2P78A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGAMEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p78A00
3MBKA 1BIFA 4E3WA 1C7ZA 1H2EA 4PZAA 2QNIA 2P6MA 4D4LA 5HR5A 2DWPA 3DB1A 3LL4A 4EMBA 1IHPA 2PA0A 1ND5A 2OWEA 2IKQA 2P30A 3O0TA 4JOCA 2P79A 4ARUA 1FBTA 4ARVA 1SK9A 3KKKA 3D8HA 1C80A 2H4XA 2GFIA 1DKLA 5CDHA 4JODA 1UJBA 1E59A 3IT3A 2P9YA 4IJ6A 5AJXA 1FZTA 4FDUA 4IJ5A 4PGMA 3GP3A 4PZ9A 1XQ9A 5PGMA 1V7QA 3K4PA 1DKOA 3FDZB 4D4MA 1DKNA 2EKZA 3E9EA 3HJGA 2WNHA 3LG2A 3QPWA 1UJCA 4GPIB 2I1VB 1SKBA 4MA4A 1NT4A 3R7AA 2WU0A 2P2ZA 3GW8A 3NFYA 3C7TA 5AJVB 1SKAA 2H52A 2YN0A 3E9CA 2WNIA 2RFLA 2DWOA 3FJYA 1ND6A 3IT1A 3NTLA 2P9FA 3QPVA 3IT2A 5AJWA 4ARSA 1CVIA 4AROA 1K6MA 3DCYA 5AJZA 2P6OA 3D6AA 4FDTA 3F2IA 3ZHCA 3IT0A 3LNTA 3OI7A 4ODIA 1DKMA 1E58A 3EZNA 1BQ4A 3F3KA 3K4QA 4TSRA 2AXNA 2HIAA 1YFKA 2HHJA 4GPZA 3EOZA 4D4JA 5CU7A 5CX4A 4D4KA 2YN2A 2EKBA 3BIFA 1BQ3A 2ENUA 3PGMA 2H4ZA 1RPAA 1TIPA 2A9JA 2BIFA 2H0QA 1YJXA 5AK0A 2EOAA 4QIHA 2HPAA 4HBZA 1C81A 1QWOA 3MXOA 1V37A 1SK8A 1DKPA 4EO9A 2ENWA 5AJYA 2P78A 1DKQA 2P77A 3E9DA 3FDZA 1RIIA 2OWDA 2P2YA 3D4IA 2P9ZA 4JOBA 2A6PA 2F90A 3QPUA 2P75A 1QHFA 5HTKA 3GP5A 1QFXA 1H2FA 1T8PA 1EBBA 1RPTA
chains in the Genus database with same CATH superfamily
1J49A 1NBIA 2DU8A 4B84A 1X7ZB 2WILA 2PUFA 1V2HE 4RD4A 3UHFA 1SFRA 4MGYR 4A5OA 1QOZA 4DRYA 3EVBA 3OHSX 3OHPA 2FEPA 3FAZA 4DW8A 5HRCA 4Z4HA 1GNTA 1EFLA 2WJVA 5KJCA 1FPMA 3R09A 2C5GA 1ZUNB 4YI5A 4CEHB 1ZA1A 4PIVA 2FPUA 3EXG1 4LZPA 4M54A 3LYHA 3VHXB 4CG0A 5HXAA 2FXVA 1ZJ5A 3CKMA 1Y80A 1N6RA 1R5OA 2SKEA 2OAGA 3OCJA 3LHSA 3CR7A 2Z98A 5REQA 2QYOA 2YC2C 3WLTA 1BX1A 5DHTA 1YRHA 2FLKA 3QVGA 5EIBD 3WK5A 1S2GA 1BROA 2YMLA 5EMHA 5K51A 2Y9PB 4TLMB 3VR5H 4EY4A 2XMDA 1Q50A 2QV0A 4KE7A 3PNKA 1U63A 4WKCA 3R3WA 1KAMA 3RKUA 3EIUA 3HYNA 1WXXA 3KTDA 3M9LA 2O3UA 3SC3A 4ZP1A 3FXAA 2QVBA 1JKJB 2XEDA 4PO8A 5F2NA 1CQJA 4PPQA 2BMJA 3I42A 3K9QO 1Z4IA 5EJ2A 3TAXA 5IUJC 4LWZA 3KDAA 1N2HA 3LVBA 3L06A 3U7FB 4O6VA 1QYWA 3FPLA 4FFDA 4XDGA 2BFMA 3H99A 4PG7A 4MWSA 3ACBA 2UYQA 1JR2A 2WNIA 4Q7LA 4A8TA 3OWOA 2XD9A 4WXYB 1QRSA 2RE8A 4C5AA 4H35A 5DNAA 1GDHA 5LIRA 4MIKA 3A36A 4J1NA 2C7BA 4N0EA 4MUJA 3F6SA 4PRZA 1G5PA 2QZ9A 4TRRA 1O94A 2RGYA 2IXFA 2XE7A 2LCFA 4I08A 3V8MA 2QS9A 1UBSB 1YD7A 2OVFA 3FNBA 3FPEA 1LBEA 2AOUB 2X0IA 5H3LA 5IDQA 2R68A 2H2GA 2OBYA 4AIIA 1AKEA 2JRCA 3WL6A 4C89A 3GNQA 1DQPA 2VDWA 2GT1A 3QV2A 4Z1OA 4B1FA 3ZHUA 4IHKA 5DHQA 4DJJA 2FKAA 3D4OA 1GHTA 4UARA 3UK1A 3P8ZA 4Q9HA 3HA2A 4RGYA 4LUCA 4D1YA 3CNOA 1HDYA 4L8VA 1E1KA 5HJ5A 1SIUA 3GDOA 3TLKA 2CWDA 3EZGA 5DCWA 4V1CB 4ALKA 1Y7IA 2B1QA 4MRVA 4RMIA 2ZGVA 2PGLA 1HFEL 4XYBA 3T7SA 1N32B 2I6GA 3O9VA 1PJZA 2VJMA 4XKJA 4ZPJA 4UFPA 1Q1NA 1NG9A 4KYVA 3L6BA 2UUCB 3IAAA 3I4FA 3T1OA 3LX6A 4JUFA 1ONSA 1RWQA 4MW2A 4N5LA 3U4MA 3BH6A 1OBVA 1ORTA 2PX6A 1RRPA 3AEUB 1V5IA 1BSVA 1QKKA 2X5KO 3ADPA 3PC4A 4GF5A 2X3UA 4J91A 4W1SA 1UBFA 3MD9A 1TK2A 4F3RA 4BX9A 3DAOA 3DCIA 4RDIA 5AVWA 2CNDA 2I9PA 3P52A 1H4VB 3PC2A 4M1KA 3ZGLA 5IWAB 2UUPA 5JC8A 3BB4A 3F9RA 4B7UA 3K1TA 3OJOA 2WV7A 1IK4A 1J8DA 4ZVUA 2E9SA 2EL7A 4AJPA 5BQXA 4L5AA 2Z95A 3A6FA 4RL6A 2JLWA 3RTEA 3HFJA 1Z4KA 4DLRA 2IS6A 5NULA 4Q7QA 1J0AA 3A2MA 2CL6X 3GVIA 3UMGA 2HMVA 3MHPA 1TM2A 4C14A 2PPVA 1PG2A 1QVZA 1XCPA 3OOEA 2ZXEA 2GN2A 4FJ0A 5TC4A 1ZSNA 2JFHA 2YIVX 1HMPA 1Z5ZA 2RBKA 4NPCA 2WZDA 5LBIA 3JCZA 1A9RA 4Q9AA 3WJ1A 3I0ZA 2NO4A 1TLTA 5KJ1A 4RHYA 3SC6A 2ORIA 3GNLA 3EGDB 2FR1A 3GLIE 1N2CE 3OPMA 4KPGA 4DMMA 1Y4UA 4BZQA 1W8DA 2J1LA 3BS4A 1X1DA 1Z9BA 4FNOA 4P22A 2YR0A 5B55A 3B9PA 1O97D 1NMZA 2IW3A 1NN5A 2ZSUA 2B4YA 1V8DA 4BNJA 1N3IA 4COOA 1S7GA 1RSZA 1DG3A 3OT1A 3S1LA 4AJEA 2JH9A 1U6IA 4GGOA 4YHHB 2QN8A 1UQTA 4DNFA 1B15A 3PEUA 1R0LA 2OO5C 3O73A 1XK6A 5DNWA 1R27A 2E1PA 4TV8A 1T5IA 1THMA 3D0QA 1N6KA 5C18A 3G17A 3AB7A 4X8OA 4BC0A 3VU9A 1I5OA 2ZITA 4YGYA 4DLSA 1EXNA 1R0WA 2WD9A 3ZCUA 1BVYF 3C2QA 1J9GA 2VXOA 1SIWA 4OX9B 3CH6A 4PW0A 2PUWA 1RQ7A 3KAPA 4XOIA 1I2DA 2FEOA 2HY7A 4GLBA 4DCCA 2HW8A 2IT1A 3QUTA 3SVLA 4GR9A 4LOKA 4ENVA 1AO0A 3M4XA 5TQJA 3KYCB 3K6SA 8MHTA 5AW9A 1QLJA 4R1QA 3IAHA 1PJCA 1RAGA 2FPPA 2NM0A 4FHZA 4TWZA 5LIPA 2MSWA 4F1KA 1JR6A 1QHIA 4K3VA 4KXYA 1CZOA 4BGVA 4HWSA 2XIJA 1HT2E 3DFKA 2AG0A 4EABA 1QQAA 2IXTA 2CDRA 4C7XA 3E2IA 1PGNA 1B00A 3G3EA 5BVHB 1V8OA 5EJGA 2OXFA 1QG4A 1GL7A 1WSDA 3T1NA 4F2PA 4A6PA 4I7EA 2GCIA 4QEKA 4RTOA 2PQ6A 1V0JA 2F67A 3V9PA 2F17A 4LGCA 4KRGA 5BVHA 1YB1A 3P20A 2GOYA 1YI0A 1MDFA 3FR7A 3I5MA 1MBZA 1GTMA 1T6YA 3DWIA 2J46A 5F1OA 3Q3JB 4KQWA 5A9SA 1OE0A 1CNEA 1SHTX 4WNYA 3VPHA 4LJ7A 2RGXA 3AWDA 1IUKA 2CLSA 3W3AD 2EFHB 3CHYA 1MO5A 5LP6B 1FP7A 1OIVA 2ZUFA 1MIOB 1CULC 3CF4G 4WBNB 5C5IA 3IOCA 4EATA 3COYA 2QLJA 5BW6B 4R1OA 2GEKA 4Q18A 3KTAA 5JMWA 4INAA 2ZTVA 3ND7A 4K9QA 4Z9BA 2YL2A 5AK5A 1N2EA 3EZ9A 3Q7QA 1NQTA 4MKRA 1E3EA 2PS1A 5BQ3A 1KFEB 1FX0B 2P3SA 1G20A 1A9OA 1ZC4A 2VDRB 3FYTA 5IJWA 2ONJA 3CRVA 4G6ZA 4ZYZA 5A1TA 3DEYX 2VF5X 1SVWA 4EHJA 3IXLA 2CFSA 1T5HX 2Q5CA 2ZOSA 1BEZA 4BLTA 1HEIA 2AD5A 2D1YA 2CNOA 3WIUA 4DMCA 1ISMA 2HRRA 