1IHPA

Structure of phosphomonoesterase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
438
structure length
434
Chain Sequence
SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Phosphomonoesterase
molecule keywords PHYTASE
publication title Crystal structure of phytase from Aspergillus ficuum at 2.5 A resolution.
pubmed doi rcsb
total genus 149
structure length 434
sequence length 438
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1997-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ihpA01
5HTKA 3NFYA 2P75A 2P9ZA 1C81A 1QHFA 3IT2A 4EMBA 1DKQA 3DB1A 1FBTA 1QWOA 5PGMA 5CX4A 3K4PA 4D4KA 5AJYA 2WNHA 3K4QA 2A6PA 1E58A 1YJXA 5CDHA 2H52A 2RFLA 2YN2A 3OI7A 1T8PA 1SKAA 2P30A 1DKLA 2OWEA 2OWDA 1UJBA 3O0TA 2P9FA 2H0QA 4IJ6A 1ND6A 1UJCA 4QIHA 1SK8A 4EO9A 2P6OA 5CU7A 2A9JA 2EKZA 2IKQA 3F3KA 2P6MA 3D4IA 4GPZA 3E9EA 1BQ4A 3EOZA 1RIIA 3FDZA 2YN0A 4PZAA 4ODIA 1QFXA 2HPAA 1SK9A 2EOAA 3E9DA 4GPIB 3QPWA 2P9YA 3MBKA 2P2ZA 1BQ3A 4ARSA 4E3WA 2QNIA 2WU0A 1DKOA 5AK0A 1EBBA 1TIPA 2AXNA 2F90A 2WNIA 4FDTA 2H4XA 4AROA 3NTLA 1NT4A 4ARVA 4PZ9A 1SKBA 1FZTA 3ZHCA 4D4LA 1XQ9A 1BIFA 2BIFA 3BIFA 2P77A 1K6MA 3QPVA 4MA4A 2ENUA 3KKKA 1CVIA 3LNTA 1DKNA 1H2FA 4TSRA 2HIAA 1RPTA 3IT3A 2P79A 3D8HA 1V37A 1V7QA 2DWPA 2DWOA 1YFKA 3EZNA 3F2IA 2I1VB 2H4ZA 3HJGA 2EKBA 2P78A 1H2EA 3R7AA 5AJWA 3GP3A 2GFIA 3GW8A 2ENWA 3PGMA 3DCYA 5AJXA 4JOCA 4D4JA 1E59A 3C7TA 4JOBA 1C80A 5HR5A 4HBZA 4ARUA 4IJ5A 4FDUA 4PGMA 3QPUA 2PA0A 3IT1A 3IT0A 3MXOA 1ND5A 1C7ZA 3FDZB 2P2YA 3LL4A 4JODA 5AJZA 3D6AA 1IHPA 5AJVB 3GP5A 1DKPA 3FJYA 2HHJA 4D4MA 1DKMA 3E9CA 1RPAA 3LG2A
chains in the Genus database with same CATH superfamily
3A0RB 2ORVA 3RQIA 3E1SA 5LZ4A 4MDEA 1R0ZA 1AUVA 1IWPB 2DE0X 1E6EA 5CYOA 1J97A 3AJDA 3DR3A 4UZEA 1W4LA 2EDAA 3HVKA 4I5DA 4GR5A 4ACAA 1LDMA 4L08A 1X7DA 4AIIA 4P92A 4N49A 3MOIA 3UH0A 1F5SA 2AI1A 2ISSD 3AHGA 3AUJB 4BO0A 4F5ZA 4DR1B 1BROA 1BGVA 4BEVA 3PDWA 3BGVA 2BCJQ 1Q0LA 4UHDA 1C3JA 2W0MA 2HLHA 3L5KA 4UHFA 3ZJ5A 1PWZA 2QAIA 2C9ZA 3QQ5A 4Q34A 1MFPA 1UJ6A 4GZ3A 4BQSA 1OC2A 1SZCA 4YWHA 3ZI0A 1M2JA 4FEAA 3D43A 1TZBA 2HN9A 2JGMA 3B51X 4K28A 4X45A 5E3HA 1U98A 1ZHOA 4ROSA 4L5JA 3U7GA 3BZWA 2GUGA 2ZSBA 4JYPA 1CJSA 3IVGA 4POAA 4HAIA 4KRXA 4GWKA 1KDYA 2HTFA 3O93A 4BO4A 4JITA 4R83A 1RWVA 1OXKB 1U6KA 2IBMA 1CS4C 2PMEA 3VZDA 3LXUX 2PGDA 5TY0A 3W05A 4PE5B 4N5HX 1Y6ZA 4UAUA 4XD2A 5DNVA 1MV8A 4UD6A 1TU4A 3CVWA 2CGEA 1SWVA 1T2NA 3R77A 4JMLA 3MAGA 9ABPA 4JJ4A 1Y0BA 4ER3A 2FDCA 2L17A 5ICCA 4L1KA 2ZT5A 1NLFA 4REMA 4PX5A 4ZZ3A 2GCEA 4X6YA 1TYAE 1G98A 3ZGLA 1J99A 2WJ3A 1QK4A 2FWBA 4KPFC 4D74A 1SBQA 1EI9A 1N5IA 4DJJA 1RQPA 4GM4A 4DMGA 4BBAA 1OLXB 4R68A 2IS1A 2PFSA 1JIUA 3HCEA 3DR5A 5H0IA 1JPNA 4F71A 3W9UA 3TM5A 4LDAA 2Y27A 1H2FA 2YVAA 1SCBA 3P9IA 5D6OA 1BHSA 2XTMA 3CLSC 2JCSA 1X14A 2A1IA 1SPXA 3B1XA 2YOHA 4GVLA 3A1VA 4JB3A 3A9SA 3VKVA 3VR1A 4BNMA 3KCNA 4AAYA 5MDHA 2O0HA 1V37A 4EG6A 3DEYX 4B2LA 1KDPA 1US8A 1VBMA 4GT1A 1RXSA 1O96A 2FEMA 2JA2A 3FI9A 4UUMA 1G5RA 1OT3A 1Z7WA 3OOWA 1TMGE 3G59A 3EDRA 2H0AA 4QAQA 4X9XA 1YJBA 4XR9A 3W06A 2TSYB 3ENQA 3HXMA 2DHRA 3Q3HA 2YNMC 4JL5A 3UBMA 2CSUA 2HF7A 1UZLA 1J8DA 1QHEA 5J2UB 1AK2A 4ARUA 3K70C 4BFUA 4BQEA 3VMFA 5CTAA 4DNOA 1K08A 1E77A 4N3AA 3CB4A 2YFKA 1TQHA 3TLJA 3A9CA 2XNDD 1QU3A 4HDQB 2V8OA 1IG3A 1P0MA 4JODA 3CNBA 2PXHA 1RWBA 3E84A 2KWIA 2K5UA 3EZ7A 3DEHA 3GRPA 5F7OA 4UREA 5B6PA 4KBYA 1AQLA 4E5NA 2PO5A 3PNPA 2VBCA 1XCJA 3ZUGA 1W6RA 1QCZA 3GEGA 4IVNA 4IFEA 2BYTA 1SKYE 3GLFA 3TR6A 4LJKA 3DZDA 4AZ3A 2O8VA 1KSHA 1B8UA 1W88A 4JI6B 2AUTA 3LHDA 3PZBA 5JH7F 1P91A 1LLQA 2YTZA 3DFMA 1UBGA 1I01A 2QTLA 3DCJA 4PX3A 5AIAA 3SE0A 1DXHA 3O75A 1GM5A 3U9SA 2D4AA 4LISA 2NTNA 5DNDA 3N53A 1GSOA 1J1ZA 1TW2A 4QATA 5LOVA 3D6FA 2UVDA 4F93B 5G53C 4Y2PA 2M32A 3ETNA 2OGZA 3IR5A 2GK7A 4N6OA 4N48A 4LTNA 3GEMA 3UA4A 1RZUA 4LYFA 4NBUA 2JFZA 5DM2A 1SC1A 2IWRA 3V55A 1Z4JA 3B3FA 3QUAA 2ID9A 1P1IA 1EXNA 4YRRA 2H85A 4QFBA 1JDBB 1XQ6A 1LJLA 2ZBEA 1MKYA 1F6DA 1PS0A 3A1EA 3VC1A 3FKSD 3KUUA 1USGA 3N8GA 1MX9A 3ZBUA 1YMQA 3GAZA 4KIWA 2IDKA 4EBBA 1DRKA 2OGSA 3TPCA 4B3RB 4HJRA 1MW8X 2HPAA 3BXOA 3AX6A 4J0QA 1P2TA 2AKAB 2ZJYA 3CX6A 1YR2A 1A5AB 1SQ6A 2ISQA 4M1QA 1HI9A 5HDQA 4HUQA 1DDIA 4QUGA 2IHTA 2RGNC 1W0CA 3CFYA 4EJFA 5K4HA 1P4RA 4MO9A 1LPNA 2I6SA 4C21A 3CVVA 4F21A 3DHWC 1QHGA 1T5LA 4L9AA 3EG5A 1YZTA 1B8OA 3L1IA 1PT9A 1EVIA 2L18A 4I8IA 2HI0A 2WHEA 2Y0PA 5KWSA 4D9MA 3M9XA 1IZYA 1O7JA 3IV9A 2QUBA 3DF9A 3K94A 1NKSA 2HA5A 3GGSA 3GQBB 3OZEA 4MW0A 1BXGA 3E2IA 5F1OA 3WKBA 4OD0A 1AE1A 1K8ZB 3KT8A 3F78A 2CMGA 5EMJA 5J59A 3QY9A 3U5ZB 4AI6A 1TUBB 4KRFA 1N2SA 1D4AA 3H5RA 3PU6A 3MILA 4BJ6A 2PUDA 5GOTA 2D4HA 1ETUA 2IHVA 3LBAA 5L3ZA 4WXRA 1A7UA 1F0NA 1I6MA 1TPZA 2W22A 2X5KO 3IP9A 3ZD7A 1SUBA 2HRZA 1P73A 2WKSA 5ELMA 1HE5A 1YR3A 2ZBFA 2J7KA 3STTA 4JKIA 4KWHA 3SYMA 3K96A 4CKYA 3G5UA 4IHQA 3IIMA 3U49A 4RTRA 4RK1A 1IN8A 4HWRA 3GPIA 3WLLA 2RC5A 2JIQA 4QBHA 1FRVA 2QLMA 3WGZA 3N87A 3FG9A 2YVUA 3F90A 4N82A 4MI9A 3NAZA 4LUCA 1T3ZA 3WKDA 5ALMA 1CRPA 4DWJA 4EX7A 2HRDA 4D3FA 3TW8A 5AI5A 5FOSA 4G1VA 3UWSA 1FQOA 1UT5A 2WYIA 4PTYA 