2P78A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGAMEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p78A00
1C80A 5AJYA 4FDTA 2YN0A 3OI7A 1H2EA 3DB1A 2H4ZA 2P2YA 3FJYA 5HR5A 3ZHCA 3E9DA 4D4JA 1BQ3A 4HBZA 2H0QA 3EOZA 4QIHA 5AK0A 3F2IA 2WU0A 1SKAA 3IT0A 1K6MA 4JOBA 3R7AA 2YN2A 1RPAA 2PA0A 3QPVA 3LG2A 2BIFA 2EKBA 4E3WA 2OWDA 3D8HA 4ODIA 3F3KA 4PZ9A 1ND6A 2ENWA 3GP5A 4PZAA 2OWEA 2P77A 3O0TA 5CX4A 2P6OA 4TSRA 4IJ6A 2P75A 1EBBA 3FDZB 4JOCA 4AROA 1QFXA 1CVIA 1UJBA 2EKZA 2IKQA 4JODA 3NFYA 2WNHA 1FBTA 1E58A 1T8PA 1FZTA 2P30A 4IJ5A 2AXNA 1BQ4A 3PGMA 5AJXA 2H4XA 2QNIA 3LL4A 5AJWA 2H52A 1BIFA 3FDZA 3GP3A 3LNTA 2P6MA 3K4PA 4PGMA 2P78A 1H2FA 1DKOA 3HJGA 2HHJA 4ARSA 4ARUA 3NTLA 2WNIA 2A6PA 1RPTA 1DKMA 2DWOA 3IT1A 2P2ZA 4MA4A 2HPAA 2P79A 2GFIA 4EO9A 1SK8A 2EOAA 1C7ZA 3E9EA 1DKNA 2F90A 1SKBA 2P9YA 1YFKA 3DCYA 1V7QA 1QHFA 1QWOA 3KKKA 1DKLA 3QPUA 2P9FA 3QPWA 1TIPA 3E9CA 3IT3A 1DKQA 1XQ9A 2RFLA 4GPIB 5CDHA 1ND5A 3MXOA 4D4MA 1UJCA 1C81A 1V37A 5PGMA 1IHPA 3D6AA 3MBKA 3BIFA 5AJVB 1E59A 2A9JA 1NT4A 2ENUA 4ARVA 2P9ZA 4GPZA 5CU7A 2I1VB 3IT2A 2DWPA 3K4QA 4D4LA 1YJXA 1SK9A 5AJZA 1RIIA 3D4IA 3EZNA 1DKPA 2HIAA 4EMBA 4D4KA 3GW8A 3C7TA 4FDUA 5HTKA
chains in the Genus database with same CATH superfamily
1M1YE 4Z4CA 4BLSA 3EUWA 5JD6A 1MX3A 5JAIA 5KUTA 3S2EA 3M9XA 3ZHYA 3GFBA 1U1GA 1AB5A 2VI5A 5F1YA 3I04M 4AICA 2KMLA 2PX4A 2HLDA 1FLDA 2GBPA 3I4FA 2XQJA 2WFZA 4PPYA 4TMFA 5LBUA 2ZSFA 1NU8A 4GD3Q 3HU3A 3OX1A 2ZIVB 1YR2A 2C5FA 3DHYA 4IOJA 5E6UA 5SY9A 3K0FA 5K6AC 1MQAA 3K8ZA 4GBJA 4RF4A 5U4XA 6ADHA 3QZUA 4NS4A 1W87A 3W5HA 1PJRA 1T4DA 4P82A 4MUEA 3RS8A 2FRDA 2J32A 3HRKA 3ICQB 3NTOA 2V6FA 1GZHB 1GFZA 4PHGA 4LZAA 3WL7A 4WHMA 4R0MA 5AM2A 2P77A 5LP6F 2IGTA 4QSMA 4XIFA 1RLUA 4XZ3A 1D1PA 4V0QA 1SVMA 3HRHA 4IUYA 4JA2A 5F2NA 3EXIB 3FNHA 1V4NA 2EAUA 2XCQA 3TIIA 3UJPA 5K0CA 3UGKA 4NESA 1QM5A 1K3FA 2AG1A 1M10A 2PN1A 3HYNA 1FX1A 2RJ3A 2PH5A 3U19A 2HSEA 1WRBA 5JS8A 1KEPA 3WL8A 3C5HA 4TPKA 1YIAA 1USVA 3LUFA 4HN9A 3SZRA 2RCYA 2YFHA 3EQ9A 4C29A 1Y89A 2OVFA 2OOSA 2O3JA 3PEWA 5EE0A 1RHJA 3EG9A 2PZFA 4Y2PA 1IBMB 3KZ1E 4HEHA 5LLSA 1Z8NA 1IJFA 3I53A 3IT1A 2OQVA 3VO8A 1W4RA 3PIIA 2FPGB 2AC4A 1Z0AA 2VSQA 3QWFA 4B7ZA 4K7JA 2BEJA 4YCDA 1OYVA 2DCMA 3E9EA 4XWOA 4NEHB 3VPAA 5BQ5A 2G5PA 2Z1NA 1DJLA 1WCYA 5KYWB 4KUHA 2CVFA 2RGAA 1RQGA 4LDRA 5AUQA 1R12A 2AFHB 3VR1A 1U8CB 1CC1S 3O8QA 1AZTA 4WESB 4CU5A 4F96A 4ZYLA 1KEZA 2P3SA 4BKPA 4LRQA 4WK2B 2AZ4A 4J0IA 4BC0A 4UBMA 2J33A 5JUWA 4BGEA 2HUPA 3A6GA 3DEZA 4XDYA 1VM6A 2EJBA 5EJ2A 1EXNA 3U7EB 2AE2A 1IUPA 3CR8A 3MGKA 3OTWA 3W2HA 2GSWA 4ZAZA 5EJ7A 1GKKA 2ZS8A 1R16A 3DT6A 3V4FA 4YMVA 2Y66A 3VZSA 5C81A 3YASA 4RGVA 2PL5A 5TDHA 1EFKA 3OSZA 3IULA 2FRDC 2JC3A 1FTWA 3ABRB 4HR7A 2A1TS 3W78A 4GMKA 5GOTA 1QV6A 5DX8A 3UTCA 1CHNA 5KOJA 1WQ3A 2JGLA 4TV9B 1FTSA 3Q1KA 5KTRA 4R3WA 2ZS7A 4DLTA 4GVXA 1GEEA 2JARA 3AR6A 1EXWA 1I2ZA 2A0WA 3IEPA 1KGSA 1XRLA 2ZIUB 1H2WA 4EPTA 5JSFA 4LNUB 2KYRA 4RTNA 3Q3VA 3N05A 3QX3A 1RVDA 2TMGA 5IXYA 3E9NA 3RVLA 1HO3A 3CUKA 4C0LA 1KMCA 4E2XA 3T1YB 1TAQA 5K45A 1R5BA 2C31A 1IN8A 4MXDA 2K2WA 4PWZA 4C5BA 4ZHQB 3FFAA 3GI1A 1D1TA 3TNDA 4B34A 4ZJZA 5K3BA 5FT9A 2P1DA 1WXDA 2DWUA 2YZNA 2P27A 3IAUA 3OHSX 4UUNA 1E2KA 3A1NA 1E6CA 1M1NB 3LD9A 2FFQA 3KB1A 5EKSA 5I7UA 2BGIA 2ZIGA 1Q0RA 2IFTA 2C8LA 1SKAA 4K28A 4RULA 1ENZA 1HGXA 4WNIA 1NG1A 1RJ9A 3JQEA 3B5JA 3NHFA 1D0IA 1RQNA 4RKWA 4PQYA 3PQ3A 1QYCA 1VXRA 4JENA 4XSVA 2OBMA 2ZBEA 5ARDA 2G6BA 4HV4A 5BR7A 4KRFA 1ILEA 1TI7A 3I6QA 3KTDA 4C0KA 3KXLA 1IXYA 3Q10A 3QE2A 4TSRA 2XKBA 4IFEA 3HFJA 2ZT7A 2ZR0A 4WKCA 2OCYC 1KYTA 2WG2A 1MNAA 1XEXA 2EQAA 3BSSA 4WKNA 5LZ4A 1LQUA 2XXAA 3RYFA 2MT9A 6REQB 2VCHA 1N92A 2VH1A 3WLJA 2RHTA 2PQ2A 1EUCA 2C3PA 2GN9A 2FPSA 2WNHA 4R1TA 4L8GA 4HWSA 5IT4A 3ADDA 5C8VA 3EHEA 1RU3A 5AJXA 4ZAFA 2XMDA 3UYKA 5DGCA 1I5OA 3AZOA 3DVQX 4MH0R 5IC4A 5JYBA 1RVV1 5CM9C 4QO8A 1E6MA 4YCSA 4EK9A 4WGFA 1TGVA 2PRJA 2ZR8A 3NT4A 3GF4A 1FQJA 4TLEA 4CV1A 1UXKA 3H2SA 5C5CA 3FUCA 5CAEA 2QRKA 2FVXA 3TPFA 4Q47A 3WWYA 4KYUA 2PL1A 3T9FA 3L0YA 5H3LA 3HU2A 2ZBVA 3O83A 1ZMBA 2PS3A 4QTYA 3M49A 5IBQA 4IDBA 2FW1A 3E2IA 1DVRA 3P9NA 3B9BA 1SVWA 3NKFA 4H7HA 4OA8A 5H80A 4J6FA 4GYKA 1R0WA 5JXJA 2PT9A 1H8HD 1APBA 4RTOA 4TKMA 1NOIA 2IF2A 4XCQA 1ENOA 2FEXA 3I2JA 4H4DA 4IMRA 1G20E 3TWOA 4BPRA 2EFEB 4YV1A 1EEXB 2LP4Y 1KI1A 5AM5A 4LK3A 3OUZA 2MSWA 1ACMA 1Z25A 1W4ZA 4HS9A 1OX6A 5CT4A 5HNKA 3H2JA 1DB3A 1IBCA 3L8YA 1J24A 3OY2A 2X1LA 2QUZA 1VL2A 1YB7A 2R6HA 3RFUA 1T1JA 2VHUA 4D4MA 2OAEA 2ZRLA 4YRJA 3UHFA 4NFSA 1N33B 3ZH9B 1EKXA 3U49A 2WUFA 1EP9A 2E7ZA 3T94A 5H68A 5LP6A 2HRZA 3NDJA 4LQCA 1RXSA 1VG1A 4J0CA 2ZJOA 1VL0A 4X62B 5GINE 1LS1A 1VYTA 1PJ2A 2ZJ7A 3G0OA 3OZDA 3RNOA 1IUKA 1FRZA 1L7PA 2ZOSA 4LC1A 4BO7A 2ZBPA 1SVOA 3OMWA 1ZAKA 4NMLA 4YGYA 4ZHSA 2XGSA 4KIFA 4NV1A 1T9GR 3DOHA 2VFAA 4MV1A 4UE2A 1N2SA 3ONVA 4DJTA 1K89A 4WNAB 2OVBA 3K6SA 4QYMA 5HJ7A 5ABPA 2YINC 4NX2A 5DHAA 5A6SB 5KCZA 4Q3AA 4YAJA 4CLRB 5KWVA 1YFLA 3TVYA 2JCBA 3RWOA 3F8WA 4L5YA 1RYHA 3IDSA 1G7SA 4D80A 1U8ZA 1WS6A 1J1UA 