1T0JB

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
215
structure length
187
Chain Sequence
FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
total genus 59
structure length 187
sequence length 215
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0jB00
4M22A 2ZRJA 1JECA 1N6KA 3B1VA 3CWZA 1HTWA 1GTVA 2QP3A 1Z8FA 1U0HC 2DPXA 4NCIA 3EZ9A 2O0KA 1U9IA 3HYTA 1G8FA 2OHFA 4FD2A 3PFIA 1KK1A 4KSBA 4X8HA 2YINC 3AVPA 2WWFA 2IS6A 2ZREA 3MWJA 1OSNA 1VDZA 4CEJA 1GITA 1W0KA 3RS7A 4B2PA 4DJTA 5KNBA 4B47A 3DOFA 2J87A 1TQ6A 5DN6A 4OI1A 3AV0B 1ZCAA 5AJVB 2YWGA 4HI0E 4DDTA 3SI7A 3RABA 1OH8A 5F9FA 3ZJYA 4HAXA 2CE7A 1LF0A 4JBXA 3KXIA 2DB3A 2VHCA 5HKKA 3TSZA 5EP3A 2P65A 4JVNA 3NEJA 4O2RA 1G21E 3ECCA 5CB8A 4URUR 4CRWB 4D4JA 4FINA 2ZJBA 5JI2E 4RZ2A 2JJ2D 4IRUB 1MO5A 3C15C 4KYIB 5JLJA 3AP1A 2B92A 4TYPA 2A78A 2QTFA 4L8GA 1KSFX 4DDVA 2HJVA 4DLRA 1FMJA 4WZ6A 2N46A 5D3MA 3VFDA 1M7HA 2B6HA 2XX3A 1RRPA 1QHXA 3GLHB 4BE7B 2QQ0A 1NVWQ 4PAMA 2JLYA 3U3KA 1FW6A 1Q1BA 4NDZA 5TV2A 3GJ4A 3TJZA 3WNDA 1P9RA 1ZUNB 4M1MA 1BYUA 3ZVLA 3U3JA 2JJ1D 2BC9A 1ETUA 5LDDC 3OFND 4BRUA 4XWOA 2ECKA 2IUSA 5G3ZA 3TE6A 3WY9A 1UKYA 2XB4A 5J4VA 1OFUX 1OJLA 4M0LA 2H92A 1XEXB 3R8FA 1GRRA 4KXFB 3T15A 4JJKA 4ZPXA 1SVKA 1GIAA 2ZRMA 4N3NA 4TMKA 2CL7X 4HATA 3TW4A 3C16C 1N6RA 1N25A 2Q0HA 4QRHA 1G9XA 1COWD 4AWXA 4F91B 1OFHA 1NRJB 4LCBA 2ZI4A 3NBYC 3DKVA 3R9IA 2OXRA 2CCKA 2PMDA 4K8OA 4DB2A 2FPKA 3EAQA 5TXGA 4KITB 2PZFA 1HE8B 1PJRA 2WHXA 3BH0A 2G77B 4P4TA 5DO9A 5EP2A 1MABA 1W7AA 3G0HA 2EYQA 2ZRLA 4HB4A 4M1KA 1AK2A 3QUSA 4QNMA 3J81k 5CJPA 1P4SA 4A15A 5G53C 1WXQA 2W6IA 3E5HA 1E79D 1W5SA 1SVSA 4NCJA 4QHTA 1E4YA 4A1FA 4C3ZA 2J0QA 4D81A 1HEIA 3T12A 4Q4JB 2GCOA 2ZE6A 3TNFA 3K9LA 2FPMA 4PQFA 2MSCB 4AK9A 2G0NA 2BEJA 2DCUA 