3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
molecule keywords Recombination and repair protein
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
1P2SA 3LX8A 3IKJA 2OLJA 2Z0MA 1E9EA 1P60A 2CCKA 3M4YA 5KSOA 1G7RA 1YR8A 2ORWA 2RHDA 1KGDA 4U02A 3AVUA 2V3CC 3IEUA 4ASUA 1P9RA 1Q12A 4W5WA 3R9IA 3IQXA 4MITA 3ZIAA 2QTHA 5C4GB 3RABA 1E6CA 2W2VA 3B2EA 4ESVA 2J0SA 2C9OA 3IIJA 1BMFA 2P67A 2HJVA 5FOWA 4RD4A 3ZD7A 1H65A 1VG9B 2ANBA 3TAUA 3THOA 3CRW1 4UNQA 2WSMA 2BWJA 5FFMA 1NY6A 2AD1A 4A0HA 4TTRA 1CR2A 1TQ6A 1YZKA 5FTKA 2ZPTX 1RYFA 1XTJA 1AN0A 3QEOA 4QNMA 5F3WB 5G3YA 1E2JA 4JLNA 1ODFA 4TL8A 5H68A 3O8CA 3DHWC 4PHTA 4XIGS 1G21E 2N1BA 3NHAA 1IN5A 3V00A 5JWOA 1Q20A 1T0JB 2QQ0A 2YJTD 2XTNA 4BLRA 4LWZA 1KTVA 3NTUA 4G5OA 3SR0A 3AVYA 4G0NA 4GDFA 2O8DB 5AK0A 2DY1A 4LV6A 5JWHA 1MABA 5DYGA 2UZIR 3D6TB 2BV3A 2Q9CA 3OIWA 1Z83A 4Z1MD 2J7PA 3L0SA 4D4MA 1Z6GA 2IYSA 3HPRA 3N2IA 4DIDA 2NOAA 3EA0A 5BYJA 3PUVA 3UMSA 1QZXA 2A3RA 2X77A 3LAWA 1HQCA 3EPHA 3TW8B 3PG5A 3KXLA 3V4RA 4B3GA 3ADCA 1VKJA 3W8NA 2HJGA 3ADBA 3CBQA 1LS6A 4FXPA 3A58B 5L3VA 2DWQA 3FFBA 5K8TA 2VIIA 1C4OA 121PA 1H8EA 1II0A 1ZW6A 2GEVA 4HB4A 5TVKA 4XD7A 1ZYUA 4BZXA 1GILA 3ZLJA 1ZBDA 2NO0A 1TX4B 4B75A 1GIAA 2QP9X 3Q7PA 2LKCA 2W6ID 5EP3A 1XWIA 3RWOA 1PLLA 4A15A 4F4IA 2YYZA 4BFSA 4V0OA 3G82C 4R2HA 4CRWB 4Q4JB 4IDOA 5DI3B 5HR5A 1QHXA 1S1CA 4A6XA 3I62A 2BBWA 2REXB 4LJYA 3U5ZB 3WP1B 4NYJR 1F5NA 1LW7A 1H8HD 2G77B 4KYUA 4MGKR 4XTCS 5ELXA 1F2UA 3I8XA 2DCUA 1G3QA 4B3FX 4BQSA 5DSZA 4XD7D 1S8FA 3KB2A 2GJ8A 5FUVA 3MMPA 2ZYVX 4P4SA 4E07A 4UXJA 4V0MA 1XRJA 5E95A 2VYFA 4JT4A 1LTQA 1NVXQ 2IYZA 4DDTA 2QRZA 4D0LB 1E2GA 2ZANA 1G6OA 1XEWX 3GFOA 1CU1A 2UVQA 3OIUA 4EFNA 3TLXA 1KO4A 2ZJ8A 2V8OA 1XJ0A 3MCAA 2GJ9A 1E2QA 4EQ6A 2H18A 2ZRIA 1IM2A 2JJ1D 1GTVA 5G41A 3L43A 4Q7MB 1W48A 4PTLA 1Z5ZA 1ZD1A 2RGBA 3TE6A 3GLIE 3CLVA 5F98A 1T3HA 5EE1A 2VP5A 2H7VA 4OQLA 1G3RA 4X8HA 2O8CB 4QJ5A 1WQ1R 3ZS9A 4D0NA 5JRJA 4OK6A 1SHZA 3OFND 1NL3A 3DL0A 5B57C 4X8LA 1NJFA 2NO6A 3GD7A 3FTQA 4HYYA 3E1SA 1HUQA 3FHCB 1L8QA 1AKYA 1IN8A 1NKTA 1NN5A 3IDQA 4CZ2A 2IEZA 5JSZA 2PBRA 3W5IA 3I92A 4DLYA 3NEJA 4KV9A 1QBKC 3THWA 3VFDA 5JHHB 1E2KA 1EESA 1E9SA 5CK5A 4DSUA 1XEFA 5EXPA 1AGPA 3REFA 1XTRA 2PX0A 2ZRLA 2ZJAA 3HYTA 4QRHA 3TSZA 4A0FA 3K0FA 3A1TA 1J8MF 2RH5A 4KI0A 2VHUA 1G18A 4QM7A 3GEHA 3MJRA 1GKUB 4Z54A 1FQJA 1X1SA 2HDNB 2XZLA 3WP0A 1GNRA 1NG9A 4DB4A 1U2RA 2W0MA 1JR3E 2I4IA 1U98A 1P2TA 1GZSA 2IYUA 3ZZUA 2ODBA 2VP9A 1SVLA 4NHOA 3VR4A 3KZ1E 4BZPA 4YONB 1RE0A 3AGPA 2BMEA 2C77A 1S96A 1E2MA 4XVQA 1GL9B 3T1QA 2GXAA 3PCRB 1JQJC 5B30A 2J0QA 2GHIA 1IAQA 4FCTA 5BW8A 2A78A 2X8AA 4Z8YA 5EE0A 4D6PA 1Q22A 2QEQA 3ETLA 3QOFA 5CM9C 4W9MC 4QC2A 4CYMA 1EFUA 2VF7A 2ZS7A 1XB2A 1OIWA 1UPTA 2YHSA 3KUDA 4BECA 5F9HA 1X8KA 1DG3A 2OFOA 2ZI3A 1XEWY 5J4HA 2WOJA 3AUXA 1Q1ZA 2A5DA 4Z51A 2IYLD 1AQUA 2E87A 4YDSA 3PJRA 2IA5A 2CJWA 2D74A 1S3GA 1UBFA 3O8BA 1CJMA 2PT5A 1WBDA 1KKLA 2O8DA 2IYWA 3VX4A 4DRZA 3VAAA 1IBRA 3NH9A 1Q1QA 2ZUDA 3E70C 2GBLC 4JKYA 4KFRA 5L3SA 2UZ3A 3H1TA 3WY9A 4CEHA 4ZKEA 3W34A 1E9DA 3QKUA 2AD5A 3RHFA 1XBTA 2OE2A 2G1JA 2R6FA 4MKIA 2HXYA 4ESHA 2GDJA 3PUZA 4RVCA 4NTZA 1EXMA 2ANCA 5EJEA 2QA5A 5G53C 1TEXA 1U99A 2CEAA 2ZRBA 3THYA 2BBSA 4K46A 1VPLA 2PCLA 5EE9A 3NC1C 4L9SA 2DYKA 2FG5A 1J7KA 1C9KA 1R6BX 2RGEA 2JCSA 5HPYB 3PEUA 5EUQB 4EPRA 1OJLA 1VTKA 5EP2A 1BIFA 1KIMA 1KHTA 5FTMA 2ZREA 2QMHA 3BE4A 2Y8EA 3OFNA 2SHKA 1A4RA 1ZM3A 5C4MA 2DFLA 1NRJB 1Z0IA 1W49A 2ZI6A 4HAUA 3A4NA 3K0EA 4OBEA 4DLVA 1KJZA 4L9WA 1P3JA 5H70A 1DAKA 1E96A 2G88A 1AA9A 2LCFA 2VP0A 5JECA 5D3MB 1QVRA 5JJLA 1N6KA 4QG7A 4B2LA 5DYIA 4FCVA 1BS1A 3K09C 3K0AA 1KKMA 4QL3A 3BB1A 3AB3A 1GVNB 1NMYA 2VP2A 3QKSB 1P9NA 4BLOA 1ZMXA 2ZYTX 3NIBA 1G7TA 3NHBA 2OXCA 4JS0A 5J47A 1TF2A 3CIOA 1OXTA 1E98A 5K8IA 1NNEA 2ZYWX 2O8EB 2I1VB 2QTFA 2ZIAA 1DELA 3CH4B 4FCWA 5JS7A 1G64A 4Q19A 1D9XA 3KTAB 3MWKA 4BFWA 3TJZA 1NMXA 2GBLA 3AQ4A 3AVXA 4EFLA 2QORA 4L16A 2CVFA 3U3OA 3BB3A 4XSHA 3VKGA 1VHLA 1KSHA 2QM7A 5FTLA 1F3OA 1GG2A 1RJ9B 4M9QA 4EPXA 3GLGA 3D31A 2HCJB 1XFAA 1Z22A 2J46A 4X8MA 4B47A 1AGRA 5FPKA 3OEEA 2QBYB 1OXXK 1EK0A 1FL9A 2WAXA 3AKEA 1KI7A 2AK3A 4PPQA 5C18A 3RS3A 1XF9A 2FMXA 4I1UA 5FI0B 1E0KA 2X2EA 4XWAA 2AX4A 2OCYC 2BJVA 4PQYA 4GRAA 3DDCA 4GMXA 4IRUB 1KMQA 3LX5A 4EPWA 4OHYA 1SZPA 3AM1A 4A82A 3MRSA 1JECA 1G5PA 3OAAD 2ODWA 3QE0A 4WVFA 1E99A 3K8YA 5FPYA 2YOHA 1KAGA 1ZC3A 1N6IA 2GKSA 4IKEA 1FP7A 1U8ZA 2P2LA 2ZAMA 1RYHA 4XVRA 2X19A 3BWDD 2HYIC 2ZE5A 1WDTA 3VR3A 1JB1A 1OV4A 5LB4A 1NLZA 4EIWA 3L8ZA 4TYNA 2ZE6A 2HF9A 2FPMA 1DVRA 5KSPA 2O0KA 2RGCA 4GSYA 4TYWA 1FNNA 2PCJA 4YLGA 5FPTA 5BQ5A 3WRYC 1T5IA 2EFDB 4ZDWA 4BFVA 4QKQA 1A2BA 2WMOB 2Q9BA 3LBNA 4MRPA 2JLRA 4PAQA 2HV8A 4BZQA 2CCGA 3QPUA 5DIFA 5A5GA 3TQCA 4GZLA 1D8TA 4PC2A 4D81A 2ZSAA 4FINA 3SBEA 3T5DA 3OE7A 2QN6A 1FFHA 5BN4A 4HAVA 1HY3A 4W5HA 4PZZA 1L2TA 3F0TA 1NN0A 1XP8A 2EU8A 2MMCA 4FMDF 1JI0A 1I2DA 3RNLA 1SVWA 4MYCA 1D9ZA 3VR5A 1IN6A 2UKDA 3NBZC 4DZZA 1M2OB 2NIPA 5G3ZA 3K9HA 1E2IA 4LHZA 3CPHA 1IOZA 2JA1A 3BOSA 3Q7QA 5AJVB 5L3RA 