1T0JB

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
215
structure length
187
Chain Sequence
FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
total genus 59
structure length 187
sequence length 215
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0jB00
3X1ZA 3SBEA 1SULA 2F9LA 3CZPA 5CK5A 1JQLB 2OCAA 2CCKA 3C4JA 5CYPA 2P65A 4HATA 2XEXA 4EPWA 6Q21A 2WIBA 2J0VA 1FW6A 1VG9B 2HV8A 2QTFA 2X77A 1H8ED 2C5LA 3QEOA 1IONA 2C2HA 4ZIRA 3IEUA 2AHOA 1ZD9A 2VSFA 2XITA 3T5GA 5EE5B 3FKSD 1RC8A 4II7A 2H57A 1E2EA 4R98A 4RD2A 2IYUA 1U0JA 1Q1ZA 1T3HA 4BZXA 2B21A 1KI1A 1TU3A 2ZJ2A 2G6BA 1RYHA 1GZSA 4MGYR 2FZLA 2G83A 3CIOA 4YXWD 2AK3A 2BDTA 4Q66C 2A30A 4OHZA 1DAEA 1EFRD 5FPSA 5D3QA 2OZEA 2EFEB 4MYTA 4Q48A 5CM8B 2AWNA 2J45A 2PCLA 2ZRGA 2F7SA 4TN1A 2B8TA 4DLTA 4CT5A 2J41A 4DKXA 2D2EA 3QG1A 4HEJA 4Q4JB 5KSPA 2FOLA 4M4SA 3RC8A 3SJZA 2J0UA 3L2OB 1P72A 3W8NA 4UXHA 4O2RA 5L3SA 4XWAA 3GJ0A 2IYRA 2A5JA 5HKKD 4UNQA 2CL0X 1YZKA 4URUR 1PLKA 3ZD6A 3KUDA 4A0HA 1N5LA 1T6NA 4PO1A 4B71A 3AVQA 1DTSA 4Z1MD 1CJUC 1BIFA 3NEYA 4PXAA 2CL7X 3FHCB 3PUVA 3N70A 3WP1B 1Q57A 3VQTA 3IEVA 1ZUNB 2Q0HA 4GMDA 3QVUA 2NGRA 3LVQE 2PZGA 4GNKA 2JATA 4LDJA 2WV9A 1TQ4A 4DHEA 2AFHE 4DCNA 5CYOA 3AF4A 3HPQA 3OEHD 3GP8A 4LBYA 2YNMA 2MMGA 3THWB 1TADA 2FSIA 1E2NA 4G1UC 1LFDB 1SVIA 2XTNA 4UNPA 5EXXA 1MRSA 1QG2A 1SVKA 5FUVA 4XVRA 2V3CC 3IO3A 5KNDA 1PUIA 1JR3D 3KQNA 4JLMA 2QP9X 4HLUA 3M4YA 3CWZA 2XZOA 5FBRB 4HAUA 4LJ7A 4LHXA 2OV2A 1TEVA 4RD1A 1NN1A 3K09A 2NO9A 3KFXA 5JJIA 3L8YA 3F8TA 1S9DA 2HXYA 1KJZA 1KSGA 1DS6A 5HKKA 5KNCA 3BB4A 1ZINA 4PZLA 5DI3B 2UVQA 3WRYC 5DHAA 2IYWA 4TL9A 5ANRB 2VO1A 3H86A 3SYLA 3FTQA 3ZS9A 4ITRC 2ODNA 3QPVA 3WMFA 3QVVA 4MUAA 3ND9A 4NYJQ 2XOKA 5EZ5A 2VBCA 3X1WA 721PA 3IQXA 5FR1A 1N5JA 2ZREA 4IJMA 5P21A 2O8CA 1K5GA 1E9BA 1C1YA 5DI3A 3O8RA 2WKRA 1P4SA 3LXRA 4IDPA 5BXQC 5AK0A 2YWFA 3EZ2A 1KY2A 1TEXA 3EZ6A 2OESA 1R8QA 1Q3TA 5EUQB 3W6OA 1FFHA 5TXGA 2F3RA 3N2IA 1M2OB 3PITA 3D8BA 3THXA 4KFTA 1YKSA 4D26A 5KPJA 4LYAA 4D0LB 2XB4A 2Y8EA 1N5KA 4PX9A 4ZIRB 3BFVA 1W4BA 3NEJA 1VMAA 4B6EA 2LWIA 1J2JA 4B6FA 4P4SA 1Z3IX 4URYR 5KYKA 5A4JA 5BN5A 5JBQA 3OZXA 3TQCA 1Z2CA 1E79D 5CJPA 4L5BA 4TL8A 2FFHA 3P4YA 1FOEB 1H65A 4V02A 4PC3A 4OI0A 1F5NA 2X2FA 3VFDA 3SN6A 2IHBA 4NCJA 4OI1A 2PJZA 2ZJ5A 4URZR 4EPTA 4DLXA 2GF0A 4BFYA 3I8SA 4LI0A 4JJZA 3HU2A 3P32A 3DMDA 3MRSA 1OXSC 2RGAA 3GJ8A 1BO6A 2OXCA 1Z28A 2REOA 1CKEA 5AUOB 3Q8XB 5G3ZA 3L0SA 4QKQA 2GCPA 1G8HA 2EFDB 3NIBA 1G4UR 2Z0MA 1OH7A 1QRAA 1CRPA 2Z4SA 3NDPA 1XB2A 2W6JA 4RZXA 2C96A 2NG1A 3K0AA 1U0HC 3WRXC 4DJTA 4CEJB 1NY6A 5L3RA 4KFSA 4K81B 4MGIR 5TDHA 1NBMA 2XXAA 3FMOB 5L3SB 1VYVA 2WJHA 1BMFD 1KI2A 4C0JA 3EZ7A 1M8PA 3QF4A 1CRQA 4KCGA 1Q12A 4C7OA 2SHKA 1QHGA 4F91B 2ZRHA 2B6HA 2PL3A 4IOMA 1QVRA 1AKYA 3QIAA 4GOXA 4QGGA 3REGA 1FMLA 2AR7A 2R6AA 2YJTD 2BJWA 4Q21A 4CEJA 2DCUA 4Q1CA 5FPHA 5FOWA 1KK3A 1P73A 3BOSA 4TSFD 1JAHA 1N6LA 1NMZA 1OIXA 4CT4B 2VH5R 2LKCA 3GLGB 3GQBA 1QHXA 1S9HA 2IXFA 3I5XA 5BN3A 4ACBA 1X3SA 3PG5A 3P26A 4NONA 1R0ZA 4BFSA 3UATA 1EFCA 3SFVA 3DMNA 3QXCA 1ZU4A 2W2TA 4US1R 1IXZA 1DE0A 1US8B 1XCPA 4QNRA 3FOZA 4OK3A 4N0DA 2VHTA 5DH9A 2EWVA 3QF7A 4TZ6A 3OAAD 4M1MA 2VHJA 3B82A 4TTPA 3QKUA 1CXZA 3B7GA 4TYNA 1MO4A 1AQUA 1RRCA 3AP1A 4ABYA 2R44A 2GJ8A 2EFHB 2ZVPX 2R6GA 2D06A 1EWQA 3W5JA 1ZJ6A 3ASYA 4EJSB 2L0XA 1IN6A 3GLIA 1C9KA 2CNWD 2ZANA 2ZEJA 2XSZD 1TAGA 2ZYWX 1GKIA 2OT3B 5TY0A 1MH1A 3R7WB 1JXOA 3RVBA 4B34A 1Q44A 2FPKA 1QVAA 3A8TA 4DIEA 3RAPR 3E5HA 5EJEA 4W5HA 3MWYW 3DZDA 3QPUA 3RRMA 1EX7A 4GOKA 2PJRA 1JR6A 1WBBA 2GZHA 1MABA 2IS4A 1G17A 4RZ3A 1F2TA 5TV2A 4QRHA 1PUJA 2X8AA 1COWA 3TUZC 1G16A 1GILA 3K0EA 4IVQA 1OXXK 3BC1A 1E2FA 4LHWA 4B74A 2FV8A 4FD2A 1E3MA 5C4GB 2NPFA 2ZRBA 3K1JA 3A37A 3CBQA 3IDQA 4Q5IA 3ZQJA 2MSDB 4JBXA 1N6PA 1IXSB 4UXJA 3TRFA 2QTHA 4GPTA 4MGKR 1S96A 2JJ2A 3EIEA 1KI7A 4B3BA 1G4AE 1ZC3A 2OAQ1 4BZQA 1ZNYA 4A2WA 2P6RA 1XXHE 1N25A 3A1SA 1Z8FA 4RVCA 3VU9B 3NVAA 2CLCX 5B2ZA 4BFUA 2BV3A 3AVYA 3FMFA 1NLFA 4FWIB 4JT2A 3RDPA 4F4JA 4Q1AA 3L43A 2X19A 2ZR0A 3B13B 4YXWA 4URVR 1ZBDA 2W6JD 4TMWA 4DLWA 2W0MA 1FUUA 1YJ5A 3LH5A 2ORIA 5LPNA 4HLQB 2J87A 3CO5A 4JS0A 1KGDA 3X1XA 3AKEA 1N0WA 2ZYVX 4A6XA 3SYKA 1SVWA 1SKYE 2GEDA 2HEIA 2AX4A 2PZEA 1ZD1A 2XNDA 1CIPA 4PQFA 1W2GA 1EXMA 4M8NE 1W48A 4F4CA 1B23P 1KY3A 2EYUA 1T5LA 4IKEA 2Z4RA 4EKDA 5ELXA 3FE2A 3TLXA 1GDDA 1O3YA 1T8UA 2W0SA 2V7QD 1G5TA 1JALA 1L7VC 1U98A 2J3EA 4NKRA 2J1LA 1AGRA 2PLFA 3OEEA 2HXSA 2YOFA 1E2DA 3MD0A 1XZQA 5AR1A 3TAUA 4DLSA 1HV8A 1QHIA 2N42A 3W3AA 3THOA 1R7RA 4L9SA 4BECA 2FGKA 4A0FA 2FMXA 2ZI5A 4HLCA 4TSFA 4OI2A 4B3DA 4BEBA 2ZI9A 2J0UB 1KSJA 4ARZB 3GCGA 1WDTA 2QE7D 1E0SA 3Q7PA 1TTTA 3C14C 2ZI7A 3IBYA 2WKPA 2ZUCA 1XTKA 5DYGA 1UDXA 1WCV1 3KTAA 2ORVA 3GEEA 4CVNA 3ECCA 4OL0A 1OHHD 4WIAA 1X8KA 1P5ZB 2DB3A 2ZSEA 5CLLA 1FTSA 4LJ9A 3RS7A 1AKEA 2IYQA 1KK2A 1LS1A 3IGFA 4POAA 1ETUA 1G18A 1PJRA 1R5OA 3GJ3A 1KAOA 5FR2A 3MCAA 3AV0B 1IQPA 2O8BB 1Z0DA 5K8IA 1G41A 1XJQA 2IYTA 3TAHA 5BW8A 3GJ5A 4QBGB 3LLMA 2OILA 5EXPA 4LUCA 4F38A 5FTJA 2JASA 3LFUA 1T0HB 2FNAA 5F9HA 