3IO5A

Crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
310
structure length
271
Chain Sequence
b'VVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTTGPMYSADTVFIIGKRYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination and repair protein
publication title Crystal Structure of the Phage T4 Recombinase UvsX and Its Functional Interaction with the T4 SF2 Helicase UvsW.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 84
structure length 271
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3io5A00
3SYKA 5JS8A 4EQ6B 4PAMA 3T61A 4M1TA 2VYFA 3BK7A 3QBVA 3U2QA 4YMUA 5JWHA 3FTQA 3K53A 4CEJB 4GOJA 1COWA 3BXZA 1GNQA 3HJNA 3PUZA 2V54A 4KV9A 1W4AA 5D3QA 2DWOA 1P61B 3PITA 1QRAA 4LZZA 1E2KA 2QT0A 4DLWA 5FUYA 4H1UA 1VIYA 5A5GA 3NDBB 4AK9A 4U7DA 2FE4A 3GFPA 1P2UA 3IIKA 1KI6A 2EFDB 4TLDA 4JJZA 1SVLA 4PPQA 2WKPA 1X6VA 3DOEA 3OEHD 2JLYA 4B3FX 4EPVA 1KZGB 1G6HA 3KFXA 4HEJA 4LWZA 2QMUA 2RGCA 3PEVA 2FZLA 5KNCA 2D2EA 1IBRA 1FTNA 1GFIA 1OW3B 5DYGA 1YZTA 4H9GA 1NIJA 3QF4B 2GWHA 4URVR 4Z54A 4XJXA 2OZEA 1GKYA 2C78A 2NPIA 1Z2AA 4NBSA 3BS4A 4OQLA 1G8HA 2BEKA 2OLJA 3NC1C 2FSGA 1SHZA 4D0NA 2AKYA 1ZNWA 4Z1MA 2Q3FA 3UATA 4NTZA 1SXJC 4X8OA 2WJHA 4IW3B 2CJWB 4GZLA 1Q12A 4M1SA 3O8CA 2O0HA 1M34E 2P0EA 4V03A 3QG5A 3KKMA 4CEIB 2PX3A 2BM1A 2WSSA 3VNUA 2BMFA 1RRCA 4Q7JB 3ZVLA 2VTKA 2QROA 1CBUA 3CNLA 3KUDA 3CR8A 1J8MF 4RZUA 4A9AA 5JS7A 5KSPA 4OQNA 5IK2A 2DFKB 1DE0A 1E9EA 2IXGA 2ANBA 3T5DA 3GD7A 4KJZA 3CX8A 4QL3A 4JLJA 3PEWA 1KDTA 1W5SA 3SJBA 5C1BA 2QQ0A 3W3AA 1DAIA 5JJIA 4QM7A 1ZYUA 4DBLC 3WYAA 3MJRA 4OK3A 2QAGC 5BYKA 2BMEA 2GXAA 5F9HA 2VHQA 5BXQC 2YC4C 2QGZA 4GBMA 5FI0B 1L2TA 3HDTA 5B64A 2I1QA 4M8NE 5CDFA 2ECKA 3CIOA 3GQBA 1N0WA 4PC7A 2NQ2C 4YONB 2MSCB 8OHMA 3RS3A 1U8YA 1U9IC 4US0R 2QENA 2ZM5A 1Z07A 4Q18A 2J7PD 4B32A 1GG2A 1E2HA 5J5CA 1HYQA 1CU1A 4KFTA 2XOKA 3QBTA 3KQNA 2W2VA 3NVAA 1LF5A 3GLGE 1Z0JA 3AVTA 5E95A 5JHGB 3F0TA 1WXQA 1VCIA 2MSDB 2J9RA 2JASA 1E9AA 5LDDC 1UBEA 2WWGA 4LBWA 2J87A 5DIFA 3BB1A 2N42A 2R9VA 3I4LA 1TUIA 2IS4A 1AZSC 4ESVA 1UM8A 1WMSA 2BV3A 3HR8A 4XWAA 4TMVA 1Q1QA 2YVUA 5CM8B 2FFBA 4OHVA 2LCFA 2A5FA 1P75A 5DO9A 4B75A 4CF7A 4L16A 5JRZA 1IOZA 1QHHB 1ZUHA 4A2PA 1U0HC 4LX0A 3OAAD 1IN5A 1H8HD 1Y3AA 3C5CA 4FWIB 1IXRC 1GL7A 2WAXA 4JLVA 4UJ5A 4ZCLA 4E07A 3U5ZB 4CEHB 2F7SA 3BORA 3L0PA 5GVRA 3PUWA 4QGAA 3MMPA 3BH0A 2ODEA 4Q21A 4Y0AA 2DWPA 2ZRNA 4Q9KA 3FHTA 4JLMA 1GRNA 5D3MA 1DTSA 2ZRCA 1U8ZA 4LV8B 3QKSB 2X77A 4PQFA 4B43A 1II8A 4Q4JB 4ZO4A 4MRVA 1CLUA 2ZE8A 3BBPA 3ND9A 4KFRA 4Q03A 1J90A 2O8FA 4WAUA 4L15A 3GJ4A 3LNCA 1G5RA 3R20A 4CGZA 3W8NA 4RCZA 4F92B 3SOPA 2HT1A 1HV8A 4Q66C 5JWOA 2B92A 1QF9A 4BZPA 1Q44A 4IXNA 2C9YA 2DYKA 4ZCIA 1FPMA 5JLJA 1PVOA 2OILA 3TNFA 2OEPA 2ORIA 3EXAA 3CRVA 4G3XA 4B47A 5CB8A 4A4DA 3VNVA 4D0LB 2G0TA 1E0AA 3H4MA 4HI0E 4P0TA 1W47A 1KK1A 1XTQA 4B3CA 4C0HA 2WJYA 2QP3A 2FMXA 3TRFA 1W4RA 3MRSA 1TUEA 3C15C 4XOIA 5FBRB 2ZRDA 1NVUQ 4A8JC 4QKQA 2BEJA 2F9LA 4ABYA 5GADl 5DI3B 3SQXA 3QE0A 4D4JA 2IXFA 3GJ6A 4L5BA 2R44A 3KKQA 4HUTA 2B6HA 3SE0A 1WQ1R 1E99A 3AH8A 3CNOA 5L3VA 4CW7A 1ONBA 2JATA 1E9FA 3KJEA 4QGHA 3ZQ6A 2I4IA 4DSNA 1W5TA 2HJGA 1DEKA 3NTUA 4TSFD 4KITB 4MRNA 3RAPR 2ZSAA 2W58A 3THYB 3K70B 4QXAA 4KFUA 2OCBA 3QKRA 2OE2A 2QM7A 3CNNA 4HLQB 3GEHA 1TQ4A 4GPTA 4JLOA 5CJ2A 2O8EA 2O8DA 1MRSA 2IK8A 1D5CA 4WA7A 1XTIA 1XD9A 2O8BB 5EXPA 1I4DD 1M8PA 1M7BA 4HDOB 2W6ID 3THOA 3EIHA 3TSZA 1AQYA 5FBWB 5ELXA 1NLZA 1ZAKA 5FPYA 5L8VA 2CCGA 4ITRC 1NLYA 2HJVA 4YXWA 5C46F 2GJKA 4PPGA 3NKVA 3WXMA 1XEWY 1N6NA 1Z28A 2AHOA 4RFSA 4JYBA 4ERNA 2PCJA 2C8VA 2YV5A 1WF3A 4NZYA 2VSFA 5JBQA 2CMKA 4KXFB 3N2IA 1NRJB 1VYUA 2ZPTX 2FSHA 2H18A 3WHKA 4US2R 3KQLA 4FIDA 3CX6A 2JCSA 1ZJ6A 2DY1A 1KGDA 1FUUA 1Z6YA 3Q5DA 3HYTA 1XEXA 3KKNA 3TR0A 3IDQA 3L0OA 4WOPA 1FL9A 2J0VA 1NG9A 2FH5B 3VHLB 1KSJA 5EUQB 4MYCA 4N0EA 3THWB 4US1R 1W36D 1HE8B 1II0A 3KB2A 4B3DA 4DSUA 1A7JA 1U8AA 3DPUA 4L8GA 2WMOB 2GCPA 5CLQA 2PJRA 3QUSA 4Q4LA 2GEDA 2ZSFA 4TMTA 3KDSE 4PTLA 4IOMA 4C0KA 3KFVA 3UANA 2G83A 5AJYA 2HF8A 1JPJA 1MT0A 2OSBA 3MSXA 1OHHD 3TKLA 2NPFA 1N6LA 1TF2A 2F6RA 2GF0A 2J46A 1RRFA 2V7QD 5H1YA 4BUJA 4BWYA 4NCNA 4KHZA 4IDQA 4BEBA 2ZSDA 4IKEA 2QBYB 4JMPA 1W4BA 5KNBA 4UNQA 4O3MA 1E4YA 2QNRA 1P9NA 2ZJYA 3T35A 1JB1A 3RRNA 1F6BA 2DWQA 1IAQA 2A3RA 2QAGB 3GJXC 2G1KA 4A1FA 4M9XA 2C9OA 5FOTA 1T91A 4JVMA 5FH9A 3D8BA 2GXSA 3LX5A 5H68A 1QHGA 3QEOA 2VHTA 4D81A 1SVSA 2AL7A 4S35A 1Z0FA 4NH0A 3FFBA 3A1VA 3HU2A 2J0SA 1TQ6A 2Z43A 3NHBA 4DVGA 3KL4A 4FINA 4IFBA 1QHIA 4TSFA 1NN1A 4ZI2A 3GLIB 4HZUB 4PZLA 4MITA 4B73A 2GBLA 2A7QA 2FU5C 1TQ2A 3C5HA 2REXB 2ZR9A 4R2IA 2WAYA 2EQBA 4M1YA 1XF9A 3C41J 3QXJA 3JZMA 5EE3A 3ZS9A 3TAUA 2PMKA 4Q1AA 5DGXA 1T0HB 4EIWA 2W6IA 3P20A 2QG6A 2R2AA 4GZMA 3T1TA 4IEEA 2YWEA 4JVNA 3B1ZA 2EWWA 4MYUA 4P3YA 5HPYB 3B1YA 3UIEA 1OF1A 2V6JA 1F5NA 1P7CA 2G6BA 5JCZA 5FL3A 4DDTA 1MOZA 3AV0B 1T3SA 2EYUA 2N46A 4JKIA 2Q21A 1Z8FA 4Q1BA 3QSYA 5TARA 3EW9A 2WIAA 1XXHB 4Q01A 1L8QA 2IUTA 3FE2A 5GVSA 5CJPA 1E0KA 2YINC 1N6KA 4HB3A 3OE7D 5K8UA 1YHNA 1LV7A 1EX7A 3TJZA 3W6PA 1Z0DA 2ORWA 4ON9A 3PENA 2ZU6A 