4WSOA

X-ray crystal structure of a nicotinate nucleotide adenylyltransferase from burkholderia thailandensis bound to nad
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
227
structure length
227
Chain Sequence
b'LPALPRRIGILGGTFDPIHDGHLALARRFADVLRLTELVLMPAGQPYQKQDVSAAEHRLAMTRAAAGSLVLPGVAVSVATDEIEHAGPTYTVETLERWRERLGADASLSLLIGADQLVRLDTWRDWRRLFDFAHVCAATRPGFDFAAASPAVAAEIASRQASADVLRATPAGRLLIDTTLALDVAATDIRAHLRACIARHAQVPDASAEHVSPAVWAYILQHRLYHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title X-ray crystal structure of a nicotinate nucleotide adenylyltransferase from Burkholderia thailandensis bound to NAD
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 77
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4wsoA00
1OWOA 3DLAA 1JIKA 1WXHA 3IMGA 3TS1A 4TS1A 1Q15A 4ARIA 1N2OA 3F3MA 2A88A 3IOCA 1OWPA 4MW1A 3TNJA 1KR2A 4MVYA 4EF6A 3FG9A 3P52A 3SYTA 3VRHA 1M8PA 3DO8A 2C5SA 4MW9A 2YWBA 2CV0A 4ZT6A 4YP5A 5K0SA 4FZJA 1N2HA 2A1TS 1ULHA 1Q77A 4CDMA 2DUMA 2JA2A 2E18A 1SURA 1TYAE 1TYCA 4EG5A 1U0BB 3UOWA 4L2IB 1GPMA 3DPIA 4DLPA 1K92A 1OBCA 1P7PA 3KT6A 3ZGZA 3AKZA 1T9GS 3HFJA 2A7XA 3Q10A 5LLTA 1I6MA 3DV2A 2X3FA 4ZT3A 4MW5A 3IOEA 3IUBA 1M8JA 1I6LA 1Y42X 3L92A 1EUQA 1U3DA 2D13A 2DPLA 2CYAA 2DERA 3SZGA 2YWCA 1TYBE 2D5BA 2QTRA 1O96B 1JMVA 4AS1A 1EFPB 2A4MA 1KKUA 1PFUA 4HJXA 2E0IA 3VGJA 3FETA 3A4IA 5LM3A 3RK1A 1GN8A 4KR7A 2A84A 2QUIA 4QREA 2NSYA 4R0NA 1NYLA 4F4HA 5HUHA 4JXZA 1A8HA 3AG5A 4HK4A 1HYBA 2PZBA 2JANA 4GU5A 3LOQA 4K0RA 1WOYA 1OWNA 4WNYA 1N3LA 4ZCSA 3IUEA 4KR9A 3GMIA 1ZJWA 4G5YA 1IQUA 2Z08A 2G36A 2XRZA 1EFVA 3HMQA 4OUDA 1KP2A 1WXFA 3CLTC 3IMEA 1PFVA 3PNBA 5KCMA 1FFYA 2WB2A 5EKDA 1WXEA 3NV7A 3S3TA 1QU2A 4I6EA 2ZUFA 4AQ7A 4KR6A 4DDKA 1H3EA 4X0EA 5H16A 1K4MA 2XRYA 4L2IA 1XNJA 2WQ6A 4MUFA 3ZXSA 1N1DA 1IQ0A 1O94D 1WQ3A 3HZRA 3KFLA 1T6XA 4H3SA 4JXXA 2IELA 3AIIA 3IOBA 3FOCA 4KKVA 3X1KA 1WXIA 1JECA 1QRTA 4S1OA 3P0HA 2Z3VA 3NBKA 1U3CA 2CSXA 3CLSD 3ZJUA 4NDAA 3LE8A 3N2YA 4E1AA 2PIDA 4KPUB 1RQGA 2CYCA 4MW2A 4ND6A 1COZA 1LW7A 2OV4A 2ZP1A 3N9IA 1O96A 2A1UB 4NAUA 3LCJA 3H9CA 4R2LA 1IQRA 5LFAA 1JEEA 4MUEA 1J1UA 1OBHA 2HMAA 2TS1A 1EE1A 4BWVA 1QQTA 3Q12A 4I6JA 4WSOA 2JAXA 2DLCX 3ILVA 4QBTA 5KWVA 4UZFA 3CA8A 3ZXIA 4MW7A 3FH0A 2A86A 5HUJA 2E89A 4I6GA 4ND7A 2EJCA 1F4LA 1GTSA 3UC5A 1T6ZA 4PBSA 2CFOA 4J76A 2IP1A 5IHXA 1JIIA 3UMVA 1EFVB 4OUDB 2V0GA 3FDXA 1PFWA 3ZIUA 1MAUA 1NZJA 1ZH6A 1NUQA 3COVA 2BTEA 1PFYA 1KAQA 1GAXA 3U1VA 1MOPA 1N2IA 1VBMA 3FI0A 1KH1A 1O97C 2B7LA 4YP6A 3PRHA 3ZUGA 2CV2A 1NUUA 3HL4A 5J58A 1N2GA 1MC1A 1MBZA 2PZ8A 3TZEA 1EJ2A 4G6ZA 4ZT2A 1NSYA 5DEOA 1LI5A 2R5WA 5DK4A 1JGTA 1JIJA 1QNFA 3ND7A 1JEDA 4MAFA 4RUKA 2PFSA 2J07A 1M8KA 3ZJVA 1F7UA 3KT3A 1YUNA 5H7XA 1GZUA 3CVUA 3KT0A 1O97D 1G8FA 1MB2A 1BS2A 5TEVA 4EFKA 4KPUA 2J09A 1IRXA 4EG6A 5BNZA 1WJGA 1H3NA 4NAHA 4CT0A 1M8GA 2A1UA 1Q19A 1O0BA 3NBAA 2CT8A 4ZT5A 2H29A 3CLUD 4NZPA 4DE5A 1KH3A 2WQ7A 1JHDA 1JZSA 3JXEA 1G8GA 3SEQA 1IFXA 5FNZA 2AKEA 1MAWA 3ND5A 1TEZA 4MW4A 4NATA 1G8HA 4QRDA 2VTBB 3COZA 3CVYA 3AL0C 1OD6A 1YUMA 3COWA 1J70A 1O94C 3P0IA 4PY2A 1V8FA 1O0CA 4PBRA 1I6KA 5IJXA 3N05A 1LI7A 1R6TA 3CLSC 3OTWA 1O95D 1DNPA 4U7JA 1QRSA 3HV0A 4G5FA 3K9WA 1M83A 1U7XA 2Z09A 3X1MA 1N77A 3ZJTA 3CVXA 2OQ2A 1QU3A 2GM3A 4EG4A 4MWDA 2EL7A 4MUGA 3G5AA 1YIAA 1YI8A 3H99A 4DDMA 1MRZA 3A05A 4YP7A 1H3FA 1R6UA 3RFFA 3IH5A 4RPIA 2CYBA 3FY4A 4JFAA 3CLRD 5JBNA 1N2BA 1NI5A 1NUSA 4U8HA 2CV1A 3L93A 3TZLA 1GTRA 1KQNA 3FHJA 1Q11A 2I1LA 2BYTA 1XNHA 2ZUEA 1VBKA 2QUJA 1QJCA 3CVWA 3MXTA 4MW0A 1J20A 1ZH0A 2DEUA 3MLBA 3CVVA 4ZCQA 3IMCA 4XFJA 2O8VA 1T6YA 4MWEA 2J08A 2HGZA 2QTNA 4ZT4A 5J5AA 1YULA 2VTBA 5DB4A 4ZCRA 4MQ6A 3H05A 2RD2A 3HGMA 3RK0A 3SEZA 1EXDA 2AG6A 4J75A 2E21A 1N2JA 1O5TA 1KQPA 2IJGX 4OJMX 3K32A 5AHWA 1UFVA 1WZ2A 3I05A 3ELBA 3IVCA 4ARCA 1N2EA 1K4KA 2QJOA 3G59A 1F7VA 4MUJA 5FO0A 4HJRA 3QTTA 5KHAA 3VU8A 4MULA 4YBRA 2X1MA 3UK2A 2QJTA 4Q16A 3FIUA 1NURA 1VLHA 1WKBA 3TQOA 1NP7A 4EGAA 4DJAA 2RE8A 1OWLA 3COYA 5K0TA 2WSIA 4HPWA 5DASA 2H2AA 2YXNA 3PNYA 4MUNA 3E27A 3D6VA 4XSVA 3CLUC 2NZ2A 3MLAA 2AZXA 4CDNA 1VL2A 1IVSA 2D54A 1F9AA 2QTMA 3PNVA 1WY5A 1XJQA 3C8ZA 1I2DA 4DDHA 2PG3A 4JYZA 4JZYA 1M8FA 3P0JA 3N8HA 3IDFA 1MJHA 2VXOA 3M5WA 3H9BA 1JILA 3PXUA 3ND6A 4EG3A 1N75A 4EG8A 4MVWA 1CT9A 4XFDA 4CQNA 1KH2A 1MB9A 1TFUA 2J5BA 1IH8A 4MVCA 1O95C 2YY5A 1ZUNA 1KQOA 4P2BA 5HG0A 4NX2A 3TQIA 3AFHA 1X6VA 2O5RA 5F23A 3GUZA 1K97A 4MVXA 1GLNA 3A2KA 1O6BA 1ILEA 2CUZA 4K03A 3Q4GA 3X1JA 1YIDA 3SP1A 2X0KA 2X1LA 1PG2A 1J21A 4UZEA 2GKSA 1D2RA 1V47A 2QUKA 2QJFA 1J09A 1QTQA 4ZCPA 5J59A 1XNGA 3IVGA 4Q93A 4YMIA 3CLRC 3ISJA 1WQ4A 1N78A 4GRIA 4R2MA 2A1TR 1FYDA 1TQ8A 4A91A 1G59A 3UY4A 3CR8A 4ZCTA 4F3RA 3D6UA 4DNXA 2GOYA 1KP3A 5TEWA 4MWBA 4U63A 1WXGA 3SZ3A 1B6TA 2PZAA 3A04A 4PBTA 3QE4A 1VBNA 3OP1A 3IVXA 2V0CA 1R6XA 4MW6A 1KAMA 1JZQA 1TYDE 1T9GR 1EUYA 2PXHA 3RJZA 3BL5A 3FNRA 1H1TA 4MUHA 1X8XA 1QRUA 3G6KA 3RBAA 3FWKA 3CLTD 1PG0A 4ZT7A 1KORA 1OWMA 1U7DA 3H97A 3INNA 2DR2A 3MUEA 4MUKA 2QUHA 3SDBA 3KT8A 4MWCA 2DXIA 5TGTA 2DETA 1J1ZA 2J4DA 5TS2A 1M1ZA 3QTBA 4MLPA 1IHOA 3GLVA 4MUIA 4EG1A 4EG7A 3RHSA 1EFPA 1NUPA 1S4MA 3IODA 5FO1A 3MMXA 3AG6A 1NUTA 2HZ7A
