3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination and repair protein
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
2RHDA 3WXMA 1WP9A 2O8BA 1UEJA 1OFIA 3PEVA 1GITA 1P4SA 3RVBA 5BN3A 1FPMA 621PA 2KB0A 3P26A 2DYKA 5G53C 5KNDA 5FPHA 1D2EA 1II8A 2H8KA 4G1UC 1UBFA 2PLFA 3U7FB 2FFQA 1N25A 1WBDA 5EE9A 5FBQB 2GWHA 3U61B 2HEIA 3SFVA 1ZD9A 3K0AA 1YZQA 1G16A 3B9PA 3NDPA 4Z8XA 1SVMA 2G9NA 2H5EA 3KQLA 3FMOB 1G8HA 3N2IA 4GL2A 1OH8A 2DFKB 1G3MA 4GOXA 3BFVA 1OIWA 3BIFA 2ZI4A 2GBLC 1A2KC 2AHOA 3V00A 5KPDA 3T1VA 2YOHA 1A82A 4I81A 4Q19A 4WXRA 3PEWA 2IYXA 4Q1FA 3VR3A 4PZLA 4CEJA 2F1IA 4AY2A 2IHYA 3GLHA 3HPQA 1ZUNB 4Z1MA 1IJEA 4HDCA 4Q03A 3T15A 4B33A 4XD7D 2QL6A 3CPEA 3Q72A 4JZKA 1AGRA 4OJKA 4HDOB 2IYYA 2ODEA 1KMHA 1BYIA 4W5WA 1E2PA 4PPGA 4GT1A 3CNLA 1UKYA 2VHUA 5CK5A 5CITA 1NBMA 4D82A 1G21E 5KDDA 3NBZC 3M1IA 1CJVC 1OT3A 1TUIA 1YE8A 4AKHA 1EX7A 1QRAA 3KXIA 5GVRA 1XCPA 3NH6A 4NCNA 3ZLJA 2AXPA 4F4CA 1CR1A 1KI4A 1Z29A 2MSDB 4WW0A 4NU0A 2XOKD 4TMVA 1FTNA 2V54A 4IJMA 1NJGA 1VIAA 2WMNB 2P0EA 3ADKA 2B8TA 1VHLA 4NYJQ 4PTLA 2BMDA 1NN0A 2GZHA 3KTAA 4UQOA 2O8FA 3VKGA 4ZDKA 4OI0A 2ZJAA 3OE7D 3CRQA 3P4XA 1FW6A 3DMNA 4LJ5A 1EGAA 4NCJA 1N5JA 3THYB 3FFBA 1AZSC 3TKLA 4M2LA 3MD0A 3SNHA 4WVFA 3K09A 4PSVA 2G88A 4B43A 4B34A 1GUAA 2CK3D 4BFVA 1XCGB 1JECA 1DAHA 2FSIA 1RVDA 2LCFA 3EXAA 4HLUA 1ZVQA 5CJ2A 3RS5A 1E0SA 4KSCA 3TVTA 3I5YA 5JLJA 4GBMA 5J4LA 2BCJQ 5FBRB 3LLUA 4K81B 5AUOB 1OYYA 1T91A 3THWB 5EXTA 1MABA 2YJTD 3QG5A 1IAQA 4Q00A 1Z2CA 4AG6A 1YZKA 4CRWB 2RGDA 3K0CA 3B1XA 4HLCA 1GM5A 2GF9A 4OQXA 1ZMXA 2NIPA 4XJXA 2CE2X 4ESVA 1ESMA 2JDID 1ZCAA 2IYZA 3U2QA 3KUDA 3AVPA 2HLDA 2XSZD 4KAXA 4P4UA 3A1VA 4B6FA 3UMRA 2HUPA 4RZXA 2ZITA 2AFIE 1BKDR 4W5JA 4PSAA 3GJ7A 4DIDA 3MLEA 5DYIA 2R6AA 5JWRA 1GNRA 3RABA 4A6XA 3AUYA 1T0HB 4TQUS 3I5XA 1OIVA 4S2EA 1G5RA 5LB4A 4WZAE 4V0NA 3K70C 1XEXA 4IDHA 2FMXA 1OH5A 4MYUA 3RSOA 1XEFA 1H8EA 1W49A 2G1JA 1XMSA 3T5DA 4M0LA 2OBNA 1KZGB 5FPSA 2YWEA 1W36C 2I1QA 1HE1C 2QA5A 4FCVA 4JLAA 3IIJA 1SKYB 1WMSA 4Q7KA 3B1WA 2KE5A 1ZU4A 3LDAA 1W48A 1ZIOA 3IPYA 3IEVA 1UBEA 2IEYA 3BE4A 5F98A 2VSFA 3EIQA 2WV9A 2XAUA 1CR2A 1W46A 4KODA 2QE7D 4M9ZA 3KQKA 4HAXA 2UZ3A 1XPRA 4QBFA 1KDOA 3FKSD 1KHTA 1RJ9B 5B57C 3FKQA 4M21A 4FMDF 4D80A 1R6BX 5CB8A 1VTKA 1YR8A 2QTVB 2ZJOA 1G9XA 4PO9A 4RCZA 5E7MA 5HKKA 5SZHB 3RLFA 3BD9A 3C7KA 3K0CC 4PQYA 1IN4A 4MYCA 3V4FA 3O8RA 2BM1A 2CVHA 4AURA 1F60A 2Q3MA 1LS6A 3MWKA 1W7AA 3F3YA 4E07A 3RWMB 3OHMA 2JLQA 4XH9B 1L7VC 4NBSA 4CT4B 3HR8A 4KYUA 4XSGA 4LJYA 3RWOA 3TH5A 3GPLA 3R9XA 2C9YA 3TW8B 2IYSA 4E09A 1NI3A 1S1MA 3GMTA 2AD1A 5DYGA 5JSZA 1N5KA 2D7CA 4D0NA 3C15C 1E9FA 2XGJA 4EKDA 2HF9A 5BQ5A 3GJ6A 3DHWC 2HYIC 1G7CA 2IWRA 3GJXC 4OK3A 4TL6A 3AVWA 3CX7A 1MO6A 1UKVY 2BDTA 2GVDC 3KL4A 4AIIA 4BZQA 5A4JA 2R6GA 1T6NA 4HZUB 2MSEB 5D3QA 4YDSA 3W34A 4Q4LA 3Q7QA 1Q1BA 4HI0E 3EC1A 1X86B 3VNUA 4JT4A 1XJCA 1T4GA 1I4TD 2ZSDA 2Q0HA 3AF2A 2MMCA 3D31A 3EWSA 2HF8A 5KSOA 2OG2A 1N2CE 2OO7A 5JRJA 4C3ZA 1T9HA 3E5HA 1FX0A 4S35A 1JR3A 3AVTA 4AD8A 4PO8A 3TNFA 2XXAB 4POAA 1P5ZB 5SZJA 3W8NA 4DLTA 5HZHA 4FWIB 2H18A 1TPZA 5LD2C 5HE8A 2WWFA 1M7HA 3OFND 1M74A 3WNCA 1M8PA 1N6LA 2VP4A 1RRFA 2X19A 3GJ3A 4R2IA 3IHWA 1X8JA 1P60A 1KYIA 5TARA 4ON9A 4KFSA 3GEEA 4TT3D 2GDJA 4C0BA 4M8NE 5BN4A 2GILA 2AKYA 2HXYA 4LZZA 3U3RA 1LVGA 2ORWA 4BFSA 1FNMA 2JASA 5CB6A 3T35A 4Q9IA 2RHMA 1NG1A 4UJ5A 2ZREA 3BJIC 1DAEA 2CLDX 1NVVR 2GCOA 2D2EA 2ORIA 2QP4A 4FMDB 2V1XA 4DSNA 4I1UA 1TAGA 1ZNWA 2F1JA 2J7KA 3DOFA 5JMTA 4QJ4A 4NMMA 3NDBB 3K0FA 2TMKA 2VPPA 5CK4A 4B44A 4DCNA 3A36A 1SVSA 2JJ8A 4UXIA 1YR9A 4CT5A 2IBMA 5JWHA 5DHAA 3HU2A 2ZI9A 2VSOA 4IFBA 2D2FA 4I1OA 3F5FA 3R9IA 1P73A 4R71A 3L2OB 3TR0A 5EXXA 4C0HA 3SS8A 4L9SA 4WXPA 3HYTA 2O5VA 4R98A 3CPJB 1K5GA 2QMUA 5A5GA 3O8BA 4KVGA 1GKIA 4BRWA 4XVQA 2J7PA 3L43A 1E99A 3RS0A 1IONA 1XU4A 3FTQA 2V1UA 3THOA 1E0JA 1SZPA 1KDRA 4DDTA 1KY3A 2NO1A 4M9SA 4MITA 3SJAA 4UNRA 2WWGA 2GCPA 1MO3A 2YNMA 4G5RA 1MV5A 5FI1B 1VCMA 4MRVA 3W3AA 1VCNA 2VO1A 4C0AC 4DB2A 1E4YA 2CJWA 1KI9A 2QM8A 2ZRDA 5IRCD 1TF2A 3VU9B 4D4MA 1TL7C 1ZD1A 2IYQA 4GFDA 4G0NA 5FBWB 4DLYA 2ZUDA 2FU5C 2QMHA 4WA7A 2GAAA 4XVUA 4HB0A 4KFUA 2NMVA 2KBEA 5B64A 1NP6A 2OE2A 1OHHD 2GZAA 3LLMA 1JAIA 2Z6VA 2QMOA 1AIPA 3CWZA 5JRZA 4OQMA 1GWNA 2OAQ1 4MRPA 1P62B 1DAMA 3RRYA 4B32A 4P4SB 1JEEA 2XB4A 1Q1ZA 1OKKA 4RFVA 3LA6A 1ZRHA 1NN5A 5FI0B 5EJEA 1C4OA 3B1ZA 1YHNA 3HWSA 4ZCIA 2IUTA 4Q1AA 4A0RA 5JECA 1D9ZA 4PXAA 3SYKA 4O3MA 3CR7A 4L16A 4I99A 4DLVA 3FE2A 2E1RA 2ZE8A 4Q4JA 1GL9B 2XJ4A 1HQYE 2WAYA 2ZI6A 3HR7A 4CZ2A 3WNDA 1OIXA 3I3SR 3THXA 1II8B 3CZPA 3KX2A 1YJ5A 2LWIA 2JAQA 2GA8A 4BLOA 4B6EA 5FUXA 4LJAA 4XWAA 1R0WA 3MJHA 2WJVA 4HB3A 2QPOA 4DCTA 3RDPA 4EJSA 2PCLA 3EZ9A 3AP2A 4IW3B 1EXMA 2ZRGA 1NSFA 4Y0VA 1GRRA 3T34A 2HCJB 2ONJA 1JI0A 4N3NA 2IHBA 4LJ9A 2V8OA 4GRAA 4M1MA 4TMXA 3HU1A 4TQ9A 3L82B 2ZQ5A 4NL4H 4EQ6B 1I2DA 1D2MA 1T0JB 2YHSA 3D3QA 5EZ6B 2ODBA 3OZXA 3NHAA 3Q8XB 2EQBA 1E3MA 4R7ZA 5FTMA 1YZTA 4V0KA 2WPDA 5IK2A 2WWWA 2NOAA 4E22A 1U2RA 3LW7A 1W5TA 4OQNA 3QKRA 4HSEA 