2P78A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGAMEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p78A00
1XQ9A 3F3KA 3R7AA 1YFKA 2A6PA 3GP5A 4JODA 1SK8A 2IKQA 3OI7A 2OWEA 1DKPA 3NFYA 1QFXA 1ND5A 3FDZA 2ENUA 2P77A 5HTKA 3LG2A 2YN0A 3IT3A 2WNHA 5CDHA 3GW8A 1C80A 4FDUA 1QHFA 2P30A 5AK0A 1RIIA 2EKBA 3O0TA 4PZAA 1RPTA 4D4MA 1QWOA 5AJZA 1SKBA 3IT1A 2I1VB 3FJYA 3EOZA 4JOCA 3D8HA 3LL4A 4GPIB 1FZTA 1V7QA 3FDZB 4TSRA 1DKNA 3F2IA 2QNIA 1UJCA 2P2YA 2H4ZA 1NT4A 4GPZA 4FDTA 4ARVA 1V37A 5AJXA 1CVIA 1TIPA 3E9DA 2OWDA 3KKKA 2H52A 4PZ9A 2YN2A 3E9EA 5AJWA 2HPAA 1E58A 1YJXA 2EOAA 2P9FA 4EO9A 1H2EA 3QPVA 5CX4A 3EZNA 1SKAA 4AROA 1C81A 2P78A 2P79A 2PA0A 4JOBA 1T8PA 2HIAA 5HR5A 3DB1A 1C7ZA 1UJBA 5PGMA 2WU0A 1BQ4A 4ARUA 3IT0A 1DKMA 3D6AA 1SK9A 2P75A 1IHPA 3LNTA 5AJYA 1DKOA 2WNIA 3QPUA 4D4LA 1BQ3A 4EMBA 2P6OA 4ARSA 2F90A 2AXNA 3BIFA 3NTLA 4ODIA 3D4IA 1BIFA 4PGMA 4D4JA 3MXOA 2P6MA 3E9CA 3K4QA 2P9ZA 2RFLA 1RPAA 4IJ6A 4IJ5A 1K6MA 2ENWA 1DKQA 3DCYA 3K4PA 1DKLA 2P9YA 2DWPA 3GP3A 4MA4A 2H4XA 5CU7A 1EBBA 5AJVB 1FBTA 3C7TA 2P2ZA 3MBKA 2EKZA 2HHJA 1E59A 3ZHCA 3QPWA 4D4KA 1H2FA 2H0QA 2BIFA 1ND6A 3IT2A 3HJGA 4HBZA 4QIHA 4E3WA 2A9JA 3PGMA 2GFIA 2DWOA
chains in the Genus database with same CATH superfamily
2NO9A 1YXMA 1ZM2A 5KSPA 5HE9A 3DOFA 2WP8J 4DA0A 3LCVB 3LPAA 3V1KA 2R8PA 2UYOA 3P27A 1WKCA 2PLNA 1Z62A 4EYGA 3SVTA 3U4AA 1RXYA 1XN4A 2QNRA 1GZUA 2B8WA 2X3FA 1F2UB 1OXUA 2XNDD 1QPBA 4WNAB 2PNFA 2O0KA 4HF7A 3ORSA 1P4GA 4N48A 2QXUA 2AIRA 3B51X 1OIVA 3NPMA 1B74A 1XZHA 4OHRA 3GW8A 2D59A 3I05A 3K9QO 4HNUA 5LQUA 1VJTA 3W78A 2QXYA 1WZCA 2GZHA 2I4OA 2WUVA 5C5CA 3I2JA 3O31A 2C7VA 5J5VA 3JYNA 1SBTA 2CFTA 2QTFA 3MQ4A 1KOJA 3KAKA 4RDHA 1NQUA 4F4JA 3LYHA 3K0HA 3JWIA 2PN1A 1LPBB 2FSGA 4C03A 4DMHA 1SU4A 4GLBA 2JKVA 4V03A 2DHDA 3IAFA 1BW9A 1H9AA 1U4NA 2V9ZA 3ASUA 3SDBA 1YVPA 4CQNA 3B1KA 3KYDB 2HBYA 1OJLA 3HY6A 1FMTA 1Y4ZA 2JGMA 2PZLA 2VOJA 2IV3A 5IDQA 3DDOA 4ZYVA 4KLRA 1L7PA 3F4LA 3CRW1 2EBHX 2L0XA 4FCWA 5IZCC 1FU7A 1HKHA 2H6EA 3TW8A 3CJTA 3ECCA 1ODKA 2IEGA 3K32A 3LU1A 2NVUB 4ZXFA 4YDQA 1NUUA 5F51A 2QRGA 3Q8KA 4AJ9A 4AJEA 3FFXA 2X9GA 5JYEA 4DIDA 3F8SA 5FNVF 2OFWA 3MTQA 4X84A 5KNBD 3CZCA 5CDUA 2DWUA 2IYPA 2C2YA 5LXTA 5JY1A 1UWLA 1W0JA 3ROQA 2QYSA 1CYEA 3R77A 5HR5A 1X9HA 4GOLD 4D3FA 4M3NA 1QGAA 3FUCA 3OEED 4ZCTA 1M9NA 3IHTA 4YJGA 3PHHA 1R6AA 2PX5A 2CMGA 3LSTA 3OE4A 3IVMA 3RGGA 1CZLA 4AX8A 4BNKA 3AV0B 1BE1A 4Z6KA 4D3SA 2IP4A 4HYYA 4L4RA 3FDIA 2A88A 4LY3A 2VN8A 5CK5A 5GVRA 1VA4A 1G3RA 4D4JA 3IO5A 5DTEA 1GGHA 4RTQA 2C4KA 2VTDA 2HTFA 2YWHA 4XIIA 3H1AA 4E70A 4FFLA 1UJ2A 3NT2A 4QBGB 4U9HS 5FWDA 2FMXA 2VG8A 3CR8A 2VNHA 1G6OA 2HBRA 3OPNA 5AXAA 3UV3A 4JEIA 1BW9B 1PTKA 2RHTA 4F8EA 1HMYA 1LNZA 2F3UA 1VE5A 2B4KA 2AWNA 3RVPA 2FEOA 3UW1A 1E7QA 1MO2A 1L4KA 1W1UA 3EUFA 3TBHA 1FQKA 4GX1A 4HGZA 1EZ1A 2GKGA 2O2ZA 4HSGA 1E2EA 3FUUA 4KRGA 1YDMA 2J3KA 3NDIA 4HEHA 3TW8B 2ZJFA 3FUTA 3U7RA 1XYGA 2IEZA 5KJEA 1GGMA 3LTNC 4A03A 2Q46A 3L7YA 5FUYA 4RK1A 1CJTC 1PFWA 2VDMB 3ITDA 1SUFA 3PITA 2BFPA 4F97A 2NO5A 3GLGA 1WM1A 2AMLA 1G5IA 1O0SA 3E2PA 3NM6B 3DTNA 4J03A 4BBAA 5T4EA 4A15A 2OCYC 3I6QA 1EJ0A 5E7JA 1JLSA 5LXTB 5LZ7A 4P4NA 2GM5A 4DGQA 1GUYA 1KA9H 1JXQA 2WAXA 3OOSA 3L77A 4GZLA 5AWFC 3UPTA 2C99A 1V6CA 5A3QA 2OE2A 4PANA 4QFBA 4YJGB 1N5OX 2ZIAA 4KYIB 5JXWA 1R9JA 1U1GA 3V42A 3U0BA 4HVTA 1YA8A 1MF7A 1RSZA 1HA3A 3F78A 5C4GB 3IIMA 3L93A 5ELMA 2O5CA 2X23A 1M2FA 3N39C 2DBYA 1SCUA 1VP3A 2QZ4A 1CB0A 1QCDA 2JLAA 1XKLA 3BILA 2F8MA 3F3MA 4CW7A 3RNLA 4FILA 1N57A 5T6MA 3VHQA 3IMCA 3M1YA 4YCJA 4BKPA 2JPDA 2VHVA 3GGOA 2OGUA 3AEZA 3CLRD 3G8DA 2B9VA 3EQ8A 3Q7PA 4JP1A 2QRVA 3CVYA 1QORA 1D3AA 2BFBA 5E2AA 1RLIA 1TJPB 3FDFA 1FU4A 5DTRA 2N0SA 4JLDA 1OBVA 2JBAA 2O1XA 2IIPA 1XCGB 1HT2E 2H08A 421PA 1LPMA 2WAYA 2Y67A 3TCXB 4A0GA 1Y37A 4OX9B 4F86A 4CE6A 1HQCA 1LRKA 3VHLB 1CQPA 1LS6A 2HPAA 3MF4A 1HNXB 5FWYA 1L3BA 4OG2A 3VZBA 1ILEA 5MN4A 1AQYA 3QA3E 1U90A 1PE0A 4ZCMA 3BVPA 4TMVA 2O8NA 4S04A 4AROA 3GLGB 2B99A 1RAIA 3DLCA 4QG3A 3EJ6A 2IBMA 4OLAA 2AOUA 2OT3B 1RXEA 2Z30A 4IIXA 2XZOA 4DR4B 3NFRA 1R5BA 1O8CA 3LVFO 3PQ2A 1JNXX 3AMVA 3V7UA 1TA0A 3E3AA 1JV2B 1Y4AE 2Y1GA 1KARA 5HBGA 4L85A 4EHDA 5JRZA 3GCXA 5JJLA 2ECOA 3EARA 1UODA 1KPGA 4OXQA 4GSKA 5TMDA 3GMSA 3MWFA 3CT4A 5FHRA 4LWQA 5F1PA 3MJSA 1L7BA 4UAGA 2G09A 2I8CA 3RJMA 1I9CA 4DM7A 3L4EA 1SCUB 4GUDA 2VF4X 1ZK3A 3TRKA 1U8FO 2YY6A 4GM1A 5FI3A 4YCCA 3CX7A 4KUEA 1DRKA 1RP7A 5HYVA 3QI2A 3KETA 1S3GA 4AU1A 1MG0A 2WDPA 1PUJA 1T2UA 1W8IA 3K1AA 5K01A 1T34A 2QRVB 4YCNA 2P0AA 2YW9A 3QPBA 4LVUA 4IIDA 3AHCA 3CH4B 1AN9A 2BFBB 3DVAA 3JQEA 1BRTA 3VTAA 4WRRA 5ALKA 2JBAB 2EZTA 1X1AA 3DS8A 4ESOA 4K9KA 2I0FA 3BEDA 1XZNA 4G5GA 2EFHB 3JZIA 4GKBA 5DXAA 1CF9A 1BEEA 2GZSA 3ZY4A 1DIAA 4G5FA 1KI2A 4IJKA 4WSOA 4DCGA 2G0AA 3GFTA 3KKQA 3NT5A 5JMPA 2R6AA 3VC1A 2PM8A 3L02A 4L2IA 4D6PA 2Q9UA 5LQMA 5FWYB 5C0OE 4QHSA 2XLBA 3R7BA 5EUBA 5B57C 1PJLA 2GPWA 1L5YA 2GO1A 2A14A 4Y2PA 1NE7A 1LK0A 2AOUB 1FA9A 2IODA 3IPCA 3PGA1 3WRYA 4DGSA 2D1FA 6REQB 3WMEA 2YINC 2WWWA 4MYCA 3WNVA 