4U5XA

Structure of plant small gtpase osrac1 complexed with the non-hydrolyzable gtp analog gmppnp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
178
structure length
178
Chain Sequence
GSTRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSVVNLGLWDTAGLEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Plant Small GTPase OsRac1 Reveals Its Mode of Binding to NADPH Oxidase
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Gtp-binding protein
molecule keywords Rac-like GTP-binding protein 1
total genus 66
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4u5xA00
1Q1ZA 3WRXC 1Q21A 1KY3A 1R6BX 1XNJA 4HAYA 4LBZA 4X8LA 1J90A 3GP8A 1JECA 3BB1A 4JL8A 2C04A 1X6VA 4R98A 3DM9B 4DDVA 4KHZA 2ZITA 4M1OA 4XVQA 1LV7A 1P9RA 1VYVA 1Y63A 2XZOA 3K8YA 3TVDA 4TL9A 3L8ZA 2R2AA 5K8IA 2QSYA 5E7JA 3WP0A 4S2EA 5JS7A 4LBWA 4LBVA 1EFUA 2IWRA 2C77A 3LRPA 4OK6A 3ZH9B 1ZCBA 5F98A 1BKDR 2VQSA 2YWGA 4JLKA 4IEIA 1L4YA 1OIVA 3K1JA 4PC6A 1NIPA 5JZVA 1GWNA 3B9QA 1NVWQ 4R2HA 4BEJA 4B76A 4PR0A 1NVXQ 3ND9A 4MQBA 1D2MA 3H2YA 5C4GB 5CDFE 3N2IA 4MYTA 3D31A 4L8GA 4CYMA 2FPKA 1BYIA 4Q9LA 1UBEA 3PEWA 2A5GA 3JVUA 3U7EB 2ZRPA 4D80A 3LD9A 5HZKA 4RZ2A 4D4JA 3GLIA 2FF7A 3O8CA 1II8B 2PJRA 1ZNZA 4O2RA 2IYXA 1PV4A 2OE2A 2X1VA 3PUVA 4LZZA 3C5HA 2WZQA 4DT1A 1YVDA 5JSZB 3FFAA 1IY0A 2RGCA 4QHSA 1M6NA 4DT1B 3TUZC 3WYGA 4IDOA 4OQNA 3MLEA 4GT1A 3X2SA 2IHBA 3GLGA 3BFKA 1SHZA 5DYIA 4KBFA 4MUAA 2ZIAA 2B8WA 3IGFA 3PUWA 4WZBE 121PA 4JSYA 1P62B 2ORIA 3LBHA 4M9XA 5TARA 1E9FA 1P7CA 4Q18A 5E7MA 2WMNB 3KTAA 4NMMA 3CWZA 2FSFA 2FZ4A 3JZAA 1XP8A 5GVSA 2BBWA 1YE8A 1ZC3A 2BMEA 3OEEA 1DAIA 5LB2A 4AG6A 4XIGS 5IK2D 4URVR 5AUQA 2IEZA 4DHEA 1T5LA 4B3XA 2ZI4A 1SXJA 1Z47A 1OXVA 5G3ZA 1E2GA 1VCMA 4D4LA 1DOAA 3P27A 4DEYA 1R5OA 4TTQA 1SXJB 2NG1A 4BE7B 4RZ3A 1D5CA 1KSHA 5HTKA 2O8FA 5M04A 2PZGA 3GLHB 3UATA 2WKQA 3MWYW 1Q3HA 1KDTA 3C4JA 4Q9HA 3NKVA 1G4AE 2QTVB 2W00A 2VHTA 3L0PA 5BYJA 5SZJA 5DH9A 3KQNA 1NLYA 2ZREA 1MABA 2Q21A 721PA 1OT3A 1ZUHA 4PAOA 1KO8A 1G8FA 4C0SA 3GEHA 2ZJ5A 3BD9A 3SZRA 3QVVA 4FCTA 4H1UA 4MRRA 2Z4SA 4QRHA 4PC1A 4ARZA 3TQCA 1OHHA 1NJGA 2VHUA 2XB2A 1RZ3A 2YOFA 4BFUA 1JJ7A 3HPRA 1FQJA 1HT2E 1IY1A 2G0NA 1VHLA 1EESA 4C30A 2QPOA 2KBEA 5FTKA 1ZAKA 3MUFA 2EU8A 3PCRB 3U4QB 1F6BA 4A6PA 1KY2A 1TU4A 3AP2A 2V54A 3LNCA 3K9GA 1PLKA 5CYPA 4JL6A 4LYAA 4TLCA 1ZNXA 4DLTA 2PT5A 1CEEA 4OHYA 4KCGA 1SULA 3BERA 4Q4AB 2RMKA 5P21A 1EFCA 3IHWA 5FPYA 2KE5A 2QGZA 4MGYR 1UKEA 5SZKB 2GETA 1Q57A 4MYCA 4ZI3A 3H86A 4XWAA 2Z0MA 4B35A 4M2LA 2P67A 4JT2A 3LO5A 2CK3D 4IDQA 1Z6TA 4FI3C 2ZRGA 1AA9A 1N6RA 1Z0DA 3I92A 2ERXA 3U60B 2PLRA 3RHFA 4GL2A 4PPFA 4Q47A 2FX3A 1F2UA 4DCVA 1CR4A 2FNAA 2Q0HA 3KJIA 5TXGA 1ZC4A 3BB3A 2X77A 2DR3A 4DC9A 4JVNA 2W6ID 1BS1A 2QNRA 1XU4A 2CLDX 2WSSD 1X8JA 3EZ2A 3MFYA 3LWNA 4I1SA 3W8RA 1SVSA 3BBPA 1CR2A 1KI7A 2IYYA 4FMBB 2FH5B 3DKPA 3MWJA 4TMTA 4MITA 4V0LA 3QOFA 5EJEA 4M4SA 3RRNA 1NVUQ 4DIEA 2GCOA 1R0ZA 1KI8A 1DAEA 3NIBA 4NHOA 3ZS8A 1KO4A 4FMCF 1R7RA 4MH0R 1JQLB 4MGIR 2PBRA 4YMTA 2FG5A 2WJGA 2ZRDA 3WBJA 5JI3E 1TQ2A 1W2HA 4DBLC 2NPIA 4AKIA 3OEHA 1KI3A 3IBYA 2C9CA 3T5DA 1QZXA 4QBHA 1RYHA 4EQ6B 4W5WA 1NKSA 2JCSA 2QPAA 4UXIA 4Q9JA 3WMFA 4B34A 3WY9A 5JJKA 4EQ6A 1A2KC 4B75A 3O47A 4C7OA 3A36A 3RANA 2D7CA 3UPUA 2WOOA 3LW8A 1M1YE 3TRFA 2JLSA 1Z06A 4QC2A 5CK4A 2NZ8A 3CM0A 2FEOA 1TUIA 1II8A 1DG3A 4OQMA 4QM7A 1S1CA 3L0SA 4IRUB 4B2LA 1GILA 1GNRA 2XEXA 2BMJA 4RFSA 3VKWA 3TAUA 1RE0A 3U44B 1G5PA 4PC2A 3TW4A 4B2IA 2C5LA 4FCWA 4LYHA 3THXA 2UZ3A 3GLIE 1HY3A 5F9HA 3ZJYA 3THXB 4QOSA 1YRBA 1ONBA 3EPKA 1SKYE 2EWWA 2D62A 4C3ZA 1BH2A 1ELOA 2WWFA 1ESMA 1FP7A 4JLOA 2E87A 2ANBA 3I5XA 4AY2A 4HZUB 1KKLA 1ZM2A 3BFXA 4XD7A 1ODFA 1QHIA 2OLKA 4NP6A 3AQ4A 2DCUA 3UG6A 4P4SA 3LVRE 4DUGA 1FUUA 2GXAA 4MRSA 1FL9A 1FX0B 1JPJA 1W5SA 4P4SB 4Z8XA 4F92B 2NO6A 2C96A 4LI0A 4LYJA 1VYTA 4RD3A 2A2ZA 2GJKA 2ODBA 1K5GA 2HJGA 4HLUA 1DAFA 2BDTA 1FZQA 2H18A 1OF1A 2F1JA 4C0JA 2E1RA 3DM5A 3GEEA 4TL8A 3QSYA 1TMKA 2B6HA 1HA3A 2JEOA 1K5DA 3VU9B 3KFXA 2BCJQ 1CKEA 1WE2A 3RC8A 4BFZA 2ZVQX 4MA4A 4LHWA 2VHJA 3QKSA 4F4JA 1GITA 1KTVA 4RJLA 2QBYA 2JJ1A 1SKYB 4US2R 3QKSB 4JLNA 1KI6A 2JLRA 1U94A 5LD2B 1QHNA 1R2QA 4DCSA 2P5SA 5EXTA 4DSUA 4TMKA 4DSNA 2ANCA 4F91B 5IRCD 2QTFA 4RSGA 3BFVA 3LXRA 4V0KA 4WOPA 4IW3B 4UKDA 1VG1A 3LA6A 3QF4B 4NE2A 4MRNA 3TBKA 5KTYA 1G291 2GBLA 2RGNA 3GJXC 4KV9A 4A2QA 3I62A 1W1WA 3X1WA 1ZNYA 3TGPA 1OXXK 1X86B 2OO7A 4LJ9A 4FINA 4XH9B 421PA 4PXAA 2NGRA 2QUZA 2ZYTX 3UMSA 2C78A 2ZS9A 3OAAA 1AGPA 2XB4A 2VPPA 4L16A 1P2TA 3FOZA 1ZM9A 4BQSA 3AVQA 4A0GA 2FWRA 4PO8A 4US1R 5EXSA 2FDCA 1ZW6A 3ADDA 3ZVRA 4R2IA 2EFEB 3MG9A 3D8BA 3B8HA 3AVVA 1ETUA 2OV2A 1R5NA 1QHSA 5FBQB 1Q3TA 5KUTA 1DVRA 4Q1AA 1ZIOA 2JIZA 2HYDA 2ZJ2A 4KYIB 2W58A 3C15C 2J5XA 1L4UA 4QGFA 2RKOA 1E2NA 4I99A 5KOYA 1ZINA 3NBZC 5E95A 2HJVA 2QMOA 2BMDA 3AKEA 2ZE7A 4HI0E 1R0WA 2N1BA 2AN9A 2XTMA 2ZJYA 3DZ8A 1Z63A 5DISB 3W90A 1AZSC 2F43A 4BLQA 5GADl 3I72A 3SU8A 1E0JA 3EWAA 1Q1QA 1K8RA 2YINC 1UEIA 2XZLA 3OHMA 2ZRFA 2BMFA 2FFAA 4NTZA 5CM8B 3UIEA 3H4MA 4NDZA 1M34E 4RCYA 4JMPA 2D2EA 3A4LA 2FSGA 2QG6A 4GI7A 1YZNA 