5UKDA 5AMXA 1XTQA 5I9SA 1YS9A 3O1LA 5JJBA 4BO6A 4QX6A 3IT0A 3RUPA 3CUWA 3WA7A 3O8DA 4BJ5A 4ES6A 5HOQA 1BW9A 3NW9A 4W5RA 4ZU6X 2D5CA 2PRSA 1R4MB 3K8OE 4FHGA 4Y7CA 5F4ZA 5IVDA 3SZOA 1Q0HA 3MPOA 1P5ZB 1TM4E 1ZH0A 2JIRA 4FN4A 4Z1OA 3B5IA 2B4TO 5CNMA 1IY2A 3GZ4A 3T1YB 3W9YA 2FWMX 2GWHA 4AW9A 1W4AA 2QQEA 5KTRA 2BEJA 4IGFA 1A1SA 5MN5A 3KB2A 2I1LA 5JPCA 3WOVA 3ZJUA 3BJEA 3DEKA 2J0SA 3MMSA 4IJUA 4TL7A 5FYDA 2F3UA 1Z56C 1MG0A 1KMHB 1PD0A 1XRJA 2R7AA 4HDMA 4WA8A 4BN0A 1QTIA 5DHAA 4PO3X 1P4GA 1G8MA 2AZTA 1P4SA 1YT5A 3BE8A 3BRCA 4XPZA 4GOXA 5AHKA 4MO2A 4F91B 1WDKA 3QBVA 4C0AC 2O0LA 1WOMA 1J25A 1XDGA 2DY0A 1X6VA 2ZUBA 4NOMA 3AW8A 3G82C 3GXBA 4KXFB 4DADA 4GL2A 1DPGA 1UJBA 2GXSA 1Q50A 2QD5A 3AM4A 3EIXA 2R1UA 2VEDA 1EVYA 4YCNA 1R9GA 2ZB3A 4PFSA 1KO4A 5TGDA 3VSAA 1KMMA 4NV1A 4DMUB 1V2GA 3ZKWB 1U90A 1OPRA 1X1BA 3AV0B 3FSGA 3W7AA 2EKPA 5K3SA 1VLMA 1RRPA 3L0DA 1T35A 2R96A 2QZSA 3E82A 3NH6A 4EA9A 2VR1A 4ABTA 1XROA 1I8TA 3DBLA 3BEDA 3FTEA 2JPDA 5BNZA 1CEYA 5T5QA 2W6PA 3H2IA 5GINE 4MJXA 4C1NA 2FPSA 5LDHA 5I3ZA 2OTCA 1L4KA 4RY0A 1MB2A 3CY6A 3GNTA 4CTNA 3EGCA 3GDWA 3CSSA 3I1JA 1DIAA 3DYIA 4R8VA 3MCTA 2XMDA 4MGZR 5LQDA 3SPXA 2Q4DA 2GH1A 3MWKA 4GIBA 5B1HA 1JG3A 4PS1A 4K6FA 4ARVA 3NTUA 1YB7A 4KQ9A 1MFZA 5ED4A 4MV4A 4A6EA 3LLCA 1GGJA 3SLGA 4YB8A 2P0EA 2CMFA 4ZMBA 2YWGA 1P1KA 4O2AB 2JRCA 4MUEA 2OA0A 3R5KA 3ZI4A 2F9FA 3ZD9A 2UYHA 1B0ZA 1VOTA 2XTJA 4IJWA 2MIIA 3K09C 5BXQC 1O6FA 4IV8A 4U0KA 4BVBA 4GE0A 3LX4A 5LQNA 1FSSA 3JWJA 4U4AA 3G89A 4YRLA 4JFRA 3CN9A 4O0MA 4ZI7A 2F67A 3S6JA 1HOXA 3FIJA 5CGQB 4R1TA 4HTFA 3VISA 1WXXA 2IUYA 3ASUA 3R7AA 1T5TA 2X77A 1YB2A 3KJIA 1QIIA 2WMOB 2X13A 3DNPA 5ALYA 5JAOA 1LDYA 3H9CA 3S7TA 2JB9A 4F12A 5C51B 2Y1WA 3KTDA 1THTA 1C7EA 1XALA 2A88A 4E0BA 1GYPA 3HI4A 2L0XA 1GPNA 2HIMA 3P19A 2RI0A 2O2JA 1P17A 4M8SA 4E09A 1XRRA 3NEYA 3QXSA 5JNVA 3TKYA 1A0OA 5AW3A 1QP7A 1QQAA 2FW6A 5HGJA 3OFJA 3BMQA 1CUXA 2ET6A 4IDAA 5AJTA 1P6XA 5JNSA 1RC1A 4Y98A 3OMLA 4C0BA 3UOGA 4OLHA 1QV6A 4PYNA 4Q18A 1MC4A 1RTKA 3BMCB 4OQXA 4R84A 1UKYA 1U1GA 3IP3A 1M1NB 3IE2A 1OBCA 4YJHB 2CNOA 2HF9A 3L0PA 4PBSA 3MQFA 2C5AA 4AMYA 1VHDA 1Y3HA 2QRUA 3LECA 2IWHA 2A58A 5CT6A 4B4VA 1EHCA 1SUIA 3DMGA 4UTPA 4G5XA 4IM7A 1DRWA 4S1WA 1YQXA 3N8IA 3LFUA 4A03A 3ND5A 3NEAA 3GA0A 4FBGA 4KQHA 1E4EB 1JAYA 1Q74A 1XVTA 4ZODA 3RANA 5EJ2A 2BM0A 4KNVA 1FNBA 4HYEA 5DEIA 4EITA 5LJLA 3DE6X 1MAVA 3O8OA 1R0LA 1KH2A 4D9KA 4LZLA 5CDHA 3RU7A 1TW3A 2ZTUA 2PUVA 2YJTD 5A9SA 4IQGA 4LAFA 4G8DA 3KIPA 2J5KA 3I6IA 4GZ6A 4Q0MA 2F1HA 4X1YA 2POCA 4QPPA 1EUZA 3RVOA 1KDZA 4EHIA 3D6HA 3L43A 1CBUA 2B6HA 1BA2A 3HKBB 3F3YA 4MX8A 4EP1A 2XQIA 2ZAOA 1X70A 3O26A 5IN4A 3WWZA 4KE9A 2HREA 1W76A 4IV0A 2XYHA 3MN1A 3DLIA 4EPVA 1GEEA 1V5FA 3RYHA 4HZIA 2UYYA 4U2EA 2M1ZA 1SQGA 3OZCA 1AZSC 3PEEA 4TWJA 5BSWA 4DR3B 2G1PA 4DCJA 1V9LA 2ILTA 4REQA 4U6NA 4ZQEA 1NXXA 2BFDA 4O2BA 2R85A 4GNKA 4ZANA 1JR6A 2HJ9A 3GROA 3A6EA 3GZTB 3OSUA 1GG9A 3TNLA 1EFKA 2FE1A 4OQEA 3B3JA 2E5WA 1YMUA 1FUKA 2IPNA 3V1LA 2DH5A 1Z82A 4ND5A 5TPWB 5HWSA 3CG4A 3EEQA 3HNPA 2VJBA 1ORRA 3AI7A 4KFRA 4CWAA 5JASA 5FLXA 3P26A 3W6ZA 1IZZA 3AY0A 3DQPA 4TL6A 3CHYA 2IYOA 3L7CA 2JCGA 1P19A 1G8SA 4TQAA 2YJZA 1MIHA 2ZSDA 4Y6GB 3ZY4A 1HDEA 1K6MA 1PN3A 1A9SA 3JX9A 2QTVB 3X1DA 4YCBA 2WU3A 3CLRD 3KYDA 3E3LA 4B3SB 5HRAA 2G9UA 3QXJA 4UZFA 4BJHB 3VYRB 1W5TA 4FZRA 1M74A 3AJEA 2VYVA 2Q9CA 2ZKLA 4WK4B 2CLKB 4BNJA 1TAHA 3JRNA 1KFEB 3QVJA 4DY4A 1H69A 5CFNA 3GD5A 2VNAA 1AT1A 4IJVA 4YJ3F 3WYCA 3DEZA 1QUFA 4YXWD 4A0SA 2OXEA 1N0IA 2LDXA 1QF9A 2VQ6A 2VOEA 4HMPA 3D4OA 3DHYA 1K6JA 4HUJA 4QFMA 2VF7A 1KJQA 2YJ4A 1WR8A 1T9BA 2QTNA 2ZJ0A 5ECDA 4QEDA 1YUMA 4XKJA 1NULA 3K05A 3WK7A 3QX3A 4QYWA 2VHXA 3UN1A 2BELA 3SHTA 3PENA 1PX2A 5CHEA 3RSCA 2C2YA 2JJ2D 3AMVA 4NARA 3RLFA 4V3BA 5KAMA 1X7YA 3L7IA 2E4YA 4XIGS 4I50A 3CW2A 1WX1A 2Q3CA 3I4LA 5EWMB 1ZNZA 5CH5A 1ORIA 2AOUA 3GGGA 2XIJA 1FP1D 5ELLA 2CCGA 5H80A 3OE7A 4UKDA 3EVDA 4JQYA 1CK4A 3M6MD 1BFDA 1SUPA 2XMCA 3GP5A 2ZUDA 2X41A 1P60A 3SMVA 3EQ7A 1J1IA 4GG1A 1F3LA 2BJHA 4KVZA 3NC0C 2XCRB 2FEXA 2E4UA 4RMHA 1RBYA 3KSRA 4O4LB 4RCYA 1XRPA 5AW9A 2VP6A 4FB4A 1HT1E 3BRWA 1N1GA 1PR5A 4TTIA 3FGNA 1DJQA 3I9NA 3DZBA 1Z0UA 2QUKA 3RTGA 1YCGA 3U3ZA 1DC8A 3AKEA 3P0IA 1W73A 4MIEA 1VL1A 4NU6A 5FL3A 3S2EA 1YUNA 1DE0A 2AN4A 4JBGA 4NZZA 4ZVKA 2JKZA 7AT1A 4RPIA 4NTZA 3TOCA 4RIHA 3VR5H 2PUCA 3NGLA 1DOHA 4JA0A 2X3UA 2DBQA 2GBPA 1CWUA 3CKYA 4BMPB 3FSEA 4IXDA 1ZNQO 1AQJA 1GU1A 3S2YA 4LSWA 4EIWA 4OAQA 3UJCA 4Y6PA 1CF4A 3THXA 2QPOA 3DO8A 1PCXA 4WUTA 1C9KA 3BSWA 4QD3A 1R64A 2LTAA 4DMLA 1FUYB 3O0TA 3GNLA 4WZZA 5L53A 1C8KA 1N8NA 3PFHA 1JBQA 5CURA 5BN5A 2F3SA 3T1TA 4JI2B 4D5EA 1TYDE 3RHFA 1GKLA 1L8OA 2BEUB 2P6OA 1MG5A 3HLYA 4IIEA 4FEGA 5DSZA 4YV7A 1T36A 4R2JA 1CR4A 1A7KA 4HFNA 4ZC8A 3EOZA 1DQSA 4BFWA 1CDEA 2XR1A 4S1OA 2AV6A 4GWLA 1EH5A 1FYFA 3W2IA 5BW8A 4CIVA 2VPIA 4L72A 4AP9A 3C3PA 2HB6A 3C3MA 3HM9A 2BFMA 4ZDIA 2P7IA 3ETCA 4JJEA 2CWWA 5KIAA 4PFKA 3D7KA 3JVDA 2CUTA 3K5WA 2ZVDA 4E70A 4AMVA 5JSQA 1JDUA 1U9JA 3X2EA 1USUA 3M6IA 4ITRC 4PSDA 5IZCC 1NDHA 1Y4UA 2O1WA 3OZAA 4UU1A 1SZPA 3LRPA 1PT8A 4JEUA 3JQ8B 4WKPA 