3SYNA 4ZDKA 2J0UB 1XCPA 1D5CA 3KKPA 2FZ4A 3TH5A 5LD2B 1W0KA 2MSEB 2XJ4A 4JBXA 2ORVA 1VDZA 2GTPA 2OBMA 2VSFA 4UNSA 1CJVC 5F9FA 1XMVA 2H57A 2XX3A 3RAPR 5M04A 4QGAA 2IS6A 1WCV1 1VYUA 5FH9A 5HZHA 2FPKA 2KWIA 3HU3A 4OQFA 3VX3A 1U0JA 2ZU0C 4NCJA 1YJ5A 2OLKA 3LBIA 2JDIA 5A0FA 3QG1A 4JSYA 3SJCA 2R2AA 4D80A 3GLFB 2BMDA 3LH5A 3RC8A 5K8UA 3SJAA 4P4SB 2NO7A 2Q6TA 3FB4A 1VECA 3KJEA 1RRCA 3IPXA 4LYAA 3OHMA 2Z4RA 4X8OA 4DWJA 4LOAA 4XVUA 2G0NA 2ZE8A 3AGQA 4A9AA 4EPVA 2VSOA 3CM0A 1MO5A 3OAAA 4TQ9A 4P4TA 4YQFA 5KYKA 4IOKA 3CWZA 1FMJA 3PFIA 4OHXA 1E1QD 2LWIA 1ZIOA 2ZVPX 4P33A 1XEXA 2D3WA 4AC9A 1YZLA 2D7DA 5FBRB 1EFTA 1QHHB 1TNDA 2QAGB 3AF2A 2W6IA 1YU9A 4PAMA 1XJQA 2G0TA 5AUNB 4KLNA 1II8A 2BM0A 2GCPA 2WZQA 3ZJYA 3N2EA 2ZRFA 4G1UC 1F2TA 4KXFB 2WIBA 2F43B 3FWYA 2J5XA 3SEAA 1XU4A 4D4KA 4UQOA 1M7HA 5LBIA 2BIFA 4B34A 3F5FA 4QJ3A 1DS6A 2QMUA 1XTIA 1Z6YA 2YNMA 4L15A 5JRZA 2VO1A 2R6CA 1KMHA 2WJYA 1K5GA 3NWJA 4JLPA 1JJ7A 1PV4A 2AK2A 1DAIA 1KYIA 4JSTA 4A92A 3RS7A 1CS4C 3TIFA 1UBEA 1VYTA 4D26A 1KZ7B 1E2FA 1OKKD 1SXJC 2CE2X 1Z0AA 2ZRKA 2QT0A 2QL6A 2CK3D 4EAQA 1QHIA 1T3LA 1WBBA 4H1VA 2DWOA 4JIMA 1UKVY 5JLJA 1M7GA 1X8JA 4M1YA 4TSFA 1SKYB 4MGIR 5HCNA 1LV7A 4BFUA 2VHQA 1TQ4A 2FGJA 1PUJA 1I2MA 2YWFA 4LPSA 4OK5A 1U8AA 2X1VA 4JMPA 2DFKB 1IJEA 2ONJA 2EVWX 2ZSFA 2BCGY 3ZS8A 1XPRA 2VLIA 1Y3AA 3K53A 3H4MA 4C3ZA 1HT1E 1TPZA 3VHXA 4BRUA 2IUUA 4RCZA 1UDXA 2PJZA 3WBJA 2AXPA 4UXHA 4FN5A 1ZAKA 2DWPA 1W5SA 3MGCA 3U6BA 3U3KA 4YMTA 4NONA 1AS2A 3GFTA 3EIHA 2G1KA 1OLOA 3R8CA 6Q21A 1DO2A 4KSBA 4C4PA 1JQLB 1W2GA 1A7JA 2I3BA 2V4ZA 1Z29A 1W36D 3RVBA 3EX7C 1VCMA 3KKNA 2YV5A 4NKRA 2PMKA 2B8TA 3UANA 3QXJA 3CF2A 3VQTA 1KI4A 2XGJA 1L4YA 1HTWA 3REGA 1TU3A 3AF3A 3U44A 4PZLA 1IY1A 3CX6A 1CP2A 2VP6A 1XZPA 2CCJA 2Q9AA 1VCIA 1E0AA 2CE7A 1IHUA 4BE7B 3RRZA 1P2UA 2P6UA 2MSCB 4XSGA 5BN5A 3DO6A 5DI9A 4DSOA 1XDBA 2ZAOA 2LKDA 3W3AA 3FMFA 4EUNA 2Z6VA 4ZDIA 1NIJA 3ND8A 4LHWA 3TRFA 3AF4A 4HLCA 3PUXA 3SYKA 2EFEB 1Z2AA 4D2IA 4ERNA 4GFDA 3FPAA 2CBZA 1ZU4A 4PANA 3PENA 5TV2A 4PPFA 1CF4A 1GL7A 1RKBA 5TB5A 4KAXA 1UADA 2WBLC 3S1AA 4GZMA 4PC1A 2PLRA 3ADDA 1VG8A 2MMGA 2QI9C 1R5BA 3M6AA 5BXQC 3KQHA 1E0SA 1XD9A 5DI3A 3B1VA 3KQUA 4GNKA 4AKGA 1DOAA 2W83A 2IW3A 4WZBE 3N5CA 3EPJA 1YZGA 3TUIC 4Z8XA 5L8VA 2VEDA 4JLOA 1F2UB 4BFZA 5DISB 1QRAA 2A5GA 2PH1A 2WWIA 1U8YA 4MKFA 3I4LA 3WMEA 1WA5A 4TSFD 3K70B 3U4QB 1DAFA 2QAJA 3FYHA 1DTSA 2FF7A 4Q4LA 4HUQA 3VKWA 1RRFA 1P2VA 1VMAA 1XD2A 5CM8B 5B58C 4B2PA 1Q0UA 3C15C 3LD9A 4URUR 2OFWA 4C0QC 1QHGA 1D6JA 2ZRDA 4D25A 2EWVA 3WYFA 4LYJA 3QG5A 3W3ZB 2WWGA 4V0NA 1W7AA 3A4MA 2GAAA 5KUTA 2ZTSA 1CKEA 4OJKA 4BLTA 1K8RA 3A1UA 2OT3B 1G7SA 3KQNA 2J0VA 4JLKA 2V6JA 1CR4A 3SJBA 1YQTA 2ASEA 2D62A 2ZRHA 4AYTA 2PJRA 4WIAA 2IF2A 4CVNA 2CMKA 4CEJA 2DHRA 1TAGA 2FFBA 2V7QA 4W7SA 3QQ5A 1ZVQA 4R9UC 4Q4HA 1EG7A 2P6NA 1MR3F 5JSZB 1L7VC 5FOSA 3EZ2A 4ABYA 4JL6A 4DC9A 1UBCA 1QG4A 2FE4A 3CNNA 2AR7A 2ECKA 3GLHA 2IS2A 2P3SA 3TUZC 1ETUA 2O8FB 1HURA 4B32A 4RCYA 3CRRA 3IQWA 2E1RA 2P5TB 4BWYA 3U60B 1P61B 1TQDA 3FVQA 5B2ZA 4ASUD 2ZE7A 4YMSA 1JR6A 1N6RA 2R8RA 4URXR 4W5JA 2IK8A 3E2IA 2O8BA 4DB2A 2FZLA 1PUIA 3DZDA 4DUGD 1VG0B 1GOTA 3DOFA 3QEJA 3TNFA 3KKQA 2Q0HA 3AUYA 5FUYA 4AKHA 4BPBA 2IXGA 2GZDA 2JLZA 4TMWA 3QF7A 2EYUA 3GCGA 3PVSA 1TF5A 4TQAA 1GITA 5CB8A 4F92B 4NE2A 3CF6R 3KJGA 1F60A 4GPTA 2QM8A 1CIPA 5FTNA 2VHJA 2EW1A 1W5TA 2AHOA 421PA 4B6FA 1UF9A 2GK6A 1OFTA 1YRBA 3QIAA 2QGZA 2FX3A 3BB4A 2CNWD 4KCGA 1UJ2A 3NG1A 3ZD6A 3VKHA 1KDPA 3CW2A 2R44A 5HKKA 4WAUA 1CRPA 3BRWD 2AKAB 2R65A 4ON9A 2C2HA 4JYBA 4YMVA 2CJWB 3GLIB 4FWTA 3C8UA 1GRRA 2B92A 4IDHA 4DLZA 3TVTA 3EZ6A 5HKKD 1R10A 1OSNA 1N6OA 1VCNA 3AVOA 2WJHA 2IWRA 3IO3A 3L0IB 2OFXA 4YXWD 1G291 2JJ8A 5KOYA 1W2HA 3AH8A 4NYJQ 2NZ8A 4MUAA 2H16A 3GP8A 1S9HA 5JI3E 4ZDJA 1ANKA 1KDRA 2Q3MA 3HP1A 3I73A 3IGFA 3SJZA 5AUPB 2ZEJA 2GCNA 5AJXA 5GJVC 1UKEA 3C41J 4YC7A 3GLFA 3MD0A 3UK6A 4FMDB 4M1WA 4CW7A 4E5UA 4QXAA 2FDCA 2ZQ5A 3BAFA 2JLXA 3ZZ0A 2IYTA 2IS4A 4F4CA 2WMNB 4XWKA 3H2YA 4DCUA 2VF8A 4XOIA 2ZJOA 4UNPA 4PQRA 4KJZA 2O8CA 2XSZD 2H92A 1S4QA 2QMEA 3FHOA 2YWGA 1V5WA 1KK3A 4JBYA 2ZITA 1XEXB 5JJIA 4S35A 3AKDA 1NN3A 2CLDX 2V7QD 2F1JA 2DBYA 1IN7A 4Q1BA 1XMJA 4DLUA 1S1MA 5D3MA 4A2PA 5CK4A 2GVDC 1II8B 3EZFA 2BBTA 3SOPA 1COWD 3HR7A 1YRAA 3CONA 3IUYA 3PUWA 2GEUA 5GVSA 4NU0A 4O2RA 5IRCD 5CYOA 1E4YA 2YC2C 1Q21A 3QXCA 3DMDA 3DPUA 1XXHE 3RS0A 1J8YF 1S2MA 3I32A 4Q9KA 4DT1B 4TZ0A 1GNQA 4FMCF 4P4UA 3RS4A 3ND9A 1JPNA 4JT2A 3K1JA 3LDAA 3DKVA 4A0RA 3OZXA 3X1WA 2HXSA 4JLMA 3I5YA 1PVOA 4MYHA 4IOMA 5JS8A 4B48A 3OEHD 4WXPA 2P65A 2F3RA 4AIIA 4HB3A 2K5UA 1OKKA 2J87A 4CGZA 1II9A 5CLQA 1E79D 1E2EA 1E69A 2VL7A 4FWIB 5EXTA 2IWHA 2XXAB 1CBUA 1R0ZA 2W6JD 1MKYA 5EZ5A 2FJUA 2BCJQ 3U61B 3IPYA 3K9GA 1JPJA 3KXKA 2BOVA 4A8JB 2RGAA 1OB2A 2NQ2C 1DBSA 3EASA 1QF9A 4OKSA 3SZRA 1HYQA 2QGNA 3DVLA 3MAAC 4KVAA 4O2LA 4UKDA 2N46A 3EWAA 5KNBA 3U6KA 1OF1A 3AVTA 5L3QB 5AR1A 2XNSA 4G01B 1P7CA 1N6HA 3QF4B 2HT6A 1Z3IX 1VG1A 4CEHB 4QJ4A 2RKOA 2NO9A 1VYVA 2ZJ5A 1XPUA 1S9DA 4GL2A 1JEDA 1ESNA 4TLEA 5IHPA 