1US8A 4G5GA 5L3QA 1E9BA 1KMHB 2NGRA 2ZVPX 3EA0A 1KO4A 2J46A 3QBTA 2L0XA 1U98A 1X1RA 4C0JA 1YVDA 4NKRA 2AK3A 3NBYC 4OQFA 1BS1A 3LH5A 4LBWA 4BFUA 1AGPA 2SHKA 3KXKA 3VAAA 1JR3E 2J87A 3KFVA 4Q1DA 1Z08A 4DUGA 1KY2A 1EESA 5AJXA 4C0QC 4DKXA 2C8VA 4WBSA 3I8XA 1W0JD 3U44B 4LGMA 3T06B 3K70B 5HR5A 4JS0A 2A5JA 4HDQB 1GKUB 5EP3A 3ETLA 1OF1A 3AUXA 2WJYA 4TQAA 1X8KA 3OIVA 3Q9LA 1RKBA 3TSZA 4CW7A 2D74A 3IPXA 3KTAB 2IYRA 2ZR7A 2O8FB 3EAQA 5UKDA 4GMDA 1OFHA 3QPUA 3KZ1E 3RANA 4PR0A 1O87A 1HT2E 3W5IA 2GHIA 4LYHA 2IUUA 4MDEA 1YZLA 4CEHB 1GP2A 1NLYA 2R6DA 1RJ9A 1XBTA 3TLXA 1G19A 1ZD8A 1WCV1 1SKQA 3NEJA 2YKGA 2H57A 3IUYA 5FPTA 1E1QA 4OI1A 1JJVA 2EFCB 4PZYA 1N6HA 3IBGA 4Q9KA 2OBLA 5AJWA 5FTJA 4TLBA 2GF0A 2ZJBA 3KKPA 4II7A 2Q6TA 2BBWA 1G8YA 1JXOA 5L8VA 2RGXA 5JHGB 2JLSA 3EPHA 2GKSA 1MABB 1Z2AA 3A58B 2JLWA 3T5GA 1NMXA 1SXJD 2R65A 3I72A 1TU4A 2XTNA 3OEED 4IOMA 4OI2A 4Q4HA 2BMEA 3N70A 2V6IA 4LCBA 4AWXA 1NMYA 1HTWA 4RY2A 1DG1G 5BXQC 2DHRA 4B75A 2A78A 3QEJA 4J0QA 2WMOB 4Q18A 1VG8A 2XITA 3PV0A 4B76A 2IYTA 2QENA 4Q1EA 5FR2A 1XXHA 4PSKA 4QKQA 2XNDA 4F92B 4FW9A 3CRRA 4EPWA 5FOWA 1NG9A 3C41J 4M9XA 1LB1B 1W5SA 1XEXB 3EG5A 4L8GA 4BQSA 5B30A 5C4GB 1KI7A 4QM7A 4DCSA 3K9NA 2NPFA 5GJWC 1X6VA 2G0NA 4LBYA 2ZRCA 3PCRB 4G5OA 2P3SA 2QGNA 3BOSA 3FMPB 2EWVA 2AKAB 2WKPA 4JYBA 1Z28A 3EIEA 3WMGA 4A2WA 3SDZA 4BASA 4URVR 3LRPA 4GPTA 3LV8A 2QM7A 1LF5A 1E69A 3GLGA 4FWTA 3R20A 1WXQA 1HEIA 2CXXA 1ETUA 3BB1A 1IJFA 4PHTA 3WYFA 4ERNA 4GZMA 1OJLA 4XVRA 1XX6A 4W7SA 4BECA 3UK6A 1E98A 1KJYA 2W2VA 4ACAA 1U8AA 3U3JA 4Q02A 3QKUA 2XZLA 5HTKA 4AYTA 3QOFA 5JJKA 3Q7PA 1CS4C 4M1TA 2GXAA 5LD2B 3CH4B 2YOFA 4QBIA 5DN6D 2GNOA 721PA 2ZJ2A 1VCIA 2GCNA 3A1SA 5CDFA 4G5SA 4PO1A 5FUWA 3MSXA 2WIAA 4IXMA 2PLRA 3ZQ6A 3HJNA 1OB2A 3EC2A 4TTPA 4M1OA 1A2BA 3SOPA 2W6JA 3KB1A 2YINC 4WIAA 2OLJA 3VX4A 4ZKEA 1HUQA 1M7BA 2AX4A 3VX3A 2QAGA 3I1FA 5G3YA 3IQXA 3TSWA 1S9HA 2LKDA 3ZIAA 4YLGA 4MQBA 3TUJC 2QT1A 3OIWA 3PENA 1KO1A 4ZCLA 3TAHA 3DZ8A 3TQFA 4XSHA 4EAQA 2PH1A 4Q66C 2BM0A 3S1AA 5KNCA 4HB2A 1P3JA 3BH0A 4Q9HA 4ITRC 3PITA 1DS6A 5FFMA 3FVQA 2VP9A 1VECA 4RD1A 5KTYA 2NQ2C 2QQ0A 4TLDA 1GTVA 4NH0A 1Z07A 2GBLA 1PUJA 4JSYA 3LBIA 3ZDQA 3BS4A 3VMFA 5C1BA 4JVSB 1U8ZA 1BOFA 2B6HA 4NYIR 4P0TA 1GSIA 4D0LB 2FA9A 3X1DA 4DLZA 2ZVQX 3AEZA 4DLSA 5BWMA 3OAAA 3A8TA 4BFYA 3MGCA 3RS3A 2GEDA 3FDIA 4IDOA 2C77A 3H0KA 1FX0B 4O2LA 3O8CA 2YWGA 3GJ0A 1HQCA 3T61A 5KOYA 4FIDA 4V0OA 1ZNZA 3ASYA 1S8FA 1T5LA 2BIFA 3PUXA 1MT0A 1UJ2A 3EASA 1E9RA 4UJ3A 2IYUA 3GFTA 1QG2A 2R8RA 1AK2A 4KVAA 1ZP6A 5C46F 2VP6A 1F2TA 2WAXA 4QM6A 1OKKD 1TQ2A 1W2HA 4MYTA 1P2TA 3KXLA 1CBUA 2ZRIA 2FWRA 3CKLA 4LHVA 4CF7A 3I62A 3CM0A 2O8DA 2ZYTX 2ZANA 2ZJYA 1QDEA 3KKMA 2D4HA 2JATA 4KI0A 5LDDC 3DMDA 2QAGC 5L3RA 4DDVA 1ZM4A 2NO6A 2JGNA 3ZS8A 2GESA 2GCOB 1UFQA 2CE7A 2QT0A 2ECKA 5TY0A 3SC3A 3R8FA 4P33A 4NHOA 1GZSA 3VQTA 4IVQA 4QGFA 3CIOA 3VR4A 1FQKA 2IK8A 2FG5A 4JSTA 3K0FB 221PA 421PA 1JR6A 2RGEA 2JJ1D 5K8IA 4LJ6A 2F9LA 1E2MA 2W6IA 4MUBA 1ZJ6A 4YMVA 3REFA 1JQLB 2ZJ8A 3R9WA 1XEWY 2QN6A 4URZR 1IN6A 2WOJA 1Z8FA 2F1HA 2GETA 3MWJA 1XXHE 3LVQE 2O8CA 2V4ZA 1E6CA 3IGFA 2CL7X 3B7GA 4C0LA 4DLWA 1HA3A 1G5TA 2VSXA 1VCOA 3BRWD 521PA 4EQ6A 1FUKA 2DWPA 1FL9A 2HJVA 5AWFC 1RZ3A 2ZS9A 1Z0AA 1U0JA 3C5HA 4PPFA 5AUNB 2WPDD 3U3KA 5CJPA 5IK2D 3P1JA 2QGZA 4OI4A 4IDQA 3DPUA 1KAGA 2CDNA 3BORA 3LY5A 4PHGA 4AKEA 2CJWB 3I92A 3KQUA 4XWKA 4C0SA 4DC9A 3SEAA 3QVUA 3GLGE 4DDUA 2YC2C 4TTQA 3PFIA 2JJ2D 1VDZA 1V43A 3MMPA 4DUGD 3ZZTA 4EPYA 4GZLA 2FEMA 4A8JC 3GFOA 1E0KA 1XPOA 4PC6A 3U44A 4US0R 2RGAA 3TQCA 5ELXA 4LHZA 5AJVB 1SGWA 2ZU0C 3DOEA 3GEIA 3P20A 2VF8A 4JLBA 3SU8A 4C2TA 3CF6R 2P6RA 4F4IA 4IOLA 4LRWA 1U9IC 2CHVA 1KJWA 4RFSA 3NXSA 5CDFE 2Q3HA 2G6BA 4CEHA 3IILA 2ORVA 3ICQB 2ZROA 4LHYA 3JVVA 2Z4RA 4TYYA 2ZSEA 4QHTA 4Q4JB 1U90A 1EK0A 2OCBA 2PEZA 2ZRBA 1E1QD 2GK6A 4LBZA 2OM2A 3K1JA 2W58A 5K8UA 3THXB 4GDFA 1BH2A 3OEHD 5IF9A 4U00A 2IEZA 2J9RA 1S2MA 1G6HA 3P32A 5E4FA 4DBLC 3AP1A 1F3OA 3UG7A 5EUMA 1AM4D 4EJSB 2IYLD 3LNCA 2V7QA 1RW4A 5TMPA 4P31A 1X8LA 5KO2A 4IXNA 4N0DA 2A3RA 2DPXA 1R8QA 3SYNA 4AYXA 1OB5A 3P27A 4HB4A 4HLDA 5AJYA 2WM9B 1Q12A 1XZPA 1W4CA 5CYPA 2C04A 3TAUA 1Z0JA 2BCGY 3I32A 3B9QA 2WVJA 4X8LA 3SQXA 2P67A 1R0YA 4JL6A 4FN5A 1E79A 3NBFA 3E2IA 1OYWA 1W4AA 4B3BA 4F4JA 3AQ4A 3ADCA 4OBEA 1NLFA 3RYTC 1LNZA 1P9WA 3QKRB 1IXSB 2UVQA 3FHCB 4ILEA 1US8B 2ZR0A 5IDVA 5L3QB 4LDJA 3QUSA 1W1WA 2B7CA 3C8UA 4JBYA 2JLXA 2GK7A 5J40A 1IBRA 4OK5A 2CNWA 4XWOA 2WKRA 2ERYA 4OL0A 4ASUA 4ZKDA 1PJRA 3JZAA 3M0EA 1TNDA 2G83A 2NZ8A 4B2LA 1KGDA 1Z0FA 1F48A 1OXVA 2AD5A 2F3TA 3I73A 1P75A 3AGQA 1UM8A 4AC9A 2O52A 4CVNA 3QKSA 4JLJA 1MOZA 2RAPA 4TSFA 3UMFA 4K8OA 4F93B 3QENA 1Y3AA 2F43B 1CULC 2WJIA 2ERXA 5FOSA 3GLFA 3M4YA 4PQRA 2JIZA 3V9PA 2IXFA 2FGKA 2O0HA 4RD4A 2GJAA 1D5CA 4EIWA 3U5ZB 4PQFA 3CUEF 3WRYC 4IDPA 2QY9A 3RRMA 4QJ3A 4PPNA 3AV0B 3X1ZA 2OLKA 3AVXA 1B23P 1QG4A 3B82A 3X1XA 2IA5A 1PVOA 3GCGA 4L9WA 4V02A 4BFXA 5K8TA 1AKYA 1I4LD 4M1SA 3GJ4A 5KSYA 2OHFA 4KJZA 1E2HA 1KKMA 3BC1A 2WSSA 4KLZA 4DEYA 1XTIA 1JNYA 3VHXA 