4U5XA

Structure of plant small gtpase osrac1 complexed with the non-hydrolyzable gtp analog gmppnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
178
structure length
178
Chain Sequence
GSTRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSVVNLGLWDTAGLEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp-binding protein
molecule keywords Rac-like GTP-binding protein 1
publication title The Crystal Structure of the Plant Small GTPase OsRac1 Reveals Its Mode of Binding to NADPH Oxidase
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 66
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4u5xA00
4M9QA 2CCGA 2JJ8A 2F1RA 4PSAA 1OXXK 2GXSA 3NBFA 4JL5A 2R6DA 4TWZA 2EFHB 3GLFE 2F43B 2WIBA 1TQ6A 1N0WA 4NL4H 4OQNA 5FL3A 4US2R 2ZRJA 4M4SA 1PUIA 4C0SA 3B6EA 3CKLA 4Q1DA 1E9CA 2QMUA 2IS4A 1XJ0A 1RRGA 4B6EA 3E1SA 4PO8A 1KI4A 4IOKA 4B3XA 1ZIPA 1T8TA 5J5CA 5DHFA 2PZFA 4BFXA 3ASYA 4HEJA 4Q4AB 3AVTA 5FOSA 1N5JA 1JEDA 1XEFA 4AC9A 1VYVA 2QE7A 1A7JA 4DHEA 1FTNA 3GLGB 2R6FA 4C7OA 1TNDA 4TYNA 3MG9A 1T3HA 2EYUA 3CONA 5AJXA 3AV0B 1XMIA 1NF3A 2F3TA 4P33A 3DPUA 4WOPA 4DLYA 1NSFA 2ZXUA 4D4JA 1NBMD 2G1KA 3ZJYA 1P9NA 2Z4RA 1GKIA 1TF2A 3B1YA 3MFYA 3QIAA 2WAYA 4NE2A 4TYPA 3REFA 3DVLA 1ESNA 5LB4A 5H8WA 5DIFA 3NEYA 3TLXA 3U3RA 1P2SA 3RRYA 5FPYA 2X77A 1J8YF 3A36A 3C14C 2ZJ2A 2KE5A 1S3SA 4M1WA 4KBFA 2BV3A 2FN4A 3PUVA 4PHHA 1YR6A 3RC3A 3SS8A 4K46A 1JNYA 2UZIR 3ICQB 1P75A 3HU2A 5EP4A 1I4TD 2MMCA 2QN6A 2V54A 3QBVA 5L3SB 1E1RD 4F7WA 3FOZA 1X8JA 2ZI6A 3RRZA 1KO8A 2G88A 1RE0A 4RZXA 3DKVA 1DO2A 1W5TA 4LV5B 3K9GA 2ZUBA 2GCNA 2ORWA 4TSFD 3K0AB 2ATXA 3TGPA 2A5DA 2V7QD 1VG0B 3DMNA 1N0UA 2VBCA 4I1OA 2IYRA 4MGIR 4O0MA 2ZRIA 4CEHB 1UBGA 1G5RA 4MRPA 2QSZA 4PANA 4U02A 5AK0A 1CRQA 3GLHE 4PPGA 1W5SA 1EESA 3RS0A 4Q21A 4WA7A 4L4UA 1J8MF 2JIZD 3ZZTA 2J45A 1P60A 5JBQA 3CBQA 5IF9A 2CMKA 3LBIA 5B58C 3SBDA 2IYXA 3HP1A 2O8FB 3C5HA 3RRNA 2P3SA 2UZ3A 1Q20A 5FBVB 2VF7A 1SVLA 4TT3D 1ZBDA 2H8KA 1G7RA 1OIWA 1WRBA 1EX7A 1G6HA 3CRQA 4JYCA 4ON9A 5FUWA 3EZFA 4FCTA 3QKSA 4HDOB 2XEXA 3K0FB 4HB3A 5FH9A 3B1XA 1XTSA 4JLMA 2RH5A 3SBEA 5KU1A 3O47A 3AUYA 1RYFA 4J0QA 5HTKA 1X8KA 4W9MC 1P9RA 1DOAA 4HLUC 1GL9B 2IXGA 2XXAA 1UDXA 2VH5R 4ZI3A 3PVSA 1BYUA 4BQSA 2J0UA 1CULC 3RS7A 5CDFA 3VKGA 4GOKA 2DHRA 2YOGA 2EFGA 2Q3MA 4HB0A 2BDTA 3OEHD 1LF5A 2AL7A 4URUR 5C4MA 1KMHB 1SZPA 1U81A 4RD6A 3T61A 1ZD9A 2VLIA 4N1AA 1E2EA 1NMXA 2OESA 3FGNA 4HZIA 1NN5A 2IUSA 3SJCA 1GRQA 1HEIA 3W9YA 4BLQA 2C78A 4PHFA 3BXZA 2WWYA 3TW8B 5HKKA 1NSTA 2DY1A 3AM1A 1W46A 4IKEA 2BBWA 3PFIA 4EDHA 1ZAKA 2QPTA 2D3WA 2GHIA 4EPTA 1AZSC 1E2NA 1YU9A 2ZRGA 3A37A 3QPVA 4TTPA 4FCVA 1WF3A 1XX6A 2IYZA 4NYIR 1Y63A 4GL2A 5DNYB 3PCRB 5F9FA 1N6IA 3ADDA 4ZIRA 1NBME 3BBPA 3FKQA 3AGPA 6Q21A 2Q6TA 4EFMA 3NDPA 3M1IA 4RFVA 5AJVB 2LWIA 1L7VC 2C2HA 4A2WA 3NTUA 2J59A 4RCYA 2FX3A 1YZGA 2I3BA 1E2GA 4QG7A 2A78A 2RGBA 4A9AA 1FMLA 4F38A 1ZD1A 2NO0A 3U7EB 1YR8A 3PG5A 1KAGA 1R0ZA 1W0KA 3FMPB 5HE9A 3SFZA 5JWOA 1E9AA 5CK5A 5FUYA 2QQ0A 2ZJYA 1F2UB 2JJ2D 3MSXA 2NIPA 2SHKA 4LWZA 1NMZA 1YZNA 4PPNA 1KSJA 4BFTA 5JWRA 1G64A 1G8YA 3C5CA 4EFNA 4KLZA 3DM5A 1P3JA 1LS6A 3BIFA 3LD9A 4NYJQ 4TMVA 5CLQA 4D80A 4E22A 2O8CB 4KYUA 3L0PA 1E2KA 4KI0A 2DFNA 4JLPA 3NKVA 1XPOA 5FOWA 2V9PA 2BBTA 1P73A 5A5GA 2JAQA 5FFMA 4B6FA 4AK9A 3A1UA 5J4LA 2OBMA 2ZS8A 4EKDA 4EPYA 1QBKC 4LBVA 2VP0A 2QAGB 4IDOA 4LRWA 4HB4A 1DS6A 3D8BA 3F5FA 2ZSFA 2XSZA 2IA5A 1XD2A 3CPHA 1XTRA 3V9PA 4A36A 2QP3A 4MKFA 2GKSA 4Q02A 3ZZUA 4GSYA 4XVRA 1ZU5A 4LV8B 4S2EA 2AX4A 4IDQA 3SFVA 2Z6VA 1UM8A 2IYLD 3GMTA 3V00A 1E4VA 5KDDA 2J1LA 3IPXA 4PO9A 2V8OA 4QGAA 1YZQA 2ZRNA 5AJZA 4KITB 1G8FA 5JECA 2WAXA 4NYMR 2QE7D 4PQYA 4OHWA 4EPRA 3IIKA 1Z6AA 3LXRA 4GNKA 4DXAA 3Q5DA 3LA6A 4MKGA 1QHYA 1AS3A 1T9HA 2Z0MA 1XFAA 3ETLA 5E4FA 3KXLA 3X1XA 5L3VA 2OBNA 2QORA 1JR3A 3CPJB 4KVAA 3GPLA 4Q7LA 2XX3A 4LC1A 3LV8A 4JVNA 5F9HA 3KTAB 2AK2A 2HJVA 5EXSA 4XTCS 3UANA 3HR8A 5IRCD 1TTTA 3BFVA 2X19A 1ZUNB 1PVOA 2VSOA 2ZQ5A 5TY0A 2Z4SA 2V3CC 2O8DB 2F1HA 2WKPA 2CCJA 2CL6X 3BE4A 3VFDA 2W2VA 4XD7A 1VIAA 1AZTA 4I1UA 4D0GA 1X6VA 3RVBA 4C0AC 3B1ZA 4MITA 5J40A 4Q18A 2ZJAA 2D4HA 1D2NA 1U8ZA 2YHSA 4ITRC 2EQBA 4BFVA 2VP9A 3CRVA 4F4JA 1BYIA 1DAIA 2ZUDA 2WMOB 1KDTA 1SGWA 4JT2A 4NP6A 4E5UA 5JCZA 1DTSA 1FUUA 2BMEA 3T1TA 3LQQA 5JFGA 3AB3A 4H1UA 4D4LA 1NLZA 2FSFA 3OE7A 5FL7D 1F2TB 3RWOA 5KDLA 2AKAB 2ZRDA 3QF4B 1M7HA 1CJUC 1V43A 2CEAA 5FTJA 4R71A 4JVLA 4JL6A 5EE3A 4DVGA 1P2UA 1SVKA 3ZYCA 3KKOA 3GLIB 3B13B 2MSDB 1VKJA 1LVGA 4NBSA 2KB0A 3KKPA 2Z83A 1TUEA 4KFSA 3WP0A 1U9IA 1G8HA 1OSNA 2B92A 3QG1A 2P6NA 1O87A 3QVUA 1ZJ6A 1CKEA 3FMOB 5FBWB 4JJZA 4RZ3A 4TZ0A 4LYFA 1ESMA 1AS0A 3OZXA 2J0VA 3QI2A 2DFKB 1OFUX 2QP9X 3AGQA 3NH6A 3IO5A 4TMXA 2XZLA 3I5YA 2F9LA 2VP2A 3GLHA 3RANA 4Y0AA 5IHPA 4QBHA 1MV5A 1SVOA 4FW9A 3Q9LA 5L3RA 2IYVA 5DISB 5A0FA 1N0VC 1UEJA 3BWDD 5FTKA 3TUJC 2XTNA 1SQ5A 4N3NA 4KFTA 4B47A 4XTRA 1IXZA 3AEZA 1B0UA 4NHOA 2V4ZA 2C8VA 1GDDA 5HCNA 1E9RA 4MQBA 4DLRA 1IY2A 5B57C 2C03A 2ZSDA 2F1IA 1W2HA 1YKSA 3FPAA 3AVVA 2CJWA 5GJVC 4TTRA 4JLAA 3QUSA 1NJFA 3TQCA 3WHLA 2OXRA 3ZVNA 4BWYA 3WNDA 4QXAA 