2IHYA 2FV8A 3L82B 3NC0C 4DDWA 3P27A 2WOOA 2B8WA 4LJ7A 1U94A 4IVPA 5IK2D 2WKQA 4O25A 4GP7A 3BH7A 1RVDA 1HE1C 2FU5C 3THYB 5FPHA 1KJWA 1T91A 2IS1A 3UWOA 3QPVA 2XOKA 5DHFA 4AI6A 3U7FB 2QP3A 3B9QA 3CZQA 2CHGA 3LY5A 5AJZA 4A36A 4Q5IA 1XPOA 4U5XA 4FI3C 1B23P 5AJWA 1CRQA 4MGZR 3PEVA 3BH6A 3EAQA 1ZNWA 5TDHA 3WXMA 4EPTA 3LA6A 3TGPA 1OHHA 5GADl 4Q7JB 3AEZA 5DH9A 4E03A 2CDNA 4B33A 3MJHA 3EC2A 2G9NA 1NLFA 3UXMA 521PA 1A2KC 4NCNA 4AD8A 2JJ1A 4QNRA 5LDDC 3ZVNA 2OHFA 2V9PA 2D2FA 3OESA 1JALA 5FUXA 3ZDQA 4JBWA 5LPNA 2A5JA 2QY9A 2BEJA 3EW9A 4NZYA 2ZYUX 3QKSA 3X1XA 2WJVA 3ADKA 4DVGA 4C9BA 4G5SA 4LJ9A 5KHOC 1G5RA 4B43A 2A9KA 1AKEA 3K70D 4M9XA 1QVAA 3UMFA 4NYIR 2GETA 3A1WA 2PZFA 3L0OA 1W36C 4QOSA 5UKDA 1A82A 3OIVA 1AJEA 2CVHA 1G5TA 3OEHA 3IEVA 1P5ZB 1JBKA 3UPUA 3PEWA 4MH0R 3QKRA 2ERYA 1Z6TA 3ZIAD 3M0EA 1SQ5A 5KDDA 2VA8A 4LBYA 2GRJA 1R0YA 2OG2A 2AXNA 3ZYCA 4IXNA 2XJ9A 1GFIA 3M1IA 4TT3D 1E2DA 4CDGA 5CITA 2YINC 3VU9B 2AWNA 3MG9A 1Q44A 3A1SA 4AYWA 1R2QA 4Q00A 1KK0A 5EP4A 3U4QA 4KYIB 4OYHA 5TMPA 3VR6A 4LDJA 3SYLA 2WTUA 3GLGE 2WV9A 4U00A 2ZRAA 2D2EA 3LFUA 1W4RA 3T5GA 1S3SA 4HUQB 4M22A 2QT1A 3IIMA 4NDZA 4Q9JA 5SZKB 5F2EA 1XD2B 1DO0A 2QE7A 3DM9B 1G8FA 2OCBA 2F6RA 4O3MA 3THXB 3T61A 2O0JA 4D0GA 1QHHA 2QAGA 4ARZA 2NG1A 4DCSA 4HUTA 4LC0A 1LF5A 3PUYA 4LY6A 4NYMQ 1W0JA 2KB0A 3TK1A 4JJKA 4Q02A 3WMGA 3K70C 1XCMA 3D7MA 2BDTA 1IY2A 2H5EA 2ZJBA 2F43A 4QGHA 3TMKA 3A1VA 3GJ0A 1KSJA 3Q85A 3SDZA 1IONA 3AKCA 3FKSD 2B7BA 1KY2A 1NVVR 1G20E 5J4YA 1KMHB 2NO1A 2XTZA 1KK2A 2GZHA 4KO8A 4OQNA 2OCAA 2JLUA 3F8TA 4KHZA 4LC1A 4PSVA 2P5SA 2C98A 4KBGA 4BLSA 4IDQA 5KSZA 4TWZA 5CLLA 3VTKA 1ZUIA 2ZSBA 1HA3A 2O8FA 3RRNA 4PQFA 1PZNA 2PX3A 3TR5A 2W6JA 3EPKA 3G5UA 4TT3A 1XD8A 3GEEA 3WHKA 3EXAA 3QXXA 3ZQJA 1ZCAA 2W0SA 5CB6A 3W5JA 1Z0JA 1E1RD 1V43A 3P4YA 2VPPA 3HU1A 2GK7A 4S2EA 3CB4A 1IN4A 3FFAA 5KNCA 2HLDD 3U3JA 3BERA 1H8HA 4QHSA 4LJ6A 5JFGA 1G4AE 1IY0A 3X1ZA 1AZTA 1E3MA 3H86A 4IW3B 3FMIA 4ZCLA 4POAA 4R7ZA 1UM8A 2QAGC 3QSYA 1R4AA 1ZUHA 1DEKA 1GWNA 2FNAA 1GDDA 2G3YA 2HLDA 3P4XA 4IJMA 5IT5A 3VNUA 3Q5EA 1RZ3A 3JZAA 4XWOA 4HATA 1E4VA 4B3XA 1Z0KA 4LHYA 1LF0A 3MWLA 5AUOB 3B1ZA 1OB5A 3TKLA 4Q48A 2OZEA 5EXSA 4G5RA 4U7DA 1NN1A 1OFUX 3LVRE 1RRGA 1MO3A 2XEXA 5EXXA 4F7WA 1WF3A 4HZUB 3MUFA 3HYRA 3GJXC 1G17A 5C46F 1N0WA 3CUEF 1Z0DA 3SFVA 4KU4A 4MRNA 3LO5A 1G3UA 2FSHA 4HDCA 4DLWA 5E3HA 5GJWC 4WOPA 1GSIA 2WKRA 4LSGA 4KVGA 4G3XA 4YDHB 2V55B 2ZR9A 4HLUC 2JLSA 1G3MA 2Q3HA 1LVGA 1U90A 1AS3A 5FR2A 2ZS8A 1LY1A 3P20A 1N6NA 3CO5A 1JXOA 1T6NA 4JZKA 4ZV4A 2EYQA 2OBNA 4LPKA 1XTSA 1N5IA 2R9VA 4QBFA 2IEYA 4D4LA 3LV8A 5JJKA 1HV8A 1HH4A 3AVWA 4B3CA 3K0AB 1OH7A 2HUPA 4DXAA 4PZYA 4PO8A 1GL6A 1NMZA 3SQWA 4DSTA 4II7A 4B2IA 2EWWA 4BRWA 2QG6A 3BXZA 3KJIA 1XJCA 3GFPA 1NI3A 2FWRA 4JL8A 2CLCX 4XH9B 2NMVA 4PXAA 4JVMA 1IXZA 1XZQA 3BJIC 1Z0FA 1CJTC 1OFIA 1U81A 1RJ9A 4BUJA 4LGMA 4DCNA 1UKYA 2WPDD 4UJ3A 4FMBB 1G16A 1XCGB 1ZRHA 2ONKA 4RY2A 5AWFC 1JNYA 2ZR7A 4AG5A 1WB9A 3TVDA 5KPDA 1U9IC 1GM5A 4CT5A 4TMKA 1G8HA 4WW0A 4Q9IA 5FL3A 1DAHA 5BYKA 3CPJB 3RANA 2WWHA 3HJNA 1E1RA 3IBGA 4Q21A 5GJBA 2J41A 4JLAA 3CX7A 4HLUA 2ZI9A 3TQFA 2NPIA 4IFBA 4JYCA 3P26A 4F93B 3AF0A 1ZCBA 2XXAA 1M74A 3FOZA 4A1FA 1U0LA 1KI6B 4NYIQ 5DLQC 3EC1A 2WJGA 1W36B 2GJSA 3PR1A 1Q1BA 2ZRNA 3IIKA 3KFXA 4MYTA 4KLZA 3GPLA 3KL4A 4LV5B 2IC5A 2BKUA 3F3YA 1GNPA 3CR8A 3LNCA 1G1MA 3AF1A 2WM9B 4MKHA 1KI8A 3SNHA 1P73A 2BHRA 2RGDA 4EJSB 5L3QA 2H8KA 1SXJE 2Z5FA 3MWJA 2REOA 4DDVA 2IYQA 2KBEA 2CL0X 1N3BA 1TL7C 4RKEA 4Q4HB 5E7JA 2OO7A 2ERXA 3ASYA 4JVNA 4V02A 4H9GA 2V1UA 4HB0A 1G7CA 4LUCA 5BWMA 3U7GA 3RS5A 4IXMA 5J4VA 1R5NA 2PZGA 3LQRA 1EFHA 1AIPA 2YC4C 4C0JA 1M1YE 4CT4B 4LJ5A 2B6HA 1N5LA 3IHLA 4WA7A 4NBSA 1ZIPA 3LLUA 4HI0E 5FTJA 2ZXUA 2WHXA 3BH0A 4JL5A 4Y0VA 3U3MA 2Z83A 4I4LA 2WSSA 1U9IA 1GUAA 221PA 3CR7A 2IHBA 2CL6X 2VHCA 4HAXA 2ZROA 1NBMA 4LJ8A 3WMFA 2QZ4A 3B1WA 1ZNZA 1VCOA 1T5LA 4Q1FA 2BBOA 2W2TA 2VBCA 2WICA 2P6RA 5FUWA 2ZS9A 4GOKA 4CIDA 2ZJYA 3D8BA 3KUCA 4ZI2A 4TTQA 4QBGB 2JJ2D 4R98A 3SE0A 4TMXA 1TUEA 3TUJC 2O0HA 3CPEA 5CYPA 3B7GA 3T1VA 2R6GA 2OM2A 3O8RA 2ZVQX 4US0R 1G9XA 1A1VA 3RRYA 3KX2A 2JIZD 4DDUA 4F4JA 3OEED 2RAPA 1PLJA 4I1OA 2OILA 1G41A 3U7EB 4TTPA 4M9SA 1SVSA 2F9MA 3X1DA 4URVR 3PXGA 4B76A 4QHTA 2FH5B 1T3SA 3BBPA 3WNBA 4DSNA 3O47A 3TSOA 3KQLA 1SKYE 1NSFA 4TZ6A 3SFZA 2AKYA 5GVRA 1SVKA 4TL6A 1FUUA 3CX8A 3I8SA 3TAHA 4UXIA 4B44A 4NPHA 2QU8A 2KBFA 2RGXA 1E94E 1VIAA 1YKSA 1CTQA 2RB4A 3ASZA 4RZUA 4PPNA 1KI1A 2RCNA 2RMKA 1OFHA 3NDPA 2WKPA 4Q4AB 2FFHA 4BFXA 1TUIA 3B85A 1KOFA 1FQKA 2QP4A 4C7OA 1FPMA 1DARA 4WZ6A 2X2FA 4Q01A 3HU2A 4RZ2A 2C78A 4LHVA 3WYGA 4RFSB 1DPFA 3A36A 1XTKA 3QBTA 3EZ7A 3HR8A 2F1RA 1XTQA 3BS4A 1CLUA 2GILA 3K0CA 4N1AA 3B82A 4PO1A 1M8PA 5KSYA 3JZMA 1M6NA 1JEEA 1SGWA 1CULC 2F1IA 4NCHA 3FKQA 5TXGA 3SQXA 3ZVMA 4PO9A 1EX7A 4N0EA 5EZ6B 3ZZTA 2OV2A 1EGAA 1WE2A 3QKTA 1FMLA 3UMRA 1N2CE 3QVUA 3T1OA 3W9YA 4BEJA 3T1TA 4ILEA 1E2LA 2OSBA 3ONWA 5KU1A 1SXJD 3CRVA 4IDNA 4DT1A 2YVUA 1NKSA 2P0EA 1RPZA 1FOEB 2J1LA 2XAUA 3UIEA 3AKYA 3L0PA 3GJ5A 2ZR0A 3SN6A 