3LBNA 1H8HD 3L0SA 4GSYA 3QXXA 5JBQA 4URYR 1LV7A 3A6PC 4I4LA 2RGGA 2ZE5A 4Q4HB 3MG9A 1Q1EA 1TU3A 1GL6A 1MR3F 4G3XA 1KO7A 2N42A 3QE0A 3N5CA 3M6AA 4D81A 3KQNA 2C9CA 1F5NA 1NN1A 1VMAA 1W4BA 2PCJA 1P61B 2ANBA 4WZ6A 5DHFA 3K8YA 2GJKA 1XXHB 3H84A 1VYVA 3R7WA 1PUIA 3SN6A 1G20E 1ZM9A 3K0EA 1QHXA 3K9LA 1A4RA 3QVVA 1GG2A 2VIIA 1XF9A 4N0EA 4RVCA 3JVUA 3KUCA 2RH5A 5L3VA 3ADBA 2W0SA 4MKGA 4A82A 1KAOA 1L8QA 4RZ2A 4ACBA 2Q9CA 2HCBA 1ZIPA 1FP7A 4BEBA 2WWYA 3SFZA 1Q0UA 3AKDA 4QNRA 3HPRA 4KV9A 2Z43A 2EVWX 2HT6A 4FXPA 2G77B 2ZYVX 4JLKA 3T1OA 3GLGB 3RS7A 2OBMA 2DR3A 2PT5A 4EDHA 1E2JA 1FQJA 3D8BA 2P65A 2N46A 2GEVA 4TL8A 2P6NA 4DT1A 5CM8B 5LB2A 2OFXA 2V6JA 4B35A 4CEIA 5GJBA 1NY5A 2PX3A 5J4VA 2FZ4A 2HV8A 3FGNA 2OEPA 5FBLB 4QG7A 1WRBA 1NF3A 2IW3A 2BMFA 4M4SA 1W2GA 1RYFA 4US1R 3BH6A 3EPKA 4Z51A 1RRCA 1Z0IA 4B71A 2FPLA 2I1VB 1JB1A 1CRQA 3RSLA 2PZEA 2IF2A 1JALA 1HT1E 1XEWX 4Q1BA 3X2SA 5JCPA 3ZYCA 3H1TA 2Q9BA 1U99A 2EFEB 2QAGB 3A1UA 2IS1A 1Q20A 2FPKA 4Q9LA 1CJMA 2ZRKA 3QQ5A 2OV2A 4NCIA 3UWOA 1WDTA 2IWHA 2V9PA 3ZVLA 3W8RA 1BMFA 4MGYR 1KK0A 3Q5DA 1SXJC 2A30A 3DKVA 3DVLA 4H1UA 4MKHA 3S1AB 4NYJR 3TK1A 2XZOA 3DDCA 3AVUA 2QI9C 5G41A 4MRRA 4QOSA 4YONB 3AVYA 2AWNA 2R2AA 4DCVA 3NHBA 1QZXA 4Q7JB 1UKEA 2H1LA 5FL7A 2FFAA 2BVNA 1R0ZA 1C1YA 3B1VA 4NTZA 3TRFA 1KMQA 1HH4A 4QHYA 4BRUA 4Z1MD 3EW9A 4W5HA 2PEYA 4PAOA 1E9AA 3AH8A 3D6TB 1Z63A 2ZTSA 2ZJ5A 5HCIA 3PR1A 4HUTA 1B0UA 1G8FA 2ATXA 4TMZA 1R2QA 5AJZA 1NBMD 4LJ8A 5FPYA 3KFXA 4I1VA 1J7KA 2QRNA 3CNNA 3OIUA 2FZLA 3NEYA 3QG1A 2EFGA 3GLFE 1N6NA 1W0KA 2GXQA 5AK0A 2OAP1 2VTKA 1OXXK 4YC7A 4DSOA 4G01B 1ZUHA 4F91B 4EFMA 3K70D 3CW2A 1NL3A 121PA 3DL0A 1G8GA 2WWHA 4L5BA 4DJTA 2FH5B 3ZGXA 4A8JB 1LW7A 3WBKA 1G18A 1F2TB 1DVRA 2UKDA 2J1LA 2AN9A 4LHWA 4AKIA 1DG3A 3L0PA 4RZ3A 3RRNA 5F3WB 1COWA 3AF1A 1BIFA 3AF0A 2C2HA 2C78A 2O8DB 1EFRA 3CBQA 1ZAKA 1J70A 5L3SB 3AKCA 5DGXA 1TADA 3ZJYA 2H16A 4BLPA 3RS2A 5C2JB 2CCKA 1Z6YA 1QBKC 3A37A 4BLSA 1NN3A 4OQLA 4R2HA 4V03A 1XTJA 5JZVA 1EFUA 1E2NA 4YXWA 4NZYA 1WQ1R 2A5GA 2QBYA 4BZXA 1FUUA 4D4KA 4LY6A 3PUYA 3IO3A 4PC7A 3EZ2A 1XFAA 3LQRA 4TZ0A 1R5BA 5JWOA 2V7QD 4EPRA 2H17A 3P4YA 2B21A 3RHFA 2F9MA 3CRVA 3KJIA 3SHWA 1G291 4M22A 4U7DA 4B3XA 2O8CB 3CX8A 3BERA 4ZIRA 1SXJE 4PFSA 4JVNA 4DHEA 1X3SA 1EWRA 1N6RA 1GVNB 2FE4A 3QIAA 3PJRA 4KO8A 4RD0A 1DBSA 2HLDD 1J99A 1N6PA 1GDDA 2FFHA 1P6XA 3NKVA 4XIGS 2RGBA 2J0VA 5EQTA 1Z83A 3BB3A 2DB3A 3B78A 3B5JA 4BWYA 1CJTC 2WKQA 5FR1A 2PZFA 4PHHA 1M7GA 4TL7A 3FB4A 2BV3A 5H70A 4C2UA 3CF0A 1XTKA 1ZM7A 1QF9A 4BUJA 3K0SA 3WYGA 4ASUD 4D26A 5TXGA 2QRZA 4KSBA 3TW4A 2W00A 1E2LA 3A4MA 3MAAC 4XD7A 1AZTA 1H8ED 4DB4A 3TIFA 1G64A 2ZRFA 5TDHA 2QQEA 1GNQA 3AP3A 4MGKR 3ZVMA 3U4QA 1XTSA 1DO0A 3LBHA 4FMBB 3LVRE 4KU4A 4Y0AA 2F43A 3ONWA 1DELA 5JI3E 3HDTA 2JEOA 3JZMA 1G4AE 1Z0DA 3LXXA 1AS0A 1GILA 1W4RA 1DTSA 2XNSA 4RFSB 2KJQA 4DLUA 2WZQA 1W36B 4M1WA 2FPMA 1L4UA 1Z22A 2XB2A 3PUWA 4EFLA 4JBXA 2Z0MA 2IF0A 3HP1A 2OFOA 2EFHB 3ZVNA 2XOKA 3RNLA 2QPAA 1YRBA 1KNXA 4ZPXA 4KYIB 3NIBA 2BJVA 4QBHA 4HLQB 1E2FA 1TF7A 3PG5A 4F7WA 1NMZA 5LPNA 5HKKD 4AI6A 2QTHA 2WWXA 1IHUA 3LWNA 1UAAA 3OE7A 3X1WA 1XD8A 4RKFA 2WSSD 3QXHA 1OSNA 2KI5A 4EPXA 2XTZA 2FJUA 3SJBA 1Q57A 5SZKB 1ZBDA 1N5LA 1OW3B 4AYWA 4TZ6A 4U5XA 3OIYA 3RAPR 1TQ6A 2CK3A 4KLNA 3TSOA 4DXAA 2JLUA 1N0VC 1XD9A 4DEXA 2IUSA 4L15A 3WMFA 1CEEA 1ODFA 1XCMA 1IN8A 1NJFA 2BWJA 4ZV4A 4D25A 3WYAA 4LPSA 2Q21A 4C7OA 2WOOA 2VL7A 4TL9A 3FWYA 1XDBA 3T1QA 3W6NA 4Q21A 4O0MA 3EZ7A 3NVAA 2J0SA 3B1YA 3L8ZA 4JL8A 2WICA 1SHZA 3U7GA 4A6PA 3UIEA 4LHXA 4DSTA 3SJZA 3B13B 3PIRA 1ZW6A 2C98A 4D4LA 1TQ4A 2FEOA 2JDIA 4PAQA 2FGJA 4URXR 5JS8A 4UNNA 2ZI7A 4TLAA 2XSZA 4BZPA 4PHFA 4NDZA 3IQWA 5FTKA 5GVSA 2Y8EA 4D0GA 1UBGA 1V5WA 4MA4A 2DFNA 2PMDA 1DO2A 3SI7A 3WHKA 1D6JA 1YU9A 4ZI2A 3EZ6A 4H9GA 4JKIA 4ARZA 3QKSB 4RKEA 4WOPA 3TMKA 1WBBA 2C03A 1JR3D 1R4AA 3GLFB 4B3CA 3QKTA 3D7MA 2VP0A 4JVLA 3QSYA 1GOTA 4Q4AB 2RCNA 1NVXQ 1U8YA 3CF2A 1GL7A 2ZI5A 3X1YA 1CLUA 1E1RA 2JLYA 1X1SA 4PPQA 2G3YA 2J5XA 1TQDA 1S9DA 1YR6A 5FOUA 5D3MA 4YMTA 1U94A 2VA8A 2ZS7A 1C9KA 4TN1A 2EWWA 3FKSA 1MO5A 2W83A 4HYYA 2YWHA 1S1CA 4NYMQ 1RRPA 3RRZA 3BXZA 3TE6A 2KBFA 1JPNA 4AK9A 2ZAMA 3LFUA 3HU3A 1YQTA 3E70C 4P32A 2ZS8A 5ANRB 4Z8YA 4FMCF 4M1YA 1OH6A 1YZUA 2KSQA 1ZYUA 2PMKA 2J0QA 3KJGA 3QPVA 3LX5A 3BGWA 4PANA 4TLEA 3Q3JB 4MKFA 3FHOA 4IVPA 2ZETA 3IBYA 3R7WB 1AN0A 2QUZA 3SYLA 3RC3A 2J7PD 5EP1A 1HURA 3N2EA 2OCYC 1IY2A 3H2YA 4H1VA 1P2SA 3IEUA 1XMIA 4HAYA 3VR5A 3W3ZB 2VHJA 3UG6A 3UKDA 4O25A 3O47A 2ZYUX 4UXJA 1IN5A 2R6CA 4BGDA 1G3QA 4NONA 4DIEA 4X8OA 2RMKA 1GIAA 2ANCA 4RD6A 3VTKA 1ZUIA 2C95A 3IIKA 3ADDA 1E2KA 1E2DA 1KI2A 3NTUA 3NH9A 2AK2A 2EFDB 3SJCA 2B7BA 2XJ9A 2CMKA 1UEIA 2A2ZA 3U7EB 3PEYA 6Q21A 2RGCA 2I3BA 2REBA 4ZCMA 2JLRA 3C16C 1KZ7B 4UNSA 4DT1B 4A8JA 1T3HA 2ZSAA 3C14C 4CEIB 3G82C 2Q9AA 4N1AA 3B60A 2WWIA 1VYTA 4I1SA 3UANA 2IYWA 4Q1CA 2OSBA 3IDQA 1QVAA 3WRXC 5L3SA 4OKSA 5AUPB 3VNVA 1U9IA 4BLRA 1VG1A 5JFGA 3OFNA 4IKEA 3B85A 4LI0A 4C9BA 4HZIA 5GJVC 2QTFA 4EPTA 4NE2A 5E7JA 4EUNA 4TT3A 4V0LA 3C5CA 2JA1A 