3B1XA 3K70D 2NO9A 3VR4A 3B2EA 3CR7A 5SZHB 4G5GA 4BFWA 1OXSC 4C7OB 3K0SA 5GJVC 1DTSA 2XXAA 3VR5A 4PO9A 3QG1A 4PPNA 2GCNA 4BWYA 1N6PA 2VLIA 1CF4A 4FWIB 4RZXA 4XOIA 3LX8A 5FI1B 1TL7C 2REOA 4LBYA 3IEVA 2IYLD 3EW9A 3V00A 3CPJB 2DFLA 3ZGXA 4C0KA 4ZKEA 1XXHB 4DLSA 1H8HA 2YOGA 4URUR 4PQFA 3CWQA 4MYUA 2R6DA 3CIOA 5G3YA 2JLZA 4UQOA 1KK1A 1KMHB 1WF3A 4ZKDA 3D7MA 4EJSB 1GNQA 1KMQA 2CHVA 3Q7PA 4RFVA 3PUYA 3TSZA 1P9NA 2F55A 1NN3A 1T9HA 1EFRA 3IPXA 3AF0A 2A30A 4A82A 2VA8A 2YWFA 4WXPA 2OZEA 3I73A 4HZUA 4EJSC 1NP6A 2Q9BA 3GEIA 4C0HA 1E4VA 1CBUA 1M7BA 1EGAA 2BEKA 3BH7A 3GD7A 2W6JD 4PC3A 1NF3A 2Q3HA 3RSOA 2BBTA 3EC2A 4TTPA 4B3GA 4LV6A 5H1YA 2WJHA 2WWYA 5A5GA 5HE8A 4QFMA 1KKMA 5EP1A 1H8ED 4IDPA 1G5RA 3VKHA 3WHLA 4TQUS 1UPTA 1E9SA 2OT3B 4CZ2A 2O8DB 4URXR 3BK7A 5AJZA 4AG5A 2FFQA 1COWD 3FMPB 2CE7A 3AUYA 5KDDA 2OLJA 3TR0A 1X1RA 2VSXA 2BJWA 2EYUA 3IO5A 1G64A 4GFDA 4TLEA 4W9MC 2RGAA 5CJPA 4TYQA 1DEKA 1MO3A 3RS2A 1ZYUA 1RPZA 3UWKA 5EP4A 1P6XA 3NG1A 2NZJA 4G1UC 4BLPA 3OZXA 3SN6A 4QHTA 2ZRCA 1QHXA 1U0JA 5FPSA 3L0OA 2WPDA 3P32A 2OAQ1 2G0TA 2CE2X 3PVSA 3R7WB 3IQXA 1G1MA 2OFWA 4JSTA 4KFTA 2DB3A 2VL7A 3NHAA 3FMOB 4EPYA 5CB6A 4PAMA 4Q7MB 4C0AC 2JIZD 3R7WA 3KKQA 4D81A 2QY9A 2ZRIA 3KKPA 1T91A 2ZR0A 4QJ3A 4A0HA 3ZVLA 1NSTA 4LSGA 3EC1A 4I1OA 1G19A 1NLZA 3V4FA 4NYMQ 1KAOA 3REGA 4TMXA 3VR2A 3NC0C 4POAA 3KB1A 4HAWA 1IXZA 1KJWA 4Q7KA 4BEBA 4F4CA 2BWJA 4DZZA 1GRRA 4C4PA 4IVQA 3CLVA 3W34A 2Q9AA 4GDFA 4GBMA 2GJ9A 3OEHD 3SBEA 3ZVNA 4OJKA 3SJZA 4Q1DA 2RGNC 1KOFA 5ANRB 2QT1A 1DPFA 1OJLA 1NVVR 1DARA 2AWOA 4KAXA 3RNLA 3TNFA 3T1TA 1U0HC 1CJMA 2AX4A 2CVHA 2ZI3A 4PPQA 1NMXA 2J7PD 2NO1A 5E3HA 2H92A 5C2JB 1CJKC 4X8HA 2VHCA 3SJCA 2ZU0C 2OBNA 3S1AB 3OIWA 1U81A 3QXXA 4U02A 1XMSA 3S1AA 2VP0A 1G8PA 1EFTA 2V7QD 521PA 3GJ3A 4A1FA 3SC3A 5HR5A 1E69A 1G17A 1OXUA 2CLSA 3I3SR 4PSVA 621PA 1UDWA 2Q3FA 3B6EA 2AK2A 4V02A 5EXPA 3X1XA 1G8HA 2OFXA 4IXNA 2JLXA 2R65A 5KSZA 3TJZA 1JI0A 3NTUA 4E5UA 5LPNA 4KFRA 4AURA 4CGZA 3GCGA 2AD1A 3QPVA 3LY5A 4EAQA 4B71A 3QEJA 3KKMA 3CRRA 5DI3B 3IKJA 1G41A 5E7IA 5EQTA 5GJBA 2IW3A 2XOKD 4Q4JA 4MDFA 4HB4A 3DVLA 4TWZA 3A1VA 1GUAA 4HAVA 1CJUC 1Z83A 3MWKA 4DVGA 3IILA 1Q20A 1ZNWA 4TT3A 4ESHA 2ZE5A 1E9EA 2AFHE 3IHLA 1OB5A 4BLSA 4EKDA 2J59A 4C2UA 4F4IA 3CPHA 2BBSA 1JPNA 3E70C 4P33A 3SBDA 3HP1A 1GAJA 2C98A 3GLIB 2WOJA 4LCBA 2P6RA 4EPWA 1EFRD 4OKSA 3CKLA 5CM9C 1N6IA 3SOPA 4F38A 4MRPA 2ASEA 1ZVQA 2PMKA 4C0LA 3HJNA 5HZHA 4WA7A 1IJFA 4OHWA 1IBRA 4JT4A 1X8KA 4NYJR 1JBKA 1NVVQ 1Z0AA 5CK5A 3TIFA 4CEHA 2QAGA 1KNXA 2Y8EA 4BFXA 1OHHD 4Q4HB 3KL4A 4HEJA 2WKPA 2ATVA 4CF7A 1TQDA 4Q03A 3TUIC 2NO7A 4C0BA 4EFNA 2BM1A 4UNPA 1M74A 1G3MA 3KKOA 3NBXX 2FGKA 2XNDD 5KDOA 5J4KA 4BZXA 1SHKA 1GKIA 1KHTA 5JHGB 1OFIA 2QQEA 1D9XA 2GEDA 4YONB 3CZPA 1N2CE 1GRNA 2IHYA 3RRMA 4PHGA 4Z1MA 3OE7A 5BN3A 1E0SA 1W48A 3AVWA 1E1RA 2IUUA 2LCFA 3A8TA 5BYKA 3AUXA 3V9PA 1MRNA 4F7WA 3QXJA 4NYMR 2OESA 3RS5A 5FUWA 3ZDQA 3AKCA 3NVAA 3TUJC 3GFOA 4V0MA 5H68A 1NJFA 4I81A 4FWTA 1DO0A 3P1JA 2O8FB 3ZZTA 1Z6GA 4BLOA 1XCMA 3SQWA 1JJVA 2VP6A 3BWDD 4QBFA 5IK2A 5IT5A 4TN1A 2CNWA 2ZSBA 1Q44A 4G0NA 4TLAA 5FUVA 2O8DA 4XVRA 3IPYA 1L7VC 2B8TA 2YYZA 3W5IA 2ZU6A 4LJ5A 3KQUA 1P3JA 5L3SB 1E2EA 1ZUIA 5H70A 3TMKA 2QP4A 1XPRA 2IEYA 1KK0A 3VFDA 1WBDA 3U61B 4QL3A 2CEAA 3ZIAD 5J4YA 5JRZA 2QORA 4GOJA 3THYA 2GEUA 2JJ8A 3K9NA 1YR8A 1KGDA 1OFUX 2DFKB 4AKHA 1OIXA 2YVUA 1E2MA 3SHFA 4ACBA 4HSEA 4XWKA 2F9LA 3NBYC 2AKYA 4URYR 3LBIA 2QEQA 4TMZA 3T61A 3SEAA 4E03A 5JWOA 2YKGA 3RWMB 3P20A 4O3MA 4ZDWA 3M4YA 4QHYA 3U6BA 4LJ4A 4QGAA 2ZTSA 4ZCMA 1WRBA 4EUNA 2IF2A 1R4AA 5CLLA 3KXKA 1AKYA 1AQYA 2O5VA 2JAQA 1TPZA 4JKYA 1UKZA 2J3EA 3EPHA 4EPRA 3VNVA 3ZS9A 4CRWB 2EFCB 2JASA 2PMDA 5C18A 2PCJA 1HV8A 1ZU4A 2EFDB 3QXHA 4B6EA 4GZLA 1ZU5A 4NL4H 4A36A 2P3SA 1GM5A 3VR6A 3AV0B 4YLGA 3PXGA 3SFZA 4KXFB 1FW6A 2V8OA 4TLDA 2C2HA 2HCJB 1WA5A 4DSOA 1E0AA 4MGZR 4BZQA 1E2FA 5CJ2A 4BRUA 2R44A 2QM7A 4JZKA 1NN5A 1TTTA 5JWRA 2GAAA 4B3DA 3QY0A 3CB4A 4FXPA 4PC7A 1U8YA 1W0KA 2ZS8A 4N0EA 2MSEB 2V4ZA 2JJ1D 1KI1A 4K8OA 1OPXA 2G1JA 1XTJA 1MO6A 2IYUA 2WWGA 4TQAA 1MV5A 2J7KA 2V6IA 2ODNA 2VHQA 5TVKA 4Z51A 1W4CA 1KI4A 2GVDC 3QNUA 2W2VA 3NEYA 1C1YA 1GSIA 2ZVPX 4KLZA 4A2PA 1C9KA 1HYQA 3WP1B 2V7QA 4BECA 4G5OA 2IS1A 1FTSA 1MO5A 1HE1C 3RVBA 3E1SA 2B7CA 4DDUA 3CH5A 3W6OA 1N25A 2ZE8A 2C9YA 2F1IA 3UWOA 5AJXA 4JYBA 4LJ8A 3EARA 1R8SA 4LWZA 3ASZA 1G3QA 3A4NA 1ZMXA 3VHXA 3AVTA 2PZFA 3QVUA 1XEWY 3RABA 4IFBA 4Q19A 5KYKA 3KQKA 3DL0A 2XOKA 2FU5C 1G8GA 4MKIA 1RFLA 1JEEA 2AL7A 4R71A 1W36C 2ORWA 4H9GA 2X2EA 2CDNA 3H84A 1WQ1R 2QE7D 4Q7JB 3PEUA 1S3GA 2QN6A 3R8FA 3VX3A 4IVPA 1WCV1 3CRMA 2REXB 5AJWA 4M21A 1AS2A 5FI0B 4Q21A 4TMVA 1CRPA 2CL7X 1GDDA 2QAGC 4NU0A 4DLWA 2QAGB 5EE0A 3WNDA 1KYIA 4B32A 1FTNA 1WXQA 4LOAA 5H8WA 2GBLC 3EZ9A 5TB5A 1B23P 1T0HB 2AHOA 1XD8A 2C95A 3VNUA 1P2SA 3FGNA 1FNMA 3RS3A 5TY0A 3CX7A 2KI5A 4HLQB 5B64A 4NYIR 1T3LA 3X1DA 4HYYA 2NO0A 3LQQA 3VAAA 4A4DA 5BN5A 2XX3A 1TQ4A 3CONA 3ZZUA 1NLFA 4YDSA 5CDFA 3RRZA 1T0JB 4FMCB 1A7JA 2EWVA 2CCJA 1U0LA 4HUQA 4RY2A 1CRQA 2BCGY 1FX0A 1W2GA 4BGDA 2QZ4A 4DLUA 2WM9B 3KQLA 4TSFA 5F9FA 