4U5XA

Structure of plant small gtpase osrac1 complexed with the non-hydrolyzable gtp analog gmppnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
178
structure length
178
Chain Sequence
GSTRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSVVNLGLWDTAGLEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Plant Small GTPase OsRac1 Reveals Its Mode of Binding to NADPH Oxidase
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Gtp-binding protein
molecule keywords Rac-like GTP-binding protein 1
total genus 66
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4u5xA00
4KBFA 1G7SA 3AEZA 1ZU5A 4LCBA 4PC1A 3K9GA 1R4AA 2FZLA 1DAMA 1RYHA 2W6ID 4R71A 5FH9A 4IW3B 5KSZA 3RVBA 2GVZC 4CYMA 4LJ7A 2G1JA 1QHHA 3VR1A 2B6HA 3C4JA 1JXOA 4KSCA 1EFTA 4P3YA 1Z0JA 3OEED 1AGPA 4N1AA 2CLDX 2A3RA 2YKGA 4IDHA 3QBVA 3SR0A 2YZ2A 5EQTA 3Q7PA 4DVGA 3BE4A 3WY9A 3UG6A 3QENA 1U0HC 4DHEA 1SQ5A 1NSFA 5LPNA 5CYPA 4GMDA 4MKFA 1ZU4A 4LDJA 4BECA 1SZPA 1RC8A 3CF0A 2R62A 4WBSA 2B92A 4P4SA 4DLXA 1GRQA 2ZTSA 2V9PA 5KNBA 4G5QA 2AK3A 2YNMA 4MRNA 2VBCA 2Z83A 3KJEA 5D3QA 4D4KA 3ONWA 1OIWA 4HDCA 1L4YA 5UKDA 2CNWD 1W0JD 1Z28A 1YHNA 5EXSA 2PEYA 5EP4A 5CB8A 4IFBA 3LBIA 1FPMA 3V4RA 1J7KA 2HEIA 4URUR 2MSCB 1E2QA 2L0XA 3IBYA 4ZV4A 3OAAD 2X1VA 2EFEB 1OXSC 3IO3A 2NZJA 2OAP1 2A5DA 5J4LA 3C15C 2XZLA 5HE8A 2QM8A 5HZHA 1UKEA 4URVR 3NEJA 2F1IA 5FBLB 3RDPA 2JGNA 4LHZA 2ZXUA 4YMTA 1US8A 4JLAA 2QMOA 3F8TA 2XJ9A 4BASA 3FB4A 4J0QA 3AVYA 4G5GA 3WYAA 1TQ6A 3GJ5A 4YLGA 1MO3A 1LF0A 2Q9BA 3GJ4A 3TNFA 2EFDB 3A4NA 3N5CA 4IEEA 5EP1A 1XEWX 3WNDA 1FZQA 4YONB 1XTSA 1BS1A 3GJ3A 4TLEA 3W3ZB 4EFLA 1JBKA 1XTIA 2BBTA 4NBSA 4XJXA 1S3GA 5JCPA 2R6FA 3BGWA 1DAKA 5FI0B 4EPWA 3GP8A 2WWGA 2BBOA 2IXFA 2IF2A 3SN6A 1OIXA 3ICQB 1GL7A 1SKQA 2OILA 3U5ZB 3Q5DA 2Q9AA 5GJVC 2ODEA 2H7VA 2IYRA 3CW2A 3K0AB 3UMFA 3I3SR 5IK2D 4NZYA 3SYKA 4RCZA 2ZE6A 2CNWA 4ZCIA 1OFTA 1XWIA 1G5RA 4IKEA 4M53A 3RYTC 4GT1A 2XB4A 4AC9A 3PIRA 2QTFA 2ODBA 4HYYA 1GNQA 4KLNA 3WP0A 3OF5A 3LX5A 2ZAMA 5KNDA 4MGKR 1IN5A 4LHVA 3QUSA 2HLDD 1UAAA 2ZRDA 2W2VA 3K1JA 3G82C 3KZ1E 3LQQA 3IGFA 4Q1EA 5AWFC 1IN6A 3NHAA 4PZYA 2OFOA 1D2EA 1VDZA 3CPHA 4CEJB 5SZJA 1T8UA 4OBEA 2GEUA 3CUEF 1XD2A 4LJ4A 3BB4A 4EDHA 2ZI7A 1G8GA 4RFSA 1NKSA 2WJHA 1XTQA 5FOTA 1Q1EA 5BW8A 3O8BA 4PQYA 2WJVA 4XD7A 2GCPA 4XSGA 1QHXA 1KO5A 3MGCA 5AJZA 1MKYA 2QGNA 4M1WA 2ZU0C 1XDBA 3VR2A 2AWOA 4QM7A 3A1SA 2F1JA 3HU2A 4PPQA 1OH7A 2IK8A 2IBMA 4V03A 2UKDA 4QGGA 4QGHA 4DBLC 2V55B 3BERA 4B43A 2A7QA 4QRHA 5JLJA 3LDAA 5JJLA 2AFHE 4PC7A 3U44A 2HJGA 4NYJQ 3RSOA 1AA9A 2CLCX 2YOHA 2BJWA 1EESA 3KUDA 3V00A 3FGNA 5G3ZA 3A36A 2O5VA 3EZ9A 1Z6AA 4POAA 3QXCA 4BPBA 5EUMA 2IWRA 3L8YA 4U02A 1D9ZA 3H86A 2QSZA 2WSSD 2V1XA 2XJ4A 5DNYB 4Z8XA 3UANA 5J5CA 1OH8A 4BFUA 5HE9A 2EYUA 2GWHA 1NNEA 4M4SA 3CWQA 1TF7A 2JA1A 1E9SA 3DMDA 4L15A 1ZD9A 2CE7A 2DY1A 4NTZA 1VYUA 1W4AA 4BGDA 4GSYA 3NBFA 4LGMA 1E2IA 4GOKA 4O2RA 4XVUA 4C0BA 1FUKA 3AKYA 3T1TA 1XF9A 2J41A 1O3YA 4FMDF 4RD6A 1M7BA 1KI7A 3OIVA 3B1ZA 1N6KA 1NL3A 2QM7A 5DISB 3PEUA 3X2SA 4XD7D 4H9GA 2O8EA 4RD2A 1W4BA 3UWKA 3WBJA 1CIPA 4TTRA 1CJKC 1GVNB 5JEDA 1LVGA 5JRJA 3GJ6A 2I3BA 1T9HA 5K8LA 4NP6A 4F91B 3CBQA 1NY5A 1XJQA 1XTJA 3C7KA 3NEYA 4PHHA 2AX4A 4RD3A 3ZJYA 4S2EA 1OKKA 1D8TA 3WNCA 1NVWQ 2AD5A 5KTYA 2ERXA 1IN4A 5CLLA 3HDTA 4MYHA 3I62A 2PX3A 2GF9A 4PC3A 3KXIA 3ND8A 3TH5A 1Q20A 3U3MA 1T91A 2UZ3A 1S1MA 3GFOA 2OBMA 3NVAA 3U6BA 4MRRA 3SFZA 1XP8A 3KFVA 4P0TA 4QL3A 1SVWA 4C0HA 3OE7D 4PTLA 2X8AA 1VPLA 2OSBA 1WRBA 1MRSA 4I1OA 4LSGA 2RGGA 2PZFA 4KFTA 2J7PA 2HYIC 1H8HD 3H4MA 4GPTA 4DLWA 1P62B 3TW4A 4URZR 1G6OA 2R6GA 2C96A 2RGAA 3NDPA 3HYTA 1RVDA 1E99A 4B71A 3W5JA 4DLTA 3KB2A 5FPTA 3QSYA 4BRUA 4ITRC 3GCGA 3RRNA 1Q44A 1XXHA 5EE5B 4HAXA 1DO2A 4OI2A 1DE0A 1P60A 1KI4A 3A58B 2IWHA 3HR8A 3EPLA 2A5YB 1ELOA 1W2GA 1R8SA 4B2LA 4Q4HB 1IM2A 5TDHA 1GUAA 3W6PA 3ZVRA 4HLUC 5IHPA 4B6EA 1KAGA 2FGKA 1RRPA 1E2MA 3DM5A 1BH2A 1DADA 4NCIA 5C18A 2BBSA 4E09A 1W36B 1OKKD 2JJ8A 5AK0A 5DHFA 3FMFA 3MG9A 1E1QA 1XMVA 2OFWA 3ICEA 3QIAA 4C0KA 3EZFA 3P4YA 2JJ1A 2GAAA 4BEJA 1IN7A 1GL6A 4ZI2A 3G0HA 1VYVA 3AM1A 4UJ5A 3EC2A 1KIMA 3C41J 1BYUA 1IQPA 3PV0A 2V7QD 4HLDA 3NBYC 1S4QA 2G83A 2DFKB 5KSPA 3MRSA 2P6UA 5FBRB 5K8UA 4II7A 1BYIA 3LA6A 3HPQA 2FPMA 3QKRA 4E5UA 1KSJA 3C16C 4QBFA 4V02A 2FA9A 3GLHB 3KX2A 3SYNA 2V6JA 3HJNA 3LBNA 1F2UB 1G1MA 2PL3A 3I61A 4UQOA 1G7TA 1NN5A 4B33A 2GTPA 2WVJA 3MCAA 4O25A 4JLVA 4A92A 1VG1A 1R2QA 4DT1A 1NN1A 4N0DA 3J81k 1W0KD 1JEDA 2QZ4A 5KO2A 3WNBA 1Z2CA 1SVSA 2KJQA 4IXNA 2E1RA 4JS0A 1U2RA 4LZZA 4TZ0A 4Q19A 4JKIA 1XMIA 3LFUA 5F98A 4W5WA 1ZIPA 3DKVA 3PG5A 4D0NA 1A7JA 1Z07A 1CRPA 4DUGD 1EFRD 3FHOA 2FG5A 4HZUB 3TSOA 3TUIC 4URXR 1EXMA 4TLDA 1US8B 3VR3A 4C2TA 4QM6A 2YC2C 2J5XA 1XMJA 1SVMA 4PSAA 5KU1A 1JJVA 2A30A 3TMKA 3GEHA 1SKYB 1UBFA 3QEOA 1IBRA 3I73A 3FKQA 3IIMA 2B21A 1J2JA 2D2FA 5DI3A 3VMFA 3MWJA 1R8QA 4PPNA 1TEXA 5FPHA 2C5LA 2WOJA 3AVXA 3UATA 3LD9A 3EXAA 3E70C 3K0FB 3GLHA 3TR5A 3TVTA 2KSQA 1N25A 3QKRB 1E4VA 1Q12A 4AYXA 3GLGE 3RRMA 2CEAA 1ZW6A 1IXSB 4PO9A 4V0KA 4MUAA 3U4QB 2F1RA 1S3SA 2AR7A 5J4YA 1RJ9A 1BMFA 