1VG9B 2ZRNA 4IOJA 4HUQA 3B2EA 2F55A 4BFTA 2OZEA 1PLKA 2P2LA 4LV8B 3CPHA 5JEDA 1G4UR 1XNJA 4BLQA 2ZRAA 4NPHA 1NNEA 3PUZA 1IY0A 2IS2A 5CM9C 2J41A 3TUZC 4BFWA 1KKLA 4FMCB 3GLIA 3NC1C 5DO9A 3BK7A 5AR1A 2CLSA 1BO6A 3ASZA 2ZJZA 1Z6GA 2OXCA 1Q44A 4RCYA 5F9HA 1HYQA 4PC2A 1CU1A 4GNKA 4A1FA 1EFCA 4JBWA 3GEHA 1DAGA 4CDGA 1H65A 2QU8A 2NTYC 1RIFA 4PC3A 1TEXA 4IDNA 1EWQA 5FBVB 2C9OA 2VP2A 8OHMA 2W0MA 2ZUBA 2CEAA 4LBVA 2FOLA 1PV4A 4PC1A 4FD2A 1LS1A 3W5JA 1Q1QA 4URWR 3I4LA 4BEJA 3DKPA 3IKJA 1E9SA 1ANKA 2YZ2A 4CYMA 4D6PA 3QXCA 1RYHA 5EZ5A 3R8CA 3LXRA 1OXSC 2VH5R 1NVVQ 1UBCA 3EIHA 4LPKA 1SVKA 3ND8A 2QP9X 1F6BA 1XB2A 3LO5A 5FTLA 1PLLA 2D7DA 4HAVA 3UWKA 4ZDIA 1KOFA 1L2TA 5DI3A 5A0FA 1K5DA 2OILA 4PZZA 2DWOA 1OHHA 2QORA 4YMUA 4QRHA 3QY0A 2ZRJA 4DZZA 1CRPA 4MYHA 5J47A 1R8SA 3U7HB 3CLVA 4KFTA 1MH1A 1VPLA 5LBIA 1Q3HA 4UNPA 1CIPA 1KI6A 2ATVA 1N6OA 1YKSA 4YDHB 4JYCA 2QBYB 3LQQA 3ZD6A 4BLTA 3QXJA 4A0FA 4JMPA 2E9SA 3KKNA 4B3FX 3DM9B 3EPJA 2GRJA 4JLVA 3H86A 2FF7A 2DFLA 2EYQA 1XJ0A 1S4QA 2BHRA 4QGAA 2ZR9A 1UPTA 3QF4A 3A4LA 5H8WA 1AQUA 3CRMA 4OK6A 1VG0B 5HZKA 1Q22A 2CHGA 3ZQJA 1UDWA 1N6KA 1QHYA 4ZIRB 3MRSA 4M1KA 3TR5A 2JLZA 3QNUA 4HAUA 1SVLA 1N3BA 2QAJA 3KKOA 4TMTA 1RC8A 1KNQA 2DFTA 3T1TA 2OESA 4JLMA 5FL3A 5KYKA 1HE8B 5BYJA 1UKZA 5KUTA 1II0A 2OFWA 1ZNXA 2WBLC 4OHWA 3AKEA 1CP2A 1U0LA 1YR7A 4MGZR 5TVKA 1RE0A 1VIYA 2BOVA 1WF3A 2XNDD 2QP3A 3ICEA 2HXSA 1LTQA 1E4VA 2K5UA 3B6EA 1DEKA 1N5IA 3SBEA 2GZDA 3F0TA 5KNBA 2D3WA 4JLOA 4W9MC 3EPLA 3AVVA 4B3DA 2A5YB 2ZUCA 4QL3A 4A2PA 4B47A 1T3LA 2HDNB 1JJ7A 1GRQA 1OLOA 4GOJA 4DVGA 1KO8A 3QBVA 5HE9A 1PLJA 3L8YA 4NYMR 2JCSA 4DWJA 1TMKA 2WJHA 3WMEA 1I4DD 1KK3A 1DAKA 4IOKA 3AB3A 1DARA 5J4YA 3QJYA 2ZRHA 4Q7LA 2G1KA 3U4QB 2RKOA 3WNBA 1S3SA 3VFDA 1F2UA 5AUQA 2AFHE 3TBKA 2REOA 3DZDA 1XD2A 4QBGB 2FX3A 1G6OA 4B73A 2PZGA 4Q01A 2CVFA 4XTCS 4LOAA 1SVIA 4Q4AA 1XTQA 4O2RA 2RGNA 4YMWA 5BN5A 4QC2A 5BYKA 1W0JA 3MWYW 4ESHA 4ZDJA 3TGPA 3QF7A 1DADA 3KJHA 2VYFA 4V0ME 3OF5A 1GFIA 1E1RD 5FOVA 1JAHA 1WB9A 2VBCA 3F8TA 5JI2E 1QHSA 3CZQA 1S0UA 3AVOA 1ZINA 3EA5A 2O0JA 3K09C 1CF4A 4JLNA 1M6NA 4D2IA 3ZD7A 2HT1A 2W6JD 4HLUC 4QJ5A 1TX4B 5SZIA 1FMJA 1QHNA 2NO7A 4QGHA 2FSHA 3J81k 2ZXUA 5CIWA 2CCGA 1KTVA 2FSFA 2PT7A 3LD9A 3ZIAD 3GLIE 1CR0A 1T8TA 2R9VA 2QSZA 3SHFA 5EE1A 1G1MA 3HYRA 4JVMA 3DO6A 1MKYA 2IX3A 1NKTA 4D4JA 1JEDA 1EG7A 2W2TA 5TV2A 4L4UA 4OJQA 2IC5A 4C7OB 5FTNA 1ONBA 2ZRPA 3SE0A 3WBJA 1Z47A 4KBGA 1SXJA 1P2UA 3UXMA 4MKIA 4OHYA 3MWLA 2EYUA 3OEEA 1CTQA 1IM2A 1VHTA 1ZM2A 3CX6A 2DBYA 3LAWA 5FPKA 2IT1A 2WSMA 1G5PA 2I4IA 4JLDA 3CH5A 1G7SA 3GLHE 2PX0A 2WTUA 1II9A 1D2NA 2C5LA 2J0UB 1Z6AA 1T8UA 1SHKA 5G3ZA 5C18A 2IS4A 2AR7A 3BH7A 4JIMA 4DSUA 3OAAD 3PXGA 4LJ4A 2H92A 4TTRA 1SVOA 4ARZB 3FYHA 1NBME 5C4MA 4E03A 2RGNC 1AS3A 2X2EA 1JPJA 4MH0R 5EE3A 1AJEA 3FFAA 3BWDD 5EXPA 1ZC3A 1CJKC 2A5DA 3PQCA 5J4KA 1GRNA 4X8HA 5CIQA 5TB5A 3MFYA 2O8EA 3TUIC 1NVUQ 3QXSA 4IHQA 2BKUA 1DOAA 2OXRA 2W2XA 4RZUA 3SZRA 3G0HA 3LW8A 1P9RA 2WHXA 2VEDA 2A5FA 1KJZA 4P3YA 3GJ8A 3REGA 5JCZA 2VP5A 2PL3A 5D3MB 2ASEA 2VRWA 1YZGA 4AG5A 2GXUA 3TVDA 3IIMA 2QZ4A 1XPUA 4MRNA 2V55B 1RRGA 2EW1A 1N6IA 4KITB 4TYQA 2GEUA 3LX8A 5DIFA 4GP7A 5EE0A 2BBSA 1I2MA 4RD2A 1QHHA 1NLZA 4WAUA 3NBXX 5KSZA 5DN6A 1SVWA 1E94E 2W6ID 3KDSE 1TUEA 4UXHA 4A9AA 5K8LA 2JLVA 2YOGA 4TMKA 5GJCA 1W47A 1FP6A 1Z5ZA 1XJQA 3QI2A 1XTRA 1UADA 1N0UA 3ECCA 3RC8A 1GKYA 4KCGA 1U81A 2B92A 2OUKA 4JJKA 1E2EA 2CL6X 2PJZA 3WHLA 4E5UA 2Z83A 5G40A 3U3MA 1IXZA 1G8PA 3FMIA 1AS2A 4DDWA 2EU8A 5DLQC 2BKEA 3ZZUA 1ZC4A 4FCWA 2WJGA 2VF7A 5DNYB 1DPFA 2BEJA 3IO5A 5HPYB 4QNMA 3K9GA 1RPZA 1UF9A 1VYUA 3A1TA 4XTRA 4GP6A 2ZEJA 3GFPA 2OT3B 3GP8A 2CLCX 1P2VA 5F2EA 1OV4A 1OPXA 4ABYA 2IXEA 1XWIA 1OXTA 2X1VA 1QHGA 1E96A 2GXSA 3CRW1 4ZI3A 2GJSA 5CYOA 3VKWA 2BBTA 4DLXA 1MO4A 5IHPA 4KXFB 4RD3A 1D9XA 4MGIR 2FDCA 5H68A 4IRUB 1WA5A 4JKYA 3SQWA 1YZNA 5KU1A 1IY1A 1E2GA 2F6RA 4PAMA 1KDPA 2GTPA 1KDTA 5DI9A 3U6KA 3AF4A 1Z0KA 2ZPTX 3I8SA 4HAZA 1IOZA 3C4JA 3AVQA 3H4MA 1OFTA 1YRAA 3ND9A 4LC1A 5FUVA 1KI8A 1W36D 3W9YA 1P7CA 2UZIR 2FSGA 2H7VA 1AA9A 1AQYA 1FTSA 2ZU6A 2FN4A 3SBDA 5DISB 3FOZA 2VHCA 4QHSA 2YC4C 4UNQA 2XTMA 3DEFA 1KIMA 1NVWQ 3Q5EA 5JHHB 5P21A 3IHLA 4BE7B 5J5CA 2F1RA 4TYPA 1U0HC 2GJ9A 2J59A 3CWQA 1XP8A 2GVZC 2A7QA 4HEJA 4HUQB 1Z6XA 4LYFA 2X8AA 2VLIA 5E95A 2WIBA 3A4NA 1NRJB 3QEOA 4LYAA 3W6OA 3WY9A 3MCAA 2PBRA 3THYA 2O8BB 5EXSA 3EWAA 2R62A 3BFXA 4U02A 1Y63A 2ZRLA 4MDFA 1G7TA 2GJ8A 2NPIA 2PJRA 4NYIQ 2C99A 2QNRA 3GLIB 2P5SA 4G5QA 4BFZA 4DLRA 2JJ1A 2AXNA 1E79D 2LKCA 1EFTA 4OHXA 4B48A 4UKDA 1MRNA 3K0AB 4GMXA 4CIDA 1LY1A 3KKQA 1R5OA 1NKSA 2R6FA 3THWA 2D62A 5M04A 2J45A 4IEIA 1S96A 4KHZA 1R10A 1NSTA 4LWZA 2ZIAA 2CNWD 4LX0A 4TYNA 1K6MA 5EP2A 2YVUA 4TYWA 1OE0A 2X77A 3G5UA 4CEJB 4A36A 1E2IA 3GLHB 4JJZA 2DY1A 4B3GA 4DCUA 3U60B 1NIJA 1Z06A 1LFDB 5B58C 3ZS9A 2NO0A 2N1BA 1ZCBA 1XMJA 4YMSA 1Q3TA 1KSHA 1VKJA 1CR4A 4IVRA 1XZQA 4Q48A 4TLCA 3EX7C 1K8RA 2ZM5A 4TSFD 3E1SA 5B2ZA 2VHQA 4HAWA 5BW8A 2OCPA 1J2JA 2JJ2A 5DI3B 5FH9A 2JIZD 3AKYA 1Z3IX 2J3EA 2REXB 3RS4A 