3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination and repair protein
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
4AURA 2GZAA 4DLWA 3TE6A 3V00A 3WP0A 4KI0A 1LS1A 5TARA 5TV2A 4BUJA 5EXXA 3FFAA 1RJ9A 2IUTA 4NH0A 3BE4A 4X8LA 2IXEA 5JFGA 2BKUA 4OI2A 1G5PA 2DWPA 5J40A 1R5BA 2CE2X 4DSTA 1XU4A 1J8MF 1S0UA 1VG0B 3HPQA 3T61A 3J81k 5L3QA 2PZEA 4B3GA 2WWFA 3GLIA 1VECA 2ZJOA 3CRRA 4YDSA 2WIAA 1LTQA 1OHHA 2P6UA 2H17A 3RAPR 3O8DA 1NJFA 2YWHA 2KE5A 1M8PA 4ZCLA 3SYNA 1DS6A 1R8QA 3ZVRA 3IQXA 4IEIA 4TYWA 3RRNA 1G7SA 3TQCA 2QT0A 1I2DA 3IIJA 2O52A 3EZFA 4Q66C 1N6NA 1NN5A 5KNBA 1C1YA 1VCNA 3DOEA 1NN3A 4N0DA 3RABA 3LXXA 2JATA 2WOOA 4CEIB 2ZU0C 2D2EA 1E3MA 3THYB 3C5CA 3RS4A 3P4XA 5F9FA 1L4UA 1T6NA 3I62A 2V6IA 5GJBA 3EIHA 4Z8YA 4JIMA 2Z0MA 2ZRIA 3GJ7A 3BORA 1Z06A 2BBWA 3I8SA 5KDDA 3U60B 2H18A 3ND9A 4FWIB 2IYXA 4M1SA 2RGNA 4DLVA 1ZCBA 1IN6A 1GWNA 2HXYA 1BIFA 4G0NA 1OKKA 1YZGA 2WWIA 4OHVA 3RDPA 2JLUA 3NHAA 1XPOA 2QAGC 3PUXA 3KJEA 1GSIA 3AVVA 4OK6A 1TTTA 4BE7B 1HE8B 4LC0A 2H5EA 2OV2A 4Q5IA 3LWNA 2RGDA 2L0XA 4DWJA 1YR8A 3NH9A 2DBYA 5KSOA 4NCJA 2BJWA 1M7GA 4DJTA 2ZTSA 4B44A 1UADA 5E3HA 4RKFA 1WB9A 2N46A 4IFEA 2IUSA 3GCGA 2ANBA 4EKDA 4PX9A 4UXHA 3BAFA 3SYKA 4GMDA 5FPYA 1EFRA 2RGEA 1KO4A 1ZU5A 2HYIC 1Q44A 1XD2B 4DC9A 5CK5A 1XWIA 4BLPA 1XJQA 1II0A 5FBLB 4AYXA 4D4MA 3BERA 1JXMA 2IK8A 3L0SA 4L4UA 3KUDA 3ADCA 4BZQA 1IM2A 4QNMA 1FQKA 3QXCA 4CF7A 1XXHB 1G41A 3WMFA 3U4QA 1ZUNB 1X86B 4RD1A 8OHMA 3MFYA 2ZSDA 4MRVA 2NO0A 4TYQA 3AKDA 4BFTA 3HR7A 1E2FA 4TWZA 3U5ZB 4C4PA 4OJQA 1ZYUA 1P73A 4P4SA 1W4RA 1L2TA 2F6RA 2O8DA 2OM2A 4IDQA 3BB3A 1XX6A 1DARA 1T0JB 1OH7A 1Q1QA 2C78A 3QPVA 4HDQB 4B3FX 4BLRA 1KSHA 1US8A 4I81A 1ESNA 1GOTA 2ECKA 3KJGA 2A5FA 3MCAA 5CM8B 4PAQA 3SR0A 3MGCA 1D2EA 1ZIOA 3DL0A 2LWIA 2GCOB 3FDIA 1U8ZA 4PPFA 2BBOA 2FFBA 4IDNA 5DNYB 2OCPA 2Z43A 4HZUA 2YOGA 3GLIE 3IO5A 1FOEB 4RZUA 2NPFA 4FI3C 2XJ4A 4LCBA 3TBKA 2O8FB 4XWKA 3IIKA 2QAGA 2WJIA 4OBEA 3QI2A 5CLQA 1AM4D 1P9WA 2OXRA 1Z0IA 3BS4A 2G9NA 1Y63A 5L3SB 4JBXA 3EPHA 3W3AA 1AKYA 1GRNA 2I4IA 3OEHD 3ZGXA 3TUJC 4I1VA 2PJRA 4MGZR 1UJ2A 4B74A 3FFBA 1K5DA 1S9HA 3DHWC 4M1OA 4LJ9A 1CR0A 4QJ3A 3LBNA 4XD7A 4CT5A 2IF0A 2IHYA 4RCZA 3REGA 4Q4JA 4IXMA 2GBLA 2I1QA 3LNCA 3EW9A 3K8YA 1FMLA 3AF3A 4W5HA 1NLFA 5FPTA 5FPSA 2FX3A 3VR4A 3QSYA 2JLZA 1XCPA 1HV8A 2A30A 3W6OA 3TR5A 3KDSE 4HEJA 5FPKA 4XWAA 2FGJA 2B8TA 4M9ZA 2ZETA 4LHWA 1CKEA 3X1ZA 1GL7A 2FOLA 1KK2A 1OFTA 4AG6A 2IW3A 5C18A 2BJVA 1MKYA 2CLCX 1XEXA 1MR3F 4NU0A 2E87A 3LVQE 1C9KA 2GF9A 4JVLA 4UXJA 1ZM2A 2W2VA 1VHTA 1EFCA 2QQ0A 1KI8A 2X2FA 3ASZA 1F2TB 4O2LA 2F43B 2N1BA 3GP8A 5DH9A 4PC7A 3PCRB 1R5OA 3WYGA 5JWRA 2HLDD 3M0EA 4Q02A 4EPYA 1E9RA 2EWVA 3FHCB 1KGDA 4R2IA 4Q9IA 1KDPA 4A6XA 2VP6A 2GAOA 2Q0HA 3ZZ0A 4Q4LA 1CXZA 1I4LD 4C9BA 2A3RA 4OK5A 1E2NA 1BMFA 3IGFA 1TQ6A 1Z0JA 4M1TA 1IHUA 2IBMA 1JR6A 121PA 4JJZA 3VKHA 2IYSA 3AH8A 5KYKA 1FPMA 4MKHA 1IAQA 4DB2A 1NIPA 2LCFA 1G6HA 1Z83A 1G18A 2IA5A 1BOFA 2KBEA 1SXJB 4B32A 3W8NA 1XB2A 4RD2A 1PLLA 2NZJA 2F1RA 4ARZA 1W5TA 1YR9A 4QC2A 1UFQA 2OE2A 2GEDA 2WPDD 4US1R 2FJUA 4C2TA 2O8EA 2HCJB 2ANCA 1CR2A 1ZIPA 4AY2A 2AWNA 2D06A 2QEQA 4LX0A 4OYHA 1XMVA 4EQ6B 1U98A 4JSYA 4OHWA 4YMUA 4LHXA 1DBSA 2RKOA 5KSPA 2HXSA 4RFSA 2EYUA 4E03A 1XBTA 3EASA 3TGPA 1U0JA 1E0SA 1SVWA 2GJKA 2ZVPX 4NYJQ 3A6PC 4G5GA 4KFRA 1P7CA 3AF2A 1U0HC 3MWLA 1IXSB 1G3IA 5DYIA 1KK0A 5KHOC 2PEZA 1T3HA 1SHKA 2FZ4A 2QU8A 2ZRGA 3EARA 4Z54A 1Q3HA 3KQKA 1XRJA 2ZUBA 1GNRA 3VR1A 1CLUA 4YC7A 2AKYA 1NBMD 2X2EA 2ZSFA 1E32A 1CF4A 4M1WA 1DELA 2CLSA 4JLAA 2EFDB 4V0OA 1QHHB 5J4LA 3AVTA 3DKVA 3BB4A 4C2UA 4A2QA 3QKRA 3IEUA 3KX2A 4DSUA 3KTAB 4LV8B 3SHFA 4MKIA 4D2IA 1YZLA 2H1LA 1P3JA 3X1WA 5JWOA 2ZR7A 4BWYA 4Q7LA 4MRNA 2WJGA 4Q7KA 1E96A 3K0AA 4Q47A 5BQ5A 2BCGY 1RIFA 3B9PA 1M2OB 1G8HA 2QT1A 3GJ4A 4BECA 4BEBA 3GJ6A 4QGHA 1ZM3A 3OF5A 3OESA 4MRSA 3QEOA 4P33A 3PUYA 1LS6A 1W0JD 2CBZA 3T12A 1KI6B 2CVHA 4AWXA 1TUIA 2J5XA 4YXWD 3BD9A 4IOLA 4PC3A 4Q4HB 1B0UA 1OFHA 2J0SA 5M04A 3KKPA 3B13B 4BGDA 2RB4A 3TQFA 1S3GA 3QENA 2OCBA 4OKSA 2CJWA 5JMTA 2QORA 4DDUA 4PHGA 1MO5A 1AKEA 2ZI5A 1JPNA 4LJ6A 2GCNA 5EP1A 2ZM5A 3H86A 1NLYA 1PUIA 2IYZA 3IEVA 4HLUA 1CU1A 4HDCA 1IN8A 2ZROA 5J5CA 5FR2A 4D4KA 3ZZUA 3L2OB 2IS1A 5J4KA 2A5JA 3VKGA 1H8ED 1YZQA 3AF4A 3UMFA 4F4CA 2NGRA 3R9IA 2R65A 4JBWA 4TTPA 3K70B 2ORVA 1OT3A 5BXQC 1GNQA 1XJCA 2VHTA 2MSDB 5H68A 4TMWA 2C77A 2CDNA 1NVWQ 2YKGA 1Z8FA 3MWYW 3QKUA 1HYQA 4LJ4A 3MSXA 3KL4A 1U8YA 1D8TA 4PZLA 3KJIA 2YZ2A 3CRVA 1SVMA 1KOFA 5ELXA 3W5JA 3TNFA 3BH0A 5KUTA 1PV4A 1OIWA 1HT1E 2XB4A 3W6PA 2GXUA 2P67A 3SJZA 4WIAA 4JLNA 2PT7A 1TQ4A 1UBGA 4URYR 4P4TA 2OT3B 3IQWA 1RVDA 3KQLA 5AJYA 3NIBA 2WWGA 2FDCA 3VAAA 1QVAA 2XTNA 1GRRA 2QTFA 5JCPA 4IDOA 1BYUA 1YU9A 3E1SA 3OEEA 1IONA 4I1UA 3NTUA 1E79D 3U3OA 5GADl 4O0MA 3ZDQA 1F48A 4TL9A 4LBZA 3B5JA 2H7VA 3EZ7A 2FEMA 4DUGA 4ZPXA 4E5UA 2ZE7A 2ZUCA 2XAUA 2J7PD 1T8UA 3ZJYA 1R2QA 2GJ8A 2VYFA 2H92A 1S9DA 2J9RA 2O8BA 1W5SA 1KO8A 1DG1G 1H65A 4XWOA 1FP7A 3IPXA 2O0JA 4H9GA 1F6BA 4QRHA 4DLTA 4HB4A 2XSZD 3VMFA 