5IJZA 2Y76A 2CYBA 1VDZA 3EC7A 5BSEA 1HDXA 1KEVA 3EOBI 1BH6A 1GUFA 1KI3A 1LC3A 1PR4A 1QKIA 1RIIA 4HX5A 3C3WA 4R2KA 2AZXA 4YV7A 4D79A 4QGSA 5JU6A 1OYWA 4NARA 4C6RA 2A9VA 1T2AA 2QSUA 5AQEA 1GNPA 4KQEA 3HA5A 1JLRA 4JOCA 2WTAA 4AYWA 3GAFA 3K9NA 1SU7A 1JKIA 1L7XA 5C1IA 2VQEB 1THTA 1U8TA 5SICE 1MLDA 3VPBA 1JEOA 3E22A 3FHOA 3WO1A 1RJEA 2VPTA 2WBLC 1TTHA 4TXLA 3DT8A 3ZDXB 1M8JA 4UQPA 3DVAB 4Z9BA 4KXMA 1LBIA 5K6RA 5KKCA 4EYQA 4PNHA 4CIDA 2ZJ2A 1EXVA 2BF4A 2R44A 2HA3A 3VKUA 1JJIA 3QKTA 2H5JA 3KWJA 4RTNA 4BVBA 3FPHA 4BCCA 4IIYA 2OL4A 4EMSA 1ADCA 1E9EA 1E4VA 1I3LA 1VRWA 3FM9A 4F4DA 1EDBA 1OIWA 4KRYA 2YN4A 4WZ6A 1K6JA 5JV5A 4UMDA 5LPNA 1TFUA 1LRLA 2PZGA 4XYMA 4F56A 2CXPA 3G1TA 4ZWNA 4A2CA 3V4VB 4EHNA 4ZVNA 3CG4A 4XYEA 4JK3A 4LXUA 1EU1A 5FJJA 1DBIA 1OY1A 3FMGA 3NH9A 3ZE9A 4AMGA 5JD4A 4PAOA 3LGAA 4M49A 2XMDA 3DB1A 3QYPA 5EKUA 5ITSA 3W5AA 1PN3A 2PVSA 3K6SA 4C2TA 5TF4A 4ZV4A 3EY9A 3AVYA 1JSRA 4KNYA 1ID8A 1JXOA 2WWHA 5FFMA 3LQ4A 1JZQA 2KWIA 2M98A 4J16C 3PDJA 3ZDBA 3O73A 2B1JA 3H4IA 3UNXA 4YYZA 5TQVA 4H0FA 3C5WP 4XX0A 4NENA 4R5HA 5B12A 3UMSA 2YVAA 1YRWA 1G5QA 1UFOA 3NTLA 4J1SA 4BAGA 4MTCA 3BE4A 4ZT6A 1KO1A 1XTPA 2BFEA 2Y1XA 2WFZA 3KG2A 4EY5A 3S8EA 3R5TA 2YZGA 1EXWA 3P2EA 4DKXA 4DV7B 1AQLA 3MRXA 3GCDA 3O3CA 3JYQA 4KBFA 3D1JA 4EGJA 3HJBA 4EF6A 3OPYA 3MGAA 2NVWA 3O94A 1IXSB 1XZDA 4R6WA 1J0XO 3C8HA 5DW3A 5K6AA 1B15A 3U17A 3WRXA 4WA7A 3NVAA 1JFFA 4JN6B 1OKKA 1F8GA 2VAPA 3NEYA 2W42A 3E22B 3KB1A 2QTAA 4D81A 3NH6A 1X70A 2IK8A 1AKUA 2ZJ6A 2QSZA 1GL6A 3IRVA 4R7GA 2AJLI 2J6BA 3BSWA 4UZFA 3RROA 2GXQA 5E9QA 3WBJA 3ZV4A 3ZHUA 2DPMA 3HCFA 1LA2A 2ZTLA 1TLTA 1XD2A 3WWEA 1NF8A 2DWCA 1X74A 2E21A 4A3SA 3OECA 1DFHA 2PGDA 3Q9LA 1L4GA 4RKFA 4E09A 1UIMA 3BSFA 3RUCA 2IX9A 1DQNA 4DV0B 3BYZA 3UCXA 4WECA 4LK2A 1O4VA 2BGKA 2FGKA 4J2HA 1UWVA 1K3UB 3V32A 3RARA 2TMKA 3OTGA 4MK4A 4Q0MA 5CVCA 4J0HA 3TLCA 3FDJA 3WTCA 3ZY6A 3L0ZA 5IU6A 3K6SB 4TVOA 4RPGA 3KWFA 4NJEA 4FDUA 4QO8A 1H1TA 1XVAA 3AJEA 5EOVA 4Z2AA 1EGHA 2F4NA 4D0NA 1SBCA 2J9ZB 4J8PA 4LXXA 5FA8A 1Z0UA 2C4WA 2ZTMA 2XVAA 4H3VA 4XX0B 5DOVA 4NENB 4C87A 5JQGF 1JPVA 3HYCA 4KYTA 4RWEA 1Y5MA 2CJFA 2IYVA 5TT0A 1IMOA 2LVBA 5EP2A 4ACBA 4E30A 1Y6FA 3G13A 4OGFA 3KJHA 4OLJA 1G3MA 1PR2A 2BFEB 5DLQC 4AJOA 5CVVA 1T2NA 1IPFA 2E85A 3LUAA 3PZRA 3A6PC 3VVBA 1XDWA 3C5EA 1G2QA 2ASVA 2DTXA 3WL7A 1QRRA 1XZIA 1SBNE 4UUQA 5JPIA 4DLZA 3OPYB 4ZYLA 2ZJ0A 3VH1A 4LQ4A 3KVNA 4ENVA 1O96A 2RC6A 3JV7A 4W99A 1NMXA 3N6VA 4XE5A 2H51A 5BUCA 1JFFB 2VUSA 4PPNA 3CUYA 3JQFC 4QNMA 3SYLA 2WILA 1ZK1A 2ZSKA 2BCJQ 3ENZA 1E3IA 2GAIA 3R6WA 4TTPA 4TLLB 3TD6A 4F12A 3BDVA 3I5XA 2CUKA 4PNZA 1E9AA 3DJFA 3KOOA 2HJHA 2AI2A 1CRZA 3IOCA 3V1UA 4BMPB 3VQTA 3L49A 3PQEA 1U2GA 5EKTA 1AO3A 4LQLA 1FYWA 4Q9HA 3QA9A 2R0QC 1Y7HA 4AY2A 4W9RA 1MUUA 2CHEA 2WKQA 2Z2JA 3T9EA 3QUQA 4YO7A 3EIEA 1MZPA 4Y2HA 4M9QA 5EWMA 2XVZA 2XSZA 4HSEA 1KYQA 1D0IA 2LDBA 3ZCXA 3KFVA 1O08A 5D84A 1PX0A 4G09A 4PC3A 2Y1WA 3EXHB 1L7QA 2XGSA 4X90A 1GEEA 3LKZA 2EXXA 4NU6A 4OOEA 4ARUA 2BY4A 2ISCA 3SE0A 3TKAA 4BDTA 1LDGA 4ZT2A 3M4NA 1KBQA 4NJEB 3OZXA 2YY5A 2LD4A 1GSHA 5KB3A 3M9LA 1VFPA 3ZOZA 3B5EA 5F1OA 5F4ZA 4CQMD 5C8VA 1BWRA 3EUWA 2F1JA 3TFQA 3UOGA 2HLNA 3CR7A 2AEEA 4U5QA 1Q14A 2BJHA 4XCVA 16PKA 2PH5A 4CF5A 1LWOA 1ZCFA 2BHSA 3WMGA 3DXFA 5CG1A 1ZMXA 4C7BA 4E31A 1J97A 3DL2A 3GN2A 4EITA 4F9TA 3GPBA 3CEMA 4BJ6A 3WGUA 1WR8A 5FUXA 4B4KA 2O8FA 1OE0A 1XQ6A 2CLOB 4YP0A 1OVMA 4IG9A 2AMFA 1L5WA 2CVPA 1Q1EA 3V2UA 3QIVA 1O96B 1QHXA 2UUOA 4KAAA 3GDOA 4DEXA 1PQYA 4BB9A 4WI1A 2QNBA 2FZ5A 1VMAA 3GLTA 2FE1A 4II7A 4ZVSA 4B3BA 4OY3A 5LIRA 3PI6A 5EVCA 4B1FA 1M67A 1ZJJA 4L73A 3EYAA 4ENQA 3QWIA 3KQYA 4X54A 1JKMA 2AG0A 4GD3Q 5CNIA 2P65A 4OQMA 1L5NA 2OA0A 3MMPA 4KE7A 3HYRA 3EXEA 5H70A 4NOKA 3ZEIA 7REQB 3D3NA 2ANCA 3NZEA 3L9XA 4O59O 3FWZA 4IXWA 4ZQFA 2I1LA 4B87A 4MPTA 5AMXA 4D42A 1AQNA 2WLTA 4K9OA 2FJPA 3L5OA 3VNVA 2AK3A 4NZZA 2WW8A 4YAJA 2JAOA 3RREA 1Z17A 4ZPJA 4Q4LA 1RQRA 1YRBA 1DJQA 5TDHA 2DTDA 1EP1B 1DAMA 2I91A 5JNLA 2XCIA 2Z3ZA 3QHQA 3ZWVA 1N0VC 3PF9A 3B9PA 3Q3HA 1Q84A 1ZSNA 1BJKA 2QDKA 3DTVA 1BFKA 3ZBUA 4KQXA 4JI4B 5JZSA 3FJYA 3HS3A 4ZCLA 4AICA 3EDMA 4MQ4A 1DC3A 1XU4A 1SAYA 4P81A 5FD8A 3P97A 4FMCF 3UB3A 8ATCA 1K0FA 3L5KA 2QORA 3UJ3X 1D1PA 2Q5FA 1XI2A 4RQBA 2H00A 3W8EA 1D6JA 4J6FA 4A2QA 4BE4A 1C4KA 2GCEA 1NASA 5DNVA 2G8NA 4PLWA 4YRKA 3DPSA 4D9IA 3SC3A 4DHWA 2NX2A 3P4XA 1XJWA 2F7SA 3COVA 4I7EA 3FTCA 5KX5A 1K9VF 1BXKA 4OQ4A 1UDWA 3D3EA 3K05A 4DIKA 4DSUA 2AYYA 2F9FA 4L5IA 3MTJA 3OLZA 5EHIA 1EZZA 3FXAA 1OZFA 1IBSA 1IY0A 2H2AA 5CX4A 3UGQA 3UQZA 2X14A 2H92A 5A9SA 1JR4A 1PRYA 2JW5A 3EXEB 4D26A 2REOA 1Y8QA 1T1RA 3MAGA 4C4AA 5C2JB 1E3EA 4BQFA 1ZGCA 1IXZA 4R2MA 3KKLA 2J85A 2E48A 3RC9A 3LPDA 3OQVA 2RGCA 2DKNA 4YT2A 5LNK1 1N5RA 4L9WA 2QB5A 4PLGA 1V5EA 1Q83A 2C5AA 2B35A 1BOFA 1M6EX 4XSVA 4BLUA 1Z4MA 3R40A 2IS1A 3I3OA 1BKYA 4L51A 2ZCUA 7MHTA 4W1QA 1MENA 1ZOIA 2OXFA 4OFZA 4QXQA 1KU6A 3W8FA 4K26A 4AWAA 1J42A 3BF8A 1R00A 3OCXA 1TIKA 1DV2A 1U0SY 2VATA 1J8VA 2ZI5A 3TRFA 2VCEA 1AMUA 1MDFA 1X0VA 2P9ZA 2PRJA 3ZZ1A 