1G2QA 1UMDA 1YJCA 3F3MA 2DGDA 3ZD8A 4EPYA 2PLFA 2DH6A 1UBLS 4X8MA 1CY8A 5JEEA 5KCZA 2VBGA 2YWHA 3H1AA 4OQ4A 1CE8B 4OQLA 5KYVA 1S96A 2O4CA 3O84A 1H42A 3DL2A 4IO0A 3AWDA 2JFNA 3GBPA 4WMLA 2ZB7A 3FOWA 3L1HA 4L3VA 4Z86A 1S2LA 2EF1A 1DT3A 3UJ6A 3CKMA 2ZJFA 3EFHA 2WMNB 3CH4B 2RBEA 1J5PA 1B00A 2K87A 3OQ1A 3PWSA 2EP5A 5CXXA 3KQUA 1H05A 2FHSA 3V80A 5FA6A 4I1IA 2RGWA 1USIA 4LXTA 4AZWA 2Q0XA 2WWTA 5H02A 3AIOA 4QG7A 4UUOA 3D9QX 1U8EA 1U3FA 3WLQA 3TLMA 4QUJA 4XGIA 5AK4A 1S3IA 3WLEA 3PKIA 1JHOA 3PUWA 5C7IO 1E18A 4CLHA 5FUXA 2NM0A 1RM0A 4B3FX 1QOPB 4OBBA 3BD8A 4RD2A 1GSAA 3T1VA 2BI8A 5FEUA 3R40A 2WQ7A 4BU0A 4A82A 2IZ6A 1N0WA 4LF6B 1NLYA 1Y9AA 3IDOA 5JXGA 3AB8A 4G1MB 2G0TA 2V7PA 3TXYA 2DTXA 3OFKA 1MJGM 1Z38A 1KHHA 4MULA 1FDSA 4YRZA 2VT3A 3HDQA 3QOYA 2Y4OA 3C4VA 3U40A 4BBPA 1GFWA 2BUCA 3KJEA 4TTRA 2JGRA 3HA5A 4IEIA 5GV7A 3PNLA 4G0VA 3I1YA 1K1EA 1TUIA 3WLKX 3Q7EA 1FXWA 3KD3A 3T5GA 1IZ7A 2RI1A 1U7ZA 4OK3A 3KJGA 4UMEA 1CUHA 2C5GA 5B1SA 4TV8F 3VO1A 1WPXA 2DPHA 4AG6A 4LV8B 2YXPX 5FJJA 1O4VA 2Q4TA 2C4TA 4MWBA 1JEOA 2ONJA 4P36A 2FSVC 3BFJA 3IDQA 6YASA 4KYVA 3NYRA 1P0CA 1MUUA 4KE7A 4B6OA 1LI4A 1E58A 1MQ8B 2QM0A 3MVEA 3N28A 3OHPA 4H18A 1VKZA 3WVNA 1G1MA 3TX2A 4RJJA 4C4YA 1ORVA 1FXUA 2PD3A 3T99A 1I5EA 3HJNA 2GKSA 2PMWB 2X40A 2XA2A 3KEMA 3G2PA 4LMAA 4CTKA 5CBPB 1U2EA 4I1RA 5TS2A 1NGSA 3PUYA 3W78A 4MPTA 1B74A 1E4OA 1T15A 1I3NA 3KQHA 1US8B 2AUMA 2W90A 1QCYA 1E3JA 3FWZA 3GEHA 3HEBA 1THMA 5CHYA 1O96B 1L4UA 2AHRA 2X14A 1XPUA 5CCXA 3KHUA 1O9HA 2IFTA 1V9SA 2KB0A 1D7OA 1T5IA 2G40A 4KVAA 5J58A 4K9DA 5BSTA 2WWGA 3G8CA 1EK0A 3EVTA 4M76B 2BTQA 2PXAA 3BF8A 3EQ2A 4PZAA 1PJZA 1U7DA 2PY6A 1KVRA 2AVNA 3COYA 3I37X 4PQRA 3AFMA 5HK8A 3BL8A 5EFOA 1DC3A 3KVNA 3ND6A 4IOJA 2IC5A 4WCDA 5IRCD 2OFOA 3EXG1 2ES4A 2QWXA 2BH9A 3ND7A 2Q7DA 3EODA 1UT8A 3RFXA 5IU6A 1CRLA 4BNFA 3A2LA 2WU0A 5EP3A 5F3WB 5EZ5A 4QHSA 5JXIA 2Q1SA 1CFZA 4IDOA 2RGGA 1RBMA 5KWVA 3ZDZB 3GP8A 2DFVA 1M1ZA 1MO5A 4GOLD 4Q7QA 1S8AA 3RRFA 1N3IA 3JQ7A 5CIYA 4F6LA 1D4OA 4DBLE 1NZDA 2IQIA 3OZIA 5FOXA 1SKMA 1XLTC 4Z54A 2DUWA 2C3OA 4MGIR 3GLFB 2VSNA 4TUYF 3AUTA 3TTYA 4AZ3B 1X0XA 5C46F 2AR9A 5BR1A 4W7SA 4CLDA 5ALRA 1OT5A 1GZ3A 2PX3A 2Q07A 2QN6A 3HO6A 1S2GA 1W88B 1Y37A 4QGBA 3WHLA 5AKYA 5E4JA 5KINB 3K53A 1UDRA 1OV4A 4YIHA 2D8MA 3OFSA 4MSUA 2G0AA 3H87A 4YP1A 2V7QD 2B9VA 2RBGA 2MSKA 2Q3LA 3LMKA 4I4TF 5EXEA 1Y6FA 3DPIA 1HETA 2C07A 1ZBQA 3TEMA 5B12A 1XNRB 1K6EA 2YJ3A 5LOVB 4PYJA 4MJ3A 3GB9A 4FC6A 4A4DA 4D80A 1KQPA 4JB8A 3U7QA 1IB6A 1O9GA 1AURA 1YJQA 3PR2B 3K72B 4IIBA 4KQIA 4MAFA 3SKVA 3ZS9A 3NM6B 1BMQA 1JJFA 2PVCA 4LWPA 4BO1A 4I36A 3E48A 1FUEA 2Z30A 3EN0A 4M1WA 3V1MA 5L6MB 3E7FA 4BJ3A 3N0TA 2XBLA 3O82A 3TQTA 2C42A 1F14A 1ZLXA 1CDOA 3P9ZA 1J9EA 3FDJA 3F73A 1FMFA 1CLUA 1HMYA 1Z5WA 1AKYA 5EI5A 2CNKA 4CFYA 2E21A 4YYZA 3LIPA 4Q7JB 4CM8A 2IS6A 2I78A 2FVXA 2JLBA 1GPLA 4BRSA 1KY4A 5BWMA 1ZGJA 2XZPA 3R3XA 1XCPA 4HUQB 5LUBA 4W9RA 3V4ZA 1M76A 2ZIGA 5F1KA 1DO8A 1PEYA 1U3GA 1WZEA 2XUOA 5IW8A 2QRPA 2XH8A 4P8RA 4PGAA 4AT1A 4ESHA 3RVLA 4ZT4A 3GA5A 3EQ6A 1FP2A 2YMPA 3F9CA 4KLAA 4Y2UA 4F8JA 5CFRA 1NC3A 5BP7A 4RD4A 5E6RA 4MUXA 1M6NA 4BASA 4U7DA 2WUDA 1C1XA 5GADl 4B47A 3I28A 1BXGB 2YCBA 1NU6A 3GHYA 3KPJA 5EC8A 5C4IA 1M0EA 4HYTA 3OZBA 2WM2A 3AYZB 2WQ6A 1KQNA 3ZWMA 4H9GA 4HPWA 1D04A 1AMUA 1FFAA 1JVSA 4PAMA 4BMDA 5U4QA 3GLHA 3NBKA 1URPA 2CL0X 2WF8A 3LOUA 3BJMA 1MXHA 2B4AA 2CMDA 1H2AS 3BREA 4IEFB 4HAUA 2ODEA 1YRBA 3L93A 3MJTA 3MOGA 5DLDA 1DV1A 5GONF 2XOKD 5BOVA 4DQ0A 2ZYGA 1QTQA 5LBTA 4Q3EA 3SP1A 3O73A 3UMMA 4D4GA 1KTIA 5H7XA 2P8SA 4WLNA 3MYYA 4LJSA 3IVXA 4EYSA 1G2OA 1NJ5A 3LWNA 3BA6A 1QFXA 3JQ9C 3VPFA 2DTEA 2WD8A 4H0NA 3TW8B 4C4PA 3SZ3A 4HAXA 5EIOA 1B26A 1ZQ9A 2NUAA 1J5XA 4HTAA 4LYAA 1AH2A 1FQKA 3QX8A 3RC3A 4ARIA 3M5DA 4PHTA 3R8CA 1ONBA 2O50A 3CUKA 1FDWA 1UL1X 2N42A 2W4IA 4P38A 5DCWA 4CMBA 4DC0A 2YQ5A 1WPGA 1BW9B 2EWWA 1Z0KA 3DM5A 3PIDA 4Q9NA 2NZ8A 2F00A 4Y9RA 3TNDA 2VSXA 3FVQA 3VO8A 4DLAA 3NTVA 1EGMB 2QYHA 3C24A 4PAQA 1NBMD 1D2MA 1FZTA 1IM8A 3ZLJA 1YZVA 2NTEA 2X9LA 2Q45A 2WSSA 3WK5A 4EHLA 3UTCA 2BMWA 1OREA 3ZCUA 4TTJA 4OHWA 3LA8A 3HCFA 1VQ1A 2Z43A 3A1NA 3OQIA 5EN4A 5K6AA 2FJ0A 4BX9A 5TR9A 2YQ4A 1K97A 3RJMA 1W85A 1CSEE 1G17A 1L7RA 3WIDA 2EFCB 5KNBH 4C0QC 3A1UA 1QZZA 4FIDA 1FOEB 2AXQA 2V6FA 3K92A 3R7DA 3T7DA 3EDMA 1V2HE 4XX1A 1M2KA 2LZ0A 1MGPA 1RHUA 4MQFA 5KPDA 4JASB 1LU9A 1QV7A 2W5UA 1J49A 3CURA 2AQKA 1DAIA 4LK3A 4MCJA 4Q4HA 2GFIA 4EY8A 3U09A 5JAIA 1NN1A 3R74A 3KPWA 4QQKA 2PT9A 3Q1KA 3MTDA 2PQ2A 1LI7A 4QGHA 1ULHA 3ANTA 1J0DA 4IFBA 3W8EA 2PKRA 3EC1A 3T9CA 3ZZMA 1XJWA 4EVIA 3P45A 1DELA 4HFRA 5IVKA 1S2MA 1A8QA 4YQZA 3SVZA 5U9CA 2HAEA 2IYEA 3PHJA 2HJVA 2PZ8A 4NLLA 4Q3KA 1JILA 1OFUA 1Z28A 2HK8A 1NUHA 1EINA 2WYOA 1ZMXA 2XAUA 3CIOA 4NG4A 3H2ZA 1C1YA 3NLLA 4OHPA 4Q48A 2FSGA 3R3WA 1BX0A 3EY4A 3M33A 1J0BA 3DBLB 13PKA 4EA6A 3C85A 2DJ5A 4B82A 2V65A 3PQ6A 4JXJA 2WMDA 4ACBA 1W6UA 1OBOA 2W2QA 2X8WA 2WW8A 3R23A 1IBMB 3PHHA 3OBIA 2PPLA 2X0KA 1BKDR 3OCZA 3LLMA 4CHTA 2FF5A 1GZUA 3EX7C 1BKSB 4FFLA 2XNHA 3OTHA 4FFNA 5PGMA 4D8TA 1BVHA 1F9EA 2X3FA 3D6NB 2HDOA 3DE7X 1JEQA 3P9RA 2ASVA 1DJLA 