3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Recombination and repair protein
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
2G3YA 2VA8A 3DOEA 3W8NA 3U5ZB 4IDNA 1KI1A 3PEVA 1WQ1R 4W9MC 4MGYR 3CX7A 4D81A 4JVNA 3LXXA 5FPHA 2QPOA 5HCIA 2C96A 4DCNA 4LYAA 1RVDA 3R9WA 2BWJA 3NH9A 2NTYC 4Z51A 1E79D 4DLTA 3CH5A 4EKDA 2PJRA 4WIAA 2PJZA 4FD2A 2WJVA 2PX0A 2QGZA 1BOFA 2J7PD 2DYKA 3PUYA 1XTQA 2GZHA 3E2IA 4RD1A 2F1RA 3EPLA 4G3XA 3EPKA 4LBZA 3FKQA 1JAIA 3A58B 4DKXA 1K8RA 3VHXA 1NBMD 2ZS8A 2CL7X 4KBGA 2WIAA 4KODA 4O2LA 1YQTA 1Q1EA 1XD8A 4JT2A 4CT4B 3K70C 4KU4A 1W48A 4Q02A 1EFCA 2JLRA 2ZJZA 4QRHA 4DWJA 3BOSA 3R8FA 3SFZA 2AWOA 4DDVA 1Q3TA 1OLOA 1ZM7A 1E9RA 1H8EA 1BYIA 5G3ZA 5JWOA 3EC2A 1F2UA 3AKEA 1QHSA 3VHLB 1RFLA 4D0GA 1TL7C 1XEFA 4P4SA 2FU5C 1F3OA 3RSLA 4B71A 5KDOA 3ADCA 1L7VC 1W4BA 2PH1A 4OBEA 2EU8A 1E2MA 1MKYA 2IC5A 1KI9A 3P20A 2CHVA 4KSBA 3MRSA 2KJQA 3QXSA 5G53C 1E32A 3GLFE 3EW9A 3U7GA 3CRQA 1PUIA 4HUTA 4W5WA 3C15C 4TLDA 3U2QA 5HTKA 1W36C 4F7WA 2AFHE 3QVVA 4UXJA 4AWXA 1LS6A 1AM4D 1Q44A 3TJZA 1XPRA 4C30A 3H4MA 3HR7A 4O0MA 3CLVA 4KFUA 4AC9A 1E9SA 3Q5DA 1NVUQ 4FXPA 1GNQA 1GVNB 1WDTA 4QHTA 5SZIA 4C9BA 1E79A 4CEIA 1M2OB 1COWA 3KZ1E 3AKYA 4LPSA 3LVQE 2YWGA 4A15A 2IYZA 4RFSB 3AF0A 3SJZA 4AYTA 2J7PA 2RGAA 4HAWA 5JSZA 3CPHA 4QBFA 1YZLA 4YMVA 1MRNA 4N3NA 2D4HA 2FGJA 2R6DA 3IIKA 1OB5A 1W49A 4A6PA 5B64A 1G7RA 1NBMA 3J81k 2P65A 3FMFA 2GA8A 2CL6X 4KSCA 1U0JA 4LV8B 4ZI3A 4LJ9A 1XJ0A 1OHHD 1T3LA 3ONWA 2Z6VA 3P32A 3PUXA 2I1VB 3QIAA 3LD9A 4GBMA 1H65A 3BFVA 1G17A 2ODWA 4DRZA 1LF0A 2G1JA 2FWRA 4JVSB 1QF9A 1KDOA 1QG4A 1ZRHA 6Q21A 1ZNXA 5BYKA 4B74A 3CF0A 2J0UB 2REOA 2YWEA 4OK6A 2GCOB 4L5BA 4Q01A 2D62A 2D2FA 4Q7KA 3BB4A 2OXRA 3ZS8A 3K70D 1E9DA 2ONKA 1AGRA 2Q9BA 2GF9A 4TMKA 3EPHA 3B2EA 4TT3D 4B3DA 3SQWA 3BB1A 1IN5A 3ADBA 2ZYVX 4IVRA 4JLPA 4KV9A 2NMVA 1TF5A 1UM8A 2AXNA 3B1XA 3FFBA 3MLEA 1N5IA 2ZRIA 1K5DA 4PHHA 2JLZA 4OYHA 4TTRA 4UNQA 2WSSD 5BN3A 2W0SA 3KUDA 1A7JA 4Q03A 4MDEA 2XXAA 3PCRB 4X8HA 3EASA 2J0QA 1KHTA 1OXXK 1E2FA 2FN4A 4LY6A 4CRWB 1EESA 4RFVA 3OIVA 5H1YA 4OQLA 2CLCX 3IQXA 3EG5A 2JIZA 5HKKA 2QT1A 2ECKA 2OT3B 4PFSA 2ERYA 1NVXQ 2GK7A 3UMFA 3EZ9A 4JYCA 4P4TA 3CR8A 1KO5A 2JDID 4LSGA 4JLBA 2GZDA 3SR0A 4IDPA 4LHZA 1XTKA 1ELOA 2L0XA 4BFZA 2H18A 4AY2A 1P2SA 1KO1A 3QNUA 2H17A 4M1WA 1U0LA 1YJ5A 3ZGXA 2GNOA 1N3BA 1OSNA 2GVZC 2OFWA 5EE5B 2RGNC 2B21A 1I2DA 3BFKA 4RVCA 4URYR 4U7DA 2XZLA 3H1TA 3CUEF 5FPYA 3T1OA 1G6OA 4MRSA 1F2UB 4P4SB 1A5TA 4TMWA 4NMMA 5EP1A 1OH6A 2Q3FA 4M9XA 3EZFA 4NONA 1W5TA 1LS1A 1VHLA 2YOFA 1X1RA 3HWSA 3VU9A 2EW1A 3CZPA 5HZHA 3NBYC 1HY3A 3LX5A 5DO9A 3RS5A 1JXOA 2QM7A 3GFPA 3TW8B 4D4KA 4M1OA 4Q4AA 4XVRA 2ZE7A 3QKUA 2HF9A 4PX9A 2CK3A 2ZRKA 4PZLA 1CEEA 2HYIC 1P73A 1MO3A 4YMSA 4GZLA 4PPNA 2C5LA 2Q9AA 4US1R 1G8YA 3LBNA 1CLUA 1Z0JA 3MWKA 1JAHA 1N5JA 1G291 4Q4HA 2OCAA 4E5UA 1E94E 2ZRNA 3UKDA 4URXR 2XJ4A 1KI6A 1U8ZA 2QORA 4LOAA 1II9A 5JSZB 2WWXA 3ZQ6A 1OYYA 2BHRA 1NG9A 1KO4A 3B1WA 2V54A 4G01B 2FSFA 5JJIA 4MKIA 2JDIA 2CLDX 1D5CA 2H5EA 2FGKA 1SVSA 1QVRA 4EPWA 2OG2A 2PLRA 1J70A 3EWAA 4URUR 3RSOA 3W6OA 3WHLA 2ZXUA 4CEJB 2C8VA 3AM1A 1ZCBA 4HDOB 1NY6A 3MGCA 3B7GA 1R0ZA 2PZEA 3RANA 1EXMA 2CE7A 4YDSA 4LYHA 4NZYA 5KSYA 2A3RA 3GLHB 4ON9A 2GJKA 1IJFA 2IUSA 3PEUA 4TTPA 2CEAA 4XWOA 4BQSA 2OZEA 3QXCA 3T5GA 3ETLA 4Q47A 5EXSA 2XB4A 4EDHA 3M1IA 4I4LA 2IBMA 1VYTA 1KMHA 4HLQB 3GJ7A 3ZIAD 2IHBA 4URVR 1NN1A 3W3ZB 1Z63A 3A4LA 2WJIA 4IEEA 4Q1EA 4M4SA 4V0MA 3THWA 3AVYA 1E2LA 1XZQA 3MWYW 4NBSA 3WY9A 1AQYA 1DAMA 2XOKA 1DG3A 4MQBA 4W7SA 1PV4A 3QXHA 2WIBA 4NYIQ 5KNBA 2GBLA 2KBEA 3SJAA 4JLNA 4IDOA 2OUKA 1NMYA 1ZUHA 1M7HA 3ND8A 2RGBA 3C5CA 3LAWA 3MUFA 3OF5A 1PLLA 3TSWA 4OI2A 3CWZA 5AUOB 2BKUA 2P6NA 2Z43A 4N0EA 2HJVA 3W9YA 2IYWA 5IK2D 2EYQA 3MSXA 5FL7A 3KJHA 4JL5A 3I73A 1R0XA 4Z8YA 2HXSA 1FUKA 1G8GA 1EFHA 1QHHA 2E1RA 2Z83A 4TL7A 4TMXA 3GJ8A 1NKSA 4TMZA 3PJRA 2IS6A 2FSGA 4MRVA 1KKMA 1FQKA 4F4JA 1S1MA 5AWFC 3UWOA 4A6XA 2C9CA 2ZE6A 3IHWA 3AVTA 2IS2A 4A82A 2WPDA 5EXXA 1FZQA 1N0VC 2PMKA 4AD8A 1SXJE 4QKQA 3F3YA 2OBNA 3VU9B 1G5TA 3AQ4A 3DL0A 1G8HA 4W5HA 1DEKA 1GRRA 3GJ0A 4R2IA 4C2TA 3E1SA 3B9PA 5EE0A 2PLFA 3EIHA 4N1AA 1N5LA 1ZD8A 5AUNB 5C4MA 3DZ8A 4LYJA 5A4JA 1VIAA 2RH5A 1G3QA 4A4DA 2GJ9A 4A2QA 1GNPA 1YVDA 4E22A 1G7CA 2IF0A 4K8OA 3FHTA 1V43A 1QG2A 3TBKA 2W6IA 2ZRJA 3IGFA 4NTZA 4JIMA 2O8BA 5FUVA 1KI2A 1I2MA 1Z6YA 3AF1A 5FOVA 3TVDA 2ZSDA 2C77A 3ND9A 1LV7A 1NIPA 3OIUA 2GDJA 4HUQA 2WHXA 5DN6A 4CW7A 1U9IA 5BW8A 4OHVA 4UNPA 2FE4A 2N42A 3D7MA 3FTQA 4ZCIA 1KO8A 3K0CA 3FOZA 3QI2A 1KNQA 5JS8A 2WMOB 4ITRC 3W5JA 4ARZB 4KLNA 4FCVA 4EPYA 2G1KA 2ZVQX 3DM9B 4M9ZA 4BLSA 3O8RA 3FFAA 4PC3A 1Z6AA 2NO1A 1S0UA 2OLJA 1U0HC 4M1MA 2PCLA 2BJWA 1E2KA 4HB3A 1U81A 3N5CA 3KQLA 4AG5A 1E1RD 4V03A 1FP6A 3WYGA 2QBYB 5A0FA 1TU3A 2V7QA 3BAFA 2BCJQ 3QSYA 3EZ6A 5K8TA 2GTPA 3TGPA 4PO9A 2H8KA 3ZVMA 3KUCA 2EQBA 3SS8A 3U6BA 3K0AA 4H9GA 2VIIA 1KDTA 3AVVA 4FMDB 1EWQA 4NYJR 3KTAB 1T5LA 4FN5A 4DZZA 2QI9C 3LXRA 1NN3A 5CDFE 1YZTA 4OHYA 1DADA 3AVUA 5FFMA 5FTMA 1SHZA 2GEUA 4C7OA 2XX3A 