2WG1A 1N1MA 1PT9A 5IZ4A 4RANA 3RTBA 1E99A 3EXIA 2WU1A 2IHUA 1X87A 2KBEA 4PVCA 3RRXA 4BFUA 4HGQA 3RYFA 2VP3A 2FPPA 1HG1A 3LQKA 5EQDA 3COYA 3NBMA 4LCEA 3FETA 3CX3A 5CM9C 5FKJA 1LLFA 2BONA 1UC8A 5GADl 5GJBA 3SP1A 2HHJA 3G9ZA 1N3YA 3A06A 3C8DA 2Q27A 1WEKA 2AW3A 4NESA 3BFVA 4JLNA 2CDBA 3W6NA 4KWEA 5A4FS 1T2CA 4WK6A 1ID1A 4KTVE 1V35A 3R74A 1UKZA 1J07A 3BOSA 5KX5B 1Z0IA 5ARBA 4NECA 4WA8A 2BEUA 2OO5A 4BC0A 2NYVA 1M2OA 1GQSA 4KXYA 1QIHA 1U7TA 2XMBA 1Q0SA 1QDUA 1SNYA 4KXUA 4AG5A 1X1CA 1G20A 4C76A 4BTEA 3QJ5A 4PLVA 4IRMA 2G8LA 1JL3A 4X24A 4FYMA 5A9SB 6GPBA 3E7WA 4B4WA 1Y8QB 5KQSA 4P92A 4YGYA 1KR5A 5JFOA 1OC4A 3K1ZA 3I9LA 1PWYE 2HDNB 1NRIA 2HF8A 4L4UA 1OPXA 4NK5A 1LPOA 3W6UA 2BDEA 2VK2A 1U9YA 3VGJA 4C05A 4OQPA 1B0ZA 3WL5A 1DWOA 4FFOA 2YQZA 4RHYA 2CWWA 2QD3A 4ZC8A 1YTLA 1SCJA 2Z83A 3VRHA 1RPTA 2XKKA 4FFRA 2QW8A 3TVYA 4KN6A 3VVMA 3PFGA 4EPYA 2I4MA 4WCVA 1SKBA 4Y9RA 2FSVC 5ESXA 1ZUD1 5E38A 1H4TA 3DLPX 2O50A 2VSQA 5H4HA 1FDTA 4AJNA 4Q1VA 3SHVA 2PWPA 2V7QD 4MRRA 5SYMA 2HFKA 3NYQA 3JVEA 4AJHA 1E0JA 3B7WA 3RYFB 2FPPB 2Y1EA 4LCJA 2R48A 3BBPA 4ZO7A 1RI4A 2XOKA 1T8WA 4GGMX 4JS0A 3W5JA 4X64B 1JFSA 3BGOS 2FZGA 4MYUA 4HATA 3WK4A 2NLOA 2K7ZA 1U2PA 3W4JA 5IHXA 3Q4GA 2YMMA 4HMOA 1AV7A 4XJXA 5AT1A 1U65A 3PTZA 2CXNA 3PDUA 2A3NA 2FN9A 3UK0A 5F23A 2Y1LA 4Z1MD 1YJQA 2ADMA 5JNWA 1C0IA 1P44A 2QTRA 5J1TB 4GICA 3CNNA 3MD9A 3VSBA 3GNLA 3N2EA 1T9CA 2XCOA 4NCNA 1TEVA 3QXJA 3ZD8A 2BEUB 3I2YX 2BF7A 4YTEA 5FP0A 3VJMA 1M2OB 3QKSA 3RF7A 3TNJA 1ZLYA 3VR5D 3ML1A 1EQUA 3AKDA 2R4UA 2R60A 1NX6A 1NNEA 1G20B 1OMOA 4X41A 4RY2A 4BO5A 4V1CI 4TGLA 2BMJA 4CMEC 7YASA 3ZGZA 2ZYAA 4QUHA 1PBNA 1X7HA 2B25A 5AKXA 3BJIC 1X42A 1KL7A 4JLSA 3NC0C 4ZVRA 3S2GA 2VF7A 3T3IA 1D09A 3DNPA 1Q19A 2GYVA 4PRZA 2GZ3A 2EJTA 3MBOA 4S24A 2QTHA 4V3BA 2H2FA 4DSNA 4E5DA 2IYRA 3CKMA 1XZLA 4DDVA 4J0CA 3R3VA 5A02A 2WU4A 3V48A 3PTAA 4N01A 1QAOA 3EWAA 1WL8A 5KTNA 4X65B 4Q9LA 3I64A 1SQGA 3I5UA 4QOEA 1LSSA 1C0PA 2WSIA 4YT4A 2RC5A 4IJ5A 4BQIA 2Z6AA 3INYA 1KIFA 2I2XB 1GJRA 1SG9A 1T3GA 2QX8A 2BP7A 1EUYA 1NMSA 3LZ6A 3WYGA 1ELOA 1MO3A 1P73A 3QE9Y 5CB0A 3CZ4A 4UU1A 1FS5A 1QK4A 2H4XA 3F6EX 4II3A 4WNYA 3WP0A 1RYHA 1NXVA 1NJFA 2WAOA 2WZBA 1RXUA 4NE9A 1ZJ4A 3A4NA 4EL5A 1FVFA 4PZ0A 4D0LB 4I08A 2IYLD 3KSMA 1F0KA 4N4AA 4CF3A 1Q95A 1Z7BA 2XHZA 3GJ7A 5DIZA 3GQBA 3HWSA 3IA7A 1PGQA 4DDUA 4ZTUB 3CUEF 2ISQA 3ZQ6A 1UZUA 5JUWA 1QV7A 3PFHA 4ZVMA 4D8TA 3ESRA 4IVPA 4QYTA 5LZ9A 2AUNA 1VJ5A 4AAYA 4W7SA 2E1PA 3PHBE 4ZZ3A 3AY3A 1UQRA 2GAAA 2K4MA 4BBJA 2NW6A 4L78A 4P3PA 2WTUA 1R6XA 5DLYA 1N3BA 3QKSB 1DEKA 2MJLA 4NAVA 3KB2A 4Q1AA 3O2JA 1LBEA 2QTBA 1NMQA 4F2HA 5CCBA 3WHIA 3EWNA 4DCOA 3CM0A 4BVAA 2XCLA 4GMFA 4KUGA 4XW2A 1PZEA 1JPJA 1J5XA 2FEXA 3L6EA 3LC7O 3MWDA 4DE5A 3O8CA 4R1QA 1D8TA 3GA5A 1D7OA 1YDHA 3MUEA 3NWEA 4KXXA 5FPTA 3C15C 4EDHA 1QE5A 4XVCA 2YXPX 4HR7A 1IB6A 2JFWA 3N07A 2AL7A 4QOFA 1VLHA 4OK6A 3RJ5A 2V58A 4G97A 2ZVJA 3WADA 1W5SA 1KC3A 2Z56A 1QRSA 3K2BA 2G25A 3F6CA 3H8SA 4XB1A 4IWXA 2P62A 4NBUA 3M6WA 2BMDA 5B7GA 1N33B 3TSYA 2AZMA 3JQAA 4LJ5A 3GG2A 3L82B 2BP7B 3C70A 3L01A 4OFXA 3DMTA 4XGKA 3KQOA 5A71A 2GT1A 3GJ0A 3PHLA 3RIYA 4E46A 5CVTA 5LZ5A 5CH8A 4EECA 3TIIA 3GLHE 2B1RA 2PGNA 1WZNA 4P4TA 2X0DA 3ANXA 2QMQA 3A3PA 4ZAFA 4MUIA 1ZGJA 1AGYA 4NV1A 4FE7A 1MTOA 2HQRA 3I4CA 3JRXA 4X97A 4WJZA 1KAGA 3GQBB 5IVHA 1W9HA 2MYPA 1G8PA 3AESA 3MCWA 4K86A 4WACA 5EHQA 4C89A 2XZDA 5LZ2A 4EKEA 1XQYA 4RK6A 4EHIA 2EU8A 4HNRA 4D99A 1CG6A 1PVVA 1YHZA 4HFRA 2ACEA 3MTEA 3SY8A 1G2PA 3UC9A 4KH0A 4DWVA 1KQOA 3EMVA 3VI3B 2XUPA 5JO0A 2X9QA 3SN6A 3IAM6 1B14A 3B7PA 4E2YA 4NYMR 4OUDA 5F77A 2I62A 4LBZA 4R7ZA 3BD9A 2H9IA 1W4LA 3B3AA 1E9RA 3EMKA 2QYTA 2JF0A 3LBHA 2AA3A 2VZEA 2OYSA 1X2BA 3MWDB 3TZCA 1TAHA 3D5TA 4EW6A 2NO0A 2HQBA 1QVRA 2BUCA 3LCUA 4KH1A 4UEOA 4KHZA 2R1VA 4IL5A 3DEHA 4YACA 4O63O 3ZEAA 2G08A 3GRFA 4NULA 1IY8A 1NBOA 3VPFA 3PNQA 2HHAA 3LT1A 5ALYA 4EYKA 1OB2A 3ME5A 4ZN6A 2GTPA 2HXSA 1HF3A 2XUHA 1G6HA 1Z88A 2O1WA 3M81A 2C94A 1SKQA 5LJIA 5JWRA 1XTSA 1NW3A 3UMGA 3JQAB 2WQ6A 2PUGA 3G0HA 2XE8A 4BPBA 1JR3A 1T9GS 2WV7A 3H04A 4KYUA 4ND8A 4QARA 4CODB 1HWYA 2G1AA 2P2ZA 1LDEA 2PT9A 2PWBA 3IHWA 4P32A 4HDKA 1PEYA 1NPDA 4F21A 1KYXA 2WIGA 3T9CA 4D80A 4ZMBA 2OK7A 4HNQA 5ECYA 5ADVA 3CXUA 2IXDA 4HRVA 3PXAA 4CM7A 2RGUA 3NOOA 4GE3A 2V4MA 3AESB 4R3WA 1YFKA 1VPVA 3LFTA 4G5SA 4C01A 1OH7A 3ZNNA 2J9YB 2VK1A 3M5CA 3R4CA 4NZ9A 7ADHA 3ZD6A 2QTTA 4JLVA 2A9PA 3FROA 1JAHA 2D1SA 4QO7A 3HR4A 5JSHA 2QUZA 4ME6A 2IYYA 2XTJA 1S1MA 2YV1A 4YRGA 1VKJA 1JTVA 1MTZA 1UEJA 3PA6A 1UKBA 4W7IA 4ZVOA 2LKCA 1KORA 5ALQA 3IBCA 2IU6A 4OUDB 3HCAA 1R6UA 3QMPA 1TF5A 1ONBA 4BO7A 1UT8A 2XWQA 1NNUA 5SZKB 1DWUA 3RNOA 2A1IA 2AI1A 1AO0A 2RG7A 2XAUA 2G9RA 2AH5A 3UAVA 5I9NA 1G3IA 2G9ZA 4FBLA 3H2YA 3G2MA 4D9BA 1SC9A 2R1VB 3H99A 4OBBA 5HKBA 5JXHA 3I76A 5M34A 4GGPA 1B1CA 4ZQIA 5ICEA 4QE3A 3R5JA 3LI2A 2C3UA 5D86A 1Y6GA 3SZGA 2VXBA 3HA2A 4ES6A 3PE6A 1JKFA 1WCWA 4MV9A 1A2QA 4I0WB 5A3SA 4UUNA 4ND8B 2DP4E 5L3RA 5K0LA 3AKEA 2IWHA 2I7VA 4HDKB 4OK5A 2J48A 1TVMA 4O2BF 1UJNA 2E9SA 1W2GA 2H2DA 