4U5XA

Structure of plant small gtpase osrac1 complexed with the non-hydrolyzable gtp analog gmppnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
178
structure length
178
Chain Sequence
GSTRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSVVNLGLWDTAGLEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rac-like GTP-binding protein 1
publication title The Crystal Structure of the Plant Small GTPase OsRac1 Reveals Its Mode of Binding to NADPH Oxidase
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Gtp-binding protein
total genus 66
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4u5xA00
2V6JA 1E9EA 1JR6A 4HSEA 4NKRA 3MRSA 3GJ6A 1OIWA 2DWPA 4ACAA 2P6NA 1M1YE 2JLSA 3W3ZB 2WV9A 3A4MA 5CDFE 1J2JA 3BH7A 2ZJ8A 3I1FA 1U0LA 1OXSC 2W83A 1ZU4A 2OXCA 4HUTA 2FGJA 4O0MA 2ERXA 1PVOA 2OILA 3OE7D 3OIVA 2AD5A 4RD3A 3C5HA 2BWJA 1G19A 4P4UA 2GJKA 3AP2A 3IO5A 4XVUA 4TYYA 4M9QA 2PZGA 3H84A 1LW7A 4PSVA 1MO5A 2HYIC 4Q1FA 4BFXA 3AGQA 3PUXA 4B2IA 2W2TA 4BZQA 5HZKA 1II9A 1XEXB 1HEIA 4D4KA 4Q03A 3BH0A 3CKLA 3FMFA 3TGPA 1Z8FA 1SVOA 3KJIA 4DJTA 4CEJB 3QEOA 3LVQE 5C4GB 4MGKR 3V00A 1W0KA 1OXUA 1WP9A 1YR8A 4YXWA 3NBZC 1TMKA 3K0FB 3PEWA 2X77A 5BN5A 2F3RA 2IBMA 2B8WA 2QE7A 3EZ2A 1UKYA 3X2SA 1NVXQ 2WICA 2G1JA 2JLWA 4URWR 3T1VA 4EUNA 4KU4A 2ZSDA 3MWJA 3GCGA 3P32A 2EW1A 4R98A 5DO9A 1ZIOA 2DWOA 3FHCB 4QBIA 4F4JA 5DN6A 2GBLC 3SHWA 4I99A 2CJWA 2ATVA 2LCFA 4PPFA 4PQRA 2Q9BA 1C4OA 2H1LA 5HZHA 2QORA 4GRAA 3ZDQA 1OFHA 2RGNC 1J90A 3T35A 1Z06A 1NY5A 3NIBA 3U2QA 5EUQB 3U6KA 1JI0A 1WRBA 1W46A 3RHFA 1GFIA 1AKEA 3GEHA 3QUSA 2IXEA 3EASA 4PAQA 2XSZD 2RKOA 4MGYR 2ZSBA 3NDPA 1XPUA 3I8SA 4HZUB 1SVWA 1E69A 2XITA 2F43A 3THOA 1E4YA 4LGMA 1PJRA 5HKKA 4M1SA 1G6OA 4JSYA 3R20A 4ASUA 1DTSA 1XEFA 3E5HA 4TSFA 4C0QC 4M1MA 3K0CA 2REXB 4B35A 2EFHB 4V0ME 3FKSD 3JVUA 5TMPA 3U44B 2Z83A 4CYMA 4M53A 1HQCA 1LY1A 1R0YA 3DZDA 1Z2CA 3GJXC 3QI2A 4LPSA 4GZLA 2AWOA 4QGGA 3K09C 1SGWA 2BJWA 3HP1A 1ZD9A 4TLBA 3U7EB 4BFVA 1KGDA 3WXMA 4MKFA 4Q9IA 5FOVA 5ELXA 2ZRDA 5G3ZA 3WYFA 3B1VA 1MH1A 4PHHA 1KO5A 1WCV1 1OT3A 2QMUA 4QL3A 2XX3A 1XB2A 1XP8A 3AQ4A 4RKFA 3CRVA 4TQ9A 4BFZA 3VU9A 2PMDA 5AR1A 1G18A 2IEYA 4NZYA 1NIJA 2OFOA 3VAAA 2VO1A 1XTJA 3W6NA 4Y0AA 3QEJA 4BZPA 2EFDB 1M8PA 1W4BA 2BOVA 3I92A 1NRJB 1OYYA 2NOAA 3IUYA 4FCWA 5JCPA 1RRGA 4FMCF 4AURA 2AXNA 3PV0A 1N6NA 2BV3A 1G3QA 4P4SB 3PCRB 4KSCA 4BWYA 4NP6A 2GJAA 2H57A 5CM9C 2XZPA 1KDTA 2P6UA 1G20E 4Z1MA 4QFMA 1KI6B 4PTLA 4PC2A 2V9PA 4HAVA 2OCAA 2CL6X 3IGFA 1E9BA 3KQKA 5DGXA 2G1KA 2QP4A 1CXZA 1SXJC 3Q72A 2D3WA 2CCKA 4LY6A 4ZI3A 2FFAA 4MGIR 3RS3A 1XU4A 3NBXX 3O8RA 4Q4LA 1BMFA 1NJFA 5KPJA 5DI3A 1E2MA 4B32A 3EC1A 3GLHB 4D82A 3EPLA 1DAEA 2ZRNA 1XEWY 4NYMQ 4S2EA 4EJSA 2V7QD 3QIAA 1UDWA 5JWRA 2CBZA 2BKEA 2RMKA 4B3CA 1E2GA 2ZRIA 5KO2A 2F9MA 3SNHA 4DLTA 2OCBA 2BBWA 4TYQA 3KL4A 3RRYA 4RD2A 4CRWB 2O8EB 1NKSA 1TX4B 5EXSA 4AKEA 4DLRA 4HB3A 1QZXA 1N6HA 5CIQA 2XXAA 1VCNA 1OE0A 3U3OA 1UFQA 2CLCX 3VX4A 2FV8A 2DB3A 3CH5A 2PL3A 2HDNB 4CT5A 3QSYA 2RGCA 2VHUA 4JLOA 5FPYA 2QL6A 1M34E 1HE8B 1ZM3A 3LW7A 2OG2A 3KUDA 4IXNA 1XWIA 3CF2A 1Q1EA 3SC3A 5FR1A 2KB0A 4A6XA 1GG2A 2QAGC 3ZIAA 4LJ7A 3WNCA 3TLXA 1Z6GA 4W5WA 5FR2A 4Q48A 2MMGA 4K81B 5KSZA 3MUFA 4TMWA 2GCOB 2GETA 1P73A 2H8KA 5FBVB 1FPMA 4WVFA 4B75A 4TLDA 4DLYA 1A2BA 3A1TA 4UNNA 2AN9A 3L43A 4RZ2A 1L4UA 2JASA 2IT1A 1Z5ZA 2GVDC 1N5KA 1E2FA 1K5DA 2IS1A 1G5RA 1TUEA 3QXCA 2KBFA 2FFHA 2HF8A 4FXPA 1W4RA 3VHXA 5D3MA 1NLYA 3A4LA 3NKVA 5GADl 1N0VC 2QNRA 1G7CA 3CBQA 4QM6A 1PLKA 5L3QB 1XTQA 4IFBA 3CZPA 1GZSA 4GP7A 2JCSA 2Z4SA 3CWZA 3OIYA 1GIAA 1T3HA 5FPTA 3BB3A 4XTCS 1X6VA 5EZ6B 4IEIA 3KB2A 3Q3JB 1XXHB 1PLLA 5JI2E 3OF5A 3W3AA 3QJYA 3REGA 3TR5A 4P0TA 3V4RA 3CUEF 3O8CA 2D2EA 5AWFC 3ZLJA 2N42A 4RD4A 1GDDA 3NH9A 3J81k 2VSOA 1UM8A 1VG0B 3OHMA 5AUPB 4LHYA 4KXFB 1EWRA 1N6PA 1UBEA 1M7GA 2FPMA 5TXGA 2PX0A 2HJVA 3O8BA 4NH0A 4OHYA 1JBKA 4TYPA 3BE4A 3UWKA 3U7GA 3EIQA 5JMTA 5HTKA 3GJ8A 2ZRKA 1U0HC 2NO1A 3TJZA 4BLQA 4OK6A 4A92A 2ZYVX 5FUVA 2VP9A 1A2KC 4B47A 2NZ8A 4HLQB 1GITA 4XJXA 3DPUA 3MWLA 4WOPA 1A7JA 1E2DA 2WKRA 1TU3A 5FTKA 5JSZB 1E0SA 1VG1A 4R2HA 4BFWA 2IYTA 1IXZA 5KDLA 4C3ZA 4BLPA 5BYKA 2YC2C 3RRNA 1NLFA 2IHBA 4LJ4A 1XCMA 1GWNA 1X3SA 1YHNA 4OJKA 4WZAE 1S0UA 5J4KA 4KBFA 2G88A 5J40A 2AL7A 2GJ9A 4H1UA 1II8B 2GZDA 1ZMXA 1UF9A 3I32A 1F6BA 1NBMD 1XCGB 4ZDJA 3TVDA 1VCIA 4B2LA 5EE3A 5TB5A 1I4DD 1R5BA 3T1TA 4HUQB 1TQDA 1US8A 2E87A 1F3OA 1MT0A 3L0PA 4GOJA 1KI7A 2IYUA 4LWZA 5FPSA 2ANBA 1YZUA 2AXPA 1QHNA 1P75A 2V55B 3GJ7A 3AUXA 4Q1CA 4IVQA 3LRPA 1Q20A 4ARZA 1TQ4A 4KSBA 4NYIR 3JZMA 1L4YA 4JLVA 3CW2A 2IXGA 3K0SA 4U00A 1E2JA 2C78A 3UG6A 2QBYB 4OHWA 3LH5A 3IBYA 3QKRA 1T4GA 4PC6A 2ZUDA 2F1JA 4W7SA 3E70C 2J0UB 2RB4A 5JEDA 4B71A 3QQ5A 1OJLA 2QQ0A 3FGNA 3PUZA 2WKQA 4YC7A 5EP2A 4ZDKA 2REBA 4RFSA 2PMKA 1GKIA 1HUQA 2A78A 3GLFA 2ZM5A 1XPOA 4X8HA 2AFIE 2EVWX 1QDEA 3FWYA 5F9FA 2IWHA 2ECKA 4Q00A 3ETLA 4YLGA 2QTFA 3CR8A 1IN5A 5EP3A 4DCVA 1AA9A 4ZPXA 1DOAA 1KSGA 4E09A 721PA 3OEHD 2XZLA 4NONA 4RZ3A 4GMDA 3LBNA 1SVIA 3W90A 2VYFA 1QVRA 4DT1A 5CIWA 2F1RA 3NEJA 1AGPA 3RANA 5J5CA 4CT4B 