2XGJA 4DCSA 3KTAB 2FN4A 5B2ZA 2IUUA 2BMJA 3PUXA 8OHMA 1ZINA 1SXJC 3L82B 4IOJA 5LB2A 5F9HA 4JLJA 3VNVA 1FQKA 4TWZA 5FI1B 3VU9B 3A37A 3KQUA 4FMDB 1JPNA 5EE0A 4M9QA 3D6TB 5IT5A 2ZAOA 2O8BA 2ZS8A 2KB0A 1S0UA 4TQ9A 2Q9CA 1ZUIA 2BMEA 2WPDD 2YOFA 5JHHB 1T0HB 2P67A 4P31A 2P3SA 5F3WB 2ZJYA 4OQLA 1OHHA 4UNQA 1IY2A 1I2MA 1X8LA 2BMFA 4LV5B 1E1RD 1I4DD 4QG7A 4WZBE 2JLSA 5GADl 2GRJA 2AXNA 1QRAA 1MR3F 3PXGA 1N6PA 3VKGA 4JSTA 1G21E 2ZRNA 1G18A 4ILEA 4YMUA 4K8OA 4BE7B 1XEWY 1PLJA 2IS1A 1Z0FA 4G01B 3EIQA 4Q7MB 4DEYA 2BM1A 4US2R 1F48A 4DB4A 3IIKA 3MAAC 5EE9A 2J7KA 4IEIA 4KYUA 2Q3MA 4CEJA 3L0PA 1BO6A 4DSTA 4YMWA 5FTMA 1GITA 4M1YA 5FBQB 4DXAA 4BRWA 3TVDA 2ZEJA 5JS8A 2OT3B 2IYSA 1GKIA 4TT3D 1W44A 4LV8B 4PC2A 4AIIA 4PHGA 2RGDA 1P61B 4HAZA 1AIPA 4V0LA 3GLIB 4ZDJA 3SQXA 4NCHA 1JNYA 4LI0A 2ZU6A 4DCTA 4DWJA 5CK4A 4MKGA 4C0LA 1EFCA 1G3QA 1OF1A 4TYWA 3HR7A 3NC1C 4PPFA 1LFDB 1OT3A 3QNUA 5AUPB 1FMLA 2JCSA 1YZNA 3DMNA 4YQFA 1YR9A 4LBZA 3SQWA 1NP6A 3AF1A 3RS0A 2H92A 1WP9A 3KKPA 4RD1A 4EPRA 5JCZA 2C03A 3X1ZA 5JI3E 3TK1A 1TMKA 2ZYWX 4A2QA 3T5GA 1E9AA 1ZM2A 1DEKA 4MRVA 2FOLA 3AGQA 3DZDA 1ZCBA 4PSKA 3Q5EA 2ANCA 2UVQA 5L3QB 2EFGA 4HUQA 3PUVA 1I4LD 2XXAB 1G3UA 1TU4A 2W83A 3TR0A 4DDUA 3RWMB 2BCGY 4H1UA 5FBWB 1Z3IX 5CIWA 3U6KA 3M0EA 2O8DA 1YR7A 1QBKC 2GKSA 4LHXA 3SJZA 1FP6A 3OESA 3ASZA 1ETUA 3GEIA 1Z29A 3U3RA 2BJVA 4IRUB 4BFYA 1X6VA 4MYUA 4MGIR 5JZVA 1G19A 2DWQA 4FMCB 4A6XA 4PO8A 4RJLA 1SXJD 2Q21A 4Q02A 3KKOA 4AKGA 3GJXC 1OXUA 1VHLA 3I8XA 5HKKD 1JAHA 3EA0A 4YC7A 3P1JA 4BLPA 3K9NA 1OFHA 2GJAA 3GEEA 3K70D 2ODWA 2O8CB 1Z83A 3UK6A 1GWNA 4QC2A 3TUJC 3AVVA 3PEYA 2O8FA 4TL7A 1NI3A 1A2BA 1G64A 3VHXA 1JR6A 1KKMA 4C30A 2RAPA 3CWZA 4TSFD 1SXJA 3P4XA 1R5BA 4KCGA 1FFHA 1DVRA 3KXLA 4TYYA 2ZYVX 3IIJA 3KJHA 1NBMA 4MA4A 5KOYA 1RZ3A 2FEOA 4JIMA 4M0LA 3QKTA 4Z8YA 3LLUA 3CIOA 1XPOA 2VYFA 4PZZA 3IQWA 4JL8A 4NCNA 3W3AA 1T8TA 2P65A 3NH6A 3MSXA 4A8JA 3ADDA 1HE1C 3A1TA 2GXAA 1KI1A 2ZUBA 3PUZA 4DLUA 4HSEA 2R6CA 1NVVQ 3FMPB 4JVNA 4XVQA 4QHTA 4B3GA 4UXHA 2IYLD 4B47A 1SVIA 3DPUA 2XOKA 2FU5C 5HCNA 1E1RA 3WMFA 1KSGA 3B78A 2ZRAA 3RC3A 5CITA 3HYRA 1OSNA 3T1OA 4B44A 1D2MA 1DELA 1KK3A 3ADCA 4XSHA 1G3IA 3EAQA 5B64A 4P4TA 2ZRCA 1T3SA 5CJPA 4H1VA 3SJCA 2ZR0A 4XTCS 2JJ2D 621PA 3X1DA 4F4IA 3W8RA 4A15A 1R0YA 2NPFA 1AS2A 4G0NA 3GJ0A 3S1AA 4NU0A 4TSFA 4GL2A 1BIFA 2CDNA 4FW9A 4LBVA 4KAXA 2GJ9A 1J70A 2FFAA 4EIWA 4XWOA 4IDNA 3U3OA 4HB2A 1GNPA 2ORIA 3TSZA 3MWLA 2FE4A 1G16A 2H1LA 3TQFA 2RMKA 4TMXA 1N5JA 4K46A 3A4LA 2JDID 4DDVA 1M7HA 2ECKA 1DAGA 2R8RA 4MITA 1I4TD 4D82A 3AQ4A 2C8VA 2QP3A 4PANA 4WXPA 3BXZA 5AUQA 3HU3A 1IAQA 2LWIA 3AF2A 2IYTA 1QHNA 1TQDA 1Q3HA 1XD9A 4TMVA 3RRZA 5DO9A 4O3MA 2D3WA 3AUXA 3L0IB 3LRPA 4Q21A 3FFBA 2AHOA 3CRMA 2VP4A 2ATVA 2ZSDA 5P21A 1P72A 3I5XA 4AG6A 4V0ME 3OFNA 1W0JA 2N1BA 1IJFA 1JAIA 3A8TA 5HKKA 3JVVA 4JYBA 4WA7A 1Q0UA 3B6EA 3KJIA 4IOKA 1GOTA 2WIBA 4JVSB 1SVOA 1E9EA 1RIFA 1Z6XA 1ZM7A 2JATA 4LJ5A 5TXGA 1SKYE 4OHZA 2J0VA 1M8PA 2HXSA 1LW7A 4DB2A 1OB2A 1VCOA 1Z08A 4DSUA 2GILA 4RSGA 2J1LA 1DAHA 3THXB 3ZVNA 1U0LA 2V6IA 3TUZC 2IYWA 2DWPA 3U3JA 1I2DA 3NKVA 2DCUA 3ZZTA 3SNHA 5JHGB 4A2PA 5BN3A 2FFHA 1XBTA 4BLQA 2Q0HA 4IJMA 4TMWA 4WVFA 3WBKA 2O8EB 1G5PA 1NLYA 1ZJ6A 1E2KA 4AKEA 2REOA 1R0XA 5CDFA 421PA 2XNSA 2IHYA 4NE2A 1RJ9B 1JR3D 3B5JA 2PEZA 3AUYA 2QBYA 4EPXA 4PX9A 5DYIA 2JLZA 1PLLA 3A1VA 1JPJA 3NDBB 2O8FB 4A8JC 3OIYA 3DZ8A 2JLRA 1NLZA 3AP1A 2W6JA 3E2IA 2J46A 1XCPA 2O0KA 4NCJA 1DG3A 2HF8A 3LH5A 4F4CA 1TEVA 2V1UA 4HB4A 1MOZA 2Z6VA 5FUXA 2PH1A 3LXXA 1LF5A 4QKQA 4URYR 3QG5A 4P33A 3T34A 2A9KA 1DS6A 1G8HA 4RCYA 3WMGA 5L3VA 3ZDQA 1MH1A 1E2HA 1CJVC 1UEJA 1CULC 3LO5A 1HYQA 5DN6D 3RABA 1SHKA 5ELXA 1E0AA 1KI6B 4D2IA 2QPAA 2AXPA 3NC0C 3AVOA 2ZROA 3O8DA 2ZE8A 3CPJB 4A0RA 4B6FA 2F43B 4KXFB 1GZSA 4B76A 2VTKA 5FOVA 1GNRA 1VCNA 5A5GA 4PR0A 1BOFA 3EZ7A 1CR2A 2GJKA 2QORA 5FL3A 1F2TB 2OV2A 3E1SA 2CCGA 2HCBA 2HF9A 2AKAB 4MRPA 1GRNA 2OBNA 3D3QA 1XCMA 3CH5A 1UADA 3EW9A 4QHSA 3GJ8A 1U81A 2OBLA 2G9NA 2WWXA 4FIDA 1TUEA 2IS2A 4R2HA 3DDCA 3FKSD 1OXXK 3ADBA 4Q4HA 1ONBA 1W0KA 2GCNA 2G88A 3LV8A 4HUTA 4B3XA 2ZVPX 2KWIA 5DN6A 2C78A 4BZXA 2FFQA 4K81B 3B9PA 3WYGA 4ZCMA 4QXAA 1VKJA 2RKOA 4Q18A 2A78A 2IT1A 2JJ1D 2OXCA 4HLCA 4JBYA 4DCUA 1P2VA 4LHWA 4ZKEA 4AY2A 2VP5A 4GNKA 3PCRB 4HAYA 2QTHA 4EFNA 1KI6A 2CJWA 1U98A 1VG8A 1KI2A 3REFA 2BEKA 1LY1A 1MRNA 3FFAA 5J47A 2QGZA 2HLDA 3AKCA 4IDPA 4KODA 1E4YA 2QE7D 4HB3A 4RKEA 3VTKA 1G8FA 1DO0A 3Q9LA 1NRJB 3MJHA 5BYJA 3LW7A 2QTVB 1YZLA 2CHGA 1HQYE 1JECA 3N2IA 5AJVB 3UMRA 4TZ6A 1E2EA 2OCYC 1N0VC 1F2TA 2ZJOA 2PCLA 2PJZA 1VCIA 4L8GA 4ZO4A 4BFVA 4V0NA 1CBUA 4BLRA 3FYHA 3WMEA 5C4MA 2F43A 2WMOB 1N0WA 1OLOA 1GAJA 521PA 1EFRA 3PFIA 3SDZA 2GJSA 5DHAA 2QY9A 3RS7A 4QNMA 4XOIA 4PZLA 1WDTA 1EFHA 3PEWA 1SXJE 1KJWA 4B75A 1GL9B 3K0CA 4NONA 2YHSA 3B1WA 1J8YF 3KTAA 2R44A 2FGJA 3T5DA 1F5NA 4NMMA 5JWHA 3SOPA 1QVRA 1EX7A 2BV3A 5DI3B 5CB6A 2IYXA 1KAOA 1WCV1 1XNJA 3IEUA 3QKUA 2JLYA 5E7MA 3K9HA 2K5UA 5EZ5A 2ZRJA 5KUTA 3CX6A 2NZ8A 4M1TA 1T5LA 2OM2A 4AWXA 4ZCLA 4HZIA 1OB5A 1CP2A 2DFTA 1HTWA 1PUIA 4MQBA 3I72A 4DDWA 1YRAA 5GJCA 1WB9A 