3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
molecule keywords Recombination and repair protein
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
3JVUA 1RIFA 4N3NA 1E9SA 4Q4HA 3U4QB 4A0RA 1XEXB 1G4AE 4PXAA 4KV9A 3KQHA 2RCNA 4NYMQ 1R7RA 1WB9A 5JFGA 2EFEB 1ZIPA 2D62A 2ZJ5A 2WWHA 4R9UC 2X2FA 5JI3E 3AVYA 3ZGXA 4FN5A 2Z83A 1CLUA 2YWGA 4OL0A 1X8LA 1VG8A 3CX8A 3ZJYA 2NTYC 3KFVA 3VKHA 3BH7A 3VNUA 1KDPA 3AV0B 2ZJOA 4UJ3A 5DN6D 3TQCA 3W90A 2XTZA 2R65A 3DL0A 2RMKA 4N0EA 3GJ8A 3QPWA 1EFCA 3VU9A 1L7VC 1N6KA 2PX0A 3W6NA 1SXJB 3QVUA 5IDVA 1QHYA 4PX9A 2VSXA 4L16A 5M04A 4U00A 1AQUA 2OCYC 3ZZ0A 4BLRA 3QG5A 5G3YA 2IS4A 3GJ3A 1YZGA 4B32A 2ANCA 2ZEJA 3DZ8A 4TL6A 4EFNA 2IHYA 3VKGA 2WWFA 1XTKA 4N1AA 1DG1G 1G291 3AF1A 1L2TA 3AGPA 1CIPA 1E2GA 4MUBA 4QGAA 3RSOA 2BKUA 1HYQA 4C4PA 4CF7A 3REFA 1PJRA 5AJVB 1LY1A 1XDBA 4IEIA 1UEIA 1II8A 2GBLC 2WPDA 3TW8B 3O8CA 1AS3A 2YHSA 2ZRCA 2MSEB 4A92A 1ZC4A 2WPDD 4M1TA 2V1XA 1G3RA 2XSZA 3K0FA 3CWQA 2NGRA 2P5SA 2QQEA 2OCBA 3TW4A 4MRNA 1Z0JA 2GXUA 3NBFA 5JJLA 4F91B 4O25A 2VHQA 3BORA 2REBA 4ACBA 3CRRA 4B75A 5C1BA 2X77A 2ONKA 1NLZA 2ZR9A 1L4YA 5L3QA 2GWHA 3FHCB 1KHTA 1R5BA 2W58A 3GMTA 2G9NA 1KMHB 2NO9A 1KOFA 4E5UA 4A8JC 5GJBA 1S3SA 1ZAKA 5JJIA 1TQ2A 3QNUA 3WMEA 4BECA 1EWQA 2CHQA 4FCWA 4F93B 4MYCA 1QHHA 2V54A 2VBCA 1E9EA 3PUWA 4NYJR 1DARA 2BV3A 1E0SA 2ECKA 3CBQA 3KKNA 2F1RA 2IYQA 2G1KA 4Q00A 4S2EA 2W0MA 3U3JA 1OT3A 3LRPA 4FXPA 4OI0A 2BWJA 2QORA 1BH2A 4HB4A 4D25A 3GFPA 4NCKA 5DO9A 3CPEA 3U2QA 1SULA 2VF8A 1RYFA 1VDZA 4LPKA 4P31A 2F43A 4KBFA 1GNRA 4GFDA 3EARA 4UNSA 1YJ5A 3WNDA 1KO5A 1JR6A 1G18A 3VX4A 1TADA 2ZI3A 2JJ8A 4U7DA 2KJQA 3ZVMA 2NMVA 2B8TA 2KE5A 2FGJA 1GKYA 1KY3A 5EE0A 3X1YA 4D4MA 2V4ZA 2FDCA 3ADDA 2XX3A 1A5TA 3KJHA 4CYMA 4DIEA 5BWMA 2J0QA 2F6RA 1Y63A 1FP6A 4D80A 4XJXA 3DOFA 3EAQA 3THXB 4EPRA 1W1WA 2FEMA 3CF2A 2HLDD 3PFIA 4KI0A 1CU1A 1XD8A 1LVGA 2NO0A 3CNLA 3CZPA 1OH5A 1LW7A 2GA8A 1IXZA 5KYKA 3LLUA 1EFHA 2R9VA 4MRVA 2H7VA 4IFEA 1US8A 3SZRA 1HY3A 5FUYA 3VAAA 2WJJA 2F7SA 3KB2A 1NIPA 4H1UA 4ZCIA 2WJGA 1EGAA 2OFXA 3T5GA 3UWOA 3V4FA 4HYYA 4QKQA 1FX0B 2C5LA 2GCOB 2ZS9A 3K1JA 1IN5A 4OHYA 2REOA 2WSSD 1ZD9A 4IEEA 1UBFA 2ZUCA 4LHXA 5FL7D 1HT2E 3CX7A 4WZBE 2Q9CA 3SYLA 3TSWA 1NVWQ 2HYDA 3PENA 2WAXA 4BFVA 5GADl 3K9HA 2WHXA 3AUXA 5ANRB 3UATA 1MABA 2QRNA 2EU8A 2CBZA 4QBHA 2BBOA 5JZVA 1MO3A 5AJYA 4TSFA 4JVMA 1ZD1A 4V0LA 1VG9B 4XH9B 2ZRJA 4FMDB 3U60B 1ZNYA 3C4JA 1DVRA 2J59A 3WP0A 2QBYA 3NWJA 4B3FX 1CR0A 4Q1EA 4QOSA 3I3SR 4TLEA 2BC9A 4Q1FA 4G1UC 1U81A 2J45A 4IVPA 2H57A 1KMQA 4PC2A 3GQBA 2O8EB 2BBSA 1QHGA 1ZW6A 4QHSA 2XNDD 4D81A 1U8AA 1QHHB 4YDHB 4AY2A 2OEPA 1WE2A 2GK6A 3GLHA 1KK2A 3LNCA 3QY0A 2QT0A 2C78A 1KZ7B 1Z22A 5AWFC 1ZYUA 1E2FA 1MT0A 3QE0A 3MJRA 1XXHB 4ZI2A 1E2PA 2ZREA 3RANA 4D4KA 3RAPR 1D5CA 2C77A 2FZLA 3A1SA 3MSXA 3BAFA 2JASA 1N0UA 1TAGA 4JT2A 5FOWA 1NKTA 2HV8A 5C18A 4LV6A 2N46A 3AKCA 2D7CA 3AUYA 3SJBA 2QZ4A 2Q9AA 4CZ2A 3AH8A 4LBYA 3HU1A 1XB2A 1DE0A 3GJ0A 3KJEA 2XZLA 1E1RD 2ZUDA 1TF2A 2QMOA 2OCAA 2PJZA 4LOAA 5D3QA 1ZBDA 1W2HA 4CW7A 4C2UA 1GOTA 5AJWA 1N5JA 5DISB 3ZIAD 5DHFA 3AQ4A 1Z8FA 3RWOA 2WTUA 3I8XA 4UNQA 1NN0A 2V3CC 3QXCA 4UKDA 4ERNA 4JSTA 1S4QA 1EG7A 4UJ5A 5CDFE 1P2VA 4FMDF 4DDUA 2FSFA 1E3MA 2FN4A 4EAQA 1RRGA 4Z54A 1X1SA 4KFTA 3SEAA 821PA 5JRJA 1RE0A 3OFND 2YJTD 5CYOA 1XPRA 1CXZA 3THOA 2DFTA 1U9IA 5GJCA 3PUXA 3A4NA 3OE7D 1KAOA 4P0TA 5UKDA 3MLEA 5FTNA 2RGNA 1E9RA 1R0YA 4A0HA 4OHZA 1NVVR 4DXAA 2SHKA 3B1VA 5AUNB 4Z1MA 1SXJE 5AJXA 4EIWA 3SN6A 1NG9A 4LYAA 3QPUA 4P4UA 1I2DA 4Q4JB 5BN3A 1I4LD 3IBYA 2CHGA 1S1MA 3HDTA 3B85A 1F3OA 4KXFB 4DEYA 2IS6A 4RD4A 1OKKA 3EC1A 4M1MA 2YZ2A 1JR3E 3QIAA 2ZJAA 4TT3D 1KI9A 1ZD8A 4PHTA 2ZRPA 5L8VA 5IK2D 1U0LA 1XTSA 1W46A 4PPQA 3RS7A 4LJ5A 2JGNA 1FQJA 1C9KA 2ZSFA 3I92A 4LJ9A 4MQBA 1F2UB 1T3HA 4F7WA 4WOPA 1FZQA 1WQ1R 4BASA 2AKYA 4QJ3A 1B0UA 2HUPA 2WSSA 1OPXA 3RRMA 2CCKA 4DLYA 4KBGA 3DVLA 1OW3B 3LA6A 4TTPA 4C0HA 2QRZA 1IN7A 4F4JA 5DNYB 3IEVA 4Q9LA 1E2IA 1YE8A 1H8ED 4ZCLA 2JDIA 3HR8A 4NYIQ 3B1XA 3GJ7A 3W5JA 2R44A 1H65A 2CJWA 2HJGA 1DAHA 5KTYA 2NZJA 3P4XA 3TRFA 2ZI6A 3B7GA 4JLNA 5EP3A 1XJCA 2PH1A 3GP8A 2ZITA 1ELOA 1XPOA 2FH5B 2HJVA 2FNAA 4NDZA 1KNXA 5DYIA 1T5LA 2QSYA 4OK3A 5LD2C 1NKSA 1CJUC 3Q72A 2JLWA 1OXSC 3EPKA 4D4JA 4XWAA 3BGWA 2ZS8A 1YZUA 1E1QA 2WWXA 2HT6A 4LJ4A 3K0SA 4RSGA 1L4UA 4FMCB 4PQRA 3FMFA 1P73A 5EXPA 1AA9A 3UWKA 5L3SA 5KPJA 3TAHA 4GDFA 2KWIA 3RRYA 3KZ1E 2YKGA 3RS2A 1R8SA 1WCV1 4O2LA 4I1SA 5FUVA 3SS8A 1MKYA 4ZCMA 2HEIA 2O8BA 1N6NA 1KTVA 1XPUA 4XWOA 4FMCF 1W36D 3D6TB 3ADCA 4MKGA 3GLFE 1YU9A 5TDHA 1A2KC 3CRW1 3I4LA 4FCVA 4E07A 1NVVQ 2CXXA 5B57C 1TUIA 2DR3A 2QP3A 3AF2A 2FFBA 2ZRNA 1LNZA 2F9MA 3U7FB 3B8HA 4WIAA 5EZ5A 4LRWA 2VTKA 4K46A 2IF0A 4ZIRA 1OF1A 1EFRD 2W83A 3GLHE 2PEYA 2JLXA 4RD3A 3EC2A 3ZZTA 1XFAA 3Q7PA 2QM7A 4US0R 3LDAA 3N70A 2W0SA 4QBGB 4XD7D 4PHFA 1Z0KA 2OESA 4PZLA 4MGIR 1GP2A 3A8TA 4A0FA 1D8TA 2YC2C 4RFSB 3OE7A 4P4TA 5CK4A 5J4KA 2AD5A 4PPGA 1XXHE 2VSFA 3DOEA 4QNMA 2IYRA 2WKRA 1J8MF 3EZ6A 4MGYR 4EJSB 4G5GA 5GVSA 1G20E 2A5GA 5EZ6B 