1JXMA 2V7QA 1E69A 3KJHA 4XVQA 3M0EA 4P33A 2VYFA 3MG9A 3QNUA 1XMJA 2QPTA 3P27A 1RVDA 1G5RA 1CJTC 4A2QA 4AYWA 4BRWA 5F3WB 1ESNA 2OFXA 3GLHA 5CLQA 5IK2D 4QOSA 4IEIA 2GF9A 2QQEA 4EAQA 3HP1A 5JCZA 4HDOB 4XVUA 1UJ2A 3CRRA 3LA6A 4BE7B 4JL6A 3KQLA 4JYBA 4EQ6A 4V03A 1KK0A 3DDCA 2QMOA 3D7MA 1NN3A 3E2IA 5LD2C 1W4AA 1Z29A 2WPDD 3K53A 2ATXA 2RHDA 3O8DA 3ZVMA 3GLIB 1FP7A 2PMKA 3U7FB 4M1KA 5FPTA 2WICA 4IVRA 3CF6R 2X2EA 1JB1A 1I4TD 5L3QB 1RRGA 1T8TA 4I1OA 4AURA 1YR6A 3U61B 3J81k 2HJGA 1XDBA 5HTKA 4E09A 3TVTA 3K9GA 1TX4B 4J0QA 4ZDWA 2JLQA 5FBVB 2YYZA 3G82C 4DSOA 3MJRA 4NTZA 1KNQA 2QN6A 3QSYA 3CKLA 4EUNA 1SXJB 3AF3A 5EP3A 2HDNB 2ZE8A 4FXPA 2FU5C 5JZVA 3P1JA 4HLUC 1SXJD 2YOGA 3QKRB 1ZM2A 5B57C 2RB4A 2P6NA 2JIZD 3WY9A 4LJ6A 2JLVA 1NG9A 2ZAOA 3O8CA 3KFVA 1AS0A 3LX8A 3LXXA 4HB0A 4TMKA 3UWKA 2W83A 3NTUA 5LD2B 5FH9A 5CIQA 1R4AA 2OBMA 1Y63A 1XF9A 1E94E 1F48A 3OIWA 1IJEA 2ZRFA 1FNNA 1IM2A 3U6BA 2IUUA 2G0NA 3FFAA 2I4IA 2WWYA 4ESVA 4H1UA 1YVDA 4JSTA 4PANA 5DO9A 1LY1A 3QF4B 1G291 3TR0A 4PHHA 3TW4A 2XTZA 3A6PC 1XD9A 4V0ME 3LAWA 1KMQA 4ZDJA 3CNOA 2GCOB 2I3BA 3G5UA 2OFOA 2VRWA 3GLFA 1OH8A 2B7CA 3H2YA 4DDWA 4GOJA 3VTKA 2J5XA 2ZSDA 3TSWA 4OHYA 4HYYA 4TTRA 3EZFA 3PEWA 2BHRA 2NTYC 2BIFA 1XJ0A 4JLKA 2ONJA 3THWA 5JWOA 5SZKB 3U6KA 1T4GA 1OB2A 4U02A 1UBEA 2UZ3A 2NQ2C 4RCYA 2D74A 2BMEA 2GVDC 4XTCS 2QT1A 2A5FA 2PEZA 5L8VA 2XAUA 2PX3A 4Q4AB 3R8FA 4BQSA 1W0JD 1HE8B 3SI7A 1E1QD 1G7SA 4M1WA 4OQNA 4TMZA 4XSHA 4D82A 4DIDA 3EPJA 1ZNXA 1YZTA 5L3VA 4PC6A 3VR3A 4NBSA 4JLBA 4DCSA 3TMKA 3FHTA 3NDBB 4ZDIA 4PC7A 3PUYA 1NVXQ 4Q9KA 1G3UA 3PXGA 1ZAKA 3K70C 3BRWD 2N1BA 1CTQA 1UKYA 4DSUA 4XD7D 2GAAA 1XU4A 4BFWA 3PV0A 3T1OA 1SVSA 4B43A 1G1MA 3WNDA 3ADCA 5AUQA 1ZIPA 5EE3A 3T1VA 5DHFA 1ELOA 4DDVA 1W49A 5K8LA 1P6XA 2F1RA 5HR5A 2JCSA 1GFIA 4A92A 4LJ5A 4Q18A 3OF5A 1X1SA 3WBJA 4A1FA 5J47A 1HT2E 4CRWB 1XNJA 4XSGA 1DAFA 1UBFA 3KJEA 4GZLA 3LBIA 3Q85A 4CEHA 1QBKC 1P7CA 5CDFE 1ZM4A 2ZE7A 1DO2A 1ZM9A 2W6ID 2J9RA 1BYIA 4QG7A 4B76A 2D2FA 4FCWA 4NYJR 3CB4A 3MLEA 3MWJA 3CPJB 3KL4A 1A4RA 1E9AA 1GRRA 2KBEA 3A58B 1U8AA 1UM8A 3VAAA 3H1TA 1OXUA 1QDEA 2BMFA 1M6NA 5H68A 2F55A 1IY1A 2AFIE 1Z6GA 2JJ1D 2F1JA 2TMKA 4C0KA 3KQUA 4LK2A 1JNYA 3C8UA 4R2HA 2KI5A 2YC2C 3R8CA 4YMTA 2VF7A 4I1UA 3EC2A 4PAMA 2H16A 1QHNA 1X1RA 4C0SA 3KXLA 5DGXA 2XGJA 4QHSA 4DUGA 4AKEA 4CW7A 1GNRA 1J70A 4JBYA 4Q9JA 1WMSA 5LDDC 2CLSA 2PH1A 1H8EA 2F1HA 4M1TA 2JEOA 2FEOA 1S2MA 3CF0A 1GKUB 3K0CA 2O8EB 4HUTA 2OO7A 1XTQA 4Q9IA 4E5UA 2DY1A 3BH7A 3ZLJA 4WOPA 4KBGA 5KSYA 2WJIA 3CW2A 1NVVQ 4XWKA 4JJKA 4RY2A 4JIMA 3RRNA 3AP2A 2CDNA 2GBLA 2OM2A 3CH5A 4URWR 1ZNZA 1U2RA 5CJ2A 4YLGA 3FHOA 2IF0A 4R9UC 1W7AA 1VDZA 2G0TA 1W0KA 2HCJB 2QENA 3H4MA 1KO7A 2OSBA 3B5JA 3TSOA 3BS4A 1S3GA 2QP3A 2EFCB 4HAYA 5UKDA 4KXFB 1Z0JA 1E0AA 1P75A 3EASA 1TQ2A 3OHMA 2IHYA 4Q1EA 3IHWA 4IDHA 1UAAA 5FL3A 4KV9A 4DRZA 1LB1B 2PCJA 3Q3JB 1UKVY 1CBUA 4LYFA 3WNCA 3Q5EA 1ZCAA 1XD2B 1N0UA 4C0BA 4CYMA 1E2IA 5J4VA 1R0WA 5FTNA 3ZZ0A 1ESMA 1P60A 1D2MA 3BBPA 5AJYA 2HYIC 2FA9A 4EFLA 4Q19A 3ETLA 1OJLA 4DVGA 1DAIA 1RFLA 3OIYA 1TF2A 2C95A 2GRJA 2OBNA 4YQFA 1IXRC 1OKKD 2HF9A 3F5FA 2P3SA 1GIAA 1S4QA 3QY0A 4TLEA 1U94A 2RH5A 4QFMA 1E2LA 4UJ3A 4AG5A 5JS7A 1UKEA 2P6UA 2R9VA 3KUCA 5DIFA 2R2AA 4U00A 2ZJBA 3SNHA 2O8BA 4AKIA 1YRBA 4N3NA 2BM1A 2ZYUX 3NHAA 2R6CA 2XZLA 1G7RA 3KB2A 3OAAA 4P4UA 1II9A 5E7IA 5AUPB 3AM1A 4M9ZA 2ZRMA 4TL6A 2BKEA 4RFSA 3BFKA 5KDLA 2IS1A 4JL5A 2KJQA 2C8VA 1XP8A 4Q1BA 5F9FA 1CEEA 3IKJA 2FF7A 3QI2A 4KFRA 5AJZA 1RYFA 3CRQA 4TLBA 4AI6A 4Z1MA 3GD7A 2CNWA 2GVZC 3QKSA 1NIJA 4BFTA 1ZMXA 1XMIA 2D7DA 2IXGA 5SZIA 4BLPA 4TMXA 4Q1DA 1YRAA 5KTYA 3ICQB 1Z08A 4GI7A 3RS5A 4OHVA 3VR5A 1I4LD 1II8B 2EU8A 2WWFA 3JVVA 5JHGB 4KYUA 2ZUBA 4Q9HA 4D4KA 4PHFA 2FX3A 2GJAA 3KKMA 2O8CB 1CR2A 1WF3A 1X8LA 3EWAA 2WKQA 5EZ6B 3AF2A 3B85A 2CJWA 2AD5A 5FOUA 2YVUA 2ZI3A 4PSAA 4CGZA 1BMFA 2PZFA 3WYFA 3AVUA 4DBLC 3BD9A 1BKDR 4OI4A 2GXSA 3U7GA 1DPFA 1T3SA 5FOTA 3U44B 2QMUA 2ZI6A 3OE7A 4LWZA 3W34A 1E2PA 1D6JA 1BH2A 2CK3D 4CDGA 5IF9A 4FINA 1KHTA 221PA 3ZIAA 4A15A 5G53C 2FPLA 3AVOA 2YOHA 1AGPA 4KSCA 5TMPA 2EWWA 1CJKC 3X2SA 4FI3C 1D9XA 4O2LA 3BERA 3PFIA 2K5UA 4RJLA 4D0GA 3SS8A 4MKGA 3QUSA 1OLOA 4NMMA 4KU4A 2QZ4A 3LQRA 4XWOA 3OE7D 4KAXA 1E9RA 4M53A 3U5ZB 2KE5A 1NG1A 4NCKA 5EP1A 1DAMA 3M6AA 4JMPA 2FGJA 4MYCA 1HE1C 1W4CA 3DOEA 4MITA 3RSLA 3HR7A 2FG5A 1E2JA 2QM8A 1WBDA 2V55B 3R9WA 3RS0A 3ZZUA 5F2EA 2ODBA 3EXAA 2Z6VA 3ZGXA 2GTPA 3TUIC 3S1AB 3DO6A 3PEVA 4QC2A 4OHWA 1XD8A 2H5EA 2RGCA 3K09C 1E1QA 1EESA 5DI9A 5E7MA 2BJVA 4WXPA 5DSZA 2VTKA 2JJ1A 4NYMQ 3SEAA 1DAKA 3T06B 5FL7D 4PAQA 4QJ4A 5C1BA 1GRQA 4IXMA 4HB2A 4NHOA 1UBGA 1QF9A 2NZ8A 1P9NA 1B0UA 3IUYA 3OEED 3K0SA 1N6HA 4IOJA 3OFNA 4MRVA 2O0JA 1GUAA 1G7CA 1XMSA 2C03A 2KWIA 4BGDA 2ZRPA 1N2CE 2QP4A 3V00A 2QTVB 5IT5A 3NH6A 2WWIA 2ZJZA 4MRRA 1US8A 2YWEA 2IS6A 4KJZA 1LW7A 1ZD8A 2WAXA 3RS3A 2HF8A 4D81A 4KI0A 3NBYC 1F3OA 2GESA 4EDHA 3WYGA 1W5TA 4QBFA 4TWZA 1E9FA 1G21E 2WWGA 1EFTA 1FL9A 3B8HA 4LJ4A 1LV7A 4HLDA 3K9HA 4YMUA 3CRMA 5FPYA 1J8YF 2QUZA 5AJVB 2ZE6A 2D4HA 5JJKA 1HURA 