2GEVA 5G41A 2EU8A 1HEIA 4TL6A 4A0FA 1X8JA 1J99A 2OG2A 1Y63A 2XZOA 4OYHA 4NL4H 1W36C 4Q1CA 1KJZA 1NIPA 3L0OA 1KHTA 2IYYA 3AKEA 1G4UR 5AJWA 4DKXA 4QBHA 3U44B 2FX3A 3DOEA 4I99A 1KDOA 4CEHB 1AS3A 2JLXA 3Q8XB 3UXMA 2WMNB 3NG1A 3CM0A 1IOZA 2QAGB 1F2UA 2AL7A 2WWWA 2ZQ5A 4O2LA 2ZI6A 2X2FA 3QJYA 2ZJAA 2AD1A 1M7GA 4YXWD 2ZSBA 1A5TA 2EWWA 4ZI3A 1CJTC 1KZ7B 2EVWX 1MV5A 1IHUA 3GMTA 3ZIAA 4PHTA 4MUBA 3LWNA 2NGRA 3IO5A 1H8HA 3H2YA 1HT1E 1NN3A 3K70C 4CDGA 5FR1A 4X8LA 1FOEB 4IVRA 5M04A 5EUQB 2HCJB 4NYIR 4JVMA 4PAQA 1GFIA 1GKUB 3L8ZA 3KKNA 1X8KA 4NH0A 4LYHA 4TTPA 3ZS9A 4L4UA 5GVRA 1W5SA 2ATXA 4RFVA 3W8NA 1YZQA 3U7FB 2VHCA 1JB1A 2VLIA 4HAVA 1DBSA 3KFXA 2G3YA 1TF2A 4C0QC 1DAEA 2ZVQX 3CONA 3D8BA 4M8NE 5JWOA 5JJKA 1VHTA 5KHOC 2QROA 1AS0A 2ZSFA 3BH7A 3DEFA 3W9YA 1A2KC 1JALA 3GPLA 2QAGA 3LW8A 3LAWA 1WF3A 3IBGA 1B23P 3TAUA 4G5OA 3QEJA 2LKCA 3QXJA 2ZRPA 4DC9A 2J87A 1KNXA 3VNUA 4KI0A 4F38A 2C95A 2O8CA 1CF4A 4R98A 1Z47A 4D4JA 4WIAA 2O52A 2NIPA 1CJMA 1X1SA 2GXUA 4DIEA 1ZUHA 3HWSA 4HDOB 121PA 1DAFA 1CKEA 3CNLA 2EYQA 2WJGA 5F2EA 4GMXA 3ASYA 1CR4A 2PLFA 2IF0A 4EUNA 2ZJ5A 4BZQA 2QMUA 1E3MA 2N46A 3JZAA 3ZVLA 1SVKA 1XTKA 4M1KA 2XTMA 4BWYA 1W48A 3SHFA 5GJWC 2ZRKA 3LVRE 4FXPA 3U4QA 3EARA 3OE7A 1N3BA 5HTKA 1D2NA 2XTNA 2GCOA 3K53A 4QOSA 4N3NA 4BZPA 2ZE7A 1XFAA 4Q4LA 3KQNA 2OO7A 1BMFD 3AVUA 2HUPA 3GLFB 2PT7A 5TVKA 2JLVA 2XSZA 4P4SB 5DH9A 1G5TA 1UJ2A 4QGAA 2YINC 1H65A 3AGPA 3VQTA 4B32A 3ECCA 4EPYA 1WBBA 2VSXA 1IXZA 1UF9A 5E3HA 5C46F 1N6RA 4Y0VA 2WWHA 5FR2A 3D31A 1NG1A 2QBYB 2WWYA 2NO9A 2GVDC 1AN0A 3IILA 2CK3D 1Z0DA 4Q4AB 4ACBA 3KQKA 2F3RA 4BFTA 1AQYA 1JR3A 1VTKA 5SZHB 1GG2A 3GLIA 4GDFA 4QBGB 2QENA 2XZPA 3THYA 2D06A 1E0SA 1JJ7A 5FUVA 4LPKA 3GLFA 4JT2A 2CVHA 2JIZA 5JRZA 4OKSA 5FTKA 1ZP6A 1NJGA 4BLOA 4UJ3A 1EG7A 3FHCB 2GCOB 2R6DA 3MUFA 1NVVR 1E69A 1N2CE 3F3YA 1QDEA 2IUTA 3CO5A 5FTNA 4AKHA 3BK7A 4DCNA 3LY5A 5FUYA 3NXSA 2D2EA 3U61B 2W58A 4LYJA 2CVFA 3AB3A 4HI0E 5H1YA 4C0AC 3R7WB 1VCMA 1OE0A 2Q3FA 1TQ4A 3P32A 3QPUA 4AG5A 3AH8A 1ZNZA 1G8YA 3OZXA 4GZMA 3K09A 4JZKA 1LV7A 4Q00A 4JLPA 2CL6X 4KV9A 2RCNA 3B85A 4BQSA 4KITB 2WZQA 2I4IA 1UPTA 4Y0AA 5LDDC 3RWOA 5C4GB 4Z1MD 3THYB 2DHRA 2ZANA 3HPRA 2Z4RA 4CRWB 5KDLA 2VL7A 1FUUA 1E0KA 4AYWA 4JBXA 2W0MA 5J4VA 1NBMD 1ZUNB 4Q4AA 4Q1DA 4WXRA 3KB1A 2YV5A 4FN5A 1II8B 3DVLA 1HURA 3T1QA 1E9CA 1P73A 4KVAA 2F9MA 2JDIA 4UXJA 4CF7A 4OHYA 2JIZD 1YU9A 4LY6A 4PPGA 4B73A 2QP9X 4Q9KA 1RYFA 2CXXA 1X86B 1XD2B 4TN1A 3K0FA 3ZYCA 4M9XA 1N5LA 4RD4A 1G6HA 1KGDA 2OCPA 3GFPA 1XEXB 3A6PC 2IEZA 2VA8A 2R2AA 1KMQA 2QU8A 1IY0A 2PZEA 2G1KA 1RRGA 1GIAA 2ZRFA 4L16A 1ZC4A 4GZLA 1P7CA 3B9QA 2ZUDA 5FOUA 5TB5A 3LXRA 3CB4A 2LCFA 5AUNB 1CR1A 4JJKA 4P4UA 1CXZA 2MMGA 3IKJA 4JLOA 5L3RA 5LD2C 4GP7A 1OJLA 3HP1A 2KBFA 1W4CA 2AWNA 2IYUA 4DT1B 4QFMA 2WICA 1QVAA 4KFUA 1L4UA 2VP6A 1P5ZB 4ESVA 1P9NA 1ZD1A 1YE8A 3I5YA 1SXJB 1B0UA 3C14C 2GA8A 2VO1A 3PQCA 3V4FA 3QBTA 4TYPA 5LD2B 2ONKA 3WRXC 1Z2AA 2A5JA 2D4HA 4B3DA 3SBDA 2MSEB 3VR4A 2IX3A 2AN9A 3BWDD 1E79A 4I1SA 4LJYA 1E1QD 3WP1B 1XCGB 2WAYA 4OK5A 5TV2A 4W9MC 4OJQA 1ZVQA 2QQ0A 4CW7A 2YWFA 1JI0A 1ZNWA 4PAMA 4CZ2A 4M1SA 1LTQA 1TNDA 2IS4A 3VKHA 5CM9C 1LS1A 2GBLA 1ZNYA 4ASUA 3MMPA 3PEVA 4KYIB 5CYOA 3VX4A 1UBCA 4YMVA 2AKYA 2ZRGA 2NO1A 1MO4A 3T06B 4MYCA 5L3SA 4C2UA 2B8TA 4LPSA 4TLAA 3VX3A 4Z51A 1SHZA 3GLIE 2ZM5A 3I32A 1S9DA 1NLFA 3F5FA 2WKQA 2WAXA 3QPVA 4ARZB 2G0TA 3AVTA 4DJTA 1MABA 1KI8A 2GDJA 1TUIA 2IYQA 3SYLA 2RB4A 1EGAA 3EASA 1U90A 5JSZA 2IYVA 1C9KA 3U7EB 1XRJA 2REXB 3S1AB 5HCIA 3JVUA 4TMKA 3QXHA 5EXPA 2ZYUX 5G3YA 5BQ5A 4MDFA 2J45A 3O47A 3RC8A 4YXWA 4Q9HA 2BIFA 1IJEA 2QT0A 3DL0A 2ZRHA 2FPLA 4US1R 4TMTA 721PA 4EKDA 1H8ED 1OFUX 5A0FA 1OPXA 2YOGA 2ZI9A 1RKBA 4G3XA 1N0UA 3OEEA 2WJIA 3EWAA 3T15A 2JLUA 5FTJA 3JZMA 4KU4A 1IN8A 1ZNXA 2CJWB 2VQSA 2XAUA 3TSWA 2PMDA 5EXXA 1FX0B 3PENA 3SU8A 1V43A 1P2UA 4YMSA 2W0SA 2WWIA 1II0A 2VIIA 5JS7A 1DG1G 2NO0A 2CL7X 5FBVB 3GLGB 4ASUD 4DSNA 1XTRA 1G4AE 2F9LA 4GOJA 4OHVA 4CGZA 2GJ8A 1HH4A 4IVPA 1ZRHA 4QNRA 2ORWA 4DRZA 4ZDWA 3GD7A 1KO7A 2R65A 1D6JA 4DLVA 3NTUA 3D7MA 4HAUA 2I1VB 3QY0A 1M34E 1T3LA 3EIEA 5FOSA 1D9XA 3GJ7A 5JFGA 1Z63A 4ESHA 2CHQA 4F93B 1DARA 4A36A 4D81A 2JJ2A 1E6CA 1XZQA 3Q7QA 1WQ1R 5FOXA 1IXRC 3B1VA 5KSOA 1YJ5A 3QF4B 1PZNA 3QG1A 4C0SA 4DLZA 5CM8B 1DOAA 1OH6A 4LYAA 1TTTA 1K5GA 5JWRA 5DSZA 2CLSA 2BC9A 2H57A 3CF2A 4I1VA 3N2EA 3UKDA 2GZDA 4PAOA 1AZTA 1P3JA 3FWYA 1RPZA 4DUGA 1GILA 1L2TA 4RVCA 2W00A 2D7CA 1KTVA 3PJRA 5H8WA 4F7WA 1W1WA 4XWKA 1E32A 1HT2E 2A2ZA 4JJZA 1EWQA 2QSYA 3K09C 2H5EA 1VIAA 4M21A 3OIUA 1KI9A 4KVGA 5JEEA 3U60B 4X8HA 4A1FA 1UBEA 1EK0A 3QKSA 2VHJA 3K9LA 2OLJA 1KDTA 6Q21A 2IS6A 4R7ZA 1QG4A 4F4JA 4PHFA 2BKEA 1T6NA 1XU4A 2O0JA 2VSFA 2W6JD 2XXAA 2P0EA 4S35A 4UNPA 4EFMA 2J0SA 1P2SA 3FTQA 4IDQA 1P9RA 2AFIE 3PUYA 1P6XA 1VECA 2QRZA 1KDRA 1GKYA 3NH9A 4PQRA 4Q9JA 4AK9A 5J4HA 5L3QA 2B8WA 1U8ZA 2D62A 4JBWA 4LBWA 3EZ2A 2HT6A 4HDQB 2CK3A 4KJZA 1R0ZA 1NJFA 2EWVA 3CR7A 2IL1A 3PITA 2OLKA 2C9YA 3AP3A 2V3CC 4AI6A 5CK5A 5CLQA 4IDOA 1UDXA 3KJGA 3UPUA 4JLNA 4UNNA 3EA5A 3I8SA 4WZAE 4FINA 3DKPA 1R7RA 4B2IA 1NMYA 2ERYA 1OW3B 