3IDQA 4CEIB 3K0AB 4CVNA 3CF0A 4LYFA 4RY2A 4OI1A 4HB0A 1J90A 5FI1B 4V0ME 5GJVC 1GKUB 4Q19A 1Q57A 2NZ8A 3NBZC 5E7JA 2GZHA 2UZIR 2Z43A 4TMVA 2ZJ2A 4NKRA 1PUJA 1KJZA 1A4RA 3T12A 4M0LA 2WIBA 3EW9A 3WRXC 1OYWA 2J87A 1KSGA 3VR2A 3EPJA 1IY1A 4BZQA 3NC0C 1GRRA 2V6JA 4MYHA 1IQPA 1RC8A 4D0GA 1WP9A 5TVKA 1TMKA 3FMPB 3RS3A 4PAMA 1E0KA 4HLDA 4QL3A 1ZNZA 2D2FA 3W8NA 2NPIA 3IQWA 4CEIA 4C7OA 1S1CA 3SBEA 4ASUD 5C46F 4Q1CA 4A0GA 4KVGA 2ZAMA 1JXOA 4B3BA 1UPTA 2ZPTX 2FPMA 4YQFA 1F5NA 4GBMA 5SZIA 1FUUA 4IFBA 4KAXA 4ACAA 1TF7A 3WBKA 1R10A 2Z0MA 2JLSA 3LXRA 2VP2A 3MCAA 4C0KA 2R62A 3C8UA 4HAZA 2BMJA 2OBNA 4CEJA 3CH4B 1DPFA 2DFLA 3AF3A 1AK2A 1FP7A 4DUGA 2BVNA 5FTJA 4GZLA 3THWB 4HZUB 3B78A 2FFHA 3DM5A 3NBXX 1TUEA 4URXR 3T15A 4BGDA 4C0AC 3SQWA 4JVSB 4JL6A 5CIWA 1OXVA 1XJ0A 3JVVA 4G5QA 621PA 2WIAA 3QPVA 2QI9C 4RD1A 5BXQC 2JA1A 3K0CC 1SVIA 2ZRDA 3A4LA 2G77B 2B21A 3K09A 4BPBA 4L5BA 5JEEA 4WA7A 4HAUA 3P4YA 1ESNA 3A37A 2ZAOA 3ICQB 2P3SA 1WMSA 4DZZA 3JZMA 1T3LA 1P75A 2OHFA 2VHCA 2O8FB 4Q9IA 3K9GA 4WZAE 1VCMA 2WKQA 5KSPA 1A82A 1K5DA 1P60A 4LYHA 1GL6A 5AUOB 4JS0A 2QBYB 1Q1QA 2VP9A 5KDDA 3TQFA 1ZJ6A 3U3OA 1VYUA 4G5SA 3R8CA 3ICEA 1Z0FA 4PR0A 2KBFA 1CTQA 3Q9LA 4JBYA 4RZ3A 1OH8A 2IX3A 1DAFA 1CBUA 1TU4A 3CWZA 3VMFA 3EXAA 2R6AA 1JR3D 5FOSA 4EJSA 3GLGA 1FNMA 3BS4A 3CNOA 3P26A 4NCNA 4R2HA 3BK7A 2EFCB 4JLPA 1CR2A 1LF5A 2LKCA 3PEWA 1NMZA 5DIFA 3QKSB 1G4UR 3OEHA 4LY6A 5CJ2A 1SQ5A 4ZDKA 4F92B 4XVRA 2PCJA 3ZD7A 1KI8A 5FBQB 4QM6A 4AYTA 4HUQB 2GCPA 2WV9A 4XSHA 2ZYUX 4PFSA 3RS0A 2OLJA 4URWR 4FD2A 1XX6A 4DLWA 1QBKC 1I4DD 3K9LA 3OIYA 4IKEA 1E9DA 1OFUX 4GPTA 2GVDC 3T34A 3RNLA 1US8B 5KNCA 4TTRA 1SXJA 1GSIA 3RVBA 1A1VA 3F5FA 2JJ1D 4JT4A 1G17A 4OQXA 4V0KA 4ZPXA 3NG1A 1OFTA 4PC7A 2JIZD 1FX0A 2VLIA 1KI6B 4LCBA 4D0NA 3QJYA 4HZIA 3EIHA 4B43A 1Z6AA 2QPAA 2ZRIA 2GDJA 2VYFA 1Z06A 4JBWA 5JEDA 2A7QA 4UXJA 4ITRC 4TYYA 4IRUB 1C1YA 2RGNC 2QGNA 3IGFA 4NHOA 3NDBB 2HCJB 5H70A 4I99A 4YMTA 5HZHA 1KSFX 1NSFA 1UEJA 1G21E 4I81A 4LDJA 4XTCS 1ZIOA 1L8QA 2BOVA 2ODEA 4TYWA 5FOTA 3OFNA 3OZXA 3O8DA 2ERXA 3KQLA 2F1IA 3WBJA 1N0VC 4ON9A 4W9MC 1YR6A 2CLCX 4A8JA 1NN1A 2ZQ5A 5J4YA 4Z8YA 5HKKD 5SZJA 1W4AA 4JLAA 4TLBA 5DYGA 3D7MA 4BFYA 1AGPA 4F38A 1J70A 1U8YA 4IW3B 4DCTA 2FEOA 3EPHA 5JRZA 2IUSA 4JJZA 4PSKA 3UXMA 2GEVA 3FMIA 5SZHB 4HDOB 3D3QA 1G3MA 1N3BA 3HU3A 2VQSA 2H16A 3EPLA 3CIOA 121PA 2AL7A 2IK8A 3KJIA 3I61A 3ZVNA 3QI2A 3NDPA 4JSYA 5JLJA 1QZXA 2FOLA 3NEJA 4ESHA 4GNKA 1KK3A 1CF4A 3TK1A 1Q1ZA 5E95A 4Q01A 2QPTA 2BM1A 3VR3A 4DKXA 2GBLA 1FPMA 3TNFA 1R0ZA 4RZUA 1BMFA 2EFDB 2IYXA 2ZSAA 1K6MA 2ZE7A 2XZPA 1GITA 1COWD 1MO4A 4DCNA 4P33A 1EFTA 1BOFA 4L9WA 4DLSA 1NIJA 2JIZA 2YOHA 5JWOA 3L0OA 2W2TA 2J9RA 3NH6A 4OQNA 2ZE5A 4URYR 3FYHA 3T5DA 2JCSA 2R6DA 3C5HA 4DDVA 2R6FA 1NLYA 1PLLA 3TVDA 3TR0A 3IHWA 4BZPA 3GCGA 4YONB 4ZIRB 1DS6A 2EYQA 1KAGA 2YC4C 3DMNA 3LY5A 4MGZR 4Q9KA 3WHKA 2CJWB 3ADBA 1GDDA 1D2NA 1XU4A 4M9QA 5FPHA 2MMCA 3UMFA 4W5WA 3I5YA 4HZUA 5B2ZA 1HE8B 1M6NA 1PUIA 2KSQA 3OEHD 3ZLJA 4C0SA 2B7CA 2HXSA 3AVUA 2IF2A 3CRQA 4HAWA 2PEZA 1F6BA 2C9YA 4Q9HA 1KZGB 3NBYC 4JZKA 4CEHB 1GKIA 1XEWY 3B1ZA 3H86A 3DPUA 4B71A 3KKMA 3WNBA 1OSNA 4UXIA 5JECA 3MJHA 3X1DA 2ZSDA 1GFIA 2FWRA 5BQ5A 3CONA 4M1OA 3S1AA 3VKWA 2ORIA 4W7SA 1M2OB 2GXSA 3M1IA 4FWIB 4LJ8A 4B73A 4M8NE 2V8OA 2ZRMA 1Z6YA 4Y0VA 3U3MA 1HTWA 3BH0A 1YZKA 5EE1A 4M22A 4RFVA 2CL6X 5KU1A 1KI4A 1SVKA 5L3VA 3WYGA 4HAYA 4KU4A 1OIVA 2XB4A 3C15C 1SXJC 2ONJA 2HLDA 1QVRA 3R9XA 2J0VA 1AIPA 1D2EA 2WKPA 2PX3A 3RC3A 1DAMA 3DO6A 2XAUA 4KFUA 4HDQB 3SHFA 4AWXA 3CB4A 2VP5A 1IN8A 2D74A 1QVAA 2JLZA 1JQLB 2BHRA 2QNRA 4PO1A 1IN4A 5EXSA 1E2KA 4OKSA 4V0MA 1EFUA 1XCPA 3S1AB 1TEVA 4NP6A 4I1UA 2KBEA 3VHXA 4B6EA 4KODA 4ESVA 5FBLB 3CR8A 3I32A 4Q21A 1BIFA 2ZROA 4JIMA 4UQOA 1S2MA 2ATVA 4RCYA 3RHFA 1KO1A 2O8EA 2G83A 4J0QA 4D4LA 5JWRA 4IVRA 4OI2A 3VR5A 3U7HB 3FB4A 2OAP1 2CNWD 5EXXA 3TKLA 4CDGA 5KDOA 1OYYA 4JLBA 2PMDA 2AWNA 2MSDB 1OE0A 3Q3JB 4Z8XA 1IAQA 1PVOA 4EPXA 2C9OA 4JKIA 1V43A 4DLUA 3T35A 1Z6GA 4LHWA 1NNEA 1JNYA 4POAA 5FBRB 2RGCA 1AS2A 3G5UA 5GJWC 1JPJA 4TLDA 2ZETA 3LV8A 4XWKA 1X1RA 1KK1A 2BEJA 2GKSA 4B33A 1HT1E 3WXMA 1KNQA 1Q21A 4IDHA 1W5TA 3T1QA 1U0JA 3EZFA 3WMFA 3EZ7A 3X1WA 3E2IA 5CIQA 3U3KA 2ZYTX 3MUFA 2O0KA 1G3UA 1SHKA 4URVR 2AWOA 2OZEA 2QE7D 4IHQA 1E9FA 2QTVB 2J0UA 5FTLA 2IXEA 4L4UA 3F3YA 4X8MA 1X3SA 2GZAA 4ILEA 2YWEA 2RGAA 2RAPA 2ZI5A 1TEXA 3CR7A 1G8YA 2QMUA 1NN5A 5E7MA 5EP4A 2KB0A 1Z47A 4CEJB 4KLNA 1G1MA 2XSZD 1XEFA 1KO4A 1G7RA 1S0UA 1XCMA 4ASUA 3K53A 1Z3IX 1RRFA 1N6PA 1KSJA 4A4DA 3SQXA 1E99A 1N2CE 1W49A 5G40A 5KNDA 3Q8XB 4IOLA 2YVUA 3ADKA 4DDTA 2Q3MA 1DO2A 2ZVQX 4M9XA 2R6GA 3K70B 1VG0B 1RKBA 3BD9A 4UNPA 2AXNA 3EIEA 3V00A 2FGKA 1XEXA 3LLMA 2OLKA 3W9YA 4R2IA 5F3WB 2WSMA 1UAAA 2A3RA 3GLHB 4DRZA 3SHWA 6Q21A 1G8GA 1W4BA 2ZRBA 4LK2A 4PC3A 1G3IA 2QMEA 1NJFA 2YNMA 2DY1A 3SBDA 1NN3A 3AVOA 3SYNA 5JCPA 1BKDR 3MD0A 1B23P 1XZQA 2AFIE 4TLCA 3AM1A 3KL4A 3VR1A 3CZQA 4HLQB 3AVVA 1Z0IA 2FFQA 1MRSA 4TYNA 4YXWD 1DOAA 5BYKA 5G53C 3ASZA 3K70C 1M8PA 1TQ4A 1G41A 3FFBA 1T91A 2EW1A 