3LDAA 4G0NA 3X1WA 4F4CA 3K0SA 1G3UA 5GADl 2NPFA 5J4HA 3KKNA 4X8LA 1KSFX 1RIFA 3X1YA 3OEHA 4C0LA 3W3AA 2X19A 3GLFB 3RC8A 1SVMA 2WJJA 4CZ2A 4LCBA 3IPYA 1II8B 1MOZA 2V1UA 2CLSA 2FEMA 2XAUA 4LJYA 1YZKA 1QHHB 3K0FA 3LQRA 1Z0IA 1TQ6A 3R9IA 2NIPA 2QP3A 2RGCA 4WZBE 2F3RA 1DG1G 1AS3A 2HUPA 5BYJA 1PLKA 3NBXX 4Q1BA 2J87A 5EZ6B 2P2LA 3KQKA 4BZXA 1VCMA 1S8FA 4DLUA 2WOOA 4BEBA 1DARA 1A4RA 1T4GA 2Q9CA 3LVRE 2FZLA 4QFMA 1E1RA 3SN6A 1W0KA 4BRUA 1S1CA 2BMDA 3B5JA 4ESHA 1P3JA 4EFMA 5DISB 2QG6A 4PPFA 2BIFA 1OFTA 1YR6A 4M9SA 3MWJA 2JA1A 1I4TD 4IVQA 1QHYA 3TUZC 1AZSC 3W6NA 2DY1A 1PLJA 2UZ3A 2GZAA 2O8BB 1IY1A 4NCIA 1YHNA 1OPXA 1IN7A 2YV5A 3FKSD 4DXAA 2QA5A 1ESMA 4NCKA 1IN8A 4O25A 4PC7A 4CEHA 2QMOA 2KI5A 4BLPA 3B1ZA 1XWIA 5JI2E 1JXMA 2FA9A 1A2KC 1P2UA 2X77A 4JLMA 5SZKB 2LKDA 3KQNA 4GOXA 1IQPA 1DAGA 2QSZA 1NJFA 3QF4A 1E1QD 2JLSA 4B48A 3GCGA 1KK1A 1RKBA 3CX6A 4PANA 4TN1A 1XU4A 2ZE8A 2YC2C 2F1IA 2ZJOA 2ZR0A 3CR7A 3OHMA 3QEOA 4HB2A 4RD4A 1OH5A 2ZTSA 5SZHB 4UNRA 2OE2A 3REFA 2GAAA 1N0WA 1HTWA 3AP2A 2O0KA 4B6FA 2IWHA 3SFVA 2C99A 4BFVA 1R5BA 1ZNWA 2G6BA 3V00A 5JRZA 4RZ3A 2DFLA 2W6JD 4KFSA 2CNWA 2P5SA 3SYNA 1W4CA 1KOFA 1M7BA 2WWFA 4M8NE 1G4AE 1KAGA 2V8OA 5GJBA 4ILEA 5FUWA 2QEQA 1TU4A 3I72A 1CXZA 1KI8A 3TSOA 3WRXC 4QXAA 2FOLA 3X2SA 1IN4A 1IONA 4DLXA 1Z47A 2A2ZA 1US8A 3VR6A 4OHXA 1E98A 1AZTA 3OIYA 4N0DA 2C95A 4Q9JA 4JLDA 4QBGB 5KNDA 1SVIA 5KO2A 1XNJA 2IYLD 1Z2AA 3D8BA 4Z1MA 4Q7LA 4FWIB 4D0LB 3H84A 2VSFA 4NPHA 4PAMA 4G5GA 2J59A 4MRRA 3K09A 4MGKR 3L0OA 4OQMA 5A5GA 2G77B 3QKTA 4AYWA 5FTNA 4PZZA 1MH1A 4Q9KA 3SJCA 3PEYA 4C7OB 2DFKB 2B6HA 1P2VA 1W47A 3B1YA 2ZRAA 1B23P 3KB2A 4A8JA 4NDZA 1XXHA 1JQLB 4RCYA 2VP0A 1Q21A 2IEYA 2NZJA 3A1WA 4IOLA 3A1TA 3IUYA 5K8UA 4WVFA 2HDNB 5E95A 2JJ2A 4HSEA 5P21A 1TMKA 3ZZUA 2R65A 1UDXA 1HV8A 5JZVA 1M1YE 3TAUA 3K0FB 2G88A 1C1YA 4LK2A 4AG6A 3NH6A 2ZR7A 4XD7A 1GL9B 1TX4B 1GTVA 4QHSA 3SOPA 4D80A 4EPTA 1OW3B 2ZRPA 4FW9A 1ZP6A 2AD1A 1EFRD 3X1DA 1NG1A 4L9SA 4GRAA 1UAAA 5FBLB 1OB2A 1H8ED 3VMFA 4GOKA 3Q5EA 1O3YA 3FGNA 5FOXA 1CTQA 4KO8A 2OLKA 1FFHA 3PUZA 1E2GA 2C9OA 3TNFA 1FPMA 1KNXA 4A2WA 1NMXA 2W6JA 2CVHA 2LKCA 1WBDA 1XMIA 2J41A 1KDRA 1VG8A 1AJEA 2IEZA 3RS3A 2J0UA 4ESVA 2D2EA 4A36A 5DYGA 1QHNA 4WW0A 1ZM2A 4YLGA 3VR5A 3WMEA 4PC2A 1N6RA 2ONJA 2X1VA 3L8ZA 3VKWA 2YC4C 4PC6A 1KIMA 1S3GA 4U5XA 1T91A 2RMKA 5D3MB 4DHEA 1FTSA 1KI7A 1R5NA 2FSHA 3BJIC 3JVVA 3TKLA 2IX3A 2ZUDA 5L3VA 3LV8A 2V4ZA 2F1HA 4HLUA 4QHYA 3UIEA 1JPJA 4MUAA 2ZI6A 4UJ5A 1M74A 4CEHB 5BN5A 4B32A 4LZZA 3F8TA 1COWD 4D0NA 2WWHA 4WZ6A 3VR4A 1R8SA 2CL0X 4D6PA 3SI7A 2NO0A 4BZPA 3QF4B 3VX4A 1G3MA 2GHIA 1Z29A 1DS6A 2EYUA 3GJXC 2N46A 1DELA 2F9LA 2WKQA 1F60A 1DAFA 2YVUA 1D8TA 1XCMA 4NU0A 2RCNA 4OQNA 5C18A 4EQ6A 2GVDC 1GDDA 3IEUA 3A1VA 3QEJA 5HE8A 1HT1E 1ZM9A 2QM8A 4JYBA 5AJYA 2BEJA 4FWTA 4DEXA 1E9EA 3RC3A 2C9YA 5ANRB 3RVBA 3WP1B 1E0SA 4FINA 3CPEA 4MYUA 2VP5A 1EFRA 3B13B 4TTQA 2WTUA 3M0EA 3TW4A 4AKHA 3AUXA 1ESNA 2BM0A 4DIDA 3BFXA 5JBQA 1ZC3A 2P0EA 5GVSA 5JWHA 1U98A 4Q9LA 2BDTA 4F93B 2NZ8A 2QTHA 2VEDA 3KL4A 3T1TA 1XDBA 1US8B 4F91B 3U3RA 2XJ9A 4Q18A 3GLIA 4JBXA 1QHIA 1N5KA 2FFHA 1GKUB 3UPUA 4JKIA 5C46F 5E7MA 2VHJA 2IYUA 3VTKA 1CRQA 1G7TA 4NHOA 5TVKA 2EFHB 3VX3A 1IXRC 4RCZA 1VHTA 1Q1BA 2PMDA 4D4JA 2VSOA 1NSFA 1ZU4A 2ZJYA 3QXJA 5GJWC 3QBVA 4A8JB 1XXHB 4D4LA 3QG5A 1SGWA 4JT4A 5F9HA 2O8DB 1E0JA 4IRUB 2GWHA 3FE2A 2JLVA 2BCGY 1HE8B 2EWWA 2JIZD 3WRYC 2HV8A 5HKKD 1YZGA 5IDVA 4EJSA 1KK2A 5L3RA 3DZDA 4Q1FA 2H1LA 5TDHA 5B57C 3BH0A 2C04A 3GJ5A 3WBJA 1OXSC 4PSKA 4A0FA 1YRAA 1HURA 4NYMR 5JFGA 1KZ7B 5CIWA 1W0JA 1LTQA 4KCGA 3SBDA 2QRNA 2WJHA 3K9HA 5G41A 5FBVB 5IRCD 4CEJA 2OXCA 1KI4A 2ZYTX 4UJ3A 3W34A 5KYKA 1X8KA 4TMTA 3PEWA 1ZD1A 4UNNA 1FOEB 5EXTA 1RE0A 4IJMA 5FI1B 3MD0A 4IHQA 2GBLC 4TYPA 4G5SA 4QL3A 5AK0A 3GLHA 3SYKA 1RRCA 3NC0C 2VQSA 2XNSA 1U8YA 2AR7A 3D31A 4MGIR 2ZJBA 1DTSA 5KHOC 2Z4RA 3NDPA 1B0UA 3Q8XB 2FJUA 1WA5A 3N2IA 1H8HD 4FCWA 5FPSA 3WHKA 4ZPXA 4M53A 1CP2A 2CK3D 2ZI5A 3HR8A 2ZITA 3GEHA 2OHFA 2QMUA 1E9AA 2YWFA 1FQJA 1SHKA 4Q9HA 2ATVA 3RS7A 3TSZA 5CM8B 4LDJA 3DOFA 5AJXA 4QM6A 3RS4A 2A5JA 4LRWA 3SHFA 5CJPA 1YRBA 2XEXA 2ZETA 2IHYA 2ANBA 3U7HB 2DB3A 4OK3A 5TV2A 2JCSA 2ZREA 2W2TA 4PQYA 4QC2A 2W58A 3OE7A 4G5QA 5EUMA 4DC9A 4M22A 2AL7A 1WXQA 3K9GA 3PG5A 4EQ6B 2P3SA 2AKAB 4JL6A 5KOYA 2WOJA 5E3HA 3RRZA 2F7SA 4HAYA 1N6OA 3QKSA 4M1TA 5J47A 3AF2A 4URWR 5M04A 2IL1A 3TR5A 3L0IB 1Z6XA 4DCVA 2FFQA 3EZ2A 2ORWA 2NO7A 5H70A 3WP0A 3WNCA 4JBYA 1IXZA 1NSTA 3P4YA 1R8QA 5J4LA 5TARA 5LB2A 4BWYA 1EX6A 2WM9B 2J45A 4EFLA 4MA4A 1P62B 2ZRMA 1FP7A 2W0MA 3ZQJA 4DCSA 3SU8A 3A6PC 2FMXA 2PBRA 2VF8A 4OL0A 4YXWA 1VCOA 1OYWA 4M9QA 3GLIB 3IBGA 1U9IC 1YKSA 3CO5A 1JBKA 1ZD9A 2J5XA 2JJ1A 3A1UA 4IDQA 2ERXA 2VHUA 1R10A 3AVXA 1H8HA 3K0CC 3FMIA 4A1FA 1W46A 4IOKA 4EUNA 1BO6A 4OQXA 3B8HA 2AHOA 1OE0A 2E9SA 5KTYA 1G19A 2XOKD 5BQ5A 4DLZA 3CZQA 1CBUA 2CCKA 2Q3HA 3BGWA 3K8YA 2JEOA 1XMJA 4NYIR 1EWRA 2R8RA 1N6KA 3HYTA 4EJSB 1R2QA 1ZM4A 1TADA 5JRJA 4GPTA 1IAQA 2QMHA 2HCBA 3O47A 3BIFA 5FTKA 2R6GA 1SVLA 1AN0A 3OZXA 1JPNA 