5HVNA 2QM7A 4QLBA 1ADYA 2QN2A 1YJAA 3LU1A 2PR2A 3O93A 4NOLA 4Y6QA 5HDBB 3AF1A 4YCLA 1UBSB 5F78A 2WWHA 5TLSA 4LECA 1HDIA 4DCCA 2D4AA 4FHCA 1L3BA 2OXEA 3NBZC 4G36A 1LY1A 1E6WA 1DEAA 3C1TA 3MSXA 2ETVA 4MW9A 4CF7A 4KDEA 4BEWA 2QY9A 4XUEA 1EG7A 3ZYCA 2X7HA 3KLBA 3TR6A 2VBCA 4HB4A 1I01A 4LSZA 4M89A 3ZZ0A 2D00A 1Y48E 3WJAA 4CHGA 4E08A 5I7EA 3R3WA 4BLUA 2W8ZA 5ALWA 5KVQA 2FOLA 1E0AA 2GF9A 1K4YA 5E3JA 4LDZA 2F1HA 3QY9A 4J9VA 3UWSA 1JDSA 2OGSA 4J0QA 3V8PA 3HKEA 4DBVO 1IY8A 3AWDA 4TS4A 5T64A 1SUFA 4XLTA 1G8KA 1Y1QA 3WZ2A 3NATA 1T10A 2Q5JA 4FOOA 4RMGA 5FBRB 3SR4A 3F47A 1AQIA 1UBEA 4PHTA 5H82A 1IL0A 1M8JA 1JH8A 1KIFA 1SRRA 2H9IA 3DM5A 3KVRA 4BATA 5J1SB 5JJ5A 2DBVO 3FUXA 3QYJA 3FVWA 5AJWA 1SUDA 2LCFA 1U04A 5M29A 3DOFA 1N9ZA 4CCAA 1KP9A 3TZLA 5TPZA 4QQKA 3ZOKA 4A0RA 5LP6C 1USKA 5KKNB 2RGYA 4PO9A 4UKDA 1YA8A 5F35A 5A2GA 1NKVA 1TEZA 4AZ0B 1GGKA 2FSSA 4HEA6 4JYMA 5FULA 1YDWA 3BL6A 3FB1A 1Z26A 3B20A 1FDVA 4L4YA 4M7WA 1P4GA 1CZNA 2F59A 2FETA 4OYLA 3UH0A 8OHMA 3UM9A 1G5QA 4XWGA 1IM8A 2JHGA 1PF7E 1R6BX 2PZJA 1KRHA 1U1CA 2QT0A 3ZWWA 5F98A 2WHYA 1YASA 5JS1A 1BWSA 4XSHA 2D8AA 2JJQA 2PBZA 2VTEA 1DKNA 2XT6A 3C4QA 1WB5A 3QVXA 5LA6B 2ZROA 4NNJA 4WXHA 1ZVVA 1HWYA 1OFTA 3CVXA 1EFTA 1RKXA 2AK3A 2NZJA 4M54A 5TGTA 4JIMA 1CUIA 1Z45A 3NXKA 4ISCA 3WK6A 1HK7A 2FPIA 1NLFA 3GZNA 1RTTA 3P20A 5JZVA 1RKBA 5CB6A 4HI0E 4BV2A 3FD8A 4MRVA 5TR9A 3IT3A 4ALNA 3MELA 5M3BA 1R6UA 1XYYA 4NY1A 2IHBA 2IEGA 2YHUA 1RWBA 4RZ2A 3NIDB 5JFOA 1HX7A 4OHBA 4X45A 1QC5B 3N2IA 2GZ2A 2ODWA 3TBHA 4OV6B 1RCFA 1X13A 2Y93A 3BZWA 3ND8A 1R0SA 2D5LA 4GXNA 1PL7A 4JBHA 4D97A 4CIXA 2ONZA 1WKVA 2X6QA 4PZZA 4CFZA 4KPUB 3UB2A 1JMYA 1KYYA 5DE3A 4C01A 3AERA 3UMCA 1ULZA 3RVMA 1MRSA 3PNKA 1Y7PA 2XLBA 2R84A 2YRXA 1OIXA 1UFQA 2B6HA 1WVGA 1G19A 3IA7A 1N7IA 4N4AA 4Y8VA 5CU7A 3WTCA 5F7XA 1NJFA 2BEUB 2J1LA 4JR0A 4ZRMA 3ZWKA 4BO4A 3M6UA 3BUSA 3WL5A 2GYUA 4DCSA 1HI9A 2BWJA 2PEYA 3IH5A 3AY7A 2Q99A 4AURA 2G9ZA 2RJOA 3SVTA 5FH9A 4HB3A 1E9BA 3MTAA 5HKKD 5LIRA 3EB9A 3V55A 4NQZA 3DAFA 3AVWA 2W37A 3G59A 1NUHA 2RJNA 1EQAA 3HP7A 3EFOA 1SBNE 4KMSA 4YBRA 4B87A 4ZV4A 1S8AA 3R7LA 1VXOA 3A1CA 1P7CA 2YZ7A 3UJ6A 3B70A 1WG8A 3TYXA 1MH9A 1HFJA 1SM4A 3MQ2A 3LHFA 2WDZA 3B2QA 1RJWA 3H7IA 1G8PA 4WQMA 2ZB2A 2BGJA 2YC4C 4D98A 2PCJA 2V6IA 2VL7A 2R44A 4PAOA 2BZGA 4LTNA 2ZWOA 1CF4A 3ACDA 4KXUA 3V4OA 1ODKA 3EGXB 4WLEA 3E81A 2HH9A 5BO5A 3VR4A 1YZVA 2ZRNA 4RJTA 1JF8A 5KMGA 2DU8A 1X7HA 1XC7A 3H9GA 4Z9XA 4H3KB 2H2IA 1ZX1A 1L7AA 4Q4AB 5JPIA 1OR8A 2C04A 4FMCB 1IXKA 2XB9A 3E3AA 4NENB 2WZQA 2ONJA 3R6TA 3FPFA 1ZVJA 3UCFA 4UAGA 1KBQA 3L0IB 3HDQA 2PZBA 1O54A 2O8NA 3MK31 1USGA 2OYSA 1FFEA 3QF4A 1WR8A 3FKSD 3QSGA 1XZCA 2LV8A 1TZJA 3FYHA 4XWTA 3KSAC 3MVEA 4YRDA 2GCOB 1RQRA 4LXTA 5EIBC 2EL7A 3SU8A 4P4UA 4XIYA 4N3AA 3U7FB 3OM8A 1EWVA 1Q83A 3GOQA 3HJTA 4C89A 3U2QA 1MAHA 2HAEA 3GT7A 1NDQA 1P33A 1DKOA 1T4CB 2QI9F 3QBJA 2PX8A 2EXXA 4AX8A 4RMJA 2GN1A 3FHOA 4QT0A 4HSGA 5FCDA 4YT5A 4RV9A 4YGXB 4ZWNA 1LW7A 1YDHA 2VDMB 2QE7A 3HCFA 3PGVA 4HGRA 5FBQB 3ZBUA 2VBIA 2XRMA 2HFKA 3CGGA 1JAYA 4EO9A 3FRHA 4DGSA 1KAMA 3KEOA 2C98A 2QT1A 2R4TA 5TPWA 3VKVA 2P9YA 2XUJA 3NUQA 3PNOA 4D8VA 1WHSB 3E1SA 3M6XA 2WJJA 2YXBA 4RHXA 3DEYX 5FIUA 3KKLA 1E7RA 1JZSA 2BBSA 1CJBA 1LKZA 2DC1A 2EF1A 2W2VA 1TMKA 3KU4A 4H35A 5K01A 1KAQA 2XMQA 4CYMA 3BT7A 4BN4A 1GU1A 1JV2B 4L6AA 1DKQA 3VTAA 4FNOA 3PJGA 3V80A 4UFNA 1JMKC 1M33A 2ZI3A 1YSCA 4BIMA 3ER8A 4X64B 1Q7GA 3QP9A 2H1FA 2CJWB 3F4BA 3IUQA 3UJ7A 4PZ0A 1Z36A 4JBGA 2YTZA 3LK7A 3R3JA 1RPJA 3D6AA 1NXQA 2EV9A 4AS1A 1NMXA 2DUMA 2OESA 2PGXA 3H13A 4L22A 5I4BA 3TS1A 4LXXA 5ED4A 2I91A 5AKHA 4P3YA 9ABPA 2CGEA 4R2JA 1ZD8A 3QEOA 3MC1A 2BGTA 1YQDA 3LX6A 4UZEA 4N12A 3OQOA 4DJDC 1P0IA 3EVZA 4RFVA 4DLUA 1DHRA 5G4KB 1BEEA 1OREA 4QEZA 5LQNA 2IYWA 4UVDA 2YIDA 3WA6A 2XYRA 4UNIA 4PN3A 4PG8A 3R5SA 3PQ2A 4JLBA 3W9YA 5EGSA 3DDZX 3TL2A 3I42A 1IVNA 3L77A 3NX4A 1QR2A 4MITA 1JLKA 1LI7A 1N2CB 3CC8A 4IMPA 2O3TA 4N9WA 4X7RA 4DIOA 2FPXA 2REOA 4U7HA 5AVKA 1OX4A 1U3WA 3HP1A 1BJKA 4IIJF 3WNDA 5AIBA 1X42A 3NBMA 4JBLA 2WIFA 4OHOA 1GUBA 3VTFA 4Q9IA 4C4YA 5DRYA 4IZHA 4LOIA 2MSEB 3M89A 1G5IA 1UDBA 2ZR7A 2B7LA 5BSUA 4EG0A 1SXGA 2OWDA 5BPHA 1M76A 1E3LA 2IZZA 2QYTA 3NBYC 1GG2A 2FN3A 4XRGA 1DXHA 1UPTA 1J0BA 1YRHA 3T3MB 1PHPA 3VKFA 2WM9B 2WV9A 3F5SA 3EMDA 3HKBA 3U9LA 4MHOA 4OK3A 3BTVA 1EBBA 1A8UA 1FTNA 1LF0A 2C57A 3NXSA 4FFPA 2YVUA 4UOQA 2YRFA 1EIWA 4PSVA 5DNEA 1M74A 5CM8B 2W2KA 2NQ8A 2FZCA 3P2YA 4GKVA 4KFTA 4BTVA 2NGRA 3FNBA 2VNKA 2Z5GA 2HU5A 3U26A 5BOSB 4F3YA 2O8CB 2JAOA 5U4QA 1YZQA 1SZJG 1B3BA 1NASA 2QSUA 4WKGA 3R41A 3VJLA 1JAZA 2DTEA 5F7JA 3NH9A 2OZPA 2P65A 1N4DA 1CUJA 1H5QA 1ZM4A 2NZ8A 3AEXA 3QXJA 1PK7A 1FP4A 3A4MA 2BFCB 2BKAA 2UZIR 1IEWA 3MWDA 3EDOA 3NDIA 3RJ5A 2BUBA 4GHWA 4J7CA 4JSYA 4OH1A 4DPKA 4XWKA 3U4CA 4GX0A 4Y2RA 2VK1A 1X77A 3QU7A 5FPSA 2Q7XA 3U3JA 1YK1A 2Q0HA 5ER9A 2O8FA 2FN9A 1G66A 1YB5A 4YRSA 1GN9A 2RI6A 2HRCA 1RRCA 3TLGA 3PF8A 1VKOA 3IMKA 3TLYA 4NFLA 2CF5A 4YS6A 5H0IA 4S0ZA 5FTNA 3FMOB 3ZZTA 1QE3A 1SD2A 3DD1A 4MQUA 3TR0A 2XNJA 4EELA 