1J2JA 1KSGA 5JEDA 4IHQA 1GZSA 3LX5A 1W44A 2IL1A 4ASUD 5KPJA 2P5TB 2WTUA 3BC1A 5FOWA 2GF0A 5J4LA 3T35A 2WJJA 2Z6VA 4LC1A 4EFLA 2CJWA 2J46A 3BAFA 4D0GA 4C2TA 1FP6A 2P65A 1NIJA 2CJWB 3KFVA 3QBTA 1QVRA 1E2PA 1OKKA 4FD2A 2NPFA 2EW1A 5JCPA 3MMPA 3AVYA 4OQXA 1QBKC 2OXCA 5B58C 1DADA 1NSFA 3CNLA 4PAQA 3WMEA 2EQBA 3U4QA 3C41J 4S35A 1XCPA 3I5YA 3NBFA 2JGNA 2OHFA 1NI3A 4JVSB 3OFNA 4CIDA 4BFYA 1KO7A 3QKRB 1ZBDA 2WBLC 4QNRA 1NG9A 3N70A 2O0JA 4KJZA 4M53A 3KQHA 4M1YA 2AXNA 1OXTA 3ZD7A 1W5TA 4A6XA 1P9WA 1Z2CA 1DBSA 1KJYA 1ESNA 2ZJOA 4TSFD 2ECKA 2FV8A 4I1UA 4V0ME 3GLGE 1J8MF 2IUTA 4XSGA 4GRAA 1TX4B 1ZD1A 1TQ6A 3LVQE 4UNSA 5AJVB 4M0LA 3VR3A 1W0KD 3DEFA 1F60A 2ZJ8A 4BRWA 3K70B 2WAXA 1UKVY 2ZROA 1N5KA 2L0XA 2GK6A 4ZDIA 3EPJA 4L5BA 3EAQA 221PA 2A3RA 2IF0A 3CF2A 1P61B 2C9OA 2D2FA 1P5ZB 3CRW1 3PITA 4QGHA 1D2NA 3DOFA 2KBFA 2YC4C 4JBWA 4LJYA 1OFHA 3W6PA 3EWSA 1EK0A 1OH5A 2K5UA 3PQCA 2CK3A 5DNYB 2QTHA 4KSCA 4Z8YA 2MSCB 2QT0A 2GRJA 2HDNB 1MT0A 2W6JA 2XJ9A 2VYFA 3DZDA 5J4VA 2ZRKA 4FCVA 2CMKA 4EIWA 4Y0VA 2GZDA 3KDSE 3I1FA 5BN4A 3K0CC 1ZM3A 4JLVA 3Q5EA 1IHUA 1E94E 2PH1A 1BMFA 3B9PA 1BYUA 2AWNA 1W49A 1KI9A 1XZQA 2YOHA 3UG7A 1N5LA 1S8FA 2R8RA 3FWYA 1VCIA 2FJUA 4NCKA 2I3BA 3NH6A 1NY6A 1XJQA 1W4AA 2AR7A 2RH5A 2PX3A 4Q01A 1G9XA 2XTZA 4HDQB 3T12A 3F0TA 1OYYA 1ZJ6A 2H5EA 2VSFA 2A5FA 1LW7A 3D3QA 4W7SA 1P2UA 1PJRA 4H1VA 3U3MA 1NBME 3A1UA 2WPDD 3AVUA 3HDTA 3AP1A 3K9HA 3CF6R 5HKKA 1P73A 1XXHE 1FMJA 2V55B 2B21A 1AIPA 3IBGA 4L9WA 3HU3A 2RGEA 4HAXA 1U2RA 2FMXA 4CW7A 1E1RD 2C03A 1WB9A 3EG5A 3RS7A 2H17A 2QE7A 3B7GA 4PFSA 2ODEA 5SZIA 3B1YA 5JLJA 2IC5A 2WIAA 3SQXA 5BWMA 4G01B 1MOZA 1ANKA 1CXZA 4DDWA 2G3YA 2WAYA 1H65A 1XX6A 2FOLA 4OI2A 1ZD8A 2WWWA 4LHXA 1IN4A 1KZ7B 1RC8A 5CYOA 4RFSB 2FA9A 3DMNA 3K0CA 2ATXA 3F8TA 3QBVA 1Z8FA 4DCUA 4B3BA 1XEFA 1FNNA 5K8LA 2WKRA 2ZRNA 3BRWD 3MSXA 4M1SA 4MUBA 3ZQ6A 5JCZA 1AJEA 1VIYA 5KHOC 6Q21A 4ILEA 1EX6A 3REFA 1YJ5A 8OHMA 1A2BA 1J8YF 5DO9A 1U8ZA 3CX6A 3FMFA 4IOMA 1JQJC 3BE4A 1SVIA 1YZLA 3PEVA 3R9WA 2J9RA 3Q72A 3AF4A 5FUXA 4EJSA 1EFHA 1HQYE 1YHNA 3Q9LA 3FHTA 4IOKA 4HLCA 3BOSA 3CF0A 3DPUA 3PV0A 4MKFA 4AYTA 2X2FA 2ZR7A 4B47A 2RGBA 2MSDB 1TADA 2SHKA 1G3UA 4B33A 3WNCA 1L2TA 3L82B 2ONJA 2RHDA 4WXRA 3AVPA 1FPMA 1P4SA 1EWQA 3CO5A 1Z28A 1P2VA 5DN6A 2HLDA 2J41A 1OLOA 2UZIR 3NDBB 3QQ5A 1OYWA 3SS8A 3OF5A 4A8JB 4A2WA 4DWJA 3HR8A 5K8TA 2J1LA 1W47A 4LJAA 1JXOA 1YU9A 2DFNA 3TK1A 4A8JA 3B5JA 4UNRA 1F2TA 1KDOA 2HT1A 2QSZA 4TQ9A 5FPKA 1IONA 5DSZA 2A9KA 4DLYA 3GJ0A 4AK9A 5ELXA 3EASA 1RRCA 2OBMA 2JLQA 1NN0A 3UK6A 2NTYC 3FKSD 1D9ZA 1TF7A 1B0UA 2OSBA 2J0UA 5HCIA 2R62A 3SYNA 4D26A 5JBQA 3RRYA 3BH0A 1GFIA 1JB1A 4KU4A 3DHWC 2WMOB 3FTQA 4DSTA 4AD8A 1VYUA 2YJTD 2W2TA 1RKBA 1XEXB 1KI6B 1A5TA 2IK8A 5CIQA 2O8CA 1W7AA 2XITA 4GSYA 4W5JA 2H16A 2IYVA 4KODA 3IIJA 5JJIA 3IIKA 1NBMD 2ZANA 2DBYA 4PHFA 2OCYC 1N0WA 3OIYA 1LF0A 3RS4A 1VCNA 3DDCA 2NIPA 2UKDA 2VIIA 5L3RA 1G4UR 1OW3B 2V9PA 3Q7QA 4ITRC 2ZRLA 5KU1A 1P72A 3IIMA 1XTRA 4ON9A 2TMKA 2F7SA 4Q4LA 4YMUA 3MRSA 1QHGA 1FMLA 5J5CA 2XGJA 1ZM7A 3HYTA 1TU3A 4LX0A 5FUYA 2EVWX 3H1TA 1AN0A 3U7GA 1I2MA 3K09A 2QROA 3QXSA 4M9QA 5J4HA 1FOEB 4JJZA 5HKKD 3EA5A 4LV8B 4GP6A 2JA1A 4GMXA 1R0XA 2XJ4A 3RAPR 5IDVA 4LHYA 4UNNA 4B48A 4K46A 1AK2A 2GHIA 1O87A 5FTMA 1BO6A 4JBYA 5FOXA 4UJ3A 1SXJD 1E2IA 3D6TB 3KXIA 4LJ6A 3TE6A 3THOA 1R0YA 1E6CA 1TEVA 5DGXA 4FMDB 3LAWA 2BJVA 4LHVA 3EIEA 2BM0A 3NXSA 4M8NE 3VTKA 3AM1A 4L15A 3PR1A 1J70A 5FL7A 4UNQA 2A5DA 3FHOA 4M1MA 2ZR9A 5FBRB 3V4RA 1A1VA 2O0KA 2HF8A 1S1MA 2YHSA 1Z3IX 2B92A 2DFTA 4IKEA 2G77B 1DG1G 2ZYUX 2GTPA 4PZLA 4Q1FA 3GQBA 2PT7A 3NH9A 4JKIA 1II9A 3R9XA 1BMFD 2BOVA 4HZIA 2KSQA 1KSJA 1HTWA 2P6NA 3F5FA 2DWPA 3PG5A 3SR0A 3M6AA 2F6RA 4TZ0A 4QM6A 1NL3A 3ONWA 2P0EA 4BFTA 1E79A 1G6OA 2ZI5A 1F5NA 4IFEA 1EWRA 3QJYA 3A1WA 3K0FB 1G7SA 4JVMA 4OJQA 1YQTA 3L43A 3KXLA 4PX9A 1MR3F 1CP2A 1GKYA 2H7VA 5FOUA 2P6UA 5GVRA 1XD2A 1QHYA 2KJQA 1E9CA 2IXEA 2ZSAA 3N5CA 2QA5A 3T34A 1WBBA 2ONKA 4HLUC 1Z5ZA 4P4UA 1COWA 3MJHA 2FZLA 3W5JA 1UKYA 4NCJA 3NWJA 3THWB 4US0R 3U7HB 1Z6AA 2ZSEA 1VMAA 1TAGA 2GF9A 2IXGA 2OM2A 2IX3A 1C4OA 4IJMA 821PA 3EX7C 4D0NA 2ZJZA 1HUQA 4HLDA 1OIWA 1L8QA 1XBTA 3IEUA 4M1WA 4E09A 4QGGA 2QENA 2O8EA 4K81B 5C1BA 3W6NA 1Z0IA 4G3XA 4JLBA 1IAQA 1XTSA 5D3MB 5EE1A 2CL0X 5EE9A 5FBLB 1I4DD 3SJBA 2JLWA 3SYLA 3CRQA 5FBWB 1EG7A 1S0UA 4PSKA 1YKSA 4NKRA 2FGJA 3AF1A 2WV9A 3K0EA 1NBMA 2ZJAA 4W5HA 4DB2A 5GJWC 1UF9A 3PFIA 3PJRA 2AXPA 1PUIA 1IN6A 2FSIA 3AGQA 1W36D 1YZUA 4ZI2A 2OCPA 1F48A 3AB3A 3I4LA 4TTRA 2YWHA 1RJ9B 4MKHA 4YMSA 1XZPA 5A4JA 3ZQJA 2WJIA 5UKDA 4HUTA 2BVNA 4R7ZA 3RSLA 3C8UA 2HXYA 1TF2A 2ZRBA 4GMDA 4XD7D 1JALA 4KI0A 3GMTA 4Q7LA 4XJXA 5EXXA 1JAIA 2BKUA 4AKEA 2J7PA 2XTNA 1RRPA 3NC1C 4WBSA 2IUSA 1S4QA 2J0UB 1W4BA 5FR1A 1AKEA 1R8QA 4ERNA 2HCBA 4Q1CA 4G5QA 2FE4A 4JLDA 1WMSA 3FKQA 1J7KA 2GXSA 3B1WA 4TL6A 1XEXA 2O8CB 2RAPA 2X19A 4UXHA 4JLMA 4ZV4A 4E22A 3JZMA 4O0MA 1O3YA 4HDOB 3ETLA 2V6JA 1M7HA 4LPSA 3UANA 4PANA 2RGXA 1TNDA 5KNDA 2JLVA 2I1VB 1S2MA 1Y3AA 3BXZA 3TVTA 1XTIA 2GJAA 3J81k 4EFMA 1MO4A 3A1TA 2ZRHA 3L0IB 1BOFA 1KAGA 1H8EA 2PCLA 4ABYA 