2V6IA 2YWHA 4L16A 2C78A 3AGPA 4UJ5A 5FBQB 4CEHB 2ATVA 5KDOA 4CEIB 3GLHB 3SQXA 4CZ2A 3RNLA 1AZTA 1OH6A 4RKFA 4ZPXA 5FBLB 3SFZA 3PCRB 1A2KC 1NMYA 2NOAA 1NSTA 3A4MA 1MO6A 1T0JB 1FMJA 3AVVA 3B60A 5AUNB 2R6FA 3U4QB 2VP2A 1KJWA 1OE0A 3T61A 1W0JA 2C77A 2CJWB 1J8MF 1Q1EA 2HJVA 4LBZA 2VSOA 3UG6A 121PA 1KO4A 2XJ9A 3RS4A 1JI0A 3D6TB 1G6OA 1RZ3A 1UDWA 4TLCA 4XJXA 1S1MA 1S8FA 3T1QA 1QG4A 4Z51A 5JEEA 4AY2A 3KDSE 1HT1E 1UEIA 4JVLA 3SQWA 1IN4A 3FYHA 1YR7A 1R10A 2FJUA 1R2QA 2D3WA 2J7PD 4B48A 3VMFA 2DFTA 4QJ5A 1XWIA 2FSFA 4EIWA 4QM6A 1ZW6A 1D8TA 4JVSB 3RSOA 2RGXA 4MYHA 2ZJOA 4I99A 4X8LA 3C5CA 1Z22A 4PPQA 521PA 3ZVLA 4P3YA 2CL6X 4EJSA 1XXHA 2QAGB 4H1VA 3LLUA 1M7GA 3THYB 1XEFA 1DELA 1IJFA 5LBIA 421PA 3CONA 1JR3E 4HZUA 1U99A 1X6VA 1EX6A 4HUQB 2QEQA 3L0PA 2ZVQX 5KSOA 4Q03A 4LX0A 1E1RA 2V9PA 1WRBA 3A4LA 2W00A 2AWOA 4NCHA 5E95A 5FUXA 1CJVC 2YINC 2BOVA 2YKGA 4IW3B 2XNSA 3F0TA 2C9OA 2GHIA 3FFBA 3LO5A 4HAWA 3VX4A 3HYTA 3KXKA 4JKIA 1JR3A 2YZ2A 2XSZA 5FTKA 2RCNA 2CHGA 1KI6A 1KDTA 1LNZA 1E99A 1VIYA 3BJIC 3M1IA 2QU8A 1GAJA 3I92A 4JVNA 4D2IA 2WZQA 4DDUA 4IDQA 5J5CA 2IEZA 1UBCA 1KKLA 4IHQA 3EW9A 1UFQA 3OEHA 3V4RA 3NBZC 5E4FA 3RC3A 4YDSA 4WXRA 5IK2A 4ZI2A 1GL9B 5BYJA 2CCJA 2ZSFA 4E07A 1GITA 3B1VA 1NN5A 3PUWA 2ZQ5A 1KKMA 1II0A 3VU9A 5JI2E 1XD2A 1MO5A 5TARA 3EPKA 4PHGA 2HUPA 1MKYA 2IX3A 3RHFA 1OFTA 1KI6B 1GG2A 3CPEA 3EZ9A 2YWGA 3NKVA 3QENA 4ARZA 2HT6A 4M1SA 2GAOA 2JGNA 2WJGA 2VIIA 4L15A 3K9LA 3U7EB 2A2ZA 3BIFA 2ZETA 2H1LA 2REBA 2ZROA 1S1CA 3UWOA 3TR5A 4RFSB 4JZKA 1SKQA 1MRNA 2GCOA 2W6IA 5EP4A 2IYLD 2REXB 1W4RA 3JZAA 2NO6A 3W6NA 3B78A 4W9MC 3GFTA 3K70D 3PEYA 2J0SA 1IN7A 1G7TA 2B92A 2OLJA 1TF7A 3AP3A 3GFOA 4FW9A 3TKLA 2IWHA 4JVMA 1OV4A 1Z0AA 1NBME 1Z0KA 4S2EA 4ZO4A 5KU1A 5KOYA 4C0AC 1W1WA 1GNPA 4K46A 4TZ0A 3LWNA 1LVGA 5LB4A 5AJXA 2BMDA 3CRW1 4C0QC 1Q22A 2P0EA 3LV8A 1NVWQ 1A2BA 5KO2A 621PA 4G3XA 2A5GA 1ZM3A 2JJ8A 4LY6A 5FOSA 2BM0A 1W44A 3FMPB 2JAQA 4LGMA 4A6PA 3IBGA 3OESA 4PAOA 4FWTA 2O0HA 1W2HA 3FKSA 2QORA 4F92B 2BVNA 1E6CA 2P67A 1XEWY 4LPSA 1G20E 5C18A 4NDZA 3SJBA 4PPNA 2JJ2D 4Q1FA 1D2EA 2P2LA 2OLKA 2WJYA 5SZJA 1JPNA 1K8RA 3T35A 4AYTA 1G19A 4PSKA 1E96A 3U3MA 1BS1A 3GJ6A 1DOAA 1VECA 4YMVA 2ZRCA 4P4TA 1RW4A 1E98A 2G1KA 5L3QA 2IYYA 1QHYA 3MSXA 1E0KA 1MV5A 4URXR 5CIWA 1P2SA 4FCTA 4ZCIA 1SVLA 2ZIAA 2ZJAA 1OSNA 1TUIA 1XTRA 1E2KA 4JKYA 4PC1A 4EFMA 1OPXA 3AKCA 2HYDA 4A0GA 1Q3HA 2JIZA 1ZVQA 4D0NA 3GLIE 3DOFA 2GEUA 4TYPA 4FMDF 1TL7C 1CU1A 4YC7A 5EXTA 2QGNA 5CM9C 3QXHA 2ONKA 3C41J 3HPRA 2BEKA 2LCFA 4U5XA 1YZLA 4X8OA 4DCTA 1IHUA 1P62B 1WE2A 2WWWA 2ZR9A 2RGGA 2CVFA 3H0KA 1MABB 5JSZB 3AUXA 4DLRA 2WMNB 2YHSA 4LCBA 4WBSA 1KSHA 1F60A 4D80A 1SXJE 4LV8B 4P32A 5CB8A 1N6OA 3RYTC 1M74A 4UXIA 3BE4A 2B8WA 4B3FX 4GZMA 4X8MA 2V1XA 2JDIA 1G3MA 5FTLA 3E70C 3TH5A 4KFUA 2O8EA 5IHPA 2IYSA 3T12A 1IN8A 4RD6A 1XRJA 3DZ8A 3IQWA 5JSZA 4JLPA 1UKZA 1CS4C 3KKPA 1E9EA 2Q3FA 2IUTA 2IYZA 4TL7A 1P3JA 3CX7A 1ZIOA 4V0KA 1E9CA 3CF2A 4P4SB 3ZJYA 4MH0R 5K8UA 4GDFA 2RGBA 4MA4A 1IN5A 4TYWA 1GWNA 4PC2A 2VF8A 2DBYA 1KMHB 4PO8A 3QXJA 2GEVA 2F6RA 3VX3A 1T9HA 4Z54A 5JRJA 4BWYA 1LS6A 2E87A 1YR9A 1U9IA 2ZE5A 4P31A 4NP6A 4YMWA 3RRYA 4C0LA 2ORWA 2WSSA 5LB2A 1KSFX 3QE0A 4DCVA 3PUXA 4RD3A 1AQYA 4B2LA 2E1RA 3FPAA 2JLZA 3BB1A 3LVRE 3VR1A 2IEYA 2MSCB 3BAFA 1IY0A 2EVWX 2ZS8A 2V54A 1KO8A 3SYNA 1XTIA 2DFNA 2WBLC 3GLFE 4X8HA 2IT1A 2YV5A 3CWQA 3BH0A 4BRUA 4DLVA 4AD8A 1Q21A 1ANKA 1KO1A 2WPDA 2D7CA 2KSQA 1P2UA 3N5CA 3W9YA 1RRPA 1YZQA 2FEMA 1XPUA 1GP2A 1N5IA 4Q7LA 2GILA 2W2XA 2I1QA 3LW7A 1Z83A 2GXQA 2Z5FA 4JYCA 2NO0A 4JT4A 2ODEA 4LRWA 1YU9A 4RCZA 5FBWB 3SR0A 3PQCA 3WXMA 5BN4A 1EWRA 3KKOA 2GZAA 4US0R 4RKEA 3VHLB 4UNRA 3CX8A 4RSGA 3DKVA 3B6EA 4Z8XA 3L0OA 3AKYA 3N2EA 1OXVA 3RABA 4AKHA 3DL0A 5FOVA 2J7KA 4I81A 1W36C 2EW1A 4Q47A 4JLAA 4B2IA 3EAQA 3D3QA 4DSTA 4O25A 4OQLA 3W5IA 3ZS8A 2ZYTX 1TF5A 3VNVA 2ZRNA 1RKBA 3JVUA 2IBMA 1W36D 2R6DA 2IA5A 4TT3D 1H8HA 1CLUA 1II8A 3DM5A 4M2LA 3CLVA 4KITB 3HDTA 3BORA 4C2UA 1R0YA 3KXIA 3HWSA 1GOTA 4LV5B 4OQMA 4PHTA 4MRPA 3WNBA 4IVPA 1XEWX 3VNUA 1YR8A 2NO1A 3IPYA 1CR4A 3B1XA 1NL3A 1ZM7A 1OXTA 1VCMA 1XJCA 2FN4A 3LW8A 2IW3A 2VEDA 1AK2A 2FSGA 1T91A 2JA1A 4WVFA 3A1WA 1HA3A 2A3RA 1KI8A 2CK3A 5JI3E 3I61A 3GJ7A 3UANA 2QSYA 1COWD 5M04A 1W5SA 1E79A 1WA5A 1VYUA 2OAP1 1OH5A 3D31A 2J59A 4B75A 2H8KA 4Z8YA 1VHTA 3IIKA 1BYUA 1XXHB 2QAGA 4UKDA 3VHXA 2VA8A 1ZU5A 3LY5A 3VKWA 2X1VA 3TE6A 5DLQC 3U3KA 1KOFA 3GFPA 3IO5A 1KK1A 1F2UA 4U7DA 1QHHB 2WJVA 1AS2A 3SHFA 4V0LA 3BXZA 4NE2A 3ZIAD 4G5SA 4KLNA 4FN5A 4ACAA 1KTVA 3WYAA 4EFNA 3AGQA 3FKQA 3BFXA 1QHHA 4A82A 4G5GA 2QAGC 1JBKA 4UNNA 3AVPA 2ZI4A 4BUJA 2BMJA 2JDID 4W5JA 1VHLA 4LYHA 5EE1A 4OHXA 4RZUA 2ZXUA 1JPJA 2DWOA 1Z5ZA 4WZBE 1N6IA 2C04A 1OYWA 3PEUA 4FMDB 1D5CA 2VQSA 4PPGA 1ONBA 1KIMA 1AJEA 3B1YA 1R5NA 2OBLA 5GADl 4TLDA 2C98A 4Q9LA 3ZQ6A 4LHYA 4D4MA 3CNLA 4G01B 1N0VC 3AF1A 1OYYA 4TMTA 2BEJA 2Z83A 1ZC4A 4NH0A 1CP2A 5KDDA 5F98A 4JLNA 4V0MA 4A0RA 2ZR7A 1OW3B 3DM9B 4MKIA 3K0FA 1RRFA 2QBYA 2HT1A 5EXSA 3MUFA 5JHHB 3NC0C 3PVSA 1KI3A 5BYKA 5HPYB 4A36A 1J7KA 4US2R 5JEDA 