1W46A 2QE7D 4UNRA 1H8ED 2G77B 4BFWA 1KSHA 1HURA 2ZE7A 1NG1A 3GCGA 5KSZA 3FMIA 4IVPA 2BMJA 2ZYUX 4A6XA 2WJIA 4HB4A 2GZHA 4OL0A 1F48A 1W49A 4LUCA 3EPHA 1YZKA 1I4TD 1H65A 5C4MA 2G1JA 2W0SA 1G21E 2ZITA 3PJRA 4JL6A 4PSAA 4PR0A 1MABA 5AWFC 2GCNA 4AYXA 2EWVA 4RD4A 1GILA 2QAJA 3TSOA 3FDIA 2CLSA 4YDHB 3RVBA 1R0ZA 4ACAA 3O47A 2QSYA 2SHKA 3K9NA 3M4YA 1QVAA 1DPFA 2PCLA 3I72A 1EK0A 3K0AA 2D7CA 4V0KA 1LF0A 1Z3IX 3GLFA 1E2GA 1OHHA 4MDEA 2V7QA 4MRRA 3X1DA 4DB2A 2JLSA 4NONA 4B34A 3OEED 5E7IA 2QSZA 2FEOA 1TF5A 1W0KD 2QTHA 4B3GA 4MUBA 3AVPA 4M53A 2J5XA 2RAPA 5KYKA 3VU9A 4WBSA 2O8DB 1UF9A 2ZREA 4P31A 1E0SA 2ZI6A 5JMTA 4QM6A 1ODFA 4ZDKA 4A8JB 2XTZA 4JT2A 1DO0A 4F38A 5EE5B 5KOYA 1OYWA 3I5YA 2BIFA 3IQXA 1A1VA 2IS2A 1P2VA 3AKDA 4XSGA 5EP4A 4LBZA 5KDLA 3R9XA 4BFXA 2PLRA 2MSEB 1T8TA 2RHMA 1KYIA 3MWKA 4NCJA 2Q9CA 1NSFA 1TU4A 1G41A 2CNWA 1DAEA 5E4FA 4F4IA 1CEEA 1HTWA 3QI2A 1NIPA 5JECA 4ZIRB 4QBFA 3THXA 2KE5A 4B76A 1YVDA 3T12A 3V4FA 3GP8A 3ADDA 3U7EB 2KBEA 2W2TA 1DARA 3QPWA 4MA4A 4M2LA 2XSZA 4W5WA 4BFVA 4AC9A 1FMJA 3VKHA 3MLEA 3AM1A 4EKDA 5B2ZA 2VHJA 2PEYA 3GLHA 3C16C 3LAWA 1ZNYA 5F2EA 4KCGA 1AZTA 2GJ8A 4PAQA 2H7VA 4R71A 4EFMA 1XEXB 1XP8A 1OFTA 3KQUA 3GEIA 4P32A 4XD7D 1W48A 1VKJA 5P21A 3B60A 4IDHA 1JAHA 4N3NA 2AFIE 1IN4A 4PHHA 4MKIA 3SHWA 3VR3A 1ZD1A 2HYDA 2W00A 4URWR 3LFUA 3W6NA 3AVUA 1NY5A 1OYYA 2ZS9A 3QXCA 5SZIA 5TB5A 1HEIA 2BC9A 2XB2A 2WSMA 3EPJA 2QRNA 1UEJA 2OCPA 3KB1A 3R7WA 4C7OA 3PVSA 1KZ7B 2BMDA 2C99A 1KO7A 2NO0A 2QE7A 3HPQA 3RRYA 4AY2A 1H8EA 5KU1A 1E2MA 2IUSA 1HH4A 2V9PA 1FNNA 3AF0A 3TW4A 1J70A 2PLFA 2HXSA 4QC2A 2P6RA 1VDZA 3SR0A 2D7DA 3IHLA 4RFVA 2GEVA 1KDOA 3V4RA 5J4YA 1S96A 2C2HA 3L0SA 4LHWA 3WBJA 3BAFA 4EPYA 1DAGA 1JR3E 2JAQA 4OHZA 4OI4A 3OESA 3ZGXA 4TTPA 4Z8XA 3A1TA 1N6IA 2QQEA 3EG5A 4W5HA 2OAP1 1UFQA 1T3LA 2WPDA 4MUAA 4LY6A 3MJHA 4KI0A 2FG5A 2VH5R 3IO3A 4KFSA 4G5RA 1SVWA 2G88A 4ASUA 1G4UR 1G4AE 1NJGA 2D74A 4BASA 4OYHA 4C0SA 2NO1A 4Q7LA 5HZHA 5ANRB 4QRHA 4HB0A 2RGGA 5E7MA 3VTKA 4Q9IA 5FR2A 1G3RA 3OEEA 2F3RA 2RMKA 2RKOA 2JLWA 1W0KA 3N5CA 5IF9A 3LV8A 3CBQA 4Q00A 5H70A 3LW8A 4BZXA 4D25A 2DCUA 5CB6A 2AFHE 1X8JA 1ZM2A 5HE8A 1AK2A 3MGCA 2OFWA 1TTTA 2WZQA 2OAQ1 3B7GA 3IBGA 3P26A 4LI0A 2GCOB 4TQAA 4YLGA 1P62B 4JJKA 1R5OA 2XGJA 2O0KA 3CLVA 2BWJA 3IPXA 4LHYA 3DKVA 2OBNA 4XTCS 4GOXA 1R0XA 2IS6A 2Z4RA 4OJKA 4NMMA 3UMSA 2WWHA 1YR9A 4DLRA 4FMCF 5F98A 4TYQA 3SN6A 3UWKA 5JI3E 3GLIE 2EFCB 1KDPA 1T6NA 3FMOB 3A58B 2FPKA 4DIDA 2AWNA 4OHXA 1Z5ZA 3LX8A 4QHTA 3ZD7A 1AIPA 2FF7A 5G41A 5F3WB 3EA5A 4CVNA 1GVNB 1XRJA 3BJIC 4BLTA 2ZROA 4JLKA 2GXUA 2BJWA 3B82A 1KNQA 5J47A 1OIWA 1KOFA 1E2FA 2UZ3A 5FOVA 1GRQA 1SXJD 4P4SB 5EXSA 2CK3D 3NH6A 1XXHE 4FCWA 3WRXC 2ZRBA 5IRCD 4DCVA 3AF4A 1DS6A 2ERXA 2F43A 3QVVA 4IRUB 3WNBA 2CHGA 2YZ2A 4IVQA 3K70C 1MABB 2XJ9A 2IYVA 3IO5A 1N6OA 2ZVPX 3CO5A 1E2JA 3LQQA 3CRRA 4D4MA 1OV4A 2FWRA 4DZZA 2ZU0C 3EC2A 3GFOA 1GSIA 2NZJA 4MGIR 1NKTA 4NKRA 4ESHA 4XVRA 2JDID 4PZZA 4WZ6A 3PIRA 4LYAA 4F4CA 4I1SA 3PUVA 2Q3HA 2ZRMA 3GLFB 1KHTA 3QF7A 2OESA 4DIEA 4UQOA 2F3TA 3LQRA 3EWAA 2H17A 2OCAA 4DLVA 1FTSA 2YYZA 1N0UA 1S4QA 1FMLA 1ZIPA 3RRZA 4NPHA 4DT1B 4GDFA 2ZJOA 5EQTA 5M04A 4FMDF 4QHSA 2ONJA 5HKKA 2GESA 1M74A 1ZBDA 3DHWC 2E87A 5KPJA 3K0FB 2AX4A 3WYFA 2ZIAA 1E79A 4TTQA 4YMTA 3U61B 1QG2A 1E3MA 4R98A 1GNRA 1XD8A 4RD1A 1QHNA 1ZMXA 1NMZA 3Q7QA 1PZNA 4PQRA 1RJ9A 1E96A 4X8MA 2H5EA 2WKQA 5DISB 2YWFA 5FUWA 1R6BX 3LXRA 4DCSA 2YOHA 1E94E 3CX7A 3B13B 4DKXA 2CCJA 2ODNA 1KAOA 2ODWA 2ZSBA 4FMBB 4AI6A 2F1RA 4EUNA 3RS0A 4C9BA 5J4HA 1E2LA 3AP2A 3AP1A 3TK1A 2UZIR 1NVVQ 2IBMA 1UBFA 3BB3A 2ZRKA 3DMDA 4A0RA 4LHVA 4NYIQ 4NL4H 1R7RA 4HAVA 4D4KA 4OHYA 2FGKA 4O0MA 1YZQA 1MO4A 3DZ8A 1F2TA 4DCNA 2Y8EA 1OXUA 2BKEA 1KMHA 1KDRA 2XNDD 3B9QA 1TEVA 3ZYCA 4BE7B 4BLSA 1Z06A 1J99A 4Y0VA 2XX3A 5BW8A 2O8CA 1KJYA 4QNMA 5DHFA 3WBKA 1WB9A 1CS4C 4EPWA 2QZ4A 3DEFA 1DG1G 2PX0A 2QMHA 3VR5A 5K8LA 1RRPA 3HWSA 1EFRD 4OHWA 4AYWA 2XZOA 4NCIA 3KXLA 2DPXA 2Q6TA 1GL9B 2HF9A 1W2GA 2IYRA 2MMGA 1E2NA 4M1WA 1K5GA 3EPKA 2VP2A 3MWLA 4LC0A 4G5QA 5JCPA 4BFTA 4H1VA 4MH0R 3SHFA 3CRW1 2WBLC 4TYYA 3EX7C 2R6CA 1R10A 4PO8A 5DN6D 1UBGA 4B44A 2XZPA 1T5LA 2OT3B 2VF7A 4TQUS 1N5KA 3LWNA 5IT5A 5LBIA 2DB3A 1FUKA 1P4SA 3CW2A 1IY1A 3BOSA 2YKGA 1US8B 1XB2A 4NYIR 1YKSA 3RC3A 4C0LA 1HT2E 2O52A 2R62A 1Z47A 1K8RA 1T5IA 2PEZA 5DHAA 2CEAA 2JDIA 4LGMA 4POAA 4LCBA 1QHYA 3ADBA 2VIIA 2C9CA 2FFQA 2E1RA 2ZI7A 3K9GA 3I5XA 1Z63A 1QG4A 1EFHA 1RIFA 3AGPA 3RDPA 4IXMA 1ESNA 4UNPA 2JLXA 1FOEB 4BQSA 1UKVY 1BYUA 2C04A 3U6BA 3OEHA 3KTAA 2RHDA 1KAGA 3QKUA 4KLNA 1W7AA 4TMZA 5FFMA 3RSLA 1K6MA 2QP9X 2VSXA 4PX9A 1TQDA 2FV8A 4C0QC 4PHFA 2QTFA 4CT4B 2GAAA 1GZSA 1IM2A 2EFHB 2E9SA 1ZCAA 3BERA 1XBTA 1M7GA 4ZV4A 2ASEA 2V3CC 1KSFX 4CT5A 1LFDB 1MO5A 5JSZB 2BBTA 4V0NA 2JIZD 2IEYA 4RZ2A 5FOSA 3FKSD 1U90A 1XDBA 1TU3A 3UWOA 2WJJA 3Q7PA 5EP3A 4OI0A 3IBYA 3U60B 1QHSA 2ZRFA 5B58C 2J0UA 2PZGA 2IW3A 4LJ4A 1RPZA 3RWOA 4J0QA 3KQKA 2BM0A 1N2CE 1HE1C 1N0VC 4HB2A 4GP7A 1CIPA 1E2DA 1GP2A 3AVOA 4RKFA 1M1YE 4HUQA 3U4QA 4D2IA 2P2LA 1RE0A 1G17A 3PXGA 5AUOB 1YJ5A 3KUCA 4HLUA 3TLXA 3ND8A 2D4HA 