2ZJ8A 1FNNA 3G0HA 2ZJBA 1JAIA 2JEOA 3WNCA 2VPPA 1NBMA 1KO7A 4JYCA 1DO0A 1TTTA 3N2IA 2PL3A 1IONA 4D82A 4OJQA 1T5IA 3LBHA 2PBRA 4NPHA 4HEJA 1EXMA 3W6OA 3GJ6A 1W36C 1H8HA 1W44A 3IILA 4TL9A 4EDHA 3SE0A 1CJKC 2BMFA 3UG6A 1SVMA 4BFZA 3RABA 2XGJA 1CRQA 3X2SA 3QBTA 3Q5DA 2BIFA 3RWMB 4ZKEA 4MKFA 1H8EA 2QAGC 2ZYVX 3CRMA 4I1OA 2A78A 2A5JA 3K09C 4X8LA 3QF4A 1JEEA 2CHVA 5J5CA 3K0AA 2GEUA 4GI7A 1ZRHA 4JVLA 4A2PA 2VL7A 5EP2A 3OEEA 4LGMA 2P6UA 5CDFA 4LPSA 3GEEA 2XTNA 4DSOA 1G7TA 4BFUA 1HQYE 1W0JD 2DWOA 5FOUA 3I5XA 1JB1A 4BLTA 1G16A 2LCFA 4GSYA 4JMPA 3THYB 1JALA 4Q4JA 1U99A 4Q7LA 1KGDA 1P9WA 4HI0E 4JLOA 4V0OA 2IYTA 3P20A 2QPOA 1OH7A 2GHIA 2X19A 2BEKA 4WXRA 4PO9A 5A5GA 3SI7A 1Z63A 1OV4A 4P4SA 1WBBA 2J0SA 4CT4B 3DEFA 5LDDC 4G01B 2Q0HA 5SZKB 1AKYA 4B34A 1U9IC 4OBEA 2O8CA 2AKAB 2QT1A 2ZRKA 4E09A 2ZVPX 5DLQC 3IBGA 2VF7A 5FUWA 1W0KA 4II7A 4D26A 3RS4A 2FZ4A 2YOFA 3AVWA 1EK0A 4O0MA 3NEYA 3B1YA 1VG1A 4LC1A 2Z6VA 2QROA 4TQAA 4ZV4A 4RCZA 1D9ZA 3W3ZB 3TR5A 2ZTSA 3SR0A 2EFGA 4LJYA 4MA4A 4ZKDA 4B3XA 3NHBA 4DSTA 1E98A 5EXTA 2WBLC 4A15A 4MYUA 4US1R 4AG6A 1G9XA 4BEJA 1R0WA 4X8HA 2WOOA 2BCJQ 5CLLA 2EYUA 3QF7A 4R7ZA 2D06A 3IQXA 4E03A 3VFDA 4GP7A 4TQUS 2A5DA 2PZGA 4DEXA 1NI3A 1IXSB 1Z0DA 3TJZA 1UBGA 4JBXA 4AD8A 3P32A 2J7KA 1NVUQ 3GFOA 3AVTA 1E2JA 1CJMA 4QGHA 4Y0AA 1YZNA 1GRNA 4UNRA 1DAIA 2IL1A 3KKPA 1GG2A 2CEAA 2QL6A 3C16C 3K0EA 4NZYA 5HCNA 1E2LA 1EESA 1N6IA 3ZQ6A 4WAUA 2C9CA 5J40A 4EFLA 1DADA 2Z4SA 4M53A 1U90A 3F8TA 4JLVA 1XCGB 3BWDD 3QSYA 3TIFA 5JWHA 3O8RA 1NMYA 2WOJA 4JL8A 2N1BA 3FFAA 1SKYE 3H0KA 1EWRA 2VP0A 2QQ0A 3PUVA 3QEJA 2VHJA 4DLVA 2O8FA 3U44B 2IUTA 2FPLA 2QAGB 3IO3A 4PANA 4Q4LA 2AR7A 1R4AA 2D2EA 2ZUBA 2HF8A 4Q4AB 1P6XA 2O8CB 1Q1EA 4A6PA 4A6XA 1W2GA 1VPLA 2QGZA 3WMGA 4BFSA 4G5OA 4B3CA 1BYIA 1JECA 2FSHA 3LO5A 4NCJA 1W36B 4O3MA 4HSEA 2V6IA 3WRYC 1G8PA 1KKMA 1SVWA 1T8UA 2DB3A 3TBKA 2P0EA 2GTPA 2GXQA 1VKJA 1VCIA 3CW2A 5CM8B 1OFHA 2RH5A 5JBQA 3OF5A 4C0JA 1E0AA 2R2AA 2D7DA 1QHSA 1KYIA 3J81k 4U5XA 2I1QA 1IOZA 2OV2A 5DHAA 3LX8A 1YRAA 1E9BA 4Q4AA 4V0NA 1Q20A 1P7CA 1KI6A 3DM9B 2H92A 2UKDA 1FOEB 2AXPA 3PEVA 4DHEA 3SU8A 1FMJA 3CNNA 1AJEA 2WMNB 3LW8A 4GT1A 3VTKA 3TAUA 1SZPA 3GJ5A 3THXA 1KSHA 3A36A 2C04A 3EASA 4RD2A 2IT1A 5HR5A 3ND9A 2B92A 3E1SA 3PVSA 3QXJA 2O52A 1XD2A 5TV2A 2XZOA 3EZ9A 1QF9A 1W0KD 4AC9A 4G0NA 3FHTA 3T1OA 1IXRC 3B1WA 4DIDA 1J99A 1LS6A 1R8QA 1OHHA 3ZH9B 2QY9A 3ZVLA 1T3SA 1N0WA 2FFAA 3QOFA 1Z28A 2VEDA 1X6VA 1GTVA 2GJAA 4KJZA 4IVQA 3QKRB 1M7HA 4DC9A 5KHOC 1CKEA 4H9GA 4NCHA 3GLGE 4WXPA 3H1TA 2BCGY 3B13B 1UF9A 2DHRA 2VH5R 1WBDA 2RGDA 4HLUA 4URUR 5J47A 2CVHA 3LFUA 3AVXA 1RJ9A 4Q7JB 1WDTA 3ND8A 1ZNWA 2PLFA 2WWWA 3HWSA 1GILA 3GPLA 3CPHA 4MDFA 4TQ9A 2F3TA 4DCUA 5JI2E 3A4MA 3HR7A 4QXAA 3NC1C 3KXIA 1W7AA 4DT1A 2K5UA 4B2PA 3C5CA 3VNVA 1XEWX 4DCVA 5F98A 1XBTA 2IUUA 2WVJA 1E96A 3QKRA 3THWA 4D2IA 4EQ6B 3RYTC 1UBEA 3PCRB 4BLOA 2WWGA 3CUEF 2GVZC 3L43A 4K81B 4PC1A 4LWZA 5KSOA 1HE1C 3L0SA 4M21A 2FPKA 4B44A 5J4VA 2IBMA 1T4GA 2BJVA 3CPJB 4FW9A 3SFVA 5FL3A 2WJVA 4M1WA 3LBNA 3UPUA 4D0LB 1UM8A 4A1FA 3MWJA 1E9CA 1P2SA 1UDXA 1Z2AA 2GILA 2G3YA 2ZIAA 3AP2A 3MWKA 4PQYA 3H2YA 2IYSA 1U0HC 2CK3D 3IPYA 1G3QA 4LUCA 1KY2A 4LV8B 2NO7A 1YR9A 1CS4C 3GJXC 2PT5A 3AGQA 4NONA 4HUTA 4C0LA 1T0HB 5DGXA 4R98A 2E87A 4B74A 5FUXA 3PIRA 4DLTA 1GL9B 5JSZB 2ZYWX 3I8SA 3OESA 1ZUIA 2CE7A 4IOKA 3OIWA 1LFDB 1MR3F 3K9NA 5LB4A 3SYKA 2OXRA 1VHLA 2DYKA 1E6CA 1XMSA 4MRRA 3B6EA 1P2TA 4EUNA 4NCIA 4RKFA 3IIJA 1SGWA 1NBMD 4ZDIA 3U7GA 1GVNB 1VYTA 2XITA 1LS1A 2R8RA 3EWAA 1ZP6A 4URZR 2FJUA 2OFWA 3RDPA 1KDTA 4QBIA 1YZLA 2X2EA 4YXWA 1PV4A 2AFHE 1WRBA 2W6ID 3AKYA 2RGEA 4IXNA 3SNHA 4DSNA 3BOSA 3IUYA 3M4YA 2H17A 3PR1A 4XOIA 4JLKA 4V03A 1ZCBA 3KUCA 4IOJA 5E4FA 1DAKA 2D4HA 1ZM2A 2OBMA 3ZS9A 1YZTA 4LHYA 5KNBA 1IBRA 1OB2A 2GXAA 2O8DB 2JLQA 5FFMA 3BXZA 1P3JA 1DELA 3TH5A 3IIMA 1MO5A 4ABYA 1OB5A 2GZDA 1T6NA 3HJNA 4LJ7A 2ZI7A 1XXHA 2ZSEA 1LB1B 3IO5A 3X1XA 3AKDA 2L0XA 3GLFA 4B47A 3UK6A 1COWA 1F48A 1U94A 2Q3HA 4AIIA 4XVQA 2AHOA 1Q0UA 2IEZA 4BLSA 4TMTA 5GVRA 1ESMA 2BBWA 5AJZA 1EX7A 4M2LA 2ZU0C 4DCSA 3FOZA 2PMKA 2QN6A 3ONWA 5IHPA 4MRPA 5DI3A 1KMHA 1N5LA 4DT1B 1IY2A 1G8HA 1HEIA 4YC7A 1S3GA 2P6RA 1SKQA 4GOXA 4GL2A 1IN6A 1NL3A 1U2RA 1W47A 3OAAA 4QJ4A 1VIAA 2DCUA 1EFRA 4NBSA 5FI0B 1P61B 2GK7A 1VIYA 2RHDA 1ZNXA 2ANBA 2GRJA 2W2VA 1X8JA 1P62B 4G5RA 4HATA 4DBLC 4CEHA 1NG1A 1FFHA 4GMDA 4UNNA 2A9KA 2WJHA 3QQ5A 4JVNA 2IXFA 2G1JA 1TX4B 2FU5C 4KHZA 4TTQA 3L8ZA 2J1LA 5FPSA 2NOAA 3ECCA 2ZR0A 1SXJD 1U8ZA 3AP1A 4NE2A 5CLQA 5KSYA 1XJQA 2H5EA 1G5PA 2QU8A 4HDCA 2OXCA 1FL9A 5HKKA 1TF5A 1ZU5A 2ORWA 4DWJA 4RVCA 2IS1A 3FWYA 2ODWA 3AF4A 4KVAA 5KSZA 1XP8A 4MITA 1AKEA 4HB3A 2PJRA 2WZQA 1F60A 1VCOA 4P4SB 1KI7A 1GM5A 5EE9A 1RRCA 4Q5IA 4ARZA 4MYTA 4N0DA 1MOZA 2IYVA 3A1VA 2QP4A 2FX3A 2P2LA 3SJCA 1E4VA 2C96A 4PZZA 1F2TA 2IWHA 4C9BA 4F4CA 2REXB 5KDLA 1XRJA 1N6LA 1N5KA 2IYWA 2J46A 2VHTA 4B3DA 4AYXA 1O3YA 2QP9X 2E9SA 3TGPA 1XMJA 4A2WA 2HT1A 5FBWB 1TU3A 2JJ2D 1P5ZB 4IOMA 4Q47A 2WJYA 1Z6TA 3I72A 3RRZA 3C7KA 3VR6A 3EWSA 4R71A 4TMWA 