4JLPA 2QMEA 4OYHA 1G3UA 1Z6TA 5FUYA 3VR6A 5KHOC 1KI6B 2Z4SA 3ZVRA 3GD7A 4KFRA 1E9EA 3CONA 3WP1B 4QFMA 1CKEA 1GNPA 5E3HA 1CXZA 1EX6A 4IEEA 3FMFA 3MJRA 3U3OA 2ONKA 3QF4B 4Q7MB 5JJLA 2NO9A 2ODWA 5EUQB 4LJ7A 4EJSC 4Q47A 4EFNA 1WE2A 2CL0X 2IXGA 1ELOA 2VHTA 3OEHA 1IN7A 4QXAA 821PA 4KBFA 2BBOA 2MSCB 1J90A 1OFUX 1R7RA 1ZU5A 2BJWA 2V3CC 5FOTA 5DH9A 3AM1A 1ESNA 2ODNA 3NG1A 4GOKA 1XRJA 2ZE6A 4GI7A 2CCJA 4Z54A 2F7SA 1TTTA 4C30A 2P6UA 1G3RA 5GADl 1XMVA 2ZI3A 1E9DA 3L0IB 2R44A 2IL1A 4RJLA 2A9KA 2J0UA 1EFHA 1L4YA 4ZDWA 1M2OB 1E2QA 1SULA 1E9CA 1E0AA 5DSZA 1TEVA 2FV8A 3CR8A 3GQBA 4R9UC 4PX9A 4X8MA 3AF3A 2AWOA 1PZNA 4LYJA 4A2QA 1FZQA 4LSGA 1F2UB 1KO5A 1KSJA 3PEUA 5JS7A 1JQJC 4C4PA 1XD2B 2WJJA 2DWQA 3CO5A 2RB4A 3KJEA 4HZUA 5E7IA 2OCAA 3WP0A 2NG1A 2BEKA 4A0HA 4JL5A 2FNAA 5F9FA 2NZJA 3EZFA 3K9HA 3SR0A 4A4DA 2XZPA 2ZSFA 2F3RA 4CGZA 4M9QA 2QEQA 1J8MF 2B8WA 2XEXA 3NC0C 4TWZA 5KPJA 4FINA 1P72A 5KDLA 3T12A 2HYDA 4AKGA 4B2PA 1KSGA 2YWFA 3BAFA 2D06A 4FI3C 5CLLA 1KK2A 1HY3A 5DE3A 1ZM3A 3VR2A 2XXAA 4EPVA 3VR1A 2IYVA 1OH7A 2QE7A 3O8DA 4MUAA 1MRSA 1FFHA 2C96A 4FCTA 1T3SA 1BYUA 4US2R 1QHIA 1CJUC 3MUFA 1M34E 4NP6A 4B2IA 4TMWA 2KWIA 4HATA 1JBKA 4OHZA 4DRZA 4MRSA 4LC0A 3FHTA 1IXRC 1BMFD 5FOXA 3Q85A 3ZH9B 1S3GA 3VHLB 4QGGA 3AGPA 2XX3A 2MMGA 4LUCA 3FPAA 4XOIA 2AL7A 2QG6A 2X2FA 5CLQA 1SQ5A 1KI1A 2CHQA 1Q21A 4LV6A 2QPTA 1O3YA 1SXJB 1H8HA 5J4HA 3CB4A 5FL7D 1A1VA 3GJ5A 2CBZA 2QROA 1FNNA 2YYZA 3CNOA 4RSGA 3KQHA 4URUR 1N0WA 1QVRA 3EARA 3UPUA 2ZE7A 3B8HA 5JSZB 1G3IA 1NY6A 2ZYWX 1KSFX 3A1WA 1M1YE 1UDXA 4NCHA 1E32A 1W44A 2BC9A 4F38A 5KDOA 1JXMA 1OXUA 1A7JA 1P9NA 3NWJA 4WZBE 5JEEA 1NIPA 2G0TA 5KSPA 5EP4A 1W0KD 1FMLA 5HCNA 1IQPA 4B74A 3TJZA 1DE0A 2Q3FA 3W90A 5H1YA 1FOEB 1T5IA 3QPWA 3BFKA 5IT5A 2YV5A 3PUVA 2IS6A 3L0OA 1KI3A 4Q9JA 5JJIA 1DAFA 4A92A 1LF0A 1G7RA 2O8EB 1J8YF 5EE5B 2FFBA 3V4RA 4LV5B 4M53A 1G17A 3VU9A 1SKYE 2ZAOA 1R5NA 1COWD 2ZSBA 3KB2A 1R0XA 3OESA 3VKHA 2DCUA 2ZRMA 1G41A 3K53A 2HJGA 4BPBA 2Z5FA 1DAIA 1EFRD 2E87A 4OHVA 3DM5A 3U6BA 2BMJA 3PVSA 4C0KA 4Q5IA 3W6PA 3UATA 2QSYA 4NCKA 1AKEA 2O0KA 4IFEA 4K46A 4YQFA 1HV8A 2P5TB 1RFLA 4P4SA 4ZO4A 4YXWD 4V0MA 3UMSA 1GAJA 2GAOA 1A5TA 4LK2A 4JT2A 1ZNYA 2VQSA 3ZZ0A 1QHHB 1KK1A 1TF5A 4A15A 3BBPA 4A0GA 1D8TA 3I61A 4P4TA 3BB4A
chains in the Genus database with same CATH superfamily
2RHDA 2FF5A 3FLAA 3DCIA 4HYEA 1UEJA 1BEEA 4UHHA 3WGZA 3WK7A 1OFIA 5JNLA 5LXTA 5K4GA 1Z2NX 2B35A 1CYDA 1SOVA 2R8PA 1FPMA 4AF7A 1YKFA 5EKSA 4ES6A 5FWDA 5BN3A 4HNSA 4L9RA 3HDYA 4NIMA 1QTRA 4E31A 3FN4A 1C3XA 5G53C 4EZIA 1J49A 1GN9A 1SKMA 3QU5A 1Y1TA 4G1UC 1J00A 6PFKA 2JBHA 2BGLA 3W0LB 2OBYA 4EKNB 5EE9A 2AT1A 3IAXA 5LQRA 2O1SA 4U0JA 1J9ZA 3UWSA 3ANMA 3SFVA 4BN0A 1VKRA 4W63A 2JGDA 1YZQA 3NHPA 5FKJA 1L7RA 1G16A 4YAJA 2VJMA 4YDQA 1A27A 1C8KA 1ZA2A 3R74A 4E5YA 2I6FA 4JV5B 1FJHA 4CKBA 1ISMA 3FMOB 2Y6VA 1OH8A 4O08A 1G8JA 5EXEA 4JX9A 4QWWA 4NXMB 1G3MA 1V1JA 4GOXA 3BIFA 1I4WA 2WJ6A 1A2KC 1YOVB 2W48A 2AHOA 3O6VA 3LQ2A 3O8OB 1IZZA 3Q2IA 3A2NA 3SIXA 3PEWA 3KWJA 4WXRA 2AQKA 2C0QA 3NYWA 5DBHX 4E5DA 4PZLA 4CEJA 3PR2B 4WACA 1ZUNB 3IUJA 4HDCA 4HDNB 4Q03A 4CN9A 4JZKA 1AGRA 4MCIA 3M49A 1KMHA 3ZV4A 4AX8A 4W5WA 5BNFA 4WEQA 3B36A 5IH3A 2IQIA 5LDGA 1R0KA 4ALJA 2Q6KA 3SM3A 4CFYA 4D79A 3ZDAA 2PGLA 3G6KA 3TLZA 4AMGA 1K97A 2GBFA 4Q3NA 4XFKA 2VDMB 3G9UA 3M1IA 3NBZC 4DOMA 3F6BX 4TUYF 1TW3A 1TO6A 1YE8A 4Y67A 4AKHA 2Q7OE 1TYZA 2OBXA 1EX7A 3M2TA 4OXKA 4DR4B 3BMOA 5F3RA 1DV1A 5GVRA 4O4HB 2FHPA 1QSGA 3N2KA 5CP8A 3WMWA 2BF7A 4HP8A 2AXPA 4PYIA 1TJ5A 2JIMA 1DAOA 1V4BA 2H85A 4IMJB 2XOKD 5KVSA 2AA3A 3THWB 1FTNA 1X7DA 3EEBA 4IF6A 2PRJA 1QGDA 1ZGBA 1PX2A 3W5VA 2N47A 1EVIA 1NJGA 2WMNB 4NYJQ 3VZSA 1INLA 2MYPA 2B94A 1QGUA 1AF4A 2F2TA 4RKYA 4AN0A 2NADA 5EQDA 3DC2A 4BWFB 4HWTA 3M1AA 4UVEA 4BN4A 1KQFA 3Q2OA 2EEZA 3ECSA 3KWMA 3CRQA 3JQGA 3IMEA 3P4XA 4Y2PA 2PUDA 1YIDA 4IIEA 1N5JA 1YASA 4IMPA 3FFBA 3THYB 3MTAA 1UAYA 1XA4A 2XA2A 4RMJA 2JZOA 4HGNA 3TKLA 2NP6A 3ZK9A 3T7CA 1M34B 3INTA 2PVPA 1CW2B 1AXRA 5DB4A 4S1NA 1S8OA 2XF8A 1XCGB 3AILA 2FSIA 1MUUA 1RVDA 4NXNB 1W75A 4JP8A 4PLPA 4KSCA 5J4LA 4KOAA 1CQJB 2IV3A 1WUJS 5FBRB 2VC2B 1K8QA 3HKDB 1LBEA 4YP1A 3USES 3WKCA 4E4TA 4G6ZA 1J4AA 1MABA 4I3GA 4OH7A 4RLQA 1BXGB 3QG5A 2WYUA 3JD0A 1OFUA 1SWWA 1YZKA 4CRWB 3NRBA 1CUFA 1CUCA 4LOLA 2GF9A 5JAQA 4D8VA 1J23A 3HNOA 1ZMXA 3LZCA 4W9NC 3W2IA 5E6UA 4X6YA 4AJHA 1K98A 2R6JA 3RH0A 2Y0DA 5TPWA 3ND7A 3TB4A 4ESVA 4KWHA 2IYZA 4XKJA 4YCLA 3H2IA 4KAXA 2MCFA 1IY9A 2FW9A 4P4UA 4Q9JA 3ZWXA 3A1VA 2DOKA 1HETA 4LFCB 1KYZA 1Q7BA 1XZHA 3FDZB 3UMRA 1K6IA 1ONOA 2CL5A 2UDPA 4RZXA 5HBGA 1VIVA 5DM4A 3MLEA 4M1EA 2R6AA 2J67A 3RABA 4B4WA 1T0HB 1U1CA 1OIVA 4RJKA 4B84A 1XEXA 4Z7OB 3OKAA 4U2CA 3TIGA 1DRWA 1U0EA 3A0UA 3CZAA 2QLBA 3GPDG 5DK6A 1FU4A 3DMFA 3O0TA 1YCFA 1FDTA 1EDZA 5KVVA 1Z88A 1T0IA 1JDUA 3KHKA 1BGXT 4LF6B 3AOGA 3T5DA 4EGAA 5TT1A 1QGYA 2PKYX 2X2OA 5I7WA 4D46A 4KXMA 3L7IA 1W36C 5ECWA 3AI7A 4CKCA 2HQSA 5K1ZA 5JUWA 4FCVA 3TD2A 4ZCRA 4AMYA 3E9CA 3IIJA 1SKYB 4BBAA 4X92A 3BSWA 2HPHA 5C7OO 4R3UC 3FR8A 3IPYA 