chains in the Genus database with same CATH superfamily
3EBPA 2DLDA 2NVOA 1VGRA 4H3VA 4UHJA 1WZCA 4XGQA 2W2MA 5TPWA 4BNTA 10MHA 1P74A 2QMHA 3NFRA 1FFEA 4HYQA 4LMAA 5A5EA 3BSYA 4F4UA 4J1SA 4A2PA 4TTJA 1QFJA 2P6RA 1OFUX 1RHRA 4JP8A 2CLHB 1CUVA 1VA4A 4MW1A 2B25A 1KR2A 1LS6A 2HBYA 3PDJA 3U3RA 2FZWA 1F51E 1KDRA 2YZGA 5FPSA 5HKBA 4ZVMA 2IIPA 3C6BA 1I3CA 3FZYA 3L05A 2XB4A 1FNMA 1TO6A 2B1GA 3AF2A 2VPXA 2Q4EA 3E8XA 3QLVA 5GONB 3ZU4A 5JBQA 2CV0A 4EHIA 2QN3A 2CXUA 2JATA 2SNIE 2IH5A 2HO4A 2A1TS 1TA9A 3BCUA 3DMYA 2OBLA 3OICA 4BFUA 4ZK6A 4FN4A 4HXFB 3ZS9A 1DKPA 5CDFA 3HLTA 2W71A 2P3LA 1JQDA 3BGWA 4PINA 2GNPA 4D5EA 1R4NA 1GPLA 1A4RA 1QE5A 1EX1A 2OO3A 4U6SA 5G41A 4KQHA 4UATA 4P3KA 1BE6A 1I5EA 2DUUA 2HRCA 1U9IC 1ML3A 2WVHA 3I9KA 3L7OA 3JQGA 2AOVA 1WUJS 1I6MA 1N6RA 4XLTA 2C4KA 2H9IA 3VU9A 3KQLA 1AE1A 3PT9A 1TEXA 4ZYLA 1FFAA 2PT5A 1HA3A 1L4HA 2G17A 2EIXA 4JBYA 4L8FA 4LJRA 3IKVA 4M76B 1D1SA 4HDQB 3DL7A 2JBAA 4CVNA 1BU8A 1E7SA 3SQNA 2D6FA 1YUBA 2YWEA 2UZ0A 2H11A 1S9DA 1NA5A 2QP9X 1QWOA 1E3TA 1OU4A 1S2IA 3GOHA 3MINA 4ND5A 3OX1A 4FI3F 2ZJAA 2Y05A 1KKUA 3KYJB 3ETNA 2CJWB 2ZYGA 3L49A 4P58A 4TMYA 4CIWA 3AJAA 4E51A 4DDUA 4TX1A 1PGNA 4LG1A 4LNAA 1FBNA 4UU0A 5FR2A 2AMLA 2AYZA 1UBNA 3A4IA 1IK4A 1YSCA 2X2PA 3LP8A 3MWLA 4QG3A 2ZT5A 4I1UA 1F14A 2IYFA 3OU6A 3FN4A 3THWB 1NVEA 4LZOA 4LXIA 3ZD6A 3AILA 4LOAA 4TYNA 1N6LA 2YW2A 3PVSA 2C5LA 6Q21A 1Z5GA 1B6SA 2Q5HA 4OHKA 3UAYA 5KOIA 5AW1A 4G0QA 5LU9A 2VATA 3D4BA 4M86A 3MOIA 1E61A 4EJ0A 4B7XA 3FMVA 4Q82A 4Y98A 4BIMA 2ZJZA 5HQ3A 1E7MA 2OV3A 3AYXB 1M6VA 1YKFA 2GCEA 4RVGA 2ECFA 2VSOA 1XRJA 4WNYA 3J7TA 3M82A 2TMDA 1A82A 3OZRA 4REQA 3UXMA 4YP0A 2G77B 1U7WA 1E5TA 2FFAA 5JJLA 2QTZA 4I14A 3CLTC 2ECPA 5JCPA 4GWKA 3EQ9A 3ZDQA 4FYJA 2H00A 2JI7A 5EJ8A 2NO9A 1V8ZA 2E5FA 2QQFA 4LGCA 2ZPAA 5FADA 3RABA 1P5HA 3UV3A 2LBPA 3C2QA 3QMVA 4Y9DA 5KYXA 2QZ9A 1BXGA 3BGOS 5E6SA 3CKYA 1WAMA 4DDKA 2W48A 2M6RA 3HFGA 5H16A 1K4MA 1P9NA 1Q0RA 1Q7TA 4CL2A 2W43A 1IM5A 3OUUA 1WQ3A 1R8YA 1FA9A 5CB4B 5DGHA 1X8JA 2J3LA 3NJ4A 1M54A 2P9HA 3WIDA 3FOCA 5DSXA 1JXOA 1KU6A 5KU7A 4LIPD 4CWAA 1I1QB 3R9XA 1KSHA 1VQ1A 3DXFA 3DZGA 3HSYA 3V55A 3NBKA 4M9SA 2W0SA 1XXLA 3MPUA 4NE2A 3U3OA 4D79A 3COJA 3WL5A 1PR5A 2REBA 2YC4C 3R6LA 3I2KA 1WB9A 2ZE5A 2GF0A 3K8ZA 1NKTA 5D3KA 1KOJA 4DQXA 1YR6A 4X7MA 4MGEA 3SJ7A 5DULA 1NAIA 4UVDA 5L95A 7AT1A 2G1PA 5JHGB 1OLUB 4FDAA 4L74A 1Y5MA 5COQA 1TUIA 3FVRA 3TLGA 4CQMB 1JKFA 4H08A 1XI2A 5HR5A 4C2UA 5ECWA 4DN6A 1DDIA 1U9YA 3B12A 3H5NA 1X14A 2HMAA 3AEYA 4IRXA 4EB3A 4WADA 1VSTA 1X9HA 2IDKA 3HXPA 3Q40A 3JD2A 5AOBA 2F55A 1Z73A 2ODWA 5CXUA 1K6XA 1O9HA 2PUWA 1OAKA 3BOSA 3D8UA 1ZZEA 3H1FA 4J7CA 1I7SB 2IT1A 5A7FA 1RBZA 1WLYA 1C8LA 2YDXA 4B4UA 4YXWD 4XCQA 2VHCA 5L3VA 3DCIA 3KRTA 3KKZA 3T7RA 1G7SA 1FFCA 1GQ2A 1HYHA 1FFBA 1JR3D 3DEHA 3KBBA 4O6VA 5DBIA 4CCYB 1GPH1 4GMKA 1J9GA 1CE8A 2WTMA 4I4TB 4RESA 4J49A 1NQWA 3TB6A 4DBLC 2JFPA 3VUFA 5J4VA 1Q57A 3F5QA 2FE4A 3DP7A 4KGXA 1WSAA 1Y7IA 1W4LA 2A14A 4Q7LA 3NYIA 3JQAD 5FTWA 1XE3A 3I3SR 2FQXA 1B1CA 1TMOA 3PWSA 5ULLA 2X15A 2IYTA 4QNMA 4LNUB 1A97A 1CUFA 1K8QA 2ZITA 3B6ZA 5DSZA 4ZT2A 2CEKA 3RVOA 3WISA 4CKEB 5H8WA 4AZTA 5EOVA 1GCGA 1X1BA 2VDOB 2XKAA 5DK4A 3OE7D 3Q3CA 4CW7A 4DCMA 5B7GA 2JVKA 4WW0A 1RI4A 5FV7A 4CKBA 4YV1A 4H4CA 1C7RA 3H9UA 1XG5A 2J07A 2NXCA 2F3UA 4HQKA 3O5AA 4MV3A 1GZUA 4MVJM 1DARA 3H2KA 1TXGA 1SCUA 1DL5A 2D5AA 4HEA1 5D01A 1OJLA 3B20A 1U3GA 2A94A 4UXHA 4KPUA 5CB6A 5JSKA 4A15A 1VJTA 5B1HA 1U2TA 3B13B 4E4TA 3MA0A 5JRJA 1FZQA 1U9ZA 2Y4OA 1IZ7A 3AUAA 3DHEA 3GOQA 1VMDA 2CNOA 2EKBA 2ZYTX 4R3UC 4OA5A 5SYNA 2ZATA 3GNTA 4DQDA 1IE3A 3STYA 4NDZA 2Q0HA 1NNI1 3FCCA 2BFDB 3PQ5A 5KSPA 3CLUD 2JCYA 1K63A 2XY4A 3KKKA 1JE1A 1U0HC 3GEDA 4KWCA 3GAZA 5TVGA 3WHIA 1EXWA 1JZSA 3AIKA 2I2XB 3PGKA 4LS3A 1WVGA 2YIDA 3PUVA 3CNEA 2WSBA 4ENPA 2J8ZA 3MGAA 3ND5A 2FVYA 1V9SA 1E6EA 1O9GA 3C98A 1X0XA 1N1GA 5E9WA 3ZEAA 1JPUA 4D4HA 1MX3A 2BRUA 2XIJA 1Q91A 2DWOA 4K1LA 1CJUC 2MYNA 3B9RA 3CXRA 3FUCA 2FJ0A 1LV7A 1UJNA 2AHRA 4WHMA 5BUQA 1J70A 2Z83A 3SFVA 4TKVA 4K6GA 5DU2A 2OUIA 3NYWA 1HZJA 3ILHA 2BDTA 5DCYA 2Q45A 3GRKA 3K0HA 2O0KA 1QH1A 1S2LA 1KJIA 1AGNA 2MSDB 2O52A 4YCBA 3EQ7A 1Y4ZA 3VVCA 4CM1A 1JFFA 1S9HA 5IJXA 1KMMA 3GHHA 3MERA 3PXAA 2VR1A 1ZMXA 2EBWA 2LW7A 4J0IA 5KHLB 5BW4A 1R6TA 4X1YB 3GGJA 2O7SA 2XE6A 4H31A 3RAPR 5B1SA 3K0AA 1L7MA 3ZV5A 3IO3A 1ZBQA 4KAAA 3JVDA 1M73E 2J87A 2QV7A 3WO0A 4UARA 2VCYA 3ESAA 4B3RB 1X7HA 2BLNA 3WWZA 3TQQA 4F1JA 1DX9A 1MLDA 2O20A 3BHMA 3DOUA 4FHEA 4XDHA 2Q2WA 2DFPA 2PO5A 5U4XA 5IBQA 3RHTA 1SK9A 1NSFA 3AI1A 2W6OA 2YN2A 4Z1MA 4AJOA 2SECE 4L6IA 2W8BA 4HVAA 3HBFA 4KW7A 3QFRA 3EBOA 5E1DA 5BR1A 2H06A 5EERA 3FD8A 4YCJA 2NQ8A 2JKYA 4DA8A 3U44B 4FKBA 4IS3A 1EU1A 4INOA 4CI9A 3G6WA 1B23P 3BHJA 4OHFA 1OKKA 4X71A 1CXZA 3U13A 3HB1A 4DFDA 4NV3A 4RIIA 4RMIA 3INGA 1BKYA 1R9NA 2GD1O 4W5JA 2GLUA 3CV3A 3FY4A 3U49A 2FOLA 3CUWA 3JASA 1C0LA 2ARKA 3PC7A 4E6PA 4OHYA 2VP9A 3AY6A 1NI5A 3E22A 4P53A 4BKOA 4C4PA 2WK1A 2XUJA 4QT0A 3MQFA 2ONCA 4Y1FA 1UT8A 3BULA 3FOFC 2PX4A 2PX0A 3AU8A 4HBGA 1JB1A 5TE9A 4B0OA 