1G5RA 3W3AA 4PAOA 2G0NA 3LW7A 2XXAB 1OHHD 2J3EA 1MV5A 2ZRFA 1KKLA 4OQFA 5DI9A 3PEYA 1SVSA 4LJAA 1Y3AA 1AZTA 2JDID 4B48A 1IM2A 4DDWA 2LWIA 1E69A 3PXGA 1W0JA 5AK0A 4PO8A 4DJTA 3KKOA 4LV5B 1AN0A 3DDCA 4Q02A 2FV8A 3LX5A 1E2NA 4NTZA 2HCBA 1Z6XA 3PITA 3NHAA 3TSZA 1G6HA 1R2QA 2ERYA 3KXKA 1XTQA 3L2OB 3KQKA 4US2R 1JBKA 1ZM4A 1GNQA 2A5FA 2C8VA 1ZM7A 2R6CA 4KYIB 3EG5A 4B76A 5KOYA 1JR3A 1ONBA 1RYHA 2ZE6A 3A6PC 3GEIA 2NG1A 3IIKA 4Q03A 1UDWA 5HE9A 3X1ZA 5G41A 1VCNA 5H68A 2ORVA 4I4LA 2ODBA 4L8GA 2HDNB 5KO2A 2GJKA 1G7CA 1R5NA 4RFSA 1GAJA 3VX3A 4RD6A 1JJVA 2ZM5A 1G6OA 3B9QA 5JHHB 2XB2A 2RGGA 1I4TD 3ZVRA 4V02A 4JLMA 1IJFA 2RB4A 1P2UA 4IDNA 5BW8A 4KYUA 4JLJA 3TMKA 1QHXA 1G19A 4GZMA 1KI1A 3A58B 3AF0A 4JKYA 3ZS8A 3U5ZB 1KO8A 4JL5A 1ODFA 5D3MB 1JXMA 3WY9A 2IYUA 4LC0A 1ZMXA 3RSLA 4EPTA 2IA5A 3RLFA 2Q6TA 2ZS7A 2C98A 3RRNA 4KFSA 3BFVA 3B60A 1RFLA 3U3RA 4Q7KA 4EPWA 1HUQA 5P21A 1BYUA 2QM8A 4M1YA 2OM2A 3CRVA 1S8FA 1UADA 1UJ2A 2TMKA 2WICA 2XNSA 3BH6A 2N42A 4ZDWA 1E79A 3R7WB 3WYAA 3BB1A 2YOGA 1Q3TA 4EQ6A 1XWIA 2ZJYA 3MG9A 3RC8A 4A82A 2G6BA 1QDEA 3REGA 1YR7A 4GOJA 1ANKA 2IHBA 1N6HA 1CULC 4QC2A 1UKYA 2QTHA 3OHMA 1OH6A 4HUQA 4OK5A 3V9PA 1P4SA 2Q3FA 2GAAA 4XTRA 1GRQA 4Q66C 4RZ2A 5F2EA 4BZXA 2W6JD 3CLVA 4HLCA 2OFOA 5FOVA 1QHIA 1E2QA 4FWTA 1Q22A 1EX6A 3BIFA 2C03A 1Z0AA 2AD1A 5TXGA 4XD7A 3W6PA 4PHHA 3R7WA 5TARA 2J7PA 4UXHA 5K8TA 2QUZA 2D3WA 5DI3B 1SVLA 3ZYCA 1G64A 2ZRLA 3SJAA 3GJ4A 1M74A 1BS1A 1HURA 2ZXUA 3K8YA 1II8B 4DSUA 1YKSA 5FR1A 1SKYB 3H4MA 5EJEA 1M7GA 3K0FB 1CJTC 2I4IA 1NLFA 1VHTA 1UBCA 3KB1A 2IYYA 4OHXA 1XNJA 5C4GB 2CCJA 1UFQA 2RKOA 3SDZA 3L0IB 3DKPA 4KLZA 4PQFA 1TL7C 2IS2A 2BBTA 2OBLA 4BFXA 4Q7MB 5CYPA 4TZ6A 4B3GA 3QG1A 4ZO4A 2VA8A 2DWQA 1E0JA 4A9AA 1MH1A 1JJ7A 2ASEA 2OSBA 5FPTA 3QUSA 3G82C 2ATXA 4AG5A 1OXTA 4AKHA 4QG7A 1FUKA 2JJ1A 4LX0A 5JMTA 3AEZA 4HLUC 4S35A 4M1SA 1TQDA 1KJWA 3PV0A 3PEUA 2UVQA 3E5HA 1NVXQ 1ZM9A 2CE2X 2GCOA 2CK3A 3W34A 2MSCB 1CEEA 3LAWA 1M1YE 2FA9A 1OJLA 4FCTA 2F3RA 3HP1A 4RKEA 4A2QA 1E9AA 4O2RA 4PHGA 1F2TB 2OE2A 3LXXA 4DB2A 1D9XA 5FR2A 4U02A 3B82A 1MABB 3LBIA 4TN1A 3T1VA 1TPZA 2PCLA 5AUQA 4L9SA 3QKSA 2OUKA 2O0JA 3H84A 2QAJA 3EA0A 4KSCA 4KSBA 1VTKA 1X8KA 4L15A 3UKDA 1Z2CA 2ZANA 2XXAA 2KI5A 721PA 3IHLA 3TE6A 3OEED 1E32A 3T06B 2F55A 3KUDA 5HE8A 4IDPA 1HH4A 1E2EA 2A2ZA 2IYLD 2XJ4A 5DH9A 2EVWX 3F0TA 1NF3A 5LPNA 3CKLA 2W2XA 2Z5FA 4ZDJA 1J7KA 2EFHB 5G3ZA 2FG5A 4TL8A 5C2JB 1KJYA 4QJ5A 4BLPA 1E1QD 4NU0A 3FHOA 3AVPA 3Q5EA 1II9A 3KTAA 4M4SA 4LJ6A 3CX6A 3R9WA 4H1VA 3CO5A 4WVFA 1RW4A 2P5TB 1JI0A 3M6AA 5L3RA 4TL7A 1YHNA 4EJSC 1J2JA 2OILA 4RZXA 1A7JA 1H8HD 3N5CA 4BEBA 3NTUA 1G7SA 2C2HA 3MRSA 2IEYA 2VHUA 4IDOA 5JJKA 5FTKA 2CL7X 2GAOA 4GMXA 3B2EA 4Z1MD 1JEDA 1W5SA 5A0FA 5IRCD 3KQUA 3R20A 2CDNA 4MKHA 1UKZA 1Z29A 4BQSA 1YVDA 2DFNA 2VP4A 2GF9A 4QRHA 4ARZB 1NY6A 1K5GA 2CVFA 2IW3A 2YINC 2PLRA 4Q9JA 4C0QC 2FSIA 4AI6A 5A4JA 2HXYA 1CR4A 3HPRA 1JPNA 1S9HA 2XJ9A 3KKQA 4EPVA 5CJPA 3I62A 2J41A 2WAYA 2QEQA 1XMIA 4QGFA 3GLIB 2C99A 5BYJA 2DPXA 3CF6R 1P9NA 2J5XA 3M0EA 1NSTA 1XTRA 4YLGA 4LHZA 3NH9A 4B6FA 4A36A 2LKDA 3OAAD 4XIGS 1E2HA 3W8RA 3BBPA 4B2IA 3T1TA 1ZC3A 2V7QD 3U6BA 1R5OA 1XTJA 1C4OA 2P65A 3BRWD 3KX2A 4AK9A 2FMXA 3L8YA 3W5IA 2QTFA 3P27A 2BJWA 2WM9B 2GJSA 2VSOA 1X86B 3O8BA 4NYJQ 1Z07A 3BERA 3RS5A 1I2MA 3N2EA 4K8OA 1DG3A 2J0UB 3KJGA 3BFXA 3UANA 5EQTA 4PSVA 4Q1AA 4W5JA 3U7EB 1IHUA 4IJMA 2GEDA 4TLAA 4AKGA 4Q18A 2CMKA 4OHWA 3LH5A 2Z4RA 4AKEA 1XF9A 3C41J 4PPFA 2WMOB 3FKSD 1OXXK 3D8BA 3KDSE 1M7BA 1WXQA 3EX7C 2GJ9A 2EQBA 4CIDA 3R8FA 3LVQE 4RJLA 5EUMA 1E79D 2JLRA 2Q21A 5HCIA 4EKDA 1K8RA 3FGNA 2GNOA 2OO7A 2V7QA 5B64A 5B58C 2RGXA 2XOKA 4QBFA 3T61A 2X1VA 2OG2A 2YV5A 4LHVA 2W00A 3U6KA 4P3YA 3UMSA 2JLYA 1T9HA 1GWNA 4KITB 2NQ2C 4GOKA 5HTKA 3GFTA 4WBSA 4DLRA 3WYFA 3HPQA 2XOKD 3VQTA 3VU9B 2CLSA 3K0CA 3TLXA 1IY0A 2WWIA 2AN9A 2ZJZA 1N6OA 2ZSBA 2VRWA 4CRWB 2FF7A 3BB3A 3FE2A 3FKSA 2F43B 1RRPA 1ZU4A 3QKUA 1Z5ZA 4LBZA 2I3BA 2ODNA 2QG6A 3MGCA 4QNRA 5J4LA 3GD7A 1BO6A 4HAXA 3CH5A 3FVQA 1OLOA 5BN4A 4MKIA 1GIAA 2A30A 3ZD6A 5DE3A 2YWHA 1DEKA 1YR8A 1Z08A 1WA5A 2OT3B 1A2BA 3I1FA 3LWNA 5JHGB 3L82B 3DKVA 4FI3C 5AUPB 2CLDX 1Q3HA 1NRJB 4BE7B 2IYZA 5FPKA 2MMGA 4LBVA 1AZSC 2JAQA 5CB6A 4DLXA 4AKIA 4NL4H 5TMPA 4X8OA 5JSZA 3TVTA 1AQYA 1D6JA 3EZ2A 4GRAA 4LBWA 4YDSA 5FBVB 2CNWA 2QAGA 3V4RA 5H8WA 1NY5A 1GUAA 3MWLA 1TQ6A 1OXUA 5FTMA 1V5WA 2G0TA 3A1WA 2JLUA 4FIDA 1XMVA 4Q1DA 2OAQ1 1SVOA 4KFRA 4FMBB 2FSGA 2G88A 3U61B 4EFMA 2AK2A 4Q48A 3BB4A 4M9SA 4TMZA 1ZUNB 4PC6A 3GLIA 1NBME 3PUYA 1KI3A 5DSZA 2DWPA 4YMWA 2ZI9A 1T0JB 5CK5A 5B30A 2O8BB 2YYZA 3FPAA 4BUJA 4LZZA 4OQLA 2DFKB 5HZKA 4I1VA 3P1JA 1R0XA 2I1VB 2GF0A 1GNPA 5FH9A 1GL7A 3OIUA 4TSFD 5KUTA 2PT7A 4B2LA 3LVRE 2QSZA 2H1LA 1OFIA 2PZEA 4HB2A 3QXXA 3C14C 3MWYW 4CT5A 3KQNA 2V9PA 2ZRAA 4BRUA 5D3MA 1QG2A 1QRAA 2UZ3A 3Q7QA 5CM9C 3QXSA 2X8AA 2DBYA 4DLZA 2QENA 5HPYB 4PPNA 5FL7A 3GLFB 3B9PA 4M1KA 4QGGA 4DVGA 2OCPA 1NP6A 2F9LA 3NXSA 3JZAA 2ZRGA 5E7IA 1YQTA 1U98A 1DAEA 3DHWC 5IT5A 1J8YF 5TY0A 1IJEA 2NO6A 1GZSA 3HYTA 1CP2A 