1FL9A 2WJHA 1LS1A 4E09A 2EFGA 4UXHA 1T8TA 1YZGA 4EJSA 3KKMA 5L3VA 1OHHD 4OKSA 4I99A 2RHDA 3CR8A 5JJLA 1RIFA 1F3OA 2ZIAA 1YE8A 2QT1A 2CVHA 4NCHA 1AN0A 4PC2A 1AZSC 4NYIR 1G4UR 1NP6A 2C9CA 2IEZA 3K0AB 5FTKA 4FWTA 4YC7A 4UXJA 1XD2A 4TT3D 1DADA 3KQUA 1H8ED 4N0EA 2AXNA 3SE0A 2ZJZA 4JLBA 3B8HA 4FXPA 2XJ4A 1G5PA 2P6NA 4UNSA 1II8B 3EC1A 1NI3A 1E98A 3W8NA 4YLGA 2ATVA 3L0IB 2C96A 3KJHA 2GBLA 1UPTA 5AUOB 3R9WA 3THYA 2FZLA 3V4FA 2QZ4A 1IQPA 4LK2A 1N6NA 1EFTA 1R2QA 1PLKA 3B60A 4PZYA 4O25A 2IT1A 5C1BA 4E07A 2HDNB 3TAHA 4NYIQ 4P4UA 3ICQB 1J99A 2B8WA 2O8EB 2WZQA 1JR6A 4US2R 1E2QA 1U0LA 3X2SA 1L7VC 2IYWA 4ON9A 2WKRA 4V0KA 3SJBA 1Y63A 4JL8A 3GJXC 2P5SA 1KKLA 3IKJA 1X8KA 2W58A 2HF8A 2A9KA 1X1RA 4PPGA 5HPYB 2B7CA 4RJLA 2GF0A 2E1RA 3NH6A 1XCPA 1N6LA 2VP9A 3JVUA 3LRPA 3N2EA 4OQNA 1X8JA 1HQYE 1XDBA 3A1WA 5ANRB 5LB4A 1DG1G 2OCAA 5CM9C 1JPNA 4A2PA 1G3RA 5FTLA 1KSGA 2CLSA 3TAUA 1QRAA 2D74A 2VP2A 1T5LA 4IKEA 4JLNA 4Q1FA 4WVFA 3TLXA 1EWRA 1EX7A 1Q20A 5JECA 1P72A 4DCNA 1DTSA 4BFXA 3FMFA 5J5CA 2QMHA 2H5EA 4EQ6B 3SR0A 4KHZA 1UKZA 3FDIA 3MWLA 4P32A 4TWZA 5P21A 3I62A 1T0HB 2VHUA 4B74A 3CNLA 1KDTA 1SVOA 3MGCA 1XMJA 5C4MA 1D2NA 4EKDA 4G3XA 2PLRA 3RWOA 3MMPA 4YXWA 3ZZUA 1E1RA 3SZRA 4DDWA 2QG6A 4WZAE 2HLDA 4TMWA 1MO6A 1XB2A 4IDPA 4YMTA 3I8SA 4U5XA 3T61A 1GL9B 4AI6A 4DCTA 1ZM3A 2AKAB 2XJ9A 4LRWA 4XH9B 4BZQA 5KPJA 2AWNA 2WPDA 1DE0A 2C8VA 5EE9A 4ZDJA 2RHMA 3EPJA 1WB9A 3RWMB 1NMXA 2DWPA 3SC3A 1W0KD 4DLWA 2IWHA 4M1YA 2ANCA 2OFWA 2YWEA 4IVPA 4N0DA 5EXTA 1SVWA 3GP8A 1CRPA 3R8CA 1NY6A 2OESA 1AGRA 1ANKA 2VA8A 4V0LA 2NO1A 5BN5A 1U8ZA 2AWOA 2FFQA 3THWB 1TEVA 3QEOA 4M9ZA 1P75A 3ND8A 4DVGA 5CYPA 4A6PA 1J8MF 1BYIA 3K0CA 3KJIA 5E3HA 4HAZA 2J5XA 3KUCA 2PX0A 3UPUA 3WXMA 2Z5FA 3QG5A 2RGDA 4FCTA 4PC3A 1KNQA 1VCOA 