4O2LA 2XB2A 1UJ2A 3BB1A 1W5SA 2XTMA 1E9SA 4G5GA 3VR5A 3AKYA 5GJWC 4DCUA 1AM4D 4AWXA 4BECA 1W2GA 4MYHA 4HEJA 1DO0A 4QKQA 1WE2A 3U5ZB 3RS7A 1G3UA 4FMDB 5CJ2A 4PO9A 1Z0AA 5FTJA 5IK2A 1LTQA 1DS6A 4LYJA 4EFLA 1W36D 3QXJA 3AVTA 2QG6A 3B2EA 2CNWA 4B73A 1FQKA 2QPOA 5FBLB 1KTVA 3DM9B 3P20A 2FGKA 4GL2A 1X1RA 2NG1A 2ERYA 3KKOA 1D5CA 3LBIA 3W34A 2B92A 2ZI7A 2FEMA 1NVUQ 2OHFA 4K46A 4EPXA 3M4YA 2UZIR 3SBEA 4LUCA 3CNOA 4WIAA 4IOMA 4NDZA 4WAUA 2EFEB 2LWIA 4HAUA 3DZ8A 1E2KA 1P9WA 2CL7X 5KTYA 4OQLA 1X8KA 2JJ1D 1P3JA 2ZSAA 3TQCA 4GI7A 4G5OA 3T34A 2EWVA 2FSGA 2V1UA 2A2ZA 1VTKA 4ZKDA 2RGDA 4JYCA 4HI0E 2Q9AA 2KSQA 4IKEA 4XOIA 4B2PA 2GJ8A 3TRFA 2W6ID 2J0VA 2WIAA 2F55A 1JECA 2F1IA 1GL9B 2D7CA 4DCNA 5LPNA 2JLRA 1ZUIA 2FZ4A 1WMSA 4D25A 2PH1A 3UIEA 1P2VA 3WBKA 3VU9B 4OI4A 4Z51A 4AKHA 1CEEA 2O8DA 1T5IA 4PHFA 3I5YA 1EG7A 3A37A 1C9KA 1U98A 4MA4A 1ODFA 3R7WB 2C04A 1YZQA 3KKNA 1N0UA 3LLUA 1KMHA 1M74A 4KLNA 4FMBB 4TMTA 1YZTA 4C2TA 5F9HA 5GJBA 2ZSFA 4JVNA 2N1BA 4RD1A 1QF9A 4HLUA 3UMRA 4TZ0A 1N5JA 1OW3B 3W8RA 1GOTA 5HE8A 3SFVA 2YINC 3N2IA 1ESNA 2IA5A 3CNNA 2J9RA 1SVLA 1SHKA 3PITA 5CB6A 4XD7A 4MUAA 1X8LA 4DSUA 4AYXA 4YDHB 2WJJA 4OHVA 3EWAA 5BN4A 3A1VA 1NVVQ 1NN1A 3BC1A 4ERNA 4IDNA 2IYXA 2SHKA 3GEIA 4RCYA 3EAQA 4H9GA 4DCTA 1ZIPA 4V0KA 1E3MA 1OHHA 2CEAA 2G0NA 3AKCA 3B9PA 5CLLA 4A2PA 1W4AA 2HEIA 5FI0B 3ZZUA 1HY3A 2YOHA 1RYFA 3EG5A 3RS0A 4DHEA 4HZIA 3GLFE 3EZ7A 2DBYA 1VDZA 1F5NA 5JWHA 1NI3A 1U90A 1HV8A 1IN4A 5C4MA 4D4JA 2HUPA 1SKYB 4ZI2A 5AJZA 4DIEA 4EJSB 3LX8A 4GSYA 1Z6XA 4LHXA 1E9CA 5CK4A 2R2AA 5LDDC 3SQWA 3PUWA 4HLDA 2ZJBA 4TT3A 3BFXA 3B85A 1VMAA 4Q7MB 5BYJA 3OAAA 4BLOA 2GAOA 3AGPA 3SZRA 1NVWQ 1P61B 3K9HA 3QF4B 1G17A 2OAQ1 5M04A 1KK0A 2JDID 3RYTC 1D9ZA 1MR3F 2J46A 3QE0A 4PANA 3EIHA 2FU5C 1CRQA 3EZFA 3UMSA 2VPPA 3SYKA 4JLJA 3U4QA 1X8JA 2WSMA 1Q12A 2YC4C 3QBTA 2VP2A 2GKSA 2FG5A 2C96A 1KNXA 5FTLA 5HE9A 1QHXA 1DG1G 3M0EA 5FUWA 4B6FA 1OKKD 2ZQ5A 1EFRD 2O0HA 2WHXA 1HH4A 5KOYA 2DFKB 2Q6TA 4C0BA 2FJUA 1P5ZB 1N6OA 2MSCB 3AUYA 4BPBA 1R7RA 1CJMA 2A30A 5BXQC 2ZJ5A 5KPDA 4TL6A 2OAP1 2PLRA 4XH9B 5DSZA 2ZE6A 3F0TA 3U3MA 5C2JB 2ODNA 1NN3A 3TSOA 4EPTA 3ZH9B 2GNOA 5AJWA 4TMZA 4CIDA 1AS0A 2WWIA 1TAGA 2WAXA 1Q57A 2P0EA 4OQMA 5D3MB 1MABA 3EA5A 2DPXA 2AWNA 4IDPA 5EXPA 1XD8A 2GBLA 3B78A 5LBIA 1NN0A 4WA7A 2WAYA 1DBSA 1VCOA 4ZO4A 4JBWA 3BRWD 4LJAA 2GXSA 4URUR 2AK2A 2GVZC 3FFBA 3LO5A 1CU1A 1LNZA 2RGNA 1RRPA 4Q1BA 4BEJA 2C9OA 3CPJB 3LDAA 2ORWA 2J7PA 3K53A 1N6IA 4R71A 3GLGB 4KHZA 3DHWC 2H92A 2EYQA 2JEOA 1R2QA 4M1KA 4OI0A 4Q4JB 3C15C 1W0KD 4W5HA 2QT1A 4YXWD 4EIWA 3GPLA 1S96A 1DEKA 2X2FA 4M1TA 3I61A 2QENA 2QE7D 1EFCA 4L15A 3DEFA 5DH9A 4D6PA 4ESHA 3QVUA 4LCBA 3AF4A 5JCZA 5DIFA 1TQ2A 4DEYA 2FPKA 3KJGA 3SE0A 2CE7A 4KODA 3THWA 1AN0A 2IWRA 3PJRA 5DN6D 3W6PA 4PPGA 4DLZA 2FSFA 1W4CA 3UWOA 2CVHA 1OF1A 3K0AB 2OE2A 3K09A 3KQUA 2WJYA 2VF7A 4GP6A 2QQEA 1N6RA 3PEVA 3MJRA 3AB3A 2ZS7A 3WHKA 3GJ5A 1OSNA 3CF0A 3UANA 4U5XA 4JBYA 2IYQA 4EPWA 2RGBA 4UXJA 1K8RA 1MO3A 5DI9A 3KTAA 1JXMA 1Z0FA 5HKKD 3MWKA 3ZGXA 5SZIA 4ASUD 4LDJA 2VL7A 4OHXA 4TSFD 2P67A 2ZRAA 1ANKA 2C8VA 5JBQA 1FNMA 2RGGA 2F9LA 4Q1DA 1GL7A 4ZDWA 1QG4A 1T3LA 2CVFA 2Z6VA 4PSKA 4Q4HA 1WA5A 5FL7A 1OXXK 1US8B 1YVDA 3KZ1E 1UBGA 1GL6A 2IF2A 1JEDA 1LF0A 2NQ2C 1Z47A 3TKLA 1JB1A 1TNDA 1A1VA 1U2RA 2IXFA 3I3SR 3HJNA 4AC9A 1U99A 3OEEA 1T3SA 2W0MA 1XJ0A 5J47A 1NKTA 1H8EA 3VR6A 3QENA 3T1QA 2FEOA 1SXJA 1DAHA 4JKYA 4ON9A 5JS8A 3RABA 3SBDA 3THYA 1GNRA 1R10A 2KE5A 1AKYA 1E0KA 1P2SA 1FP6A 3ADKA 4C0SA 5JEEA 4LRWA 1TADA 4R2IA 2XJ4A 1DG3A 1CJVC 2W58A 2UZ3A 4EPYA 1R6BX 2QM8A 3CPEA 1IN6A 1OXTA 3QKSA 4HATA 3CWQA 3QXXA 5GJCA 1AQUA 3CB4A 3KJHA 1GSIA 4IOJA 4A36A 3LWNA 1CR2A 1ZM9A 1YJ5A 1WQ1R 2B6HA 4LK2A 4DDVA 4JLMA 2KWIA 4KYUA 4GT1A 1XDBA 4RFSB 3GLFB 3OZXA 3FVQA 3PG5A 1OB2A 4Z1MD 2QPTA 4BQSA 5JHHB 1ZM7A 5FOTA 2ZVQX 3R9IA 3U7FB 2Z5FA 4A2QA 3R8CA 4LV6A 1E9AA 2VHJA 4Q7KA 1S2MA 3AP3A 4D26A 1SVMA 4MRRA 4KYIB 1YZGA 4O3MA 1YRAA 1QHGA 1NG1A 3GQBA 5KSYA 4GNKA 1KI3A 3ZZTA 4FWTA 2YKGA 5FOSA 4QJ4A 4RY2A 5BQ5A 1BMFD 3BGWA 1T91A 1W0JA 2QY9A 1XTKA 2ZS9A 1RE0A 4XVRA 5B64A 4KITB 1NP6A 3FMOB 4DC9A 5DE3A 4JJZA 2ZRLA 1KSHA 2QAGA 2KJQA 4TL8A 3NH6A 2W0SA 3ICEA 4A8JB 3GP8A 3AVUA 1DAKA 4DWJA 3ZS8A 4B3GA 1D8TA 1R8SA 3N5CA 3LXRA 3TSWA 1G9XA 1E6CA 1YKSA 2ORVA 2QU8A 2WPDA 1G3IA 1J8YF 4NHOA 4D80A 4E5UA 1HURA 3L82B 5AK0A 5L3VA 4RVCA 4B44A 4URVR 1E99A 4PHTA 4PHGA 2KBEA 1OFIA 1E2EA 4AKGA 3MGCA 3R9XA 4A0GA 3QXHA 4W5JA 3LLMA 5FOUA 1P62B 4DEXA 4Z54A 1IY1A 3SS8A 3A6PC 3HYRA 3B1ZA 1GUAA 4Q7JB 1DELA 3UPUA 4F7WA 4RZUA 2J0QA 3IKJA 5GJVC 1RKBA 3IPYA 4WZ6A 3P26A 1CR1A 1B0UA 3LBHA 4D0LB 3ZIAD 4M22A 4MRSA 1XX6A 3S1AA 2YNMA 5FOXA 4LV8B 2A9KA 4G0NA 2IEZA 1UBFA 4LHZA 4IXMA 2WWWA 4FCTA 5H1YA 3T12A 4DLWA 3AVVA 1UPTA 2NPFA 4ABYA 4OJQA 1NLZA 1ZBDA 2ANCA 4ILEA 2GJSA 4A2WA 3C5CA 1EX6A 4ZDIA 5DNYB 4M1WA 2QP9X 1KMQA 3L0SA 1ZINA 2IK8A 4NCHA 3TVTA 2E1RA 2TMKA 2EU8A 3TAUA 3V4FA 1G291 3W5IA 2CLDX 5L3SA 4QBGB 5B30A 2E9SA 2J5XA 4HYYA 1W36B 2IYVA 2O8CA 4BASA 3D6TB 2B7BA 3CONA 1AS3A 1SXJE 4PAMA 2R6DA 1E32A 5HCIA 2W2VA 4MDFA 1IM2A 4M9SA 2Q3MA 2ZR7A 1P60A 