1K5PA 3BE4A 4OBWA 4R8RA 2ZUTA 3DD5A 1IULA 2I2CA 1CR2A 1UZUA 1SCUB 1W46A 2YQ5A 3HB7A 3OHPA 2HLHA 3R09A 5HEKA 5ERXA 4S12A 3QXGA 1ZX1A 5BQXA 1VL8A 5T4EA 3RFXA 5JSUA 4EEXA 2G5GX 4LYDA 4XX1A 3LXUX 2ZVDA 1SZDA 2EFYA 1QDUA 3JQ8A 4YT4A 4FMDF 3DKIA 5CB8A 1VTKA 3O4VA 5LWHA 1CZRA 2PRSA 1NUSA 4HQ0A 4PO9A 1ZGGA 4LSZA 1LNSA 4B3HA 2Y76A 4V3BA 1IN4A 3OG9A 3O8RA 2K87A 2CVHA 2B4AA 1XJ5A 3ASUA 4IV8A 3RQIA 3STVA 3T4UA 5JMOA 2BTEA 4JX8A 1LS6A 3ID6C 4DMLA 2R25B 4CUJA 3MT8A 1IOLA 3HR8A 3D3WA 1Z39A 4KYUA 4AJEA 3CKYA 4LJYA 5EJ2A 3UAZA 5LYYA 5CFNA 3GPLA 3ZGZA 3KJZA 1NONA 1PT8A 2XXJA 1NV8A 3TW8B 2QTAA 4QU9A 3VR5D 2VN8A 4Z9FA 5E3IA 1NI3A 3PICA 3PFBA 4G09A 1DXHA 1ECPA 2AD1A 2H2GA 5DYGA 3EXIB 2LCQA 2AXEA 2NUPA 3QLUC 2D7CA 2M6KA 4QOEA 4C7JA 3GUYA 1X13A 5FFFA 3DHYA 3JD3A 4KTTE 4OG2A 3GJ6A 3DHWC 3GZJA 3U3XA 3F6SA 1QONA 1YS9A 2QN7A 3LX6A 3BGDA 4LHSA 2Y0CA 1A8HA 1WW8A 4AIIA 3D7KA 5ECGC 3L8FA 1O5TA 1FBNA 4JQYA 5EJ4A 4WK4B 3B3QA 1C2YA 5HUHA 3PFNA 4MUXA 4UCQA 3VPFA 4DW8A 4MLPA 1EVEA 2QDXA 1HKUA 2FZWA 3VNUA 4C08A 4Y2SA 1JB9A 1T4GA 1I4TD 3EWSA 1E6KA 3E03A 3U39A 4Y1FA 5KSOA 2HSZA 2OG2A 1H9CA 3GNLA 5JJCA 1VBFA 5CU7A 5H5JA 5KNLA 1PJQA 2QPLA 3KLOA 4EB6A 1HQDA 4LZNA 4EELA 5LOVA 4DLKA 3JQCA 3TNFA 1JR4A 3PI7A 4FWIB 1TPZA 2H18A 4Q7QA 1M7HA 1N6LA 2VP4A 2XQJA 3EGXA 5DRYA 2I4NA 3EGDB 3IHWA 5TARA 3GEEA 1P7VA 4TT3D 2R8OA 4M8NE 3GRCA 1U7UA 1UIMA 2WHPA 4OKNA 5BN4A 3DOIA 1DINA 1XQ6A 3BE5A 1ICIA 1I10A 4J8PA 1Z36A 3ZGOA 3LP6A 4EKIA 1U3VA 1K8ZB 4H2DA 3D1JA 1YL5A 1DAEA 1PDVA 4FGKA 2R7KA 3UPTA 4MHSA 1NVVR 4NOKA 3K2EA 3ZV7A 4FIZA 4WV3A 3ZDDA 2V1XA 1SKBA 2LTAA 4NOMA 2HB6A 1N2OA 4QO7A 4RYDA 2H4JA 3FWNA 3PWKA 4IJQA 1SCAA 1STOA 1NFQA 1TLLA 5K3FA 5EWJB 3K0FA 4L75A 4RTQA 4GMFA 4FN4A 4XDGA 1WZNA 4DCNA 5JPIA 5AD1A 1VRCA 2W2NA 4C6TA 3BD7A 2E4UA 4UFNA 4B45A 4E5PA 3H19A 4CT5A 2IBMA 4EI7A 2H08A 3GCWA 4EUKA 4F4HA 2ZI9A 4UC0A 4I9HA 4CIBA 4U7TB 2CB9A 1YH3A 2HHLA 3U16A 5FJIA 4Q9NA 3F5FA 3R9IA 3W1EA 3CLUC 1NLUA 1Y9DA 1CUWA 2AJDA 2OP0A 5LA6B 1QLJA 3TR0A 3ZW9A 4C0HA 3LDGA 5T4FA 3HFSA 4FYKA 3CPJB 3E3AA 5K0BA 4KVGA 1JDBB 1GKIA 4N82A 2IPMA 4XVQA 4BRWA 1BTOA 2XUQA 5DM70 1WZ2A 5LU9A 1LPBB 5K5EA 1J07A 5DM0A 3D2AA 3RS0A 2H59A 1XU4A 3FTQA 2GLXA 2V1UA 1O94C 4JJ4A 3RGWS 4HDNA 4L1KA 3B51X 1KDRA 3ITEA 1JP7A 3ML1A 5ITZB 4DDTA 2NO1A 4CCWA 4TTTS 2CN1A 1JPUA 2D5BA 2QHXA 2GCPA 4OSOA 5EJIA 2C4NA 5A0VA 2HCTA 3GB9A 4GDMA 5FI1B 4MRVA 1U5BA 1UMDB 1Z13A 2AFIB 1VCNA 1J0CA 3DZIA 2RI6A 4UM5A 4V0RA 1IU9A 2J8ZA 1PWZA 3L84A 4V24A 5HCUA 1Z8DA 2BE9A 2I66A 2QM8A 3V8QA 2ZRDA 5IRCD 2I5PO 4XPZA 4KRFA 3LE8A 2IS1A 1EA5A 2WYIA 1U7OA 1M6VA 3SKYA 4LZAA 2QX8A 4G0NA 1PFQA 3N5KA 4WA7A 2GAAA 4QX6A 4KFUA 4RW0A 4O02B 5AW6A 4ARAA 2OE2A 1PNQA 3HI4A 3EVGA 4OFBA 4RTKA 1JIQA 2Z6VA 1GAEO 4JNCA 2ZB3A 2YFQA 1GWNA 4Z9XA 2OAQ1 1AXGA 3QKWA 2PZLA 3ND5A 4P4SB 4PLZA 4ZI7A 4LDQA 4V2IA 2DP4E 3B5EA 4TS4A 5TE9A 2G1UA 2XYQA 1FXWA 2DQ4A 2WSBA 3PL5A 1YHNA 1D7OA 3AL0C 2ZVJA 3SYKA 1AUQA 4NV3A 4CT0A 3CR7A 4GVLA 4TSRA 3D8UA 4NQZA 5CURA 4L16A 1NWCA 3U31A 2PBZA 3LT4A 3Q2KA 1T25A 3QFCA 1JEQA 4OAPA 3FOEC 2E1RA 3HZHA 4Q4JA 4U7HA 3KLBA 2WAYA 2ZI6A 3U9TA 1NE2A 2DE0X 4QDKA 1OIXA 1U3CA 1ZOPA 2GMWA 3G8YA 3CZPA 3Q1KA 2JAQA 2WMDA 2XKJE 4QULA 4ZOCA 4W5QA 4PM4A 2OHJA 1RU3A 4UHCA 2O7NA 5T7BA 1LJUA 3NGMA 4PICA 3IUPA 5FI5A 1NNLA 1F9AA 2JFOA 4OEHA 5LQSA 1DQNA 3A11A 1J5XA 3NHSA 3RDPA 2I3AA 3TKYA 3DVRX 1THTA 4O5OA 4TPKA 4MQ6A 1EXMA 4N8SA 4XGRA 4I8DA 4GKVA 4X1IB 4YJKA 4AJJA 1HOXA 3H5WA 4DY4A 2ONJA 4N3NA 1SEVA 5G1NA 1TM3E 3EMKA 4M1MA 2NYUA 3F8SA 1Y48E 3DFIA 3L1IA 4QDTA 4TMXA 4CPDA 4DC1A 2CBXA 3NV9A 4F45A 4EY7A 2O0MA 5F5XA 2ZQ5A 1D3AA 3F6EX 1AT1A 1Y6RA 3V7NA 5EHNA 1MENA 1ULTA 3PRJA 2YHSA 1VMEA 3EBLA 4I0WB 4YO8A 2PGJA 2C1ZA 1GQYA 3NHAA 3OZXA 3Q8XB 2I8CA 1ZIYA 1YZTA 3L8MA 1QIHA 4V0KA 3I2GA 3HJFA 3PHIA 4J7AA 1M73E 1KFEB 3ELUA 3LW7A 4X54A 2P1RA 1M1YA 2OQIA 4JELA 1VI2A 1P7WA 3S2YA 3F9RA 5L3QA 2JHPA 1TZJA 1UXKA 2ZVPX 3A1CA 2PANA 5D51S 2V6GA 1GFZA 3QBTA 1U98A 1WHTA 5LZ5A 4KRYA 3HV2A 1B42A 3NBYC 2HSDA 4Q12A 4WI1A 1V37A 3LH5A 4LBWA 4X64B 4BP8A 1K5HA 1JR3E 1TOAA 4JR1A 1NUQA 1C4KA 2GN1A 2OXEA 1QVVA 4RANA 2VWPA 5ECYA 2ZW9A 2PSSA 2ZZKA 3JYOA 1P9OA 1XDDA 2G25A 3UN1A 5K0FA 4FR5A 2O2CA 1QOZA 4RQTA 4HDQB 5HR5A 3NWPA 1GKUB 1ZVKA 2IYPA 2OQRA 2VUUA 2O9JA 1OF1A 2JAXA 5CA0F 1JDSA 2GTHA 4MV0A 1XTUA 3OP1A 1H4TA 3OIVA 1TVKB 1QGOA 1PFYA 3D6JA 3TSZA 3UK2A 2OLEA 5KQPA 2D74A 3KTAB 2QIOA 2ZR7A 3TIVA 2VQ3A 3WB1A 1DOZA 3EFEA 2DPYA 2VP3A 4BVFA 1OGJA 1SCUA 4JUBA 4NBNA 4CM7A 2HTFA 1CWUA 2HY7A 3H9CA 2IUUA 1S2OA 1GA4A 4RNDB 2CVZA 5CHYA 2IYEA 1ZDMA 4RLFA 5DBEX 2O05A 1GV1A 1QOPB 3W77A 3TLXA 2ABWA 4M9UA 4HAOA 3NEJA 3GK3A 2YKGA 2H57A 1PI3A 3IUYA 3NKLA 2IY7A 4RTJA 5HRUA 1RLJA 2EFCB 2HRCA 1N6HA 2IPXA 1VJCA 2OBLA 3FTCA 4PZYA 4TLBA 5TNXA 2RG1A 2ZJBA 4HAIA 3SVZA 2WZCA 3KKPA 5AJHA 1U8FO 3B7PA 3GLQA 1ZLYA 2B83A 1OFGA 1UK8A 2X14A 5IBCA 1DJPA 1L8OA 2BBWA 4KQ2A 3TO5A 4AQDA 5BPHA 3WLTA 3LDFA 5EJAA 4J1TC 3L0YA 3EPHA 1ZJJA 2JLWA 2AJCA 4YGXB 1TAHA 2FVYA 3OC0A 2PH5A 5ED0A 3GGGA 3U81A 3H9JA 1ENYA 3I72A 2JGFA 