3CRRA 4AWXA 5EE9A 3HYRA 1JPNA 1W47A 1OKKA 4LHZA 4V0ME 2VO1A 2JJ1A 3BH7A 1KGDA 3U44B 4G0NA 1P2VA 3EWAA 3K9HA 2DWOA 4HATA 5HKKD 1QHNA 2QMEA 3AQ4A 4XWAA 5F2EA 4DDVA 2O0JA 2QT0A 3EPHA 5JI2E 1DAHA 3AF3A 1Z8FA 3Q85A 2GZDA 3BD9A 1Z2AA 4BECA 2FF7A 1KDRA 2CVHA 2RGAA 2YOFA 1II9A 1G3IA 3BB4A 4Z51A 5BN3A 3EIHA 3SJAA 3JVUA 3AUXA 2QSYA 5G40A 2QT1A 2VHUA 2JLWA 1NLYA 2XGJA 3KKNA 3BRWD 2EFEB 2W0SA 1HURA 2WJIA 3ADKA 2L0XA 1SKYB 5EE5B 3CR8A 4DJTA 3PIRA 1NRJB 1IN7A 2ZANA 1QHXA 2XZOA 4IFBA 4Q9HA 3K9LA 5J4VA 3OIUA 5FOXA 4XH9B 4F4CA 5C1BA 2C9CA 3NDBB 1GL6A 2WWHA 4B2IA 1GOTA 2YV5A 4LYJA 4A82A 3AVXA 4A6XA 2W2TA 1EFRD 2JLRA 2XZPA 2Y8EA 4YC7A 4Q9LA 2IYQA 3KKMA 3KDSE 4A0RA 2FZ4A 1T0JB 4ZPXA 2UKDA 4JVMA 3B1VA 1EXMA 4EPWA 3U6BA 4IVRA 1KI6A 1UEIA 2ODNA 2PX0A 2X2FA 4MKIA 3SHWA 3VU9B 4MDFA 2R6AA 5AUNB 1Q0UA 5CJPA 1FNMA 3Q5EA 2QL6A 3FMIA 1PJRA 1CJVC 4AYWA 2EYQA 4HAWA 1AJEA 5EP1A 1ELOA 4OHXA 4C0KA 4OHYA 4RFSA 3VR2A 1E3MA 1E1RA 2OCBA 3MWLA 4DDUA 1M1YE 3TSZA 1XCMA 2JA1A 3EZ2A 4O3MA 2YC4C 1EX6A 2NPIA 3QENA 4XWKA 2WBLC 4KBGA 4LJ5A 4UNQA 1ODFA 1GRRA 4JLKA 1G3RA 2C95A 4TSFA 1IHUA 5SZHB 2F3RA 2GAOA 4GT1A 4ZKEA 3UXMA 2HXYA 1IONA 5GADl 5J4YA 4FI3C 2GXUA 1XP8A 5DN6D 4CF7A 4A0HA 1R7RA 3CNOA 3THWA 4URYR 4YMUA 621PA 1R0WA 4M2LA 3HPQA 3SR0A 4D2IA 3U60B 2N1BA 4C2TA 4D4KA 5FOVA 4DC9A 1JR3D 4QC2A 2OE2A 4N0DA 2PH1A 3MLEA 3QXSA 2ECKA 1DAFA 5CDFE 4URWR 4XVUA 3ECCA 2C5LA 2GETA 4IEEA 4RCZA 3UK6A 2QM8A 4TT3A 4B73A 1EFUA 4AKGA 1E98A 1XMJA 2EFDB 1OXVA 1WA5A 4JT4A 4LPSA 2X2EA 1TQDA 3G82C 5FBQB 1AIPA 4QGGA 2YZ2A 2J5XA 4IDNA 4A15A 3U61B 3EZ6A 1DVRA 3JZAA 3VR5A 4Q48A 2Q3FA 3RLFA 3B85A 3B82A 1DARA 3BH6A 1ZINA 2J7PA 1HQYE 5HZHA 5FPTA 1VCMA 1T5IA 5DI9A 1OPXA 4B35A 3HDTA 4G3XA 1S9DA 5BN4A 1EGAA 3OE7D 3AF0A 3E70C 4EUNA 2FFHA 2VP4A 3OFND 3PXGA 2WSMA 2YYZA 4D81A 2ZM5A 1NG1A 2WV9A 4AIIA 3O8BA 1E96A 1K5GA 2FFQA 4BEJA 3EPKA 4AY2A 4JSYA 3LLUA 3W6OA 1U94A 2IX3A 4PSKA 2R2AA 2D2EA 3TH5A 2Q3HA 1W4RA 3K0EA 3QKSB 4TMWA 2AD5A 3NBYC 2F6RA 2OHFA 4JMPA 4YMVA 2IS1A 2IT1A 1NN0A 5DE3A 3RABA 1H8EA 3A4NA 1TQ4A 3H4MA 3LH5A 4DBLC 2B8TA 1FUKA 3LDAA 4OJKA 2GEDA 1CIPA 4GI7A 1Z83A 1XEWY 3NG1A 3EG5A 3N2EA 1XD8A 1G291 4IJMA 4O25A 1G3QA 2JGNA 1JI0A 1U90A 2IUTA 3AF4A 2NTYC 3FMFA 2G6BA 1XDBA 1Z0AA 1E9DA 2A5JA 3I92A 3MMPA 2J0UB 4QGHA 1HTWA 1CEEA 4ZI2A 1CR0A 4WIAA 1KI7A 2ZEJA 3BAFA 4A4DA 4HUTA 2IWHA 3VTKA 3U6KA 3WMGA 4C9BA 3AVQA 2X8AA 3W3AA 2ZVQX 4OQFA 2ODWA 4QM6A 5GVRA 4Q1CA 1KZ7B 4MH0R 2E9SA 4P4SA 2JDIA 2Q9CA 4B3DA 3X1YA 5KSYA 5ELXA 3RRMA 4DEXA 1VCNA 1OKKD 4M9ZA 3IEVA 4PQRA 4DLUA 2HF9A 3NEJA 2JLVA 2JJ1D 4Q1FA 2QI9C 4PZYA 3U4QA 3M0EA 1JJ7A 4KAXA 4B3FX 3V4RA 1QVRA 1UBFA 2NO1A 3ND8A 4M53A 5DYGA 3R8FA 2YJTD 4B48A 2P6RA 1ZUHA 2PZGA 4JLBA 4UNPA 3IEUA 1YRBA 2P6UA 4OQXA 4BFUA 2QTFA 1XTQA 1NKSA 2OZEA 2QAJA 1OH5A 1KAOA 3GFPA 4B33A 4GPTA 1TX4B 1E0SA 1FZQA 3IIJA 3VKWA 4ZIRB 2ZR9A 4FMCF 2IS2A 2IYUA 2REBA 4FMCB 1OB2A 4NTZA 2OFWA 1OFHA 1JR3E 3CRMA 5G3ZA 3X1DA 2IEYA 1MH1A 1T8UA 2PJZA 4F91B 1U8YA 4FXPA 1YZLA 4V0MA 1BOFA 4V0OA 3OAAA 1NKTA 3OIVA 2DCUA 1G16A 3ZGXA 4B3GA 4A8JC 1E9BA 1T3SA 1T5LA 4YQFA 1XCGB 2B7BA 3B60A 5SZKB 1N6LA 2YC2C 3VHXA 1S8FA 1BKDR 4QNMA 3QQ5A 4PC2A 3UG7A 4PAMA 3R7WA 4QOSA 3L43A 4QBFA 1XXHA 5IT5A 1HY3A 5EUQB 1RPZA 4FD2A 2R65A 1G18A 4KFRA 1KNQA 3H84A 3THXA 1DG3A 3ZIAD 1KSGA 1COWA 2ZI7A 4JBWA 4CGZA 3FE2A 4UQOA 2VA8A 4RD4A 5CK4A 3ZDQA 4Q4HA 3ASZA 4CIDA 3JVVA 2N46A 2WOJA 3B78A 4WZBE 2ZSAA 2CBZA 3LQRA 1KI8A 2OV2A 2QMOA 1IN5A 2IYTA 1XD2B 4BZXA 4ZDIA 4G1UC 721PA 3RNLA 3FWYA 3GEEA 2ZYUX 5F98A 3HJNA 4B76A 3IKJA 4FMBB 4HDCA 1CLUA 1AS2A 2GCOA 3IHLA 5JS7A 3WBJA 3FVQA 3A1SA 2GXQA 3PV0A 2CDNA 4MYCA 1UKVY 1W0JD 4XWOA 4CEJA 2JCSA 4LI0A 2LCFA 5KYKA 5G53C 2EU8A 4Q1AA 5FPKA 3ZS8A 1N5KA 1GNQA 1KI1A 2KI5A 2KSQA 3L8YA 4D82A 5FL7A 4LJAA 3KB1A 4OBEA 1PLJA 4M22A 3QY0A 3GLFB 1RC8A 1JB1A 5K8UA 4POAA 2J3EA 5DI3A 1R5NA 2WICA 1U9IC 2B7CA 4LC0A 1E2JA 4B71A 4TYWA 5IK2A 4Z1MD 1QZXA 3LY5A 4ZDJA 2IEZA 5BW8A 1CR1A 2PT7A 4B75A 5TXGA 2BKEA 3RC8A 2IXFA 4MKHA 5KNCA 2IW3A 1E9FA 5JI3E 4G5SA 5KSOA 4XSGA 1P4SA 2ONJA 2ONKA 4C0QC 5EP3A 2IXEA 1JXMA 4TLCA 2QGZA 2YINC 2IYWA 2OILA 1PZNA 3AKCA 3I72A 4PR0A 4L9SA 4WW0A 1CJTC 5HE8A 3LBHA 1F6BA 4OK3A 4M8NE 5IDVA 3GFOA 2NO6A 1F3OA 3IPYA 4UNSA 2J7PD 3P26A 3RSOA 5CLLA 4II7A 4LJ7A 4IXMA 3DZDA 3X1ZA 1WBBA 3EZ9A 1O3YA 3SJBA 5BYJA 2WSSA 5FI1B 5B64A 3HWSA 2O8BA 3W6PA 1QRAA 4URZR 3EA0A 1DAKA 3KQHA 3ADBA 1AGRA 1W1WA 2NPFA 4LYHA 2Q0HA 3MJHA 1OFTA 1RJ9A 4V0NA 3GEIA 5KNBA 2ZTSA 3SHFA 1U0LA 4EQ6A 4B3BA 3PJRA 1MOZA 1XD9A 2HEIA 2O5VA 4AG6A 2B6HA 1J7KA 2ZSBA 3QKRA 2IF2A 3W34A 1IAQA 4DSNA 4LHWA 1AM4D 3CIOA 4DCTA 1DE0A 4EFLA 1GUAA 2ZI5A 3GJ7A 4C0HA 1K6MA 1UBCA 2E87A 2FPMA 3CPEA 2OCYC 2JLSA 3BS4A 1H8ED 4PPFA 4HZUA 3SYNA 3SC3A 1F5NA 2HT1A 4NCNA 3VQTA 3GLHB 2GZAA 3PEYA 2CL7X 3VX4A 1F48A 3ZS9A 1IXSB 3PUWA 2IS6A 4KV9A 1P7CA 4M21A 4IRUB 2REXB 3H2YA 1DELA 4LHXA 4LOAA 4YMSA 3LVQE 1QHGA 2AK3A 2GTPA 1N5LA 1JAHA 1G4AE 3IGFA 4TL6A 1D2EA 1GITA 1RW4A 2XJ9A 5JJLA 1Z6XA 4CYMA 5LB2A 2NQ2C 3U5ZB 2ZS9A 1S1CA 2YVUA 3Q7PA 4NONA 5L3QA 4IOMA 2CJWB 2VPPA 2WWGA 1Z5ZA 2BMFA 4LJ8A 1CP2A 