03A 3CTMA 4XYBA 2HZ7A 2KMLA 2W7TA 2I1LA 5G02A 3PQ6A 1L4BA 5TQ2B 1XRMA 3ND7A 2VT2A 3PKJA 1R4AA 4JB0A 2COUA 4H1HA 4Y2YA 3W2GA 4E7PA 1JQJC 2C3PA 5JZBA 3UW1A 3TLKA 1NI5A 1KR2A 4EJ0A 4KI7A 3G9XA 3M5DA 1REQB 1G7TA 2DPMA 1QHYA 4N0DA 5CCBA 2C57A 1X7WB 2R7KA 4XASA 5FWXA 2HRDA 4U5QA 3PWTA 2P68A 2QG6A 4YP0A 4YCSA 5HK8A 1CWUA 5IANA 4NNJA 4ARUA 5CAEA 4US2R 1WE2A 4WGGA 3HWX1 1JBQA 3N7AA 4GSKA 5CH8A 5JYDA 3A6EA 3COZA 4N49A 4PY2A 1E2QA 2NSLA 1JZSA 4NEHB 2QTHA 1NX6A 1C8LA 3D6VA 5ARDA 1EXVA 1QQ6A 5F1YA 1IY0A 2ZITA 4J29A 5AI9A 3QXGA 5BSUA 3OY2A 4Q1FA 4WXPA 1UDWA 2RHLA 1H9AA 1AS2A 2W2LA 3FCYA 5TJHA 4DF3A 1QOPB 3PNOA 2Z6AA 1EVIA 1WDWB 1U31A 1OLXB 4G8BA 4U9IS 4CKXA 1THMA 1SXPA 2KI5A 2VSXA 4GQBA 2OG1A 5EZYF 3QHQA 2F9LA 4KXYA 3BZBA 4PM4A 3EIUA 4DMLA 3IEVA 3DDUA 2COEA 2ZSDA 1S7CA 2FRXA 1RACA 3I5XA 1GAEO 2HB6A 2YMPA 4N8EA 3N9IA 5LSAA 2H0AA 1M76A 4BKMA 1KZ7B 4HR7A 2NU6A 4B81A 4HV4A 2QM0A 2VEDA 3GAAA 1KY3A 1FP6A 4I1RA 2IBTA 1QQ5A 3NASA 1B3BA 3AR7A 3PQDA 5ED0A 1NVUQ 2KLBA 1UDCA 3D6NB 1E0JA 1JXQA 3FN4A 4M9RA 1I5EA 2W6MA 4OL9A 3TB4A 1TD9A 5GZ1A 3MWLA 4YRTA 3GRKA 1E1KA 1R9JA 3B6EA 3PITA 3OG9A 4YDHB 4LZZA 2HHCA 2I33A 3GLIA 3OFKA 5DCUA 4BMYA 1RXUA 3TDNA 5MDHA 4QYSA 4BFWA 3M70A 1CUGA 3NT5A 1ZIOA 2JJQA 4G0XA 4LN1A 4BO2A 4MDFA 4N76A 3CVUA 4LSMA 3WICA 1ZG3A 2HBZA 1N1GA 3P2JA 4NDAA 4EA7A 4JC0A 2GLXA 1YJ8A 1B4DA 4OI4A 3C15C 5LZ8A 3L7DA 2C83A 3GWZA 4GQAA 1Q0PA 3GLFE 1U8XX 1U8ZA 3NIBA 3L40A 3N70A 4QDOA 5AIAA 3HXMA 4L72A 2YDYA 3VFDA 5IT9A 3P97A 2BCEA 3ND5A 2O2DA 2C7BA 2PS0A 4DS3A 4Y1FA 2Z83A 4PU0A 1YQWA 4KO1S 2X4LA 1TC2A 2PMDA 4MR7B 1YQUA 2LWIA 1XZGA 4BNZA 1FU8A 3I76A 2YN2A 5TNXA 4HAVA 2YN0A 4BMVA 1NU6A 2EERA 3EHEA 2POQX 3DQZA 4D6XA 4F45A 1NF2A 4HWSA 4QRDA 4DTIA 3KBBA 3I2GA 4RY8A 3ZTYA 1E2MA 2FUG1 4M9QA 4CCYA 3AVWA 3NS7A 2R1VA 1BW9A 2H1HA 4FGKA 4GLLA 5KWVA 1DKMA 4R81A 1VL5A 3NWEA 3H1GA 1OZGA 1V3UA 3JARB 3WDMA 3T5MA 4MMYB 4CLRB 4LC9A 1SWWA 4HL6A 1L5MA 3PGKA 1MFPA 1CB7A 4BFZA 2B7CA 2R6AA 1CCWA 