4DPLA 4PCUA 2O1XA 1GUZA 4BQOA 4KRYA 1D7AA 2IP4A 4JS0A 3V7WA 4DIOA 1T3TA 1OLXA 2DFNA 2VYND 2I33A 3CB4A 4KK4A 1GV1A 1L5SA 4FGZA 5BW6B 2C7QA 3NXKA 1SXJD 1H23A 2C94A 1D09A 1Z29A 4P4TA 2FWBA 3EMKA 4C89A 3ENWA 4YAKA 3NWBA 5F1OA 2QTNA 5UKDA 1E2LA 4F4JA 1ST3A 5KOJB 4WZZA 5LQRA 2ZG6A 3HKBA 2HH9A 5A9SA 4LGVA 2VNSA 4DXAA 3H05A 2V59A 3HXQA 3RS4A 2QTBA 1F0NA 3HGMA 5EHIA 5KOHA 1YQUA 3FTCA 1KSGA 3WICA 3PDWA 4C6RA 3FCYA 1KQPA 1PV1A 1VBFA 3IQZA 1IB0A 3MMNA 3OI7A 2OZKA 4W7IA 4U9HS 1XHLA 4FLFA 1NRJB 3QVLA 3FOEC 2JI4A 4PC1A 5IZCA 4ARCA 2VHUA 4ZIRA 2YXDA 5LZ5A 1JU4A 4BVJA 4QTZA 2X1MA 3RS9A 4BJHB 3IAHA 2QJRA 4AKEA 4JKIA 4QGGA 2AFIB 2OP1A 3M4XA 3K1ZA 3F97A 3O8DA 3RF6A 3KKEA 5DASA 3O4JA 1XVUA 4KWHA 2VNKA 1T26A 1XNQB 1OPRA 2QL7A 4CYMA 1SVIA 1GUFA 4DTCA 3EFOB 2RSLA 3CB2A 3H18A 2FSIA 5DOZA 4B2YA 1FYXA 4RY2A 1UC9A 2IQ5A 4BRUA 2GO7A 2IS6A 1HMYA 1AX9A 1ZNWA 1AGPA 3A4MA 1AT1A 1UODA 1UPAA 2MHCA 4MB0A 3EXIA 4GL2A 3TZBA 3EXFB 3HCPA 2HY7A 4N8DA 2G9NA 3EZGA 5K4HA 5F9HA 4X66B 4RIGA 2C29D 2V6GA 3I34X 3P0JA 4AG5A 4ZTZB 3JAWA 2EG9A 2X86A 3LFUA 3M5PA 2QIOA 4RX1A 2XDQA 4UFNA 4BYGA 1AQIA 4FS8A 1ZJ5A 1Z68A 2CD7A 2N46A 4RSHA 4U2KA 1YJ8A 1BWSA 2CVOA 2O1WA 1W93A 1EGAA 2BR5A 3HR7A 1VDZA 2JIZA 1NHWA 3A0UA 4M8KA 1SRQA 3AY7A 5ALJA 5JAZA 3JZIA 1G8JA 5KNDH 2C3MA 5DXAA 5I9TA 3VUEA 3ZLJA 2AMFA 4YWHA 5F7XA 2Y2VA 5CCEA 5HVNA 1XQWA 1XRPA 2X5JO 1SC6A 1JG2A 4NF2A 3VA7A 1E2NA 4RSMA 4LFCB 3GUZA 1K97A 4JSTA 3QKSB 3AWDA 521PA 4DRXB 1UJ5A 2P4UA 1ZIOA 1A9RA 1R8JA 1XMSA 2Q5OA 1G8YA 3C87A 1MQ9A 1DB3A 4CMJA 3KVYA 4U7DA 4MEBA 3SP1A 2ZI9A 4PLGA 3G2OA 1NLZA 3ROPA 1UMDB 2XVAA 3UHJA 3IXMA 3MWKA 2VNIA 3JQ6A 3ZGLA 4NULA 3V8NA 1Z16A 4CR6A 1HI9A 5AKZA 5KWSA 4EY3A 1AKTA 1KOFA 4OLFA 1HNNA 5TT1A 1T6BY 3HN7A 5DZSA 3SJBA 4R0MA 5AP9A 1NKVA 5B6JA 1H5UA 3CT6A 3ZQUA 3ONWA 1ZQ1A 2AQKA 2CB0A 2R6ZA 2YDYA 3DOIA 1CQJB 1M66A 1UH5A 1YDFA 3MILA 4KQGA 3R5TA 1LUAA 4DMRA 2EQ5A 5PGMA 4RXUA 4R5MA 1W0KA 5DH9A 5JUWA 2AW5A 1E3IA 3MTBA 4G65A 2BZ0A 2PH5A 2HSGA 3P45A 1V16B 3VU3A 4Q12A 1NVKA 3O8OA 4MIOA 5CPFA 1T0UA 1Y8RA 2MINA 4UEKA 1EFRA 3ONFA 4V2IA 2JD0A 1FFDA 3PCTA 1SJ9A 1U0TA 4IDPA 4TMZA 4WKNA 1GDHA 2XUAA 4GLJA 3QE4A 1P7YA 3HV2A 4EA6A 3R8CA 4KH0A 1NU8A 5K2OA 1T9GR 3OKAA 2BFBB 3JWHA 5GGXA 1YRWA 2XOKD 3LNCA 4JJZA 5IT5A 2HREA 2NTYC 1SPXA 2QGNA 2AEMA 4B33A 3M2TA 3OC0A 3ICEA 1HYEA 1XHEA 4TT8A 1GKUB 1W88B 2X4LA 5CR9A 1L7QA 4C0KA 1OH8A 1T2AA 4MUJA 3V4LA 3SDBA 2ZEJA 3DWGA 4R84A 5IDYA 5DTEA 3PQEA 5FBVB 3MCAA 4XQEA 1T5BA 5H5JA 1K4YA 2ZVQX 4MCHA 4PIPA 4ZJZA 1B0PA 3LY9A 4C22A 3U3ZA 1P80A 1R4MA 1DQPA 3C3JA 3ZC3A 3OF2A 4E08A 3CUYA 3IP9A 2R6DA 1NR7A 2JHFA 1CG6A 5A2QA 4Q9DA 3EGXA 3U3XA 4CV1A 4EHLA 1D6JA 1ISFA 4CBVA 1G20B 3JRXA 5K6TA 1XAHA 3NOVA 3QIAA 1N0HA 1KJZA 4UQPA 3TG8A 1Q0TA 1Q15A 4Y0AA 1GKYA 3BJMA 3FCXA 3IJEB 2FWAA 4CM8B 3K0CA 4NMWA 4U2BA 3W78A 4ZHQF 5GAJA 4LMPA 5CP8A 1E9AA 4N7MA 5HILA 1V6SA 1G2PA 3JZMA 1KMCA 1VLJA 4KVAA 1LDYA 2ESRA 2P9CA 3VU0A 2IZOA 3JVUA 3RS0A 1TZKA 3SMVA 4AWBA 1U3TA 3IQWA 3P52A 4RJLA 4AKSA 5ICMA 1SBZA 4LE1A 4RVSA 1O8BA 1JW9B 2VXYA 3FCEA 2YWBA 2G08A 2CKMA 4OP1A 1N5IA 1U98A 1KKLA 3E9ZA 3E3LA 3JR3A 2NVBA 8ABPA 1ZX1A 4G5GA 4GS5A 4FZJA 4MTCA 3NH6A 2FSHA 5KQLA 4O4JB 3WLJA 4FKMA 1Y3FE 2X19A 3LL4A 4JP2A 3HCOA 1WP9A 4JYMA 4ZPXA 4Q4JB 2LUOA 2C9YA 4DC1A 5FX2A 2NZ8A 2WFZA 3FKQA 1AUOA 4QFMA 2NVUA 3RWBA 4E12A 1E4OA 1W9HA 2CLIB 1DZ3A 1VRVA 1XJCA 3OTGA 4J2OA 3WL8A 3E7DA 5IF9A 4US1R 1JR3E 4ZOQI 3HHEA 2MYTA 3BRWA 4BX8A 3M81A 4Q3CA 5FJJA 1P6XA 1QGOA 4JL5A 1XKXA 3JQ9A 3RAGA 5KTYA 3G1TA 3VR4A 4LYDA 4QVGA 4KR0A 2OYRA 3Q10A 1KOLA 4JSRA 1PR2A 3KU1A 1PBTA 3WKDA 3HJFA 1EUDB 2L19A 3IOEA 3NDIA 3I09A 3SC6A 5I9MA 1DG9A 3OCXA 1WCYA 3FFWA 1BXRA 3QU4A 1W2GA 3IE0A 1U3DA 4G1EB 4AKGA 2B7BA 1W5FA 2XUGA 3DLPX 1UBGA 2FLVA 4MO9A 2R4UA 1V9CA 5BN5B 2W6PA 4CCAA 2CMHA 1E4EB 2ZRJA 1O96B 3I58A 3SX4A 2A2ZA 1EE9A 5D6OA 1XA3A 1YZVA 3IOYA 3GDHA 1GTL1 2BHLA 1U0EA 5AYVA 4AJNA 3ZHUA 4CM3A 1ZOIA 3A1TA 3UMMA 1SKAA 3LW7A 3FZQA 3SJAA 1MENA 3U3DA 1YQQA 3F96A 4HLQB 4ND3A 1XTBA 2A84A 2OVFA 5CEEA 1K6IA 1QGDA 3PHHA 2B4YA 1QG0A 4L4XA 3CVOA 4JQOA 1NYLA 5F78A 5HOEA 1MMFB 2PRSA 3S70A 4RMGA 2C77A 2WJWA 3ZHZA 1H94A 3FAKA 3PC2A 5MN6A 4YJHB 3EC2A 2X0DA 3LI2A 2JANA 3GA5A 3KCQA 9ABPA 3FIJA 3ZLBA 1Q6ZA 1UPBA 2GTHA 3FFBA 1M33A 1H85A 3FUWA 4YJ3B 4I7EA 4Q03A 4UTNA 1XFDA 2C2XA 1LD3A 2GILA 2G36A 3OPQA 2PANA 3IAS6 3SIWA 2C88A 4OB8A 1Q6YA 3P27A 5A0FA 1U2GA 1VE9A 3OQVA 2IUYA 3RQIA 4BTLA 1YVUA 2VUIB 4NFYA 5DCWA 7REQB 5DNDA 4MMZB 5B12A 3DBVO 4NCNA 3EF1A 3G13A 4INJA 1VJDA 2NU9A 4DLKA 2AXEA 5BXQC 2QM8A 1NY5A 4B34A 1QZXA 1O2DA 2ASVA 3OUZA 1YB7A 2H7CA 2QTHA 4GOLD 4QM7A 4JB8A 2CNDA 3HO1A 3KFLA 1S8AA 3AHDA 4OPMA 1CEEA 3IDZA 3A3PA 2GGSA 2H7YA 2RHMA 3GA7A 4GOND 1P2TA 1ZXBA 3NTUA 2PT9A 5CX1A 2OGWA 3ELYA 4BLTA 4ND2A 1CUJA 2CHGA 3EDOA 3S5UA 3RAEC 1DCMA 1USVA 3MOGA 5TQ2B 1H1LA 1KO5A 1UFKA 5BVHB 3OIDA 2CYCA 1HDIA 3E3AA 2Y93A 3I5UA 3KAJA 4DT1A 3SDZA 3IUYA 4FFOA 1GPWB 4F84A 1C9MA 2OBFA 5H3CA 2DRIA 3NORA 3K09C 1Z18A 1H66A 2PZGA 4LVCA 1Z3CA 5JI2E 5FNVA 2HDHA 1NM5A 2K7FA 4B6SA 1WA5A 1BRTA 1Z6GA 2G0NA 1QPZA 2F1KA 3DZJA 3K4QA 3DKRA 1MFZA 5JE8A 