1LF0A 1M34E 3SYKA 1EFRA 1SHZA 2JDID 1IY0A 1U0HC 4LJYA 1DAEA 4MYUA 1J70A 4JLDA 3E2IA 3AKYA 3ADCA 5JRZA 2V6JA 1VCOA 2QG6A 3MJRA 2PZEA 3NHBA 3Q7QA 4YMWA 4P4UA 2REOA 2PLRA 1II0A 3W5IA 2HCBA 2AKYA 1YVDA 2ZRHA 4OL0A 1E99A 1OIXA 4L16A 3WNBA 1AK2A 5GVSA 4PTLA 3PITA 4Q4AA 1EWQA 2EWVA 2ODEA 2GJ9A 1D5CA 1Q3TA 4TL7A 1T91A 1OYWA 2HYIC 3OESA 5CIWA 3GD7A 1XRJA 3I61A 3C15C 1G5TA 4DSUA 2GVZC 5DH9A 2V6IA 2BCJQ 4OI0A 4D25A 5EE0A 4HDQB 4JBXA 2WOOA 3CW2A 3OAAD 2ZSEA 3ZVMA 4DLVA 5KOYA 3B8HA 1KYIA 2GDJA 2BCGY 3SYLA 1NVVQ 1WDTA 2PMDA 2A5FA 1QHHA 1SHKA 2RB4A 4DLSA 1GFIA 1Z29A 5KPDA 1D2MA 4BE7B 5DN6A 4ILEA 4A8JA 1VMAA 4DB2A 1CR4A 4BEBA 2VHJA 3GJ5A 5EXPA 3T1OA 2O0HA 3PUXA 2W58A 1PV4A 3L8ZA 5LD2C 2NMVA 4G5GA 1COWD 2D62A 4TQUS 1ZVQA 4LBZA 5BQ5A 1KI6B 2Q9BA 4LBWA 2QM7A 1D9ZA 1AKEA 3AF1A 4IDHA 1KO7A 3OEEA 2OG2A 1G8GA 2CHVA 2NOAA 2ZRAA 1KK2A 2WPDA 1G3MA 2VL7A 1VYUA 1OFIA 2CVFA 3M6AA 3QVVA 3SNHA 2DPXA 3K0AA 4LJ9A 5KUTA 3WYGA 2ZUCA 5EQTA 1KK0A 5TMPA 1HQCA 3I1FA 4RFSB 1KHTA 1UPTA 4OHZA 1IOZA 2C98A 1N3BA 2R44A 2TMKA 2X1VA 4WZ6A 3VAAA 2V1UA 2J0SA 4C4PA 1OB5A 1KDPA 5B30A 4W5JA 1JQLB 2W6ID 2OSBA 1M6NA 1A5TA 4WAUA 2C99A 1WCV1 4HI0E 1II8A 1Q57A 2MMGA 2W00A 3QEJA 4PAQA 2WVJA 2O8FA 3ZQ6A 4L9WA 2Q9AA 1E1QD 3FDIA 4Q01A 4I99A 3EZ7A 5D3MB 5EJEA 2JLUA 2ZRCA 1FQKA 4Q7JB 3THWB 3B5JA 4C0BA 1E9EA 1JXOA 1N25A 1RZ3A 3ZVRA 3OFNA 2BEJA 1XWIA 2A5YB 1S9HA 2H18A 3AP3A 3DO6A 3GEHA 4BASA 4OQMA 4CEIA 1NLFA 2BJVA 1LV7A 5IK2D 3NC1C 4US1R 2HV8A 3O8DA 4OQLA 5AR1A 5UKDA 3TVTA 4P31A 5SZJA 4RD3A 5KSZA 3ND9A 2J9RA 3EXAA 4MGYR 3CF6R 2WMNB 2WZQA 3CB4A 5JLJA 4DZZA 2AWNA 2HCJB 2PX3A 3VNVA 2ORIA 2XNSA 5JJKA 1YRAA 2V1XA 1DAGA 1E0JA 3BB3A 5AUOB 1QG2A 1G9XA 1R5BA 1ZC3A 5FR1A 3LNCA 3KFVA 3TK1A 3HU1A 1E0AA 2QGNA 1US8B 1OJLA 4JLVA 4WXRA 4ASUD 5DHAA 2G3YA 3EAQA 2CL0X 4AURA 4AYXA 2O8EB 1ZRHA 5DLQC 4RD0A 4Q9JA 2C77A 2WSSD 4BFZA 5E3HA 2ZS7A 2GF9A 1QHSA 1Z0JA 1Q1BA 3TR0A 4HSEA 2D2FA 4X8OA 3PQCA 3KQKA 1XEXA 2ASEA 2IYSA 1N6HA 3LFUA 2ZU6A 4CZ2A 4XJXA 3CNLA 3M4YA 1KJWA 2VTKA 1PLLA 3A6PC 5GJBA 3AVWA 2XB2A 3QXJA 3D7MA 3RAPR 4A6PA 2RMKA 3REGA 4I1VA 2CLDX 3C4JA 3TKLA 1NVXQ 2J87A 1MR3F 2AHOA 3NBZC 5F3WB 1YZTA 4LGMA 5JMTA 1Z0FA 3A1VA 3VR3A 1XXHE 4PC7A 4C30A 1E2HA 4K8OA 4W7SA 1U98A 1TU3A 2MSEB 3P27A 3OHMA 1NVWQ 1Q21A 3QXCA 4GOXA 3TSOA 4NYIQ 1IXRC 1G7SA 2A2ZA 3WRYC 3UKDA 4URXR 1KI3A 3F0TA 3BK7A 3TIFA 1TADA 3P4XA 4C0JA 3BGWA 821PA 2BWJA 1ZMXA 1F60A 3B1WA 1TUIA 1QVAA 2RGGA 4KO8A 4A92A 3GCGA 4TL9A 4EAQA 5LDDC 3A1WA 3LXXA 3EC2A 4L15A 4LUCA 2K5UA 5KHOC 1VHTA 4X8MA 2LKDA 2WKRA 3IIMA 4B2PA 3OF5A 2BOVA 1S0UA 1X8LA 1Q1EA 2HXSA 3LAWA 2QU8A 1ZCBA 3QEOA 3MUFA 4A2QA 4EIWA 2BEKA 1ZM2A 1EFHA 1N6OA 1XF9A 1G1MA 3U3KA 2ZRPA 1E4YA 4UXIA 3T5GA 4RKFA 3U4QB 4MYTA 3ZIAA 2P2LA 3RDPA 1A2BA 2OAQ1 3FKSD 1HT1E 1X3SA 4XIGS 1OH8A 2FWRA 3CZPA 4LSGA 1W4AA 4UNNA 3AKDA 1A2KC 2ERYA 3OIYA 3SJZA 4FMDB 4TYYA 4P3YA 2VEDA 1XZPA 5L8VA 2ATVA 1GAJA 3DM9B 1OE0A 2QBYA 1Z28A 4ABYA 4V0KA 2KBFA 1M8PA 2BBOA 5FOUA 2PCJA 3BB1A 1S1MA 2ZJ5A 3FHOA 1JALA 1J99A 4EJSA 1LNZA 4NCKA 4U5XA 4JLNA 1XTKA 5JRJA 4TQAA 2OBLA 4K81B 2Q21A 3EA5A 4O2LA 3QF7A 4V03A 3IQXA 4TL8A 1E69A 2WTUA 1CJMA 2GXAA 1OXSC 2KWIA 4ESHA 4LPKA 5CIQA 1C9KA 2DR3A 2HF8A 4YDSA 1P61B 1ZM9A 3GP8A 1XJQA 1W48A 4Q4JA 2AWOA 4FN5A 3SE0A 2GF0A 5FPHA 1W0JA 1Z6GA 1R0XA 1ZM4A 2WM9B 3T1QA 4IVQA 5C4GB 4U00A 4C7OB 2VHCA 1NIPA 1NY6A 4NCHA 4QHYA 2WHXA 4QJ4A 4M1YA 3THXB 3T12A 2DFLA 1R8SA 5ANRB 2NO7A 1CBUA 4URVR 1G17A 2ZAMA 4I4LA 5FR2A 2N42A 2JASA 4EPVA 1S2MA 2BIFA 3AP2A 3KFXA 1R2QA 4BRUA 8OHMA 4Z1MA 2VF8A 4DLTA 3SN6A 5K8IA 3I62A 3OEED 3WMEA 1OHHA 1KOFA 4PFSA 2WPDD 4F4IA 2IHBA 1FP6A 1ONBA 4LBYA 1UDWA 4DDWA 3VR1A 4H9GA 5G41A 5HCIA 1U0JA 3EX7C 1T0HB 3CH5A 1G4UR 3ZD6A 1RRFA 2BM1A 1R8QA 2BMDA 3NBXX 4TN1A 2J41A 1KO1A 2RHDA 3TE6A 4LHVA 4UXHA 3EPJA 2WJJA 2GWHA 1NIJA 2GJ8A 1YR9A 3A1TA 4BZQA 3KJEA 2FNAA 4E09A 4CEJB 3GLIA 2FZLA 1UAAA 2IK8A 3SOPA 1OIVA 2G0TA 5E7MA 3QJYA 3MRSA 3QG5A 2HLDA 5EUMA 4Q1EA 1RIFA 5E95A 3THOA 2ZRMA 1E2DA 3TVDA 3L2OB 4IXNA 4GOJA 2FEOA 4Z8YA 2FOLA 1QHIA 4QGFA 3CX6A 4MRNA 4G5RA 2QTHA 1GZSA 3EASA 3K0CA 4I1SA 4DUGA 221PA 4ZDWA 5FUXA 1OW3B 3R9IA 4AI6A 1WXQA 2W83A 2YWHA 3A58B 1D8TA 2ZVPX 3VX3A 1QF9A 3F8TA 4TTQA 5GJWC 3QPWA 1E79D 5M04A 2G9NA 4OYHA 4E07A 1XMVA 3CX7A 2R6GA 1JPJA 1W49A 2A7QA 5EE1A 3WHKA 4KODA 4IEIA 4P0TA 4Q00A 1KJYA 3TMKA 3AKEA 3QKTA 1A1VA 5FOTA 2GK7A 4G5OA 3N70A 4DLZA 1SVSA 3B2EA 2RCNA 2C96A 5TDHA 2XXAB 2XJ4A 4ERNA 1XMSA 2CHQA 1GL7A 3ZZ0A 4KXFB 1LW7A 4DKXA 1HT2E 2FV8A 1XEWX 3TAHA 1H8HA 4ZO4A 5JEDA 3BERA 3TNFA 4NCIA 5K8LA 4GP7A 3LW8A 5TVKA 1BS1A 3KZ1E 5EP2A 1ZCAA 4B32A 4OI2A 2CE2X 2P0EA 2QP4A 4NKRA 4TLEA 1N6PA 2FSHA 3WMFA 3FHTA 1IN8A 1MKYA 3R20A 2ANBA 1FX0A 5TARA 4P4TA 4Q47A 4EQ6B 3EC1A 4JZKA 1Z63A 1FOEB 2GILA 3BC1A 5CYOA 2DWQA 1YE8A 1BMFA 2P5SA 4CT5A 1VPLA 5CYPA 1S3GA 1KK1A 1MRSA 4W5HA 4NH0A 3EPLA 3LRPA 3A8TA 3HR7A 2VSXA 2PLFA 2GJAA 3W3ZB 3KQLA 1ZNZA 1DPFA 2Z5FA 3QE0A 2PBRA 4KCGA 3VMFA 2EWWA 3LVRE 3H86A 4NYJR 2VYFA 5BYKA 3CWQA 3RS3A 1GSIA 2RGNA 4IOLA 3DL0A 1E2LA 2RGEA 2WWWA 3C8UA 3QNUA 4TYQA 1Z2CA 4X8LA 3GFTA 3T34A 1E0KA 1ZUIA 