3DO5A 2BTQA 2ZUEA 3F5DA 4F3YA 1ZUNB 1Y6GA 4JH0A 4CKEA 4YV0A 2WJHA 3WC4A 3AHEA 4ZCRA 2HSEA 3ELWA 2FMUA 3F6SA 1EWYA 4KG7A 4M99A 3AU9A 4G37A 5DHSA 1NOKA 4ZVRA 3D4NA 1ZGCA 1PJ2A 1KBOA 2X8LA 5AVZA 1J20A 3K70C 3BQMB 1W9MA 1YR7A 1RHJA 2QQEA 2W0SA 2PTGA 4DZZA 2VNJA 1JR3A 4NEGA 1L7MA 4J1SA 4ZOCA 3CNQS 1U7ZA 5GINE 1DQPA 2GCOB 1GUZA 5ES4B 1JKXA 4W5OA 1CVRA 1AT1A 1D4AA 2JBAA 1XQVA 4UUMA 5DTQA 3BMQA 4L51A 5J9FA 1UBOS 4A2WA 5KOHA 1II9A 3K16A 2PX2A 3KJZA 4JJKA 3TIXB 4DIOA 1IUOA 5IEJA 1OI2A 1XMXA 3WJ1A 2X0IA 5MFPA 1MJHA 1U28C 5EHNA 2UZAA 3WHKA 1YVUA 5HG0A 4Q1CA 4YUXA 3D54D 2EWMA 5A4DA 1YRWA 3ZCSA 1RP7A 3R7FA 2FEAA 1V1JA 4G0MA 4S2UA 1NY6A 4Q7JB 1U7PA 5K0BA 2H63A 2D7CA 4I9GA 4HAOA 1OB5A 2OORA 3R0XA 2NQ2C 4JLJA 3U37A 4UEQA 2YCLA 3N6VA 2Q7DA 1AF7A 2ZJ2A 1XDGA 1ZX1A 2ZU0C 3QVVA 5KWJA 2VHQA 5F2EA 3NTLA 3TZEA 2FEMA 3GAZA 4P1ZA 5AMXA 5A2QA 2SCUA 2HLPA 2ZAIA 1ZOOA 4P92A 2QZSA 3EXHB 2XBMA 3D4IA 2CNLA 4HG2A 2JHFA 4EG1A 2JCYA 4G1CA 1F51E 2DWQA 2SECE 3RBXA 3UJDA 3RSZA 4HMOA 3B1XA 1SOAA 5EJ9A 5KZMB 4RQUA 4GOMD 1E99A 2A1IA 3ZWOA 2O2EA 4YIHA 4KW7A 2HH9A 3MPUA 4ZCPA 1PQWA 3VR6H 4TL8A 2DLNA 5JQGA 3CUYA 5C5DA 1KYZA 2W6ZA 4LYFA 4FFWA 3WGYA 4KR6A 1TVEA 5KQRA 2AJTA 2JBWA 3N0XA 3PUIA 5DLEA 3QXCA 2G9VA 5TY0A 3KHSA 2WM9B 5HKKD 1P19A 3RJ5A 5AVOA 4D57A 3A1CA 4CV0A 1YS4A 2WHEA 4X71A 1CQZA 3B89A 3F1LA 3RTCA 2RGNA 5DJ5A 1XVAA 2GYYA 3CNBA 3CSDA 3I09A 2W2XA 5CU7A 4ZVOA 5EGNA 3W79A 5I9BA 4EQ6A 1PWYE 5BWOA 4QQFA 4WBNF 1ZJZA 4FCCA 4I14A 2VPIA 1LW6E 5ILQA 1CY8A 1KH3A 2DH5A 2Y68A 2YS6A 4BLSA 1O77A 4O2RA 5BWLA 4W6QA 4M8LA 5G3YA 5EP1A 5AK4A 2Z3ZA 1P8JA 3UTCA 4BO8A 3NHJA 3HYLA 1ZESA 2IYSA 2JI8A 2OZEA 3KPYA 1YGPA 3COJA 4CLOA 1EAMA 4B75A 4MUBA 5FFNA 3DPIA 2P6OA 3RYIA 4MUXA 2C5GA 2R8PA 4GYKA 4MVJG 2OCYC 4FQ7A 4ND8B 1OH8A 1FFBA 1WCXA 3DWGA 2PSFA 3I8XA 1FMLA 1MB9A 4FINA 2YWCA 2ZFUA 4J43A 4LQCA 4QPPA 5DOVA 5H0IA 1F2TA 1U9ZA 5JFTA 3VO2A 2FSSA 2FU5C 3LE8A 4B3HA 2B82A 3PHIA 2AEJA 5ELLA 2X77A 3WV5A 3R3YA 3WL3A 2PVPA 