2WIAA 2ZUFA 3HWWA 3AGQA 3DV0A 1T3SA 5HOEA 1RE0A 2R6ZA 4B71A 2WK1A 2F3RA 1M6YA 3F0TA 1KSHA 4ZGGA 4XJTA 5ITZB 3ANXA 1V7PC 2QZ9A 2OXIA 1EXMA 4RSGA 4EVSA 5EINA 4TZ0A 1TXGA 1QOZA 1Z4NA 2ZRBA 3MOGA 4QWWA 1BMQA 4KO3S 1CS0B 2FFJA 1QH8B 5TQJA 4XD7D 5F12A 1DIOB 2JLBA 5D86A 1A9ZA 2ON6A 3ZE0B 5MHTA 4ND6A 2EFYA 1J8QA 2ANBA 3EA4A 2BVNA 2VUHB 2POQX 3HB0A 4KL8S 4KWCA 3DE0X 4F5YA 4UU8A 5I8ZA 1N34B 5AQ1A 1YE8A 3QKIA 3TM4A 2D2VA 4HTFA 5TPWB 2OL4A 4EFKA 2FDCA 2Y67A 3HVIA 4JVLA 4E3ZA 1M8KA 5D7BA 4DCGA 3V32A 3UEOA 1LJ8A 2I7VA 2VQ3A 3ODPA 5CH5A 5AP9A 3RHFA 4UAUA 5G02A 1CE8B 3EVTA 3EH2A 1LVUA 4DXHA 2VRNA 5FWYA 1SZDA 4M7RA 3VR4D 1TF7A 3A8TA 4Z1MA 5DHUA 3FZQA 4MUYA 4R2XA 3OQHA 3UMRA 3KQVA 1ST2A 4HQ0A 3DD5A 2XCTB 4X3PA 1H5NA 2D59A 4KZKA 1XZLA 3I2YX 2WF5A 3WGLA 4B74A 3CLSD 1LPNA 2HQOA 3LT1A 2NUAA 1ULUA 4CQLA 2HHHB 4CEJA 3LDUA 4Q4JA 1CZKA 1SQGA 421PA 5REQB 3IRVA 4HO1X 1S2MA 2CW5A 4K3UA 5ER6A 1ZJJA 1Y4DE 1L5GB 3F7TA 3HPQA 2V7PA 4BO8A 1NBME 1VPTA 3BORA 3D0OA 3F46A 3UJ8A 4LE0A 4IG9A 3PYLA 4I6EA 4E4TA 4WWHA 2D62A 5IKPA 1GA4A 5I7VA 2QMUA 1TJYA 3BFKA 4R71A 1IONA 3JCZA 3PNPA 4WN9A 1NLZA 1SY7A 2I8LA 1H4QA 2Z4RA 3KOXA 1IC6A 4KSCA 2WQ7A 1OBHA 2PD6A 3DG9A 1T5BA 1TKCA 3RUDA 5FRDA 2OG2A 1IN4A 1OFVA 2Z4TA 4MMZB 3G9ZA 4NYJR 3OQNA 2X0IA 5DM0A 2Q4OA 4CKYA 2P0EA 1T9HA 1LSOA 1T3GA 4RPGA 3KPWA 5AKKA 4CEHB 2FW6A 4R1QA 3UJNA 4G07A 1KYQA 1RS0A 5KREA 2LDXA 1GG5A 5KJFA 1N1DA 1VJ1A 5EA2A 1MD9A 5C53B 1TD1A 4BO2A 3QUQA 5AK4A 1XRQA 4ZCPA 1KJYA 1NJSA 7MDHA 3JATB 4X3OA 1PQ4A 3BRWD 3I32A 3NC1C 4ZMRA 1EX7A 3FYSA 5HUJA 4QSHA 4CBVA 5I47A 2Q6LA 2PT6A 5CB0A 1RBYA 3ZQ6A 1XN1A 1WM1A 4GWLA 4AP5A 1XTSA 1KFEB 2WNIA 4UW9A 2RBEA 2DYKA 4Q4DA 4BMDA 1MB3A 1UJ4A 5IVKA 1B93A 2OHOA 2REQB 1OLSA 2NXJA 1XPJA 2AWOA 1GUDA 5KNBH 1KKUA 4C14A 1GA1A 4XR4A 1IDN1 1TEXA 4E5YA 2V5UA 2MSCB 4AX4A 1U8AA 2CL5A 4OQEA 5EG5A 4OXQA 5JO9A 3TXYA 3HACA 1B3RA 2P0AA 4EB6A 5HIIA 2CXTA 4R54A 2ZIXA 2JA1A 1BCRA 3RTAA 1X7ZA 1DIHA 2H1IA 2BISA 2QI9C 4J0DA 4UREA 1X87A 4JN6B 5DYIA 3GN1A 3SXUA 5JFTA 2FN8A 4IIJA 1GIAA 2GPYA 4Q66C 5JI2E 1PCXA 2EZTA 4KWTA 4R9RA 1OLUA 1JIQA 2HMWA 2OXRA 5HILA 1MABB 3WK7A 2NUTB 2PYDA 2AWNA 3PYXA 1U94A 1QB8A 4MVJE 3PXGA 1TJPB 1NL3A 1P2BA 1Z13A 5J4VA 1QZXA 1UK8A 1ZH2A 4LS3A 3CA8A 2QRUA 5FJJA 5J4KA 2GAFA 3TZBA 1J2UA 3OG9A 4F6RA 4EPRA 3BEOA 4R68A 4G1FA 4Q48A 1OYYA 1LPOA 4DY6A 1P0QA 2ZM6B 2C2BA 4DL9A 3HDGA 1WKBA 4IJWA 3OTHA 3P9YA 1QG0A 4YRFA 1G8FA 1B1AA 2ANCA 1NG9A 1O2DA 2JF0A 5JVDA 2Z6AA 1BHQ1 1G1MA 1NJGA 2D74A 4IXTA 2ORWA 2RGBA 1V35A 2L0XA 3GZ4A 4JLOA 2UUOA 4C08A 3OF5A 5LBTA 4MUFA 4YAOA 1NF9A 1ODCA 3W6NA 5EMKA 1ZLXA 4BMSA 1XZMA 4EPVA 1I14A 4BHTA 4OMDA 4EF5A 3OCYA 3X1YA 2J9XB 1XGKA 2B21A 2QZ4A 4MVJF 5D5PA 4ZI7A 3AL0C 2V45A 3RNLA 4ZGBA 1A2KC 3SNHA 4RKQA 4LN1A 1P0PA 4FP9A 4FE4A 4Z4HA 1R18A 1MB4A 4LSGA 2ZE5A 5IUJC 3G2LA 2UKDA 2VJQA 4RZUA 4RMNA 4AN1A 3DBLA 3A6HA 4RZQA 5ALKA 5THKA 5D51S 1K7EB 3REGA 2G4LA 4F71A 4CLXA 1G5RA 4BGUA 2Y6VA 1SBZA 4WDRA 1GJRA 3WKEA 1J5XA 1EX6A 1L7NA 1T6BY 1Z74A 3VC2A 2W6ZA 1EDEA 3NVAA 2Y71A 3AFOA 3SEQA 4D4HA 4P3OA 4PINA 3HYLA 1OTXA 2Q1UA 2UDPA 4HPXB 4HDSB 3VZPA 3QOYA 3ZQUA 1WPRA 1OILA 5KAPA 2X2PA 1VMDA 1HQYE 3MWEA 4GE3A 1EVZA 1TE2A 4DA6A 3UBTA 3BB1A 3FDZB 4LMRA 1U28A 4PC7A 3N6XA 4W8HA 1N1EA 2QIPA 3ZXUB 2CEAA 3O4IA 2ZS9A 4X20B 2I3DA 3ITEA 5TGZA 5LP1A 2XXJA 3I6MA 4DIFA 4X6YA 2G17A 1R0KA 2WF9A 5TT1A 2G36A 3LF2A 3ROPA 1Q16A 1AKRA 1IG3A 5DF1A 1EK6A 4LIPD 1TC1A 1PR6A 1XAGA 2C2ZA 3AY6A 3QH4A 3FUVA 1DFGA 3HZZA 4HFMA 4UVHA 4E5NA 4EHBA 3THWB 2I7TA 3UG7A 2IS1A 4E5DA 4F9GA 3OFJA 4E5MA 2CD7A 1DKMA 1JJBA 4YVFA 4M46A 4B4VA 1NNSA 1JILA 1JAXA 2ZVPX 1E2UA 3IP7A 5IH3A 3T7RA 1QTRA 1LZLA 1WABA 4WXPA 1A82A 5FORA 1UAGA 2J5BA 3HY6A 4IJUA 3GD7A 1Y8QA 4FJ1A 5FPYA 1EI9A 5NULA 4GNRA 1KSGA 3A28A 1A8HA 1QO0A 2FP4B 4Q7KA 1QVWA 1BAPA 3BGVA 3AESA 2EF0A 2JLSA 3D8BA 1L3IA 3PFCA 4JNCA 1L5MA 2P3OA 2PGLA 3U3DA 4U9HS 2YHSA 1BDJA 2DECA 4ZQFA 4CMKA 1JT2A 1ZM7A 4PN7A 3GLFA 1GADO 1CBUA 3HCBA 2A94A 1DRVA 2JFXA 3PJFA 4EH1A 5AW6A 2HUNA 1DCKA 3VRHA 1A88A 1BGXT 1ZH0A 4AJEA 4U6QA 4B17A 4EHKA 3CSDA 1DPFA 1W4CA 2HD4A 4J3FA 1GDDA 3GGJA 4QPPA 1NWCA 1PT9A 2CWWA 4CLOB 1QQTA 1JFRA 1Z33A 2NUPB 3WI7A 4DWVA 2B5OA 2OB1A 4ZV9A 1Y34E 3AEQB 5A4AA 5FEUA 3X2EA 2VDPB 2R2GA 4CM1A 2IYZA 3L7OA 4OVKA 2ID9A 3OQ6A 4ZT5A 2BDUA 2XWSA 5IT9A 4JI4B 5FI5A 2R8YA 2IIQA 2VS1A 4PLWA 4EL5A 1NT4A 4KSYA 2VUSA 3ILSA 3RO7A 1H3EA 2HJWA 1BCSA 2FG7C 3OA2A 4I0WB 3PVZA 5D6OA 1ZIPA 3WNZA 4ASUA 1U28C 2BFEA 2ZJ1A 3QPDA 1A3CA 2O20A 3MAGA 3P4XA 1OCEA 1QIHA 3PQFA 3DL4A 3E9ZA 4RO0A 4WZBB 4J03A 5EP3A 3A4TA 4MRPA 4RDHA 1I80A 2VF5X 4UUOA 5CP8A 4MP3A 4RJIA 4X54A 2UU9B 1VRCA 3DT8A 2BLNA 4BB9A 1EJ2A 4FJ2A 2WV7A 1FBNA 2MR5A 3H83A 5K0BA 3PHCA 3KAJA 4KR3A 5ALXA 3C5VA 3HDVA 1CFJA 3X2SA 1QAMA 1C7QA 5ARBA 4FZ3A 2JS7A 1RABA 4M36A 3ROMA 3ZBQA 3DAOA 4R8SA 4KFUA 1ZGGA 4HMPA 3IL2A 1Q95A 1HE2A 4UDYX 1SC9A 4RVDA 3OPXA 3SHQA 3I8OA 3UW3A 1ZMXA 3ZE7A 2A9KA 4V03A 3LHSA 3L43A 4FFOA 3T3DA 1YQXA 1VI5A 4GXRA 1AXEA 1SO8A 2GF0A 3M8KA 3UKJA 1C9YA 4QBHA 4TWZA 2C88A 3DW1X 