1IHPA

Structure of phosphomonoesterase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
438
structure length
434
Chain Sequence
b'SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHYTASE
publication title Crystal structure of phytase from Aspergillus ficuum at 2.5 A resolution.
pubmed doi rcsb
molecule tags Phosphomonoesterase
total genus 149
structure length 434
sequence length 438
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1997-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ihpA01
1DKNA 2WU0A 2HIAA 1V37A 2P78A 2F90A 2YN0A 2P9YA 4D4LA 2A9JA 2HPAA 2WNIA 3E9CA 3IT1A 3F3KA 5AK0A 4GPZA 1UJBA 2DWOA 2PA0A 3LG2A 1SK8A 2P79A 3IT3A 4ARSA 1IHPA 1XQ9A 4ARVA 4EMBA 1QHFA 2BIFA 1YJXA 1DKLA 2IKQA 3QPWA 3ZHCA 3K4PA 2P77A 4JOBA 1EBBA 3FDZA 1NT4A 1C81A 2P6OA 3QPVA 2YN2A 4PZAA 2RFLA 1BQ4A 1FBTA 2GFIA 4IJ5A 1QFXA 4GPIB 1H2FA 1ND5A 3F2IA 1RIIA 4FDTA 3PGMA 2H0QA 4JODA 5AJYA 2P9FA 2EOAA 2OWDA 5CX4A 4EO9A 3MXOA 1DKMA 2P2YA 3NTLA 4D4MA 1SK9A 3DCYA 2P75A 3IT0A 5AJZA 3LL4A 5HTKA 2H4ZA 2A6PA 2P6MA 3EZNA 3KKKA 4IJ6A 3K4QA 3C7TA 2P2ZA 2ENWA 2DWPA 3E9EA 5CU7A 4MA4A 1T8PA 3HJGA 5AJVB 1CVIA 1SKBA 1UJCA 2I1VB 3O0TA 4D4JA 1DKQA 4PZ9A 4QIHA 4JOCA 2ENUA 5AJXA 1DKPA 2EKBA 3QPUA 1E59A 1V7QA 1RPAA 3GP3A 4ODIA 3R7AA 3OI7A 2P9ZA 3BIFA 4TSRA 1TIPA 3E9DA 2H52A 5HR5A 1BIFA 3FJYA 4PGMA 1DKOA 3NFYA 4FDUA 2WNHA 1FZTA 3FDZB 2P30A 1H2EA 5AJWA 2EKZA 3MBKA 1ND6A 2QNIA 3IT2A 2AXNA 3GP5A 1SKAA 2H4XA 3D4IA 3D6AA 2HHJA 4AROA 1C80A 2OWEA 1RPTA 4D4KA 5PGMA 1YFKA 5CDHA 4ARUA 3EOZA 1QWOA 1K6MA 1E58A 1BQ3A 1C7ZA 3D8HA 3DB1A 3GW8A 4HBZA 4E3WA 3LNTA
chains in the Genus database with same CATH superfamily
1XTJA 3EGDB 3SU8A 1U0BB 2P0AA 1MJGA 4TLMB 5C80A 3SI7A 4P7KA 4JLVA 4Z9YA 2CFIA 2W6OA 4OV6B 5AW0A 5EHZA 1IQRA 4IDBA 4G2NA 1CJTC 3LFHA 2AEJA 4EA9A 3BAZA 4TN5A 3EOAI 1PJQA 1E2MA 2QSUA 5KKAA 2HRCA 3BWBA 2C8LA 2PH3A 1NVWQ 1VGVA 3PB3A 4UNNA 4X1KB 3QWIA 3RROA 4DMMA 1SOVA 4EPWA 3FUTA 1HL7A 4MV3A 2AUMA 2QLNA 4EA7A 1YNSA 5AJUA 1D6JA 1F1JA 3WLNA 3HCEA 4CM3A 3RVKA 5JYBA 2ZQZA 3QITA 4FMDF 1X19A 4O4HF 4B4DA 4DXHA 4EY3A 3L40A 4OP2A 4PGGA 1LDMA 4M98A 5BRAA 3WLKX 2NSJA 4FKBA 3ZHZA 2WWTA 1PFKA 1ZCJA 1TFUA 3QIVA 2RHTA 3WHPA 4PLPA 5HIAA 1E8MA 3MUOA 3LUFA 5JMOA 2RAPA 2PKXA 2JLVA 4JJ7A 4D9NA 1Z5ZA 1ZIPA 4OHXA 4TMYA 4UNRA 2PZLA 3RUDA 3IVCA 1Q16A 2D5IA 4AO6A 5DHUA 5E9QA 1E1QD 2BM1A 4XAQA 4DSZA 1H5QA 3D5TA 3I45A 4KYUA 4B47A 1Q21A 3OPXA 1H22A 5CBPA 1DFGA 3H84A 3QXGA 2P9GA 3D7NA 1XD2A 2UYYA 1FFWA 3C6YA 2LZ0A 1IQPA 1NFFA 1SHKA 4M22A 1P7YA 2X0NA 3HYRA 3U81A 2FA9A 4DDTA 4ON9A 1X87A 4Z4GA 3F8SA 1GWNA 1SPBS 2EGUA 2ZSUA 3IR6A 2OHGA 4H3KB 4MA4A 5KC9A 5DLPA 2D1YA 1T9KA 4RTNA 1WR8A 4U2CA 1A96A 1TJPB 3MJEA 1R6XA 3SZGA 4Q19A 2NU7A 4YP0A 5AVZA 1K9SA 4Q6WA 3PC6A 3E2PA 3RHSA 4ZDKA 4LDNA 1H2XA 2XWBF 4K6GA 4KQEA 1W46A 1L7DA 3B20A 5DIFA 4A92A 4B0OA 4CM7A 2Y1KA 2CGEA 2FNAA 1N6NA 1NJGA 3E15A 5B7PA 4DILA 5K3FA 4X91A 1PZMA 1GFSA 1YB2A 2HPVA 4OHVA 4PGFA 4PANA 4LE1A 1HFEL 4TYQA 3VM6A 3I9V6 4PG5A 1M2HA 3SYRA 3TTWA 3E84A 4BXOA 4A8PA 3QBTA 1Q91A 5J2TF 5AM5A 5F52A 3W2TA 3SNKA 2EKZA 5H4GA 3PEWA 4PHTA 3UNXA 1Y3BE 1LSJA 3R8XA 2DY0A 3I2HA 5I9MA 3FOCA 1PNRA 1KFKB 4FGUA 1WM1A 4G6ZA 3T3EA 3N8NA 2O8DB 2Y1GA 4PZDA 3MJ4A 2RK4A 3EPRA 1D4ZA 1PJ3A 2QTFA 1BMDA 1WVIA 2EBUA 4KTTE 4PG6A 4X54A 1C0IA 2ESRA 1N5LA 1QXSA 3MMPA 4OBWA 1AQUA 1CUAA 1PJCA 1XLWA 3GYGA 4C06A 1SHJA 3DMTA 3DMTC 4TZ6A 1SKUA 3DE7X 3WQHA 4C2BA 2V7UA 5F51A 3FPEA 3VR0A 4DA7A 4YJHA 3J81k 2WAXA 1P39A 3GPIA 2GYUA 3TLXA 3ZU6A 5EQJB 2WTBA 4TMKA 3UOGA 1MX5A 1A4UA 2D1TA 3VKHA 1BD4A 3MOGA 1LVHA 5CT9A 2CDRA 3GVPA 2FW9A 2YN0A 5ALPA 3UYKA 1T5TA 4EG7A 3TOCA 1O96A 3P5BA 1G63A 2UZ4A 2I99A 5CYPA 3VYTB 1MABB 2YWHA 3AR4A 2BM9A 3PJGA 1KVSA 1OKKD 5CCDA 3RC8A 4MR7A 3PS9A 2G9RA 3EEIA 1SNYA 1WW3A 4HWTA 4LK2A 2IYRA 1P1KA 2YX1A 4JT2A 2Q7OE 2GJ9A 4XWWA 2KJQA 1DU4A 1L5KA 2O8NA 3V1YA 1WZ2A 4I36A 1ZMXA 1NI4A 4ZYWA 2DUWA 1R9MA 2H0AA 3JWPA 3K4PA 3DPSA 4JC0A 1XPRA 3UMJA 3V1UA 4LOIA 3H8WA 2V7VA 1M8FA 3KUDA 4MRSA 4PZYA 4YRFA 1U3CA 1RE1A 4G5FA 1U7PA 4B9EA 3ANSA 5C35A 1ND5A 3P0EA 2JH3A 3GDWA 3KAPA 1YFLA 3K6SA 4TTPA 2OV4A 1UQUA 1VZ2A 3B38A 3GFGA 4RVOA 1KQOA 3STXA 5J2UA 2A35A 2Q5OA 1HTWA 4LI0A 4UEOA 1GDDA 2QHXA 3HA2A 5EAIA 2HBZA 1P2UA 5H81A 1UXOA 2X76A 3EEFA 2VHXA 2HU5A 2Q21A 2F00A 3COPA 2C4UA 5E6UB 1EFKA 2A9RA 3DWGA 5BSEA 1NW3A 2P2ZA 4BB5A 2YCLA 1NX9A 2QTHA 2CLMB 3AM4A 1NMZA 4QXQA 3W8NA 1CDZA 5EZ6B 4KE9A 3I4LA 1XZQA 4FINA 5EE0A 2PL5A 4QD3A 3FOEC 4B7CA 4ZRNA 2H5JA 1L7NA 3CZ4A 2BP7A 3ZE8A 2OHJA 2GYYA 3HM9A 4QGBA 3FR8A 3R76A 3RVJA 4LKRA 3AC0A 3R7SA 1TKCA 3DQQA 3AHJA 1IVYA 1DQNA 4GM1A 4PM4A 3RB8A 4U7TB 4ZPXA 4EG0A 3LBFA 1R0ZA 2CLHB 1D1PA 1M2VA 1U8FO 3O3MB 3V3TA 4Q7JB 4YAKA 3C48A 3NBYC 1IM8A 5M34A 2YRFA 3PFWO 4IQ0A 1PV2A 4LYGA 4JC4A 3KP1A 1TVKA 4MVYA 3LLUA 4ZQEA 4HYYA 3W6NA 3WB9A 4ER3A 3DFKA 3BJIC 1YWGO 1Z6GA 1Z07A 3AVQA 3U4GA 3A6PC 3NBKA 4E07A 1P91A 3Q3HA 3QLTA 3WWZA 3CX8A 5IVKA 4BLUA 2NSHA 2VDWB 3WAKA 1BDIA 5JOQA 2R6FA 4J3NA 3FCAA 1XK7A 1T10A 4G09A 4YO8A 3W4JA 1VCIA 4BNTA 4F8JA 3FSGD 1P1CA 1X8XA 4MAFA 1DPFA 1DKRA 