3FZGA 4OFZA 5TQ2A 4ZICA 4GYWA 1QH8A 4OHBA 1DINA 2IDKA 2FN4A 4OJKA 1HNNA 1QUEA 2H8KA 1GA1A 1G3UA 2PTGA 4LRSB 1BS9A 2VCEA 4NONA 4BAGA 4M38A 3NS7A 2XE6A 3KHSA 3PCXA 4OQFA 3ROQA 3TSAA 3ZS9A 4B79A 3FUVA 5KSYA 3AK4A 1COWD 5EXDA 4F1JA 4RNDB 1ZL2A 4KE6A 4YAKA 4F06A 4KO3S 4NBUA 3WBFA 1GZ4A 3TLJA 4YUAA 2W6QA 1G5RA 4NENB 5EHIA 2YKGA 1TKCA 2XOKD 1Z12A 4P3OA 1M7HA 5JH7F 3T06B 4L16A 4QRHA 3A0RB 2FMTA 1OGYA 3VO9A 4ZT5A 4M0LA 3CNHA 4GZ6A 1L4EA 2Q2QA 1IBKB 4C4PA 2GPWA 2XUGA 1IY9A 1DB3A 5EXSA 3LZCA 1PFGA 4U7WA 3H9JA 4AD8A 4EW3A 3W4KA 3JY6A 2CFCA 3JQAD 4OXNA 2Q9AA 3PPWA 4N47A 3LSTA 2BM0A 1FDSA 1EZ1A 1GYRA 1BX0A 2IYUA 1I1HA 3HCWA 1VKJA 4UTOA 2E4YA 4I3FA 3FCSB 5JWHA 3OAAA 5ARCA 3RJZA 1C1DA 1W0JD 2GEJA 5B7QA 3K30A 4BJ6A 4HB2A 2B2CA 2I62A 3C6YA 3K0AA 4LS3A 3TRDA 3QU5A 1KZ6A 4MV7A 5L53A 5BMVF 4YV2A 1T43A 2IITA 1YC2A 4FEEA 4RFSA 2NT3A 5EMLA 1SBTA 4HX2A 1A5ZA 1OWOA 5CD1A 3HCDA 1Y8AA 3B1JA 3DWEX 3W2EA 1E2LA 4II2A 4ENPA 2I3BA 3PNSA 5HS4A 4HTFB 5JALA 1XYYA 1Z74A 1OZAA 2N1BA 1K88A 2A3NA 3I64A 4PYLA 3BILA 4OF4A 4Z9XA 1H93A 4CM9D 5A06A 3FVQA 3BT7A 4NBTA 4L7VA 1FQOA 2Z83A 2VDVE 1P17A 3AIKA 3P9QA 3OKFA 5JQGB 2HSWA 3O26A 4JL5A 4BZPA 3OJXA 2OV8A 2D0OB 3IAUA 3THXA 1QFYA 4HAYA 2AJLI 3G89A 4HDRA 1JWBB 1ADBA 1USKA 1M6VA 3DOEA 4CFSA 1XTSA 1RHMA 5JV5A 1JPJA 3VKWA 2VWPA 4U2CA 4OXIA 5AK0A 2XB9A 4Z9YA 1MZVA 5AKYA 3E4CA 4KDFA 2HPAA 3R3ZA 2PMWB 3JQGB 4NCXA 3UWOA 4DTIA 1XNRB 1BFKA 4N1AA 1KYXA 2I4RA 3ID6C 1JEEA 1VB5A 2HLHA 3BH0A 4OBEA 2E4ZA 3T3HA 2IYTA 2ZVPX 1TUEA 3S2FA 5IFLA 2W6OA 2Q4BA 2YNMA 3AEQA 3NIGB 1EVIA 2NUAA 4HG2A 4TLCA 2J6CA 2CJPA 4DJEC 1KBZA 2WJ6A 4PCAA 4DAOA 4Q12A 2QL5A 1NAHA 3I9KA 1T0IA 1SCAA 3IEMA 2IY7A 5KC9A 3VPGA 4LXGA 1Y6JA 4TGLA 5ER9A 4NI5A 1K66A 1ZOLA 4MIYA 3EQ8A 3V2UA 3U3MA 2W42A 1YL7A 5ES3A 1XRJA 3A2KA 1MZPA 1Q7RA 5C1DA 3SSMA 1WUJS 1Z6PA 1V1RA 2B99A 3IHWA 1GN8A 3IAS6 3TLCA 1VQ1A 2F1HA 4FI3C 5EXPA 5LD2C 5GJBA 3WAGA 1CY2A 1E3JA 1O0BA 4JHXA 2F43A 3F7MA 1EM8B 1BO6A 2I8LA 2PL9A 2R86A 1E96A 4KV7A 3UFXB 2MSKA 1FJHA 2NV2B 2YNMD 4RV5A 3W8RA 3GI1A 3RDPA 3R9XA 3WL8A 3AR3A 3QHPA 3EY4A 3L8HA 3ASUA 2WD8A 3ZE2B 2H2WA 4DBLC 3DMFA 5DSTA 3AHJA 5I7OA 2GETA 3DBRA 5FJIA 5ALZA 1UJ6A 3W5JA 2BE9A 4BFXA 4ACBA 1PV2A 2XWJI 2MT9A 3F6YA 4BNMA 1K9SA 2ISQA 1W75A 1DCMA 4DV6B 3EPHA 4FE7A 2CT8A 4IDCA 2MYUA 3ZCPA 3B2NA 5EJAA 1PV1A 3A1VA 5KDDA 3QE3A 2BRUC 3G02A 2W48A 4FCWA 5G0UA 2ONYA 4ER0A 1P7CA 5T64A 1E59A 5DHAA 4E1AA 1OI3A 4RD6A 4C5BA 1VBKA 1VSTA 2NXWA 1GSAA 4Z54A 3AG5A 1S2DA 4HH0A 1FLVA 4C7JA 2JLUA 1P74A 4AZ0B 4D4MA 1A2KC 5KCZA 1H9AA 2Y93A 3JSXA 1SCKA 4HZIA 1XDDA 3D1JA 1QF7A 1UMDB 3AC0A 3INGA 1GPLA 4PFSA 5C3MA 1VPWA 1UANA 2FVYA 3BFVA 1E1RD 4WDRA 1W46A 3R8XA 1OZHA 1Z6ZA 2BGMA 3R5XA 4QULA 4YAFA 1E3TA 2Q6LA 1Z35A 4DLWA 4F1WA 1OXVA 1KA9H 1ZA2A 3GCGA 1JZQA 1CUEA 1GZ6A 2WU4A 3PKZA 4FGSA 2FWIA 4K26A 4Y6OA 4YRNA 2J41A 4E4RA 5C80A 1OH5A 2HR1A 1BWQA 3W8EA 2FR8A 1HSZA 2BDEA 3WR5A 3HSYA 4B47A 4LZZA 4CMEC 1TMKA 7AT1A 2QJFA 2AJDA 1EDZA 1FSSA 1NHGA 3P9CA 3MLEA 5IU6A 1HK7A 2C0QA 1LW6E 3DTTA 1A1SA 1HTTA 1BS2A 2OR3A 3PXBA 5AOVA 4BGEA 4IKPA 4LCBA 2J4FA 3FOEC 4B2IA 3IQDB 4TS3A 3IIMA 4HEA6 2V7QA 4JL8A 5F9MA 4GWGA 3VR6H 4EI9A 4PINA 5JLJA 1E1NA 3OIWA 3RVRA 4JL6A 1C1XB 1LS1A 1OX5A 2VP9A 3Q7SA 5CX1A 2CVHA 2GASA 3HN2A 4X7BA 3DLHA 1ZMTA 2QQ5A 3VR5D 3NNSA 3BMOB 2ZTLA 2W4MA 3TXAA 4DEYA 4WY5A 3VKVA 4ZV7A 3GLGB 4UU7A 1RXUA 4EB3A 4J0FA 1TC2A 3ZE9A 1L4KA 3LFTA 4ER7A 4NICA 1P0CA 2JA1A 3USCS 2OXEA 2XXAA 2ZYSA 3NTVA 4DLUA 4JJEA 1AY0A 2JAXA 4P7KA 1IEXA 1PJTA 3WQBA 1A77A 2G70A 2F3PA 4PSCA 3TOXA 5LR6A 2FE1A 2Y0DA 5E8JA 1IQ0A 2R4TA 4UCFA 2HSDA 3TB4A 4PRKA 2QVXX 3BOSA 4I5EA 3ADDA 3TKYA 3EEOA 2B36A 3DEHA 3QOYA 1T3HA 3PNYA 2IXGA 4QUAA 4KREA 3S0JA 1KS9A 4F97A 4NMMA 3ZE0B 2C9YA 4HL6A 2VNJA 1XHFA 2Q0XA 1JPNA 2O4CA 2ZRFA 2CLFB 3L7LA 4KN6A 1E3SA 4L9AA 3A10A 4ND4A 5AHRA 5BUZA 1KEKA 2DBYA 4YJFA 3F6CA 3FLMA 5ALOA 1CWUA 2HXSA 3B60A 2Q46A 2NV0A 5AVVA 3KYIB 3AHEA 3N2EA 2GDJA 1ISFA 4TS4A 5MFZA 4LVNA 1OWNA 1XV5A 3LBAA 2VSNA 4ZT2A 3BRWA 3LBNA 2JLCA 1JVNA 2XF8A 3BEOA 1LI7A 5EERA 2DT5A 1KRHA 3V4VB 2LW7A 1Z7EA 3A14A 3GRVA 3S4YA 1Z15A 4J1QA 4QE3A 1OFHA 1CR1A 1PRYA 2GCOB 5JG7A 2JHGA 4QJ3A 2Y1FA 4JAVC 4ZYXA 2Z04A 2HZ7A 2DUJA 4QOHA 3E18A 4J03A 5SZIA 4CM6A 1ZS9A 5G1PA 1R4MB 1M8KA 1RKBA 2ZANA 1HQKA 3P4UA 4GICA 1LDYA 3SSNA 1QHHB 3FCAA 5AJXA 1ULZA 1UIRA 3HXQA 3SS9X 1QH1A 1JWAB 3EDCA 3NKFA 2UV8A 3L2OB 3O0DA 3OC0A 2V5UA 4UUOA 4V0ME 4G0ZA 3ZU3A 1K2VN 1U1CA 5DKFA 4DV7B 3Q72A 4RK0A 4CCWA 2DOKA 2I6XA 1H42A 2I6FA 2WHYA 3L7YA 5JANA 1JT9A 1KOJA 2DWQA 2IUTA 2JATA 2UVPB 3QNMA 3VYSB 1GU1A 1SC6A 2WKSA 4LZNA 3DZKA 1EMDA 4E1BA 4G5SA 5ECGC 1MOQA 3DKRA 3KXKA 3GT0A 1HBJA 2JDIA 3AONB 1V16B 1ZY2A 3Q9LA 3RIYA 4GL4A 5CDTA 1VB3A 4XJTA 1KI4A 4NZZA 1FDOA 3A6LA 1VPTA 4JBYA 2BH9A 2RFLA 1Z6AA 2WJHA 2WG0A 2ZCVA 3GCWA 4JIMA 1WTCA 2Q50A 2OA0A 3LUGA 5L3RA 4KE8A 1DKRA 4IEFB 1ZW6A 4UOQA 4D9KA 4DLPA 1JIJA 3KBOA 2H7CA 1XEXA 4IINA 1S3GA 2WTEA 4RK4A 4HQ0A 2XUKA 1JR4A 1OV4A 2VA9A 3OI7A 2JIRA 4AURA 3U1BA 3MTDA 1ULAA 1ZH0A 2BP7A 3TS1A 1I7NA 