3WZLA 5IABA 1DAOA 1UBFA 2DFNA 3M0EA 3NTOA 4AWBA 4WXYB 4RZUA 2ZW9A 1WU7A 4RADA 5IASA 4QYXA 1F2VA 3GRKA 2DSNA 2Q1TA 3D7LA 2Q4DA 3IQDB 2H17A 2GMWA 4EJSC 1ZGGA 3HN2A 4LXHA 3EX7C 10MHA 1ZH2A 3C3PA 3WNZA 2SECE 2G3YA 3MAAC 3V4SA 5JXGA 4JDUA 4C7KA 2QLFA 2WKPA 4C2UA 3P1JA 4R2WA 1NSFA 2ZSBA 4H7EA 4LFBB 4LMAA 4HXYA 5FLKA 5T7BA 3JWJA 1P2FA 2VTVA 1WMDA 2NNLD 2IU3A 1JJAA 5EL0A 4B3SB 4O2LA 1NRJB 1CJCA 1JHOA 3QPUA 4UREA 2GA8A 2HUNA 5DHTA 4TMFA 5G02A 1K9SA 1XTKA 1TU4A 1JZTA 1TCVA 1UQTA 1USIA 1RXIA 2NYRA 4H6XA 4GSYA 2JL1A 4QGAA 5K0ZA 1WVIA 3I2KA 1EGVB 3HXTA 3K4QA 2J4DA 3MMNA 3L4BA 3UMYA 3LQFA 1I0ZA 5AXCA 2PXCA 1V3TA 4K8RB 3IR7A 2QQ5A 1X8LA 3NKVA 3E5NA 1F2TA 4JELA 1RI1A 2CLKB 1RPZA 4DJAA 3JQ9C 2IY9A 5FOWA 3ZW8A 1VPWA 5AVXA 4HB4A 1NATA 1DQRA 2Q0XA 2O4UX 5BWOA 2OQIA 3UK6A 4OKIA 2PGIA 3PIDA 1J0CA 2CLMB 4GX5A 5KTMA 1FJXA 1ZYUA 2ZP1A 1Y6ZA 1CUZA 2ORED 1HLFA 2ZJ7A 3BMNB 3HM2A 4O4HA 2R6HA 3RFXA 2ID9A 4EKGA 1C8KA 1QQ7A 2BMWA 4FT4A 2VYNA 4I8XA 4B8WA 1SVWA 3QVGA 1V7CA 2JBHA 5FRDA 5I9TA 3SK0A 3V6LA 1ZVMA 2JVIA 3WNDA 3TEJA 1VIVA 5U1PA 5JZVA 1N77A 3HY3A 3RFVA 3QPAA 1V3QE 2AF3C 1UBGA 2PJZA 4DBVO 1WUTA 3OI7A 5KNDA 4AS3A 1A5BB 1GYQA 1MXHA 1P4RA 3T9BA 4IKEA 1ZI8A 3A3KA 1HYGA 3TZBA 2UYYA 1M2KA 2P7HA 3HDTA 3WQRA 4WXRA 3A0RB 5C1OA 1HNZB 4A8JA 3C1UA 3ES9A 1AA6A 1WRBA 5CEJA 1Z18A 4LTDA 5DISB 2C8KA 4A9AA 2COUA 2IJGX 4MQ6A 3AR7A 3CRNA 3EW9A 3LXXA 4UEJA 1HDYA 2OYRA 3WFIA 2PUTA 2ERXA 3MERA 4LJ7A 4EHBA 2XIJA 3JY6A 2P68A 4H0CA 3W90A 1WPRA 3M4YA 4BQQA 3HRHA 5C5IA 3HJUA 3VPCA 1BMFD 1R6BX 1Y4DE 2AN3A 2DECA 4QJBA 4P7JA 2XEXA 3IPYA 4HYEA 2PLWA 5K0FA 4IHKA 3OIFA 1FSGA 2VYVD 2PO5A 3M3HA 4KDRA 5BYBA 3FTFA 4TS3A 1ZH8A 1F2TB 2YQ5A 3JX9A 4QLOA 1IHOA 3BIJA 4KNVA 1TQDA 5LQAA 4EDFA 1UINA 1PYOA 5IBQA 4F84A 1NRWA 1PS8A 2H0AA 1HGXA 4ISCA 3EULA 4R0NA 2ONYA 2V3VA 4O4HB 4EB3A 4MO2A 4L22A 2E4WA 3ZHVA 4ZYZA 5CLFA 5I51A 5JAMA 1JJBA 3OQOA 1KH1A 2AFIA 3K96A 4J9VA 1R7RA 3IURA 4NOLA 1KGDA 4ARBA 1GA6A 3WJ1A 2EEZA 3QVGB 4DUYB 4DR1B 1UWCA 3NHMA 2WA2A 3D6VA 4B44A 2OM2A 2VA9A 3RUEA 4DVGA 3QBVA 4MYTA 3K92A 1L4FA 2ZUSA 2PXXA 1MGPA 1C81A 3U3XA 3LY7A 2NPOA 2J1LA 2EX4A 1NQAO 2VH2A 3R0XA 4BQOA 1GGJA 3EK2A 3OG9A 4OQQA 2YZ2A 1NMYA 3CEJA 3KEQA 3PR2B 3SJ7A 4CM9A 4LGYA 2J45A 1BQ4A 3CS3A 3ZTWA 3K9FC 1K8ZB 5E4YA 1O0CA 4CR7A 4A8JB 3G68A 3WLHA 1Z16A 3JQBC 3DEAA 4HN2A 4Q5IA 5AW6A 2XUFA 1CRQA 3MTAA 4NV3A 1R8SA 2R47A 3HCOA 5DM60 1FPQA 3SHQA 3B89A 2FR8A 3A6FA 3RUFA 3AY7A 2FN4A 2J4CA 4K3VA 2RI6A 1W85B 4JC0A 6LDHA 3PYXA 3H2BA 1JQ5A 1R66A 3JR3A 1XZAA 4TV8A 3L43A 2DR2A 2HM7A 4H18A 1KHHA 3N9IA 1ORWA 2GGSA 2M6SA 4ER6A 1F8UA 1SVNA 2OSBA 3RFUA 1BO6A 1KDOA 3WMRA 5COAA 1FSFA 1Q12A 4Z86A 1P2BA 5TVGA 2CHQA 3W5IA 4YRNA 3UN1A 5JC1A 2IT1A 3PFIA 1Z0SA 5H59A 3VJKA 3VDMA 2G06A 1JDPA 1XDBA 3KBBA 4UJ5A 3ZQKA 1KH3A 3TRIA 2OK8A 3OUTA 1PDVA 2MCFA 4GWLA 3T7KA 4LC9A 3UYKA 4LZJA 4OU4A 4W5HA 3G2HA 1Z39A 5JS7A 5BWBA 1XTZA 1HTWA 1VRCA 2GCOA 3A9VA 3SJUA 2AFIB 5J2TA 5H3LA 3QKIA 2GRUA 3M34A 2VDRB 3QEAZ 2J59A 2PSDA 3AM5A 3L7OA 3QW4B 4J91A 3I8SA 3BULA 3LT0A 3OLCX 3WRWA 3RC2A 5EJ9A 4UHDA 4H7KA 5U4XA 4EI7A 4LGVA 1FW6A 2HPVA 4LYJA 2V6BA 4R1UA 5AIBA 5B37A 3PEVA 1XMSA 4QELA 4G0YA 1YA6A 5FH9A 3B6KA 4O4IF 1XFDA 3TZLA 3CTPA 4HS4A 1WB5A 3E0QA 4RMNA 3REOA 3SNKA 1H5NA 1J22A 1Y3DE 3EVNA 3EW7A 1ECJA 1G0NA 1N2GA 3OZCA 1V8DA 3DDZX 1YZFA 4PX2A 4XWYA 3QVXA 2Z4SA 4GEKA 2EJBA 3T94A 3U4QA 3WP1B 3KLOA 4BFLA 1YRYE 1A9YA 3L7KA 2VJLA 1N36B 4PG4A 1QVZA 4RKEA 2ZUWA 3JQCA 4TV8B 4P7BA 3V5NA 1TNDA 1YT5A 3KQSA 5DCYA 1A04A 2WPNA 3GN1A 5ES4B 3LIIA 3GI1A 4AKIA 1NYQA 4G23A 5FQOA 2PVPA 3FLMA 2R6GA 5A5VA 4F1WA 4GAEA 3V46A 1KXJA 3KXIA 4ND7A 4BIIA 1THGA 1YC2A 3FGPA 2NYAA 1CUWA 2ZAYA 2ZUDA 4FI3C 1RHQA 1U28C 4H35A 1YZGA 4FDTA 3RWOA 2YZ7A 3BRWA 5A5DA 3GGPA 1YFZA 2VS1A 5ER6A 4G1MB 5JMTA 1SVIA 3W7AA 1E1NA 2VP2A 2C4TA 2NVOA 3EBLA 1E2QA 1OVGA 5HMMA 4NQRA 1FCJA 2AKEA 2O2YA 1FYFA 1K98A 2GCOB 4QBIA 1L5VA 3PPIA 1N5KA 5GY7A 2IDKA 1C3EA 4KXVA 1SQ6A 4FGZA 2FZ4A 3T4EA 5C8YF 4IGAA 1SKAA 3Q7QA 3D0KA 5I9IA 1CUCA 2B5VA 5J40A 3PQ5A 1JVSA 2FPSA 1V11A 2ECPA 2YNMC 3CGWA 4LOIA 1F4VA 3M4XA 4P80A 2PUCA 1VI2A 2CVHA 2YXLA 4PLHA 3TECE 1X7XA 2ZB4A 5CM8B 4KR9A 3TD9A 3RBXA 3LQQA 4TPKA 5HHTA 1A71A 2I7DA 2W2XA 3JASA 5I48A 1CK4A 4HL6A 4RZ3A 3LDGA 4YDHB 4BO3A 3O8NA 5ILGA 5ILOA 3U4QB 2OORC 1XO1A 1FUUA 2CNLA 2HUPA 2C4MA 2JCYA 4OJMX 3B9RA 3S8MA 4JI7B 4MVJA 2GAFA 4L4YA 5DIFA 2P9HA 1U2EA 2X0IA 3JVUA 2BTEA 4OQXA 2K2WA 3HXOA 2CDRA 2XVMA 3L4SO 1TM3E 2RI1A 4Q9AA 4YRMA 2ZYDA 2QD4A 1QK5A 3FJ1A 1QHNA 5EZQA 3CR3C 4FJ0A 4WVLA 4WINA 1GQOA 3PZBA 3E84A 3O0DA 1PDWA 1R3DA 1SCNE 3FRHA 3JAKA 1L1FA 2F1HA 4YP7A 3RSFA 4YUWA 3IBGA 2Y05A 1WXWA 3BD6A 1UBKS 3K15A 5IM5A 2YIJA 5EHNA 3M5DA 2IYOA 2ZIFA 3KZNA 5CEFA 4TWBA 2FU5C 3BGVA 3LMKA 4H3KB 1DVRA 3A6GA 5KNBA 2B5OA 2VTBA 3PLAE 2JLVA 3F4KA 4BRWA 4IDCA 2OY0A 1M6VA 5CLJA 1U7HA 3FBGA 4LTNA 2C1XA 2WI8A 2YNMD 1AM4D 2D8MA 4IO0A 4LJ6A 4O2RA 3H0KA 4PRKA 4Q39A 5EWJA 3ROZA 3OEEA 1JIIA 3M3PA 2Y3IA 1TM5E 1V11B 4JXZA 1ZRMA 5G41A 3U9SA 4BECA 4Q4CA 3OUUA 2V7BA 1XL0A 3ONVA 4H4EA 