1R0YA 1WDTA 2XNDA 4MGKR 1IN8A 1Q22A 3AF1A 1IONA 4I4LA 1N5LA 2QPOA 4DEYA 3GPLA 1XD2B 2JJ8A 1DAFA 2A5GA 2F43B 3HP1A 3ICEA 3SC3A 3AVWA 2YWGA 2JLUA 5FPHA 4BEJA 3J81k 1RVDA 3LBIA 6Q21A 2L0XA 3I8XA 1EFRA 4B35A 4DCTA 4C2UA 1EGAA 1E9DA 1TNDA 2IYXA 4OI1A 3RSOA 1ZNZA 3MD0A 5EXXA 4OI2A 3BE4A 3ZH9B 1IQPA 3U7HB 1JNYA 3TW8B 4B3BA 3LDAA 5EUMA 5AJVB 4G5OA 2OBMA 4TT3D 1P9WA 1Z0KA 2OCYC 3R9IA 4BGDA 2JLZA 1DELA 1MR3F 2VP6A 1TMKA 5CLLA 3QPUA 5CIWA 1YQTA 4L4UA 1CR1A 1EFCA 2IL1A 1KI6B 4FCVA 4DXAA 1S3GA 2J7PA 1ANKA 1W0JD 2ODBA 1SKQA 1VPLA 3K0EA 4GFDA 4JLPA 3BFXA 5KSOA 1E32A 3RS4A 3RS5A 3OIYA 4OQMA 521PA 4BZQA 1VECA 3VR2A 2AD5A 3GLFE 1UKZA 2D3WA 1NLFA 2D2FA 1W2HA 2DFNA 5JI2E 4F93B 1AM4D 1Q0UA 1KNXA 4V0LA 5A0FA 3UKDA 4CYMA 121PA 4XVQA 4NHOA 2QL6A 1HQCA 3TQCA 3MCAA 3TE6A 2GTPA 1XPRA 3OAAA 5K8IA 1H8HA 4U00A 1WBBA 1IJFA 5G40A 3U3JA 3X1XA 2IYQA 3MFYA 3Q8XB 4AKGA 1VIAA 3QOFA 4LC1A 1YU9A 1YZNA 4IFEA 4D4LA 1FX0A 1S9DA 2VSOA 4LHZA 1XCPA 1LVGA 4TLBA 1DBSA 1KMQA 1VYTA 1XJQA 2JJ1D 2ONKA 4LPSA 5H8WA 1NNEA 1CKEA 1R8SA 1VG1A 3CPHA 1KI1A 1NVWQ 2JIZA 4LJ8A 1Z83A 2X8AA 1VCOA 1P72A 1ZUIA 2Q3MA 1Z6TA 5KNDA 1L4YA 4Q19A 4DHEA 1N6HA 1ZD8A 2V1XA 4YQFA 1VG9B 2VA8A 2HCBA 2DHRA 3I73A 1IXZA 3PUYA 2RGDA 2P5TB 3BFKA 3HU3A 1DG3A 2WM9B 4YC7A 5CYOA 5AJZA 2NMVA 1SKYB 3ONWA 1VG0B 1NMXA 2AXNA 4DLUA 4WVFA 5DH9A 1JEDA 1K5DA 1JXMA 4M4SA 4HAWA 2ATVA 2I3BA 2HDNB 3RYTC 4P4TA 3L0IB 1YR8A 1E2IA 2ZXUA 1CJVC 5FTJA 1LY1A 1E1RD 5KHOC 4FXPA 5KUTA 1AS0A 4MKFA 3QXHA 4EJSA 3EARA 4IEIA 3VKGA 4WXPA 1X1SA 3CKLA 5CITA 4Q48A 1B23P 2IA5A 1L7VC 1GTVA 1Q1ZA 3REGA 4F91B 1PLKA 5LPNA 2GBLC 5KDDA 3IIMA 4M0LA 4XH9B 3NG1A 3LD9A 2FNAA 2IC5A 1FW6A 5KDOA 4GMDA 5KTYA 1EXMA 3NBXX 5FUXA 2IUUA 4DC9A 1GL6A 2RH5A 2TMKA 4JKYA 3W90A 2BVNA 1VYVA 2GHIA 1X1RA 2ZR7A 2VL7A 3K0CA 4QBIA 4NDZA 2CL7X 1QZXA 2X2EA 3I61A 2NO7A 4AKIA 3FFAA 2OFOA 4UNSA 1V5WA 1W44A 4LOAA 1S9HA 4LJ5A 2QPAA 2ZRHA 3WNCA 2EFGA 2DFLA 2QN6A 4MYTA 4KSCA 4JYCA 2Z5FA 4NP6A 3E1SA 1W0JA 4PANA 1XPOA 1IJEA 3B8HA 3CF0A 3MWYW 1ZM3A 1CR4A 2ZRJA 4Q1DA 1MO3A 5DE3A 1CJTC 2VQSA 1XMVA 1F2UA 4V0MA 1N3BA 2J1LA 2C98A 5C4GB 3PR1A 1G18A 5EZ5A 3TUJC 2W0MA 3HPRA 5D3MB 5JEDA 2ZRPA 1NSTA 2NO9A 1II8B 2KBFA 2PBRA 1IXSB 1DAHA 3A4MA 1BOFA 5J4VA 1KK0A 4BFUA 4G5GA 1XFAA 2O8FB 1BIFA 2EW1A 4ACBA 1NN0A 1D2EA 2B21A 4UJ3A 1SGWA 1LB1B 4DDWA 1V43A 2REOA 4ARZA 2R65A 3EWSA 1W36C 4Q5IA 1XJ0A 1JQLB 4Q4AA 3SJCA 1Q21A 3U44A 1OH6A 5J4LA 5L3SA 4GL2A 1X8LA 3H1TA 1OFIA 3JVVA 4HUQB 3MUFA 3WMEA 1WE2A 1CF4A 4I1OA 2OV2A 2ERYA 4QOSA 4PO9A 2PT5A 4A2WA 1YRBA 4FW9A 3F8TA 2A9KA 4HAZA 1JQJC 1ESMA 4F7WA 3Q5EA 1CTQA 3PFIA 1G9XA 4WZAE 1TL7C 3VQTA 1ZW6A 4G01B 4TL9A 1KI7A 1U99A 1A2BA 2FSIA 2I1VB 2OO7A 4W9MC 4RJLA 3H2YA 1VTKA 1CRQA 3AQ4A 1E2EA 3AVQA 221PA 3CRMA 3FHOA 2KB0A 2NZ8A 1RRGA 3SFVA 3EA0A 1UJ2A 2ZS7A 3WYGA 5J4KA 3AVVA 2ZR0A 5FOUA 3TGPA 3WMGA 4BFYA 3LRPA 3SJAA 1E1QD 3B2EA 2CHQA 1JALA 2WWFA 1W4CA 4JBXA 4JZKA 5HCNA 4XVUA 5AUNB 4PC3A 1JAIA 4TQ9A 1NBME 1KO4A 2VRWA 4AWXA 4KLZA 2B7BA 4EDHA 2IHBA 2KWIA 1XJCA 3PUXA 3WMFA 4IOKA 2GAOA 1ZP6A 3CR7A 3QKRB 2ZVQX 4MKGA 4V0OA 2OXRA 1Z22A 4EQ6A 2O8EB 3RS2A 2BBOA 3NWJA 2Z4SA 1CR2A 3K0SA 4CEJA 4DJTA 3A37A 3DL0A 2WVJA 1XCMA 1GIAA 3IIJA 3QQ5A 4EAQA 2ZJAA 1CXZA 1G7TA 2P6UA 3NHAA 1AGRA 5DI9A 4UNNA 3TQFA 3WHLA 3LVQE 3DKPA 3T5GA 3UMFA 3LLMA 5F9FA 5L3RA 4BLRA 1AS3A 3GFTA 2OUKA 2PMDA 1AKEA 1Q1EA 3MAAC 3EAQA 1S1MA 1XMSA 3Q85A 2G3YA 1EWRA 2A2ZA 4ZI3A 1X86B 4RFSB 1OSNA 1BYIA 2KJQA 2O0JA 4JVSB 5E7JA 3D3QA 3PG5A 5LB4A 3ADCA 5TDHA 4PPFA 2XJ4A 2GXQA 2JLVA 4A0HA 3U3MA 2GJ9A 2ZI5A 3VR1A 4M1KA 4RZXA 2C77A 1GKUB 4HDCA 1ZU5A 2CE2X 4KYUA 2F9MA 2ZE5A 4HSEA 1W1WA 5GJVC 1OFHA 3BRWD 5FPKA 1D9ZA 2F1HA 2VF8A 3W6OA 4GSYA 1DVRA 4MGZR 2GF9A 3EZFA 4BRWA 4K46A 4QGFA 1XMIA 1G7RA 2D62A 1PV4A 2A30A 3UK6A 1C4OA 2CJWA 1TADA 5FUVA 4MKHA 5JFGA 4CEIA 2FGJA 1E6CA 4JVLA 1NN3A 3TVDA 1U98A 1BS1A 1DADA 2GZAA 2VHUA 1EG7A 3TSWA 2HYIC 3OE7A 2X19A 4PC1A 1G1MA 2CL0X 2ZAMA 1R5BA 3SQWA 2DFTA 4DDUA 3IPYA 2AWOA 1FP7A 3EZ9A 1LS6A 3GJ0A 4LJYA 5JWRA 2DR3A 4TWZA 2PZEA 4AD8A 4LJ6A 3M6AA 3WNDA 1QBKC 1CR0A 2CE7A 3LH5A 4S2EA 4B2PA 4CZ2A 4X8LA 1XCGB 3B78A 3OFND 4B3XA 2WICA 3LLUA 4PZYA 1F3OA 1GITA 2GZDA 1YR6A 1SKYE 4Q1CA 1M7HA 1FNMA 3VR6A 721PA 4KVGA 2IHYA 3SYNA 1YZGA 4DLYA 3A6PC 5EE0A 3ASZA 1TPZA 3X1WA 4FWTA 1ETUA 5SZHB 3KZ1E 2Z83A 3LVRE 1E2PA 5CDFE 2A78A 4KODA 2IF2A 4GRAA 4PSVA 1BO6A 3M0EA 5TV2A 3K9LA 1WRBA 2XB4A 3K70D 2KSQA 4TL6A 3JVUA 4DUGD 3CH5A 4C3ZA 4G1UC 4I1VA 3KQHA 2ZANA 1KK2A 2WWIA 4I81A 4B48A 2V55B 1KI9A 1RKBA 3NEJA 4OK5A 5BN5A 2YHSA 3OF5A 3AF3A 2ZYWX 2Q0HA 4NE2A 3K09A 1KSGA 2Q9BA 3QVUA 2J45A 1OXXK 1R8QA 2CDNA 5CK5A 4L9WA 1S3SA 4FCTA 2HV8A 3GEEA 4M9QA 2WMNB 2GVDC 3TVTA 4ZDJA 1G3MA 4LJAA 4NCKA 3I1FA 4Z1MD 1G8YA 1ZM9A 1G19A 3RWMB 3HYRA 5BWMA 1E0JA 1QHHA 1Z29A 2QORA 1AN0A 4KO8A 5KO2A 2WOJA 2ZJ8A 5G3YA 1CULC 3L2OB 2QT1A 1IN7A 3KJGA 5AJWA 2B8WA 4CEHA 4RKEA 2GA8A 1IY2A 2EYQA 3TR5A 3R8FA 2IYTA 4HZIA 1OXSC 4DSOA 4P33A 4C0BA 4JLNA 4DB4A 5LD2C 3VAAA 3U44B 3SI7A 1GUAA 2FZ4A 2A5YB 3Q3JB 3I3SR 3CWZA 3QKSA 4BFZA 2WWYA 1Q1BA 2RGEA 4Q4JA 3CF6R 1G6OA 3DMNA 4JS0A 