1G3IA 2A7QA 2IYYA 2R44A 2VP9A 3GJ3A 3T61A 5FL7D 4BLRA 3BK7A 1GRQA 2X2EA 3VR3A 1Q1QA 4Q4JA 3C7KA 4UNSA 5H8WA 3JZAA 4MDFA 5FR1A 2JLUA 1Q0UA 3IILA 1T6NA 3OEED 4ARZA 3IO3A 3CRRA 4Q48A 1I4LD 3MAAC 3WYAA 2O8CA 3CBQA 1W2GA 2FPKA 4LI0A 3SQXA 2Y8EA 4ZDKA 4QJ3A 1QHXA 3CRVA 2WPDD 4C0HA 4DT1A 2WV9A 4IVPA 2OFOA 2P6UA 4EAQA 1FNNA 2H7VA 5EE9A 1G8PA 1U99A 1QDEA 3EC1A 1YR9A 2ZSEA 3FMOB 3U3KA 3SE0A 4O3MA 1NIJA 1K5GA 3I8XA 4JLKA 1XMSA 2QBYA 2WAYA 3I32A 1Z0KA 4P3YA 3PENA 5DI9A 1II0A 1T8UA 1F48A 1OXUA 2PX3A 1G64A 1QRAA 3R7WA 3NXSA 3LQQA 2QPAA 3D6TB 2VH5R 1ZUIA 3HYRA 2GCPA 2ZI7A 4AI6A 2W6ID 4WBSA 2C98A 3KTAA 3HPQA 1IHUA 1GUAA 5TXGA 2PCJA 1KTVA 3QE0A 5KSPA 1NI3A 2G0NA 3U3MA 1T8TA 3NC1C 4R2HA 2VP2A 3VAAA 1Z2CA 2HJGA 4MYHA 2IXFA 1XMVA 4NCNA 5DN6D 4BFUA 1MR3F 3G5UA 5CK5A 4DCTA 3TH5A 1OKKD 2QROA 221PA 4US0R 2P67A 3P26A 1ZUNB 3AP1A 1VCNA 2ORVA 5KSOA 2OM2A 2BJVA 2Q6TA 4HAVA 3GLFA 1AKEA 2Q21A 3QKSB 1IY2A 1UJ2A 4TSFA 3ZVRA 5JHHB 2YKGA 4DB2A 4DJTA 1JR3E 3IIMA 1II8A 5FOUA 4YC7A 3HU3A 3S1AA 4HATA 2ZSAA 1SVKA 1DAHA 1YZNA 4RZUA 3TIFA 1HYQA 3OEEA 1GRNA 3EIQA 3LX8A 4LJ7A 4Q1DA 3HP1A 1UEJA 5CLLA 2FV8A 1XJCA 4CT5A 3ZYCA 1JECA 4HB0A 5C4GB 1UKVY 1R0WA 4DSUA 3T34A 5BXQC 4C3ZA 5DE3A 1NP6A 5CIQA 2HLDA 1ZNZA 1XEWY 1MO5A 2PZGA 3LWNA 4DB4A 2V7QD 2YINC 3CNOA 1E2PA 1XEWX 2PT7A 1Z6GA 3BC1A 5DYIA 1E2EA 5HPYB 1NNEA 3NVAA 4XVQA 2BBTA 4G1UC 1N6NA 1S3SA 2AKYA 4M1SA 2OESA 5DI3A 5KUTA 1L4YA 4B3GA 3K0EA 3FHOA 3AVPA 3SEAA 1U90A 1E99A 1OFHA 5E7IA 2VHTA 4KLZA 2LWIA 4BASA 2ATXA 3QENA 3MCAA 3BD9A 2QNRA 3BBPA 3HU2A 5TB5A 1E2JA 1XPUA 4JVLA 4V02A 4B35A 3CRW1 5FTLA 1D6JA 2Q3MA 3FVQA 4JBWA 1SZPA 3OEHD 1LFDB 4IOMA 1VG9B 4AKEA 2CCGA 1G3RA 1ZJ6A 1L2TA 2WICA 3IKJA 1OKKA 5UKDA 5LPNA 2R9VA 4LGMA 4FMDF 4Q4JB 3RWMB 1KDPA 2B8TA 2MSEB 4YONB 3IQWA 2HYDA 2YWHA 4M2LA 1NKTA 4TYNA 4BPBA 4V0NA 3PQCA 3R9XA 5FBQB 2BMJA 2WKRA 2O8CB 2ZJ8A 1MV5A 2KE5A 1KJZA 2R6AA 3RRYA 3QXXA 4KITB 5JMTA 2EFDB 1ZMXA 3OAAD 4FMCF 3AKCA 1W4RA 1IBRA 1Y63A 3K09C 4ZKDA 3GLGE 1ZU5A 1VECA 1PUJA 4DT1B 3CRMA 4OHWA 1O87A 4ZCMA 4XSHA 1M6NA 1RRGA 3QY0A 4TLBA 1CIPA 1KI3A 4LPKA 4TMVA 1W44A 5DHFA 4ZV4A 1ODFA 4KYIB 4URZR 1W36B 2ZYUX 4A8JC 1W0KD 3ZJYA 2VSXA 3KFVA 4DBLC 1ZVQA 2BBSA 2REXB 4QNMA 3UWKA 3KXLA 3T35A 2OEPA 2IK8A 3KJGA 3R7WB 3NHBA 4V0LA 1YR8A 4BGDA 1WF3A 4MYCA 1FW6A 1MO4A 1DO0A 1VTKA 4LWZA 2FPLA 3OFNA 2FH5B 2VP4A 5GJCA 4BECA 3JVUA 1BYUA 1G16A 5L3SA 2OV2A 1UKZA 4MRPA 2IUUA 5KU1A 4NCHA 4RZXA 5FOSA 3ZVNA 1E2HA 1HQCA 1N6IA 1ZW6A 3F0TA 3FDIA 3TAHA 4RKEA 3QBTA 4D82A 5JCZA 3G0HA 1XPOA 1ZIPA 1P6XA 3UMSA 2C2HA 1G21E 2Z4SA 1HT2E 5CYPA 2IXGA 2OBMA 3AF4A 3L2OB 4B2LA 3MWLA 1KSHA 5HZKA 1JEEA 2NG1A 1SQ5A 2DHRA 4OKSA 5AR1A 4B75A 1JJ7A 1KO7A 2DBYA 3JZMA 3S1AB 4ABYA 2AD5A 2EFEB 4B43A 4BLTA 2QGNA 4MGZR 1GIAA 1Z07A 4YMTA 2DFNA 3V9PA 2ZAMA 4ERNA 2BEKA 2H57A 2XNDA 5AUPB 1ZBDA 1N2CE 4MYTA 1CR0A 4NP6A 1P9WA 4CIDA 4HLUC 3A1SA 5CYOA 4B33A 4LC1A 3OAAA 2GEDA 1XD9A 2CNWD 4C0JA 1LVGA 3DKPA 3VR2A 3CNLA 4GZMA 1M7GA 3DO6A 4JJKA 3VNVA 3BERA 5AUQA 1SKYE 4JLJA 2MSCB 2I4IA 3Q3JB 3CF2A 5DI3B 1DE0A 2NQ2C 1G5RA 4C0SA 1GKYA 1F6BA 3F5FA 3RWOA 2IS4A 1TQDA 4Z1MD 3D3QA 3I3SR 2JATA 5D3MA 3THXA 3E5HA 5CITA 1Z28A 4BEJA 4L4UA 1XEXB 1KSJA 3TK1A 5FBWB 1P9RA 1HA3A 3EA5A 4Q7MB 4AKGA 3GEIA 3Q85A 3WMGA 1XTJA 3VNUA 4QJ4A 2ZRBA 1DAEA 1N6LA 4Y0VA 4PAQA 1KMQA 2A78A 4E07A 1G7SA 2ZS9A 3GFTA 5KNCA 2F43A 2IYVA 4QJ5A 2P5TB 2JJ2D 3PFIA 4NYJQ 2VTKA 2WBLC 4ACBA 3SZRA 1R6BX 2J0VA 3KFXA 1PZNA 1NBME 2VL7A 4ZCLA 3WYFA 4XD7D 2VF7A 1Z0DA 4E03A 1A2BA 2YYZA 4IOJA 3SJBA 1WRBA 3TRFA 5D3QA 1XZPA 1NN0A 5CM9C 1FL9A 3T12A 1P60A 1G4UR 1OIWA 3ZZTA 3T1QA 1RPZA 1OJLA 3AVOA 2A5FA 4EPXA 121PA 1E2IA 1SVOA 1NF3A 2OSBA 2QE7D 1XFAA 4GFDA 2H92A 2NO9A 1KYIA 4PXAA 4BFYA 3DHWC 2ODBA 2W00A 3A37A 4IEIA 2WSMA 4XIGS 3VKGA 1ZC4A 2VRWA 3DMDA 1LNZA 3I4LA 1BKDR 2GJSA 3C5HA 4DCUA 1GWNA 3AF3A 4R71A 5DGXA 1XTRA 4EJSC 1TF2A 1CJTC 1Z6TA 4M21A 1GKIA 5FOTA 4UXIA 4BFWA 1D9XA 3U4QA 1OXVA 4JSYA 3V4FA 1OIXA 5JLJA 2RHDA 4LC0A 4GI7A 1MO6A 2J3EA 3GFOA 4GOJA 4P31A 5L3SB 3I5YA 4XVUA 4M1KA 2EVWX 3PVSA 1BS1A 3W5IA 5IT5A 4C2UA 4A9AA 3EIEA 5F9FA 1SXJA 2VYFA 3I8SA 5HCNA 3L82B 2O8DA 1DPFA 5JHGB 4B3CA 3P1JA 2J0SA 1NVVQ 5LBIA 2FSIA 3L0SA 1NLFA 3TMKA 3BXZA 3TE6A 4D25A 3BH7A 3Q7PA 1WE2A 2MSDB 4JZKA 3C8UA 1EK0A 4C0AC 4DLRA 3PITA 5FBRB 2QP4A 2CMKA 4FIDA 5FI0B 1CRPA 4EPVA 2BBOA 2I1QA 4RZ2A 4TLEA 3EX7C 4C4PA 3FB4A 1SVWA 2QN6A 5K8IA 1W7AA 3CPJB 4QGHA 3GJ6A 1HQYE 5FR2A 2RHMA 3ZS9A 1GP2A 1T9HA 5FPKA 1NLZA 2QE7A 5DH9A 2ODNA 1PJRA 2X2FA 5DHAA 2FF7A 3EA0A 1RJ9B 1GITA 1U94A 3BRWD 4KBFA 3AB3A 4HLCA 3ZH9B 1CS4C 2XTZA 3CONA 2AK2A 4V0OA 1F2TB 4LHWA 4CVNA 3NG1A 1VIYA 3U6KA 4F4IA 3THXB 5EZ5A 2IUTA 3AVQA 2R62A 4HDCA 3IDQA 5CK4A 2V55B 2GK6A 2H16A 1YR7A 3GEEA 2W2XA 4JL8A 1E4YA 1AGPA 4EPRA 2J7KA 3TQFA 4JLAA 1VG1A 5KSZA 2QUZA 1XP8A 2O52A 3HU1A 1GSIA 4S2EA 2IWRA 2TMKA 1U8AA 3FWYA 1KAOA 3LW8A 2F43B 3C14C 3ZVLA 4C0QC 1W2HA 3BB3A 1N25A 3B85A 4XSGA 5J40A 2WVJA 2QSYA 2YHSA 3U44A 1OH7A 2CHQA 4B3FX 4YDHB 2WJYA 1HE1C 5J4KA 4Q4LA 3NHAA 3A4MA 1UKEA 5AJVB 