1H3EA 4FDMA 2DX7A 1RI5A 2Y0DA 3C0KA 3IAEA 5BV1A 1X7XB 3HUUA 3CG0A 4I2VA 2GSDA 1KRHA 1TDJA 1TPYA 3M82A 4MW0A 4A1OA 4FKBA 3ABZA 3H5NA 1W5TA 3WGVA 4OBXA 2X8JA 3IQFA 1Z0FA 3JASB 4FN4A 4XTRA 5AM3A 4UFNA 4QUGA 4LY6A 3WXMA 3H5AA 3OT1A 3W05A 4GOXA 1QF6A 5EXPA 4YPFA 4LA4A 2A84A 1DJLA 4DLBA 1WULS 1F5SA 2R9VA 2GARA 5IZCA 1DUIA 3TR6A 1YL6A 2QQEA 2W8ZA 3M6FA 2JD2A 3Q7EA 2QK4A 4K46A 5BSGA 5B4TA 3WAGA 1V48A 1KK0A 3STVA 2HCJB 3GT4A 1USGA 2HWWA 4P0TA 5LQDA 3HKBA 5D01A 1WZIA 1WF3A 2FSUA 1NW6A 4AO6A 1U7ZA 3KYBA 3Q8LA 4EZEA 2CCJA 1G4AE 4IRUB 3JAKB 4TZTA 1EGQA 1BEZA 1VL1A 1WMAA 4GZ3A 2NZYA 4MYHA 4EFLA 3Q8XB 3OY7A 5ALPA 5EUMA 2R96A 4M8LA 2YZKA 4Z3DA 1Y1QA 4TXNA 4XFKA 2GNPA 2P5YA 3NI2A 3GLFE 2QL5A 3O03A 2VTBB 5LU9A 2O0LA 1DO0A 1D5WA 1PEKE 2GK3A 5SYNA 4DIMA 1JEAA 1M6VB 3CQ9A 3N1UA 3PRYA 1H8HD 5CHEA 1ZM3A 3AI7A 4TZKA 4A6EA 5KNLA 4RJTA 1A9ZA 2P78A 4GT1A 5EWJB 4L1KA 3P9NA 1L6IA 4LSZA 4IUDS 3VR3D 4ETMA 4LJRA 4IR7A 2I66A 1YNOA 2FPWA 3T34A 3EQ7A 4E51A 3HGTA 4A36A 5DNAA 2Q3LA 2RGNC 1FS6A 2AYXA 2WSYB 2HHLA 4MGKR 2VR1A 2J08A 1EX7A 3P2KA 4RIEA 1QFJA 2W6OA 3EXG2 5FI5A 3UJNA 5K51A 3I23A 1YS7A 5CJJA 4ALIA 4R0VA 1CLEA 4I4CA 2X5XA 1PD1A 2PBZA 4BNYA 5LU8A 5AVJA 1PGNA 3P9YA 1BEUB 2X8JB 4QDTA 1IBMB 3CN9A 2P8JA 4C4ZA 1YTUA 2A0XA 4DQUA 3H0EA 2E4UA 2AUMA 2ZYSA 3OT1B 4RY8A 3C1OA 3C6QA 3G0OA 3D2AA 3U6KA 3AG6A 1CUGA 1IY2A 3NU1A 3TOZA 4ZAXA 3A1TA 3RTAA 4TWAA 4PLFA 4X93A 1FXSA 1L8LA 1WV0A 5JJBA 2FWNA 4RE6A 2EFCB 3HACA 2XWSA 3KS9A 4MGHA 1MO5A 3V7WA 4RO0A 5KHAA 3DDCA 3QM1A 2E4VA 3IEVA 2H8GA 1FLNA 2FSHA 1LGYA 2FQYA 4IMIB 4O08A 1XTJA 2HLHA 2W4QA 3HKBB 4QQFA 4F72A 4UATA 3UCEA 5JI2E 4F5WA 3PWSA 1QP4A 2HU2A 3BORA 2O6HA 1I3OA 3CH5A 1HE1C 2J3EA 4HMQA 4KPFC 4F5DA 2C0CA 4F5YA 2C1EA 3S8YA 1OH6A 1D0VA 4WEQA 4U7HA 1CKEA 1R4AA 1P4JA 3EH1A 3UAOA 5CFMA 1JH9A 1JHPA 3I34X 4OB6A 3N6RA 1AF4A 4HVLA 2FE4A 3VPDA 3WAJA 3KQKA 4A2WA 1Y89A 3HUEA 2YHBA 2YRFA 3L7NA 2RGWA 4ZAVA 4F5EA 1TVKA 5HJ5A 3KVVA 3DEJA 4E5VA 3CZQA 3JPWA 5IH3A 4CIXA 3ITNA 3AEQA 3I39X 4GZMA 3HBLA 4PCAA 2ABWA 1Q7TA 4D46A 4F6LA 2NU6A 4LZWA 1B41A 3T0GA 2P6PA 2CMKA 3VKWA 4HLQB 1EFVA 4ZAYA 1LBSA 5COBA 1JBEA 1TLFA 2OHHA 4OA5A 3OIUA 2VRWA 4EI2A 1DBQA 1MKYA 3IEMA 2NIPA 4I4TF 4J0FA 4F2WA 1RD4A 2ZB3A 3SZUA 1AUQA 1T9DA 4B0PA 4FFPA 3W6PA 3A9CA 3B2QA 3CMCO 1JMKC 4MHTA 3I04A 5AVUA 3IAAA 1RAHA 2HTEA 3RYTC 2V0CA 4HX9A 2WUGA 3HUTA 2OHGA 4E5MA 2Q1YA 3TUJC 2Y77A 1Q0QA 2CB9A 2CDCA 2HWXA 1TCBA 3SX2A 1Z5PA 5A5GA 3KQHA 3VU9B 4LBVA 2HRCA 2BGIA 5SY4A 3LDUA 4C4OA 5FV4A 5CCEA 1VPLA 1X7WA 2W4MA 1CFZA 1D6SA 1W581 2X5JO 2HLDD 4BEBA 5BW8A 1XDSA 3O4GA 3KXPA 3GH3A 2PBRA 1HC7A 2EEPA 4C04A 4V0QA 2JZOA 1WP9A 2ACKA 3RRZA 1ZOLA 4JJ8A 2ZEJA 3RI3A 3AOGA 1M74A 2D5AA 3MD0A 4UAUA 3H05A 4UTRA 2D74A 5EKDA 1TAGA 1TZJA 3RLFA 3DYBA 1DG1G 4XUGB 1TVKB 4DMGA 2CFCA 1VPDA 1DBPA 2A9FA 3PPYA 3WKEA 3DULA 4FHCA 1IK6A 1FRQA 3MWEA 3AEQB 1G8YA 5KOIA 2HNKA 3DAHA 1BVUA 3JVDA 1KEWA 3NOQA 5DDIP 5ANRB 5JYBA 2F9LA 2NU6B 4F3RA 1DFIA 3EY4A 4B17A 3NX4A 3EDRA 4HNSA 5DCLA 1COWD 1EFVB 3QENA 2C29D 1UKAA 3IYLW 1W5EA 2ID7A 1LW7A 2AMYA 3MBIA 5BV7A 2VUTA 1Z2AA 2AJDA 4MRVA 4KSCA 3R20A 3SC2A 4C20A 2G63A 4YP6A 2F17A 2R751 4ZYYA 1OAAA 1YNSA 1GQFA 1QE0A 3CLSC 4HQ0A 4NF2A 4P7GA 4Q1EA 1NVBA 3KDAA 1X3SA 3TCKA 3DBIA 4I50A 3BXEA 3NC1C 5DSXA 3B8EA 3GP3A 5E7MA 2PX3A 4MV8A 1I7PA 4GQBA 2HSEA 1Q17A 1NVKA 1AIPA 5C31A 5J5CA 1E9CA 1M1NA 1O6ZA 1WZEA 5HQ3A 4C6TA 3DZHA 3R3HA 4V24A 1QDLB 1SBQA 2W90A 5HZGA 5MGNA 4RAOA 1M2NA 1B73A 4B2IA 1W0KD 3AL3A 1ZA2A 1AG9A 4CKWA 1NJ8A 2HT1A 2E3JA 3PNMA 1X7WB 1Z36A 2GRAA 4FHFA 2EERA 3RCBA 1GU1A 3V4FA 4NI5A 3A25A 1ZD4A 4LMRA 3TB6A 1JFLA 2ODAA 4XDHA 2W6NA 3K71B 4J94A 4R83A 2Q8NA 2C61A 4MP3A 4WY5A 2BZSA 3DMNA 4OU5A 3K8ZA 1W5BA 1HZZA 1KYZA 3TAUA 2HNBA 3Q10A 1DL5A 4UZEA 1HPLA 4IJVA 4YUZA 2OV6A 4HOYA 2EW1A 1NRXA 1I5OA 2HJWA 3GJXC 3ISTA 2CVZA 3NGMA 3TSZA 3UEOA 4WFIA 4N5MA 2A9RA 3CE6A 3E7DA 4GKAA 4OGWA 3MWEB 1XTUA 4ZVPA 3V2IA 1KP3A 3KALA 4W8OA 2P27A 4U2FA 5LDGA 2RD2A 1I1HA 1WABA 5D51S 3CU5A 3EGXA 1CYDA 3ACBA 4ZHQF 5L4LA 1RHJA 2XMGA 3QTTA 5CLGA 5HSGA 3PR1A 4MXDA 1MNQA 4I9NA 3GEEA 1PKEA 2QTCA 2A94A 3KFXA 1P62B 3PRKE 1J7KA 3CLSD 2GZ1A 4PSDA 1NPTO 3SC2B 4BYGA 3ICEA 2QE7D 5KC8A 1Y9AA 2O3QA 3B9BA 5T67A 3LCMA 3M89A 1ODIA 5LQSA 2PUFA 4CTKA 1ZFNA 3AVVA 4Z4IA 2WJYA 3T99A 1FQWA 1PZNA 2BUAA 4I50B 3E9NA 4JKOA 2QU8A 2IS2A 5A7FA 2NV2B 1I1NA 3IJEB 4XZ3A 1LD3A 2BMVA 1A50B 3I9FA 1JG3A 1M1NB 4G36A 5HQ3B 1JECA 4W82A 4C6TB 3RS8A 1G8JA 1CJMA 1U2DC 1YUMA 3FPLA 2OXTA 5B4VA 2VLBA 2UXDB 1IN6A 5G3YA 4MKIA 1SB8A 1ITZA 3IXLA 4CKWB 4JBHA 1QVAA 5HPYB 1SOWA 2IZ6A 1GCOA 4WVFA 4WNIA 3D9QX 3O4VA 2EOAA 1TB4A 1A9XA 3P0FA 4J43A 1SU6A 1LZLA 1UUFA 1ZICA 3PHGA 4KQ1A 4AO8A 4YXWD 5K45A 3OAAD 3WLOA 4CI0B 1H94A 3QTBA 1VHTA 1ZG3A 4CLHA 1GSAA 4HC4A 3JD2A 4XWOA 2A57A 3EQ2A 2LXNA 3Q3JB 1VB3A 3Q5DA 4IGIA 2IZ1A 1TE2A 1C3XA 2BMAA 2FYTA 3HGMA 2VHTA 3NDRA 3WBFA 2CBXA 1JIXA 5TXGA 2QLBA 3UHPA 4Z4GA 2HA6A 4AZ3A 1VMEA 2CYAA 3RD5A 5EESA 3EGXB 1JR6A 1GCAA 1DQSA 4HXEB 1CCWA 1E3JA 3F5DA 1GPNA 3PX3A 1N2ZA 3FSJX 4H1VA 