2BKUA 2WWIA 2GAAA 1TPZA 3MCAA 2AXNA 4B2LA 5L3QB 1FQJA 4IOJA 2ZR7A 2HDNB 2RGXA 4LZZA 4M0LA 5KDOA 1IQPA 2GBLA 4UJ3A 2DWPA 4JL8A 3AH8A 2XITA 4YDHB 1RKBA 2PL3A 2W6JA 3CO5A 4BPBA 1LB1B 4GMXA 4LCBA 2D7CA 2OEPA 2FG5A 3J81k 3S1AA 1MABA 4KLNA 1Q12A 2CNWA 4IFEA 1NVVR 1L8QA 5CB6A 1NNEA 1ZD8A 4H1VA 1Q1QA 2H16A 5B2ZA 3SU8A 4OI4A 4Q5IA 5AJYA 2QY9A 5FBRB 1SXJA 4MUAA 2GA8A 1SULA 5FUVA 1C4OA 1MO5A 5KSPA 3P1JA 3K53A 1FNNA 1Z0DA 4ACAA 1U8AA 2QNRA 1GTVA 3EIQA 2ZJ8A 4WXPA 4YONB 3RWMB 1XBTA 3MAAC 1S96A 1MO6A 5TV2A 2W6IA 1TL7C 3JZMA 1L4UA 3ZLJA 1JEEA 1P62B 3DOEA 4V0LA 2JLYA 3QXHA 3R9XA 3GJ4A 3ZVLA 4ESVA 3T06B 4ZKDA 3MWKA 4RSGA 4UNRA 2ZJBA 2IL1A 3R9WA 4UXJA 1QHHB 1ZNYA 4NPHA 4KVGA 3DDCA 5FTLA 1E1QA 1RFLA 3NH9A 4A8JB 1J2JA 1IY1A 1CR2A 2CLSA 3L0SA 2PT5A 2ZE6A 3W8RA 2ZIAA 4DCUA 4QRHA 1RVDA 4X8HA 1Q3HA 4PO1A 1W44A 4DSOA 4DDTA 3I3SR 5JCPA 1FL9A 521PA 4B3CA 2AFHE 2GK6A 1NMYA 3NIBA 3PEVA 4Q19A 2XTMA 3AVOA 1NL3A 4OI1A 4C2UA 2A9KA 2UVQA 4TMZA 1OHHD 2HUPA 4ZCLA 2F9MA 3O8CA 4DT1A 2A3RA 1HE8B 5CM9C 1DG1G 3VR6A 4AKHA 1GNPA 1T4GA 3IUYA 3KX2A 2ERXA 2FPKA 4QM7A 5AJWA 1Z07A 2RHMA 5AUPB 1LTQA 4M9SA 1BO6A 1N6KA 2IF0A 1YQTA 1UKEA 3G5UA 1TEXA 3THYA 1I4LD 3T15A 4YLGA 1KMQA 1NN3A 3I4LA 4LJ4A 3FYHA 3IBGA 1IM2A 2BBSA 1II8B 3P4YA 4L8GA 2IYYA 4HLDA 4ASUA 1N6NA 3GJ8A 4AG5A 4WZAE 2GESA 1XTIA 2FU5C 3F3YA 5JWHA 2ZJZA 4JLJA 4D26A 1GNRA 1GIAA 1SVIA 2ZPTX 3K09C 2HLDD 3T1VA 3BORA 1Z0KA 2FFAA 1K8RA 2ZYTX 1Z6TA 2GRJA 1Y3AA 2V55B 4CEIB 2XNDD 421PA 1ANKA 2ZROA 4A0FA 4DUGD 3I73A 2D7DA 4D4MA 2FH5B 2I1QA 121PA 1UJ2A 2ZE8A 3KL4A 4MA4A 3X2SA 5C2JB 2F55A 1P6XA 2WJHA 5AWFC 4B43A 4G5QA 3LBNA 3PUZA 4PPQA 1CRPA 3D3QA 3DMDA 3NXSA 1OXUA 4TZ6A 4Q7MB 4LJ6A 1LFDB 3UWKA 2ZAOA 4RKEA 1M2OB 4U7DA 5CB8A 2MSCB 2GEVA 4FINA 4L5BA 4KSCA 5EZ5A 1R5OA 2NG1A 2QTVB 5BN5A 4RD1A 4ARZA 2H92A 5AUQA 3X1WA 1R6BX 2GJSA 4A0GA 3KUCA 1UADA 2FMXA 3AP1A 3GJXC 2FDCA 3PUYA 4BFWA 3VHLB 1U99A 2W2XA 4HUQA 2ZI4A 4W5WA 3KJIA 1H8HD 1X1SA 3BJIC 1G6OA 1KO5A 5FTMA 1YZKA 2IC5A 4RY2A 5EXTA 2XTZA 2F7SA 3OIWA 3TUZC 1NVUQ 2QAGC 1MT0A 4DIDA 1XEXB 1G7TA 4TLBA 3QOFA 2G1JA 4BZPA 2C9YA 1OYYA 4UKDA 5JSZA 3CUEF 4KU4A 3WBKA 3CRW1 2IBMA 1VG1A 2BMJA 4KYIB 4LK2A 4JKIA 4MRSA 2WWXA 4TMTA 3U3JA 3K70D 2XB4A 1P2TA 1VTKA 4JYBA 1WBDA 1EK0A 1KY2A 1ZP6A 2F43A 2OLKA 2RKOA 1N5IA 1BMFD 4TQ9A 4NMMA 3ZQJA 3FKSA 4Q4LA 3IQWA 4IHQA 1HUQA 4LX0A 4NZYA 3BH0A 4PC1A 2IWRA 4EJSC 1L4YA 1NJGA 4QJ5A 4QKQA 4Q9IA 2YNMA 4Y0VA 3UWOA 3UMFA 1TMKA 1IJEA 3UMRA 4BLSA 2ZRLA 4TMKA 2O0KA 5KNDA 1J90A 2J46A 2PCLA 5HZKA 3KJHA 3U7HB 1AN0A 1DAMA 2I4IA 3CX8A 3GLGA 2YKGA 3AVUA 4HYYA 4OKSA 1FPMA 4OJQA 3R8CA 1UBEA 4F93B 1ETUA 1XPUA 2G83A 1UKYA 4XOIA 2WWFA 5DSZA 3LX5A 3C41J 1P5ZB 3CNNA 2QMHA 5JHGB 4RVCA 1EFTA 3WP1B 3FFBA 3KKQA 1FFHA 1G8PA 5GJCA 5LPNA 3NHAA 2VP5A 5H70A 2ZREA 2OO7A 3GJ0A 2R9VA 1UFQA 1Z0IA 5FTNA 4ZCIA 3U3MA 4GZLA 1OH7A 1GG2A 4B34A 2W6JD 1NN1A 1P72A 2W0MA 3BFXA 3CWZA 1MO3A 2G77B 1GM5A 1BH2A 4Z8XA 2VIIA 1DEKA 4UJ5A 4V02A 2ZYWX 5CITA 2CNWD 2WIAA 2ZJOA 3IILA 4Q9KA 3AF2A 5L3SA 3GLIE 1KTVA 1YZUA 2GNOA 3RS2A 2QBYB 4GDFA 2JATA 4FWTA 4YXWA 4RZ2A 4NCJA 1M7GA 1HH4A 2J7KA 1I2DA 1QG4A 3W6NA 2C9OA 3I8SA 2OUKA 1SXJD 4EJSB 3VKHA 2RGCA 3SQWA 4MRRA 3ZH9B 4IDPA 1HA3A 4RJLA 4HLCA 3B7GA 2NZJA 4CEHA 2I1VB 1Q1ZA 1TAGA 1CF4A 1OXTA 3AVPA 1L2TA 3SQXA 1X86B 2VHTA 3FHCB 3UMSA 1WB9A 2ORVA 3GLFA 4OK5A 3K9NA 2FFBA 4Q4JB 3UG6A 1SVWA 1TEVA 5P21A 3KQNA 2JLQA 1FW6A 1MO4A 1W4CA 2BHRA 4GFDA 3P32A 4QBGB 5H68A 2QQEA 3H1TA 3KJGA 1RYHA 1OV4A 2BVNA 4HAVA 1DO0A 3B9QA 3IHWA 3TW4A 4BUJA 1CTQA 2BC9A 4R2IA 3K0CC 4LY6A 4CRWB 2ANCA 1Z6YA 1R0YA 1ZNWA 4PC3A 3PEUA 1G20E 1TQ2A 1TF7A 4Q7KA 2RAPA 4G01B 2AN9A 3MGCA 2FGJA 3K0FA 2R8RA 3ONWA 3H0KA 3SEAA 2VP6A 2P67A 2FSIA 1ZYUA 2FA9A 1Z47A 2C04A 3RYTC 3BFKA 3T35A 1FTSA 4RD2A 2JLXA 4GRAA 3TRFA 4DLWA 5LD2B 3O8RA 1E79A 3UIEA 4EPXA 3CF2A 4AD8A 4HAZA 4CVNA 4QBIA 3L82B 4D0LB 2FJUA 3TBKA 1GKYA 4R98A 2FGKA 2AFIE 2BJWA 3QXXA 3EWSA 1Q44A 2OXCA 1CS4C 1E9SA 3RS4A 2FE4A 2CHGA 2QEQA 4E03A 1KY3A 4MGKR 1KMHA 2RGDA 1AQYA 5H1YA 3ICEA 4M9XA 1A4RA 2WJGA 4MYHA 3I32A 1ZW6A 1SKYE 4PZLA 2PEZA 4TLAA 1R10A 1IJFA 3SDZA 3TSWA 1KNXA 2IHYA 3W90A 3FFAA 2HJGA 2P65A 2NO9A 4PC6A 3I5XA 5KO2A 3WYFA 2QUZA 4R9UC 4A1FA 2QPAA 1HV8A 4PSVA 4N0EA 3SZRA 3K70C 1T6NA 4R2HA 1NY5A 5SZIA 3QSYA 3DHWC 1JR6A 2CK3A 4BFSA 3HU3A 3DEFA 4CW7A 3UPUA 1KIMA 2PEYA 4DIEA 4MUBA 3K09A 5CM8B 1B23P 1H65A 4LV6A 1FMJA 3GQBA 5JEEA 2IUUA 2QROA 1OF1A 3K1JA 1G19A 3CZQA 2H1LA 1N2CE 3QKUA 3LWNA 4JLOA 5BXQC 1LY1A 1JBKA 4KFUA 1R4AA 1E2MA 5J4KA 4CT4B 2P5TB 2GEUA 4AKEA 1TF5A 1X1RA 4HLUA 2D06A 2GJKA 2H17A 1E2IA 2YWFA 5KTYA 3PEWA 2DFTA 1W36D 1SVMA 4YMTA 2F1JA 2RGNC 1ZM7A 4ZV4A 1M74A 2ODBA 3D6TB 1T3LA 4JKYA 3K0SA 1N6RA 2DBYA 1S4QA 4QHSA 1WP9A 4DEYA 4OK6A 1P9WA 4PX9A 2XOKA 1VG9B 4PZZA 1IN6A 1E2PA 1F2UA 4XVQA 5C18A 1XTJA 2ZE7A 3U7FB 4O2RA 4FCWA 4QNRA 1GILA 3VR4A 1YJ5A 4D6PA 2GBLC 2JEOA 1BIFA 3C16C 2G0NA 4HAXA 2O8CA 3ZD7A 1SXJE 2WKQA 2EW1A 3N5CA 1KI9A 2VSFA 3I8XA 3QBTA 4JSTA 3RS5A 3WYAA 1AA9A 1IN4A 1Z22A 2R62A 1AKYA 1DADA 3NVAA 1FX0B 4GP6A 3EW9A 2A30A 4P4SB 3K70B 5J47A 1XCPA 1GWNA 1JQJC 