4Q9IA 2GK7A 3QF4A 1W4RA 1QHHB 1AM4D 3FKSA 2AK2A 2FWRA 1Q1BA 1AK2A 1DAIA 2WKPA 1H8EA 3P26A 5D3MB 1T5IA 4ACAA 2ODNA 1XXHB 1M74A 3QVUA 3R9WA 3ETLA 2NTYC 3R20A 1AZSC 1KO4A 3EZ6A 3AF3A 3MFYA 5IDVA 4CEIB 3CRW1 3T35A 2IXEA 3QQ5A 2FF7A 2ZJBA 3HU1A 2GETA 3OIWA 1ANKA 4U5XA 4Q1AA 4LUCA 4TQAA 3GLFE 3KUCA 2JAQA 2YWEA 1W46A 1JR3E 4FD2A 3K0CC 2JASA 4MKIA 2SHKA 3M1IA 1JXMA 2GNOA 2GEDA 2MSDB 1XD8A 2VHQA 2YC4C 3RS5A 1U0JA 1A1VA 2J7PD 3VR6A 2ZRMA 4G1UC 3CRQA 5FL7A 3MWKA 2B7CA 4AD8A 1L8QA 2FPKA 2ANBA 5FTLA 4OQNA 4KBGA 2YVUA 4AYTA 4D4MA 1W7AA 3EC1A 3CX8A 3MLEA 5AJXA 4TLBA 5LBIA 1XPRA 1ZBDA 2KBEA 4HAWA 3MJRA 1D5CA 1GSIA 1ZC3A 2QE7A 3SS8A 4BUJA 4KSBA 2FV8A 3SZRA 4ARZA 2Q3HA 2OUKA 4TTQA 4BEBA 1N6LA 5JBQA 4Q7LA 2A5GA 1N6HA 4CT4B 2ZRIA 4GBMA 3SJBA 3CRRA 5EZ6B 5EP2A 4EQ6B 2H8KA 2A5FA 5FPKA 1YR6A 3TAHA 4JVLA 1GM5A 3L2OB 4JSYA 2WKRA 2OE2A 3FDIA 4Q9LA 3T1VA 1Z6YA 2ZJ2A 4U7DA 2W2TA 3FHTA 3RS3A 4PSVA 1Z5ZA 3IQXA 4LX0A 2FEMA 2QPOA 3QXXA 1QHIA 4X8MA 1FTNA 2IW3A 2FSFA 3CH4B 1KK1A 2FSGA 2F3TA 1OFIA 2C99A 2PJRA 2QMHA 3M4YA 4FMBB 3SBEA 3TE6A 5ANRB 2WV9A 3KQHA 1Q57A 3K0AA 5BN4A 3L0SA 4MYTA 3VAAA 1NSTA 4HUQB 2NQ2C 4FCWA 4NDZA 1VG0B 3FMOB 2IA5A 5BN5A 1EWRA 1ESNA 4UXIA 5B58C 4XTRA 4L9SA 2I1QA 1ZIOA 3AF0A 4RZXA 4V0OA 3LQRA 4OL0A 1S8FA 4LWZA 4HATA 3KKMA 4JYCA 2F6RA 1M6NA 1OIVA 3U7HB 3W34A 2PZGA 3BB3A 4L9WA 4OQXA 1YVDA 3H1TA 2VP0A 3IUYA 1HV8A 3QOFA 4GI7A 2GESA 4LC0A 1E9BA 2HV8A 2VP9A 4KLZA 4A6PA 2C77A 4HLQB 2Z5FA 2DFLA 1ZCAA 3ZD7A 5KDOA 4P32A 4WZ6A 3W5IA 3B82A 1N5IA 3TKLA 2MMCA 3MWYW 2ZPTX 3BFXA 3GFTA 4Z54A 3EPKA 1VIYA 3R8CA 1KDPA 4D25A 5FFMA 2BMDA 1KMHA 4NPHA 3U2QA 4D4LA 3CPEA 2P6NA 3ND9A 3V9PA 2IC5A 4LYFA 3AF4A 1U9IC 4DDTA 4D6PA 2WM9B 2XB2A 1M2OB 3LVQE 3QI2A 4G5SA 3N70A 1FTSA 3KKQA 2PBRA 3ZIAD 1E79D 2WIAA 2Z0MA 1G17A 5DLQC 3RRYA 2IHBA 4JT4A 2JEOA 2V8OA 5EE1A 3AV0B 1A4RA 4QJ4A 3B8HA 4PFSA 5CIQA 2ZSAA 1MT0A 2J0QA 3A1UA 1R5NA 4MDEA 2CL0X 4C3ZA 3NIBA 1S96A 2J9RA 2XITA 3R9IA 1E9DA 4KO8A 2EW1A 3M6AA 4O0MA 3TJZA 2J0UA 4EJSA 3FE2A 3ZZUA 2D74A 1SGWA 1G9XA 3RNLA 4B3BA 2GF0A 2XTZA 1E2DA 4JKYA 1UFQA 3SHWA 1YZTA 1G8PA 3CZQA 1ZMXA 4BLTA 4PXAA 4QJ5A 1II8A 4I1UA 1OHHD 1RW4A 4A4DA 5L8VA 4Q5IA 3EWSA 1KYIA 4WOPA 3WHKA 5JSZB 4OK6A 2VF8A 4HB0A 4RD0A 4MKHA 2DWOA 2H16A 4IVQA 4URWR 2XNDD 4ZPXA 2RHMA 1OH5A 5KPDA 4LHYA 5AJYA 4D80A 3SJAA 2G77B 5B30A 5IF9A 2E87A 2XEXA 5GVSA 1WXQA 2F55A 4KFRA 2RGEA 4N0EA 3CLVA 5C2JB 4DSOA 2J59A 3X1WA 2XX3A 4FI3C 1OYWA 1AQUA 2UZIR 1KMHB 4LOAA 1E2NA 4TYNA 1FQJA 1FNNA 4BFZA 4W5JA 1E9FA 2V54A 1E2LA 5E7JA 4NCKA 4D0LB 3THOA 4QJ3A 3EPHA 2BHRA 2Z4SA 1PUJA 4R2IA 2WJJA 2ZE5A 3A4MA 4D26A 5FOWA 3SC3A 4DZZA 2VP2A 4E07A 2GXSA 1OV4A 1CS4C 3T61A 5HZKA 1OXTA 4C9BA 5J4KA 3REGA 3H84A 3B1YA 4RKFA 4Q01A 3LLMA 3ZH9B 3BIFA 4HZUA 1AGRA 5EXTA 3FOZA 1UDWA 3I4LA 2WJYA 3GQBA 3G5UA 1CLUA 3ZGXA 3I92A 4RZ3A 5J40A 2WSSA 1G3MA 5LB4A 2PCJA 1UKVY 3CR8A 221PA 4ON9A 3TLXA 3W90A 3CRVA 3OHMA 3EIHA 2QRNA 4CEHA 2ZITA 4XIGS 1RRCA 3L43A 2QQEA 1S1CA 2JLQA 4US0R 4OQFA 1IY1A 3BB1A 3BRWD 2DPXA 1Z6GA 4EPTA 1NMXA 4IFEA 1SULA 1HUQA 1JQJC 1XEFA 3DM9B 4LJ9A 5EJEA 3THXA 1Z0AA 2ZI3A 5TMPA 3CNOA 1KK2A 4XWAA 4NHOA 4F92B 2FFBA 1WMSA 2O0HA 1EX6A 3OEHD 3VR5A 4JMPA 2C04A 2Y8EA 4CIDA 1PV4A 4UNSA 1E2JA 1XZPA 1U8YA 1R6BX 2ZJ8A 3C5CA 5C1BA 3CF6R 1J8MF 2CBZA 2NOAA 1TL7C 2BVNA 4OHXA 1WBDA 1KK0A 2R9VA 4HEJA 3ZD6A 3IEVA 5KDDA 3BC1A 1G20E 3LX8A 4B48A 1PVOA 2VH5R 1E98A 3B2EA 1GP2A 1YKSA 4PO1A 3TGPA 1KY3A 2XSZD 5DYGA 5SZIA 3KL4A 4PQFA 1U94A 1XB2A 1NF3A 3A1WA 4L5BA 2GZHA 5JJIA 2ZIAA 1LB1B 4TL8A 1SVLA 2GHIA 1JQLB 4UNRA 2BCJQ 2ZRBA 2FJUA 2WSMA 3CKLA 4BFSA 2WWFA 4XVRA 2HYDA 2ZR7A 3VHLB 4JL6A 4MGYR 2WPDA 1RRFA 2BKUA 3ZVMA 1PJRA 1DTSA 1TU3A 1KOFA 4HLUA 4DLSA 3TRFA 4PC6A 4Q66C 2GZAA 2R6AA 4W5HA 5EE3A 1GRRA 2Z43A 3KXKA 1G7CA 1NY6A 2F7SA 4GOXA 1EFUA 1YR8A 4KHZA 1VMAA 1TPZA 2CE2X 1U9IA 2OEPA 2HT1A 4E03A 4YDSA 2RGXA 1KZGB 5KYKA 1XEXA 4IXMA 1YQTA 1Z6TA 2CMKA 821PA 2VEDA 4ERNA 4C7OB 2NO7A 4NYIQ 1YZGA 1W36D 2RGNA 2FMXA 1FMJA 4B3CA 3NBXX 4MH0R 1FX0A 4IOMA 4GP6A 3RANA 3E5HA 1XPUA 1V5WA 1NKTA 1S9HA 1NG9A 4GFDA 2ORVA 4RZUA 3THWB 2BM0A 4ABYA 4FCVA 4CEIA 1LNZA 4A2WA 3AP2A 1Q3TA 3LNCA 1U8AA 1RE0A 2IYZA 1IONA 2H18A 3IHLA 4LC1A 5B57C 4DEXA 1G41A 4EPVA 4M22A 3QPWA 3RS4A 2H17A 4W7SA 4RY2A 3BD9A 1MO6A 1R0WA 2ZETA 2ZI5A 4YDHB 1DPFA 2ZR9A 1VYTA 1Q1ZA 2G0NA 2CCKA 3OEHA 2IEYA 5KSYA 5BYKA 2JLWA 3SEAA 3WRYC 1VG9B 1ZD8A 2EFCB 3UG7A 4C4PA 1KKLA 5GJBA 1G3RA 5G53C 3W6OA 2ASEA 2GBLC 2J0UB 4Q47A 4EJSB 4ZIRA 3Q72A 4NYJR 1T4GA 1YZUA 3QKSB 3RLFA 1Q1QA 4Q48A 1HY3A 3BJIC 1X1RA 3O8CA 2C9CA 3BBPA 4MRSA 4B3FX 2DYKA 1ZM3A 2ONJA 3W6NA 2REBA 2E9SA 4EJSC 2P5SA 2IXGA 3OFND 2OZEA 3BS4A 2ZI4A 3Q85A 4A82A 1Z0KA 1S2MA 2P5TB 5DIFA 1P2TA 1Z0IA 3AKDA 2OHFA 4DIDA 3ADKA 2N42A 4LBYA 2QMEA 3LBHA 1G291 5E7IA 3RSLA 1ZM9A 2Q6TA 5FPSA 5TARA 2QA5A 1E94E 4LJAA 4TMZA 2HXYA 4XH9B 3TBKA 1OYYA 2BBWA 3B60A 3FMIA 4M1MA 1PLKA 2OCAA 2YWHA 3IPYA 2PMKA 4NYMR 2QEQA 1NMZA 5DE3A 4QHYA 4KFSA 1X3SA 3BFVA 3QF7A 1C4OA 1F60A 1FNMA 1N5KA 2ZYTX 3FVQA 4TLCA 2WOOA 5FPYA 1WA5A 2DB3A 1TF5A 1P4SA 2NMVA 3BFKA 1FP7A 4AKIA 1KO1A 3QVVA 