3SU8A 2V8OA 2NMVA 2BWJA 5B64A 3GLGE 3PR1A 4ZCMA 2ZJYA 4W5WA 1NSFA 1XZPA 3QKSB 1KDPA 4WW0A 3A4NA 2QBYB 2CMKA 1VCOA 2BKUA 4GBMA 4A2PA 1PV4A 4R2IA 2VHQA 3LNCA 2PEYA 1DARA 4ASUA 1G5PA 4DSNA 1H8HD 4O0MA 4EPRA 4L8GA 2RHMA 2IXEA 3AEZA 2DFLA 2QG6A 4TLAA 4Q7JB 2OHFA 3CR8A 1GTVA 2CHQA 3EA5A 3FWYA 3GEHA 1SQ5A 4DT1B 3BGWA 5H8WA 1ZP6A 1DG3A 2BBWA 1Z6AA 4GT1A 3ZVRA 4BLRA 4D6PA 4GL2A 2XTMA 1DBSA 5C46F 2O8DA 2F3TA 1NF3A 3I4LA 1AA9A 3QXSA 4HAZA 3L8ZA 1HTWA 4D25A 2GK6A 4DLYA 1EFHA 1G3QA 1XEXB 4LHVA 4M9QA 2QY9A 1LF0A 3IPXA 3WMEA 3KJIA 2ZJ8A 4KVAA 4TT3A 3LDAA 4XD7A 1KI4A 4R7ZA 4IEEA 4KBFA 4QL3A 4MYUA 5FFMA 4PQYA 4BLSA 3CZQA 3IILA 3THXB 1PVOA 2W58A 5KSZA 1DEKA 2ASEA 4C2TA 3GEIA 4XIGS 1CR1A 1KO5A 2O52A 3A1VA 2V4ZA 4ZDKA 2P5SA 1JECA 3QBVA 1SHZA 3AVTA 2P5TB 4WZAE 1FQJA 2ERXA 2G88A 3EC1A 2O5VA 2CEAA 1F2TB 3SHWA 1U9IC 3QEJA 2MMCA 3KQHA 2IL1A 1NMXA 2GWHA 2WJJA 3ZZTA 1JAIA 1XTSA 4Q7MB 5KHOC 3FGNA 2ZRIA 2ZS7A 2DR3A 3FB4A 3Q9LA 2KBFA 4D4LA 3DKPA 2QA5A 3IHLA 2AXNA 1FPMA 3I73A 2OUKA 3H84A 4NCNA 3EPLA 2CE2X 1X86B 3JZMA 3OIUA 2IUSA 2XOKD 3W3ZB 4EPXA 5HZKA 2QL6A 2QI9C 4DC9A 4TYYA 2O8FB 4KYIB 5JJLA 2FZ4A 3DVLA 1A5TA 1TQDA 4MGZR 4OYHA 1OHHA 4RD0A 1A82A 1VKJA 4B3GA 3K0AB 1V5WA 2DWQA 4PO9A 5DN6A 3CRVA 2QPAA 2Q6TA 2I1VB 4LYJA 4ERNA 1RIFA 4NYIQ 4B44A 1JQJC 2RGEA 4Q02A 1IY2A 4KVGA 1F2UB 3UK6A 3MWLA 3FDIA 1YHNA 1U8ZA 3TQFA 5C4MA 1OB5A 4C7OB 1DADA 4LC1A 3K8YA 1JEDA 4EPYA 1Z47A 2VP4A 1K5DA 3KX2A 1TU4A 2XZPA 1UADA 2AXPA 3UMFA 1YZNA 4B35A 2BCJQ 2WMOB 3S1AA 3HJNA 1RJ9B 4HDQB 1A1VA 3T34A 4TTQA 2A9KA 3BB3A 4QJ3A 1VIAA 1NRJB 1R5BA 1NKSA 3B9PA 4QGHA 4CEIA 3GJ4A 2Q3MA 4RFVA 5IRCD 1WB9A 2VP9A 2VP0A 2HLDA 1VG1A 4GRAA 4LZZA 4OKSA 4PQRA 1Z2AA 4D4JA 1G8PA 3SJCA 4AIIA 2VP5A 3BH6A 3TBKA 3QOFA 4MDEA 3PJRA 1OKKA 1OFHA 3VKHA 3ASZA 1SVOA 4YDHB 1E9DA 4E22A 4O3MA 4G5RA 4PZZA 3CPHA 2V1UA 5HE9A 1G8YA 4IXNA 5KNBA 4OJQA 2ZPTX 3ONWA 3T1TA 1R8SA 1XX6A 2LKDA 2VHCA 3C16C 3I32A 3I72A 1HYQA 4AK9A 4F7WA 2E9SA 2IF2A 4OBEA 4B73A 1U81A 3NC1C 4LJ8A 4C3ZA 3P20A 2QSZA 1XTJA 4ON9A 3AQ4A 3U7HB 3ND8A 3EIHA 4BASA 3U3JA 3QBTA 2EQBA 1G64A 2PT5A 4B2PA 1V43A 1D2NA 4I1VA 4OQXA 4OQFA 1TNDA 3TJZA 5J4LA 2XB2A 1WQ1R 1HUQA 4DXAA 1DVRA 2QNRA 2ERYA 2FFAA 5HCNA 4GP7A 4GFDA 1NKTA 2YC4C 4LHZA 3LBHA 1LTQA 1NVVR 2ECKA 3R20A 1GL6A 4A8JB 4PZYA 2FWRA 2AKYA 4G5QA 5HZHA 4UNSA 1NJFA 4GMXA 4HUQA 4OK5A 3TIFA 3DPUA 3V9PA 1J99A 1P9RA 2PX0A 1Z6TA 3K0CC 3QJYA 3E1SA 3P4XA 5EUMA 5CITA 2WOOA 1O87A 4RD4A 4I4LA 1UEJA 2PBRA 4DCUA 4H9GA 1OIVA 4HZUB 4A8JA 4BFZA 2O8DB 3MMPA 4E03A 1VG8A 2WIAA 4DB4A 2RMKA 2H7VA 2ZSBA 4GP6A 4DEXA 2EFGA 2ZITA 3VR4A 1SZPA 2WHXA 3TGPA 2AKAB 5FI1B 5E3HA 5AWFC 2ZRJA 4IFEA 1UF9A 1ZUHA 4TYQA 2MSEB 3L82B 4HSEA 4Y0VA 3RRZA 3EX7C 2VHUA 4M0LA 3QPWA 3X1DA 2J0QA 1SXJC 5GJBA 1GSIA 2HCBA 3U3OA 5FPKA 1E4YA 5HE8A 1M7HA 1NBMD 4A9AA 3THYA 2F43B 2WWXA 1U8YA 4FIDA 1VCIA 3BWDD 4M21A 3UMSA 1CR0A 3GJXC 4DLUA 3C7KA 4ILEA 1Z0FA 3VR6A 3KB1A 3NXSA 4IFBA 3ZYCA 2CLDX 4UQOA 3KZ1E 4BFVA 3V4FA 3PIRA 4TQAA 1NNEA 1FTNA 2UZIR 4I1SA 4Q4HA 2CVHA 1X8JA 1OF1A 4TQ9A 5DE3A 2R8RA 4DWJA 2Z43A 1E9SA 4MDFA 2JLRA 2C99A 2O0KA 3QG5A 4QBIA 4XTRA 4XOIA 3RWMB 4BFXA 2FDCA 4Q4HB 1EFRA 1F6BA 2Q3HA 1ZNWA 1MR3F 3ZH9B 3G0HA 1FNMA 3ZVNA 3L0IB 3MAAC 2GNOA 4N0EA 2QPOA 1YQTA 3T15A 1KJYA 4B47A 2VSXA 4QHTA 5FL7A 4TQUS 4CF7A 1GVNB 1VCNA 5JLJA 2Q9BA 4Q01A 1KYIA 5G41A 4AKGA 1FX0A 1IAQA 1N6KA 4K8OA 3R9IA 2OFWA 4FMCB 2FPMA 2VL7A 5FOXA 5J40A 1DAHA 2DWPA 1R0XA 4OJKA 1M7BA 3WHLA 1VG0B 1W46A 3ZDQA 2QRZA 1Q0UA 2ZAMA 3AH8A 2FH5B 1YZGA 4IDNA 4B33A 2QQ0A 1ODFA 3U4QA 2QMHA 3WP0A 2BC9A 1JEEA 4NYMR 1AS3A 5J4YA 4WAUA 3EG5A 4ASUD 1JJVA 3K0FB 4RZ2A 5CK4A 3K70B 5GJVC 3I62A 4MQBA 1E2HA 1ZCBA 2RGDA 1RE0A 2AL7A 5FUYA 4YMSA 3AKDA 1AN0A 4JLOA 2OCYC 3LX5A 1N6RA 5IDVA 3UKDA 4B3CA 1NN0A 4S35A 2JLWA 1KAGA 2CBZA 2GDJA 5D3MB 1VYTA 4NCIA 1JJ7A 1G8FA 4BEJA 2QE7A 3UPUA 4PPFA 5CB6A 4BLTA 4BPBA 2IK8A 3A1TA 2G9NA 1VTKA 4QM7A 3GPLA 2GK7A 4QGAA 4AG6A 2C9CA 1DG1G 5E7JA 2G1JA 2JLXA 2V6JA 4B32A 5EE0A 3MJHA 3AUYA 2FFQA 3BK7A 5TB5A 5EQTA 4L9WA 2WOJA 4ZV4A 1GNQA 1WXQA 3TW8B 1L4YA 2IYVA 3ADKA 3QXXA 5DNYB 2KB0A 4ESHA 2CXXA 1L8QA 1MT0A 3B1WA 4NZYA 3HR8A 5EP2A 1P9WA 3ICEA 1Y3AA 3QKRA 4M1OA 4WZ6A 4Q7KA 2F9MA 3B1ZA 3CNNA 3UIEA 3NBXX 2GXAA 1NLYA 2OEPA 4HB4A 1LF5A 2DHRA 5HCIA 4DZZA 3VR2A 2QMEA 2ZRKA 5J4KA 3R9XA 2OE2A 3O8BA 1MOZA 2AN9A 3WBKA 1QZXA 4N1AA 3Q5DA 2DPXA 3W6PA 3LBNA 4LOAA 4MRSA 5C2JB 1HY3A 1NIPA 2FSHA 2WTUA 2ZRAA 1GM5A 2NIPA 3LRPA 2GJSA 5SZHB 1P61B 2ZUDA 4DB2A 3DEFA 4LSGA 2O8FA 1CULC 2RGNC 4W7SA 2W2VA 1XFAA 1TUEA 4QGFA 1ZRHA 1QHSA 1P2VA 3B2EA 3KKNA 5JECA 3REFA 2GJKA 1HEIA 1XBTA 5J4HA 4HI0E 1SKYB 1KMHA 3A1UA 1Q1QA 1S0UA 4QNMA 3LQQA 4IOKA 5JRZA 1SHKA 1W36B 2Q21A 3B9QA 5DYIA 1EK0A 2N46A 4DDTA 1W0KD 5JS8A 5JWHA 3X1YA 1K6MA 4NL4H 3SDZA 3KQKA 1W47A 4R71A 1KZ7B 3WHKA 2UKDA 3OFND 2IC5A 3HU1A 4LPKA 1I2MA 1HQCA 4Q00A 1VPLA 4BLQA 4C9BA 1CJMA 4Q4AA 1U90A 2ZRLA 2ZM5A 4Q4JA 3DHWC 3IIJA 4HZIA 3I1FA 4Y0AA 3SE0A 4CIDA 1AIPA 2PLRA 3CR7A 2GJ9A 2WVJA 1KDOA 1I4DD 3NH9A 4M22A 5JMTA 3EA0A 1AZSC 1E32A 3U3RA 3ADBA 3CM0A 