1MO3A 3CSDA 6REQB 4K05A 3WRWA 2SBTA 3HYLA 4RDCA 2MSKA 3EGIA 2P3OA 3TOXA 4HGQA 4IJWA 3VR6H 4WECA 4JCCA 5LQAA 1NC3A 3IAUA 5A03A 2NZJA 2F9MA 3WQQA 3T7JA 3BL8A 3T5MA 3FROA 4ETWA 2Q3BA 5EUCA 3IESA 1J97A 4GH5A 4KYIB 4B6JA 3ED1A 4XDHA 5HDBB 1QO0A 2QV7A 3PHJA 4CZ2A 1DO0A 5HCIA 1EP9A 3SFTA 2FW6A 5L6MB 3KTAA 3HN7A 3HUUA 1N0IA 5CDFA 5HUHA 4WCVA 1ADBA 2P8SA 2I80A 3VU8A 1NLFA 5ES3A 4EVSA 3AVVA 4YBRA 2G9NA 1J8FA 3EVFA 4BRZA 4YHBA 2X42A 3KE8A 4R8RA 3WQBA 2ZE8A 5CLQA 4RQUA 3RPEA 1U8UA 3I0NA 1KVQA 3W3ZB 3IL2A 2XT0A 5JHGB 2C78A 3RC9A 4XX1A 3E35A 3ILXA 2PX0A 2WM2A 2HWXA 4RCZA 3VR2D 3DLBA 1NJ5A 4FI3F 4Q9KA 1U28A 1U28C 1XDGA 3KK0A 4JEIA 5AHKA 5EUMA 5IJWA 1L5YA 1YRHA 4QOSA 5JADA 4BDSA 3ST7A 3K1TA 3BILA 4CN8A 5BVHB 1SCKA 3HTXA 1XA4A 3GT3A 1C7IA 4G5GA 4PQRA 3THRA 1QYWA 1UBEA 1YS9A 1IEXA 4TLAA 4AJ1A 5K3EA 5DOZA 2DTEA 4QXPA 4BEWA 4IJQA 4E03A 3HBLA 3I6MA 2EFYA 3FNQA 1OFUX 1V25A 1GGHA 4KUGA 4RLHA 2XCUA 5IUJC 3GPBA 4XPIB 2X0FA 1MN6A 3QV1A 4H4DA 3MWJA 4JFRA 1ADYA 2JLBA 4X6XA 1BWRA 1EFVB 4L7VA 4DR7B 1MX9A 3P32A 3IERA 1GZSA 2OP0A 4QUJA 5IHPA 1TIBA 4KQHA 3I5AA 3D4OA 1JG6A 1YCHA 3OIGA 4YCDA 1Q7RA 1WPXA 4AY2A 1VGRA 1WXIA 4LQCA 3W9YA 2B92A 1OT5A 4KN8A 1ZXLA 4MHSA 5EINA 1H2AS 2WKWA 2DQKA 4WGFA 1PNQA 4D81A 4HDKA 1ONNA 1IY1A 1H0KA 1WSDA 2O2HA 1Y9AA 4OM7A 4D44A 4RQAA 3NIDB 3O8QA 3UCXA 1QPBA 4I2VA 3WWYA 4CN9A 3KL4A 2QW8A 4Q1FA 4CMBA 4YLYA 1H2HA 2Z8YA 4Z53A 2Z1DA 2Y2UA 4LZNA 4KOAA 4TS9A 3AUYA 1AQJA 3E9DA 1KC3A 1PBNA 4A23A 3NHSA 3RS3A 1GYRA 3IDAA 1JZSA 2JA1A 3M9XA 4L0DA 1DKOA 4RMJA 5KTPA 2QPOA 2YVKA 3DV0A 2FDXA 3BSSA 3P27A 4H1UA 4JEHA 4L08A 4QULA 4B6EA 1M0EA 3O8LA 1YI1A 4QU8A 2VPZA 4BFCA 2IP2A 2AKYA 4ZYZA 5T7BA 1DIGA 3D7LA 5SYAA 1N5MA 4KXWA 3ZNNA 4NMMA 5E9AA 5AKLA 1K6EA 4RV4A 4ZT4A 721PA 1J0XO 3THXB 1V5GA 2ZJ8A 1L1EA 1QB8A 2DFKB 1NHGA 2AFRA 1TZBA 2V9PA 3S2UA 4XB6B 5DM0A 1O6ZA 1C4XA 1U0RA 1UJ4A 2GF2A 2FFAA 3RU9A 1LDNA 1KWKA 4R2LA 1N8KA 2JA2A 2BHSA 4P3NA 3RCBA 1C7ZA 3EJ6A 1IZYA 4XYEA 2ATXA 3RHFA 1PGQA 3HKCA 3M2TA 2Q3HA 1U2QA 3ZTTA 2XOXA 3LZ6A 2V96A 5EZYA 3FNFA 4Z4FA 4BYMA 2MSWA 3WY9A 2X8JA 5C4IA 1QFZA 4IL5A 2HD4A 2NNLD 4URYR 3A9TA 3QMWA 2R5FA 3GUCA 2W8ZA 1G2PA 1P8AA 1U9ZA 1R0XA 1U0OC 2QP4A 1SXQA 1IULA 3K6RA 2OMEA 1TW2A 2X2OA 3PLAE 3OPQA 3B8EA 4J2HA 4JI6B 2PGOA 4FT4A 5D6OA 2P79A 3NM6B 3LHIA 3RIHA 4JGIA 4KVAA 2PZAA 3A9WA 4LXTA 4W99A 3B6KA 2WMOB 5EHQA 1TF5A 2QAGA 2QAGC 2VQFB 4JT9A 1QO7A 2VSYA 1KP2A 1E20A 4HI0E 3OWHA 2R5WA 2FW8A 1FX0A 1WB9A 1RRKA 3OHPA 4ZCTA 4BV9A 4TXJA 4HAYA 2C8KA 2ECOA 4XVUA 3KETA 2O2CA 3R8CA 2DSNA 1OQAA 4D3ZA 4GEGA 5B7NA 2BFBA 2XUOA 3KQKA 2IUFA 1XRRA 9ABPA 3B1VA 4P7FA 2IHVA 5ALUA 1FFCA 1FPQA 4GLFA 4ND2A 2II6A 2MSLA 2OGUA 2PEYA 4BO0A 4D8TA 2CJYA 2B3TA 2Y05A 4A27A 1B73A 5K6TA 2AJTA 4KN5A 4W82A 1RI1A 4WK4B 2A86A 3NOQA 3ZE1B 1O94D 2JZCA 2YCBA 2XDWA 5E38A 3C87A 5GONB 1HR0B 4NICA 2B2NA 1Q83A 2QQ5A 1HQKA 2VDOB 3M6LA 4HDRA 3BK7A 3K4QA 1E0JA 1HK7A 1RPJA 4RLQA 4TT8A 5DF1A 2CMKA 5AHXA 5FRDA 3UZUA 1QKJA 3OCXA 3BKXA 5DU2A 4ES6A 4A8TA 5BMVB 5ITVA 1Y6GA 4Q1VA 3OCVA 4IINA 4PFSA 3B1FA 1CB7A 5FBWB 3SEAA 5HQ3B 1UCFA 1K7CA 2ZT5A 4GDMA 3NAMA 1GSAA 3EIFA 1AHNA 4ZCQA 3ZHRA 1RM0A 1Z45A 1L2TA 3EEBA 4ZCPA 4ZZ1A 6NULA 5I9TA 2WHQA 1R5OA 1SPXA 3DEFA 3BB1A 3ILHA 1JEDA 2HC9A 3G2MA 2GK7A 3ZE7A 1EDDA 1X13A 3DW3X 4RPHA 4HAOA 5F1OA 3O82A 4EFKA 3MJDA 3JD0A 4QA9A 5GQSA 1XTQA 2A5DA 2CF5A 2GBCA 3HS3A 3INNA 4L78A 4MI9A 3T5TA 5DYYA 4CUJA 5G02A 4GP9A 2ZI5A 3HRKA 4RF3A 1DHTA 2IW3A 2EKDA 2RG7A 2X3FA 2IODA 4U7GA 4DIOA 1UP7A 1W0JD 1GPNA 2QX9A 2QU8A 2ZRJA 2AMYA 3VNVA 1XLUA 5B3KA 1CUCA 1QBGA 2OCIA 1DMSA 2I5PO 3DBHA 3R3ZA 4L2IB 3TM4A 2BBWA 3DJYA 2ZS8A 3W77A 2CV2A 3DEKA 5BW5A 1KI6B 3N58A 3SC4A 2CCKA 5JH7F 1SCJA 1RLUA 5T67A 4BFXA 1TQHA 4MI1A 2IOFK 2VCYA 4CLRB 1J7JA 1E7RA 3EVTA 4UBOA 5DOVA 5KTRA 4PO9A 1NXPA 2SECE 2XE7A 1KJQA 3Q9UA 4JX9A 5JI3E 2I4NA 1M66A 1MV5A 4V0RA 4L4ZA 1PJBA 2B7LA 2CNOA 3LPMA 1H23A 4K7JA 4ILKA 1KPIA 3R2JA 3DLHA 4PQEA 3D7MA 1YB6A 2HLNA 1R8QA 4LRWA 1GR0A 5HKBA 5LU8A 3TWOA 1VP3A 5HZKA 3JQBA 3JQBC 1JWLA 1O97C 1GFIA 5I01A 4EMBA 5HQTA 1LS1A 3DGEC 2GBFA 3B7WA 3QKWA 1H1TA 1JLMA 4OH1A 2YOFA 4M54A 4CCSA 3UHOA 3TZBA 3TQTA 1KKMA 3M3DA 5HP4A 4EA6A 3I5MA 3VJRA 2JGKA 1VLZA 3L7JA 4BRSA 3GEGA 3JV7A 5CURA 4EB6A 1HORA 4EDHA 4GG1A 5FOVA 3VR1A 5LP1A 2ORED 1N7IA 1XQ1A 3I30X 4OBBA 4R2XA 5JEDA 1EINA 3UAGA 1G8AA 1X9IA 2QNBA 2WLTA 2YRXA 1AKNA 3LY7A 3TTYA 3S8YA 4X5OA 3VDNB 1O1YA 2OG2A 1KRWA 3FWKA 2H7XA 2AS0A 2FN9A 5HUQA 1YA4A 4RCVA 3CZQA 3O6VA 2AK2A 4PXYA 1QVRA 1WCWA 2ERYA 5FADA 4V0LA 1E5VA 1NIPA 4FE7A 5CR9A 1OBHA 1YB1A 2VRNA 4M0LA 5L3QB 1Z39A 2J0QA 3D0OA 3KM0A 5GIOE 1Q77A 2NP6A 1EFTA 1JXOA 2AC7A 3BB4A 1JHAA 1TJ4A 1SVOA 3BREA 3EQZA 3IBGA 4UXIA 3VUEA 4EW3A 2C99A 3SVTA 2BY4A 3T41A 1VHWA 1CVLA 4FDLA 3UPDA 4CEHA 1V26A 5BUQA 2W2TA 1OUMA 2C98A 5ESXA 3TKLA 5JYCA 3KOXA 3EIHA 3OE1A 4EY4A 4YMGA 1XYYA 2C31A 1RLOA 1U1GA 1YGPA 2ZBGA 5KTSA 4NBWA 3MAAC 3ZDAA 3U9TA 2FEKA 4DC0A 5FQNA 1NZFA 1QNFA 1R37A 3I6YA 1EEHA 1EX1A 2F3SA 1IONA 1TKAA 1BXRA 1E9FA 3HNPA 4WZBE 5AW5A 1D1QA 1T4BA 5BNTA 4GM4A 4MQ4A 4A3SA 1QMPA 2VNAA 3FJYA 1XJCA 1BDMA 1KMCA 3NRCA 