2VDRB 4ZRDA 3W7VA 3ZNOA 5AVQA 4RTPA 3WGHA 4C29A 1BE0A 3LIIA 1M2OA 3E8MA 5CIQA 1X94A 2IZ1A 2ZE5A 4C6SA 2R8ZA 2QJTA 4X95A 3SF0A 4UOQA 4C0HA 1SVWA 1SVLA 1R6DA 1IXYA 3OF5A 3G7UA 1HEYA 1LBQA 5FI1B 1HG0A 2I7TA 2COKA 4TLCA 3M4XA 4NABA 2BZ1A 1T91A 5H16A 3PDCA 4ZI7B 4OSEA 5AI4A 5L4SA 4R7TA 4V0MA 4HTFB 1MO4A 1P2BA 3ACCA 2KYRA 2PTGA 1QH8A 4KN5A 1XNJA 3Q88A 4KXQA 4MV9A 4MPJA 1M1YA 4IRMA 5LMZA 3EPHA 1G0OA 3I9MA 1VPDA 3RC8A 4QWWA 2BGRA 1T6BY 3Q7QA 1E1DA 2PPVA 1ZD1A 1CUUA 2JAXA 4IXMA 5BWOA 3B82A 3WNDA 5GIPE 1GTMA 4JENA 1H0KA 1O94D 4YP0A 3WRYC 3JQBC 4RV5A 1JR3A 2I2FA 3BMQB 3PG5A 3STWA 3WWDA 4RHXA 4AROA 2WJWA 3A6JA 3HZRA 2YV5A 5DOZA 3GJQA 3LSYA 4HCJA 4HXEB 5BQOA 5IM4F 2P9JA 3BHNA 3F6BX 4DA8A 4ZQIA 3JQEA 5EA2A 1JEEA 3K0BA 4TWZA 1RHRA 4X1IA 2GLTA 3V1NA 1P45A 1QOZA 3H2KA 4PIVA 3ZCRA 4YAEA 1EEXB 2IU4A 2LKCA 3L7BA 4R9SA 4A2QA 2BBSA 2PV7A 1SHKA 3O8OB 5ALIA 2NO0A 1KIMA 1HSZA 1QRAA 1ZM7A 3H19A 2YKGA 3EQ9A 1OA1A 3MUOA 2B82A 3SJCA 3ZDDA 1U3DA 4PQGA 5A9SB 2NW6A 5IUJC 1ONNA 2EL9A 1EGVB 3UWDA 4X1YB 2UUOA 4Y8VA 2GCIA 1GQRA 2ZQ5A 1X42A 2P0YA 3K9LA 3RVKA 4CDNA 1CP2A 3N8NA 4FK8A 4HFMA 4M9QA 4QOEA 1HG1A 1N4DA 5TNXA 4LECA 4ZN6A 2AR0A 2C8LA 2DSTA 3LHFA 5EXSA 2YUTA 1CJTC 1DIBA 3UB4A 5CVJA 1IVNA 3I0MA 3RYHB 2FK8A 1RAHA 4LCJA 5E3IA 1KRWA 2M6RA 2JD1A 1P2UA 2F1OA 2HMWA 2J6CA 2ZYSA 2HFKA 3MTIA 4REQB 1KI1A 3RCBA 2MWMA 1DKPA 2RGXA 3OQVA 5JPIA 1JTEA 1WTAA 2BFDB 2FFBA 4O2BB 4CDMA 2ZTHA 1Q1GA 3H0CA 1N34B 3S5UA 3DE2X 1O6ZA 1YQDA 2V55B 2ZULA 4QE3A 5DOVA 3KFLA 3R8FA 4FW9A 3ZK9A 2QTTA 5I7EA 4DSZA 1QM5A 4B09A 3IVMA 1SQFA 2WEKA 1M54A 4W99A 4MQLA 3ADCA 1P29A 2J9YB 1GFZA 3ENZA 4URWR 2B3DA 4UXHA 3ZHRA 1YZLA 1TJ4A 4FW8A 2PFGA 4OLFA 4RVDA 2DPGA 1T4CB 2GZ3A 2V6JA 4EELA 1KNXA 4OP1A 4NZNA 3KYDB 5TARA 1HL3A 1GGEA 1P7YA 3NHWA 4KPGA 1UMCA 3EW9A 3EXHA 3FKJA 2LDBA 3P94A 1LNSA 1OH6A 2WZQA 1TIBA 2B2NA 4J1TC 1B1CA 1HNZB 5TQ0A 1V6SA 4ZYWA 2TMKA 2IYVA 3BORA 3FPSA 3LC0A 4ZOEA 1TUEA 5H3LA 1C7QA 1D0VA 1EDEA 2GPJA 3E4DA 3FETA 4MB0A 1PP4A 5JISA 3V2UA 3MMXA 5B1DA 1N6KA 3VU0A 4I4CA 2J07A 3TQRA 1E5QA 4RM2A 3R7WA 4C6RA 3WLSA 1L4YA 1U2ZA 3OMWA 4XDGA 1QG2A 5FULA 5J2TF 1FSFA 1SK9A 2JS7A 1O58A 3ZWAA 3PB3A 2QMHA 1H1DA 1UM9A 2JAWA 2BPOA 3FTCA 2A2ZA 1NT2A 1X7YB 2XLBA 3JASA 4JT4A 2GN8A 4I50B 2IV2X 1OIXA 4CM7A 2HKIA 4S1VA 3DDNA 3DJFA 2V8BA 3NAMA 2EW8A 2H07A 2AOUB 1WVIA 4MVCA 4CCYA 4Q9JA 1LWOA 3SSNA 3QKUA 2XEDA 3L6OO 3BHMA 3DOHA 3O31A 3ZDCA 4LBWA 2WF6A 1SKQA 5HIAA 1H6AA 4R16A 4XQ0A 3K0AA 1U7WA 1Z25A 4E4TA 4NFYA 3WB2A 2O7VA 5EIEA 1BGXT 3CEPB 1J2UA 2DBVO 1CTQA 1UK6A 2IEAA 3U3JA 4FSHA 2QL9A 5LYYA 2Q5OA 4W1QA 3VH3A 4B2YA 2JGJA 3NBAA 2REQA 1Y1SA 1C3EA 1EGHA 3U9LA 3QE4A 4MLCA 4CQMD 1JIVA 2LWIA 4OFZA 3H6GA 3WDMA 2VH2A 1JKJA 3NP9A 5U1PA 3RIXA 2GJAA 4GAEA 5CJJA 1LQUA 3LLSA 4BEBA 3THXB 4FGUA 4BCBA 2O7RA 2RI6A 3U7IA 2HT6A 3QEOA 1W25A 2UXDB 2QDKA 3PGA1 4FQ7A 4HN4B 3OE1A 4XQEA 3GV0A 1SU6A 4URZR 5CYFA 5BN5B 4B3BA 4CCWA 4D9FA 3WKEA 2C88A 2WZBA 3ER6A 3PFCA 5AVVA 4G5OA 2BGWA 2VJPA 3BWBA 1N8KA 4JLMA 2Q0SA 1IRIA 1QVRA 1T36B 2JAPA 3TTWA 1O57A 1U0LA 1VRWA 2BBTA 2VUUA 4PYRA 4RDHA 4U9IS 4FJ2A 3N07A 5JCJA 5SV2A 3ZK7A 5HYVA 4XSHA 2WM8A 4TWRA 3KE8A 4YA6A 3E5MA 4DZZA 2KMLA 2PAFA 3VU3A 1W46A 4YHBA 1Q0PA 3TVDA 1XZCA 1G20A 3E8SA 3TLEA 2YXNA 1Y1TA 3EBOA 3RVSA 4DR6B 4QXQA 1Z68A 4QVGA 2GBLA 5HKKA 3FPFA 3TD6A 1UOPA 3AKYA 5KC8A 3P5SA 3MHTA 2W00A 1J5EB 1IHYA 4M22A 1U8CB 1UMDB 3IO5A 1PWXA 1L3CA 4KAFA 5BWCA 2P9HA 2I55A 2ZLBA 5EJIA 6Q21A 1WULS 9LDBA 3S55A 2Q5HA 3IESA 1E4VA 3QU5A 2PAAA 1DO2A 1G4HA 1C0PA 3BPSA 5CA1F 1NYTA 1YDEA 2VWGA 2XHEA 5FA8A 2X0FA 1JTVA 3NMUF 1ZN2A 2HMVA 3AVWA 1ZGCA 5LM3A 2J3HA 1V3VA 3GWGA 4HQOA 4Y6OA 3KQYA 3NRJA 3D81A 4BMOB 1M0TA 4XJXA 2JI8A 1XDWA 2O2SA 2B1IA 3IP6A 1JQKA 1XEAA 5AIBA 1TZCA 5CBPA 2OBBA 1NMXA 4S1NA 2Z5FA 1RP1A 4PANA 5KSPA 1NRJB 4JUCA 2G5TA 2VLBA 4NATA 4OHKA 4EZIA 1FVXA 1V8DA 1BQ4A 1WTCA 2Z6VA 3IH5A 4P08A 4MP3A 3KEOA 1AGPA 1KEKA 1V1MA 3Q0TA 4I6EA 4DWVA 1ANKA 4QG3A 3ZHVA 3M6LA 2DJIA 2H4YA 4TWAA 4ZAFA 3TL2A 2PVSA 5LP1A 3PE4A 2WA2A 2H2GA 1PNQA 2VJKA 2DFNA 3CZ5A 3QXXA 4LJ6A 2NPIA 3K5IA 4NU5A 5DVZA 1JI3A 3WLNA 5H4GA 1M8FA 1UEIA 5K99A 2R9VA 1RYYA 1E1LA 4GMFA 4OI2A 5KAPA 3ID6C 3WSTA 4YRAA 5FBVB 3SQWA 1QU2A 3LTEA 4KO4S 3V2HA 3T9FA 1IVYA 4F3CA 1QJCA 1FYXA 4WV3A 1IIRA 1SUEA 2X8JA 2EEZA 1EVQA 5JATA 4IIJF 1Q0UA 2C00A 2CVOA 1XOIA 3I9V1 5DYNA 3U17A 3ASZA 1P74A 3A27A 4MVJD 4RVNA 4XE5A 2XTNA 1TEZA 2HCFA 5KNDA 2VJMA 4XI9A 3SYRA 1TMKA 4HLDA 4HXYA 5D3QA 5F9MA 1TIKA 3J7AC 3B3GA 4MB6A 3WWEA 1OOEA 3NVMB 2P1RA 3QHQA 2QMZA 1GA1A 3QW4B 2X7HA 2WG2A 3P71T 2ZRQA 5E0OA 3NETA 4QODA 3EZNA 4D81A 1GL9B 4KDCA 2MMCA 1XIVA 1O4WA 3T7EA 3I12A 3R0IA 1DAPA 3THYA 2WM9B 3HJRA 5C3UA 4DC1A 4CETA 4UHBA 1PJLA 8AT1A 2GA8A 2XYQA 5FBHA 1C8BA 3E0QA 1P1FA 2FEOA 1WMAA 1YR8A 2NO1A 3IMFA 3QMWA 3V4OA 2RGCA 1EA5A 3NEJA 1TFRA 4OXYA 1HLFA 3JY6A 3R6LA 3BUSA 2QRMA 4LY0A 4MUNA 1RADA 2WAOA 1NSYA 2QV0A 1N36B 1TOAA 1ZZEA 4BMYA 2YDYA 3K1YA 3LOQA 4I6GA 5AK5A 4D3ZA 3R0XA 3U16A 2GF0A 2PKXA 2PA0A 3RVMA 4FS8A 5FX2A 2WHXA 2ZSUA 1BN6A 1HTWA 2P6PA 3D4NA 2ZAMA 1QONA 4KX5A 5C18A 1Z16A 4Z7JA 4UE2A 3QLVC 