5FUVA 4RD3A 4KU4A 1KI2A 1W36D 1YR7A 3AB3A 4PR0A 2WIBA 3ZYCA 4Q4AA 1KYIA 1ZVQA 2DB3A 2V55B 3CO5A 4RZ2A 2BC9A 3LX5A 2OBNA 3A4NA 1OXTA 4UNRA 5B58C 2C5LA 4K81B 1TEVA 2G0TA 3RLFA 3T5GA 1N6IA 4Q1AA 5FBVB 1P72A 3B1WA 3PIRA 4NCIA 1TF2A 1GAJA 1II8B 2AK2A 1NIJA 3SI7A 4A8JB 3P27A 4TSFA 3BXZA 3T5DA 3QG5A 4F93B 2RGAA 3ONWA 3QBVA 4IDHA 1EXMA 4TLDA 3AP2A 5AUOB 2QPTA 3JZMA 2V6JA 1JI0A 2GAAA 3HJNA 4QL3A 2GCPA 4IFBA 1W7AA 2C04A 2WWWA 2FA9A 4BLTA 4HAWA 4ZI3A 1NSFA 2R6GA 4BFYA 1S1CA 4URVR 2QMUA 2WHXA 4UQOA 1MABA 1NRJB 2D4HA 3ZD7A 1Z47A 2Q3MA 2JAQA 3L43A 3PENA 2JLXA 3A8TA 4MRRA 4DXAA 1EG7A 4C7OB 2AFHE 2BKEA 4TLAA 2YOFA 4RZXA 5FTLA 2QBYA 3OE7A 4CIDA 4DDWA 3QY0A 4CRWB 1OYWA 5BN4A 1W2HA 3AV0B 3NH6A 2BM0A 3K0FB 3JVUA 5AJXA 3RWMB 4CZ2A 1VYUA 5F3WB 2Q6TA 1NI3A 2N42A 3GJ8A 2WJVA 4Q1EA 3O8CA 4LYHA 4CEJB 4JLPA 4EJSC 1E4VA 1VPLA 2J0UB 4D0GA 1OE0A 4C0JA 4MYCA 1EWQA 3AP3A 3U7EB 1J90A 1OKKD 1E9DA 2W00A 1HE1C 4IRUB 1YHNA 2J41A 4D0NA 2Q9AA 4IW3B 2ZIAA 5CK4A 2ZJYA 4Q9HA 4O3MA 2YNMA 3HP1A 3P4YA 4N3NA 3DKPA 4KBGA 1L4YA 3SJCA 4DSOA 5DISB 3PJRA 4CEIA 2GA8A 2DWOA 2OCYC 2JLSA 3OIYA 2V1UA 3AVQA 3QJYA 2PMKA 4G3XA 2P65A 2MSCB 2QE7A 2ODNA 4YMVA 1E9SA 5A4JA 5H1YA 1NN0A 3U3RA 3R7WB 2ZRBA 3U7HB 1TQDA 3UKDA 1OPXA 3UWKA 4PPNA 4CVNA 2BWJA 2DCUA 2ZR9A 5LBIA 1E2DA 4HAUA 4URZR 4TL6A 3QEJA 3BIFA 3KKQA 4QGGA 1XD9A 2BEJA 2RGGA 4JLJA 2P2LA 5CYPA 3WNBA 4ESVA 3PUWA 1G3MA 1E2JA 2P5SA 1IY1A 2IYLD 5EE5B 1EFUA 4C30A 1MO4A 2FPMA 1ZD9A 1OLOA 4Q7JB 4BRWA 2RAPA 2ZI3A 2ZJ2A 3QG1A 1EESA 5TXGA 3A1SA 3SQXA 1ZD8A 2WZQA 4XIGS 3CR8A 3CBQA 2ZXUA 2X8AA 4UNSA 3C5HA 4M1KA 5CITA 2VO1A 5FOUA 2OAQ1 3CNLA 2IL1A 4N0EA 3CB4A 3A58B 4PTLA 1J7KA 1XD2A 1N6PA 5FPHA 1W4AA 2A5GA 4WZ6A 1R0YA 3QPWA 1N3BA 4QFMA 5CLLA 1VCOA 4A82A 1XXHA 4LBWA 4Z8XA 3GLHE 4TYNA 3KFVA 2Y8EA 4G5QA 1R10A 1YZNA 3CX7A 1TUEA 1EK0A 1R4AA 4GZLA 5AWFC 3NEJA 4FCWA 2G77B 4NCNA 2CEAA 4KODA 1FUUA 3I32A 4K46A 3VU9B 5KDOA 4EFLA 3U61B 4KITB 2AXNA 1XMIA 2ZRDA 2VTKA 3BH6A 5BN3A 4RFVA 1GG2A 1U99A 2OLJA 1OB2A 2BBSA 2ZITA 1W2GA 2P3SA 2D2FA 2RGNC 5JJIA 2IS6A 4Q9LA 1G64A 4B3DA 3CF2A 5KDLA 4EPRA 4ZV4A 2OG2A 1XTSA 2QENA 2BBTA 3RS5A 2O8CA 4CW7A 5LB2A 2ZREA 1E9EA 2NQ2C 1W1WA 5HKKA 1Q1EA 3FKQA 4H1UA 3IDQA 4TMZA 4FW9A 4D81A 1XTQA 821PA 1KO5A 1LY1A 1ZAKA 5AUNB 3LFUA 3UG6A 3VX4A 3NC1C 3CW2A 1IJEA 2CNWA 3IUYA 1N5IA 2WSSA 1CTQA 2GDJA 2ZPTX 4D4JA 3FHTA 4QBGB 5L3SA 5A5GA 3AKYA 5FOVA 4LPSA 3TVTA 1WXQA 2F1HA 3QF4A 3VKWA 3A1WA 2RH5A 3TRFA 3EPLA 2FFQA 2JLQA 4YQFA 2ODBA 1FTSA 3Q7PA 4V0LA 2GETA 2HUPA 3OHMA 4CEHB 3H4MA 4RJLA 2WTUA 2BMJA 5GJCA 2Z83A 4AYTA 2QG6A 3B60A 2H16A 3I4LA 3KB1A 3F5FA 2PCJA 3EPJA 2IT1A 3HR8A 1Z0AA 4GPTA 4B3BA 4S2EA 1KIMA 1NNEA 5H8WA 2JJ1A 4F4IA 5HE9A 3RNLA 3GJ0A 3PG5A 4MGYR 2HF9A 1E2EA 2TMKA 4UNNA 1D6JA 3LO5A 1G5RA 1AGPA 1XD8A 1IJFA 3A37A 4DSNA 5JEDA 4JT4A 1FTNA 4M1MA 5EJEA 1DAEA 5IK2A 3UANA 5JZVA 3CNOA 2EW1A 1LV7A 1UF9A 1G4UR 5AR1A 4QOSA 2FWRA 2R9VA 3G5UA 2UZIR 3RRZA 2D7DA 2VP4A 1UBFA 1E0AA 4WA7A 3R8CA 2Q3HA 1NY6A 2BMEA 2WJYA 1SVSA 2VEDA 3TVDA 3BJIC 4M4SA 1KAGA 2E1RA 3ICQB 4IHQA 5FOSA 2AKAB 4V0MA 5KPJA 1E2QA 1NVUQ 1R0WA 4AC9A 4A2PA 3FMPB 2XGJA 2WKPA 2FSHA 3UMSA 1UBEA 2XZLA 1G3QA 5G3YA 3UIEA 3KXKA 1XMJA 2DHRA 3T1VA 2B92A 5SZIA 3ICEA 1XXHE 4YMWA 4NYJR 2FF7A 3OAAD 3TUZC 1VIAA 4AG5A 1I4TD 4DDVA 1JAHA 1T4GA 4GOXA 4TZ6A 4ASUA 4OQLA 4W5JA 3GFPA 1R6BX 2ZRCA 5E7MA 4EQ6A 1IN4A 2GBLC 3S1AB 4LHVA 3GJ5A 3OFNA 5B64A 5KNDA 5DHFA 3K70C 1TF7A 2WJHA 4M0LA 1ETUA 3WMEA 1VG9B 621PA 5JECA 5DN6D 1KY2A 4A2WA 3E5HA 1ZM9A 1Z28A 4F7WA 3GJ3A 4HAXA 4Q9KA 3GLFB 3H0KA 3KUCA 4ZO4A 3LAWA 3X2SA 3WHLA 1XMSA 5EP4A 5GJVC 4YONB 3MJHA 3VTKA 3T06B 4DLYA 2XXAA 4A6PA 1AA9A 3AP1A 3WYAA 3MLEA 4HAYA 2VP5A 3QVUA 2XNDA 4HYYA 1W48A 1ZNZA 1D2MA 4MYHA 4JYCA 3U3JA 1VCIA 1J8YF 3AKCA 3WYFA 4GL2A 3M4YA 3THXB 4HLQB 5IRCD 1OXVA 1L8QA 1GITA 1WF3A 4C0QC 1XZPA 1KI9A 2ERYA 2QY9A 3KTAA 3SS8A 1DPFA 4IOJA 2HF8A 4A0FA 4QHTA 1Q12A 1JR3A 1AN0A 4P32A 4ZCMA 4MUAA 1NMZA 1ZU4A 2PEYA 4HAVA 5FL7D 1P5ZB 3AVWA 4B33A 2AL7A 3BWDD 1Z2CA 3KZ1E 2CXXA 2OEPA 3LDAA 2EFCB 2CK3A 1A5TA 4O25A 1U90A 1TL7C 2UVQA 3DEFA 3L82B 2Q3FA 2RGXA 3WP1B 4DT1B 1A1VA 5JSZB 5BWMA 1Z6TA 2KBFA 4Q19A 1V43A 2NMVA 3CONA 3H2YA 3SZRA 2CL7X 3FOZA 3K0EA 1Z0KA 2EU8A 3TMKA 4QBHA 4A1FA 3BFVA 2VHUA 5DGXA 3DMNA 4L5BA 1W47A 4B71A 1KDTA 4Q9JA 4BZXA 1Z3IX 2R6CA 3NKVA 2IS2A 5CJPA 4KSCA 5DI9A 1SKYE 2FV8A 3QQ5A 1SVOA 3WBJA 2ZJ5A 2DR3A 3CX6A 3DDCA 1PLKA 2QP4A 1FX0A 3TH5A 3I61A 2JJ8A 2IWHA 5IF9A 5CJ2A 1W36B 1AK2A 3NVAA 4IVQA 1KY3A 3AGQA 1KK1A 1VYVA 4MA4A 4PZZA 1N6HA 5TDHA 3N2EA 2JIZA 3IBGA 1CJVC 2IWRA 4I1SA 1RJ9B 4KYUA 1ANKA 1CBUA 1FUKA 2J87A 3CUEF 4V0ME 4ABYA 5EZ5A 5ANRB 4H1VA 4OK3A 5C46F 4KV9A 3C7KA 4NCHA 3RANA 1Q20A 1YKSA 2ONJA 5AK0A 1SKYB 3EXAA 5L3QB 4BEJA 2QP3A 2XTMA 1ZM4A 1SXJE 1XNJA 3K9GA 1KMQA 5LD2C 4XVRA 3PEVA 3SU8A 4LYAA 1E2IA 4NL4H 3ZVMA 1JB1A 2AD1A 4RKEA 5JBQA 2ZE6A 2O0KA 1OFIA 2P5TB 2V54A 2PLRA 2VF7A 4TN1A 2C9YA 1Q57A 4GZMA 1HY3A 1Z6GA 1NMYA 5C1BA 3PQCA 2W6IA 1KI1A 4KO8A 2GEVA 2F7SA 4TMXA 4R71A 1NL3A 5EQTA 5C4MA 1A4RA 2IYRA 