3RVBA 3UHAA 4TWRA 1ZA1A 1O58A 4YDRA 3DP9A 5CX1A 3VQTA 2D5LA 5HVNA 1SIBE 1D2EA 2ZDGA 3BXFA 3OD5A 3SPXA 4Z4EA 2WINI 1ODLA 1WCIB 1D4FA 4Y9UA 5IFLA 3L0ZA 5DX8A 2IEIA 1FP7A 2RI0A 2R1ZA 5ICGA 3H5AA 3C24A 4R51A 2G83A 1JEQB 3LXUX 5K3SA 1T26A 1ADCA 5C5CA 4FGLA 5TDHA 1IXSB 1GV1A 5DWVA 1CF2O 3OX4A 5I9LA 4EYGA 4RVCA 4B43A 1J21A 5D85A 2QGZA 2PL1A 1M6VA 4DLUA 5EXPA 3SOPA 3S2YA 4AMZA 3AM5A 2MINA 5AOBA 5FBHA 1W0KA 2ZBUA 5KS2A 3P0JA 3L18A 3MEQA 4HUQA 2CNDA 2QZJA 4Q5IA 1IEWA 3R3JA 3H42B 4K6OA 5K6AA 5K6AC 1F5SA 3O7WA 2QRZA 3FLBA 5ALZA 1SRRA 2DPMA 4OKNA 1XZAA 2H1RA 2H59A 4UUMA 3U7QA 2O5EA 1Y3AA 1U0JA 4A6PA 3R9XA 5KTMA 5BYJA 3T1OA 1VE3A 4XTCS 1Z4KA 2DBVO 2FB9A 2YN4A 4MITA 4X6UA 1NBMD 1GYPA 1I36A 3ZWXA 4E5YA 5C1OA 1WABA 4BATA 1E2PA 1JEOA 4HDMB 3WX0A 5KVCA 2OMKA 2VDNB 1VJ5A 3PPXA 3Q3JB 1GTZA 1R9JA 5JAMA 3QLEA 5TF0A 1G42A 1A2BA 1GADO 4DZRA 1Y4AE 2ICAA 1OILA 2AK3A 1AF7A 3STUA 2YWGA 1H4VB 3F6PA 3NORA 5JTTA 4PFJA 4Q03A 2ECKA 1E2LA 3EZ9A 3VR6A 4XWKA 2VYNA 3IQDB 1U65A 4HZGA 2VPYA 2YW2A 4BMPB 1BC5A 1W25A 3RANA 2NADA 1NDQA 1XP8A 2OOKA 2RBEA 2WSSA 2XAUA 3B82A 4Q12A 3IILA 3U49A 3GMDA 3K20A 3RSOA 2WU1A 3WDKA 5B55A 2BEJA 3JQAD 3GZNB 3ND5A 2ABWA 2OY0A 1QQ6A 2SCUA 5BR8B 1X7HA 1QS0B 2YNMD 2C4MA 3DCYA 2YYAA 3TQOA 5DP2A 1ZGGA 1RRMA 1RBYA 4I08A 4A8HA 2XXAA 3Q7IA 4EARA 1W1WA 1E18A 1U3VA 3L4BA 4NEHB 3LF2A 3ZHXA 1BH2A 3W4KA 5L3VA 4YALA 3O8CA 5LZ8A 3TVYA 1KFBB 2XA9A 3M34A 1LI4A 4JYPA 4CU2A 3V7YA 2H0RA 3TG2A 3IOEA 5EFOA 4B74A 1BE1A 3TLAA 4M6WB 2W2NA 3QFRA 4D5GA 2PMDA 4W6QA 2UUPA 3QVMA 4B3SB 3DYBA 3KZXA 5K01A 4UEKA 1RABA 3O1JC 4IKOA 3EZ6A 1TPYA 4BEVA 3KEQA 4MS4B 4ZOAA 2H1FA 3RVDA 1QHIA 1ZUWA 1QYVA 1VL2A 3P2JA 2F9FA 4DT1B 3I5YA 3LC2O 1QU2A 2R11A 4EBBA 3ERCA 4CQJA 3MRXA 3NS7A 2D8MA 2Y1EA 3C3BA 4KAJA 5T8KA 2Y71A 5T8KC 2R48A 3VMFA 4AFNA 3RG8A 3DMPA 1RQRA 4P4NA 1XRNA 1EVIA 5ADVA 2DJIA 1KH2A 2YYYA 1C9KA 2HQOA 2GBPA 2XKAA 1EH5A 1HM5A 2OO3A 1VJCA 4O59O 5FFFA 1DTEA 1DTWB 3E22A 4S1TA 4AC9A 2VXYA 2OBNA 3N8HA 2J3DA 1XDZA 5JJ5A 1PWYE 5J1SB 3CO5A 1NSFA 2PSHA 1D9ZA 1U4SA 1TRKA 3UQYS 1EMDA 3EY4A 2G71A 3T94A 1IN6A 3AZPA 3UXMA 3WIDA 3WLMA 3B2NA 1E1CA 1OZGA 3NBUA 3DDWA 2PNFA 4QVGA 1U5CA 2YQ5A 4U2KA 4TUYB 3W5SA 4O4IF 1BYIA 4R1MA 2QNRA 3M6UA 1EZZA 1T3TA 3A36A 3P9XA 4GVXA 5I45A 1QGED 3NO4A 2CXOA 4J2TA 1M7BA 1OROA 2RBKA 3AVOA 3UT5B 3LDUA 3WKDA 3GQVA 3O2JA 1TUBA 3S40A 3UWPA 1BWSA 3IP3A 1AZSC 3IO5A 3CRRA 3L1JA 5CRIA 5F5LA 2ADFA 4YR9A 3CKMA 3SEFA 2PFKA 4N8SA 4RHXA 2PUCA 1PR9A 1XZNA 1XMSA 2JIMA 3OLZA 1KAGA 1U0LA 2JGDA 4NULA 5F1PA 4G0WA 1NRXA 3G17A 3HJRA 3OCUA 3R23A 4ZDIA 3IEVA 5DK4A 2O19A 1SUWA 5LNK6 5TPZA 4YUXA 2Z9DA 2PUAA 1BVYF 5CW1A 1JQ3A 3R74A 5HJ7A 1E6UA 2HMWA 4LTDA 1LPNA 1V7CA 5L3SB 4O4JB 2AC2A 2VHWA 3JZAA 3G02A 1ZCAA 2LXNA 1E69A 3M6MD 2W2KA 3MJRA 4MWGA 2EZTA 2GASA 4IGIA 4UBIA 4MW5A 3KWJA 3P71T 4YT4A 4GI7A 1EFPB 5CXUA 1Y7PA 2Y2VA 4GPBA 2XBLA 3AHEA 2OHHA 1YL7A 3N0XA 2XBUA 1NQXA 4LDRA 4BN4A 2WYHA 4Q9LA 2VS1A 2C9BA 3K2EA 5DM70 3L8FA 3P9NA 3EUWA 1L8AA 3UJ9A 1GZHB 3R3UA 2Z4SA 5AVJA 1AK2A 2VK2A 3NPMA 1M3SA 1JZTA 3PQ5A 2BF7A 4CIXA 1THMA 2VAXA 2BCGY 4XDGA 1NC1A 2UZ1B 1V11A 3KXKA 4IIFA 1F51E 1VG9B 5TQ0A 3SP1A 4P6VF 3EQ9A 1WQ1R 3OETA 2V8BA 2EEZA 4QTUB 3FFWA 2J45A 2RH8A 4JROA 5HCNA 4FD3A 1DTSA 5J5VA 3N0RA 3BXOA 4X44A 1PR5A 3DOFA 1JALA 1U8TA 3AEKA 2WWGA 3GNQA 2IU3A 1T34A 2HCFA 3F4BA 4C43A 4KHPB 3WSVA 2DG2A 4JYCA 1XAHA 4N48A 1Y89A 3NT2A 5COQA 1DDIA 3RSCA 2WWIA 3G6WA 4IKEA 5DLQC 2ZWPA 3DL7A 1E6WA 3MRTA 2EDCA 3UB2A 4X00A 3KBOA 5HFJA 5LA6B 2CZCA 1FYWA 5K3CA 2IYSA 3KXDA 4NU5A 2DFVA 1PWEA 2YY5A 4RUKA 4J1QA 5IC6A 3I8XA 4YC7A 3VVLA 3IAS1 3ESDA 4J7UA 4Y6OA 1PT9A 3U4QA 1F2DA 4WHMA 4FZVA 1V7QA 2E6KA 3G89A 5D51S 5K3AA 2ODEA 3VKFA 4F71A 3P5SA 1EVEA 2DT8A 5KC8A 1LLFA 4YQFA 4JLWA 4I6JA 4MVJM 2AFIB 4FHZA 3OFVA 3DT8A 3BJZA 1CW2B 4P0PB 2AXQA 4HZUA 1JR4A 2M1XA 3A31A 4R8MA 4JIMA 3TVTA 1VFNA 5DHAA 4Z0NA 1W8DA 3ICPA 1GN8A 4JASB 1RP7A 5KO2A 4M9XA 2XPCA 3HL4A 2JIZD 2R8ZA 4JOSA 5JSYA 4X24A 1QK3A 2REBA 4S2EA 3VU0A 5EJ9A 1EI9A 1N2OA 4NDZA 1V8BA 3HRHA 1FP4A 1N6PA 1P8JA 2J08A 2PPLA 4UC0A 2IITA 4XM2A 4YRAA 3A25A 1LCIA 2BPOA 3BTSA 5A4MS 2BV3A 2BZ0A 1OHHA 3CPHA 4JBLA 5SZHB 3TBKA 3UHFA 4BO1A 5LD2C 1OLSA 1RAFA 2W5UA 3JS5A 1B14A 5EWJB 5KOJA 1K88A 2IYLD 3AFMA 1H6AA 3UXHA 2CNBA 4DB2A 4EYEA 3QX8A 4MVXA 3FMPB 4DQ0A 1ORVA 1ZG3A 1VG8A 2BI8A 1C30B 2FRXA 2K7ZA 2QMQA 2Y99A 3F6YA 3H5NA 4IR7A 4OQQA 1QF7A 3DUWA 2JGLA 4I6GA 4BKQA 3DE3X 3AM1A 1P80A 1M0TA 2W93A 1KQNA 3RUFA 1PQPA 4DV3B 1K66A 3QI7A 3SS9X 4GLBA 2CN1A 4FHCA 3V4ZA 4ANFA 3KCNA 1KEKA 5GJBA 5K2OA 3CA8A 3ESZA 1RXEA 5DYIA 1TCUA 3CKYA 2QLJA 3GRRA 4RPGA 3VO9A 3ROXA 3DOUA 3HG7A 3ZV5A 4DAEA 4NESA 1LW7A 4IVRA 4G01B 1JLLA 2C9OA 3JTEA 4G63A 4MW1A 3EVGA 3URMA 5KCMA 1T0BA 1AURA 1UMCB 1Z82A 1GPAA 1WB4A 4J7CA 1QAQA 1N6LA 2P9JA 3IIIA 3PNSA 4PRKA 1EBBA 3IH5A 1KDRA 4B0PA 1XZPA 3ESBA 4YK7A 5FP0A 5JECA 3M1YA 4RCYA 2J41A 1G7SA 3QVTA 4MEAA 3T5GA 2FP3A 2NX2A 2ZGVA 3ANLA 1NVMB 1YIAA 2VNSA 2CHFA 3MTGA 1FDIA 4O02B 3F7NA 1R4ZA 1JEEA 4B79A 3V1TC 1CBUA 1MV8A 5ADHA 3ZD7A 3MCVA 1ISSA 1EUCB 1A77A 1XD9A 3FIUA 3I6ZA 5DT9A 2YS6A 4IH4A 