3KSMA 2BD0A 5IG2A 2ZYRA 2IYTA 4UAVA 2Y1EA 4DYHA 4FVTA 4JNKA 4JEHA 1Z35A 2IH2A 3NB0A 3HDGA 1QS0A 3VVCA 1IRXA 3EEIA 4UAJA 4ZVVA 2NXWA 2ODBA 3WQBA 3FVWA 3GK3A 3T5TA 4JJGA 4X6XA 1UQUA 3TRFA 3VUEA 1QCDA 1HT0A 1WXEA 2I4MA 1DRJA 3EZ6A 3DOJA 2WIJA 1XF9A 1YBFA 1GWNA 2XYRA 1IK4A 3JQ7B 2ZI3A 3NTRA 4NU8X 1JMKC 2B0JA 2XZDA 3SDSA 5G41A 3TOVA 2IUSA 3FI0A 3LHKA 3UEOA 2POQX 2RG7A 4XGKA 2XAAA 3L0IB 4LMPA 3K0SA 4MKIA 1ZSNA 5CB4A 3FMIA 3UJAA 2C61A 1HDZA 2VRBA 4MRAA 4E6PA 4YS6A 3IBFA 2QXYA 2WHPB 2EX0A 3AHCA 2NTYC 3L07A 2IQ5A 3ZE8A 1X9GA 3UAYA 2GPYA 3QVWA 1HGXA 4CUJA 2R86A 4FE4A 3H2YA 3QBEA 2V0GA 1DQRA 2NIPA 2V59A 3I76A 4PVCA 2H7CA 4FSXA 2C59A 3KKOA 4HB0A 4M0CA 3C15C 3ROKA 1J2RA 3T3HA 3H11A 5CYGA 2C7GA 3E2MA 4II7A 4NEGA 2NZ2A 1NKVA 1I9GA 3U7QB 3OQNA 4YJFA 3QUCA 2ZRPA 2WLTA 3SXPA 3MMZA 1IHDA 2VP4A 1B43A 1QIJA 1C4OA 4F4JA 1YRLA 2M6LA 2EV9A 1KZHA 3UKOA 1C3OA 2OBFA 1G5TA 2OORC 4P3YA 5B58T 1UH5A 4TRJA 1XYYA 4F1JA 4BO3A 4JCOA 4EVRA 2BT4A 1ZM2A 5EJGA 4DBVO 4KWTA 1T9HA 2YX1A 5AVWA 5TIIA 4W8GA 2QGZA 1TA9A 4YY3B 4H35A 5BMVA 1GQYA 2D2VA 4LX8A 2QAGC 4M98A 3AXTA 3BIXA 4MK4A 4CM8B 4F4HA 4L78A 3VH4A 3DBHA 2G6TA 2PQMA 1GT91 1SKBA 2CFRA 2JASA 2Z83A 3AUYA 4NBVA 4Z9XA 1G63A 1PR9A 3QKWA 1XQVA 1T2DA 2WAAA 3C43A 3QE2A 2VXCA 4AKTA 4XB1A 4EFDA 4KLRA 1JA9A 2Y1XA 1GNPA 2DT5A 1R5NA 4HRVA 1C0IA 1ZSYA 1SXJD 4R7GA 3FSGD 5A4JA 1AXGA 5E9AA 1QLHA 3MWEA 5CH3A 3CZ9A 2JEZA 5BQ5A 4CCSA 4CN8A 2DR2A 5BWBA 3Q8MA 1TQDA 1UWVA 5E6RB 2QY6A 1ZD5A 2O2ZA 421PA 4RHEA 3UK1A 2VRCA 4KUHA 4HT3B 5IJXA 4PCVA 3X3HA 1C1XB 5CD1A 4P9NA 3BJIC 3ZUPA 3QJ5A 4Q9HA 5K3FB 2GK4A 2XCTB 2GA9A 4ZQFA 4JZKA 5JY6A 2AJBA 1Q6ZA 3N58A 1KH1A 1M72A 3TBFA 3PDJA 2VYQA 1P4HA 3LO8A 4A8JC 3OE4A 1LVGA 3GLHB 4B6EA 5EQDA 5JU6A 2G5PA 3W3ZB 4F72A 1FFWA 3UMVA 3N2GA 3O8NA 2G4CA 1ESNA 3ICWA 1T0UA 3JD1A 1NI4A 2B4QA 3K0FA 3KEGA 5LQKA 3IXMA 3QWFA 4KQEA 5DSTA 2E5LB 4E30A 1ML4A 3SQLA 3ANXA 1E92A 3PICA 1M9NA 2H8KA 3SXJA 2Y1GA 2NN3C 4LFAB 1ND5A 4XVRA 1C1HA 1ST3A 4QHYA 1RKXA 4OFXA 4A16A 3A3NA 4AJOA 4L3WA 3V8MA 1CQJA 2QPLA 3H5NA 1I5RA 3NXSA 2C9OA 2CC2A 2GBIA 2BDEA 3OEHA 3PUIA 4KP7A 2Z4SA 4PICA 2NUAB 3V33A 1P77A 3EF3A 3UHJA 2BMJA 3E9EA 4INJA 5AVXA 4W6ZA 1MB9A 3A1DA 4IAOA 4BVLA 4Z9FA 4ND3A 3I05A 1OZ0A 3VR6D 4YRSA 2OEPA 3T38A 4EKEA 2DSNA 3DT9A 1Q7EA 1ZI9A 3O0DA 2FP3A 2GF2A 2XUZA 4HQNA 4V0LA 3VUFA 5CLHA 3FMGA 2JKYA 2WT4A 4NBWA 1XZPA 4OOEA 2RHHA 4G5FA 5IT9A 1DWQA 4Z0PA 5B1EA 1YGPA 4E32A 4K8OA 4LVCA 3P4UA 3M6AA 4EUFA 4L4RA 4EA7A 1J33A 4N5LA 4L4YA 4ZDWA 4S05A 1VL0A 1WB6A 2JLVA 1FDOA 2RFLA 2I6XA 3RTAA 5CNIA 3F6EX 5AO9A 5CLFA 1THZA 4ZCTA 3SVLA 3GUCA 3OQIB 1I3LA 1T1IA 1DLJA 3C48A 3NUGA 4N3CA 2HA7A 3VTFA 4DCSA 2CXOA 5TF0A 2JFBA 2NU6A 4JLJA 1W85B 1W75A 4LTMA 3S4YA 4LYJA 1GGVA 1JSRA 4WL0A 4C7JA 2UXBB 1DVRA 1XGKA 5DNWA 2XQGA 1HYQA 2MINA 4D43A 1P0PA 1RI1A 4IQ8A 4UXJA 4MQFB 1KO1A 3R9IA 5JCXA 4JELA 5K20A 4Q4HB 4N47A 1XMOB 2X9VA 4LHYA 1GTL1 2IT1A 1FDUA 4Q4JA 4LHXA 3MJVA 4NPHA 4RZHA 1CEXA 3TAUA 2GTIA 1FTWA 1M34A 1YJAA 3G2JA 1LBIA 2QJRA 3M1LA 2VDWA 3O83A 1DAHA 4K87A 4XEUA 2I03A 3CUTA 3NYQA 3TOSA 2VHJA 3AFGA 3RIEA 2WLSA 4RK5A 4FX5A 2WVHA 3IB6A 1X1DA 1WJGA 4F9TA 4GZMA 1GQ2A 2FAXA 3RRYA 4F7WA 5AM1A 1C3LA 3SM3A 2JIPA 1QOQB 2CLOB 2XYPA 3WE7A 5F3DA 5BSEA 4RTKA 2RKOA 1XTPA 4IQ4A 3GLUA 4DOMA 3LH5A 1KMQA 4G4JA 2V4UA 1W1WA 1Y4ZA 2FMHA 2PMFA 3K73O 4N6NA 3E61A 4TPKA 5C3MA 1NF9A 4KR7A 1FEZA 2HA2A 4XXHA 2F1KA 5I8WA 1I2DA 4EGCB 1JAZA 4TWIA 3E0XA 1VLZA 3NOXA 5B3KA 2PSHA 4BX8A 2GZRA 4BUCA 2J3MA 1ZOOA 4X91A 3D8RA 5DBEX 4JXZA 4D8YA 5LR6A 3OAAA 2JBHA 4HDOB 3U3OA 4HNTA 1EAMA 5JXWA 3BJRA 1KJ8A 2FWAA 2I8AA 3DE4X 4MGKR 3F5FA 1JEQB 3SHWA 1X8XA 2X15A 4YAFA 1EJ6A 1M2OB 4UMVA 2VP9A 5KOIA 3HJGA 1B2RA 1GAEO 3OA0A 1XTTA 5LB2A 1EVKA 3UV3A 2Q7XA 1SY7A 4E2WA 4WVFA 3HVIA 3FLBA 3SS7X 3RS8A 3O7MA 3RSOA 3BTUA 4FEYA 1GYRA 1XYGA 4UBJA 4LZNA 3B36A 1KQOA 5GVRA 3OC6A 1FF9A 3L06A 1C7RA 1PNTA 3PK0A 1RLIA 1T6XA 5COQA 3SF8A 2ZI7A 3D3NA 1F8UA 1QH8B 1X7XA 2QRNA 2WPDA 2ZIFA 3HBNA 2ZJOA 1M1YB 1VYHA 4YI3A 4QZVA 5TMPA 2PLRA 2BUBA 5G1NA 5KTOA 2LNDA 5ETJA 4HVCA 2VYVD 4NIMA 2C7RA 1ML3A 3O4JA 4ENPA 4BWVA 2GYYA 2IEBA 3BL6A 1ZXLA 4GKBA 1E61A 3HVHA 3WRXA 1TNDA 3GUZA 3KZKA 3U7FB 2B36A 1UKCA 1KY3A 1IM2A 3ZE0B 4B76A 5BY2A 3ONNA 2QUAA 4FKZA 4D4KA 1HL7A 2G9NA 3D4BA 3ZKAA 2AK2A 3HADA 4Z0HO 3NV7A 3VC2A 1RM4A 1R74A 5FTMA 4O02B 2Q2QA 3KJFA 4AS3A 4B6JA 1V3TA 2XE6A 5THQA 3H9QA 4X1IB 1T8PA 4R41A 5IHPA 1QFYA 4MR9A 3SBEA 2V7XA 4I5EA 3FMFA 4IX9A 2H0QA 4LSZA 2LPMA 4BWYA 1VDZA 2B8JA 3A9RA 3VNAA 2OHOA 3R20A 3H5TA 1HDXA 2DP4E 1XZDA 1EG2A 2G06A 3M82A 1WNTA 3M9WA 3OC0A 2QY9A 3LDHA 1LBTA 3T5CA 1C9JA 1L0BA 4BB0A 3BRWD 4CF6A 3DDWA 2IYLD 4JDPA 1QGYA 1NN5A 2FRDA 3WDLA 1LPBB 5CMLA 4CLXA 1SUWA 1VDMA 2H11A 2W37A 4HKTA 4UNNA 5AJUA 5C8YA 1MR3F 5TV2A 4G1BA 3FCSB 5ALJA 2X23A 3QPWA 3HN7A 3KZ1E 3I23A 2OGWA 4P0TA 1ISRA 1CUCA 1CUFA 1NLUA 1Y8RA 2ZRJA 3HK2A 3CCFA 2I87A 2K2QB 4Y2GA 4U9HS 4ZHSA 3KJXA 5ADHA 2IYUA 1JG4A 2PUTA 1RT9A 1Q5PA 1JXMA 3FNBA 3Q3GE 1L5RA 1IYZA 3DZGA 3IEUA 1DAOA 2JBAA 3E9ZA 4I8XA 1BEZA 1XQ9A 2DPYA 5I47A 2PBLA 2EBUA 2O8CA 3TSOA 5T4BA 1B1AA 4R2KA 3RRXA 1KDVA 