1G6HA 4EPXA 2DY1A 2I4IA 2DWQA 1V5WA 1VDZA 3OIVA 5JMTA 1IN8A 4BUJA 2IS2A 4BLTA 1JR6A 1SVMA 2CNWD 5FOVA 4AIIA 3VR1A 1U8AA 2ZI7A 2AD5A 3L2OB 3ZYCA 4WVFA 5JJLA 2J0SA 1NN1A 2XNDA 1XMJA 4LUCA 2LKDA 3C7KA 1S96A 4NCNA 1MABB 5LD2C 2GDJA 4FIDA 1E98A 3EZ7A 1W0JD 3U2QA 2GK7A 5DI9A 3R8CA 5C46F 1EX7A 1CJVC 3QUSA 5EP2A 4UXJA 1Z0KA 3U7FB 2O8BB 3KUDA 1I4TD 4NPHA 1J99A 4XVUA 1LY1A 2KB0A 4CT5A 2O8BA 4OL0A 1F3OA 5JEEA 1Z08A 1W36B 1WDTA 1HE8B 2A5JA 1AS0A 4RD0A 1GNPA 2VSOA 3U3OA 1FQKA 2GAOA 4TZ6A 1Z6XA 4NZYA 5KSYA 4FW9A 1XRJA 4JLJA 4Q00A 3T15A 1NMYA 3E5HA 3FPAA 1DAKA 5EE5B 3AH8A 1XEWX 5KSPA 5JWHA 5DI3A 3ADCA 4U7DA 4D4MA 3R20A 2H57A 1R5BA 2JDIA 2XSZA 4PPGA 3IUYA 1OH6A 2RB4A 4PQYA 2LWIA 2VRWA 1UM8A 4LK2A 5BW8A 4OK3A 3CPEA 4PZZA 2OILA 4URZR 3SI7A 1SVKA 3ICQB 2CVFA 4Q4AA 5EUMA 3TSWA 2QP3A 4Q02A 2ZXUA 3F3YA 3K0FA 1DELA 4Q5IA 1M2OB 2C8VA 3K0AB 2XZPA 3PUZA 3CH4B 4F93B 3GLFA 1OH7A 1GKUB 1NG1A 1Q12A 1ZUNB 3DOEA 3K0AA 3FFBA 2WJVA 3Q8XB 3QI2A 3GFPA 3PUXA 1GOTA 1E79D 4N0DA 1LVGA 5FR2A 2Z4RA 1QDEA 2CL6X 2ZEJA 5CB8A 2R6FA 2H8KA 2VF8A 3VQTA 1LF5A 3T5GA 4BZPA 2CLCX 1NY5A 1U90A 4LY6A 1E2JA 1A4RA 2BHRA 2XNSA 3W8NA 1XTKA 1S3SA 4KLNA 3A1SA 4QJ5A 2QGNA 3AGPA 1VHTA 2OUKA 5D3MA 3CX8A 4A0FA 4PTLA 2GJSA 4IOLA 2OAP1 4DIDA 1G16A 5HE9A 3HU2A 3AP3A 1YZQA 3GJ5A 2ZJBA 3MAAC 2ODWA 5FTJA 4M9SA 1ZRHA 4D0LB 3B1VA 1RW4A 1DS6A 4GZMA 4AI6A 1VTKA 2JJ2A 4JLPA 3TQFA 2IA5A 2MMGA 2YC2C 1TF5A 3BS4A 3U3JA 4B3FX 4NH0A 3FB4A 1CR0A 4NYIQ 3PEYA 4DLVA 1XPOA 2FEMA 4O2LA 2J87A 5JRJA 1VECA 3FVQA 1JNYA 1E3MA 3EZFA 1TUEA 1N5IA 4B3CA 1E4YA 2GEVA 5G53C 2DYKA 4CDGA 4PSAA 3WXMA 1G7TA 4WW0A 4V0OA 3ZZ0A 2OCBA 2I1QA 4LDJA 2JJ2D 1U99A 4NCIA 2QI9C 2EFGA 2LKCA 5KSOA 1FUKA 5L3SA 1JAHA 4YMWA 3GJ4A 2FFBA 1BIFA 2F9MA 4LPKA 2PLFA 2NOAA 2AK3A 3Q3JB 4JYCA 5EZ6B 4HB3A 3HPQA 2YV5A 5AUNB 2RGGA 3A4MA 4A92A 4RD1A 3A6PC 1IOZA 3UXMA 2GCPA 5JSZA 2OFOA 2ORVA 3GJ8A 2J45A 5FL7D 4II7A 3P4XA 5K8UA 4FMDF 2CHQA 4Z54A 4UJ5A 4Q48A 5A0FA 3HR7A 4Y0AA 5L3VA 2WWXA 1GL6A 1JR3D 2G9NA 3GLGB 3QKUA 2WWIA 2ZRJA 3OE7D 4WIAA 3K70C 3B1ZA 4B2PA 1V43A 1S9HA 3MCAA 3MWLA 3LLUA 5TV2A 4KSBA 2RCNA 2ZRMA 4KFUA 1IN5A 1CR1A 2GVZC 3T1QA 3FYHA 3CW2A 2VP9A 3OAAD 1OSNA 3DKVA 3LV8A 3AF3A 4YXWA 3UMFA 2W6IA 3ICEA 2QL6A 2QMEA 4U5XA 5FPHA 2A78A 5JI2E 4BLRA 1JEDA 1W4RA 1M8PA 3NEJA 1SKQA 4OHVA 1QG2A 2QM8A 3O8DA 5EE3A 4ACAA 1KZGB 3GFTA 3PIRA 3EXAA 3GLHA 4DDTA 3G5UA 2GILA 1E2KA 1XTQA 2ZUCA 4L4UA 2BEJA 4DB4A 1AQUA 1LNZA 1UAAA 2RHMA 2ZUBA 1RVDA 3KKNA 3LH5A 2IWHA 3EIQA 4NONA 4KFSA 1K6MA 4NBSA 1SQ5A 1N6NA 4RD2A 4OBEA 1KNQA 2ZYVX 3O8RA 4TYYA 5L8VA 1VG9B 5DHAA 1RIFA 3WRYC 3KJHA 4DCTA 3QIAA 1NMZA 2N46A 2EFHB 3VU9A 3ECCA 5HCNA 1CULC 2DHRA 4D2IA 4GNKA 1E2QA 1E2DA 2QPTA 4R9UC 3W3ZB 1GL7A 1D6JA 2ZSDA 3BGWA 1T8TA 2ZETA 5G40A 4OHZA 3CNNA 4B43A 3AKDA 4EDHA 2IYTA 3P4YA 3QF7A 5TMPA 3GPLA 1NNEA 2QBYB 4HB0A 2AKAB 2N42A 1XCGB 3R9IA 5KO2A 5BXQC 2GWHA 3I8XA 1SZPA 1P75A 3TLXA 1AS3A 2HF9A 4RKEA 1UBCA 3BB4A 3IDQA 4IXMA 2ZI6A 2G83A 1II0A 1LS1A 2GZAA 2VP2A 1GG2A 2GNOA 5L3QA 4P31A 3RS0A 2OEPA 3BIFA 3HU1A 4G5RA 1PLLA 4Q9KA 2VF7A 2CBZA 3OESA 4I1VA 3LW7A 3TAHA 5L3QB 3AF2A 1SXJC 2ZSFA 1KI2A 4Q1EA 5F3WB 1H8HD 2Q6TA 3GLFB 2GXQA 4P3YA 1PZNA 3CUEF 3KJGA 5AK0A 2B7BA 5DHFA 4IDHA 5JFGA 1IM2A 2H1LA 4X8MA 1GTVA 1S9DA 4M1KA 1E1QA 2R6GA 2REBA 3HYRA 4HDCA 1F2UB 1I4LD 2WWHA 4U00A 5FBVB 4GOXA 2KWIA 2CCKA 2D4HA 4XTCS 1E99A 1E9RA 1N3BA 1Q0UA 3ADBA 5DE3A 5LB4A 4JBXA 1N5JA 4ZCIA 4XTRA 4I4LA 2RGDA 3A37A 2GXUA 1QVAA 1A82A 4PHHA 2Z83A 2HLDD 5DLQC 1SGWA 3Q85A 1VPLA 4C0QC 2ZYWX 1VKJA 4CEIA 3VKGA 1JXMA 4KO8A 3CBQA 1CJTC 2C99A 3AVXA 4KITB 2G6BA 2XAUA 4CEIB 4URWR 1D8TA 1VG0B 2EYQA 2PZEA 4OQLA 2NQ2C 2VEDA 3IO3A 4BASA 4YDHB 2GCOB 1PVOA 3K09C 3WYFA 1Z6YA 2JLUA 4ESVA 2HXSA 5KPDA 1PLJA 2BIFA 1KDRA 4XWOA 3QENA 4JIMA 1LTQA 3LQRA 1CTQA 2X8AA 2F43B 4A0RA 2W0MA 4JS0A 3EPLA 1OE0A 1OV4A 1U9IA 5FL3A 2JATA 1KO1A 1E96A 4HUQB 4IEEA 1ZM4A 1YRAA 2Z5FA 3WYAA 5DYGA 4WZ6A 1KK3A 2YWEA 2G88A 2WVJA 3K9LA 2CXXA 4TYPA 2P2LA 2ZQ5A 5LDDC 1YR7A 3QE0A 3SFVA 4AWXA 1N6HA 4Z1MD 3QG5A 1T8UA 3GJ6A 4PO1A 3B13B 2XXAB 4V03A 1OB2A 2WIBA 2ZM5A 3MJRA 3BJIC 4IOJA 1D2EA 4HAZA 3LBNA 4MKGA 2F1HA 2FN4A 1X3SA 3QEOA 3ZLJA 4TMWA 5B2ZA 1SVWA 4QJ4A 4N3NA 5AUOB 1HQCA 3U44A 1G7CA 2ZPTX 1JR3E 1RRFA 3U3KA 3SYKA 4OI0A 4WAUA 1XPUA 3G0HA 2WSSA 2QRNA 4KBGA 1US8B 2J0VA 3ADKA 3FKSA 3AKYA 3QKRA 2AFIE 1KMHA 4YC7A 2PEYA 4G5SA 1W46A 3Q5DA 1Z22A 1YZGA 2VO1A 3ASYA 4Q66C 4LV5B 2WICA 4D6PA 4AC9A 1T4GA 1UJ2A 3DMDA 5AUPB 2IYWA 1AGRA 4JL5A 4GP7A 3I32A 3WBKA 1Q1BA 3LXXA 4PQRA 5FTLA 1UBGA 2FSHA 3NDPA 4OYHA 4TT3D 2G1KA 1ZD9A 4LHZA 4OI4A 4QBIA 4YXWD 3I8SA 4IDNA 4RVCA 1IN7A 3H0KA 4LJ7A 5JECA 1E2LA 3X1ZA 4B73A 1N6KA 4RKFA 2QMUA 3MGCA 5EUQB 2V1XA 1NRJB 2BC9A 3FE2A 3RC3A 4KVAA 2D7DA 4AYXA 1UDXA 4OHXA 1Z0JA 3M1IA 4M9ZA 2FPLA 1T5IA 4FN5A 3ZVMA 1QF9A 1SXJE 2Q9CA 4DLXA 2IXFA 3AVOA 1DAGA 2CCGA 4DUGD 4AKGA 1G18A 4N1AA 1KIMA 2FPMA 2QRZA 3GLHE 4EPVA 2GESA 3OIUA 3UKDA 2F3TA 4YQFA 2V3CC 5DIFA 4RD6A 4QXAA 3U6KA 1G5TA 1GL9B 1KK2A 3T1OA 2GJ8A 1AZTA 2OBLA 2QP9X 2D74A 1N0VC 3QKTA 1RRGA 1G3IA 2OCAA 1HH4A 3M0EA 4QBGB 1CU1A 3TSOA 