3UAGA 1H4SA 2XUQA 3GPDG 1OBHA 4F85A 3M4ZA 1XZHA 3EOZA 1DC7A 1NVFA 3RFTA 1F8UA 1NFFA 1Z47A 3A70A 3C5CA 1N36B 4EPRA 4L75A 4F9GA 1K75A 1C2YA 1ODSA 4V0ME 1OXSC 4OVKA 5T5QA 3WA7A 4WKPA 1JDNA 1LF5A 4PLVA 4YUZA 4XRRA 2JLUA 1EEXB 3VOAA 1C0IA 2VQDA 1C41A 1O5IA 3R74A 4C7BA 1AK9A 2O2HA 1P6QA 2QDXA 1V5GA 4ITRC 4OP3A 5T6MA 4DR4B 2IS1A 4WJZA 2AE1A 2PQ6A 2VYFA 2WU3A 3TZCA 3IBFA 4KSBA 4PLTA 2AR9A 5LU8A 5DYYA 2FPGB 3DT8A 1OGYA 1OGJA 4MPRA 4PQGA 4Q66C 2QRKA 3GDOA 1XEXA 2B8WA 3N8DA 1PJBA 3P9RA 1CF4A 1E0KA 3H04A 2CXHA 4BNGA 2ZRFA 3ZKAA 3OA0A 2A57A 5HYVA 3H5WA 3KQTA 2BM1A 4G8JA 1VBMA 1ZVJA 3MD0A 2JLXA 1YJCA 4QM6A 4ZVUA 2TRSB 2VH1A 3MAJA 4JGIA 1MX9A 4PM4A 4RF3A 3C3BA 5ESDA 2CLMB 1MB0A 3KJIA 1B0AA 1MC1A 1MJFA 4NL4H 1I2ZA 5KI6A 3HK2A 3U1TA 2CJPA 1W49A 4UAJA 1W0CA 4I1VA 4Y18A 5AW2A 5AVJA 5IULC 3FGPA 2B3TA 2HDNB 2XPCA 4O1MA 4ZRMA 4KEAA 3ICOA 3W90A 3ZX4A 2RHHA 3HU5A 4R3NA 2QV0A 3N07A 5HX7A 1JEYB 1Z4OA 4KV9A 1RP7A 3UAXA 1H9CA 1RJ9A 3GNLA 2GNAA 1FXWF 3F67A 4H3HB 3NIDB 2O4CA 4UDOA 5KNCA 1CDDA 3QXJA 1HFKA 1NF8A 4HKTA 3LX4A 1AGYA 5FWYA 1IDOA 2WRZA 2PWYA 5D1NA 4U2GA 5G0WA 1PJZA 4HFJA 2XWSA 4PCVA 3LUKA 2D2XA 2GD0A 3DMTA 3LQ2A 3PFNA 3Q7QA 3BD9A 4NEQA 4B0PA 3PQ8A 4BBPA 4NP6A 5DYIA 3MJCA 1Q19A 2GBGA 2ZSJA 4YRMA 2Z5GA 5I9LA 3LVFO 2Q49A 2RJOA 2O2GA 3NDPA 4Y2QA 2H29A 2I4NA 4JXKA 2RFLA 1X80B 3ICPA 1U81A 2C9CA 4GNKA 1IVNA 5JWOA 1SBIA 2RI0A 3IALA 5CA1B 3NHYA 1SOAA 3CKKA 2JJ8A 4L3VA 1FE8A 1DTWA 3GJXC 4R6WA 1VSQA 4IHJB 1XZFA 5AT1A 5C35A 3LPLA 2ZUWA 4DSZA 1OMOA 1G17A 1QOQB 3TTUA 3Q15C 4PSVA 3P9SA 3ZXYA 2PUAA 4O5OA 1ILWA 3BORA 5DM4A 1XC7A 3AB3A 2CF5A 3LQKA 4WOBA 5C4MA 5CFMA 1F2UB 3ZK8A 2ATIA 2O1EA 2I7VA 4WKCA 4ENVA 2H4YA 2PFGA 2ISSD 2JGRA 3ETCA 4ZKDA 2FWIA 3FPCA 2ZYHA 4HRYA 2A67A 3L7DA 5JJBA 5DM0A 2C4UA 2V5UA 3VPXA 2QRQA 1A8PA 4OM7A 2B94A 4R01A 1T1GA 1ODLA 4HRXA 1YCDA 3L02A 1X42A 4F12A 5B1IA 1W34A 3G9TA 1Z4IA 1MH9A 2HSWA 2G9ZA 2YBDA 1Z0JA 1V1MA 3HB5X 5BOVA 3UMFA 3SF8A 4IX9A 4KQMA 4CMAA 3H9QA 1JDBB 1QM5A 3DA8A 4ZU1X 4AF8A 2VA8A 3C8MA 5IJ0A 4XVQA 4DB2A 1AH2A 4AZ0B 1K5DA 4TS4A 4QO8A 3HE3A 1R27A 1UXOA 1E63A 1YJBA 3Q3IA 3KPVA 4MV0A 2HK7A 3E9CA 4KAXA 1TVMA 1IPFA 3OLXA 3WIOA 4BTVA 3MWGA 3KTAB 5C1OA 3U09A 2YRWA 1FFWA 1XZDA 4QDKA 1X77A 2ONYA 5DT9A 4ETMA 4B6OA 2FN9A 3W0LB 3GDFA 2ZI3A 1R6UA 2VRCA 3L3BA 3A1WA 2FX2A 5EINA 4Q9IA 4DOMA 1D4OA 3SGLA 3OEED 3DLHA 1WV1A 1JA0A 1FL9A 2FW7A 2JH3A 3LFTA 5AUPB 1DWUA 1DWPA 4JC4A 2WKWA 4WUTA 2FFBA 4B7UA 2XNSA 1DUIA 1N5MA 5BNTA 4NECA 2A3RA 2PUVA 3EVAA 1UBJS 4HGOA 5DM60 1N5OX 2Q2OA 5FTJA 3KSBC 2HFKA 3MXTA 2DF8A 1QH8B 4WVFA 1RKUA 4ML3A 4WWHA 1QGAA 2VJNA 4KDFA 5ES4B 1N2ZA 1CR4A 3BCSA 1VCOA 2J08A 3R23A 3JATA 4IF6A 1I7PA 2VTBA 4CMCA 1H2XA 4LAFA 3L4SO 4MQ6A 5HMMA 5J1TB 4AO7A 2QIPA 1AS2A 1U7OA 3UEOA 2EVWX 4XYMA 3WAKA 3SF0A 4K6KA 9MHTA 3DOEA 1L5FA 3D5TA 4A3SA 1IZZA 2RH4A 4GEKA 5L6MB 1EX9A 1JI0A 5AOVA 4JI8B 3LDFA 1NXVA 4C4AA 4PHHA 1OTHA 5ALOA 2NV6A 1PK9A 2IC5A 4MULA 4XSHA 2MMCA 3RR2A 1WETA 2FLKA 3K05A 1OFUA 2GN9A 4LDRA 3UJAA 4UPEA 2JBWA 1LPNA 3L40A 3H8VA 1CJBA 2PR7A 3TQSA 5ICSA 1MZPA 1XTIA 4LPSA 5FB3A 2YFYA 3RW9A 1XDGA 1YE3A 2H08A 1BHJA 1E18A 5CYPA 3RASA 1X74A 2ENUA 2XD4A 2RE8A 5LQKA 2YICA 4YAIA 3H2ZA 4JEUA 3EZYA 4PYKA 1GEEA 1WU7A 2B1RA 2H2AA 3HM9A 1P4SA 2P7HA 1PJCA 4QXQA 5HRCA 4FWTA 4MVJE 3AETA 4P7KA 3WP1B 1YZGA 5EXDA 4QO7A 1BOFA 3OTQA 1XHFA 1OH6A 1F9AA 4JT2A 1PWZA 5FFFA 1BMDA 2YRXA 1GPDG 1JXAA 4GXNA 1A7UA 3PPIA 8GPBA 5LOVA 1LPSA 1YVEI 4RCVA 4HNTA 2H4ZA 1YCFA 4U6NA 1T3SA 1IBCA 2QGFA 4MHOA 4LA4A 1JHUA 3QZUA 2WF5A 3PHBE 3SM9A 1P1RA 3DOCA 1MVNA 4NR0A 2NO0A 2WV7A 1C3VA 3PNQA 2Y1KA 3S8YA 4WBNB 1E2EA 1WS6A 5CUQA 1IATA 3HY3A 2FLWA 4DSNA 1ST2A 2YNMC 5EXEA 3DZKA 3BCRA 3L8FA 3AQIA 4PNHA 2J4FA 3RJ9A 2VSXA 4HZGA 1ULBA 3OJFA 1XZEA 3K94A 4KOEC 1CUIA 1Y7PA 3HPQA 3OSUA 4MP6A 4PHTA 3KLNA 8AT1A 4NX2A 2WFMA 3GR6A 3A7EA 3LP5A 2I3AA 5F1YA 1R5NA 4WXHA 4E15A 4F21A 2P62A 3I32A 3MGGA 2N9UA 3PEYA 2WF6A 2B5OA 3E23A 1XZMA 4ALMA 5F7JA 4H7FA 3VTKA 1O6FA 4AZ3A 1VG9B 2QT1A 4C3VA 3VR1A 5HKKD 4PO1A 3UYKA 2X6QA 2HWWA 1DT3A 2HQRA 2FWJA 2JJQA 1LK7A 3G82C 2JIRA 4RPCA 2EEZA 2GKSA 2AG1A 2H59A 2HJWA 2YV4A 3WQHA 4A8JB 5E2IA 3SK0A 2GD6A 3N7TA 5CVCA 1ZKDA 3LCCA 4IXWA 5CVEA 1A98A 2GSDA 2G8NA 4H60A 1EVYA 1XEAA 1YASA 3Q0IA 1JWLA 5AWFC 1KVUA 5K8LA 5D87A 2FGKA 3E03A 3GRVA 3GUYA 3K6SA 2AVDA 3GX1A 1BRMA 4XB6B 4J07A 2XXJA 1D1TA 4J3JA 2VRBA 1V3UA 5TS3A 2XTJA 3SFZA 3FPSA 2R1VB 2V0NA 3FCOA 1ZH8A 2DBYA 3IB3A 2X0JA 2QLBA 5KWEA 1KY5A 1HEUA 2R8YA 1SUCA 4FMCF 2XCTB 4RJ2A 1F38A 2LNDA 1RJEA 3PFKA 1N0VC 1T1EA 1VL5A 1YRYE 4OB7A 4DA6A 2IZ7A 3ZI4A 5IYZB 1JXQA 1V3TA 1KPIA 5BV1A 4UPDA 3KD3A 5ILGA 3WK5A 2H18A 4AVYA 1GY8A 1GU1A 1UOOA 3MJFA 1FU8A 5F98A 3ZVRA 3O83A 4M7RA 4PYRA 2W42A 5CD9A 1NULA 3IVXA 3R0QA 4NNJA 4B3GA 1IN4A 4WEOA 1CQPA 4L72A 3FNRA 4ER6A 1TEHA 3GFOA 5JSQA 2BTQB 2DU8A 2GKOA 4PRYA 3G6KA 2QYHA 1PT8A 3OWOA 4R98A 1PDOA 4XDYA 5D8DA 4MQ4A 4BUZA 5EJ4A 3H97A 4BLSA 2Z6AA 1FDUA 2F9MA 2QVLA 1Q14A 2YVUA 3A3YA 4AXBA 3G9XA 3MTDA 2X5OA 4L5CA 4CF6A 4ZYTA 1N9GB 4P08A 3O92A 1M1XB 5FBKA 2FUNB 3SEAA 4DV7B 1DXYA 2ACKA 3L07A 4YV0A 5AOCA 3VC1A 3BDAA 3GLVA 3M83A 