4RKWA 4ZARA 4J2TA 3ZH9B 4DJTA 2QAGA 4OP3A 1TJ4A 1YVRA 4BWFB 3ND9A 2UVQA 4I5EA 5E3IA 5LWHA 2PK3A 1E2KA 1AKTA 2VLIA 2C2XA 1CR4A 3G2KA 4TN1A 3DHYA 3WYCA 1ULAA 2J3HA 3V8VA 4DV3B 1Y8AA 1NDHA 2CHFA 3L40A 3ZVRA 4B7AA 2X1LA 2J5KA 1E2PA 2OFOA 3PQ6A 4XLLA 2J31A 1OPRA 4U2EA 4HAWA 3K8QA 4E1BA 1N9ZA 1NPYA 1NQ5A 1I5EA 2GVNA 4AF7A 3T7JA 2QVXX 4AKEA 5JBNA 4MV4A 4EG0A 5TMEA 3G2OA 1RYBA 3E1KA 1ENYA 3AONB 3F6PA 4A8PA 5FUMA 1ADBA 2XLCA 4KTTE 3W8RA 2H7YA 2WVHA 2P1ZA 3H5OA 1JHAA 4I8DA 4ZODA 5EJFA 9ATCA 1UOQA 1YU9A 4ITRC 1E1RD 2D00A 3A9TA 4Z7JA 1H6AA 3PDCA 2ZI3A 3A4IA 4UCQA 4CDNA 1A9XB 4FYXA 1NDUA 4I9GA 2DPGA 2JATA 3ECSA 3FDZA 1UOOA 3NS7A 3WNQA 1ICEA 2I1WA 5DGCA 2P77A 4WY8A 2HC9A 1A95A 3Q0EA 3EFEA 4RK5A 1KQPA 3FFWA 5F2EA 4XD2A 4M86A 5IM4F 4F4UA 5LZ8A 1SUWA 4CQMA 3J81k 2GEUA 2BKEA 1FMJA 1AE1A 2VPYA 2X8AA 3MW8A 4D57A 5AK0A 2HZBA 3HPRA 5FEUA 3DOEA 4O6VA 2GSWA 5D87A 2XBMA 4AZ3B 1FPMA 3G6KA 221PA 2CLSA 4HWOA 1UKCA 1XE3A 5K8LA 4GMKA 4KJZA 2BFAA 3E70C 1F3LA 4KGXA 4POAA 1ZHFA 4GE0A 1I7SB 4HDOB 1RXCA 2QAGB 2WJAA 4MULA 5EIAA 1RHRA 1YBAA 1M3SA 2G0TA 1O5IA 3LK6A 3HB1A 3QEOA 1N5JA 5CLHA 1BN7A 4X6YA 4EPTA 4UEWA 3B1VA 4BVLA 5LKAA 4PSCA 1LPSA 1UANA 2C42A 2JNWA 2R7AA 4R9SA 4P82A 3WNBA 1DG3A 3I0ZA 5L95A 3N0RA 1N8KA 2R97A 3KL2A 5HUJA 1K8QA 1MT3A 2FPRA 3ESZA 2GBFA 1AB5A 1NAIA 3CVWA 2G1PA 1W19A 3BTUA 2WM8A 3QY0A 4ZU6X 1AXEA 4YCBA 5CUQA 1GG5A 1U6JA 2IOQA 3MUOA 4DANA 4RZXA 4GNRA 4B46A 5A0FA 3TTXA 1I9GA 4GKKB 5SY6A 4R1SA 4IDPA 3P2JA 4LI0A 5TF0A 5LA6A 1IVNA 1PJ4A 1JU3A 1IZ9A 2X2PA 4OSPA 4S1TA 2DUJA 4OXKA 5K1ZA 3L8DA 1Z25A 2A5YB 3MELA 1KZ6A 3RPEA 3OU7A 1DXOA 1NQTA 2ON6A 2BW0A 4G5RA 1C0EA 1HL7A 4YO8A 4BRUA 4PQEA 1DMRA 2ZDQA 1K08A 1ZK0A 1KP9A 3OPVA 4ZVQA 4ND4A 1QLJA 1UPFA 4M98A 3WS7A 5BVHA 5J5AA 3OEHD 1P1BA 3FMVA 3JQDA 3TM4A 3U3OA 5E1BA 4CQMB 2QMEA 2Q3FA 2BRUC 5IVDA 3RVJA 1Z8DA 3SNHA 3FZNA 4DY4A 1HLPA 1UJ4A 3EVGA 3NEJA 1YC5A 1RJFA 3OJWA 2XTMA 4KQ6A 5C4MA 5KJCA 1YQWA 2OP0A 1HDIA 3G49A 3SEFA 2PGJA 2BGJA 4XVHA 3KDPA 2YV4A 3R9IA 5BOSA 1P1KA 4J3FA 5CPBA 3T3PB 4UMVA 1J2YA 3O26A 4A7PA 2V74B 3KR2A 4DADA 1RXSA 5TX7A 4LG1A 5EIEA 4I6EA 1F9AA 2VDLB 1NP7A 2H0RA 4PO9A 3MM4A 3IEXA 2X13A 3UG6A 3LBIA 5DGDA 2V6FA 3PJEA 2V1UA 1JEQA 4IIJF 5HVNA 1ORDA 1ORVA 3EGOA 1YVDA 1HE2A 2OXRA 3ZKWB 1AHNA 1TM4E 1S2NA 1QNFA 1FP6A 1T8RA 4E4TA 1CUIA 5FYQA 5DVZA 1NI5A 5EE5B 3KJIA 5AVRA 1FFXA 1OLSA 4EOGA 2A1UA 2POQX 2R2AA 4GR5A 4H31A 4BCDA 5LA6B 3U3RA 4HLUC 3QRWA 4U1RA 3T38A 4NIMA 4ZI7B 4N5LA 1T13A 4IDNA 5B3KA 4XD7A 2BH9A 2IIVA 3OZBA 4J49A 3EZLA 3PVCA 3P0EA 4EB8A 1BFDA 5IC6A 3DDNA 3KQUA 4M60A 4RTOA 3DL0A 2GFQA 2X2FA 1CJVC 2BEKA 1LFDB 2Y71A 3AM3A 3K2EA 4MSUA 1M6YA 3ONFA 1N4DA 5IJ0A 5JZ9A 5SZJA 2UZ0A 4Y7CA 3N76A 3G5AA 4B45A 2OHXA 4KPYA 1UBRS 4B8YA 4X8OA 4QSHA 2QW0X 1NNLA 5FBVB 4HHEA 3SQMA 2M6KA 5CTAA 2Q4RA 3UA3A 2WYWA 2ZTSA 3O4HA 5I5EA 3MHTA 4F3TA 1GPWB 2VWGA 4MAFA 4XQCA 4EF4A 4KSYA 1O4WA 1UEIA 3SMVA 3ZV7A 3KTAA 1ISIA 1YHYA 2GK6A 4TSRA 1DKNA 1QB8A 1VFNA 2GJ8A 2ORYA 3PT5A 3CSDA 4WMLA 2QNIA 1DOZA 3OUZA 4RK4A 5BYJA 4N40A 1DARA 3ZWOA 3HCDA 1K66A 1G2IA 1I6LA 1K3TA 3K9BA 1MIOA 3DVQX 4U2GA 3O1JC 4JROA 1ODJA 2C2KA 1JEQB 3VZPA 5C4IA 1L5SA 3WLMA 1ZKDA 4GC9A 3IQZA 5GOZA 3G2IA 3PGVA 3AR2A 5DBIA 3F7MA 3NHFA 4PGHA 3ZY5A 2XUGA 5C8ZA 1Z6TA 4EA7A 1RLMA 5F4BA 5BW4A 2HMUA 3BDAA 4E2WA 4ASUD 4M9RA 3KFLA 1UJ6A 1WXHA 1E2GA 3FYCA 4RNDB 1FFXB 2WEKA 2WIJA 4P3OA 1H23A 1OLSB 3SZ3A 1GPJA 1PQ4A 2A1UB 1SB9A 2QZJA 4IXMA 2GEBA 5IP5A 3TMKA 4PX9A 1LC0A 3OP1A 2KI5A 3GYGA 1USUA 2JHGA 2HI0A 2AE1A 4EHHA 1Y6QA 3L6DA 4F7WA 4G0ZA 4GI3A 3RVSA 2QY6A 2J7PD 5DHSA 4BN4A 1NI3A 3A11A 2ZFUA 4NBSA 4QJ4A 4Q16A 4S3MA 1MVLA 3SSAA 1HBJA 3TTSA 1IG3A 2O8CA 3KOYA 2J6IA 2GJ9A 3VAYA 3P2MA 3QITA 3COPA 3KR1A 4M1EA 1E1QD 2XUIA 4ZQCB 5L7TA 2PD4A 3QUTA 1A98A 3G1UA 4JSRA 3T3EA 4P35A 3WK9A 1K4YA 3D6JA 5FBLB 2NU9A 5AI6A 4Q4AA 4R40A 3ZDCA 1QTIA 3PHCA 1P60A 1AHIA 2V7QA 4YFYA 1WBDA 1WOMA 2CMFA 1GNTA 1YK0A 2FPLA 2XCQA 4O4JF 4OHPA 4ROSA 4OJNA 4KN8A 3H75A 1KMHA 5AUPB 3F7OA 4QAJA 3KTAB 3L0BA 3LCRA 2COKA 2JJQA 2FLKA 3OJEA 3OTQA 3E9ZA 1F8FA 2W37A 4INOA 4JB3A 5ALLA 721PA 3TTWA 2Q4TA 4B31A 4B3HA 4KU4A 3DCNA 4GGOA 4P9NA 2WHQA 4JX8A 4PTZA 5FPYA 4Z1MA 1MIOB 3OCWA 2RHJA 1PNRA 2BL4A 4KO4S 2ZITA 3VX3A 3B5IA 1NVMB 1N9KA 2ERYA 4MICA 3T3NA 2LRHA 4HAZA 3HTXA 1XHFA 2ERCA 2GEJA 4F06A 1B6TA 4PO8A 3VR5A 2QUJA 1R8QA 2JB9A 2CHUA 4JJAA 1FB5A 6REQA 3KSBC 1R9NA 2QT1A 5K99A 4DUGD 5BWCA 3PV0A 3JD1A 4QICA 3MS4A 1JJFA 4KR0A 2CXQA 4OI4A 1LUAA 4QHTA 2YFQA 3R09A 4N65A 1U3VA 2CJPA 4P3XA 3VUFA 1ZNQO 3ADPA 3I2HA 1IZZA 1ZN7A 1MR3F 4IJQA 1X0XA 5JWHA 4XWWA 1OV4A 2FSVA 1I3MA 4L0DA 3WKDA 3DHNA 4H7JA 2J67A 2C83A 1RMYA 2ZBFA 2PD6A 2O8CB 2RKBA 1FC0A 2X6RA 3MYYA 5YASA 3SJCA 1P29A 5G0WA 2PSHA 4A6PA 4BB5A 4YR9A 4HQOA 1AGNA 3QWBA 3CUKA 3OE7A 3OM9A 2NU9B 3S68A 3VU1A 3OLWA 4Q4AB 5JNTA 5EEGA 3GFFA 5KVVA 1I33A 4KIWA 4X7BA 3TTUA 3EFOA 1KMHB 2JFHA 2Q3MA 2QTGA 1QHEA 4GXRA 3IMEA 1NFFA 4M9XA 3B1JA 1CTQA 1PV2A 3RT1A 3OF3A 3ZOKA 4UHBA 1T3SA 1ZGAA 4D96A 1TM7E 4UBKA 3RV3A 4KGDA 1A8PA 5LQCA 1QC5A 