3INNA 2O6HA 1KVQA 1UADA 3DP7A 3VX4A 2HWUA 2FMFA 4I1VA 3MSCA 1P2SA 1RQRA 2EARA 5JW6A 2C03A 2FSHA 1DG1G 2Q99A 1QRSA 2IPMA 2ZRAA 1DEOA 1FMCA 1C7JA 1TQ4A 4J4HA 3WGJA 2GM9A 2DWPA 1ZMRA 1EX6A 1DXYA 1XJCA 2DWOA 2HQSA 2ZYDA 5ED0A 4UHKA 1JSZA 1UM8A 4GH5A 4WFJA 1Z0JA 4EL5A 1BTOA 4OLBA 1ZH2A 3FLAA 1DO0A 1TC1A 5IBCA 4LK2A 1AXEA 3MRTA 1PVVA 3B89A 1TO1E 1SOWA 1E20A 1UMCB 2PEZA 1RKBA 2QDXA 3EXHB 2NO4A 3B6MA 1GL6A 4RGBA 4GM0A 5TQ0B 2COUA 1N5RA 3D5EA 4E5DA 1DQYA 1SU4A 4JC4A 5JMPA 1EIWA 3K0HA 2EJTA 2X5JO 5AVSA 1HF3A 1F7UA 4AMZA 1E89A 4ISBA 2CVPA 1VHQA 4K05A 5C53B 4JUIA 4CM4A 3RK0A 4R1MA 2FSPA 2JHCA 5DYTA 2PRIA 2V6GA 4B45A 4Z7NB 3A10A 4CGZA 4KFCA 3O9VA 5T67A 2JLAA 2FZLA 1V5EA 2R6DA 3R7WB 1BJRE 3E3OA 4EI9A 5DPMA 4LXGA 2GKGA 3WGIA 4NE7A 1UM9B 1FFDA 3OQ6A 5H3CA 3OM1A 3JASB 4X60A 3S70A 3LG2A 4CMKA 1XPRA 3IAS6 2GDZA 3G2IA 5EL0A 1SOAA 5JFTA 1W47A 4CCYB 2QSUA 4OATA 2NU8A 3A6FA 3VI4B 2PMCA 2G1KA 1CC1S 4TTTS 4MKFA 1WB4A 4ON9A 4RADA 2I2BA 2VNHA 3K0AB 1TM3E 4YIKA 1CVRA 3WBBA 1B6GA 1CHDA 2WRZA 3PPYA 2V1XA 3E3AA 1TU3A 5JOQA 2WFAA 3JV7A 1Z7GA 3R5JA 1XYVA 1IPFA 2REQB 4C05A 1FYEA 4YCSA 3GA7A 3INTA 3ZG6A 4NMLA 5EOVA 3COVA 2HY7A 1YZUA 4ZVOA 3AF5A 1UBNA 2C83A 3R9KA 3ROQA 3WZ2A 3A4LA 2AI2A 1JKJB 3B52X 1XJ5A 3SCZA 3DKPA 3WNCA 4B84A 4Y3UA 3IV7A 3E9NA 4ZT3A 2FX2A 1KRXA 3ABZA 4GW3A 3NASA 4GOND 1KF0A 2B8EA 2H2WA 4KG7A 4ZVUA 2X3YA 3UQZA 1Y5MA 3ZHUA 5JNUA 1QJ4A 2A5FA 4TKVA 2PKQP 4DLZA 2ASEA 5G0TA 2A5DA 4A0GA 4YT8A 5JSFA 4H60A 2V3VA 4RETA 1CNMA 1W4BA 2NP6A 4K9RA 5IAAA 1B0PA 3D1VA 5E8JA 2HDWA 1HLGA 3OJCA 4C08A 4YLEA 1XELA 2PS0A 1T4DA 4QTUB 2ZDGA 5DE3A 2ZK7A 3Q41A 1TYZA 4ZOAA 1RXWA 1XE3A 3BWDD 1S2NA 3PXUA 4WLUA 5E9QA 2WSYB 2QYTA 4EVQA 2GI4A 1DINA 2WFLA 3PC8C 3QSGA 2WTEA 4MJ7A 1G41A 3GC6A 2IEGA 4RULA 1BU5A 3KHTA 4OHYA 4Q3BA 3MGCA 1I10A 1QQBA 3LM8A 3UHOA 3TJMA 3AINA 1YB1A 2O2DA 3ET4A 4L7QA 4LPSA 4JC5A 1A50B 3Q9SA 1A9RA 3FSJX 1MOPA 2Y1CA 4BDTA 4NXMB 3FOCA 4QA9A 2OCIA 5DBGA 4WLFA 4DLVA 1PV2A 3EIWA 3L4SO 1F8FA 1V7QA 2O3QA 4LJ9A 1SCQA 4GECA 1FNCA 3WO0A 3R9XA 4MUHA 1IEVA 1E2PA 4UJ5A 4MTCA 4BC0A 1N77A 3TLAA 3UC9A 2E49A 1FMTA 1SULA 2ZSAA 5KVQA 3HB1A 3ZU6A 2H1CA 3ANMA 3AVXA 2CMHA 4RKQA 4S3MA 4WFQA 3HO8A 1ZRHA 1XO1A 3PUHA 4PWYA 5EMMA 3SZMA 2J3IA 5JXHA 1KP2A 1V5IA 2KW5A 3WZLA 3E5HA 1Y3AA 3LCUA 1XF1A 4E5PA 1FJHA 5JVDA 3OT1A 3UICA 2QG4A 1Y9JA 3SMQA 3OIWA 2Z8XA 1JT2A 3WV4A 4DZTA 1VG9B 1V1MB 1A96A 1N7HA 2YUIA 3O74A 2HHLA 3X44A 2WI8A 2P2YA 2D74A 1R16A 2GN2A 3GI1A 5DSXA 4MA0A 1NM5A 4GXRA 4DM3A 3ZBQA 3UHPA 4BNNA 4LHWA 2NSLA 2MSCB 1ZY2A 3L4BA 4P2BA 4EY3A 1S6YA 1QB8A 1Z2NX 2GCPA 4FUQA 4TX1A 2XF2A 1N1DA 2JFOA 1CP3A 3JZIA 1T2UA 5EHIA 3PTAA 2H1OA 1VMAA 4KREA 4G0ZA 3J81k 4IXNA 1L4HA 2G5GX 2QR3A 4KODA 4CQJA 2IW3A 2A9QA 5BT8A 5T4FA 4KSBA 5DISB 4GMDA 3MLBA 2GXAA 1D7AA 2X8JB 1AGRA 4UDNA 3WNBA 1F20A 3K4QA 2VAVA 5IWAB 1JDBC 1T4BA 2V5AA 2VHVA 3SSMA 4UFPA 1TJNA 4YMSA 3CG0A 1YE8A 2VJMB 2B6NA 1U1IA 1JG2A 3E03A 4R1QA 4B3TB 1K6IA 1WXFA 3GRRA 3NGXA 3DDCA 1YK1A 1ADCA 1D0SA 2CXUA 3IVAA 3RC7A 2EKQA 3RUDA 1V6CA 3UAOA 1T0HB 3VXKA 5JWRA 4A1FA 2W2NA 5AUQA 2XJ9A 3Q3CA 3TGWA 5K0EA 2HZBA 1KRHA 3AB3A 4F1KA 4QAJA 4INAA 3LE8A 5JRDS 1YRHA 4DPKA 1ENZA 4KWCA 1XNQB 2GSDA 3BXPA 2C99A 2PQ6A 1B16A 4GHWA 1XZFA 3AZQA 1ACLA 1BG6A 1ZS9A 2IUTA 2MMGA 3BBPA 1E2LA 1VZ2A 3F4BA 5L3VA 3MJEA 3THYB 5C8VA 1DEAA 3BZBA 1V4BA 4IRXA 1ZGZA 3DLAA 1OU0A 2YZNA 2FN4A 4RGVA 1B3RA 3KV3O 3OJLA 3P7MA 4KZPA 5M29A 4JUDX 5KYGA 4G2NA 1J2EA 4UBMA 5JDIA 4ZREA 1IG0A 1ODKA 4IDBA 1OTHA 1PW5A 1QFZA 3GFTA 3ESCA 2FW1A 3MERA 3C1TA 4NZMA 5KYWA 4IIVA 4ENVA 4ED9A 4RQUA 3ENVA 3LYHA 3KSBC 3E35A 2CL7X 2A57A 3I2JA 4PONA 4RE5A 5E6SA 5DMHA 3OX2A 2UVQA 3ZV3A 1P1RA 2GF9A 2GGSA 2XB4A 2P4UA 5TXGA 2XRYA 3RLIA 1YZ3A 1QS0B 3ZU3A 1XA3A 3VFDA 2I76A 1NURA 4W8HA 4C20A 2R5NA 3GVXA 2GESA 3KX2A 1GTRA 2ZI4A 2JLZA 3CB2A 1O08A 2HMTA 3H97A 2B98A 1EFDN 3WGMA 2YHUA 2A92A 5KTKA 1BMTA 2ILVA 2GN6A 1KI8A 3OWXA 3OF3A 1MD9A 1U81A 2YWRA 1H22A 3DHVA 4LJ4A 3IDAA 2IEIA 3MTJA 3NHPA 3T5DA 5CB4B 5EYPA 3V1TC 1JJ7A 3WMFA 5BWNA 1Y3FE 5ES4B 1QVAA 3O4HA 1LXCA 1ZL0A 4CUKA 4D9JA 3SEAA 1INLA 2MSWA 4P4LA 2WSBA 1TJPB 3DCYA 2X9QA 3S1AA 4C04A 1QMPA 3C3CA 3MWJA 4K9NA 1ZISA 3QNUA 1AUQA 1U7HA 2B2XA 2GXQA 3UIEA 5JSYA 4G1UC 2WSSD 3H11B 2Q9UA 3DNMA 1Z5OA 2B34A 5JBIA 3EAQA 5FCDA 4IYRA 2G5CA 1ARZA 4XIFA 1WA5A 2AMYA 3AQIA 4YJFB 2RHGB 2D8AA 3DZJA 1M83A 4JMPA 2VT2A 3KXLA 1QFSA 4BEWA 1JHDA 1GZ5A 4GQIA 4OGGA 4TTQA 1C3OB 2QHXA 2JIBA 4RFSA 4Y2QA 5ILOA 2HV9A 2CHQA 3OY7A 2NSYA 1JXQA 4HNRA 1J90A 4MCHA 4UXIA 4K03A 4UUNA 1IBCA 5KTPA 5F9HA 3PQ8A 5EGSA 1QGDA 1SHTX 1OJLA 2NVBA 2XE7A 4DVGA 2WWXA 5BMVB 5L51A 1L5OA 2Y9PB 3DBHB 1HO3A 3SYNA 1N6RA 1WXHA 1XVUA 2F64A 2ZUWA 4AJPA 3T3DA 1XEWY 1BWQA 3D3QA 4QVKA 1KZ1A 2V7BA 2QP9X 5E2AA 5KQRA 1XPOA 3GCWA 3KKPA 3OZUA 1WM1A 1W93A 4K2AA 4QUEA 1OIWA 2QX6A 3QIVA 4YRDA 2ZZKA 3ETEA 4TSFD 3BCHA 3MWEB 4X7MA 5EZYF 1DKLA 3P9SA 5EWJA 4MLDA 1JU9A 1TT7A 2O06A 3ESYA 3C7DB 1L3BA 1YB6A 2WJIA 3HPRA 2Q28A 1G8JA 3IMCA 3L7JA 5ER6A 1ISJA 1QLWA 1EQUA 2FUKA 4YRJA 4BQRA 5ITWA 4KO2S 1OFGA 4OLJA 2F43A 4HF7A 3N5KA 5KOJA 1MJNA 2MSNA 3C3KA 5D5PA 