1EGAA 2JGNA 3KQHA 1M34E 4I1OA 5AJWA 2OAP1 4LJ6A 1QHGA 4JLOA 2UKDA 1G5PA 5CDFA 4B34A 1W0JD 2GESA 2CBZA 3KJEA 4II7A 4QGGA 5CB6A 3AH8A 2IYSA 3GQBA 1EG7A 2J9RA 1J99A 4TZ6A 2P6RA 5FTJA 3IO5A 2OAQ1 1D9ZA 4LBVA 5JEEA 4TYWA 4IKEA 2QAGA 2KSQA 1UBEA 3LBIA 2VO1A 4D2IA 4DSOA 2R6FA 2ZVPX 4A0RA 2QY9A 3O8DA 3Q72A 2ZAOA 4HDQB 1ANKA 3CB4A 3E70C 1S2MA 4YMUA 2C03A 2EFCB 2ZQ5A 3U4QB 4GP6A 4CDGA 3Q7QA 1XTIA 4IFEA 4RD3A 2G0TA 4V0ME 4EIWA 1F5NA 1CJKC 1ZINA 1GOTA 2YOGA 2V6IA 1J2JA 2FDCA 4P33A 3LW7A 4RSGA 1S9HA 5EE1A 1SXJB 4Q1AA 4DEYA 1TPZA 4MKFA 1XJQA 3KKOA 3OE7D 3LO5A 3THYB 1R0YA 4W5JA 2WZQA 4LBWA 2V3CC 1UBGA 2OBLA 3VQTA 3QKRA 3AP3A 5G3YA 3BE4A 2DCUA 4B47A 1J90A 1Q20A 1OV4A 3AKDA 4YQFA 5JEDA 3AEZA 1XRJA 4QGFA 5TY0A 2ZJAA 4PQFA 1FMJA 3L43A 1EFUA 4WAUA 1FNMA 1G41A 1DVRA 3TLXA 4Q9IA 2ZYWX 4JVMA 3THOA 3I61A 3FMPB 3EARA 3ZLJA 1LW7A 2IYRA 3LLUA 1W5SA 3IHLA 4K46A 2ZRCA 5AJZA 1N6PA 4XH9B 4I1VA 3EPJA 4E09A 2ZU6A 721PA 1X6VA 1E9CA 4HZUB 1C4OA 2RB4A 4PO8A 3FPAA 2GRJA 4RD2A 4LJ8A 1U2RA 3HDTA 5C1BA 4YXWD 1VKJA 4J0QA 2CDNA 4C0BA 2YZ2A 3AGPA 4F38A 1NLYA 3LH5A 2JJ1D 2D3WA 1X8LA 1VG0B 2DFTA 2A5YB 2O0HA 3NBFA 2WJGA 3GLGB 3KXIA 5IF9A 4DLVA 1RRPA 4NCJA 1OFUX 3DDCA 4B3XA 4TYQA 4GNKA 4OI4A 3GMTA 3ADKA 1Q3HA 1CULC 2AN9A 2PEZA 3EXAA 1FUUA 1CJUC 3RLFA 4XJXA 2RGDA 1ZIOA 3DVLA 2ZS7A 3SBEA 3SC3A 2O8EA 1CU1A 4HAZA 4Q7JB 1W4AA 4TL9A 1P5ZB 3RRNA 2B7BA 3A8TA 1L8QA 1OF1A 4PR0A 5EP2A 1G1MA 3ZD6A 1KK3A 5J4YA 3U44B 4P32A 4BLQA 2XTNA 4RD0A 2BC9A 1TUIA 2A30A 4Q5IA 3CKLA 1KY2A 2DWQA 4TQAA 2DWOA 4QBHA 4ZDJA 2ZIAA 1GFIA 3SHWA 2GXAA 3MG9A 1D2NA 1ONBA 2A5GA 2BM1A 1YE8A 5F2EA 3SDZA 1KJWA 1L4UA 2E87A 1P75A 4B2IA 3KKQA 4QG7A 2FFAA 4LHXA 1NRJB 4OI0A 1FX0A 1GL6A 3T15A 1S9DA 2N1BA 1QZXA 4KHZA 3X1XA 5EUQB 4BZQA 2ODEA 3B6EA 2O0JA 4LJAA 2FZ4A 4RKFA 2D7CA 1AK2A 2QAGB 5FUXA 3T06B 2D74A 3W90A 3WNDA 4OJKA 3RRMA 1N0UA 1W36D 4PSAA 2OO7A 4NYMQ 4OQFA 5DNYB 4OI1A 5FUYA 3RS0A 1T5IA 1G20E 2I3BA 4B3BA 1WMSA 2ZI3A 2RGGA 2QL6A 3QVUA 4B44A 1BIFA 2D06A 2UVQA 3CW2A 3EWSA 1GILA 2CCJA 2GCNA 2GJAA 1OHHA 2YJTD 3H86A 1E2QA 4KAXA 1WB9A 1E2DA 2DWPA 3GD7A 2ZUBA 5L3QA 3AUYA 2QU8A 2AK3A 3G82C 2QAJA 2B8WA 2QQ0A 3DMNA 4DSTA 2QPTA 1X3SA 1SKYB 2XZPA 3PIRA 3KKPA 1OH8A 2F6RA 2CHGA 1CR4A 4P0TA 3SYLA 3QKRB 4RJLA 2CVFA 5FH9A 4K81B 3DM5A 3T1VA 3NIBA 1P72A 1Q57A 4DDUA 4ZDIA 2UZIR 5B58C 4GSYA 4M1YA 3HPRA 3L8YA 4TSFD 1Q1ZA 2PEYA 1UPTA 2F55A 3IPXA 1DO2A 3DKVA 3IIJA 1LB1B 3O8BA 4G5RA 4TT3A 2JLYA 3QUSA 1E9FA 5BN4A 4JSTA 5IHPA 4MKGA 3KXKA 1X8JA 4TL8A 4IW3B 4TZ0A 3UG7A 4TQUS 2PL3A 4CEIB 2WAXA 1DAKA 2XGJA 4R7ZA 2WSSA 4LV5B 3RYTC 3LA6A 3K9NA 5H68A 2ZSBA 3ASYA 1G9XA 4KXFB 4XWAA 3HJNA 4ZO4A 3PV0A 2K5UA 1N6HA 2CJWA 1E6CA 2HLDD 1MABA 2B7CA 1G8FA 1KY3A 3RDPA 3ADDA 3V4RA 1RW4A 4PC1A 1R4AA 1Z5ZA 3KDSE 2CE2X 4EFNA 3KQUA 3IBYA 1Z83A 3K9LA 4FMBB 5EE3A 3WMFA 3MFYA 4AYXA 5BWMA 2GJ8A 2EFGA 4I1UA 3VKHA 1UBCA 3OIWA 1RRFA 2JJ8A 2F9MA 3GP8A 1AS0A 2HT6A 3PUWA 4Q00A 5KDDA 1UKYA 4CGZA 1P9NA 5JCPA 5EJEA 2ZI4A 4GDFA 3QPVA 8OHMA 1GZSA 4KFRA 4FI3C 5EQTA 4Y0AA 3H2YA 4PPGA 2GAOA 5CLQA 3UANA 2A5DA 4DDTA 5EXPA 3C4JA 1A1VA 1FMLA 4DDWA 2O8FA 1RYHA 2XITA 4S35A 2O8EB 5J4VA 2W2VA 4POAA 4HZIA 2IYXA 5LD2B 1JALA 1NY5A 1GNRA 3VR1A 4Z8XA 4NKRA 4PSVA 1NN5A 1S4QA 1TEXA 1QBKC 2FX3A 2NGRA 5KPDA 1BMFD 2G9NA 3FYHA 1OFIA 3NTUA 4R9UC 3I92A 1J7KA 2GETA 2WWIA 3NBZC 3NWJA 2ZR9A 4PZYA 5LB4A 421PA 1VYUA 3U3JA 4JMPA 1XCGB 1Y3AA 2ZEJA 4B73A 3LLMA 2XXAB 3QPUA 2ZRHA 1R7RA 4OK5A 1JB1A 1I4DD 2QMEA 1FX0B 4NH0A 5GJVC 3WBKA 2HCJB 2QENA 2VLIA 4Q21A 4XTCS 1OT3A 5DSZA 2QTVB 3ASZA 4XOIA 3U7EB 3ZZ0A 5F3WB 2XZOA 4H1UA 1AKYA 1AS2A 4FCTA 1WBBA 1TUEA 1KKLA 4I99A 1CKEA 3RABA 3VFDA 4GMDA 3TUIC 1Z3IX 2OFXA 4L9WA 1VPLA 1KZGB 4I1SA 3W8RA 1TNDA 1XF9A 1P4SA 1PVOA 1NL3A 1GAJA 4QNRA 1IXSB 4TL6A 4DUGD 4A92A 4BFTA 3ICEA 2WKPA 2JLXA 3IEVA 1UFQA 3OFND 4BUJA 1KSGA 1RYFA 3PR1A 5JS7A 1JR6A 1G6HA 5L3QB 4JLVA 3ZD7A 2A9KA 3UMRA 4IDHA 1XEXA 3TVTA 4LHYA 4ASUD 4RD6A 2AFIE 2B92A 4TQ9A 2IS1A 1E4VA 1TAGA 1XXHE 3NDBB 2WMNB 1CF4A 2FG5A 2OCBA 4JJZA 4TLCA 4HAXA 2FPMA 2IXEA 1M8PA 2Q0HA 2QT0A 2JASA 4MH0R 4Q4AB 3K70B 3C41J 2QP9X 2HF8A 4DVGA 1Q12A 2RAPA 2GF0A 4Z54A 1BMFA 1NJGA 3QQ5A 4HAUA 1E2NA 2DPXA 1ETUA 3ZIAA 4TYYA 2G83A 4OJQA 1J8YF 3NEYA 3UATA 5EP4A 3U7FB 2RGNA 3AV0B 3I5XA 4CF7A 4QOSA 1VYVA 2BMEA 3B9QA 2GEVA 2XNDD 3P27A 1IM2A 1Z0AA 4Q4HB 2LCFA 2AX4A 4BRWA 1UDWA 1J8MF 2QRZA 3QOFA 2IA5A 1KI6B 2PT5A 3ZDQA 4Q66C 2CJWB 1P7CA 1TQ4A 1VMAA 4L8GA 1MABB 4NE2A 3BWDD 2ASEA 2ZM5A 1UEIA 3BH6A 3NKVA 5HE9A 3NEJA 1SULA 1K6MA 3RNLA 2VHQA 1HEIA 4PQRA 4KYUA 3N70A 4L15A 1SXJC 2MMGA 2NPIA 3KB1A 3A36A 4WXRA 4LJ4A 4R98A 2HT1A 5JECA 5E7JA 1OXTA 3WXMA 3W6PA 2PZFA 5HR5A 4AURA 1OIVA 5IK2A 2ZE5A 4ZI2A 4PTLA 3I62A 2ZJ5A 4TLAA 2QZ4A 1KJYA 2MMCA 2AWNA 3ECCA 3REGA 3UXMA 3L0PA 1DAIA 4DUGA 1AIPA 1IN6A 1X1SA 1R5OA 4PPQA 3UG6A 2ZRFA 5FPTA 1CR1A 1XTSA 2VBCA 3KKMA 5FL3A 3SNHA 4HLDA 2O8FB 1VDZA 4TWZA 4BLOA 2XB2A 4MRNA 4HYYA 1QVAA 1XD2A 4B76A 2CXXA 4ASUA 3B1VA 5TMPA 4O2RA 2BVNA 1D2MA 2OCYC 2VPPA 2J1LA 4LJ5A 1KMHB 3GJ4A 4DLYA 2HEIA 1ZAKA 