5K8LA 5IK2A 3BJIC 2H8KA 1XTIA 3AKEA 2ZI4A 1NJGA 4KCGA 1FW6A 1RVDA 1WF3A 3ZDQA 3R9IA 1W4CA 4BFTA 1OKKD 4MRSA 1RJ9B 3MFYA 521PA 3QBVA 2JLVA 4DB4A 2EWWA 2XEXA 1W4RA 1Z83A 4FINA 2BM0A 4OI4A 5FPYA 2B8WA 1PLKA 3UG7A 5IF9A 2ZRHA 3GEHA 4AURA 4MGKR 4BRWA 3QEOA 5K8IA 1II0A 4MDEA 5EUQB 2J7PD 2QA5A 5H1YA 1HQCA 3TUZC 2NIPA 1P72A 3ETLA 4NYIR 4BLQA 3LQQA 1AM4D 1UKEA 2IWRA 4HAVA 3FDIA 2W6JA 3IPXA 1YZQA 3AP3A 3FKQA 3WP1B 3SJZA 4A8JB 1ZVQA 2AK3A 5JS8A 2O8DA 2ZR7A 4ZI3A 5JS7A 4NMMA 1F2UA 3B5JA 3SC3A 1Q1BA 1ZM3A 1KI2A 2BMEA 1ETUA 4W5HA 3QKTA 2XTMA 5EE5B 3HYRA 1Q12A 2F1JA 4M9ZA 1UKVY 1BMFD 1YRBA 2GETA 1P9RA 1OIWA 4F4IA 4Z51A 4TWZA 1QHNA 3ZIAA 3IEUA 3VR4A 5F9HA 5EE3A 2RHMA 2BDTA 2A5YB 4EPYA 4MH0R 1S9DA 1ZCAA 1E1RA 5KPDA 2GJ8A 4D6PA 1MRNA 2ZE8A 3QXHA 2W6IA 3AVQA 3ASYA 4PSAA 2EWVA 1FQKA 1CRPA 4TZ0A 1KDRA 3D31A 3UIEA 1E4YA 2CL0X 1G8FA 2VIIA 3VHLB 3UMRA 2NPFA 4B35A 3BFKA 3LD9A 3U44A 1W48A 2JATA 3ZQJA 2WJIA 4Q4HB 3U4QA 2O5VA 2VO1A 1O87A 4IXMA 3TSOA 4QFMA 3HU2A 5F9FA 3LQRA 2CCGA 1N5IA 1DTSA 1OIXA 5L3SB 1SHZA 2WWYA 3AB3A 3TUIC 3TUJC 1CR1A 1LTQA 3KFXA 4GP6A 4C0BA 3MMPA 2VP6A 4IDQA 4C2TA 2BMDA 2GCNA 3NIBA 4LI0A 5L3QB 3EIQA 5DN6A 4WW0A 3K70D 1NMXA 1Q44A 3I73A 5FOXA 4XSGA 2XNDA 1G5TA 1HA3A 3E70C 4YMSA 5CITA 2YWFA 2QE7A 4JYBA 4OQMA 1E2MA 4PAQA 1RPZA 1HV8A 1M34E 1S96A 2RGBA 4JLDA 4OJKA 1FTNA 1E94E 5JCZA 4OK6A 5EP1A 2F1HA 3A1UA 1MO6A 3PJRA 2IXGA 3SOPA 5C4MA 4YMUA 3QENA 3GLGB 4QHYA 3PUZA 2ZU6A 1VECA 4LSGA 4TMXA 1PLJA 2BKEA 3NVAA 1QG4A 4TYQA 4G3XA 2B6HA 4NYMR 4RD0A 2PZFA 5BN5A 2P6NA 4C3ZA 3WHLA 1XD2B 2V55B 3PG5A 2AX4A 1N6RA 3O47A 3PQCA 4P32A 1XD9A 3KTAB 2P67A 2FE4A 3ZZUA 2IC5A 1R6BX 4LYJA 5LD2B 3DMDA 3THYA 8OHMA 3GLIE 5ELXA 3OIVA 4PZYA 3FMOB 4YMVA 1JQJC 1LF0A 4OYHA 2JJ2A 1LV7A 2HYIC 4E22A 1KDOA 5TB5A 4NH0A 1PZNA 4C30A 2V1UA 1VYVA 3SFZA 4QHTA 1AGRA 1CJVC 4CGZA 1ZUHA 2O0HA 221PA 1AS0A 3L0PA 3KXLA 1N25A 1RZ3A 2GESA 3EA5A 5LB2A 4AYWA 4TMKA 5E3HA 1JAHA 5K8UA 1DBSA 4TYPA 4Q1BA 421PA 3MAAC 4PTLA 3A1TA 1E2DA 2H18A 2Y8EA 3DZDA 3BC1A 5CB8A 3IKJA 3NKVA 4QM7A 1D2MA 3QVVA 4XVUA 1VMAA 1FMLA 2C95A 3QF4B 2B7BA 4OHVA 1TNDA 4DUGD 2Q9BA 1KIMA 4JJKA 1DAGA 2E1RA 4TT3A 4BFWA 5AR1A 5J4HA 1XZPA 1ZINA 4MUAA 3FTQA 2NO1A 3BE4A 3CM0A 2QMHA 4C7OB 4KO8A 3Q85A 1T8TA 1FTSA 5LBIA 1KK0A 2HF9A 4WZ6A 4BWYA
chains in the Genus database with same CATH superfamily
2V4UA 1B7GO 3LOQA 3LKZA 5FOQA 3KT0A 3L5KA 1ZIXA 5B1IA 1ZG3A 4UARA 1CHDA 4Q4HA 1GR0A 2PQ0A 1OU4A 1NAHA 4F5YA 4KV9A 1M2VB 1A4UA 1WB4A 1X15A 2RCNA 3DLIA 5JFGA 3ZHRA 3K5IA 2Q5JA 2PY6A 1HZJA 2D62A 2ZJ5A 4R9UC 4YCLA 4C06A 3PGJA 2Y77A 5F3DA 3ZE6A 2C4HA 4CKBA 3DV2A 4QDOA 2H2HA 2YWGA 5ALEA 1VG8A 3CX8A 1YGPA 2OB1A 2QR3A 2DTEA 4LE2A 3AV0B 3D0RA 2B37A 3B70A 3ROGA 3UEOA 1UMBB 3BGSA 2PRYA 2X4DA 2RMKA 2I3AA 1LZLA 1PGOA 3GJ8A 2UYYA 4ITVA 4D74A 2EL7A 1DIRA 4HPWA 3W6NA 1N6KA 1SXJB 4D9JA 3MWEA 3W9UA 5TC4A 3NBUA 1KHHA 4ND8A 3OT5A 2XGGA 5C52B 2HIMA 3QPAA 2G4CA 3T3GA 1ABEA 2L69A 2CVPA 3VMMA 5JMOA 3L9XA 2IS4A 2YVKA 5IUKC 4YN3A 4C7MA 5KOHA 2YN0A 5TNXA 4EFNA 2IHYA 3GXBA 2EL9A 3EODA 2G1PA 3EN0A 3EXHA 5FBHA 3BXXA 2NUAA 1T6BY 5DRTA 3KBBA 1XCJA 2YCBA 1AQNA 4C4PA 5A3JA 3RYCA 3L1JA 3NUGA 4CF7A 1G2QA 2QLFA 2VI5A 1LY1A 1AXGA 1A4XA 1UEIA 2GBLC 1AS3A 1UEXC 1OYOA 4TXHA 2JVKA 3I5UA 1F8UA 1E89A 5H9WA 1KEEA 4OG2A 4AZ0A 2PYZA 3FOWA 1G8MA 3F96A 4F2DA 4NV3A 2AEJA 1J0CA 2HHAA 2NGRA 2P5SA 1W85B 2O2ZA 2OCBA 2QQEA 2WI8A 3FNFA 3OP1A 4GM1A 3GT3A 3FGOA 4I9UA 2I4OA 4MRNA 5C0OE 3QBDA 2HQSA 2XE6A 3ZG6A 2QMQA 4HDAA 3SR3A 3OTHA 1JFTA 2VHQA 1XCOA 3BORA 3FCAA 3ORSA 3S68A 4ZOLA 4B75A 5C1BA 1NP7A 1NMQA 5CXSA 1L4YA 1VMKA 3V8RA 1DXHA 4YRBA 5KWIA 4IV0A 4LJKA 2WF6A 2I7VA 4F72A 3HVRA 3PFCA 3PLRA 4JLUA 2ON6A 1JXAA 3X1MA 4X97A 1TUBB 2EHDA 5FULA 1O57A 3U40A 2WILA 1H2HA 2RK6A 1L5KA 4E5UA 3ZHCA 3EW7A 1QTQA 2DX7A 5GJBA 5DGIA 1A1SA 2GS9A 2DUMA 3AQIA 1NBAA 2HJWA 1TQ2A 1WVMA 2H2GA 5TF4A 2YZ7A 3WMEA 1UXKA 5HG0A 4IJWA 4BBPA 5BN1A 1KWKA 2ZUVA 4MYCA 4HT3B 2V54A 4QOEA 2VBCA 2HRBA 2OG1A 3PUWA 4ZALA 1DARA 3I5AA 3TLZA 3UFXA 1E0SA 3QX9A 1E5LA 2MSWA 4J4BA 4Q00A 1ULSA 4ZVPA 3ZCQA 2BHLA 1Z7WA 2SECE 4QFBA 1IFXA 1OT3A 1UBHS 4HNGA 3WE7A 4CT0A 4OKIA 2BWJA 3ESAA 4HB4A 4D25A 3GFPA 4CI0B 1CDDA 1NVFA 4IFTA 3CPEA 1SULA 4LPKA 4WNAB 1BROA 1I8TA 4GFDA 4UNSA 1G18A 2ZT7A 1TADA 3VX4A 2JGLA 5IULC 1M9NA 4KLCA 3RBVA 4XRGA 2YN2A 5KBYA 4U7DA 2WIKA 2KJQA 3DD5A 4NJMB 2AMJA 2PSEA 3CN9A 4UHKA 3D8SA 5HKAA 1GKYA 1KY3A 4BMVA 4ZICA 2A0UA 3BWCA 3HBMA 1A5TA 4KN9S 4J1NA 2G9UA 4BNGA 3ZJTA 1N92A 3WTBA 4V0QA 2IOFK 1JFVA 1ODTC 2ZFUA 5CPBA 5BWOA 2RJOA 3QU5A 1U0NA 3CZCA 4W9RA 4JBIA 4Q34A 1UZAA 4P7BA 5CAEB 4XWGA 4D80A 1EEXB 3NXKA 3EAQA 1RMTA 1E3DA 4MQFB 3PHLA 4OB7A 1QTIA 4EPRA 3N6VA 2VEOA 3JWPA 2Z8YM 3NTQA 1W1WA 1B4DA 3ZU3A 1MDFA 4ZAYA 1DPGA 1LVGA 2VOJA 1PF7E 2C2KA 2O4UX 3GW8A 1IXZA 5CT4A 4PZ9A 5B2EA 3AFGA 1EX1A 1EGQA 4J7AA 4D02A 3J80A 5GIPE 3COSA 1G9TA 1VI2A 3KFLA 1BEUB 4MRVA 2XYPA 5KJEA 1T0PA 3IMEA 2ZJ1A 4RELA 4MW6A 3UVEA 1HY3A 4L0QA 4BB5A 2FPGA 3KB2A 4HWKA 1UXOA 4IVNA 3ZV5A 1AO0A 1M1NB 1YGYA 2WJGA 3IUEA 3U3XA 1UWCA 