5FH9A 1E9BA 3HWSA 1F60A 3OIVA 4PSVA 5G3ZA 4TSFD 1RZ3A 3X1YA 2GNOA 5H70A 3RSLA 3I5XA 3FKSA 4B35A 3EIQA 3VFDA 4EAQA 3HU2A 4HLUC 3PR1A 3CPJB 2ZAMA 4BFXA 2PJZA 1JALA 1DAHA 5SZKB 4LWZA 2VSOA 3B7GA 4DBLC 2JEOA 1M74A 2QRZA 4NYIR 4DB4A 3HU1A 2BIFA 3AM1A 4JZKA 2H57A 1Z2AA 3TLXA 1GZSA 4KJZA 4AD8A 2OZEA 1B23P 4PO1A 2YYZA 3LQRA 2IYUA 3DO6A 4JT2A 1G8FA 3U3KA 1JR3E 3OE7D 2YJTD 2PX3A 4QNRA 1UBCA 1CS4C 4B47A 221PA 2NOAA 2VF8A 4Y0AA 4KFTA 5AJVB 4DCUA 1JQLB 2OBMA 5F2EA 4I1OA 2VL7A 3FYHA 3QNUA 3L0OA 1A2BA 4KLZA 4WZAE 3WRYC 2DFKB 1OJLA 3VNUA 1KI3A 1JXOA 1CRPA 1KJZA 4FCVA 4HLDA 1KSJA 1GL9B 4M53A 3TK1A 1E9AA 3V9PA 1RRGA 4LYJA 5KTYA 2GJ9A 1UKVY 4FMCB 1Z07A 5JS7A 1Q21A 3TAUA 1KK3A 3VHXA 4C7OA 2A2ZA 2OUKA 4OQMA 2QP9X 2W2XA 4UXIA 4HB0A 1DO0A 3QBTA 2WAXA 2ZS7A 1T8TA 1R5NA 2J59A 5P21A 4U02A 2OXCA 2QE7D 2RCNA 3K0FA 3B85A 3PUVA 2J0VA 2QL6A 421PA 2V9PA 2YWFA 3AVUA 4RZ3A 3I1FA 3G82C 2EWWA 3MD0A 3K0SA 2ZRMA 1O87A 2ZSBA 4CEJA 4KVAA 3FGNA 3THWB 3NBYC 4LUCA 2GJSA 1E98A 3CZQA 3CIOA 3NBFA 4QJ4A 1YZKA 5HR5A 4AKIA 3CH5A 5AUQA 1CJMA 3QXHA 3LA6A 4I99A 4IDPA 3RS3A 4E07A 2YWGA 1LB1B 4NTZA 3ETLA 1JJVA 2VHQA 2IXFA 2X19A 2QAJA 3U3MA 2ZYVX 1ZUIA 4HZUB 4PHTA 2I3BA 4QBIA 2VA8A 1ZCAA 2ODWA 3SNHA 5EXTA 1RPZA 1E6CA 2XZOA 4AIIA 3D7MA 1J99A 3FE2A 3QXJA 4TT3D 2R8RA 4BFSA 3M6AA 4Z51A 2QAGB 3JVVA 4B34A 4DEYA 1JNYA 4O2RA 4V0NA 2XOKD 4Q1FA 1NF3A 4NBSA 4B73A 2UZ3A 3R7WA 4IVPA 4DVGA 5HPYB 2GZHA 2O0HA 4JS0A 2WVJA 1GKUB 2A5YB 4QHYA 2IS4A 4OHXA 1TADA 3AQ4A 5DO9A 3SHWA 3C4JA 3KXLA 1ZC4A 2X77A 3BK7A 2W0SA 4RCYA 2NO9A 1Z6YA 3N70A 4HZIA 4MGKR 2ZRFA 4PPGA 1EX7A 4OJKA 2EFGA 3TSWA 1ZRHA 3FB4A 4GOJA 1HEIA 1E1QA 1Z29A 3AEZA 1P2TA 1YQTA 2PLFA 3THOA 4BFUA 4DLXA 3X1XA 1VYTA 3ECCA 2PL3A 4NHOA 1WMSA 3FWYA 2FPLA 3Q5DA 1ZNYA 5E95A 5FR1A 1HH4A 3P32A 4LC1A 1G5TA 1AQUA 2QSYA 1GILA 1TAGA 3NDPA 3NHBA 1IXZA 4P31A 3U44B 3EC2A 2ZRHA 4XH9B 2C95A 1HA3A 2W2TA 5CM9C 4Q1DA 1S96A 3BRWD 4NDZA 1XFAA 3D31A 3SBEA 2AFIE 4QGAA 3TKLA 1X8LA 4C3ZA 1OIVA 4P3YA 4DLSA 3VR5A 2W6JD 1NY5A 2QI9C 2RHDA 2ERXA 1HT2E 3AUYA 3ASYA 3KKOA 1AJEA 2GZDA 5FTJA 1QF9A 3PEUA 2DFTA 4MUBA 4S35A 3PXGA 2JDID 3RHFA 3ZIAA 4B3XA 1YRAA 5HKKD 2FMXA 2FU5C 4L15A 2SHKA 4GDFA 4TQUS 3RVBA 1OV4A 2QA5A 1OB5A 1VG1A 2GK6A 5TB5A 3W8RA 1S2MA 1E1RD 4GT1A 2CNWD 2G1JA 3HYRA 5K8TA 3R8FA 5A0FA 3L8ZA 3VU9A 4ZDKA 5B30A 1RC8A 2XZPA 4ILEA 1P9NA 1FMJA 2GJAA 3T15A 1IOZA 3Q8XB 2ZI7A 1DOAA 1G16A 2C9OA 4JJKA 3RSOA 4NYIQ 3FTQA 2DFNA 2O8EB 3VR3A 5FL3A 2VBCA 1V5WA 3GLHA 3VR2A 1VTKA 1G8PA 2YINC 3T1QA 1OHHD 2HLDA 3IKJA 1A82A 4XSHA 4HDOB 3FMFA 2QPAA 4DCTA 2ORIA 2BDTA 3C15C 2JJ1D 4QM6A 2NO7A 1O3YA 2R2AA 4L8GA 1WQ1R 1ONBA 4NZYA 4B2PA 4E22A 1AQYA 2VIIA 2GILA 3CKLA 2EYQA 3M1IA 4U5XA 1GKIA 2HEIA 2JLVA 2B21A 4HAZA 3WRXC 2PMDA 4JLOA 5FI1B 3BH7A 1SULA 4A15A 5J47A 1Z6AA 5IK2D 3C8UA 1F2UB 1W4CA 1GRQA 2PT5A 3EPKA 1JBKA 3LD9A 4GI7A 2QM7A 2QROA 2C03A 3GPLA 1M7HA 3PV0A 2OESA 4A9AA 4W9MC 3DPUA 2ZR0A 3AVPA 5K8LA 2J46A 1LW7A 1DVRA 2HYDA 3N2IA 2GRJA 4Q1CA 4B6EA 5DI3B 1FNMA 1QHNA 1VG8A 1FZQA 5DLQC 3TUIC 1Q1ZA 2ZE5A 2RGCA 4N1AA 5K8UA 2XB2A 4B2LA 4YLGA 5L8VA 2QQEA 4DDTA 1ODFA 2GXQA 3CWZA 5E4FA 3K0AB 4DLUA 3GLGB 4D26A 4AKEA 1EGAA 4B75A 1ESMA 2GEUA 2YHSA 2ZYTX 5CDFE 1CR4A 3KB2A 1IXRC 3R9WA 2VRWA 1OSNA 4JVMA 3RS7A 2ORWA 1DG3A 2QTHA 3SYLA 1COWA 2DWQA 1XCGB 2OBLA 4WXRA 3IPYA 1ELOA 1T91A 3UMRA 2FZLA 2JLWA 4PSKA 3LLMA 3SJBA 3THYA 2B6HA 3NEYA 1I4DD 2ZVQX 2ZYUX 3VNVA 1LNZA 4OI0A 1N0UA 4ASUD 4LOAA 2CJWB 5GJWC 4YMTA 3U7FB 2GESA 2XX3A 3H84A 1EFRD 3SBDA 5TMPA 5GVRA 2YWEA 4U7DA 2DYKA 3OFND 1XTJA 1Z0DA 1NKSA 2ZJAA 4RVCA 4DZZA 1JEEA 2BV3A 5KPDA 3QXXA 4GFDA 4US0R 3CF6R 3WMGA 4LJ5A 3EIEA 2QGZA 3W6NA 5FBQB 1D9XA 3LXRA 2MMCA 2W83A 5DSZA 5EP2A 2K5UA 5FTMA 2ZSAA 3EX7C 4A92A 2VHJA 4M2LA 4NCKA 1NG1A 2NIPA 1DADA 5JJKA 4XSGA 4IOKA 4TL7A 2GXAA 4TLCA 1ZM7A 1X6VA 3BBPA 1XP8A 2JLRA 3NBZC 3DVLA 4LV6A 1E2GA 5C4GB 1BS1A 1YZTA 3GFOA 3RC3A 3CWQA 1GTVA 1MO6A 3I72A 1KSFX 4DIEA 3E2IA 2AK3A 3S1AA 1FP6A 2JJ2A 3N5CA 1GFIA 1T3LA 3BFKA 2PCLA 1UKEA 1K8RA 3UG7A 3DOFA 1MT0A 3EWSA 1Q3TA 5KSYA 1XPRA 1E2LA 1SVKA 1G8GA 5D3MB 1KHTA 1X1RA 2DFLA 5BW8A 3PEYA 4JL8A 2B7CA 3GQBA 4W7SA 3LW8A 1JEDA 3RYTC 2ZS8A 3GD7A 5DHAA 5CB6A 2QGNA 1SKQA 3NXSA 2PBRA 3CX8A 1IY2A 2GK7A 3IIMA 4L9WA 4DCVA 3IO3A 1P2VA 1HQCA 1P6XA 4KSBA 5GVSA 4KAXA 4D6PA 1H8HA 2ATVA 2OFOA 2ZQ5A 3VR6A 2WWXA 2R6DA 2RMKA 1XTIA 4XVUA 1A2KC 4Q00A 2JASA 4QXAA 2VP2A 2CE7A 1IBRA 4C0HA 1TU3A 1UDXA 1W44A 4ACAA 3B8HA 4KXFB 3EWAA 1QZXA 1SQ5A 2C9CA 3PVSA 4XD7D 1P9RA 3K09C 2A7QA 4JVSB 1KO7A 1MO3A 1XEFA 2J45A 2VP0A 4HUQB 3Q85A 3RRYA 3B82A 2GCOA 3RS0A 3CR7A 4Q4AB 2JGNA 1E0JA 3K70D 4BRUA 1K6MA 3QPUA 3QKSB 1GL6A 1E79A 1N2CE 4JMPA 3DMDA 3SDZA 3D8BA 3D6TB 2JIZD 1SXJC 2IYVA 4FMCF 2FSIA 4DT1A 4E09A 3W3ZB 5JLJA 3HU3A 2CHQA 4U00A 3K9HA 1HTWA 4JLMA 3IBYA 1CJTC 1NLZA 1Q0UA 2CCGA 3C16C 3LV8A 1NSTA 2CMKA 1KSGA 5LPNA 5SZHB 1XCMA 3ZD6A 2O8FA 3AF0A 1DAGA 3LBIA 3B1VA 2KWIA 3K9LA 2JCSA 4C0KA 3QE0A 1TU4A 2CHVA 1X3SA 2V7QA 2VH5R 2ZSEA 4MQBA 2BHRA 1W0KA 1QG2A 2CVFA 1VKJA 2ZEJA 4Y0VA 3Q3JB 1UKZA 