2E5LB 1SIOA 3QVVA 4CODB 5IF9A 4U3JB 4U7DA 4ZN6A 4PLFA 5DYWA 3NTOA 5TB5A 1EWKA 3PLNA 1J8YF 4DCSA 4DRXA 2IQ5A 1LWNA 2HIHA 4BUCA 2PSDA 4EGFA 2QK4A 3JQDA 1HLPA 1I2ZA 2F8LA 1JS1X 5EIBD 2QPTA 5AH0A 4OX9B 1N0HA 1TZKA 2J5RA 1N4AA 2OV3A 2D62A 1DHRA 3BYZA 4Z99A 3GEMA 1HH4A 3ZPXA 4EPXA 2OXEA 2CCJA 1BX0A 3SQXA 5BORA 3OMLA 4G0OA 4F5YA 4D25A 4Y30A 4YRLA 1XAIA 2PVPA 1NVEA 3BL5A 3K8QA 2FPGA 3QVGB 1PU2A 4KNWA 4DXDA 1WRBA 1WW8A 1LQUA 4P31A 1K3UB 2H5EA 3A4MA 3CSUA 4IWXA 1XTPA 1F6WA 5E3JA 1ZVVA 4Z9AA 1TEHA 4OLBA 3I62A 1AV6A 4NAUA 2ZB4A 1ZSVA 4EFDA 4RIEA 1ML4A 4C08A 5KVSA 2D5AA 2A1UA 3RC3A 3HGTA 4B3GA 5EJEA 5MHTA 3SF8B 4JELA 1XU4A 4G8CA 1XWWA 4QGSA 3ZYZA 2Q0QA 1E99A 2I2AA 1DDOA 1ECCA 1EM8A 1VHTA 3GNSA 3I53A 3E1GA 3T1VA 1QYDA 4P33A 2OXCA 5ARDA 521PA 4C7BA 3OJFA 1MOQA 1YUMA 1K5DA 4M9CA 2QXUA 5HUJA 1DXYA 1IQ0A 3NHBA 4R98A 1PAUA 4EEKA 2XCTB 3ACBA 1ZH0A 2DPHA 2PNJA 5I6DA 4RGBA 1PL6A 2FZEA 3FMGA 3R6TA 3E0QA 4YJ3A 5BSUA 3S70A 3BM5A 2I3GA 2GPBA 4QEKA 4CIYA 4RTJA 16PKA 3H86A 1BQ3A 3I72A 3PC4A 1MDBA 4UUNA 3SHVA 5EP2A 1H1LB 1LLQA 3I9FA 1S8OA 2GF0A 5G53C 3H1TA 4A2WA 5HPYB 4FEAA 5DGCA 1WQ3A 1OGIA 4HQNA 3AUSA 4IUYA 2Q5EA 3PEVA 2AWOA 4ZT3A 5EHIA 1Z7YA 3L82B 5GADl 5REQA 2A5GA 3E70C 4AICA 4QKQA 3UJPA 4IFBA 1GD1O 1QNLA 1M0WA 2HRQA 3FGOA 2WY2D 1Q50A 2PEZA 2WE7A 4XQ9A 4BTVA 5KB3A 2XYGA 2X22A 1RQPA 2NAPA 3OD1A 4FWTA 3VJLA 2YJNA 2YXEA 4Y9DA 1TOAA 3G9XA 4MR8A 1JAHA 1RT9A 3EFEA 4L4YA 5K0TA 3K73O 1AZTA 2PRZA 4JHLA 2C00A 4N82A 2YV5A 2C04A 2E4VA 3HN6A 4L5JA 3ZH9B 2NV6A 4WFQA 1Q7BA 4U2DA 7MDHA 3MCTA 4AQDA 1I4OA 3V2IA 3FMIA 5JU6A 1WUTA 1R88A 3I52A 4OLHA 4UNSA 1U90A 3AONB 2BZSA 3NBZC 3SQLA 3UGQA 1BX3A 3ZVLA 1PFVA 1KPHA 1LEHA 2PX8A 2WV9A 4G56A 4D92A 3NNSA 4N6NA 1BRMA 4TROA 4V24A 2G70A 1V47A 1V8FA 1FZQA 4K6CA 4LZAA 1XDDA 2CUZA 3ONWA 1W1IA 1CKEA 4EY6A 1NF9A 5GONF 4M9UA 3ASZA 4YUYA 1WB5A 4W7SA 1QTRA 4FE4A 1GUAA 2YWDA 2DRIA 2HYIC 2BISA 3UV3A 2UVPB 2OZLB 4B3XA 5C7YA 4DSNA 3HJBA 2QRMA 3G5TA 3V2HA 2IYXA 3RYFB 5HNKA 1F14A 4PXAA 4H4CA 4QQFA 1D1TA 3GVHA 3FHOA 4K88A 3NCHA 4PNZA 2GPJA 2Q5CA 1M2KA 4PSKA 2CZGA 3L7YA 5CNKA 4YONB 1K7XB 1U1EA 3DW1X 2D6FA 1MMFB 3H18A 2BAGA 4BO9A 4Q7EA 5JS8A 3D5QA 1H69A 2DULA 2ZRCA 3CXRA 4NCHA 4Q1AA 5IK2A 3ZU3A 1P9OA 5KOIA 3ZDBA 4F3NA 5CA0F 3HJTA 3PXUA 2O8CB 1CZHA 1DEOA 3C3EA 4N0PA 2BMWA 4KMSA 3ZWKA 2VDVE 3I2GA 5I9NA 4M2LA 3M6FA 3UUFA 4BLVA 1PSWA 2XMCA 4ZYTA 2H00A 1KYWA 4LFAB 2IP4A 1M6YA 4LUCA 1QE3A 1RXWA 2AE1A 3HEBA 5EGSA 3TRHA 4R3WA 1P9LA 1XN1A 1JI0A 1MOZA 1WOMA 1SUFA 2QR3A 2Y9PB 3OKCA 1NAIA 1ZMTA 1VIYA 4JU9A 2FUG6 1RHJA 3W6UA 5AJWA 3H0EA 3K0AB 3S5UA 2I2FA 2OBFA 2AEMA 2GLXA 4HRYA 3REGA 2X14A 1SD2A 1JLRA 1A8QA 1BE0A 1UM9B 4REMA 1PYDA 2G80A 2OLEA 3N7AA 3NH9A 3FYUB 3E27A 3N7TA 1GLGA 3B1WA 4FYJA 4CR8A 2CE7A 4B3MB 4FOOA 1JW9B 4J1TC 3CX3A 4J1TA 1KEWA 3MFQA 4GPAA 4R1LA 3VVCA 4XSVA 3JQ8B 1GTJ1 2B5VA 5BQFA 3PQ4A 5H3LA 5I47A 1PVOA 3I0ZA 1W2HA 1WMFA 3CEMA 4I8IA 4JP1A 2GZ2A 3OESA 3A6HA 3FYDA 5KNBA 3N6RA 2VWGA 2JJ2D 5I5EA 3GP8A 1IPHA 1F0NA 1E6CA 3K0HA 2O6HA 5K1ZA 1R64A 1XTZA 2LGJA 1LPBB 3A6FA 3J81A 4LS3A 3I61A 2W00A 1I80A 1ZRHA 1O7JA 2VHVA 3AZQA 1G3RA 3ZZTA 3CVOA 4XR4A 1MFZA 1SVNA 3FYCA 3N3AC 4LJAA 1PX0A 3BGVA 4B73A 1M2GA 3BF8A 2WYVA 4HTFA 4JLNA 2GTIA 2X13A 4FIZA 5ERYA 3T34A 3VDQA 3OZWA 5DTMA 3DDNA 3B13B 4WCDA 1SVKA 3HB1A 3OLWA 4IDPA 5FD8A 4ARVA 2VAWA 1QGDA 2IZ0A 1E5QA 2G8NA 3P97A 1FUEA 5EPUA 3WL3A 4HH1A 4E4YA 2G9ZA 2AKEA 2P6PA 1S02A 3HO8A 4Q05A 4LOJA 3GLIA 4FFOA 4IZOA 2HZ7A 4ZOBA 2PLRA 2G72A 1X7YB 5CK4A 1YFZA 1VPLA 1WHTA 1Z4JA 1IAQA 1ZNQO 3A1WA 5G4KB 5KCZA 2O8BB 3PGJA 3F1KA 2R6DA 1I13A 1KIMA 3C5WP 2NYRA 4Y2RA 5JIBA 1ZLXA 4ZO7A 5A7HA 3OMWA 1Y5IA 1LLCA 2FVYA 2VP3A 3MINA 3NUGA 4TSFD 2ZT6A 5P21A 1B3BA 1YL6A 3E4CA 1RWWA 4G2TA 5JPIA 4IBOA 3U56A 2XIQA 1FFGA 3DP7A 4H3VA 3COVA 2EW2A 1V96A 4CFSA 3USZA 4L5CA 3GGJA 1RD4A 4WK6A 2VTVA 1I9CA 2JI6A 4Y2TA 4AJNA 3NAQA 4ZKEA 4WNCA 4BAZA 1PT6A 3AEZA 1MNAA 2OFPA 3ROMA 2ZSFA 1NN3A 5AK5A 1N0UA 2O8FB 2B2XA 3N2GB 1KI4A 5B1DA 5LQDA 1DAKA 1NUPA 2IX3A 5LU9A 1RQ2A 2J3MA 4RACA 1MAHA 3A4VA 3L8ZA 2F67A 3H9JA 4U7HA 3HDGA 4TRRA 1CJVC 2J5QA 1DWPA 5AW8A 3LX6A 1M8GA 1GGKA 1FYXA 1YRYE 4PX5A 3W3AA 1XXHB 1YT5A 5DNCA 1QCZA 1N9ZA 1T5IA 1NF8A 3N07A 1LBSA 5ERXA 2WSBA 2IXGA 2WF7A 4WN9B 5GJWC 4ONEA 3LBYA 1WUIS 4F46A 3MYRA 3K72B 4MHOA 4DMGA 4ESEA 1PEAA 1B23P 4BVBA 2FEXA 3BMCB 1XMXA 3ZDRA 3ONVA 3L46A 3IQFA 3OE7D 1VL1A 4CL0A 1UT6A 3KVNA 4RH3A 3GAFA 1U11A 4PNHA 3TH5A 3VKUA 4CXMA 4DUZB 3C8MA 4IV8A 1FP2A 4A15A 2IIVA 2QJRA 1HDOA 4Y1RB 1J0BA 1NUHA 2EERA 3D4IA 1EP3B 4UKDA 5K8VA 5CCXA 1MH9A 3LRPA 4L9SA 4PYMA 1ODIA 3LA6A 4IQGA 4R3UC 3V2GA 4BOYA 4EIWA 1G1AA 4CKYA 3V4LA 2FG6C 4RULA 1WVGA 2C2YA 3NNDA 1E4EA 1PWHA 4NTZA 1N9GB 1Y7LA 4HBZA 1GV0A 2V54A 4YNBA 5FV7A 1EVQA 3K94A 1U9YA 3PTZA 1EESA 4ND8B 4FXPA 3CKLA 1D09A 4DA8A 4MO2A 4RMIA 3SHWA 4TVKA 3UJCA 4RKQA 3SM9A 3M1IA 1RWPA 2X3YA 1SG0A 1AQLA 5G0UA 3ZWPA 4E88A 3GJSA 4AZ3B 5GTDA 3BA6A 2BFCA 3TMYA 3NUQA 5TX7A 4QYWA 4GVPA 4NBTA 1EJ0A 2OD2A 4WXRA 3ZWBA 4TMTA 2XY4A 4BV3A 1YOVA 2AHRA 2UYCA 5TQ2B 3KKMA 1YDWA 3PQ3A 4G0XA 4FWIB 2XCQA 2F43B 4W5WA 2CK3A 