3WYEA 3T95A 3COYA 4AWXA 2XUFA 2WUEA 4UZSA 1DMSA 2DHRA 4GXRA 4RGVA 1LA2A 1RPNA 2JCVA 2DJIA 3THSA 2A78A 1FB5A 1NC1A 3DO5A 3IUBA 3IV7A 3REOA 5KZMB 5KTTA 1UQTA 2XUJA 5EL0A 4URHA 1SBIA 4CLOB 3OF2A 3S2SA 3TQTA 5K8CA 2FN8A 5COQA 2XR1A 5KBYA 1UZAA 1QV7A 2QX9A 3AR9A 5ALHA 3NXKA 4M9XA 1U7XA 1ZH4A 1W5SA 3M3PA 3KQSA 4O2BF 2FR8A 2VHWA 3O4GA 3EFOB 3I28A 4DCSA 3R7NA 1AKWA 3DOOA 4KX3A 5GJWC 2O2EA 5CA1B 3D8SA 4WK2B 4ZQIA 2K7FA 1Q1AA 1ZL2A 4B87A 3DMPA 2HDWA 4NAVA 4I3HA 5A2QA 3ZJTA 2F00A 2QGNA 2CEKA 1G21A 2EWVA 2YY5A 3AEKA 3GAMA 2V4MA 4LGYA 4EF5A 4GIBA 1QYWA 1WR8A 1IVYA 1X74A 1E69A 1GCUA 1KEZA 2CXXA 2VDJA 2XNCA 1FLDA 3MLAA 1IK6A 3M7IA 4IDBA 4TMYA 4UBLA 2Q1UA 3PUKA 4YS6A 3SLRA 5DP2A 3RFCA 4RTPA 2DSTA 4XEHA 5HIIA 2R751 1UJMA 4OYLA 3U3JA 5HTKA 4HL6A 4AYTA 3H2SA 4G5FA 3Q7PA 1CUIA 4IHKA 2GXAA 1Y1KE 3CH4B 3JPWA 1EYZA 4QBIA 1TI7A 2CYCA 2ZJ1A 1XZ8A 2IE8A 3OQBA 1VCIA 2GCNA 2Q2WA 3QVGA 5AKLA 1QO9A 3K35A 3A1SA 3R7DA 4G5SA 5FUWA 4EG0A 5KJCA 1FDVA 2W7TA 3FB1A 4R5MA 3UMMA 1HZZA 2C7BA 3HJNA 1MX1A 2PS1A 4JNKA 3L4KA 4ZJPA 4F5EA 3SOPA 3ENKA 2W6JA 3GGOA 2WEKA 3GR6A 4OQEA 4JBHA 4UBOA 4DQUA 3IJ5A 3HN2A 2IV2X 5M29A 3KZVA 3Q4GA 3T94A 3TRJA 5A05A 4TTAA 2EJWA 4PN7A 1SA0B 1Y1PA 2HQRA 1KKUA 3KTOA 1WEKA 4OFZA 3PENA 3TGWA 4HTFA 4ZCLA 5AW5A 4R4JA 2VT6A 4D02A 1JTEA 5ESDA 4WUTA 2NUTA 4DILA 5BV1A 5LA6A 4EJFA 4CNQA 3BH0A 3H1FA 4I55B 2VHZA 4ITRC 4WKGA 2V96A 3PITA 1DS6A 4EHDA 3BHMA 4XDZA 2CXSA 5HKOA 1N57A 3MAJA 4B3GA 5DU2A 5KTYA 2QQ0A 5CVVA 1YAJA 5A3RA 4OATA 1Z07A 2GBLA 3GWZA 3WSWA 4KWIA 3ZDQA 1VXRA 4BDTA 3BS4A 4J4TA 2ID4A 3VMFA 3LCVB 2G28A 1NQXA 1L4HA 4BNJA 3RYHA 1XKLA 2WNSA 1L5FA 2WLTA 2AFIA 4D0LB 2UXBB 2FA9A 1AY0A 3IR7A 4TXMA 2CZGA 3LPLA 1AK9A 5GOTA 2C94A 1RD4A 2FKNA 3MGCA 3EQ9A 3QOWA 3VZPA 4KQCA 4NJOA 5CT4A 2GEDA 4IDOA 4R1LA 3HBLA 5IN5A 3T5TA 1SM4A 4OMUA 4O2LA 4DM3A 4A5OA 4BE4A 5JQGF 3F3KA 3O8CA 1T3TA 1FSFA 3GJ0A 1HQCA 4RHYA 2V59A 5AHXA 2CGEA 1N4AA 1E1NA 5JAPA 3H3XA 4ZP1A 3D3JA 4K9SA 3ASYA 1NQWA 5E8RA 2YN0A 1QS0B 3NFRA 4N41A 3IX7A 1PFGA 3D4LA 1JEOA 2A35A 4UJ3A 3FRHA 1H3EA 1Q19A 3GFTA 3TYXA 4QM6A 2CVPA 2WAXA 4MGHA 1KPHA 2XMQA 3L6RA 2NVWA 1MAVA 4AL4A 1CBUA 1RT9A 2QNIA 3KLMX 2ZUUA 5DPMA 1WP4A 2FWRA 4JP1A 1QFYA 4ENUA 1H6CA 1GRCA 2O8DA 2ZYTX 2ZANA 3KVNA 4KI0A 3DMDA 1L8AA 2QAGC 2YHAA 3L8DA 3UCFA 3PQ5A 2VJDA 1ZM4A 4PAWA 1MJFA 4YRKA 2JGNA 2SNIE 1UFQA 3BIXA 4OYYA 1DEAA 2QT0A 4ZO9A 2ECKA 3SC3A 3R8FA 1U3UA 2PUWA 4P33A 4RMGA 3FIJA 4IVQA 4PNHA 4BBJA 1FQKA 2IK8A 1H1DA 4Y6GB 1RR6A 4KREA 1R4NB 3ZBUA 1IJBA 2RGEA 1DI0A 4FFSA 1JR6A 4LJ6A 4MUBA 1ZJ6A 1DDIA 2ZAYA 1JQLB 2ZJ8A 4YMVA 1U63A 4X1IA 3WQBA 3VPSA 2JC3A 1JLKA 1EVLA 4FGUA 2X0IA 4IMIB 3TL3A 4AZSA 2ECQA 1OLXB 3MWJA 4OLHA 5HQTA 2O8CA 2YWXA 3IGFA 2I2BA 4U2EA 3WL5A 4C0LA 2WD8A 2VA9A 1QMGA 1Z0UA 2B34A 1G5TA 4PY2A 521PA 2OUIA 1TKBA 3CCFA 2BFBA 2DWPA 1HLDA 1V39A 1FL9A 3GY0A 1J8FA 4RHTA 4DL9A 2IEAA 4FFMA 3STYA 4KR7A 1YVRA 2JFNA 4HH4A 1NOJA 3C5HA 4PPFA 2C2MA 1P1JA 4BB6A 1SZJG 3H8JA 2QGZA 1QWOA 3DNMA 2L2QA 4LE1A 3WA6A 3VDXA 3W7VA 1KAGA 2CDNA 4KO3S 4C01A 4PHGA 2DETA 4AKEA 2JK0A 4H17A 3S5UA 4B1FA 2AQ8A 4PG4A 1WY5A 4BTLA 3JWGA 4XWKA 3KQUA 2CJXA 2H4HA 2RIPA 1UBUS 2Y4OA 3SEAA 4BNDB 3JVIA 5AKYA 2CMDA 3F73A 3JV7A 3MC1A 3PFIA 4TTQA 3URMA 2Y6UA 1V43A 3F5QA 3OZGA 2LUOA 4YK7A 4EPYA 1Y8RA 5FA5A 5CCBA 5LMCA 1E0KA 1X9IA 1M2VA 5I5EA 3C4VA 2FSVA 1CX9B 3PDWA 4NARA 5U1PA 1M66A 1CDDA 3TQCA 5EWLA 3L07A 2BFCA 4QDXA 2HI0A 3SEFA 1GXSA 4LHZA 1SGWA 2ZU0C 1FFXB 3GEIA 3IEXA 2VF8A 3PTLA 4ZARA 1N9ZA 3VR6D 3TF5A 2YVAA 4F4IA 2GZ2A 1ORWA 4IOLA 5E1MA 4LRWA 1U9IC 3LPAA 1KJWA 1LQTA 4RFSA 4AZVA 1EK2A 5CDFE 2ECPA 2VPXA 2WDZA 1JG7A 4U1RA 3ZCTA 5CIYA 2OCGA 3BWCA 1IN1A 3JQRA 1NVEA 4KLCA 1T5DX 3OICA 4JGBA 5K0CA 1WIWA 4MUMA 3MJFA 1T9ZA 4TYYA 1CUZA 3I0ZA 4DWOA 1UUFA 3E7WA 3A9WA 1IHOA 3V7WA 4MZXA 3W7BA 4WA8A 3RSQA 2ZRBA 5JQGA 1E1QD 1X1BA 2UYGA 3FCAA 1O96A 1HG1A 2IX9A 5K8UA 4NPAA 2WILA 3P7MA 1F3LA 2JKZA 2IP2A 2IEZA 2J9RA 1RP7A 5E4FA 3BWVA 4MV6A 4JQOA 3FD8A 4KPGA 3LNCA 1PKEA 1U0TA 5DX1A 1RW4A 1Y7TA 4OPMA 5LCXA 5TMPA 5EIBC 1LLQA 1J56A 1NURA 1B76A 1GYQA 2A0YA 2FQWA 2PWYA 3O91A 3QVTA 1ZN2A 2DPXA 4HD8A 4OFWA 4WFQA 3SYNA 4RE5A 2UXDB 2I2DA 1MVLA 3ZHVA 1X9HA 3W2FA 4QOGA 3ZK7A 2HO4A 2ZFUA 4B81A 5CAEA 1L1QA 2Z8YA 4FYWA 3I32A 5DBFA 5EGNA 5AIBA 2WVJA 4X8LA 2FPXA 2P67A 1OJ7A 2H3HA 1QPZA 1TEHA 2QD5A 1HE4A 2BZGA 1MX5A 4OBEA 1O9HA 1J0BA 7ABPA 3VISA 2X9VA 3DFKA 3MQ2A 5EEHA 1NLFA 5LBTA 2FPIB 2UVQA 1CZLA 3DBVO 1US8B 2ZR0A 1L7BA 4JZYA 4TM8A 5EKDA 4KGXA 1YFJA 1QXSA 2B8NA 2B7CA 3DDSA 3W06A 4JBYA 4BMDA 4JBGA 3CF4G 4ZCTA 1EIZA 4XWOA 2O2DA 4YRCA 1J24A 4P83A 5KX5A 1J42A 4YACA 3RI3A 4OHRA 3PEEA 4BNWA 1Z0FA 4RC9A 1JSXA 2Q3CA 4G9GA 4Y1RB 5ALZA 3I73A 4KC0A 3FTEA 3AGQA 4IHAA 3N58A 2O52A 4IQGA 3HWX1 1RBMA 3BTOA 2R8YA 2YQZA 2ZXFA 1MOZA 1OUMA 2RAPA 4CMIA 3E9MA 5IANA 2WHQA 3M6LA 5ULLA 2F43B 4BVHA 4F93B 4P2GA 1C9JA 1VE3A 2C9MA 2P2SA 2W9XA 1ZA1A 2WJIA 1MX3A 1QO0A 1PL6A 2DM6A 3M4YA 4NV0A 4QXPA 3WDMA 2LBPA 4PYJA 3KAPA 5H81A 1ZN7A 3BBLA 1XZGA 1QIIA 3CH6A 3R0JA 5KQSA 2IXFA 2D5CA 2XVYA 5JMPA 