3CPEA 3JQ8A 3ADCA 4O2LA 1E1RA 4WAUA 2OMKA 2C2HA 1EVZA 1FQOA 4G56A 4G97A 4M2LA 2BFWA 4MINA 4MQFA 1RW4A 4NMLA 4R5HA 4PPGA 5E8JA 2R44A 4AAYA 4DXHA 4OI0A 4WD3A 2F8LA 2OZEA 2OV1A 4WMLA 2JGNA 1JSXA 1B3RA 1ISPA 3F3MA 3H5TA 3ED5A 4Y3UA 1IEWA 2ORVA 2IXDA 1ISJA 1TFRA 3M6MD 5DTQA 4I55F 4RZXA 9ATCA 1OOEA 3QLTA 4MVYA 4EF6A 3I5AA 1D4FA 1TW3A 1UWLA 1G5FA 5LQMA 3RSHA 1O89A 3UTDA 5AXBA 3B70A 1ECBA 2IEYA 1B00A 1KARA 5TLSA 3HYRA 4X64B 3DUFB 1P1BA 4S1WA 3LA6A 5CURA 1YHZA 4PGFA 3QYJA 2ID9A 4R8LA 3KSZO 1X15A 4XIGS 1T8PA 4G8BA 4H1UA 4D98A 3L43A 1Z4JA 2FW0A 4JA0A 1LFDB 1FK8A 4B74A 5JAIA 2A9VA 5KSYA 3HDYA 4XTCS 2UV8A 1MEEA 4BCDA 3WIEA 3H83A 4HDNA 1TYAE 2JFUA 2X8LA 4YJ2B 5KJEA 1SO8A 1WMAA 1YKSA 5EIEA 4FFBA 3UICA 2O3UA 5LKAA 4IL5A 4NICA 1D04A 1DAKA 4RE6A 3RV3A 1WDMA 1LBQA 1KEKA 3UNXA 4B5LA 1KI9A 4LN1A 3KT6A 3D7RA 4XPIA 5L3QA 2ZUVA 2H5LA 1PZEA 2W93A 4G41A 1A9ZA 4EA7A 1XNRB 4MA5A 5EWJB 2D5IA 5CLLA 3ZHXA 3KQHA 4I8DA 1KYXA 4ZT3A 2H4XA 5BWLA 5FI0B 1WVMA 1WULS 5ERYA 4W5OA 4N4AA 3DKKA 5ALFA 1XTVA 1TAGA 4UEQA 3ZV7A 1KS2A 1Z7BA 3W04A 3NWEA 3W2HA 5ALMA 3KVVA 1T0JB 4N3NA 3TSOA 3GDGA 1A5SB 3V3TA 4BNIA 4DA4A 2ZWIA 2JFWA 4DS3A 4BL5A 1KIMA 4B4WA 4MR7B 2AXQA 3B6EA 4CQLB 3I01A 2YHIA 3LSTA 2OOSA 5AM5A 4JCOA 1A5ZA 4QXRA 3SBEA 1YVPA 3FTFA 1PFUA 1ETUA 3DL2A 1YZNA 3A6JA 4P36A 4TS3A 3KYCB 2O7NA 3NBUA 4UM5A 2W37A 2GPJA 1TF7A 4C78A 5J2TF 3PJFA 5AHOA 4KR7A 4L6AA 1ZXLA 2H63A 2HIAA 4F2PA 5ECDA 4KXQA 2AR7A 2I4LA 2AK3A 3NDJA 5A9RA 1TTTA 4ZV7A 2EZTA 4B8WA 4F6LA 4CTKA 2A9QA 2R48A 3PC6A 3USES 3NXSA 1HSZA 4ALLA 3L9WA 4TLAA 3ZNQA 1FBTA 4JIGA 4KFCA 4B3XA 1D07A 1J0DA 3KPWA 4IJUA 4KQWA 4PE5B 5FOXA 4PFSA 1JHZA 2R1ZA 1G20E 1U7PA 1GQQA 3DE3X 1QCZA 1DG3A 3IUEA 3O4IA 5LP6B 3B85A 3L0PA 2GEBA 3GJ5A 3Q85A 3O91A 2IEBA 1QC5A 2YJ6A 3NVAA 1IBKB 2D0OB 5KCMA 3D8NA 5BSHA 4PPQA 5JATA 2PUHA 3RS2A 4DCUA 3RFVA 1I9GA 3DONA 1W5BA 3GLIA 4NBKA 1Q17A 2GZMA 1QU2A 2UZ4A 5HJ2A 2QBYB 2IEDA 3OCZA 2QYTA 1UJBA 3I73A 1KS9A 2RGNC 3ZWBA 1TT5A 2VHQA 1KQFA 4FONA 4IGFA 2HMYB 4TMKA 4RGBA 1IBSA 1MC4A 1N57A 4M0LA 4MRRA 3CURA 4F0JA 5C7OO 1T3LA 1Q50A 3A6FA 4DV4B 1YIOA 3AOGA 3JYNA 2IELA 4PSDA 3RSLA 1DV2A 1AQ6A 5ALRA 1YBHA 2ZRAA 1JFLA 2J45A 2VJDA 4BVBA 1I32A 1XZJA 1CS0A 4LX0A 5CW1A 4WQMA 2OGZA 2V45A 3B52X 3R20A 4JBIA 1M6YA 3R3XA 3UMRA 1VL8A 4DG5A 3ITNA 4POAA 2KBEA 4F56A 1M0WA 4AG6A 2OFWA 4OKIA 3OQOA 4Q1VA 5EIHA 2BFEB 3TDMA 4RZSA 3CJTA 1UXGA 4DWJA 1RHKA 2IKQA 1L8AA 2OC9A 1KAGA 1VE7A 3K0FA 1M2OB 4R2LA 4DUGA 3I8XA 2WMOB 3FCAA 3QFTA 3AGPA 3UYLA 4A6DA 1FFGA 1FYEA 1MTOA 2A1IA 4FEGA 1GVHA 3GCXA 1SULA 3WOVA 1GAJA 4CLOA 5ADHA 5C8ZA 1ECJA 1WOMA 2J5KA 4P4SB 4TTTS 5E3JA 4CEIA 1RAHA 3NI2A 1US8B 5JDCC 1B8UA 3X2FA 2EX0A 3BX1A 5CNIA 3BJZA 4PG6A 4IWYA 2E89A 4IMPA 2CFTA 3B6KA 3U19A 3BJEA 5EQFA 1Q7CA 2XKBA 4OQLA 4Q4LA 3U0VA 2YKGA 3H2IA 1T2FA 3QFFA 4J76A 3WLEA 2DB3A 3E61A 4NARA 1M1YA 1ZH4A 4I99A 2XE8A 1EQ2A 5JRZA 3VDQA 3HKDA 2PV7A 3N3AC 1CSEE 1AKQA 2PTHA 1L7RA 3STUA 1RQNA 4DR3B 3L8ZA 4G26A 4W5RA 2UZ3A 3PQ2A 4C6TB 1N33B 1NY6A 3P5SA 1JHRA 1E9DA 1RI5A 3EZ6A 4JB0A 3E1SA 1VIDA 3DMPA 1L5VA 4MQUA 4OSOA 5AXCA 3NM5A 3PRHA 3RBVA 5CFPA 1WCIA 1RRKA 3AFGA 1M5RA 2J9FA 1K88A 3GARA 3GXBA 4I0WB 4UE3S 5KTRA 4YRBA 2R5FA 3HJGA 1GUDA 4FNAA 4I2VA 1OC4A 4TM7A 3R3WA 4U7WA 4O1HA 4D9NA 5C46F 3VTZA 1QE0A 1H2YA 1NBME 1PL8A 3IQIX 3O4GA 5B3JA 1F0KA 4BNDB 4HC4A 4MGYR 1BA2A 2ZSAA 3LLUA 3ILYA 2J6HA 2P2NA 1JAYA 2VP3A 1V41E 3WP0A 3KUXA 3WLSA 4DSOA 4KHPB 3KT3A 1CDZA 3R0XA 3Q0TA 4D9MA 2DR0A 1XRMA 3OA2A 3PLNA 2OCAA 1Z36A 2D59A 2JH9A 3AY3A 3NJ8A 4L0CA 4NV1A 4EZBA 1R88A 4RLSA 1O1YA 4Y1EA 5TEVA 5LDHA 1G8KA 3BDIA 3BIXA 4X6LA 3KKNA 3K9QO 4ID3A 2WYOA 1CR0A 5LA6A 5CCBA 4YCDA 2CDRA 4YROA 2WUFA 3ZQ4A 1TUEA 3RT1A 1O0BA 4DR7B 2Y71A 2OPBA 3AHIA 2EX4A 3LHKA 1SXQA 1MAHA 2GPSA 2B21A 2XODA 3TIIA 3I28A 2WAAA 1H2EA 3KB8A 1JYSA 1TW2A 4LW8A 5IH3A 1TL7C 1UXIA 2GZDA 4G01B 1SBTA 2IYSA 3UHOA 4AZSA 2E82A 3ZCQA 1ZM7A 2G40A 3O8CA 1GLGA 1ZG3A 1NJ2A 2A9RA 1G8GA 2C1ZA 2C8JA 2ZDQA 4PNPA 1LTKA 5EUCA 1YA4A 4LK2A 1FLAA 4L3OA 3I2FA 3GLUA 3O84A 4HDKA 3QUTA 4NFSA 1H6DA 1IN5A 1ZI9A 3HSKA 1DUSA 3MCZA 3DNMA 3EHDA 3NKLA 4J0KA 4PONA 5DT2A 1XQXA 3ABIA 3LTNC 1D03A 1LDMA 3K9NA 2FF7A 2XMGA 4RIHA 2JJ1D 1WSDA 1SHJA 3NP7A 1TOAA 4HAUA 4I50F 4W8HA 3RVQA 3UH0A 4Q3OA 4RK6A 3LZDA 3GFGA 4IUBS 1R16A 1KFCB 1ZA1A 1POXA 4CL0A 1XD2A 1KJ9A 1SY7A 3AQ4A 4NG5A 4FVTA 4DMCA 4W5QA 1YCHA 1YRAA 4AM8A 3OZ7A 3BN3A 1A4UA 4D8VA 4EUNA 1E3EA 5L8VA 4PV7A 1VSUA 2P3QA 3D3JA 2CSUA 3EISA 1DNPA 4WERA 4WXRA 3TSWA 4D8WA 3HP7A 4HB0A 3PPXA 3ILSA 3PR3A 1PSWA 2RHRA 5A3QA 4MKRA 3D3WB 4YV2A 5KEIA 1HYQA 1VCHA 3NAQA 4P4LA 1P1HA 5TSDA 2CB9A 2Q1WA 3KB2A 4Q4DA 1K9VF 3QVXA 5E6RA 4DJTA 5BNWA 5K05A 3WK7A 1QQ6A 4JLWA 5LQDA 3IR5A 1ZMTA 5KVSA 5CFLA 2WYUA 2PWAA 4RS4A 1NVWQ 3RUAA 2P9BA 3IBGA 4TLLB 5KYGA 5CB4F 1ZN2A 4G4JA 3NUZA 4UUBA 1ZFNA 4MDHA 4Q9NA 3KAQA 5IKEA 5AM1A 1E9BA 5L40A 3R9WA 2XUPA 2D2EA 3TRDA 1PVDA 1Z5NA 1XPJA 2HA6A 3LQQA 4HMQA 3BL6A 4KLZA 4NHOA 3FHOA 4MKZA 3R5SA 4EUHA 4PZDA 1UEIA 2EYUA 3B89A 4IXMA 4RENA 3NM4A 1EM6A 3WO1A 3BZUA 2GN0A 2XCOA 1QFZA 4KN6A 1FJGB 4C7KA 2G6BA 2PL1A 4MDEA 1A95A 3LK7A 2WU1A 4E5UA 