3R44A 4HNUA 1XRSB 3UFXA 2JATA 3PQ6A 5FF9A 3E9MA 1UAYA 1ZD3A 3MTIA 3N2IA 5A4AA 1PLKA 2LW7A 2W6CX 3JRXA 4A6DA 4ER5A 3MUEA 2YINC 2XMRA 4PZAA 2A0YA 3OHMA 1NX6A 1VRWA 2R2AA 4IJ5A 5KMGA 4KPEC 1EK2A 4CV1A 3ENZA 1HLDA 3TNFA 1AN9A 1E62A 1HMPA 4N03A 3AHDA 4FNMA 3T61A 3PXEA 4JUAA 4PZLA 2G08A 1QRSA 2FMHA 1E3MA 3OP1A 1J2TA 4C88A 4HX5A 4X61A 3GGGA 1S3IA 2HK8A 5TVGA 1GGMA 4Y0AA 3JAWA 1E3DA 2BZGA 3I58A 3NDJA 2WTNA 1DARA 4JUCA 2VH5R 4MS3A 2OLJA 2REQB 3HB5X 2BEVA 2GCPA 2AG1A 2L82A 4AIIA 5KNCA 1H05A 1PFGA 2PUDA 3GLFE 3JD2A 2MDTA 3DAPA 5HE9A 4UU1A 5ERGB 1UDAA 1R0WA 2D74A 2XQFA 3P2IA 2WZBA 4LZWA 5BRJA 1HNZB 3L4EA 1SU7A 4OXYA 2R1UA 1Y1QA 1ZRNA 4ETNA 3G23A 5C1PA 1XYGA 1JDPA 2CFTA 1S2DA 3CVXA 4F3KA 3NC0C 1OLUA 2GEVA 5F4ZA 1MC4A 3H1EA 4LXUA 1FFXB 4GC5A 1XLVA 3Q9SA 1YE3A 4ZT7A 1UBGA 3OAAD 4M7WA 2FG7C 2PH5A 4OX9Y 4C4RA 1PVVA 4RAQA 3W79A 2XNKA 4PFQA 5FOTA 3A9UA 5HK8A 1WPRA 1COWA 1GA4A 4U5QA 121PA 3B1ZA 3FOZA 3QWBA 5IT4A 3LCVB 5ALKA 4ZTBA 5JT1A 1J0AA 1YUNA 1HE2A 1P5JA 4XVHA 3DMDA 1PZFA 5HR5A 3ETJA 1PDWA 2HA5A 2VTEA 1XX6A 1T6XA 1MB4A 2BFAA 5DCLA 3EXG1 1NU8A 1NLUA 3EXEA 3KO8A 1QUFA 4XDZA 2XQJA 1N57A 1YOBA 2D5BA 3GLUA 4H7EA 3R24A 1TEZA 4MW7A 4B48A 4I5GA 5C81A 1SC9A 1PS9A 3C14C 5L8VA 2MU1A 1KGDA 4JK3A 5ALEA 1MB0A 4K87A 5EQTA 2BOVA 5SYMA 1CY2A 5FWYA 3FTCA 5KVAA 3GP5A 5KYYA 2DWCA 3GJRA 4FMCF 4LXYA 4FFVA 4XTRA 1AHHA 1BAPA 1LQ2A 1UMDB 1XZGA 4UNQA 3UUWA 1TJ5A 2PU5A 1H8HD 1IC6A 1XC7A 1JIXA 1OFHA 3DOEA 4G0MA 2WWFA 2YXLA 1OLXB 4JBIA 2AW3A 2D8AA 1UAAA 3IEXA 3L7BA 2JFGA 2XGJA 4ZVMA 4UDNA 4BHTA 4RTMA 4FSDA 1BN6A 3CCFA 4OQFA 3QU9A 3SQOA 3C7AA 3EMDA 1PF7E 4RSRA 2VYVD 2W6PA 4KUEA 3IODA 5CH8A 4CM4B 1UBFA 5FB3A 4DCGA 2CJWB 1JB1A 4ND6A 1BS2A 3GGOA 1JQDA 4WLOA 4DIBA 1KJWA 1G21B 1U81A 4FR2A 3OTHA 3R7WA 4H17A 7REQB 1ILEA 2VPPA 4UHHA 3HLTA 5DTQA 2DT5A 3GJ3A 3MQ4A 2JFBA 3ORQA 2YOHA 1L4LA 1D2NA 3D4LA 3LYLA 1NHWA 1ZJJA 3H83A 1BX1A 3RRJA 1MW9X 5E3IA 1B1CA 2JEZA 5K0BA 5DO9A 2GARA 3HDQA 4JC8A 4UXJA 5BN3B 1DQYA 2XNJA 1YASA 5KAMA 3LT2A 2NZYA 2X9VA 4BMSA 4DLPA 3BH6A 1ULAA 3FRHA 4JGGA 4ZQHA 3MS4A 1QOPB 3E48A 3Q1LA 1ZD8A 3QJGA 3TR6A 1DJQA 3ZX5A 2JLCA 4EZIA 2ZJFA 5JC8A 3EF1A 3BS4A 1D6MA 4ZQFA 1I7PA 3RLIA 4A1FA 2WF6A 2NXEA 1WXQA 4B4WA 4Q1EA 1RYZA 4FDTA 1FXUA 2NACA 3G0DA 3PHCA 4JUIA 4BV2A 4ARZA 4XGNA 1JU4A 1NUAA 3I3OA 3KJQA 3AL3A 2ZRLA 3ZI4A 3Q8KA 3QWFA 3PC7A 4RU1A 3WC4A 5CXXA 2YMLA 3PQ8A 1II0A 3F8WA 5ALTA 5AVYA 1GKLA 3BGDA 3DXXA 2QRKA 4ZZ2A 4B3DA 3IMEA 2RHRA 1DCFA 2QTGA 3INGA 4ZYLA 1LPMA 2ILTA 3D3QA 1APBA 1UQRA 4LECA 3WSWA 4BKRA 4C5AA 3FKSA 1ST3A 1MJGM 1PBTA 4PBRA 2PZFA 2WP0A 4KGXA 4RZ2A 5H80A 4YT2A 1ZQ9A 5JWHA 5JBIA 3HKEB 3PV0A 2O8EA 1PGOA 1QQTA 5D7BA 3VO8A 3VR3D 2W4IA 1D6NA 3IALA 4ME6A 1FNBA 2WFLA 5JDCC 3V5NA 3TX6A 5IJ0B 5ULLA 1QF9A 1NL3A 3PF8A 3R4CA 2C42A 1PFYA 3GJQA 3U7JA 5LQKA 3J7AC 1FQOA 4CG3A 2GEJA 1Z08A 3OZSA 1E1QA 2F1KA 4JQYA 5FTNA 5I4BA 1Q6YA 2HV9A 1PJRA 1QIMA 5AIAA 5JXHA 2YC2C 3GMIA 2C7OA 1E3WB 2P5TB 2WPNA 1L4GA 3LW8A 3MMZA 3FY4A 4ERXA 5KTTA 3GLQA 3GRKA 2CL5A 4INAA 3LWBA 4KE6A 4HEQA 4H6PA 3P1JA 1YRQA 4HBGA 4PRYA 2P1DA 1W88A 3ZYCA 2A88A 2JLXA 4HPWA 3SX4A 1JFSA 4CE6A 1UADA 1OB5A 3IVRA 4ZAYA 3QEMB 5HJ5A 3AHFA 4M55A 4JXXA 1YJCA 1W36C 2A9FA 1ZI8A 1XV5A 2JBAA 2I6TA 4GBMA 4L0QA 3M7IA 3PGVA 4YJFA 3BIOA 3AUXA 3GLSA 5LWQA 3R77A 1IQUA 4EGSA 3UG7A 1T2CA 1Z13A 1CUSA 3R6LA 4MQFA 3DZ8A 4NNOA 3BMNB 2VUHB 3UMFA 1P0CA 2JIOA 3EDOA 1YMQA 2F6RA 2HMTA 1V5IA 2EDAA 2GN8A 4QUHA 4XDYA 2O7NA 5CDYA 2F8SA 1E58A 2AJCA 1VHDA 4M1SA 1EX9A 3SD7A 2VOJA 3W7VA 2VKQA 1TQ4A 1W4LA 2I6SA 4O5AA 3IQHX 4IZIA 2ASVA 3QLUC 2ORVA 4YRNA 1SUSA 1RAIA 4U7JA 4ZEOA 3U16A 3H1GA 1F4LA 1TK9A 1OZHA 4EHJA 1EDZA 4AMGA 3OH8A 1PR3A 4XLTA 1L5MA 2GD6A 1D8TA 4YCNA 3AERB 1B8PA 2F48A 2XGSA 4RQTA 1Q3TA 5CJ2A 1XKLA 4AO7A 1BD3A 2CJXA 3N05A 1U7ZA 2LRHA 3KALA 1SK8A 3COYA 3GAZA 2ONYA 4JMLA 3MGCA 4Y7DA 1UKVY 3FM9A 2IKQA 4IWNA 4ZJYA 5D3MA 2R6R1 5HKKD 1M9NA 3ME5A 1Z2AA 2XGMA 3AKYA 4PIMA 2H51A 2BF4A 4XIGS 5A71A 1GDHA 1EUDB 4PAOA 4ZDJA 4RNCA 5LFAA 2PYZA 2C3PA 1W9HA 3E9ZA 2BMFA 3HJAA 4MJXA 2EZ4A 4ND5A 5FL7D 5LB4A 3WADA 5BNIA 1ECPA 2QUBA 1W5AA 4LK3A 4JI1B 2PBLA 5TJ9A 1CNFA 4QYXA 1C1YA 2OP1A 4YT5A 4FXOA 3H99A 3BZBA 3Q7EA 1OXKB 3EEYA 4UVGA 3RJ5A 4BN5A 2QW1A 4JD5A 1YZUA 1FDUA 4HQLA 4MUBA 2NMVA 1RCUA 1MAWA 1OKKA 4HNAB 3LM8A 3T7KA 2P41A 1D9XA 3T3PB 3FUUA 1EG2A 1ONSA 2O05A 4M0CA 3SZUA 4DW8A 1T9CA 2E5WA 2FE4A 4BV8A 1KWGA 1Z5PA 5GGXA 1POWA 2H06A 4MQEA 5BT9A 1TMOA 2Z3VA 1I01A 3H3XA 2NVWA 7ABPA 5DTRA 2OSVA 4B87A 1ZW6A 3GJ4A 3JRNA 2OQIA 4OB8A 5FFMA 3FCCA 2AEEA 3LXRA 1QIGA 4L22A 1P7WA 3H4VA 3PIIA 3AP3A 4ND4A 3ISTA 5AM4A 5L53A 3SC2B 5JS2A 1FEZA 1EFHA 3KZMA 3QY9A 5LQSA 1QVVA 2ZANA 4NARA 1B6SA 3I6QA 4MPPA 4Y2HA 1KS9A 3PHIA 4EJMA 4U6SA 4Q3NA 5IPFA 1N32B 4Y2YA 3ROFA 1N0WA 1R50A 3ABRB 3AR2A 4XIFA 1GLVA 1GKUB 1XNJA 5JCZA 4DRYA 1EWQA 4TZTA 3EQ7A 3O4HA 2UZ0A 3ENKA 1T2NA 5FO1A 4BZPA 3GLFA 1QG6A 3PCXA 3HHPA 4PAMA 1U7XA 1VKOA 3CZMA 2X15A 5AW9A 5FJJA 2WA1A 1KIFA 1KR2A 3E23A 4I5FA 4BQFA 2O4CA 4KLCA 3TSAA 1HUQA 4YASA 1TYCA 4DSOA 2C3MA 4XSHA 3K0CA 3K0CC 5KJEA 3DO8A 3WNQA 1MHTA 3ELBA 4RQBA 4ZKDA 2HHJA 