4P4UA 4WZAE 2DR3A 4D4MA 5B30A 2GXQA 3B60A 4D26A 2F3TA 2VP6A 3THWB 4JKYA 2R2AA 1ZM3A 2J46A 1YZUA 1ZYUA 1KGDA 3LBHA 2KWIA 2IT1A 2OCPA 4QBIA 2C78A 3DEFA 1JJVA 2GXSA 5SZJA 4FMCB 2JLQA 1YZQA 1E0AA 4BFXA 4U02A 2RGEA 2YOHA 4AKIA 4MKHA 2V6JA 3N2EA 4V0KA 4KFTA 4XWKA 1T0JB 1TF7A 1Z06A 4B2PA 1T3HA 3OESA 3Q9LA 4PAOA 4UKDA 1RJ9A 5G40A 2BV3A 2XSZD 4JS0A 1JR3D 3GLIE 3U61B 1EX7A 1T3SA 1E0KA 2GILA 1F2TA 3QJYA 3O8CA 4ZDWA 3CM0A 4CYMA 1VCIA 3X1ZA 2GXUA 3DPUA 5F98A 1TTTA 4AIIA 1Z22A 2IYTA 4ZIRA 4XTRA 1P2TA 521PA 2WWGA 3RS2A 5CJ2A 1FTNA 2ZROA 2QQEA 1RC8A 4DIEA 5JJKA 5KDLA 1TQ2A 1E9BA 2FEOA 4BE7B 1SXJD 5CB8A 2BBWA 4OHZA 3RHFA 1YU9A 3K1JA 2QTFA 1UBFA 1LF5A 1UF9A 4KJZA 1ZCAA 3I1FA 2OILA 3B78A 3LY5A 4Q19A 4A0GA 2JLWA 4UXHA 2ZSFA 3KX2A 3EZ7A 2ORIA 2QAGC 1E3MA 1XB2A 4LBYA 4UQOA 5JJLA 2IYQA 4HI0E 4KVGA 2YNMA 1XCPA 5K8LA 1NVVR 4AK9A 4BFSA 4B6EA 2Z0MA 1W1WA 3WNBA 1E96A 621PA 4MUBA 1IJEA 4YMWA 3GPLA 1DOAA 1RZ3A 3CH4B 4LYFA 1CJMA 2HXYA 2GKSA 4DLWA 1GL7A 1A82A 1BH2A 4HUQB 3QG1A 4RY2A 2IF2A 3T5DA 1LY1A 4H1VA 2O5VA 4G5OA 4QM7A 2JAQA 4LX0A 4C0KA 1C9KA 4L16A 3ICQB 1DBSA 2XTMA 4GP7A 3GLHE 4KVAA 3P4XA 3AGQA 4WXPA 4X8MA 4HB4A 821PA 4LUCA 3PXGA 1MRSA 2XSZA 1WCV1 1JR3A 1WP9A 4PHFA 2BOVA 1P61B 5J5CA 1NVWQ 1MT0A 2AXPA 2WWWA 2ZU0C 1JQJC 4ACAA 5FOWA 1X86B 3R8CA 5C2JB 1D2EA 1ZNYA 2R6CA 2ANCA 2ZANA 3U3OA 4X8OA 3QF7A 2Z5FA 1XD2B 3KJIA 2ZUCA 3PUVA 4PHGA 4Q1CA 4IFBA 4GT1A 1IOZA 3MJRA 2FFBA 1KK0A 3CIOA 1Z0FA 4QGAA 1EFTA 5L8VA 3BS4A 3AVWA 3RAPR 1AA9A 3MMPA 3K0AB 3TQCA 1Z8FA 3THYA 2SHKA 1T0HB 3LRPA 5JI3E 4IXMA 4NL4H 2IW3A 1HH4A 1SKQA 2BMFA 5DLQC 2BKEA 3K53A 2V1XA 3A4NA 4IXNA 3B82A 3CNNA 3CF6R 1AQUA 1TEVA 1IY0A 3M4YA 4GL2A 1GM5A 2X8AA 3CWQA 2W83A 2F1JA 5ELXA 1Z08A 3FKSA 3CX8A 4U00A 5KPJA 4A2PA 1V5WA 2EWVA 5B2ZA 3TUJC 4LV6A 3FHCB 4A0HA 1XX6A 3QPWA 5EP3A 1JEDA 4DSNA 2ZJ2A 1UADA 1CJVC 4F92B 1NMZA 1S96A 2FNAA 4HZUA 4RFSA 3R20A 5GVRA 4DLSA 3M6AA 4I81A 1E1QA 2RGXA 5LD2C 3LNCA 5E4FA 4WA7A 5JWRA 1XBTA 3EAQA 4PO1A 5DIFA 2KB0A 2ZRLA 2VHCA 3C16C 2WWYA 1E69A 1JI0A 4WOPA 4ZIRB 3U60B 1JNYA 2REBA 2ZRDA 1CR2A 4ZKEA 2KBFA 3GLGA 5LDDC 2ZRGA 4LHVA 4US2R 2ZPTX 1Q22A 3TR0A 4GMXA 3LFUA 1HUQA 3UK6A 2NO6A 2RKOA 3BORA 3MJHA 3H0KA 2NOAA 2D7DA 1GG2A 1G18A 2V9PA 2GCOA 4HEJA 4KI0A 4MITA 4PHTA 4M0LA 2ZI9A
chains in the Genus database with same CATH superfamily
2G3YA 2QOEA 2FZGA 2VA8A 1W6RA 4N39A 4W7HA 4P92A 3BWEA 4IDNA 2QTRA 4TXHA 4WKCA 5FBKA 3PC2A 3ZN2A 2AOTA 3UUEA 5CVDA 4JVNA 4EI9A 1MX1A 2VAXA 4KQIA 5FPHA 2C96A 5ALSA 2FETA 4DCNA 4G09A 4MB0A 4L0MA 4QUGA 3B3GA 4FD2A 3V55A 2IU4A 4PZCA 2QXUA 1GYPA 5EFZA 4BNDA 3QELA 4ZPJA 1YR3A 1BOFA 1Z45A 2QGZA 2OO5C 3HADA 3HBAA 1XTQA 2GZHA 3OLZA 3PUYA 4RD1A 3V8RA 1T2DA 4G3XA 4IGFA 1W1IA 4MVWA 3GZ4A 4A16A 2X1MA 1G21A 1JAIA 5DJ5A 4BDTA 1WVIA 3M1AA 1SEVA 2EX1A 4LISA 3KD2A 3GI1A 4KRYA 2CL7X 2HJ9A 2WIAA 3K16A 1ABFA 4G4JA 4I66A 2WD9A 2FAXA 5EPEA 1SCUA 3FPKA 2B5OA 3I1JA 4KODA 4O2LA 3FYUC 4DVJA 2ZYHA 1YQTA 4GVPA 1Q1EA 1XD8A 3HB4X 4US2R 4ETWA 5GTDA 3K70C 3QE9Y 3EGXA 4Q02A 2GAIA 4IINA 4DLAA 1U0BB 3IEMA 2GYWA 1F8YA 2ZJZA 2DPMA 4WINA 1N2CA 4DWJA 2DKOA 2I78A 3BOSA 4MR8B 4W1QA 5L53A 4G8BA 3R8FA 3S6JA 3P0HA 5FA5A 4BX0A 5J59A 3QLTA 3RYHB 1BYIA 1H2YA 2PM8A 4ZEVA 5B7NA 3KPWA 4C4ZA 1Q0HA 4G86A 1V4NA 5KDOA 3ADCA 1Z7BA 4KZPA 3SQDA 2YJ5A 2HREA 1W4BA 2XY4A 4QQFA 5KWVA 3PR3A 2OAGA 2PH1A 4OBEA 2EU8A 5KAMA 1HEUA 3LT1A 1HFWA 2IC5A 3DV0A 2AOUB 3H16A 4C29A 1QGDA 3OICA 2CHVA 1J7JA 3MRSA 2FPIA 2P9FA 3QXSA 4JC0A 3LL4A 1V11A 3KSDO 3EFEA 1U9JA 3UK1A 4BO3A 3GLFE 4WECA 2RKBA 4AY4A 3INNA 3C15C 4FIZA 5HTKA 5WRFA 4N0MA 2AFHE 5AFSA 3CSSA 2Q0SA 2I71A 2Q28A 4DA4A 3TKYA 1Q44A 3DWEX 4WLFA 2WWTA 1HDZA 1YB1A 5IEJA 2YW9A 3F90A 2HWXA 3ZU2A 3V8BA 1B73A 5LLTA 4ZU6X 4S1VA 1E66A 4PV7A 5PNTA 4AC9A 5LA6A 3IH5A 1SXPA 5HJEA 1GLGA 1YB5A 2HGSA 3HKBA 4FXPA 4QHTA 4UMEA 4WZZA 4XGKA 2JVIA 1VPVA 4AJHA 1COWA 4JJFA 1JHVA 1O57A 3NWEA 2AUNA 3IXLA 2FTKE 4OJTA 3BF8A 4Z5XA 3C3CA 2RHHA 3AF0A 3LMKA 2IYEA 2J7PA 4RFSB 3HA2A 4TT8A 5E6RA 1HGXA 3CPHA 4QBFA 5KTTA 1YZLA 1WQ3A 2FCAA 5K0NA 4D44A 3EMDA 4YMVA 3CX3A 3ZXIA 1RZRD 4BMDA 2OZPA 7GPBA 1W49A 2NXCA 2JFBA 3TNYA 4A6PA 4C01A 5ICSA 3U16A 3J81k 2R7LA 3ZWBA 3D2AA 3FMFA 2GZ2A 1EP1B 2ODTX 5EKTA 3UICA 4MUJA 4IAOA 2P9TA 3ROEA 2GO1A 4DCJA 2JJQA 3IPRA 2WF5A 3GP3A 2R751 3TLCA 4TTAA 3VSBA 3QIAA 5E9JA 1QTQA 3U7IA 1H65A 4DRZA 4BMSA 4YJFA 1LBEA 2FWRA 4KWEA 2PUAA 1QF9A 3QFRA 3UTCA 1TT5A 3DQZA 1YF3A 3OQMA 5DHRA 2Z1DA 2Q4DA 2VPXA 4B74A 2YWEA 1PJAA 1VI5A 2N75A 4OK6A 4RVFA 3QMWA 4C04A 4AP9A 1QVZA 5JXIA 3AB8A 5IZCA 1GDHA 4QXRA 3W5HA 1ETHA 1Z5UA 2I7CA 4AG3A 5ITSA 2PMEA 2HDOA 1N3LA 3HUFA 3HI4A 2ONKA 4BE9A 2Q9BA 3KOXA 1D1TA 3SQWA 4D3FA 4BN4A 3ADBA 2IVZA 1JA0A 1WD5A 3HCAA 2VBFA 1CZUA 2PL9A 2NMVA 1EUDB 2BUBA 1UM8A 2C2BA 3T54A 4RSRA 1K5DA 4RHUA 1U1CA 2WKWA 4IJVA 3PC3A 3GDGA 2L19A 3JQ8A 3K2EA 4CIXA 4Y2XA 2DWCA 1EWTA 5AH0A 3PJGA 2IEDA 4Z2AA 2XE6A 2HWWA 1TGYA 3EASA 3IP7A 2J0QA 3D6MA 1OXXK 1T8SA 2JHPA 3FTPA 3FPBA 4OQLA 1WXDA 2XT6A 3IQXA 2JIZA 1WF6A 3QHPA 4PFSA 3NGLA 4L28A 5MF6A 3OT4A 3UMFA 