4Q7JB 4FCTA 3I1FA 4BLSA 4NKRA 4Q03A 1E96A 2ZS9A 4B35A 1ZAKA 2F1HA 1UKZA 5DGXA 2P6RA 3C8UA 1NBME 2NPIA 4BFWA 3CZPA 4WAUA 2DR3A 2LKDA 4ZDKA 2YYZA 3R9XA 5CJ2A 1CTQA 2RH5A 1YZKA 4OQMA 4MGZR 2FSIA 5HPYB 1QHGA 2FZ4A 5DI9A 5AR1A 4Z1MA 3GLGA 4LJ6A 3QE0A 3AVQA 4Q7KA 3KDSE 4LK2A 2OESA 4JLKA 4AURA 3GLHE 4B2PA 1K6MA 4I4LA 3QXSA 2PT5A 1O87A 2GXQA 3BAFA 5FL7D 4WW0A 3EG5A 3O8RA 4QBIA 4TYQA 3NBZC 1ODFA 1ZM4A 2VSOA 1JEEA 3IHWA 4FWIB 2HJVA 4EAQA 5HR5A 2O8DB 1F3OA 3ZQ6A 1NIJA 1W5TA 4JLDA 1Q22A 3NHBA 4LV6A 3SI7A 1K8RA 1QHYA 4M1OA 1A82A 4C0JA 3VKWA 1XJ0A 3FPAA 5SZKB 1W2HA 4DLRA 1KSHA 4OJKA 1BKDR 4OK3A 5JMTA 1E2GA 1AKYA 1MO5A 2WTUA 5CDFE 4OI0A 4JL5A 4IOLA 4RZ2A 4DLYA 2D7DA 3SFVA 1P75A 2G6BA 2X77A 3IPXA 2ZJZA 3R8FA 2O8BB 1Y3AA 1UM8A 1CR0A 2XNDA 3T12A 4A9AA 2QI9C 5L3SB 3K8YA 3VU9A 2EFHB 3EX7C 2OCBA 2RGBA 4FMCF 5F9FA 2ZUCA 1TX4B 4G5RA 4R9UC 4TT3A 4BFXA 2W2XA 1KI3A 1NN0A 5IRCD 4C7OA 2B7BA 1N6IA 1COWD 3ZQJA 4Q4JA 1U99A 1Z8FA 1QG2A 2OXRA 3PVSA 4X8OA 2IUSA 4Q1FA 1R5OA 4UKDA 3B1XA 3BH0A 1J90A 3CNNA 2VRWA 3MD0A 4NYMQ 1FL9A 2RGNC 2DFNA 1TQ2A 3DHWC 4I81A 3U3KA 1UBGA 5TY0A 4V0MA 4E22A 3ZS8A 2X19A 2C98A 2PLRA 2BOVA 3F0TA 1ESMA 2P2LA 2CHVA 3K70B 4U00A 1QZXA 4GRAA 3ZLJA 2YJTD 2C9OA 1Q21A 1E2PA 2KE5A 4A0GA 2QL6A 1ZYUA 2KI5A 1HA3A 1F6BA 2QAGC 1E0JA 1P9WA 5E95A 4ZIRB 4ZKDA 3EPJA 2QP4A 3DOFA 5D3MA 2RGCA 4B34A 1RFLA 1E9RA 2TMKA 3PUWA 3RS2A 3BORA 2VHTA 2QPTA 1CEEA 2OFXA 1XXHE 1MABB 1G7RA 2GK6A 1COWA 1HQCA 2FH5B 3TQCA 4ZDIA 3P27A 4CVNA 4B74A 3KQLA 2OAQ1 1OXVA 4LRWA 1AJEA 2V7QA 1C1YA 1M1YE 2BDTA 2FSHA 1KNQA 2WBLC 3C5HA 3K0EA 4TL9A 3ZZ0A 3Q3JB 3UMSA 3AVWA 3WHLA 5FUWA 5KPJA 2ZREA 3P20A 5JI2E 2QT1A 1Z06A 2PX0A 4D0GA 2VHUA 3BOSA 4JLBA 4RFSB 5G40A 2QG6A 3WXMA 3VFDA 4FWTA 2BEJA 2EQBA 3SE0A 2CCJA 1NVUQ 4CT5A 5BWMA 3TIFA 1TAGA 1CRQA 1LS6A 1KSFX 4Q4JB 3OAAA 3CX7A 2GAOA 1E2FA 1GDDA 3IDQA 2NO6A 4M9SA 1XMSA 5EP3A 3X1YA 1N6NA 1CJUC 3PR1A 4M2LA 1T0JB 1YRBA 5AUOB 1KO8A 1W47A 5KNCA 4EQ6A 4LJ8A 1II9A 1CU1A 2ZRLA 5H68A 2C2HA 2XOKD 2J3EA 4OI4A 2QUZA 1GTVA 5IK2A 5E4FA 2VF7A 4DCVA 5A4JA 3AVPA 5JECA 1AKEA 3U7GA 3THWA 3UIEA 1QHSA 2QAJA 1T3HA 2HDNB 3RAPR 1WE2A 3UWOA 5K8IA 4IHQA 1FW6A 3BH6A 5H70A 1Z22A 4JLMA 4Q1BA 4OI1A 1L7VC 1QF9A 2BWJA 3DO6A 4OHWA 3X1XA 2WHXA 4A0HA 1KY2A 2X2EA 5K8TA 5BXQC 1HE8B 3RHFA 1NVXQ 3TW8B 2QN6A 1W49A 1XJCA 2YWGA 2ZSEA 2VPPA 2V4ZA 3B7GA 3H0KA 1UKYA 2W6IA 1UEIA 1TADA 4TQUS 3B13B 2FDCA 2NG1A 1N6OA 3K0SA 2DBYA 2FNAA 3R7WA 2ZS7A 2QNRA 1XX6A 3NWJA 4A8JB 1KJYA 3WYFA 4M9ZA 2RHDA 4QGFA 1K5DA 1R10A
chains in the Genus database with same CATH superfamily
1U65A 3AEZA 3GMSA 4H4CA 3M5PA 2YWRA 3QVJA 5DULA 3OX1A 4YRFA 5K6TA 2BEWB 4HXFB 3LDHA 3H2JA 3OQBA 5FH9A 5KSZA 2WIFA 2BKLA 3GF4A 4H7JA 4GVXA 4MVYA 5KSWB 4DWWA 1MT3A 1SQFA 2G08A 3D5QA 1TD9A 2ENUA 2G1JA 2GMWA 4PINA 3RYIA 4HNTA 3VR1A 3LCVB 3C4JA 2J3DA 2HPZA 4KSCA 1AGXA 3AESA 4Z4EA 2A3RA 4PGAA 1WHTA 3B1JA 3BRCA 4QEKA 2YZ2A 2PIAA 3Q7PA 3SHOA 3SR0A 4DNOA 2WF9A 3Q88A 4TUYA 4BP3A 1NSFA 4GMDA 4LDJA 2V3WA 2NUTA 2W70A 1LSJA 1RC8A 4P4SA 1GRQA 4FGUA 1XZKA 5KNBA 2NYVA 1U2GC 4OGWA 4RTKA 2A1UB 2QZ9A 1PGOA 1QTNA 1WUTA 2Z83A 2ZJ3A 3KJEA 3KTOA 4Y1FA 3R75A 2Q1UA 3QE3A 1OIWA 5SV2A 3QZUA 5ALQA 2R8XA 2B5WA 1C9EA 2Y0EA 2IYOA 1H5UA 1E7SA 1W0JD 4U2DA 5FF9A 2I67A 1UBMS 4R8RA 4PVDA 1U7OA 4JXKA 2GM5A 1KYVA 4BX0A 4QXMA 2WEKA 4BCCA 5HXAA 3LBIA 1KOGA 2BYTA 4YRIA 2PKWA 3V4RA 1J7KA 2VYCA 5FUMA 2CD9A 1G8KA 1O9HA 1RNLA 2IYEA 2YJ4A 2ZAIA 3B2QA 1O97C 4LXTA 3STXA 5A4IS 3OQOA 1BGWA 2XIQA 3DV9A 1PD0A 4ZV4A 3DVRX 3HHEA 1CDEA 2L17A 3CNQS 1EA5A 4JUIA 2G9RA 3LUGA 2EFEB 2XV1A 3UGKA 5TJ9A 1SEPA 1OU4A 4X95A 5EIWA 5F7ZA 1Q17A 3AM5A 4IMIB 5HE8A 2HIAA 1ZN9A 4DSZA 1HLFA 3FFTA 4EBBA 4I19A 3AEUB 1TRHA 3DOOA 2F1IA 4IRMA 1TW2A 3EFEA 3Q1KA 1I1OA 2NXNA 1YKGA 5L3ZA 5HMLA 3MTIA 4JLAA 2QMOA 1PZEA 4BASA 3IAS6 7YASA 4ADSG 3WS7A 2JHAA 3X1JA 1TQ6A 3ZE1B 5BR4A 3GJ5A 3LHIA 4AAYA 4DYHA 1MO3A 3TNFA 3WQRA 3C5VA 3HY3A 2R7LA 5IAAA 4AS2A 2P68A 1GT91 1FZQA 3V1MA 4YONB 3RK4A 4C07A 4EFLA 3N8NA 2A1UA 3QMMA 4QOIA 1X1AA 1XTIA 4NBSA 5HG0A 4UUPA 1S3GA 4IUDS 1YL5A 4AMBA 3R3VA 1QQTA 3BDAA 3WRXA 2BDEA 2IXFA 1PQPA 4F3NA 3PDWA 5FIUA 1BFUA 2N3ZA 1GL7A 1SKQA 3IB6A 3F4KA 3SDBA 3PS9A 2WQ6A 1DTEA 1F6DA 2H7VA 2IYRA 3CW2A 2Q8NA 5ELLA 4OFWA 4B4WA 2XDQB 4E5YA 2NVOA 4JC4A 4IGKA 4DWVA 1T6ZA 3QY9A 4AZ0B 4M53A 1UKBA 1RPTA 3RYTC 5AW1A 4JFRA 1SBZA 3EDQA 3MT8A 3JVDA 5EZYF 3CINA 4AC9A 4U39A 4EHLA 5H81A 4AJ9A 3RR2A 1YQDA 2ODBA 3OQ6A 1GNQA 3U5TA 2OGWA 1DBPA 3LX5A 3HZHA 5BURA 1IN5A 4DKXA 4LHVA 1UFOA 2HLDD 4P2BA 1U1FA 4H77A 4PAGA 1UAAA 2W2VA 4ZHQB 2Q99A 3G82C 1GDTA 3BICA 4FEGA 4O33A 2JLAA 4RV9A 3FNQA 2OSVA 2C57A 3AZOA 4PM4A 1L5KA 4OBEA 2GEUA 4JUBA 3G7NA 3GJRA 2ZW9A 4UBNA 5K0JA 4NMWA 1OVMA 4YBZA 3M33A 3UTCA 2XD9A 1XTQA 3G23A 3HZOA 3OCYA 1C3JA 2XWBF 2WJVA 4XSGA 5CX1A 3RVLA 3ACBA 3MGCA 4UTXA 3ANTA 1ZIDA 5IKPA 4G2NA 5HFNA 2CDBA 3ZJ5A 4OXYA 4DG9A 3VR2A 1SXIA 2I4MA 3JAWB 5F5LA 3WTBA 5B7PA 5CURA 4GAEA 5ICGA 4R1PA 3INTA 1CUAA 2CXSA 3FGPA 4E7OA 1V4NA 1SCUA 3SF8A 2QE6A 2Z08A 1NQUA 2R6JA 1WPGA 2IK8A 3K71B 4V03A 2YTZA 4RTSA 5CBKA 4M89A 4B43A 5BT8A 4QRHA 3GJQA 