1NVXQ 1OFUX 2Z6VA 4IXNA 2NZ8A 4BFWA 1BO6A 4TL8A 2QNRA 2G83A 3AVOA 2WMNB 4NMMA 2RHMA 3W5IA 3K0CC 3ZH9B 1NBME 4DCSA 1ZP6A 1K5GA 1T5LA 1UKYA 4LHZA 4ON9A 1P61B 3B1ZA 4JSTA 3CH4B 1GP2A 4MYUA 4Q03A 4XVQA 4D82A 2GTPA 3GMTA 2P6RA 4P0TA 2W6ID 3A4LA 5FUYA 1AS3A 1CP2A 4D0LB 1UM8A 1BMFD 2QBYB 4DKXA 1RRPA 4TQ9A 2FH5B 1FFHA 4TLEA 5KSZA 1WA5A 4M1YA 4PC6A 4JLVA 1CULC 2C2HA 2EVWX 2YC4C 1XF9A 2ZRPA 4Q1BA 4RD6A 5FBWB 1TNDA 3FKSD 4M9QA 3EC1A 4FMDB 3ADDA 1LFDB 2CLDX 1BKDR 2QMHA 4TQAA 2F1JA 3WNCA 2J7KA 2FE4A 4PFSA 1CJKC 4URXR 1S1MA 4FN5A 1F2TA 3ZVNA 2ZI4A 3B9QA 3CLVA 4G01B 4WW0A 3X1DA 2F43A 3LRPA 4V0KA 4BQSA 5DIFA 1NVVQ 3D3QA 1OH5A 1DAIA 2IHBA 3R20A 4HLCA 3H1TA 5FOXA 2G0NA 3GEHA 3T35A 2OO7A 1EX6A 4B76A 2LKCA 4PC2A 2BEKA 3NG1A 4IJMA 4BLOA 1QVRA 3K09A 3CRW1 1YE8A 2FFAA 721PA 1Z63A 1UDWA 4LJ8A 2ASEA 3AGPA 4URUR 4Q21A 5FOTA 3GLFE 2ZI9A 2F1IA 1SXJA 2ZANA 5G41A 2JLYA 4ZDJA 4RY2A 3NC0C 3KKNA 1RRCA 3O8RA 1KO1A 1KI4A 2D3WA 3VHLB 4F38A 4WVFA 3CNNA 4EUNA 1QHIA 4JVNA 4PQYA 4XTCS 1MRSA 4OQFA 3SC3A 4EDHA 6Q21A 1P2SA 2AR7A 1ZMXA 3DM9B 1FQJA 1OW3B 1PUJA 4BFZA 4BFVA 3B1XA 1CEEA 5J4YA 1XTKA 3K0CA 3O8BA 3MWKA 5J4HA 2GXSA 3FHOA 3ND8A 1JECA 1RKBA 3CRQA 2G88A 2HDNB 3OZXA 1P2UA 4GNKA 4QJ5A 5FTKA 2G3YA 4IVRA 1AGRA 1LVGA 3CZPA 3CM0A 1AZTA 4M9XA 4AKGA 4LI0A 4LJAA 3F0TA 4LYFA 1N5KA 4C0LA 1ZC3A 2PZGA 4B6FA 2XXAB 4PHHA 1NMXA 1C4OA 1Z08A 1QHHA 1G19A 1HUQA 2OCAA 2WMOB 2OFWA 4BLSA 2VSXA 2ZRNA 1KJYA 4AI6A 3RWOA 1DAKA 3QUSA 4IOMA 1OYYA 4TLBA 4EJSB 2IUUA 3LLUA 1KDRA 2GVZC 1VHLA 5HE8A 3BGWA 5CIQA 2NO6A 3I5YA 4LK2A 2EFHB 3V4FA 4ESHA 2BCJQ 1KMHB 1YR6A 2VHCA 1KI6A 3SFZA 1ZD1A 2A78A 2ZI6A 2HT6A 1XTRA 1S3SA 2MSEB 2V1XA 3EG5A 5DE3A 3THWA 5KNCA 1Q22A 1FNNA 4NKRA 4Q4HA 4WOPA 2OFXA 2A9KA 1MV5A 3L0PA 4A36A 4IEEA 1KJWA 3VX3A 5HZKA 5JI2E 3I73A 2IC5A 4PQFA 3EA0A 4B48A 4NONA 1E1QD 5BYJA 3TSZA 1G21E 2D62A 3WXMA 2QMEA 4ZIRB 5L3VA 2O8CB 1GIAA 4WXPA 2QPOA 1X8KA 2IYTA 1UEIA 3NWJA 1DO2A 3U6BA 4PSAA 1U0LA 4ITRC 3ADKA 3OEED 2W58A 3WNDA 4B2IA 4PAOA 1GVNB 2OAP1 5FFMA 4Q01A 2G6BA 4R7ZA 2NO1A 4WZBE 3AVXA 2QUZA 1YRBA 4LJYA 1QHYA 3LVRE 1HQYE 4MYTA 4A8JC 4GRAA 2R6AA 2BOVA 4GP7A 4HATA 1MOZA 4DUGD 1E9CA 2VP9A 3WBKA 3MAAC 3QF4B 1D2NA 1ZJ6A 2WAYA 3PITA 4Z1MA 3OIUA 5AJZA 5HZHA 4GOKA 1UEJA 3QOFA 3SEAA 2ZRLA 4POAA 4X8OA 4L16A 4JLBA 5IDVA 3P1JA 3GLIB 2NPIA 2REXB 4GSYA 3ZIAD 5EP3A 1KNXA 4KCGA 3IILA 2B8WA 1TPZA 2Q9CA 2Z4RA 4QG7A 5C2JB 2J3EA 3HPRA 3RC8A 1CIPA 3KQUA 5LB4A 1Q1BA 1AS2A 3ZZTA 1SVIA 1TX4B 1LF5A 3PUZA 3BB1A 4CT4B 4F4JA 3U44A 3R9XA 2R44A 3GJXC 4F92B 1G7RA 2A5DA 3AUXA 4P4UA 1YJ5A 1M1YE 2IEYA 4II7A 3EZ9A 2CL0X 4NPHA 2IF2A 2OSBA 1VDZA 1OXXK 2B7BA 2WJJA 1N6KA 1TQ2A 1G4AE 1RYFA 3KFXA 3U6KA 1XZQA 1R0ZA 4TZ0A 1LF0A 4LDJA 5D3QA 5BYKA 3ZLJA 4EPTA 4AKHA 1OH8A 2F55A 4DLZA 5G40A 4LBVA 1PLJA 5SZJA 2YC2C 1ZW6A 1L7VC 2GF0A 3GFTA 1EWRA 1P62B 2R62A 4MDEA 4DLRA 3UPUA 4AK9A 4LV5B 1WP9A 2VLIA 3LH5A 4FXPA 2OLKA 3OIWA 1YZUA 4FCTA 4OHZA 3MJRA 1U94A 2IEZA 3PFIA 3TSOA 2C96A 4RD0A 3F8TA 1RFLA 2E9SA 5F9HA 4JLDA 4GBMA 5KO2A 4JKYA 2GHIA 1J70A 1EFTA 4NE2A 5JCZA 2J0QA 4L9SA 5EUMA 3GEEA 1QDEA 4NYMR 1M34E 1QHXA 4FWTA 1KI7A 1Z6XA 1UAAA 4UNPA 4KHZA 4TTQA 4OQNA 1II8A 1RW4A 4A8JA 4YDHB 2FSGA 5TVKA 4HB3A 4A0RA 3SQWA 5B2ZA 4PHFA 4B43A 1II9A 4PC1A 2HV8A 1XEWX 3MUFA 4BZPA 2JA1A 5L3RA 1AZSC 1AIPA 1CRQA 4FINA 4LZZA 3A1VA 2KI5A 4QBFA 5CB8A 3A36A 3SN6A 4Q18A 1VCMA 3ZVLA 1DAFA 3BFXA 2H8KA 1F5NA 1G291 3I3SR 2CHGA 4MGIR 3W34A 2WWHA 3EAQA 3U4QB 2VQSA 1KKMA 4G1UC 1COWD 1F2UA 2VPPA 4K8OA 4OQXA 4QKQA 4JKIA 3P20A 3T34A 4X8MA 2GKSA 1M6NA 4P4SB 3TJZA 3OAAA 2O8DB 5FUWA 4M8NE 3CPEA 4V03A 3EZ2A 3A1TA 3BC1A 5DI3A 4TTRA 2UKDA 4JLKA 4RSGA 2RGBA 4I4LA 2PZFA 2BMFA 1US8B 1KNQA 2J0UA 4M9SA 4J0QA 5EE9A 4W5WA 3GEIA 1HURA 1MH1A 4HB2A 1IQPA 5DN6A 3GLGA 1E0KA 1SZPA 2GWHA 4XOIA 1P4SA 5FUXA 2WKQA 2MMGA 4EIWA 1SVLA 1YVDA 5JWHA 4LSGA 2ZRJA 5AJWA 2IX3A 4ACBA 1RE0A 3KQNA 4OI1A 1N6OA 1RRFA 4PANA 5HTKA 1S8FA 4GMXA 1OF1A 1E2HA 2WM9B 1DAMA 4JYBA 2IYWA 1D9ZA 2P6NA 1Z22A 4KFUA 3F3YA 1WE2A 1DEKA 5K8IA 4ZDIA 1F3OA 3HDTA 4MITA 4EFMA 4D25A 4PPQA 4QM7A 3AKEA 2F3TA 1Z0FA 2JJ2D 2OILA 2ZE8A 1IY0A 3O47A 3Q9LA 4M22A 1N5JA 3B2EA 4FMDF 5CYOA 2NG1A 1P75A 5CDFA 3LY5A 3MRSA 5FL7A 4FD2A 1FX0B 4LPKA 3FMOB 1MRNA 1PJRA 4MH0R 4CGZA 4Q4JB 1UPTA 2YOHA 1BYIA 4A0HA 1KAOA 3C41J 4CDGA 1OH6A 3UATA 4MRPA 4Q48A 3Q7QA 1N0VC 2OHFA 2FNAA 2NTYC 1NKTA 5AUPB 2AWOA 2HT1A 2KJQA 2IXGA 4RD4A 2AX4A 2ZJ8A 1QRAA 1E2PA 2CCKA 1NG9A 2XNSA 4ERNA 3B1YA 1XJ0A 1H8HD 3LX8A 4IKEA 1OXSC 1U9IC 2ZUDA 3UWOA 4DHEA 2FPKA 5KOYA 2Q21A 4R98A 5EXSA 1JAIA 1XEXB 2XTZA 3OEHA 1ZBDA 1WDTA 3Q5EA 5J4VA 2VSFA 2O5VA 4GP6A 1NN1A 5UKDA 3QKTA 3ZQ6A 1KZGB 2F9MA 4F91B 4JBYA 2REOA 2EQBA 2LKDA 5FOWA 1NJGA 5D3MA 4PO8A 2REBA 3DZ8A 3I92A 4PO9A 2HJGA 4LRWA 1U81A 5FBRB 1N6LA 2HJVA 1T0HB 1TF5A 3RS2A 3TIFA 1G6OA 4OI4A 1J2JA 1XEWY 4LJ7A 2ZJBA 4FIDA 2WSSD 2FSFA 5IT5A 1XDBA 4PZYA 3T1OA 1TMKA 1W49A 2V7QD 3CPHA 2J1LA 4LHYA 1N25A 1W0KD 2BM1A 4WBSA 1RYHA 3WHKA 5E7IA 2I1VB 5LDDC 4JL6A 3TR0A 4ARZB 5B57C 5JI3E 4LY6A 3BOSA 2IYYA 1IN5A 2ZS9A 