2RCNA 3IFSA 3KT0A 4LC9A 3V8RA 4MIEA 2VT2A 2IYSA 1VHJA 2MWMA 3Q8WA 3R0JA 3LIPA 3UMSA 2Y1XA 1FXWF 1VI2A 3AIIA 1KSFX 3AM4A 3FGOA 5HIJA 3QKSA 4WBNA 4R8KA 3LC7O 4LISA 4RETA 4AY3A 3OOHA 5L45A 3RIHA 3IP7A 2HLNA 2JFNA 3GD7A 4XAQA 1NLUA 4L4XA 2I4OA 3OPNA 5DXFA 3SJ7A 4C9BA 4DIDA 1WBBA 6CHYA 4CEIB 3IE0A 3M1IA 4G56A 1KDYA 1GL9B 3ZWYA 5DYIA 1YQDA 1VCHA 2D1RA 4FS3A 5ALSA 3ZDRA 5JARA 1JDNA 4GE3A 1IWBB 1BYIA 1GTG1 4DILA 3R0QA 4MWBA 2JRLA 4DV5B 1J23A 2JK0A 1LLQA 3MAGA 5KSOA 3NG1A 2HCFA 4M1MA 4IOKA 2HO5A 2C2OA 1MH9A 3K31A 3EBPA 3IP5A 4KCGA 3TSOA 3BWXA 4KMOA 4KKXB 3ZK8A 4E2XA 2PQ0A 4HXFB 1MT3A 4GD3Q 3FCOA 4F91B 1V47A 3NTUA 2N46A 4UBIA 1UWLA 1JFFB 2EJVA 4DA4A 2X13A 4OLFA 1JIKA 1SXJA 4CF7A 1FDTA 4RM2A 4LJRA 3KD2A 2XUOA 1WQ3A 2Y77A 3E22B 4PLZA 5CCEA 1X8KA 1ULSA 2WWGA 4FHDA 2GVZC 3F1LA 4J2HA 4MB0A 4RX1A 3IQFA 4ILKA 5J2UB 2I3GA 3UWDA 1XMXA 1IJEA 1GGJA 4DM4A 5CITA 5KNLA 1V8BA 3Q3EA 1Z5VA 1YS7A 4URYR 1RPTA 1JUDA 1ZI9A 2LIVA 1YZYA 4WXEA 5CYOA 5SY4A 1OZGA 4DWOA 4QUIA 4E94A 4X54A 2I7VA 3MJRA 1RE1A 2OBBA 3UMYA 5A0FA 3H75A 1JLKA 3H9UA 2I99A 3QMPA 3KAJA 4HGPA 2EW8A 3JYNA 3NGMA 4P4TA 3G5TA 1L1QA 4NS1A 3OQHA 1SCBA 1XTQA 1TYDE 5JASA 2J3KA 4MLZA 3MWFA 1TA0A 4RFLA 5AW5A 4D8WA 4AKTA 1E3DA 5EP1A 4EB0A 1ZMRA 3QIAA 1X2EA 1YKSA 5TGDA 1E4VA 2XT6A 4QATA 4B2LA 1XWWA 1XTZA 3IT3A 4C43A 3K71B 4KXLA 3VR6D 2LCIA 2AZ4A 4O4JB 4JC8A 1CQJB 3GLHE 5H82A 3A6ZA 1JKJA 1WLSA 3HJCA 3IQIX 1RLJA 2WSIA 4M8NE 2VYQA 2C4VA 2FZWA 4Z0TA 1K5HA 4RH1A 3Q5GA 3ZHBA 3FZNA 1KKMA 1XWIA 5D6NA 2Q3DA 1VG8A 3WMFA 5H80A 4RZ3A 5CFPA 4X1KA 4DLKA 3QA3E 1SUIA 1WB6A 4DM3A 2J8ZA 4IVPA 2UVPA 4UHHA 2XI4A 2AOXA 1EVJA 1H2AS 4G5OA 4GC5A 4QU5A 4EGFA 3TSWA 3T3OA 1UAYA 3FRIA 5TGZA 1B6GA 2OZVA 3NDIA 2QRLA 4AJHA 1X1EA 2PKQP 3JTEA 5AJWA 2JBHA 1Z8NA 4GWKA 3JQAA 4WVFA 2GF9A 1EUDA 2P5TB 2VEDA 3ZV6A 4YAWA 5JRJA 5FIUA 4MMZB 2C4TA 3SC4A 1WL8A 1C9YA 1E69A 3PQCA 1IC6A 2O2XA 1RC8A 2WJPA 3T5BA 2VTKA 2VPXA 1TCVA 5TVGA 4OBXA 2QGFA 4DG9A 1YQEA 4YRDA 1FP6A 1OX6A 1M2EA 3GFSA 1ACMA 4JVOA 2RARA 4G5RA 4PBTA 4BAUA 4FYKA 5DI9A 4ZMSA 3NCHA 3H6GA 3SE0A 2C9OA 1T9DA 1UFRA 1I3OA 1X1RA 4HDCA 2OBNA 2FN7A 1CRPA 3LVFO 4MVJM 4ALMA 1N2XA 3PGMA 5H4GA 1RLIA 5DNYB 1BEEA 4D45A 2VF8A 1QVAA 1SO8A 3HJUA 5HOEA 2WMDA 3BGWA 3TLXA 4FCVA 1L0BA 4EPRA 1XDZA 4RPHA 1QVVA 1XU9A 2Z5GA 4MUGA 4TWAA 3SOPA 3V4SA 1T2CA 4RSGA 3ICPA 4G0NA 1FFAA 1V6SA 2W00A 3W79A 2P62A 4I4LA 2FW0A 1TTQB 1H4QA 1LZKA 2I03A 1U0HC 4M0KA 2PRZA 2Z1NA 2IE0A 5GJWC 3RVPA 3TSYA 1BD3A 2DHRA 4Y6QA 4R9VA 2NUPB 1V7PC 4KO1S 2PT7A 4QOEA 3LLSA 2L17A 4BMNA 3PQ8A 3STUA 5BYAA 1SVMA 2ZJ4A 1L5LA 2IQ5A 2GF0A 3C6KA 4BO2A 2F90A 1K7EB 2FZLA 2QLBA 1F5SA 2ZIFA 1GY8A 3AF6A 1FK8A 5DGXA 3RJMA 2YDXA 4PICA 3NEPX 4ZT6A 3ZDXB 1IVYA 3W05A 2GBCA 2W0SA 3FPGA 3W8FA 3MERA 3WP0A 4IILA 1MU0A 4CG3A 1VTKA 2BFPA 1Z4OA 3KB8A 3T94A 1A9ZA 3PICA 2OD9A 4MVYA 5KPJA 5KOYA 3I92A 1U2QA 2B34A 2IUEA 5AKEA 4ZT7A 5AVQA 2O59A 4TKUA 1OILA 1CRLA 3BH7A 3KCNA 4KJZA 1XJ0A 4YR7A 4M99A 4NK4A 2Q6VA 4UXIA 4E08A 5K05A 3OZRA 3IUBA 1UBOS 2CB0A 4DXAA 3P9NA 3E2MA 4JWKA 3FNGA 2H2HA 1A4RA 4S1PA 1ZG3A 3BC1A 4L6IA 3MWLA 1MENA 1SBZA 2XLBA 3V4FA 4KR7A 2AEFA 3AR7A 4JH0A 2AXQA 2BISA 3I9OA 2YQ5A 3TSCA 1QIFA 2HSZA 2Q45A 4CLXA 4XCXA 2H9AA 2LZ0A 2QL9A 4EEKA 2PWBA 1NVTA 2DWCA 1Q15A 2DPLA 5GZ6A 3W3AH 3QWIA 4GYKA 3D8RA 3AYXB 4IY1A 3NM6B 5LCXA 1QYVA 2D00A 3R24A 1LSUA 3N75A 4BS9A 3V8QA 1Z37A 1GKKA 3ZS8A 3SJAA 3RSOA 3K0SA 2CXXA 2NTYC 2W6IA 4K0RA 1AQJA 1DCTA 1OGIA 3PKJA 3K5IA 3KEQA 3EIOA 5HKAA 3D5EA 2FCAA 1MAUA 1C50A 2JFGA 2W6PA 3TIIA 3WDLA 1KSJA 4W99A 3TVTA 1JL3A 1Z16A 1JAIA 3DDWA 3EZLA 4P4UA 4XYGA 4AJ9A 1UFVA 1JJIA 3WG9A 3ZZUA 1VMKA 1WRBA 3QK7A 1WUTA 4FYHA 2PEYA 2YJZA 5CB8A 5KYGA 1UBJS 1YUNA 1P0FA 1XEWX 5DIZA 4HEA1 5PNTA 1E2IA 3TW4A 1IN7A 1USIA 1U2TA 1JG3A 1AA9A 1BCSA 3BSYA 2ZSDA 3NHPA 2QRPA 1KU6A 3OE4A 3Q87B 4YAOA 3SM9A 4AG6A 5CA1F 4EHKA 3QEKA 3VYVA 1FFWA 1T6NA 1YZHA 2JGLA 4RKYA 4XH9B 1AMUA 2GN4A 4PNPA 4Q3EA 1CS0A 5AWFC 5L3SA 4XEHA 3BICA 1P3Y1 2HCJB 2QRKA 2QXTA 4JHLA 2W2VA 4CCSA 1Y98A 2GM9A 1HE3A 4HUQA 4DARA 1CDOA 3EOAI 3QKIA 2B21A 1Z47A 2Q5QA 3CH7A 3FGNA 4LRYA 3HY4A 4KOAA 4RK1A 1JQKA 1OD6A 1QO9A 4NKRA 4L2IB 3E7DA 4AN1A 5C1BA 3TE7A 2RG1A 3D6NB 3CVXA 5JCPA 3EPLA 4U8HA 4YQYA 2GK6A 4I9NA 5C5EA 4QODA 3R3YA 1EJ6A 4MWEA 4U4AA 1R6VA 4A15A 1EESA 2HEIA 1YHYA 2LBPA 3KZ1E 4MKXA 2YVKA 4J49A 4BNDA 1XCLA 2JI7A 2P27A 1S02A 4NE9A 4AJ4A 2IUUA 4Y6RA 2HT1A 3M6LA 3LLMA 1KH2A 3ZV5A 3RV3A 1R6XA 1LQTA 4ERNA 2R7NA 1NURA 4ZREA 5JSUA 2R6FA 1X19A 4HI0E 5TQ0B 1MO3A 4ANFA 5JRZA 4UDYX 5C7IO 4JDUA 1VGQA 2QV7A 4MR9A 4YNBA 1BGWA 3WY9A 2EBFX 4I4TF 3O7WA 3ONNA 4M49A 1P62B 2KSQA 4U6NA 1UCFA 5DNDA 1NN3A 1RRVA 1YVRA 3V48A 3K9FC 4CCYB 2YASA 2ZWMA 2B6NA 1XKXA 3KYDA 5JZSA 4MVJI 3P2OA 2IPMA 2GZRA 1K7FB 2VAVA 3FKJA 1PGOA 3MYYA 1RZRD 4EHBA 3MWDB 4CGZA 3BE8A 5EZQA 2FW9A 1POXA 5KVQA 1F51E 3J81k 4IO1A 2XADA 2W58A 1DQYA 3H2BA 2JLYA 3BJEA 2D7DA 1QO0A 2VKTA 4J0DA 5AVOA 4DCGA 1P6QA 5SZKB 4X95A 5CR9A 3H18A 1BWSA 3I6ZA 1GFIA 3B38A 3TRFA 2Q1SA 1KHTA 5IMBA 4R01A 2L82A 5I7VA 1NP7A 4YFYA 