2OFXA 3OOWA 2JD1A 3NU1A 4ENRA 1FX0B 2ZBUA 4OHYA 3PE4A 3HL0A 2BKXA 3BMQB 1TI7A 4MJ7A 1UBFA 3N2KB 5FL7D 5LWQA 1LDBA 1RAFA 5IPFA 1KEUA 2ZWMA 4WZBE 1TLFA 2Q9CA 3VGPA 5JDIC 2HYDA 2PZMA 4BFVA 5L7TA 3UJ3X 2EKDA 3L18A 5LP6A 2A0WA 5TE9A 1FU8A 1ICEA 2V8BA 3O95A 1LPNA 4UFOA 3B3FA 4QBHA 5BW5A 1M5UA 4QEZA 5JZVA 1MO3A 3W5DA 4D9EA 3D6HA 2H1FA 4ZVTA 1VG9B 1RMQA 1X1CA 5JW6A 2Y1FA 3VH1A 2PR7A 3AXSA 5HRCA 3MTIA 3KTFA 3TLMA 3BUSA 1VB5A 3HYLA 3DT6A 1C9YA 1A9QA 1H2FA 3QRWA 4FMDB 1DVRA 5I9LA 3OU7A 4R2XA 3WP0A 1B74A 2L42A 3IR7A 3DXZA 3ZW9A 1CR0A 4TLEA 2FX5A 2JIQA 3I3SR 4NF2A 1M75A 3PXEA 3FUVA 4G1UC 2CXTA 5DYYA 4J1SA 2HR1A 2H57A 1KMQA 4HRVA 4EY5A 4KREA 4RW0A 2O8EB 3QQPA 4UBMA 1E1KA 4UCFA 3BULA 1VI5A 3BMNA 4DPKA 3LQ4A 4M9CA 2P4HX 3N2LA 3UWPA 3NNDA 2HAEA 4O3FA 2PXCA 3SCZA 1KZ7B 1L5SA 1GEEA 1K4KA 4Z0PA 3VO2A 1U8UA 1O0BA 2OCXA 5DLDA 3QE0A 1MT0A 2JI8A 5E4TA 5IUJC 4JP8A 4WEOA 5EKUA 3INRA 4LC9A 1E2PA 2F90A 3HKCB 4ENSA 2I6FA 3MPUA 4J2TA 3BWXA 1XZJA 4OY3A 2ZUTA 4KQ2A 2ZREA 3L41A 2ZSKA 3T3PB 4FGLA 4LF6B 2YRXA 2QHXA 4MQEB 3RANA 3ZBPA 3RAPR 2FZLA 1J39A 1XZNA 2A9FA 2C77A 3CZ5A 4INOA 5G2OA 1E6LA 2ASVA 2BP7A 2GR9A 2FLKA 5C18A 1RTKA 4X1YA 2W6QA 3P97A 3L7JA 2Q9AA 4LBYA 3ABSB 3P5BA 2HK8A 1XB2A 3K3PA 4OGWA 4S1PA 4D99A 3O5AA 2ZUDA 3A0UA 2QMOA 2OCAA 3KUXA 1COZA 1B0PA 1ZBDA 3IT1A 1YS2X 4IKPA 5ECYA 3VPFA 3DR5A 5IZCC 2R1VA 1GOTA 3PKIA 5DISB 4C2UA 4GBED 5E1DA 2I1WA 3AQ4A 1Z8FA 3OKFA 1JQKA 2WTUA 4ND1A 4HTAA 2V3CC 1NN0A 3RJZA 3QXCA 4AS1A 1XHEA 2NTVA 2QD3A 3BF7A 3L6UA 4QSHA 1EG7A 4UJ5A 5DCWA 5ESWA 4C4SA 1JTEA 3JPYA 3C3KA 5JNLA 3BE6A 3AYZB 1FQWA 3WGUA 2AR9A 3ZY2A 3UGQA 4BC0A 2WG1A 4C0WA 3ZWMA 4EAQA 4M7PA 1T2NA 4Z54A 1X1SA 1SN7A 1VL5A 2EJWA 3JYOA 3KZKA 4TTVA 4FLFA 4KZKA 5JRJA 1RE0A 4QPJC 2H1CA 2I54A 3H7AA 1KEWA 3OFND 3R3YA 4KXXA 4M0FA 3OJCA 4MPJA 2J5RA 4ZV9A 1BX1A 1U9IA 4UPVA 3LUHA 2WB2A 5E9AA 5GJCA 1UR5A 2FN7A 4P0TA 2I66A 5KREA 3V80A 3KXDA 3KDPA 2X0FA 2AZ4A 1RJWA 1C30A 3WMRA 4GXTA 1NVVR 3JYLA 4KO4S 3N2KA 4Z9FA 1QLHA 1ZGBA 2Q2WA 1EFVB 1AD2A 3B1VA 1YK0A 4JR2A 4ZU6X 1SRQA 4A10A 3HVJA 2AFHB 3QPUA 4G8CA 1V39A 3WGQA 2CHGA 2J9ZB 1AG9A 1ZK1A 3R3ZA 4KXFB 2Z08A 3VM6A 2E7ZA 3ZZNA 4DEYA 5B7QA 2IS6A 4M6WA 1OKKA 2P4SA 4FDTA 4U9IS 3NGLA 2JFFA 1S7GA 5CH5A 4YRPA 2HA4A 5LA6B 1E1LA 3HJBA 4OGGA 2YHIB 1NHWA 1U0LA 2GASA 2XA9A 4PPQA 1T9GS 4LJ5A 3QVOA 4EM6A 5I01A 3UT5A 3RUCA 3I92A 1F3LA 3CNBA 3H9QA 1XAHA 4MQBA 3S8YA 3FOBA 4F7WA 1TIKA 3O93A 4WOPA 3H13A 1FZQA 1WQ1R 4WOCA 2RI6A 2VAVA 2XWSA 3D8HA 4QJ3A 1CUSA 1LNSA 2HUPA 4RSHA 4RTJA 2G9ZA 1RQXA 2QG9A 3EXFA 3TL6A 1ZHHA 3DVLA 4X65B 3NNSA 1SR8A 2PL1A 1AKTA 1IN7A 3D7SA 3MZ0A 4UEOA 1G55A 2WPNA 5ECWA 3WB2A 5DNYB 1Y89A 1WWKA 3S28A 4DA7A 3W1WA 3UJNA 1VKNA 4IUDS 2JDIA 4TUYF 4DQVA 2R44A 5H59A 2QOEA 2MTBA 5L6LB 1ZGHA 4JUAA 2I87A 4XEHA 2JGJA 3TRFA 4YRAA 4RMIA 5BSVA 5HUQA 3VZQA 2CVOA 5EP3A 2Q62A 4WCFA 3SD7A 1UDRA 1ELOA 1Z6ZA 3ZNPA 2OMEA 1L7MA 2VP3A 3U4GA 1XPOA 1H0KA 2FAXA 2QSYA 4HCJA 1D7OA 2NU8A 3I23A 4HVLA 1U2SA 3HI4A 5JXHA 1OXSC 1DRJA 2DH6A 5D5PA 5FWYB 5JNUA 3EPKA 2UUCB 2FP3A 4EUHA 4MVJA 4N9QA 1O0SA 2VOEA 1OT5A 1YVEI 2WWXA 1ECPA 2HT6A 4LJ4A 2CKDA 3EISA 3K0SA 1U0BB 1N2JA 3LQKA 1NC3A 2TECE 3RYIA 2MINB 5EJ5A 5EHZA 3CJTA 5JC8A 1AA9A 3UWKA 1ZI6A 2CY0A 1E1MA 2R6HA 3IMCA 3E9MA 1DT5A 1ZK2A 3KZ1E 3LF1A 4LQDA 2HJSA 4WX2B 4AJEA 1XZHA 4EB8A 3K2IA 4XGRA 1KEVA 2GN1A 3DT8A 5THXA 4EENA 3ZQUA 1ZH6A 3CVXA 1I0ZA 4ZTUB 3HKEA 4YRKA 3ZTTA 1V7PC 4PRYA 2HDWA 5DASA 1SFRA 4MP8A 5KYUB 1XPUA 1QAQA 1QGYA 1CY2A 1Y5NA 1UJBA 1N2ZA 4MKGA 1Z5PA 5LC1A 3M2PA 2FWMX 1SXHA 3GLFE 16PKA 1KR2A 2CD7A 2OGUA 1HMPA 2R5WA 3LECA 1YDHA 4YWHA 2P91A 4NECA 5KTPA 2W2MA 1CDOA 5E3JA 2CXXA 3DZHA 4CM7A 2Q4DA 2WG0A 4AG3A 5B57C 4RIEA 3RM3A 5HJ5A 4PYNA 3AF2A 2WU4A 2XRYA 2F9MA 1X0VA 3B8HA 3PLAE 2J6HA 3DDNA 3S2UA 4LRWA 3FNRA 4K46A 5AK5A 2WVHA 4ZIRA 2WM2A 4N41A 4L95C 1Y33E 2JLXA 4MV8A 1XFAA 1V6AA 3ZZTA 1LU9A 3MTDA 4GOMD 3T94A 2DGDA 1H42A 2QSUA 5DIZA 4LRYA 3G02A 2O3QA 3G5TA 2Q8PA 5F4ZA 4BN4A 4BMZA 4Y9TA 2WG2A 1RQRA 1UP7A 1XKTA 3A8TA 4A0FA 1D8TA 3BWMA 5BN3B 3OE7A 4FPXA 1J33A 2YHAA 1QCZA 2IBTA 5CK4A 1FYEA 1A27A 1I7NA 1MQ9A 3DOEA 4M8SA 3WA7A 3K2EA 3V1LA 2IYRA 3E58A 3OBIA 1THZA 4AMBA 3EZ6A 2HRRA 1TVKA 1V35A 1I1HA 1ZKDA 1TTQB 4G5GA 4H08A 3PDIB 3SXPA 4P82A 3OJLA 5EZ6B 2VYNA 4NU6A 3K0AB 1P0CA 4DRXA 1D4OA 2PRZA 4LYFA 2ZGVA 2I33A 1GARA 1GKUB 4Q19A 1YV9A 2GZHA 1YBFA 4TMVA 3OZIA 3C1AA 4GLFA 3BBLA 1Z13A 5H02A 4KYVA 4S04A 1KJZA 2WIBA 3U3DA 4DUPA 4MW5A 5K0GA 2Z6UA 2E4WA 2X2PA 4JT9A 1PYOA 3WRXC 4Z1OA 1QUFA 3E3AA 3DDWA 1H9CA 1E1NA 2ZCJA 3EPJA 3MN1A 4BQPA 1RC8A 2RIRA 4PAGA 2WKSA 1V3TA 1H4QA 1C8BA 2MWMA 1BW9B 5TVKA 1TMKA 1XEAA 2P9CA 3FMPB 4LWPA 1LBEA 4G1MB 4QL3A 1ZNZA 2D2FA 3W8NA 4DREA 3IQWA 4N6GA 4LDAA 4CV1A 1U3FA 1S1CA 2M98A 2Y0PA 3SBEA 5BW4A 5B6JA 4P58A 2HQ1A 2PX4A 5MF6A 1RHMA 1JI3A 3TRJA 4DJ5X 4OF4A 2PSJA 4E5YA 1HDYA 2ATEA 2HA0A 2XOEA 2FPMA 1YB2A 2NADA 2FR8A 5CJJA 3WGGA 4GS5A 2PS9A 5COQA 1TF7A 2VYQA 1ADGA 5D6OA 3RIEA 3ZV4A 1L8XA 2Z0MA 2AR0A 3ECAA 4FBLA 4I0WB 4NZNA 3O4VA 1QVZA 4K9QA 4AX8A 3VR0A 4CEJA 4HAZA 