2A5YB 3RLFA 4JLDA 5G3YA 1J90A 1T3LA 4C30A 4DUGD 3GLFB 2WWHA 1Z6XA 1HH4A 3NBFA 4F4IA 4JLVA 2ZU6A 1NI3A 1RJ9A 3KTAB 2JLUA 4HAVA 2A5DA 3Q7QA 4KLZA 1PLLA 2IYXA 3I3SR 4DT1A 5H1YA 1AM4D 1XCMA 1WP9A 2BBTA 3SC3A 5CDFA 3T5DA 3GLHE 1SGWA 2WSSD 5JWRA 2BCGY 2IS2A 1KDRA 1OIWA 2VLIA 1XPOA 3VKGA 1GL7A 3QQ5A 5TVKA 5A5GA 5DN6D 1L2TA 1Q1BA 3RS2A 3HU3A 4FMCF 4M9SA 2BBSA 1U0LA 5FI0B 1EFUA 5FUWA 5GVRA 1G6HA 821PA 4XH9B 1G3RA 2QAJA 3WMGA 2GCNA 3CX6A 2ZSAA 3UXMA 1G3IA 2G3YA 5DISB 5GJCA 2FFBA 1D9ZA 4HAXA 2OCPA 4AYXA 4G5OA 2RAPA 1SVMA 2F1IA 4G0NA 1DO0A 4B3XA 2GETA 2RKOA 2ZRDA 3QKTA 1R6BX 4MKHA 3CH4B 2FE4A 3AB3A 3AVWA 2A78A 1DAGA 1XMVA 2R62A 5JCPA 2DYKA 2R65A 4Q4LA 3EARA 4IDOA 1HQYE 4PR0A 1E0JA 1BOFA 3SBDA 3W8RA 5KPDA 4MKFA 1E4VA 4EJSC 1E1RD 2PMDA 3UG7A 4IRUB 2QRNA 1G8GA 1KZGB 3RANA 2JLSA 2GZDA 2ZS9A 1EGAA 3C15C 2XJ4A 4LJAA 3R7WA 4ZKDA 4ZCLA 3U44A 3ZD7A 2XNDD 3UMRA 3MWKA 2JLYA 3AVXA 1IBRA 4EQ6B 1E2QA 3CUEF 1RPZA 3EPHA 1MO3A 2GXUA 1Q20A 1FP6A 1FZQA 3FMIA 3PENA 1I2DA 2OXRA 2H18A 3ADDA 1EG7A 2A7QA 4KSBA 2OG2A 4BZPA 4C4PA 2QGZA 3I8XA 5A0FA 4LV6A 2QROA 1PLJA 4ZI3A 2J7PA 1M1YE 1Z0IA 2QM7A 2ZTSA 1OFUX 3K9NA 3IIMA 2NPIA 3C5HA 3SOPA 3OIVA 1NJGA 3NWJA 1C4OA 2Q9AA 1FUKA 2C9YA 4QBHA 4JSYA 1SXJA 3SZRA 4KHZA 2ANCA 2CE7A 2H92A 1E2MA 4JL8A 3NG1A 1TMKA 1UPTA 2WAYA 4P0TA 1NLZA 5G40A 2F43A 2H17A 1L4UA 3FVQA 2GBLC 2CCGA 4LBVA 3W90A 3HYRA 1XPRA 2NZJA 2HLDD 1NP6A 4PFSA 3U2QA 4NPHA 1TQ6A 3TVDA 2G77B 3GMTA 2CHVA 4YONB 2D62A 3AF0A 4KODA 4NU0A 3A36A 1FX0B 1Z06A 3KJGA 3PUZA 1FQKA 4FCVA 4L4UA 4PSVA 4ZKEA 4QXAA 2IWRA 3SJAA 1Z6YA 3TUJC 5JFGA 1TPZA 4A4DA 4HDCA 5B30A 3MFYA 4AC9A 4IOLA 2B7BA 4PTLA 5GVSA 3Q72A 1GRNA 2DFKB 2OCBA 4MRNA 4OK6A 4DLZA 2XXAB 4DEYA 4M9XA 2J46A 2QT0A 1T5IA 2ZU0C 3LD9A 3EWSA 1PZNA 4GSYA 1ZUIA 4MUBA 2AK2A 2ODWA 1XCGB 3EIQA 4NYIR 3NHBA 3O47A 4LC0A 4V0OA 4C0HA 3MGCA 5B58C 4FMBB 2BBOA 4WA7A 1KNXA 2GKSA 1YE8A 4KO8A 1P2TA 1S3SA 3TNFA 4JLJA 4JBWA 3KKQA 1NVUQ 3F3YA 5AJWA 3TK1A 1Z07A 2RGNA 1M34E 4F93B 4EPVA 1CF4A 2NO7A 4LJYA 5D3MA 2ANBA 5FTMA 3TSZA 4A8JC 3GLGA 2WSMA 1N3BA 1IOZA 4M1YA 1KI9A 3I5YA 2VP6A 1XEXA 4HB3A 4QHYA 1ZYUA 2VPPA 1E2GA 3RWOA 4AWXA 5BQ5A 1NY5A 5EE9A 4LBWA 5KUTA 1N6NA 8OHMA 2Q9CA 5K8TA 1G9XA 2XX3A 5GJWC 5BWMA 2AD1A 3U60B 1GKYA 5H70A 4BLOA 4TMVA 1OT3A 2PT7A 1YZUA 2WM9B 1Z63A 1OFIA 2GA8A 1A7JA 2EYQA 4V0NA
chains in the Genus database with same CATH superfamily
3X1ZA 3L0CA 3QX8A 3SBEA 3KV3O 3ZHBA 1VLJA 1JQLB 3U16A 1GAQA 2CCKA 5TQ0A 4CQNA 1NM5C 1NVTA 2HA6A 1WIWA 5E6SB 4CG3A 4KV7A 5DM0A 3D8NA 4E70A 1E92A 3OI7A 1JWLA 4Y6GB 2ZWPA 5U9CA 4O1IA 3EY4A 1H8ED 4HWGA 2ZZNA 2GM9A 4FP9A 5JAOA 4XIJA 2WJZB 2E6UX 4OFWA 4GM1A 5F5NA 3A9VA 2AOUB 1T1SA 2C2HA 2G9RA 3KDPA 4GU5A 3K9CA 4Q9AA 2PD6A 4F1KA 3ZLUA 1RWMA 4YCAA 2C7BA 4S1TA 5T4BA 5CPFA 1SXQA 1DI0A 1WDMA 2IVZA 5EE5B 3T5GA 1PD1A 2QR5A 2H57A 4DBZA 4R98A 1OAOA 2AG6A 4JI6B 1DOHA 1YB1A 3H13A 3CISA 1L9XA 4IO1A 4D98A 4DV7B 3AXTA 5F7OA 4DWWA 1A9TA 1LQTA 2IUFA 4U7TB 1IBMB 4BZXA 3OECA 3M70A 4WMLA 1S6YA 1GG8A 5REQB 4BMVA 2ZJ2A 2A9QA 2FZLA 2QOEA 2LTAA 4DJ5X 4IJ5A 1KXJA 5HJ7A 1EFRD 4J03A 5K2OA 2QTBA 5D3QA 4D4HA 2VPWA 1NXWA 2Q4BA 4UEJA 5CM8B 2Q5LA 3QQPA 2AWNA 1PZXA 2J45A 3A9CA 3EA4A 2IBSA 2MYUA 1UDCA 5IHXA 1R0LA 1I5OA 2JS7A 2XUAA 2D2EA 3MN1A 3QG1A 4G63A 3UJAA 4L5JA 2HWYA 5L9AA 2UYYA 3PGVA 2V98A 2DBVO 4OXIA 4S1PA 2JK1A 2QIPA 5K0TA 4KI7A 2A9RA 4N5HX 4WFIA 3VO1A 3UJDA 1F5SA 2A67A 1J1ZA 3OPVA 2VH2A 4H6VA 4XWAA 3BXGA 5E3JA 1OX6A 1WMFA 2NO5A 3RYFB 3ELDA 1PLKA 1Y1QA 2WTXA 4TV9B 3ZD6A 3M6IA 4IJ6A 4PO1A 4WX2B 1T1EA 2QJOA 3QHAA 4JQSA 2J3KA 2R84A 1SBNE 4CCAA 2DBQA 2HJRA 1BJRE 2PGOA 1PVVA 4PXAA 4DPKA 4DJFC 3PUVA 3PE4A 4RCVA 4RHCA 3UAXA 2VAMA 1VIVA 2IZZA 4P81A 1QG6A 2ZVDA 2DF8A 3FVWA 1HZZA 4HRYA 4WGGA 3IT2A 3KB6A 3A1NA 3AHCA 3FYTA 3Q1KA 2C4UA 3QVUA 2NGRA 1OD6A 3LVQE 4A2CA 1VSBA 1REQB 2GCEA 1V6CA 2JC3A 3L4EA 4Z3OA 4ZGWA 1ZIYA 3EVZA 4RPKA 5DTEA 3RJMA 1KWGA 2AFHE 5AW6A 3F5SA 3QX9A 4C7JA 2RBKA 5B1YA 1EE9A 3HPQA 5AHXA 5LMZA 4AS1A 3L7LA 1TADA 3IT1A 4Q9DA 4FDMA 4Q3DA 4YRLA 4UBOA 3LCRA 4G1UC 1CR6A 4OKIA 4KK3A 3LHKA 2UZ4A 5DSXA 5LSAA 4GXTA 1JHMA 2IYPA 2NQ8A 1MRSA 1QG2A 2VK4A 2FEAA 1VM6A 4R8VA 5FUVA 1PP4A 3QEAZ 3KG2A 5KNDA 4BAGA 3VNBA 4E5SA 4ESEA 4JLMA 2AFHA 2HRBA 4ARVA 1LC3A 2ZBUA 1AKRA 1Z2DA 2FG7C 5FBRB 4BQOA 2AA3A 1EFAA 4M89A 1L3BA 5EZYF 3P9SA 2PSEA 3ICPA 4U7FA 1V3UA 4LF7B 3LOQA 4QJBA 4OGLA 4JXXA 1RADA 2H52A 1DJMA 2JFUA 3AJ9A 4G9BA 3VZSA 3G9TA 3THYA 2H2HA 3BB4A 1KHHA 1ZINA 3DFIA 3PYLA 1R1DA 2YXPX 1JLMA 3FNBA 2VWHA 3MTAA 4MB6A 5FD8A 5IZ4A 3PC2A 2F3SA 2OGZA 5DHAA 3S1SA 3GT3A 3KXPA 4PIVA 2IYWA 4TL9A 3RVJA 2RARA 2QRVA 4FYJA 1QFSA 3H86A 3SYLA 3ZS9A 4ILKA 4F45A 1CW2B 1IPFA 1J9ZA 1L5RA 1W5AA 2D1TA 1P4RA 2ODNA 3WMFA 1FSGA 2PTHA 3M82A 1AXGA 1XRRA 4NDNE 1VLHA 3CUSA 2XOKA 4NYJQ 5EZ5A 1P7PA 4DS3A 1U2TA 1WSWA 2DZDA 3UXEA 1JW9B 1KP9A 4DDHA 5JIBA 3WWCA 721PA 1T9KA 1N5JA 2YWJA 3A25A 2W2LA 3OZDA 5JUWA 1NVFA 4CU5A 2C7RA 1K5GA 2O8CA 4ZMSA 4LY0A 1EK6A 1OXBB 2AYXA 2L17A 3DHEA 4GBJA 1R4ZA 5E8RA 5LUBA 4E5KA 5F35A 1EFVB 3LXRA 4IDPA 4KQEA 2V5AA 2X1MA 3EZ2A 