1ZUHA 2BVNA 1TEXA 1G9XA 3VQTA 3SJAA 4HUQA 5EXPA 4TYYA 2XITA 1M7BA 3DM5A 1WBDA 4DCNA 3K9NA 4TMTA 3L8YA 1WBBA 2WSMA 3QKSA 1G17A 3G0HA 1GKYA 3LBHA 4DIDA 2QRNA 4RFSB 4QHSA 5JJLA 4B3CA 4NYMQ 4XTRA 1R0XA 1R8SA 1VIYA 3TAHA 1BH2A 2WOJA 3EA5A 1E94E 4ZI2A 2D7CA 3GLGE 3MWJA 1R7RA 4HUTA 1VMAA 4URWR 1E2KA 2CCJA 1QHGA 1G3RA 3UK6A 1E4YA 4DRZA 1N6RA 3NDBB 1SHZA 1U9IA 3RRMA 4CEHA 4KVGA 1A7JA 1E99A 4R9UC 2WPDA 3QKRB 1OIXA 3KQHA 5EE0A 1Z5ZA 5HCNA 3W9YA 2BMDA 3QIAA 2ONKA 4YMSA 5FI0B 2ZAOA 1W46A 1WRBA 2KSQA 5LD2B 1G8YA 3CF0A 4FMBB 3I8XA 3EZ6A 5JRZA 3AF1A 4R2HA 1U2RA 2GVDC 3JZAA 1T5IA 3W90A 1NVVR 2FGKA 4BLQA 1X8JA 3QVVA 1T9HA 3CRMA 4G5RA 3L0IB 1SXJD 2AD5A 3ZS8A 3ZS9A 3KKMA 4WAUA 4A0GA 1ZNXA 2V4ZA 4LGMA 1WCV1 2ZU6A 1IN7A 1G7TA 1KDOA 3MG9A 1NBMA 1U8AA 4US2R 4C0SA 4KYIB 4MDFA 5HCIA 5CIWA 2PX0A 4CYMA 5JRJA 2ZJZA 3TW4A 3KJHA 3ADBA 2QSZA 1GNPA 2Z4SA 4UNQA 2P0EA 5JS8A 4DEXA 1E9FA 2QMOA 3C14C 4TMVA 2V8OA 3FMIA 4EFNA 3FPAA 4KFSA 4EPXA 1CR1A 1D5CA 1Y3AA 5DYGA 2WICA 2WV9A 3P26A 3UXMA 1N5LA 4HI0E 2AHOA 2WKRA 3Q72A 5FTNA 2FEOA 2EFEB 3LW7A 3IHWA 5TY0A 4KBFA 4D4LA 1W0JA 3E70C 3PEWA 2XJ9A 2XNDD 4YXWA 1AS0A 2AN9A 1CJUC 3IHLA 3HYTA 4D80A 1DTSA 4EPWA 1G3UA 3U7GA 1G1MA 1N0WA 1W36C 1T3SA 4MKGA 5F98A 3SFVA 1JR3D 4Q7MB 5JEEA 1JPJA 4ZKEA 4ZKDA 4PQRA 2IYQA 5G53C 4C0AC 1QBKC 4KLNA 4AYWA 3GLFA 1H8EA 2CK3D 2C8VA 3V4RA 2AXPA 2DY1A 4PAMA 1FL9A 4TT3A 5BN5A 1GUAA 2R6FA 3A4MA 1ZNWA 2ZRKA 2XOKA 5EE3A 4EPVA 3DZDA 3K53A 5E7JA 2QZ4A 1E69A 2QM8A 2FFHA 5JHHB 3B6EA 1KTVA 1PVOA 4XJXA 2D74A 4G5SA 1G20E 2X1VA 3FVQA 4X8HA 3SOPA 1PZNA 3QXSA 3THXA 2FN4A 4NP6A 4UKDA 1EFHA 1JQJC 2O8BB 4UJ5A 1G7CA 4TMKA 4BPBA 2PH1A 1S4QA 3MMPA 5IHPA 2C99A 2V3CC 2Z5FA 4EJSA 2F9LA 3ZQJA 1SGWA 2FG5A 2KB0A 4TYPA 4LBYA 1GM5A 1X1SA 2W0MA 2F3RA 3NBXX 4HSEA 2HCBA 3T1TA 2DPXA 1E2MA 5EZ6B 1KMHA 4V02A 4ZDWA 5KU1A 5EUQB 1FW6A 3B78A 1P60A 5JHGB 5JSZA 2G1KA 4BASA 2WWYA 4M21A 5EE1A 4A4DA 4Z1MD 521PA 3K1JA 3U2QA 2J7PA 2W6JA 4UJ3A 4OL0A 4ZCIA 2Q9BA 1W4BA 2ZYWX 4MKFA 4JL5A 4C0BA 2CL6X 3GLHB 1I2MA 2ZRAA 4PXAA 2C98A 2JDIA 1KZ7B 3REFA 4ZIRA 2ATXA 3SE0A 3WY9A 3AVYA 3A1UA 1KKLA 1DE0A 2XSZA 2WBLC 1ZINA 3KXIA 2QN6A 1JJ7A 1QG4A 1QHSA 1GDDA 2YV5A 4OHYA 3LQQA 2QTVB 2ODEA 3QF7A 2XEXA 3TW8B 4G5OA 1MABB 1E1RA 1XPUA 2YVUA 1NP6A 1OXUA 4QGFA
chains in the Genus database with same CATH superfamily
1PJ2A 2BEVA 3TE6A 3MNFA 3V00A 4HWTA 4KI0A 4BUJA 1HL7A 2VUTA 3FFAA 1N1EA 4UDYX 2IUTA 4Q3KA 4RU1A 3WLAA 3SC6A 1EIWA 4FB5A 1THGA 3A2MA 5JFGA 1G5PA 1C30A 1J8VA 5J40A 1R5BA 5CCBA 1HORA 1R4MB 2AT1A 1P77A 5LZ8A 2R87A 1OU4A 1Q0SA 3DEIA 3EBLA 1F14A 3HPQA 5K99A 2EX0A 2OCDA 3GFFA 1LPBB 3EGIA 1SCUB 3GLIA 3IYLW 5FKJA 5F5XA 4O1HA 5EKDA 5K8JB 2CC2A 5C81A 4RE5A 4Z4HA 3MMNA 4DA8A 2EGGA 2KE5A 5A3JA 4G0ZA 2PNJA 4MYDA 3SYNA 3HBMA 4IEIA 4HXEB 1XVUA 3HVUA 3HVIA 4RF2A 1YQEA 2GI4A 2PZBA 5L53A 4DJAA 3IIJA 5CA1A 3WWDA 2Y66A 1NN5A 4DQUA 2VBIA 2DUMA 5ALDA 3T5MA 4ZOLB 5F4ZA 2FW8A 5IDQA 1JV2B 1WWKA 3L8EA 3LHDA 2QYSA 3MAJA 3KG2A 5GM1A 5CDYA 2IPXA 2ZU0C 3SK0A 3OI7A 3GGDA 3ZLVA 4G5HA 2MSNA 3EXIB 1MF7A 1RWOA 4PGAA 3RS4A 1L3CA 3P4XA 4W99A 5ENVA 3MPOA 4WOBA 2P68A 1V7CA 2V6IA 3E9QA 4F12A 5GJBA 4X64B 3QVOA 1AGYA 3GJ7A 2CYCA 4JIMA 4PGFA 3BORA 3O90A 1VJ5A 4UD2A 3I8SA 2BH2A 5KDDA 3MIIA 1DJNA 1G8AA 3ETGA 2XCUA 3F96A 1ZESA 3RU3A 3FWPA 3AHDA 3K7EA 1KFEB 4GZ5A 4JOQA 1E1CB 4DJJA 3ZHUA 5KVAA 5JS1A 3QU7A 4R0MA 1EJ6A 1BIFA 3EVDA 1OKKA 1NYRA 2WWIA 2JLUA 1MVLA 3NHAA 2XGSA 3VZPA 4DMMA 2D8AA 2GBIA 1SVNA 2QAGC 3LHFA 1G6Q1 2OHXA 2C2KA 4L4RA 3CN7A 2JFVA 2OCGA 4BE7B 1TTTA 2VH1A 4LC0A 3AR8A 1D7OA 4KAAA 2NU8B 3D7LA 3RFUA 3TBHA 3S0JA 3HLYA 5DNVA 1NJ1A 3NH9A 3V4SA 4CQLB 2DQZA 4BN0A 4WXHA 4L78A 1LRKA 1RVV1 3ISJA 4OXQA 3VM6A 2FN7A 4M3NA 4RKFA 1YHZA 2N46A 4IFEA 1WB9A 1L9KA 2ANBA 3ZU2A 4UXHA 3SYKA 3BAFA 2OOKA 3K6SA 3ZZ1A 5YASA 4B46A 4OHKA 4HGOA 3KLOA 4LGYA 1Q44A 1NXQA 4LRYA 1XWIA 2HDOA 3IP7A 2XY4A 4IV0A 4DIKA 4NWIA 3ZJTA 2HRZA 4H2DA 3U9TA 1YACA 5BNZA 2PQMA 2BGMA 4O59O 5ICSA 3L0SA 3A4IA 1H4TA 4L4UA 4RDIA 3DOIA 5AVKA 2EFYA 3KE9A 4BZQA 1IM2A 4QNMA 5J1SB 4Q24A 4CF7A 1WXFA 1SCDA 3EZYA 1SBZA 3M6XA 2G17A 1X86B 2I66A 4Q6WA 2OGTA 2R8EA 4YQEA 1JYEA 5D01A 1X19A 4PXYA 4ED9A 1RBZA 1WETA 1JIJA 3ZV6A 2NO0A 5A2QA 4BFTA 5KX5F 4IXDA 4L3WA 4RHFA 4JI0B 4P4SA 1IZ0A 2WABA 4BNTA 1L2TA 2BE9A 4J76A 5I7VA 4B6JA 4RPGA 1KORA 1XX6A 4OL9A 2DERA 2JFZA 3HCPA 1FJXA 3P2MA 2HRDA 1CY6A 1JFRA 3EIOA 3GGSA 1ZA2A 3JWGA 4X6LA 3ZDYB 2V6GA 2XLCA 3HY4A 5HZMA 1Q6ZA 1GOTA 2B7LA 3KJGA 4OV6B 2A5FA 1E58A 4EHBA 3NOQA 1RDFA 1KVTA 4F2DA 3PR2B 3N28A 1D2EA 2B34A 2VDVE 4ZCRA 1ZIOA 5BQXA 5JQGA 3G1WA 4PPFA 4WQMA 3NNDA 4W5QA 3DDSA 5IAKA 4HZUA 1GPJA 4CV3A 5F73A 1PJSA 3HVKA 3DDUA 3M4NA 1EKXA 3IO5A 5JV5A 3PPXA 3ELDA 1MEJA 1FOEB 4FFPA 4EI2A 1ZD3A 1TRKA 3E2PA 1CRLA 3PT5A 1O9BA 5CNJA 3IIKA 2WJIA 4MDYA 1EE9A 3QI2A 1P9WA 2OXRA 4IYJA 1PT8A 5KOIA 2OORA 3RTGA 5L3SB 2VAWA 4D9BA 2SBTA 4JITA 1HE2A 3OEHD 5IC5A 5A3VA 4PLWA 4QZVA 5LJIA 4HWSA 2WNSA 2PJRA 1DSSG 4RHCA 4MGZR 4H35A 1WBJB 4I9GA 3EFOA 3N8IA 4R1LA 5E0KB 5GM2A 5EZQA 4O4LA 4G09A 1Z6ZA 2CV1A 