1HORA 3UA3A 2CD9A 3PC6A 2IHZA 3CH4B 1U0GA 2V3VA 3C3EA 1EHIA 4I4TA 3U9SA 3C3BA 1E92A 1P9LA 2WKWA 4HZUB 1RI2A 1REQB 2IEGA 3RC2A 2ZAYA 2GFQA 3ES9A 3NBXX 1TUEA 1FJXA 3T15A 1XLTA 4CIBA 1SHLA 2VDLB 1O7JA 3ZD8A 4JVSB 4JL6A 5CIWA 3SJ7A 1DI0A 3NGXA 3PSAA 3HRKA 5FYQA 2PT9A 1ODJA 2B9VA 2QI9C 3QPVA 4I2VA 3ROPA 1PW5A 2JA1A 2YIDA 1NF9A 3GUZA 2ZRDA 3OTGA 2G77B 4F3CA 3P7MA 4H0FA 4L5BA 2RHRA 1GL3A 4DC1A 1UC4B 3BGVA 2CLHB 2IU4A 3QITA 3P4YA 4YP1A 1IHYA 4XYEA 1FYDA 3ICQB 3QVLA 2XRMA 4ND3A 4MA5A 2CXSA 4HL6A 5A3QA 1P75A 2OHFA 3B7PA 3MMXA 3WBBA 3MRVA 4Q9IA 1ZD5A 4IHJB 5KJ1A 4YK7A 2ZB8A 3UW1A 4EGCB 3RYCB 1MN6A 2QBYB 4LN1A 5ES3A 2VP9A 3TQFA 3VKUA 1JAXA 4G6ZA 3KUUA 4HLNA 3R8CA 5G1PA 3UO8B 1QH8B 2E0IA 4EHNA 2O0LA 4RZ3A 1WMFA 1CBUA 3HB9A 4CMHA 4RTMA 3SVTA 5TQ0B 3TXAA 1WZCA 1MLDA 4P7GA 3FOCA 1QR6A 3I30X 3ZU2A 1UMCA 4NCNA 3H5VA 2ZBVA 1TT5A 4N3GA 2BFCB 5F12A 1ONNA 3BMNB 1EI9A 3EGWA 4JLPA 4MWSA 5CB0A 2VTBA 2LKCA 2OD2A 4Q3DA 1T8RA 4Y9SA 5E6RB 1U3DA 5ELXA 1G4UR 4UDOA 1V4NA 2P41A 4UASA 3ZD7A 4F45A 3AZOA 3MTJA 4IP0A 5FEMA 4EVRA 4HUQB 4CWAA 2AJDA 4KACA 4XSHA 4CM6A 1TT7A 4PFSA 5FJJA 3RS0A 2TYSB 1YDWA 4JQSA 4URWR 3B3GA 4OOFA 4QO8A 1XX6A 1PSDA 1QBKC 1ZCZA 1AUVA 3K9LA 4NAHA 1E9DA 2VH1A 2Y2UA 1EUZA 2GVDC 3V7UA 4NBLA 5JASA 1G59A 1TU0A 3TJRA 1NWHA 1US8B 4LF9B 2VCYA 1JLMA 3F5FA 4JT4A 8MHTA 5T8KA 3RAFC 4ZPXA 4NY1A 2PD6A 3UAXA 4ETWA 4X7BA 4YY3B 5DLYA 3C6QA 4MI9A 1CG6A 3O7WA 3DC2A 3EBPA 2OORC 3SSAA 2JIZD 3JPWA 1NUSA 2VLIA 4P86A 4OHPA 3A4YA 3EIHA 5F52A 1FMCA 2ZRIA 5K0FA 1GR1A 5HIAA 3CB2A 3RTBA 3JQGA 1YASA 1R37A 1LFAA 5FCDA 3ZV6A 1K92A 1XTUA 2XVMA 4IRUB 3CINA 1H2YA 1AUXA 1UP6A 4XPIB 3IGFA 1DKQA 1ISSA 1RLMA 3ORRA 2HCJB 2M6RA 1KYVA 3OOSA 3DBHA 4GM0A 3FGPA 4I99A 1KSFX 2NTJA 3C8ZA 1RI4A 3IVCA 4FHEA 1G21E 4HNUA 2ZJ4A 5JNRA 2VXCA 5DGCA 1ZDMA 5IBCA 4PIPA 2F8MA 4RXMA 1MRZA 4TYWA 4P0PB 4C5CA 3F6SA 2ERXA 4H27A 2F1IA 3QI7A 3KQLA 1N0VC 1XZKA 4JK3A 3A0RB 4PSDA 2GD2A 2WM3A 4DIOA 4W9MC 2VUTA 3BHJA 4HDSA 3E0XA 1NN1A 4NK5A 2ZQ5A 5AVYA 4Z7JA 1ILEA 1GVHA 1Z16A 4QBKA 2NXCA 1W4AA 3NKFA 4ZZ2A 2E82A 3W4JA 4FHDA 1H3FA 3O82A 4BFYA 1N34B 1K88A 2HU2A 4UU1A 4F38A 1J70A 1LSJA 1Z8NA 3PPVA 3R6WA 4WXEA 5I7RA 3JQPA 1T2VA 3U39A 4BFLA 5JRZA 3IERA 2JCYA 4MQFA 3D1LA 2DQ4A 4GSKA 5FWNA 3OHPA 4ZQGA 2AI3A 4DLLA 3D3QA 2J5BA 3PZRA 2Q3DA 2R7KA 3D3WB 1OJ7A 3EPLA 3ZWCA 121PA 4FEYA 2J09A 3K31A 5DJ5A 2IK8A 5KVSA 2AZXA 4I3HA 2M32A 3P2YA 4JSYA 2ZJ3A 2QR2A 1QZXA 4E2XA 5D3KA 3NEJA 4MUHA 5JE8A 5DMHA 1K3UB 4OTZA 1Q1ZA 4B3JA 3U4IA 2IEIA 1C1XB 3FLAA 3K92A 3VR3A 4F2HA 2QUBA 4TV9F 1FPMA 3W5SA 4P4NA 3AI1A 4RZUA 5AKLA 1BMFA 1VPWA 3A6ZA 2IYXA 2P2CA 2QZPA 1K6MA 2ZE7A 4MR9B 5DT9A 5HQJA 1ZMOA 4D8TA 4MV6A 2BZSA 3LWZA 5CT8A 1COWD 1DUSA 3D6AA 1BOFA 1JV2B 4Y2TA 5JFOA 2R47A 2R60A 3R5FA 4CQLA 5A6SA 1YD7A 2YOHA 2CFIA 3Q6IA 1PEKE 4OQNA 3T5DA 4E1AA 3LCJA 2JCSA 3C5HA 5AM4A 3MJEA 3CVOA 3MXTA 4EA6A 4DDVA 3QWFA 1HE5A 1YMQA 2NW6A 1FRFS 3CTPA 3IX7A 2E5WA 2QRGA 2CLFB 2YWBA 3PBKA 5AJUA 4YONB 4ZFNA 1JR2A 3DMNA 3L7LA 2AMFA 4MGZR 2O59A 4CLOA 3PFHA 1JDSA 1PD1A 2VTBB 1YOVB 1C3VA 1D2NA 2NO5A 5FWXB 2C3MA 3VZDA 2MMCA 5K6AA 1RI1A 4AZSA 2PQ2A 5BYBA 4BVGA 4G0VA 1Q1GA 4W5WA 3I5YA 3BKXA 4UBLA 1HE8B 1PQYA 4A6EA 3OF3A 5BVGA 1T13A 3RT1A 4C0SA 4GR9A 1NLUA 4X6YA 5KCMA 2HXSA 4C1BA 5B6IA 3MYYA 5JDCA 1BDJA 3R6DA 3FTFA 1XTTA 4NEQA 2JBAA 5KVAA 2WW8A 1GCUA 4HSGA 3C97A 3GYGA 3I6YA 3M34A 4Q9HA 1QH1A 1V8OA 2HWKA 2O07A 1YSCA 4FOOA 2IP2A 3K6JA 4IIXA 5FTWA 3TZKA 1GKIA 2VJKA 4ZMRA 4NCBA 3CV3A 4E7PA 1GQSA 5JXGA 2WF7A 2Y1DA 3B1ZA 3H86A 4R4JA 1ITZA 4LYEA 4ONEA 1TC2A 3P19A 2Y1CA 4PPYA 5CYOA 5IYZF 1OSNA 4B71A 4UXIA 2VDNB 2Q8NA 2FVXA 4TKLA 5REQA 4OP1A 3IQIX 1DKRA 3AY3A 3PTZA 3MJHA 1GFIA 2HU8A 4NATA 1ZIDA 3WRXA 3CONA 3W7BA 4CFYA 4ESOA 2ILTA 5ARDA 3S1AA 2ORIA 2VBIA 3QU7A 1R0KA 3LX6A 1M2OB 3G2QA 4FWIB 1WXDA 4LJ8A 4OVKA 5DEIA 4RULA 2V8OA 1EGMB 1N5RA 3BH0A 3VYTB 3PX7A 4M22A 4LE1A 4RFVA 2CL6X 4NOMA 4HG2A 5AVSA 5LOVA 5L3VA 5ALSA 2R6JA 4MHOA 4HAYA 3WYGA 1P6UA 5HNKA 4E21A 1M2KA 2XB4A 5I4IA 5JALA 2FWBA 4RPJA 5ES4B 2HLDA 1QVRA 5D1NA 4JI3B 2J0VA 1CV2A 4XB1A 1Y3HA 1ZOPA 1VFNA 1IQ0A 1XQVA 3DO6A 4PE5B 3UHJA 1Z15A 3CB4A 1KY5A 3VAYA 2J08A 3ON5A 3C24A 3VSAA 5A0TA 3BMXA 2D0DA 3CLHA 3VO9A 2VWGA 4J3NA 4R6WA 1EBUA 1YRHA 1QRRA 3S1AB 5A02A 5IJWA 3DEKA 4HXEB 1TRKA 5EJ9A 5LP1A 1T29A 5CT9A 4KODA 4RORA 5IYZA 1JFSA 2QRLA 2IQIA 3BA6A 1B6RA 1BIFA 2HBZA 1A69A 4GW3A 5AKGA 4C4YA 4ZCTA 1YBMA 2ATVA 3IOBA 1J1ZA 1O58A 4C03A 2XIJA 3AO0B 4FVTA 3QE3A 4J0QA 4D4LA 3BCHA 2KQUA 4OI2A 2JEYA 3VR5A 4D5GA 4D9BA 4NJOA 3U7HB 3OLQA 2E85A 2CNWD 5EXXA 4BNVA 3A2NA 3G2HA 1Y42X 4CDGA 4EABA 1Z56C 3MJFA 3PB3A 4BBZA 5KDOA 5BNFA 2J31A 3C0KA 3K6RA 5ETJA 3TBFA 1OY1A 2Y1EA 3MS4A 3DBRA 5JXIA 4YJ2F 4DJAA 4DLUA 4OHKA 3T35A 1Z6GA 4LHWA 1JNYA 4L2IA 4POAA 4FBMA 1LEHA 2J67A 1YF3A 3RTCA 3WKDA 4B82A 1NLMA 1QDUA 3NM5A 3QKWA 2HNKA 3LV8A 4TLDA 5DGHA 1Y1PA 2BEJA 1OZFA 3QUQA 3WXMA 3DFIA 1Q21A 4IDHA 3DEIA 2YS6A 4UZFA 1E18A 2R7LA 3QFSA 4HS4A 2ZR8A 2PR2A 4IHJA 4CLOB 2JA2A 2CUKA 3GA7A 2HIHA 4RZHA 1RCUA 1JZQA 1UJ6A 1LGYA 2YY6A 