5C8YA 1HX7A 3RC8A 3QWAA 1JIXA 1AS0A 1JW9B 3SJCA 2D7CA 3UCFA 1R4NA 1NF8A 5JDCA 4OB8A 3HNRA 3WBKA 3D59A 3QM1A 1KSGA 3CGWA 3F90A 3H8JA 4IDQA 1UK6A 1MEEA 3X1KA 3EVEA 1P4HA 3UGTA 4IX9A 4UHDA 3MRVA 4QYIA 4G9EA 2JAPA 2REBA 1BRTA 3UUWA 1FS6A 1UQUA 2DCMA 5JD6A 1A0OA 2VVTA 2QM7A 3LKZA 2V9PA 3PGKA 3EZYA 3OJLA 4BO7A 2NGRA 2G09A 3AH8A 3HB1A 3ACCA 2H4HA 2XXBA 2P2CA 4G63A 4QBTA 4QBKA 4Q9IA 4EDHA 1JFLA 5BUCA 2CXSA 4C0WA 2OPBA 4Q03A 4QOIA 1T1RA 1CCWA 2Y1KA 4GLOA 4KUHA 2Y1DA 3ZIUA 4RELA 1RLOA 3QEMB 3GWGA 3DMDA 4ZAWA 4TSKA 4RF2A 3WJ7A 1E98A 1GGHA 1AG9A 1FTGA 2VP3A 2VYVA 2WU1A 5CCXA 4YRSA 3FWYA 4ZRMA 2WYHA 3TLYA 5A0TA 1M6VB 4PQYA 5AXAA 1SWVA 1HI9A 1WD5A 3HBFA 1RWOA 1J22A 3KZMA 3OETA 4TTSA 3QTTA 3ESCA 3E53A 1UK9A 4XR9A 2QIOA 3EXIB 1ES9A 1N9KA 2DSNA 4Q6WA 3AINA 2J7PA 2GSDA 4BZZA 4ID3A 3SZ3A 1BMQA 3RGWS 1P2GA 1MPXA 4MITA 3T38A 2PYZA 3TEFA 2EP7A 4EY6A 4ZQGA 5FFFA 3M70A 2ZRJA 1YJXA 3NC0C 2VPPA 1YZQA 4OU5A 1FCJA 2RC5A 1HEUA 2JPDA 3EDQA 4YRJA 4NR0A 3ZWNA 1V5EA 3PQ4A 4Z4CA 3S8YA 2C1EA 1YCFA 3K3PA 4F5EA 3LK7A 2D2IA 2GN8A 3DHYA 3DOCA 2D62A 4M3NA 2R2AA 5ED0A 4TN5A 2XUJA 2VPIA 3EEBA 1DCFA 5GV8A 5L3QA 1CUYA 3E9DA 3IUNA 3AR8A 3HXKA 1PR4A 2OBFA 3DA8A 3M5CA 1U1DA 3PZBA 4II3A 3P2KA 1DBRA 4G09A 3HYTA 4WNAA 2GO1A 3KTAB 4NX2A 2P9CA 3T0GA 1OZFA 4LF9B 3LRXA 3LDHA 1DTWB 2HTEA 2XMSA 1OOEA 1WNFA 3HNPA 1WXQA 4JUCA 4ZDWA 5BURA 1MT0A 3VAYA 3T4XA 5J2TA 1ZRSA 2B1JA 2D0PB 3VVLA 4DDMA 3MIZA 3OTIA 3D8SA 2EFCB 4YQEA 5T8KA 1HL7A 1YBVA 1QP8A 1XA4A 4M1EA 4NMXB 1RS0A 4A0HA 4MO9A 2A92A 2QA5A 3LUAA 3LTNC 1JU4A 1GAXA 3P94A 3UYKA 1V4BA 1Y48E 4LF6B 3P32A 1KYIA 5A2GA 3IUMA 1AZTA 1JJFA 3D2AA 1DAMA 2VJCA 1ND5A 3OD5A 4XSGA 5C4IA 3I0MA 4N5DA 4CE6A 2R2GA 3ESDA 4KFTA 3N87A 4PM4A 4WOBA 5TS3A 5C53B 1HDZA 2AF4C 2A1UB 3IP1A 1ZGZA 2C99A 3T7EA 4GP7A 1J9ZA 2GEBA 3G5MA 3G7NA 1VCOA 4B73A 4YRZA 3L7CA 4D9GA 1OKKA 2WW8A 1QAMA 4QWWA 4PC2A 4B3HA 3R2JA 4WE3A 3VZSA 1RRFA 3MFYA 1KEWA 1LPAB 3W9SA 2RGUA 1JLRA 1ZUD1 2JGKA 4ETMA 1Q83A 3B36A 1CQIA 2FF5A 1E7MA 1R0XA 3UV7A 3KTFA 3QVTA 3GEBA 4HQOA 1IDOA 3AXTA 4JUBA 4MI9A 5AOAA 1ZESA 5T4EA 3WOVA 2IW1A 3FHTA 1NYRA 1LKZA 1UFOA 3RWOA 3QQPA 2ZAIA 4MUYA 4CKEA 3AEXA 1SKBA 4QOJA 4X90A 1W9MA 2IEZA 1E1QA 4DCVA 5D5HA 3V8PA 2IA5A 2G1KA 2IU3A 4DLNA 4JKOA 3N0WA 2CD7A 2HUPA 4KIGA 3G0GA 3ZZ1A 4JSRA 2HAEA 1NNSA 1MMFB 3WYFA 2J9RA 1QP7A 4ND8A 4BMXA 1SQ6A 1B93A 3W9YA 3NTLA 2ZE5A 4D96A 1Y63A 2H1FA 3B70A 3RE1A 3RSGA 1YDWA 4J0JA 5T7BA 1OH8A 3CF0A 2IU6A 3BG5A 1O4WA 1J2UA 1RXIA 4G3XA 5HEKA 4QAQA 4AL4A 4XUGB 1II0A 4J16C 1VCNA 4OM8A 4B3TB 2NZUG 1KO1A 3FE2A 1C7EA 4QRDA 4R51A 4E5UA 2QRNA 2XYQA 2P69A 1GUDA 1HFJA 4FVTA 3QEAZ 5FYDA 4HGQA 1U0GA 1RZUA 3ES9A 4GFDA 2I8CA 3OVMA 5JS1A 5BN4A 2PWAA 3VR3D 5FNVA 3BFPA 1EM6A 3QTBA 4NFLA 4YWHA 4C87A 2XITA 3E9YA 3L1IA 5LQRA 3EE6A 4BYMA 4DV1B 1QXSA 4PYIA 4Y0AA 2OBMA 2YICA 4Q9JA 4AJ1A 3EPRA 4CMGA 1KERA 3JWEA 2AUNA 5TPZD 3DVQX 4Z0NA 4IZOA 3ZY3A 4JB8A 2GNOA 3O2JA 3EDYA 4X64B 5KVCA 3FM9A 1NM5C 1IPFA 2C2YA 3IPRA 5M3BA 4TROA 5FA5A 2DLDA 2O2YA 1SD2A 3L8MA 4PIMA 1P31A 1P4JA 3TMKA 4RD2A 1Z6QA 3C4VA 4E5SA 1T0BA 1PHRA 3ESRA 1MIHA 3QWFA 1VG1A 1WDLA 3P0JA 1N3LA 4YJ3F 4OJYA 1T0UA 2G07A 2X15A 4J1TC 5AI9A 4TRMA 4I4TB 4D4HA 2FZEA 3O8OA 3CR8A 3RYIB 5C1OA 2D0IA 5ALKA 4JOBA 2HSGA 3TW0A 2WDPA 4KSYA 1PF7E 1ZKDA 4EB8A 1L7EA 4HQLA 1QIMA 1NVXQ 3WKCA 5JUWA 4HS4A 3IIKA 1XYVA 4CUKA 4JLOA 5DHUA 4CBVA 3G8DA 3I34X 4JYBA 4WOCA 4X71A 3TQCA 3THSA 1XKTA 2QJWA 5JW6A 1OPRA 1GRNA 4I1UA 3HXPA 4MVJA 2OD2A 2P1RA 2R3SA 2QJOA 1GQRA 5AVYA 3KDSE 1FLNA 2KLBA 3AUXA 4KXNA 1SVIA 4YJHB 4CM7A 5HF5A 2ZU6A 3DBHA 1F6WA 2HCRA 5B37A 4P54A 2BFAA 4RTLA 5I7SA 3N86A 2V3WA 4WW0A 3DFZA 1SZDA 4KDRA 3LWDA 1RKUA 2QAGB 1G2IA 2XEXA 2JA2A 1A82A 2HF8A 2P41A 4BVKA 4BQIA 2P79A 1TUBB 2QPTA 2RHLA 2BOVA 2WIAA 3KALA 3KFLA 4XFDA 1T2FA 1NQXA 4Q82A 3SXJA 2JGIA 3HLYA 4BLUA 1GQOA 3ZGYA 1JYSA 5B2ZA 2JIBA 1P7ZA 1SJ9A 4RK7A 3F5FA 1KP2A 1D1PA 3A4MA 3UF0A 3FY4A 1PEYA 2OCAA 4LCEA 4N8DA 1J2JA 1C8KA 1E6LA 4R8VA 2EG5A 2VDNB 3NHKA 1V43A 5C51B 1KEUA 3AVVA 1ONPA 3F78A 3KSZO 2YDYA 3EASA 5CA0F 1B3RA 1R0RE 2B83A 3TYXA 5MDHA 2G0AA 3AFNA 4HKTA 5J47A 3TKLA 3PZRA 3M6FA 1VP9A 3F6BX 4FYMA 4OOFA 1L5GB 4BEBA 2BFNA 2XGGA 3J7TA 2KW5A 3TW8B 1O9HA 3ZBTA 1ZK2A 4E32A 4M8SA 2QQFA 4FMDB 4M60A 2CKMA 3CO0S 2HT6A 1KVRA 3O3CA 3H0CA 1T3LA 3MM4A 5KIAA 1U2ZA 3EGIA 5T3UA 1GTZA 3GLHB 1YJBA 3SJUA 3NHYA 2MR5A 1HLDA 2JAOA 3DGFC 2QG6A 3M33A 3M3PA 1P80A 1UKVY 3QFSA 4OQQA 4QFBA 3L6CA 3TL2A 4AECA 1DLJA 4BLRA 2MOKA 2ZJBA 4BN5A 5DT9A 5LMUB 4I4CA 4J07A 4PAGA 3GJYA 5H5JA 4C4SA 1GZ7A 4R71A 5CVCA 3PJDA 3RUCA 1T9CA 1NXPA 5CHYA 1NQWA 4TYYA 5H3HA 1M1YA 3N59A 2PSFA 1UZMA 3PF9A 2PGAA 1CEXA 1MJ5A 3NV7A 3K2QA 4OYLA 1BW9A 2CNBA 3C97A 3GVXA 3IQXA 3NVMB 1Z6YA 1DWQA 3GLVA 1DCKA 1NZJA 3ENZA 3U4IA 4RV4A 5GM1A 3WWOA 4E07A 3BGOS 2XRZA 1L7DA 1D09A 1EX1A 3ZDZB 3OQIB 4LRUA 3NOOA 4AC9A 3P27A 1S3IA 4WY2A 3A6JA 4V24A 2C59A 4INPA 4F9EA 1H66A 4HZUA 2JJ1D 4YP9A 3A70A 5A02A 2RGNC 2REXB 1SUSA 5D84A 1JR3E 4EHHA 4L9SA 2LIPA 2OC4A 4IIFA 3HI4A 3LPCA 1BVUA 3WK4A 3NIWA 2PT6A 4P6VF 