3MGKA 3OPYI 4NATA 4WZAE 1ZIPA 3G23A 1RHUA 1TMYA 2D1YA 2A30A 3D3WA 4HDRA 3EIFA 4TKVB 5BT8A 1MJGA 1O94A 4UFPA 1D6JA 2H51A 4FC7A 4HI0E 4MEAA 5EYPA 4FB4A 3R8FA 3JVIA 1T9KA 4MHTA 1K6EA 3OTQA 3QWHA 3WTCA 1A9QA 4D44A 1IBLB 1CQJA 3PHJA 3GFTA 1CEEA 3O8OB 1XPJA 3WR5A 5JY1A 5LL6P 3G2PA 2F6RA 2NXEA 1G8MA 2YMLA 1ZHOA 2ZSBA 4BNDB 5CBPB 1U3WA 2N9UA 3G0DA 3HDHA 3K0HA 1G3UA 3NTXA 3PFBA 4E08A 1IM5A 5ALTA 1V39A 4C7OB 1R0SA 5DMHA 2ES4A 4Q16A 4DR6B 1LS6A 1DWOA 3HKCB 5KJ1A 2KJQA 3LTEA 5HA5A 3AV0B 1ZAYA 3EGIA 4D5GA 4AL4A 2WIBA 1E20A 1MJGM 1U0RA 5DTRA 3D59A 3ZV5A 1JQ5A 2VSYA 3C8MA 3TG2A 5JRJA 1P0IA 1AZTA 1NOJA 4DILA 2IYNA 1X3SA 1AV7A 1YFZA 2EQAA 4IJVA 4N0EA 1VJ1A 3SEAA 4L28A 5BSMA 3QV2A 5IXSA 4HZIA 3WQQA 3W06A 4RTPA 4QU5A 4KR3A 1V1MA 2RC5A 5MFZA 1OLUA 4W5QA 3L7CA 3RS7A 1MLDA 4Q4LA 2H2DA 3COWA 2FKAA 4DMGA 4EFNA 1G2QA 3RUEA 3DZGA 1Z06A 1HC7A 1T10A 3FMFA 4FFLA 1WY5A 5E4JA 3D4BA 5JYEA 5LCXA 5LA6B 3OOYA 3NXKA 3TI7A 2HXSA 2OR3A 4LNUB 4TKUA 2WQ7A 1OZFA 2OB2A 3SNHA 4DSTA 1ISJA 4CF4A 5K0TA 2IS6A 2HM7A 5TF4A 1E3QA 1ENYA 1QBKC 2ECKA 2EC5A 4RDIA 5HMMA 5C9ZA 1CS4C 4KQWA 4I46A 1ORIA 3UWDA 3ZGNA 4JQZA 1UPFA 1XMVA 1VL2A 4RY2A 1GQQA 4CIWA 1OHHA 1J90A 5IK2A 3OT4A 2YIMA 2XDQA 4CL3A 4HN4B 3VA7A 5D5QA 4OXYA 2PS1A 3W8EA 3TOCA 4OQYA 3ZWPA 4GM4A 4PFSA 1T2UA 2GETA 5DI9A 5BSWA 2YV2A 4ENQA 3RAJA 3NQ41 2AQ8A 4GPBA 3NDIA 1T3LA 3RREA 4FB5A 5A04A 3PEYA 1JP7A 2JCXA 1PJQA 4OIFA 2AOTB 4ZVPA 3UXMA 1U0SY 2ZI4A 1VIAA 2OY0A 2WHPA 4N3GA 1Z34A 5MGBA 1TZKA 2VDJA 2WKWA 3O4RA 4ZO4A 5HIMA 4CE6A 5CDUA 3B9BA 4H08A 2OHOA 4RKEA 3GBPA 4KBYA 1W7AA 4GR5A 2PD6A 4KQEA 1Z4IA 3RG8A 4FNGA 4CJXA 3HACA 1FVOA 2BGRA 2GM9A 1B0AA 2QE7A 1TB4A 3AG6A 4IQ4A 4MI3A 4DV0B 4INPA 3NKVA 2QDKA 4HWPA 4HFRA 3JD3A 5EKXA 3IJ5A 2UYCA 2CNDA 4U6NA 3PNSA 4RK1A 1R6VA 1QTRA 3U3DA 3IRUA 3IOEA 3DEAA 1XJWA 4MW7A 4OXXA 3P94A 4Y2HA 1L5NA 3BMNB 4F9TA 3U4QA 4BQOA 1UT6A 1RCFA 2HBRA 5HRUA 1SUBA 3A6DA 3M6WA 3W8DA 4F3NA 5HIIA 5LMCA 1OXUA 3C5VA 5JU6A 4XE5A 1W5SA 1K92A 