2VRWA 1KKMA 1UKZA 3Q8XB 1VCIA 5D3QA 5EXXA 3SI7A 2QAGA 2VHQA 2ZE5A 1GRNA 3FB4A 2ZI3A 4Z54A 3GJ6A 3E5HA 3A4LA 5K8TA 2ZETA 1QDEA 4CDGA 5JJIA 1SXJC 2A5GA 2OFOA 3KUDA 2AD1A 4FMDF 1AGPA 5E7IA 3AVYA 3NWJA 4Q03A 1M7BA 2B8WA 1KJZA 3N2IA 1W0KD 2H5EA 2QPOA 3HPRA 4JS0A 3C7KA 2ZITA 4B74A 3TUIC 2PJRA 1G7CA 4DLXA 5JHHB 4AKIA 1E2FA 4FWIB 1NBMA 4DCSA 3B9PA 5JZVA 1KKLA 3CM0A 4I81A 3UATA 2ZRBA 4DCNA 1ZC4A 1E6CA 1ZIOA 2OCPA 2KJQA 4FIDA 4F92B 4GBMA 2QENA 3KTAA 1OLOA 3DZ8A 1ZU4A 4DB4A 2PMKA 2H57A 4PXAA 3R7WB 4D0NA 2O8DA 3WY9A 1GVNB 1XXHB 4M1SA 4IW3B 4DWJA 4QL3A 1CJKC 1SKQA 2CCKA 2YOHA 5J4HA 1XB2A 2AR7A 2O52A 2OLJA 2XSZD 1MABB 2QRZA 3S1AB 2CE7A 4NYMQ 4C0LA 2OCAA 2ZU0C 2B21A 3U7GA 4Q4HB 1A82A 4LYAA 3TQFA 1VECA 5EZ6B 1KDOA 5A4JA 2OT3B 4BLTA 3KB2A 4YXWD 2YWGA 4GZMA 1JJVA 1SXJB 4Q66C 3DKPA 4BLPA 2ZRFA 2V7QA 1WE2A 4KHZA 4DSTA 3WRXC 3WXMA 1Z06A 3LO5A 3MD0A 1KZGB 3V4FA 1JAIA 1E32A 4JJKA 1HYQA 1XJCA 2GCPA 5D3MA 2HT6A 4NU0A 1XZQA 1VG8A 2FEMA 2D74A 3DOFA 2OM2A 5DO9A 4TLDA 4ZCMA 1F2TA 1XPRA 3MWJA 1DBSA 1EWRA 3WNCA 1VIYA 3QF4A 2GCOB 2CXXA 4HB2A 5FI0B 1NG9A 2JIZA 2ZR0A 1XU4A 4JBYA 5DGXA 1IBRA 1JECA 1K5DA 1TU4A 1U2RA 4M1TA 3W5JA 4JVSB 2QZ4A 3CH4B 1NI3A 3CF0A 1V5WA 1VDZA 4NDZA 3QPUA 4BLRA 4BFYA 3LW7A 2JLZA 4BLOA 3IDQA 4XD7D 4HLQB 2R6CA 1UF9A 1W2GA 2XNDA 1Z08A 5DI3B 3W8NA 2WJYA 1LS1A 3KXKA 5FBLB 1OT3A 2FPLA 2QRNA 1W4BA 1G41A 5HR5A 1D6JA 2QA5A 5TB5A 1YHNA 1XNJA 3GJ3A 1W36C 1E2QA 4DT1B 1US8A 4MDEA 3Q72A 2O8EA 1E94E 4QFMA 2DB3A 2OFXA 4GMDA 1ZNXA 4MGZR 3P20A 5BWMA 3OEHA 3FTQA 4LDJA 1Q22A 3TR5A 3K8YA 3THYB 3PR1A 3L0IB 2ZRKA 1KSFX 1KI2A 3KQUA 1OH6A 3U2QA 1VYTA 4JIMA 2HYDA 4IVPA 1PUJA 3TAUA 2GZHA 1C1YA 2H7VA 4KSBA 1FP7A 4P32A 3LX8A 3CR7A 3G0HA 4A2PA 4DRZA 4R7ZA 4C3ZA 5HPYB 2E1RA 3U44A 4PAOA 3Q3JB 1MRNA 4AYTA 3IBYA 1NP6A 1WMSA 3NC0C 1AQUA 2O8BB 3LLMA 1KSHA 4BRWA 2YWEA 3IO3A 3L0OA 3KXIA 1EG7A 4OHVA 4RZUA 5FPSA 3HYTA 5KPJA 3GLGE 5JS8A 1RRCA 1RJ9B 2CK3D 5CJ2A 3PENA 2EFCB 2ZYVX 3BOSA 4XSHA 3VNUA 4PHGA 2NZ8A 4S35A 2Z43A 5LBIA 4QJ3A 1G5PA 4WVFA 4ZDKA 4LHYA 1YR7A 2KBEA 3QKRB 3MWYW 4PQFA 3RSLA 1HE1C 2GVDC 3RHFA 1G3UA 2FSGA 2LKCA 5C46F 5G3YA 1I4DD 1W36B 1PLKA 2XAUA 1CU1A 4HAYA 4M1KA 4US0R 2WJVA 4HAUA 3D31A 4HZUB 4ARZB 1KK3A 1ZM3A 4QHTA 2DYKA 3CLVA 1GP2A 2ZI9A 2BM0A 4M1MA 1WQ1R 2EVWX 3EIEA 4M1OA 4Q1BA 2OAP1 2JJ2A 3TJZA 4KJZA 2XOKD 4PHTA 2NGRA 3U3OA 4HUQB 4B44A 1GKUB 4WBSA 4ACBA 1KO4A 1VHLA 4DCVA 1W7AA 1G21E 5E7JA 1RRPA 3EARA 4BGDA 1CXZA 1Z3IX 3T5DA 1EFCA 3A4MA 1D9XA 2AXPA 5DYIA 1I2MA 2J0QA 4MRVA 2VQSA 2CLCX 3VU9A 5JSZB
chains in the Genus database with same CATH superfamily
3NJ8A 2I9PA 2IDJA 3A6KA 3PDJA 4M9QA 4O1MA 4RSHA 4CU5A 2GD2A 4U2KA 3LL4A 1OXXK 4H0FA 2NUTB 3G9QA 4JL5A 3RAGA 1NR7A 2R6DA 4XWWA 5B7QA 1XZKA 1BXRB 1PSWA 1JHPA 1F8XA 4LE1A 4NL4H 5FL3A 1ZSVA 3HA7A 4CL3A 4US2R 4H4CA 2PUCA 4QEKA 2CD9A 2RHGB 2VYCA 4KAJA 4UPEA 1I1OA 3K8QA 3HB1A 3HM9A 2A0KA 3A0UA 4Q1DA 1I7DA 2IS4A 5JSKA 3SZUA 4O6VA 5ER9A 4J90A 1QYWA 1ZIPA 2AB0A 5J5CA 1PT9A 1OC4A 2VK4A 1A7AA 1AB5A 3BD7A 3O9ZA 4G97A 3HO6A 3I3OA 3LY9A 4GQIA 1JEDA 1EPUA 4BV8A 1B6SA 2IZ7A 1VYVA 1KORA 1A7JA 2EJCA 1OXBB 1X9IA 5KKAA 2VZEA 4HQNA 4TYNA 3U9TA 3TLMA 1RQNA 2FF5A 1XMIA 2R97A 3OUTA 4Q37A 4P33A 4Y9RA 4L5AA 3EG9A 5IW8A 4R1QA 5WRFA 1NYLA 1AH2A 1AZWA 3UH0A 4DANA 5A4KA 1YZHA 4RGQA 3KZVA 2VRCA 4KTTE 5CEFA 1O6FA 1NXPA 3PBKA 2G1KA 1EDZA 4IIBA 5E7QA 4NRDA 4ZWNA 1W8DA 1P9NA 2C1ZA 1E1KA 3KOUA 3ZW9A 3V1LA 2WAYA 5FI5A 3SX0A 5EHQA 3DVLA 1SBCA 3UAVA 4CF4A 3TLXA 3NEYA 5AVSA 2WYIA 4GWGA 5FPYA 1EM6A 2BDUA 2X77A 4JOQA 3EGCA 3HM2A 1QFZA 5E0KB 1TM4E 2OKGA 4M1WA 1M6VB 5A05A 1XA3A 3SS8A 1XZNA 4K46A 1W5BA 2C5GA 4H7KA 4NAUA 3KYCB 1H4VB 2B61A 2NSYA 2VK1A 3IDAA 2XTJA 5DNAA 1OLSB 1XMPA 2MMCA 2V54A 4C5CA 4CFSA 5ISMA 1YRQA 5KQSA 3RUDA 4MVJD 4X94A 1B8UA 3TIXB 2I9KA 5C5EA 3KWLA 1DKUA 4LYYA 1DO2A 4Y0NA 1QP7A 4LV5B 3CURA 3K9GA 5HDQA 4JQYA 4MIYA 3UMCA 1K4YA 2X2OA 2HWXA 3CEAA 3M3HA 4IICA 4TSFD 4ALIA 3TGPA 4G0QA 2V7QD 4GI3A 4YAIA 1VG0B 3DMNA 2VBCA 1Z39A 4F97A 5EJGA 3LE8A 4JC8A 2HJSA 4MGIR 3KELA 1PU2A 2ZRIA 3ZLTA 1Y4UA 5JC1A 1G5RA 1NGSA 2QSZA 5AK0A 5D7BA 1UMKA 1ULTA 5BW4A 1M2FA 3GLHE 2IITA 4PPGA 5JFTA 3L77A 3RS0A 4GW3A 3HYLA 2X0EA 3A1DA 1I2CA 3G2PA 3IUJA 3LDHA 5AHRA 4NBNA 1E62A 4B6SA 1P60A 1U8UA 1Z4NA 2PKYX 4B82A 1M1YA 3B8EA 3HP1A 3W9SA 3C5HA 4MEAA 3RRNA 2P3SA 5EESA 1EJ6A 3BDAA 5JARA 3L84A 4JLSA 4LXTA 5D7NA 1RBYA 4J7AA 3NHYA 3NTVA 1ZBDA 3FPFA 3R0JA 1BN6A 4BJ6A 3T3DA 3EZFA 1QYIA 5C35A 4EY6A 4KMSA 4YREA 3K0FB 3NONA 2F3QA 1PDWA 1JLHA 4TXMA 3IA2A 2VF5X 4JLMA 1IEVA 4UQPA 5ARBA 3SBEA 1B8PA 2AE1A 5ALXA 1J8DA 4OHPA 4L8LA 3LOPA 2Y1FA 4WCFC 3VR5D 4W9MC 4LVOA 5BT8A 2Q49A 1TJYA 1TYCA 3K0BA 1IZYA 4AW9A 2VHYA 5ERXA 5ALGA 3CU5A 3ABQB 1A8PA 2VVTA 4FSDA 2G1UA 4C05A 2J0UA 3FTEA 3F9IA 2ODQA 5CTAA 3W3AH 1M76A 4UBNA 5GTDA 1VHQA 3OX3A 2LNDA 3GX1A 3F78A 1Q1AA 1QAMA 2A7XA 3D4BA 5IJAA 1JQAA 2X7XA 4R3WA 3DMYA 3TMAA 4H0CA 1QJ4A 2IV2X 1YA8A 1U81A 2X86A 5A04A 4OHUA 2X76A 3Q15C 1E2EA 5JAOA 1T5BA 5HMMA 6REQA 1P6QA 1DQRA 2OESA 2PMFA 3OP4A 4MRMB 4UMFA 4HZIA 2QY6A 2ZSIA 2C2KA 2QTCA 3PHIA 4XGIA 1XQXA 3UUGA 4HKTA 2HK9A 1O95A 