3O9MA 1L5MA 2BEWB 3DYBA 1MRZA 1XP8A 3CN7A 1KH1A 4YVFA 4A10A 1GLVA 2Q2NA 3R5HA 3X1JA 2FX3A 1OU0A 3LKDA 2Y0CA 1YVUA 1ZRNA 2GJKA 3CX4A 1HZJA 3BK2A 2YNMC 2Q7XA 1VKRA 3BWDD 3EXEA 2W37A 2AW3A 4UATA 3U7RA 2V4MA 3VJKA 4GOLD 1XU4A 1DBQA 1H05A 2BEKA 2IE8A 4G97A 4MWTA 1T24A 5FL3A 4CLOB 1U98A 1SQ0A 3FVTA 1NMEA 2NU8A 4BWGA 1HG0A 1H0RA 1QPBA 2QE7A 4L0QA 4OB6A 4WX2B 3FKSA 3ZBQA 2WTXA 1LX6A 3FLEA 1U8UA 3FPAA 4C0BA 3TKAA 3RTAA 1ULBA 2ZZNA 2Z5LA 4RJIA 3WLHA 3IVRA 3PKIA 2W6ID 1MN6A 5HF9A 1VLVA 4EGCB 1A95A 4P5DA 4ND2A 4WFIA 4HFRA 2QZSA 2YX1A 3ESQA 3LGSA 2FW6A 1UK7A 1XTTA 5TMDA 1NF3A 3WGLA 4HATA 2I4IA 4DYVA 3DE2X 2W5UA 5I47A 3DVAA 1N2ZA 4WDQA 4B87A 4FPXA 2I2BA 1XU7A 2WF8A 4AY4A 4BVJA 1VPVA 2RJOA 1LDBA 2GGSA 3A6GA 3RF6A 2BZGA 5HKKD 1M6HA 2YXDA 2RGCA 4WKOA 5BQ5A 1SNYA 1VLHA 2UUOA 3G2MA 1MJGM 6NULA 3IBTA 4PPFA 3IDSA 1L1FA 1XHLA 2VQEB 1C7QA 4RDCA 1IG0A 1NJGA 4TV9A 3B52X 3W2GA 1Z4QA 2B4TO 2NN3C 4ZD6A 4LZLA 2H06A 2KX7A 2P5SA 1XZIA 2X5XA 3DXYA 3OZFA 4ZGWA 4HRXA 2ZI9A 4H18A 3WLFA 1G8HA 1U1IA 1HYQA 4TV9B 3F73A 1U0EA 2LKDA 4WNCA 1A7UA 4JEIA 3C98A 3LX5A 4AMVA 4HB0A 5G0VA 7ADHA 5JBIA 3IALA 3HYLA 3QEBZ 1N6LA 3A27A 4HB3A 1NFRA 1VZ3A 4FGWA 1SH7A 2J9GA 3C3EA 1M1NB 4G41A 1OYVA 2EFEB 2P8JA 1DRKA 5I4BA 2QN9A 1KIMA 2Z8ZA 3ETGA 3GRZA 4LOIA 4E51A 3NXKA 1OA1A 3KVYA 3IHKA 3KR1A 3RSSA 1XMIA 2UYGA 4ZYTA 1NU8A 1SHLA 4IFEA 3U3XA 4RCZA 2FWMX 2NAPA 5AW3A 1CUJA 1WSWA 1W49A 3VX3A 2BELA 2JHFA 5CYGA 4GPEA 4LXHA 1SKMA 1PK9A 4EPWA 4RF4A 4Q1DA 1QR2A 2XX3A 5E3JA 3WLNA 2ADFA 1U2EA 1Y6FA 4C0QC 1GYQA 2YXLA 7MHTA 5EFOA 1LFAA 2GDZA 4LXXA 3BB1A 2RAVA 1EVEA 1DBIA 4B46A 4DV4B 1JLLA 4GM4A 4HAIA 4NCAA 5B57C 5DCLA 3OOWA 4JXJA 4AM8A 3A06A 1ZCFA 3OEEA 3C0KA 1PG5A 3RJ9A 2CEAA 1NRIA 2ODEA 4IVRA 3QOFA 4W1PA 4AJOA 4DANA 4JB2A 3IJPA 1MXHA 4G65A 3TJMA 1VBMA 1KC1A 3B1XA 3MWJA 1C0PA 3OFJA 4W8GA 4XOUA 1FVXA 2LVBA 5B6PA 5CVEA 3TIFA 3V42A 4RZXA 2ST1A 3GMDA 2QTVA 4PO9A 2X5OA 4MYHA 5EKDA 5KMGA 3COPA 4NNJA 4L9WA 3THWA 3RSCA 1RAHA 4BTVA 3GA0A 2PZEA 4NZPA 3CZ5A 5B7NA 2JFVA 4OHUA 3L0CA 1WPGA 3QLUA 1J0XO 1U3VA 1G20E 1W93A 3RYTC 1WW2A 4Q7MB 5DBHX 2CLLB 3Q6MA 3JQ7A 2VTBA 3DAPA 3O82A 3VC3A 4LHYA 4BFLA 4NQZA 2YMMA 3GARA 4RXUA 4U7HA 1X1SA 3G2LA 2CV1A 2X86A 4ZZ2A 1FLDA 4DB2A 2J3MA 1KK0A 3AILA 3T5TA 4Y7DA 3AB8A 5HK9A 4MW9A 3PWSA 5CNMA 2F7SA 5EHNA 2Q1UA 5H70A 3ZVKA 3D8HA 1JI3A 4GVLA 1LW7A 4DE5A 3PPXA 3Q6IA 4CN9A 4MKIA 1QU3A 1JAXA 2GARA 3IERA 4J16A 4QPJC 4F92B 3K6SB 1JKFA 5EIBC 2P0EA 3GGJA 1FZQA 3L8FA 5T8KC 2F9FA 1DKOA 3MTGA 1XCGB 4UNSA 3JQBC 3AU8A 4LX8A 2Q27A 1WB9A 1FDIA 4BVLA 1XZGA 4XPIA 3SK0A 1IY8A 1NY5A 2K2QB 3DHVA 2Y1EA 4OCZA 1EX7A 1A4IA 3KJHA 4JCOA 5K0CA 4DR6B 1H8ED 2ACEA 2BMEA 4GR5A 4L02A 2AA3A 5JCXA 2NO7A 2X42A 3DTVB 5IT5A 4RPJA 4ZAYA 1W36C 1NU6A 2H52A 1KYWA 5H68A 1SXHA 1KWKA 4E5KA 3GLFB 1IIRA 2CFIA 5BNZA 3OQBA 2LR0A 1RI2A 3GFRA 4FBGA 4G8DA 4LNAA 2YHAA 2O5RA 4B9EA 4BUCA 3KRTA 1K5GA 4MWDA 4BUZA 2JIMA 3IUJA 4NOKA 3LPMA 2X6QA 1G42A 2CY0A 3QJGA 4IS2A 2EQ5A 5BOSB 3DV0B 3GN2A 5AUNB 1OWLA 3LQ2A 3NP9A 5IW8A 4KO4S 1HL3A 2BY4A 1W85A 2JFPA 4BWYA 4TMFA 5BRNA 3COJA 3OY7A 2FQYA 3CSSA 4G86A 3S8MA 2HIAA 3U44A 1U2PA 1XPRA 4FOTA 4KW7A 2ZBGA 3HYCA 4QECA 2XCRB 5DXAA 4REOA 3SF8B 2G3YA 4BGUA 2R751 4ASUD 4DCJA 2FX5A 3GLGE 5G2OA 2GJ4A 1RI5A 4H7FA 3UJ3X 4RKQA 4B7CA 5DDIP 4N0QA 4UHKA 3OZDA 3GFOA 1UMCA 4CLHA 1YL6A 2W8ZA 5TQ2B 4RXMA 4KQ6A 3IPLA 5DM0A 4YLYA 5DBIA 2J0EA 4YRGA 5BXQC 3WB1A 4FT4A 3E22A 3KKOA 2X40A 2FMXA 5FNVF 3G8YA 5I9MA 4JK3A 4O4LB 3UN1A 2PO7A 4JX8A 4MPDA 5K6RA 3T5AA 1MRSA 3WLPA 5KX5F 4R40A 3KZKA 1KJ9A 4LDRA 1DPFA 3WRXC 4YAIA 2H16A 3SYLA 4WV3A 2VXYA 3E81A 3JR3A 3ZNNA 3PTZA 3WLAA 1W87A 5DO9A 2XLCA 3CIOA 1TW3A 4XPZA 2EBHX 3EJ6A 2H3EA 1DJQA 1SQFA 5EPEA 4I5DA 1JI0A 4KBGA 1LX7A 1ZMBA 1JSLA 2GJ9A 4DMHA 4F3YA 2QTVB 3WGUA 5C52B 4F5YA 1RWKA 4E0BA 4IOJA 3INNA 2LDXA 3FROA 1REQA 4GZLA 4O4IB 3TCKA 3H2ZA 4W9RA 2JDID 1TJ3A 1VFPA 4B4DA 2BBSA 1BN7A 3O38A 1KMHB 2XWSA 1TM4E 2Z08A 3FOBA 5AKKA 1XD8A 4CTNA 1MJNA 2UDPA 2PX8A 5E1OA 5K3FA 3V1YA 4Z1MD 4BY9E 3F3SA 4FZ5A 1JG2A 3L07A 4YX9A 1KJ8A 1W5SA 5TDHA 4C21A 5K6AA 4KNYA 1GYPA 3IR6A 5DWVA 1TJYA 4WZBA 3BJIC 1X87A 4UQPA 3JAKB 1GTVA 1RR6A 4BRZA 2VEOA 1KMNA 2VT7A 2ACWA 2YZ2A 5T6BA 5TJ9A 4D46A 4FSHA 5FBVB 3I5XA 4RDXA 1D4AA 1SKYE 5F78A 1Q95A 3T1TA 1G21B 1LY1A 3VO2A 4B0PA 4NESA 3CT6A 2A9FA 8LDHA 3B2EA 1XF9A 1HNZB 3A1CA 4TYPA 4ZGBA 3FF4A 4P3XA 4Q01A 2EX4A 2G83A 5P8WA 5CEFA 2VH5R 5JU6A 3GLFA 3ZDDA 2ZQ5A 1TPYA 3WLRA 4BKQA 2COEA 4B6QA 2ZI3A 3GEIA 4LRQA 2EW2A 4XI9A 1GZHB 3ZLTA 2PUBA 4EEZA 2ISSD 1LA2A 1Z8DA 2IKSA 1J7JA 3JASA 1MC5A 1T2EA 3OF3A 1W0KD 2HDWA 3TZLA 4DZTA 1QHNA 4DLTA 1DEXA 1PX0A 1ZHFA 3EGWA 3QVVA 4HYQA 4LYDA 2OXCA 2BFCA 4R1LA 1ZXLA 2ZJ1A 2WYVA 4LGYA 3CJRA 3U1VA 1XDUA 3BDIA 4MOWA 5FWXA 1L7QA 1MNQA 4L85A 1YCGA 3B5IA 3LDGA 5KYUA 1XL0A 2Q4DA 2VCHA 3R6LA 3WAKA 5EJEA 1EBUA 3PR1A 4NTZA 4RQTA 4HRYA 3FUUA 3H5AA 1SKQA 4REQB 2FPGB 5K8LA 1P7WA 4Y9UA 2NOAA 3PL5A 4X66B 2W2KA 3E27A 3L1HA 3TM4A 1SELA 1NW5A 3FMVA 4AULA 3TF5A 2ZM5A 1U1FA 4GHWA 3KQYA 3TRJA 3OCYA 1P2DA 3EA4A 