1UZMA 2Q4OA 3SXJA 2YY5A 1FFAA 2LDBA 3EZ6A 1JJFA 1XPJA 2GHQA 5TQ0B 4UTPA 4KR9A 1VJ1A 3IOCA 4RTPA 2BEUA 1M2OB 4OEHA 2BELA 2E21A 1UKAA 3D8BA 1ZK3A 3THXA 5A9RA 2Y1GA 4IR7A 1LPSA 3BJRA 4J0JA 5KPJA 4D26A 2LUOA 1ZO8A 3RSSA 4PX5A 4D0LB 3NUQA 4R4JA 5EMHA 5IX8A 3TL6A 4PX9A 4ZIRB 3BFVA 3SYRA 4CDNA 1Y1KE 1ZGCA 1LVHA 1VMAA 3QMPA 4X66B 2LWIA 1J2JA 1OLXA 2XAAA 3OEWA 1GPNA 3T95A 5KYKA 2Q41A 2WUFA 3OFKA 1HEUA 1GKKA 2H1WA 2PL1A 1R6TA 3C5EA 4IG9A 1JAYA 4UFPA 1G9TA 1Z2CA 2DUNA 2JH8A 3T0FA 3IAXA 3KYDA 4EG1A 1Z5VA 5JNVA 1H65A 2I6SA 3WZLA 4V02A 1RJWA 3K20A 4PC3A 1F5NA 2X2FA 1DIGA 3KOMA 4MHTA 2D5LA 2GF0A 5ALZA 3SEZA 1JAXA 3MT0A 3L7NA 2EF0A 2M6RA 3DV0B 1X7GA 4LI0A 3INGA 4OD0A 2JVIA 3MRSA 3GJ8A 3TTXA 4PSDA 1NW3A 2XQKA 3VR5H 4W9RA 2OV3A 4U9HS 3K96A 2GCPA 1Q1AA 1V8DA 1XLTC 1G4UR 3GH1A 1UKBA 5AKGA 3SQDA 3UWMA 4F3KA 4RF5A 2EKPA 4RZXA 2C96A 1E3SA 1LTHR 1U0HC 3K0AA 3VPHA 1NY6A 1E18A 1RPJA 5TDHA 1JU9A 1JJAA 3FMOB 5HA5A 4U0KA 3M6UA 5C1OA 3HXQA 1FP4A 3L0DA 1JQ3A 2GH1A 2RK6A 4WV3A 3RYHA 4AQ7A 4QAJA 1B76A 4FFRA 5MGNA 2F4NA 3G0IA 5J63A 3RU9A 1RLIA 1Q12A 4C7OA 4D9JA 3EHDA 1QHGA 1UQUA 2KW5A 3E9MA 2B6HA 3N39C 4MYRA 1QVRA 1AKYA 2P5YA 3QOXA 4GOXA 2J08A 1RPNA 2F00A 2YJTD 2R6AA 3DDUA 3LS2A 3CG0A 3PXUA 4A3SA 3IKMB 3QM1A 2DCMA 1IJKA 3LCJA 4CEJA 1TA4A 4RVFA 4BU1A 2DCUA 3UEOA 2E4UA 1ZJ5A 2QLLA 1KK3A 1SCUB 1ZH0A 3A1EA 3KSMA 2R4TA 3FSGA 4GPBA 4JROA 5B1DA 3RYCB 1JLSA 3H2ZA 1THMA 2C5SA 1HYEA 4UM5A 2QN2A 3GQBA 3V8QA 1QR2A 3RLIA 2IXFA 3I5XA 3PG5A 3BRWA 3O92A 1FJHA 4HEA6 5IBCA 3SLKA 5DLYA 5ALWA 2OXIA 1R0ZA 1XOIA 3NUZA 4BO7A 5CD1A 4PONA 1U2ZA 1XCLA 3DMNA 3QXCA 1KS2A 1G59A 3OY7A 2HWUA 1US8B 3I34X 3FVRA 2H9IA 3PFNA 3FOZA 3NJ8A 1PEKE 3LZ6A 5C9ZA 2WINI 1NFRA 2PY6A 1SEVA 3A26A 1OVMA 1JA0A 1LBEA 2J9ZB 2VHJA 4M1MA 4IYRA 3QKUA 4BB6A 4M0FA 4AJKA 3DVRX 1MQ9A 1ODKA 2ZVPX 5KOHB 3LLCA 3CT4A 3E7DA 4NECA 2FCAA 4UHKA 3TTSA 3ZX5A 4DWOA 1EWQA 1K3UB 4PLPA 5E2AA 1XTZA 2G5GX 2L0XA 2XVZA 4G4IA 2WG1A 3GLIA 5F4ZA 2YJNA 4ECAA 4EMUA 2CNWD 3EUFA 2WAMA 1Z25A 2NYUA 1B15A 4JU8A 4A6EA 4N6GA 2AFRA 2YWRA 2IVFA 3UB4A 2OM6A 4YRDA 4B34A 2MSKA 1HDGO 1MH1A 4MYSA 2IX9A 2R7KA 4JI2B 1ZOOA 2Z30A 1F8UA 4JJ8A 4E5YA 3EQZA 3MJDA 1Z2OX 2JI9A 2PH7A 4WZZA 1L5OA 2GFQA 1IXKA 3H19A 2BDEA 4W5HA 3SSNA 1RJFA 4DA8A 1MUUA 2GYWA 4HDMB 5GM2A 1WBBA 1WPQA 1MQSA 1Q7EA 3GFGA 3VR5D 4RZ3A 2CYCA 4QYWA 4CV2A 4EI7A 1A8QA 5AT1A 1COWA 3TNDA 5IUNC 3GY0A 4IVQA 4GR9A 3S81A 1OBHA 4K87A 4FD2A 4OOFA 4B74A 3ZOKA 4G1MB 2HA2A 1NHGA 2HADA 4Q5IA 2MSDB 4JBXA 4UXJA 4ZZ3A 4LCEA 1XAHA 2QTHA 2DQ4A 4GPTA 1P9LA 5CVCA 1KI7A 2BLNA 4LF9B 4R8MA 1MOPA 3L46A 2OAQ1 1VE1A 2P6RA 4TQGA 1N25A 3EK2A 3R5FA 4RVCA 4INAA 1EK1A 1Q84A 3H5LA 1EKXA 4R8SA 4BFUA 2BV3A 1ZWLA 3EXIA 3FMFA 3P9NA 5JCJA 2PKQP 5C37A 2JANA 4XB2A 1M72A 5EIXA 2X19A 3H1BA 1OAOC 4URVR 1GCUA 1ZBDA 2O6HA 5IVIA 4TWBA 5IYZA 4BY9E 2XMQA 5LPNA 5FBHA 4P0PB 5CGZA 3AKEA 4LXHA 3QITA 5AO9A 3SYKA 1SVWA 1CS0A 3MJEA 4O4JB 4TLMB 3D64A 2PZEA 1ZD1A 3HDVA 1CIPA 5MN6A 4YLYA 1EQUA 1EXMA 3FIJA 3KKLA 3AUSA 4O5AA 1T5LA 2Z4RA 2BP7B 1CD5A 4MQ6A 4UVIA 3TS1A 2QVYX 1TA0A 4NKRA 2J1LA 1QGED 1SC1A 4KDRA 2P8JA 3L77A 5CEJA 2XCRB 2R7LA 2R8BA 3MD0A 3CLRC 3CUYA 3PFKA 1VIDA 3H9GA 4QELA 3Q8LA 5LQSA 1HV8A 2N42A 4FDVA 5HF6A 2I8AA 4L9SA 4IQ8A 5EZSA 3UHOA 4BVBA 2FMXA 1AOXA 4KIUA 4B3DA 3TOVA 5JADA 1HMPA 4QRIA 1Z7WA 1Z9BA 3A6FA 1Y8RA 3JVEA 2ZI7A 3EODA 1T13A 2WKPA 1EG2A 2B5OA 2I7CA 4H3HB 5DYGA 1UDXA 4DV1B 4QEDA 2FLWA 4YV7A 2YQ5A 2J9GA 1FC0A 4OL0A 3PEEA 5CMLA 5JCOA 1P5ZB 1TIPA 3E2PA 1FTSA 1JEYB 1J0XO 4TX1A 1AKEA 2HPAA 1M33A 3G8BA 1A4XA 1ACJA 4FEGA 3ZV5A 4PBTA 4TWRA 1RRMA 5TX7A 4XDYA 1QRRA 1Y1PA 3QE4A 4RK5A 5EIWA 1ULAA 5K9ZA 4A91A 1PJRA 1Q3KA 1R5OA 1KAOA 4UE6A 5FNVB 3MCAA 3CEHA 4ZHQA 2C42A 3R3YA 4U6QA 5LZ2A 5I45A 3RU2A 1IQPA 1JIIA 4FGKA 1I3LA 4W5TA 1B0AA 1Y81A 4XJSA 3TAHA 2IYTA 4R8KA 5AJHA 3A4YA 1IZZA 3GJ5A 4QBGB 1EUCA 1A76A 2OILA 4F38A 2R1TB 5FTJA 2XF8A 3EG9A 1PR9A 3LFUA 1RWOA 2L19A 3CE6A 4HRAA 4DYVA 1BA3A 1LLUA 1Z4QA 1FYVA 4DQXA 1ADYA 3GLQA 1ML3A 3M0EA 4XVQA 5TJ9A 2VYFA 3QNUA 1DQYA 3USES 3P27A 2VJKA 5BR4A 1XA0A 5F3WB 3CURA 5SYAA 4Q7QA 1DX6A 5HMLA 1SCDA 4OP1A 1L4LA 2C7OA 2NVOA 2VDNB 5IM4F 2AMYA 1NURA 3IBTA 3LM8A 4J7AA 4QOSA 5DNDA 1E5VA 4IEIA 3ZOZA 5C53B 4JYZA 1E6MA 1NJ8A 2FYTA 5IULC 1TJYA 4X65B 4TOIA 1UJ2A 2H48A 3CRRA 3ZLBA 3HA5A 3FOAA 3OC0A 4JL6A 2R6ZA 5FIUA 2YXDA 1E8DA 2JD0A 2PFGA 5EIFA 1A0OA 1Z29A 4BQNA 2WPDD 2QJFA 2LR0A 2B34A 1TK9A 4NCXA 2PMKA 4XDZA 2JPDA 3HBAA 4JWTA 3S44A 5L3QB 4AURA 1XTPA 3U61B 3J81k 4CEJB 1QC5B 2HJGA 4HX9A 2JNWA 1C4XA 2ACKA 3ZE8A 2PUJA 3G2IA 4JR0A 3TVTA 3ZWCA 4LJKA 4LXIA 3RRBA 2OSVA 1H3EA 2YYZA 4MS4B 4D9FA 3IXQA 4EF6A 2QN6A 3KL2A 2YFKA 3AF3A 4FXPA 2VF4X 4BX8A 4BIMA 3PB3A 5B57C 1KEKA 5JVDA 2ZIXA 4OTZA 3MD9A 1Z4LA 3GZNB 5JNLA 3DG9A 3BCSA 3P9XA 2J6CA 3CINA 4BAZA 4C3VA 3O8CA 4EEKA 2FQYA 3MUNA 4LHSA 4CKYA 1AS0A 4TMKA 1F8XA 4HB0A 5LD2B 3I2YX 1HG1A 3V80A 5TC4A 4ID9A 2PZLA 3ZE0B 3ICWA 3LK7A 1EWKA 2JJMA 3H9BA 3NVKI 3OIWA 1LBHA 1IJEA 4NE9A 1IM2A 1KPGA 1QOPB 4BNYA 3KAJA 4FI3F 3U6BA 4XRGA 5I8PA 1RKVA 4PYNA 1E59A 5FHQA 1JE1A 