2F3RA 4E07A 3CZQA 1VCOA 2D3WA 1LS6A 4DLZA 1E1QD 2QMHA 5D3QA 1CIPA 4DJTA 3QF4A 3P26A 4KYUA 1VG8A 4CEJB 3CRVA 1G7RA 1VIAA 4XSHA 4OI1A 4CEJA 1T3HA 3B82A 3QPUA 5BQ5A 4C9BA 3EA0A 4ZDJA 2ZI9A 2VBCA 3KZ1E 4KVGA 3B78A 5J40A 1ZP6A 1IY2A 3ZD6A 4P32A 5FPTA 3TW8B 5AJYA 4QKQA 3HWSA 1CLUA 5IF9A 2JLYA 1XD2B 5C4MA 4QG7A 4O25A 1UEJA 2W83A 1DAHA 3THWA 1DE0A 2HUPA 2ZRAA 3SE0A 2ZUDA 1MRSA 4DCNA 5FOSA 1GRQA 1GIAA 4Q9IA 4GPTA 4DLRA 5FH9A 1DAMA 3LFUA 2O8EB 3WMGA 3L8YA 5EZ5A 4YMVA 2IYRA 3UMRA 4GOKA 1IXSB 4OQFA 1P60A 1XMVA 2VH5R 1N6LA 2W2XA 1I2DA 2Z43A 5KNBA 2ZS7A 2HT6A 1XWIA 3FDIA 2DWOA 4D82A 4L9SA 1RYFA 4JVLA 1T3SA 2IYQA 1IJEA 2QQ0A 3BORA 3WNBA 3THYB 4B74A 2ERYA 1GVNB 2IS4A 2D06A 4ASUA 1ZCAA 3TH5A 1U98A 1SVOA 3SJAA 4DXAA 4Q4JB 1RJ9A 1Z29A 1XB2A 1PUJA 4TYWA 3C16C 4JLAA 1LFDB 1YR6A 1FFHA 3KX2A 1T6NA 4P0TA 5AWFC 1F2TB 1MH1A 1XJ0A 3NHBA 2VP5A 4NYJQ 4ZDKA 4J0QA 5LBIA 4DKXA 5B57C 4X8OA 1HURA 2JDID 1U9IC 2XSZD 2PX0A 3G82C 2GA8A 1HT1E 4LYFA 1E9AA 4CT4B 1G3RA 5IHPA 3KUCA 1XD9A 3QPWA 1NKTA 2J0QA 4D25A 2F1RA 4WZAE 1XXHA 4A8JC 3W3AA 1KDPA 2BBOA 4RZUA 1G20E 2QU8A 3JVVA 4BPBA 3IQWA 3TKLA 3MD0A 4PZYA 2UVQA 3LLMA 1XDBA 5J47A 2IYZA 1OKKD 4ZIRA 1YZTA 1W0JA 3ZIAA 1US8A 1E9BA 2GZHA 1G21E 3K53A 2V1UA 2WHXA 4ZIRB 1QG4A 4V0NA 5DN6D 4CEHB 4MGKR 2IS6A 4RD4A 5HPYB 3T06B 1R10A 2IBMA 1G8YA 4PHTA 4A15A 4Q4HA 3RWOA 3E2IA 4LC0A 3KTAB 1E9DA 3OFND 2ZE6A 1JR3A 3VX4A 3A58B 5CIWA 1EXMA 1XFAA 2PL3A 4MYHA 1XJCA 3X1YA 4BFVA 2A5YB 5EP3A 3SHWA 2QAJA 3SNHA 3U5ZB 3EZ6A 4CVNA 1XF9A 5JS8A 1QHHB 3LDAA 4TYNA 3EIHA 1E32A 4Q1BA 2HV8A 1QHHA 4IVRA 2OXRA 5F2EA 3BH6A 1UBFA 4DRZA 3QXCA 3OEED 3CNOA 2OG2A 4HAUA 1XMIA 5JHHB 2GKSA 3CR8A 1N0UA 3ND8A 5FTNA 4LRWA 4A9AA 1Q22A 3RYTC 5TDHA 1E2HA 2Q3MA 3PENA 2NMVA 2BKEA 2MMCA 4ZCLA 1KO5A 2PEZA 3FHCB 1ZIPA 3FMIA 5B30A 2CHGA 2BV3A 2HEIA 2WSMA 4NCHA 4HB2A 4EPTA 4ZO4A 4ARZB 1LB1B 4M22A 3SDZA 1OH8A 1TEXA 4MDEA 2W0SA 4JJKA 4D4KA 3WHKA 2IYSA 4AYWA 2VP4A 3TR5A 2VTKA 2DPXA 2YZ2A 3KJEA 5E4FA 5FOTA 1Z2AA 1OFTA 3B85A 5KDLA 4B6FA 2A7QA 1GP2A 2E9SA 3N2EA 4MRVA 3T1VA 2O0HA 3B60A 1KSFX 3I61A 3AEZA 3GJ7A 2HYIC 1SVLA 3C5CA 1X1SA 1KJZA 4HATA 3GLFE 4OK5A 2IT1A 5KNCA 1AM4D 2ZAOA 1CS4C 1N6OA 1UADA 1WP9A 4ZPXA 3VHLB 5CITA 2R6CA 1YR9A 3RDPA 1Q1EA 5G41A 2PJZA 2ZAMA 3O8BA 2WJYA 3KB2A 3RLFA 1Z0FA 3U3RA 1HEIA 1MKYA 4TLBA 1IXRC 5CLQA 2R9VA 3C14C 3DO6A 1YZKA 1Z07A 4QNMA 5GJCA 3W9YA 3VMFA 4DEXA 4P4TA 1M7GA 4RCZA 4BFSA 1UFQA 4M1TA 2FFHA 1X8LA 2R6AA 5AR1A 1QRAA 4LGMA 1IQPA 1E0KA 4B44A 2O52A 1DO2A 5FFMA 2YNMA 4TL7A
chains in the Genus database with same CATH superfamily
1Q1ZA 1GQQA 4ZREA 3IUBA 1H9CA 4EGAA 2G07A 3AUUA 3ANNA 2Q62A 3L93A 4HAYA 1OFGA 2IHUA 3ZHCA 5HS4A 4G07A 1KYZA 5ADWA 3HFRA 3VH4A 3VDNB 4LHEA 4GL2A 5AJUA 3KJZA 4G0MA 2TRSB 1ZWLA 3DM9B 4DDVA 2XCSB 2QIOA 3NEAA 4KHZA 4K40A 4UC0A 4M1OA 1XRLA 4AX4A 4JT8A 2XZOA 3TVDA 1EJBA 4MPTA 2A92A 3AI3A 4TL9A 4DV6B 1WY7A 3ZGLA 3JARA 4OGFA 1EXNA 1DKLA 3QP9A 3OCUA 4S2EA 3SEQA 4E11A 4G8BA 4FDVA 4RK1A 3HDHA 4RQBA 3M5DA 1A2OA 1X38A 2BUBA 1V8OA 1QK5A 3LRPA 4JNKA 4Q3BA 5ELLA 3ZH9B 5F98A 4PZ9A 2PL5A 3FPKA 4H35A 2YWGA 4E4TA 4JA2A 1A27A 1EVQA 4PC6A 4PF1A 4XDYA 3VDQA 2I2DA 4CM8A 4EENA 5JOQA 1USVA 2CJYA 1JLSA 3B9QA 5I7SA 4E08A 2O59A 5E4JA 4FC6A 4KMSA 4PR0A 2G4LA 3U1TA 2WTAA 3NO4A 2GO1A 3H2HA 4GLLA 2CYAA 1QK4A 1AVTA 3L4JA 3H5RA 5C4GB 5CDFE 3LT1A 4LNUA 1RQRA 1T36A 4L8GA 1U2SA 2FPKA 1BYIA 3FVWA 3PEWA 4Q0MA 1ISPA 5CGQB 3U7EB 5AVJA 3LD9A 1NUAA 2PUDA 2P11A 2YVLA 2XE4A 2EW8A 3QBDA 4RE6A 3AEYA 4D4JA 2HSEA 3IQEA 2ROQA 5CDHA 4UARA 1PV4A 1BQ4A 2AFHA 1TD1A 2FSUA 2HK8A 3LU1A 3PUVA 4J16A 4LZZA 3MMXA 2GN9A 1MBZA 4AJIA 3H5AA 1YVDA 2WA2A 4UAVA 1SUDA 4XFDA 2ZATA 1AKRA 1M83A 1IY0A 4FNGA 4HYTA 2RGCA 4QHSA 4EECA 1PK8A 3RJZA 3WYGA 5EUBA 2B9VA 4IDOA 2WM8A 1PNRA 4MP8A 4QLOA 1YQEA 2O48X 1V1JA 1GG9A 2Q8PA 4GT1A 4EO7A 3BFKA 1SHZA 4IWNA 3IVXA 5K3CA 3S44A 3TCNA 2PSFA 121PA 4E46A 1NUPA 1P62B 5ALNA 3ZG6A 4YXFA 3GFVA 1HL7A 1P7CA 5E7MA 3WL6A 2UZ1A 3KTAA 1LLUA 2AKEA 4WOKA 3CWZA 2FSFA 1P31A 2G67A 4JFRA 4LFAB 3X44A 3ZE0B 5DVZA 3R7DA 4RLQA 1ZOIA 3E8MA 4X92A 2GEKA 3OEEA 4BN5A 4E70A 2H6EA 5AK6A 5AM1A 5AUQA 5D6NA 1GNSA 3CZAA 3NHRA 4DHEA 4BQRA 1T5LA 8GPBA 2XYRA 4H18A 4UZSA 5JAPA 1BFUA 3NT2A 1Z47A 1KH1A 4A8PA 5C1PA 2EKBA 1SXJB 1Y3HA 3Q7TA 5LA6A 1D5CA 1G5QA 4HN9A 4MVJF 5HTKA 2O8FA 2WWRA 4KR9A 2PZGA 4B85A 3UATA 1ETHA 2UUCB 2MYUA 5ESDA 1NDHA 5HRAA 1RRMA 3C4JA 5BYJA 3KQNA 3DL7A 3DVQX 3TEJA 5KQLA 1ZUWA 5A0VA 5SZJA 5DH9A 2DBVO 5NULA 4ESEA 2ZREA 1JXQA 1TRKA 1VHWA 5LZ8A 5EKTA 4PYNA 2GM5A 2Q21A 2QRQA 3ONVA 2VDOB 5BNWA 1WU7A 3DMTA 5A4DA 1LQUA 4ZQEA 4C0SA 3AY0A 5EYPA 3C6QA 3KHKA 2PX6A 2ETVA 2HK7A 2X4GA 4HUJA 3QVVA 2QUBA 4KKXB 1JN0A 3SZRA 3VNQA 2WFMA 3CCFA 3I1YA 1NJGA 1OU0A 4OB7A 2B0JA 2VXYA 1C30B 3TJMA 1SQFA 4I2VA 4RADA 1EE9A 4F3RA 4L08A 4OP3A 5HFNA 4OX9B 5ESXA 3C98A 1AGXA 5FTKA 3W6ZA 2VTDA 4OYLA 4JI5B 1IFXA 3CB2A 3D6HA 3NYRA 3U4QB 1IBMB 3GXBA 9ATCA 3O31A 3E27A 1EHIA 1GN8A 3C3EA 3KXDA 4NQZA 1ML3A 1PLKA 2X41A 1N2CA 1UJBA 3CWCA 5EERA 5IEJA 3HTXA 1PNTA 3BGOS 4YI3A 1Y8RB 4OHYA 3BERA 4RGQA 4H3KB 3V1MA 1P5RA 1Y6QA 3U26A 3IHWA 3PLRA 