1PVOA 1XBTA 1XPJA 2TYSB 1V4NA 3BSFA 4WK2B 1RNLA 3KSMA 4KHZA 1WKBA 4IQ4A 2ODWA 3H86A 1FSZA 4BCBA 5BSHA 1MVNA 1QHGA 2WTAA 4KYUA 4EM6A 5G4KA 4HMOA 2V8BA 4CM8B 3CUUA 4A8JA 3GZNA 4YFVA 5DM4A 4EY7A 3NHMA 1DHTA 3K35A 5LUAA 1W0JA 1EFDN 1XB2A 3I2GA 4CQNA 1SXPA 1RWMA 1Z4NA 1BC5A 2O14A 5E6RB 2FSVA 3Q8XB 2EWWA 3KFXA 2FZGA 1KPIA 4KODA 1Z88A 4OHFA 4PX9A 2WYUA 1N9ZA 3DBLB 4M89A 3UJ7A 5BY2A 1TD9A 5JNVA 1WXFA 3LXUX 4XB1A 1D0IA 2F3UA 2P2SA 1Q5PA 3HHPA 4MHOA 4TWJA 2WKPA 4FW9A 2C94A 2EX1A 3HKEB 3DT8A 5FO0A 3FYUC 1D2GA 2ISCA 3G8AA 1ZSVA 3VU9B 3TTXA 2QJTA 3GBVA 2P2YA 3NT5A 3ZIAD 1J24A 4DSUA 4UDNA 3RT9A 6REQA 1A9XA 1A9SA 3ZHRA 1MQ8B 3OZSA 3QNUA 4OHVA 3KQNA 1U9YA 3GPDG 2FG5A 3LCUA 3H4IA 2UZ1A 1OWMA 5TQ0A 2IOHA 3OEHA 5FR1A 3KXIA 2IVFA 5D51S 1JHUA 3K94A 1Y7LA 4RK6A 5J1SB 3KT6A 1AKNA 3S55A 1UPFA 3KWFA 4JV5B 1T5LA 3I9FA 3C1TA 4YT4A 3IVGA 2ECKA 4AB1A 2NIPA 4AAYA 1JFVA 1GP2A 4UVHA 4OHCA 2GTIA 3C3PA 4XLZA 3K2BA 4Q3LA 5E3IA 3WB9A 4ERXA 2O8NA 5K3BA 3AFOA 2Z6AA 2I9KA 2ZBQA 2MMGA 3AERA 2W2TA 1NDQA 3II6X 1SK9A 5KC8A 2VSYA 4NE2A 4XRRA 1ESMA 1V6CA 4RQUA 4DXHA 4UUMA 2JZCA 4RE6A 5A62A 3GOQA 3T7TA 4AZSA 3DGEC 3WHKA 1CUDA 2QR5A 4IJ5A 1AS3A 2BR3A 4GSKA 2YRXA 3I1IA 4U2FA 1RMQA 1E1CB 5HOQA 3UAGA 2TSYB 1Z7YA 3CW9A 2DJIA 2J9YB 3MC1A 4ZI2A 1VRVA 3OOYA 4EF4A 3FG9A 4CF3A 3QY0A 4P58A 4MKFA 3WHPA 3RASA 1UBRS 2HKIA 2QTWB 1XZPA 3B9QA 1PVDA 3DEZA 3KUXA 2FLVA 5FOSA 4D92A 3I62A 3TR5A 2P6RA 3A6KA 1L7MA 4BE9A 1UKEA 4RANA 3MS2A 3N3BC 5CYFA 1KQGA 5AKGA 5DBOA 5EHZA 4CT5A 1XTJA 1V3TA 3KZXA 3OE5A 1DTWA 4GXTA 4WADA 2UYHA 4EMUA 1ONNA 1E9EA 2J3IA 2VHTA 1PL8A 3PTAA 3HJTA 3EG5A 2YBDA 3FPKA 3K0FA 3IUSA 2ILTA 4FT2A 5FV4A 3BKWA 1JEQB 2SCUB 1RAEA 5U4QA 4EFMA 4FB5A 4C01A 2C07A 1NXSA 3E03A 3GZNB 2ZZMA 1Z5PA 3TN7A 5HIMA 3VV2A 1ESEA 1U90A 5JADA 2REOA 5DHFA 4JI2B 4KITB 2J07A 1D2NA 3BA6A 3OUUA 2QRQA 3P5BA 5HGJA 4H15A 5LNK6 4KZPA 4WHMA 3TIVA 1NJSA 2PLAA 3PPIA 4TMXA 4ZT4A 2CV2A 2ZJ7A 4QELA 2RHCA 1C2YA 3UZUA 1DAPA 2JFZA 2DM6A 2ZYTX 3EF3A 4GKJB 3OEHD 1R6BX 5EJ6A 2SECE 1X39A 1YIOA 3I8OA 3A9RA 5KYYA 2D5LA 3PNOA 3ONDA 4XQ9A 5FI0B 2QN3A 5LBTA 5LP6C 1IBLB 1TMOA 3NM4A 3QKWA 2ZWIA 4X65B 1E2GA 3HH8A 4CM5A 4NC9A 2GH1A 2POCA 5CMLA 5E4JA 3UGJA 4ZQHA 2GF2A 1TZMA 2PNFA 4GU5A 3BRCA 4OUKX 1XNGA 2HI0A 1G4UR 1QBKC 5H81A 3D4NA 3W2IA 3DG9A 4QL3A 4BU1A 3L0YA 4L76A 4DSTA 4CIBA 3TUZC 2TMKA 2B7BA 1M0SA 3QENA 3H1TA 4MW6A 5CVJA 5AM1A 5JYCA 3PRYA 5B3JA 1XX6A 1XTUA 3DMYA 2O0KA 3O8CA 1D9ZA 3OIVA 3PU6A 4R5MA 1CJTC 3OPYA 3IURA 5HTKA 2OCDA 1LBSA 3DW1X 4ZKEA 5L9AA 3EZ2A 4U9HS 3U39A 1EP1B 5KTTA 4Q9LA 1QIDA 2ZJZA 1YZGA 4LTDA 4NBRA 5K0LA 1KL7A 1KHHA 2IIQA 3GJ8A 3PC8C 4MV9A 2J32A 3PD1A 1L8AA 3FDFA 3BD9A 4R84A 4LHWA 1ID8A 1GNSA 1AURA 1AMNA 5ECDA 4WXRA 1A4UA 3DNPA 4CKCA 5KYWB 1HE2A 3KQMA 3QFTA 2G06A 5DTMA 3AZQA 3T5CA 4X7RA 3P2IA 2PIAA 4BMZA 3Q2IA 4Z4QA 3INTA 4ZVOA 1C3OA 1YE3A 1UBKS 1QTRA 4OMDA 2J9FB 4R6XA 16PKA 1G6Q1 1XZEA 1F5NA 4B7ZA 3UCXA 3WSVA 1XQ9A 4FZRA 3UJ8A 1GZ5A 3WXMA 1RKQA 1YB7A 4DMUB 2NACA 4FC7A 4B0OA 4P0PB 3FPHA 4OK6A 3CEAA 3N1UA 4OXKA 1O1YA 1P75A 4UEWA 5IF9A 3ZDAA 1GLNA 1N1MA 1EKXA 4QDOA 4BKMA 2Z09A 1RBZA 1X7WA 2J08A 4FUQA 4LZOA 4I4TA 3QVGB 3CZMA 2B8EA 4WLEA 3FH0A 3DCNA 3M6IA 4MVJH 4NAHA 3RC7A 1JN0A 1NRXA 1K5DA 1NXTA 2FQWA 2WBLC 3IBYA 3ITNA 3NR2A 2IV7A 4Y2VA 5E6UA 3ZVLA 1TYCA 3PRHA 4CQMD 4CIYA 1YT5A 2CJWA 3DB2A 2Y67A 3G59A 3WBJA 1V45E 4I5IA 3WNZA 3BA1A 1KBOA 3WYBA 2QP3A 1VIMA 3VPCA 3KJNA 3JD1A 4UPDA 3G0CA 1UP7A 2I55A 4TZ6A 5JCJD 5DIFA 4PSUA 3UY4A 2BMVA 2NO9A 2Q0QA 4BNFA 3AR9A 1DEKA 5JRDS 4I14A 3ENQA 5BV1A 5LDDC 3I2KA 1PBTA 1XQWA 4NMHA 4YJFB 3DD1A 1BE6A 4URWR 2BGLA 2MSLA 1L8QA 1MTZA 3GFFA 4WXMA 1IRIA 1PQUA 4K1LA 4MYRA 4LF8B 1N36B 4FMCF 3MVEA 4N54A 3RTGA 4LC0A 2IIPA 2VK8A 4NYIQ 4PZZA 3QXGA 2WIGA 3LPLA 1Z0AA 2ZSEA 1G8PA 1YQWA 1STOA 3RS3A 4CL8A 2A9JA 2PSJA 1C9DB 1NGSA 3GQVA 4PC7A 1NASA 3BGVA 1GARA 1QWSA 3AR2A 5BV0A 3GCDA 4P7JA 5FBLB 3MTEA 2DBZA 4I55F 5E38A 4BWFB 2I2WA 3KSAC 1BMDA 1MAWA 1U8EA 5FEMA 3JV7A 5T4FA 2MU1A 3IP6A 3U7QB 2IOFK 4ZQBA 2VUTA 1FSPA 4PHTA 1K1EA 4BQPA 2MTBA 1KMIY 1R00A 4YK7A 4YACA 5CA0B 2PX5A 4HPJB 4O1IA 3PQFA 1E62A 4ZHQB 4OGFA 3EXAA 4BX0A 2NYVA 2CDCA 4K6CA 3GFGA 4QFDA 2BV3A 3V4LA 4B6EA 2UYYA 1I3LA 4WH0A 3T0IA 3VR5A 4WZ6A 4EJ6A 4KFCA 2VNAA 3ST7A 4UZFA 2OAP1 2FZKA 4ZK2A 4DSAA 4F5ZA 1JR3D 2NTVA 3W6ZA 1E60A 3CZRA 5LD2B 2ZK7A 4HV4A 5LYJF 3R7WB 4BBPA 3HY3A 1JLLB 3COZA 1GKIA 3PL1A 4CYMA 3VVCA 1IZ0A 3O3NB 4XB2A 2C2MA 3S2IA 5KNBH 2Z0MA 2I6SA 4LWPA 4OXRA 4QAJA 3SF0A 2XGJA 1NBHA 4JLKA 2BM9A 1U3WA 1WBJB 1ZN7A 2YV3A 3EMVA 3BD6A 1O6BA 4Z6KA 3UJHA 1ZVVA 4XIGS 4HJXA 4Z5XA 4BJHB 3CSDA 3QIVA 2AH5A 1MB9A 5FP0A 3LC0A 5FUXA 1RJDA 5A04A 3UGQA 1E5TA 1KWGA 1W5TA 2HTFA 3CLTC 1ONOA 3RLIA 2GEFA 2NT4A 3VNRA 4B2PA 2C5BA 3U56A 3BERA 5HE8A 1JEQA 4MHSA 4KXUA 3A1FA 4RA9B 2X0FA 3B3GA 1Y4ZA 3HCNA 1QSGA 4OL0A 1A27A 2XGOA 1I6WA 4JVMA 2YXEA 2GAJA 3ER6A 5U4XA 4PF1A 1VKOA 3GBSA 1PD0A 5EXEA 1ADYA 3M6AA 5ICGA 1Q1BA 2OECA 5EAIA 2ZB2A 3OKPA 5IN5A 1B73A 3KHKA 4OXYA 2ZUDA 4DS3A 2W98A 3CBQA 3SX4A 1U9JA 4GBJA 4HQRA 