3K0EA 1N8NA 1YVDA 1FS6A 4JSTA 5JQGB 3GYBA 1XNHA 1PNRA 2RHTA 4DR3B 1NNEA 3I6ZA 3PPWA 4Z0TA 1SCAA 1LD3A 1NBHA 5FLKA 1XD9A 3UHFA 4AX4A 4NG5A 5DXFA 3KVRA 5ENZA 3ZV6A 3VXKA 2I3BA 5DNEA 1WR8A 4ZT2A 2OFOA 5JY1A 2G9UA 4HZGA 2XUZA 3K4PA 3I42A 4UFNA 3H2YA 4GOJA 1VJDA 2I2WA 4NK5A 3THWA 1CZUA 2BHRA 2TMGA 3AESB 3D2BA 3JARB 3OJCA 1FF9A 4JLKA 3NFYA 4EGCB 5JWOA 3U6KA 1OB2A 3B3JA 2I6QA 1SKAA 1TJPB 3H11A 2UZ3A 5JMWA 3RAGA 2E82A 2BSAA 3I2KA 1X77A 2BMEA 4GW3A 4HN9A 4PF1A 2VT3A 4XTCS 3VKVA 5IWAB 2PGLA 1BZYA 1K7YA 2XAUA 4Q4AB 4EA7A 4Y1GA 3SI7A 4IJWA 1IMJA 4ZQCB 2OQVA 4C6TA 4D82A 2WQ6A 3EPJA 3QFRA 3VR3A 1GQRA 2PZKA 3N8DA 2WIJA 2QJWA 4JXJA 3Q9NA 1MT3A 1L1QA 4K8RB 2PX2A 3TMAA 1YS6A 2GPBA 4PC7A 1YSCA 4RKRA 2WUDA 2C4KA 3C97A 5CLHA 3NO4A 4E5NA 1G3UA 4GVPA 3MVEA 4PLFA 3NONA 1T43A 5CVJA 3RI3A 3KAQA 2FPUA 2IIQA 3BRWD 2N1BA 2HHLA 3C45A 1M5UA 5JSKA 4D57A 1CTQA 1GYPA 1UKYA 2ZTVA 3KYCA 2GAAA 2QS9A 1NV8A 3JQQA 4QYXA 3MILA 4KQFA 3T1OA 1TZ2A 2D0OB 1NZDA 3E0XA 5H80A 1ZJYA 4B45A 4DZTA 3H1PA 3ADCA 2NACA 1ZIPA 1NWHA 2OV8A 4HYEA 2JIBA 4GE0A 1B6SA 4Y2PA 3UAWA 1U2PA 3WAKA 5I7HA 5K8LA 3OZSA 4M1EA 1JHYA 2JHCA 3JQ8A 1H2EA 1VE7A 2WU1A 3OF5A 4A1FA 2GRUA 4EKGA 3GQBB 5J47A 4BAUA 2GVNA 2IDKA 5D7BA 3T4XA 5AM2A 3FTNA 3HKBA 5AKIA 2ZTHA 3LBIA 3Q85A 5AOAA 1QBKC 4QOJA 3FLBA 3FUUA 5BW4A 3WZ2A 1ZM4A 2LNDA 4IVNA 4X7PA 4RV4A 1LPBB 3FCYA 2W6ID 4LSMA 1BYIA 1H3FA 4RF3A 1UPCA 1P0PA 4FCWA 4UZSA 1MENA 1VKRA 3RJZA 4NYJR 2WTNA 3O94A 5FCDA 1I3NA 5IJ0A 4FB4A 3UJ9A 4WZAA 3VAAA 1UM8A 4HS9A 3SIPA 1OXUA 2BT4A 5BO5A 2NAFA 1GO2A 1SMKA 1N4DA 3R6DA 4X1KA 5H68A 5JAHA 3H42B 1MB0A 4C0KA 3K6SA 2F1JA 1IUOA 1JNYA 2BTQA 4R2HA 1U4OA 2YC2C 3RFTA 4YMTA 3DL2A 3JSAA 4I1UA 4YJHA 5JANA 3VR6H 1X1RA 2RGYA 3NANA 4O4IF 2NU9B 1A9SA 5TMEA 1HFJA 1X9IA 2SBTA 1GNRA 1J70A 2PO5A 4Q9JA 5ALNA 5LDDC 1M2EA 2X4DA 3DXFA 2PH1A 1YOVB 3M9XA 3TD9A 1L5SA 4WBNB 3HEMA 1JSZA 4RZIA 1RVV1 2JEOA 5AIAA 2F8TA 2WJ4A 2QRGA 3CF0A 3WGYA 4C4YA 3K0CA 2E6KA 3HSSA 1XTQA 4HUTA 3HVKA 1SU4A 5KQPA 2JAUA 3Q10A 2FAXA 5D85A 3VNAA 1I5EA 2Q6VA 3LUDA 4KBGA 3H5TA 5KSYA 3QMMA 2I80A 4U6NA 4OYRA 3SM9A 1TUBB 3DC7A 2JFQA 3P0JA 4EKNB 3MIIA 4ZO6A 1JFTA 2PQ0A 2CDNA 3ND6A 3D6JA 3AOEA 5TPWB 1PS8A 4B9EA 1RAHA 2QRJA 4URWR 4Y1RB 4YLGA 3VO9A 2IF0A 3SGLA 3T3GA 5JD5A 3NAGA 4B3JA 5TPZA 1W7AA 1VDZA 2G0TA 1V5GA 1W0KA 1XN4A 3GDGA 1KO7A 1U8UA 2OSBA 4Y2RA 4E32A 3VTFA 1X9GA 1X9HA 3C6ZA 1EAYA 3HUUA 4HAYA 1EDOA 1A5ZA 3HN2A 4FJ2A 4KXFB 1H2WA 3JATB 1YL5A 4DW8A 4CKCB 3EPRA 3EASA 3OHMA 1DT3A 1ECFA 2E37A 4NEQA 4FGLA 5IAJA 3OU6A 2IEAA 2Y1FA 2FF5A 4DRZA 1T5DX 3IP1A 2PCJA 5I48A 1CBUA 2QUJA 1WB4A 3Q5EA 1PYDA 2H8GA 4IQ0A 3K1AA 2Q49A 1CRZA 1E2IA 4ZAGA 4CYMA 4J0KA 1DC8A 1FNSA 1YK0A 3E3MA 4KO2S 1B3RA 3LWDA 1WEHA 3HA7A 1ESMA 4FLEA 3ZZ0A 1B26A 4EO4A 2HYIC 4PG7A 4Q19A 3ETLA 1OJLA 1N8SA 3BD6A 3G7NA 5FA6A 4C88A 5LN1A 2XODA 5MDHA 2EP5A 2FMUA 4W9NA 3UT5B 2MDTA 4PNHA 1PL8A 2W37A 2F64A 2OBNA 2IEBA 3LDFA 4RXMA 3HYCA 1IXRC 2UUOA 1KP2A 5DGDA 4TGLA 5ABPA 2OGTA 1A8IA 2W42A 1S2OA 3BFPA 2C2BA 3OLXA 3BWVA 4LZAA 2DP4E 3ER6A 4L07A 4XFKA 1JYEA 3KEGA 4U00A 3RYHB 4XCXA 5THKA 3CZAA 2NWQA 3TRHA 4MOWA 1BH6A 2R6CA 4YP7A 1AV6A 1G7RA 1JDNA 4FGUA 4UVDA 5A5DA 3DD5A 4EJFA 3I2IA 6GPBA 4GQAA 2BKEA 1C5KA 4RFSA 2IS1A 4UEOA 3FYSA 2KJQA 1XP8A 1BX1A 2EZ9A 1TUGA 3LCVB 3LUFA 4OLJA 1QO9A 1V1MB 4FZ5A 5GV8A 2H00A 4I4TA 4KFRA 3AFOA 5BV0A 4X91A 3GD7A 3IE2A 3RV3A 2I78A 5CLGA 2EYQA 1G8AA 5JTUA 4QVGA 1ZMXA 1XMIA 3COVA 2Q5EA 5E1MA 2GFHA 4GWLA 1U3FA 5JMOA 1MDFA 1ORHA 4JJ7A 1A72A 3D8UA 1C1XA 2HU2A 1OYOA 1QH9A 2Q0QA 4HG2A 3USCS 1ZPDA 4YRPA 2BR3A 3HYLA 3ZQKA 1FRNA 5JAZA 1IXYA 2WWFA 1DBIA 4D99A 1BE6A 1HSOA 2CDRA 3IAS1 1OLSA 3FZQA 1O08A 2ZUBA 4D4KA 4E08A 3U9LA 3ILVA 3S99A 2JVJA 2AMLA 4UTNA 4PHFA 1AT1A 3LY8A 1JKJB 2O8CB 4PBSA 3EWAA 3HKEA 3S2FA 3VVCA 4BB0A 2WKQA 5EZ6B 4BLWA 1KWKA 2GX6A 3AF2A 5IG2A 2AD5A 2ZXFA 2YVUA 4PSAA 3VZDA 1BMFA 2NZWA 5C0OE 4CGZA 3AZQA 2GYVA 4OI4A 3HMQA 2NX2A 1DPFA 5FOTA 3U44B 5GP1A 2Q5JA 2QMUA 4ETWA 4LXUA 3T9EA 2JHGA 3AQIA 2GARA 2WU0A 1FS4A 1QM5A 4KN5A 5IF9A 3COZA 3DS8A 2K6GA 3PT9A 4OA5A 1KHTA 221PA 4I14A 1QZ3A 2EZ4A 2G28A 2ZJ6A 5G53C 4RLHA 2C1ZA 3UK1A 4CIVA 1N9GA 3EFEA 2VQFB 1JSLA 3ZPXA 1GL3A 3B1FA 2OXEA 4FI3C 4GRIA 3T0IA 3OX2A 3G02A 1YCGA 2DPHA 2I67A 1VPWA 3ZE9A 1MW9X 3O9VA 4G24A 3HUFA 3SS8A 4BNDA 2GSDA 1LBQA 2XCTB 1FMTA 1OLOA 3PUIA 4NMMA 3WJ7A 4RHFA 1IIRA 2PQMA 4F3CA 1P8AA 2YCLA 4JR1A 2EX1A 2GN6A 2NU6B 4M53A 4WNAB 4ZAFA 4EI8A 1NG1A 5JO9A 4UU0A 5L4LA 2QW1A 1DAMA 1PJAA 4JMPA 2FGJA 1Z12A 4F21A 1W4CA 4UHEA 2W8BA 4V1CB 2W4QA 1GDHA 1XDDA 1ACMA 1OT5A 4OYLA 1RRVA 3O31A 2W22A 2FN3A 1KYZA 4RJKA 3WB9A 3WGTA 4PBRA 3BGIA 3ZGXA 2GTPA 2GCIA 6AT1A 1C8VB 1HBJA 5JROA 4WQMA 3ZLTA 1PSZA 3LHIA 4QC2A 1XD8A 4AUNA 1XZIA 1H23A 3C3EA 1E1QA 1BC5A 1Z74A 2O06A 5E1DA 2XRZA 1EESA 1E5LA 1JQEA 2VTKA 4NYMQ 2RK3A 4YJ3A 3UF0A 4KMSA 4JBGA 4PAQA 4I8DA 1A4UA 4LRSB 3Q9SA 1YZFA 4EECA 3P9YA 1PFKA 1KP3A 4IXMA 3FPCA 4NHOA 1VJ0A 5KQGA 4C6SA 4NDAA 1L3CA 5ER9A 5FNZA 1QF9A 3OM0A 4ZK2A 5FUMA 1ISFA 1UJ4A 1OI4A 2IHJA 3HYSA 3R4VA 1PN3A 4IOJA 3NWPA 1XRMA 3FUVA 5GGXA 