3ZX4A 1PBTA 2HLPA 4RKWA 2OXTA 4LXGA 4QPCA 1L4KA 4XB2A 3TLCA 5JJLA 4JHXA 4QDOA 3GNLA 3NGLA 2ZWAA 4CKEB 1IC6A 4BN5A 2XB9A 2P35A 1X80A 3ZDBA 2YOHA 2BJWA 3G8YA 5EWMA 1EESA 3DE0X 1VBNA 4DJAA 3KUDA 5LKRA 2MWMA 5KOHA 3OT5A 3A36A 2O5VA 3EZ9A 1Z6AA 5D87A 1WBJB 3QXCA 2ZB8A 4BPBA 2IWRA 3WE7A 4BB0A 3C3DA 3STHA 1DJQA 3MOIA 2HK8A 2V1XA 1E89A 5JXGA 3NHMA 1Z5WA 4Z8XA 1P3Y1 1PWHA 3KZMA 5C8XA 5T3UA 2GWHA 3AEYA 4B85A 6YASA 4EYKA 3RVPA 2IV2X 1IFXA 4IJ6A 1CF2O 4L15A 3ZJUA 3O8LA 3L49A 2HBQA 3EXHB 4NTZA 3SNKA 3U4DA 4EGJA 1VYUA 1W4AA 1KYXA 1RAAA 5FP0A 3UMBA 4BGDA 1BJKA 4LGMA 4N65A 1E2IA 4GOKA 4B4UA 5ERYA 1CV2A 4O2RA 2GFIA 2PX6A 4IIFA 3K92A 4IIBA 4JI5B 5I48A 1P0MA 4Q0MA 1M7BA 1KI7A 1MO2A 3OIVA 1NL3A 5DISB 3LTEA 3C3YA 4XD7D 5ARBA 4KXXA 4TOIA 3ZU4A 1W4BA 1EVEA 2IUYA 1DRWA 4XDYA 1UK8A 4MVJE 4Q3BA 2NUAB 2JFVA 4DY6A 2IVZA 2DF8A 4E15A 5ILGA 4WCDA 2C4UA 1E8MA 3CBQA 4KWEA 3C7KA 3OOEA 4H16A 2C3MA 3B51X 4O4LF 1QP7A 3HKCB 1OKKA 3ZK9A 1NVWQ 1Y1PA 2VLBA 2VP3A 2BFNA 4RMHA 3SCZA 4RTRA 2ZUUA 5J23A 3MB5A 1PNRA 1U11A 2FSPA 2GF9A 4D4HA 4PBTA 5MN6A 4DMKA 3TSCA 4D96A 2BLNA 1AGYA 2JGRA 3KTFA 3NHUA 5C1IA 2P8SA 5L7WA 2PM8A 4RWEA 3BTOA 4I14A 4RZHA 4WASA 5K3AA 1ZK1A 3SFZA 5IJWA 3KFVA 4ZGBA 3UHOA 4QL3A 1J2EA 2CXQA 2HIMA 2ZTVA 2X9LA 4PTLA 3SIRA 3H6KA 2PSJA 3FKJA 3PXAA 3PLRA 3NORA 3QPAA 4J0GA 3INRA 5I01A 5MGNA 4HAIA 3TL3A 3P0JA 4YXFA 3VR6D 3CKMA 3W78A 2RK3A 4C76A 1Q0RA 3K1YA 3H4MA 3IOBA 3T7AA 4KNVA 1P62B 1P2GA 3PYLA 1G6OA 3KZNA 3OPMA 1FYXA 1KYQA 4BNVA 1GN8A 3LCUA 4IIUA 1KFCB 2KM1A 2P11A 2NTNA 2VHVA 3P9KA 2JH8A 1C50A 1WULS 3BMNA 3I9KA 1AG9A 4H0CA 4ITRC 4BQEA 4HAXA 2JGDB 5EY5B 2LUOA 1QGUA 2DQKA 1AXRA 3PJGA 3UAZA 4HGZA 1NFRA 2Q5JA 3U4AA 1RCFA 2CXPA 2J5BA 5E1DA 4CDMA 3KVVA 3LLCA 1W2GA 2C2KA 5D6OA 1CVIA 3RJ9A 4B2LA 4KPYA 4N3AA 4P81A 4Q4HB 4R83A 3S44A 1WKCA 2UYOA 3FZNA 1F51E 1OWNA 3EGVA 3SVLA 1BH2A 2E4XA 2BBSA 4DLAA 3QNWA 4UTRA 3TD9A 3N2ZB 3VV3A 4J4HA 5ENZA 3RTEA 3H65A 1MORA 2I22A 3JSAA 3MG9A 4MUJA 2V0GA 4B4KA 3CH6A 4GYYA 5B12A 1TYBE 4IDAA 2D2VA 3EZFA 4CKWA 2GAAA 1TTHA 3DE1X 1VYVA 3AM1A 5ADUS 4UJ5A 3C41J 1BYUA 2RGUA 3KDAA 5L4LA 3PV0A 1H0KA 4QSMA 5JYCA 5F7JA 3QFRA 1XZCA 1GEGA 3TW6A 5FUBA 3O82A 1QVWA 2DPMA 2R7MA 2PKYX 3CX3A 4QWMA 1E2UA 4S1PA 3WV5A 5CXXA 3SYNA 3V2HA 3HJNA 3LBNA 5I7UA 5EJ6A 1G1MA 3EGDA 3TTSA 4S1WA 5AI4A 2PGDA 2R5NA 2J9XB 2BTQA 4J1TC 2ZIUB 3QNMA 1NN5A 3AQIA 4JJAA 3NIWA 3PXBA 3V55A 3QHPA 4HX9A 4Z7OB 1DX6A 2H52A 4JJ4A 1WMDA 1Y8AA 1NN1A 3E2MA 3J81k 1W0KD 2IEDA 1JEDA 2QZ4A 3DD1A 4Z99A 3H04A 3GMIA 4OQ4A 1ZXLA 1Z2CA 1Y7TA 1U1EA 5GZ3A 5BRAA 4LZZA 4KRXA 4RGYA 4JKIA 3DE5X 1TCCA 3IFSA 3LZ6A 3P4UA 5THKA 1R0BA 3DFFA 4D0NA 1IDOA 1A7JA 1X7YB 1Z07A 2BHSA 2R96A 4ZVMA 1CRPA 4PY2A 4DUGD 4PG4A 4OLBA 4URXR 1ZI9A 3Q8WA 1CE8A 3LYHA 4GUDA 4H17A 3HJTA 1G98A 4KKXB 4Q34A 1QDLB 5FPQA 5IKOA 1XRLA 4C2TA 2YC2C 2JRCA 3Q98A 1PDOA 3AL3A 3F6RA 4PSAA 4QXPA 4U1RA 1JJVA 2BP7A 5KU1A 3GEHA 3K8QA 4OG2A 1NJ5A 4AXXA 5B1EA 2C2MA 1SY7A 2RGYA 3LXUX 3PGMA 2HF2A 4HWOA 2NU8A 2O7RA 3HRHA 2FRVA 1J2JA 3IJ5A 3RARA 3VMFA 2EBUA 3NEPX 4S1TA 4NULA 1VE6A 3ABZA 5B3AA 3UATA 3EXAA 1TVKA 2Y4NA 4Q3KA 3M83A 3L92A 3LZCA 3NHSA 3QKRB 4DN6A 2QTCA 5CNIA 3SZGA 2ZBGA 3TCXB 7GPBA 1MX5A 2I34A 1QIHA 1ZW6A 1IXSB 1X1BA 2P30A 5EJ2A 3GX1A 4K2HA 3WGQA 3H1BA 1O0BA 4FE3A 2H4XA 4MLDA 4AZTA 5BUSA 2GASA 5J4YA 1ZMTA 4IUCS 2C7QA 4C7BA 4RA9B 1QUEA 2FN4A 2GEFA 2ILTA 1O94C 3BAZA 2O14A 3ILHA 3A2NA 4L78A 2PRZA 3C6BA 3UO8B 3WLMA 4UE6A 3ZE7A 5MDHA 2PLNA 1ZN2A 4Z0HO 1IK6A 3K5WA 4PZ0A 4TWZA 2JZOA 4I50F 3VU9B 4AWAA 5JQWA 2HOQA 2GYWA 4PRKA 2NV2B 4BEWA 2HDHA 3MBKA 4YH1A 1B26A 1HFKA 1TTQB 3KJNA 2YOFA 1PEKE 2EBWA 2QN8A 2Z5GA 4UCWA 5F3RA 2DU8A 1V8DA 1Y98A 2ZJYA 1I2MA 2CUTA 3K2IA 4LV5B 1E1RD 4HNGA 3PSHA 1FS5A 4PLCA 5TMEA 2C92A 2GRJA 3AK4A 2AXNA 1QRAA 5DYWA 3PXGA 3ZXSA 4DIMA 5C7IO 4O4HF 5IZCC 1N77A 1H2WA 1QIMA 2JI8A 3E5MA 3F8SA 4EA7A 2WF5A 4DSAA 5A4AA 1PLJA 1XPJA 1H66A 1Z0FA 1B41A 1HBJA 3V2IA 5C51B 3GUCA 2BM1A 3LPDA 3NALA 2XXBA 3ADPA 4LWQA 5EE9A 2J7KA 5AK3A 3ODGA 3W2EA 3J81A 1VZ3A 4KYUA 4XARA 2BSQA 1V5GA 3Q3VA 4PZAA 4NXMB 1BO6A 2ZYAA 5FTMA 3A70A 1GITA 4RKRA 1FP4B 3JZIA 5IAGA 2R7NA 3NX4A 4HBGA 5EIBC 4DTIA 1GFSA 4H2DA 4TT3D 2DAPA 3OC6A 1W35A 2AZ4A 4PHGA 2AQKA 2D3TA 2QJTA 4F71A 1AIPA 3SJUA 2G8LA 3GLIB 3SQXA 4FZJA 1JG1A 1VP9A 1Y7PA 2ZIXA 4LI0A 4OB7A 4OQEA 2YYSA 3QPCA 1Z4PX 4X84A 1JDVA 1YK1A 3LK6A 4GYJA 5KYWB 3O92A 4G4JA 1EFCA 1OF1A 2R6ZA 5EFZA 4C87A 3HR7A 5E8RA 1C7RA 1T1IA 3QNUA 4ZV7A 2QN1A 2JCSA 2ZUFA 2AGVA 4LBZA 5B1SA 1NP6A 2Q07A 3QBJA 2CJXA 4J0FA 3S2IA 2A9FA 2MYNA 4RD1A 2C29D 2Q6IA 4IGIA 1K8ZB 2C03A 1EQ2A 3BYZA 3PC6A 4L2IA 1WUJS 3R7FA 2AOXA 4DNFA 3S81A 1E9AA 1ZM2A 1DEKA 3DZDA 1UT8A 1T8YA 2UVQA 2N47A 2EFGA 4TTJA 1P1IA 1RJWA 4LGCA 3PUVA 1ORIA 2PR7A 3BMNB 4FFOA 4JCCA 2QD1A 1D0VA 4G41A 3RWMB 2BCGY 4Y2JA 5FBWB 1KEPA 3WNZA 4CCYB 1Z25A 1X9HA 2P2CA 3UXHA 3HHPA 3R3XA 1YR7A 4DSUA 4YUAA 4ZODA 1EAMA 5F1KA 1FP6A 2P40A 3LI2A 2GZSA 3GEIA 4N8SA 4YJHB 4ZRNA 2BJVA 3A31A 4CM8B 1X6VA 3KLOA 4UM8B 4HDNA 1GZDA 1G19A 4OHCA 4I4TB 4N7MA 4BVAA 1NXXA 1L5MA 4RJLA 2RHJA 2Q21A 4Q02A 5AICA 4AKGA 3PSAA 4QJIA 2QV7A 