2IYNA 1C8LA 1KAGA 3PUZA 1R6DA 2O0MA 3PQ6A 2AOVA 3VNVA 3LVFO 3WLMA 2RGWA 1UZLA 4UHBA 4YRNA 3GAAA 4S05A 2EDAA 3TSAA 4Q6BA 1FDTA 1C8KA 2B78A 3IEVA 3LECA 4MR9B 1DOAA 2Z5FA 1OLXB 3OICA 3AI1A 5D3KA 4EVIA 4GLFA 1NOKA 2IV7A 2WA2A 2H0AA 1IXSB 1Z0SA 1HRDA 6ABPA 3H5WA 4EWLA 2OD2A 5J2TF 2JBHA 1WSAA 3ES9A 1E63A 1CR4A 3R6GA 5CDSA 4AFNA 3OLWA 1LPAB 4RS4A 3EXHB 4D0GA 4BZXA 1YKFA 1A5TA 4CF6A 4BO6A 4DARA 2AW5A 2V3WA 3BM5A 4RZXA 1VKZA 2GR9A 3IOEA 4FGKA 4LZZA 4PGAA 5DNDA 4PR0A 4HX5A 2F62A 3WQQA 4L9WA 1NX9A 4WZAE 4ON9A 4DF3A 2XT9A 2GEDA 1FCJA 1X6VA 2P79A 2V6MA 4M8SA 2FW8A 3J7TA 3RSSA 4EUKA 3VNUA 2F4VB 3GYGA 4B8ZA 2XRYA 2HXGA 1ORHA 1XDSA 1A9PA 3DWFA 5IJ9A 2H18A 2FLVA 3PVSA 4N03A 3SDSA 1PLJA 2AVDA 3HKDA 2ZDGA 3P71T 4J0FA 2WG1A 1MEOA 3WJ2A 4BNDA 1OD6A 1SBIA 4FFBB 3COSA 3OLZA 4FK8A 4MEJA 4ROTA 2YJZA 2WWRA 3EIEA 3OAAA 4BMCA 3VC7A 3VZBA 4BRWA 3EFEA 4ITRC 3EXFB 4RZIA 3PGJA 1AKUA 4FEEA 4U3JB 4CMIA 4EG5A 2R87A 4ZCQA 2EYUA 2DQSA 3A2NA 3M5WA 2IPXA 4DV1B 4IUCS 1W29A 2ILTA 1Y9ZA 1WWKA 2JAPA 2RHLA 4HDNA 2BEWA 4JT2A 2HGZA 3AUYA 3QX7A 4GX5A 1DEOA 5FLXA 2B4RO 4QASA 3BFXA 4GMGA 2BZSA 4CR6A 1J2EA 4I8IA 1T26A 1UJ6A 5AJVB 2B8WA 3ZCUA 3F73A 2IXBA 1YA6A 4CKEB 4CM7A 1T5LA 1Z4MA 1YDMA 1T1EA 1G4HA 1M2JA 1QKIA 3F6RA 3KPUA 3O3MB 4Y1GA 1AVTA 3M3DA 2IHVA 4URWR 2BCGY 4DXDA 2JGEA 4YJFB 1EHCA 3L9WA 3HU5A 1T3TA 10MHA 2WJWA 4MW5A 3LTEA 4W8GA 5C8YB 1WDMA 1M34B 2G7MC 2W6OA 4YAEA 1E1QD 2BRUA 3MRSA 3RG2A 1JHOA 1JX6A 1G6OA 3H9QA 1HLGA 4G0ZA 2PNJA 1V5FA 1XAJA 4QRDA 3EE6A 3K05A 2LTAA 3AIOA 3A36A 2W90A 4M6WA 4OXXA 5IMBA 4C78A 4CEIB 721PA 5C7LO 1E4OA 5LQMA 2SKDA 3PU6A 1HRKA 2FPWA 2OAQ1 4LE1A 4YWJA 2HQRA 5AT1A 3FTFA 1JA0A 1Z0UA 1CQPA 3ZNQA 4IGKA 5B1SA 1HOTA 1A2BA 2X9VA 5CG2A 1BVHA 3A7DA 3BWEA 4MULA 2PSHA 2R1UA 5I9BA 2IUTA 1C9KA 4C7OA 1IQRA 3LO8A 1UXHA 1K6MA 5TQVA 1JZQA 2WWTA 3A10A 1S02A 4O4HF 3NLLA 2QTGA 1U3VA 2Z83A 1Z5PA 4CTOA 5I4IA 4HXYA 3ZCVA 1VE9A 1B6SA 2IUEA 4B4WA 1LI4A 5GY7A 4V0SA 3RS7A 3FSRA 2WM3A 2W8BA 2NYUA 5DB4A 3CR3C 2G09A 1V16B 1E1CA 1Q1NA 4KV7A 2JGDB 3KO8A 1GSAA 3IV6A 3MYRA 1OXMA 1YRAA 1Q15A 2X5JO 2FK7A 3KPJA 2OB2A 3PC7A 1W88B 2FJUA 2Q49A 2QL5A 4ML3A 2E4YA 1WNFA 2GXUA 5IYZB 1MA0A 1L4YA 3L6BA 2HF9A 5KDLA 3TAUA 5A4JA 1PR9A 3AVUA 1C30A 3KJHA 1XVIA 2EX4A 6YASA 1C7JA 4M8KA 3VPFA 4L15A 1KMIY 4HWKA 3IVCA 4JP3A 4UJ3A 3ET4A 4BAUA 1K63A 5ALMA 1LLFA 3MYYA 3VUEA 4RS3A 5TX7A 4RTSA 1OXBB 3ZWYA 3HNPA 5ESWA 3QEBZ 1IHXA 2BGRA 2NVWA 4COKA 1VBKA 4FZJA 5KOHA 5H8WA 3U1BA 1H9AA 4JXZA 1O9BA 1H4TA 2JI7A 4ENTA 1I2DA 2X0NA 1JFFB 1EVQA 5JNSA 2AFRA 5C1IA 4HDKA 3TNFA 2FAXA 1JVBA 2PMKA 2ZI5A 1MC8A 3C7DB 2CZCA 4R7GA 2BMJA 2BRUC 4DG8A 2EBWA 3QMWA 1ODJA 3DCYA 1G2IA 4DMLA 4FOPA 3GJ3A 2JCVA 3A1TA 4HBGA 3ONWA 1Z0KA 4TN1A 3DO5A 1Q5PA 3MMXA 2JFVA 2VATA 1NFFA 1WQ1R 2ZWPA 2MYUA 2G04A 1ODLA 1YZKA 4HLDA 3ZY3A 4H3SA 1LQ2A 4B4UA 4LBYA 3WHPA 4J75A 5IJZA 1PSZA 2WT4A 4TQ9A 4JK3A 1AKEA 1NKSA 4WX2B 4RK6A 1AGYA 4RUKA 4BBAA 2PUDA 4D44A 5BSVA 4OHXA 5AK5A 4YRCA 1F06A 1O9GA 1W93A 3D6NB 1QB7A 3A1WA 5J2UB 1ZD1A 3BWVA 4V02A 1RBMA 3DTTA 4M60A 2JRLA 2ZE8A 1D2RA 2QRQA 3O4RA 3K32A 1CT9A 1XXHB 4GM1A 2V6BA 4HAVA 4LJ6A 5IC5A 4HAYA 1YVEI 2VDVE 3MBKA 5A1TA 4KDFA 4O1MA 5FKJA 3II6X 1N3YA 3NORA 2C2KA 2PWZA 4M1EA 4ZVKA 5GAJA 2B94A 2HA0A 4H7IA 3FN4A 1U4SA 1A8IA 2OCIA 3OBIA 3OOJA 4X1YA 3W4IA 3N1UA 4GMHA 4QVGA 2H57A 4QQNA 2F6RA 5J2TA 4CG3A 1UP4A 1PLKA 2WAYA 2A5JA 2XB8A 3C98A 3CKMA 4IIYA 3BXPA 3H11A 1JQEA 4QAQA 3MWYW 5E7JA 5CXUA 3ZHRA 3AP1A 4HL6A 1WA5A 1SB9A 1H3FA 1Z2PX 2NSLA 4WXRA 1T2VA 3AJDA 2GCEA 3OI7A 1GUAA 3PDJA 2O54A 2CDCA 1ZM3A 3E8XA 1H65A 5DSZA 4LHZA 2WVHA 3DO8A 4L9RA 2QM3A 3FFWA 5LL6P 4PRYA 3FPLA 1T36B 2OK7A 2PMBA 3N07A 2ZSHA 1H93A 2K5UA 3IURA 3WC4A 1KJZA 3ELYA 5AVVA 4C3UA 1NXOA 4EZIA 2GTHA 3GT0A 1J2YA 3H99A 3PLRA 1NR1A 2I6SA 5BV1A 4I1VA 4W7HA 5T3YA 2J67A 2ODTX 3K0BA 1PWHA 1RWMA 2BELA 3NPAA 5DMXA 1XTJA 2BM0A 4CL0A 1K08A 2WJ6A 3IVXA 5KQPA 3DEAA 2CLHB 4DNXA 4OKSA 4HJXA 3ASYA 3LYHA 2DTXA 4PSKA 5JTTA 3D7RA 1KOJA 1SG6A 1P2SA 4DXAA 4MX8A 2G63A 3LPMA 2AUTA 3NP9A 5TS2A 3ESQA 3C2QA 1YR3A 3C8UA 1DBSA 3EGCA 1NI4B 4N3NA 4AIRA 3N2ZB 4Y6LA 1GZVA 2JD1A 3TZKA 1YFJA 2A0XA 4XGKA 3N2YA 4E5UA 1KEEA 2GBFA 5EZ6B 1RKVA 3T41A 3P8ZA 2IZ5A 3TTUA 3W2GA 5EP4A 4ALLA 4G5HA 4ATNA 3O7WA 5BN3B 3QJ5A 5L6LB 3KQMA 3O3NB 2GD1O 4UUPA 3X2FA 1ID1A 4GP7A 3CUYA 5C35A 3CCCA 2QWXA 1VLQA 1YZNA 4PYIA 2Q07A 3F97A 4WACA 5DDIP 2VSXA 2Y05A 3UFXB 5CEFA 3CR7A 2FR8A 3EVFA 3OAAD 2W2PA 2VNJA 4C6TA 4GRDA 4ETMA 1MC5A 1A98A 1PKEA 4YJ2F 3J80A 3ZE9A 3UHOA 1F1BA 4GLLA 4RTKA 4AS3A 3EC2A 3CB4A 4HAXA 2I34A 4I50B 4CMAA 3OPQA 1PJLA 1LVGA 4IDFA 1AQYA 1U8FO 1Q6ZA 1UOPA 2NG1A 2PGDA 2QMHA 2YFKA 2BMWA 3GLHA 4E88A 5TV2A 4PYLA 2CUTA 1RXIA 4XW2A 3T5PA 2QAGB 2YWRA 1V1MA 5KQSA 4LYFA 1SHUX 4KZPA 4AJ4A 2ID7A 5EPEA 3EF3A 4JB0A 3M6AA 1NSTA 2REBA 5DOZA 4ZIRB 1TRKA 2C2OA 3SYRA 1YGPA 3OEYA 5DI9A 4FE7A 3MJSA 4C6SA 4LDPA 2X3YA 1ICEA 1ZUHA 2O8BB 3GAMA 1GQ2A 4YO7A 3VR6D 4AJOA 3IR7A 4O4HA 2FP3A 4A6XA 3KWJA 4B80A 5CVVA 1O58A 3U7QB 5BNTA 1J6UA 2J41A 3LNCA 3EZ2A 2AYXA 5C4GB 4FXPA 1PS0A 