1YNOA 3W5DA 2FWAA 3BTOA 4IICA 3TS1A 1JDBB 2BEWB 2FR8A 3KBOA 3REGA 3OPVA 3T7KA 1N2IA 1ZGAA 4TT8A 3EW9A 1KVRA 1O6ZA 1OWMA 3QLUA 4GQIA 1X0VA 3VR4A 1A5BB 1JR4A 3IX7A 1U0BB 4U2GA 5J9FA 3WNZA 2C4KA 2ZYDA 3KDSE 3AL2A 4DRYA 5IJ0B 1NQXA 2NADA 4B45A 1A5SB 4QYIA 2QXYA 4JI6B 3GRPA 5CNKA 1GUZA 2G0AA 4FOTA 3B5IA 3TIVA 3RU7A 1KK2A 1NHGA 2ZIFA 3I34X 4FNOA 5J2TF 2WIGA 1Q2XA 3D7NA 3N8DA 1SBHA 1MR3F 3MD9A 2GERA 5TQJA 3BHMA 1RPAA 2PIDA 4U9IS 2V0GA 1MIOB 4HMPA 3Q8LA 4PG7A 1VHTA 1U7UA 3PIIA 2YXBA 1WCIB 5CB0A 2X2FA 3ASZA 1KAHA 1F2TB 4WK0B 5HDQA 3VR3D 1S3FA 2SKEA 4HNHA 1R5OA 1ZN7A 3FCYA 1E9RA 2OECA 2P1DA 1U8UA 3BHJA 4G9BA 4Q9IA 2GAOA 2I2FA 2Q0HA 1GGHA 3MQ4A 3LNTA 1CXZA 3VHQA 3ZZ0A 2C1ZA 4D79A 4OK5A 7REQA 1BMFA 2UUPA 4YAFA 2CXQA 4M1TA 1IHUA 5E1BA 121PA 1FBNA 2WE8A 2IYSA 2X42A 3G5AA 2QUBA 1JIQA 2HJSA 3H9BA 2J08A 4GKBA 1C3OA 2TMYA 4NV0A 5K3DA 2NU9B 4ZOQI 4DB2A 2OCKA 1RAIA 1Z83A 4CCAA 2KBEA 3FFWA 4FFWA 3IJ5A 5AKKA 3I2JA 3ZNPA 3FYCA 4RD2A 2C4MA 2OPBA 4IS2A 1O5TA 4CTKA 4HX9A 2CLEB 3UO8B 4MUMA 4ARZA 1LWOA 1DXOA 2QR5A 2LIVA 4FLMA 2JAPA 4QC2A 4B3MB 1VJ0A 3DMGA 2OE2A 3CBGA 4C2TA 4YRCA 5CA0A 3T41A 1Y6FA 2QLFA 4RW0A 3FNHA 1RKXA 4IIGA 4AY2A 2AWNA 2QEQA 2VYND 4IIJF 4KXUA 4TLMB 4V0RA 3F90A 1B43A 2Z9CA 3WQSB 4JA0A 3OZFA 2NV6A 3P9XA 5EXDA 1HDGO 4LHXA 4E31A 3TECE 1DBSA 5E38A 2Z9DA 3LI2A 3CURA 3D59A 3MC1A 4X1YA 2HA0A 4AJNA 4DADA 4CKBA 4D57A 4IV8A 3ESYA 2BRUA 4HAIA 2GJKA 2ZVPX 5FD8A 3OOSA 4DOMA 2IXBA 3A31A 4KFRA 1WSDA 3AF2A 3SXUA 1DUVG 3LT0A 2OV8A 3DFZA 1T3HA 1D09A 1UBUS 1Z5NA 3C45A 2ZRGA 3EARA 6REQB 4D46A 3KQKA 2ZJ3A 1R15A 4I5EA 1K68A 2ZUBA 2IPLA 5H81A 4ECEA 5IAAA 1Z2PX 1K8QA 1XU9A 4W8GA 1NBMD 2X2EA 1KR5A 1E32A 2NXEA 3SF0A 1JHXA 2CLSA 1XAJA 3PXUA 1X92A 2R79A 4LHEA 3DKVA 3BB4A 5J4LA 1CQIB 2H7CA 4A2QA 5B55A 3PPVA 3VO9A 1U7ZA 1DBWA 4DSUA 1O54A 3KTAB 5K45A 2NQ8A 2OHGA 3GEMA 1NVTA 1JRLA 4J0CA 1YZLA 1FK8A 1V3UA 2QSJA 3O94A 1G8MA 4IILA 1YDFA 1BEEA 1Y6RA 2ZR7A 5E4JA 5H4HA 4K05A 4KFCA 4UBOA 3LOQA 2FZGA 1B0AA 3KU4A 3G8CA 3UT6A 3VH4A 2A1IA 5EJAA 2FR1A 2BCGY 3IPRA 4CV2A 5HQJA 4HN2A 4F5ZA 1IHOA 1Z2EA 2OQ2A 4JYMA 4MJ3A 1LVHA 4QGHA 4YVFA 2QX4A 3OESA 3R0IA 3TTTA 3KYJB 5AM4A 4MVYA 1KZ6A 1LS6A 1NGSA 1T5HX 1TK9A 1YS1X 2UZ1A 3O75A 1KE2A 1VYHA 5LBUA 2G9VA 3X43A 3JARB 3L6EA 4AWXA 3GUYA 1DZ3A 2B9VA 3L05A 2FI1A 4HWGA 5DHPA 4KDCA 4DLNA 2XYRA 4FZJA 5AP9A 1JU9A 2RB4A 3DPSA 4JFRA 2H1FA 5U1PA 4YMHA 5JNVA 2CJWA 1ZJWA 1X7ZA 5H02A 3HJTA 5EP1A 3S6JA 1NLYA 3A6EA 2IYZA 4KB5A 1FDRA 4EELA 4KR7A 2IU6A 2QUIA 3TNJA 1IN8A 1XC7A 2Y68A 1EXDA 1QZUA 3A04A 3G5LA 3UPTA 2IS1A 3SOZA 2A5JA 4PICA 3VKGA 1H8ED 1YZQA 2ATCA 4HQOA 5IAGA 1U2GA 2WU3A 3JQCA 1IY9A 1ZK4A 2A0YA 2LBPA 4NC9A 1NNI1 5BN1A 1X1EA 4LOKA 5B7PA 4II3A 4RVHA 4II2A 5DCWA 1T3ZA 2FVYA 1RJFA 1RM4A 2HFKA 2WM3A 2ZB7A 1DL5A 3B1FA 3BUSA 3KTDA 3KUKA 4X91A 2C77A 1PT5A 2CDNA 1NVWQ 4FBMA 4UHEA 3HYNA 1TZMA 2P8JA 3MWYW 4X45A 4DIUA 4YJFB 1VMIA 1EFDN 3MSXA 4PZLA 3AZQA 3KZOA 3SZ3A 2YZ2A 3K73O 4EVQA 4PNEA 4OP3A 4MQLA 2VT3A 1AKTA 4N4AA 4P84A 1JN0A 3BFJA 4DSAA 1AO0A 3TG8A 3CCBA 4ZJZA 5AVXA 1P4RA 3MT7A 4CUJA 5L7YA 4MS4A 4WIAA 4AP6A 4N03A 2V7XA 2BR4A 2OD9A 1A76A 2Z2YA 4XUGB 4BU0A 1RVDA 1KERA 2H4WA 2QM3A 3FJ1A 4D7AA 1GQYA 3Q2OA 2XZDA 1QVAA 3LL4A 1VHJA 4JP3A 1KRHA 3WDSA 3OEEA 1YU9A 2JH9A 1YS6A 3GJTA 2WLTA 4ER6A 2CD9A 3LC7O 3MWDB 5ENDA 3SY8A 5BPFA 2X6RA 2GF2A 1XQ6A 5GADl 3L7NA 3KQTA 5F3WB 1SCIA 1MOPA 1VA5A 3RTBA 2ICAA 3A3NA 1L5LA 3B5JA 4MRAA 5KYTA 4ZFNA 1EWYA 3EGEA 2J7PD 2JCXA 2VN8A 3CY6A 2ZUWA 3H7AA 4WNAB 1PW7A 3ZJYA 2GJ8A 2EGUA 4G0OA 4O2BA 3DZFA 1GZ6A 1LSSA 4WFKA 3GI1A 2O8BA 4BP9A 3GRYA 5F78A 1EGHA 1H0SA 1F4LA 1W5SA 1GGFA 1PJ4A 2B1QA 2H8GA 4ZTZB 3DBHA 3KHTA 1DG1G 1NBHA 1H65A 3AL3A 4WKNA 2O50A 3RSSA 2JAWA 1QP4A 1VOTA 3EWIA 1JDUA 2XSZD 1YS9A 4FQ5A 4HB4A 5LZ5A 3VMFA 5FUVA 2G82A 4IM7A 3QTBA 1FIUA 4NH4A 5BRNA 3D8NA 3ZYCA 4YO8A 4MA0A 3SQNA 3BPSA 3R6LA 4TUYA 3K1TA 2DB3A 5EAIA 1QHFA 3CO5A 3HNPA 3QWIA 5EMKA 2Z09A 1PUXA 2VWGA 5L45A 1XG5A 5BYAA 2VLBA 1KH1A 1NVMB 5H4GA 3E9DA 2G0TA 4CL3A 3C3KA 3RLFA 4ZQBA 4EMSA 1N2BA 2B3TA 3FOEC 2VPIA 4IMPA 4Q1AA 4Q9DA 1P72A 2GM9A 2PTHA 3ANXA 1TF2A 4XR4A 5JR3A 4A8JB 1E8NA 3ZPXA 1NIJA 1EBFA 3ETCA 3EEQA 1SC3A 4DFDA 1E9VA 1U8FO 3P27A 1HC7A 4TSFA 1L7EA 3T5DA 5CFNA 4MWEA 2E85A 1USGA 2RGAA 3GLQA 1JHOA 1PFYA 4M98A 1OBVA 1BWSA 1CB0A 4IZ6A 3SSOA 1KMCA 2AN5A 2QLNA 3JZMA 5A7GA 2IV7A 4O02B 8GPBA 2D0OB 3HSKA 4HAWA 1IEQA 1ZN2A 2D3TA 2V5AA 2R6GA 3TW8A 4WK2B 4S0XA 4UQOA 4F06A 1NRJB 4IIHA 5BRAA 1CQPA 2D4HA 2F9FA 2Q3MA 1JDZA 4BO2A 2FP4A 3PENA 3MJFA 2ZULA 4DXAA 3F4BA 2YIJA 5AVOA 2ZCUA 1L7AA 4TLAA 1Z75A 1E1LA 2QBYA 1W88B 2PAFA 1EVEA 1FUYB 3O4HA 5I47A 1SO8A 1Q92A 5U4XA 3EA4A 3OJCA 1QS0B 3G2NA 5J59A 3K0FB 1G42A 4RF5A 1Y6JA 2Q6TA 5CFLA 1ORTA 1ZWKA 1RCFA 1SAYA 1R0SA 2AN3A 2I6GA 5CT6A 2A4KA 4JLPA 3ROGA 4HDMB 2FEPA 3V1NA 1VMKA 3WZ2A 4EJSC 1PQPA 1N36B 3BWMA 3KLPX 1VPLA 2J0UB 4NJOA 4D0GA 5LN1A 3HCFA 5AW9A 1YULA 5K0EA 3AFIA 2J5BA 4CLOA 2AEFA 2W71A 2XQVA 3OZGA 1IQRA 4E7PA 3U5TA 1T8YA 3U7JA 2A84A 2AJTA 4E5SA 2VDMB 1E9DA 4TTVA 4XKJA 2HEGA 4QDUA 