5HKKD 4CIAA 2JJQA 3DZFA 3P1JA 4MIOA 3O8QB 1JMKC 2IW1A 3ICOA 2C07A 1IB6A 3GEEA 4W5RA 4GM0A 3K6RA 2QVXX 3FW1A 4OYLA 1Z83A 2P90A 1A2OA 2R1TB 4FBGA 2O8CB 4QYWA 4BDTA 3E84A 2O8FA 1JQKA 1JHMA 1W85B 2I54A 4UVDA 3A7EA 2PKCA 4Q3AA 1MG5A 1KKMA 4TSFD 4EB0A 1SXGA 2J09A 3JAKA 2BM9A 1R5BA 2QU7A 1SD5A 5JNWA 3FNHA 5C8DA 3KT6A 1I94B 1WMAA 1FFHA 2D5LA 3BL5A 2VSYA 2R1VB 3KCNA 2GR9A 1V8BA 3PGKA 4JIMA 2Q0XA 2B36A 4HDSA 4B31A 2BF7A 3QKIA 4MB2A 3T5AA 1VI6A 1HEYA 1DC4A 1M34B 2Z1DA 4NCNA 4W8OA 4ZO8A 2C5GA 2XWSA 2QL5A 2XYRA 4MHSA 4S1NA 1SBHA 1CUBA 2HLHA 1U0RA 4PZCA 3V8EA 4CL8A 5INTA 2HM7A 2RHWA 4J03A 1T4CA 1Y3CE 2ZUBA 3FJOA 5AW9A 3L7CA 3OVMA 2VTBA 8GPBA 4XVQA 4B3GA 3DUFA 4UXHA 1XA3A 3BA6A 3NBUA 4P7FA 2PMWB 4MPPA 3HDVA 1Y9DA 2AZXA 4IXWA 2FU5C 1E1RA 2FCRA 3MJFA 4I2NA 4JXJA 1KSGA 3BJMA 3RC3A 2JH9A 2C2BA 5LDHA 3DDOA 4Y9UA 1LV8A 1OSNA 5H16A 5A6SA 4O5OA 4P86A 4TTSA 3TDKA 5PGMA 1NVBA 2H4WA 3GNSA 3WSWA 2Q62A 1FY2A 2H9AA 3I45A 3KZKA 3DGFC 4WOBA 2R87A 4LCEA 4ZRMA 5KJFA 4L72A 2GK4A 3NJ4A 4FW8A 4BNUA 2I76A 3KHSA 2VF5X 1B8OA 2JJ2D 4MRAA 1IZ7A 4HK4A 1U9JA 4JX8A 2W2KA 2YRXA 3ZKWA 5KBYA 5AXAA 3Q1LA 3QVMA 4DXHA 4NU0A 4TSFA 2TS1A 2V96A 4HEA6 4LBVA 1TJYA 2DRIA 3IVCA 3MWDA 4KAXA 2W6ZA 4DG5A 3PLAE 3DSRA 1GNPA 4FE7A 2ORIA 3GIDA 2VQFB 4ND7A 3HKDB 1YOBA 2FE4A 2H1LA 4XGQA 1BWPA 5H3HA 2RMKA 3LP8A 4DIOA 4K46A 1M2WA 1M7HA 3ETCA 1U3GA 1EBUA 2XUQA 3CT6A 3GROA 2C8VA 4PANA 2IX9A 5ITZA 3BWEA 3BXZA 1V8ZA 3HU3A 1XELA 1IAQA 4H7IA 4KKVA 4YECA 4DF3A 1XD9A 2FW8A 4DR3B 4RF3A 1SFRA 3V2UA 3DOCA 1MOQA 2MT9A 4R9VA 5DO9A 3OOJA 5TEVA 1DFIA 2VAMA 4N48A 1VHJA 2YN4A 3AUXA 3L0IB 1TYAE 3O4RA 4HQFA 3FFBA 4Q21A 1P80A 1ADGA 1F9EA 4HFJA 4AO8A 3KB8A 2Q8PA 4GUAA 3EH2A 3LT5A 4G37A 4RX1A 3N5KA 5P21A 1P72A 5AK4A 5HZGA 1E3QA 1JEQA 4AG6A 4YV1A 2N1BA 2JRLA 2BM8A 5HKKA 4Q7QA 2KLBA 2QW1A 2HRZA 1RYBA 4YMIA 1SVOA 1ZESA 3QBEA 1Q7CA 3UAGA 4W8HA 4UHJA 4PLZA 3PD7A 5TXGA 1V71A 5DOZA 2G1AA 3VTAA 2G1UA 1H1LB 1SBIA 4RL6A 2DP4E 4KN8A 2Z04A 4F4FA 3NS7A 1OB2A 1YONA 4ND4A 4A0SA 1JU3A 1WO8A 1RWPA 2J1LA 1CQIB 3VVMA 1DAHA 1NTOA 2O19A 4TXNA 3L77A 1USUA 3CZCA 1I2DA 2HRCA 2DCUA 1TM7E 2IIBA 4JASB 3SNHA 1RIIA 1XGKA 1PN3A 4A2PA 1NPDA 1A5ZA 1CUJA 2WHPA 3DKRA 1PJTA 1NW9B 1ZJ6A 3AHGA 4KQXA 4EJ0A 3VTZA 1YTUA 1PTJC 3WL5A 3OZDA 1PP4A 1CEYA 3WGTA 3CN7A 4LRYA 4TVOA 1YRWA 2P41A 3N6RA 2IKQA 2QBYA 1JEJA 2FYTA 4GR5A 2AN4A 2JLZA 1NF2A 1O95C 4MO9A 3BMQB 4I5FA 4WFQA 4MRMB 2OAGA 3DZ8A 3GZNA 4RPGA 4GKBA 3AP1A 2V7XA 2W6JA 3E2IA 3DDHA 4B80A 4BKQA 3S8MA 3I76A 2X15A 2ETVA 3C43A 2C4TA 3H5TA 1TEVA 5DCWA 4ZEWA 1MB0A 3B5EA 5EJ9A 3MYYA 5FUXA 1JMVA 5HP4A 1PZMA 1Y1QA 2GKGA 1ARZA 3O38A 1GAEO 2XVZA 2NT3A 3GJYA 4WA8A 1KS2A 3DXZA 4FNMA 4IO1A 2A9KA 1M83A 1G8HA 1HRDA 3I9OA 3AJAA 3JATB 1ATZA 4RCYA 1UEJA 1VE3A 1CULC 3RABA 5KOHB 1JW9B 3R2JA 4P3KA 2W90A 1E0AA 3CLRD 4QUBA 4KBYA 3TLGA 4D2IA 5BMVF 2NTJA 1RE1A 3P5BA 2AXPA 2ZPUA 1IOWA 5CHYA 3K9CA 3PCXA 2ZE8A 4DY4A 4IRXA 4XRRA 1RWBA 4G26A 3WISA 1EFVB 4L28A 1ZKDA 4PLFA 4B76A 4Z1OA 1SCUB 3SF8B 3PLNA 3AEQA 2PU7A 5A5GA 4CG1A 4J6FA 1CR2A 4ENUA 2OKGA 2QORA 5FL3A 3N2GA 1T1GA 1U6IA 3ZK8A 2HCBA 3CW8X 1OWMA 1GRNA 2AA3A 3D3QA 3H9QA 4GX2A 4YR9A 1XCMA 3Q3IA 5LZ4A 1DKQA 3FUCA 3O0TA 3JQQA 3EYAA 5A9RA 3VU0A 3OQHA 2IY9A 1GZ6A 4J2HA 4J7XA 4TT8A 3DLTA 1U1GA 5GWXA 5A5EA 1X70A 4UAUA 2I4RA 3VSDA 1UPAA 2ACVA 2YFYA 4Q4HA 2FR0A 1PZGA 1UQUA 1LSOA 2NZWA 2P9TA 3EEBA 4L0CA 3V4ZA 5JSHA 2I4OA 4KK3A 2VCYA 3QWBA 1SHTX 4O2AA 3OX4A 4NS1A 2C78A 4N8EA 1BH6A 1BDIA 4UPVA 3IAHA 4JN6B 4MQMA 4MVJM 3B70A 1AH2A 5FRDA 3D9QX 4F6RB 4BIIA 3R9KA 4CUJA 1YJXA 1J1UA 3H5IA 4MEBA 4DCUA 1KBQA 2XCOA 3D81A 4JC5A 4WWHA 3L18A 3RQIA 4QELA 4LHWA 1PUXA 2FMHA 2JCBA 1K7YA 4GNKA 5G02A 4C3OB 2WF6A 4K9OA 4LE1A 3WWEA 1RWNA 5JNLA 2O07A 3RV4A 4M87A 1VG8A 2W6PA 2GK3A 4NX2A 2ZUEA 1S2NA 4MYRA 1MRNA 1W88A 2QGZA 1LVUA 2HLDA 3IDFA 3TIXB 4IDPA 4W8GA 2QE7D 1UZAA 5D00A 6AT1A 1G8FA 5E8JA 3NVKI 3DZJA 1NT4A 3LW7A 2QTVB 5DM2A 1E1MA 4V1CI 1PT7A 1HQDA 3NXKA 3UMRA 1OAKA 4BZZA 1H9AA 2FEKA 4R5MA 4S2UA 2I6XA 5CA1A 4MWDA 4BGEA 4CIYA 3AJRA 1F2TA 2MINB 5EJ4A 4BFVA 1SCJA 1HDRA 1JAZA 4V0NA 5IU6A 2XIJA 2PYDA 1EJBA 4QVIA 2PL9A 1RWQA 2VPXA 4BVLA 1CFZA 3DGEC 3W77A 5HUHA 3R7LA 2F43A 2Z3WA 4LISA 3ZBTA 3MAJA 1UK9A 2FN7A 3GCZA 3AC0A 1OC2A 3WYEA 2YS7A 3ODPA 2J4CA 4E08A 3RHTA 2G7ZA 3OQMA 4L57A 3FHJA 5J5VA 4MA5A 4QGSA 1PJ8A 4QNMA 4PZLA 1QIEA 1QLJA 4S24A 4V0QA 4ARAA 4Y2HA 3PEWA 4KR9A 1GL9B 4JI0B 2DFPA 6ABPA 4MR7B 4H6PA 4JIGA 5C5IA 2BFEB 4I4TA 4XSVA 1XTVA 1E58A 2FGJA 5JWHA 3SOPA 1EX7A 2BV3A 5I4IA 3MTGA 3LUPA 3N6VA 1NW8A 1WCV1 3DTTA 3DXFA 1Q15A 1XLTC 2XRZA 3K9HA 2IJGX 4X90A 4KQHA 2K5UA 3PCTA 3S5UA 5BSKA 4EKIA 3OTHA 3PPIA 4ZI7F 1CW2B 3DT8A 2ZBRA 5AI9A 3EW7A 4M1TA 4TTIA 1EM6A 4PGGA 5BSHA 1A8QA 2OM2A 4AWXA 3VOAA 3D2BA 4E21A 3BZUA 4HZIA 2DFTA 4MQBA 2IBTA 3AOEC 4DDWA 4C43A 4GD3Q 1YRAA 5GJCA 1C14A 1SQGA 1VKRA 3BJRA 1QTIA 1R9NA 3RT1A 1XZIA 2RD2A 3KEMA 2C20A 1X8JA 2OG2A 3FMVA 4TKVA 1ZS9A 2HW8A 5I8PA 3CJQA 4IH1A 4A16A 3Q4GA 1ACJA 1DIHA 2H2AA 3JVEA 5LMCA 5CLIA 2CNBA 5FPTA 1KJZA 5K3FA 1NIPA 1AQNA 1KHTA 3P0IA 2IE0A 4U4AA 3LUHA 4ZCRA 3U44B 3QEAZ 2FX3A 2GHTA 2YBEA 