2I4TA 1H1TA 3R0QA 4JLWA 4P4SA 4M98A 4B3BA 4D9HA 1TO6A 4KQMA 5C4MA 5BMVB 4UM7A 2DLNA 3V8RA 1WMSA 2JLUA 1Z63A 1Q3TA 3EDYA 3IMCA 3COYA 1NIPA 3WYBA 1MB0A 4FYXA 4PYJA 5JMWA 1XMIA 5FR2A 1BE6A 4G8JA 2VK8A 1LA2A 3JAWA 4JBXA 1QDUA 3W8RA 3NYRA 4EMBA 4CIYA 4UAJA 4QDZA 1DQPA 2QRNA 2HMUA 1NW8A 3HBMA 4IO1A 2NO4A 2WHEA 4H7FA 3P2EA 3PI7A 2WABA 1K3UB 5FWNA 2L69A 2XDQB 8AT1A 4F8EA 1RACA 1W0KD 2X0DA 3A37A 2ZBUA 3VR2D 3WXBA 3S7TA 4URYR 1Q74A 2QMYA 2Y4OA 3G49A 3SF8A 1TYZA 3QJYA 3V2HA 3ZD9A 5H83A 2FR8C 1TVKB 5JSUA 4LFBB 3B9RA 3Q7RA 1W5FA 2P62A 3D3NA 3ORRA 4YDRA 3UMGA 1UOEA 5CBPB 4U5XA 3JAMA 2JG3A 1DINA 3U81A 2WTXA 2ORYA 3TFQA 2GRJA 4LOKA 5LXTB 2B6NA 2J0VA 3T9EA 1DLJA 4Y1FA 3RIEA 1T4MA 2CVOA 1PJZA 3STYA 5CIYA 1XMPA 4CKBB 1JXQA 1JSZA 2TMDA 3ZWCA 1XQWA 4URVR 3HSSA 1QFMA 1KO4A 4Y9TA 2YWDA 1OU4A 1CD5A 3KELA 2IYEA 1GV0A 2ZWIA 3DLHA 4I4TB 1Y1KE 2OHGA 2BGNA 2PLFA 3JWGA 1AKMA 3QEJA 3QU4A 4P22A 5CVJA 4F4FA 2J3IA 4D2IA 1RWKA 1R0BA 3MHTA 5B5SA 1GTSA 1P6UA 1OH7A 3K1TA 4MR8A 2DWCA 2FPKA 4O2RA 4M0DA 4CUKA 4H18A 1AKYA 2ZSUA 1Q12A 1L8QA 2Z3VA 4DQDA 3L4JA 2WM8A 3JTEA 1S7GA 1PN3A 3F6PA 4QBTA 2HSDA 4QD3A 1KTIA 1W5TA 4MJ3A 4B3DA 1GA6A 4KXLA 4L6IA 5BVGA 5JTUA 2ZZKA 1SXJE 1RWVA 1Y9EA 1Z28A 2CJYA 3SNKA 3U1TA 1SVKA 3FWKA 3JQQA 1BXZA 1WAMA 2I2DA 4X91A 3GIDA 4YIKA 3UO8B 1AV6A 5B1EA 4DCTA 3IAS1 5FLKA 2UZ3A 2D5CA 3KOYA 3QENA 1WQ4A 1CZRA 4MI3A 5CXXA 4IKPA 1ULAA 5KAMA 4KDCA 3DS8A 3UNXA 2E1RA 4YRPA 4F4JA 2JFFA 2QJRA 3F67A 3Q6MA 1N6RA 3KWMA 5SZKB 1KWGA 2MWMA 2OKGA 3W8DA 3B1FA 3B3FA 1Z0FA 4ENVA 3Q3CA 1VC2A 1YS2X 1WU7A 2J87A 1ZVQA 4OQPA 3B9PA 3HA2A 1T6ZA 3W5DA 2C61A 3LUDA 2VDWA 4R0VA 1O5OA 5E3IA 2GJAA 5LKRA 2FZWA 4EHNA 3QBVA 4IDOA 3CRVA 1XQ9A 2Q0QA 2PYIA 5CHYA 2XTMA 4P53A 1WCIA 2F1KA 1JVNA 1SA0A 2C7OA 2YQZA 3KYJB 1IZYA 1WTCA 2ET6A 2HA6A 1C81A 4L16A 3ZEIA 5I7RA 2UUAB 2NM0A 3R8FA 1QQ7A 1IBRA 2HU2A 4BDSA 2BI7A 3CZ9A 4PIMA 3ZJYA 2AOTB 4QNNA 4RPHA 1UBKS 1VYUA 3HR8A 5F4BA 2IEDA 1FOEB 2UYQA 2XCLA 3JASA 5HE8A 4Z3KA 4NYIQ 3NT5A 3IEKA 4R6XA 3GA5A 3VOAA 4AK9A 5IZCA 1JBQA 1UK6A 1ZCZA 1Z5VA 2F1IA 3C6KA 1Y82A 2HDWA 1N6PA 2HIMA 5AJZA 3NHJA 5IC6A 1O0CA 4EA9A 3T7DA 2Y1EA 3QBTA 2Y68A 1E0DA 2O2JA 3AJAA 2G5CA 3PXAA 4B73A 5SV2A 4XYLA 2G0TA 1F8UA 4O4JF 1GHTA 1ZK3A 2G1KA 4Z4FA 4RA6A 5DP2A 4BNVA 4LJSA 4C87A 2A0UA 3RGWS 4JDPA 4D57A 4YJ2A 1G5HA 3V00A 3CF6R 4XLZA 4WXYB 3A11A 3CKKA 2ACEA 5ECDA 2GYYA 4FFVA 5K9ZA 3D4BA 4KQJA 4UAVA 3GFSA 1GUFA 2GLXA 4NOKA 4QJ5A 4QU8A 5CUQA 5FPHA 3LLCA 3U1VA 5JATA 5AUOB 2EERA 4MQEB 4YQZA 2EJWA 2VCYA 1DO2A 1QNLA 1P9RA 3G7SA 5JSKA 3ZX5A 4CL2A 3GP5A 5GZ6A 2YZ2A 4FI3F 1F9AA 4R8KA 4Y67A 2F1RA 5KOYA 4CT4B 3MS2A 5JNTA 1FVFA 1VE1A 2VHYA 3LOPA 1IIBA 2XGMA 2WWFA 2WOJA 2JEZA 3HJRA 3IHTA 4F4DA 1Y81A 2JLXA 4Q18A 4DQUA 1CVIA 4Z53A 2R00A 4ZVMA 4A82A 2CXQA 5IANA 2NPIA 4OEHA 1FUUA 1HDEA 2OKCA 3G8BA 3DHEA 3LHKA 2CLIB 4LI0A 4V0MA 4EVRA 1MHTA 4BFTA 4FHDA 1TT7A 2GN8A 4Q9JA 4BLWA 1HH4A 2JBWA 4Q1FA 3K4PA 4P34A 3SJCA 2O8DB 1QRRA 2VTBA 4HEQA 4YCCA 1RW4A 5ICFA 1QYRA 1VB3A 3Q2KA 3S1SA 4M21A 4O0MA 1E3EA 3COZA 4UTRA 2A67A 4EB3A 5IZCC 1BVRA 1SURA 2I87A 3JZMA 3N9IA 3DP7A 3OOSA 1IPFA 3NNNA 4JI5B 3PX3A 3KQLA 2XGJA 4CMBA 5CM2Z 1VJGA 4UCWA 2FGJA 3NHBA 2H1LA 1PQWA 3VJRA 4XVCA 1P91A 3GDWA 2K2QB 3KQYA 3CF2A 1HOXA 3QPBA 4M1ZA 5H02A 2NWQA 3OJOA 2FSHA 4H4CA 2ZCJA 4YMIA 3GGOA 1Z56C 1XNGA 4TSFD 4DSOA 3WYDA 2DPLA 1EDOA 2OFPA 2R47A 4DC0A 3BSFA 4IVQA 1TQ8A 4X92A 1XVVA 5LBIA 3TNJA 2PLWA 5H16A 3IKVA 4KYVA 3IKMB 5CDHA 1ZHHA 4M55A 1G3UA 1KZ9A 3E9MA 3U4MA 1NJ8A 3P9SA 3OMLA 2WA1A 4YP5A 2DSNA 2WUEA 3DDNA 1U2RA 5JCXA 4P0PB 3K16A 3I2FA 4BNHA 2Q27A 2BR3A 5M7EA 2ZU6A 1EJ0A 4OMUA 3LWZA 3PXCX 2YS7A 3NBFA 2ODBA 2XVMA 1NUAA 1TECE 1WXWA 3VHXA 3PJDA 3X1ZA 2EJTA 2ZRGA 3BRSA 3E5NA 1PNOA 4CETA 3GHYA 3N6VA 2QORA 3L7BA 1UQUA 2R00C 2FZ4A 2BTQA 5JI3E 2DP4E 1KERA 5BXQC 3T5CA 1XQYA 4FNGA 3IILA 2XCUA 3Q7QA 4IW3B 5SZHB 1GCIA 2LCIA 2Q6KA 2AX4A 1MHPA 1YV9A 3LFTA 1UXGA 3OO0A 2YIVX 4Y2SA 5ALTA 1GNRA 5AJYA 3VV2A 2IQ5A 4DPLA 1JIIA 3IBTA 4GS5A 4ER6A 2PRYA 1HLDA 3B8HA 2IDJA 3L79A 1FMCA 4L73A 5HM6A 3R8CA 4GXTA 2DHDA 3CMMA 3EY4A 4DCNA 5KYXB 1V6CA 1PQUA 2XE6A 4MPTA 4YMWA 4KOEC 4EHFA 1VHWA 2BSXA 1H9BA 4JWKA 3KC2A 1EJ6A 4ND8B 4UVIA 1P2DA 2WWVD 3K09A 4LZLA 4HFRA 2VH2A 2PH7A 4P5DA 5DNAA 1VHQA 5KO2A 5C5EA 1O5TA 2OBYA 4FDLA 3BGOS 4C20A 3VR4H 1G0NA 5JS7A 4DR1B 2IUYA 2RBKA 2C54A 2V7XA 2Z8YA 4L8LA 4CF3A 4RANA 5HW0A 4YI3A 3RG8A 2RHWA 2X5XA 5IH7A 1BWRA 1HT1E 5LM3A 3IDOA 2VRCA 3NVDA 4PFJA 1BD4A 3JYQA 3M82A 1P75A 3PQ5A 3RF7A 4LX0A 4C07A 1MAUA 4G1EB 5JSZB 1H1LB 4KWIA 4F5ZA 1AN9A 3LPNA 3OSUA 1YR6A 4YA6A 1Y6GA 2DE0X 2PXAA 1UJBA 2QA5A 5SZIA 1YBFA 1QCYA 1B15A 4BX3A 2O2DA 1HY3A 2BH2A 4K40A 4C4PA 4AZ3A 1H2HA 2DWQA 3ELBA 2HNKA 3OVMA 3EA0A 4HH1A 1MGPA 3LLUA 3DNMA 5FWXA 1E1DA 2Q6VA 2PMFA 3LUJA 1I6MA 1M8GA 3ND5A 4GPTA 4AYTA 1PGQA 2YWCA 1M6EX 1PNTA 4B85A 4HMOA 4QM6A 1P44A 1ZU5A 1LNZA 5NLLA 2QX6A 2OCDA 3HFSA 2WICA 4ZRNA 4DUPA 3VH1A 3P97A 1Y7LA 1GRRA 2WPNA 3TRDA 3SJAA 3NHWA 2OPHA 3P45A 2ERXA 3E7XA 5AW2A 2ZB7A 1BW9B 4ZI2A 5CB4B 3I0NA 1J39A 