4AVYA 1POXA 1S8FA 4LJLA 3QP9A 5KREA 2B37A 4CMEA 5KNDH 1E2DA 3PQ3A 4YRZA 1Z28A 4FQ5A 1RXWA 4NCJA 2XAAA 4LDZA 3KZ1E 4RD2A 2H9AA 5P21A 3W9SA 1FP2A 1U9IC 3A4LA 3CB4A 5CA0A 4XYBA 2YJNA 4RENA 4BRZA 4V0MA 2YHIA 1JTEA 5ERGB 2ZETA 2ATEA 4TZ0A 4KLCA 1B23P 3BK7A 1Y9DA 4BHTA 2GK4A 3RG2A 1UFKA 4GZ5A 3H5RA 4S35A 3R7NA 2HMTA 1XCOA 1H6CA 1JWBB 3L0DA 4G2TA 1F4LA 3E48A 2CJWA 1ZKMA 3ZZNA 1JHUA 3Q72A 4N49A 1Z6GA 4D74A 3HSYA 3IKJA 2Q5LA 5FF9A 1NL3A 4LZNA 2IEAA 3NAMA 2J87A 1H6DA 3ZKAA 1EHYA 2AXNA 3PFCA 3D4IA 3LDHA 1JEJA 3GEMA 2AFHA 2P6MA 4HH1A 4D4HA 3IE2A 1WDMA 1G7RA 3F90A 1NLMA 4D92A 1BXZA 4GM4A 1YZLA 3BSSA 3EFOB 4TQAA 4ON9A 3CRMA 3ZCPA 3P4UA 5L9AA 1SHTX 3WYEA 4URYR 3NORA 1KETA 1PEDA 2BFMA 1KYYA 5C8DA 3Q2IA 3WLQA 2P9GA 4TTJA 3KCQA 2DWQA 4EG3A 1QQBA 4N9WA 1IY1A 3PXCX 3ZLVA 3BEOA 1QX3A 1IN1A 3ZNQA 1GTVA 2Q9CA 5J2TF 4U8HA 2FSPA 2V9PA 2ZJYA 3FZGA 1QC5B 5K0BA 4IAOA 5KCMA 3WJAA 3FZQA 2XA9A 1R88A 3HJTA 3QYFA 5FT9A 3RKUA 1SURA 2VQ6A 3L9WA 3UA4A 3NDJA 2PD3A 3OKCA 4EYSA 2X8BA 3DCIA 2FFJA 5CA0B 1JQKA 1P17A 5L7WA 2YHIB 3LWZA 4EKYA 2IF2A 1L9KA 5F33A 2NTVA 2DAPA 1M8PA 1N78A 1VL8A 4MPJA 2R5NA 1D2AA 5E9AA 4WXHA 1EFUA 1OQAA 3QVSA 3U48A 4HV4A 4CDRA 2PWAA 2W6JD 4WZAA 3UJ8A 4ZKEA 5ALWA 4IYJA 1Y8RA 1XRRA 3BTVA 5IDYA 3VKFA 4II2A 1DC6A 1E98A 3HUDA 2J5RA 3FYSA 3RU9A 1WBJB 3OZGA 4GX0A 3KKNA 2YXEA 2PFSA 2AFHB 3G8BA 4E08A 4EPVA 3C1AA 1OA0A 2MMGA 4RMHA 1V8ZA 3TGWA 3I9OA 3VBEA 2PR2A 1A0OA 3P32A 2EGUA 3PWZA 2FEAA 1RWQA 3WSVA 5EC8A 2HGZA 4DRXA 1L8QA 1RPJA 2SNIE 4BTLA 3WV4A 4G4GA 1XTBA 1T10A 4LE1A 5BURA 2AE2A 4WV3A 3GHYA 4WADA 4RCVA 4HB3A 3LHFA 3NXKA 4IJMA 3ZV3A 1E2MA 5AD1A 3AF3A 2D5LA 4JJKA 1Z07A 2PG3A 5DXJA 4LOKA 5KNCD 1V3VA 1YR9A 4G5OA 2GBLC 2I4IA 2QTMA 2YMLA 3NASA 1E1LA 4JU9A 4ZZ0A 2P4QA 2HH9A 2VBFA 4EHJA 4CMAA 3KZVA 4XM1A 3DZIA 3W1WA 4KWHA 1E1CA 1AXRA 3KHUA 1ECPA 2ZSHA 4DLVA 1PHPA 1WQ3A 3KYIB 1RJ9A 2NTJA 3I6ZA 4MPDA 4ZZ2A 2ZRHA 3KSZO 5HDQA 1KJIA 3GK3A 3A6JA 4MW7A 4F2PA 4F6RA 3I4LA 1JEDA 2WU0A 2QSJA 3O90A 2FK7A 2G36A 4YFVA 4IUCS 1P72A 3KQMA 4N76A 2W2VA 3CUVA 3RTDA 1XPOA 1IOZA 1UMDA 2P5TB 3H4MA 3F96A 2Q4BA 2GN0A 3CZPA 4ZP1A 2WB2A 3EOAI 2H65A 4WZAB 1VCMA 2RHDA 4MVWA 4P08A 1RZRD 2IYZA 3K0CA 4KRXA 1Y8RB 2BI7A 5EAIA 2VJCA 3PS9A 2KYRA 2O8BA 3UKOA 2WV9A 4G1FA 5DP2A 3W34A 3NHWA 1NE2A 1QBKC 5IVPA 4AS1A 4B73A 2O19A 2JI8A 4UBIA 1NOIA 4C7OA 2V8OA 3FYUC 1YMVA 2N46A 4BQEA 3PPVA 4C7VA 2X15A 1NWHA 1YBHA 1SD2A 5CU7A 5SZHB 1XXHE 1T4MA 1EUDA 2H1CA 1EP2B 4AC9A 1PWHA 1ETUA 1SUDA 3QPWA 5FORA 1E7MA 3F7NA 2PJUA 4GOOD 5JTUA 1GFIA 2Z2YA 3AJ8A 4DKJA 3TEMA 2J3DA 1QWSA 2IGBA 2AKAB 2VYCA 3PUWA 4AL4A 3GMIA 4G4IA 1BS2A 1BWPA 1F1BA 1P2TA 3RIXA 2C4UA 5D00A 2QRNA 3WTBA 5I4KA 2CWDA 1BVHA 2DJ5A 2G67A 3PGKA 1DJPA 3B5JA 4NP6A 4KXQA 2A6PA 2ODWA 2PLFA 5HF8A 3T4PA 4B5KA 1E1CB 4RD1A 4P3KA 2W98A 4YIKA 3OJXA 1MMFB 1S3FA 2QG9A 1RJ9B 3AUSA 4PX3A 4QULA 1ICIA 4IINA 3UGTA 3UJAA 4E2XA 3TLXA 5LDHA 4F9FA 5JALA 1UC4B 2XF2A 4M9UA 4TRMA 5F73A 4F6RB 5LP6A 2BKUA 3LX5A 1NF9A 5KZMB 5M2QA 3I37X 1K7XB 4AI6A 3L7DA 4JT9A 1UZLA 4AN4A 3AW9A 2FZWA 1ZOPA 3BWVA 3LPLA 4GRIA 4I99A 3OQ1A 1MHTA 2O07A 3S6JA 3NNNA 4G3XA 1LI5A 4MVJH 4YQZA 2Z2KA 5JJCA 1QH8A 2O8BB 3DAYA 1XMJA 3K70C 2F8LA 3X1JA 4UNSA 1R1DA 2D2EA 3T7TA 4FW8A 3MCTA 3D54D 1MAUA 3DR3A 3D0RA 3FOAA 3OZTA 1PG0A 1UC9A 4C7OB 1PTJC 2KBFA 2FW1A 3DUWA 1NW8A 3R5FA 3RSSA 1NV9A 3HDGA 4HTAA 4RBNA 5DNEA 1VC2A 5DX8A 1J90A 1CWUA 1W96A 4FBMA 2QUIA 4BEVA 4YJHA 2IEDA 1OXVA 1Z4LA 1VG1A 3FCOA 1A9OA 3CWCA 3D6NB 3GYBA 2BHTA 4I46A 4RJIA 4WKBA 5AM4A 5ENVA 4YONB 2WF8A 2TMYA 1EUDB 3EIQA 1G42A 4KJXA 4ZV7A 2EF1A 2GF9A 3MMXA 4JB0A 3B3GA 4EJSA 5KNBH 2O8EA 4A0RA 1L5ZA 1K8YB 3K20A 2CLEB 1UXGA 4NEGA 2ZM5A 2A7XA 5U4QA 2R68A 1IJBA 3BXHA 4NDAA 3ZGYA 5G0VA 4F9EA 3AVWA 3RSHA 2QJWA 1RQPA 3ZUPA 5JROA 2FF5A 3CT6A 3PL5A 4DV5B 2C9MA 1G5RA 1H42A 3DWFA 5DHAA 2I71A 3DZBA 3EZNA 3A9SA 1JDBB 1VSTA 4AB1A 2UVDA 3OPMA 1U1DA 5CIQA 2HIAA 2OO3A 2G9UA 2A30A 2HA4A 1Y9EA 3TNFA 3VR1A 4U7FA 2LCIA 1GAWA 3KPWA 5BY2A 5JEEA 1BWQA 5LP6B 3TVDA 2O7VA 4WOPA 1A8HA 2BKVA 2OFPA 1ZM7A 1DHTA 1N9GA 5FLYA 1I4EB 1L7NA 2C07A 1NWCA 2FWAA 3ACDA 3IJRA 4P5EA 4D4LA 1U1EA 5B1SA 4CL2A 5B36A 4REMA 1CQXA 2H7VA 5JRDS 5K3DA 2B20A 3ABQB 4UPVA 1E0DA 3DLHA 1BWSA 4BYMA 4BDSA 3DKRA 3CPEA 3SJBA 1TM1E 1QH8B 4OMDA 3ICPA 4KKXB 4CDGA 2VYVA 1E0KA 2GN1A 4ZGWA 1KQGA 5IW8A 1GRNA 1ZC3A 3GT7A 4P7FA 4RHFA 4KBYA 2JLWA 4OUKX 2WUDA 3KBOA 5LL6P 5TPZD 3GD5A 2O0JA 4L5CA 3STTA 5CCDA 3G9UA 4DNOA 1NV8A 1I4WA 1KK3A 3QKRA 4YJHB 5IK2D 1WZUA 2GZAA 5IYZA 3QFSA 1QMGA 2HCRA 3R8CA 1ZJZA 2ONZA 3H11A 3ESQA 3IPLA 1RWKA 2P1DA 3KC2A 4XX1A 4MV6A 3V97A 1MAVA 1ECLA 1XBTA 1YVEI 4EJSB 1UDCA 2O8EB 1GPUA 4WPGA 2Z9DA 1JT9A 2B4AA 2CJXA 3HVKA 1BTOA 2R4QA 3VGPA 2Z8ZA 1IQPA 1JJVA 4G1EB 4A5OA 1XU9A 3DDSA 2O4CA 3HFRA 3LOUA 4E7PA 4PSAA 5DASA 1FJHA 5FTMA 1OFTA 1TTQB 3H8JA 4JZKA 2H1OA 4HWPA 4AZVA 3MMSA 4DLUA 3NHUA 1QHHB 2J7KA 3GLQA 5B53A 3L6BA 4AXXA 3BL6A 1NYRA 3G23A 3D59A 4YCDA 4ZEWA 3ONWA 4ENWA 1P3JA 2FLVA 3WLRA 1UFQA 5IT5A 4IGKA 2FETA 1N9GB 2GCIA 3EBPA 2Z08A 3P0IA 3UXMA 4BP9A 1V16A 