4JYCA 3UJ9A 3OBIA 1KQ3A 5HFNA 1RWKA 3CR8A 2JDID 3MB5A 2A58A 2M1XA 1KRHA 3A3YA 3DAGA 4EKGA 1NZFA 2L42A 3IOMA 1EVEA 1UFKA 4M9UA 3URMA 3SDBA 2AR9A 2H17A 1N8SA 4M1WA 3O4RA 4U9IS 4CNQA 2GNOA 2OD2A 3I0ZA 3KYDA 2OFWA 2OC9A 2RGNC 5M7EA 3BFKA 4URYR 3UV7A 4HGYA 5EJ5A 2XZLA 1PJ4A 3WWOA 4FR5A 4O2AA 3I9MA 2VRBA 1JKFA 2DPGA 3E9EA 2H06A 6PFKA 2F8SA 4JIGA 4NONA 2IPLA 3DXFA 1RNLA 2GJ4A 4K6CA 5AK6A 3KBBA 2NUTA 2IODA 5ALDA 2XIQA 2ZB8A 5DOVA 1X1RA 2WNIA 3VM6A 3WGIA 5I7SA 5JTTA 1UK7A 1Z6ZA 3PKIA 5JS6A 1KZ6A 1HY3A 4IQ4A 1H3EA 3QGMA 2PBLA 2GPWA 5A2QA 2VWHA 2QM7A 4D4KA 3TW8B 4M1OA 5DU2A 3T9DA 2XECA 5IUJC 3BCRA 4CFSA 2PHZA 4B40A 3AIMA 2ZYDA 4Z49A 4Q39A 1H2WA 2HYIC 4UU1A 1TD1A 3A7DA 2FPGA 4BNUA 4TKMA 2EQAA 1IZ8A 2MYNA 1P1CA 4LRTB 4US1R 4MARA 4OBWA 1G8YA 3CW8X 2O7SA 3E15A 2QTCA 4R2LA 1OXKB 2PO5A 1C4WA 4Q4HA 1YVUA 2WNSA 4IJ5A 4QFDA 3V32A 1G9TA 2IIVA 1CSEE 1WPRA 1XTUA 2FWNA 2XJ4A 1SAYA 3QUTA 3UKDA 3GFSA 3TTXA 5JSZB 1KYXA 4PXSA 1Z33A 4AIRA 3DB2A 3IBTA 1KO4A 3F5QA 1E20A 2I55A 2UYOA 1XO1A 2V54A 3TLGA 4BVLA 5LZ7A 4UCFA 2G72A 4KIJA 3NAQA 3ES9A 1CJCA 4MKIA 5K0BA 1X39A 3WGKA 3ZE2B 2FLKA 1QVRA 3TLKA 3FCSB 4WBXC 4CEJB 1ZH6A 1W581 4ZEOA 1EE1A 1ZN7A 3BICA 3ETCA 1Y4UA 5EKDA 2PQ0A 4UEQA 3RANA 2X8JB 4HUJA 4YDSA 4LYHA 2HGZA 1YBHA 1YR2A 3HCCA 1CUZA 3WRYA 2JFUA 5KSYA 4ON9A 1H9CA 1SCQA 3ZV7A 1JBQA 3KYCB 4TTPA 4XWOA 4A36A 3QXCA 5DCYA 2HO4A 5AW9A 3BTUA 1ISRA 4LMBA 2ZBUA 1IUKA 4M7RA 3X2EA 4KFCA 2O23A 1ZFNA 4RF3A 2PO7A 2NVWA 4I4LA 3HEBA 2IV3A 1DRWA 4HLQB 3GJ7A 4OXRA 4E32A 3ZIAD 1E58A 1JIXA 5IJ9B 2PKCA 1Z63A 1SBQA 4RTOA 3SZMA 5F2KA 5LP6F 1EE2A 3PWTA 5CCEA 1TZBA 3CEHA 1E2LA 1N0IA 1NZJA 3H2HA 2PQ2A 1I24A 2YFHA 1XCOA 1B7GO 1BS2A 2YUIA 3MWYW 4MQBA 1PV4A 4NYIQ 4XRGA 1PE0A 3CUYA 5KVAA 1YFKA 2PTGA 1YQWA 2ADMA 4BVBA 2CXPA 4CLXA 3WL5A 1RJGA 1W73A 3ZDAA 1NMYA 3E4DA 3ZWKA 1M7HA 3NHKA 3ZU4A 2RGBA 2GLXA 3C5CA 3VYTB 3MUFA 4NR0A 3R9KA 1PLLA 3ZU6A 3CWZA 3L7BA 3EUFA 4N0EA 2HJVA 3DAYA 4J7UA 2FQ1A 4QTYA 2MWMA 1OLXB 1H1LB 1EHCA 1TK9A 4F7DA 1C3XA 2J31A 2XCRB 1BDMA 2RHOA 1E4EB 2GBGA 1G8GA 4RXUA 3W5SA 1YCHA 2WVGA 3OQPA 3S8YA 2O6LA 2HV9A 2J3MA 2VUUA 3O21A 4TL7A 4TMXA 4EG0A 3PJRA 1YZ3A 3Q0TA 1Y8RB 1NVEA 3DA8A 2MYPA 2D0DA 3NCTA 3SLRA 1QQ7A 2QLMA 4EUSA 2BFBA 3RC9A 1YA8A 3MPUA 3QEBZ 1YB4A 2C9CA 3IHWA 2HCFA 4GGMX 4IHJB 2WPDA 3Q12A 5EXXA 1FZQA 4I8IA 4P22A 2YX1A 4AD8A 1PDOA 1GZVA 1SXJE 1XP5A 3GLTA 4YYZA 2GZ1A 4QLAA 3FDZA 4IX9A 3RF7A 1UR5A 3AQ4A 3DL0A 4XIIA 1V41E 1Y4DE 5GONF 1NHWA 1GRRA 1RCUA 1RC0A 3GZNA 3HXTA 3O90A 4QATA 4J9UE 3MTEA 3EIUA 4BBJA 4HADA 3GC6A 1E2UA 1V8ZA 1P5RA 1DX9A 4RA6B 4WCVA 5C4MA 4WKNA 3VJRA 3DZ8A 4G1EB 5A4JA 1KMCA 1VIAA 2YIMA 3NDIA 3EDMA 4UDNA 4UFNA 2DULA 2HBYA 4ND3A 1FLVA 2B35A 2VHEA 4JJ7A 1CNMA 1EVKA 2YYYA 4XIYA 4C14A 2QNBA 2EARA 2QTAA 3TBKA 1QYDA 3H9QA 4EQZA 1OA1A 3RVRA 1MHTA 5K99A 5FUVA 2BGIA 2CXRA 3PICA 1KI2A 5LC1A 1HMPA 2F3SA 1PJSA 3HXOA 4YFVA 3LGXA 1UJCA 4B5KA 1ZMBA 2MR5A 3ND9A 4MV7A 1LV7A 2DGDA 4FMPA 1HT0A 1F4LA 2WHXA 4GSLA 4HUQA 4WESB 4Y6RA 5DN6A 4WKGA 2HA3A 1GAQA 3AK4A 4NVRA 5BW8A 3FY4A 4F5WA 2PSSA 5ALEA 3E3AA 3VPCA 1Q1AA 1KO8A 5I7AA 1NV9A 5BQOA 3WJ2A 3A1DA 3ZHQA 4BYMA 1M34B 2J33A 1E77A 5JS8A 5DW0A 4XYMA 3W5JA 4ARZB 1Z0ZA 4X1KB 3H8JA 2G1KA 2O05A 2PWPA 2VPZA 2Y93A 4C7VA 2I67A 4M9ZA 1VKNA 5BSMA 2I4TA 2J48A 2HR1A 1L3IA 3LK7A 3O4JA 3UPDA 3SSMA 4PC3A 1RKXA 1T5SA 1L4FA 2PCLA 2BJWA 1CY4A 1OFVA 1E2KA 2Z09A 1JN0A 5AI9A 3KR0A 1U81A 4YUYA 2NPOA 5I3ZA 3RUHA 2VDLB 1PL8A 2QX7A 5LYJB 3HZOA 5SV2A 2GAJA 1PEDA 3EZ6A 3I2JA 3IUMA 4PO9A 2H8KA 1DUVG 2X0KA 3KUCA 4ARVA 1G20A 1PQUA 3I5AA 3L7YA 2YNMD 1Z4OA 3LSYA 3VNRA 1C7IA 4DTIA 1FRZA 4FGWA 4EG4A 4FFBA 5LMZA 2AZ4A 3AVVA 1O54A 4MULA 3GQVA 3N87A 3V2UA 2H1VA 4DZZA 1NI4A 4LVCA 1PR0A 2QI9C 4H31A 3AWDA 3HCPA 1RVV1 1YZTA 2FMIA 3ZWPA 4OHYA 5E38A 3HBJA 2D2IA 2FOIA 2JIQA 3OPNA 4ISBA 3AVUA 5FTMA 5IWAB 3BWBA 4D3ZA 3PQ2A 5ENDA 5E1DA 6GPBA 2NV6A 3LDAA 4G0NA 4ECAA 3K0SA 2R4UA 1C7QA 1E89A 2HOQA 1LJUA 4LTDA 5FBZA 4AB1A 1NQVA 2NPFA 3ZI4A 3PDUA 2BD0A 1RHQA 1V5EA 2Q27A 4F3RA 3X1YA 1JG7A 3OEHA 5JCJD 3W3AA 1MJHA 3SVTA 3KSUA 4EG7A 2O20A 1M6HA 4FYVA 3O8QB 3BWXA 4LCBA 1MOZA 3H2SA 1AK1A 3VO8A 2HRRA 3D8HA 3QU9A 4J90A 5G4LA 1PVDA 5K7SA 1SHJA 4H7PA 1NC1A 2PT6A 4EMSA 2LGJA 1YZKA 1NUSA 4L2IA 3K0FA 4LXTA 1TQ6A 2BFPA 3AFMA 3DFFA 1VDMA 2EL7A 3ZLUA 2H51A 3PQ6A 4NK4A 1HZZC 4F56A 4XFJA 5I9MA 3LKVA 1YZFA 1W6UA 2VXCA 1FP4A 2GM4A 3NBXX 4LQDA 4IH9A 4JODA 4ZVQA 3LLCA 1GY8A 3C8MA 3B3FA 3WL3A 2R5WA 4HQ6A 1PBTA 4HOYA 4V38A 3KQKA 4HDKA 1RBMA 3GMDA 2QT9A 3WOHA 1VCMA 1I3MA 1QO0D 2X5NA 1EVZA 2RH4A 3IODA 4UDXX 1A4RA 3PQ5A 3R41A 1AD2A 1T4GA 2Q9CA 2FF5A 3LVRE 4NJOA 5KYVA 1NXTA 3CE9A 4FUTA 4YAFA 5H9VA 1S1CA 2BMDA 4DIOA 4EECA 2XYHA 3ZHXA 4BBPA 2R6JA 1BAPA 3N58A 3AG5A 2BIFA 2EZTA 4P83A 3MBIA 3DYVA 1ZOLA 4MS4A 4CN8A 4RGQA 1GPH1 4IVQA 1CC1S 3B9BA 1AZSC 3IAAA 3SM3A 3WKDA 3WADA 3ZU3A 1LBTA 1CRWG 1PLJA 4U5QA 2DH6A 3IBSA 3L8DA 1IY1A 4HXYA 1YHNA 1OPXA 2E0IA 2UVDA 4QREA 2VSNA 3P9CA 3LP5A 4DXAA 3CLUC 3AG6A 4AJOA 1ESMA 3MILA 1IN8A 1ZJZA 4GPBA 4NCKA 2FXIA 4WN9B 2PUEA 2UV8A 