3C15C 4XTRA 1WHTA 1F0PA 2V6GA 4MPPA 4X60A 5D3ZA 1F4VA 2PX3A 2ZQ5A 3GPDG 4FOLA 5HCUA 3RTBA 4DJJA 1LDBA 1TDJA 1Z62A 1U9IA 4O4JA 2XZOA 2B34A 1XZ8A 4R1OA 2GJ4A 4Q3KA 4AS2A 3FFBA 3GFTA 2Y2VA 4N5DA 5TQ0A 3AG5A 3TDMA 5E8JA 1YULA 5T41A 4Y2UA 3KKKA 3Q5EA 2OCLA 1PR4A 1QVAA 4YMHA 3PEEA 3WLTA 4C2UA 1LTKA 3GA0A 1I4TD 1TK3A 2FMKA 1U0FA 3O82A 1VYVA 2G88A 4QHTA 2W6ID 1EZ1A 4ZAWA 4DDTA 3C0KA 1OJLA 3K31A 4G2TA 2VHWA 3A3NA 4D3XA 1N5KA 2G72A 3F7OA 3NQ41 4FLEA 4JWTA 1XTRA 3K09C 3D4NA 4RW0A 3SIRA 1UJCA 1KORA 1XFDA 1CUEA 1YCFA 4RY0A 1LRLA 2IGBA 3LZ6A 2XTZA 1OWPA 2YHIA 7GPBA 1QLJA 4ZK2A 4NU6A 2R7NA 4LFCB 2M6KA 1OXSC 1MENA 3M1IA 2WHPA 2IT1A 2FW0A 3D2LA 3AI2A 3IAFA 3F98A 4R05A 4R5HA 1YJXA 3RKUA 5GV8A 4QE3A 5FTMA 3WGTA 4B35A 3WA7A 4H77A 3BMCB 4IDGA 4Q93A 4MKXA 3GEGA 4OQLA 4ZO7A 5A5FA 5M2QA 3M7IA 2GM3A 5AICA 2WAOA 3T06B 1TMYA 2PX6A 3DYVA 4M0CA 1XD2B 3CLUD 2ERYA 3NIGB 4IJMA 4W5WA 3D3JA 1X7WA 1WMDA 1AHHA 1OA0A 2G70A 4EATA 2P5UA 2VEOA 4RVCA 3DA8A 4A8JA 4RLQA 2IX3A 2Z8XA 1QGUA 3PWKA 1OXTA 1KU6A 1SMKA 4PNHA 3G0DA 2DF8A 2WSLA 5DLEA 3STUA 2FY8A 4ZDWA 5BWLA 4DV4B 2CUZA 4OIFA 4E7OA 3ZY5A 1TLTA 1U6KA 1DQSA 1EUDA 3I58A 1SBTA 1X80B 4UM9D 4R2KA 3V6LA 3AEYA 1JB9A 3QMMA 3S4YA 3GLVA 5DGDA 1NSYA 1U9IC 2J7PD 4YPFA 3D0QA 4CU2A 4XPIB 4OLFA 5DSTA 3FHCB 4U7PB 3RIXA 1OC2A 4QREA 4D3FA 1E0SA 2GBIA 221PA 4Q3NA 4HMQA 1CUFA 3GPBA 3U3OA 4RVFA 1C8BA 5GQSA 3UJHA 4B3IA 4M37A 2V4MA 5KQRA 3OFSA 4OX9Y 3W9BA 5D00A 5ALEA 3JRXA 3USES 5KQLA 1WCV1 1ZXLA 3KHTA 4DDWA 4B31A 2QNIA 1TW3A 4XIIA 2X40A 3JQ7B 4L1KA 4RTJA 2L17A 3PG5A 3UIEA 5JZMA 3AR2A 4M1WA 1M2NA 4FI3C 1UT5A 4NCNA 3G9TA 3C5EA 3L8CA 2NU8B 1NATA 3SQMA 4TRMA 2IU3A 3TUJC 3NIWA 5DIFA 2AFIB 5LYJA 4ARUA 2XB6A 1QG6A 3A6DA 4OOFA 1CX9B 5TXGA 5CCDA 3UXEA 3IGFA 2RGUA 3DPUA 1PTKA 4DLVA 2KE5A 3AL3A 1UFVA 4M9SA 4NF2A 5IKOA 1PR0A 4WT7A 2Z1MA 4W5RA 2I8CA 1ADFA 2PFKA 4KGZA 4YMUA 5JD5A 2H59A 3A1DA 4IL5A 3R40A 2YJ6A 4N0DA 1K6JA 3ILYA 1V7QA 3CEHA 4IYJA 5GVSA 1MT3A 4TYPA 4OK6A 4X95A 5JXGA 2D0DA 5KB3A 1D2GA 3OEHD 2IL1A 4IY1A 1QH1A 1ZU4A 1Q1ZA 4OFWA 5H4GA 2HCJB 4A8JC 2GKOA 4EHAA 4LF7B 4UQLA 3WQRA 1MDFA 4G25A 4EZBA 7REQA 3JARA 1XA0A 2DKFA 3DNPA 3SR3A 4I9NA 1XLWA 1O87A 4ALKA 5KS2A 5IM4F 4WCFA 3H17A 3MHPA 3PQ8A 3IQFA 1CDEA 1ZOIA 1CUCA 4R0NA 1EMDA 1KU0A 2M6RA 3KLNA 2V9CA 2BPOA 3B5IA 3ZV4A 1WSDA 4G24A 5LQRA 3PHLA 4N41A 1JJAA 3PDCA 1JR3E 1BE8A 1Y1LA 5ALHA 1D4AA 4TLCA 4H3VA 4Y1RB 5DX0A 2G1UA 2OEPA 1L5HA 3DO6A 1I33A 2YNMD 3CT6A 1KA9H 4WLVA 2Q50A 5A1JA 1G42A 4BFCA 1NQUA 4A5SA 2YIJA 3ZK8A 2F3UA 2YVKA 3SZ3A 2IE8A 1C8VB 3VPCA 4TUYF 1QV7A 3PENA 3HR4A 3KJQA 4RH0A 5LSAA 4PFKA 4YB8A 5B4TA 1GTJ1 2JEOA 3LKZA 1EVYA 4ACAA 3HE3A 3DBRA 1SU4A 3LSTA 3LLVA 1R3DA 1T2NA 5B7QA 3OLCX 4MP8A 2D1QA 3KT0A 1ABBA 3KRTA 1EP3B 1TQ6A 3NUGA 4ZEMA 3HJNA 3ID6C 4Z4EA 3DXFA 5GVRA 3CZMA 3S28A 4DM7A 1NVBA 4QXRA 4MPJA 4CM9A 4UUBA 2NO1A 4X63A 4PO1A 1NBHA 4JXXA 2AN3A 2VG8A 2IXAA 3GDOA 4YLEA 4RHEA 2OCGA 2Z30A 1KGDA 4BQRA 4F8JA 3H5RA 2X77A 3HBAA 3MMPA 4AMYA 1GG9A 1PL8A 1PSDA 1ZNWA 4GOXA 5AD1A 3B13B 2ZJ5A 2GILA 1DQNA 1QYVA 3HDJA 3DVAA 4KO4S 2AYZA 4Z0NA 4C76A 3SJUA 3HK2A 4GKJB 3QPAA 1WOMA 4B32A 4DV7B 1JIVA 1XWIA 4X00A 2PS1A 5KZMB 1U3TA 1UJ2A 1IY0A 3BSYA 3KPYA 4RYDA 2R5WA 1CB7A 1KJQA 1ZOOA 3WGQA 4E46A 2GAJA 4YH1A 3VKGA 2PUWA 3CRW1 4WNCA 2BKVA 4KLCA 2Q8PA 3AHJA 4I55F 3OT1A 2J6CA 1G60A 1M2WA 4DRXA 3WBJA 2F7SA 1QP4A 2XVZA 4WCFC 1E5VA 1C0IA 4BGIA 4FB5A 4FQ8A 2TECE 5J1TB 3S44A 5JHGB 2LVBA 4E13A 1R8XA 1Y8RA 4DQ0A 3LXUX 2PT5A 1DXOA 3RV4A 4PX2A 3QKRA 3A4LA 1L2TA 1ECLA 4EYGA 1ECCA 1GKYA 3QFHA 1P3JA 4KXXA 3IVMA 1IU9A 2G9UA 3OQPA 1Z6TA 2GZ3A 4M0KA 3QWIA 3I05A 1CP2A 1ZOPA 2KS6A 3T3HA 5L8VA 3HJCA 3CZCA 2PWYA 1XELA 5JANA 3NCTA 4XIJA 5TJ9A 1J8MF 1UWLA 2VXCA 2XKKA 2FMUA 2DXIA 3ZDCA 2UVQA 3IEMA 4G67A 1WF3A 1W94A 5SICE 4PR3A 3FGZA 3REFA 2GAOA 1Z22A 2XUPA 2EG5A 3M9WA 3W3AA 5EKUA 1G38A 3M1LA 3K9QO 1YXMA 2E55A 3QPUA 3X1WA 4MV3A 1L5WA 3VGPA 2JGFA 2ZPTX 2HDHA 4N76A 3P9PA 2H16A 2JANA 3MZ0A 2GERA 4TYYA 1ZNXA 2G77B 4KO1S 3KR9A 4D8WA 3KFXA 3T99A 3OURA 3FMIA 4I8DA 1M2EA 1DIAA 3E5RA 4XX0B 4DDHA 4JUBA 2UVPA 3SE0A 3B36A 3UTDA 5IKEA 2BFFB 2W7TA 3ESXA 5F77A 4YAUA 1IK6A 3EGDA 1WB9A 3FM9A 3FZYA 2ZREA 2VPXA 2KBFA 3R9XB 1W85B 2P2LA 1LD3A 2E9SA 3WYCA 4OATA 3T1QA 2GTPA 2EW1A 2ZJ2A 3GBPA 3TCKA 2WP0A 3AHFA 3UMFA 1UC8A 3NAZA 5AXBA 4I9UA 1XIVA 3AHDA 2PQ6A 2CT8A 2EJCA 3D02A 2DLCX 4HVAA 2CMDA 4ND5A 2J3QA 4RXUA 3VR5D 1ZN7A 5BW5A 4DBLC 4YUWA 4TTTS 1S8FA 4H1VA 5K8JB 1U0TA 3WTBA 1AUQA 5GJWC 3G0CA 2VWGA 4BO3A 4HEA1 4LTDA 4Q4HB 3DJYA 3R5HA 1HETA 3PLAE 3JQAA 2UYYA 1GCOA 4GXQA 4DA4A 3AUUA 1KFCB 2CLCX 4RM2A 2JI8A 3IJEB 4MUIA 4REQB 1KOFA 2E48A 1W96A 2NO7A 4FYHA 5AVUA 4ZCMA 4D3YA 4K6MA 2B8NA 3ITDA 4E12A 1GRCA 5C31A 2R5FA 2GZSA 2XMCA 3M4ZA 4P38A 3I6BA 4EVQA 3RC1A 2H0RA 2CFSA 1OKKA 3GEPA 2ATVA 3BIJA 2EKBA 1F5SA 5BR4A 3LKBA 1AK9A 3FMFA 1JYEA 1KKLA 4OQNA 2ISQA 4WERA 1REQB 4JS0A 4QYIA 4C4ZA 1V8BA 4KE9A 3QEMA 1ST3A 2XOKA 4P7GA 2C97A 2BV3A 3KIPA 1S4QA 8MHTA 1EVLA 3QY0A 4FX5A 4M9UA 1YC2A 3E48A 5IM4A 5JDCA 3O4JA 1YL5A 4B47A 