3FHTA 3W90A 2R6AA 1FTNA 1MT0A 2QSYA 5JHGB 4JLVA 1TTTA 4I99A 4V0ME 2KI5A 2FFQA 2GAOA 2JAQA 1E79A 2GZAA 4CF7A 4JLDA 2AFIE 2GF9A 3P32A 4AWXA 1FX0A 2PL3A 3WRXC 3NBYC 2HT1A 3AVPA 1YZTA 1ZNYA 3LQQA 2QROA 2C96A 1E9FA 3A8TA 3AP2A 3C4JA 3Q72A 4MRRA 1N6LA 1GRNA 4IVRA 1BKDR 2R62A 1ZD8A 4P31A 4M8NE 4KSCA 3SHFA 1E0JA 4ZIRB 3K0CC 4EDHA 5B64A 3WNDA 4KFSA 4WXRA 3GLIA 4M1OA 1F6BA 2YOGA 1Z63A 3R7WA 4NMMA 5CJ2A 2VSXA 3IILA 4IFEA 2WWFA 2BMFA 2F3TA 3KXIA 3QF4A 3AVVA 3SU8A 3OIYA 1US8B 4K81B 1AM4D 1FTSA 3P1JA 1KO8A 4IDPA 1PLKA 1ZM7A 3ZVLA 3U2QA 4PHGA 1LS1A 2E9SA 3LW7A 3U44B 5EE5B 1P75A 4HAYA 4V0LA 4XTRA 3FGNA 4F38A 3GJ8A 1MRNA 2D4HA 4QM6A 4HZUA 3EIQA 1G19A 4TMZA 4OI0A 4TL7A 3LVQE 3KDSE 3KKMA 2WJIA 4G5QA 4TMTA 2W2XA 3QENA 4LBWA 3NXSA 3RSOA 4DLXA 2XSZA 4PPGA 1J2JA 2IL1A 3NVAA 4L5BA 5FOTA 1NG1A 4ACBA 3TW4A 1BOFA 3VNVA 4TLCA 1JAHA 1NP6A 1YR9A 1TF7A 5DO9A 3B1YA 4NP6A 1KI3A 3PITA 4P0TA 2GXQA 4PAOA 5FI1B 2F55A 5KPJA 4MUBA 2G83A 1P4SA 2VHTA 4TLBA 5DNYB 1VIYA 2V1XA 2QPAA 3K0SA 3O8DA 1COWA 2C8VA 4HDQB 4N0DA 1N6PA 2OXRA 4M0LA 5FOXA 2C04A 2FPLA 4E09A 3ICQB 1TADA 2OAP1 4DJTA 1SXJB 1ZD9A 3QBVA 1YR7A 4OL0A 5G40A 2PEZA 1RFLA 1ZP6A 5IK2A 2CLSA 2GJAA 1XX6A 2FEOA 2FA9A 3T06B 1K6MA 2FSGA 1BMFD 4TL9A 5H1YA 1R5OA 2ZJZA 1KNQA 2XNDD 1X6VA 1TQ2A 1JR3A 4MQBA 1G8PA 4OK3A 1KSGA 4B73A 3I61A 3NDBB 4K8OA 2L0XA 3KJHA 1N5KA 3QVVA 5KNDA 2MSDB 4BEBA 4DHEA 3BFXA 1R8QA 2GWHA 2W00A 2QENA 2GCOA 3U3RA 5IF9A 2NTYC 3VMFA 5BN3A 2JLQA 2GF0A 2AL7A 3VU9A 3KTAA 3WYAA 4BFTA 1ZJ6A 1NF3A 4AKIA 4ITRC 1OXUA 4QHYA 1C1YA 3MLEA 4JVLA 4EKDA 4GBMA 4A8JA 1NVUQ 2GVZC 5FR1A 3RRMA 5JMTA 4Q1CA 3BGWA 3CH5A 1T8UA 4C2TA 3JVUA 4YXWA 1QHNA 4ZKDA 1KJYA 2NZJA 2J45A 1UEIA 1WP9A 2G6BA 1WMSA 4LYHA 2QRNA 2IF0A 4LZZA 4BFYA 3EPLA 4UJ5A 2F9LA 4LK2A 3KQKA 4DBLC 3I3SR 3QY0A 2VP4A 3THXA 4EQ6B 1A5TA 2J7PD 2OAQ1 3GEIA 3GLFE 5JZVA 3BFVA 2B21A 2C9CA 4ARZB 1OE0A 3I72A 4KITB 4HAZA 3R9WA 1J70A 5AJYA 5JI2E 5JEEA 1Z6XA 1OW3B 3W8RA 4KFUA 4QGGA 1MOZA 4C0LA 2IYXA 1ZINA 4QBIA 1Z28A 4M2LA 4HLDA 5FBWB 621PA 1R8SA 4PFSA 3IHWA 3DMNA 4NCIA 2R6DA 5TY0A 3ECCA 4Y0AA 5A4JA 2D06A 4MDEA 5CJPA 5DN6D 2RGGA 1OPXA 1X1RA 4GI7A 1GRQA 4OI2A 1Z08A 1TEVA 4E22A 4IEEA 1W4BA 3A4LA 4RKFA 4AK9A 2KJQA 4I81A 4JJZA 2OEPA 1M7BA 2BJWA 4V0KA 4OJQA 1OXVA 5JWRA 4HSEA 4M53A 5GJCA 1E1QA 4M21A 1AK2A 4FW9A 4TLAA 4A6PA 4YMWA 4AG6A 1R7RA 1W0KD 3QUSA 1Q3HA 5E7MA 4GOXA 3ZGXA 3CKLA 3AV0B 4JLJA 2J3EA 4Z1MA 2ATXA 4A8JC 3A6PC 3A37A 1KAOA 2IX3A 2WJJA 3N70A 2XZPA 2QPTA 3AVQA 3EA5A 5EE3A 3FMOB 2WWYA 2YKGA 2ZRPA 4WBSA 4M1KA 4AYXA 1LB1B 3I1FA 1Q3TA 1W46A 3DZ8A 2AFHE 1RC8A 1NLYA 5HZKA 2N42A 1NY5A 3K9NA 2A30A 3CNOA 3QNUA 1CR1A 5FPSA 3B9PA 3NH6A 1Q1EA 4OQMA 2XOKD 4TYQA 1YHNA 3K09A 3RYTC 4Q4JA 3K9LA 1XXHA 3RC3A 4C0SA 3QPWA 2FGKA 2ZSDA 3LXRA 1KZGB 5JCPA 2CK3A 2A5FA 2J0UA 4LBVA 2FSFA 3C14C 4PHFA 2XB4A 2DFNA 1IXSB 2CHQA 1ZM2A 2O52A 3D3QA 4UNNA 1Z2CA 3RWMB 2PLFA 1I4LD 1N25A 1DADA 1XMIA 5L3SB 2QSZA 2ZRMA 3R8FA 1G3IA 4B6EA 3RS2A 2VRWA 1UDWA 2A2ZA 1SVMA 3MFYA 1YVDA 4YMUA 4MKGA 2OCPA 5E4FA 3IBYA 4US1R 3RSLA 3ZVRA 5IDVA 3Q5DA 4AURA 1G8GA 1G6HA 1FUKA 2ZUCA 4RD2A 3QXHA 4TLDA 3CRMA 2CXXA 4N3NA 4RD3A 1EWQA 4JKIA 4QBHA 4L4UA 3B8HA 4Q66C 2JATA 4Q7LA 1MO6A 4MRSA 1ZC4A 5FOVA 1OT3A 3FE2A 5FBLB 4CEIA 1KI2A 2GA8A 1X86B 1SKQA 2BMJA 3EG5A 1Z47A 1DAGA 4AY2A 2ZRJA 1R0XA 5CIQA 3C5HA 5DE3A 3B5JA 3ZQ6A 1UBGA 3E5HA 1FZQA 5SZIA 1YZNA 1KY3A 2JLWA 4FMCB 2GJKA 2CL7X 1EFRA 2FFAA 1X3SA 2IUTA 4PC3A 1XNJA 2DB3A 4GT1A 4Q47A 3THWB 2GXUA 4LV8B 1F2TB 1GP2A 1MO4A 2H17A 4EFMA 4IOJA 4RZ3A 3HDTA 1CXZA 4KODA 3GJ3A 2BVNA 4LX0A 2JLYA 4RD1A 3U7HB 4H1UA 2O8EA 1NJGA 3OE7D 2DFTA 2QTVB 2DPXA 4GP6A 1J99A 1RW4A 3QJYA 5J4KA 1O3YA 1Z06A 4OHWA 5C1BA 4HB2A 2W58A 2VQSA 3AP3A 2OESA 3W6PA 2C95A 2C9YA 4RJLA 5HCIA 5J5CA 2QQEA 1KNXA 3C7KA 4JVSB 4PR0A 1W0JD 2GNOA 1LNZA 3WNCA 3KKOA 5KO2A 2ZI4A 3BORA 2WAYA 1AS0A 4MDFA 5LD2C 1FNMA 3CF0A 5SZJA 3G0HA 2WSSD 1B0UA 2ZETA 2FN4A 2WIAA 3BFKA 4LJAA 4NH0A 5HE9A 1SHKA 1OIVA 5DHAA 4Q1EA 1Z07A 1DE0A 2QPOA 4GOJA 1F48A 4A0GA 4V03A 3CRQA 4ZIRA 1RRPA 4G5GA 2A7QA 1N5JA 3PEYA 2BC9A 4QFMA 4PSAA 2FOLA 5E7IA 1TU4A 2IXFA 1FP6A 3V4FA 721PA 4KBFA 2XTMA 4PSKA 3GJ4A 4C2UA 2JDID 1O87A 2I1QA 1E9RA 4BLQA 2EFHB 2ZU6A 5SZHB 5KDLA 4IEIA 4RD6A 4DCTA 2ZM5A 2BEKA 2IT1A 4C0BA 3BK7A 2YOFA 3UATA 3J81k 4B74A 1U0HC 1VHTA 2ZRGA 5FBQB 2XB2A 5CDFA 1KO5A 3BIFA 4BLPA 3X2SA 1MABB 1I4TD 3V9PA 3UWKA 2RGNA 1QG2A 3DM5A 3R20A 1IXRC 1P9WA 2REBA 4DLRA 1T8TA 1D2MA 4Q7KA 2J59A 4R71A 3I5XA 1SULA 3W6OA 3OF5A 4NL4H 3SC3A 3SHWA 3B60A 2YWEA 1W47A 5CIWA 3LLMA 2VTKA 2QMOA 3B1XA 2Q3FA 3JVVA 4US2R 821PA 3TSWA 1N0UA 1I4DD 5EUMA 4DEYA 4EJSC 4KFTA 3AP1A 5ANRB 4DEXA 4MYUA 1W4CA 4DCVA 1JXMA 1P6XA 2JLVA 3UKDA 1G8YA 1ZM4A 1IJFA 1PJRA 4C0KA 4ZCIA 4DLSA 3NBFA 4MGYR 2PEYA 3B78A 3DKPA 5JBQA 3QKRB 3FKSA 3WBKA 2V54A 1OHHD 4F91B 4HEJA 4M9ZA 2H1LA 4URWR 2D7CA 1OIXA 3MSXA 5DGXA 2TMKA 4Q9HA 4PHHA 1J90A 3TBKA 1EWRA 1ESMA 3T34A 1ZU5A 1M34E 2F1HA 1BYUA 4J0QA 1TMKA 4M1MA 3H0KA 1E9BA 3GQBA 4OQXA 3T35A 3TR0A 4QGFA 4I1VA 2PMDA 4AKEA 4BGDA 2ODEA 4TQUS 