4XPIA 1ES9A 2P2NA 4HNVA 2NPOA 4EUKA 1NI4A 1NVKA 1PP4A 1WSWA 1NN3A 1XJ5A 2NTYC 3CYFA 3P45A 4GPIB 3T3DA 4BBZA 1HOTA 3BXHA 3ACBA 4XYLA 1RQ2A 4HX9A 2GA8A 3UK1A 2ST1A 3LQFA 2P7IA 5KI6A 4KU4A 4OM8A 2PBLA 5F3RA 4EYOA 1M72A 4E0BA 2HR1A 1A4RA 4J8PA 4EHBA 1JJAA 5A5GA 3EZFA 2QN6A 1UK6A 2HT6A 3PK0A 4MV8A 4S1TA 3S1AA 4CQLA 1MA0A 4CIAA 3UYLA 4KXLA 4NYMR 1DRUA 3QQ5A 1ABEA 3QYJA 2OCIA 4UHFA 4D80A 4E5SA 3CN9A 1LK5A 4NBNA 4TTIA 1ODSA 3RKUA 5ABPA 3OJFA 3VU1A 3SYRA 1Y5RA 4YTEA 4CN8A 1W36B 2G1PA 2JA2A 1LVHA 4OHWA 2DPLA 4TS1A 4DMMA 1JXMA 2PS9A 4OHVA 4RLSA 3TZ6A 3BHNA 3A4NA 3GQVA 4HZGA 4BLPA 2Q5IA 1GITA 4FOLA 1T0BA 5I7OA 3G1WA 4YALA 5IDYA 4ES6A 1Z2OX 3FKJA 4UHCA 2A9VA 2DKFA 1XVVA 2IGBA 2PMKA 3P0EA 2DFDA 1AGXA 2ZSFA 3TLGB 1SG9A 4LVOA 2QAGA 4NLLA 5KNBH 1M6VB 2JAQA 1CUHA 3MGBA 4R5HA 4BU1A 3FYDA 3EVCA 3T9EA 3HCDA 1PEAA 5DYTA 1K7YA 4BRZA 5G0VA 4U02A 5EWLB 4CM1A 5JHHB 3DAYA 1WMDA 3F49S 4DB2A 5C80A 4NJMA 4B0PA 1IXKA 1GPWB 4W1PA 4RPCA 3STXA 3WA6A 1XRLA 3R44A 4HADA 1FFHA 1Q74A 2K87A 1AKWA 1Y0BA 3R1IA 3I6IA 4LSWA 4K9MA 2WJPA 3HSYA 4M6WA 3T4PA 3A8TA 2Z58A 5HWSA 2PBZA 1T8YA 2Z2ZA 1VQ1A 1NPDA 4L4YA 2EF1A 5FHQA 4L02A 4HGQA 3GP5A 4X00A 1FRZA 4Q39A 1Z82A 3Q6MA 3QE2A 4RSGA 4LY9A 1SKUA 4MKZA 2D8AA 5ALYA 3CF4A 3Q5GA 2QN8A 3H86A 3QBDA 3RW9A 3QK7A 3NOXA 3PGA1 2XNCA 3AR5A 4PF1A 2V0GA 3IVAA 1A3CA 1MABA 4IOLA 2HA2A 1WW8A 4LOKA 4KGXA 5NULA 3CXRA 1I6MA 3JRNA 5KNCA 4V3CA 1E59A 3LQRA 3NTUA 1MEJA 1ZH8A 2GGSA 5FPHA 1M74A 3VHLB 5BQXA 2PGDA 1E7SA 1CQXA 1VL1A 2YWEA 2FW6A 2ORVA 3CJRA 3AUAA 4JJ6A 3LZ6A 3R3SA 4W9RA 1QHEA 5B1SA 1MW9X 4K2HA 3F4KA 1EKXA 4N82A 3WMXA 4UOQA 2LCQA 3WP0A 4BLWA 2IEDA 5JAOA 3NU1A 1QIHA 3D7LA 1D2RA 3R3UA 4ARSA 3PQEA 4UTOA 1RQGA 4H0NA 4D98A 4EDHA 1YB2A 2ZJFA 3IBSA 4JCOA 4PYJA 4GGMX 4LF5B 3KB2A 1IE3A 2G67A 2QUKA 3IQDB 1RBMA 4OU5A 3M3DA 3DT9A 3KUKA 4AUNA 3WK5A 1R18A 2IV7A 4GSLA 4DARA 1F7VA 1D1SA 2CLOB 1CJUC 1FS5A 4K6HA 4JR1A 2PS3A 3K9GA 4JUDX 2E4WA 4RMIA 4RSRA 4EHAA 5BR1A 1QK5A 2NZWA 2H29A 