3SQOA 1L7RA 4J1TA 5JI2E 1T25A 2H1SA 5D51S 3FTEA 3DKRA 1EAYA 3R3JA 3SYRA 2X77A 1A2KC 2AIRA 4Z9FA 1NC3A 4JLMA 3S2EA 2LKDA 1XCBA 3OUTA 4MWBA 4Q4DA 3KQNA 2X6RA 2V6FA 1IQPA 2W6QA 1AF4A 2XRFA 4QPJC 4WLVA 2C29D 3I2YX 2JGFA 3B3JA 1JKMA 4JH0A 2RKWA 1V5IA 4ZU3A 1OILA 4R9SA 4BTLA 1GL3A 4CG1A 4CI9A 2FUKA 2CXOA 3N8KA 1P1IA 4PANA 4TN1A 1SH7A 3UH1A 1T1EA 3KSAC 1WHTB 1XU4A 2ZE8A 3CVOA 2F1IA 3P52A 3QEOA 4RD4A 3UTDA 1TVEA 3J80A 1ZR4A 2P9YA 2XYQA 3G2PA 3NTVA 2I6SA 3Q4GA 3SKVA 4YPOA 2JFQA 4KAAA 5CXUA 5BNIA 3EAFA 3HVRA 3ZW9A 2IWHA 2C99A 3S1LA 4MWSA 1BJTA 1S2IA 1NJ8A 2R47A 2RAFA 2Z56A 2AG0A 4RTSA 2G6BA 4DR6B 3V00A 2ES4A 6REQB 3M82A 5I8WA 4UBLA 4HVTA 5BSVA 4MR7A 5DN9A 4ZK2A 1M7BA 3ADPA 3GUCA 2V8OA 4EGAA 5B36A 4MUMA 4I9FA 1TU4A 5JTUA 1KI8A 1N4DA 2AQIA 3EMBA 5CGQB 3WRXC 3QW2A 2E55A 3W5BA 1Z47A 1JHRA 1FS4A 5AKHA 1ZVKA 5A06A 5A1JA 1O94D 2C95A 3JYQA 2FB9A 4JLDA 1SVIA 4Y2HA 5KO2A 4DDMA 2IYLD 1NVDA 3LNTA 1PJCA 3CEMA 4BAGA 3QP9A 4FWIB 4OB7A 3FNGA 4QUBA 1FTYA 3TRHA 2ZSJA 4D0LB 2NUBA 3HDQA 1SU6A 3F7OA 4G5GA 5DPMA 3WGQA 1R37A 1A7AA 1YB6A 2G77B 3QKTA 4FFOA 4OP3A 5CP8A 5IUKC 1FMTA 2G76A 4Q9KA 3JAKA 3SJCA 4C7OB 2DU8A 5AW1A 3R3XA 2GN0A 2B6HA 4N8DA 4EX7A 2YFQA 3WV4A 1SIBE 3IIEA 1WKCA 3KB2A 4FFNA 4RCYA 3V7NA 4A8JA 2C0PA 3F1LA 3R6TA 2IFTA 1O89A 1IWPB 1VA4A 2RHTA 4AZWA 3N53A 4UMFA 2Y77A 4KQFA 3WL4A 3VSCA 4U7WA 3WLFA 1ULUA 3BMOA 1CUUA 3KZNA 2JJ2A 4WVLA 1VJDA 5KMGA 3Q9NA 5P21A 3OT1B 4C6SA 4M38A 1Y8ZA 1ES9A 4H3HB 4W5QA 1UDXA 5JZVA 1M1YE 1QIDA 4GX1A 4MIEA 5AKYA 3TAUA 1AB6A 1J2YA 4ZOBA 1LX6A 3PHBE 5CB0A 4ZV7A 5IHXA 4BTEA 2IEBA 3U7JA 4LWPA 4QHSA 2F1OA 4WJLA 1NYLA 1U0SY 4D80A 3DP9A 3DEKA 1OW3B 1CQZA 1DQZA 4UVIA 2AD1A 1OX5A 3LOPA 3T9AA 4AQDA 3PB3A 1XQXA 4KMSA 4W6QA 4R2WA 4KQXA 3HJUA 4A3SA 5BYAA 3RVMA 5CA0B 1H8ED 3VMFA 4RIGA 1G8AA 4NFHA 1O3YA 4KDCA 3SEZA 5B2FA 4I9UA 1KRWA 4KQ9A 4KO8A 4E6PA 2OLKA 2QHXA 5JAHA 2ICAA 3ETEA 4NJEA 4P4LA 2W6JA 5K0GA 3W8EA 1ULAA 1XMIA 3RS3A 2ASVA 3GX1A 2HHJA 2D2EA 4RQUA 4UUOA 5DGTA 4CKCA 2BYTA 1QHNA 1ILWA 1ZM2A 3I4FA 5E0OA 2GPTA 3WMEA 2Q1TA 1N6RA 2IDJA 2ATIA 4L5CA 2YC4C 4PC6A 1KIMA 4QPPA 1YR1A 5D3MB 3ZQUA 1NX6A 1SC3A 2RMKA 3LCJA 1Y6QA 2A9FA 3QWBA 1KI7A 4LXQA 3JVVA 4QLBA 1ZA1A 2VZEA 1L4EA 2VXOA 2IX3A 5L3VA 3GELA 5K0TA 3LV8A 3MERA 5JRDS 3UIEA 5DASA 1QIIA 3ZCVA 2ZI6A 2VA9A 2O2ZA 4CUKA 1W5BA 4CEHB 2X86A 2IH2A 4EB6A 1YI8A 2Z04A 4LZZA 3F8TA 1SWVA 4B32A 1A9OA 1E1MA 4U1RA 1GGEA 3WR5A 3KQWA 2JFVA 3EHEA 2C58A 2GB4A 3M9WA 1EIZA 4UUBA 3RB8A 4EA9A 4RKQA 1X2EA 3BGIA 1TLLA 3QF4B 1X7DA 4XM2A 1Q2UA 1DS6A 1Z73A 4OUDB 5HKBA 1DELA 1DAFA 1HBJA 2GSDA 2Z8YM 4RVGA 2YVUA 4WZAA 1D8TA 1XCMA 2QVBA 2X3YA 3TWOA 4EQ6A 2HWUA 2XUKA 5BWLA 1HZJA 2E18A 3PKZA 1AN9A 3PEFA 3QEJA 4JI6B 2CWDA 2FY8A 3W4KA 1HT1E 3HH8A 4KQ2A 4U9HS 3UJAA 3LUCA 1P74A 5HUQA 2BEJA 3C4VA 3MCWA 4DEXA 1T43A 2E7ZA 1E9EA 3D1VA 3QLVC 5ANRB 3ZGOA 3GLSA 3OQHA 4FINA 2E85A 4MYUA 3TNLA 1PSZA 1KVRA 4F60A 2WTUA 1PRYA 1QCYA 1LRJA 1ADJA 3TW4A 4AKHA 1CFJA 1N2SA 4TV8A 1SBIA 3M2PA 4EVRA 1ESNA 1O1YA 1XWWA 3BFXA 5DYYA 5H82A 1XZKA 4KXQA 4RSMA 5K3FB 4UZSA 3SIXA 2VEDA 5LOVA 3FVRA 3H2JA 2JVKA 3M9XA 5EL0A 1OU4A 1ZD3A 4FR2A 1Q11A 4U7JA 3INRA 1XDBA 3GFQA 3C98A 1GZHB 3DONA 2HSGA 3U3RA 2XJ9A 5IT4A 5EEGA 1NMEA 2FQXA 1KHHA 2FDXA 1A98A 2A35A 4BO8A 2VWPA 3JY6A 3SHVA 2GLTA 3FIJA 2VHJA 3IQHX 5KWJA 2EFYA 1V8PA 4W99A 1ZZEA 3T3EA 4WFKA 4RTPA 3PPIA 3F4LA 2BEWA 2YBEA 5TVKA 4NHOA 2EFHB 5ALVA 1IXRC 3DP7A 1ATZA 2I4NA 1VHTA 2R8PA 3LKZA 4IILA 2AFIB 2VSOA 1ZU4A 2R87A 1K5HA 3QBVA 1T2UA 1XXHB 1IZ9A 4MAFA 4JT4A 4MPJA 1TLFA 4D9BA 2O8DB 4IRUB 4R2XA 1JU9A 3DL7A 4F0JA 3VYRB 3SXJA 4IWNA 2EWWA 2CLFB 5FHRA 5J58A 4KXMA 1PFWA 1ZITA 3WMWA 5IDVA 1AK9A 3HFGA 2Z58A 3Q3GE 1EIWA 1KK2A 3LC0A 3V8VA 1SQSA 3DZDA 3FLEA 3G1WA 3I52A 4XDYA 4KYVA 5AHRA 1AHPA 2AG6A 1BGXT 1E3DA 3G2HA 3M83A 4KH0A 1OXSC 5A7FA 3H5NA 4E3ZA 3WV5A 1TTHA 4NYMR 2ZJFA 5AVQA 3LUGA 4BO1A 4QDTA 3SBDA 3M81A 4FE7A 3R3VA 1R3UA 2L17A 2R60A 1KI4A 1P4HA 4GI5A 4BEWA 3PEWA 2I9KA 3A6HA 1ZD1A 1QRSA 1D8AA 1JDVA 1VGRA 3E48A 4BMOB 5BWCA 2QTGA 2Y1WA 1E3JA 1SOVA 2UUPA 4IJMA 5FI1B 2RB5A 3HB1A 2H4XA 2GBLC 3MD0A 5AK0A 5DGHA 3T4XA 4ALKA 4BX3A 3GLHA 3BKXA 3NC0C 2VQSA 4EH1A 2AR7A 3ITKA 1DTSA 1V6AA 1WB4A 4JASB 3VR6H 5EEHA 3ZDEA 5L6LB 1B0UA 1ULSA 1UWLA 5IT9A 2EV9A 4YHBA 2WQ7A 1BSVA 1H0HA 1KAMA 5AKLA 5KNDH 5IKPA 3GBVA 3ER9A 1V7CA 5KQMA 4X3OA 3WHKA 1FFGA 1YHYA 4KLCA 4ZPXA 5FJJA 5GWXA 1CP2A 2V7BA 3FKJA 3HR8A 3N0RA 5JALA 3GEHA 3RTBA 4B3TB 3DO8A 1FQJA 4OFBA 2P69A 2HNAA 3FVVA 3E7XA 1AKTA 3OJXA 4KQJA 3DOFA 4Q3BA 1DCKA 4H1TA 3SC4A 4C89A 1KC1A 2A5JA 2IZ0A 5EWJB 1YRBA 2XEXA 1VE7A 2ZETA 1RMYA 4FBMA 4UUPA 5D01A 2IHYA 2ANBA 1K3UB 2BFDA 4G0ZA 4NPCA 4OK3A 3RE1A 1B74A 2PUTA 2W2TA 1TJPB 4QPCA 5G4KA 2AC4A 4QC2A 5IP5A 1EP3B 4G0WA 3SHQA 5JATA 1NVBA 4PLPA 1JSXA 3TZCA 2CC2A 2AL7A 4OA8A 2Y05A 2JLCA 5B3KA 4WXEA 4HPXB 3K9GA 4M76B 1XJ5A 4AZSA 2OV8A 3LHKA 4NXNB 3CXUA 2P3SA 3JX9A 5E3HA 1H93A 3RRZA 1DJLA 1N6OA 5J47A 4HQNA 3OA2A 4JFAA 2CB0A 2G6TA 2ZYAA 3QBJA 4LZLA 4PBRA 3SBXA 3ZJ5A 4TZKA 4CMCA 3FWHA 4EGFA 4IZIA 1ZH8A 2EL9A 