2HHLA 4HPJB 4PFKA 4CUJA 5EPOA 2AWOA 5D84A 5DBEX 1U4SA 4IHQA 3DVQX 3PHBE 2IXBA 4EEZA 4L4UA 2BFOA 2VYND 2E48A 2O3RA 3D3JA 2Y9PB 3GC6A 2O23A 2RAPA 1U8EA 2BF7A 2HU7A 1TEXA 1ZXXA 3GGJA 3GZTB 2QMUA 2G1AA 1KE2A 3PGLA 3Q3IA 5E7MA 3DKIA 4TWAA 3IEKA 4KLNA 2OBFA 3DE3X 1KO4A 1XXLA 2J5QA 3EBLA 3JD0A 4LXTA 3GIWA 4YH1A 1G7RA 3WDKA 1NQVA 1TCCA 5IDQA 5JSUA 2NUPB 5JZMA 10MHA 4LVCA 3L4SO 4TS1A 1ISIA 1ST2A 4IGKA 4JIGA 2C5HA 5D86A 5LU8A 1NRWA 1N2CE 2QVYX 4LOKA 4J0IA 1T8PA 3OPMA 5ADWA 1Y7LA 3U9LA 1N2SA 1WXWA 4Y2GA 3ADKA 3FX2A 2C0CA 1DO2A 3ORHA 3ZE0B 3K70B 3P2IA 3R8XA 2N3ZA 5EINA 3ZDBA 2YV2A 1JP7A 1RBQA 4ALKA 3HY4A 5JCOC 2P35A 4MW4A 4R2IA 2AN5A 5IH3A 3GLHB 1U2TA 4R1UA 4EEXA 3SHWA 6Q21A 3WC4A 2ZRBA 5T64A 2WAMA 4CLDA 4LVOA 3T7JA 3ZXYA 4I9HA 5EMJA 3OD1A 1L4HA 4QZVA 3AVOA 3SYNA 1CUJA 5IX8A 1I2ZA 5JCPA 2PPLA 2DE0X 2RJ3A 3PNPA 4GZ6A 3KL4A 3VR1A 2BR3A 5EIOA 1L5ZA 2LGJA 3AVVA 3W0LB 1YR1A 2QZSA 1MRSA 3GEGA 4XUEA 4DM4A 1UFKA 1WB6A 2AQIA 4N7BA 5I7SA 2OGSA 1DOAA 1FBTA 2F64A 3IB6A 1BD4A 3ASZA 3K70C 5CBPA 3CR3C 1HM5A 1G41A 4UZEA 4QXQA 4I1YA 3ABIA 4UAJA 4WADA 2ZJ8A 1VIVA 4KE8A 3G0HA 3FMVA 3ZXIA 3VV3A 3F8WA 2JAPA 3TW0A 1DO0A 3A25A 4E11A 1TTTA 1Q7BA 2VLBA 1NQOA 2PL3A 1IONA 4JENA 4RIGA 2B4AA 3GRFA 1ES9A 4HGPA 4KQ1A 4OJQA 3P71T 4EHIA 3U1BA 2PBRA 4NPHA 3QOXA 4GOLD 4OATA 3WRVA 3W9SA 3W6OA 3V2UA 4JUIA 3EXIA 3UCXA 4JJ4A 4ER6A 3DBRB 3EPPA 1DWUA 1WETA 1Q7CA 1RCTE 2ZIUB 2BMFA 2VZ8A 4GPEA 1H3EA 4LISA 4M0PA 1RM0A 3QVGA 3EVTA 1VJ0A 2OBXA 3X2SA 3QBTA 2NUBA 3Q5DA 3JYPA 1DT3A 1Z0SA 2C31A 3I1IA 4OXNA 5DRYA 4UZSA 4ZKEA 5M3BA 3CRMA 4YCDA 3BYZA 1Y82A 3DMTA 1JEEA 2CHVA 5REQB 2EARA 2BEVA 5LQKA 4RKWA 2OAEA 4Q7QA 3NCHA 1VMEA 1P1KA 4IZIA 2HMAA 4JVLA 4WGFA 3LHFA 3UK7A 3OEEA 4UHBA 1A8PA 5CDFA 1R16A 1U9ZA 3UAVA 3L6DA 2EEPA 4FFDA 2BELA 4D6XA 3E61A 3OEWA 4C3VA 1W0JD 4ZYUA 3EEOA 1E7RA 3RG8A 3D4PA 1VJDA 4JMPA 5MFZA 3QMWA 1JALA 2CNNA 4MOWA 1PGJA 1U99A 1W88A 3THSA 4NZMA 4NE7A 1Q0TA 4UC0A 1CQZA 3KR0A 4RGVA 1NBOA 2Q6IA 3P20A 4GC5A 4INJA 4ZT3A 3IHKA 4EG3A 4WXRA 3OFSA 4EA9A 3KPYA 1G20A 3O8QA 4ODIA 4RMJA 1Z63A 4ER0A 3WICA 5LDDC 3CUWA 4EG4A 4R83A 1AKYA 3TZBA 4B34A 3V2IA 4ZK6A 2O8CA 3SIWA 4IO1A 1XZBA 3E7DA 3P8ZA 5JQWA 2J30A 1BKYA 4HWOA 2PNJA 3V34A 3R7SA 1UPFA 5DLQC 3FSJX 5EHIA 1LPBB 1W0KA 1KEKA 4II7A 1JJBA 2VWQA 5B3JA 3GHYA 5AI8A 1EK0A 3STTA 2ZWAA 2XW6A 3NOXA 1QF6A 1G9SA 1MIHA 4NSNA 3IDOA 4EAAA 1IAVA 2OO3A 4G5XA 2DECA 4F21A 1D9ZA 2X86A 4QYWA 4XWTA 2ZTSA 1DC8A 3HO6A 4PBRA 1X7DA 1CIJA 2HEGA 3QLVA 4MA4A 1Z12A 1DKOA 2JIRA 2XT6A 3WJ7A 2VCHA 3DLPX 1O2DA 2R5NA 3C39A 1S4MA 3O8OB 4WOKA 4BEJA 1BVYF 1KJ8A 3DT9A 2QL7A 3CF4A 2W4IA 4WCFB 3EXHB 1A77A 3QEMA 5CLLA 4QPNA 4DR2B 4M7WA 5JMPA 2EYUA 5KB3A 1XALA 2GB4A 5LZ9A 1U1EA 2UVDA 2W98A 4EJMA 3PYXA 4GP7A 4PCAA 2A5DA 5BV2P 1CVIA 4OX9Y 1WSDA 1ZQ1A 2XE4A 1IXSB 2FETA 4QODA 3SQOA 1UBLS 2FUCA 1IG0A 1SAYA 1JHVA 3KU4A 4R0VA 4FR0A 2UZ0A 1M8FA 1EP9A 1CJCA 4UTNA 1JHUA 1OV6A 4BHTA 2EAUA 1IQRA 4G67A 4CM1A 2ZUWA 1T5SA 1E2LA 4LEIA 3RFUA 3TTYA 5I7FA 1UPUA 4RJJA 4HWSA 4CHTA 2P6PA 3V1MA 3EJWA 2GUWA 4NDNE 4JNCA 4ANFA 1DADA 2Z4SA 4DS3A 1AO3A 3CEPB 4G5YA 3PC2A 1FJGB 4R8SA 5CFPA 3Q4GA 3BMQA 3TIFA 4RTNA 5KVQA 1LZKA 1NMYA 3DOIA 1H2ZA 3ENVA 3IOEA 2WOJA 3DDUA 4UM9D 3I9JA 2AG6A 3K96A 4ALNA 3RFXA 3LP6A 2DERA 4FIZA 3TZEA 1F8FA 2RBEA 2DG2A 5EPUA 1L5GB 3NVMB 3QFHA 3PUVA 5DCLA 2WT8A 4I55A 3CT4A 4DLVA 3U44B 1VLMA 2AC2A 2FPLA 1QQTA 1K1EA 3ACCA 3IO3A 3NM6B 3PYMA 3FWHA 1H1DA 4X45A 3ELBA 3NDIA 4OO3A 2ZUBA 1D09A 1SC9A 5YASA 2COKA 4IJQA 2HF8A 2PVCA 1GPNA 1P6XA 4XASA 4A6XA 1T1SA 2WU0A 4OLJA 1BGVA 1W2GA 3CISA 3HO1A 1VPLA 4IWNA 2AX3A 4G5HA 3WMGA 3V4VB 2HO4A 4QDXA 2YMMA 4BFSA 2C2XA 3CX4A 1A8UA 4GR5A 4DCPA 1YZHA 2X3UA 4YAIA 1ZEJA 3B3QA 4XX0B 1JEQB 1G8PA 2XLCA 5FP0A 1TVCA 3I01A 3WRYC 1P45A 1T8UA 3DZCA 3K9FC 2PE5A 2VQ6A 5ALOA 4EARA 2P0EA 3CLUD 1ICIA 3N59A 4ID3A 2FB9A 4JEMA 3WWOA 3CW2A 3QX3A 1C1DB 5JBQA 3OF5A 4C0JA 2RKBA 3EVGA 4YP6A 1E0AA 1Z0ZA 2I7TA 3UQZA 4Q05A 1A9OA 1KYIA 2QTCA 4NRDA 4F86A 2C00A 5DHAA 1S8NA 4RHTA 5HRUA 2BGMA 3R0XA 3LBFA 4GPAA 1E9BA 1H6BA 1U5AA 4HC4A 4Q4AA 4V0NA 3VC2A 4EJ2A 1KI6A 1P1FA 1UPBA 2ZZNA 4DHEA 2MSKA 2I7XA 3ZHOA 4AWBA 1AJEA 3KHUA 3OX2A 3N6RA 4Z4HA 4TX1A 1KBZA 3MB8A 1NUAA 2IT1A 4Y2VA 3ND9A 5HR5A 1T1EA 2AEFA 2O2GA 3DCJA 3PQ2A 1QZ3A 3EZ9A 1QF9A 3ELUA 4NI5A 2R00C 1HI9A 1BWQA 4QU9A 1GCAA 1JH9A 2C83A 2WMDA 2NP6A 2QY9A 1T3SA 4GR4A 1OI4A 3GPIA 4QX6A 4YGYA 1KR5A 3TLKA 3TX6A 1SU8A 2FFAA 4KMSA 3CNQS 2VEDA 3ZK9A 3T7TA 4C78A 2I8CA 3C8MA 3TW4A 1PJZA 4IVQA 1H3NA 1GFWA 3GN2A 5C9ZA 1KMCA 5KHOC 1W4LA 1I3MA 1OUMA 3I09A 1I1OA 3OIGA 4HN9A 4W5QA 4ZGGA 3VNAA 5CD1A 3OCWA 3B13B 3OPNA 1UF9A 2DHRA 1JZSA 2IHNA 2XHEA 1WBDA 1VL2A 1EDEA 3H11A 5AOVA 4UREA 2IEDA 2PKRA 1OXMA 1WEHA 1XRNA 3WWYA 1V9LA 3PCXA 1L4GA 4Z2AA 3GPLA 4O33A 1FMTA 3G7SA 3QFTA 5A9RA 3T7IA 5G0UA 1DBVO 4MDFA 1BHSA 3A6DA 1TM3E 3A4MA 3HR7A 1V25A 4N6OA 5EZYB 4DT1A 2K5UA 2ONCA 2P9QA 3T7DA 3HJGA 1PJ2A 3L84A 1MOQA 4UU7A 4WK0B 3Q8LA 1FFYA 2C7GA 4JX8A 1ENPA 3W6UA 3OD5A 3WK5A 3WL6A 2DFDA 3TRDA 3CZMA 2ECFA 5G1OA 1M1UA 2BTOA 3ZE8A