3X43A 3PR2B 1SC3A 4N4AA 3G88A 5C18A 5CB4A 5ICCA 1IBCA 1FLAA 3GFBA 3PJEA 4O8ZA 4BGVA 2OOSA 3MMXA 2NPIA 5JPDA 3LVRE 2P2LA 4D8WA 4NCNA 1IWBB 1SBYA 1ZXBA 5CVCA 3FZQA 2X19A 4YDSA 3V32A 1AGXA 1G64A 1C7QA 2H4HA 4KN9S 1NW8A 2FDRA 2C4KA 4F4JA 2QJWA 1XCBA 4IPTA 3W9SA 4CQLA 1Y81A 1UFVA 2QJTA 5AI4A 2WOOA 4KFCA 1NR7A 2HIAA 2QGNA 2C7BA 1VJDA 3FSGA 2HJRA 2ZI4A 5CYOA 2ZITA 1U2DA 1U2DC 4HADA 1PSDA 2HWWA 2WSMA 4F60A 4JI3B 5CITA 2BC9A 1MAAA 1UMKA 2C5EA 2A3NA 2Q27A 4NPAA 2BR5A 1QP8A 1NYTA 3GLVA 3LT5A 1CLUA 4V2UA 4RK4A 4DJJA 2QR5A 4C3OB 1BDBA 2X41A 1PV4A 1S2OA 2BJVA 3DDHA 5EJ4A 5H9VA 5LQUA 5KINB 4DSTA 1MHPA 1Q44A 3OF5A 1RYNA 4N7MA 1MJFA 1L4FA 3QUAA 5KPDA 5JMTA 1DFIA 1QHHA 5CAEB 4AS3A 2HDWA 4M0PA 3QW2A 5B6JA 5AUOB 3KSDO 1LNQA 2OKCA 2Z5LA 1GUZA 3A8TA 4JR1A 3S1LA 5FDFA 4QM6A 2FWIA 5T5QA 1AK9A 3TO5A 1W6UA 1FUKA 5EP1A 1W93A 4LDZA 4E11A 1T1JA 1IOWA 3KJFA 5TPWB 4LHSA 3C1TA 5C2JB 3AUTA 3ZGVA 2CVFA 1LLDA 3THYB 2RGCA 3LFUA 4WL0A 4BEJA 1E4VA 1CX9B 1JHMA 1X1RA 2FFRA 4FC6A 4MGKR 4RC9A 2JIPA 3AUFA 1MIOB 4OMFG 1M1NA 4H7KA 2PKRA 3CRQA 3EBLA 4QDXA 2FX5A 5FPTA 3AQ4A 5CJPA 2ETXA 2WSIA 3VR2A 4UULA 2PANA 2XUKA 3GLHB 1E3SA 4KXYA 3TW8B 3ZR4B 2QQ0A 4MXDA 1CS4C 3ZDXB 3QW4B 1F12A 3C70A 4YV0A 2YFQA 4LQLA 2IPLA 2XZTA 1NY5A 2UZ3A 2BLLA 3QBJA 3RU2A 3FIJA 4CGZA 2HOQA 4BX3A 2YHUA 4A03A 4J76A 1Y7IA 4P5PA 1TM3E 1EHCA 1N2XA 1V16A 2AN3A 2P4HX 2PUHA 4MCAA 4WNYA 2ZJ6A 5G0TA 4LAFA 1YI0A 4C7JA 4D9FA 2G1UA 2IU4A 1F2UB 3U0BA 4R01A 2G77B 2CW5A 2V9ZA 4WK2B 3VUFA 2C5AA 5CM8B 2AQ8A 2B98A 4IFIA 3F96A 3KQSA 1XZHA 3JAKB 1OAOA 2A94A 1XVLA 2J3KA 1MVNA 3IDSA 4FFWA 4TMXA 4UMEA 4F38A 4FLFA 3JTMA 1L7XA 1V5FA 4MVJG 5K2MA 5AOVA 1RU3A 1UL1X 3BWVA 5A0VA 4Z3DA 1OTYA 2HPHA 1QP7A 4OIFA 3S99A 1UC8A 4AUEA 4TSRA 2ZYTX 3TDNA 1AKTA 1WKVA 2QTCA 4O6VA 3WNCA 5A9SB 4P4LA 2ZOSA 1M34E 2HXGA 3IC5A 4MCIA 2AOUA 4Q48A 5CT5A 3HCBA 4IJUA 5TMEA 1D3AA 4ER0A 3HR8A 1B0PA 2DUUA 4UREA 1OFUA 3WIVA 5HEKA 4YXWD 3TEFA 1RMYA 4YS6A 1CRPA 1GRCA 4HX9A 3I9V1 2WTEA 3COWA 4BVEA 3PE6A 3DFIA 3HA3A 2VSNA 1GQYA 2ZSKA 4HGYA 3ONFA 3E53A 5CH3A 1M10A 2G4LA 4M21A 4KDEA 3EA0A 3FNBA 3CIOA 4ZAGA 4BNGA 2YBDA 1NFQA 1UEXC 3A05A 4D02A 3Q2KA 3GXBA 4KIUA 3ANXA 5FV4A 2HT1A 1J1ZA 1WY7A 1IY2A 1A0OA 5CXQA 2OBBA 1FMCA 4KQGA 5KQGA 4RJLA 3DMHA 3HABA 4GPTA 2AOWA 2FWBA 3T15A 3K9FC 5J9FA 1IN4A 2RGXA 3NR2A 4R2MA 5A05A 1UMBB 4D8XA 5JWRA 3ODPA 3DPUA 1EE9A 2ZIUB 2ZBDA 4KVGA 3EXIB 4TV9F 3KPWA 4YQZA 3FSJX 4WRRA 5KDLA 4G37A 1RMTA 2IL1A 3A4YA 3CEAA 2ZBFA 3W2FA 3EN0A 4DA9A 2Y9MB 2OECA 3ZGYA 4G4JA 3KHTA 4BO5A 2BN4A 5B5SA 1IN7A 3CGWA 3KYIB 2P69A 2QRVB 2I78A 2FPPA 2PPVA 5DGIA 1C7EA 3VPFA 5FOUA 3THWA 4ZYVA 4D0NA 5L9AA 1NBME 3EX7C 4EG6A 1TECE 3EZYA 1GNRA 4MPTA 3T6KA 5I48A 1Z4LA 1QU3A 1XVAA 4A6EA 3H5OA 3KQPA 1ZI6A 2TRSB 4MV4A 3CQ9A 5EZYF 4YAIA 2XZDA 3HUFA 1QP0A 1KJIA 2YIMA 3HM2A 3OUTA 1GCOA 1SZJG 3Q1KA 1NIJA 2BYTA 4FMPA 3LA8A 1YS2X 3TZQA 2Q6KA 3Q0TA 1JIJA 1U8XX 4KBYA 1NXVA 1USKA 1LD3A 4DIFA 3T0FA 2ZIGA 3QYPA 3JX9A 3WICA 3TIIA 3F97A 3IPXA 3O8DA 3KIPA 1OOEA 2NUBA 3BBPA 4MWCA 1E9SA 3PU6A 3FWYA 1JHZA 2WLSA 2NQ8A 2GZRA 2FWPA 4X63A 3GDGA 3Q11A 4GOLD 3UJBA 5LZ2A 5TGZA 2ZBVA 2J9ZB 1VJTA 3D2AA 4CQMD 2O14A 1U02A 3EW9A 3VDXA 4Z4QA 3AILA 4RNDB 1VE5A 5CVJA 5F2EA 3KAQA 5FWAA 4DQXA 1G55A 1N6KA 5LMUB 1KKUA 2JAPA 1X74A 2P2SA 5LXTA 2QQFA 1CUBA 1Z0JA 2HAEA 1I2DA 3DKRA 3TNYA 4IEEA 3DHYA 4FSXA 4Q1DA 3IPAA 1GU0A 5C3UA 1DGQA 3KJEA 2PCJA 5CGQB 3OI7A 3P9RA 1D7AA 4BKMA 1O94A 1O94C 1I5RA 3IVMA 1CIPA 1NQUA 2DUNA 2W48A 4HB3A 4QXOA 1CJBA 1CUWA 1KZ4A 3SR3A 4D45A 1K8QA 5CLJA 1H2ZA 1ZNWA 1XR3A 1W8IA 1WXHA 3HHEA 5EQDA 2L42A 1YZLA 1GNVA 1I0LA 3V42A 2YZ7A 3ZY4A 1RWXA 4PHGA 2DPLA 5JJBA 3OQIB 1I6WA 3JZDA 4DN6A 3FYTA 3M6IA 4M0FA 3VKGA 2P3LA 3ZKWB 3AX6A 3JWHA 1EFRD 2VF4X 2NVBA 1GYQA 4U8GA 5D5HA 1AMUA 3NWOA 3IT2A 4NJOA 1Y8AA 4R84A 4G85A 4M7PA 5C8ZA 2RHBA 4YUVA 1IJEA 4R40A 3KSRA 4FZJA 3S2SA 3BK2A 3DDCA 1D7OA 1L5OA 4MJ7A 4TV8A 5G1OA 3WMXA 3VPGA 2NO0A 3OU6A 2QN7A 2QN8A 4KVFA 4EITA 4I4TA 5JI2E 2GNOA 3SZLA 3MTEA 4KCGA 2PD6A 2J4FA 4POAA 1D0IA 1G8MA 2G82A 3EIOA 3C3PA 4FJ2A 4JJGA 4JJEA 4CMKA 2EJUA 1D2RA 4D82A 3AFIA 1OBFO 4CL2A 2DEUA 2QTVB 1Q0LA 3BK1A 3KJGA 1RQLA 4KGZA 1W0JA 2VATA 4REOA 1AKWA 4TLBA 1X42A 2HTFA 1FY2A 2DM6A 1KY4A 4CIAA 1ZQ1A 1EE2A 3EXHB 2IOHA 1JNYA 1TT5B 4YJ2F 4N65A 1EA7A 4PCLA 1UJBA 3S2EA 3ZIDA 1EK5A 4AIRA 3CCCA 1GNPA 4H0NA 3WR5A 4XM0A 4I81A 3VR5D 1UP4A 5CM9C 3S55A 1LSOA 5EHGA 1AVTA 2I1LA 3EZXA 5B3AA 3V8RA 4MDEA 3OT1B 2B69A 1CPYA 1Z5VA 3FPFA 3ZTWA 3RJMA 4AKEA 2IXAA 4BCCA 2VTBA 1QQBA 1DL5A 1J4AA 1PR0A 3FDJA 2G17A 4CI0B 5B2FA 4NXMB 3BXEA 3G5MA 1PIWA 1XTIA 3LO5A 2XYQA 3RVSA 3SCZA 3DQPA 4MUFA 1A8IA 3SKXA 4DV1B 1R0BA 4JKOA 4GPIB 3QKRA 4NF2A 1TYDE 3BRSA 4ARSA 1Y3DE 5JS1A 4IHQA 4L9AA 4FW8A 4JP8A 1I3MA 1YR1A 1IY8A 3MCWA 1G0NA 3MLAA 3WNBA 1WP4A 1T3LA 4K5QA 4B1FA 1KMHB 5KKCA 2GZHA 4XYGA 3ZQUA 2Q3FA 3HBNA 3MWEB 2H29A 3O5AA 2X7JA 4H3SA 3ESAA 4H7PA 1NVXQ 4J8PA 5DBIA 5CA1A 3IBCA 4B82A 4FB4A 1WP9A 2EEPA 2IHJA 4AN4A 3F2VA 5LLTA 2EWMA 1JG7A 4FQ7A 2CVZA 4TL8A 3UJHA 5BVGA 5DT2A 2OV6A 4ZVKA 1URPA 1RAHA 2PYIA 4R2WA 3FPGA 3RYCB 2AQIA 1VCOA 1N1GA 