1XZFA 4AJ2A 4O4LB 2BGKA 5FNZA 5LU9A 3K6RA 3HR7A 4OMCA 2R8RA 2PKQP 5E6RA 1KDPA 3PXAA 4HUQA 3VSBA 4ZTUB 4RANA 2UUOA 3PU6A 3OQVA 3SXUA 1Q3HA 4GBJA 5JARA 1H3NA 3B8EA 3OIWA 4HKTA 4MGYR 2RGXA 2XMSA 1RE0A 2JRCA 2P6NA 4IIDA 4HDOB 4B2PA 2Q1UA 2YYSA 4OIMA 2BE7A 4YACA 2JJ8A 1U3GA 4ED9A 2VXCA 2GILA 3K1ZA 1G4AE 1CIPA 1LZLA 4KQCA 4QBGB 1YIOA 2YVLA 3GRFA 2HX1A 1B93A 1CUXA 4G97A 2FW0A 4PTYA 1QB8A 4XQ0A 3VISA 4C08A 2QTTA 3OLCX 4JODA 4Q37A 4EBFA 5A4JA 5C7LO 5CYGA 5JNRA 4PAWA 3N58A 2HO5A 3QGMA 3RRMA 5JQGF 4CLEA 2ZAOA 3O4GA 3PCTA 4KLRA 2QAJA 3S8MA 2AMJA 3HJCA 2J46A 3C7AA 1JHYA 2IUSA 2FSVC 4UU0A 1KDYA 2FP4A 2OQVA 3TQHA 4DMUB 1TL7C 3GFPA 3B1JA 1ZAKA 1R5BA 3PXEA 1KMMA 2C7GA 1RJGA 3DL4A 3LPCA 5BMOA 1QGOA 3LQ2A 3E7PA 5CB8A 2HGZA 3DTTA 4DABA 5K03A 4EA8A 1Z9BA 2BKXA 4JR0A 3INTA 4PTLA 4EPRA 2IEIA 3GEBA 2E18A 3KCQA 4IDQA 2O6HA 4ML3A 1KOLA 4DEYA 4RIGA 5JVDA 2QTMA 2PA3A 4TYQA 3LH5A 4MYDA 1SG0A 1CHNA 3T12A 1EFCA 4D9IA 4BGEA 2VYVA 4GC9A 3DBLA 1SC1A 3DXYA 3EFHA 4FI3C 4X84A 1VHWA 4V1CB 1F60A 4F7DA 2DR3A 1U3DA 2AN3A 2YJGA 2HIAA 1OFVA 1R50A 2ILVA 4FJ1A 4E22A 3H7AA 1O96A 3GC6A 1E6EA 2C78A 1IONA 3A3KA 1RBZA 3HO6A 1YR9A 3HR8A 2ID4A 3HCEA 1B0PA 4G5OA 2V59A 2Z6VA 4Y6QA 5IZ4A 2HCFA 1ISIA 1R10A 1TVKB 1WKCA 3KYJB 3A9UA 1V5EA 4F46A 3AHIA 3HY3A 3Q8MA 3JYPA 2J9GA 3OKCA 1W2GA 4MK4A 4BVBA 2QP9X 1CUIA 3C3YA 3RSSA 4A23A 5DYWA 3VR2D 4QATA 1PHPA 1GJRA 1T9BA 2BM8A 2GK3A 2FPPB 3DFIA 3LO5A 3PDCA 1I3MA 3L6BA 1IDOA 2X5JO 3OF3A 1LPAB 3UAZA 3D02A 4JJIA 3BFVA 5FUQA 5GADl 3WADA 4LDPA 1ZK4A 2HJRA 4ND4A 2D2IA 1DELA 2BEWB 1HYEA 3JYNA 4IKOA 4CMKA 1A7JA 3L5OA 1I7NA 3PDJA 3BHJA 1FXWA 3RVMA 1YZHA 2I1VB 5JFOA 4TYNA 2QD4A 3OQIA 2CMDA 3CZPA 5J1SB 4U2GA 4O5OA 1WXXA 1Z17A 3BFKA 4UEOA 4F97A 4QZVA 4II3A 1DG9A 3FHOA 2ZRJA 5DI3A 2ZIXA 4F06A 4BCBA 4PINA 5G4KA 4O4JF 1ZIDA 1RCUA 4MRAA 3U7GA 5H3CA 1XUOA 1J07A 1YS1X 2NZUG 3AHDA 3KWMA 3KOMA 4HMPA 2W43A 3HUTA 3SD7A 4AJJA 4EA9A 2HQSA 5JY6A 1MFZA 1W88B 2LVBA 3OCUA 3P2EA 4FDLA 3IDSA 4JVSB 