3TMKA 1WBDA 2YC2C 3IHWA 3CF2A 3QY0A 1JPNA 2WHXA 4HLCA 3TUIC 4XD7A 3PEUA 1T8UA 5IDVA 4QNRA 4BECA 3CWQA 4DLXA 1JR3D 3C8UA 4GT1A 1NL3A 5G3ZA 3Q9LA 4A82A 1W36B 3A36A 1CJUC 3VHXA 4QFMA 4TLEA 4IHQA 2QU8A 4M21A 4A0FA 3PEYA 2RGNA 1E9SA 4RD0A 3A4LA 3NBFA 2OLKA 1OKKD 1Z0IA 3K0AB 3CRQA 2ZUDA 4ILEA 4XSHA 2FEMA 1P9RA 4NU0A 1XU4A 3TUZC 1FQKA 1P60A 3DOFA 3BH7A 4C0JA 1Z6XA 1ZVQA 3IILA 2XOKD 2CVHA 1KI3A 5E3HA 3OFNA 4TZ0A 5TXGA 4TL7A 5FBQB 3VU9B 2EU8A 1G291 3ECCA 1ZM4A 5DI3A 2GK7A 1VHTA 1S0UA 4YMVA 1BKDR 1IHUA 3B9PA 3A4NA 2RGXA 5FBVB 1RFLA 2OFXA 4Q9HA 2CXXA 5FPSA 2AR7A 1OB2A 4JBYA 1Q20A 2WJVA 2JA1A 2FPLA 3V9PA 1G5PA 1GDDA 3KJIA 4ZDWA 3QKTA 3W5IA 3THYA 1TEXA 2OG2A 4I99A 4DUGA 1GRRA 3P1JA 4Q1FA 4XIGS 3W9YA 3FOZA 1KTVA 3B1VA 1U0LA 2C95A 2IWHA 2O8BA 1GAJA 4TN1A 4EPXA 3NH9A 3EZ2A 1KY3A 3THXB 3NXSA 5IHPA 2OM2A 4AIIA 1RYHA 3HU1A 2YOFA 4JL5A 5FOWA 4M9SA 5EE9A 4B33A 3NC0C 4LPKA 2YNMA 1VHLA 1HT1E 1Z6GA 1T9HA 2AXPA 2VO1A 2C96A 3BB4A 4PFSA 1G3QA 3AB3A 4GMXA 5J40A 3GLHB 2OBLA 5K8TA 4U02A 5AUQA 4R2HA 3P4YA 3AKCA 1ZUNB 3ZIAD 1S8FA 4C30A 2ZJZA 2IT1A 4YMSA 2REBA 2IYZA 1SVKA 2RGAA 3NDPA 4Q4HA 3SJZA 4AG6A 3DO6A 4LJ9A 5EP2A 2JGNA 2GKSA 3SNHA 4TZ6A 4P4UA 1II9A 2K5UA 3B6EA 3OIVA 1XTKA 5B57C 2CVFA 4QBHA 4HAYA 4E22A 3R7WB 5BN4A 4C7OB 3IGFA 5DYIA 2IX3A 4AKHA 1KIMA 1E9CA 2CL6X 3LY5A 4ZKDA 4UXIA 3T34A 4L9SA 2ZS8A 3B5JA 1I4LD 3ZVRA 4LBYA 1SXJA 1VCNA 3ZZUA 4BLOA 4XWKA 1AS2A 3THWA 2CK3A 2W2XA 3OIUA 2GILA 4LHXA 4HAXA 4PSKA 3NBZC 4MRPA 3NBYC 1JR3A 2VP9A 2P5SA 4FI3C 1OE0A 3R9WA 2ZRAA 4GP6A 1OXVA 1NVVR 2BOVA 4WW0A 2Z0MA 1XTSA 1M6NA 4XTRA 3SBEA 4DCUA 4F4JA 4LBVA 4NYMQ 5DSZA 1MRNA 2J3EA 2FPMA 4W7SA 4XWOA 1PLLA 3H0KA 3LXXA 3T1VA 1OKKA 2ZRGA 3IEUA 3QXSA 4ZKEA 3REFA 4PPNA 1P6XA 2XXAA 3PQCA 3ZD6A 3NIBA 1ELOA 1UPTA 2AN9A 3AGQA 2QBYA 4O2RA 3A1SA 4TYWA 4CRWB 1A2KC 2EFEB 1G8PA 2UKDA 2R6DA 3SBDA 3L82B 3L43A 5SZKB 3KKOA 3W3ZB 4O2LA 4AURA 2ZQ5A 3O8BA 3ZQJA 3ICQB 1GNPA 2QAGA 1DAMA 3GMTA 4II7A 2CLDX 3AUXA 2BBWA 1XNJA 5JZVA 1D2NA 5FOXA 4PC6A 2YJTD 4DEXA 1KKLA 1BMFD 1WA5A 1UBCA 3D31A 3BGWA 2ZI9A 1XZQA 3FKQA 4IJMA 2IXEA 4YXWD 1AKYA 1JEEA 1AGPA 2GETA 2ZUCA 2FFHA 1U9IA 3DM5A 1ZC4A 4HLUC 1DAKA 4B2IA 3GLIA 4HZUA 3QIAA 2FOLA 4V02A 2ZE6A 3RABA 2H92A 4DLTA 2VPPA 4DSTA 2V8OA 3UXMA 3PCRB 1KJZA 5LB2A 3VX3A 1D6JA 3D7MA 4QGGA 3WRYC 3VKWA 3TIFA 3QXXA 4HAUA 4UKDA 4Q9JA 1UEIA 4KU4A 1U81A 2HLDD 5G53C 2H16A 2J41A 4NYMR 5JEEA 4V0ME 2QGNA 2VP5A 5FR1A 1X3SA 1PUJA 3UPUA 1TAGA 1FQJA 1PJRA 3T06B 3LW7A 2ZI3A 1ZU4A 3BC1A 5B30A 2P65A 3AKYA 4C0AC 2X1VA 4EPTA 1N25A 3ZIAA 1XXHA 5HZKA 4EPRA 4IOLA 4KBFA 821PA 1E2QA 2KI5A 3LBHA 2G9NA 2EVWX 5FL7D 4B71A 3OIWA 3AKEA 3CZPA 2ZJ5A 5EE1A 3LO5A 4QJ4A 2FDCA 1M2OB 5GJWC 5LD2B 4LK2A 1ZIOA 3C14C 4KSBA 5TVKA 2BCJQ 3F5FA 5GJCA 5JJKA 4PXAA 5JRJA 1JJ7A 4URUR 1E69A 3U3RA 3I8SA 3X2SA 1E9RA 1OIXA 4N1AA 3EASA 5DLQC 3A1WA 2ATXA 2B8TA 4UXHA 1AQUA 3AVYA 4FN5A 4JLBA 3RHFA 4GOKA 3I62A 5DN6A 1XTJA 1KJWA 3ZDQA 1O87A 1Y63A 5TY0A 4OQXA 1OFUX 2VP0A 3ETLA 1AJEA 4MYHA 5EZ6B 3UG6A 4BRUA 1ZCBA 1TX4B 621PA 3V00A 1G7SA 1XWIA 2A5DA 2VP4A 1IY0A 2DBYA 2FSFA 2IS1A 2FA9A 1RJ9B 4KYIB 3ZZTA 1S1CA 2CHVA 3S1AA 4DDVA 3AUYA 2R8RA 4RD6A 1JXOA 2PJZA 4TLAA 1LW7A 3K8YA 3I32A 3BH6A 2CBZA 2GJAA 4D82A 2MMCA 4A8JA 3ZVNA 1SVIA 1WP9A 4RY2A 4JIMA 3GJ5A 4O25A 4LV6A 1GWNA 2ZSEA 3QG1A 4A0GA 1BMFA 3P32A 3RANA 4TMXA 1T4GA 1D8TA 1T3HA 2F1JA 2NIPA 1F2TB 4OKSA 2JJ2D 2NTYC 4Q47A 3GJ3A 3L8YA 1KMHB 3QENA 1OH7A 3QJYA 5DNYB 3G0HA 4GI7A 4Q02A 3FKSA 4ZIRA 2QP4A 1NY6A 2R6AA 4EJSC 4Q4HB 3EZ6A 1NI3A 1XX6A 2YOGA 2O8CB 2PL3A 5CK4A 2ZYVX 3P4XA 4FD2A 1FFHA 1CJKC 4JL8A 4AKEA 4HATA 2IYWA 1RC8A 2HLDA 5C18A 1PLJA 3FMPB 3GLHE 2XNSA 3VX4A 3H86A 2XTMA 4OQFA 3DVLA 4Q1EA 4A2QA 3DZDA 4C4PA 3U6KA 4PC2A 5AK0A 3SZRA 3U3OA 2IEZA 4Z51A 1Q3HA 1J2JA 1EFTA 4QJ5A 1P2SA 2XITA 3FYHA 3K0CC 5EP1A 1SXJB 1KO5A 4IDPA 3FGNA 2BBSA 1OIVA 2GK6A 1KKMA 1Q3TA 1SZPA 2ZYTX 5TMPA 1TF7A 1Z6AA 2C5LA 5GJBA 5FL7A 4B74A 2ZETA 4IOJA 5BQ5A 1LTQA 3GLGA 3X1YA 4PO1A 3HR7A 2ZUBA 2WIBA 5KPDA 2CLCX 1QDEA 1NP6A 1XPUA 2IYSA 2XEXA 1SVMA 2R6FA 1P3JA 2W83A 5CIQA 4IDOA 4DLZA 4JSYA 3E70C 4MQBA 2XXAB 4JLDA 4TT3A 1OH5A 1ZNXA 3E5HA 4QJ3A 1NJFA 1J8YF 2QI9C 1EX6A 2ZAOA 3ZJYA 1ZRHA 3FWYA 2JLQA 1YE8A 2B7CA 1ZINA 3T1QA 4CDGA 3I92A 3CPEA 4D80A 3QNUA 2QPTA 1G3IA 2WOOA 3KTAB 3ZS8A 5CYPA 5A4JA 4QG7A 1MV5A 4M9ZA 3OZXA 2AK2A 4Z8YA 4D0GA 2H8KA 4HYYA 1G16A 4RSGA 3NEYA 5L3QA 3EIQA 1CP2A 1HA3A 3KXIA 1N5IA 2F1IA 1UDXA 1YR7A 4AYTA 4EFNA 2NOAA 1XZPA 2NO6A 2CNWD 2RB4A 2PH1A 2QRZA 4RD3A 2V6IA 2WKRA 1KI8A 4OBEA 1RW4A 4B6EA 4R7ZA 3T15A 1R5NA 1O3YA 5FTLA 4ZPXA 4QHYA 4ZCMA 3A1UA 1OJLA 4KBGA 1QHXA 3SU8A 3AVXA 3IKJA 2XSZD 2O5VA 2J0UB 2GCOA 3RC8A 2GJSA 1NMYA 3RNLA 1P73A 2QM8A 2GVZC 3LA6A 2C03A 1XMJA 1U2RA 3AF2A 3MWJA 3U4QB 4G5SA 1E98A 2IF0A 1RZ3A 2W6JD 1OT3A 4KVAA 2HEIA 4K8OA 2FN4A 2NG1A 2JJ1A 4TTRA 4NYJQ 2JJ2A 2CCKA 4ZDIA 1QVRA 4Q7KA 2WTUA 2ZRIA 3K1JA 1I2MA 1OPXA 4OK6A 1R0WA 1NN5A 1JBKA 3WP1B 4HLDA 4BFSA 4LYFA 5JJLA 2QUZA 4IVRA 3OHMA 2ZJ2A 3UMRA 1ZM7A 1G20E 1C9KA 2IYUA 4E03A 4Q7MB 1P2TA 3N70A 3B1XA 4DRZA 5BYJA 4JT4A 5KSYA 1LS1A 1N6RA 2XTNA 