3LZDA 4O6VA 2XB8A 3STVA 3R24A 2BGKA 4GUDA 4JBNA 3AEZA 1D09A 3LCRA 4U6QA 4D9HA 4F4UA 1TE2A 3P8ZA 1NBME 2HSDA 3GRZA 2ZBQA 4FFVA 3N2GB 1Z4IA 2V03A 4IHJA 2QBYA 3O4IA 1M10A 2BGJA 5B36A 1NI4B 1QIMA 3K0FB 2UZ0A 4I9UA 3AJRA 2B5WA 1R0CA 2JFFA 5KNCH 5KTMA 1EXDA 1OHHA 3EQZA 1XN4A 3OUZA 5CDTA 4WNIA 3LHIA 2QNIA 5C5DA 2BI7A 4EGFA 1TIPA 1VI6A 3JWEA 4WGGA 2RB5A 1WMEA 3WWYA 1I3CA 1CQJB 2RHRA 3PXDA 4JLVA 4QOIA 4D97A 3NDBB 2F1IA 1XQXA 4QYMA 3TW0A 2AXEA 1OX4A 1FTYA 5FBRB 4JT9A 5EQTA 4D9GA 1USWA 4M86A 4E12A 2Y2UA 2YOFA 2Z5LA 1A2BA 3IPAA 3MZ0A 5IKEA 5FR2A 4UNIA 3R4CA 3PS9A 4WWHA 4JI1B 1RMTA 1D1TA 2WJJA 3K3PA 1EFPA 4B4WA 4TSKA 2RGAA 4D96A 4DQXA 2WTUA 5JNWA 3DMTA 4L5AA 4MZXA 4LXHA 4EZBA 3U56A 4RPKA 1MCZA 3N0WA 4W9NA 1G3MA 3JQAA 3QOXA 5JG7A 4DAEA 4I0WB 2FOLA 5ISMA 4F8EA 4ILKA 1H8HA 3RK4A 3ZW8A 2V58A 4MYDA 1JS1X 3LUJA 1OQAA 3OPYI 5KYUA 2YHIA 4BFCA 2BHLA 1PYDA 2ZJ2A 3Q7RA 4QT4A 4NKRA 3KAQA 1MBZA 1JR3D 3QW2A 1TJ3A 1ZAYA 2VYCA 1I6KA 8GPBA 1PEDA 2HJSA 1Y1KE 2NU6B 4DSTA 4RTOA 1CR6A 3D54D 4B6RA 5E3JA 1JW9B 2CB9A 5C5EA 1JPJA 1UBEA 2MINB 4GX5A 1G16A 4LWZA 2XB6A 1EM8A 1XLWA 3C6QA 3DEJA 3LY7A 3L79A 4C14A 4PGMA 1R9JA 1ISHA 3G7SA 4JIMA 4Q4JB 3KQPA 3CRQA 4TYNA 4U02A 1Y5IA 3OX4A 4M0DA 2VDWB 1J07A 1T1RA 3LZ6A 2D1SA 3NAGA 3CNNA 1UBKS 2X1VA 1E1QA 2ZETA 2G25A 2PS1A 4LCEA 1T0PA 3S2IA 4N5DA 2VPPA 5D3KA 4EARA 1LDGA 3DYVA 1MX5A 1GJRA 3HWRA 4C7XA 2GBCA 3URKA 5GM1A 3KU4A 3MXTA 2HJWA 3PQ3A 5K03A 4C6TA 3WL5A 1Y1QA 1EJBA 2QRGA 2Q4EA 5TB5A 1MT0A 3LQ4A 4BKRA 5DRTA 3GLVA 1XTUA 1X8LA 1JIJA 3RSGA 4F0JA 1B0UA 4XFJA 4PAWA 4L5CA 4ZJUA 1P72A 3U44A 4W4TA 4NJMA 3PYMA 5HIKA 4RENA 5EFZA 4FP9A 3CZ4A 1EGQA 1ZPDA 3PGKA 3NNSA 4WJZA 3HVRA 2WU8A 2H92A 1HFWA 3M83A 5HS4A 2QKYA 1R37A 4OJNA 3ZWXA 3DVQX 1SUDA 3ZGVA 4B0PA 4HQFA 5TPZA 1YAHA 5HGXA 3JD4A 3O2SB 3FZYA 2ZT6A 1J23A 1OAOC 3D4IA 1NXVA 3DEAA 2C9DA 2OUKA 4KQJA 4L0CA 3WYAA 3AR3A 4TVSA 1XVIA 3CUSA 4ZI2A 5LXTA 2UUAB 3JQGA 2H0RA 4Q3DA 3QTLA 5BW6B 5EJAA 2NPOA 5DTRA 1U5BA 5FTJA 5BW5A 3F8TA 3HR7A 1DS6A 2CJYA 3JARA 1CNEA 4OHCA 2IUUA 1S4QA 4D0NA 9GPBA 1O3YA 2RHBA 3SF8B 3H13A 1U28C 4IZIA 1IOZA 4TMZA 5K0JA 3FLMA 4OIFA 1YVDA 3A31A 4C1BA 3TF5A 2HA3A 1X7XB 5CFPA 3IQGX 3SKXA 3MWYW 2XDYA 3OPQA 1ORHA 1K7YA 2JJ1A 1U2TA 3CGGA 2KS6A 4E08A 4LRQA 5L4LA 1LRJA 3CZMA 2TMYA 5A5EA 5EJ9A 2MSDB 2GQ0A 1NT4A 2FQ1A 1IBRA 1NY5A 3QVOA 4EVSA 1ZD4A 2QLJA 1GZDA 5L7WA 5LU9A 1O94C 5JZVA 2HU7A 5TQ2A 2HNAA 2SECE 4YREA 3VDXA 4NHEA 5JRZA 2ENUA 2VJDA 5A3QA 4YJ2A 2YZGA 5JWHA 3REOA 3W04A 3IOYA 4XWKA 3RHZA 4DTIA 2O1SA 1LK0A 4G4IA 1XXHA 3R4VA 2O3JA 5H82A 2BDTA 2OZLA 5CT4A 4PQFA 2WAMA 4DAOA 4FFPA 1FTNA 4ZQBA 3WADA 3GJYA 2J5XA 1JHAA 1NOKA 3B1FA 4OHZA 2CUZA 4UEKA 1YS1X 2B8TA 5DW0A 5JAPA 4B3GA 4W5NA 3PLNA 1SPBS 4MR7B 2YV1A 4MRRA 5LMNB 2VPTA 3OWOA 1VJCA 2E0IA 3NHBA 1XLUA 4MR9B 1U7TA 4P5PA 2BSXA 4MQ6A 3G2LA 3QX7A 4S2EA 5C37A 1UEJA 1FNNA 3KM0A 4II3A 1QYRA 1Z8NA 3HJAA 4KOAA 1CY4A 1VE7A 2WQZA 3GRCA 4GOMD 4RQTA 2WF7A 3N7AA 1P8AA 4COOA 4FDUA 3TZ6A 2WE7A 2R8RA 4YRPA 5IKMA 2W7TA 1CG6A 4KH1A 1RZ3A 3D1LA 3HCDA 1FPQA 1QGAA 4O1MA 5HM8A 4GI3A 3ESXA 4OL0A 1T10A 8ADHA 5AICA 2O8EA 4NQZA 1LTQA 2BONA 2EG9A 3V7NA 4D26A 3BCRA 1T25A 3OLCX 5C8YB 2R8OA 4OSPA 4DR2B 3FXAA 3M89A 3NKVA 4H4EA 3ZQ6A 2L2QA 1DUVG 1Y8RB 3GT0A 1J9ZA 2V7UA 2ZQYA 4H31A 4TMVA 3AVYA 3LY8A 3HVJA 3RS4A 5ALOA 4D99A 2RARA 4CG0A 3NIFB 2UZIR 1JFRA 3MJHA 3Q9UA 3N7TA 2RK3A 3EC2A 3QMVA 4UHHA 5HBGA 3L5OA 2HYIC 5LLTA 2C2HA 1ZO8A 2JBAB 5TT0A 4JJ8A 2WV7A 4AJ1A 5TLSA 3IKTA 1GCAA 4B87A 2O8CB 3ICVA 5ILQA 5HOEA 4AWAA 2BM1A 4KCGA 3N2KA 4L2IB 2R79A 4L5BA 5JCJD 2R4TA 2RHTA 4TT3D 1O95A 2W2LA 1MO3A 2CT8A 2IYPA 3FGOA 1CRQA 2ABWA 2PMBA 3EMVA 1ORDA 1FQWA 4FNGA 2AMVA 3EIHA 2P9FA 3UJBA 1PL8A 2B8WA 3KYJB 4GMHA 2A1UA 1KZ9A 3TLGA 721PA 3D2LA 2BHSA 1R4AA 2K6GA 2Q2VA 3EC7A 2UKDA 1MJGA 3I04M 4MUGA 2Q21A 4DMHA 3S68A 5C32A 4JSRA 3NJRA 4B6SA 2VXOA 4ZZIA 3BQNB 1A5SB 1ZGBA 1NJ2A 1VKHA 1Z15A 3IGFA 2C0QA 1RBZA 5FWXA 3OCXA 1I2MA 3C2QA 3H7IA 4LY3A 4Y9TA 2HU5A 4BFLA 5BNWA 1E5VA 3QELA 1HE1C 5KWIA 2OGTA 2J3QA 3L49A 4MYSA 4ZCRA 1WZUA 4CM4B 1VL2A 2CXQA 2Q4BA 3D31A 4O4JA 4YRTA 4MWTA 4BNYA 1VKNA 3D3WA 4G4SP 3FSRA 1UQTA 4TMWA 3UT0A 2P6UA 3C6BA 2PSJA 3JZAA 5IJAA 1CUWA 3RVQA 3HPQA 4GI1A 5IBPA 3OLQA 1DEHA 3FPEA 4LJLA 2FW8A 4D4LA 3ELUA 2OFXA 4YCLA 5AH0A 4EMSA 2P77A 3C5CA 3EZGA 4I1UA 1OH5A 1UBFA 3ROTA 3MIIA 2OO5A 3G85A 1IAVA 2V1UA 1SC9A 4R9VA 1NVVQ 2J0UA 4NFSA 4Q1EA 2EG5A 3RTDA 2NU8B 5AK3A 5LZ2A 2ERCA 4FR2A 3OZDA 3IQEA 4EENA 5G02A 3U0VA 1PKEA 1BGWA 2W6CX 1XHFA 2I4TA 1GU0A 3WIBA 4Q3CA 4E15A 1THGA 5ERGB 4F1WA 3EZ9A 2W6IA 5AVRA 2WYUA 1U3TA 1MPTA 2AZ4A 3IUMA 3RJ5A 3VOAA 4LXIA 2CLLB 3I5MA 3M70A 2LGJA 4NOLA 3ZZ1A 1XAJA 2O57A 3KQLA 1ACMA 1CZLA 3FDXA 3KOUA 3RV4A 2FZVA 3KT6A 4HZUA 3S2UA 3SI7A 4ZVQA 1T8UA 5TE9A 3OCJA 5F51A 3OIGA 1ZLYA 5EE5B 1GUDA 4ZVRA 3NBUA 3OCUA 3WGOA 2Q6LA 2QR5A 2NZUG 2J4CA 2RHMA 2F9MA 3VAAA 2IZOA 2JFVA 3LDAA 2ZRNA 5KNDD 4BEJA 1RWMA 1EHYA 1T3GA 3OM8A 3LWDA 1C7FA 3LCCA 1WZCA 1X13A 1TO6A 4TKVB 1PTJA 2PH3A 2DC1A 4GEKA 3TXXA 3UAZA 4DFDA 4KBGA 2V97A 4GSLA 3FN4A 3TOZA 1U9IA 4YV2A 3VDRA 1Z29A 2KI5A 3NVAA 1KORA 