3UCXA 4TMKA 2A9KA 3LOUA 4GOJA 3R7SA 4C04A 3HB4X 3C3XA 3KR9A 1SNYA 2R4TA 2GKOA 3A1VA 2A5LA 3DFZA 3FNHA 3S2SA 4URVR 4QYMA 1GO2A 2EL9A 2CFCA 5BYJA 5JAUA 4Q03A 4KQ9A 4C6SA 3DOEA 3PFFA 1VGQA 4TTRA 4BKRA 4IHQA 3TRJA 5AYVA 1P31A 2R6CA 1XNJA 1EYZA 2OESA 3THSA 3AYZB 3IVXA 5K1ZA 4GRIA 4L3OA 3UAXA 4ERNA 5A3QA 1TVCA 3UB4A 1COWA 1UKBA 4BMZA 3H9GA 1KEEB 1Q92A 1Z0FA 3CVOA 3MAAC 1KJZA 4PZEA 4R8LA 3EEYA 3LPAA 1WHTB 2V3VA 1BVUA 2QLMA 2CHQA 2YW2A 1K8YB 1UEJA 2GLTA 2X9NA 1HMPA 4HS9A 4RDHA 4TN1A 2ZUCA 2REQA 4QD3A 3RB8A 3VOSA 1Q2UA 1JDBB 2JFYA 2PZAA 8LDHA 2Y66A 1PNRA 2WJ6A 1PEKE 2Z1MA 4L4ZA 5EWMA 3BGSA 2OUIA 4EG8A 3WGZA 4XDYA 4C7MA 3RH0A 2W0MA 4YAEA 1TUGA 4G0UA 1MG5A 2FX3A 3I2HA 4M88A 1CP2A 1XP8A 5E7IA 2ESRA 3ROQA 4D9FA 5EJ8A 2PRKA 4PZ0A 2D0PB 2IYOA 3DW1X 3JQEA 4UTZA 3GRRA 3RVNA 2DQSA 2OSBA 3TRIA 4H4CA 1W87A 3SEFA 4YY3B 1EX6A 3U4MA 3QJ5A 4N9QA 1UBJS 4E51A 3NHPA 1CR4A 1KE1A 4ABYA 5K99A 4MDEA 4FYIA 2I4RA 1UPUA 3SBEA 2BUCA 1G3QA 4R4JA 2BGWA 4N0QA 5FPSA 3ITEA 2ZRHA 3ZHBA 1TZ2A 3VZPA 2B8EA 1YBFA 4I3HA 1Z5OA 4RSHA 1ZXLA 1W0KA 4PCUA 1D2AA 4ZPXA 3KR0A 3X44A 3QWFA 1GZDA 2GB4A 3A4YA 4JOCA 1KWGA 4UFNA 2Y1OA 3LT1A 4HDAA 2EGGA 2QAIA 1Q1GA 1NUAA 2NMVA 1U1CA 2P5TB 4BMNA 2PVSA 4PEVA 1G6KA 2EFEB 2PRSA 3GJSA 4JC4A 5DRYA 3KV3O 3THXB 2BFCB 1RR6A 4PR3A 4ZGBA 3MJVA 3ZD6A 2E1PA 2VDLB 1VA4A 1YTLA 5F5LA 5C1DA 2BFFB 1S2LA 1SBNE 4TUYA 3EBLA 4DC0A 1HEIA 3FVVA 1DG3A 4F8JA 3J7TA 1BCSA 3A3PA 4BO0A 1MO6A 2PRZA 3FOBA 2PU5A 3GT4A 4GX1A 3TR6A 2JFOA 3GXOA 5IAAA 4DPKA 3LT0A 1GFIA 1AKMA 5D6OA 4HWOA 2OWEA 1WR8A 2P6UA 4OLFA 1Z4NA 1YI0A 2BELA 4LY3A 2O2SA 2HIHA 2H2AA 3QX3A 1VHDA 3B1ZA 3GGOA 3IS3A 2C4WA 2GM3A 2B83A 3VZRA 5BV1A 3GNTA 2HF9A 8MHTA 5A7FA 1CDDA 2WMOB 5JDCA 3Q9LA 2O8BA 1B73A 4V2UA 1T9HA 3VO1A 3L0PA 1YR3A 3CBQA 2V3CC 3ZU6A 3F2IA 1SD5A 5LYYA 3PC2A 2HMAA 3CEMA 1DO8A 1RM5A 3ST7A 1ADYA 5EJIA 1ZRHA 1JDJA 4M8IA 1XTVA 2IX9A 3K0SA 4E13A 2PXHA 3CZ9A 3TMYA 3D8UA 1XTBA 1ZR2A 3PPWA 3GUVA 4F6LA 3E03A 2WJIA 4QREA 5FP0A 