3ZUGA 3GIWA 4V38A 3OZGA 1M5RA 4UM9D 3JPWA 3HP1A 3UT6A 2IZ6A 2WUWE 1XZFA 2AHOA 3GDHA 3NRBA 3OIFA 5DGTA 2HX1A 5JZMA 3KD3A 3FHCB 4IWXA 3TIGA 4BO5A 3CT4A 4NWIA 2CSXA 4IIBA 1JVSA 4NYMQ 3AHCA 3PUHA 3ZHSA 4DLVA 2DH5A 4X61A 4OMFG 4UQOA 1DFIA 1P4RA 3HKDA 3M5DA 2IZ1A 5EXTA 4EHLA 3MS7A 2ZS9A 4DZZA 1WMSA 2A5GA 1UZLA 2WF7A 2RI0A 1LTKA 1HGXA 2QLLA 4BO1A 2FUEA 1NIJA 2ZBVA 4GPZA 2VZ9A 5CAEA 5HIKA 4AQ7A 4V3CA 1KVQA 4B71A 2GRUA 2CXPA 2VAXA 3QLTA 4O08A 4UW9A 5FLKA 4J90A 3FYCA 4BVHA 3WYAA 1FMCA 3QPBA 3LOUA 1E1LA 2QTHA 3M49A 4P4SA 3M6WA 2C1XA 3UPUA 3ZJUA 3D7SA 3V8VA 2PWZA 1IOVA 5KZMB 1YBHA 4XWYA 4GPAA 3I8XA 4I4NA 4ZZ1A 4UAVA 1ZDMA 1ZGBA 4MGKR 5TJHA 3ZQ6A 1V37A 2FH5B 1TQ6A 2UYCA 2E7ZA 2CB9A 3N3AC 1DKPA 3UK2A 2Y2UA 3CINA 3WRWA 4MZXA 4DNPA 2Q21A 2C2XA 2XTJA 4PZUA 2NVWA 4DJTA 2A9RA 1H69A 4P92A 1V39A 3ZWXA 1XCJA 2XAAA 2C97A 4NRDA 2IGTA 4N7JA 5BR1A 4TTVA 1W59A 2I76A 4Y8VA 4IJVA 5C8YB 2FN8A 4F84A 1EWTA 1B42A 2SICE 4TMYA 3U80A 1O89A 3DD5A 2E87A 4E5PA 1PWEA 3QRWA 2QVGA 2OUKA 3QEJA 2YZKA 2JCXA 4ILEA 3REFA 1S8OA 3FSGD 2DKFA 3RI3A 2AZXA 4TTQA 3A3OA 4BQOA 5C3UA 2OY0A 2QRJA 1OBOA 2ZYGA 5JPDA 3QF7A 2XOEA 2GHIA 4RY0A 2ZYUX 1HYBA 2QQ0A 3H3FA 2OV2A 3SAJA 5ELXA 2PVCA 5ALPA 1B8VA 1RD4A 1SU7A 2P65A 4JU8A 3L93A 1Y8QB 1D7AA 221PA 4M9QA 3HKCA 3QKSB 3WMWA 1E61A 2OB1A 3M8KA 1DMSA 1UPAA 3D5TA 3R75A 4FBLA 2CJWB 2A0XA 2FSFA 2V6JA 1MA0A 4RORA 2G8LA 4RZIA 3PG5A 3VPBA 1KI9A 4HNUA 2EZUA 3EPKA 4BE4A 3BRQA 2FV8A 4JT4A 3I83A 4POAA 1SG9A 1VBNA 2KLHA 3GXBA 4PO3X 3NO4A 1Z06A 5E0OA 3UV6A 4N39A 3ODPA 3ELBA 4H7PA 1FJGB 1YZUA 2Y1OA 4Y6SA 1QTIA 1G2QA 4EI7A 2M6SA 4Q47A 3UTDA 3KEFA 3R4VA 2H4JA 4Y6GB 3N0RA 3ROGA 3UT5A 4XWKA 4DIBA 4BDSA 4JJGA 3VJMA 3WWPA 4DYDA 4LF4B 5BMVB 1FYVA 2Q4RA 4QA9A 8AT1A 3OO0A 2Q6TA 2DFDA 1RYDA 4A7PA 4XFKA 3QE4A 3URKA 5BWLA 5J43A 2OSBA 2A9VA 4QDJA 3OZBA 1YJQA 3GUHA 4G1UC 1NVAA 5GONB 4M1OA 1OMOA 5DFAA 2YJTD 1B6SA 1NKVA 3USES 1K27A 4ZQCB 3RYCB 2J4DA 4ZJZA 4GL2A 4R81A 4ZQEA 5FKJA 5GMOA 1TAUA 4IXTA 3JZDA 2COUA 1HDEA 1U6KA 1KMMA 5D3QA 2C61A 2H92A 4RS3A 5CLJA 1NXQA 2OZKA 5D3MA 1JHXA 1Y3AA 2QBYB 3E8MA 3M34A 1S01A 4ALLA 4YAEA 4X3PA 5DTIA 1B8UA 4ZO7A 3D2BA 1N9GA 1Y8QA 4Y2RA 4MVJD 5LZ7A 4XRGA 1K3UB 1N8SA 4QYWA 3KKEA 4OD0A 4CQLB 2ZYIA 5CB4B 3SQXA 4RWZA 2V7GA 2XT0A 4AXXA 2I2FA 1CPYA 1MQ9A 5CLIA 2K87A 2H1RA 3JVDA 4L8LA 4MTCA 5JAUA 2EDCA 1XMSA 1KXJA 3PT5A 4A5SA 2NG1A 2G9NA 3VZQA 4NXNB 4EPXA 4ITVA 1YOVA 3DL0A 4H27A 5ESDA 1GVNB 4DG5A 1Q7EA 5AVSA 1QHXA 3DFMA 3EH2A 4QU8A 1QVRA 3T3DA 4AJJA 5K3EA 4X94A 1WZUA 1EK1A 4L74A 4EO9A 1QM5A 2NU6B 4GSYA 4XX1A 1GG2A 2B61A 1U28C 1Y1SA 5IZCC 3D3KA 1UKBA 4L0CA 3MTJA 1N7IA 1C9JA 4QG3A 1BMFA 3QQ5A 3N8KA 2YJ4A 1WWKA 5FO1A 4AZ0A 4LY3A 4ZVVA 2Q1XA 4JUAA 1G9XA 1KMQA 1G18A 3RAJA 1V8FA 1UC9A 5L7TA 4QQ8A 2IELA 4QQFA 3OFNA 4QGGA 1IVNA 1L5ZA 3SXPA 3L46A 3A1TA 1L4YA 4XUCA 2C5FA 1PW7A 3W5DA 4DEVA 3TRIA 3UMBA 1EIWA 3UHAA 2CN1A 5HZGA 1F7VA 1J9EA 5AOCA 3VPXA 3DLBA 4A2CA 5ICMA 2VJDA 3WISA 4P0QB 4IJMA 3DLAA 4BFWA 3MBKA 1BIFA 1TDJA 3PVZA 4KO8A 3FCUB 3QWBA 2ZTSA 1PTJC 1G8FA 3P7MA 4MV8A 2QF7A 2HRBA 1JQAA 4EHFA 2FSIA 3DKKA 3F1KA 1OQAA 1Q92A 3FCEA 1JECA 2TRSB 1I94B 5LDGA 5FB3A 1C0EA 4QDZA 3NMUF 1L5RA 2DR3A 5AKZA 2JIZA 1P8JA 3C7AA 4HX9A 3PGLA 9GPBA 5J4KA 4ARUA 4CIWA 1E9SA 1PT5A 1RRGA 1Q57A 4UD6A 1G8JA 2HRDA 4OI4A 3UJPA 4D25A 1TQHA 3PE6A 1THZA 3CQ9A 5LA6A 3HI6A 4B43A 1DAFA 2QE7D 4UCQA 1H2RS 4E33A 2VOEA 5HQJA 4RULA 4FFMA 4LF7B 5IRCD 1NI5A 3TEMA 3VBEA 1Z5WA 4MHTA 1TQDA 4CN8A 1OB5A 2I5PO 4I19A 3D6TB 2F8SA 2NZ2A 3R7AA 2IYPA 4ZO4A 4OEHA 2K4MA 4NK5A 3HLKA 2AMLA 2QX9A 4Z0HO 3TL3A 4QLBA 5TVKA 1CUBA 3JYLA 4IRMA 4C4ZA 3PX7A 3TCXB 4V0NA 3E9ZA 2RHMA 2LDBA 2PQ2A 1JDSA 4RLHA 5U9CA 1Z25A 1UPTA 2HWKA 3IAFA 1W44A 3MGCA 4AP6A 2XDQB 3B1ZA 1X8LA 4KQMA 4IXMA 1BJRE 3LMKA 4OREX 1NI4A 3REOA 4CR7A 2O52A 4ZRNA 4YCCA 3E7XA 1UXOA 2XUAA 1LC0A 3RC1A 3CVUA 2PO5A 3OZIA 4X3OA 2BGIA 3JATB 4ZU6X 1SOUA 2V54A 2XCTB 5JFTA 2INGX 5DN6A 1XRLA 2KI5A 3BAZA 4E13A 3FNHA 1DOZA 2GZ1A 4HFJA 2EIXA 2HDOA 2YHIB 3W3AA 2YWBA 4IRXA 5AVUA 1OFVA 1TCBA 3CX7A 1JHPA 2FJUA 4Z3OA 2NXCA 4J1SA 4JI7B 1W76A 2UYOA 3E9QA 4LNUA 3HLTA 4AJLA 5JISA 2E2WA 4A6EA 2G28A 3QBJA 4X0EA 1F2DA 4B4VA 3VVBA 2WMOB 3BZBA 5GP1A 1ZCBA 1U7PA 2F43B 1X8XA 5A4KA 3CLKA 4MP8A 1I7SB 4O8CA 3O8DA 2E5FA 4HFMA 4OI0A 5AHXA 2WEKA 3GB9A 2BBWA 3QMMA 2XOKA 3FIUA 3PX3A 3C24A 2XQIA 4G89A 5J1TB 4HWRA 3RU2A 4GH5A 4JMPA 5B3JC 2G1JA 2GM4A 1R6TA 2WWIA 4CETA 3D4BA 2YW9A 2XQFA 4CCAA 1E18A 2ILVA 2IUYA 2IEAA 5K8JB 3F5QA 1DC4A 3TQQA 1DEHA 2CMGA 1R16A 4DGQA 1RXSA 3K9CA 3RC9A 3ZH9B 2EZTA 4MIOA 5HSGA 4HK4A 1M5UA 3DPIA 5BSRA 5ADHA 4TV8F 3NGLA 4UHCA 1G20B 1QGED 5KDLA 1TK3A 1ZD2P 3G7SA 4M21A 2JGFA 1JIVA 2HDNB 5AM4A 3V9AA 5KOJB 1OV6A 5GGXA 5IC6A 3REGA 5TMBA 3DE7X 3OPYI 3KK0A 3UA4A 5JECA 1KJJA 1IHYA 3USZA 2A0FA 1OX4A 1AQNA 4IRUB 1LSJA 2NU7B 3BN3A 3HUDA 2XTNA 3JALA 4E30A 1SQGA 4AJKA 4CHGA 4L8FA 2DKNA 4Z3KA 5HQTA 2PZKA 3WRYC 4F6LA 1VMIA 1QHSA 2VBIA 2GKOA 2NU7A 3CNEA 3JALB 3D1VA 4HNSA 3H9QA 3GEHA 2PS3A 4C6TB 3ZLVA 1QH9A 1GPAA 4PLYA 5E2AA 3LF1A 5HMMA 1EUQA 