2GO7A 5EAIA 1SG0A 2OB2A 1OB2A 5ALFA 4DHWA 5HF6A 1DAMA 5B6IA 1PEAA 1XMSA 2QW1A 3RSHA 2IVFA 4K3UA 5E7JA 5KC9A 3T94A 2Q1TA 4WD3A 4M9CA 2V9ZA 3R0QA 5FWDA 3RHTA 3VNRA 3RD5A 2V5UA 4DDMA 2AJ8A 1GNSA 5K3AA 3RBXA 4KVGA 1F8GA 4MW7A 1YOBA 1TYCA 4UEWA 3V3TA 1NMZA 4BE4A 1M5TA 4RGYA 1ODCA 3ZZNA 1A4IA 1TD1A 2AOXA 2DQZA 1ZCFA 3KEQA 4N03A 4ZI5A 3GLFE 4H0CA 9MHTA 1DBPA 2PQ0A 4HDNA 1XMXA 3E9YA 4V39A 5J43A 1EE2A 1HEIA 1T5SA 2YWBA 5ECWA 4LZAA 1SH7A 2ST1A 1XEFA 2UZ1A 1ZC3A 1H85A 3PFFA 2HM7A 3SHFA 1ZXXA 4ND4A 2Q8QA 5G1PA 2VRWA 2ZB2A 7YASA 2FSIA 2ZB8A 1SOVA 3IKVA 4C2UA 4HX5A 3PGLA 5BV2P 4ZCIA 3FY4A 3OESA 4NYJR 1SBNE 2PT6A 4RVHA 5HF5A 4JI3B 5LQUA 2OECA 5C7OO 4W5QA 4NX2A 4HP8A 1YRQA 2Q1YA 4RDCA 4IPTA 1JX6A 2GB4A 3PWTA 1R0KA 5A5GA 5DYGA 4CF4A 1QAQA 2VO1A 3RSQA 2Q5IA 1ODTC 4Q9KA 2XT9A 4MVJE 3T9AA 1MGOA 3VR4A 4NONA 5JVDB 3ONFA 3OT1B 2EJCA 2ATIA 5EHXA 2FPGA 2PIDA 3TFWA 4OQPA 3LKZA 3L8MA 4P80A 2EFGA 1DBSA 5D7BA 3NTLA 2H1SA 3AFHA 2HK9A 3MS7A 1YVPA 3VOTA 2CVFA 1CJKC 3KQMA 2Z6UA 1ODJA 3VZPA 5K8CA 1Y7HA 2B7LA 3C5VA 2QRLA 3IA2A 2AEMA 4GICA 1G18A 2P3OA 1U8XX 2G1JA 2PGAA 3M81A 4LPKA 1E8DA 2VXBA 3RARA 3D8TA 3DC7A 3LNTA 2J67A 2NV6A 3CBQA 3RG2A 4B7AA 5JDCA 4BVHA 4OB6A 1J2TA 2P2CA 1LSOA 1BE6A 1I4TD 4MYTA 4P84A 4DIKA 4JD5A 2LCQA 4EW6A 1N3LA 4Y6LA 1Z2EA 4ONEA 1K75A 3LRTA 4C5AA 4HAWA 1SBHA 4IH1A 4IIFA 1IPEA 1LY1A 3P1JA 1OTYA 2H18A 4ZQCB 1O87A 4DXHA 5JBQA 2O8BA 4US1R 3K15A 2MYPA 3LVRE 1PLJA 3HA7A 1E0SA 5F52A 3KV1A 3IOEA 3BWYA 2QPAA 5BUCA 3L6RA 2GRUA 4NV3A 1JV2B 2C2ZA 4DC9A 4N7BA 1GAWA 5DP1A 4DF3A 1XQ1A 4EHFA 1UEXC 4F85A 4PG8A 3A9UA 4HRAA 4QVIA 1JQDA 2I4OA 1NE2A 2CEAA 3ILHA 3SXUA 3MWFA 1OX5A 4CR7A 4Z2AA 1YVUA 2W6OA 3FTPA 4KDEA 2WIDA 3PPWA 4FEEA 4K6GA 3LQFA 3ZY3A 3IQXA 2OHGA 1D5CA 3FTQA 4NBTA 3AHJA 2VRCD 3NTQA 5DYYA 2QU8A 4KXMA 4W9MC 2P2NA 4FHFA 2X8AA 2VNJA 2XITA 1NJ1A 1XP5A 2PKEA 3GFSA 2WTXA 4ZZ1A 1DT5A 5DNAA 4Q00A 3WKCA 3MB5A 4GLLA 1TAQA 4E14A 4MMXB 2XLCA 5HF8A 3U3DA 2A33A 5IYZF 5E6SB 5JS8A 3SLRA 3I5XA 1CRZA 5DNYB 4BX3A 3P32A 4BQQA 5ENDA 4O2BF 3TIGA 4XYEA 4WBNF 3TTVA 2X22A 1W48A 3ESQA 5A1TA 2Z8YM 3PQEA 4N18A 5ALKA 1PGNA 4S0ZA 4ARBA 5MGBA 5FPQA 5LD2B 2XE4A 4AF7A 4X00A 3OU7A 3TK1A 3H5VA 1SCJA 5K0BA 3OEHD 3ZNPA 5I7FA 3NXKA 4MOWA 3KPYA 3KELA 1U9ZA 4P7BA 2PL5A 5BRNA 3WRVA 2PUBA 4XX0A 1CIPA 2A0KA 2CJXA 1RIFA 4UM9D 4QECA 3W1VA 5LU8A 1NYRA 5EYPB 3UMFA 5HNKA 3RS2A 1UXJA 2PX6A 2R4QA 4JB0A 4O5AA 2KLBA 1V7CA 4QJ5A 3N74A 3U1TA 2XNDA 3A70A 4CNBA 2I1WA 2OP1A 5DTIA 1MHTA 2AKYA 5HF9A 1GDDA 3L1UA 2ZUFA 2CV2A 1G3IA 4JLUA 3S1AB 4P98A 3T7TA 5B7NA 3B7PA 4AY6A 4OYRA 2PUJA 4DJFC 3RYFA 3GRAA 3LK7A 1E1MA 1KJIA 3CT4A 2P2ZA 1BQ3A 1ZI6A 2YWFA 2W42A 1H23A 1YZQA 3HV0A 4FUTA 4AYXA 1PF7E 4FYIA 3PX7A 2ODTX 4M1KA 2IS4A 2QORA 1JB1A 2R65A 4BYMA 3RAPR 4MGEA 5F1PA 4RS4A 4AFNA 2C2GA 4UVDA 2GHQA 3GFPA 1KVTA 4QNRA 2YICA 3AOGA 4M1TA 1ZCBA 2G17A 4K88A 4RFSB 3N2LA 4QXPA 5GM2A 1FVHA 1P39A 4FMCF 4OJQA 3ONVA 2YV3A 4KW7A 1WCV1 3IJ5A 2IE8A 4ICIA 4PG5A 1KWGA 1W35A 2RH5A 4P4GA 1J6UA 5AVOA 2QW0X 1W49A 4UOZA 5FWNA 1RFLA 3FR8A 4WXYB 5IXJA 3AP1A 1NASA 1M1XB 3MCWA 1MVNA 2JFHA 2J0VA 2OHIA 4OHBA 1QIKA 4FYJA 5KQGA 2XMZA 4P5DA 4MI6A 1JI0A 1N5LA 1Z0FA 4FLMA 2ZCUA 2FFAA 4HDSA 4PZLA 1NVGA 1L6RA 1SC6A 2C8KA 3COZA 3R3HA 4JVMA 2GXUA 3ZW7A 1W8IA 2PSEA 1XKLA 1KGDA 2G77B 2XWJI 2F3QA 3IKJA 3LGAA 2Q5CA 3FKSA 4Z8YA 4BVEA 2W2VA 4YUXA 2QT0A 1EP2B 3PL5A 1UP7A 1ISSA 2CW5A 4C4OA 1K88A 4DQVA 2ONCA 2F43B 5KOJB 4W1RA 3VR2A 1UDBA 2APJA 4AM8A 1XC7A 3PJFA 1Y6RA 4ZKEA 5J23A 4AJ9A 5BNTA 3G0CA 5DGHA 4J0FA 2Z2YA 2AUNA 4K3VA 4BC1A 1QAMA 4M9ZA 4RKEA 3T95A 2I7CA 4AUKA 4BLTA 3MF4A 3F7TA 4IHJB 1NJGA 3FPBA 1P1BA 1A7AA 3TIFA 1PSWA 2VSFA 2DHCA 2FSUA 3DT6A 4KMMA 2A67A 3KYIB 4XW2A 3PEWA 3G2KA 1ZM3A 2GZ1A 2I8LA 1U6JA 4DIFA 4H1UA 4MXDA 4CFSA 2J41A 1NNSA 1QYIA 1UDAA 2GM5A 3LBIA 3NBYC 4QGSA 1H0RA 4TMTA 2NO9A 3LDGA 2Y0BA 3VSBA 1OXVA 2ZUVA 4PHGA 4EB3A 1OX4B 4DG9A 1VKOA 3RASA 1ZOPA 3B6EA 1PR0A 4PRKA 5FF9A 3TAXA 5CFQA 1V41E 2DLDA 3FZQA 4D8XA 1N2BA 1UBJS 3A0UA 3IIEA 4HEJA 2BZ0A 4TTSA 1AX9A 4AL4A 4PC3A 1EFPB 3ZHOA 4C0WA 2WPDD 3PVCA 2FWRA 4PSUA 4RSHA 3WAKA 1JEAA 2I5PO 2D5AA 3M9LA 1IMOA 1OAKA 2X8LA 3JQAB 3GUHA 3QM1A 4YX9A 1NVDA 3EZ2A 4QIHA 2O2HA 3ND8A 2IEDA 5FUWA 3HUFA 4OHXA 3WGQA 2O3TA 2WM3A 3FZNA 4CV0A 5K0FA 5L45A 3ILYA 3E9RA 3EEYA 4M88A 1GA6A 5KYUB 4WFIA 2NG1A 2YHIB 3C5HA 4UDOA 2QM8A 1X80A 2BBOA 3R7SA 5JALA 3DXFA 2QN8A 3EVNA 1L1RA 3KJNA 3MJRA 3FMOB 2CXRA 2DFTA 3DZIA 2PZJA 1X1AA 5HKOA 2A3RA 3AXSA 1KERA 3IOCA 4V0NA 1GXSA 3DD5A 5JC8A 1QWSA 1Y4DE 1Z4NA 2IF0A 3H9BA 4TVOA 5GZ3A 1EXVA 1EM8B 3F5MA 5KU7A 4MDYA 5FD8A 3M0EA 1TO2E 2QN7A 5I45A 5AQ1A 5A4AA 5IXSA 5IARA 3N7UA 3CZPA 5EIXA 4YO8A 1GV0A 3GU3A 1Q1BA 4C89A 3CC8A 3JWGA 3GYBA 3TZEA 3RVBA 2P2GA 1HKUA 1Z8FA 2H48A 3LNCA 1NXSA 4MRNA 4E1AA 5BW4A 3ZWQA 1YF3A 4C4XA 5FBKA 1YKSA 3AG6A 3RODA 4NBLA 4IZOA 4B6GA 1JZSA 1Z8HA 3PX3A 3TSZA 1KGSA 4KWEA 1RYHA 4WLVA 2AF3C 3AYXB 2PKWA 4EKDA 5K4AA 1W5BA 1II8A 1ISPA 3FUCA 4C6TB 2PUFA 2ZPAA 3IBSA 4I7EA 4HVTA 4D82A 1JKIA 2G71A 3PNMA 4CIXA 1JLKA 2FZCA 1TPYA 5M7EA 1K68A 2ZYHA 4RNCA 5KU1A 3TEJA 3CXUA 3TW6A 1CJMA 3CT6A 1BO6A