4PHFA 2X0FA 4E5NA 1J8FA 1M6EX 4BOYA 4KX5A 2WWYA 4QQ8A 1DXOA 3FCUB 3AM1A 1E4OA 2DY1A 1K89A 3ETGA 4JJFA 1E5VA 4ZJUA 2BBWA 3O94A 1YTUA 4COKA 4EDHA 1Y4SA 3O91A 1ZVKA 4YJ3A 1BS9A 2QPTA 4AX4A 4QWWA 4CETA 2LXNA 4WECA 3COYA 3MUOA 3RVSA 3TFWA 2Y67A 1BWSA 4L5JA 1N7IA 3EEIA 4IIEA 2IYZA 2PSEA 2Z8YM 3BCRA 3M81A 3N2KB 4NYIR 2PIAA 1KTIA 1JBEA 2H31A 2ZVJA 3W7VA 3P2OA 1KPHA 3EFOB 3EPRA 4HHEA 2FUCA 1XK7A 4NJOA 5C5DA 3BRWA 3CC8A 3AGPA 5EJMA 6Q21A 1OWOA 3LHKA 1BMTA 1SUSA 3LBYA 4KLRA 3M3DA 1UBSB 2ZYAA 2XYRA 5IVHA 1L7VC 3CQ9A 3EDQA 3GJZA 3ILXA 4M36A 1KP9A 3BIXA 2C2HA 1UMDB 4LF6B 3R5XA 1J20A 1YK1A 2OP1A 4ND4A 1SIOA 4Z7NB 3CR3C 3NTUA 1T5TA 4HGOA 1YZGA 4CM6A 4B09A 4A9AA 2R7KA 1T1IA 1ZD1A 2TECE 2VTBB 2ZIFA 4B8WA 1P3DA 1KAGA 1LX7A 4ISCA 2W98A 5JVDF 2IZ5A 4Y1RA 2ILTA 1Z17A 1E9AA 1F1JA 5K9ZA 4CCSA 5HSGA 4QVIA 4NMLA 4R7TA 3IP3A 3U31A 2SHKA 1YZNA 3VNSA 1KSJA 3CZRA 4BFTA 4HQOA 4CCYA 5JWRA 4O1HA 1WKVA 4DMMA 4EFNA 2MYTA 3BIFA 2BFWA 4TMVA 4D80A 3QLUC 5EIAA 3R09A 5FHRA 7REQB 3VUEA 1I1QB 3TCNA 1HL3A 1NQXA 4LW8A 4XM2A 5AKYA 1SQSA 4RF2A 3AUUA 3IH5A 3T9EA 2BBTA 1JUDA 2HA4A 2WP0A 4WFJA 3SKYA 3TL6A 5A5GA 3NM6B 4AK9A 5E1OA 5J4LA 2YYAA 2ZS8A 1WDWB 3HDQA 4EPYA 4OA5A 2GSDA 2XUPA 1XKLA 3IBSA 4LBVA 4QREA 3QPAA 3RTAA 4F2HA 2Z5GA 4LRWA 2IZOA 1DS6A 2D5LA 3E7XA 3QX9A 3SC4A 3U4HA 3OQIB 1TECE 1PV2A 2HO5A 5E4TA 4DQDA 7ABPA 3ZJVA 1LC3A 2H1WA 3CPHA 4PWZA 8ABPA 1CUIA 3FROA 1IUOA 1ZO8A 1SUAA 2WSYB 2RK4A 3NBKA 3B20A 1WZEA 2P40A 4RF5A 1USIA 5GQSA 4LV8B 1X7DA 4KWHA 1JFTA 4GLJA 4U9HS 2WFZA 2J1LA 3RK1A 1FP4A 4F86A 4PO9A 5E2BA 3GT7A 4BN4A 2ZRNA 2NXNA 2WAXA 5DK6A 5HF6A 2JAUA 3VTFA 3KCQA 3EVNA 3PJGA 4H1TA 4XIYA 4YWHA 4D4HA 1RQ7A 4DXAA 3LXRA 4IIGA 5IEBA 3PGMA 4MKGA 1QHYA 3QVMA 4MUKA 1AS3A 3QIVA 1W5EA 1XN1A 1XFAA 4GPEA 1I36A 1R3UA 1RLIA 3DKKA 2ZSKA 3KAKA 3KK0A 3KXLA 5LKRA 1EFPB 2VRCD 4YR7A 1JR3A 4KVAA 1L5HA 3GPLA 2FZWA 2PGJA 3D1JA 2HRQA 1UEXC 2IEDA 2R1ZA 1V2HE 4JVNA 4A03A 5IRCD 1J56A 2IHZA 4WCDA 1ZGBA 3CHYA 1KJJA 2ET6A 5JFOA 1PVOA 2Z30A 1SG9A 2SCUA 1J06A 2Z4SA 3NOXA 1Z13A 3Q3HA 1GL3A 2CL6X 3HBJA 3VFDA 1BSVA 1DGQA 1NHWA 4V0SA 4M9UA 3K5WA 2O19A 1AZTA 3HDYA 3MD9A 4I1UA 2NZWA 4DV6B 1R15A 3M33A 4B4UA 2RBGA 1S01A 2G07A 4PCUA 2HBRA 4XDZA 3WKAA 1HXHA 5DM0A 1DX9A 1UT6A 1VL1A 3B1ZA 3FETA 2XUJA 1CUUA 1S7GA 4MLCA 3M6MD 1P0IA 1U8ZA 2YHSA 1GEEA 3NCHA 4IWNA 4TXLA 4UBKA 3IQHX 1EE1A 1HYEA 3RIYA 1TUBA 4E5SA 5JQGB 2CLKB 1BYIA 3OJLA 1P91A 2C59A 2XDYA 3MYRA 4BV9A 3LQKA 4F4UA 1SCNE 4TV8B 5JCZA 2ZJ6A 1E0DA 4NP6A 5FP0A 2EQ5A 1FUUA 4EHDA 4RW0A 4FDTA 5CFLA 3EXHC 1BAPA 2Q99A 2D1YA 4UZSA 2R8XA 3L6UA 4FK8A 3UUFA 2P4HX 3E4CA 3RR2A 4D4LA 1NLZA 4ALNA 2FSFA 4C2BA 2ZXFA 1P81A 4H17A 5CTJA 4CM7A 3H2IA 2M1ZA 4FEYA 5K1ZA 4XQCA 4WK0B 1SXHA 2K4MA 5KDLA 1K92A 3QF4B 3MTQA 1CJUC 1FS6A 4K2HA 1NUUA 1PQUA 3G2IA 4JVLA 1SZDA 4PYJA 1PT7A 2BGIA 3UJBA 2XUKA 1JN0A 3ZYCA 1JLSA 4GM1A 1TM1E 1SUBA 1X2EA 1JQBA 4KXXA 2J32A 1H9CA 3B13B 3W5BA 3NAMA 2IEGA 3P2KA 4RNDB 1FJXA 3KKPA 4J29A 4KFSA 2WHEA 3HEBA 4OB6A 2JI9A 4EGJA 1G8HA 4A10A 1OSNA 1BD4A 3NPMA 5CXUA 4QEZA 4LYEA 3NT2A 3ND7A 3Q2OA 2R5NA 2O50A 3VVMA 2X8JA 2WC1A 3F49S 3OZXA 3I09A 1CY8A 2DFKB 3NH6A 4H27A 5C31A 1BEUB 5FLEX 1RQGA 2ISQA 2CLMB 4XFJA 4YALA 5A06A 3LSYA 3BWDD 3HBMA 1QRUA 4G25A 3NHLA 4REOA 1A4UA 3AEZA 1J5PA 2HC9A 2I2CA 3H11A 3RFXA 4A5OA 2FWAA 2DHQA 1E9RA 4MQBA 1IY2A 2GSWA 16PKA 4N3BA 2G04A 5J9FA 5LKAA 2CLLB 2A84A 2F1OA 3LY8A 4TLMB 1MGOA 3DF7A 5BMVA 3T3PB 1YKSA 3IJPA 3D6VA 4K6FA 1N1EA 3VBEA 3FHJA 3O7WA 1M8JA 4IXDA 5HBRA 4QTUB 1MIOB 5ALIA 3WHLA 2OXRA 1QX3A 1J07A 2XMZA 4KDCA 3EVZA 4IS2A 3WNDA 3OU2A 1X7HA 2P4SA 1JPNA 2QNBA 4BNYA 1H2BA 1OKKA 4O1IA 4V0ME 4EUKA 2VA9A 5DFAA 1O95D 4OKNA 4DGQA 4Q16A 4I5FA 4WK6A 4I55F 1PJ8A 2O0JA 3WOHA 2ZZMA 1DAHA 2PH7A 3BD9A 4RVGA 1WU8A 1IPHA 1L7NA 2O3QA 4A0SA 1FDSA 3F6BX 3GP5A 3MEQA 2YOFA 2C97A 3R3WA 3WFJA 4Z51A 4B6OA 2AN4A 4BMNA 3EIHA 1BHSA 3DVQX 3IUSA 1ESEA 3L7MA 4DBZA 3I04A 2DFDA 2O06A 5AK6A 1JJBA 2QSYA 3GQVA 3ON5A 1ZAYA 2QT1A 2CZGA 3NAZA 5M3BA 2WEKA 4I6GA 3BRWD 3UMVA 4CG0A 2W0SA 5B4TA 1ADCA 2QD1A 2L0XA 9MHTA 2J5QA 2XKJE 4LFAB 4R2XA 2H06A 4AXXA 1SC1A 4L6IA 1PWZA 1QHXA 2ZANA 3ODPA 4HNAA 3K9LA 5B3JC 3I4CA 5LJIA 1XELA 2ZBPA 1EIWA 1QS0B 1QQTA 4RM2A 3HGTA 3PX2A 4A82A 3OOEA 4W1PA 1IUKA 3AVXA 1SAYA 2W2TA 3EOBI 2JLRA 4L5IA 4WQMA 2PQ6A 4NLLA 3IOEA 5DHSA 4PYRA 2AUTA 5EYPB 5I8ZA 1M2VA 3F4KA 4AJKA 1YSCA 3DGFC 2HFJA 3ONVA 1WUJS 3NUZA 2FZ4A 2UKDA 3H8JA 1MA3A 3OCJA 2DKOA 3H13A 5DK4A 3R7AA 1EXMA 1I2ZA 2MHCA 3CS3A 3TJRA 4F7DA 3EIFA 1UEIA 2ODNA 4OUDA 4DIUA 4EJMA 3UA3A 2R4QA 3SHWA 4EHKA 5BSFA 1N78A 4OKIA 1VXRA 2WJZB 2RE8A 3AUJB 5AUNB 4X66B 1VRWA 2CDRA 2ZBQA 4DV5B 1I6KA 3K73O 1YUMA 4HY3A 2ORYA 3M6XA 1JHAA 4Q9NA 1VLMA 3HVHA 3U3DA 3VH4A 3VISA 4C0KA 4D9KA 4OHYA 4EG6A 4CMCA 3OEYA 4ZI7A 1B74A 1SWWA 2BJHA 1NXSA 1L7QA 2OCBA 5DNWA 3HSYA 4IDDA 3TSZA 1YJBA 1XQWA 1W88A 3M5DA 5DNCA 1J22A 3AINA 4PY2A 5EJAA 4M8IA 5TPZA 5EZYF 1JHXA 4KBGA 4LJ5A 5IT0A 4FONA 4G8JA 4JLKA 5TXGA 2F3RA 2GAOA 4ZKEA 3UXMA 2DF8A 1FQOA 3PIDA 1GZ7A 4TTSA 5L4SA 1XP8A 3OC6A 4BE9A 1NOJA 3RFVA 3EG9B 1RTKA 3F9RA 4PIVA 3M3PA 1I3MA 2C3PA 4G6ZA 3KQYA 