1KHHA 1YHNA 4IRUB 3PNPA 5ALRA 5K3EA 4O3MA 2ZJYA 1RLMA 5ESRA 3TZHA 4DNPA 3P4YA 1QANA 3DEYX 1ZMTA 3UBTA 1ZIXA 3AV3A 5DISB 2PG3A 4CI9A 3T9FA 4CEIA 2PZKA 2JAOA 2CXTA 3VGJA 5CT9A 4GECA 2P62A 2JLSA 3DOJA 4XDHA 2COUA 5BV1A 2V1UA 3QJYA 2PMKA 3AOGA 3VU1A 2MSCB 2QE7A 5G1OA 4MSUA 5AVTA 3FSRA 1XUOA 5J43A 1VPVA 3ENNA 3BULA 3UKDA 2Z5VA 4WBXC 3OP1A 3PNQA 3K2QA 1BMQA 1VRWA 2X7JA 2QKYA 2BWJA 2HRCA 2W2MA 2ZR9A 3C3WA 1PYGA 3NKFA 1JLSA 1WPQA 4HAUA 4EJFA 1XKQA 3QSYA 3BIFA 4QGGA 1STOA 2H4XA 1RWNA 4I14A 4RJJA 3TRJA 4NCAA 2P2LA 1N0HA 4R1QA 3JASA 4EENA 2QOEA 3G68A 4ZVVA 3FSEA 3WNBA 3OQHA 4NBVA 2QLMA 2YHIB 2YHUA 3INNA 4OXIA 3IEKA 1E59A 2FPOA 4C30A 3RNOA 2X13A 3RAEC 2FPMA 4HWPA 3TSAA 4GX2A 3HDVA 2RAPA 2ZI3A 1V8DA 3MLBA 2C2GA 4HHEA 4MB0A 5KCMA 5TXGA 1Y5IA 3N8HA 5BR4A 1LX7A 1ZD8A 3M34A 2XR1A 2Z2IA 3JXEA 3CR8A 4MZXA 3RHSA 3CBQA 1Z6QA 4NZZA 4OYLA 4PINA 1LH0A 1XOIA 3LTEA 1I32A 5E6RB 1L1FA 3IVGA 3EGCA 5ESWA 5CITA 9LDBA 3N0TA 4MW1A 5THKA 1RJWA 2OAQ1 3B9RA 1JI3A 4I9UA 5IS2A 3NR2A 4N0EA 1Z4JA 3WL3A 2BHSA 4LG1A 2FQ1A 4KR9A 5G4KA 1MV8A 4C22A 1QUEA 1SKBA 1YC5A 2CXRA 3K5IA 4FGUA 4OQZA 4WZ6A 4HNVA 2OHJA 4UE2A 1JDTA 1KEKA 4LZPA 3P9YA 3WIBA 4CIVA 3OWXA 1ULZA 4XGKA 2HA6A 1XXHA 3DBRA 2DPGA 2AR9A 3D3EA 4TYNA 1YKGA 2GZ2A 1SELA 1O97C 1YZNA 2Y8EA 3JYOA 4G5QA 4H7JA 1LK7A 4IKPA 1MFZA 4KN9S 5CTAA 5ALXA 4NHEA 5HJ7A 1C3EA 4ZAGA 3Q1KA 2HAEA 1U31A 4INJA 5KU7A 1KQGA 3KSAC 4EJMA 3OICA 2G77B 2JHCA 2QL7A 3TFWA 3GWZA 2CEAA 1FUUA 3FNRA 3MOSA 3WYCA 3CKYA 5LP1A 5JS6A 1N7HA 4KITB 1BGWA 2O1EA 5LQNA 4M9UA 2QZPA 1GUFA 2ZJ1A 2HWXA 1U99A 4PAGA 3LYLA 4RFVA 1UZMA 5FLKA 1VE5A 1DT3A 4BGEA 4YRPA 2QW8A 4E3WA 1QMGA 1V96A 2RGNC 3SEQA 1SRQA 3JVIA 1UMCA 5ALWA 2RJOA 1AF7A 5BSWA 1HMYA 3T9BA 2JB9A 5AKJA 1E18A 4QEZA 5KDLA 3VPHA 3WBKA 4EPRA 1XTSA 2QENA 4W9NA 3RS5A 3Q9NA 4ZHQF 1E4OA 2IOFK 5LB2A 2O8CA 1E9EA 4TS3A 1EFPA 4RTMA 1PR9A 2MT9A 3A06A 4TMZA 5TF0A 2QLLA 4D81A 1LQUA 3WJAA 1ZAKA 1K27A 3LFUA 1CUBA 4I0WB 2QTCA 1Z39A 2Q99A 4RTRA 5F2NA 1XLTC 2ZJ0A 4NCXA 2YMMA 3FLEA 3VKVA 3IUYA 4OHCA 3WJ1A 4DA4A 1JJAA 1CTQA 2GDJA 3KZXA 5C51B 2PLAA 5BVHA 1FFXA 2JBAA 1AU9A 3E7FA 4E11A 2FG7C 4LYEA 2CN1A 4F9TA 1WXQA 1EFKA 1N0IA 2WF7A 4B40A 3TRFA 4CIWA 2TSYB 1H93A 4TTIA 3RUCA 3ORHA 4CN9A 1EG2A 2ODBA 3M33A 3Q7PA 4RXUA 1N7JA 1EA7A 2DHDA 3E03A 1Y3FE 3KPJA 3H4MA 4H1TA 3L01A 4IINA 2HQRA 4QAJA 5G0WA 4CF6A 2BMJA 2WTUA 1SK8A 2IP4A 3FDFA 4AYTA 2HDWA 3FPKA 4MP6A 4NENA 1P44A 1POWA 3F5FA 2PCJA 2QIOA 4EATA 2OA0A 1Z0AA 2B99A 4LK3A 5H3CA 3FUUA 1SWVA 3GVCA 4F4IA 3O73A 4PS1A 4NQRA 4MGYR 2BMVA 4RVNA 2C5EA 5T8KC 2TMKA 2D0IA 1Z5VA 3HKCB 4MARA 3E27A 1V6AA 1IJFA 2ZXFA 2EKDA 4ZO8A 2VP3A 1Y48E 4DSNA 5CDTA 3K96A 4PN3A 4MAAA 5CAEA 5FWYA 2DXIA 2CSXA 4M1MA 3RJZA 5EJEA 1DAEA 4YJHA 1T4MA 5IK2A 3CNOA 3UANA 3JD4A 1UF9A 1O03A 3IOMA 5J63A 2OWDA 2KHZA 3BXHA 3H1AA 3JD2A 5ALVA 2R9VA 4J0HA 5K05A 1OOEA 5DTQA 3RRZA 6ABPA 3FCUB 5JRDS 4PZCA 5K0JA 2D2XA 4RANA 1E6UA 1J2TA 4N6NA 2J3IA 2FRVA 3KSZO 2UVDA 2W8BA 3BJIC 5LXTF 3F9RA 5LUBA 5C32A 3INTA 3V7UA 2QX6A 4IHQA 4FFMA 4G0PA 1XRQA 4V0MA 2NUPB 2IZ5A 2PRYA 4R69A 3FMGA 1Q3KA 4Y2VA 3D4NA 1FUEA 4O4IB 2OZLB 2XYGA 2WKPA 3WK4A 4AP5A 4TV8A 4RIEA 5ITZB 5B7NA 4RH1A 4BE4A 2XZLA 1G3QA 3KWJA 3GZNB 4QUIA 3HTXA 4H3SA 2BTOA 4IIXA 3KXKA 4MVJA 2AUNA 5HFJA 3T1VA 4EY3A 5MGNA 1K88A 5LLDA 2IIVA 2H85A 3K1ZA 1MT3A 3PA8A 3FTPA 4RA9A 5JZOA 1GNSA 5COAA 3ICEA 1AQJA 1NU8A 5DTRA 1UPAA 5A1JA 8AT1A 2ZB2A 5C5IA 1KQOA 1GLGA 2F62A 2GAIA 4HYQA 2PQ0A 1QYWA 3RVMA 1FFGA 5KYVA 4GC5A 4C4YA 2NYRA 4Y6SA 1MU0A 2ZRCA 5E7MA 4EQ6A 4RPKA 3AMVA 1SXHA 4WMLA 3L79A 1PN3A 3X1KA 1YONA 4WVLA 1QAQA 1E62A 1H22A 1KY2A 4A2WA 1UBMS 4RKWA 2BSAA 1Z28A 4F7WA 4RDHA 3BMNB 3QOWA 2MIIA 4AZ3B 4BO7A 2YJ5A 3H0KA 3WQHA 4ZO4A 2H2IA 2WV7A 3LAWA 3WHLA 3X2SA 3SC2A 5EP4A 3GQBB 4UPDA 1NC1A 1T0UA 3T0GA 4EZEA 4XVCA 4B2YA 3MIZA 5DBFA 4X97A 2XUGA 3VSEA 3AP1A 3GA0A 5ERGB 4XWYA 3OD1A 1FFYA 1YBVA 1EJ2A 2YXEA 4GG1A 4Y7CA 3T4PA 1W48A 3AG5A 4RFLA 2JNWA 1O6FA 1PGPA 1VCIA 1VE7A 2WF6A 3AKCA 5FYDA 3WYFA 4UHHA 3ABIA 3M4YA 4Y2YA 1DX6A 2HU8A 3T3DA 4YLYA 3OMXA 1X94A 3S29A 1BKYA 2AZXA 2ERYA 4E1BA 5BSVA 2IEDA 1M5RA 4QOJA 4A0FA 1TVKA 1EVJA 2GKOA 1Q12A 2B8JA 1AN0A 4IH9A 5H16A 4F3TA 1NMZA 1RWMA 4HAVA 4XM1A 2CLIB 1UQRA 4LRXA 3WXBA 1C8BA 5KVVA 1Z2CA 4DR2B 1WUYA 2GPWA 1JILA 4B7XA 4D98A 5D6NA 1ZDMA 2CK3A 2E49A 1GXSB 3C3JA 3NT4A 5J2UB 1F9EA 1Z0UA 3D9QX 3H5IA 3ORRA 5CDGA 5IVKA 4HEA6 1TL7C 1H1LA 1QC5B 4WZAA 1Y8RB 1UC5B 3DEFA 2ZTVA 2I2DA 4UCFA 1B26A 3WP1B 5IDXA 3SXPA 5BWMA 4J03A 1PGOA 2KBFA 5BWNA 5A02A 1T9BA 3RJ5A 1C7QA 1ODTC 4L5IA 1EVQA 1YB6A 2GN1A 3WKDA 2O2ZA 3UHAA 1QBGA 1N3IA 1G5QA 1UH5A 2HN9A 4C87A 1JT9A 2AHRA 4A1FA 3ROXA 3BFVA 5KQLA 5AK4A 3DMNA 4L5BA 3Q10A 3CJRA 5JAZA 2CLMB 1OLUB 2GPAA 1SUSA 3OECA 1X1CA 2IS2A 3MJ4A 4PG4A 5CJPA 1IBCA 2FV8A 8MHTA 1F20A 4B82A 2ZJ5A 5EWLA 3TH5A 5C8YA 1TZBA 2XB8A 5CLJA 3FI9A 1MOSA 1ECGA 2Q3CA 5IF9A 2Q3DA 1L4LA 4I1PA 5T41A 4IVQA 5EIHA 3K1AB 1KY3A 1KQPA 3AGQA 4QYTA 1KK1A 1TB4A 1V5GA 3KLBA 1GQFA 4MWDA 1JHQA 3ENVA 3GG2A 3LC0A 1QFZA 4RSRA 4GOOD 5C8VA 2JIZA 2C5SA 