1JR6A 4TLCA 1IN6A 4RVCA 4LJ7A 4LYJA 2BCGY 2QY9A 4P4SA 4PQYA 2V4ZA 4JLAA 2BJVA 2P67A 2X2FA 5EXTA 1XEFA 3IQWA 2H1LA 1E1RA 3FMFA 2N1BA 3D6TB 5BN3A 3F3YA 3T1OA 1GM5A 2IWRA 3X1ZA 3ZVMA 3FPAA 4A92A 2WPDD 1G8FA 1MH1A 1OB5A 1UDWA 1CRPA 3N2EA 4BLPA 4MDFA 3C4JA 3H84A 1UAAA 5L3QB 3EC1A 1UKYA 2P3SA 1S2MA 3U3KA 4ASUD 1VMAA 1JECA 1OLOA 2AD1A 1VG8A 1XTRA 2VEDA 421PA 2D06A 3EZ7A 1YZUA 1ZD9A 4TYNA 1G64A 4NYJR 1GKIA 3KX2A 3M1IA 1BH2A 3AP3A 3S1AB 3WY9A 1WCV1 2F55A 4DT1A 1DO2A 1JI0A 4YDSA 2G0NA 4PAOA 4BPBA 3MG9A 4M1MA 1F60A 2XAUA 3SFZA 3WP0A 1NF3A 3IEVA 3GJ7A 4A6PA 3K0FA 2BDTA 2IYYA 3SYLA 3BFVA 1MO6A 3QF4A 2ZEJA 1UKEA 4WIAA 1PUIA 1A4RA 1U94A 3K9HA 2PT7A 4X8HA 4WZBE 4AG5A 1D2MA 1SQ5A 2LKDA 2IYLD 3DM9B 1FX0B 2JLRA 2J59A 4W5JA 2GRJA 3BIFA 1E4VA 4K81B 1Z2CA 3KJHA 1ZC3A 3W5JA 1UADA 4RZ3A 1D9XA 2QMOA 1KI2A 2FJUA 2VHCA 4Q9LA 1CJMA 2BHRA 3CUEF 3QPVA 3ZZ0A 3TH5A 4C2TA 4DLSA 1N5JA 4JSTA 2AKAB 2VLIA 2H57A 3CONA 2OHFA 4TYPA 1KO1A 4FMCB 1C1YA 3RRMA 4URZR 2R6GA 3U7GA 2W6JA 3QEJA 1HUQA 5UKDA 4D6PA 1B0UA 3EPLA 4OJQA 1NBMD 4LRWA 3G5UA 2NGRA 3L8ZA 5FPTA 4LDJA 1I2DA 3ASYA 4EJSB 2OXCA 3A8TA 5HTKA 1DOAA 1FZQA 3DDCA 4DWJA 1KY2A 2QEQA 2HXYA 2WWWA 3W34A 4I1UA 4GNKA 4QBGB 3GLGB 1COWD 4G0NA 3K09C 4URXR 3FHCB 4WXRA 1EFUA 2HT6A 2P6NA 3RS7A 4CIDA 3CM0A 1YRAA 4PHTA 4JBWA 2Z6VA 1R4AA 1N6PA 2GDJA 2V1UA 1E9BA 1NKSA 4KAXA 3SEAA 1SXJE 4NCHA 3VR4A 1A82A 1Q57A 4R9UC 4TL8A 1E1QA 3BD9A 1P5ZB 2UVQA 3E2IA 1SULA 4A15A 1NVXQ 4A36A 4MRSA 1X8KA 2ZTSA 5HKKD 2J0QA 1G3UA 3UG7A 1US8A 1A5TA 3Q72A 1EESA 3BWDD 3FB4A 3FVQA 1E79D 1L4UA 4N0DA 3IUYA 2WWXA 1Z0AA 2YWHA 3CZQA 1OH8A 1U0JA 4E09A 1G5TA 3ZLJA 2HUPA 3VFDA 1GOTA 1F2UB 4M1OA 3C7KA 1R2QA 2ANCA 2LKCA 1KO8A 3PV0A 5SZJA 3O8DA 4YMWA 3TBKA 5CM9C 3VMFA 2PZFA 1HQYE 5HR5A 1FP6A 2JEOA 5HCIA 4EFLA 4FMDB 1SVOA 1OXTA 3U7FB 3EIEA 2WJGA 2ZI4A 3ADKA 3B85A 3SS8A 1AA9A 1J7KA 2WSSD 3R8CA 4TMKA 4LV5B 4ARZB 3RLFA 3CPJB 4TMWA 4E5UA 1SHKA 4IDNA 3AEZA 1RYFA 4Q4AB 2VBCA 5AR1A 2ZRLA 4D26A 2RGNC 2RCNA 5FTKA 5JSZA 2QA5A 1KK3A 1LNZA 5L3SB 3O8RA 4U5XA 5IK2D 3CH4B 2FX3A 5JHHB 1G8GA 2GNOA 3CB4A 3B1WA 3KKPA 1YZLA 4BLQA 1EWQA 2A5JA 2J7KA 3KXKA 3LBNA 4RCYA 1KI4A 3W8RA 2FFAA 1VCMA 2GEUA 3P27A 2LWIA 4RD2A 5FTNA 2ZJBA 1JJVA 4B2LA 4HDQB 2WV9A 3GJ8A 4MGYR 2RGBA 1HY3A 2BKUA 4PHGA 5C2JB 5FBLB 5FI1B 4URYR 3SDZA 3TAHA 4LYHA 5AJXA 5FTMA 5HE9A 4UXJA 4LSGA 1G7CA 4M22A 2XZLA 1MKYA 1T0JB 2Q9AA 3JZAA 2QTVB 5EJEA 5AUPB 1XEWX 3G82C 1NBMA 1XD2A 1Z08A 2AK3A 2QMEA 4B6FA 2HCJB 2ORVA
chains in the Genus database with same CATH superfamily
4NAUA 3PRJA 4WKGA 4Z7JA 3WFZA 4EWLA 4PAMA 4URHA 1PHRA 1PR0A 2VYFA 1XWFA 1C2YA 4HAOA 4HQOA 1RMYA 1PQ4A 3K53A 4OH7A 2QXTA 3IVRA 2QQ5A 3RBVA 3U4CA 4N54A 1COWA 1GPMA 3HJNA 4BNWA 4KV9A 1NV9A 3Q41A 2YXPX 3LWDA 3VSEA 3F90A 4LGYA 4Z4GA 4OREX 5BWOA 3L18A 3P2KA 1FFWA 1C9MA 2QT0A 4H1UA 4OX9B 4OD0A 2CC2A 3UMCA 4KLCA 2REQA 4UPEA 3A0UA 4U7DA 4WOCA 1P2UA 1ZJZA 2ATEA 2W22A 4TLDA 1SVLA 1RXEA 3IVMA 4LOKA 1PJ8A 3PNMA 4EPVA 1JFVA 1KZGB 1S3IA 1G6HA 1XELA 2ILVA 2YN2A 4NBVA 3ICPA 2RGCA 5KNCA 3AZQA 4WXHA 1UQUA 1WEKA 3C74A 4MUYA 5I9LA 2OTCA 3CKKA 1X80B 3QQPA 1G42A 4KK3A 3F73A 1NIJA 1XTZA 2ZJ0A 2AX3A 4D9KA 4PR3A 1ZK1A 1C7QA 3CXRA 3EGIA 3TZLA 4Z54A 1QOZA 4DXHA 4XE5A 1XA0A 1LK5A 2J30A 5JNRA 5F76A 4RJKA 2CLEB 3OT1B 4B84A 3AI2A 1U11A 2VJCA 4OQLA 1YDGA 1TYBE 2WM3A 4M0KA 1JHXA 3DSRA 4ARBA 2C7GA 3U19A 2WLTA 3ZKWB 4F0JA 4Z1MA 1YS2X 3G2NA 3WIDA 4C4ZA 1IN1A 5JCXA 2YVQA 2EL9A 4AULA 2V03A 4WOKA 3RRJA 3G2JA 2CJWB 4GZLA 1YUBA 2AC7A 5BMOA 5K01A 1SOMA 3DDUA 1M34E 2CLKB 4V03A 3QG5A 4ZAWA 5CXUA 3A9RA 5KYYB 3HJRA 2QIPA 4OSPA 2YMPA 3B51X 4E33A 3VNUA 4ME6A 4I5EA 5FWXA 3PRKE 4Q7JB 5J43A 2F8SA 4BKMA 1CBUA 4WLUA 1V71A 1R6UA 4HYTA 3CR8A 4NBRA 3E8MA 4F3NA 4BNJA 1H5QA 5FB3A 2I0FA 5JLAA 2DWCA 5IK2A 2X0FA 3H1PA 2QRGA 4HCJA 2PMEA 5JQGF 4WCVA 3GDOA 1GZUA 2ANBA 3EVCA 3L8GA 3R7FA 3U0VA 2FPOA 3GD7A 5KTYA 1ZRMA 4JLJA 1DAOA 1KDTA 2PAFA 3DH0A 1KEUA 1W4LA 4O4LA 1W5SA 4CLXA 2O14A 3CZRA 1A97A 1DAIA 2RH4A 2AZDA 3QELA 3W3AA 3TL2A 1W93A 1ZYUA 3V8QA 4DBLC 5K0NA 1Z39A 1M1NA 3NOXA 5DHRA 5FLYA 4OK3A 2QAGC 1LK7A 2RHBA 1ZN7A 2VHQA 3FNQA 5BXQC 4GBMA 1QIGA 1ZN2A 5FI0B 1SIWA 3MWDA 2I1QA 3OOWA 3PNOA 3ENWA 4M8NE 4H17A 2ECKA 3CIOA 3Q9UA 1CUBA 2ZAIA 3RADC 1Q6YA 3FOWA 3QPDA 1VKOA 1Y80A 2O4UX 3TKAA 2C42A 5EAIA 1SQSA 1CRLA 1ES9A 4V39A 2VUSA 3KZOA 1U9IC 5C7IO 1Z07A 2J8ZA 2JFGA 5BVGB 2YCLA 4M8KA 4I55B 4W9NA 2Y4NA 4ZT3A 1HYQA 4C14A 3IT3A 2OCLA 1YVPA 3E82A 3QBTA 2P35A 2W2VA 2AE1A 3KC2A 1Z0JA 4R1SA 4UD6A 1QCDA 2VNKA 2VSYA 2DKNA 2IVFA 1YQWA 2WLSA 4U63A 4HNUA 1G1AA 1X7ZB 4YTEA 2J9YB 3L6OO 1QCYA 3DMYA 3JR3A 1DKUA 1AD2A 2YZ7A 1NQOA 3ZR4B 5HKAA 2VZLA 4ND2A 1E4EA 1SCUA 2J87A 3BB1A 2N42A 1QIIA 1TUIA 2CDBA 2IS4A 2HCRA 4ESVA 2Z2ZA 1JSRA 3LYAA 5GZ1A 2XCRB 3KELA 4XVCA 1A04A 3IAM6 4OHMA 4FHGA 2E89A 4QEDA 3TGWA 4UTZA 4RIEA 2FFBA 1J8DA 3AUJB 4DR7B 4CF7A 1SB8A 1WY5A 4AXXA 3FDZA 5K8CA 3KQTA 1B0AA 3K4PA 3VV2A 3KKZA 4ZCLA 3C5CA 1GL7A 1QM5A 2AVNA 3QOWA 4UJ5A 2EBUA 3UJ9A 4JWTA 3ITDA 1QNFA 1ZH4A 3L0PA 3K32A 4QGAA 4KEAA 4GE0A 5JPCA 3MMPA 1UBHS 1K88A 3LK6A 3KQYA 5COAA 4Y0AA 