2CXSA 1X7ZA 1HMYA 2FJPA 2F62A 2JGEA 2O1XA 3IULA 3K96A 4UEJA 3IQEA 3CW8X 2VZ8A 1VPVA 4UPVA 1DUSA 4C4OA 1KEEB 1UXGA 1LJ8A 4D79A 3BD6A 3FI9A 2PUTA 2VRBA 1K0UA 3FVQA 5LIPA 5ICFA 1K92A 2MSCB 1E1RD 2F2TA 1GGJA 3H04A 3W0LB 3IPRA 4E70A 4BNKA 1FBNA 2A84A 2FLVA 1UPXA 5CUQA 2PT7A 5T4EA 3W05A 1Z74A 4B2PA 5HS6A 2OPHA 3MWLA 1SGWA 1HYBA 4O4HA 4QHYA 3UK6A 5DBHX 4GQBA 1P5HA 3CMMA 1JIKA 3GMTA 4NE2A 1IG0A 3RKRA 3TLZA 5F9MA 3PA6A 4UQPA 3REQB 3DM5A 3IBFA 4PSCA 4IDEA 3WK8A 3KPUA 3GVCA 3PYMA 3FCUB 4NJMB 3UGTA 3AR6A 5A06A 4X7PA 3OPNA 2H08A 3OZRA 3NYRA 1N3LA 3U61B 3R0XA 2IZ6A 4NONA 5KQLA 1DIAA 3RRFA 1KTVA 1YZVA 2WHYA 4D97A 2X3UA 1VJ1A 5DNDA 2H4WA 1HT0A 3O2SB 3RFTA 1VSVA 3EF3A 3U4CA 4WLUA 4TXHA 4WCFA 1P6XA 3JQGB 4QUIA 4WCFC 1M34A 5C5DA 1FSSA 4LJ9A 3BIXA 2H92A 3UQZA 1X9GA 2VJMA 2ZB8A 3FMVA 3GRVA 3ZCTA 3JARA 1I4DD 3ENVA 1TZMA 4J0JA 1UJNA 4P54A 4PPQA 3PHHA 1PUXA 2VTDA 2O4UX 3DZIA 4WFJA 3RAEC 2Y4OA 3RS2A 7AT1A 5HFAA 2FV8A 3DBLB 4YP7A 3BIJA 3SZ3A 1E7MA 3NHUA 3UBMA 3ZCVA 1IVNA 1X2EA 5HIJA 2Z9CA 4GICA 5AYVA 3HB7A 3R7NA 3HFSA 3I42A 5BP7A 3GLGE 3WWPA 1DBQA 2V5UA 1QE5A 4H08A 4TL9A 1G6KA 2IYAA 1CY4A 3CS3A 1ZU5A 3IDZA 2ZYSA 2MSDB 3AUUA 3FHCB 3HDYA 4UUPA 5ISMA 1O0SA 1QHXA 4XGRA 1E9AA 3GK3A 1DO2A 3ACDA 2FR8A 2FR8C 2O2IA 3IUBA 1B41A 1VMIA 1B26A 1F9AA 1Q5PA 1OV4A 3BWYA 1MCZA 2HA4A 3KB8A 4HLCA 3H2BA 3Q7TA 3RFXA 3RV3A 1WZUA 5T3UA 3NHWA 1X1EA 2FSHA 2HU8A 3U6BA 5CH5A 4MI6A 5TF4A 4J94A 5IUKC 1FCJA 4OMUA 5E1OA 1Z8DA 3VC3A 3FG9A 4MRMA 3GRAA 3GUVA 2GH1A 3E7FA 4MB6A 3SYNA 4LHZA 2R1VB 2YJ4A 4PSAA 3RBVA 1Z8FA 2VHQA 1C7JA 1HTBA 3OZBA 1GNQA 5LKRA 3UUEA 5AQEA 1NBMA 4MYRA 4FOLA 1L5FA 4AVYA 2R85A 1Z35A 5IJZA 1KJNA 3Q10A 1QZTA 3DZKA 4D4MA 3FNIA 4A2PA 1X8JA 2IYYA 3FBTA 1PEKE 4LIPD 5DISB 4NG5A 3TIGA 3A3PA 1XEXB 1M2NA 2ZSHA 4WT7A 4TQGA 2QAIA 3C7TA 1N9KA 2AXPA 3NV9A 3W34A 7YASA 1XL1A 4PR0A 2HA7A 4IIJF 4R41A 2XA2A 1TADA 1PD1A 1YVRA 3HN2A 3HCWA 3ICEA 1ZM2A 5F9HA 5F35A 4EW1A 3MMSA 3RV4A 4DLAA 3O0TA 4YAJA 4DCCA 1KDPA 4NBLA 2C0CA 3P9PA 3S7ZA 1HDRA 2R6CA 1K68A 2OK7A 2WJAA 3A6GA 1YDGA 3CR7A 5B2EA 2QE7D 4H3HB 1G4AE 3UYLA 2YMQA 3DE2X 2Z57A 2BMJA 3JQAA 5IT0A 4YACA 4F1KA 4G5YA 3VU3A 1OI3A 2FLWA 3RAJA 1V43A 4MNTA 4DGSA 5CB0A 2I33A 3ZU2A 1ZH4A 3NRJA 5E6RB 1ECLA 3CW9A 3L4KA 4DADA 3IR5A 2WZCA 4K8OA 2Y92A 2HJWA 2OORA 2OORC 3IUSA 3U3KA 3W1EA 3HVIA 3ZCSA 1Q12A 4REQB 1CTQA 4HQ0A 3NHZA 4I8XA 4KK3A 3GARA 5IWCA 3RIMA 2B25A 2JCGA 3GL9A 4HFNA 5TS2A 1V1RA 5G4LA 5BSHA 4LY9A 4RE5A 2RD2A 3IXLA 2ZUUA 4O1HA 4ENQA 1GTL1 3G8YA 8GPBA 3A6LA 3NP9A 4GKAA 1N7HA 2HF2A 2P7IA 4PVDA 3Q0EA 5D00A 4BU1A 1JR2A 2DBRA 4PPYA 1QC5A 3KQOA 3WBFA 1JJ7A 1MP0A 4AKHA 4S1WA 5ADWA 3BMOA 1P2FA 4PFKA 3I3SR 1DC3A 4BKOA 1JA9A 3UFBA 5B36A 1K8ZB 4B3HA 1OH7A 4MYHA 1FLNA 2H4YA 1K6MA 1SMKA 1HXHA 2P0EA 4YEDA 9LDTA 1RWNA 4OHPA 5FLXA 2FOIA 4MVJF 1U9IA 1U9IC 3GPCA 2D06A 5CA0A 1L3IA 2OQ2A 3HVHA 3LK6A 4R1SA 3H2GA 4IRXA 4P4UA 4PYNA 3BJEA 4QE3A 4XZ3A 3CY6A 3REOA 2ZSJA 4PX3A 3TAHA 3RS4A 1I6KA 4U2BA 4KSCA 5JR3A 4YJGA 3NVKI 2HB6A 3F74A 5E9JA 5C31A 5JS7A 3NONA 2ADMA 2GJ4A 4P34A 4BNYA 2O2GA 3HZHA 4Z0TA 1A3CA 3BDAA 3FWNA 3OF2A 3TOVA 4JP3A 1O5TA 3UICA 4OEHA 3BPSA 4N3BA 4IQ4A 1KU0A 4FDVA 4ZOCA 4JWKA 3AQIA 5I7SA 4AO8A 2WFZA 3SM3A 4J6EA 1Q1BA 5FL3A 4GQAA 1X8KA 2WR8A 1G5RA 1Z16A 1MO5A 4DJ5X 2BKUA 2ERCA 2CUNA 4NZ9A 4PPGA 1C8LA 4FUTA 5EUQB 3VPHA 2FUKA 1X7XA 2XTMA 1ID1A 4BLPA 2Z5FA 1P0IA 3H4MA 2ZJYA 3G85A 1E3TA 4G4IA 4H7DA 3STHA 1PJAA 4I1IA 3D6MA 4CCWA 1G20B 1LPOA 5E6SA 3PXGA 1A7JA 2X0IA 1TYBE 2JHGA 1SC6A 4OGLA 3U3OA 3SSNA 3ZWQA 1NULA 4J1NA 4EG8A 2PMWB 3KYCB 5BQ5A 1AGYA 1V35A 4QPDA 3NNNA 2W2MA 5DNVA 2VJAA 2ZUEA 1YJQA 4JQSA 3WXBA 1H9AA 2BZ1A 3LCMA 2QS9A 4OSOA 4NXNB 4AF6A 2EX1A 2R25B 3CPEA 4RYLA 4OK5A 4R2HA 3SICE 1UK8A 4LGYA 1X1BA 2A57A 1KYZA 1GSIA 1M72A 4AX8A 4EY5A 1ST2A 4Q4AA 3ZY5A 5LMCA 2R65A 3DOCA 3NUZA 3T7DA 4BQIA 1Z6PA 3B2EA 1CQXA 2GN4A 1W5SA 5KTKA 4TT3D 3HCPA 4DLYA 4N54A 1JDNA 2XDQA 4OBEA 2PAFA 1OWPA 2FQQA 1A72A 3KFLA 3Q12A 2N0SA 1SVMA 4BXOB 1CF9A 3VVBA 4IQFA 4GXRA 2HZBA 3ZI7A 3DQZA 4DNQA 3ZWAA 1B74A 4R69A 1ZUHA 1GT6A 5FPSA 1EXNA 1ZVKA 2Q7DA 1JTEA 4V0OA 4A36A 1IOVA 1R4MA 3SDZA 2I7CA 3D1JA 1DEAA 1PK7A 1II9A 4FI3C 4U39A 3L6RA 5LUBA 4CEIA 4GNKA 1GTG1 3ZJ5A 2ZSDA 2OK8A 4LHWA 2HCJB 4Z7JA 3GXOA 1A8UA 5AP9A 1A2QA 3R20A 2OFWA 1U8CB 5ER6A 1L5NA 4PSDA 4EW2A 5JC1A 2D5CA 1J8MF 1X0VA 4R5HA 4YJHB 2ZR7A 4AJLA 1Z0DA 4DWJA 3ASUA 1SKMA 3DT9A 1S2MA 3GDFA 3ZCUA 3A1TA 3QOXA 3WJ2A 1P9NA 1QZ3A 1RKUA 3UH0A 4A8JB 4IVPA 2XJ4A 3SYMA 1IWOA 3TB4A 1KI3A 1BDHA 1A4RA 1X77A 1DCMA 1JLKA 4FYIA 4MVJP 5K99A 1A8SA 1S2GA 1WXXA 2G1KA 2VPQA 3FFTA 4MINA 4BNZA 3X1YA 5M7EA 3G7NA 2ZKLA 1FLVA 3KL2A 3RRMA 3VR4D 3TOSA 3WO0A 4EYOA 4P92A 2ACVA 4BX9A 2CE2X 1ADJA 2C3UA 4MR7B 5FXMA 3TTVA 4OUDA 1PT7A 3DF7A 3DFMA 3IB6A 1K8XB 4JLUA 3ZV3A 1QF6A 4QRDA 3RC7A 4C6HA 2X0RA 3MTDA 5FORA 3RSLA 5IU6A 1W19A 3H16A 4QJ3A 1XFAA 1Z33A 2JIZA 2ZI7A 2VH1A 3HV0A 2NTNA 3I73A 5TVKA 3HB9A 4KO3S 2FQWA 2HBRA 3EAGA 5KNDH 2CB9A 1DQSA 4O2RA 4PX2A 3Q7PA 1IUPA 3KPJA 4X60A 5ENZA 4C20A 5BXQC 4PLTA 2HJGA 1VJRA 4HJRA 5J43A 3K6SB 1JAXA 4RD0A 2Y67A 1T36A 3DYVA 2QORA 