1OTXA 2JLVA 3SHQA 4QFDA 2IWRA 4R8KA 1RJ9B 3N8KA 2J87A 1FUKA 5IANA 1RZRA 2VJKA 4B84A 1CY0A 1LGYA 5IMBA 3DE3X 3C7KA 1Q20A 4ZGWA 2C3PA 3WSTA 1G21B 2ONJA 1SKYB 2H4ZA 1IH8A 3UMVA 4FQ8A 1BEZA 3AR3A 3SNKA 3WOHA 1MAUA 4XWGA 2G9RA 1WMFA 4DCJA 2OWEA 1MBZA 2Y4OA 5JSHA 3OZVA 4RK1A 3VXKA 3K9GA 4WJZA 2WF9A 3ACDA 3TE7A 1JTFA 3VH2A 4CWAA 1UBKS 3CC8A 2C31A 3O4RA 1PFGA 1O58A 2C3YA 2AG6A 3ENKA 4LYGA 1C9EA 3F7OA 4ZGBA 3NW9A 2G9QA 5JBQA 2ZE6A 2O0KA 2CUKA 2HHLA 2R00A 2V54A 3AO0B 4TN1A 4KIUA 4YGYA 2C9YA 1ID1A 1E5TA 1Z6GA 4FE3A 3PQCA 1ZS9A 5WRFA 3MUNA 2GEVA 3JD3A 3PXAA 2F7SA 2XTAA 4R71A 1NL3A 5HF9A 5BSFA 5B1HA 3EC7A 3T0IA 4WTOA 1QQ6A 4NJEA 4UUOA 3V4LA 4D8TA 1O0SA 4G0WA 3H2KA 2PR2A 3E3LA 1P8AA 3C6ZA 4LC9A 5I7UA 1F60A 3OIVA 4PXSA 3VPFA 3FG9A 5IM5A 1MH9A 4HEA1 3RSLA 4YLEA 3I5XA 2IHNA 4BWFB 5HKLA 3DHYA 3KKEA 3DTVD 3WHPA 2X5OA 2CV2A 2BONA 3FCSB 3DF7A 2J8ZA 4TKUB 5IVPA 4EGSA 1DAHA 5SZKB 4W82A 5C7OO 5KKAA 2QRZA 4NYIR 5EVJA 1UL1X 3DONA 3O9MA 5KQRA 2BIFA 4J07A 3EOBI 1O94D 5AVYA 2G67A 3TLXA 1I6MA 3BQNB 4XM2A 2HPVA 4WGGA 3LQRA 2YW9A 1Z82A 2ISQA 1G8FA 2M32A 4MJLA 3U3KA 5I8WA 4UU8A 3VYWA 4MLCA 4XIJA 2HZ7A 2PX3A 2AYXA 4QNRA 4R6XA 1U3TA 1UBCA 4EY7A 1CS4C 3W9SA 1K7SN 3ADPA 3EEIA 2LCQA 3HWX1 1ORWA 4MR8B 1XLVA 2VF8A 2YIDA 3M1LA 4IMIB 3R3ZA 3BEDA 3RTCA 5C34B 8ATCA 5TC4A 3OX4A 4DCUA 4LF4B 4PN7A 1JQLB 3DV9A 2NSJA 4L9RA 4RZQA 1H2WA 1P7ZA 1N2SA 3QNUA 4AF8A 5JH7B 2BGKA 1PIWA 3WLHA 2VHYA 2R3SA 3TM4A 3VNUA 1CRPA 5BP7A 5CDHA 3OHPA 4HLDA 2GD0A 4OCZA 3SM9A 3ZKAA 1QGYA 4JROA 4A1OA 1E9AA 1KOLA 1U0RA 2AMVA 5ADUS 1VA4A 1CC1S 1RRGA 5KOJB 3FUXA 3AUJB 1ECBA 1Z4QA 2EP8A 3FNBA 2HREA 4C0WA 1WG8A 4L0DA 1Q21A 4OLHA 3TAUA 2R4TA 3VHXA 1NW8A 4C7OA 1HPLA 2VJCA 3AOEA 3N2GB 4OQMA 5AHOA 2DEUA 2QP9X 4LNUB 3U7RA 4UXIA 3KQVA 4HB0A 3QBTA 3L7BA 1NNLA 2WAXA 3CLRC 1UIRA 1R0KA 4YRQA 4IV5A 2GGSA 4U02A 1K7YA 5DBGA 2Q6VA 421PA 3KSMA 3ZLUA 4F7DA 4HWKA 2YWFA 3AVUA 4RZ3A 2CY0A 3ZCVA 2EWWA 5HRAA 3MD0A 2CNNA 1UDCA 3P96A 3PX7A 1PYDA 4FYVA 2P9JA 2GPJA 2IVFA 3NBYC 3QFFA 4KO3S 4LUCA 3BJRA 4MQFA 4WKOA 4AKIA 5HR5A 1EVKA 2I9PA 3RQSA 4OFZA 5K0ZA 2C61A 3IAAA 1NR1A 4GICA 3C1AA 3TD6A 1WEKA 1ZN8A 2V3WA 2ABWA 1LB1B 2YWGA 3ETLA 1Y80A 1JVNA 2VHQA 1TM1E 2IXFA 3R40A 2QAJA 4DR3B 1LQ2A 1ZUIA 4W1SA 2HMAA 4PHTA 5MDHA 1AX9A 2WIKA 2NYUA 1S2NA 3OETA 1SURA 3ZCUA 4BKRA 1E6CA 2GN4A 3H9UA 2OK7A 3ZI0A 3IAS6 3WO1A 4YRMA 1J99A 3FE2A 1VKNA 1J2EA 2OBXA 1OMOA 1Y1QA 3EZLA 3JVVA 5E2AA 2ID7A 1JNYA 2V7TA 4DEYA 9GPBA 4K7JA 4NBSA 4YJ2B 3LUKA 4DVGA 4IVPA 4N3CA 3KLNA 3OLZA 4MV1A 1PFVA 4JUAA 4BRZA 4U3JB 1SZCA 2A5YB 1TADA 3ELBA 3SJUA 4PM4A 3SHWA 3T4XA 4JUFA 1JZQA 1XDDA 1ENOA 4DCMA 4HZIA 1G0NA 2EBUA 2PSHA 3PWZA 3WV5A 4KXXA 3OBBA 1AKUA 3R41A 4PPGA 3TTUA 1ILEA 4MV9A 4S1OA 1LQTA 1ZRHA 3FB4A 1G4HA 5B1DA 1HWYA 2HPZA 1PSWA 1P2TA 1YQTA 2UYQA 4ZV9A 4DLXA 2JVKA 4LFBB 1KIFA 1YRWA 2ZBDA 2B35A 3F3KA 2WDZA 1HH4A 1V8ZA 1Z33A 2HFJA 4PIMA 4RABA 3NYWA 1AQUA 2OFFA 4DM7A 2O2GA 3U44B 3WB0A 3VPAA 1A0OA 4D9NA 4Q1DA 1GFZA 4NDZA 2YZ7A 4XRGA 1HFJA 3ED1A 4D43A 3CVJA 4ZQHA 4ZYXA 2AFIE 5AVSA 2G5PA 2R66A 3P9RA 1WXXA 2P8SA 2RSLA 1L8LA 1U0FA 4UOZA 2G5TA 1NP7A 3OZWA 4R5MA 1NMQA 3ANTA 3JTMA 4BO0A 3H2IA 4W8HA 2VDJA 2RHDA 2AI1A 2ZVJA 3ASYA 3VAYA 3OP4A 1Z17A 3O8QB 5T4HA 1GGEA 4PY2A 2DOKA 3F1LA 2JDID 2WLSA 4LX8A 4ND1A 4Z3OA 2VKTA 3C6BA 4M49A 3ZIAA 5JUWA 1U2PA 4WN9B 2JCBA 4FHFA 2FPIA 2FU5C 4NBKA 3BHNA 1EDOA 2SHKA 4LXXA 5J5VA 1EJ0A 2VVTA 3P2KA 4XX0B 3C7CB 1OV4A 5ENZA 4ARIA 1QONA 2IYAA 3W8RA 4L95C 2AEJA 1E1RD 1QIEA 2G1JA 1TGVA 1FNSA 2XW6A 3F5SA 2P41A 1ZIDA 1RC8A 1QLJA 3M6LA 2NWQA 3TOXA 5TF4A 3LPLA 3BM5A 4CTOA 4UHKA 4XEUA 3T15A 3KYDA 4HJRA 4UEQA 3ICPA 1IOZA 1H4SA 3Q8XB 2ZI7A 1E4EA 4RKQA 2IKSA 3P9ZA 4AJHA 1W93A 3IP8A 1M5TA 4GW3A 3UWSA 2QVGA 3CE6A 1G2IA 4MVJP 4BYMA 4F6RB 2XGGA 3VR3A 3PEEA 5BNWA 3GLHA 5HDBB 1VTKA 3UYKA 7MHTA 3E23A 1QNLA 3ZLTA 1TA9A 1BTOA 3RGGA 3TN7A 4YS6A 2I8LA 1OHHD 3I04M 3KM0A 4M7PA 1OZAA 4TS9A 3IKJA 2GFQA 3E6AA 4J0KA 4MNTA 5GAJA 3SZGA 4DCTA 3LCUA 3TB6A 1Q19A 3THYA 2JJ1D 3MCTA 4IH1A 4CR7A 1X74A 5KX5B 1UBOS 4L8GA 3RUIA 3HJGA 3RI3A 2VIIA 5GONB 1FXSA 2VJQA 3ONFA 4N5DA 2Q7OE 1P19A 3VZSA 1Q7BA 1AUQA 2JGEA 3GEGA 4HAZA 4G63A 2PMDA 1ENZA 4X7PA 1V4VA 3DR3A 5AESA 1G2QA 1RXEA 1M2HA 3GRKA 5J47A 3OQIB 3C7AA 3DVAA 2PGXA 2FSSA 1F2UB 3C8UA 1CRWG 3GLUA 1KETA 5IASA 5D8DA 3LD9A 1VSVA 3KCNA 1DUIA 2R6ZA 4GI7A 3CHYA 3ZNOA 4F3RA 3O38A 4F8YA 2C03A 2COEA 1YOVA 1M7HA 3E3MA 3Q2IA 4K9QA 4BC1A 1NLUA 4G0VA 4RV5A 2DBRA 5DYWA 2WG0A 1IEXA 1CVRA 1LW7A 1DVRA 2DE0X 1ZXXA 2RAFA 3E22B 1N2CA 1V9CA 1DKNA 3N2IA 3MUOA 5M3BA 1VG8A 1M83A 2VYNA 3FRHA 1G8JA 2QTMA 2ZE5A 2II6A 1P9OA 1ZCZA 5KWIA 3LUDA 1NYQA 4B2LA 4JEIA 4DUYB 1QCYA 1UBLS 2GEJA 4ZAVA 3GLGB 1MZPA 1NT4A 1RP7A 1HOXA 4XDYA 3NNNA 4PCUA 4WCVA 2WJZB 3GT3A 1HT0A 1E5QA 2OD7A 3KB2A 3IURA 1QRTA 3Q6MA 3R9WA 3R5KA 1JG7A 3IQDB 2PS0A 2ORWA 4RMJA 1DG3A 3COVA 1PNVA 3SYLA 4WFIA 1L8AA 1COWA 2HA7A 4IHAA 4KLRA 3EQ6A 4AJ1A 3KEQA 2IHJA 2PSDA 1ELOA 2V9CA 3IPYA 4FJ2A 1FXWA 4ARUA 4GEKA 4DNOA 3BDVA 4HVCA 3VC7A 4NZPA 3LDGA 2BSXA 1UDRA 2IZOA 2B6HA