5FPYA 4JU9A 2QV0A 2JIOA 1C29B 3A04A 5SZKB 4MW7A 4F84A 1IWOA 4ZI3A 3ZBQA 2P4EA 1I7PA 4CL0A 5L53A 4BWVA 2DHEA 3ZE7A 1IOLA 1ZUNA 2Z0MA 4B35A 4LY3A 4M2LA 5A4IS 4FYHA 4NK5A 4BB0A 3BSYA 1NQOA 4FI3C 5E3IA 4D4IA 1BG6A 4RIIA 3TECE 5KYXA 3N2ZB 1U2EA 3MWEB 1F0PA 3U60B 1XI2A 4YCDA 4CUKA 2CNKA 3F90A 3CXUA 4DR7B 1LDMA 1Y5MA 1R0KA 2ZIVB 4HDNA 2FX3A 1VOTA 4O6VA 3RIYA 2P9GA 3ACCA 1YS6A 3NQ41 2RFLA 3MTBA 5TXGA 5COBA 3BB3A 1CW2B 2BFMA 3IOMA 3NAQA 1UZUA 5EIAA 5FYDA 1BDBA 1NBAA 4JVNA 1NOKA 1L5NA 1BQEA 1M1NA 3UXYA 1FDSA 4EYSA 1XU4A 2CLDX 2G7ZA 2QLTA 3CZMA 2BI8A 3STTA 4DLNA 1N8NA 3LWNA 3OQNA 3BGIA 1T5HX 3K1AB 1DCMA 3E3LA 4O4LB 1KI7A 4CF3A 3W2HA 4E5YA 3D0QA 2PKEA 3DKPA 4DAOA 3MWJA 1DIRA 3QOFA 1R4MB 3D8SA 4ZZ2A 4RY8A 4M4SA 3X2EA 3OQOA 2OCIA 2P9CA 1WPGA 2C3YA 2JI7A 1R0ZA 4W1PA 2JBAA 3NIBA 4QU8A 4KE9A 4GYKA 4NHOA 3F6BX 1V4NA 4D02A 4DNFA 1R7RA 4IMPA 5JXGA 1ECGA 2FPGB 2GJ4A 2QYHA 1WABA 4COOA 1XSEA 2PBRA 4EYQA 2PYZA 2ZRDA 2BFBB 3BTVA 2CW5A 4YJGA 3B53X 1WSAA 4FHDA 3ZGVA 4BNXA 1ZN8A 1RWVA 4C7BA 2OHOA 3IP9A 3N0RA 2XMSA 3IOCA 3UGTA 4Q05A 4Q9NA 1RYHA 3DT6A 4CUJA 3VR3D 5JJKA 2NU8B 2L17A 1MC8A 3CRZA 4EQ6A 1A2KC 4IDEA 3GI1A 4WEOA 4H15A 5K3SA 4QAQA 5IVHA 1KFBB 2HNKA 2WOOA 5HUQA 3SEFA 1LBTA 2JLSA 3GA7A 1M0SA 2QPLA 1TOAA 3ISTA 1IB6A 4EKNB 1U9YA 3RYIB 3VR4D 1S1CA 4MVCA 4IRUB 5JXIA 4F3TA 2BMJA 2QW0X 4YI5A 3LCMA 1XAHA 5EZYA 5FWXA 3QWHA 4H7FA 4RX1A 5I7AA 3HCFA 2A0KA 3P2KA 4KXXA 3M83A 5IVPA 2Y71A 1QLWA 3S8MA 4KPUB 1U28C 5CX4A 4ENPA 4FCWA 4XDZA 3UNXA 3UQYS 5DDIP 5IF3A 2YHBA 1OLUA 4JN6B 1HY3A 1GQ2A 2DHDA 4OBBA 1VRCA 5CLIA 2GYYA 2JI6A 1ONBA 3EPKA 1SKYE 2O2CA 2EWWA 2D62A 1BH2A 3PE6A 2FF5A 1QIKA 4IILA 3USZA 4AF7A 1UM9B 2XGOA 1CYDA 4M1QA 1JV2B 1JTFA 4H4DA 4AY2A 1E1CA 2C07A 2VS1A 5BQOA 5KYYB 1KKLA 4WGGA 3E1KA 3TNDA 1V3UA 2CF6A 4MB0A 2WYIA 2E49A 3MTIA 3RG8A 3WSTA 3H5VA 3ZHZA 1SC9A 1J07A 1QHIA 3BIWA 4LKRA 4NAVA 4P6VF 4D97A 1CF2O 3WQQA 3UG6A 4P4SA 3QWBA 4P3NA 3V8EA 1OFUA 4XYMA 3T9AA 4JELA 3VAYA 1T2CA 4E94A 1IHOA 1FL9A 1W5SA 2CDAA 1U7TA 2AOWA 1DJQA 1RR6A 3HSSA 5CEEA 1D4FA 3E82A 4F92B 3LE8A 1SEPA 2UYGA 3BG5A 4KO2S 1WUJS 4LYJA 4A2CA 3DCNA 4ZAVA 2ODBA 1XZIA 3NRBA 1ZS9A 3K8ZA 1IUKA 1EPUA 1K5GA 2QIPA 1W5EA 4X54A 1X1EA 4DJEC 5JXWA 3QLVA 1KQNA 5KOJA 3IHKA 3WICA 3L8DA 3LQKA 1WXDA 2C1XA 1PGJA 2YYYA 3NTLA 1YOBA 4ZU6X 2E1RA 3DM5A 5JH7F 4TL8A 2Y1KA 3ZGNA 3QSYA 4TWIA 3B38A 4OSEA 4ER3A 4L6CA 3JX9A 3O90A 1K5DA 3VU9B 4CM7A 2IUYA 1WF6A 3RTDA 1GPWB 2YV4A 1NYLA 2O19A 3I9LA 2ZVQX 2I67A 4O2BA 3EVBA 1RD4A 2Q1UA 3G9TA 3QKSA 4LHWA 5BSMA 3TLMA 4R1PA 2ODAA 3FDXA 4RJLA 3DOJA 4HWTA 1CNMA 1FYWA 1SKYB 4Z7OB 2PR2A 5CCXA 2HCTA 1JWLA 5KKCA 1U94A 3PDCA 4J1TC 4TV9B 3QHPA 3EE6A 1A9XA 5DX8A 3UK7A 4DCSA 1NPDA 4AY3A 5AK5A 3U3ZA 4DSNA 4TMKA 4CIYA 5J23A 2ANCA 4NFSA 2OZVA 4JQZA 4YLEA 4DCMA 5CFPA 1OLSA 3ADOA 5HTOA 4LRUA 5JFOA 4UKDA 3LA6A 1SWVA 4RL6A 2M9MA 3R7FA 4NECA 3COYA 3GJXC 5DK4A 1C4KA 2JJQA 4Y2TA 4IIJF 1VRVA 3GT3A 1MJNA 3CNBA 1QZTA 1ZONA 2VK8A 4KV9A 4W4TA 3UMGA 1ZNYA 3X1WA 4A2QA 2J9ZB 2RG7A 3LUDA 4QGBA 2HHHB 3AJEA 2OXIA 3NIWA 1JQ5A 2F1KA 4XH9B 4AKSA 5IDQA 5LVAA 1A5SB 4PXAA 1A5ZA 4KRGA 5DTRA 3UMSA 4KWTA 4BV3A 2YUTA 2ZS9A 5LP6F 3NIFB 3I5AA 5I7VA 1EFPB 2A94A 2XB4A 5D5QA 1BE1A 1P2TA 3OURA 1O94C 3FOZA 1N32B 3GMDA 2AQHA 4NARA 4A0GA 2CLLB 1ZK1A 2CUNA 2WU3A 3CGWA 3KSRA 3FCXA 5EXSA 3VJLA 4C7XA 5JBIA 3EYAA 1YIDA 3SQNA 3JQGB 1SAYA 4PPYA 3KWJA 4HNAA 5FBZA 4Q3DA 5K4HA 3VPDA 2Y1WA 3P9ZA 2C7QA 1R5NA 2FEKA 1QGUA 4P2GA 3AWDA 2EX0A 3HSKA 1AU9A 1Y9EA 3IA7A 3IUMA 3PR2B 1O6BA 1ZIOA 2JIZA 3E8SA 3THRA 4B8YA 4DIMA 2J5XA 3ENZA 1KBQA 1L4UA 2C5EA 3K1AA 1VL0A 3PQ3A 4BZWA 4EG1A 4QGFA 2JRLA 2RSLA 1JFFA 1KEPA 1O94D 2RKOA 2PWPA 3FAZA 3EQ7A 3EH2A 1HYEA 1ULUA 2E37A 3DZFA 1SM4A 3HB7A 4FHCA 4M9UA 3T7CA 4GP9A 4ERXA 4AJ2A 2YN2A 2MSLA 4X7RA 1CNEA 1RBZA 2ZE7A 4HI0E 2WG2A 1R0WA 2XTMA 2AN9A 2ZJYA 3DZ8A 5DISB 4ZAXA 4C43A 3O1HB 1BDIA 1ZW1A 4WGFA 5I01A 3C3CA 3RIHA 3SU8A 4HP8A 1E89A 1UEIA 3GELA 5GOZA 5KSYA 4GD3Q 4TVKA 4XASA 1LCIA 4NDZA 2ZOSA 4DQUA 3NVMB 4M1EA 1RRVA 4O0LA 4WKPA 3A4LA 3S2IA 2IKSA 4AU1A 1LPPA 4CLOB 3Q4GA 4K9QA 1CDDA 4WUTA 4E12A 2I9KA 3B2EA 4EHKA 4EVSA 1TRHA 2YMQA 4BFWA 1N36B 1OXSC 3EBOA 3QFHA 5BOSA 2YZGA 5LQMA 2GCNA 2Q6VA 5ALPA 3LO8A 3VZBA 4Y7DA 2C57A 4P7FA 4HN4B 4AO7A 2REOA 3IEVA 2IYLD 3EW9A 4II2A 1HG0A 1ZK4A 2G36A 3I0MA 4MR9B 1FYEA 1F8FA 4GW3A 3STHA 2Q5CA 3WKAA 4R1LA 1RADA 5FWXB 1XXHB 4ER0A 2BGJA 3JAKA 3O73A 3R3YA 1H8HA 1BFDA 1KR2A 1L7OA 5TMBA 4QREA 4D8VA 2RGUA 4MYUA 1MDFA 2W2LD 5KYUA 1O03A 4HFJA 1CY1A 1F0KA 3D6AA 2Q4EA 3ETGA 1NJSA 1O97D 2PUTA 3JU3A 3IOEA 4N5DA 3AKZA 3LI2A 2PGLA 2G80A 3HJAA 3D7MA 5LMCA 1IWBB 2H65A 3CUWA 3Q6NA 4EHDA 1GNQA 1WXIA 2VLBA 1BCSB 2BFFA 1EFVA 3G2PA 3O93A 3O4IA 3Q7PA 3DMPA 4KQ2A 4PYLA 2Q7OE 3SQOA 3TSZA 3DXYA 1HE5A 3O0DA 2O8VA 3UJPA 1KU6A 2IHNA 2B8NA 4DLKA 2BMAA 4KR0A 1SUWA 4RW0A 3VGPA 2CMFA 3FM9A 4FXOA 1OZ0A 4A82A 5LQSA 1A4XA 2VCYA 4AJOA 1M0EA 1E1CB 2OZEA 2Q9BA 3GEIA 1E4VA 3PNSA 1QAQA 1SPXA 2F8MA 3EYWA 2IU6A 1ESEA 3BH7A 3COJA 3ESQA 1DT3A 1HT0A 3PCTA 3UGJA 2C92A 1DTWA 4IZOA 1I7QB 3PYMA 5CBPB 1JLKA 1OXKB 3OLYA 4B3GA 1DEXA 1UXHA 4XDHA 