5JFOA 2J3HA 2HHLA 3DONA 1M6HA 3ZNOA 3C5EA 4WOJA 5D3MA 4D3ZA 1U8ZA 3HBNA 2XCSB 4BN0A 1E5XA 4YUYA 1II8A 1A7KA 3O1HB 1HL7A 1QVWA 3D0QA 3PJGA 1DDIA 4P2GA 3ND9A 4ZO4A 1WZIA 4POOA 3BMXA 8ATCA 1J90A 2AVDA 2H1SA 4KDFA 3FM9A 4EI8A 2HIGA 4P82A 2IZZA 4QQFA 1YIAA 2PQ2A 3LNCA 1RT9A 3MJSA 5EJ7A 3GWGA 4E2XA 4CGZA 1BN6A 2W6OA 1G21B 1MAHA 1ESCA 3DE2X 3EOBI 4RMHA 1K7FB 2CJPA 3HXOA 1QF9A 2HEGA 1Q44A 4BZPA 3QLTA 4AMGA 2C9YA 2DYKA 4AG3A 1GGKA 1VPEA 3ET5A 4QAJA 3VR5H 2O6LA 2JFHA 3H5AA 3IVAA 3MWEB 2OILA 5T7BA 1DX4A 2FFJA 2GRUA 4FE3A 4C06A 1H6CA 1SCNE 3QY9A 1SPXA 2AS0A 4IF6A 4O4HF 1PNRA 4WJLA 2L18A 5CB8A 1XL0A 4DR2B 1F12A 2C84A 3ELBA 1ESEA 3RQIA 4CNQA 4EMUA 1X19A 1PFYA 3GA0A 1L3CA 4HI0E 4P93A 2H54A 4P0TA 1TW2A 1T35A 1XTQA 3TFWA 3MGKA 5E4TA 1F6DA 1BW9B 3EMVA 4ETWA 3R74A 2FP3A 3EMBA 4IQ8A 3UT6A 1P7ZA 4KIFA 2ZT8A 4LCJA 1ZXBA 1ZK0A 3VJMA 2IVZA 1CETA 2JFUA 1NVUQ 1UC9A 2O2IA 3QXGA 4UQLA 1F8UA 4ABYA 3ZDDA 1M8JA 1TO2E 5DI3B 4H4CA 2QVZX 1NLMA 5EMNA 3SM3A 3GJ6A 4U7FA 4HUTA 4TVSA 4Z53A 3WYEA 2B6HA 2BUBA 2UYGA 1OA1A 2H1FA 5DSTA 3W04A 3I0MA 3NOVA 3CNOA 1JL3A 2JATA 3AFOA 2YDYA 3C1TA 3KJEA 5JISA 1RMTA 2I4IA 5CFNA 1FRVA 1W5TA 1DEKA 1XFDA 2YZKA 3IEPA 3RO7A 3O4GA 3GMIA 4QXAA 3K70B 2OCBA 1UIRA 3QKRA 4JLOA 2ZGVA 2O8EA 1YNOA 2O8DA 1CW2B 1DBQA 1X7YB 1DXHA 2QV0A 2IK8A 2R66A 1BFDA 3ABIA 5SYAA 2C82A 4IV0A 1WW2A 3DFZA 4N6NA 1ZH8A 1S89A 5B7QA 2CDRA 2YXLA 1Y1PA 3U13A 2ZTHA 1PWEA 3D6VA 1WD7A 1LRKA 4IHJF 3KPWA 2VWGA 1NLZA 5FJIA 1WMFA 2QRQA 1S8NA 1UDCA 4CM9A 2HJVA 4YXWA 3PSHA 5C46F 5JFTA 1SHTX 4PPGA 3ND7A 3NKVA 3UJ7A 3WXMA 2C31A 3R5TA 3M81A 4WEOA 2QVXX 4MV4A 5CYFA 2QLTA 3M6UA 1PFWA 4JYBA 1X9HA 2PCJA 1ID1A 2O2HA 1Z4IA 2RCYA 3IR5A 3HEAA 5JBQA 2HF2A 2AOUB 5KYUB 1L0BA 2ZBVA 3ELUA 1HMPA 3ER8A 1J97A 4LRTB 4UZFA 2R8YA 2ZPAA 1NRJB 1O6BA 3IB3A 1LA2A 2ZPTX 2FSHA 1OY1A 2CF6A 5CJJA 4YRMA 3U37A 4UUNA 3CX6A 3L7NA 1ZJ6A 5FWXB 2O2GA 3H05A 1IWPB 1PWYE 2JS7A 4R16A 1JEAA 1Y4UA 2WWTA 4LZNA 3C3DA 1E6MA 1E5LA 4WOPA 4A6DA 2J0VA 3U56A 3CE9A 1VCHA 1JBQA 1G5FA 2QE6A 2AGVA 2C2YA 5EUQB 1FA9A 1KEEB 2GZMA 2VDQB 4DLLA 4I5DA 4N0EA 1ZOPA 3TEMA 4US1R 4BVKA 4FFNA 2NU7B 2X4IA 4B3DA 4DJEC 1YB7A 5E8RA 2E5FA 4BNUA 3ESBA 3KYDA 1EX9A 5E7QA 3G0IA 2R00C 4MUEA 4RX1A 5CLQA 5ELLA 1X1QA 4TMTA 5ED0A 3R7BA 3T99A 1I3MA 3KDSE 4PTLA 2V98A 4IOMA 4C0KA 3M1YA 3TECE 3NAMA 1J39A 2GBPA 3HUDA 4ND7A 5AJYA 1MT0A 1OHHD 2J48A 3MWDB 3WQQA 2PR2A 5L4NA 2GF0A 2VK4A 4NBKA 2J46A 4TKZA 1CR6A 3D6HA 1FRFS 1IB6A 2WUWE 3GRRA 3TLMA 3PQFA 4IDQA 4GVPA 3NKFA 4KGZA 4LCEA 3TLJA 2Q28A 5T4BA 4CDNA 3AY7A 4AUEA 4BEBA 5BVHB 3KOUA 2AG6A 2YWDA 3FBTA 4X6XA 4KXMA 1FSSA 1VE9A 5BV2P 5K0ZA 1P0FA 3EXHB 4TZKA 3T35A 3JQGB 2DWQA 2A3RA 3GJXC 2G1KA 4BMXA 4M9XA 4XGIA 2AF4C 1SHLA 4S05A 4HN9A 3ZV6A 2C1XA 2GXSA 1QVZA 4F60A 1QHGA 1WUIS 2NUPA 2R7MA 1Z26A 3EDRA 3LGAA 4V3CA 2J9ZB 2O2EA 2AMLA 5J2UA 3WDKA 2NSJA 3IJPA 3JD2A 3OZDA 3A1VA 1EWVA 4K5QA 3U48A 2V7XA 2EXXA 4B6OA 1QIHA 3A9VA 2QUIA 4FINA 1MQ9A 2EZUA 4QBKA 1W25A 2GB4A 3IVCA 5KREA 2WT4A 5B4UA 1CP3A 4HZUB 4PZLA 1B76A 4MW9A 5L45A 2CXHA 3GLIB 4MITA 1V4VA 2GBLA 5AJTA 2X5XA 3V4OA 2JL1A 2IUFA 2JIDA 2REXB 1X8XA 2ZR9A 2PXHA 4R2IA 3V1YA 3C6YA 4R54A 3C41J 3UAXA 4PBRA 5EE3A 3T4PA 3E8XA 3TAUA 5IABA 2OZPA 2FKAA 1FUYB 4V24A 1QX4A 4FLEA 4EIWA 3G23A 2NVUA 3LJKA 4F72A 4JVNA 3B5IA 4P3YA 4RY0A 4ZQEA 3I1JA 4KRGA 5HPYB 2BGWA 2V6JA 2GBIA 1RQRA 1CUGA 4XUGB 3CLSD 3MMZA 3WYBA 4DDTA 5LQUA 1V2HE 2OHGA 4Q1BA 4RANA 3C85A 3JAMA 1Z8FA 3JWPA 5TARA 1HORA 2DR2A 5G1NA 1XJ5A 4XWWA 2P6MA 1YT5A 4ZAXA 3EGDA 3UK0A 3C7DB 1RRVA 2XKKA 1N1MA 3FE2A 1UZUA 3LKBA 4EY4A 3BM5A 2V65A 1LBSA 4LJSA 3AR4A 1FUIA 2OXTA 1YHNA 2FEKA 2I4TA 4L9RA 3W6PA 3FPFA 3OOHA 2QE7D 2FQ1A 3E9MA 4BFWA 1M2FA 2QTNA 3O8OB 1HURA 3GCGA 5H7XA 5KSZA 3ZWYA 2PGIA 3KSBC 3LTNC 1C7ZA 3QGMA 5DXAA 2MYNA 2GZHA 5EIFA 1KA9H 4OL0A 4WFJA 4W9RA 1F48A 1W49A 1Z7GA 2C54A 4WX2B 5A4MS 3GBVA 4KQCA 3OPYB 2C7PA 1I4TD 5K0BA 2XMZA 4NEGA 5EIEA 1A3CA 3UCFA 5C4MA 2G1JA 2W0SA 1BD3A 2H6EA 2ZITA 4OIFA 3USES 1M2VB 3VH3A 4JH0A 1JIIA 1JILA 2ADOA 2GCNA 4MRMB 2EWVA 4FCCA 4N8SA 3CEMA 4OF4A 4PAWA 4WA8A 4AZ3B 5LMZA 3TSOA 3OJFA 1JVNA 4FI3F 3RVBA 4F21A 4OA5A 4TGLA 2SHKA 3K9NA 1SCAA 3R40A 2IU3A 4QYMA 4ZRNA 5JQGA 2WUVA 3NHUA 4UATA 2BISA 3WLQA 1MX9A 2C3UA 3AR3A 5HF5A 3MTIA 2J4CA 2PUHA 4CF3A 4DA6A 2I6UA 5BR8B 1YE3A 1CJSA 1YASA 2PKQP 4OGGA 5E7IA 1L7PA 3ME5A 4DM3A 1QX3A 4HKTA 1OGYA 2FP4B 2XWSA 4JU9A 2TS1A 4LNHA 3ZI0A 4MUBA 4B3GA 3MBOA 4M53A 5FXMA 4HWRA 2O8DB 2NXNA 4P31A 1VKNA 2P2GA 2APJA 1VLLA 1ODFA 1I0LA 1PJQA 4HX2A 4A8JB 4ZDKA 4N01A 4JT2A 1DO0A 5EE5B 1P5RA 2JD2A 2Z98A 4EW1A 1OYWA 3I5YA 4BNNA 2W6NA 4RHXA 2KX7A 3FMVA 5F52A 3KP1A 1P19A 3P7MA 3VISA 4LBZA 5KDLA 3R9XA 2FSUA 1Y8AA 4R7TA 4B82A 4DV0B 3P9QA 1T8TA 3ZLVA 3MWKA 1KYIA 4EM6A 2WZDA 2A1UA 2Q9CA 4XGKA 5D87A 1JG6A 4F4IA 5JD6A 3DNMA 2WUDA 2FUCA 3OWXA 3QI2A 3DUFA 1CUDA 4C20A 3NASA 2QB5A 1PJBA 1EJ0A 4I4TB 2VJPA 3WK6A 2UYCA 5A9RA 4ZIRB 4F04A 3VYVA 2KE5A 3T12A 1R88A 3GR6A 4BYGA 3ADDA 1E20A 1IC6A 1QR6A 2K6GA 4LYYA 1GQOA 1DARA 2O50A 3CCBA 1K89A 1NRWA 4MA4A 3TF5A 3D81A 3WO0A 4BFVA 4MUKA 3H16A 2PA0A 3QX9A 3F6EX 5DVZA 3MLEA 