4LZZA 1QBKC 2ZANA 3K0EA 3C41J 2EYUA 2IYLD 2XEXA 4YMWA 5KNCA 4EQ6A 3Q8XB 2R62A 1N0WA 5EP4A 1FX0A 4Q18A 1OV4A 4F93B 4DUGA 3DOFA 3NC1C 4TMXA 3SHFA 2ZXUA 3K70B 2VQSA 3P27A 3K8YA 2Z0MA 4UKDA 3SQXA 4OQXA 3PVSA 2FWRA 4JIMA 3FOZA 1SQ5A 1Q3TA 2AKAB 1UADA 1WBDA 1GKYA 1Q44A 2D06A 1FP7A 4I1SA 2FFBA 4I81A 2PEZA 4MITA 4A1FA 2ATXA 4B48A 4ZCIA 4QC2A 2G3YA 4IHQA 5JFGA 1JJVA 1W7AA 1Z2AA 2J87A 3GLIE 1KZ7B 3DKVA 5FFMA 2JLXA 4FI3C 1OH5A 1E79A 4P33A 3QF7A 4JKIA 4Q4AA 4LBVA 1E4VA 2R6CA 2EQBA 1T0JB 3CX8A 4LSGA 1OH7A 2PT5A 3G0HA 1OH8A 3BAFA 2QZ4A 1KZGB 2NO6A 1VYUA 4LC0A 4M8NE 4YDSA 2DFNA 4QNRA 3RAPR 1R5NA 2ZJAA 1Z07A 4EKDA 1EXMA 3BH6A 1CR4A 1IXSB 2XOKA 4JLPA 4DSNA 2IS6A 2GF0A 4Q1EA 5GVSA 3U60B 2X1VA 2HCJB 1E1QA 5JJLA 4FCVA 2ZEJA 1Q22A 4NE2A 2GK7A 3RSLA 3BFVA 5EE9A 8OHMA 2J1LA 4FMCB 2V54A 1ZU5A 1RJ9A 2QUZA 4A9AA 1DE0A 5EP1A 2P2LA 2O52A 2NMVA 1JPNA 4JS0A 4N0DA 1J8MF 5FL3A 5SZKB 3T15A 2B8TA 4B3XA 1JQLB 2FFQA 4N0EA 4D4MA 3GJ0A 4NYIQ 1G4UR 5KDDA 1UDXA 2BMFA 2VP4A 2A5DA 2BEKA 2UVQA 1G8HA 3DDCA 3NBYC 1IHUA 1E2IA 3LY5A 5KNDA 1QHYA 2B21A 1PLJA 4UXIA 2JJ2A 1IY0A 1FUKA 2VEDA 1AQYA 3PXGA 3DL0A 4B3FX 2IS4A 3ZVMA 1MV5A 3Q9LA 2OT3B 3VNVA 2IL1A 3BS4A 1SVKA 4LJYA 2O8FB 3ZQJA 4OQNA 4L16A 2O8BA 5A0FA 2ZROA 4DVGA 1QHHA 1ZW6A 1JR3A 1ZD8A 3RS4A 2ZRGA 1G7TA 3ZVNA 2DFTA 2FA9A 1YZNA 3A1SA 4I1VA 1GTVA 4BUJA 1E2NA 3A58B 4Q9JA 5P21A 1OXVA 3DOEA 4TQAA 3L0OA 2VSXA 4IEEA 1QG2A 4RSGA 4UNQA 3A36A 3RS2A 2FX3A 3AVPA 3VMFA 3AVXA 1E2QA 2ZAOA 3HWSA 1P2TA 2NO9A 4TYWA 4PC1A 4DLUA 3SJBA 2J41A 1D2EA 4NCKA 4RD0A 4F4CA 1PV4A 4GFDA 1KNQA 3U61B 3ZD7A 5CYPA 3VKHA 3ECCA 1UBCA 2MMCA 1MOZA 3G82C 4R7ZA 4DRZA 2PX3A 3AVOA 2XNSA 5L3RA 5DHAA 1XFAA 1G16A 2ODEA 1VYVA 3ZZ0A 3ZYCA 2VF8A 2PJZA 4L5BA 4AG5A 3L0IB 1IN8A 1SHZA 4JT4A 2IUUA 1IY2A 2XAUA 4LBWA 1GRRA 2GEVA 4UQOA 2D4HA 2BJVA 2G0TA 2Z4RA 3LV8A 5IK2D 1VHLA 3Q85A 3SYNA 4CEJA 1I4LD 3IPXA 1ZC3A 3FMIA 3LA6A 2CNWD 2A5FA 3NEYA 2WOOA 4E22A 121PA 2BDTA 1NMZA 2X8AA 3KTAB 2QRNA 4G5QA 1KSFX 4C30A 3K0FA 4AY2A 1CJKC 4PO8A 1JXOA 2CXXA 5JS7A 1CJTC 2HLDA 5FBQB 1IQPA 3MMPA 5DLQC 4BFSA 4DLSA 2P5SA 2NO7A 2VHTA 2ZRBA 1BO6A 4OK5A 1OPXA 2GESA 4V0NA 4Q66C 2O5VA 5E4FA 5A5GA 3AEZA 3KKQA 4LHWA 1W5TA 2ZIAA 4Q7LA 5KUTA 1BIFA 1U9IC 1Z0IA 3NG1A 1FMLA 4D2IA 2RGAA 2W6JA 3TMKA 3LX5A 1FL9A 4O2RA 4TLCA 1ZNWA 3NWJA 3WMFA 2R6FA 2BIFA 3FHOA 2PLFA 4DLXA 1G1MA 1E9FA 2CE2X 5B2ZA 4QBFA 3KJEA 5DISB 2EWWA 4D0NA 5LD2C 2IYYA 2R44A 2ZI5A 4C9BA 3THYB 3AV0B 2CJWB 4LHVA 4TQUS 2CCGA 4PR0A 5FOWA 1LS1A 4HZUA 2G9NA 4FINA 2HJGA 1MRSA 1ZCBA 4HB0A 2BBSA 1N25A 2GRJA 3H2YA 4CEIA 1E1RA 3IEVA 4K8OA 1FTNA 4BLRA 1QRAA 1Z29A 2CLSA 2VSFA 2ZETA 4NMMA 2VP5A 1W49A 2QMHA 5KNBA 3E1SA 3KFVA 2J3EA 1OFTA 3B1XA 3I4LA 3PIRA 1FNNA 3RVBA 3U44A 4JL5A 3RSOA 4MKHA 2OXRA 2F43B 3KX2A 4M9XA 4MDEA 2IC5A 4NTZA 4XD7D 4DIDA 1P72A 1AZSC 4WXPA 5JI3E 3KQHA 4U7DA 3KQLA 2VBCA 5LB2A 3CF6R 1PZNA 2GTPA 5CK5A 1W48A 2XJ9A 3UMFA 1RW4A 2D74A 2WJIA 4M1YA 4MYUA 5HPYB 3K70D 4J0QA 2GZAA 2Z43A 1JR3E 4LI0A 1OHHD 2OEPA 4Q9HA 5KDOA 4C4PA 5FPKA 2WWYA 5FBWB 1SULA 2OCYC 3TBKA 3UATA 2REOA 2XNDA 1E2HA 4AK9A 1X86B 3DO6A 2GXQA 4ZIRA 1VKJA 3EARA 3IDQA 3HR7A 3OFNA 3BERA 1VIYA 2LKCA 4EPVA 2J7KA 4KVAA 3W6OA 1C1YA 2BBOA 2DYKA 1ZP6A 4P4SA 3WNDA 5G3YA 3DKPA 4RZXA 4BFUA 3QPUA 1EFTA 4US2R 5JJIA 2V1XA 4OBEA 4PXAA 1ESMA 3LNCA 1OIVA 1ZAKA 4P31A 4TMVA 4TT3D 2YWGA 4Q9KA 3SR0A 1JAHA 4EFMA 1Q21A 2IYSA 3OAAD 4UNPA 3TW8B 3LD9A 2G6BA 4B76A 4W9MC 3SJCA 2QROA 3RDPA 2WWHA 4XWOA 4G01B 3TE6A 1Z28A 3MFYA 1LFDB 3HDTA 3FHTA 3ND8A 3A1UA 2VTKA 4QJ3A 4WBSA 2VLIA 5DYGA 5FPHA 2PT7A 5G40A 1T6NA 1R0ZA 1VPLA 1M7BA 1U8ZA 2D7DA 2J59A 2P6RA 1F48A 4PQYA 2GHIA 2RHMA 3EZ9A 1X1SA 2QSYA 3B13B 3EPJA 1ZJ6A 3AKEA 3S1AB 4YMSA 4AD8A 4C2UA 3NHBA 4DKXA 4WXRA 4IVRA 5JECA 1KAGA 4HDCA 1R8QA 5G41A 1KHTA 1ETUA 2QSZA 4TLAA 5HCNA 4OI1A 1H65A 4D4LA 4ZCMA 3AP1A 1NNEA 3QG5A 2JA1A 3A4NA 4TTQA 1WXQA 3LQQA 1KJZA 1E96A 5KSOA 2AKYA 1TF5A 2IUSA 5DI3B 4U02A 1KDOA 1CF4A 4X8MA 4LX0A 1L8QA 3AVYA 3IO3A 2ZS8A 4LYHA 5JHGB 4JJKA 4KV9A 2BMEA 2CK3A 1I2DA 4M21A 1NJGA 2ZUBA 4BFTA 1UKEA 521PA 3TQFA 2GILA 1NSFA 1COWA 1OB5A 1A82A 3WRXC 3ADBA 1H8HA 4HDQB 2GCPA 4A6PA 4KFUA 3X1ZA 2XXAB 4JT2A 2J7PD 3U7HB 3KKMA 4QNMA 2Y8EA 5A4JA 4A8JC 1KI2A 1J70A 3UG7A 4HDOB 1NBME 2GCOA 1G3MA 3H0KA 2AK3A 3P4XA 1FOEB 3CRMA 3Q7PA 4P4TA 2ZI4A 4NCNA 2BVNA 2GWHA 4IDOA 3MLEA 1Q1BA 1DADA 2NZJA 3LW8A 1TF7A 1YQTA 1N2CE 1XF9A 2QEQA 4II7A 3THXA 2OFWA 3AF3A 1TF2A 4TYNA 3ZVRA 4B34A 2WZQA 2WWGA 1KI9A 2N46A 3F8TA 4UNRA 2RCNA 2ZR9A 4DSOA 4OL0A 4GDFA 2FZLA 4KJZA 3KQNA 1LVGA 4MYTA 4IJMA 2FDCA 1XXHA 1GRQA 4N3NA 1KY2A 4QJ5A 1SKQA 4Q4AB 2QM7A 1NL3A 3RRZA 1XJQA 4L4UA 2FH5B 4NU0A 3O47A 1KK3A 1MO4A 4TL7A 1ZC4A 3VTKA 1U8AA 3C16C 4BLSA 5EUMA 4TWZA 4V0OA 3HR8A 4P32A 1ZCAA 1OFUX 5K8LA 4QHYA 2VHCA 5KSPA 3X1WA 3LXXA 4ZKEA 2H16A 1XJCA 3I62A 3VHLB 1D2NA 1DVRA 1N6LA 4C0KA 4CGZA 4HAWA 1T8UA 2ZYWX 1KI4A 1RJ9B 3MWYW 3T61A 1W36C 4PZZA 2DCUA 4QGFA 5FL7D 1DAIA 3I8XA 3LQRA 3CNLA 2VP6A 4FIDA 3MJHA 2W2XA 1UAAA 3G5UA 3UKDA 4FW9A 2YVUA 5AUNB 1BH2A 3RRMA 4WZBE 4LJ5A 4PX9A 5TVKA 3OEED 2Q0HA 5IF9A 2ZE5A 2IYWA 3K1JA 2XZOA 1H8ED 