6PFKA 4B4VA 2G4VA 2XUHA 4GYKA 4HP8A 3HPQA 4LOIA 1EMDA 3JPYA 2N1BA 3GOQA 3T0FA 4D96A 2EZ8A 3IDZA 4D4KA 4DC9A 1JR3D 3R7DA 2XXBA 2FPXA 1CY6A 2OE2A 2QJFA 4QC2A 3GVCA 4IH1A 3VZRA 3ZCRA 1DAFA 2RHLA 4EY3A 1UBNA 2FSUA 3K1AA 4L4RA 3ECCA 3AI2A 2GETA 4IEEA 3H1FA 1PJSA 1N2XA 5B6JA 4TT3A 4B73A 1Y48E 4TS4A 3PJEA 3IULA 1VKHA 4L3OA 2EFDB 5EKTA 1OXVA 1URPA 2PWBA 3JRWA 3RREA 4BFLA 5EMHA 2C2BA 2F4VB 5FBQB 3O0DA 1L7XA 5TT0A 1J9EA 5B4VA 1IK6A 3DDHA 4C2AA 4I50F 1J0BA 1GTRA 3Q0IA 3HCRA 4OX9Y 4A15A 1KYXA 3H9EO 4NBWA 1P4AA 1DVRA 1FFAA 3EUAA 4Q48A 4QULA 1HOTA 3X1KA 3RLFA 3S7ZA 1C8KA 1EJBA 1E5LA 2HPAA 4F6RB 5ECWA 4ENUA 2J7PA 3S5UA 5KREA 4Q7EA 2BZGA 1MEOA 2AFRA 2BY4A 5FPTA 3WK7A 3K1ZA 2W43A 4K1LA 4M49A 1T5IA 5EKXA 4MCIA 2QLBA 4DMLA 4U63A 1TM2A 4ENVA 4ND5A 5C9ZA 3HDTA 3IIEA 5BVHA 1K6IA 2GLXA 5BN4A 3BGIA 3E70C 4EUNA 2FFHA 2VP4A 3RT9A 4G8CA 4JFAA 3EDRA 4TYMA 5B1YA 1V45E 2B4TO 3EXHA 4QDTA 4D81A 4C4XA 1FA9A 2R7MA 1T4DA 3O8BA 4TMFA 3OKCA 3ANMA 3HSKA 4EL5A 5DLDA 2Y6UA 3OE1A 3EPKA 2C4TA 5FA8A 4D99A 1M1YB 2I4LA 3LLUA 4KQGA 1U94A 2IX3A 3PSHA 3WICA 2G36A 1CNFA 3AI1A 2HCRA 5F1PA 4Z49A 3ZWDA 2GZRA 4ARAA 2CXQA 3OZ7A 4GS5A 1FIUA 5EJ2A 1A9QA 3HUDA 1W4RA 3NGXA 4YMVA 4JMPA 1J9ZA 2IS1A 4HQ0A 2IT1A 5DHRA 4LFCB 4CV1A 5DE3A 4CLOA 3A4NA 3LH5A 3BMCA 1OGJA 4DBLC 1IJKA 2JI6A 4OYLA 2G63A 3TXYA 2FW1A 5KWJA 4FFWA 2GEDA 1Z83A 2DUJA 3NG1A 1P5JA 3EG5A 3GFBA 3PC7A 3N2EA 1G291 4IJMA 3SXJA 2XOXA 4GL4A 4O25A 2XV1A 1UWCA 1W76A 1U90A 4KQIA 4R31A 5T41A 2CD7A 3HZHA 1Z37A 3RHTA 2A5JA 5JMWA 3TW6A 2BFAA 2J0UB 4HDRA 1F38A 1QO0A 2XAAA 3BG5A 4JI3B 3HWRA 4PG6A 2XI4A 1DJLA 3GLKA 1JIQA 2BL4A 2AH5A 1OYVA 4H1HA 3A9VA 2BZ0A 3GCZA 3CKMA 1AHHA 2JIMA 1ZRMA 5KTTA 3SQNA 3AVQA 2D1TA 3ILYA 4WDQA 6REQB 5AVVA 1MB0A 3QU7A 5ALDA 1KZ7B 1V3QE 2V0GA 4NFHA 3BQ9A 4J1NA 3RRMA 1JLMA 1OKKD 1FQWA 3HH8A 1WABA 2CXTA 2PTGA 3NEJA 2EKPA 1ZQ1A 3NHRA 4DLUA 3TLAA 4ENRA 3U4QA 1JJ7A 1JS1X 4KAXA 3V4RA 5DYGA 5ENZA 1QH1B 1YAHA 3WYNA 3OQVA 1GR1A 5K0LA 1ABFA 4FQ5A 4G86A 4YJFA 4TRRA 4BFUA 3WZ2A 5AYVA 1PL6A 2G9RA 1XTQA 5HJ5A 1H2RS 1VMKA 2QAJA 6AT1A 1E58A 3DGEC 2NYVA 4B33A 5JZSA 1X9HA 2KQUA 2B69A 3BYZA 1QF7A 3PE6A 1FZQA 3G79A 3IIJA 1E77A 1ISHA 4R8VA 4BJ1A 5THXA 2V98A 3STXA 3MCTA 2HPVA 1RWPA 2REBA 3KXDA 4LYDA 3HCBA 5AKEA 3F8WA 1P39A 1QSGA 2P90A 3TDMA 2YY7A 1T8UA 1EE2A 2DR2A 2PX5A 1YGPA 3G5TA 4FXPA 5B37A 2AE2A 1YZLA 2OCDA 4YMHA 1OX5A 3DUFA 1S2IA 3OAAA 2BRUA 4GX5A 4EA6A 2DCUA 3GDGA 3NHJA 2DLDA 1WV1A 3DZKA 1HZZC 4AJIA 1ULBA 4HDMA 5JIBA 3WRYA 3B60A 5KTMA 1DEAA 1JG3A 1N6LA 1GR0A 4JNKA 5G4KA 4E51A 2J8ZA 1SKMA 1BKDR 4Y1RB 4Q3NA 2EBFX 2R7NA 4WLFA 4B7CA 2QQGA 3Q1LA 3UKJA 2A9VA 2XZDA 1M83A 1XPJA 2G9UA 4QOSA 1XXHA 4PNZA 5B3JA 3RIHA 4WY5A 3R44A 2NAPA 3ANYB 1QGZA 3H84A 4E30A 4RH3A 4XR4A 5BV7A 1N1MA 1C9YA 1DC5A 3AIOA 4YRTA 2OV1A 2ZI7A 1N77A 4CGZA 4P9NA 1UC5B 2Q5HA 1MP0A 4LOHA 5DMXA 4U39A 5F1OA 3RS8A 3HKBA 3DLBA 1UZUA 4UAUA 4DDKA 1YJXA 4Q4HA 1N7GA 2XE6A 1Y7PA 1KERA 4R4JA 3BTSA 5C8ZA 3LKZA 1OX6A 1ZOIA 2I91A 3AIKA 4WBNA 4YRRA 4JOSA 1DIAA 1TTQB 1IL0A 4LRSB 2CBZA 4RQBA 5AFSA 2OV2A 2IOHA 2X6RA 5LSAA 2QIOA 3PQ6A 2IYTA 2VPIA 2V6MA 1GT6A 2I2WA 3BDIA 3GBPA 4TS3A 1LBSA 5K20A 3RNLA 2MR5A 3GEEA 3HMQA 4JB0A 5JCXA 3V6MA 2PWYA 2VF2A 4B76A 3IKJA 2CJXA 1AHPA 4FMBB 4HDCA 3CJTA 1JE1A 5EG5A 1JL3A 1RFGE 3S28A 2GCOA 3WK9A 5LXTF 4QODA 2PA3A 3A1SA 3EGDA 4QICA 1DKLA 1FP4B 3WGIA 3FSJX 4KH1A 2V65A 4XWOA 4JYAB 4ZHQF 3NIFB 4TPKA 3HVUA 5G1PA 2D1FA 2AMLA 2LCFA 4WKCA 3ESZA 3ZS8A 1CUBA 1N5KA 1P4RA 1I32A 2HX1A 5FL7A 4LJAA 2GOYA 3KB1A 2VDWA 3DB2A 3RT1A 5IKPA 3K15A 3LUKA 4K88A 4N8SA 2HMAA 1BA3A 5EQJB 2YUTA 1FZTA 3GLFB 5EJEA 1Y7HA 4POAA 1L5HB 2J3EA 3LGSA 2BKLA 5AKKA 3OJWA 2IPOA 4HJXA 1U9IC 3D0KA 1RMYA 3NHFA 4PGFA 4YAFA 2QXTA 2W22A 4H6WA 3GXOA 4YONB 1ODJA 2IEZA 1C5KA 5BW8A 2N1MA 3JZIA 3KEOA 2C4NA 2QVXX 4CE6A 3PWSA 2VT2A 3PQ4A 3TLJA 1XDSA 3Q7RA 4FLFA 3RC8A 3SGLA 1E9FA 1NUSA 3SHQA 1FNCA 1PHPA 2EJWA 2PZBA 1EIZA 3GIDA 4QU9A 5IVIA 3UKOA 4ETWA 4ZAYA 2Z6QA 3UWDA 2HMUA 1H22A 3COSA 3GJSA 4DMUB 5EP3A 4XARA 1KOLA 3RB8A 3JYPA 2OECA 1X0XA 1R00A 4TLCA 4BO4A 1UDBA 2M6SA 1ZGCA 2NTJA 4MINA 1TUBB 3I52A 3N0XA 1D2HA 5JD6A 1TZCA 2HBQA 3KVOA 4N5MA 2FW0A 1XC7A 1EAMA 1A1SA 1CX9B 1KQPA 5F33A 3UA4A 1JMKC 1Z6PA 3DL4A 5ITZA 5IDVA 2K7FA 1OTHA 4EFKA 1JIKA 2RIRA 1E6WA 2J7PD 1E61A 3PD0A 4LJ7A 4IXMA 3DZDA 5DASA 1QRTA 1G8MA 2GN1A 4JEUA 3SSAA 3SJBA 3QE9Y 1T5SA 1DDGA 5B64A 4ZGBA 5FWYA 3A06A 4K9QA 4Y7DA 3C98A 3ZDAA 4GLOA 2GR9A 2VQEB 1NATA 1YC5A 4ZEVA 3KQHA 3SMVA 1W1WA 3E3MA 3ZEAA 4LYHA 4A27A 2QF7A 4Y6OA 3R0ZA 3P9SA 4V0NA 3GEIA 4B46A 3MBOA 3B2QA 1S2LA 4IIHA 5KNBA 2JFPA 3SHFA 4FOOA 3FI9A 1MOZA 2HEIA 2Q5OA 3D5QA 2D8AA 2IZZA 3GAFA 3N7UA 1QDUA 4AG6A 4C4SA 5CLGA 2B6HA 4Y6PA 1JLKA 2ZSBA 1GGNA 3QKRA 4FS8A 2IXDA 3W34A 4M3NA 4LHWA 4RVFA 1AM4D 3ZY2A 1DE0A 2GK3A 1W0CA 4KKVA 5CBKA 3GJ7A 3IVRA 3M5CA 1E3WB 3ACDA 4QUEA 5ADWA 5JV5A 2X8JB 2E87A 1P18A 4YT8A 4KMMA 1ZWLA 3GHYA 4IIJA 3PC2A 1DZ3A 1RCFA 2HT1A 3ONDA 1LX6A 1WJGA 1RACA 1OA0A 5E4JA 2YIJA 1ZW1A 4L22A 1F48A 5DM1A 3MMNA 4D3YA 5LN1A 3FHLA 1DB3A 1AKTA 2HPHA 2WM2A 2XXJA 3IMKA 4FFDA 4JAVC 4WY8A 2IS6A 2REXB 3PIIA 