3O6VA 1CZLA 3BXFA 3L7YA 3NFYA 4CR8A 4DCVA 3VISA 1ZUNB 2Z2XA 1FFXB 1YR8A 3CF4A 1A71A 1E62A 3LL4A 3HBLA 1W2WB 1LK7A 1JEEA 2XNSA 4XWYA 4ZPJA 4UVEA 5A04A 3IPCA 1Z3IX 3HV2A 2FF5A 1GGNA 1GXSA 5JOQA 2GJ8A 1B41A 2JFQA 3LHIA 1HQCA 4HY3A 1E1RA 3BD9A 1EM8A 5HFJA 4EAQA 3NTLA 1FP2A 1LK0A 1SPBS 2EW2A 2GFQA 2P6NA 4OUDA 3SFVA 4TUYA 3FPCA 2ZYHA 4RC9A 4A2WA 3GQVA 3ZX4A 3RW9A 1QFZA 1RNLA 3BPSA 3WWDA 1P74A 2UZAA 5BVHA 1KZ6A 3INTA 1SH7A 4Y3UA 2XNDD 1JU9A 5EKTA 4J4TA 3KSBC 4FR0A 3QWBA 2IBMA 2H2DA 1KQOA 1Q2XA 2FSVA 3DPSA 3E23A 1BNCA 1N2GA 1WW8A 2J0UA 3GVCA 4XJXA 4E31A 5JJLA 1VP9A 4RD3A 3DWGA 2QX7A 1G7RA 1GU0A 2X8JB 1H3NA 4QXPA 4US1R 3WK9A 5BN1A 1O94A 2O19A 2GETA 4JVNA 4V0KA 1D5CA 4PEVA 1P9LA 3BD7A 2O0JA 4FUQA 4PC3A 4PZLA 4MV8A 5T4HA 4KXQA 5C7OO 5CPFA 3IBSA 3H1FA 3WGUA 1UXJA 4RPCA 2J9FB 2YQ4A 1E5DA 2CN1A 2ZRKA 3D7KA 3F6CA 4PHHA 1KF0A 3HWSA 4JMLA 3VZQA 2IXFA 2PVSA 2NXCA 4C0XA 4C2AA 4I55A 2C5AA 2HSZA 3VYTB 4QUIA 1XN4A 2WTNA 4A4DA 5EIFA 5A3JA 1C1XA 4CM9D 1K4MA 3KB2A 3D81A 3VC1A 1VMKA 4A0FA 5JDCC 1F2UB 3GVPA 1BE0A 1U5BA 2YYYA 2BHNA 3ASVA 3Q8WA 4BNNA 1MFZA 1DEKA 3K92A 3PK0A 5ALLA 3T5MA 4JGBA 4AJPA 2O0KA 1DOHA 5KYUB 2GBGA 4IH4A 2VHTA 1N4AA 3RI3A 3N7TA 1EWYA 1XA4A 2WU8A 2CVPA 2JD0A 2XB4A 3ESBA 3MRVA 4WKPA 3HNRA 1M2OB 4OGKA 4FYIA 4QYXA 2QR3A 3KL4A 3CUUA 2JJMA 2A9PA 4YRLA 2W2LA 1A9SA 4UDNA 3DCIA 1ZBQA 3QVTA 4OLAA 1CJTC 4O4IB 4CM6A 2WINI 2WC1A 2H06A 3CE6A 3K15A 2FWPA 3QVKA 4M0EA 5CVDA 5DSXA 1Q14A 2ZYAA 4HF7A 5JRDS 2VYND 3RIHA 1RPAA 1MCZA 3FFTA 1T3ZA 3FAZA 4ICIA 2I33A 4LNAA 4XM0A 3M2PA 2Z8ZA 1FS6A 1LRJA 4LGYA 2A9VA 5ALOA 2QXTA 3RUFA 5BMOA 2FSVC 4QQRA 4B2IA 3OIFA 4YV0A 1FC0A 1KVQA 5FPPA 4DQVA 2I4RA 2N1MA 3ESDA 3R9WA 3REQA 5BSTA 2VWHA 3F7NA 1O94C 1Y5NA 2KI5A 5JAMA 1JLMA 2IKQA 2WSSD 1C4XA 4CTJA 4LCEA 2PKEA 4D26A 4PSUA 4X6XA 3HMQA 2IXEA 4WCVA 5FI1B 3OZAA 2FQQA 3DZBA 5EYPB 2ZPAA 4MRMA 1K6IA 3G9UA 2FFAA 4QBKA 4ITUA 4WFKA 1UZMA 1LNSA 1R15A 2MSNA 4UARA 3ZU2A 2ZI7A 1RBZA 3QG1A 4H7JA 5K51A 3ZQKA 4PG5A 4XVRA 4G0YA 1PK8A 4DA7A 2A8YA 4HAOA 1R6TA 1E9EA 1JG6A 1TQDA 2OQRA 1UMBB 2XW6A 2J9RA 3PA6A 3VH4A 1ITZA 4P93A 4BMYA 1V11A 2QD1A 3H5TA 2OQIA 1X9IA 3AEKA 3HR7A 3BHMA 3W5SA 4IRUB 3ZGVA 3KVOA 4FC7A 3D8SA 5FXMA 5BNFA 2C7VA 1X1TA 1J23A 2P7HA 3K1ZA 4MR7A 5TQ2A 4ZZ0A 3L7AA 1T1IA 1ULTA 1PX0A 2Q46A 1H9CA 4CN8A 1D0SA 4EUEA 4I1IA 4IM7A 1AQLA 4PNPA 5CDFA 3ZV5A 4K5QA 1QQ5A 1U98A 5IAJA 3J81k 4H0FA 1EXDA 1O97C 3S8YA 3RYCA 3HN2A 3HGQA 3RIGA 3N5CA 1U7ZA 2AIRA 4Q4LA 3SLGA 1SVLA 1HXHA 2XGOA 2PSEA 5CH3A 3ROGA 1CQJB 1II8B 1K9VF 2P6UA 3TSWA 3CRQA 3WS7A 2KLHA 2DT8A 2O5CA 1MBZA 1WDWB 1DBQA 1YNOA 2QD2A 2X1HA 4L85A 1JKIA 3HXKA 3NR2A 4N9QA 1XZFA 2B25A 2FZGA 5EIHA 3JVEA 3THYB 4F2DA 2W2OA 3B3QA 5K0GA 1YZUA 4NBLA 1L1FA 3N8GA 1O95A 1IWBB 3W9SA 4QFMA 4UXJA 1OV6A 1KOLA 3VGJA 4Q9AA 5C1PA 2RG7A 1EA5A 3SZGA 1FP1D 1Z06A 2YX1A 1GG8A 2IEAA 3CVOA 5CA1B 5GJCA 1L4UA 3O8OA 4YRQA 1TQHA 2X9GA 2Y0CA 3O73A 4PGHA 4YCMA 2BTOA 2O7QA 1UPCA 2AEJA 2CYAA 4P4TA 1PWEA 1JHXA 1SUBA 3RADC 4IICA 4RZHA 4PF1A 3VR6H 3P27A 1TL7C 5MFPA 3GLGA 1HFKA 3OBBA 3OE7A 4RVSA 5L3QA 3OIDA 4IUDS 4UMVA 4WOCA 4L72A 4MLPA 3AIIA 4O2BF 1U1FA 5BN4B 5THXA 3WP0A 4ZN6A 5KYYB 2PRKA 2GZAA 4CKZA 1T1RA 5IJAA 2TMKA 4RD0A 2H4WA 4LWOA 1NQTA 1DC4A 3R7FA 2LW7A 2NTYC 3HKCB 3FDFA 3R9IA 3O74A 1LK5A 3H3JA 1IM5A 1DBPA 5A3VA 3JWJA 3P9XA 1QH0A 4MQLA 2G4VA 3P4UA 5ERGB 1A9YA 3SXUB 1YTUA 1RWWA 1Z6GA 5L4LA 4RK1A 2BUAA 3G5MA 1P73A 3L7IA 3NFRA 4OLJA 3KQHA 1QK4A 1W48A 2OOKA 2UVDA 3DXXA 2VZ0A 3IYLW 4IFBA 3WP1B 7AT1A 1CIVA 4F4CA 2DFTA 3LSYA 3UMYA 3VSCA 3HSKA 4G5XA 4HPWA 2B8TA 3LC1O 3V42A 3JVVA 3TLJA 2WB4A 4MKGA 5E1OA 3N8IA 5JWHA 4O1IA 1T24A 2QW1A 3CBQA 4NYIR 2MOKA 3VI4B 4JKIA 1JLRA 2YW2A 1BMTA 3OFNA 4JQOA 4KPGA 1MZPA 1E5LA 2IP1A 4GAEA 4BNTA 4DOMA 1C7RA 1CDDA 1R6AA 2NXEA 2H4XA 3HB4X 4ZTZB 3QVGA 1AUOA 1SOAA 3CEAA 2GEBA 2H07A 3KHSA 4KVGA 3LY7A 5J5CA 1GARA 3TL3A 4EB0A 5BN5B 1G291 1Y6JA 2A7XA 1J90A 1O95C 3ENNA 3FY4A 2GPBA 3D2CA 4BUCA 5BPFA 4AQYB 2PRIA 5MF6A 4QARA 3G2NA 2P4UA 4KRGA 1UODA 1CY8A 3DHVA 4IKEA 1CJKC 2QVBA 3CX6A 1RYBA 3OU6A 4WKOA 5AKLA 1IBSA 2YUIA 3BCRA 4CWAA 4HNAB 3PA8A 1GPH1 2YV3A 2O8VA 3BK7A 1Y6FA 3GIWA 4BCDA 4G0VA 2QYOA 4KAAA 3NM4A 3T3EA 1NX6A 2FSGA 1KDPA 1FMTA 2AMFA 4EA8A 4RWZA 4F84A 1L6RA 3EXEB 3Q8LA 1ORRA 1YS4A 2I55A 4PLGA 2BTEA 2CK3A 2A5YB 2Y1DA 3GVHA 5LYYA 3REOA 4CRWB 4HVCA 1RQXA 2ZB4A 5FTLA 4NWIA 4H7DA 4HHEA 4BB5A 1TUBA 2FOXA 1R5NA 1SHZA 2PGNA 3L8EA 3E05A 2E37A 4O1HA 4RABA 1ADJA 3PXBA 4LOHA 1TT5A 3B3JA 4P7KA 1GTRA 4DEYA 1S2IA 2DTDA 3CZ4A 1Z2DA 4FFDA 3NVMB 2DHCA 4Q82A 3QV2A 1DMRA 2WNSA 1PE0A 4BGVA 3ECSA 2PIDA 4H59A 4L5AA 4LX8A 2AXPA 4A6DA 5DNCA 2V7WA 1ZNQO 3ZNOA 3RWMB 4G1UC 3JSAA 4H3HB 2GX6A 3A3PA 4O2AF 3GNLA 4IPTA 1XG5A 1F20A 1RHUA 4QYSA 4MO9A 1MR3F 3ORYA 2QQ5A 4L5JA 2FWAA 1O97D 3AEUA 1R4MB 2PX0A 3EWIA 3OPNA 3VM6A 4CL3A 3KJEA 3QKWA 1CJMA 1ZCAA 1YJ5A 1X2BA 1PFGA 1VFNA 1WUHS 2P5TB 4OUKX 3P94A 4Q0MA 3ZXSA 3AEZA 3R0IA 5EESA 2MYTA 1P8JA 1PS9A 2BM1A 3THSA 4GECA 4X1OA 3ZNNA 2O6LA 2ZAIA 1O96A 5IW8A 2XKAA 1AA9A 2DH6A 3NNSA 3BTOA 3X1XA 