4ZO4A 5EQTA 4Q4AA 2Z4SA 1NVVQ 1YE8A 4TMVA 2QBYA 1LFDB 3LW8A 2ATVA 1N0VC 4RFVA 4C7OB 4D82A 1KSFX 4Q18A 5H8WA 5LB2A 2F7SA 4NYMR 1W1WA 3Q8XB 4LJ4A 4WZAE 3T15A 4C0HA 2PT7A 1WRBA 1ZM9A 2BKEA 2Z43A 4IVQA 1K5DA 1HE8B 3PV0A 4P3YA 2YZ2A 1Q57A 3EWSA 1XMSA 4EJSA 4RSGA 1NIPA 1EFRD 4Q9LA 5J40A 2Q21A 3Q9LA 3FDIA 3PIRA 1NBMD 2ORIA 2GXSA 1OYYA 2IYYA 1QDEA 1SVIA 2C03A 2FEMA 1UFQA 3VHLB 2JGNA 2WVJA 4LBZA 3UG6A 4RZXA 1IQPA 1DAMA 1DG1G 1UKZA 3W6NA 4PX9A 2YWHA 1NSTA 8OHMA 4CEJB 1AQYA 4LI0A 4TYYA 3BC1A 1QHYA 2OUKA 3EARA 3K0FB 4M1TA 1FW6A 4O0MA 1ELOA 1WXQA 4XJXA 3B13B 4RD0A 3R9XA 4Q03A 4C0AC 5FBVB 5KDOA 2IYRA 5KTYA 4DIEA 1CEEA 3B6EA 1OXSC 4FD2A 2HCBA 4HAWA 5DN6A 3EIEA 3NKVA 4URYR 2GEDA 4L8GA 3GLHB 5TARA 3LRPA 1E2HA 3RLFA 2ZI5A 1RIFA 2EFCB 1CR0A 3LWNA 1OH6A 5K8LA 1HT2E 3EZ9A 1EX6A 3KB1A 4M4SA 2O5VA 2XNDA 2QNRA 4B35A 2O8BB 1NBME 1SVOA 1Z8FA 3IO5A 4LRWA 1P62B 4HDOB 3SS8A 5JCZA 5CDFE 3L8YA 1E2NA 3UG7A 1T4GA 3T12A 1R0WA 4TYPA 2ODNA 1E2PA 1W44A 1L4UA 1ONBA 1E32A 2B7CA 5FL7A 5D3QA 1BYIA 1GKIA 1MV5A 4LHXA 2FSIA 2PZEA 2IUSA 1X8LA 4PC6A 1CJUC 3ICEA 2ZI7A 4BASA 4URZR 1HEIA 2DR3A 3QI2A 3KFVA 4IOLA 3DOEA 3HWSA 3R7WB 4OI1A 1UEJA 2RGNC 5P21A 3GMTA 4R2IA 3ZH9B 4MA4A 1ZUNB 4HZIA 4MRVA 1YZQA 2GESA 1US8A 2HEIA 1S0UA 2ZRCA 2IXEA 3Q3JB 3NBXX 1MRSA 4B3DA 1BH2A 3CWQA 5FL7D 2HF8A 1XXHB 2JEOA 3RDPA 2QE7D 5EP1A 1KO7A 1P72A 1JAIA 4IHQA 3SBDA 3MWYW 3PQCA 5C2JB 1HQYE 3GLHE 4C30A 2HYDA 4DKXA 3C16C 2C99A 4I1SA 2BM1A 1JR3D 1W4AA 4OHZA 2J7KA 3VR2A 5J4LA 1GKYA 2AN9A 2EFGA 2RHMA 3NEYA 3SI7A 3GJ6A 4RFSA 1OH8A 1CJKC 2JIZA 2OBLA 4ZCMA 4FIDA 1KDTA 1AZSC 1KK1A 2WWXA 4NCKA 3GJ7A 2NPFA 2IYVA 2ZSEA 2J9RA 2AWOA 3FMPB 1EFCA 4TN1A 4OHVA 3CZPA 1NVWQ 1BO6A 2A5YB 1QHSA 2CNWA 2V6IA 4Q1DA 1MH1A 3X1YA 4CEIB 4PC7A 3LXXA 1Z6AA 1OYWA 2JASA 4LCBA 4GMDA 1SXJA 1G4UR 2ZJ2A 4UNRA 2JJ2A 5JEDA 4A2QA 1UAAA 2WPDA 3WHLA 3BD9A 1YR6A 4B3BA 2NGRA 2C5LA 4B71A 5FOUA 4DUGA 4OI4A 1D2NA 2VH5R 2WWWA 5HTKA 5HE8A 1KI9A 1H8ED 3HPQA 3S1AB 5AUQA 4LYFA 3VR1A 4EPYA 4P32A 3LBHA 2EQBA 2ZUBA 3L2OB 1E9AA 1KO1A 4M1SA 1DAEA 1JJVA 2XZOA 3CNLA 4ZPXA 1T0HB 2IBMA 4D4JA 4Q1AA 4ZI3A 3GLGB 2XITA 2KSQA 1YZUA 3C5CA 3DEFA 4A2WA 2GCOB 2CHVA 1ZNXA 3QXSA 4DLTA 2KE5A 4HLQB 1FX0B 1OH5A 4A4DA 4ACAA 4JLBA 3H84A 1T9HA 1D2EA 1GAJA 1KI6A 2QUZA 1KDOA 1E9CA 1Y63A
chains in the Genus database with same CATH superfamily
1J8QA 1E62A 2GPWA 2NAFA 2OLJA 2Z0MA 3IAAA 3M4YA 1P77A 5KSOA 2ORWA 1YR8A 2SNIE 3HB9A 1WDLA 1E8MA 3MBOA 3RUEA 5LP6F 2V3CC 3RPEA 1JHDA 4ZQGA 2FLKA 4ZV7A 3O93A 2W42A 4FFMA 5IASA 3IQXA 4MITA 1OBCA 3ZU2A 2AHRA 4HGZA 3TJMA 5IC6A 1RKVA 4J0KA 3IIJA 1O4VA 4K1XA 2J30A 2OQ2A 4RD4A 4MNTA 1AMNA 2P4SA 2OFPA 3O8OA 1ZOPA 3UT5A 3TAUA 1GA6A 3IHTA 2WAAA 3P9QA 2WSMA 1JA0A 2AD1A 4OIMA 1P7PA 5LLTA 1YZKA 4B47A 1V4NA 1RYFA 3FYUC 3IDFA 4NWIA 4W1QA 4JLNA 5G3YA 1ODFA 4K9KA 4TL8A 1PD0A 2AOTB 1D2RA 1TB4A 4OKIA 2PUJA 4QUHA 5H68A 2OYCA 1V6SA 3SSMA 3PTAA 3PE4A 1AB6A 4XIGS 4ZGGA 1IN5A 3QBEA 4AMGA 3WI7A 1EVYA 3V00A 4Y6SA 1IRXA 2WG0A 4NBVA 4EA9A 1T0JB 2V6GA 4PFJA 2H00A 1XSEA 2XTNA 3SQDA 1Y8QA 4LY3A 4IDCA 1NYQA 1GAXA 1ZJYA 4BLRA 5AVYA 4NBLA 2OTCA 5KC8A 4I1PA 3GCWA 3AUUA 3NTUA 2JRLA 1I2CA 2C7OA 1V3VA 4YRKA 3NFRA 1PF7E 3E9ZA 1DAPA 1ZK1A 4CCYA 4FZJA 5BVHB 1FSSA 4FN4A 1EA5A 1QYCA 4HFJA 5GY7A 2UUPA 2BV3A 4DSAA 1Z83A 1ST2A 1R5JA 3WKBA 4NPAA 4D4MA 2FK7A 2DKNA 2NOAA 3SY8A 2QJFA 1ISPA 3R5JA 1NUSA 2WQZA 3LAWA 1XAJA 1JX6A 3V4RA 1BE0A 4B3GA 3TI7A 1NR1A 4NMHA 3W8NA 3WL4A 1LS6A 2A3NA 3G9QA 4Y8VA 4YUXA 5AVKA 4XAQA 4RE5A 2WF8A 2VIIA 3W7AA 2MINA 3FSEA 1C4OA 1ZW6A 3QLVA 1Z4OA 3WX0A 4MVJM 2PBZA 4XD7A 3ZXUB 1D0VA 5A9SA 1L9KA 5CH3A 1TX4B 1NC1A 1Q0RA 5B7PA 1FK8A 2DM6A 4B84A 5EP3A 4WCFB 5ALUA 1MV8A 1L5VA 1JIVA 1PLLA 4BDTA 2AB0A 1W34A 1UPUA 2WSYB 4NXMB 4V0OA 5HR5A 1CUBA 3I53A 3UOAB 3IOEA 1XQ1A 4A6XA 1LSUA 5HFAA 3U5ZB 3ANMA 3LKBA 3AZPA 1DEOA 4C88A 3AFIA 3L0CA 3B5EA 4WLFA 4KYUA 2LXNA 1CY4A 2RH9B 4FFBB 4XTCS 4B3FX 5TRTA 1A8SA 2DTXA 1S8FA 3F6PA 3ITEA 4KN6A 5FUVA 4Y6OA 1MC5A 2O0LA 2ZYVX 4G07A 4P4SA 4YBRA 2ZUVA 5DN9A 4UXJA 3QKIA 1YJAA 3IAS6 3K1TA 2VYFA 2I1WA 1ODLA 1P44A 3DLTA 4JT4A 1LTQA 2ZUUA 1M6HA 3BWCA 3QTLA 4PZAA 3BL6A 2V7GA 3SS7X 1E2GA 2ZANA 4TTTS 3TLBA 2IOQA 4H0CA 5HQ3B 1J2EA 3OO1A 4LDPA 1QMGA 3A9VA 1NVGA 3GFOA 3OD1A 4J1SA 2MU1A 1DFGA 5C5DA 3IP9A 3TLXA 3IELA 1FXWA 3WWPA 4EZEA 4GUAA 3VNRA 4KGXA 3O4HA 4Y2GA 1TI7A 4BNDB 3PI6A 3L7YA 2O8CA 3C6XA 4N01A 2YRFA 1IM2A 2AMJA 2VZ0A 1ENPA 5G41A 2BN4A 2PUBA 2ZB8A 1I14A 1Z5ZA 2RGBA 2QG9A 3OLZA 3K8OE 4N0MA 4PYMA 3TE6A 3GLIE 4KGDA 3QEBZ 5EE1A 3HRKA 4OQLA 3T4PA 3UC5A 3MMSA 2O8CB 1SMKA 4P3XA 4QJ5A 4GQAA 1GNLA 2C0QA 3OX4A 4YT8A 3EFOB 3G2HA 3I9KA 3DL0A 3OFND 5JRJA 4S05A 5JATA 4OAQA 3IBTA 3PHHA 3E8SA 4X8LA 2NO6A 5AXAA 4OP1A 1FMTA 3FTQA 4HYYA 1HUQA 1UXIA 2IDMA 2NZVG 4GR4A 5DNVA 4WY5A 5GZ3A 1NFRA 2VRCD 5FJJA 3JWHA 3ZBQA 1IN8A 1NKTA 1NN5A 1K7XB 2XUDA 1XQWA 2F3UA 2YYAA 3GR6A 1F8XA 1YS2X 4G41A 4I5DA 2PBRA 1JFFB 2PSHA 3I92A 4J6EA 4OQDA 3W5IA 4KV9A 3THWA 2Q2VA 3OZGA 5HJ2A 5KKNB 5AXCA 1E2KA 2HIAA 1J8DA 1XEFA 2G28A 1H2RS 2HADA 4PG6A 5EXPA 