2AF4C 4L73A 3V7YA 1YQQA 4UUPA 4XR9A 5I7AA 3JARB 3WRYC 3OJOA 4B7ZA 4GP9A 3AHGA 3MT7A 5LUBA 3OTHA 5F1OA 1B23P 2QNBA 2GM3A 3M1YA 3CLHA 2IA5A 4ZMSA 5KAMA 4OHUA 1ZGJA 5K3SA 3AKZA 3NHRA 4K03A 2C2GA 1GZDA 4L9WA 1CSEE 4V02A 4BFXA 1V7CA 3ZY3A 2XODA 4M1SA 3GARA 4P3KA 2HFJA 5KSYA 2Y1FA 1E2HA 3MS4A 1QCDA 4P0QB 3D4NA 1U4SA 4KLZA 4DEYA 1I0ZA 3PXUA 5ICGA 5HM8A 3VHXA 2EW8A 2D0OB 3BREA 4WSOA 1QQBA 2HMWA 5ALWA 4EI9A 4DA7A 1O54A 2JLXA 5FHRA 2UZ0A 3T0IA 3A6PC 4B0PA 4I4LA 5JS2A 2ZE5A 3GC6A 4ND6A 4Q4HB 5BR1A 4N76A 1GL6A 1EGHA 1CJBA 1RAIA 5C5EA 2VJPA 3QE0A 4ZVTA 3M6AA 1U8TA 2YWBA 4D81A 2GNAA 2JHFA 4UVDA 5F7OA 3DE1X 4M0DA 3B6KA 5JD3A 3L77A 2ANBA 4KQFA 4R5HA 4B7XA 4D3ZA 1JVBA 2GJKA 2BMVA 3H84A 3JAMA 4YCDA 1SC9A 3H5NA 2HWYA 3RIEA 4MQ4A 3S1LA 2ZT7A 4MPDA 1ZH2A 3T3PB 4A8PA 2J30A 3P9YA 1GG2A 2AJ8A 4FT2A 4LTMA 3KQWA 1XF9A 4P9NA 2OZLA 3RK1A 3KUCA 1T2UA 1YRYE 2RH5A 1TMOA 2O0LA 1DIAA 1U8XX 2YRWA 3W5DA 3LDUA 2AOVA 1NA5A 2IEBA 4GLOA 1N75A 1P5HA 2I54A 2NU6A 3LWBA 4WOBA 4MS1A 1VBMA 3V2HA 4CKEA 1E5TA 4LCJA 4BEBA 4H7EA 4ZK2A 4LNUA 4YIKA 3JQPA 4TWBA 3ZNOA 2DFVA 4D74A 2Q3LA 2VJYA 3HKCA 4QLBA 3WAJA 4QGSA 2PMFA 2ZBVA 4ZAWA 2G77B 2G63A 4JLKA 2UYOA 3T1OA 4C3OB 1R4MB 4YEDA 3RS7A 5AFSA 5CFRA 4GKJB 2PT5A 1EI9A 1XRLA 1RPAA 1RIIA 4BB0A 3BD8A 1BDIA 3KAQA 4FBLA 2WIGA 3T41A 2GEVA 3MMNA 3WLMA 2QRUA 4XGQA 5KOHB 4EUHA 1P77A 1X7HA 4JUCA 2C4MA 1LJLA 3SQLA 1PWYE 5DDIP 3DHVA 1OI4A 2BKVA 4HRYA 4GM1A 5T4HA 3WYCA 3G8CA 3KUXA 3DWIA 1FEZA 2FZ4A 1D4ZA 5FBLB 3QUQA 5T6BA 4DA9A 2QRMA 2VQDA 3G0BA 3D43A 3T5CA 4C2BA 5IKPA 3NHFA 1SCKA 3B6MA 1D4FA 1MAUA 3BH6A 1Z0IA 4BQRA 4YMLA 1RRCA 2CV2A 2Q2VA 1JB1A 4I1YA 1JNXX 3RSLA 2X5KO 1W76A 3D0QA 4L78A 3X2SA 5JCPA 5DLPA 1NM5A 2JJQA 3H1TA 3ZYCA 2E6UX 1U99A 3IKLA 3UFXA 4DXDA 3D59A 1MB3A 4L28A 1EUCB 3JAKA 1SOUA 1U02A 3NX4A 1KTIA 3AZPA 4Z3KA 1QYVA 3R23A 3IQDB 3B48A 4C2AA 1RHMA 5AW7A 3NTQA 4AX4A 5CTJA 1KK0A 1PUXA 2E55A 2QXUA 3Q5DA 1KDZA 5FBZA 4FYVA 5JISA 3CVXA 2IU6A 5GY7A 3DVLA 4H1UA 4L0CA 4FFVA 4XVCA 1JE0A 1WQ4A 3A2LA 4QDOA 7YASA 1NQTA 4YONB 1V2GA 3CA8A 1UJ5A 1ZH6A 5BMVA 3ME5A 4FE3A 4Z4HA 5B6IA 2B1GA 2FFAA 1QAQA 1GT6A 5JAIA 2QG4A 1R0ZA 1C1YA 3OPYA 1FRNA 4BMCA 3NU1A 3WOVA 2Y0BA 3O9MA 5JMWA 4X71A 1OBCA 1RI4A 2BR5A 1HF3A 4PAOA 1E9AA 2YUTA 3AH8A 1W88B 2NZXA 4MWCA 3D6TB 4ZVVA 3HJBA 2HO5A 2QTWB 3L3BA 4HDKB 2ZJ5A 4M7PA 5KYUB 1BMTA 3SICE 3Q8LA 4HUTA 1G8FA 2ATXA 4E7PA 4TN5A 3R5XA 5C3MA 2P11A 3DF9A 4RTSA 1NBMD 5FPYA 3DTVA 3NS7A 4G0WA 2Q8PA 4HOYA 2CHFA 4K1LA 4Z9BA 3RTDA 4AZWA 2NYVA 4DNOA 3E4CA 1W0KA 3E27A 2OAP1 4BMSA 3HEMA 3ICPA 3AUUA 1HRKA 2AOUB 3QVXA 1M2NA 1Z6ZA 2JLCA 1R9GA 3KTFA 4N0QA 4P3NA 5F76A 4EFMA 5A4KA 4QVKA 3E7XA 1SIWA 5D00A 2P9BA 1EP1B 1VJTA 1CV2A 1PT6A 5GINE 4A8JB 4ZOBA 1LW7A 4X3PA 1G18A 3AU8A 2P8JA 1DVRA 4I4IA 2J1LA 3C3BA 4NEHB 2AN9A 2FX2A 2E37A 2H1SA 1DG3A 5E0OA 4XYLA 5LIPA 5F3WB 2FJPA 4AKIA 5JQWA 1BRTA 3WGLA 3I64A 3MB5A 1G2IA 2C2HA 1IUPA 1RYZA 2Y1CA 4X66B 1VJRA 2J3HA 4KIFA 4TZKA 4BLPA 2CCKA 2VQEB 1Z6YA 2QD4A 3C6YA 4BLSA 3WBFA 3CNEA 4R2HA 2CVQA 4ALKA 1FW8A 3GRYA 1J22A 3KQYA 3TGLA 1XTJA 2VTBB 5JZVA 1UXOA 4YXWA 4ZT6A 3VX4A 4M0PA 4KIWA 4DUZB 1A5BB 2A5GA 1Z5VA 2BUCA 4XGKA 5LP6A 1QIKA 4BZXA 2XIJA 2LIVA 1NYTA 2ZYGA 4HVAA 2IU0A 4E3WA 2WE8A 4PC7A 4TZ0A 1XFAA 5TX7A 1C1DB 1SC6A 2PVCA 3EB9A 4IQ8A 4EPRA 4XQ9A 4DR2B 3P4YA 4Z7NB 1E92A 4LZOA 3QBDA 1XJWA 4NK5A 1Z26A 1L1EA 2F9MA 3CRVA 3D5QA 3K94A 2C20A 4EI2A 1FRZA 3BERA 4ZIRA 1NZJA 2O7QA 3UJ6A 3P0RA 4NEQA 4DHEA 2HIAA 1EWRA 1N6RA 3TLAA 5IVKA 2OAEA 3BE8A 4D9EA 1RABA 1DBSA 2GD6A 3LLCA 1W52X 2HLDD 4XASA 4H3KB 1GDDA 3B6JA 3KOWA 3O75A 3EXFB 3PF8A 4FQ7A 3I2HA 1P6XA 3PFGA 4QNNA 4XIGS 5EQTA 3SMVA 3B5JA 4IIDA 5TQJA 3TOXA 2H63A 1EDDA 1T6BY 1KRXA 3DZCA 1X1CA 4KUGA 2G6TA 5AOBA 1FA9A 1RKXA 3PTZA 4Q34A 5ERYA 5CXQA 2AE2A 5AJTA 3QLJA 2ODPA 4U3JB 3HGQA 3ZIDA 3KVRA 1ORDA 3TPCA 3TKAA 2BY4A 4NOLA 4H08A 4D26A 5HJ5A 5TXGA 2QRZA 2NPOA 4IVNA 4S05A 3IKTA 3R76A 5I8PA 3HUFA 3CG4A 1AZTA 1H8ED 4YFYA 1DZIA 2W37A 3TIFA 4CG0A 4ZEWA 4DB4A 3OIFA 2ZRFA 2YDXA 5GIPE 9ATCA 1W5AA 4UQPA 4YR7A 1BOOA 5EY5B 2XEDA 2J4DA 3AP3A 4MGKR 3LWDA 1SH7A 1N2CB 2BZSA 3OJWA 4FMBB 3AIIA 4OYRA 3ZD8A 2F43A 3ONWA 2PUVA 3PQ8A 4TWAA 3AR3A 3HDTA 2JEOA 3TQOA 3ZZNA 5BWNA 3LXXA 4HEHA 1AS0A 2Q4TA 5B53A 2XNSA 3WLQA 5ICMA 1CG6A 2KJQA 3LRTA 2DUJA 4F9FA 1L4UA 4YP9A 2UYHA 3EH1A 4F4FA 1UBNA 1I7QB 1FTYA 2WHEA 4PIVA 1JX6A 2IF0A 2P6PA 5TQVA 4IGIA 4CXMA 3FPFA 2XOKA 3H1EA 3JARA 3LZ6A 4G8DA 4XGIA 4C14A 5AM3A 2QPAA 4NFYA 4HCJA 4GSKA 3IUNA 4YJHB 1KF0A 1KNXA 4ZPXA 4JENA 3SHOA 3SG0A 4BVLA 1C41A 2XQFA 2BJVA 4HWGA 1IDOA 1RBYA 3PG5A 1LLUA 1H93A 1RMYA 4K9LA 2QTHA 1O1YA 5F2NA 1UP4A 2WWXA 4JOSA 1IHUA 1VZ3A 2VZ9A 1EDOA 3GT7A 4H16A 4R31A 4ZGGA 7MHTA 1E9VA 3HK2A 5AXCA 1MNQA 1ZK4A 2HIGA 2OQ2A 2WSSD 1NT4A 3ORQA 4P93A 3F7TA 3FOFC 3NONA 2XTZA 1ZBDA 1N5LA 2ZIZA 5I3CA 5IU6A 1LWNA 3RAPR 1B6RA 2X1MA 4TRJA 4DXAA 1NOKA 2WJZB 2JLUA 4PV7A 4ERXA 2JBAB 1R6UA 2JFXA 3KVOA 1ODFA 3ZTTA 1Q3KA 2BWJA 3RRFA 2PKWA 4EW6A 1EG2A 2WOOA 4O29A 1UDAA 1XRNA 4HQFA 1SBTA 5EZSA 4XJVA 1DDOA 2I55A 3IAUA 4GOND