1PGJA 1IUPA 3HBNA 3NM5A 3NM6B 4HDQB 5BO5A 3WLKX 2PYIA 5CJPA 3HI6A 5IVIA 4YWHA 4RH1A 2VNIA 3PENA 3EUEA 3JWEA 1EP1B 5THKA 4ZEWA 2XCUA 1NGSA 1VE6A 3GEGA 3K6SB 1ORTA 3UK6A 5JD3A 4YFVA 5GVSA 2HMTA 3WGJA 4HGRA 5DX1A 3B13B 4DA7A 4LJAA 5ILOA 3M9LA 2B1QA 4F2HA 4CKCB 5DM1A 3OEYA 1RXCA 4OGWA 2QN7A 4RMHA 4Z9FA 5ENVA 4B44A 4BXOA 9ATCA 2I65A 3AEQA 1DCFA 1SA0A 3GZNB 4WJKB 5FH9A 3RVDA 3CPJB 4HFJA 5K3DA 4B4DA 1XXHB 5EE1A 2VF8A 1O1YA 4XQ9A 2YRXA 3ECAA 3ICVA 1JZQA 4QDKA 4ZEMA 3KDPA 5JJLA 3LC2O 2BGIA 2C03A 4DLRA 2X0DA 1TTTA 1NP6A 2P9BA 1IFXA 1LSOA 4MPTA 1Q0TA 4X6YA 2GN6A 3K5HA 1ISFA 4V24A 2P2SA 4PTZA 3VJKA 1OFTA 4B31A 1WCV1 3CRRA 4JJZA 3EA5A 3O2NA 3Q8WA 4U00A 4GQIA 4MJLA 1PL0A 5AVRA 1UFKA 1AKQA 1XB2A 1XJCA 2YMQA 3KR1A 3THOA 5EJ4A 2FY8A 1MB0A 3R09A 3BQNB 4OFWA 1R0LA 1WLSA 2DCMA 1H8ED 2CL6X 2OYSA 1UP7A 1PIWA 1MIOA 2WUFA 2VYNA 3ET5A 2IHNA 3ZX5A 1XCBA 3FPKA 2ZSHA 2DP4E 3MJ4A 3QPAA 4XVCA 5HGXA 5D5HA 1Z5VA 1ADCA 4OB6A 2W22A 4C87A 4YUVA 5JD6A 1RPJA 4R2MA 1NUPA 2PNFA 4OXKA 2VZ8A 1EXNA 5GOTA 1S6YA 1P3JA 4MV6A 3W7BA 2QTVA 1Z25A 5M5BA 2A7QA 2UYGA 3A0RB 5T7BA 3SQXA 1T4CA 2HQBA 5DTIA 3MS7A 1SXHA 5F1KA 4DCNA 3PG5A 1KGSA 1KJWA 2ZUDA 1FE8A 1DO2A 2PX8A 2OSVA 2P9GA 3NHUA 4Z0TA 2X9GA 1I5OA 3U13A 2VJNA 3LJKA 2NTEA 3LU1A 5FB3A 4AMGA 4J6EA 1NMXA 1OV4A 3TQIA 2VJBA 2O8DA 2VI5A 1DEKA 1DE0A 1SXJC 4NMXB 1N4DA 3F46A 4IAOA 2C2KA 4KAAA 4A16A 3GUYA 1GVNB 4E3WA 5KJ6A 2ACEA 2MSLA 3QFHA 5TS3A 5DN9A 2QD2A 3DOHA 1C8BA 2BBWA 4J2HA 1TLLA 5K4GA 3CCCA 3KRTA 4IIFA 2ZRAA 1KJQA 1EUDB 3N2GB 4RF5A 2IU0A 2VBCA 1JXOA 1EGVB 2PFGA 4XH9B 1IULA 4R2XA 1RMTA 4RADA 3SM9A 2J0QA 1C7FA 3DE6X 4ASUD 2Y1KA 1IOLA 4C4RA 2RJOA 1RXVA 4ZZ0A 2CDNA 2AEEA 3HUUA 2A1TR 2P9QA 1NURA 1IHXA 1YI1A 2HCRA 3OQHA 4GWLA 4J1TC 4MQ5A 4Z9YA 2XWJI 5BOSA 1KMQA 1QFMA 2OFXA 3BCSA 3OBIA 3JATB 2ZI6A 3W04A 1L8OA 2WJJA 3KQQA 3KT8A 3HVRA 4G9BA 2QHXA 4JVLA 5FOXA 3PFHA 1FY2A 3ZHTA 2B4TO 3FTQA 5EZYB 3STVA 4EGQA 3H6HA 4D8TA 3VMMA 4M8SA 4ZCQA 1DZ3A 3ZNOA 4XIJA 3D8RA 