1P7CA 1TT7A 3UG7A 1F2DA 5KKAA 3VMFA 1TA0A 3K92A 1I0IA 4JI4B 2QX9A 4ISCA 3IQDB 3GWZA 2X23A 4DCOA 2QUJA 1J8QA 3LD9A 4FFWA 2AOUA 1ZH0A 1NBAA 4IIJB 1NW5A 5FL3A 1SU8A 1EBUA 4G09A 3HCWA 5BPHA 4TZKA 3LY8A 3D6MA 1VPVA 2MU1A 3I1IA 4EKDA 5EXPA 4W1SA 2XKKA 5BV2P 5J5AA 2ZIAA 5B64A 4LUCA 3W8FA 3N74A 4I9FA 1JDBC 4N39A 1O5OA 3DDWA 2JVIA 2AIRA 3SKYA 4P93A 2G09A 4B3SB 3RVNA 4WZBA 2OCKA 3G5MA 1PT7A 1N2JA 2AOTA 3ICQB 2Q3FA 4OXXA 3ZE8A 2XOEA 3C15C 3BRSA 4C21A 2Y9MB 1U0JA 3Q87B 5FBRB 1WZ2A 3SS9X 4D26A 4M0UA 5JWHA 1UC4B 3IVCA 3F6BX 3G59A 4HUTA 3BB4A 1E66A 3IBTA 5DN6D 3TIGA 3R6WA 1YVRA 4MGHA 3VU8A 4DM7A 4LZNA 4NCXA 4XEHA 1V2HE 3EG9B 1HOTA 1HMPA 2Q6LA 3O31A 5DW0A 4AJ1A 3HKEA 4HWRA 4FM9A 4HRVA 5I7VA 1NP7A 2ZW9A 4TWJA 2NP7A 4KSYA 1WHTB 1I4EB 2SKDA 5HIIA 1QYWA 1NLUA 1P6UA 4HPWA 4WLNA 4RXMA 2JFHA 4TKUB 4LKRA 1J33A 5KYUA 2ZKLA 5A3JA 3E27A 3INTA 1LTQA 3O2SB 1TTPB 2AMJA 2DT5A 2RMKA 3MLAA 3CBQA 2WIDA 4Y6GB 5ER6A 3JYLA 4WLOA 4NBVA 1UZAA 1RYYA 4O33A 3C45A 5ALNA 5KMGB 2FP3A 2WWGA 4CETA 3MUOA 4UDXX 3WLMA 1N6KA 1I4DD 1UKZA 3OIFA 1FU4A 4ICIA 1DCKA 5K51A 5G3ZA 3VBCA 3DMGA 1AU9A 4W1QA 1HRKA 5IUNC 3U9SA 4LOJA 4M8NE 2YX1A 1SBCA 2ZYSA 3HYLA 4TL9A 4TRRA 5E2BA 3BMCB 3MAGA 4ERNA 5LA6B 4LV8B 3V2GA 3GPCA 1TB4A 4NFHA 3WGUA 5DFAA 2FUKA 4ZVPA 2QW8A 5DM2A 5C4GB 1STOA 1Y5RA 2GZ2A 2VBIA 4AKIA 5K5EA 2OYSA 4QIHA 4WK4B 5SV2A 3VR6A 4DYDA 1HPLA 3QLUC 1HORA 1ZUNA 3LC1O 4II7A 2FY8A 4E3WA 4G9EA 5KOYA 1KR5A 2CMGA 3ANYB 3GVIA 3H17A 4OXNA 4AIRA 4AROA 5KJ1A 2OHGA 1N7HA 3CH7A 4LMBA 3OCWA 4YP9A 3M9LA 1LLDA 2FG5A 1ILEA 1QIGA 1W4ZA 1B2LA 3NVKI 4FQ7A 1UBOS 2H7XA 4GNRA 4ZHQA 5KQPA 2F00A 2QAJA 1WW8A 3PD1A 1N8SA 4WIAA 2O3RA 5J2UF 1RM3A 3JARB 4EGFA 5CEFA 2PH3A 4DJ5X 1R00A 2O14A 1RAAA 2H0AA 5C8YA 2KM1A 1OYYA 4Y1GA 1CUHA 1EDEA 2XEDA 4ZCPA 3VC7A 3HBMA 4B3BA 4MVJF 3EVTA 3CRQA 3G9ZA 3B3GA 5ALDA 4S05A 1SKYE 4DAOA 1FVFA 3HVKA 4BMPB 3CLRC 1WCWA 1Y3CE 2Y6UA 2R9VA 3AIMA 1N5DA 1DO0A 3VX4A 1YB4A 2WC1A 4IJKA 1E9SA 1PR9A 2CHEA 3IRVA 1JIQA 4MPPA 4QPNA 4E5DA 1A9TA 1DG1G 1XRLA 1R5BA 3U56A 3ADPA 2A1TR 1AZTA 1KVRA 5DI3B 4PAQA 3VSAA 1WR8A 3IAM1 5EWMA 4RJJA 3ETLA 3E7PA 1ADYA 3NG1A 4B7ZA 2IYAA 5JO9A 4OI1A 2GOYA 1KP3A 3JTEA 4NENB 3YASA 1AS0A 2K5UA 2XVZA 5B6PA 2Z4SA 1M7GA 1P5FA 1L7VC 1LPBB 1WB6A 1EX7A 2QP4A 3JRWA 2PGJA 3E05A 3QH4A 5EGNA 3O7WA 1AKNA 2ZAIA 4W6QA 3UA4A 2VJKA 5AVZA 2PUCA 1U8YA 2ZIZA 1EUYA 4GSLA 1MTZA 3L2OB 1ZSNA 4HNSA 2PY6A 1EFKA 2IFTA 2PPLA 1IHXA 4WK0B 3IKMB 3U4GA 2WE7A 1Q12A 1QGYA 2JJ2D 4IGEA 3RLIA 4DY6A 4F3CA 3FNFA 3WAGA 2QSYA 5BV7A 2DR2A 3FYUC 1MJGM 5LQSA 2W2VA 3K9HA 2CLKB 4G1UC 1DQZA 1YZHA 2HGSA 2CNWA 5CTAA 4ENSA 5A02A 3VH2A 2O5VA 2G5PA 1U2DC 3CZPA 2WM3A 3QVVA 4YRPA 1EFPA 2NXNA 2PGOA 4JLPA 5AKXA 2QT9A 3AESA 3MG9A 1W87A 3LUHA 5DTJA 3DCJA 5KTTA 1XMXA 4MA0A 3DLAA 3A1VA 2PKQP 2O8EA 2BMEA 1BXZA 1C7ZA 2O0HA 1IJBA 2HSJA 3T9EA 2VQSA 2C31A 2RC6A 3DVQX 3LKDA 3VZRA 3CSSA 3VSDA 5H4GA 2VBGA 1MOQA 1RKBA 3FNEA 2M6SA 1ZD4A 3ANMA 3CGGA 3NHSA 4LHWA 1F1JA 4Q6WA 4RSRA 2POCA 3OQIB 4K46A 2IDJA 4Q4AA 3P2YA 5BXYA 5TB5A 4HP8A 3TR0A 1V6CA 2NMVA 4FPXA 4EHFA 4I66A 2G80A 2W9XA 1CJSA 4H7DA 3TG2A 4K9KA 1YU9A 4ZT6A 3V7YA 2B4KA 2BEWA 4N40A 3ZU6A 2OZLB 2X4DA 4Z3DA 1NRWA 1J2RA 1N2HA 5JAQA 3DE5X 4MRNA 1MRSA 2JFQA 3MCUA 5L7YA 1M2GA 3AJ8A 3QE0A 1Y48E 4P83A 1KI3A 4X92A 5KSZA 1I3NA 2J33A 3ZHOA 4GRDA 4UVIA 1H0HA 2WJIA 1ZY2A 3F3SA 3JQBA 4BX2A 2SCUA 2QN1A 1REQA 1Y4DE 4JR2A 3BXHA 1OBCA 4G4GA 3ZGZA 2OBBA 2BFOA 2YW9A 4H9GA 1RXVA 4Q02A 2F8SA 2A7XA 4Z4QA 2Z3ZA 3ZVKA 3EVDA 2YIVX 1SAYA 5CT9A 3IDOA 4KODA 2CVZA 5KYVA 5KJFA 1BE8A 3QJYA 2OM6A 4JVSB 2BHSA 4EX7A 5C8XA 3VNUA 2XB8A 3CZCA 2FR1A 1FP7A 2R6AA 4CM4B 4QVKA 3NDRA 1EWVA 2XGSA 1FS6A 4BFTA 4L5IA 4PICA 2VT7A 2QS9A 1T1SA 3VJMA 1QNLA 2X6TA 3D4IA 2XD9A 4IJ6A 3LWBA 3V6MA 3WYCA 4AMZA 3EEFA 5AVTA 4PNEA 3R77A 5KSOA 5J40A 4WCFC 3ZCUA 5A4DA 2R7AA 3D0QA 1NR5A 2IS2A 3JW8A 3FETA 4JB3A 4NC9A 1BGVA 3S7ZA 5JROA 5KTSA 2QI9F 4K8OA 5TQ0B 4DF3A 4QREA 2DC1A 5JZOA 1Y4AE 3O75A 3P2KA 5ENVA 2GPNA 1JIUA 2QB5A 1URPA 2GAFA 3O82A 4JXZA 3T7SA 3LXXA 1M2NA 1A8HA 3QEBZ 4HPJB 4ZVLA 3T1OA 3VPBA 5KREA 3HJTA 1DS6A 3N8IA 1N3IA 1SELA 3PXGA 3KSMA 3I52A 2DWQA 5I4IA 2NV0A 2ZJYA 1NPYA 1OWNA 1WOYA 3MPOA 4HR7A 4IM7A 4JUIA 2IHNA 1T4CB 4KOAA 2A5GA 2QRVA 5T57A 2JAQA 2BSAA 2JFVA 2D74A 4LSZA 3JWPA 3G5TA 1Z6ZA 3C6QA 3IMEA 2OBNA 4XYEA 3SX2A 1C1XA 1ODKA 1UANA 3ZJ5A 2WVAA 4C7XA 1TAHA 4CKCB 1IU9A 3PYMA 1DBRA 5T4FA 1MZVA 2ZAYA 3U39A 4EF4A 1EDZA 3O8LA 4O25A 3DVSX 1G3QA 1ZS9A 3AZQA 3EA4A 4NK4A 4Y7CA 5DNVA 3PI7A 2ZUFA 1WMDA 4MV8A 2QRMA 4Z3OA 1ORTA 1RI1A 1WBBA 1Z83A 3AVYA 3QA3E 1V8PA 1P4HA 1PZXA 4L2IA 4N0QA 5HCUA 1PLLA 1H05A 1FNCA 2DLNA 2DULA 2H1FA 3QELA 3E1KA 4GPEA 4R1UA 3C0KA 3OF3A 4H3SA 1KMQA 3CX8A 5ESWA 5H70A 1ENYA 4KP7A 3AXTA 4QXAA 3UV6A 1Q84A 3NEAA 1S8OA 1LU9A 1R0SA 2KLHA 2ZQ5A 4BLQA 4C88A 1FXWA 2HCRA 3EZ2A 4RPLA 3FJYA 4E2ZA 4GXQA 3OZXA 4XM1A 1Y9ZA 3LPCA 4JA2A 4E1AA 3WY9A 3OCCA 5KCZA 1DEKA 3B8EA 1UBKS 4PEVA 2C03A 3FMFA 2VBCA 4J1NA 1LQUA 3DDHA 2WNSA 4RVHA 4FE4A 5B53A 4ZODA 1CWUA 3AR7A 5AI9A 2WNIA 3ZV3A 3RRYA 4IQGA 4UNRA 1IQRA 4BHTA 4I5FA 1IOWA 2HQBA 1PWXA 2REQB 2XUKA 2IYLD 2WSMA 1YE5A 