3V2IA 1XTRA 1P1HA 4GEGA 1AHNA 2VJBA 3EGEA 3DE1X 2D1SA 3SGLA 2RH5A 3ZNPA 3JWPA 1YZFA 2VHUA 1G18A 5K09A 4QM7A 4LXTA 3WHIA 4GG1A 3LO8A 2XZLA 1JQBA 1WV0A 1FA9A 4DB4A 3FNIA 4GVLA 4N8EA 1U98A 1P2TA 3PDJA 1CRZA 1GZSA 4I19A 3LHDA 4R8RA 3TRJA 2C57A 2I67A 4ALIA 4AZVA 4BEVA 1NT2A 5L40A 1F9AA 1QNLA 3PC4A 4AJHA 5LU9A 1E2UA 1O94A 4YONB 1ZWLA 1J22A 1JWLA 1E2MA 4HX9A 1EXNA 1GL9B 1T9GS 1R4MB 1SIBE 1UC9A 2C20A 3CPSA 4LXIA 1UBSB 1Y6FA 2O07A 3DAHA 5FWNA 4TROA 4GKAA 1BW9A 2W71A 1FDWA 1TD1A 4E46A 1P3DA 1QGZA 2QX8A 5EE0A 5JYEA 3ETLA 4W9MC 4QC2A 5AKYA 1OJ7A 3Q5GA 2UYGA 3WAJA 1XWFA 1UMCB 3KK0A 2FZCA 4WT7A 2YHSA 4BU1A 3DXXA 2Y1GA 4QPNA 1CE8A 1JKMA 4IH1A 4KPYA 3FUCA 4PZDA 4DS3A 3K96A 2WOJA 3DP9A 1XAHA 2JEYA 1CG6A 4YDSA 3OSZA 3K5WA 3PJRA 4JLUA 3FCAA 3P5BA 5JS1A 2D74A 1S3GA 1ZOOA 3I5MA 3O8BA 2CVZA 5K05A 2M6LA 4XYBA 4EDFA 3CVYA 3VX4A 4DRZA 3D8TA 5FTWA 1FRFS 3E70C 5LYJB 2UZ3A 5EJIA 3WY9A 2D2XA 1E9DA 1P0MA 1OLSB 2AFHB 2JBAB 3RHFA 4OKNA 2OE2A 3VNAA 3ZE8A 4XKJA 1M2JA 1MIHA 3H1GA 4ND2A 2HXYA 3A9RA 4M7PA 1V3QE 4PLZA 3F3SA 2QD3A 3C43A 3EH2A 3PUZA 4GMKA 1DIHA 2QJTA 1ZSVA 2AG1A 2QA5A 1SIUA 1N5OX 3FJYA 2FPXA 5F51A 4YLEA 3K35A 4X0EA 1P7WA 4I3FA 1GN8A 1NDUA 3N6XA 3Q88A 3E82A 4B4KA 1ZGJA 4K46A 3GT0A 1KY5A 5HX7A 5K6AA 4FGLA 2DYKA 4HSGA 4GPAA 2RGEA 5ICFA 2KLHA 2JIQA 1XZ8A 2EBHX 1WD7A 4UBKA 3ENWA 4YHHB 4BQEA 1VTKA 2QIPA 3WA6A 1T1IA 2NU6B 3MCTA 5EP2A 1RWQA 4EO9A 4MVYA 3THSA 1ABEA 1SBHA 3ELDA 1U2TA 3UJDA 3H5VA 3OZSA 3U31A 3OFNA 3D7LA 5G0TA 1I24A 3K9QO 4AP9A 5HJEA 3FDFA 1K4YA 1NRJB 4GW3A 4Z0NA 3A4NA 1VC2A 3A0RB 3ZWBA 2O2JA 4PXYA 1KJZA 1F0NA 1MJFA 2B82A 4L9WA 4NBWA 4B31A 1AA9A 4EVQA 2QVYX 3RSGA 6YASA 5D3MB 5JECA 1QVRA 2Z5LA 4B2LA 4QG7A 2X5XA 3CKMA 1J97A 4V0QA 4D41A 2VKTA 1E4EA 3K0AA 3F47A 3ZX5A 2IPXA 2PD3A 4GNRA 1OXKB 2P9HA 1RXEA 1DGQA 3NIBA 1G7TA 2W4QA 1I1HA 1I2ZA 1L8OA 1TF2A 3CIOA 4PYJA 1E98A 2O8EB 2ZYWX 3AI2A 3KZKA 4JI2B 4FCWA 3UMYA 1G64A 2A1UB 1C80A 1FJHA 2CB9A 3BHIA 1ECFA 1UC8A 5C1OA 4UQPA 2C0CA 1KJNA 1FUIA 1NMXA 1PZMA 3TJZA 2IODA 4EKNB 1A9ZA 1S3IA 4ETIA 3AVXA 4L16A 2CVFA 1DWQA 1E8DA 3IAEA 3HCDA 3BB3A 2G8LA 4QYSA 4XSHA 3VKGA 1KSHA 2QM7A 1DRUA 2NU9A 1F3OA 4HR7A 5F76A 3A27A 3EDYA 3LQ1A 4BVGA 4EPXA 1I4OA 5CJJA 2HCJB 3I58A 3F6RA 4G0WA 4CMAA 2PUEA 1AGRA 1L7AA 4YWHA 2DHCA 3EGXA 3OZUA 1X1QA 1FQOA 4REMA 3OD5A 1KPHA 2HWUA 4AY4A 2P2NA 3AKEA 3H99A 3HO1A 4D3SA 2DBRA 3HI4A 1ONPA 1P7VA 4QASA 1XF9A 1T24A 4I1UA 4CMKA 5FI0B 1E0KA 3PNVA 1FBNA 4BMCA 1BDJA 1SQSA 4OYYA 5JY6A 2PWYA 4RDIA 3HB1A 2XGOA 4JB3A 1OX4B 3DDCA 4IRUB 1OC4A 1YOVA 2XCRB 1XZBA 1SZPA 2Z57A 1GTL1 4B8YA 3MRSA 1JECA 1F5SA 4KO1S 1GR1A 1G5PA 1YB6A 2X2OA 3BXGA 1AV7A 3RIHA 5FPYA 2YOHA 1RWOA 1XAGA 3ORQA 5D5PA 4BQOA 2GZ1A 3DZJA 2ZSUA 3ST7A 4RNCA 1TVKA 3C6MA 3QEAZ 2ZE5A 1BQ4A 3I76A 4FE3A 5FT9A 2AJBA 3AHJA 1RWPA 1P8JA 2I6SA 2AH5A 2Y4OA 4F6LA 2FQQA 1R8XA 5CB4B 2GJ4A 2MIIA 2WD9A 2UZ1A 1T36B 4F86A 3L8ZA 1CY8A 2HF9A 4CKWB 3OLQA 2JL1A 1QB7A 4Y6LA 2Z58A 3V8PA 5ALEA 1KQNA 3TZCA 1IEXA 1FTYA 2PCJA 5LYYA 1Y3DE 4I6JA 5CG1A 3S1SA 3M6WA 5BQ5A 5SYAA 1EK2A 1YB5A 1T5IA 2EFDB 1GUDA 4X6UA 1GGMA 4QKQA 3C8DA 3P9RA 2WMOB 1GGHA 1VM6A 2PMEA 3M5WA 2CLEB 5A5GA 3LOUA 4RX1A 4XWTA 3VR0A 1M6VB 1RQ2A 3DFFA 3RG8A 4HNUA 4BO4A 2YW9A 3CNQS 4KLAA 4PC2A 4E7OA 2C2KA 2MTBA 3INGA 4FINA 1XNQB 1C1XB 1FFHA 4DV1B 2WFLA 5CX1B 4MI9A 3T9EA 4CPDA 1PFVA 4HAVA 4RMHA 3O03A 4PZZA 3LE8A 4ES6A 4EUSA 1NN0A 5KNDD 1C2YA 3RT9A 1Q74A 2HHHB 4YRJA 1ZCZA 5AESA 2UKDA 1I1QB 2G04A 1FP2A 1ZZEA 4F12A 1SWWA 2ZB4A 3KKLA 4NJOA 1QC5A 3BOSA 3C5VA 3IT0A 4ZDKA 3IPAA 5CLIA 4XE5A 5LD2B 1USGA 5LYJF 2ZTVA 3NOQA 2NZ2A 1J06A 4XYLA 2MSEB 2XJ4A 4IXWA 4DBZA 3FGOA 3FFXA 6GPBA 3RR2A 2LPMA 3MS7A 2XX3A 3RAPR 5A4MS 1SCUA 5M04A 3TKAA 4I9UA 1NVTA 2B4QA 3HKBB 2VPXA 3IUMA 2FPKA 4OXXA 3VO8A 4DA7A 3B1FA 1U0JA 1XTUA 1Y5IA 2I4TA 2P6OA 1ZSYA 2XCIA 2ZU0C 3ECAA 2OBFA 4RJIA 3LBIA 4ZOEA 2JCXA 3VDNB 2JDIA 4KWIA 5JAZA 4QLAA 2IYFA 1GDTA 4D80A 4BCBA 3GLFB 1ECBA 2QRVA 1YVEI 3ETCA 1SXQA 5CA1B 2P8SA 2XBUA 2O23A 3LH5A 3LQKA 1DKOA 4PIMA 4A26A 4D5GA 4EELA 2UV8A 3RC8A 5K8UA 1M34A 3EK2A 4MVCA 2DKFA 2NO7A 1C8VB 1VECA 1ZVJA 2INGX 2J07A 2Q6TA 3KJEA 1UDCA 4JZYA 1ZI8A 2VF4X 4X8OA 2CLIB 3U3DA 2RHTA 2ZE8A 3MTBA 3OT5A 3ONFA 3KXPA 2WPNA 3MUOA 3KR2A 4R8KA 4TQ9A 2IE8A 1XZDA 4YQFA 5BMVF 4IOKA 4OHXA 3SK0A 1E1QD 1VSBA 1Y5RA 3BF7A 4CDRA 2LWIA 2ZVPX 1YHZA 3FPEA 2O2YA 3RHTA 1XEXA 4HK4A 1NM5A 5H3HA 3FIUA 4EHLA 1DMRA 1F8GA 4AC9A 5LXTB 5FQNA 4C2AA 1YZLA 4GLFA 5FBRB 3D6MA 4TTJA 5ITVA 1EFTA 1TNDA 4CDMA 5BSMA 2A0FA 1YU9A 1NLMA 5IHXA 3ZDAA 5AUNB 4KLNA 2R85A 3REQA 2BM0A 2GCPA 1UK7A 2H85A 2ZRFA 1F2TA 3JQRA 3ADPA 2WIBA 1Q0ZA 3GGJA 4M76B 1W75A 2BEWB 1JSCA 3L7IA 1EJ2A 1MVLA 1XU4A 2C7QA 1M7HA 2XDAA 3GD5A 1T15A 4FLFA 3A1NA 4QECA 1G2PA 1R00A 3H1EA 3ZTWA 1Z6YA 2RCYA 1L7BA 4KQCA 3RFXA 5JRZA 1QFZA 5JIBA 4EW1A 3OJ0A 3ZKWA 2XQJA 2YHBA 1FDVA 1SUSA 4CKEB 1VQ1A 3PQ7A 4F9EA 1DAIA 4DXDA 1QUEA 3L1JA 1MB3A 2JAOA 4U7PB 3EIOA 3X0DA 2O1EA 4PN3A 2XYGA 3VNQA 3ZV4A 1CVLA 2AJTA 1WZIA 4PRLA 5BWCA 1A3CA 4YAIA 1M1YB 4MOWA 1M1NA 1I6WA 1RQXA 5A5DA 1AGNA 2CK3D 