2D6FA 2WVAA 4N8DA 4HDSA 1DXYA 1ZK2A 2QP4A 2I1LA 4MHSA 4YJ3B 2J33A 3N58A 2IS6A 1YULA 1BHQ1 2YWEA 3LOPA 5CIYA 3SJ7A 1ZD8A 1DINA 1IFXA 5J3JA 4ZT4A 3PC8A 2OCIA 4MDYA 4EDHA 4P7BA 1C9DB 1K6XA 1W5TA 4QBFA 1E9FA 4TWZA 1SOAA 2WWGA 3B8HA 1FL9A 3SYTA 3SBXA 4BVLA 1LV7A 5H9WA 3K9HA 2H4YA 1J8YF 2BMVA 2FZVA 2XLBA 4JP1A 5AJVB 2DULA 2UAGA 2V6IA 3A06A 2YWHA 4ND8A 1CNEA 2VDQB 4OHRA 3TEJA 4F5DA 3NATA 4BBPA 3PI7A 2P1RA 1H3NA 2XUQA 3DAYA 3GLHB 1AXEA 3SQXA 1CRWG 2O1XA 3ANTA 3N5KA 4ZPXA 1KBOA 2VHWA 4YV2A 1KMIY 4TV8A 3CW8X 1NSTA 4GUAA 3NBUA 3B3AA 1KDVA 1MO6A 4MLZA 5HS6A 4RFLA 3U3DA 4L8LA 4ARCA 5HKOA 3MJFA 2O2YA 4Q34A 3U4QB 2NZUG 2HGZA 1BEUB 1OE0A 2WW8A 3JQRA 2C77A 3MS2A 5DM70 5DT2A 2Q6IA 3TOCA 4GI3A 2G76A 4W9NC 4Y2JA 1XZBA 5DT9A 1KO4A 2GS9A 2CXPA 3RS4A 3U17A 2ZRQA 1T6ZA 4NJMA 4E2FA 4EMBA 5LYJB 4TLCA 1XL1A 1S8FA 3RVRA 1TCBA 1P91A 2H7YA 3Q7EA 4TUYA 1AUOA 1T4DA 3T1QA 3KPYA 3U31A 3ESDA 4JVLA 3SQWA 1YR7A 1GCOA 4CKBB 4DUZB 3G5LA 3MS4A 4E5PA 2UUAB 4B48A 3VMFA 4G5HA 1H2AS 2FSFA 3BTUA 4EIWA 1ZW6A 2GGSA 1GVHA 5CHYA 1VI2A 4F72A 3I23A 5CLFA 1UR5A 2PR7A 3N6XA 3V2HA 3STVA 4U7JA 2YJGA 4BHTA 1QPGA 1VBFA 2CL6X 1OA0A 2O0LA 4H1VA 4MR9A 3S5JA 3LLUA 4O33A 3WWYA 2KMLA 3PZBA 4ME6A 1XEFA 1I4EB 2YWXA 3DT6A 2C54A 5LBIA 421PA 2CGEA 4F5EA 2JKVA 4CQMA 1LPOA 2GUGA 4D3XA 2ZJ3A 1RM4A 1X6VA 3L04A 3T99A 1U3VA 4HUQB 2QEQA 1DC6A 2HTFA 1MFZA 3EOAI 4KXWA 5H7XA 3WLRA 1R12A 1NX6A 3W8EA 1RM3A 2FX5A 4YY3B 2V9PA 2W00A 4FDUA 4LFAB 2BHSA 1CJVC 2P6OA 2AOTA 1B7GO 3V55A 2GHIA 1ZXLA 3FFBA 3HYTA 3KXKA 4JKIA 3NNSA 4CCYB 2YZ2A 3MTBA 2XSZA 3PA6A 4FDAA 1XWFA 2RCNA 4N3GA 4G84A 1F38A 1I24A 4M3NA 4QXMA 2GO7A 2QU8A 4CMKA 2IU4A 1ULTA 5KWJA 1X1AA 1XZLA 4CTOA 4QPPA 3PLAE 1SRRA 2IEZA 3VV2A 1QRTA 2FZGA 3D5QA 4MP8A 3OEHA 4OL9A 3V4RA 1SR8A 2B4TO 4ZI2A 5B1EA 1RZUA 3KLMX 2I2AA 2JGDB 2QQFA 4LF4B 1GITA 2QJRA 1NN5A 3KCQA 4L4YA 1KKMA 1XD2A 1BCSA 4PHGA 2IX3A 2FRXA 4U9IS 4HN4B 1OFTA 3AUFA 4UHDA 2C4WA 2JW5A 3FMVA 3EZ9A 1ZUNA 2C4MA 3PKJA 2AMJA 1MA3A 3T3HA 1Y1LA 1R6AA 5LQDA 4L15A 1Y7PA 3OTGA 1TTHA 1WETA 2TMYA 2ATEA 2UYOA 4MWOA 5DXAA 3E27A 4FZJA 4EENA 3GT4A 2W2MA 2A5LA 2ZROA 3IEPA 3NCHA 2Z9CA 2W5UA 4C4RA 4TMFA 2HJWA 2HSWA 4X1IB 4QTYA 2GCOA 1MX5A 3ITNA 2IYLD 2ZBFA 5AXDA 1JHAA 3JZAA 1XQ1A 2NO6A 4W9MC 4U2CA 1TVKA 1WTAA 4ZC8A 1ISIA 2J0SA 1IN7A 1QDLB 1M8GA 5H5JA 2B92A 3GVPA 3X43A 1RWPA 1TF7A 5C4IA 3AP3A 3GGGA 4RJIA 3TKLA 4YPOA 4LRQA 1EUZA 3DEIA 1IQUA 3ANNA 1T9AA 2P2GA 1TLLA 2GKGA 4GMKA 4K9KA 2RHCA 1DDOA 2VSNA 3F67A 2WA2A 3LWNA 4O4LA 3UNXA 2QRUA 3HP7A 4YJFA 5LB4A 3CRW1 4NU8X 1Q22A 4UM7A 2A0YA 2XWQA 4G8JA 5J2TA 3OZGA 4KR2A 1OUMA 1V8BA 5KOIA 4H60A 5FOSA 4JXZA 2Q1WA 5KC9A 2BM0A 1O95C 1ZHOA 3FMPB 3A6DA 5M7EA 3VPXA 2A86A 3F71A 3IBGA 3L7MA 4R1OA 1JFLA 3KU1A 3SE7A 5HK8A 1U5BA 4L76A 2QORA 2YMMA 1TVEA 4G25A 1XEWY 2E4WA 4ZCPA 5EWLB 4NDZA 2WNHA 3SJBA 1MFPA 1H94A 2E7ZA 2JJ2D 3BWXA 4J7UA 1DUSA 4JC0A 5HFNA 3KYCB 3EXEB 4BKUA 3NP7A 3HDJA 3OZEA 4EB3A 2W2KA 3QW2A 4RKWA 3ZJ5A 1QO0A 4YRRA 5JTTA 3T35A 4F2GA 2F3QA 2FHSA 1B2LA 1G19A 1TK2A 3GFSA 3L7YA 1UANA 4YROA 1XZCA 2A94A 1BS1A 3GJ6A 4YCSA 1Y3HA 1HM5A 2AJ8A 4H4DA 4I9GA 1RW4A 4I55A 5L3QA 2IYYA 2ZUFA 1E0KA 4OXRA 4FCTA 4RMGA 4BFLA 1SVLA 4R9VA 1INLA 1OSNA 1KTIA 1ULSA 4EFMA 3G9QA 4OHCA 3L93A 5KNDD 5F78A 3ZY5A 3G8YA 1CP3A 4PO3X 2P6PA 3RPEA 2RHWA 4D0NA 1R4MB 4W1QA 3DOFA 3G59A 4L5AA 3ZTYA 3D7SA 4FMDF 4CLOB 1RYMA 1CU1A 2XYPA 3KZKA 1Y6ZA 4CV3A 4RTRA 4E7PA 3HKEB 2DG2A 3CTMA 3K3PA 4X8OA 5K03A 4U5XA 2ZDHA 1BDBA 3A6HA 2Y71A 1TO1E 3BL6A 3WL3A 4MJ3A 2QTNA 2YBDA 1GQQA 3RUEA 4UUBA 1IOWA 5ECGC 1QLHA 4HMPA 1AZLA 1N6OA 4TS3A 3L7KA 1M74A 5CTJA 3O8QA 4PS1A 4E46A 2ZUEA 1QX3A 1R4MA 2DQKA 1UPFA 3MYRA 1BOOA 2Z5LA 1XI2A 4GZMA 3LTNC 2CYBA 3IDAA 4QVIA 3QA9A 2DE0X 3WLPA 3DOCA 4ZEVA 4C06A 4RPIA 1SIOA 4J49A 4AWBA 5IHPA 4YO7A 4DQLA 3OD5A 1ORDA 1VE5A 4RD6A 1E5XA 1SOWA 1XRJA 3I64A 5EUBA 2HTEA 3IQWA 3C85A 1PL0A 3YASA 1P1BA 4JLPA 1RPAA 2AQHA 4HUJA 4PYRA 3MTIA 2IUTA 2FSUA 4LYDA 1PNQA 4TL7A 1ZIOA 4V0KA 1E9CA 3TNLA 2OP1A 1I1OA 4FNOA 1QGYA 3CLSD 1YB5A 4MH0R 3NDJA 5IBQA 3WGHA 5K8UA 3VC7A 5FOQA 1CUUA 4TYWA 4MW1A 1JDVA 1HE2A 5LQRA 1QIHA 3VU3A 3LKVA 4D79A 2V7VA 2BFMA 1T9HA 3HY6A 4N6OA 4R7GA 4BWYA 4BNJA 2FK7A 4WLNA 4D0RA 4L5CA 1LS6A 1RXIA 3OLQA 4H17A 3W3AH 2EKLA 1L1FA 1IPHA 5C81A 2JIDA 4R2XA 3NI2A 5TQJA 4P31A 2H7CA 3RRYA 2ORWA 3G2HA 2ZVJA 5LB2A 3IEIA 1AQYA 2E1RA 4DQ0A 3RBAA 4ZAVA 3BB1A 3NKFA 5FQNA 2BN4A 2IEYA 2MSCB 2W6NA 3BAFA 1TO6A 3EE6A 2DT8A 3DEZA 1VCHA 1JU3A 1PS0A 1WPGA 2V54A 2YZ7A 1KO8A 5ARDA 5FPPA 1H0SA 1XTIA 2C5BA 2KLHA 3R3XA 3RIYA 2HX1A 5KTTA 3TKYA 4JUDX 5BMVF 2X5KO 2VJBA 1VJGA 1CY1A 2YV5A 2C2OA 2N47A 4B0OA 4OLAA 2PTGA 1L4BA 2FUKA 4HPWA 4EOGA 3BA1A 3DMPA 2DBRA 1PEYA 4FOSA 3K0KA 5GIPE 2COEA 4OHUA 2VZ9A 1XLVA 1JLHA 1HDYA 4OV6B 3TMYA 1KFKB 4FEAA 4AD8A 4BO3A 3O0TA 5LP6A 4NBNA 1EINA 2PS9A 2QRHA 2XT6A 4RGVA 2B0JA 2DC1A 3KJFA 1P2UA 4EUKA 3T6KA 1YZQA 1MTOA 5DP1A 2GILA 3NDIA 4M87A 1Z83A 1RR6A 4QQKA 3RIHA 3STHA 2WIFA 5A03A 5C35A 2NO0A 1R00A 1Q19A 5JDCC 2G07A 1TTQB 3TX6A 3COPA 3H2IA 1C30B 5D5PA 2PMBA 1CQWA 4K9RA 2DKFA 1NUAA