3N2EA 3U3RA 1SXJD 2ZRHA 1FQJA 1ZYUA 4OKSA 3U3JA 3BXZA 4B74A 5KU1A 3IHWA 4E03A 2XTNA 3GLHE 4NYJQ 3CX6A 5CITA 1U81A 1CBUA 1FZQA 4MYCA 1XBTA 2WIBA 1Z0DA 2H5EA 2QA5A 2ZTSA 5AJVB 1QHSA 3B6EA 5L8VA 2JIZA 3MCAA 1N5IA 2JLVA 1P2UA 3W8NA 1KO1A 1IN7A 3JVVA 4B6EA 4JLAA 1YE8A 2KI5A 2BEJA 2MSDB 2CMKA 1KYIA 2BBTA 4HUQA 5B58C 4MKGA 2ZREA 4MRVA 1GM5A 1BOFA 4I1OA 4IOKA 1VECA 4Z8XA 1E0JA 2HXSA 3IILA 1L2TA 5CM8B 1Q1ZA 2R8RA 5D3QA 4GZMA 4DBLC 2CCJA 1KI1A 5KHOC 2WWXA 3QG1A 2Q9CA 4YMVA 2NO0A 2ZSEA 3B1YA 3CX7A 1OIXA 2ZU0C 2QBYA 2ZJYA 3FTQA 4IDHA 2YOGA 2OV2A 1W0JD 2IUTA 1F2TA 4JL8A 5EJEA 1K6MA 3FDIA 4JZKA 1EWQA 1JAIA 4XIGS 4MUBA 2J0UA 4ARZB 4BEBA 3PFIA 4TL9A 4D81A 1ZM4A 4FN5A 5H68A 3U3KA 4DSTA 2WKPA 2WPDD 4NYJR 1P6XA 5FUYA 3KB1A 3QKTA 2Q3FA 3QKRB 3SFZA 2WSSA 1TUIA 2W00A 3LVRE 4QGAA 1UEJA 2XGJA 1F2UA 2D2FA 3WNBA 2OZEA 3O8DA 2OSBA 3QVVA 1XD2A 1T5LA 1G4AE 1FTSA 2O0KA 4FWIB 1XXHE 3EPKA 3SU8A 3PEYA 1QVAA 3HU3A 3H1TA 3K9NA 2K5UA 1Z6AA 3T5DA 2OM2A 2RH5A 3IIMA 3KXLA 4JVSB 2EFCB 2IYZA 2RGXA 5TV2A 5C1BA 1S4QA 2FNAA 2A5YB 3HPQA 3QY0A 3I72A 5J4LA 3BK7A 1S8FA 3OE7A 3IEUA 4BRWA 2VP0A 3GLIA 4DT1B 1GILA 3H4MA 2NIPA 3DM5A 4JLKA 4NCJA 4X8LA 3WP1B 3AF1A 2IW3A 4ESVA 3TH5A 2AHOA 3KUCA 3AF2A 1JALA 1TEXA 2GAAA 4CEIB 3X1DA 4DB4A 2BKUA 4C7OA 2CHGA 4NL4H 1E2PA 3TNFA 4XTRA 3VNUA 2I1QA 4XSHA 4DDTA 3E2IA 2YYZA 4M4SA 3QPVA 1IAQA 4V02A 2F7SA 1G3RA 5BW8A 4QG7A 1YRBA 3PR1A 2VRWA 1E2LA 2XB4A 3P1JA 1WBBA 3WMEA 3MD0A 1JNYA 4LPKA 4Q47A 4JYBA 2ZI6A 3CRW1 1YR7A 1KI8A 3VKWA 4LV5B 2WJVA 4V0LA 2ZE8A 5B57C 1P4SA 1Z0JA 5E7JA 3TR0A 4NBSA 4AI6A 1KAOA 3BFKA 4RKEA 4DUGD 2EFGA 1AIPA 4ZCLA 4QHTA 2ZRFA 4G1UC 4C0LA 3ZS9A 1AJEA 2A5JA 1J7KA 2YWEA 4F38A 5EQTA 1I4TD 3AH8A 4D0GA 2H17A 3R7WA 4XVQA 2I1VB 4ZIRB 1HQYE 5CB8A 3KXIA 1XEWX 2C5LA 2YWHA 1Q1QA 2XTZA 1PUIA 2FSHA 3KKPA 5EE0A 2XSZA 1N5LA 2ZRPA 5H70A 4AKIA 2C2HA 4GMXA 2OBMA 2GZHA 2O8DB 4UJ3A 3RWMB 1XMIA 3F5FA 1Y63A 3K9GA 1E79D 3ZVLA 3EZ6A 4TLEA 2BC9A 2JLUA 3CPHA 5JJKA 1KMHB 1FMJA 1CIPA 2BMDA 5AJXA 2F1HA 2WMNB 1NN5A 1UKZA 1KK2A 1Z0KA 3FKSA 2R9VA 1PUJA 5JZVA 4JL6A 2XOKD 3B60A 4RCZA 1GKUB 1DPFA 1NSTA 2QGZA 1BYUA 3NHAA 1G41A 3FFAA 4R9UC 4CZ2A 2PJRA 2QI9C 1E1QD 3I73A 4M9ZA 4XWAA 3B7GA 3JZAA 4KFRA 4FD2A 4E07A 1R0WA 3DMNA 2NTYC 1II0A 4OQFA 5TY0A 4KO8A 1P9RA 4JBXA 5LB4A 3ASZA 4CEHA 4OI2A 1QHIA 4LJ9A 1ZD1A 2ZAMA 3FE2A 3PENA 2WBLC 4QBHA 1NMXA 4LC1A 3AVWA 4P3YA 5GVRA 2ZE7A 1HTWA 1YR9A 3DVLA 4IOLA 4IRUB 2ZYTX 3B1WA 4TMKA 5J4VA 4OYHA 3CRRA 3QF4A 1G5PA 3CIOA 1CRPA 1CJUC 3D3QA 5C18A 3K0CC 3WBJA 1NMYA 3CRQA 3UK6A 1ZUHA 2JJ2D 2X19A 2QMEA 5HR5A 3SEAA 3VKGA 4AIIA 2ODWA 4IVPA 4IW3B 4Q21A 4L8GA 1MRNA 2DY1A 2YHSA 5KYKA 2AD1A 2PCJA 3AM1A 4CVNA 4BRUA 2HCBA 1JR3D 3NVAA 5EZ5A 5AUQA 4CW7A 2V8OA 4S35A 2CDNA 1KY3A 3GMTA 1HYQA 2DWQA 2ZI9A 2F6RA 4M2LA 3KFXA 4KAXA 4B43A 3U4QB 1IJFA 2HV8A 5H8WA 4B3BA 4L9WA 2C98A 3CM0A 4CDGA 1S1CA 2GDJA 1VCMA 2C03A 3P4YA 2GXAA 4EFNA 1GAJA 4MRPA 4F91B 2ZITA 2IS2A 2OBLA 1HE1C 2JAQA 1D2MA 1IONA 3L8YA 4DLVA 1IOZA 1JEEA 5IDVA 1WDTA 5AUOB 3B5JA 3CZQA 4A0HA 4URZR 3THXB 2OLKA 2DR3A 2V7QA 4NYMR 3RNLA 2ZRCA 3Q7QA 4JSTA 5SZHB 3R8FA 2ZJOA 1U9IA 5IHPA 2YV5A 2YOFA 4US1R 2R6GA 1RYHA 4G5RA 2WM9B 4Q01A 3GLGA 1VIAA 4BZXA 3ASYA 3BD9A 1MABB 3ND9A 3WYGA 1L7VC 1TL7C 3B82A 4Q4JA 1OH6A 4WW0A 5C46F 5F2EA 2J0SA 1R5OA 5TDHA 5ANRB 3QXSA 3Q5DA 3ZQ6A 1FW6A 1DAMA 2QTVB 4X8OA 1D6JA 4GPTA 1A5TA 2WJGA 5AJYA 4B33A 1E98A 2ZJ2A 4JVLA 3FPAA 2WOJA 1Z6TA 4PPQA 2HLDD 1CULC 4FMDF 1HT1E 1AGRA 2V4ZA 3C14C 3C4JA 4RD6A 1AK2A 3IIJA 3BB4A 3TAHA 4EJSC 3BORA 3EXAA 2JATA 3GFOA 4KBGA 4QM7A 2JLYA 2ZRMA 3K0AA 2FSIA 3WP0A 3GJ4A 1NIPA 1G8GA 3D31A 2W6JD 1KSJA 2OCPA 4BGDA 4YMTA 4DDWA 3WRYC 5TARA 4PQFA 1M2OB 2BCGY 2P5TB 1KK1A 3BJIC 3T06B 3THWB 4PAOA 1G5TA 1G6HA 2OESA 3EA0A 1CKEA 3FMPB 4KCGA 3EWSA 3WY9A 2CHVA 2ZRJA 1B23P 1S9HA 4A4DA 4KI0A 3SN6A 1RRFA 2PZEA 1CR0A 4PC7A 1SKYE 1U0JA 1E1RD 2YZ2A 2QMOA 1CLUA 1XEXA 3KXKA 1W44A 6Q21A 3LAWA 2YJTD 1J99A 3EX7C 5SZJA 1LV7A 5E7IA 4YONB 4PSAA 5J4HA 4CEHB 1YU9A 1VG8A 4AYWA 2QPAA 4OK3A 5JLJA 3ZJYA 3BOSA 2FPLA 5CLQA 2HT1A 2PEYA 2PCLA 4Z8YA 1GNQA 3ADDA 2NGRA 4AYTA 1R0XA 1EGAA 2I4IA 1E94E 2OO7A 4PZLA 2JLZA 1XTIA 2G83A 1EFUA 1U94A 2ZUCA 1EK0A 4QRHA 4KLZA 4C0JA 1S9DA 1DO2A 2YWFA 621PA 4Q4HB 1EX7A 4LJ6A 1XCPA 4RFVA 3NC0C 1E0AA 1KOFA 1YZKA 4ACBA 2ZJZA 2JJ8A 3R9WA 1EESA 2BM1A 1ZRHA 1F2TB 3VR2A 3L2OB 2O0JA 3CLVA 4A15A 2WJHA 2XNDD 3QOFA 1CP2A 4LBZA 1SVSA 4UJ5A 5EXTA 1TTTA 3IQXA 3Q5EA 1SZPA 2IX3A 4M0LA 1SXJB 3OFND 3IHLA 1RZ3A 2I3BA 1FUUA 4URYR 2NPIA 5FUXA 1NY6A 4BFYA 5UKDA 2CL0X 2GXUA 1G21E 4A0FA 4EAQA 3X1YA 1Z6YA 1G7RA 3CO5A 1XMVA 4MRNA 3WYAA 3M6AA 3PEUA 3FB4A 1NBMA 3GD7A 4LYFA 3AKDA 2VHQA 3BBPA 1F2UB 2V6IA 3QKSB 4HLCA 3GEEA 3GJ3A 3L8ZA 1XD2B 2AR7A 2OFXA 3FKQA 2J45A 1ZUNB 1CS4C 1UKVY 3MAAC 4GOXA 1KO8A 1I2MA 2QRZA 3VR3A 4KFTA 5BWMA 2V3CC 3GLGE 1XMSA 1S1MA 3TW4A 2QAJA 3MG9A 2QT0A 4DDUA 1NF3A 2VIIA 3SJAA 3VR1A 3X1XA 1KKMA 1V43A 2ZPTX 1F60A 4DXAA 2D62A 1T8TA 3HU2A 3OESA 4A8JA 1WB9A 1VYTA 2FF7A 2HT6A 4AG6A 1O87A 3TSZA 2R6AA 3GLIB 1TPZA 1ZNZA 2QN6A 1Z63A 3NTUA 1T9HA 2DFLA 1TQ6A 3IQWA 3EC2A 5DHFA 3W9YA 1TEVA 