5J2UB 4YN3A 3SDSA 2IXFA 3OCWA 2H7YA 1SY7A 5DNAA 4R9SA 4TWJA 1KFJB 4KX3A 3ZU5A 1SHLA 1ZD4A 2YY6A 3FYHA 3TQHA 4AQYB 1T1SA 2YJGA 4NCIA 4NQZA 4DCMA 3KUCA 5DN6D 4G1UC 3T3GA 1XTTA 1XKQA 4DDKA 2XXJA 3W6OA 3IA7A 3DR5A 1JVSA 3K2IA 1Q11A 1AXEA 2NUAA 4DPKA 1H2BA 1IL0A 3GLGA 5T4FA 2YICA 2EP8A 3ELUA 4I99A 1Z6XA 4IMPA 4PV7A 4WBNF 5AUPB 2AD5A 1PZNA 1FMJA 3SS8A 2AB0A 4KQXA 2BP7B 4NZOA 3X2SA 4E13A 1HNXB 2J0UA 5DZSA 4DMLA 1XMJA 3V48A 1NURA 2OWDA 4ALJA 5A4DA 3DMGA 3PFIA 2G88A 4TQ9A 3IA2A 4US2R 3DBRA 4FFPA 5DI3A 1AKUA 2B94A 1M2VB 5JAZA 3NIFB 1QAMA 1QLHA 1SG6A 1VSQA 2H4ZA 3EUAA 4X94A 4D0LB 1UK9A 4RVGA 2WDPA 3EAQA 2RHWA 3OX2A 2EVWX 4V02A 3PDUA 3ZXSA 4F9TA 4ZJPA 5LMNB 2FSSA 3AP2A 1WDTA 3KR9A 4W8GA 3DOOA 1Q1EA 3RVPA 4UVDA 1EWTA 3ZWWA 4CM8A 5JARA 1UPCA 4LWZA 1NXXA 3LQ2A 5JJCA 1NNSA 3ROTA 4JT4A 1NTOA 3ELWA 5MN5A 4W5TA 2FR0A 2C7RA 5HGJA 5JZMA 4QUGA 1Q7EA 1ZESA 4HDNA 3E3NA 1XMVA 2NO6A 3QPDA 4J0FA 1R1DA 4GNRA 4IHAA 4LNUA 4NOJA 3CF4G 1UR5A 3GR6A 1JWBB 1O8CA 3QXHA 4JVSB 1XVTA 4L74A 4JBXA 1G0OA 4F9EA 1EUYA 1XCGB 3II6X 4H1HA 1GL6A 1XJ5A 3TAXA 2C82A 1P7ZA 3PQCA 4BJ6A 3KKEA 3GUHA 1T3GA 2UV8A 4ZZ3A 2XKKA 2IYTA 5IH3A 1ZP6A 1VL5A 4B85A 2E5FA 3QPCA 5EIBC 1P3JA 1UBRS 2QG9A 3VKWA 1KQ3A 2WD9A 3VBEA 4FM9A 3EBOA 2OVBA 2OZPA 1JFRA 4HAZA 5TT1A 1EFAA 2ZIXA 3NLLA 4BNHA 2ZPAA 1A95A 2M98A 3KTAB 3OE5A 3EH2A 4L8LA 1PZHA 2Y0CA 1WETA 4IXWA 3B60A 1MQ9A 3MT8A 3IUMA 4UATA 5FUXA 2AYXA 1G8KA 4W8HA 3RYIA 1J0DA 1HLFA 2DFLA 1O4VA 2G7ZA 2N9UA 3D3NA 1R18A 3L4JA 1GAXA 4DYHA 1SA0A 2IIQA 2AZTA 3FAZA 3JWJA 3L84A 3A58B 3MB5A 3FPKA 3HJFA 1CY0A 5EE3A 4CMAA 1BHJA 1VYHA 3JXEA 3ZS8A 5EOVA 4QTZA 1GQOA 1VB3A 3ROEA 4ZAFA 4BP1A 4HXFB 2XUQA 3EXFB 3QELA 4WX2B 3A1SA 3WRYA 3WRYC 3F49S 2NLOA 3B78A 1P1IA 3BSWA 1DPGA 4BGIA 2CLFB 2ANCA 4AP6A 4YRIA 2IELA 3MJHA 1FUYB 1Z2NX 4CW7A 1NSTA 3OO1A 4QAQA 4ZIRA 3KSMA 1N2EA 1K7EB 1GM5A 1WA5A 4KMOA 2W90A 3B7GA 1A5TA 3GDOA 2AWNA 1L4NA 3DTNA 5LNK1 3U39A 4BMVA 4EMTA 2WJHA 3I9LA 2Q3JA 3HBAA 3C15C 3LDAA 2K6GA 3WB1A 4RTOA 3HP7A 2ZKIA 2H2FA 3LHSA 4RJKA 4BMXA 4XOIA 2Q6IA 3DHNA 4QGFA 4UE6A 3ZV4A 1B8OA 5G0VA 4N39A 4A82A 2A78A 5EWLA 1US8A 1Z2DA 1P2SA 2ZXFA 4V0SA 4IIHA 5EP3A 3RW9A 5CFQA 1AXRA 1EDBA 2H1HA 1PJTA 1N25A 3ZQ4A 3U44A 2B30A 1ENOA 4HDOB 3Q40A 3FZYA 2BDTA 2IE8A 1TO1E 3TLBA 5KI6A 2ADOA 3KZVA 2ZT7A 2XJ9A 5CEJA 1SQSA 1NZJA 2VQDA 3P2YA 4L8YA 1JQLB 2KBEA 1CIVA 2YQ4A 4HDKB 1KRXA 1H6DA 1P61B 3T3OA 2ZBEA 3R3VA 1XMPA 2SNIE 1BMQA 3O8QB 2JKVA 3IEIA 2A0UA 1L4UA 1S2NA 2PCLA 4MW0A 4U9UA 2BONA 4ZEXA 2JGFA 1R27A 4YP6A 2V7EA 5JH7A 1T0UA 1FRVA 4CEJA 1C9MA 5JISA 4R1PA 2ZTVA 3VMMA 5ILGA 4F12A 1ZK2A 1JSRA 2BTQB 2P6UA 4HJXA 4JLAA 3ZTYA 4CKEA 5JWOA 3E3MA 4IX9A 4UU0A 1QRUA 1L1FA 1FTQA 4G86A 1UEJA 3QE0A 3DV0B 1RZUA 3PA8A 2GJAA 2QTNA 4EVIA 1M2EA 3JQ7A 1ZN7A 3HXLA 4I55F 4BGEA 5GZ3A 3QEBZ 5AXDA 4PZEA 2CFRA 3ADKA 4C2UA 4Y6PA 3B6ZA 1R5BA 2ZIVB 3P0FA 5HIMA 3TK1A 4P4SA 1YFJA 5EKXA 3VYRB 4HQKA 2GR9A 2BT4A 1ZH2A 1VLLA 1BXGB 2FPSA 3CYFA 1OGJA 1F17A 2XMZA 3QG1A 4GBED 2W43A 3SJ7A 1W4RA 3V8NA 4NYIQ 2VYCA 4W1QA 4Y2VA 4LSWA 3M8KA 5JSZB 3NP7A 1Q3HA 3ZBTA 1GIAA 3AFOA 4XIYA 2AI2A 4ZFNA 4MB2A 2ATEA 3WIUA 1BIFA 4MJ3A 4ESOA 4ESVA 1U9JA 3TSOA 1TQ8A 1T2UA 4LPKA 1OXTA 1PYGA 2CMFA 2WJYA 2A5LA 2HSJA 3K32A 3HKCB 5AQ1A 1H94A 3IRUA 4R5MA 1O0CA 5ES4B 1TM4E 1NLZA 2HWYA 2V98A 5LDGA 3UHPA 1NR1A 5BWMA 3AF1A 2X8JB 2FWMX 4KI0A 2PZJA 3DHVA 1ZJ4A 4YQYA 4D43A 4C6TA 5CJJA 4BQEA 4KXMA 1DIBA 1W30A 4KIGA 1USVA 4EYQA 1F7VA 3T1QA 2BMDA 4H1WA 5H70A 3PNQA 4WVFA 5B7GA 2CEKA 2XB9A 4UDXX 1GTSA 1BMTA 1VDMA 1YCDA 4Z9FA 3DM9B 3S3TA 1KDYA 2Q9CA 1Z15A 2OILA 4QBIA 1OR8A 3RC1A 1NNLA 3BFXA 4FKZA 3IUPA 2QB5A 2QAGB 3V46A 5B58T 4J3FA 2OXTA 1SC1A 2GN6A 4TTRA 1UP6A 1MX1A 3PDIB 3W9BA 4DVJA 2NV2B 2J0EA 1FX0B 2JLRA 2O3UA 4HV4A 3A1VA 4I9HA 1D2HA 2VFAA 4FCTA 3PZRA 1U6JA 1ZIDA 2V4UA 5LC1A 4G8BA 1P2GA 4QXAA 3W2HA 3EEQA 1BFUA 1BJTA 1NBHA 2CNWD 3IS3A 4NJEB 3RVMA 1R4NA 4F6CA 4M76B 4FHEA 3TJZA 3BXHA 3F3KA 3FOBA 4X7MA 5BSMA 2R6ZA 2Z95A 1PQYA 3SE0A 3ND9A 3VHXB 3WA7A 1QHFA 4BO4A 1MTOA 3SYTA 4ENWA 2C3YA 3IQXA 2PGJA 3R0JA 4ITRC 1DKLA 1J8DA 1VG0B 2HXYA 3LRTA 3T8YA 4H18A 2DR0A 2EWWA 2G5GX 2I54A 2YR0A 5E8RA 4E1BA 2WJ4A 4M1MA 3V34A 3BTVA 1S4MA 2OKGA 4OI2A 2I2BA 1BGXT 1UIMA 2JJ2A 2WICA 3FD8A 2PSEA 2XEDA 4QLAA 4J3JA 2IU0A 4BMNA 1J0CA 5FPPA 4G84A 4RESA 1B6TA 1IXRC 3LVFO 4D9GA 1H6BA 4I9FA 5FUBA 3UC9A 4NAVA 3UHJA 3ICQB 3QJYA 4HDQB 13PKA 1TVEA 5FHRA 1TGYA 4AL4A 3VPSA 5LQJA 3JWGA 5IS2A 1TQ2A 1BCRB 1HEIA 1E2NA 1YZQA 1VCMA 2ROQA 4IDAA 4EOGA 3QKSB 1RKXA 2DH6A 3UENA 3EGDA 3ZWVA 3KD3A 4G1FA 3AKZA 2Q62A 1J22A 1W85B 3QVKA 4PS1A 1I4WA 5AVTA 2VHCA 3KNZA 4NMXB 1BRTA 2R6HA 3DBVO 3KT6A 5EVCA 4YMHA 1AQNA 3H6HA 3D59A 4U7PB 1U0SY 3JQEA 1CVIA 5HILA 4TSFA 1TCVA 2FX3A 2O2DA 2P2GA 2LBPA 1YQDA 1P0PA 3O8OA 3MXTA 4D3SA 4MV5A 3ZS9A 5MN6A 3NTXA 1I3KA 1WAMA 4IMIB 5E1DA 1Q1NA 2N75A 1TCBA 2AJBA 2HMVA 2Q5QA 4XH9B 1N33B 1YMVA 3HUTA 4FONA 4GC9A 3W5AA 3FVVA 1KMIY 4TXLA 4NBVA 1Q14A 1M2FA 5DJ5A 5HZMA 3DBHB 3NHPA 2QMOA 2JBHA 5B64A 3V80A 2SKCA 4B76A 5FH9A 4EATA 3U60B 4N3NA 2BM0A 3CRZA 5EP4A 3TLMA 3TLJA 4ZU3A 2AOTA 3PX3A 4MDYA 4NP6A 1UZMA