4M1QA 3QFRA 1RXCA 4AKHA 1T8SA 1NQAO 1IM2A 2H5LA 4HNRA 4JZKA 4BNXA 2DY1A 3JVDA 5AHXA 5BWMA 5CDGA 4UMDA 4GOND 1ZL2A 2X2OA 3ZTTA 3F49S 4ZO6A 3QLEA 3FOZA 1P3DA 2C42A 4B3XA 1JEQA 3ZK9A 4WUTA 3A4IA 1SXIA 1YVDA 2JAHA 4QQFA 3VFDA 1IEQA 2AHOA 3DL7A 3PT5A 2Z9BA 3DTYA 2XWQA 1IWPB 1BWQA 1KZ1A 3A4VA 4Y2TA 2XNCA 4EKEA 5JDIA 1NMSA 3R7AA 5EMHA 5KX5B 3L7JA 1D4OA 3TRFA 1M5TA 4E2ZA 1CIJA 1R8SA 1PJTA 1TQ4A 4GKAA 3HCRA 4XUDA 3CRNA 1LSSA 5LMCA 3BD8A 3IB6A 4FKBA 4TWRA 4NBVA 2O0HA 3KHUA 3NIBA 1VYHA 3WSTA 2RBGA 4BNIA 2N46A 2AR9A 1OT3A 4A0QA 1QQBA 3K1AB 1GAXA 5ADVA 2EZ4A 2E85A 3LT4A 3LX5A 2C0PA 5FUMA 4FGWA 4K1LA 3SIPA 4YJDA 3QXGA 4N7RA 3VMMA 1DDIA 5IBPA 1HFEL 4QOIA 3N70A 4IJ5A 3WMWA 3ZWAA 4CKCB 3ZHBA 3AUAA 1DDOA 3RS2A 2H5EA 1YJ8A 3HZOA 1YQ9A 2JEYA 4YRMA 4D79A 1PFYA 3AFGA 4WK0B 5EXPA 5F2OA 3O0DA 4UBLA 3GP3A 4MEAA 3UMVA 2Z2YA 4KH0A 4BRSA 3X1MA 5COBA 4R81A 4WI1A 1Z5UA 4I9FA 1XZAA 1L5FA 4RELA 2BR4A 1I51A 3M2TA 5EL0A 5K1ZA 3OX4A 4PZUA 4R1PA 4JR2A 3TECE 4B5LA 3HVKA 4WE3A 1F1JA 4PPFA 3C3YA 1TPYA 3CGWA 5F7OA 4LF8B 1M2KA 1DXQA 2OCXA 4OM7A 1EHYA 2O8EA 4O2BA 1LBEA 3I64A 4NATA 4MKRA 4PCLA 4DA9A 1YUBA 4WDQA 4ZDJA 5K8UA 4S0XA 1T2FA 1T8TA 2JDID 1PJCA 4UU1A 4BJ5A 4JXJA 2QX9A 1FSZA 1UL1X 2AZDA 1DKLA 2XBLA 3IXMA 5AH0A 1G6Q1 2PNFA 3BQNB 4GZ5A 2B3DA 4OKNA 1Y3DE 2Q3HA 3I9LA 4BX2A 1ECGA 4HGZA 1G5FA 2XDWA 4JKOA 4PZCA 4XX1A 1ONBA 2GRUA 5JDIC 1F0NA 4L9AA 1VL8A 1KPIA 2DR0A 2FJ0A 3A05A 3W04A 1N9GB 4W82A 2BHSA 4WVLA 2XAUA 1J0AA 3PXDA 2IELA 4CIDA 4EYQA 1X70A 1MLDA 2BHRA 4B5KA 1E2LA 2BFAA 4IIUA 4KE6A 3CX8A 4YXWD 3FPGA 2O1EA 4HC4A 5DWVA 4ZCLA 4RSMA 1MTZA 2AUMA 4MHTA 4RPIA 3B6IA 2FRVA 1Z88A 2AJ8A 2NADA 1DKPA 3D4IA 4IIHA 4QYTA 3HJBA 2JK0A 4TVOA 3MJCA 3E15A 1GZ6A 3G2HA 3MJRA 4OI4A 5AWFC 2AN9A 2I4MA 3JX9A 1F12A 3C3KA 4FSXA 1E3JA 4H9GA 4LQLA 3K5WA 3LWNA 3PNVA 4Q3LA 1VZ2A 3B82A 1VPWA 4PZDA 3INYA 1NMQA 3RS0A 2COUA 4HLNA 1ORIA 1M1YB 3U31A 3ZVNA 1X8KA 3D5EA 1FXWF 2KB0A 3JY6A 4JC5A 2CNBA 3UUFA 2ZTVA 3E03A 3PUIA 2WJHA 4GRIA 3S8EA 2GS9A 3FIUA 3GUYA 4N5MA 2JKZA 1NXWA 1N6KA 4YYZA 2JAXA 2CWDA 3AR7A 2H1WA 3D0RA 4K26A 4OJQA 3LUBA 4RQUA 4RLFA 3C8DA 3GGPA 2D7JA 2OHVA 4TGLA 3CNNA 1YHZA 3ISJA 2PLRA 5FFFA 4C1NA 2HIHA 3QPVA 4IZ6A 1NT2A 4E30A 4NZNA 2XQKA 3S55A 3PFNA 3U4QB 2AZTA 4P3PA 3V7WA 4NECA 1BH2A 3O3OB 1W36C 1H4VB 3DUFB 4MVJP 4X93A 1RPZA 4HRAA 3NWOA 1T5IA 3GUUA 5JE8A 1WTAA 3W1VA 3U80A 4PFSA 3NWEA 1NF8A 1N1GA 2QRZA 3H2GA 7ADHA 4AO7A 1NBMD 2I1WA 2OECA 5KCMA 1C0LA 2AQHA 4RGBA 1L7DA 3T7CA 4ESEA 2VHQA 2HMVA 4G0WA 3AXTA 1Y8AA 3FETA 4O2AA 2VQEB 3RVQA 1YE3A 3ZU5A 3SZUA 1DHTA 1C4WA 2IYPA 5J58A 3LYAA 3CNQS 1D7AA 4TV9F 3DMYA 4WV3A 2PUJA 5EXXA 4D02A 2B83A 1ZA1A 3BREA 4TV8A 2B30A 3TIFA 3LDGA 1JEDA 1OI2A 2FPPA 1CZOA 2X0KA 3VYRB 1PLLA 3KVNA 3TEJA 2XT0A 2H31A 1CRQA 4D5GA 1YQWA 1XV5A 2YOHA 4JUFA 3RRJA 1AN0A 1UPUA 1TJNA 3RK4A 4CHTA 1HT0A 3K72B 1UBHS 4LOAA 3UJBA 1MJFA 1U8YA 5KYNA 1NA5A 1FTYA 1E6EA 2DRIA 3FGNA 4IDNA 1ONOA 1QVVA 2ICAA 2JGRA 4W9RA 4ZHQF 5FOQA 4Q7JB 5CNJA 1JLLA 3ETHA 4RF5A 5DHPA 1BX1A 4IHJA 1UM8A 3R2JA 1FTQA 4O5AA 5A7HA 3MLBA 3ZTYA 3DOJA 2ZU0C 3QOXA 1WEKA 2DQKA 3W4KA 1NAIA 2NU7B 4MDFA 2FG5A 2FG6C 2XQGA 5KC9A 2XB2A 2E5WA 2KSQA 5FO0A 2QAJA 3RFVA 4D9JA 4R1NA 3BOSA 3Q8MA 1LQTA 4FW8A 2CY0A 1LEHA 2RGNA 3D31A 1J8YF 1Q20A 2JLRA 4W1SA 2Q6OA 2FWJA 2O48X 1IFXA 1RXUA 3MG9A 4V38A 3A1UA 4G5FA 4WW0A 2AR7A 2XYQA 4LVCA 4F21A 2WF6A 3GRVA 4WA7A 1QORA 4Q3DA 4WJKB 5HQJA 4UULA 2ZBFA 1T4BA 1BQEA 4O3FA 4RTLA 2EGGA 3H5IA 3EWAA 3O8DA 2OORA 5LOVB 1WMFA 5EKXA 2I1VB 4JLMA 3STHA 1OJ7A 4Y2JA 2Q45A 5BYAA 1LW6E 1QKJA 4GBGA 3KVVA 1DXYA 1D3AA 3FNGA 3UMJA 1QUEA 3VR3D 2ZAOA 3AETB 1S7CA 3VSDA 3CSSA 3LS2A 3GJ4A 4N3BA 1UAAA 5JQGB 3SC3A 2JKVA 1DAOA 3JZDA 1UDAA 1UINA 1XL0A 1HEIA 2YN4A 3OZFA 4L8FA 2IOYA 4KXFB 4D4KA 3GLIE 1NBIA 3C3DA 2JFGA 1GTG1 4WTOA 4G4JA 5I7SA 4RFLA 8ATCA 1HDZA 1E1MA 3SC6A 2CFIA 4UFPA 1R2QA 4UCXA 2DVMA 3B52X 1KE1A 1DUVG 1DQRA 3GEDA 3AR5A 1T1GA 3G9XA 3PF9A 4W7IA 5G0UA 2H1OA 5AI0A 4BKMA 3FPJA 3R3XA 3MGBA 4BWYA 1V2HE 3ZXYA 1W46A 1WKCA 2PXCA 2JBAB 3X1JA 2R48A 4FGSA 4FBMA 4FHZA 5DTIA 1Q7RA 4IMJB 3ZU3A 5SYMA 3FRIA 1VIDA 1Q6YA 4PZAA 4W5JA 3NI2A 1NW5A 1G9SA 2J85A 1U8EA 2WVJA 4NBNA 1W1IA 2A0FA 3TW8B 3UZUA 1YIOA 1U02A 1BD3A 4XCXA 4Y2GA 5JY6A 2XODA 1C2YA 1RSZA 4DUYB 4FEAA 2CD9A 3MAJA 1F7VA 1K7FB 2RGNC 3VOSA 4BZWA 5D8DA 4XB6B 2AD5A 3ZLUA 1IBLB 3ER9A 1N5OX 3CWCA 4JXKA 3LKDA 3UVEA 2AI2A 3EXIA 4YP0A 3NTQA 2XWBF 4ZZ2A 3AKZA 3O21A 3W5IA 1AKNA 2FPOA 2PAAA 5HIMA 4YPOA 1F7UA 2HDOA 4IJVA 4Z99A 1CUBA 2GESA 2HHLA 3L6OO 4N6GA 5AKEA 3WLRA 4ETNA 2BMAA 2DPHA 3P0HA 3G6KA 2W48A 3BKXA 2OORC 3H2IA 4MCHA 4M83A 4C7MA 2GD0A 3M1AA 4HGNA 4ZO9A 1OWNA 2OLEA 3QBEA 3ZLVA 4E5VA 5IJWA 5MN4A 3BWDD 2V4ZA 2O3SA 3HJUA 3TNYA 1NUUA 4LC0A 4G37A 3SD7A 5HQ3B 2HC9A 3VU9B 4ZO4A 1FXWA 4CV2A 1PIWA 1MRZA 2D2FA 4PX3A 3VNSA 5I5EA 2FPGA 4J0GA 1CLEA 1SC6A 3SVZA 3I9V6 1G20B 3UH1A 5L45A 2PZKA 1Q19A 2C1ZA 3CEJA 3GFOA 2ZI6A 2VT6A 3VX4A 3E9CA 1E1YA 1Z38A 2EATA 3SS9X 4IIVA 5KYWA 1YRQA 2BDTA 4QUKA 4UHFA 1R50A 1Y4SA 1RWOA 3O26A 4Z4GA 4U39A 2AFHA