3IRUA 2OFFA 3INNA 1YB7A 4IIDA 1U04A 5A5FA 1PSWA 1Z5GA 2DWOA 3NCTA 4JIMA 1UKVY 3HUFA 2Q8QA 4HTAA 2QD2A 4G65A 5EVJA 1EBUA 2RHRA 4X65B 2NN3C 1CY2A 4YCNA 4JASB 4WN3A 1TQ4A 4FFRA 3ZE6A 1YBFA 2YWFA 3PXDA 4JMLA 1WUKS 5KCZA 4RVNA 3KPUA 1N9KA 2DFKB 1IJEA 4YCBA 2ZSFA 3LA8A 2BCGY 3PC8A 4NBRA 2CDCA 3F4BA 3DJYA 4MJ7A 3CZ9A 1XPRA 1RBZA 1NW7A 4GLLA 2NV6A 3UMBA 3PFWO 5KNCH 2C2YA 3KPJA 3K53A 2NU8A 3H4MA 5IC5A 1HT1E 4DILA 1LK5A 3ZBUA 2O3QA 4NE7A 4BRUA 5KBYA 3VR2D 2CFSA 2NYAA 3AUSA 1YUNA 3CLTD 4OO3A 3UXYA 3T9DA 2OR3A 1YU6A 3ANLA 3HEMA 4P08A 5ALLA 4IKPA 2B4KA 1Y5NA 1JKJA 1HDZA 3FZEA 4FKZA 1W5BA 2DWPA 5KQLA 1IZ7A 3MGCA 3QMPA 2J8ZA 3WZLA 3I01M 4NONA 1CQIA 3EIHA 3EZLA 1VGRA 4G37A 3EBLA 1OUMA 3AY3A 4DLNA 4K26A 3A3KA 3CSSA 2NZUG 6Q21A 2YXNA 1KTIA 4H3KB 1TCBA 2VEOA 1ULHA 4U8GA 2O5CA 3GEPA 2R7MA 5KQMA 1QCDA 2HGSA 1VCMA 3KKNA 2YV5A 4MWSA 1N3IA 2JFGA 4NKRA 4ZALA 4ZT3A 3RBXA 1T2EA 1RABA 1WCXA 4ODIA 1NP7A 1ISSA 1TT5A 2J3QA 4OMUA 1TU3A 2XNKA 4PZLA 1IY1A 1GYQA 2HQSA 3E03A 3CX6A 3L1KA 1JDVA 2VP6A 1XZPA 2XE8A 4RQUA 5LOVA 3C3PA 4OAPA 4PO3X 1P2UA 4BV9A 4GGPA 1CUWA 3B36A 5BN5A 1IPFA 1FRZA 3I42A 2GZRA 2ATCA 5AI8A 3T9FA 3W3AA 4X1KB 2V6MA 3CLSC 1G42A 3HBNA 3HV0A 3ND8A 3DWIA 3TRFA 4HLCA 3PUXA 5AVJA 2KS6A 3SYKA 2Z1NA 1Z2AA 5C53B 3T41A 4UULA 5I9BA 3FPAA 1ZU4A 4KQ2A 4EHHA 2FRVA 5A06A 2W4MA 3PENA 5ALQA 1B93A 4PPFA 5TV2A 1RXYA 5TB5A 2ACEA 5TJ9A 4K9RA 4BMOB 1UDRA 2RHGB 1T6XA 2V74B 2YJ6A 3KVYA 2PLRA 3B6IA 3UNXA 2DGDA 2WKWA 5BXQC 5EWJB 3B70A 2P5YA 1Y8RB 2EEZA 2N75A 3B1VA 1NW9B 1ACJA 2EJWA 4KE8A 3UBMA 2Z9DA 1DOAA 2W83A 5IMSA 4TWAA 1YRLA 2IW3A 5AW3A 1WHSB 1YZGA 3G2KA 3M4ZA 3TIIA 3WZ2A 3S2FA 1MX1A 5DISB 1POXA 3GDFA 4UC0A 4ZU3A 1WXIA 1DIRA 1SURA 2PH1A 2QV0A 2WWIA 3FSRA 1K7FB 3KLPX 3LS2A 2DFDA 2WIGA 3VC7A 4CR7A 4UOEA 3WWDA 3LUGA 4BEWA 3WMEA 1RQNA 3ELYA 3FBTA 3ONNA 1P1RA 2HSEA 1RQGA 3EFBA 2XCTB 2ZCJA 1DAFA 1OA0A 3COPA 4Q3NA 1DJPA 1RKXA 1ZCFA 2FF7A 4M83A 1QB8A 1GPNA 2J9FA 3BMQB 3DAFA 4ZO9A 5JPCA 4CCSA 3DUFA 1H2BA 1P2VA 1O1YA 5IAGA 3SQLA 4CKCA 4C0QC 1HZZA 4G56A 3UK0A 2EKQA 4K9SA 4RJ2A 4RTSA 2VQEB 1KJ8A 3WYFA 1WPQA 2BHTA 3QG5A 4V0NA 4IVNA 1SUAA 5E6SA 1CKEA 3JQ7A 1G7SA 3TFWA 5ERXA 2J0VA 2NADA 4JLKA 3T3GA 3IUSA 4PZ0A 1NRWA 5D85A 1HDOA 1EFKA 3G17A 1Y34E 3ZZ1A 4CVNA 3HVRA 3HA3A 4G89A 5JAIA 4FUTA 3AIIA 1ZNQO 3OPXA 4Q0MA 5EPEA 1IRIA 4XARA 1GQ2A 4TS9A 2IXDA 3FUUA 5CEFA 3G85A 3IP7A 1SHUX 1XL1A 1CDOA 2BRUC 3ETJA 5TSDA 2V4MA 5D1HA 3GBSA 4MB6A 1O6CA 5TC4A 3W2IA 4LX8A 3P2IA 1KJQA 1ZK2A 3N05A 4ZO6A 4ABYA 2HMSA 2X13A 3DCNA 1UBCA 1QG4A 2HQRA 3CNNA 3VGJA 3P2MA 3FBWA 3JY6A 5A0VA 1W6RA 3DGFC 4B32A 1VSQA 3WL7A 4A1OA 1ZD2P 3ENQA 1JE1A 4JFAA 5AKHA 1P61B 3BWEA 2AZXA 2Q1XA 3AERB 3IT1A 1J09A 1UMBA 3KKKA 2R8RA 1E7YA 1RAAA 1U0NA 3RUFA 4K03A 3WTBA 4LCEA 1ODJA 3NAZA 4DB2A 5EESA 2FI1A 1GOTA 4LCJA 3BSFA 3R0VA 4OJNA 4PCAA 3H2IA 3AUYA 3K9CA 3LT0A 4IHJA 5FUYA 3PLAE 1FW8A 5C1IA 2GO1A 2IXGA 2JLZA 3CX4A 5BWBA 1PVVA 1Y9DA 1PDVA 1H2AS 3WLFA 2EYUA 4DQVA 2WEKA 3DBIA 2YZKA 3WLKX 3OVMA 1DSSG 4AAYA 4QVIA 4V2IA 1EQAA 4F92B 2XRYA 2BFNA 4R2KA 5KREA 4Z2YA 5IBCA 3KJGA 1ZIXA 3FUTA 4E4YA 1OBFO 2IYNA 2VHJA 2EW1A 2P1RA 1V48A 2LP4Y 2FX3A 3BB4A 2CNWD 3QE4A 1N0IA 1RRKA 3L8HA 3NG1A 1KDPA 4JJ6A 2G6TA 3ZD6A 4GGMX 2B4RO 5HKKA 1PT7A 2F67A 4JX9A 5JVDF 1TM7E 3RIEA 2XI4A 3N8DA 2OHOA 3H2JA 1L4BA 2AKAB 4ON9A 4ZC8A 2C2HA 1K66A 4UMVA 2YFHA 2XE6A 4X7BA 5F1KA 2OOSA 3GLIB 2I9KA 1EG2A 2A86A 2GH1A 1U2QA 1GRRA 2B92A 2OHJA 1B00A 4NFYA 3K6RA 3TVTA 3EGDB 3WB1A 2VAMA 1ECGA 3EYWA 5IDXA 4RETA 2IHKA 5TR9A 2C2XA 3OBIA 3K6SB 4BATA 2OFXA 3GJYA 4UEKA 1E6EA 1T2VA 4KMSA 2JJ8A 5GOZA 3R5KA 4DIBA 3LCRA 4PZEA 2NUPA 2NZ8A 3B2NA 4MUAA 1CYDA 2RG7A 3WLSA 3GP8A 5JI3E 4YP1A 1P5JA 2WK1A 4ZDJA 5IJ0A 1IBCA 4YAEA 3HP1A 4AS3A 4YMLA 4WK6A 1QQ5A 2ZEJA 1M8FA 2PKRA 4O5OA 4ECEA 5AJXA 5GJVC 1LC0A 1UKEA 4CTOA 1GA1A 1E1CB 1LWOA 5IYZB 3MD0A 4AJKA 4FMDB 3KU1A 1OQAA 2OM6A 1ZJ4A 3PFKA 4MA0A 2XKKA 3D7RA 1G55A 1A9QA 1NXQA 1VBMA 4ENRA 2ZYGA 4MWEA 3RUAA 2IS4A 4NZPA 1MQSA 4QTUB 4XOIA 2ZJOA 1U2DA 3IKVA 3NQ41 3FMGA 5M34A 4NFLA 2FR8C 2H92A 5EZYF 3FTEA 1MC1A 1WUTA 2AXEA 1MHTA 1T5SA 2C9BA 3OZBA 3LCUA 2YNMC 2CNOA 5IP5A 3AHHA 4N0PA 4RLQA 4F11A 2ARKA 4MS3A 4S35A 2Z8XA 4OX9Y 3SCZA 4ENPA 2DAPA 5HEKA 1XMJA 2RHJA 3PD1A 4ZOLF 5CK4A 5C1PA 1T8SA 1M5UA 1S2IA 3L7OA 3JQFC 1I36A 1II8B 1X2BA 1YS9A 4Y6RA 3SOPA 2UUAB 1QR6A 3H75A 2XWSA 2GEUA 5B5SA 3RSQA 5IRCD 5CYOA 2NT4A 5IT9A 4YRTA 3NOXA 4R9SA 1UH5A 1Z4PX 1VE3A 1M8JA 1J8YF 1S2MA 1JQ3A 1XXHE 2P4EA 2ZIZA 3A3OA 2UDPA 1N2OA 4Q9KA 4TZ0A 5A02A 2H9YA 2C59A 4FMCF 2HPVA 2NUTB 1JPNA 2NAPA 3LDAA 1DKUA 4JA2A 3ZDBA 2AJLI 1JHPA 2BFFB 2H06A 2B4YA 3QU4A 2D3TA 3A4IA 3ANXA 2AC2A 5FPQA 5B58T 3IODA 5L3ZA 3TQHA 4FX2A 1K88A 3UQYS 4B48A 5BV2P 5JS8A 2X7XA 1U28C 4IKOA 5ILGA 4CGZA 4R8SA 2IV3A 5CLQA 2YMMA 4PICA 3S8YA 1QIMA 1RKQA 2C5FA 2DRIA 2F9FA 4P83A 4QREA 4BP3A 2IWHA 4ETWA 4BOYA 4EGFA 2CGEA 4U2EA 3V48A 3PBKA 2Q5FA 4D56A 1X9GA 4AJOA 1XTBA 3IPYA 1UDBA 3F97A 1SNYA 1QGUB 3BF8A 3EZNA 5HP4A 4F6RB 5EIAA 4CIWA 1O5TA 1I33A 3O0DA 3DVLA 2QGNA 3HI6A 1I0ZA 2FFJA 