5GMOA 3OZWA 1ICEA 1EVLA 1U3VA 2BR4A 2IEGA 1U8UA 2QL5A 2DVMA 3N2NA 2F9LA 3QK7A 2IPMA 4GZ5A 3GJQA 2VP6A 6CHYA 2HV9A 1X7ZA 4RH3A 4JLSA 3KDAA 3OIYA 4A1FA 5A5DA 2XZOA 1M2VA 3KXKA 1C1DB 1XWWA 3OQHA 4HEJA 3AGQA 3M5DA 4Y9SA 1VXRA 2OP0A 5AK6A 3TR5A 2GK6A 2W6NA 4W63A 1GTSA 3QU2A 1RQPA 1VI6A 2BPOA 4YRZA 4J94A 2SKEA 5DKFA 2AT1A 2HB6A 4L4RA 4MUBA 5K3OA 2W8ZA 1OQAA 1I3MA 4DZTA 4LHVA 2DY1A 3CM0A 3BKWA 3ITEA 1O0SA 4FR5A 4JBXA 3TPCA 5IXSA 1K2WA 1FW6A 4QYXA 4OQMA 1H9BA 3FBGA 4YRRA 1KAQA 4HVLA 1NJ5A 3F2IA 5CXXA 4E09A 1ENPA 5JAOA 5CLGA 4DUZB 4HLUC 3DZFA 3QKRB 2NPOA 4CU5A 4GOMD 1E1CA 5BURA 5JI3E 2ZRKA 4HRAA 4CV0A 2HCFA 1RM5A 4LQCA 4EOGA 2C2MA 4RAOA 5J58A 4CMGA 1D4AA 4XAQA 3DFIA 1YC5A 2PZ8A 4HDRB 2PA0A 1AA9A 1SVMA 1B73A 1YS9A 4LC0A 3Q41A 1LI5A 3UATA 2QK4A 2RG1A 4PLPA 3SQWA 5KPJA 3QMPA 4UBJA 4V3CA 4CG3A 1JGTA 1WCXA 4HXEB 3OT1B 1JEDA 3ZWAA 3RVRA 1EFTA 1IHDA 2WWIA 4KMSA 1Y1LA 13PKA 3BSSA 1JE0A 2WJGA 2J3MA 1HLGA 3DR3A 2UZ1A 3UT5B 1E3WA 1YR1A 5MGNA 2FMXA 3TZQA 4KVGA 3CVUA 2ZXEA 1G8FA 2QDKA 3PXCX 5BMOA 4DV1B 1NN1A 1RKQA 1TI7A 4HEQA 4EVIA 2IBTA 1U28C 2FQWA 3EUEA 4FC7A 5L45A 4CRWB 1P73A 2NV2B 3A3NA 3DMFA 2AL7A 2R751 2PV0A 1H5QA 3BUSA 3ITKA 3PUYA 3QYPA 4IICA 3X1ZA 1NMYA 2C84A 2WUWE 1U0SY 4PTLA 4QASA 2VP0A 4X8LA 2FWPA 4U39A 2EATA 2R4TA 4FT4A 5EQTA 4C3ZA 3RANA 1KI4A 1A9XB 1E6LA 1TUBA 1B2RA 4C20A 4CODB 1Z4PX 2GTPA 2YH2A 1BD3A 3A1SA 3K4PA 2CE7A 4DE5A 3NPMA 3E4CA 2ECOA 3A25A 2ZBEA 5HJ5A 3AF0A 4J0DA 4M0DA 1OZAA 3PNKA 4D99A 1LJLA 4AUKA 1G8HA 3VV3A 2QVBA 3COZA 4B2LA 5KYNA 4QAQA 4L95C 2R65A 5JIBA 1FJ2A 3E4DA 4ENQA 2BBWA 4S0ZA 3P71T 3GHYA 1ZL2A 2EZ9A 5IC5A 3OOSA 4S04A 3VKFA 2I6SA 4LSWA 4OGFA 4B17A 3VZCA 4OHPA 5HCNA 1U2RA 4JI7B 4Y2YA 5LVAA 4Z9BA 1P72A 3PI6A 3U2QA 4P0QB 1K89A 1I33A 3BIJA 4YJ3F 1ZNXA 2R00A 1L1FA 1TRKA 3EXHB 1KYTA 3HJNA 1QR2A 3L6CA 1J9ZA 1SD5A 4RQAA 3K30A 3VPFA 4WN9A 4HQ6A 2VNHA 3JR7A 4ND8A 5CG2A 3TK1A 3S1SA 1FDSA 4E32A 2YZMA 3WWYA 3CEPB 3NC1C 4B5KA 3EIOA 4Z1MD 1LRJA 5A3VA 2LV8A 4HZUB 3WTCA 2PXCA 3L0CA 3RC8A 1GRCA 4EDFA 4K8RB 4RJTA 3DW1X 3G1UA 2F43A 2IXAA 1QB7A 1G7RA 3KNZA 4AB1A 2CL6X 3L6RA 1OKKD 1XMVA 5BSFA 4BUCA 4R51A 5EMJA 4U0JA 4LKOA 1YI8A 4XYBA 3M34A 1SBHA 2PKEA 3HUDA 3O03A 4UHFA 3OZTA 4YP7A 4YUVA 3C8HA 3U7IA 4QPDA 2ATEA 3O9MA 3H1GA 1DEOA 3K8QA 3PPWA 1PV4A 4PHFA 3CF4A 3WR5A 1QS0A 2Z8YM 1WDLA 4P5PA 2ZRIA 4MI9A 4CMBA 1XMQB 2JHCA 3F6PA 1XEWX 4GEGA 2VH2A 2QUZA 3CZRA 2YXPX 2O5CA 2JAUA 1TLFA 2JAOA 4K9SA 1KQNA 3WNQA 1NDUA 1ZLYA 4YYZA 1Q7BA 3R7WB 1VIMA 4FK8A 2A0KA 1YS1X 2X77A 3HEBA 5J4KA 3HS3A 2OEPA 4FBGA 2HA2A 3PUZA 3MS4A 4HVCA 5BN4A 5JT1A 3CEMA 1H2AS 1NR1A 2H2DA 3G23A 3MLBA 4RVFA 2P5UA 2GEDA 5DBGA 4C1BA 1SUIA 1S5PA 4EW6A 1Z37A 2AG8A 2C07A 1RCUA 2XJ9A 1JQKA 1P19A 4YH1A 5GM1A 3RRFA 1ZNZA 3THOA 2ODBA 4B7AA 3WOHA 2D1TA 3EAQA 4U2DA 3QGMA 5HRAA 3CZ9A 2NTVA 1ZNYA 4LI3X 1W19A 1XJ0A 4RWZA 1Z4KA 3AFOA 1G5PA 1T8WA 3IR7A 1GP2A 3HCNA 2WV9A 4GLLA 2ZR7A 4H35A 1NU6A 1Q21A 5GOZA 2YVAA 4PPFA 3F49S 2Q27A 3RKUA 4IKEA 3NFYA 1AA6A 4TRJA 5FO0A 2IWRA 4X9XA 2G06A 2P78A 3G2LA 3MTGA 4HO1X 1W25A 2FN3A 4YBRA 1VA5A 3RFCA 4OSEA 4DNPA 5AVVA 3GGCA 1XCBA 2BDUA 1XGKA 4RDIA 5AI4A 1JG6A 1L1QA 1XD9A 3VO1A 2J0QA 1DXHA 2DCMA 2R60A 5DXFA 1WD5A 1SQFA 3V1LA 2RG7A 3UA3A 1IQPA 1E7YA 1YR7A 3MW8A 4EJSC 1U6KA 4GM1A 4ZVQA 1C81A 3AK4A 1OFTA 1P1KA 2Z2YA 2DWPA 3ABZA 2VZ8A 4WBXC 3K70D 3QBDA 3W4KA 3FDZB 3X0DA 2I2DA 1NN0A 4MUNA 1XRSB 2BKLA 4G5QA 3CLUC 1ARZA 2PFKA 3JX9A 5EEGA 5I7OA 3F6SA 5CM8B 4UTXA 5JPCA 1BKSB 2D54A 4JKOA 5CK5A 3WGHA 2AR0A 4CMEA 2VNAA 2XHEA 3C3MA 4YT5A 4CEHB 5H3LA 3S2FA 4TUYA 2PUJA 4IVQA 2FZ5A 4OI2A 2IY8A 2HU5A 3S68A 1M8FA 4FB5A 1UMBB 1UKCA 1UPCA 2Z56A 4QBHA 4QGSA 3I1JA 5KTPA 1GTVA 2R8RA 1CU1A 2JIZD 3N2EA 4UFOA 2HAEA 2V3VA 3NTRA 1SQ5A 5P21A 1Z07A 5L51A 1RT9A 1W7AA 5EAIA 3AJRA 1L7OA 1N75A 3U9TA 4PSAA 1JHOA 3F9CA 1N8TA 3W3AA 4YJGA 1TU3A 1W581 2ZS9A 1BCSA 3KELA 4C0WA 1DINA 1YZUA 3MLEA 4A73A 4HAIA 2NPFA 1KH2A 1ZONA 3AKYA 2XSZA 3LK6A 2C61A 1HDRA 1RRVA 1VHQA 1XF9A 3HO6A 4YBZA 5EMKA 3TCXB 1WPRA 3TLYA 4D1YA 1KQOA 5ESRA 3V33A 3KZVA 5CA1F 5HHTA 3WFIA 1DQNA 4G1CA 1RRGA 1ACJA 1GGMA 2FZEA 2H1CA 2IHYA 2AFVA 4F38A 2H48A 3NNNA 4MUAA 4NBWA 3U3JA 1XZCA 5AVKA 1E9VA 3EIEA 2CW5A 4AMVA 4M6WB 2WFLB 1KAEA 1P2UA 1TUGA 1WY7A 2YINC 3V4OA 1UDWA 4A0QA 1XEWY 4KQIA 2PSEA 1CNFA 2GN6A 2EQBA 4J3NA 5FPHA 4F8EA 4I55A 5EIBD 3A36A 1U0FA 5DJ5A 3HU2A 5AIAA 4R9SA 2Q46A 1E0SA 2B2CA 2HJSA 1F5SA 3DTVD 3P9PA 5J59A 3SHVA 3VSBA 2P1RA 4BN4A 1LPMA 4KREA 3ISJA 3GELA 2GYUA 3QY9A 5EYPB 2PZJA 3L1JA 3Q8XB 1OLOA 2QTLA 5BQXA 5JC1A 1NVDA 3DMHA 3O8RA 5T8KC 4MZDA 2H51A 1X13A 1N3YA 3DBLB 1W0KD 4IFTA 3VHXA 2G70A 5HSGA 1M9NA 4OAPA 4D5GA 4ER5A 2WF8A 2QEQA 3G2JA 4MR8B 4DCNA 3BE5A 5FEUA 3L4JA 2AI1A 1HKUA 1OAOA 3OO0A 6REQA 4RZQA 3C97A 1YTUA 4P22A 1EFRD 3USCS 1SXJC 5JCOA 1UM8A 4MWBA 2ZI7A 1ZLXA 1QF7A 4NJEA 4P3OA 1GR0A 3RSFA 4BN0A 4O2BF 1JU3A 2ZRDA 2ZIVB 2ZS8A 4IRMA 4K6MA 5KC8A 4BO9A 2WT8A 3WNVA 1V3VA 2AJLI 1B76A 1KDOA 4CM9D 3FPHA 4KMOA 3ZXXA 2XNJA 1SUBA 2AC2A 4OV6B 2O8DA 1LLQA 4PYNA 3ZZNA 1DU4A 5BUZA 2PH1A 3ENQA 4M0FA 1RLOA 1VZ3A 1YK0A 1FX0A 4A26A 4BZPA 2BY4A 3ELUA 2PMEA 3T4PA 5LD2B 