2ODBA 2P3SA 4LBYA 4EDHA 4URXR 5F98A 3QKUA 1RFLA 4F92B 1RC8A 2GK6A 2BM0A 2HXYA 1G8FA 4OHZA 4B3DA 2QAGB 4DZZA 5K8TA 3RC8A 4EPRA 4IDQA 2ONKA 2A5GA 4F4IA 1XTSA 4C7OB 3LFUA 4JVMA 4YMUA 3BIFA 1Q3HA 4N1AA 3CH4B 1IJEA 2X2EA 1ZNYA 1XD9A 2CK3D 3F3YA 4Q02A 4UXHA 2MSEB 1Z22A 4H1VA 2FN4A 3QBVA 1JPJA 3TUIC 3DMDA 1KI6A 1DAGA 1LF5A 1XTRA 1GRNA 1COWD 2AFHE 2VH5R 4QGHA 2FE4A 1H8HD 3TIFA 4I1UA 1Y3AA 1YZLA 1KO4A 1MKYA 1N3BA 3OEHA 3VFDA 3H86A 3PUYA 3SYLA 2P65A 3OIUA 1BYIA 1G64A 1RPZA 1DARA 4QXAA 1AS2A 1Z08A 2WMOB 1P9NA 5IRCD 2QTHA 3IBGA 4TZ6A 1XZQA 5JWOA 2IYRA 1G7SA 3GLHA 1HT2E 4C0HA 2H7VA 2GEDA 2A7QA 4XSGA 2VA8A 5JRJA 4KFSA 1M7HA 4IFEA 5JRZA 2ZVPX 1KIMA 4Q19A 1KJWA 3AF0A 4UNSA 1RIFA 2WVJA 3T1OA 1Z83A 4GOKA 4TTPA 3N70A 3U6BA 2R65A 2FMXA 2RHDA 4MGZR 1UEIA 1N6KA 3BWDD 2O8EA 1IBRA 3HYTA 4JLNA 5FTMA 4A82A 5F3WB 3PQCA 5L3SB 2Q3HA 4DCSA 1NG9A 2C9CA 2JJ1A 1XNJA 3WHLA 1Z3IX 4PFSA 5E3HA 4HB4A 1VG9B 2ZI3A 5EXXA 3TK1A 2O8CB 3GFTA 4HAZA 1W47A 5CDFA 1KO7A 1MO6A 4HAYA 4L9SA 4QHSA 4Q1AA 1S3GA 3NBFA 3SJZA 2W6IA 1S3SA 4POAA 2JLQA 2QGNA 1BS1A 3CR7A 2OBNA 3I5XA 2BCJQ 1FFHA 3FYHA 2C99A 4XWKA 3VX3A 3B9QA 2ZR0A 3OIWA 4CF7A 1M6NA 2ASEA 3D8BA 4EQ6B 3NDBB 3KDSE 2B7CA 1A4RA 1FX0B 2HYDA 3RWOA 2Q21A 1XZPA 1ZM2A 3W5JA 4LOAA 1HA3A 4PZYA 1GNPA 4TN1A 3VQTA 3UXMA 2CHQA 4M1OA 1W1WA 1G8YA 3C8UA 1VHTA 3ICQB 1BKDR 3D7MA 2AX4A 4KVGA 4LYAA 3RLFA 4NPHA 1KDRA 2IF0A 2ZU6A 4PO1A 5DYIA 821PA 3ONWA 5FI1B 1XRJA 2C9YA 5G53C 5L3QA 4ITRC 3WMGA 5FH9A 4LJ8A 1CTQA 4G3XA 3RS5A 4HAXA 4V03A 1DAFA 2GA8A 3QNUA 2C77A 1JQJC 1YR6A 2JIZD 3AVQA 4NCIA 1K5GA 5FTNA 5K8UA 2WTUA 3GFPA 1O3YA 1OLOA 4JMPA 4MH0R 4A0RA 1RVDA 1IXRC 1EFHA 2OLJA 5CJPA 3A8TA 2RGEA 4PPNA 1NVVR 3EPHA 221PA 2FOLA 2IHYA 5K8IA 1ZNXA 5CYOA 1LS6A 4US0R 1ONBA 2JGNA 2C95A 3IIKA 3NXSA 4BLTA 1U8YA 1W2HA 3EIEA 3C7KA 3K9LA 3TUZC 1D9XA 2ORIA 1Q0UA 2A3RA 4JLBA 4O25A 1RRCA 1OYWA 4BE7B 1XMJA 3EW9A 3MSXA 5FBRB 2ONJA 1T0HB 1V5WA 2OUKA 3RC3A 3QPWA 1ELOA 4HLUC 2UKDA 3M1IA 4DB2A 3ZD6A 1E9DA 5E95A 4I4LA 3SI7A 4Q9LA 2O8FA 2QP3A 1G8PA 4Y0VA 1LB1B 2F3TA 5JSZA 1GP2A 4V0MA 3VR4A 5E7MA 2RAPA 2GF9A 1ZVQA 2JDIA 4G5SA 2LKDA 1KDPA 1E9RA 1R4AA 4YQFA 5J4YA 3PUVA 5LD2B 2WWFA 2BHRA 2GCNA 1WF3A 3T5GA 421PA 1GVNB 4PC3A 3K70C 3HU1A 5EE1A 3HPRA 2PZFA 4QOSA 2H18A 2WSSD 4Q5IA 1II8A 2ZYUX 2HF9A 1P7CA 4GBMA 1TU4A 4MKIA 2DHRA 4RJLA 2BMJA 3REFA 4TTRA 3SOPA 4C0AC 3ADCA 4ZV4A 2O8BB 4MQBA 2PBRA 4JLDA 1QHHB 2L0XA 1KKLA 2G77B 1OKKA 3A1WA 1EFRA 3B8HA 1AZTA 5EE5B 3SDZA 5BN3A 1XPRA 5IT5A 1JJ7A 2GEUA 1KJYA 4HB2A 3TUJC 3V9PA
chains in the Genus database with same CATH superfamily
2V6JA 1NQ5A 1SC4A 2HDWA 4NKRA 3MRSA 5DM60 2Q62A 1UXKA 1YQUA 1LJ8A 1OIWA 1SU4A 3R0VA 1TD1A 3W3ZB 3A4MA 1EG2A 1RWWA 4NJMA 1U0LA 1OXSC 2RK4A 1ZU4A 3H04A 5CA1F 4EGCB 2OHGA 4HUTA 4EY3A 1WUTA 1G2PA 5LQAA 3F74A 2OILA 1K27A 5ADVA 1MXHA 1O54A 1P3Y1 2ZR8A 3C8DA 2BWJA 1G19A 2IYEA 2YWJA 2P69A 3B51X 4LMAA 5FWXA 1KEWA 3AP2A 3SSOA 1SQ0A 4TYYA 4WGFA 4D9NA 3IAXA 1XZKA 3U13A 5L4SA 4PRYA 2Q7XA 3FLMA 4PSVA 5TQ2B 4QUEA 5A3VA 3NGXA 2RGWA 4BZQA 1YVEI 1NR7A 3AGQA 3OFJA 4DCMA 5HZKA 2FPXA 2JFNA 1GPMA 3CKLA 4Q03A 1PBTA 3FMFA 4IF4A 3HCAA 1KARA 5GM2A 3LVQE 2BI8A 2EBFX 5SYAA 1FU7A 1RXVA 2IU3A 1KC3A 3T7JA 2ZWPA 1W0KA 4XQGA 2XLBA 4WXYB 4G4GA 2Q1TA 3Q15C 1YS1X 4JI4B 2MR6A 3JSAA 4O4LF 5DXFA 1EVZA 4C0XA 3RYHA 3R7FA 1Q77A 2IBMA 2QE7A 2R4TA 5BN5A 6LDHA 1UKYA 2G1JA 2QJFA 4JYPA 4Y1RB 4KU4A 3P32A 3U4MA 4UM5A 3CLKA 4B6QA 2PMWB 3DAYA 1VP9A 3JQQA 4IIEA 3N1UA 1QMGA 3FOAA 5IU6A 2LCFA 2PRIA 4PPFA 1M0EA 1U2ZA 1CUSA 5E6RB 4D41A 4NHEA 2HDOA 2Q1YA 3M3DA 1SVUA 3LT2A 1RYEA 3L06A 4QUIA 3ZI0A 4CLOA 3ZDQA 4YAUA 1T24A 5EHQA 2PLNA 2RGNC 1CDEA 3SS7X 2YZ7A 1YK1A 1NY5A 5JASA 4Q34A 1GUDA 1JZSA 2R4UA 4G85A 4YRFA 3MJEA 5K7SA 1W46A 3RHFA 3S2UA 3VTAA 2PSHA 2ZT7A 2F4VB 4HNAA 2OXTA 4HTFA 1VZ2A 1WX1A 1XZIA 2C5GA 4F86A 1QF7A 2RKOA 4WFIA 2CW5A 4MGYR 2B34A 2JVKA 2XUPA 1XPUA 3QBEA 5I5EA 1KPHA 1Z3CA 2F43A 1UKAA 5H81A 2QX4A 1E4YA 1Y9EA 1IBCA 3BQ9A 3JXEA 4M1SA 4UTOA 4NCAA 4C7JA 4PR3A 3SVZA 3Q7RA 4C0QC 3W9SA 1JT9A 2REXB 1PJSA 2C82A 4OLHA 5IZCA 1E3IA 4UTNA 1P1HA 1LJLA 2P90A 1O97D 3FKSD 4CWAA 1KYYA 2A0WA 4GU5A 1T8RA 2A0KA 2QRUA 2Z83A 3BD7A 1HQCA 3DZDA 3OE4A 4FZ5A 1I3CA 4M53A 3HVUA 4GZLA 4QGGA 2FYTA 3HEMA 1JEAA 3GT3A 5TRTA 3HP1A 3ZV3A 1K06A 3ZDFA 4NI5A 1IBLB 1ODIA 5ELXA 2ZBRA 3TDMA 1DDOA 4JC5A 1JF8A 5M34A 4RNDB 3EGXB 1K92A 5BXYA 1MH1A 2B4RO 1NATA 4ZAFA 3X0DA 1GZ4A 4QXPA 5M3BA 3E9EA 1EVYA 3GYBA 3SBXA 4JXXA 2A0UA 2XX3A 3LFHA 5HXAA 4C22A 4I4TF 4BFZA 3KPYA 3HVKA 2J08A 2H4XA 1Z33A 4FYKA 1XZLA 5EFZA 1DFIA 1QOZA 1RLUA 4AMUA 2QR5A 1L5FA 1ZIXA 3E4CA 4Y2SA 2UXDB 1SIOA 2CKDA 1YO6A 3I2FA 4U6SA 4BZPA 1YGPA 3WGOA 5ICMA 2BOVA 1P5JA 3EG9A 2NOAA 2GN0A 4FCWA 5CVDA 4DV5B 4GF5A 1V9CA 2IVZA 1RIIA 2ZRQA 3DBHA 3AUSA 1MB4A 1N6NA 3JPYA 5EGSA 3FSJX 1XVLA 4D92A 2YQ4A 3Q11A 5F3DA 4L5AA 3SPXA 3K6SA 3LRTA 3G13A 3KHSA 2XZPA 4Z1MA 1LRLA 4JEMA 4QYIA 2X8JB 3VZPA 4FB4A 3OU7A 4KQKA 5B1HA 4U7GA 2HI0A 1TT7A 2CBXA 2X58A 2XMZA 1ZMRA 3MOIA 5CFZA 5K8JB 5KS2A 2OCAA 3QZUA 2CL6X 4CUKA 2HJWA 1E9BA 1NNUA 3UGTA 2G1KA 3R77A 4JB2A 5I6DA 4JUCA 1DJOA 1SXJC 