5H1YA 1JHXA 1J0BA 4X6LA 5D1NA 5A5GA 5IJ0B 4GMHA 1J21A 3B6IA 2ES4A 2EKDA 4IDPA 3HFGA 1G5RA 3VKHA 1UPTA 4Y2HA 5CW1A 4EY5A 1YZ3A 5KOJB 5CVVA 5AJZA 4A7PA 4AG5A 3FMPB 4NULA 1H2XA 4R0MA 4CMIB 3AY3A 4MNTA 2VSXA 4KWIA 4LWOA 2BJWA 2EYUA 3R9KA 3IO5A 3E18A 3TXXA 1Z15A 3GD5A 1WULS 4B6RA 3GAZA 4UE6A 2YWBA 4TYQA 3S3TA 4DRXB 2FN9A 1U3VA 2KX7A 1P6XA 3G5LA 4MYSA 1N7IA 1H5UA 3OZXA 4PLVA 2O3SA 3QUAA 5CMLA 3TDNA 4C2AA 5SICE 1QHXA 5FLYA 1M54A 1W85B 2I03A 1ZG3A 1DDGA 3P32A 2G0TA 2CE2X 3OZ7A 2DB3A 5IPFA 2OFWA 2XE6A 4RZQA 1J22A 4D9MA 3MNFA 4BAGA 1RJEA 4C0AC 1K7CA 3DNFA 3R7WA 4TVSA 2ZRIA 1XPJA 3A6LA 1T91A 3S40A 2ZR0A 4E5UA 4O4HB 4A0HA 2V74B 3T9DA 1QXSA 4H31A 4YRQA 3PKZA 3EAFA 4YCJA 3NP9A 3WGIA 4NYMQ 4O2AA 2GZ3A 3REGA 2VRCA 3KAQA 2OO5A 3U3XA 2H5LA 3OE1A 4WK6A 1NONA 1HOXA 2G40A 2YZNA 2EL9A 1YO6A 3AFOA 4KXUA 2R5NA 4EATA 3Q9NA 4TKUA 2PVSA 4KUHA 5A5FA 5HMMA 1HKHA 4C4PA 1NFQA 2HJRA 3ESDA 3W34A 2Q9AA 4Y2GA 4GDFA 1PZXA 2R25B 4P84A 2GJ9A 3OEHD 4HF7A 3BMNA 1MORA 1UAYA 4OJKA 1MV8A 3ETEA 1IDN1 2AV6A 3ZVNA 2XVAA 2GB4A 3OKAA 4Q1DA 4RXMA 2QT1A 2C4NA 1NVVR 3H7AA 1DARA 1JMVA 4HAOA 5JSFA 3T1TA 1U0HC 4BMZA 2ZI3A 3PZRA 4PPQA 2J7PD 3BGVA 4Q3EA 3RF7A 1H94A 2Q5LA 2WJ3A 3H75A 5C2JB 4HNAB 1PFYA 4X8HA 2ZU0C 4FJ1A 4NS4A 4QU0A 4W8HA 5JVDA 3T4PA 3UN1A 3I2HA 3T7JA 1WZIA 4HPJB 2YIVX 1I8TA 3R3JA 3GLTA 3CG0A 4G8DA 1YI8A 4Z7QB 5TQVA 521PA 2BHLA 3GJ3A 3LDHA 3SC3A 4BO2A 5CXXA 2CGEA 3OHPA 1IG3A 621PA 5EMNA 2Q3FA 3PF8A 2AK2A 4OHCA 3X1XA 2R3SA 4IXNA 4PSUA 4EITA 1FYFA 4QO8A 1M3SA 1V95A 2EARA 2O57A 3TJZA 3TB6A 1P8AA 1MO2A 3HRIA 3L9WA 2I54A 2OK8A 3MT9A 4KFRA 2JFHA 3S4YA 3HV2A 5DB4A 4CLEA 1VZ3A 2Y68A 4AJ1A 3QPVA 3N28A 1CZLA 4K86A 3AIMA 4J7XA 4MW4A 5DI3B 5I9TA 5LZ7A 4ED9A 2OB1A 5EQTA 3LYUA 4M37A 2Y0EA 5ALQA 4B7ZA 2IW3A 1YA8A 4Q4JA 4WQMA 5GJBA 2A4KA 3GNSA 2EKPA 1H3EA 1TZCA 4HAVA 4WFKA 3GJQA 1Z83A 4ZOBA 3IILA 1EI9A 1UZAA 3MOIA 4TT3A 3WGNA 5KB3A 4Z53A 3V2GA 5CW2A 3AI1A 4EKDA 2J59A 4C2UA 4F4IA 5IZCC 2I71A 3ER8A 3CPHA 1RP7A 3FDZA 3M81A 1FP4B 5AMXA 4N5MA 4QEKA 4P33A 4PZUA 4XIJA 5C4IA 1A88A 4EZEA 3RCBA 2HA6A 2VA9A 3KB6A 1IZ7A 3FWZA 3QY9A 4DCGA 3GLIB 1IEXA 4KMOA 1RAEA 4LCBA 1I9CA 1SC1A 1HC7A 1EFRD 2W22A 4OKSA 3KSZO 1EK2A 5CM9C 3PYLA 3F5QA 1M8GA 5EAIA 3WIUA 4CMCA 1EG2A 3PI7A 3SOPA 4AUMA 3CE6A 3GVCA 1E1KA 1GNTA 4F38A 2F62A 3VZDA 2PMKA 4C0LA 4FUQA 3HJNA 1CIJA 2V7GA 3WJ2A 3ID6C 5HZHA 2XB6A 2EBWA 2M1ZA 2QG9A 4N48A 2YIDA 2C5HA 1X8KA 4JT4A 5FQOA 4QT0A 4Z9YA 4E7OA 1TZMA 1Z0AA 1UJCA 5DNUA 1BXKA 1X2BA 2Y8EA 3GZ4A 4GR4A 1EVKA 4EUEA 5C8YF 5JQGA 3EVFA 3T5TA 3IOBA 3O95A 4Q4HB 3MERA 5CDUA 2WKPA 5J2UB 3HMKA 3T54A 4BE9A 3JQQA 4EA7A 2Q2VA 2PQ6A 3TUIC 3TZCA 4RQUA 1CVIA 2DQSA 3NBXX 4MS4A 4A6DA 5J4KA 4BZXA 3L7AA 4YWJA 1FVFA 3HUUA 2WJ6A 2GEDA 3T7SA 4YQZA 3SR4A 1R4NB 2O3RA 4F8EA 3EW7A 3WDSA 5AXCA 3RRMA 4Z1MA 3OE7A 2N75A 3CU5A 4BOYA 3AVWA 3MOGA 2IUUA 4B3HA 2FR1A 3HYLA 5BR4A 3AUXA 1WSWA 2B2CA 5BN3B 1SY7A 2I1LA 2JFYA 2VSNA 4F7WA 4NYMR 2OESA 4OIFA 3CLUD 4J07A 3U4MA 5DCYA 3TUJC 2UYHA 4V0MA 1QF6A 1VSVA 2WF7A 3WQSB 2WTEA 3HKBA 4JI1B 1QQ6A 5KQPA 5TR9A 1DO0A 1YU6A 3P1JA 1R0SA 1U5AA 2ZWIA 1Z6GA 3ZZTA 1Q0PA 3RGWS 4QBFA 2H4ZA 4BLOA 2QX6A 1NATA 2WRZA 4XWTA 4TN1A 1U28A 5IT5A 2KQUA 4LMRA 2IYFA 3KT8A 3L5OA 1PJBA 1L7VC 2B8TA 2QN9A 1DOHA 2ZU6A 2QZJA 3L7KA 2XQJA 5L3SB 2VZ0A 4HWSA 1X9IA 5C8ZA 2VNAA 2QP4A 2FY8A 4Z9XA 3P19A 1XPRA 1HYBA 4M7OA 2GWRA 3U4IA 1S2LA 3UXHA 3A3OA 3BT7A 3FXAA 2MCFA 4QL3A 4Z0PA 4YALA 3RV4A 3VO2A 5JRZA 3PL1A 5C81A 5DX1A 4BC0A 4P7GA 2ZT5A 3IUQA 5HFJA 3ANLA 3INYA 2AJ8A 4XX0B 5JARA 4G1EB 4R1SA 4OLAA 1WCIB 4WLOA 3MPUA 4H2DA 3AJDA 3A3YA 2AHRA 5K0ZA 4XWKA 2AKYA 1LD3A 2ZSIA 3RPEA 3PGA1 5BXYA 3L6RA 4IF6A 3RWMB 2OQRA 3P20A 4INZA 3DWFA 4DYHA 4ZDWA 1E6LA 4QHYA 3QELB 4WV3A 3RVOA 4E14A 3W5CA 4OCZA 4RV4A 4OHKA 1J23A 4YCNA 2W42A 3AHEA 5H7XA 2IF2A 1R4AA 3PFGA 3KBBA 3KXKA 3F1LA 5FRDA 1M2NA 3OZVA 1AQYA 2C84A 2JAQA 3ZDCA 3BCHA 2J3EA 3EPHA 1FFGA 5J2TB 4X90A 2IVZA 1CUYA 3ZS9A 3IXLA 4ZC8A 1V41E 2UVPB 4XR9A 1CD5A 2JASA 1PTJC 2PCJA 1ZU4A 4B82A 1Y1SA 4B6EA 1IRIA 2IOFK 4A36A 3W9BA 3K20A 4JUIA 1GM5A 3VR6A 4CKWB 3U16A 3HVUA 1VJDA 3K4HA 3EFHA 3OZUA 1DXQA 2AA3A 1BCRA 1DC6A 2XDYA 2XYGA 3ELYA 1GJRA 2CDCA 3R5JA 4IJKA 4FEAA 3AJRA 4L4YA 4L72A 1OWPA 4YTEA 1A7AA 4HRYA 4I6JA 4IV8A 3EGOA 2TYSB 4RJJA 2WEKA 3ZI0A 4MGZR 2AJDA 4DSOA 3RH0A 4R5HA 3KR2A 1VRWA 3GGPA 4BZQA 4AX8A 4EHNA 4GOND 1M1YA 1CEYA 4IEFB 1IMOA 4Y9RA 2I6QA 1E66A 2PRIA 4DNXA 3C87A 5JWRA 3O2NA 4AICA 5LWQA 4YY3B 2MINA 1TAQA 1M5UA 2RHHA 3PXDA 2YYSA 4PC7A 3EMVA 4I50F 2XH8A 2ZS8A 1F6WA 4IJQA 4IQ0A 4DWWA 4IUYA 1MO6A 3QZUA 5IYZB 3KO8A 2P91A 4YJ3B 3RARA 4YIHA 1R9GA 1W4CA 1NV9A 2JVJA 4ZQHA 5LM3A 3QNUA 2A0WA 3NEYA 4E5KA 4NMXB 4EJ0A 4KQKA 3LZCA 4O1HA 4ZRMA 4A2PA 2A9VA 2C1EA 2Q50A 2D5BA 4LY9A 4TQGA 1TO2E 3STUA 1THMA 2QUJA 4BECA 1EXWA 4FFBA 3FWHA 4G9GA 4YS6A 4ZJUA 2OZPA 3L46A 3Q3IA 5FO1A 3NTRA 5BN1A 4FGKA 3SR3A 4ZI7B 4AY4A 4DDUA 2G08A 2IHTA 4BKUA 3EFOA 4QXQA 3IPLA 3Q11A 1R8SA 1DBPA 4UVHA 3A4NA 1WZNA 1ZMXA 3ZWAA 2BH2A 3QVUA 1IXYA 1WG8A 3L05A 1HE2A 4Q19A 2QUIA 4LFCB 3K5HA 4J3NA 3DL0A 3WL5A 4Q7QA 1XOIA 2QQFA 2WVGA 3AR3A 3G49A 3TQTA 