3ILXA 2B1QA 4AP9A 4RD3A 3BL8A 4ZAVA 1G3MA 4PLZA 4G24A 3CF2A 1OB2A 4HX9A 5C1PA 2RGXA 3R8XA 3ZTWA 4LE0A 2VPIA 4MLDA 3GFFA 3DDNA 4PXSA 3W5SA 5CVUA 4EG7A 5LNK1 4IO0A 3FCSB 1JKIA 3L77A 1RADA 1S7CA 1T8UA 2B30A 2JGDA 5DHPA 1QHHB 2D1QA 4LMRA 1UOEA 2AX4A 4RZUA 5AESA 5J4HA 3D5QA 1R5OA 3E9QA 1IC6A 4PWYA 1SZCA 1UPTA 2XQIA 5KKNB 3N75A 1JHAA 1GNSA 3QQ5A 1T10A 4MYHA 4ARIA 1SUSA 4IEFB 2NNWB 2GN2A 1JPJA 1XWFA 4KXUA 1EYZA 4CT5A 3EX7C 1PX2A 4XQCA 3H42B 5A04A 3RADC 2BGUA 3WA6A 1JG3A 2XWQA 2YUIA 4ZQCB 4EI9A 5FAXA 4MR9A 1FRNA 3SHWA 3AO0B 4YXWA 3IEVA 2NO6A 4G5SA 1JAZA 4GWLA 1TD9A 4RORA 5I9SA 2FZ4A 1UKAA 2P27A 3T3HA 3FNHA 5HTOA 1F8FA 4XCVA 1AQUA 1YCGA 4EW3A 1JR3A 2WDPA 4LHZA 3FSJX 4OUKX 3U7JA 4TZ0A 2D2FA 2VJMB 1MOSA 2ZSDA 4GXRA 5C3UA 5D5QA 4B3DA 3MUNA 4TYPA 4NZOA 3OZFA 3TMKA 5IT0A 3E5NA 2JA2A 3ZU2A 3OE4A 4CDRA 3AHHA 3HRIA 2VZEA 4P0PB 4Q3BA 3MWEB 1KSFX 5FUXA 3OBIA 2ZR0A 1QIMA 2OVBA 3BRWD 1OC2A 4C0JA 3KQUA 3ZVMA 1K92A 4RMJA 4DQUA 5F2EA 1VP9A 4FJ2A 3VR4D 4L8LA 4DWVA 3OT4A 2Q6IA 2V9CA 3EFHA 3D6JA 3NUGA 4RELA 4ME6A 3LL7A 2WVGA 5GTDA 2FFRA 3GT3A 3L92A 1UJ4A 3LCUA 3CHYA 1MAAA 2VDUE 4NCJA 2OYCA 2DERA 2FOIA 2ZVJA 1CIPA 2EFGA 2A58A 3F46A 3F9IA 3AF1A 3LHFA 4M53A 4OQPA 4BFVA 1C9KA 1TYBE 1BA3A 4P98A 5ELMA 3CUEF 2GSWA 3VPHA 1NF9A 5C4IA 4WXPA 1DBVO 1RAIA 3ANLA 3CMCO 2W5UA 2PUGA 3GAFA 1V7CA 2PKYX 3N86A 4X94A 3V5NA 1DHRA 5AHRA 1DXQA 3NANA 2JLCA 1OTXA 1RXYA 3K4HA 3VYRB 3KLBA 3KVOA 4L0MA 4X8OA 3X43A 1GDDA 5AVRA 3G17A 2Z2JA 1JR6A 5K3DA 2DSTA 2ERXA 2HA5A 2W2OA 2HMUA 4UOQA 3WMGA 4A7PA 1C14A 1LNSA 2NQTA 2X8JB 1FDRA 4H4EA 4R0NA 3SIXA 4AG3A 5JD6A 1J00A 3HDGA 4JJ6A 4JQYA 3JWIA 4I3GA 3LUDA 4N5DA 4IZ6A 3TYXA 1JFRA 2MMGA 1A04A 3WRYA 1J06A 1P0QA 3VKHA 4GU5A 1V5IA 3H5RA 3HDTA 3TRJA 4FDUA 1H1DA 4OCZA 4LRYA 1AHPA 3A9RA 4EJMA 3WLLA 2IYOA 5IU6A 1QBGA 3ECAA 1SK8A 2C3OA 5JNLA 2WLTA 2XRZA 2FUCA 1KP2A 1QAQA 3RC2A 4XWOA 1OH7A 4LX8A 5K3CA 3D43A 2FPOA 2WOOA 4XW2A 1FFYA 2C9BA 2I7CA 4PLWA 1P0CA 3ABRB 5EXXA 2ACVA 4GBED 2VG8A 3FWYA 1H2ZA 3MYRA 3LUBA 3N2GB 4P7JA 4WZAB 5BR4A 3QWFA 4AQ7A 1RJDA 1W8IA 3AOEA 3HVIA 3LCRA 4RF2A 1W8DA 4YRIA 1LNZA 1G8SA 1Z25A 4X3CA 3DZCA 5CJPA 4JYAB 5EI5A 1X94A 3HU3A 2CBGA 4IOJA 4FWIB 1ZUD1 1PJ3A 2FHSA 4MVJI 4I3HA 4BFWA 1OFIA 5AJWA 4YUXA 4WY5A 4JB2A 1F2TB 2PQ2A 4S1OA 3N6VA 1R37A 2WYIA 4K6CA 3VKVA 4L50A 8ATCA 1O58A 4K05A 2FDRA 2ERYA 4LNHA 2J3EA 1GNLA 4YJKA 4MGKR 2HJHA 2OPHA 1HE1C 2JEOA 1M6NA 2OR3A 1M1UA 4YPOA 1JEQB 5THXA 3MQ4A 1D5CA 3N2KB 4V0MA 3TSZA 3A7DA 4AO8A 2A1UB 2PRZA 3RLFA 4FX5A 5ENDA 3WLAA 4RANA 2CJWA 1PF7E 3OKCA 4B7CA 4PR3A 1NHGA 4H18A 5FYDA 2PWZA 1I5RA 2X13A 1LK5A 2Z9DA 3I04M 3QPUA 2W98A 2W0MA 3VAAA 3LJKA 1KO4A 1NOKA 5C80A 4CR8A 4ONEA 2JS7A 2GF9A 1AXGA 3THWA 1Y9AA 3E9NA 3NT5A 3T7EA 2WHQA 1MEJA 1P39A 3R24A 1T4MA 4I6GA 1ECFA 2WTNA 3E2IA 5ERXA 1P2BA 1R18A 4DA9A 3DLTA 3F6YA 3K09A 1RHMA 1WSWA 5KWIA 1J99A 1XLTA 2RGUA 2GDJA 4ODIA 5FBWB 3ZK7A 1EGVB 4QE3A 1CB7A 1NZJA 1JPNA 1Q0PA 3ZIUA 3D3KA 4YDSA 4OB6A 2VH5R 3DGFC 4G4IA 5J63A 3O2JA 4EKNB 2WM8A 5HCIA 4M7PA 1C30B 3IYLW 3QSGA 4Y6QA 1N2IA 4QUEA 2Y76A 2R11A 1QKIA 2DBVO 3JTMA 3ZJYA 3ZXUB 1RLIA 2PL3A 5DCUA 4QPJC 1C80A 2QRLA 1PK7A 3UJCA 3NZEA 4Q1BA 2XRMA 3TFWA 4U4AA 5HZHA 1EJ2A 1Y82A 4N6OA 5A6VA 4NOLA 3HI4A 3KOYA 5HS4A 1QNFA 1BDIA 3KS9A 5IMBA 1TU4A 1Z5ZA 5CB4A 1LPOA 3V32A 5EZ5A 3UKDA 2LP4Y 4DLSA 2XV1A 2AVNA 1R8SA 4ZGWA 3MGCA 5KNCD 2G9RA 2ZOSA 2B2NA 5I9IA 4IIYA 3LH5A 3QXHA 3MOSA 4YMLA 5K8TA 1O03A 4JU9A 1BHO1 2BONA 2Z43A 4EFKA 2IYYA 3VR3A 5DYNA 3B7WA 1WJGA 2J46A 4GR9A 2HMWA 5SY9A 1Y63A 3UO8B 2A0WA 1ZGCA 4YRGA 3TJZA 4JJFA 1ORHA 3K2BA 5AQEA 5JQGB 3D6FA 1OLUA 3A1NA 4CQMA 1QKJA 5DP1A 1NG1A 5C3MA 4FXOA 5TT0A 5CB0A 2QA5A 1AK1A 1CVRA 3E81A 4COOA 5AM2A 5KX5F 1PZMA 3PTAA 5EWLB 3M3PA 3O8NA 4TV8B 2GZ1A 4TMFA 8LDHA 2F1IA 3OZAA 5KINB 1I2AA 1V45E 1YQWA 2DKOA 4KXLA 2AKEA 1BEEA 4H0FA 3C4QA 3G8YA 1XVLA 1SH7A 1UIRA 3P96A 1FFSA 2XCIA 2ZROA 4K9RA 3C5VA 1Y1TA 4FZ5A 4YASA 5EFZA 4N5LA 2EW1A 1Z4MA 2YJ3A 3OKPA 4I81A 5EZ6B 4YNBA 4L28A 2OFFA 3TXYA 1E89A 1EZ1A 2PA3A 4Y6OA 4LJLA 4D9HA 2HQOA 1N6OA 1JDSA 4WOKA 5BRAA 2L69A 1EIZA 2VDVE 3O95A 4TXLA 4CCYA 1HLFA 4DADA 3IT1A 2OT3B 2EZUA 4ZVNA 4V1CI 5LP6F 3GDWA 3L7JA 3OOHA 4I4TA 4LF6B 5FRDA 5JJCA 1VPDA 3OLWA 4YRSA 1VIVA 1FF9A 1U1FA 1EE2A 3HNRA 5AK0A 1IPHA 3HKCB 4L73A 1CY4A 3CEHA 4BNHA 4Z4CA 1XTSA 3OAAA 1ONNA 3V8EA 2BE7A 1NC3A 2H3EA 3FHCB 4L16A 1NQTA 4IDNA 3RC9A 4LNUA 3C43A 3K1TA 1WXWA 3BWVA 5COAA 1FMJA 5YASA 4CKEA 2EP7A 4BNWA 2YTZA 2QTVB 2YC2C 2IPXA 1F2VA 2R6FA 2YZ7A 3AZOA 1D4ZA 2OCLA 3J81A 4JUBA 2WJPA 4V39A 4RNCA 4I9NA 3K96A 4E31A 1N7IA 2XAAA 3D4OA 3DAPA 5IAEA 4FD2A 1UC8A 1Z0FA 3EPLA 4G36A 1U0GA 4YECA 1XZ8A 1YIAA 3H99A 4E14A 3SR0A 1FUEA 4QDTA 4ZOLF 2VRCD 2WA1A 3KJXA 2JLVA 1K9SA 3DW3X 5HZKA 1CTQA 1E2QA 4BVGA 3GLTA 2CCKA 3L8HA 1UDRA 2FSGA 2LGJA 3W5JA 1BD4A 3SQMA 1NDQA 3NTXA 2OFOA 5CH8A 4DM4A 1WB5A 3EPPA 3T4XA 3ODPA 4TZTA 1QORA 2A8YA 4U8HA 5AJXA 3TZLA 3TUZC 3WLIA 3FBWA 4K9QA 3KZXA 3LV8A 1Q11A 2HM7A 2XOKA 2HA7A 2N3ZA 2ZUEA 1E2DA 2BFDA 3E8MA 4HLNA 4IDDA 4XKJA 3T38A 3WRWA 2B83A 2O2SA 1GRVA 3QF4B 4NU6A 2COEA 2A9KA 4OXYA 1HLPA 3BHIA 1PTJA 2C8KA 2I8AA