5H83A 4UUNA 4CTJA 2Y1KA 4YWHA 1FLAA 1E18A 2DPMA 2YMPA 3U0BA 4WZBB 1V6AA 2DSTA 1KYWA 3FYTA 2X4LA 1A71A 3RS3A 3VUEA 3O8RA 4G8DA 2OYRA 1BZYA 4Q4LA 1BMFA 4UAGA 3ZLTA 4WBNB 3QM1A 2H48A 3HZRA 4UDNA 1WXDA 2ABWA 2AHRA 2GK3A 2QZSA 3B38A 3RYIA 2J6BA 3TRIA 4D7AA 3CFYA 4B32A 3PTAA 2ZLBA 4D82A 3INYA 4ZVVA 4XB6B 2J3KA 1F5SA 2GFHA 4BO0A 1GQ2A 5F9MA 3RFCA 3QW2A 4NYMQ 2ZYAA 4RJKA 4S2EA 5BRAA 1PZFA 1KFCB 2XXJA 4JYZA 4TGLA 1M5TA 2FSVA 5JWRA 4OQEA 5K5EA 4U2GA 5ABPA 4UPDA 1A5AB 3BCUA 3FSRA 2OCBA 3QFRA 1MBZA 4L2IA 2BBWA 4TYQA 2OAGA 3RRYA 4EB6A 4CRWB 1U6IA 2IZ7A 4LFAB 3WKEA 4AKEA 2JFBA 3WRYA 1H0KA 2PWAA 3VAYA 3QBDA 1OE0A 3WMRA 3COJA 1LPMA 1UFQA 1I2ZA 1ZX1A 1YGYA 1V47A 2CL5A 4IXDA 4K1XA 5F5LA 2HSWA 2PL3A 5C35A 2RGCA 2VHUA 3VPXA 4JLOA 5FPYA 1C3JA 1PQPA 1XQXA 4MYSA 2AVDA 3IR5A 3WKDA 4EHNA 2R47A 1M72A 4KIGA 1QAOA 2WILA 2ZCUA 3LW7A 1ISHA 2CXHA 1B41A 4H4DA 3VZCA 4OY3A 2IHNA 1S01A 3WLFA 3CF2A 3SC3A 2M9MA 1LCIA 4H0FA 5EIBD 3TNDA 4F11A 4YGYA 1KVQA 1GG2A 2ZTMA 2FPPA 3TLXA 1SC3A 1Z6GA 4MTLA 4W5WA 4K81B 2PMBA 3M5DA 5AKJA 1BWRA 3UOGA 2XODA 4TMWA 1GG9A 1FW8A 2GETA 2H8KA 1JPUA 5K8CA 3ANNA 3QPCA 4BBAA 1CC1S 1A2BA 2Q6LA 3TW0A 3HCRA 2AN9A 4KV7A 4TWIA 3ZCSA 4R9RA 3HRIA 3OQOA 3ROQA 1E7MA 4RZ2A 2JASA 3I04M 2GVDC 1A8QA 4U2KA 3UFXB 1S6YA 1K5DA 4P7GA 2VZLA 4D3ZA 5ENDA 3K35A 3HKCB 4BATA 2FFHA 5D3MA 1Z5OA 2XWSA 3IVCA 2H29A 4DG5A 1WF6A 1N0VC 3DDNA 5DNAA 5T8KC 3WAKA 1G7CA 3NM6B 4QM6A 2P7IA 5L3QB 4GYJA 2VS1A 2JCSA 3D81A 3LOQA 7REQB 1VGVA 2Q50A 1T3HA 2BGTA 2KX7A 4GGPA 3N53A 2WLTA 5DB4A 3RHSA 1XYGA 1XZFA 4DLBA 4EZIA 3JAKA 3A9CA 3KB2A 4L7VA 1GR0A 1CX9B 4P80A 1J1ZA 4ICIA 5E2AA 4PU0A 4BYMA 1DQRA 2P79A 1O5IA 5J2TA 2BTQB 2YNMC 4J0HA 1I7NA 1RC0A 3CUEF 3ZWKA 3O8CA 1QRUA 2D2EA 4CL2A 2LR0A 2ID4A 2ZSHA 2FPGA 2CXRA 4IJ6A 5IVIA 5K3OA 3SQWA 2GBIA 2J85A 4K6KA 4UM8B 4WL0A 5C1PA 1Z4MA 2HRRA 1VG0B 4PICA 1VIMA 4AU1A 2C7PA 3L1HA 2ZKIA 3OHMA 4YJHA 3CE6A 1EFDN 2E0IA 2XYPA 5AVRA 5ITVA 2C3YA 3SSAA 5TXGA 2FRDC 2FWPA 2AQKA 1RWPA 3UCEA 4E6EA 1W19A 4OHYA 2VJNA 3BE4A 3GNTA 1TYAE 3UK7A 3EHEA 5ETJA 3OZIA 2H2AA 5JMTA 2VJPA 1J33A 5B7NA 3AESB 1WMAA 1U0HC 3WLHA 3VO9A 4ZYVA 1T0BA 1VGRA 1V4BA 2XT9A 3T5MA 4BLQA 1OC4A 1NWCA 4W1RA 1XQWA 3H5RA 5JJBA 4RX1A 1A2KC 1FMCA 1G8JA 5LA6B 1NYLA 4N12A 5E2IA 4M86A 3DPUA 1FDRA 4MVJA 1RXCA 1A7JA 2JI9A 3VR2D 4BKQA 1TU3A 5GGYA 2JGKA 2QW1A 5KTPA 2OCDA 4R2HA 1H9CA 2XE7A 4YUXA 4BLPA 2YC2C 3N6VA 1KWKA 4F5DA 2IHBA 2XUDA 2XAAA 3JQFA 3NC4A 5KI6A 3CHYA 2BZ1A 2J9FA 1LQ2A 4WZAE 3UXEA 2ZJ1A 1IU9A 4BUCA 1JILA 3H99A 2WHYA 3HXMA 4NZNA 2AL7A 2GJ9A 4QBKA 3VC1A 2I1LA 5K3FB 4EY4A 2Y4NA 2I4TA 4LXTA 1T1JA 4S3MA 4LFBB 3P8ZA 4Z0NA 4XOUA 4JXZA 4WLOA 4MW7A 4B2LA 5EE3A 2EQAA 5CW1A 3WK7A 4KG7A 4I5DA 1ML4A 3DXXA 2GLXA 4PPYA 1Y89A 3L4EA 4QD3A 1MT0A 5JZMA 3L0PA 4GOJA 1P3DA 1E3DA 3ZE9A 2NADA 4EW2A 4TV9A 4L8VA 2G76A 4MEJA 4JI5B 5DF1A 4G63A 2WNIA 2W2KA 4RHUA 3JZMA 2IU4A 1KZ6A 5BSRA 1L4YA 2V5AA 2DQYA 5CXSA 4F2PA 3G9ZA 4E5DA 1Y4SA 2JLBA 4LE1A 3VO8A 4QAQA 5FWXB 1LA2A 2VI5A 3KE8A 3W05A 5ICFA 1OX6A 4GH5A 1MAHA 3MK31 1JHVA 2F1JA 3AI3A 1GZHB 4KRFA 4P0QB 2FW0A 2B61A 4K6HA 3WBBA 4YRMA 5IJAA 2I78A 3PHIA 4PYQA 5AJHA 3PRHA 1V4VA 1JFSA 2QQ0A 3C6ZA 4TVSA 1SU8A 4PSCA 3PUZA 5BSHA 2WKQA 3PI7A 5BP7A 1TDJA 5EP2A 2CT8A 1C5KA 2REBA 4C4OA 3BJMA 3LA8A 4LMBA 2DG2A 1HE5A 1RBZA 1Y8AA 1K2VN 3AQIA 3AM4A 3IR7A 4J0JA 1NUUA 2B5OA 3CR8A 4EITA 3QOXA 1DOAA 1KSGA 1DUVG 4KR0A 2PQ6A 4C5AA 3CO0S 2YY5A 4IJVA 3O74A 4OMDA 4CKCA 1RHQA 1Z8DA 4NONA 4FJ1A 4RZ3A 5K0NA 1BJKA 5T6MA 3W90A 4DT1A 1OPRA 2VAWA 4EMBA 4F21A 1U7ZA 1VLQA 4PN3A 5BSGA 2F90A 1E63A 4R9VA 3RANA 5C9ZA 4O2LA 2VCHA 1A8SA 5JW6A 1U8UA 1Z2DA 3GGJA 1UBNA 2XTMA 3DTTA 3T4UA 2CNBA 1Z73A 3AKYA 1AVTA 3A4YA 3G17A 1LGYA 3LE8A 1P1FA 4JN6B 3SQNA 3TGLA 1AM4D 4O2AA 1PG2A 1W2GA 3VSAA 3HV0A 4FOPA 1YK0A 4J7AA 2BGNA 4RVFA 1AK9A 5D7BA 4QKQA 1OZGA 1PBNA 4HWTA 1KETA 4BO8A 5BMOA 5CJ2A 3OQNA 4G41A 1Z0AA 3WSTA 4J7CA 4J3JA 3EULA 2JAOA 1K9SA 5GM1A 1H1DA 1W36D 3RTDA 1M2NA 4FJ2A 3DFFA 1LPPA 2CNWA 1AZWA 3NFYA 2J5RA 3DM9B 3DWEX 3EVDA 3P20A 4HC4A 4HNRA 3BJEA 2ERYA 4WASA 1C3OA 2BGLA 4DQXA 5C7IO 3I9JA 1RCTE 1ZRSA 1ZCFA 2B92A 5J63A 2CLFB 4MNTA 1X7DA 2FSUA 2JZCA 1G8KA 1VFPA 2XGGA 4K46A 4EARA 1JZQA 3M4YA 4Y1GA 3TZ6A 1EVIA 3CNOA 3QKIA 1VPDA 1ZH4A 4AJ1A 2LWIA 4TWJA 3DZ8A 1E2KA 2V74B 2I99A 4C05A 5KKCA 3EODA 2FMTA 4IUYA 5D6NA 1P3JA 3UJNA 3FOFC 2ZIEA 4F9FA 1XZDA 3Q7EA 3TQCA 1TKRA 2FSGA 4RVNA 5IFLA 2OLEA 2HA2A 2I91A 2A2ZA 2VYCA 3K1TA 3WIVA 2RGDA 2XKAA 4JYCA 1JEQB 2PO7A 4IKEA 4YR7A 4D79A 2VF4X 2PGDA 4C4YA 4B2PA 3EVTA 1KFJB 5LUAA 2W6ID 3I37X 4KXLA 2Y3IA 1V2GA 2UYOA 4NBNA 2C7VA 3R6DA 1JECA 2YX1A 2O2XA 4ZV7A 1YL5A 1Q0HA 1SFRA 1YBAA 3FD8A 3Q2KA 3SHFA 5H9WA 5LPNA 1UQTA 3F9CA 3GGDA 4FYPA 5JADA 2JGIA 3KUUA 2FZ4A 1USIA 3L5OA 4TKLA 1WMSA 5DNUA 1S8AA 2QRMA 4D25A 3PDJA 3PC8C 2VYNA 4QELA 5KB3A 1ZJYA 3GVXA 3OSUA 4L85A 1KJIA 4M60A 1L4NA 3D8HA 3PJFA 4KKVA 2PGIA 2O8DA 1EK2A 2BYTA 1X39A 1X7WA 3UJAA 4WXEA 2OV3A 1YI8A 3FUUA 2ET6A 3DAOA 4DJ5X 3PCXA 1ODFA 1SQFA 1M1NA 3CLUC 2C04A 2DUWA 3OKPA 3RARA 4E4YA 5BV1A 3H7IA 2WUDA 3QFSA 2PN1A 3KOXA 1JL3A 1Q7CA 2N1BA 2BI4A 1CUHA 4J94A 