4W1PA 3WG9A 2NZVG 1ZOIA 2F62A 3F3KA 1ECPA 3L0ZA 3F5MA 1V9LA 1KJIA 3CXRA 2HV9A 3CM0A 3Q8XB 1IOZA 4ROSA 4YRDA 3A6ZA 1CF9A 1F2UA 2Q2OA 2W9XA 4KE7A 3OZCA 1NPTO 2CFOA 3NW9A 1I3NA 4G1FA 4O2LA 1FRQA 4IQ0A 1IULA 3R7AA 4F2PA 3BE8A 3UHJA 2ZJAA 1IAVA 1M7GA 3ECSA 2B0JA 4YO7A 3EXHA 3NT2A 1B3BA 3ESBA 4YXWD 2XQKA 4ARCA 3FR7A 2UVDA 3QLEA 4Z7JA 1A5TA 2DSTA 2WG1A 2J4DA 4LSWA 4FFWA 1CJTC 3DZKA 1M67A 2EVWX 1IHDA 3GMTA 2Y9MB 2C4HA 1UJCA 2E85A 3V46A 4X3CA 4GQBA 4YWHA 1U9ZA 1Y4AE 3OG9A 1KZ9A 1K97A 2UZ1B 3PUJA 2NGRA 2EQAA 1NN3A 4ND1A 4MEAA 3AETA 4RA6A 5COAA 2DSNA 4DQDA 5FYQA 1X0XA 5HGJA 2M9MA 1BDBA 2UYHA 1DZIA 4BYMA 4NYIR 1NE2A 3P0HA 3ONFA 4HUJA 2W8BB 3KKNA 4ZA2A 4TTPA 2CLIB 5I5GA 3GN1A 4L4UA 4RFVA 2HIHA 1YZQA 3MTJA 2JAWA 3D8RA 3NT5A 1NVGA 2VLIA 2GX6A 3H6HA 3KFXA 3BIWA 3PXEA 1TF2A 3ADOA 1DAEA 1FRVA 2XMBA 3PNPA 5CFOA 3IERA 4KXYA 1SR8A 3JARA 3HLTA 5JNRA 4NE7A 1OC4A 4KAAA 2AH5A 2WAAA 4MDHA 3VO9A 5EPUA 3W9YA 5TLSA 1JALA 3U09A 2F00A 1A72A 5EJAA 3W2GA 2ZBVA 3O3CA 6REQB 3VNUA 4KI0A 2DMRA 3QH4A 1CF4A 4R98A 1JFLA 3G2LA 3HCEA 3RYFB 2XPCA 2O52A 4URFA 5U1PA 1ZMOA 2XUKA 1CJMA 1X1SA 4I4TF 4LDRA 5DNAA 4TV9B 3LCRA 2R1ZA 4E2WA 1DAFA 1F7VA 3CNLA 2EYQA 1XLUA 5LQSA 1BW9B 4X0EA 5B1YA 3G89A 1R9GA 4Y7DA 4ZMBA 3E82A 2N0SA 1LDMA 3E9NA 4CF4A 1SVKA 2P4QA 2HDOA 3LKDA 4M1KA 3W8DA 5HOQA 1NYQA 5K2MA 5E6UA 1R4NA 4HPXB 5F78A 1N57A 2QL9A 3EARA 1AMNA 3TTYA 3KU1A 3SC4A 4TZTA 1O95D 3BBLA 4CQMA 4BO8A 3G79A 1GYQA 4N3NA 4PE5B 5C32A 3PIIA 3ROQA 4PG7A 2M6KA 4RIIA 4CKCB 4DANA 3HDGA 5DGHA 2X0FA 1R12A 1XFAA 4K9QA 4H7KA 1KY5A 2OO7A 4OMDA 1UPFA 2I4TA 2JI7A 3OZSA 3GLFB 1LPMA 2JLVA 1WVIA 1DQRA 2PX5A 5DH9A 1G5TA 3WTCA 2YINC 2PKEA 4EPYA 2DEUA 4E94A 1UF9A 3GH1A 3GZNB 4R1QA 5C46F 1JFFB 2WC1A 2YASA 3ZNQA 3OZUA 2E48A 2G1PA 1YVUA 5GIPE 3L8DA 1AT1A 1V9SA 5G1NA 3GARA 3PRYA 3D6JA 1Z0DA 2CKMA 3PT5A 3R3YA 2F3RA 4GOLD 2JKVA 1AQYA 2ZTMA 2VNKA 1PFYA 1PG0A 3VC1A 1NM5C 3IX7A 3T7DA 3RIHA 5FUVA 5CA0F 1UDRA 2DLDA 2CVZA 3COWA 3LWBA 1J7JA 1VLZA 3C1UA 3WGGA 5JRZA 3FCOA 3HJCA 1KVUA 4ZI7B 3PQ7A 2OUIA 3LK7A 2WE7A 5HGXA 5E3IA 3L7AA 2ZBFA 4D43A 2FI1A 1QR2A 1CRLA 1NVVR 3F3YA 1Z7WA 5LA6A 1VFPA 1OLSA 1QANA 2XGMA 3AR7A 3EIXA 3NJRA 2CNDA 4HF7A 5FULA 4DPMA 4DMHA 1E2BA 4MSUA 1RAGA 2EKZA 4I55F 1RRMA 2HSJA 3M70A 3L4BC 4NQRA 5ALJA 2YKGA 2W58A 1DRJA 4MI9A 4ALKA 4KG7A 4K88A 4K6KA 4TKMA 4AQYB 4QT0A 5H1YA 1Q16A 4OGKA 1OE0A 1O94A 3P32A 3QPUA 1QE3A 3MQ2A 3UUWA 1LK7A 1RCTE 3AH8A 4TKZA 4GVLA 2C4KA 3OZXA 2HQRA 1ZOSA 2IXTA 2JGEA 2MTBA 4L7QA 3QA9A 5DBHX 4WFKA 2VKTA 4P2GA 4AJJA 2WYVA 4LZLA 1SA0B 2DPLA 3B85A 3DAGA 4P53A 4BQSA 4H1WA 3SY8A 3ZI0A 1JDTA 3I0ZA 1GTMA 1ISSA 1W93A 3FOFC 3SK0A 2B4KA 1NZFA 3NYIA 1T25A 2AFHB 2FB9A 5JAQA 2WUDA 1YB2A 2WZCA 5KDLA 1A8HA 3S99A 4TWAA 4WGGA 5KWSA 4AYWA 3A6JA 1WB6A 2O1SA 1NBMD 1ZUNB 4UUBA 4Q1DA 4WXRA 2ZATA 5AH0A 5JH7B 2BE7A 1II8B 4E2YA 1HURA 2X3FA 1CIVA 3NV7A 3H3JA 1P73A 4UMFA 4BBPA 3GFRA 4UXJA 3TKAA 2JIZD 4DLPA 1MU0A 2I7CA 3H16A 2WHQA 5K3SA 3O3MB 1X86B 2H2IA 2ON6A 1M8JA 1QO0A 1M1NA 1T5BA 1U8XX 1L5HB 1E5TA 1T8RA 2XNCA 3ROMA 5BY2A 2PZMA 3FJYA 3HS3A 3I01A 3CG4A 5JO0A 5JDCA 3FZEA 3H8WA 5CMLA 3KXDA 2PN1A 1HE3A 1L7MA 4DV0B 4PX3A 1O4WA 1SC4A 4JQZA 5B4TA 1JB9A 3C6ZA 1HDYA 2VA8A 2ASVA 4EX7A 2OYRA 2ZBEA 1IY0A 2PZEA 4MS4A 4OHOA 5BT9A 4X91A 4C4OA 4D9GA 1WOMA 3GHYA 1KJ8A 4L16A 3GRUA 2L18A 4GZLA 4LVUA 2ZUDA 4Y6GB 5TB5A 4PPYA 2HSDA 3T54A 3U17A 3FDXA 3I9V6 4QO7A 1PGJA 2FPOA 2LCFA 4MQEA 3S2SA 4DM7A 2CD7A 4HG2A 5D2CA 2C94A 1M34A 5F7XA 4GP7A 5JVDB 3DCJA 4ZQIA 3JQGB 4ZYUA 4XB6B 3ETDA 4D8UA 2FUG6 3EPRA 3DFMA 2AWNA 4OREX 1NC3A 4R81A 4RAQA 4ARUA 4EYQA 3OQ1A 3ORHA 2D0OB 2WICA 1QVAA 1R4MA 3EXFA 4KFUA 4FFBB 5ALRA 4BRSA 4J0IA 5B6JA 5KNBD 4WERA 1Z45A 1KRHA 5EWJA 1SXJB 1B0UA 2J3JA 2IITA 4HDMA 3V4FA 4ML3A 1GTZA 3QBTA 3QJ5A 4GR9A 5FX2A 1XLWA 2F3SA 1Z2AA 3WRXC 1QHFA 3A05A 5D5QA 1DRKA 1JU4A 1JEYB 2IX3A 2AN9A 3N0TA 4J2TA 3UB4A 4FKBA 1AHPA 2AYXA 2WAYA 4QYIA 5LP1A 1ZZGA 4B45A 3JQBA 4N5LA 4IIXA 2YWFA 3LPMA 4GLFA 4CZ2A 3FIUA 4NPAA 5MN4A 1N33B 5CM9C 1LGYA 5LOVA 3GOQA 1ZNYA 3KT8A 4MP6A 3VNRA 2ZQYA 4ASUA 1S2GA 3MMPA 4O4HA 1X7HA 1A9SA 4QU8A 5CYOA 1EE2A 2FVYA 3VUFA 2D4AA 2FZKA 1LX6A 4K9NA 3UOGA 3G5AA 4E30A 1MO4A 2A67A 3L4EA 2C4MA 2OKCA 3ZDFA 3BF8A 2OFFA 2PRJA 1NBHA 3KELA 2ZBUA 1V95A 1JDJA 2C5BA 4RORA 1JT2A 1SHZA 1MHPA 5JY6A 3RBZA 1NR5A 3T3DA 3F8WA 3OIGA 3I32A 4HFMA 4TRJA 1S9DA 2Q45A 3QPVA 2OP0A 2JKYA 2G0TA 4U7TB 1MPXA 1R9JA 3RUFA 2VAXA 2LP4Y 1TUIA 4K8RB 4CUZA 3JYQA 1NQVA 2X0JA 3D7SA 4FFBA 1MN6A 4XX0B 5JSZA 1GAQA 2JGLA 4TMKA 1RAEA 1T24A 2OV1A 3FD8A 5KTTA 5JS6A 2H1FA 4Q9NA 1WDKA 4XR4A 4MDFA 3O47A 4X6YA 1GTRA 3KWJA 4D74A 3HFSA 1Z2DA 1BHQ1 4K6FA 4Q9HA 4F3YA 2BIFA 2PD6A 1KU6A 4YJDA 2ODAA 3MTEA 4FIZA 4WBNB 4L1KA 1H8ED 3R5JA 4R8VA 1ULUA 1E6UA 1OPXA 2NNWB 2QMYA 2ZI9A 3GCWA 4X63A 2WJIA 2VPQA 4BQFA 1J5EB 3T15A 4CIXA 1KYTA 5FTJA 2CJWB 3RC9A 3SQDA 2VQSA 2BGJA 1QC5A 1NV8A 1RHJA 1FX0B 5KX5F 1M6VA 1V43A 1P2UA 2WWIA 5CH8A 3O1IC 1L5ZA 1GSAA 4G65A 1DG1G 2D00A 4DMMA 4DCPA 4WFJA 2GHRA 4DSNA 3FYSA 3DZGA 5CFQA 4QIHA 3NNNA 2JCXA 2Y2VA 2CYAA 4EEXA 2ORWA 3R9XB 2JH3A 1KVQA 1OXKB 4QUJA 4ZDWA