3HA7A 3KFLA 4DR6B 1ISSA 3GLHA 1SU6A 3LAWA 2HMSA 5F2EA 2LUOA 2Q41A 4KCGA 2GJ8A 3R3VA 4CLHA 1VHQA 4LA4A 4UTNA 1XP8A 1ISPA 2RBEA 2VK8A 3T7CA 4IQGA 3H2GA 1JAHA 2JCXA 3W5AA 1GU7A 1QCCA 1R8YA 1N36B 4PHHA 1ZD1A 4CTNA 3PWTA 4XDHA 2W00A 3ICCA 3A6GA 3LFUA 1GPKA 2CLLB 1NY5A 1HDZA 3KYDB 2JANA 5DTJA 5SZIA 2BC9A 1Q7RA 3RVSA 5LL6P 4A23A 2QRNA 1UMCB 16PKA 2BONA 2BFBB 3PVSA 4MVJH 4AY5A 2NPOA 4ZC8A 4C7OA 3KLPX 5IEJA 1H8EA 3ABQB 3MBIA 4FFDA 1E2MA 3CVOA 2DU8A 1JDVA 3EGCA 4R68A 4UDXX 1HH4A 2JGJA 2V9PA 3MRTA 3TTSA 1F7UA 4EBBA 3TW4A 2IV3A 3WLOA 2P6RA 1D4OA 1YA8A 4MCJA 3SR0A 2FRDA 4MA0A 2CKMA 3GEPA 2HSZA 1O5IA 1S96A 1UJ4A 3AY3A 2C2HA 2WV7A 3D3WA 2ZIVB 1B8PA 1AU9A 1SCQA 3RC7A 4ES6A 1DAGA 1JR3E 4AS2A 3AM3A 3VZSA 3OESA 2YN0A 4QTYA 2QQEA 3SBXA 2WTBA 3ZXSA 4LXHA 4MVJI 4I6GA 1T3LA 3C3WA 4EG6A 2PO7A 4O4HA 3L49A 2FG5A 2VH5R 3SPXA 4KFSA 4KWCA 5DYYA 4X24A 1QP4A 1JFRA 3SR4A 1D03A 3L7AA 4EW3A 3DEIA 2QRHA 3JTEA 1UWKA 4ASUA 2AR0A 1DKLA 4BASA 5J2UB 3LQFA 4R2MA 5ANRB 3OOJA 1DX9A 5FP0A 1XZDA 5CPBA 1BZYA 2GO7A 4Q9IA 5DLDA 2QJFA 3G68A 3WNVA 1G3RA 3RJ9A 2F3RA 5HA5A 1SUCA 3WKEA 1XHEA 2JAWA 1WW3A 4IF4A 5IF9A 3LV8A 3A7DA 1QQ5A 3Q3GE 4MUXA 1TZMA 3LW8A 3MN1A 5H70A 2GUWA 5T67A 2EZ8A 2DCUA 5CB6A 4ALJA 4X3CA 1X8JA 1Z0ZA 1ZM2A 3IUJA 1VRCA 3MGCA 2XE6A 2D2IA 2OAQ1 4I6JA 5LUBA 1KE1A 3G8CA 4TQAA 4YLGA 1P62B 2XYHA 1XKXA 1K0FA 1IU9A 1N2CB 1R5OA 2HWWA 2PMBA 3C8HA 2A33A 4JJKA 5TPZA 3IPXA 5T5QA 4LHYA 3DKVA 1M1YB 4X45A 2GYUA 4NMMA 1JLKA 3L6DA 2PBLA 3SNKA 1O5TA 3BIWA 4IWNA 4B5KA 3D0OA 3UWKA 3C1OA 2GCIA 3DO8A 1Q2XA 1TZBA 3O03A 4EKIA 4Q9AA 4XWYA 4CLRB 1E3IA 4ILKA 1YC5A 5EIHA 1CDZA 2FPKA 3INNA 3EGDB 4HEA6 4CQLA 1DKQA 1Z5ZA 2WDZA 3LX8A 3ZCSA 4JX9A 4ZO7A 3DAOA 4GPD1 3KUKA 3BGIA 4IHJA 3OX2A 1PKEA 2FF7A 1RLUA 5G41A 3L05A 1G20A 5F3WB 4UAJA 1DB3A 1IH8A 4FOTA 3HFJA 5AOAA 4J0EA 1XRJA 2XWBF 3DOHA 3TAXA 1X39A 4W1SA 3BJRA 4WBNF 4FS8A 3MA0A 5JU6A 2BJWA 3B82A 3LUGA 1SKUA 2WHPB 5CA1F 1UC4B 5E6RA 5J47A 3U31A 1JH9A 1E2FA 2B4TO 2I66A 4LG1A 5DYNA 1B1AA 4IIJF 2HC9A 1MEOA 4P4SB 1PGNA 1H0HA 4LQ4A 3PC4A 1XXHE 4H7KA 2KM1A 3ORQA 3F3KA 1JDBB 3DE0X 3JYNA 4MUNA 1W5BA 2ERXA 4IRUB 2YY6A 4R0VA 1AH2A 4IVQA 4JDPA 4M9RA 1PJTA 2XJ9A 2IYVA 1T15A 1EBFA 2PKWA 5AK6A 5FADA 3LQQA 4CCYA 1T8PA 3RVLA 4KDEA 3OTQA 3CRRA 1ZJ4A 1OV4A 4D4MA 1LX6A 2ZU0C 3C1UA 2WYWA 4YALA 3DKKA 2BFFA 4MGIR 1GSIA 2NZJA 4AZ0A 1NKTA 4B6PA 4ESHA 3LK7A 4XVRA 1EXVA 2ZPUA 1FB5A 3TW8A 4ANFA 3FI9A 2P68A 4I1SA 3PUVA 5G0UA 1KHTA 5KYWA 1ND5A 1L9XA 3KBOA 2F3TA 4ENRA 3EWAA 2NZVG 3VYUB 5CCBA 2B83A 5TMEA 1EX1A 1QJ4A 3HKEB 4OXQA 1Y6RA 4I9HA 5CPFA 4P8RA 3ZXXA 4YJHA 5C3UA 4UOEA 4D79A 2YYZA 1JSLA 5IWCA 1FMLA 1QSGA 1TLFA 1HEUA 1ZIPA 4NPHA 3Q0EA 5IT0A 1AKTA 5E1DA 4E08A 4QHSA 3JTMA 3KPUA 1M74A 3N8IA 2Q7OE 4DMLA 3QOYA 3TRIA 2E87A 3ZV7A 3VHRA 2IZ7A 4G4SP 1NGSA 3BTUA 4Q6BA 3DBLA 4MW4A 5HGJA 3WYFA 4D42A 1E79A 4TTQA 1C9DB 1CIVA 4YJ3B 2X3FA 1TAQA 4YMTA 3NVMB 1GNRA 4QWMA 5AM2A 1QQ7A 1YJCA 4PQRA 2XUJA 1OR8A 5HMMA 2C61A 2YWFA 1R6BX 1WP4A 4KQGA 2AE2A 3COPA 1XZHA 4QIHA 1I51A 2G72A 4PQEA 4G89A 3MTBA 1FP1D 2A1UB 1E94E 3K1YA 3QU4A 4MMYB 3TB4A 3PA6A 4EY5A 1P2FA 1V6SA 3A2KA 2ODNA 1KAOA 2ODWA 2VAMA 3GXBA 3HVIA 4G56A 2XGSA 3R3WA 1WNTA 1VLQA 3AP2A 3E61A 3JWHA 4JJ6A 3VBEA 3THSA 3EIOA 3C5WP 3R5FA 2UZIR 3DV2A 1KL7A 4FFMA 4LJKA 4OLFA 1V5GA 4AT1A 2PUBA 1KMMA 3BDIA 1FX1A 3DMDA 4NYIQ 1C1DB 3T4UA 4DJFC 4OHYA 2FGKA 2PYDA 1M10A 1HFWA 5B5SA 4XR9A 1F2TA 4DCNA 2B78A 1KMCA 2R60A 5DF1A 5CT5A 1U80A 4OVKA 2EP7A 3N7UA 1JXQA 4RK5A 4L7QA 5IASA 3KHTA 3L7BA 4HXGA 4L8LA 5CVVA 4BN5A 4B2YA 3NGLA 2VPIA 1WHTA 3GJRA 2XX3A 5BW8A 2HR1A 1KJYA 2B4AA 1LCIA 1YC2A 3WBKA 1W85A 4YIKA 2Q6VA 3TTTA 2PX0A 1RRPA 3BL6A 3ED5A 1KZ6A 2CVOA 2J4FA 3GRKA 4AYWA 4D9EA 9GPBA 4NCIA 4C08A 4ZAZA 5IAJA 2P4UA 3OCXA 1C9YA 4AJ1A 2CFOA 3N07A 2C29D 2Q6TA 4UTPA 3ABOB 4HMOA 1Z2DA 2IYRA 4NU6A 2P0AA 5CTAA 2X0KA 2UU9B 3UM9A 2JGDA 1G2PA 3EPKA 3MWLA 4LC0A 4NOLA 4OSEA 4G5QA 3RASA 3VJKA 3WIEA 2JCBA 2IYEA 2MR5A 1YBFA 4BFTA 3HJFA 5KCZA 4IIUA 3D2BA 1HZZC 3OQIA 3CRW1 5BWLA 2QYHA 1JA1A 4Y2UA 4TYYA 2FRVA 2H5IA 1R10A 2Q5IA 3BWCA 4PO8A 5L3ZA 2DHCA 3P0EA 4DUPA 2HSGA 1BG6A 3DCIA 4E2FA 1NFFA 3BGVA 4MB2A 2NU9A 2QVBA 4G0UA 4KE7A 5LBIA 2DB3A 1M54A 2E85A 5B58T 2CV1A 2ZJ6A 3OX3A 1US8B 1ZS9A 4KXYA 1KY5A 2QMYA 4X6UA 1XB2A 3HGMA 3RC3A 4AJ2A 3V7WA 4L6CA 1PR1A 4MTLA 5BXYA 1HT2E 4MUMA 3G8DA 4U7GA 3KUXA 5EKUA 3KDAA 1LJLA 4HPXB 4JUBA 4LGMA 4LCBA 4ZOCA 3ADBA 2CSXA 4I3HA 1MN6A 5MHTA 2OV1A 1Q0RA 1DEAA 1MLDA 3N8NA 3U5TA 4JI3B 1TK2A 4MICA 4H77A 4R8MA 1Z63A 1QG4A 2YV4A 3K71B 1MOSA 3HKBA 1RE1A 1UPCA 1ESNA 4UNPA 3W1VA 4F97A 3KZNA 5F5XA 1BE0A 4X85A 1UKVY 4BQSA 2C04A 4BVEA 2QVYX 2X8JA 3OEHA 5C81A 1GVHA 2RHDA 3KTAA 1N7GA 4KLNA 4YDQA 5FFMA 5HM6A 3RSLA 1E5VA 1JG4A 1VLMA 4X60A 5A7GA 1EUDB 2Q1XA 2QP9X 4HGYA 2N0SA 3DYVA 4UBNA 4NG5A 4JENA 4L4YA 1DRWA 1TQDA 1U7UA 3AY0A 4PHFA 2CZCA 1CRZA 2QTFA 1RP7A 3G1TA 1WS6A 3E9YA 1PT6A 1M7GA 1V11B 3OU6A 4B8YA 1KSFX 5B3JC 2V3CC 3OZSA 4ZEXA 1B6GA 1Z5VA 2DG2A 2JIRA 4V0NA 5M34A 2JIZD 5HZMA 2IEYA 3RBZA 2OV4A 3PC2A 4RPLA 5GJBA 3LF1A 4ENPA 5KNDD 3BQ9A 1LUAA 4QOGA 3NTXA 1NP7A 2O7VA 