2JZOA 4KZKA 1JEOA 4UDXX 5TQJA 3WK8A 2P78A 1SPXA 1DXHA 3D4BA 5DP2A 3U6KA 4XIIA 3C85A 2QTNA 5BP7A 4AY5A 5T6MA 3DTNA 5K0BA 5AR1A 1QM5A 1VLZA 4B6GA 4C5AA 1NJ5A 4G01B 5DW3A 5HMMA 1O08A 1Z5WA 1DJNA 1NR5A 4RTLA 5LWQA 1A9SA 2HT6A 3WDSA 3WHPA 1XDGA 1Z3IX 1VG1A 2ZBVA 3M89A 4F1KA 3UK7A 3VSBA 4AF6A 1OMOA 2ZJ5A 3HL0A 1E5TA 5EL0A 3PQ4A 4IJKA 1XPUA 3O31A 4W7HA 2B9EA 5GM1A 1N57A 4GMFA 2RE8A 3MQ4A 5EVCA 5AT1A 4QU9A 2WOOA 4H1HA 4YJHB 5EJ5A 1J7JA 1O4WA 4IV8A 5F5NA 3GO4A 5J59A 1JJIA 2QRLA 3PX2A 1KDVA 1E9VA 3WLMA 4F1JA 3CS3A 4GP7A 1ZW1A 1BCRA 5C5CA 1GCUA 2HF2A 3AFHA 3THYB 3M6XA 1YT5A 4ND1A 3RRJA 5ISMA 5AM4A 3NNNA 4K6MA 1X87A 4IIXA 5DHFA 5EUBA 4AI6A 1PCXA 5KINB 1Y6ZA 1PT5A 5A1TA 1IM8A 2JLCA 3T99A 5ERGB 3NFYA 4CMIA 1SM4A 4LHSA 1B23P 4A36A 5BWNA 4F97A 1XPOA 5AQEA 5GZ6A 5AJWA 1JIKA 3Q9UA 4PFQA 1FLAA 3IQIX 1ZNWA 4J8PA 4GE3A 2Z8YA 4YP0A 3GL9A 5IXSA 2EJBA 4A3SA 3AEZA 3MB8A 1V45E 2A0YA 3OE5A 4E03A 3GUHA 4E3ZA 1QNFA 2ACVA 2G9NA 5I9LA 4TTVA 1TMYA 3A11A 1EQ2A 1P4JA 5HIKA 3K3PA 1XJWA 3GGGA 2OHFA 2RARA 3H9QA 4FKMA 3OESA 3CEMA 2HXGA 1P1FA 2WDPA 3CC8A 1JALA 4FSDA 4MW5A 2OG1A 4NR0A 5FUXA 3UK2A 4JBWA 3ZDQA 1JG1A 1G9SA 3HCNA 3EEFA 5EN4A 1QPGA 3L1UA 3ZV5A 3NT5A 4R9RA 4HPWA 1RKUA 2BEJA 2JFWA 1UZMA 3EW9A 2ZYUX 3QKSA 4X20A 3MTEA 3N6RA 2PV0A 1G5RA 2JAHA 4O1MA 4B43A 5I51A 2VUTA 3TZEA 4KPEC 2Z08A 4DLLA 1LPOA 2WT8A 4M9XA 4NYIR 3D0RA 2GETA 2OGZA 3FPKA 4YAJA 5L95A 1O95D 4OXKA 4QOSA 1U1DA 2G9QA 2CVHA 1G5TA 2VDPB 3KWJA 4XQCA 4R7GA 1JBKA 4E14A 3IOBA 3NO4A 4ND5A 4MH0R 4NNJA 3PFBA 3HY4A 4CNBA 4J3JA 2ERYA 1Z6TA 3ZIAD 2H63A 2PLWA 5KDDA 1JT2A 2VA8A 3GZNB 3KG2A 3VZDA 3TOVA 1EB8A 3V2UA 4GSLA 4HL6A 5DBGA 5BQFA 2I3GA 1WVGA 2OG2A 3C4VA 5DXJA 3RH0A 2XJ9A 1GFIA 3ZYCA 4YIKA 3L40A 5DGDA 3FSGA 4P82A 1G8AA 1E2DA 4YHBA 4ARCA 1UUFA 2YINC 3VU9B 5JZMA 3KJNA 3VO9A 5IULC 3MG9A 1Q44A 4Y2VA 5DM60 4IWNA 4AYWA 1R2QA 4Q00A 1N8KA 4P4LA 5EP4A 1U9CA 3BXOA 3ZLVA 3F74A 2YRWA 3R6DA 4KYIB 4OYHA 5TMPA 3ICOA 2NW6A 3DBHA 3HSSA 3I01A 5FWDA 1TM1E 1VE6A 2XDQB 3BRWA 3KTFA 4U0KA 5JSKA 3T5GA 3GLGE 1YR2A 2HA6A 2QT1A 5SZKB 1K5HA 2H51A 2W6MA 5F2EA 1QFJA 5F5LA 5AVSA 3EXIB 3DM9B 4ZOLB 1GPLA 3VOTA 3TSAA 1QIKA 4GPD1 1RPTA 3NGLA 4NE9A 1GU1A 4GBGA 1D1QA 5FA8A 4M0FA 5U4QA 4UBLA 4M89A 4RY0A 5K3AA 2QSUA 1L5WA 1QHHA 2RH4A 4UUQA 2NG1A 5K1ZA 4ARZA 4DCSA 4LYEA 2BMAA 4JT8A 4TXMA 3ZE1B 3WMGA 1W0JA 2F3QA 4HNVA 3K70C 1AKUA 3KHSA 1XCMA 2WHPA 1Q2UA 2H5EA 3EH1A 2F43A 4EG3A 3TMKA 4NC9A 3GJ0A 3E9MA 4HEA6 3Q85A 3HY6A 1G4HA 1IONA 3FKSD 4DCGA 1KY2A 4A03A 4LF6B 2QQFA 1A5ZA 1G20E 4L74A 1IVNA 2GUGA 5HIJA 2XTZA 2GZHA 3EIUA 2O3RA 4Y0NA 4QUJA 2JLUA 1VJ1A 3D6JA 3BGIA 3F8TA 3UGQA 3VPHA 5MDHA 3O2SB 4C5BA 1AK9A 4PSVA 2C98A 5KSZA 3AHCA 4BB9A 1ZUIA 2ZSBA 4HDRA 2PSSA 2R2GA 1E1MA 2WV7A 3M7IA 2VXBA 1EDOA 1WQ4A 1DJMA 2GGSA 3IB6A 2V7EA 3KR9A 4UPDA 1GPKA 3H8SA 3M82A 3TECE 4PQFA 3ODGA 3TOXA 3H5LA 2IY9A 3DE7X 1RCFA 2CXSA 2IPAB 4RE6A 3SXPA 3SZOA 3TR5A 2W6JA 1Z3CA 3WWYA 3ZWVA 2G5GX 4TT3A 1XD8A 4D3YA 1ZCAA 5REQA 3UHPA 1DX9A 1Z0JA 4LRYA 4JHXA 5CA0A 3ICCA 2OV1A 4B6OA 1YIAA 4JWTA 4Q3BA 4YRMA 1J49A 5ALJA 1F4PA 2P2YA 4HRAA 4RVOA 3ZHXA 2VJAA 4ZT2A 2JFZA 4NZOA 3I2YX 3TCKA 2I7XA 1RHJA 1Z2NX 3Q1KA 1JPUA 2FJPA 3IBFA 3CLRD 3OT1A 1AZTA 3EW7A 1RBMA 1QO7A 1WG8A 4YPVA 1E3MA 1O97C 2H4ZA 3FMIA 2EJUA 5CPFA 3JCZA 1EH5A 2QAGC 1MX3A 1R4AA 4G4SO 3P4XA 2HLDA 2W2KA 2G3YA 1Z5VA 4YBZA 3T4UA 5IT5A 1NBEA 3F7MA 5LQUA 2QX7A 4CL8A 1RZ3A 5HRCA 3GVCA 4HATA 1E4VA 1QCCA 2EWMA 2R4UA 5JNLA 1LF0A 5FUQA 3MWLA 4MRMA 3B1ZA 3V1LA 2ABWA 1UWLA 3OPYA 3UHFA 4I50F 3G68A 1OB5A 2PXXA 3FH0A 2O5EA 4MV8A 4JHLA 1QV9A 4UTZA 1I2AA 4P81A 1NN1A 1OFUX 2A9PA 1YHYA 3HDYA 3VC3A 1RRGA 1WXXA 1KEUA 3KOOA 4O29A 5C1BA 4NJMB 1EFPB 1KR2A 1RDFA 3WFIA 3HYRA 4AZTA 1JBQA 1G17A 4LMAA 1T3TA 4R1MA 3AV3A 5C46F 3R75A 2VJMA 3CUEF 3BDIA 4KQ6A 4P3OA 5CXSA 3FWKA 2CNBA 3O8QB 1JMVA 5JFTA 5I4IA 2FSHA 1FC0A 2B3TA 4HDNA 5E3HA 2B25A 1JIQA 1VE1A 4IQGA 3OLVA 1GSIA 1OWOA 4F84A 1VKZA 4BGEA 4N48A 1ISGA 4ZCQA 3TFOA 2ZR9A 1XVVA 2NO4A 3C39A 1ZEMA 2AN3A 1UXOA 2QN7A 1V2GA 2Q3HA 3ABRB 1FQWA 4IIFA 1T9AA 3HDQA 2CMGA 5FR2A 1KU0A 4ER0A 2ZS8A 4D74A 2JGIA 3MWGA 1NBHA 1JXOA 4HN2A 4JZKA 5AKLA 1NYLA 2DUJA 1L7PA 2OBNA 3G5MA 1BXGB 1LLCA 1XTSA 2R9VA 4LPKA 1XRNA 4FM9A 1SBNE 4HDKA 5K2OA 2P41A 1M6YA 3KQSA 1EINA 5LM3A 2HTFA 4C22A 2CMFA 5TS3A 1HH4A 3DOIA 5B3JC 5MGNA 5DK4A 1XROA 3Q3IA 3VH3A 4DXAA 3U39A 3JYOA 5A7FA 3GG2A 2XUQA 4WOBA 4AW9A 2OYSA 4PO8A 2AMVA 3FNEA 3HWWA 1MMFB 1IK4A 1JUDA 3CMCO 3KZVA 1SUPA 3BWMA 5TMBA 3WK5A 1SD2A 4RK6A 4DSTA 4II7A 3VNSA 2R8OA 1ML4A 4BNXA 1TUGA 4BRWA 2QG6A 1EI9A 3KJIA 1UPCA 1L1RA 1KEEB 4GC9A 1NI3A 2C4HA 1WKBA 4JL8A 4K05A 5KYXA 3I2FA 1C3EA 2ZT7A 4PXAA 3W4KA 2H11A 1NE2A 2MCFA 1Z0FA 2FW7A 1RJ9A 3JAKB 3E53A 2GPSA 4KXNA 3C3CA 4LGMA 1H66A 2ZAGA 1SCBA 1UKYA 2VCHA 4UJ3A 4DG8A 4FMBB 4IGIA 1C30A 5AWFC 2H0AA 3TLGB 1MLDA 1Q7CA 3EHEA 3O3CA 4PGAA 3JALA 3I3OA 4DC0A 1KC3A 4ARAA 2EG9A 2OXEA 1IZ8A 1E1DA 3DBRB 1K75A 4U39A 2HBRA 2D13A 5FL3A 3RKRA 3WB9A 2G5PA 2O4CA 2CJYA 4C6HA 3GOQA 4Q21A 4BE4A 3IBGA 2WD8A 1P4AA 2AS0A 2J5RA 4JLAA 1BD3A