3A6PC 1X1AA 4YBZA 2O2DA 1ZONA 2IHYA 2XVYA 2FSHA 1YBFA 2QX4A 2ZRNA 4G4JA 3ROTA 4CDNA 4CM3A 4H16A 1V4VA 4ZCRA 3MSXA 4R8SA 5KKCA 4C4TA 3VUFA 1LFDB 2JAUA 1U9CA 1G9SA 1QDLB 3NYIA 4EYGA 3NEYA 4URUR 1CR0A 2XDWA 2MDTA 4DKXA 3E8XA 1E9CA 1KGDA 4H7DA 3OJEA 4KQFA 1WTAA 4HGNA 5FH9A 4NBKA 3OPXA 2Z6QA 2WNHA 4KIFA 4L7QA 4LFBB 1D04A 1KJNA 4ZHSA 2AKEA 3HRHA 2GLTA 3W9UA 3AU9A 3C3MA 3G1UA 4MLDA 1ABBA 4EI8A 1WMEA 2B7CA 5IK2D 3WRXA 1P5ZB 2WT8A 3WGQA 1C1DB 2QK4A 3QX9A 4WD3A 1JKMA 1FY2A 4CMCA 2ZTHA 4RZUA 4D0GA 1EX9A 3S70A 1EI9A 3ETLA 4X84A 2IPAB 3RS5A 2P4QA 5HILA 3AWIA 3G6WA 4PX3A 4CQJA 4KVFA 1NQVA 3F6EX 4JT8A 5L7WA 2B92A 4W5WA 4BYGA 4WOKA 4Y67A 1B14A 2QD1A 3GCXA 3CF2A 4JLUA 1RTTA 3ZK7A 1U7OA 1QCDA 1XEWY 2J87A 2V97A 4OHRA 4EX7A 3LNTA 4IIUA 1PAUA 3RK4A 3NQ41 4EKYA 1XTPA 2PBFA 5AXCA 4NCKA 1OR8A 2WB4A 2PVSA 4JJ7A 5EUCA 4GVXA 3MGKA 3Q1KA 3ISVA 1OXXK 4EMSA 1MB2A 2IX9A 3K6KA 1HOTA 2GYUA 4MZDA 1XWFA 2RAUA 4A0SA 4UU0A 2XVMA 5DGHA 3A1SA 3L01A 4U7GA 3RAGA 1YR2A 3R3JA 1P9RA 3LM8A 2JCYA 1NPDA 1KJZA 3IR7A 1GAWA 4IVNA 5AI0A 2BZ1A 3HZOA 3UV3A 3K70D 2JAHA 1PR1A 4XTRA 1X74A 3W04A 1X92A 3PFHA 5KNDA 1NSTA 2PRKA 4QYSA 3QA9A 2Z4SA 2OCIA 2OO5A 3IBSA 3CXRA 3RRYA 5EJ7A 2PFGA 3HR4A 3O3OB 4ARCA 3KUDA 1D2AA 1B0AA 1XQYA 2NXJA 4EAAA 4WA8A 4EAQA 2DFLA 3RRJA 2ZJ3A 4BKOA 3W6UA 5JR3A 5HUHA 4ZJPA 3ROEA 1E63A 2FYTA 2GD2A 4OO3A 3T0FA 1CRQA 2G08A 3OFVA 1S96A 1UIMA 1EVYA 3D8TA 1N5IA 1SOAA 1VJCA 3IPXA 4HF7A 4WXHA 1ECPA 1QE0A 1N1DA 3Q0IA 1MO2A 2A84A 5AW7A 2Z3WA 2OGTA 3A31A 3C4QA 3FNIA 4KQXA 3CKLA 5AMXA 4DRXA 4GDFA 1UT8A 4G1BA 4NIMA 4URXR 4XEUA 2FTKE 3CE6A 2GXUA 2I54A 4X93A 3UAYA 3MBOA 2W4IA 5L7YA 2PSHA 4J2OA 2BM8A 3B7GA 4EG6A 1E2FA 2CJFA 121PA 2P6MA 3C8MA 3V4RA 1O4VA 2J85A 3A6EA 3CEHA 4JFRA 4D3SA 4F2DA 3QWHA 4TT3A 3F6PA 4EOGA 1YL5A 3RT1A 4AICA 3ENWA 4FYPA 4MX8A 4PLHA 2JGRA 3KSBC 4G0VA 4KHPB 5EKXA 4P36A 2Q5LA 1SVUA 5HPYB 1C80A 1WVMA 2AFHE 5FOQA 5D7BA 2R6R1 3DTYA 2QR2A 2CYCA 1NFQA 3CF6R 4S0XA 4C6TA 3I3SR 1IN5A 3W5VA 2I2DA 1M34E 4XB6B 2O5CA 2QQEA 4HCJA 4BLVA 1IZ7A 3D0RA 4CKXA 5TNXA 4XIYA 2X3YA 2GJAA 3U49A 4JUIA 3VFDA 2ZSAA 3H84A 1YZLA 3EFOB 5BNTA 3HC7A 4KWIA 3BHNA 3W5UA 1O9GA 2WFAA 1J99A 3GCZA 3L05A 1RJFA 4C0HA 2Y8EA 2C5AA 2W0MA 4DVGA 3EJWA 1BKYA 5GADl 1DWPA 1KZGB 2P2ZA 2R8YA 4UVDA 4BLSA 1OW3B 2OP0A 4ZANA 4LPKA 3I9V6 1GILA 1NDUA 1SBCA 2YN0A 1T10A 3M9XA 4IHQA 3N2IA 4Q1BA 3MWEA 5K0JA 2QHXA 1YVDA 3KKZA 3ZV7A 2W83A 5LU8A 3TDKA 2QRUA 4GT1A 4ZCLA 3VU3A 1IUPA 5F33A 5FTLA 4TWIA 4IQFA 2BL4A 3IV6A 2O2ZA 5DULA 5KTNA 3ANNA 4WAUA 3RNOA 2J30A 1DAIA 1S0UA 2JI4A 1J97A 3A4YA 1PV4A 1E5DA 1BU8A 1Y7TA 3CONA 3LYAA 2QRVA 1PE0A 4A23A 4D4IA 4NJMB 1XJWA 2E85A 2MSNA 5FBZA 4MR8A 1LC3A 4CF5A 2G5PA 2BGKA 1OHHA 1EHYA 4NCIA 2NYRA 2QRVB 5EJ5A 3INYA 1H2BA 2EKQA 1ZUWA 2VPZA 3K9LA 1EG2A 4JOQA 4XVCA 1V5WA 2XE8A 4XGRA 2XB2A 4MK4A 2O06A 1OZ0A 4NU5A 1VJDA 3PEYA 1Q6ZA 1PFVA 1UC8A 1Y5LA 3DBRB 3IMKA 2MJLA 2WMYA 3T1QA 1Y6ZA 2R5WA 1SHKA 1G5HA 1TEVA 4HDKB 1OJLA 4KUEA 4XW2A 3WB0A 5CVDA 4ROTA 4V03A 1GGMA 5AM2A 1WM1A 2XIQA 4BRWA 4CNBA 2H2DA 2RDMA 3VR1A 2CXUA 2JLSA 3UA3A 4ALIA 1TF2A 2FY8A 5G0SA 3QXSA 2IYVA 1X7WB 4K40A 1F8XA 4ZXFA 3AT1A 2FQ1A 2R6CA 3I4LA 3TNJA 2QN6A 1AUOA 1UJ2A 1Q3TA 4BVEA 2BFBB 3MQ4A 1EUYA 2FPWA 1WNTA 4OVKA 3HM9A 3A1WA 1O5TA 1GFZA 3LDFA 1TM5E 1OXMA 4HADA 2F48A 1T5DX 4NG5A 3HDYA 3ROXA 4D74A 3B7PA 4D81A 1L8LA 1G0NA 4NU6A 3W3ZB 4QUDA 2YC4C 4DT1A 5FI1B 3ZJ4A 4MRAA 2EJTA 3VYRB 3UMVA 4DBLE 2GERA 1PJLA 5EQTA 3DMGA 4ALJA 4D6XA 2FPRA 4WCDA 4KJXA 4YJGA 3SMVA 1C9NA 4DJFC 4CG2A 4AX4A 3FVWA 1I3MA 3KYJB 3SBXA 1RBYA 1HUQA 1PFYA 1FBNA 2YZNA 3M3HA 5ESXA 2W6JD 1GNQA 1U9ZA 2CNNA 3CIFA 2BJHA 2RKOA 3T1VA 3LKVA 1E7QA 3VR4A 3WXBA 2WP8J 2IOFA 3B20A 4HMQA 4F9FA 5DP2A 1TQ4A 3BHJA 1REQB 2JC3A 4RVNA 3OCCA 4LHSA 4ZTZB 1UJ5A 3FHJA 4AW9A 4QTYA 1V11B 1YZ3A 1T1IA 4GP6A 5CT5A 2HB6A 1Z7BA 4IDGA 1NWCA 2CHEA 1IONA 3ESZA 2Q7OE 4JODA 5BT8A 2G5GX 3IRUA 1TT7A 4FFOA 4M7OA 2OD7A 2Y99A 5K0BA 1GSHA 2B5OA 4F45A 1W1UA 4KGDA 3WLJA 7YASA 1N57A 3HDGA 1U7ZA 2FEMA 3NDRA 2QGZA 4EYKA 1RQLA 3GUCA 1S3FA 2J5XA 3IBGA 2GBIA 3YASA 4DC1A 2XBMA 4TL7A 2JKYA 1U2RA 1BFUA 2OCKA 3UH1A 3ZPXA 4BQSA 1W4CA 4ZIRA 3ZQKA 4LDJA 5YASA 3ZI4A 4C3VA 1ISRA 3L0DA 4KL8S 3UTCA 4B3MB 1YRYE 5K8VA 1O0CA 1AZWA 4NECA 2RB5A 3KKPA 4IO0A 4KLAA 5I7UA 2DQSA 3HR7A 4CUJA 1NXVA 4DGSA 1E99A 1Q0HA 1IBMB 3BJZA 1H3NA 2F59A 1CVIA 3T9EA 4NCHA 3AEUA 4UNPA 1QIIA 2GWRA 1AT1A 3DZIA 1Z34A 4Y2HA 2CBGA 3GAAA 3L8EA 3PIDA 5EESA 4F9TA 4UM9B 3VHLB 3H1FA 4Y7CA 4HXEB 1ISPA 3Q85A 1G7RA 5IYZF 3MMZA 1QPZA 3QG1A 2D2VA 1GPDG 2ZEJA 3CNLA 4OMCA 3BCHA 1YFKA 4YXWD 1DIOB 2AZDA 2G04A 3P2YA 5JAOA 4UUPA 1W73A 1PL7A 2NVUA 3EGCA 2F1IA 3PVCA 4JLWA 1RHRA 5EE3A 3THXB 2RHHA 3FN4A 5EP4A 3HDQA 2X76A 3PDHA 1E1YA 3OZUA 4B7XA 5CA1A 4IDPA 1N3BA 2PHZA 4IHJB 4MKHA 1QO0D 1UDBA 3WIBA 5BMOA 4OI2A 2FN3A 4HP8A 1TJNA 4FEAA 2BI7A 1SCJA 2DFVA 2REQB 5JI3E 3UAOA 2QLTA 4JI6B 3P97A 4AY5A 4MWOA 4AS2A 3A3NA 1FXUA 2ZRMA 2V74B 2N75A 3CVJA 4D7AA 4XWGA 4F5WA 5LXTA 3HJAA 5FCDA 3G85A 1U0RA 3K0CA 4WOPA 5FBKA 5A5GA 2F3RA 2C7OA 4M9CA