1L4EA 3GW8A 3JQAD 5F73A 3EFBA 3ZGYA 4OHCA 1GZ5A 2YW2A 4CQLB 5B58C 2PZGA 2NV2B 2IW3A 3R5JA 3R5KA 4N7JA 2BM0A 3RHSA 1NOKA 4KGDA 4MKRA 5JCOA 1HE1C 5HIMA 4GP7A 3ZHYA 1E2DA 5BOSB 4BMYA 1A88A 4NVRA 2QQFA 2NXJA 3H5IA 4D2IA 2P2LA 4OQQA 4R8SA 3FVTA 5DK6A 2YQ4A 1G17A 1SC6A 4W8HA 2I6XA 3K9WA 3KUCA 5E6RB 1YB6A 2Q1WA 1AQJA 2ZUVA 4D97A 2PR7A 3ZD9A 3FOFC 4MGKR 2ZB8A 2M32A 2Y71A 3FUCA 1IN8A 4F6LA 4EJ2A 1NJ6A 1N5LA 1P1JA 4H6XA 1MA3A 3WRYA 4O6VA 2VK1A 4PTYA 4CM7A 3SC3A 5AVJA 1ODTC 2JLUA 4HFRA 3J81k 4G8CA 3VDQA 3I8XA 4JP8A 1EFRA 5DV9A 5T4HA 4B35A 6Q21A 4I3GA 1AMOA 2CUTA 3WWCA 5M5BA 1E9DA 1L1EA 2J5RA 5GTDA 2YJGA 3MD0A 5EXXA 3AFIA 1VJTA 3ZH9B 1RWMA 5I7OA 1YUMA 2Y68A 3TW8B 1KJQA 3HLYA 5EUMA 2OMKA 1E63A 1ZW1A 2R6R1 1SN7A 4YNBA 1Z0KA 2PFSA 4FVTA 2M6LA 1ECLA 2JLZA 2NZWA 1DELA 2R1ZA 1V7ZA 1TMKA 2AV6A 2VP6A 3B52X 4RQBA 4V38A 5CIWA 4DMFA 4YJHB 2Q3EA 3SZGA 1JAXA 5GPBA 2AB0A 4LYDA 5H02A 4QLBA 2VT3A 3WQSB 1NURA 4QUAA 5EWMB 3BSFA 2H5LA 2ZYRA 4YREA 4D9GA 5BOSA 3D59A 1T43A 3WL3A 4HDSA 3K0EA 4BV2A 3R7DA 4DMKA 4JUCA 5FUMA 5KSOA 1E32A 2QX4A 3ODPA 1UUFA 3DBLB 1NYRA 3IBCA 4FE7A 1Z5PA 1DJQA 1ADJA 1JMKC 4HFNA 521PA 2LCQA 5T8KC 3VR2A 2JIQA 5IDXA 3WGNA 2D3WA 3EWNA 5K3OA 3CF4A 4EVRA 4OM8A 1QTIA 1TIKA 3PICA 3DCNA 3S2IA 5M2QA 1A9OA 1JQEA 3Q88A 1RHRA 1KNXA 4V0LA 4CIBA 3QEBZ 2GGSA 1LH0A 2G4CA 5A0FA 4DC1A 1TOAA 1WCIA 3EGEA 4ZCPA 121PA 2B1RA 1Z0UA 4XVQA 2WG2A 4TT8A 5JAUA 3SK0A 3TQCA 3DT8A 5EJMA 4L28A 1ZK4A 2LGJA 5IJWA 1O9HA 2NAFA 1K3FA 4WNCA 2BMVA 4U00A 4RTQA 5G40A 5CDYA 2AN4A 1SEPA 1YAHA 3Q8XB 4LC1A 5SYMA 2JGAA 9LDBA 1JU3A 3IULA 1JZSA 4F9FA 4UM9B 1T29A 4RZQA 4DYHA 1BTOA 1OBVA 1S9DA 1SCKA 1IZZA 4TLBA 1ZR2A 1DBSA 1VYTA 2D2VA 1Z45A 2JJ1D 4LPSA 4QYIB 3K92A 2C1ZA 2ETXA 1CKEA 2NNLD 4LY9A 3IUSA 5H8WA 4E21A 1GGNA 3E3LA 1P72A 1ZUIA 3C1AA 4ID9A 4KH0A 2CXPA 4CTJA 4KUEA 4OLHA 2RHOA 3OICA 4FHCA 2YX1A 2VDNB 3HV0A 4YMGA 1EVLA 1CNFA 1E2BA 1VIMA 2VDVE 3I73A 3KTFA 4RH3A 1C3VA 4FNOA 3W8DA 1IXZA 3LDHA 3OM0A 4B0OA 3NM4A 4LDPA 3MHPA 5CYOA 2NMVA 4N65A 4UTRA 4FOOA 10MHA 3ONWA 1Q0LA 1VG0B 4MVYA 4WVFA 2SKCA 2EL7A 4IL5A 5IZ4A 3MQ4A 3E7FA 4A03A 4HVTA 3UHPA 3GPDG 1OLXA 1JXMA 1KYWA 6GPBA 2DPHA 2I3BA 2C4TA 5JDCC 4Z3KA 5LQRA 3JARB 1LC3A 3RYTC 4LZPA 3GQBB 2HRDA 4O02B 3TB6A 1CJVC 4G0OA 3HLTA 4R7GA 5EKDA 1F1JA 3FAKA 3OQIB 4DG8A 2BGTA 3EARA 4IEIA 2E4AA 3VKGA 4WXPA 1DX6A 2RJ3A 3T7TA 4DTCA 4F91B 4ZZ1A 3CLHA 4WBNA 1PLKA 4NJEA 3UC9A 3WLMA 4YR9A 5KC8A 4G5HA 3KM0A 4CR6A 2I2DA 1EP9A 2IC5A 4S1NA 1FW6A 1XXLA 2B82A 4EG4A 4IIJA 3G7SA 1BA2A 1EXMA 3FNBA 1NU6A 5IBRA 5K3FA 2BFCA 2IUUA 4DC9A 3JXEA 5CR9A 5C9ZA 4I46A 1FMCA 5IAKA 1H6AA 3R09A 4ZO9A 3W90A 1VYVA 2A86A 2F67A 1A4UA 1P7PA 1X1RA 2GHIA 2B0JA 3FCOA 4QBIA 1I5OA 4TXHA 1C3OB 2H2FA 3G2LA 4D3DA 2GPJA 1RVV1 2G40A 1PU2A 2WKSA 1T5HX 4PYNA 2Q4TA 4UNSA 3WGVA 1O8BA 1Q17A 1V5WA 1ACMA 4OU4A 2WUGA 2AR9A 3PQ8A 2CY0A 2ZRHA 3H6HA 2DFLA 2QN6A 4W82A 4KSCA 3V32A 3VVMA 4FMPA 1V3VA 1JH8A 4I4IA 4BMDA 5KOHA 5TVGA 1T36A 2XMCA 3GGPA 4LXTA 3QHQA 4I5FA 1BDHA 1ZM3A 3GJZA 4MV0A 3V46A 1B41A 4KDRA 1AGXA 4IZOA 1Y9EA 3ND5A 5TRTA 4WCFB 1PGJA 2FWMX 2N3ZA 3KU1A 1EDBA 2J1LA 3OZRA 5HK8A 4CUZA 2ZBRA 1LPBB 4NV1A 5MN5A 4OFXA 1JF8A 4OHPA 3TUJC 3OZAA 5CNMA 2MWMA 4G86A 2WK1A 1MFPA 5JEDA 4K87A 2G17A 2ZRPA 5KWSA 1WXFA 2NO9A 4CCWA 3TG2A 3ZX4A 1NUQA 1TQHA 1PEAA 1RAGA 3T4XA 3WGOA 4EYOA 4G5GA 1XFAA 4FOSA 4QUHA 4IRMA 4XQEA 1O9BA 2EW1A 2A88A 2VRCA 4NFYA 5A3QA 1D2EA 2X4LA 1YFZA 4XLZA 2B21A 3PE3A 1SGWA 1LB1B 4R9VA 3ADPA 5A5EA 5JO0A 1EBUA 4EHAA 1IQ0A 2ASVA 4QXMA 1JU9A 3V1UA 1JQLB 4J4BA 4J0JA 5KHLB 1FK8A 1Q21A 1VJ0A 1WZCA 1OH6A 3F7MA 3T9BA 4ISBA 5CUQA 1J5PA 1PJLA 3H1TA 3IESA 1KQNA 3STWA 4Y98A 3PEFA 5B3KA 2OLEA 3LDGA 1H2FA 5IT4A 1WE2A 1HNWB 1CF4A 4I1OA 2B1JA 6PFKA 4J76A 2QLBA 2O2ZA 2OPBA 4PO9A 2FPSA 4F2WA 3UA3A 4BP8A 3MB8A 4G1CA 3U7IA 5KYXA 4ZVSA 1M66A 4K7JA 1EK2A 2ECFA 3RFVA 4BFLA 3REQA 4DJ5X 3O8QA 5ALXA 5AVUA 1G9XA 1TL7C 3ZZ1A 4CLEA 3V2IA 1J22A 1OASA 1S2OA 3LUFA 2OO7A 5THKA 3C3AA 4RJLA 2VYND 3H2YA 3PVZA 1QRTA 2FMFA 1JKIA 3OZEA 1RRGA 1HC7A 3ZGNA 4YRGA 3EA0A 5IVIA 3WYGA 3AVVA 5A4IS 1KFCB 4S1TA 4N9QA 3I12A 3GNLA 4AO8A 5K45A 1VLZA 2J08A 3DDHA 3H13A 2UXBB 3DF7A 3LRPA 3NUGA 4N8DA 2CHQA 3LWBA 4MJ7A 1W4CA 5HCNA 1MW8X 2GN2A 3KOYA 4PC3A 4WESB 3WLRA 1KO4A 2VRWA 4YJFB 4KLZA 3A2MA 2JFZA 1EXWA 1Z74A 2IHBA 2KWIA 1XJCA 2XVAA 3PBKA 3PUXA 1J0AA 2YS6A 4L57A 4RADA 3WMFA 4ZFNA 3HABA 1ZP6A 4K9LA 2ZVQX 3RTEA 3AI1A 1DKOA 3CMCO 4I36A 1CIJA 1LBHA 1XLUA 5JPIA 3CWCA 3NWJA 1CR2A 2V6FA 5DX0A 4ZAYA 1AT1A 2BF4A 4F5YA 2VYQA 3ZU6A 2PH5A 4DJTA 3A37A 2BI7A 2WVJA 1YV9A 2WT8A 3VTZA 1TUGA 3VDMA 4Q3KA 3IHKA 3HCAA 2ZDGA 4EAQA 1ECJA 2P6UA 4IGAA 4JLWA 3WHLA 1PTJA 1T8SA 5KEIA 3DV9A 1ZNQO 3JZDA 2Q5LA 1O7JA 3TTVA 3UMFA 3RSFA 4F1JA 4F1KA 1Z4QA 2RK3A 1ZH6A 1EINA 1LJUA 3JYHA 3DMGA 3L06A 1D0SA 1Q1EA 1U0NA 3MAAC 4PLWA 3FTFA 3VYTB 3O5AA 4CUKA 3IT1A 3KAJA 4IQFA 1TMGE 1U7HA 3ZQUA 4BVJA 3SMQA 1QV9A 1UK9A 4Q82A 1RI4A 4PX5A 4ZI3A 3IP6A 1UWLA 2PQ6A 1RD4A 2Q1UA 3D3QA 3PJEA 3I9FA 2XJ4A 3AUAA 3I8OA 2YY5A 3IAAA 1FP4B 3KUUA 1KBOA 4XARA 3HY6A 2QR2A 2ZI5A 2OPHA 4Q4CA 1GKUB 1ZU5A 2CE2X 3OOEA