2WJWA 2X4GA 2IKSA 4XARA 5LXTF 1W87A 3RR2A 4RVDA 1AT1A 2PSEA 1QKJA 1VL0A 1JKJA 3LZDA 2PU7A 3AGPA 2QD5A 4DL9A 3W2GA 1EK2A 4RTMA 4X63A 5B7PA 2OECA 4FM9A 1GYRA 3ZDQA 1Y3AA 2GBIA 2OEPA 1KJ8A 1SIOA 3EODA 2PANA 3USZA 4BX8A 5LMNB 2P91A 2L19A 4XEHA 1DAHA 2ZKLA 3TLJA 4FHEA 4RWZA 1BGWA 4RVFA 4YRCA 3DMYA 3IVRA 4FHGA 1A9SA 3CFYA 4IH1A 5D3KA 4BC1A 3QKRB 4HEA1 4ZVKA 4ZO8A 3JRWA 3UJPA 3BGSA 3QMVA 3HZOA 5B2FA 3PHJA 5IYZB 1KEKA 4GL2A 3H11B 4IIGA 2FP3A 3WK7A 5HZMA 1FMCA 2GYUA 1K6IA 4PZDA 4HAUA 1HNWB 3E9MA 1IZ8A 3OIWA 3ETJA 5FHQA 5LM3A 2CYCA 1R10A 2IH2A 2B1QA 2ZSAA 4BMOB 2AJCA 4ZD6A 3ROMA 1OFIA 1H2EA 2QY9A 1O6CA 3HRKA 4LMPA 4UHJA 3FYDA 5IBPA 4OX9Y 3ET4A 2I3GA 1BN6A 3TX6A 4NMMA 1Y5NA 5JY6A 2BGTA 3IDOA 4G9BA 4KO3S 2FJUA 1EK1A 3DV2A 1B6GA 4DY6A 4IWYA 1BGVA 1ZN9A 4PS1A 5PGMA 4P98A 3G7SA 3SICE 4BV9A 2JLXA 1SBHA 2W0MA 3GX1A 5KBYA 1M2VA 1OB5A 3ANLA 2FJ0A 3R3WA 3N0XA 4D43A 3EN0A 1NN0A 1NU8A 1SXHA 1FTNA 1V16B 3REFA 3JSAA 3LFUA 3QK7A 1DIRA 5DZSA 1J8DA 1OAKA 3QOYA 3QQPA 2H1HA 3N2LA 5DM1A 1JKJB 3MXOA 1RCTE 3JWHA 2Z4TA 4ZZ1A 3UWMA 1CIPA 4ZEVA 1OFGA 2DB3A 2PRIA 2PNJA 2EFYA 4F4FA 1G19A 3BWCA 3U4MA 3IIJA 3LS2A 3QE3A 4D56A 2GM4A 1V8PA 2WF7A 4HD8A 1DHRA 3S28A 2OSVA 4QGGA 4P2GA 5DNCA 5IKXA 1XNGA 2Q6TA 2C57A 3C3CA 5REQA 5EXDA 2I8LA 3KJFA 3ORQA 3AF6A 2D06A 3IDFA 4YBRA 3TQQA 1GTL1 2XTAA 1CR6A 2XHEA 3P9CA 4MO9A 4DWJA 4TVSA 3I9MA 4J6EA 5IAOA 4PYRA 2TMGA 3TUZC 5F12A 4TMKA 5EKXA 4KO8A 1YQGA 5JSYA 1HE4A 4B3IA 5C7OO 2NSLA 2Q8QA 4N0DA 2HU8A 3BWEA 3U9TA 4CMGA 1XWFA 3SX4A 3F3KA 2YWFA 4W9NA 1DTWB 2FN8A 1O6GA 3TOVA 4CCYA 2QT9A 4JODA 1X2EA 1SUAA 3UUWA 2QG4A 1KZGB 2DKFA 4U00A 4F96A 2AF4C 4B6SA 2DFTA 2A7QA 4ARAA 3FZYA 2YJ6A 1TMYA 4PF1A 3HA3A 4RM2A 5ALRA 1PS9A 2V6JA 4Q7KA 4ER7A 4HDMA 2FCRA 1SXJE 2FQXA 2WTNA 4H3HB 2UXBB 4RU1A 1HDRA 4JXJA 4JSTA 2WZDA 3HJRA 1EVZA 1A7JA 4F45A 3PE3A 2ZANA 3FPJA 1TUGA 4DCUA 2X77A 2KMLA 1DU4A 3OX1A 4PHGA 1H4SA 2YC2C 4QVIA 3RABA 3P5SA 4BNFA 5B1YA 1LEHA 3Q1LA 4AD8A 2WPDA 5KQGA 1LVGA 1MH9A 2Y6UA 4A92A 3TQCA 4DXAA 4ZT4A 5IAKA 3RSZA 1U28A 2AX3A 4RS4A 4UNNA 1JQ3A 5EEHA 4MCAA 3AP1A 3ELBA 3FBTA 4MQ5A 4QTZA 4R8MA 3QG5A 2RBEA 1VZ2A 1X1DA 3ZX5A 1B76A 4M99A 2JI9A 5IKPA 1QV6A 3S55A 2Q5OA 1AU9A 5REQB 1PWZA 5BNTA 2OILA 3T3GA 1HOTA 2XPCA 3EGCA 1MX3A 4DG5A 5A4AA 4LRWA 3OMLA 3UT0A 4P54A 3DFUA 2GCNA 4AY6A 1QO0A 3MTDA 5BW6B 2QD2A 2YNMA 6NULA 5JSKA 2FWJA 5TGDA 4U2CA 4X66B 4F2GA 7GPBA 3R3JA 3AY6A 1Z6AA 4ALNA 4LKOA 1ULSA 3VSAA 4CCYB 3L6RA 1G5TA 1XTIA 2ZB8A 3BH6A 4BRSA 1J9EA 4AF8A 3ZXXA 1U9ZA 1ZXBA 1EHIA 1H8EA 5FBKA 3VXKA 4LVCA 1DADA 2Q1WA 3PD1A 3QYJA 5FBRB 4E3ZA 2XYQA 4HDMB 5IFKA 2OORA 3R24A 1A5AB 4UZSA 1NLYA 4HH0A 2WM9B 1IVYA 3F5FA 3IP9A 4OH7A 3QWHA 1SUEA 4KGZA 2EFDB 4LZOA 4EG4A 4Q12A 4I14A 4DV1B 4M1ZA 4PCVA 4PWZA 1G8HA 4L6AA 2XMSA 4A0SA 4BVEA 4ALLA 3AB3A 5KQLA 4JCOA 3RK1A 5DX0A 3WRVA 1LF5A 4L4SA 1DUVG 5AVKA 5EJ7A 1IWOA 4DOMA 1S8NA 2IYWA 4V0RA 2PMEA 3PJFA 2EDCA 2N1BA 4M7WA 3W9YA 4BEWA 1ZD2P 4UMFA 5T6BA 1C41A 2H9YA 3PD7A 1E1KA 2I2AA 1ORRA 1OFUA 2JVKA 2BEWA 3CIFA 3DW3X 4MKRA 1ZWKA 4WK0B 3WHPA 1CUFA 1KSHA 2PE5A 2HBQA 3K6RA 3ND8A 2GKSA 1TADA 1PG5A 4BP1A 3I2GA 3JS5A 1LB1B 2Z0MA 1Q0UA 2QTZA 2ZT7A 3RJ9A 1A1SA 3KYCA 3SZOA 4MHSA 4QU5A 1WVGA 4RC9A 2C5EA 2RARA 1C7QA 1H8HA 2BFNA 4PGGA 4TM8A 4EBBA 3I1FA 2OV4A 3L1IA 3CCCA 3SHOA 1AZTA 2VH1A 2PX8A 3DPUA 3VR3A 5T4HA 5J3JA 1KO5A 5H5JA 1WHSA 2HFJA 5ESWA 3AZQA 5LLSA 3F71A 3M33A 4HXGA 2I33A 4XLTA 3BA6A 4N82A 4UDXX 4DLKA 2Z5VA 3CF4G 1RAFA 1XAHA 2C7GA 4G84A 4BIMA 3SQWA 3FSGA 1FOEB 3QWAA 3O1IC 4E88A 5FOQA 1U04A 1BHJA 2HEIA 3TQRA 5CDHA 1JAZA 2VWQA 2E5FA 1D2EA 3OZDA 3WLKX 5I7WA 2RGGA 1D6NA 4HFMA 5KQRA 4LGMA 4KZKA 1XZFA 2WIFA 1E1DA 1HNNA 4D4MA 4RHXA 3G9TA 1EB8A 3CPJB 5DX1A 1RQ2A 5EZSA 1TI7A 4PHCA 4R6XA 5EJGA 5BSWA 5I7FA 2FRDC 3G82C 3PRJA 4JU8A 4PAMA 3SF0A 3QE0A 2JGLA 3W4KA 1P3Y1 1Z35A 4R51A 4P34A 4X6XA 5I9BA 2DR0A 2V1XA 1T4GA 2EX1A 1MJ5A 3SBXA 4BO0A 4EHKA 1Q0TA 2BFCA 5AHRA 3D3QA 5COQA 5I45A 1XPRA 3EASA 2QRMA 3Q40A 1ZR2A 2BEWB 2Q2QA 1XGKA 2ADFA 2WVGA 1ZX1A 1JIJA 1O6FA 3MWJA 1VBMA 5EERA 3THRA 4CLXA 2FUEA 1J0AA 3GRAA 2R8XA 2F8TA 1ZPDA 3KYCB 2POCA 1VE9A 3CRZA 1TEXA 3P2YA 1BDIA 4ZIRA 4YJFA 4QDJA 4DC0A 4DHEA 3GFBA 3U61B 8ABPA 2GQ0A 1G98A 1JIVA 5HUQA 2W0SA 3E81A 2P40A 2Q4OA 3VOAA 2H18A 5J63A 2RGNA 2BMFA 2VXCA 3BIXA 5BN3B 4XQ0A 1LJLA 3BD7A 2JLCA 1WHSB 3OF2A 5F9HA 1NG9A 2DERA 1EFKA 2GESA 1II8A 4RPLA 4D7AA 4PN3A 3V1LA 1J2UA 2NQ2C 3F8TA 5G1OA 4C5AA 1L7RA 2FEPA 5MDHA 3D6AA 1QP8A 2D5BA 2YH2A 5AW7A 1OXSC 4LECA 1BROA 1BMDA 3RS2A 1U3FA 3G2NA 4HP8A 3DGEC 4RF3A 4DLXA 1AKMA 4ILEA 5BNIA 2E1RA 3DE4X 3K0EA 1YUNA 2G9VA 1P0IA 4M0PA 2ONKA 4ZREA 4JI8B 1NW7A 1YCDA 3HB4X 5CT5A 3ZWCA 4B74A 1WW8A 2OHVA 4DYDA 4NCKA 4PFKA 4RUKA 1RTKA 3G2PA 4CGYA 5KOYA 3HB9A 3K30A 4Y0NA 4LC0A 4IHJA 4FCTA 4FYPA 3VO1A 4AS2A 3SHWA 3ICVA 1VL6A 2B4QA 2C82A 5KJFA 2ACWA 2YIDA 5E95A 4F5ZA 5GVSA 1SXIA 3D64A 2O7QA 4YAEA 4JHXA 2BFCB 1PFYA 1W6UA 3TZ6A 4R01A 4EJ0A 4MDEA 2O1EA 1E2UA 2YJTD 4LVNA 3ZH2A 2EJUA 1ODLA 1C8VB 1Q7CA 2YWJA 3IUPA 2YR0A 3QUAA 2R6DA 4PYMA 1LVHA