4QT4A 1NPYA 1YZHA 1G8GA 5HHTA 2YNMD 4RELA 1AG9A 2CXTA 1ZI8A 2I66A 4MA0A 4DSZA 1TVMA 2JEZA 4R71A 1W36C 4H9GA 2X2EA 1O7JA 4K2AA 3DD1A 3UOAB 4HY3A 3HA7A 3VX3A 4AMYA 3KV1A 3W9UA 3UMCA 4L8WB 2B4RO 1NVAA 1POXA 5AJWA 1RU3A 4HMOA 3GJTA 2HA3A 5FI0B 3FBTA 4TMVA 1CRPA 5EGNA 2CL7X 5L3ZA 2YX1A 3WLKX 5JANA 5T6MA 3S5UA 3WNDA 1KYIA 1B41A 3OZAA 1HI9A 1NNUA 4BUCA 2PV0A 3F7TA 3RVNA 3HZHA 3G7NA 1LJUA 1GGVA 4NC9A 4TV8A 4NMWA 4QWWA 3F9IA 2VQ3A 3ZCTA 5AVXA 1T0HB 4UVIA 1BVUA 1UBNA 2AHOA 2C95A 2ZZMA 3P9KA 1FNMA 1BVYF 3OZSA 2B34A 3KXPA 2QYTA 1Z5PA 4GXTA 1UWLA 1T3LA 1MFPA 1OTHA 1RYDA 3KTDA 5BN5A 2YVQA 5ADHA 4S05A 1DV2A 2P8SA 3ZZUA 1NLFA 1C2TA 3NOOA 3TLBA 2AN1A 3D0KA 1GARA 5LA6B 3WFZA 1VFPA 1BWSA 2ATCA 2JCBA 3LPNA 3HKBB 2BCGY 4HUQA 1FX0A 1W2GA 3PHLA 4BGDA 4W63A 8MHTA 4TSFA 1KSGA 1U02A 4U9IS 1JIUA 1M2KA 4IHQA 2VJQA 1GZSA 2C7GA 5F3DA 4AJLA 1H4QA 4QDKA 1TVKB 1U0EA 2GYWA 1WEHA 2ZGVA 5LYYA 3MMZA 4Y2QA 4EHIA 1W9HA 3RJTA 4KDRA 1GYQA 4NATA 4U6QA 4L76A 3P0EA 3EXG2 3OQVA 3IHTA 1T26A 2J46A 3GF4A 5BW6B 1HR0B 3NWOA 3SQWA 2B5OA 2P65A 1BMTA 3EHEA 4KOEC 1ADJA 5B6IA 1VSUA 3F2VA 3S55A 3H1EA 2OYSA 1E2PA 3M6WA 1UBJS 3H2KA 2EW1A 4M7RA 3VPBA 1XZLA 2PXAA 4IFTA 3MMPA 4OQXA 2P9FA 4BMNA 3LKBA 1LPNA 4NZ9A 1DADA 1PJLA 3N39C 3T7KA 1JJBA 1XKLA 4PAQA 1OAOA 1THZA 2EQBA 2JH3A 2P9EA 3U4QA 3HXKA 4V2IA 3WBBA 3ED5A 2JGNA 3Q7SA 3KAPA 4R2MA 4NWIA 4KPYA 1JHQA 3RE1A 4DARA 1XRSB 2GDZA 4HEA6 4CIDA 4BFYA 1KC1A 2WBLC 5K0CA 1LSUA 1FX1A 5BMVF 2DBQA 5B4UA 5H83A 1GSOA 3UVEA 4EF4A 4JBGA 3ZD7A 3V8BA 2BHSA 4IMRA 4DIOA 5CEFA 3VHQA 3EGIA 4U7HA 3AM5A 4M54A 4IGKA 1KJYA 4QYWA 4ZMRA 4IAOA 3SX0A 1A5AB 2X5JO 3IRVA 4OHOA 1GYPA 2VYNA 2XY4A 1OV6A 1TX4B 1UBRS 3NMUF 2C8LA 3LVQE 1OWOA 5JADA 4RGVA 4EFKA 4TMYA 2ZJ8A 3ZW8A 4F3NA 3QLEA 2L0XA 4IIBA 2GK6A 4JP2A 2IPOA 4XQGA 1T9GR 4QDXA 2QB5A 2FCAA 4I8XA 3HVHA 221PA 2OHIA 1BMDA 3DDSA 3O74A 3CF2A 5FBHA 5IUKC 1K8YB 3UHFA 4D5EA 1B00A 1V48A 4KZKA 4MQEA 4FZJA 1V3VA 2BP7B 3TD9A 1FUYB 1E92A 1YB4A 3DOHA 4OAPA 2F8LA 2YC4C 4JJFA 1KY5A 3NDRA 3WO1A 1GTG1 3QYFA 3RR2A 5HKAA 2EERA 3C43A 3UMVA 1UZNA 1U9JA 2K5UA 2PKRA 3PQCA 4BVGA 5ALJA 2CK3A 9LDTA 5DNYB 1E77A 5K0JA 4X62B 4Z8YA 5BNZA 5JW6A 1R74A 4QODA 5LFAA 1XAGA 4O4IB 1NW3A 3W78A 2W6JA 1XELA 1P3DA 2VYFA 3CLSD 2ZRKA 3KS9A 4QOHA 1SIWA 2R2GA 3I1FA 4JEUA 4L4XA 1X7DA 2AF4C 2QHXA 3NLLA 1C3EA 1E94E 3Q5EA 4FOSA 5HF6A 3M6XA 1BYUA 2AWNA 2WVHA 2V5UA 5BN4B 5KYTA 2F1OA 1TB4A 3UG7A 2EC5A 4GI1A 1GTJ1 1DEHA 3GIWA 4LRXA 2J0EA 3LBYA 1QRTA 4LVCA 4WVLA 3W04A 1XLVA 2I3BA 3NCTA 3AQIA 1M8FA 1W4AA 2RH5A 3G8CA 3KE8A 4W5OA 1Q0SA 3O7WA 2O2XA 3A26A 3WZLA 5DYNA 3T12A 1OYYA 2Q8NA 2EQAA 3F5DA 1NUTA 3P2OA 1ZVKA 2PSSA 4YJGB 2VSFA 4MVJI 4K9SA 5HJ2A 1P2UA 5AI9A 3A1UA 2V6FA 2WPDD 4IXWA 3U3MA 2R48A 1V7PC 1MQ8B 1X80A 3CKKA 1P73A 4FQ5A 1XXHE 4J0DA 4P81A 2N9UA 4RQTA 4XCQA 5H5JA 4BU0A 5AI4A 3RS9A 2AUMA 2IDZA 3IBGA 1XZDA 2V3VA 1YE3A 4HAXA 1U2RA 5JNLA 2ZSJA 1XMQB 1P1KA 2I99A 2QE7A 1Q0TA 1P18A 2R7MA 2ZWOA 1HNWB 3U62A 4OH1A 3B1YA 4IDAA 3O9VA 2D7JA 1PL8A 2WIAA 4JASB 4P5EA 4CTJA 3L06A 1MOZA 1ANKA 3RLIA 2WZCA 3V7FA 4DDWA 2G3YA 2BW0A 4M88A 1XX6A 4X84A 1V5EA 2H3EA 4E33A 3RIEA 1EK6A 1KEUA 1Y6FA 1JTVA 4NMHA 4AZSA 3M5PA 1EVZA 3F8TA 1FRVA 4M60A 3D7LA 1E7SA 3PCXA 3ZGOA 4B3BA 4CF5A 3INTA 5B1DA 2J9XB 2WKRA 5JPDA 2A0XA 4M1SA 3VZQA 4I3HA 3QVGA 3LHFA 1J00A 1VIYA 1JKIA 3I9V1 3W05A 1K8ZB 3VA7A 4EKEA 1YUMA 2Z3VA 3CPSA 3QW4B 1BWQA 1J8YF 4BNTA 1T8PA 1OZGA 2DOKA 4OQEA 2M32A 5DHUA 5LP6B 3PEVA 2C94A 2WIGA 3JSXA 3EWIA 4P3OA 5FUXA 4A03A 4EJSA 1EFHA 1RYYA 1YHNA 1ZD2P 3Q9LA 4V1CI 1TDJA 1WNFA 4MGHA 5HOQA 2G9RA 4FCCA 2GCGA 3AEUA 1EKXA 3BOSA 3DPUA 3PV0A 2W5UA 4ZQFA 4AYTA 2ZR7A 4FBMA 2RGBA 4ONEA 4C07A 3H04A 2WILA 3ORSA 5T4FA 4B33A 1AA6A 1U0GA 2W2KA 4X3CA 1HDEA 2VCHA 3L82B 1M72A 1QX4A 3KDAA 1PFVA 3C6MA 1FPMA 3FTCA 4CMGA 4YT8A 1P4SA 5K09A 1P2VA 1QO9A 3DULA 1Y4DE 3G85A 3DZIA 3A4VA 5DN6A 1OLOA 3JYHA 3OTGA 5I9BA 3NDBB 2K7FA 1ABFA 3K2QA 1THTA 1WAMA 1JFVA 2QN8A 2DY0A 2QU7A 3SS8A 1OZAA 1JDBB 3MM4A 3ABQB 5ECDA 4DILA 3BDIA 4LOLA 5K8TA 1PFGA 1W47A 4ARVA 1IXKA 1RTKA 2BKVA 3FSEA 3L6UA 1MJFA 4ZVNA 1YHZA 1F2TA 2HT1A 3A1EA 4PICA 4U4AA 2VCEA 5FPKA 1IONA 3H13A 2A9KA 4TM8A 3RBXA 1O96B 3B6KA 1RRCA 2OBMA 2XNCA 1B8OA 1E4EB 2A9FA 5ILOA 2OSBA 2BT4A 2ZAIA 2CLMB 1Q3KA 3OMXA 2R62A 1G8JA 4FFWA 4JJAA 2NTVA 2AF3C 2BL4A 4QVKA 4E3WA 5JBQA 1YB6A 3TQQA 1ULTA 4RTQA 1UODA 1DC5A 1I1QB 2CBGA 1K6XA 2QVZX 3ZV7A 4RA9B 1P17A 4DSTA 4DV2B 4U2FA 2M98A 2YJTD 1VDMA 1D4ZA 4W82A 4MMYB 2Y67A 4B3IA 4EHAA 3MEQA 3DS8A 1B4DA 4DF3A 3H87A 4GSYA 3STWA 2H16A 4ZALA 5NLLA 3ODPA 1TJNA 4J94A 5JSUA 1Z5VA 2YQ5A 1U5BA 2ZANA 2JVIA 1I3MA 3QHAA 4IMJB 1RYZA 4PHFA 4UM9D 4B6OA 1N0WA 4NNJA 3QUTA 2GZMA 4C7MA 4DIKA 2CKMA 1WOYA 1G4UR 4R8LA 2V4MA 1NE2A 1DAPA 1OW3B 2F3PA 3EGCA 3P0RA 4LTNA 4ITRC 5CT8A 3TLYA 1OA0A 2XMCA 4FGWA 3CIFA 3R09A 1UC8A 4Z2YA 4HNHA 3V2UA 1VE9A 2JARA 3VJKA 4JXZA 4Q4LA 4L0CA 1NXVA 1OCEA 3A3PA 3I01M 2QVGA 1FMLA 2Q4TA 3IAFA 5J5CA 2P9YA 4W9NA 1SN7A 3OE5A 1GV1A 4LX0A 1ZICA 2DU8A 3H1TA 5KTOA 2I29A 1C2YA 2GGSA 3K09A 4UUMA 2QROA 3HMQA 1YIAA 3G8DA 5HKKD 2B8JA 1FYVA 3IP8A 4G23A 1UMDB 1CP3A