2KYRA 4J2OA 4KB5A 4D3YA 4PIMA 2QTCA 2VR1A 3NT4A 1IHOA 1P6QA 3LDUA 4XYBA 4TZ0A 3ANSA 1GOTA 5HE8A 3SFVA 4I3GA 4TTJA 3EXHA 2HMAA 1C0LA 3HO8A 5LZ5A 3HWWA 2GPWA 1ESNA 2J9RA 3O3MB 1SVLA 1SHKA 3IEIA 5HVNA 3PITA 3HI6A 4JJ4A 1Q0PA 2X3YA 1BE6A 1UXOA 4DSUA 4NENA 2V9ZA 4ZQGA 3NWPA 4UHDA 1BN6A 3K1YA 2W6NA 3A1VA 3WIUA 5JAPA 1PR9A 4IDNA 4BKPA 4NZMA 5C37A 3FPSA 5BQPA 3HLTA 4KHPB 3ESYA 2F4NA 4M88A 1T1RA 2O2IA 4YRCA 1TA4A 3FLEA 1ZIPA 4NBVA 4V0KA 1OHHA 2B4KA 2CEAA 2L17A 3AKCA 4YB8A 5IXJA 1W4AA 5FAKA 4OSPA 2X2OA 5EQFA 2JFHA 3ZZUA 3G3EA 3E1KA 4DHEA 2O0MA 5I7WA 2HJHA 2NYRA 1E1NA 7AT1A 3C6BA 5EWMB 3EZ7A 2DBYA 4PZDA 1UZLA 4HFMA 4ZCSA 4OXIA 4UMEA 3IPLA 3R9KA 1N7IA 1R8JA 5D87A 3NBMA 1Q0QA 2CD9A 4GBGA 3U37A 3FI0A 5H5JA 2HR1A 2D5LA 5AJZA 3HUUA 3KRTA 4LHXA 1E9CA 3JQAD 5ALQA 3I0ZA 3PUWA 1CY6A 1JKJA 4DUZB 3W8EA 3BZBA 1PFQA 2ZJBA 5JXJA 4TT3A 3BFXA 3B85A 1VMAA 3U4CA 4OD0A 3OAAA 5AKGA 5F12A 1EFVA 1X9HA 4W5QA 1ZOOA 1DBIA 3VR4D 5M04A 2FP4A 2EKQA 2JDID 3L0DA 4GEGA 4AF8A 1QJCA 4OYYA 4ZO8A 1MR3F 4DW8A 2I9PA 2J46A 5A05A 3QE0A 3URKA 5DX8A 1SCDA 3T4PA 4A2CA 4C7MA 4M9UA 5AK3A 3M2TA 4Y6GB 2ICAA 2EATA 2OO3A 3EZFA 3WISA 5EMKA 5FNVA 1XCLA 5TPZA 4JLJA 1VSVA 1X8JA 2OXFA 2WSMA 3YASA 5CD1A 5TVGA 4YUZA 3QBTA 2PMEA 4C7VA 2WVAA 3DBRA 1YJXA 4FOSA 3U17A 1W2WB 2P62A 2JJQA 3PQEA 4JROA 1ICEA 2C96A 3S0JA 5L7TA 5FTLA 2P4EA 2O1WA 5FUWA 1VPVA 2GN1A 1JSXA 2E4YA 4HWRA 5TMBA 4C4TA 5CVTA 4AS1A 1HH4A 1KMNA 3PTLA 2QN1A 1DEAA 5FXMA 4C0BA 1UK8A 3BUSA 2FJUA 3AR9A 3TPCA 3WI7A 5JZ9A 1LLQA 2I2BA 3TOSA 1CCWA 5KPDA 2XHZA 4TKZA 4J0EA 1RHMA 4TL6A 4XH9B 1JHZA 2J5QA 2ZE6A 5AHOA 2I2CA 2ZYSA 4TS9A 3TSOA 1ZRMA 2JBHA 5AVYA 3ZWVA 1G21B 3OJFA 2WWIA 4JASB 3X1JA 2P6OA 5IYZA 1FCJA 2VNAA 5D3MB 3EA5A 2RH8A 2PS3A 4ODIA 4IDPA 3HKBB 1BFKA 5LBIA 1NN0A 3GARA 4G5YA 1VCOA 3ZHVA 4ECEA 4JBWA 4WJZA 4TOIA 1XL1A 4LJAA 2GXSA 4URUR 2AK2A 3ILSA 5FHQA 2GVZC 4WWHA 3LO5A 2QTVA 1YCGA 4ND8A 1CNFA 1SCNE 2RGNA 1RRPA 1GEEA 2C5SA 2HO5A 2YIMA 3ET5A 3SIWA 4S2UA 2GM4A 4EY5A 3IEMA 3NHLA 3GLGB 1CD5A 2ODTX 2FWBA 3WMXA 3BWBA 1UAYA 1L5YA 2EYQA 1NNI1 5IG2A 4OI0A 2CF5A 2OK7A 4Y2YA 1FSPA 3U3XA 4ZZ0A 1W0KD 3SXJA 2QT1A 3KBOA 1FFWA 4EIWA 4JBLA 4AUKA 5LZ2A 4HQ6A 1IJKA 1I9GA 1T3ZA 4I2VA 1DEKA 4PGMA 3BPSA 4W8HA 2ZB2A 3HFSA 4BNWA 1PJLA 2V97A 5JS1A 2QENA 2QE7D 2WKWA 1PNRA 3DEFA 3OQVA 3H5OA 1QR2A 2BF4A 4FOLA 4WN9B 3DZGA 4DEYA 2LPMA 1C9NA 4KODA 5F3RA 1Q0SA 3RS8A 2EP5A 1M5RA 3L1KA 1FUYB 1AA6A 2C5BA 1W4CA 1DC3A 1F9AA 2QW8A 2PX6A 4AROA 4QUGA 4D97A 4DUPA 5U4XA 3KQUA 2WJYA 4ESOA 2QQEA 3T7DA 3BJRA 3ZY3A 2D7JA 3KAQA 2QSUA 2ZS7A 3P0EA 2V59A 1FU4A 4QOHA 2XZTA 3RFUA 3WB2A 4PYNA 2VLBA 4F5EA 4UUOA 1JDTA 2IYQA 4CETA 1ZL0A 4EPWA 1QGOA 4YY3B 2B9EA 1K8RA 2BEWB 4DYHA 1WG8A 1XNHA 2FPWA 1R4MA 1RACA 2PJDA 4GGOA 4OAOA 3UB4A 1BDMA 2PGAA 4OFXA 1Y82A 3PA8A 1VXOA 4RDCA 4X1KA 3DT9A 1GARA 1JTVA 3R8XA 3ZGXA 1WTCA 1ANKA 4UUMA 3ZKWA 3G49A 2RGGA 4W1PA 5FBZA 1GL7A 3SC2A 4ZDWA 2AQIA 2CVFA 2WM8A 2C4MA 2YFKA 4C3UA 4Z7OB 4IG9A 1WULS 1TPYA 4NDNE 1GL6A 2IF2A 3FGOA 1UJ5A 2NQ2C 3ZCTA 3MMZA 2DRIA 2VJCA 1DIAA 1M83A 1UOQA 1RI1A 1U2RA 2YRFA 3PHJA 3PNBA 4TLMB 2JNWA 1U99A 1AUOA 1XJ0A 4GLOA 3PXBA 4G4SO 1DJPA 1JFTA 1DCTA 3P7MA 4YRLA 3QENA 3KAKA 2C9ZA 2FEOA 1SXJA 3QPDA 1X13A 5B1SA 3SQOA 1HDRA 3VDRA 3G68A 3OJ0A 2GD6A 4RLQA 4YRRA 1JFFB 1U6KA 5B37A 3THYA 1E0KA 3AHHA 5DLEA 1DT5A 2RC6A 4LJSA 3OH8A 3LCVB 4OHUA 4ZCRA 5JSUA 4PONA 1QUEA 3JYLA 2VUHB 4DRXB 4C0SA 2BFFA 1MZPA 1O5TA 3LUDA 4RDXA 2GRAA 4TVKA 2UZ3A 4QPCA 2QM8A 4EI2A 1NI4B 2H4WA 2NTNA 1Q19A 3S2GA 5IKEA 5EUBA 5EQDA 3GBVA 3CWQA 5GJCA 4KR3A 4FX5A 4A36A 5K0BA 1ZM9A 4GOMD 3IDZA 2B6HA 4J3NA 4BBJA 2Y1LA 2KWIA 4KYUA 5IAKA 5JT1A 4WI1A 5ERGB 3PG5A 5BSMA 4FN4A 2C3UA 4F5WA 4Z1MD 3EIWA 3EGDB 2HSGA 3PX7A 2B94A 3G9TA 5FOTA 5DM4A 8MHTA 2W4QA 2Z5FA 3WOVA 1CZOA 4A2QA 3U7FB 3JY6A 4F2GA 1J5PA 1J8DA 1WCIA 5KC8A 4C5BA 4XB1A 4CIVA 4KYIB 2V7GA 4O3MA 1V5FA 1NG1A 4GNKA 4YVFA 3ZZTA 2KMLA 2YKGA 2K2WA 4FP9A 4RY2A 1BMFD 2VJMA 3HUDA 2HD4A 3PLNA 4Y0NA 4ZD6A 1E89A 1NI5A 1NP6A 2EFJA 3P19A 4NZOA 1TCBA 4DC9A 4JT8A 1CY8A 4O2AB 2SKDA 2KJQA 3G5LA 4KH1A 3NH6A 1GV1A 4FZJA 4ZZ3A 3I8OA 2QX6A 2F1KA 3O1HB 5LYYA 3GP8A 3AVUA 1LVUA 1VHQA 3D54D 2EKZA 2PT9A 5TQJA 2QDKA 1RI5A 4XI9A 2QU8A 3B5EA 2IGBA 5JNWA 3U4AA 5GPBA 4JX9A 1ISIA 3WRVA 1RMQA 2QD5A 4G36A 4DM4A 2QY6A 5AK0A 3ZDYB 2VDPB 4RVCA 5L3VA 5EWLA 4D8VA 1OBOA 4AJ4A 1JSRA 1E99A 1W96A 4FMPA 2OD2A 4URVR 2YRWA 3H4VA 5JC1A 3DMPA 4I1RA 3MGCA 1WSAA 1PIWA 2Z56A 1KMCA 3PJGA 4JOSA 3AEUA 1YMVA 1CP3A 2VOJA 4W5JA 5FOUA 3WGYA 1QO9A 2W2OA 3HXPA 5JNRA 4FE4A 5T8KA 5HUQA 1Z6ZA 1SEVA 2AUMA 4Q82A 5KQRA 3HYRA 3B1ZA 4D4IA 3MTQA 1L5SA 2NXEA 2R8OA 3UPUA 4Q12A 3UYKA 3GX1A 4UE3S 5EUCA 3ZDBA 1HLDA 1UP7A 3AWDA 3NKFA 3OPMA 2WB4A 1XGKA 4WZ6A 1JS1X 1CR1A 4UFNA 1B0UA 3DE4X 3LBHA 1GU0A 3OZTA 4NG5A 5GONA 3ROFA 3STWA 3TSAA 4DQVA 5KQGA 5J2UA 1ZK4A 3FSEA 4QAJA 1UUFA 2YNMA 4P36A 1DIHA 5IWAB 2HO4A 4Q3KA 4EQZA 2QUKA 1UBFA 4IDDA 4DR4B 3JD2A 4LHZA 3L41A 2WWWA 4FCTA 5T4HA 2FN7A 1K0UA 1ZR2A 2RK6A 3JYPA 1U0GA 3I9V1 3CZCA 4OQ4A 2GYVA 4XLTA 2MT9A 2W6CX 5H1YA 3T12A 1ZBDA 3OOWA 3AVVA 2GJSA 4ZDIA 3C5CA 2QD4A 5A6VA 3KYCB 