3GJQA 2VDOB 2VQ3A 4X91A 4MVWA 3VPDA 1TDJA 4YAKA 3A6LA 1G1AA 3ZH2A 1U7PA 1QHGA 1ZPDA 2AK3A 2GTPA 3H11B 4UVEA 2A9RA 3UJNA 5DM70 3EMDA 3U48A 3VYTB 1G4AE 4TL6A 1RW4A 3VYVA 4B4KA 1PZGA 2XJ9A 5JJLA 2Q6OA 2NQ2C 3HSSA 4TT8A 4BU1A 3P9IA 4NONA 1JHZA 5LCXA 3PPYA 1E1CA 4S24A 2OBYA 2TMYA 1YS4A 4NABA 1Z5ZA 4RPLA 4V0RA 5EGSA 1A9XA 2GKGA 1HQDA 1UJ5A 1M34E 2IEAA 2XECA 3K4QA 1OFVA 3VYUB 4U9IS 2Q1UA 3DR5A 1QTIA 4LJYA 1TZBA 1DAEA 3MINA 3UYKA 3U1VA 4ARCA 3AUKA 3E2IA 3MT8A 4JLDA 3BL8A 1SVNA 5JRZA 4EI8A 4X45A 4HYQA 3UHOA 2VK8A 4BNXA 3G7SA 4EARA 1NLMA 4P4UA 2REOA 1II0A 2AJBA 2G08A 3TQSA 5JAHA 2V7XA 4N5LA 3T54A 1YVDA 1NQVA 4QYXA 4ZAFA 1AUXA 1WB4A 2L19A 1OWMA 1PIWA 5HUQA 4FYMA 4KE8A 3PITA 1AE1A 4PTLA 4Q4AA 1EWQA 1C8BA 4ERXA 3WLFA 3DW1X 4UEOA 3UJAA 4R2LA 1WUTA 3JQ9A 3RSFA 1OYWA 3QYAA 4B7XA 2JFFA 2X5XA 4MHOA 5CIWA 5CJJA 3TBFA 3MQ4A 1EXDA 1G0NA 1J23A 1UXGA 1XRJA 3K6KA 3V1NA 3I61A 3KHKA 1G5TA 1NW8A 3S40A 4BMYA 3WSVA 2GVZC 5DH9A 4OI0A 4CN9A 4D25A 4RPKA 1C9NA 1P0CA 2PU5A 4HDQB 4HNAB 4CL0A 2WOOA 4DYHA 3ESRA 2C5FA 3OAAD 3DAOA 3V34A 3BXXA 4ND8A 4YJHA 2GDJA 1A9YA 4RE6A 5JC8A 2YN0A 1WDTA 3E6AA 1E3LA 2A5FA 3GFFA 4X84A 1ZX1A 3RTBA 1A5ZA 1QHHA 1SHKA 2RB4A 3W2GA 4BRZA 5AVTA 1D2MA 1VZ3A 1ZBQA 3VGPA 2RARA 3MB5A 5DN6A 1M2VB 4BKPA 2P5YA 4X92A 4DB2A 3S27A 3HMKA 5ADHA 4LTMA 1DMRA 3ZKWA 1ZXLA 3T1OA 1CFZA 2QRJA 1V1RA 3DHNA 3NV7A 3AFMA 5LD2C 4BU0A 2J5KA 3SNKA 1XQ6A 2D62A 1ZVQA 3RGGA 1JHOA 2Q9BA 5KWVA 5THKA 3UTCA 1ZI9A 1KY4A 4BLUA 3A05A 3I05A 4OP3A 4IDHA 4JEMA 3OEEA 3P5BA 5C3UA 5K6AC 4GLBA 3SR3A 4MJLA 5LYJA 5LQNA 2CVFA 1BVHA 2CMFA 4MIEA 3L0ZA 1JA1A 1UPAA 1YZFA 2WJPA 1MNQA 4HVTA 4K1XA 3SR4A 3TOCA 4D7AA 4DJFC 4Y67A 2C5SA 5EQTA 4UW9A 1R37A 1HQCA 4ZYWA 1GQQA 4IUYA 1QH0A 1L1FA 2RAUA 4ZI7B 1IOZA 2C98A 3AM3A 1M2KA 3RBVA 4S04A 2X1VA 4WZ6A 3VAAA 1FXUA 2PBZA 1HEYA 4C4PA 4E5VA 4LE2A 2JIPA 1W88B 4Q24A 1KZ9A 2JIOA 4BGIA 5JZBA 1LWOA 1I4EB 1WCV1 3VOTA 4NENA 4D8VA 3X0DA 4EYQA 3CH6A 3LPMA 1XVTA 3QMVA 2XWBF 3FUWA 1K9VF 4CQLB 1JA0A 1YI8A 1E7QA 1Z5NA 1PWYE 2HMWA 1ARZA 1XRNA 2EL9A 1Y82A 4LRYA 2Q1YA 1ZRNA 1M75A 2HRBA 1OGIA 2QRHA 3T4EA 2XYGA 1XP5A 4IDAA 5EMLA 4MIKA 2R87A 4Q7JB 5BNZA 2MT9A 1N25A 2OK8A 1XE3A 1A77A 3MT9A 5LMNB 4MV4A 3GEHA 3V8MA 3FCSB 3STVA 5CFQA 1EA5A 2I4MA 4CEIA 2ETXA 4PNEA 3QBDA 4XJSA 4IJ5A 2BJVA 2A6PA 3BKXA 4EJFA 3KUUA 3KJQA 3NC1C 2DWCA 2HV8A 3B9RA 1C7ZA 3K1AB 1FYFA 2Z2IA 4KN8A 1VIMA 4AICA 5K6TA 4PGMA 5SZJA 1NP3A 2A9FA 3ND9A 3UHPA 3E18A 4H6PA 3NZEA 3O4FA 2J9RA 3EXAA 4UCWA 3T0IA 3CF6R 2VZ8A 5CLIA 3TQHA 3TE7A 4JBLA 4OH1A 2I6QA 2AWNA 3BUSA 1NLUA 2WSIA 1H23A 3M5PA 4GAEA 4GQBA 3U26A 2FWIA 5PNTA 5I7OA 1LZLA 4MW4A 4J03A 1YRAA 2NNLD 1DAGA 3BB3A 4O8CA 2QTVA 1Z5WA 4ZVLA 3JVIA 2XE8A 2Y1CA 2M6LA 2X0NA 4WE3A 2Z58A 2HWKA 1Y9AA 1E0AA 2QGNA 3V4OA 1O9BA 1EVJA 1US8B 4EGSA 5JNUA 4ASUD 2Y4OA 5B3KA 4AYXA 4G5FA 4L4SA 5I9TA 5DLQC 2R6JA 5BVHB 1JX6A 1Q84A 5BN4B 2D5CA 3GA0A 1GUYA 1TW2A 4P1ZA 1DO8A 1CJBA 1EDOA 1UP6A 2PVPA 1NZFA 2XCOA 5CCDA 3EXHB 3BKWA 3GNTA 4NFLA 3LC1O 4XX0A 2GF9A 2QVYX 2QR2A 4RHEA 3DEKA 5FA6A 1ENPA 3PDCA 2TYSB 1WKBA 1GGEA 4M89A 2C7PA 2BR5A 3LFUA 4UUMA 4DV4B 2Y2VA 4L8VA 4CZ2A 1JVNA 2NSDA 1PLLA 2XVAA 3QPDA 4XYBA 2XB2A 3QYJA 4PAGA 3D7MA 3VSAA 4LE0A 2YJ6A 3BWMA 1EDEA 1V9CA 3LSTA 2X9VA 4OIMA 3FTCA 3ZHOA 4A6PA 4E08A 3L46A 3MJCA 4I4CA 4ZAWA 5KYNA 1JXAA 1R6UA 1NVXQ 2J87A 4BNNA 5LLDA 2VEOA 2X1LA 1V5FA 3ICCA 5F3WB 1CETA 3C45A 1MF7A 2I2FA 1Z0FA 4P84A 4CLOB 1NR1A 1MO2A 4Q4CA 4Z5XA 1JJAA 4S05A 4OD0A 3TTSA 1ZHHA 4PC7A 5KHAA 4NR0A 4C30A 4W7SA 3DJFA 4FHZA 4N3GA 3HN2A 2MSEB 3BFPA 1SCDA 3OECA 4C6SA 1HDIA 1Q21A 2FJ0A 3RF6A 3SDBA 3ZXUB 5JVDA 5TMBA 1DRVA 4KP7A 4HDRB 1G7SA 2A2ZA 3RJ5A 3EBLA 3UFBA 3UKDA 1G2OA 5A62A 1NPTO 1TADA 3VKFA 3BGWA 4EO7A 3B1WA 4KO8A 1TUIA 1NAHA 4TL9A 2CV1A 1WXDA 2JEYA 3K30A 4EEXA 1GGVA 1EVEA 3O8OA 1O57A 4U2GA 3AOEC 4IWXA 4DMFA 5KHOC 3S1SA 3ZCPA 5CD1A 2CT8A 2DVMA 1B26A 1OFGA 5F77A 2Q6IA 3OF5A 2QTNA 1S0UA 1X8LA 3OJXA 4BVEA 1TRKA 5IJ0B 3HY4A 3IE2A 3A4TA 1ZCBA 4TM7A 4A2QA 3T5PA 1QE3A 2A94A 1ZGGA 2BEKA 2V8BA 4I08A 4LXGA 3TWOA 1XF9A 1BRMA 3AFGA 3T7RA 5HIKA 2G9VA 3R3SA 1WU7A 3U4QB 3HHEA 5EUBA 1U3VA 4FR0A 3ZIAA 3JVEA 1P1RA 2PPLA 3HY3A 2O57A 1A96A 2QTWB 1U2GC 4WSOA 1ILWA 2FWRA 4RY0A 1W4AA 4XIGS 1A2KC 2ERYA 3V4PB 5DSTA 4YJFB 4TYYA 3D7LA 2VEDA 2WWTA 3F46A 1G5QA 2YNMD 4ABYA 4BCDA 4AJOA 5AKGA 4DJEC 2KBFA 1E7SA 3LXMA 1M1XB 2AOTA 3EH1A 3MT7A 3JQAA 5FOUA 3IEMA 1NV8A 3BB1A 4HN4B 1JPUA 3FHOA 1IC6A 3SIWA 3FVWA 3ZQKA 1ECGA 5I9LA 2OD9A 4U5XA 3S68A 5BQOA 5EMMA 5AM2A 4TQAA 1JJIA 4K81B 3SS7X 1TK3A 3H2GA 3KSZO 3CLHA 3UGTA 5F7XA 2HF7A 4V03A 4CWAA 3C43A 2F00A 4NCXA 4QXQA 2GBGA 1OMOA 3DUFB 2GXAA 2CY0A 3JYNA 4GGMX 3TSAA 4OBWA 5LQUA 5KKCA 2UYCA 5CIQA 3UMYA 2DR3A 4YDSA 1YFKA 1SCAA 1XJQA 2BGMA 4OQEA 3N2YA 2Z5LA 4W8GA 4Q4JA 5G4KB 4AO7A 5F23A 2XTAA 3BULA 1Z6GA 2C8JA 2WM9B 3T1QA 4C7OB 1ZI6A 5AJHA 1EHCA 2P68A 4CR6A 4JEIA 3C8HA 2WHXA 3JQ8B 3G8YA 1RXYA 4RAQA 1SUWA 4EB6A 4M1YA 4JWTA 3DLTA 1R8SA 4UC0A 3O21A 2HXGA 3OFKA 4KGXA 2NO7A 1GPKA 4URVR 1G17A 4I4LA 4CM1A 4G9BA 1X14A 2N42A 1JXQA 4DV0B 1S2MA 3LOQA 1IOWA 1R2QA 4DHWA 4JP5A 4Z1MA 4GR5A 1NWHA