1D6NA 3LP8A 3PD1A 3IP3A 4Q6WA 1PX2A 4PYKA 1EDOA 4X61A 4BQEA 1DFHA 1VJ0A 1PQPA 4AM8A 1MORA 3BEDA 3WP0A 3EVTA 3BZUA 3PYLA 4JBYA 1IXZA 1Y8QA 2E48A 3QVLA 1NLMA 1GV0A 3E81A 4Q9AA 3M5DA 3JQBC 5J4LA 4PGMA 1ZQ1A 3GIWA 3AFNA 3I58A 3AB7A 3B36A 1FP7A 4DBZA 1VKZA 2W43A 1FW8A 4MRMB 1BDJA 1CUSA 3SU8A 2AW3A 3EFOB 1ZN9A 4ZTBA 4BN0A 2HQSA 3D4IA 4OL0A 3UH0A 3WLQA 4YXWA 1CZOA 5BVGB 1VCOA 4D0SA 1I5RA 1U9IC 5JCOA 2GKOA 5IJAA 3WGNA 2D0IA 3H1FA 4Q3CA 3EQ2A 5CDYA 4WZBB 2ERXA 3AVXA 1R10A 3K0CC 2PSHA 2C7OA 1HDEA 4OQXA 3B8HA 4DV6B 1P18A 2JNWA 1K08A 2QD3A 4AN0A 4N5NA 1G19A 2V4MA 2UYCA 5BQ5A 3PCXA 1Q2XA 2O0LA 3HDYA 4ZO7A 3VYSB 4M46A 1O4VA 3AJAA 1WQ4A 1Y1QA 4X24A 2X3UA 1JWAB 5TGTA 3DE6X 1CBUA 1GZ5A 2RBKA 4IH1A 4RTLA 4V1CB 3JYNA 3I6IA 1OBCA 1T9GS 1WZ2A 1LKZA 2JEOA 1T8WA 3ZTWA 1OI3A 3OZFA 1YCFA 2F3QA 4EJSB 5NLLA 4DIMA 1TADA 3LPMA 2FHPA 4GPTA 4NNJA 1U4SA 1DBWA 2BI4A 2HCBA 1TYCA 3IJ5A 1BQEA 3H5AA 3J7TA 1N1DA 4DA9A 2A7QA 5IVHA 5A3VA 3VR3A 5H8WA 2ZBRA 3C7KA 4YCDA 4L4YA 3BD6A 4UDOA 1TFUA 4RVNA 1Q0UA 1E9VA 1XDZA 3E53A 4DA7A 1FJGB 3MAAC 1JZTA 1YL6A 3CBQA 3GGCA 4EFKA 3SBOA 1F9EA 1BVHA 1DJQA 1KEVA 3BEOA 3ZU5A 1QHXA 2IE8A 2ZT6A 1J1IA 3IQFA 1SUPA 3CRVA 2YBDA 1J5EB 2WYOA 4W1RA 3VJLA 4D9IA 2OFOA 2B2NA 4HS4A 4S1TA 2OGUA 4QSMA 1DFGA 4B6GA 1G8PA 4UOEA 3EC1A 3FMOB 5FB3A 2VJQA 3CVXA 3U3KA 2DBVO 1A9SA 3AW8A 3EZYA 2B82A 3F3SA 4IFTA 2OMEA 4HGRA 3USES 5HFAA 4A8TA 4YK7A 3I8XA 4CL8A 4FBGA 3OOWA 4M8IA 3I32A 2CY0A 3Q10A 3PENA 5DI9A 3RJTA 2V7WA 4QO7A 1F48A 1RYZA 3C24A 4MYSA 4NRDA 2PX3A 3HI6A 5CD1A 1O6CA 1QRAA 3NXSA 3PU6A 2IYAA 3IXQA 1NFQA 2AGVA 1LWOA 2PZLA 1L5KA 1XZCA 2ZI7A 5KJ1A 4CLEA 2HIGA 3KZOA 3TIXB 4IHJF 3CLKA 1MGPA 2FWJA 3OOJA 1KOJA 2ZAGA 1P29A 4E1AA 2O5RA 5CDTA 2PBFA 2WQ6A 4INPA 1T8TA 1XRSB 3VAAA 5HFJA 4MYHA 3UF0A 2QRJA 1RQXA 3B1FA 4BFUA 1MR3F 2B4KA 3G5UA 3TOCA 2YQZA 3TH5A 3WKAA 1JL3A 4OH1A 4ES6A 1FQOA 1XHFA 221PA 4PAWA 4US0R 3U1TA 3FNHA 4UUQA 1KKUA 3PZBA 2ZGVA 2VH2A 1VCNA 2BEUB 1KEEB 2CD9A 2G7ZA 2PVPA 1T4BA 3ACCA 2OM2A 2BJVA 4PEVA 1FRQA 5EIBC 4WE3A 4A27A 2RD2A 4LNUA 1UJ2A 1P7ZA 1JR3E 3BGDA 1WY7A 2VN8A 3HU3A 3WYCA 1Q15A 1M6VB 2ZCUA 3EGIA 2CUTA 2YS7A 1NAIA 4XCVA 4I2VA 1HYQA 1QTNA 2W2PA 4FEAA 2FP3A 1CFZA 1BC5A 4Q1DA 4QOHA 4CT5A 1QYCA 1QGYA 3EF1A 1JECA 3K0BA 1T9DA 1L7PA 1I6MA 3CKKA 4GIBA 3QITA 3PE3A 5D5PA 5C4GB 1R0WA 1L5OA 4ZCTA 4KO3S 2CJFA 5BXQC 4M0PA 4FD3A 1PNOA 1TZCA 3AL0C 3OLVA 3TFOA 2FVXA 1KETA 4QXMA 4DB4A 1N9GB 2JKYA 2PZKA 1NJ1A 1P0QA 1QZZA 1XEWX 2V7QD 2V97A 2WK1A 2YY6A 4G0MA 4JDUA 4KAFA 1Z6GA 4GQAA 5CTAA 5K0EA 3WLAA 2BBTA 1NNI1 4Y9UA 2ZW9A 1ZA2A 1Y9ZA 1QIJA 2P1DA 3EWIA 1OZFA 3N2KA 2H3HA 4OXIA 3EDRA 5BY2A 3WLEA 3HDHA 4DG8A 5BVHB 3EEBA 3NATA 4I50B 2WTAA 1U90A 1E99A 4D02A 1AY0A 4HNTA 3H1AA 3BE6A 3N2GB 1CUEA 1OTXA 2GPNA 3MCAA 3QA9A 2QNRA 3GLGA 3LYLA 1J9ZA 3GB9A 2M6LA 4KN9S 3U48A 2H63A 5BV1A 3UKOA 1NLUA 5KYGA 3I4CA 4RVSA 5DWVA 5AK5A 4L3VA 5LYJF 3D6VA 5FTLA 1D6JA 2Q3MA 3ZGVA 4FGSA 4FFPA 4DZRA 4B09A 1KH3A 1I0ZA 3A6FA 2PAAA 2QN7A 2VQFB 2ACVA 4PYNA 3A6KA 4FVTA 2WICA 3IKJA 3VDNB 1WXIA 1T2NA 4LGMA 4Q4JB 2WYHA 1KDPA 3OZSA 2BISA 3P9QA 2HYDA 1CHDA 1NKTA 4V0NA 1X7WA 4MVJE 1N7GA 2VOJA 2BMJA 1YQGA 2WKRA 1MV5A 4X71A 5EVCA 1KJZA 3M6VA 1KMIY 1OZGA 3RRYA 2VTBB 1TEZA 2YIDA 1KP2A 2X7JA 3QXXA 4KITB 2FN8A 3IPAA 1KRXA 4O02B 4MIKA 1W4RA 1ZU5A 4DT1B 1PUJA 4XARA 2J30A 5DHFA 4TLBA 1HFKA 1W44A 4ZV4A 1OASA 1TFRA 4JUDX 4DW8A 1XELA 1ODFA 4KYIB 1Q5PA 4URZR 3ZDDA 1W36B 2YHBA 1JFLA 2ZYUX 4O4LA 4XGIA 3RK0A 4F2WA 2JCGA 4QNMA 2BBSA 4IJWA 3UWKA 3OPXA 4WGFA 5A6VA 2GN2A 2VI5A 2WUVA 1UC4B 1Y1LA 3T35A 4C0XA 4KHPB 1DBRA 1N32B 2PGOA 1WXXA 2FRXA 5I7WA 2X9GA 3CV3A 3R0VA 4FOLA 4KIWA 5GP1A 4BGDA 1MO4A 1FW6A 3Q7RA 4JQZA 4QGSA 1XMQB 3UGJA 2OVBA 2R5FA 3HO1A 4EUHA 3UFXA 2ZIXB 2VP4A 1HETA 4PFKA 4HEA1 3IOEA 3L4BC 4BECA 5AVKA 5GIPE 3V7UA 4LXXA 3UT5A 2OV2A 1UKZA 1MAWA 3EGWA 4YAKA 5L3SA 3IL2A 2OCGA 1RHRA 1J0CA 4ARUA 3WS7A 3F0TA 4D9JA 1V3QE 4RKEA 5JCZA 2D1YA 4WTOA 4QQNA 4LCJA 4HD8A 1SC4A 3K73O 1QGZA 1JLSA 3B1JA 5KYYB 2AUTA 1ZVMA 1ECLA 1Z2NX 3CNBA 3F4BA 5CYPA 2OBMA 1GGVA 3L2OB 3T3DA 3FETA 2O2SA 3K5IA 1L1RA 2C42A 5DNCA 4OKSA 4DQDA 1JJ7A 1GKKA 2B8NA 2PTHA 3BUSA 1EB8A 2DBYA 4JI5B 3PPVA 4KREA 3ESRA 3WLSA 4BMZA 2XAAA 1OBVA 4GYJA 4L95C 4HBZA 4MGZR 4BQPA 5C1DA 1QRTA 2DFNA 3IR6A 2HY7A 1EG2A 4UEOA 2ZAMA 4YLEA 1USUA 1V5FA 3GJYA 3UBMA 4EFLA 1NVKA 1P9WA 2H31A 1YBVA 4HLUC 4KVFA 4Z4EA 3OM9A 3UWPA 3OAAA 3HC7A 2MYUA 4BV2A 1Z6PA 3ESCA 5HZGA 3HXQA 4NDAA 2NP7A 3CNLA 4FJ0A 4CIYA 1LTKA 2P1ZA 4OHMA 5AUQA 2DBZA 1WAMA 1XK7A 4QVKA 3WICA 4I1PA 3IP5A 3H04A 2I4IA 3LUJA 3CSDA 2DR2A 2JRCA 2WU8A 5GZ3A 2X15A 3TQRA 3ILHA 1CIJA 3U62A 2XXJA 5DI3B 3L77A 3UCFA 2NQ2C 2TMDA 1D6MA 1DKOA 1UBMS 3BMCA 4R54A 4PYRA 2OPHA 3RWOA 4QYIB 4ZI5A 1FVOA 3D3QA 2WG1A 2QU7A 3ND7A 4XUDA 3ZUPA 4Z1MD 3ZV4A 1Z28A 1O6FA 1RLMA 1ORDA 4XI9A 4E08A 5K4HA 4BWFB 3G2NA 4Z3DA 3OH8A 5FEMA 5HIAA 2BFNA 5MGBA 4D3DA 1YFZA 1HQKA 1ZONA 3G2IA 4NV1A 3HDGA 3OETA 3GEIA 3V1TC 1XTJA 3FGPA 1I5EA 2X22A 3HHEA 4K6FA 2WUDA 4XOUA 4G1BA 4F72A 1N6LA 3LC1O 4AKSA 2OPBA 2A78A 1V9CA