4QXRA 1A8PA 2XXBA 1T8UA 2ZIWB 4H60A 2G76A 4QDJA 2FWNA 3JYOA 3L4BC 4ZVMA 5HP4A 2JB9A 2VP2A 3ZK9A 1AGYA 4I5FA 4AY3A 1PN3A 2YV5A 5JVDF 2HV9A 4JBWA 2FPIB 3HBFA 5KAPA 2EZUA 2GSWA 2JGJA 3KJGA 4OGGA 1HE3A 2AFHE 1J1UA 1R0YA 4DJFC 2HF7A 4CF7A 2VPYA 4LJ7A 4RAQA 3E3AA 3VR4H 2R7LA 4M9SA 4U3JB 5C81A 4M60A 3RR2A 3N8GA 1C30B 4CM8A 1OU0A 1ZJ5A 2HQ1A 4S3MA 1KIMA 1PFYA 2IQ5A 1HDXA 3CW9A 3LPMA 3LW8A 3Q7SA 4P81A 2D2XA 3E05A 3NHAA 4WPGA 2JASA 4XKJA 1JKJB 3DGFC 2W4IA 3TLMA 6ADHA 2D7JA 1P81A 5IM4F 2QUAA 4EI9A 4JR2A 4RPKA 5AVYA 1FP4B 3RJMA 1U1GA 2PUJA 3KSUA 4OV6B 5FUXA 4MV5A 3RWMB 3SCZA 4CQJA 3O8CA 2XUAA 3HJUA 2DHDA 5K4AA 2CVHA 2HYDA 4H0CA 3TSOA 1AIPA 1HG0A 4ACBA 1P7VA 2YNMD 3LXMA 4CTKA 3PXXA 2Q5JA 3BERA 4MA0A 4M8NE 1I4LD 4RFVA 1HZJA 3A2KA 3TUZC 2ZRLA 1QF6A 1D0VA 4HTFB 2PANA 5E3HA 1YR8A 1AX9A 4HQLA 3IP3A 5IUNC 1W48A 5C1OA 4OSEA 4L9RA 1Z3CA 1P2GA 2C4NA 3VYSB 2QSJA 2GPNA 5SYNA 3X1XA 1KTVA 1FXWF 1GKUB 1T6BY 1EJBA 3IPCA 1UCFA 4H6WA 1U8YA 1PL8A 2BLNA 2HA0A 2IXFA 2WK1A 4YONB 3IP8A 2CZGA 2YQ4A 3AUKA 1N2ZA 3DC2A 3OCWA 4U4AA 3PHGA 4OHBA 4EMSA 3BREA 3E4DA 4EX7A 3BMOB 3Q3VA 4UNPA 4F3CA 1OMOA 2Z5FA 2IP2A 1WMFA 1W2HA 3VV2A 1SCAA 1NW3A 1SZPA 1VB3A 3KDSE 1PUIA 2XZPA 3EVFA 1DTWA 2BFDA 3OTHA 4GMXA 2CCKA 1GPUA 1HYBA 2QN9A 1EK2A 2RHBA 5DHAA 3LA6A 1UZMA 2XVYA 4TXNA 5EA2A 3SZMA 2JL1A 1SBHA 1MORA 5HMLA 3RIEA 2V1XA 4WLUA 2FG5A 3FTNA 3L1UA 4R1PA 5I5EA 4NQRA 2OGZA 3NNDA 4GX0A 1E5DA 3M1AA 1U2ZA 2WLTA 3K7EA 4P4SA 3F1KA 1RXSA 1SEVA 4E6EA 2GK6A 4B84A 5KJFA 4CU2A 1KFBB 2D5IA 3SQDA 2OBXA 2NQTA 1NQWA 1H2WA 1RKBA 1YZGA 2W6PA 5E4YA 3RYCA 4EMTA 2R8ZA 4I55A 4ZI7B 3AILA 4R1OA 3DCJA 3R5SA 5AKIA 1BXGA 4IKPA 4H4DA 4LOHA 3T5AA 4YQZA 2B2CA 3V4FA 2NXNA 4NJEA 4NAHA 3OQNA 1LBQA 4QXQA 4BQSA 4MQUA 3ETDA 3OZUA 2L17A 3ABIA 3GJ7A 3L7KA 4HLQB 1QYVA 4NY1A 4LVNA 4F12A 1K5HA 5D3MB 4D4HA 1M0EA 1QAOA 3M9WA 2IYTA 5BURA 1A95A 5JNLA 2GPJA 4JROA 4P3YA 3TTTA 3ON5A 3Q72A 5FTJA 2PEYA 4FYMA 4FR0A 1JN0A 4BX8A 2R2GA 9ABPA 4F11A 1OAKA 3L82B