3EQ8A 2EJCA 1EEXB 5FI5A 3SZLA 1KJ9A 2FRDA 2QG4A 3I6BA 4UDXX 5FULA 3QBJA 1CYEA 1M1NB 4LA4A 2ISQA 4ZT4A 5JD6A 1CDOA 2DR0A 1RJWA 1SELA 4U8HA 4E4TA 4QYXA 2QIPA 4ZVTA 5H02A 1BVHA 1JZTA 2PS1A 1EE2A 4PAMA 3TDNA 2QYTA 1E6EA 1FP1D 3EXHB 1E32A 3GEBA 1XTPA 5HCIA 3MZ0A 4EHAA 5IVHA 4MDFA 1N33B 4DV2B 2H6EA 1IHPA 1IM2A 3CRNA 3RJ9A 1U7UA 1JHYA 2ZR7A 3F3MA 4IV5A 1QBKC 1M8GA 1QE5A 4X1IA 4MUKA 5IVKA 2IYLD 3HP7A 3AL0C 2C2GA 5LDGA 4L1KA 2R62A 4CCYB 2NZVG 1PR3A 4JUBA 4GBJA 4Q18A 3U26A 3AR2A 1I6MA 4HQOA 1PWEA 5C8YA 5F4ZA 3K70B 4MPJA 3VU1A 4N01A 3DMGA 2M6RA 4KZKA 3EEOA 3E7WA 1H3EA 3P27A 1EA5A 2XUGA 2Y9MB 3PFWO 4NS4A 4OQXA 3STUA 2XMCA 2FWRA 5J23A 3C3DA 4AZ3A 5DCUA 3G8CA 4E1VA 4C6TA 4GUAA 4YP9A 1UADA 4H0CA 1EAYA 2XNHA 4ALJA 1E92A 5CHEA 2D06A 2POCA 5KTTA 4CF6A 1USVA 4B48A 2IHVA 5JO0A 4XDHA 3CJRA 5HIIA 4PYOA 1JJVA 1PL7A 1ZOIA 1JFRA 2B1QA 1NT2A 4MVJD 1FNCA 1KJJA 4R31A 4ZOBA 3WAGA 1CQXA 3HBAA 4XCXA 6AT1A 2ZBQA 2PKEA 3KV1A 1S3IA 4HVAA 1NUQA 2IP2A 4NAUA 1WEKA 1CNEA 4LBVA 4Q4AA 1E4VA 1DJQA 1T0JB 1MX5A 3BL8A 2C07A 4N5IX 1BGWA 2BFEB 1EI9A 2NO6A 3OOYA 2BFAA 4M8NE 4ZOCA 3FPHA 1YRLA 3RAPR 4BQNA 4YUWA 4UAUA 4CGYA 1I5OA 3ENZA 3EF1A 1EXMA 2HIMA 1R16A 3HFRA 4QFCA 1FQOA 4D9HA 3L5KA 4N4AA 3TL6A 1A9OA 4R8MA 4IJKA 3V48A 1TYZA 2QTBA 1E1QA 4GICA 1K2WA 4FCVA 3H1FA 1GCAA 4CQNA 1K3TA 2IKSA 1PG5A 4DMFA 2AF4C 3R0QA 4NEQA 5EE9A 3NNDA 3S8MA 8OHMA 4JI2B 1ACLA 3K4QA 1RJ9A 4F3NA 1BHSA 1DKRA 1R4ZA 2XT0A 3ETGA 1KEZA 2P2LA 4PYIA 5CD9A 2OM6A 1L4EA 4JS0A 1J8MF 2Q28A 2P2GA 2QL7A 2M32A 5SZKB 4PYMA 4XFDA 2X6RA 4B3XA 2R00C 2OHVA 4FEYA 1MB3A 3TPFA 3F4BA 2PKCA 4BWGA 1U1FA 4HX5A 1QVZA 3AHFA 1UDXA 2FUG1 4NYIQ 1BWQA 1SOAA 4WJLA 1L5NA 2XKJE 2O4CA 1HK7A 4Y7DA 2YFHA 4YT8A 5IYZB 5KNDA 3E9RA 1SBCA 1Z16A 2B21A 1PLJA 5KYYA 5FLXA 4G9BA 3FYUC 1RAAA 1RSZA 3MJFA 1MV5A 2BFCA 5ALHA 1KE1A 2JBAA 3X2EA 2BI7A 2OT3B 3VNVA 5EMJA 3K32A 4R84A 3VDQA 1SN7A 2WZCA 2YWCA 3QWBA 4YCJA 2MYPA 3ZQJA 3UV7A 5FOQA 2WFAA 3VVLA 5A0FA 3O4GA 3EXIA 1PX2A 4EY6A 1JR3A 1ZD8A 2NQTA 1Q5PA 5KIAA 1ADCA 3SZGA 1ABFA 1GTVA 2O7VA 1ISMA 1PD0A 3CYFA 1IL0A 3HJFA 3Q3GE 4Q9JA 3B3JA 3H9BA 4TQAA 5I5GA 1GKKA 1RLIA 3E5NA 3L0OA 2NXNA 3KSDO 1U8XX 2YN4A 3GZ4A 4P7KA 2QYHA 3WK9A 5K99A 1JJFA 1WPQA 2MSLA 2F64A 3A2MA 3JD0A 3LYAA 1E2QA 2AZTA 2DJIA 1DBVO 2XYHA 4IGIA 3RAJA 1OGIA 1NGSA 1UJNA 4FYWA 5FHRA 4GFDA 1QWSA 1EU1A 1JJBA 2WFLA 3A6DA 3R3ZA 3AO0B 3C3AA 3SXUA 3AVOA 2XNSA 1K7CA 1S2LA 1XFAA 1G16A 3AL2A 1FLNA 3BE8A 3IDSA 4MRAA 1BOOA 4XQ0A 4X6UA 4NG4A 3ZZ0A 2XYVA 2PS9A 3AFIA 4MJ7A 1QLWA 2VUTA 1RKQA 3MMXA 2IUUA 2V7TA 4FI3F 1IY2A 2XAUA 3HL0A 1R66A 2IIPA 3C1OA 2D54A 3DFMA 3IUPA 4HFNA 3Q4GA 2Z4RA 5LQDA 2I6XA 3KYJB 3Q85A 1OZAA 2J4DA 2Y1WA 3QMMA 2XUKA 1I4LD 1R0KA 2VPQA 3IPXA 4MUMA 1ZWKA 4CG2A 2CNWD 2Q29A 1KJNA 1C8LA 2ZQZA 3DDZX 3NEYA 3KJZA 3PC8A 3V8RA 1QFYA 121PA 1QH8A 3RU9A 4N49A 5ALIA 4Y2JA 6NULA 3TBFA 1H1LA 5ALPA 3I23A 5AOVA 4N03A 1T2DA 1XZ8A 1CJKC 3PFBA 3ZBQA 4C3VA 1LK0A 1RPTA 5FPQA 4C7KA 1IZ7A 3E84A 3FXAA 3H5AA 3Q8KA 1MUUA 3S70A 3HDJA 3CF4A 4EYGA 3A2KA 3ANXA 3P9ZA 1PR2A 2BF7A 1U63A 1KGSA 4Q66C 2Q3JA 4DAOA 5IDWA 4OF4A 4OREX 5E4FA 3MCZA 2G5CA 4AW9A 4MS4A 3DMHA 2ZIAA 5EVCA 1FLDA 4ANFA 3NG1A 3VJMA 2P11A 1QMPA 4JFAA 2PVPA 2W6JA 4DYDA 4A7PA 2GASA 4FDTA 4AMVA 5CAEA 4ZRNA 4KRGA 3HADA 2PLFA 3E22B 1TYBE 4DLXA 2WQ6A 2O8VA 4QBFA 1MRZA 3A27A 5LD2C 1E3WB 2IYYA 2R44A 1Y3DE 3THYB 2WA1A 1A9TA 2QTTA 4LHVA 2VYND 4QQKA 4YUAA 3IH5A 3ST7A 2HFJA 3SFTA 2G9NA 4FINA 2Q5EA 4KPFC 2GRJA 3UK0A 4EKYA 5IEJA 5IP5A 1LDBA 2VDOB 3WNZA 2ADFA 1GLGA 4TXLA 3TD6A 3ORHA 1QRAA 1Z29A 1WB5A 1OX5A 1QRRA 3OQ6A 4OHCA 1J1UA 1E7YA 1I2CA 4NMMA 1DRJA 1M34B 2OENG 3E1SA 1L9XA 1Q16A 1OFTA 2UYQA 2JA2A 3D3KA 3HEAA 3PIRA 2IITA 3RVBA 4AY6A 3U44A 3IERA 4JL5A 3KCQA 3RSOA 2YN0A 2PYIA 2YJ3A 1JHOA 2NVWA 2NVBA 3GR6A 3NCHA 3UAXA 4J0KA 3ENWA 4EJ6A 5JAHA 4L27A 1Z18A 4NTZA 1FS6A 1H9AA 1HDGO 5JI3E 1BX0A 4NOJA 3KQLA 4OIMA 1T6YA 1NKVA 5LB2A 4NFHA 5BVGA 2BY4A 4X41A 2OUIA 2ZJFA 5CK5A 5AQEA 4C21A 1XNRB 3IP5A 5BR7A 2Y1FA 1GPLA 1T4MA 3KHKA 2WJIA 3TB6A 5HPYB 4C6SA 3K70D 2W11A 4II3A 4E51A 4M8IA 1NU6A 3PE6A 4JUFA 4LI0A 1OHHD 4E88A 4B3MB 5IFKA 3FNBA 4C4PA 4ETWA 5HX7A 2O2YA 5HBGA 2QN8A 5FPKA 1DINA 1SULA 1TK2A 1WZCA 1G1AA 1RR6A 1VJGA 1A77A 2JCGA 2QV0A 2YQ5A 2ZB7A 5SY4A 2JPDA 1IPEA 2GXQA 5H0IA 4UPVA 1M33A 4UVIA 3RYFA 3KZXA 3OY2A 1IUPA 1KYXA 1ODLA 3S99A 2OGWA 1NVTA 1HDCA 1M8FA 2WJWA 1U0OC 3CUVA 3QLEA 4JITA 4P4SA 1WHTA 3WNDA 1VL1A 2R5WA 1SH7A 3PXXA 3DKPA 4US2R 3E27A 1YFZA 1K6XA 2HBQA 1CVRA 2AJCA 2V1XA 3KT3A 3LT5A 1ESMA 3QVJA 1ZAKA 2YMLA 3KQQA 4FWBA 4TT3D 2YWGA 1QH1A 1V8DA 3OAAD 3HCPA 4R6XA 3TW8B 3LD9A 2QROA 2A7XA 3GZTB 1FP4A 3NU1A 4KXWA 4LDRA 4LXUA 5EJGA 3RDPA 3TE6A 5I45A 2ZQYA 3KOUA 3CE9A 3AEUB 3N0VA 2IPXA 2P9ZA 2VJAA 2W8BA 1JDPA 4XB2A 3V46A 4CHGA 4O4HA 5I7AA 5C32A 5KTMA 1FTWA 5TPZD 1VOTA 1T6NA 2SKCA 1SWVA 2ZUFA 3U62A 1N1EA 3U9SA 1U8ZA 4GC9A 3OCVA 4E1AA 5BV7A 2JFOA 4LF4B 2DPYA 4BNDA 2XDAA 1ZN9A 2WDPA 5GONB 3Q41A 1BX1A 1WDMA 1A8HA 2P4HX 1PGJA 2QSYA 3B13B 1KP9A 4HN9A 4GR9A 4LJKA 4RHCA 2VDVE 1ZJ6A 3MERA 4RO0A 3AKEA 4TVBA 4YMSA 4E11A 5J58A 4C2UA 3NHBA 3FM9A 4WXRA 3V4LA