3Q85A 4ZI2A 1ZCBA 4BWYA 2EYUA 1SKYB 1G41A 3LO5A 1XCGB 3QXXA 3RRNA 3PIRA 2HT6A 1T3HA 2GKSA 821PA 1NG1A 1SKQA 4HB0A 3PEVA 2QPAA 4EJSC 2FF7A 1RC8A 2BDTA 2BHRA 3IPXA 4Q4AB 4TLEA 5DI3B 1HQCA 1Z6YA 2CCJA 3A8TA 1OLOA 4LJ6A 3SDZA 2AR7A 4TQUS 2ZYWX 3A1TA 3GLFA 5SZIA 3SOPA 1JAHA 1KJWA 4XTCS 4DLSA 2DY1A 1UBCA 2X2EA 4NCNA 1FP7A 4BRWA 4EFNA 3QKSB 2VL7A 4YDHB 5L3RA 1G1MA 2XTNA 5CYOA 3VTKA 2X8AA 3LD9A 2QQEA 1Z0IA 2EVWX 3K70B 1P9NA 3K0AA 2N1BA 2BMEA 1SHZA 1G16A 2CHQA 2G1KA 1PV4A 3GFTA 4NE2A 3DM9B 5FOVA 4BLRA 2R6GA 4ZDWA 5KNCA 2ZRBA 3VR5A 1ZINA 3U61B 1N2CE 1XJ0A 2CXXA 1X8LA 2RMKA 4LJ9A 1DOAA 2NOAA 2I3BA 2Q3FA 1VG9B 4IXMA 4LHVA 3TGPA 3CNOA 3LLUA 3BS4A 3WBKA 4IVQA 5E4FA 1D2EA 5FOXA 2CJWB 3ADBA 1CP2A 4IOLA 2ZYTX 1KO8A 2OT3B 1JXMA 2FV8A 4BLTA 4OI0A 2ZJ2A 1JB1A 4GOKA 4TL6A 2IHBA 1SGWA 1KI8A 3R9XA 1Y3AA 3C4JA 3KJEA 1D5CA 3U7HB 4M1OA 2ZRPA 1E94E 2ZSAA 4EUNA 3O8RA 1LFDB 2GESA 2XXAB 2QTVB 1H65A 3CPEA 3L43A 2JIZD 5CDFA 5KPDA 3I32A 3W6PA 4YMWA 1KO1A 4RD3A 3LA6A 4KFTA 1ZC4A 3UG7A 4DZZA 2P6RA 4US0R 5FUVA 1KI1A 1EFHA 4Q9HA 2X77A 3TW8B 3K1JA 2QROA 4UNRA 3W6NA 4V02A 4P4SB 2YZ2A 3BIFA 1KSHA 3K0FA 4FMDF 1BMFA 4PSAA 4YMSA 1G8GA 1E9DA 3W90A 621PA 3RC8A 4C0JA 1NBMA 3ZVNA 3SEAA 4BEBA 4TTQA 4CT4B 2OXCA 4GOJA 1C9KA 2WWHA 3Q72A 4QGHA 3EARA 4RD2A 2AK2A 4IOJA 4A0GA 2RGNA 3TBKA 5FUXA 4KV9A 1QZXA 4B3DA 3LQRA 3DMNA 4RZ3A 3UXMA 1KGDA 1SZPA 4Z51A 3HDTA 4LYAA 3ZQ6A 1PUIA 2QSYA 1F60A 1OF1A 1T3LA 3PUXA 3UMRA 2XGJA 5F3WB 2V55B 2OFOA 4QG7A 1XPRA 1K5DA 5FR2A 5DN6D 1ZNZA 1TUIA 4HZIA 5FH9A 1G8HA 1LNZA 4MKGA 5BN4A 1U9IC 1KY3A 3GQBA 2YOHA 1T9HA 2IYQA 3F3YA 3QKTA 1YZTA 2ZJAA 2IBMA 1AKEA 3BOSA 2YWFA 1IONA 1E2FA 1NVUQ 1KYIA 1P61B 3EZ7A 2NO6A 4JBYA 4OI4A 3I5XA 3UMFA 1TEXA 3UIEA 3VNUA 1P2TA 3ZQJA 2IS1A 2F6RA 1OYYA 2IS4A 4IVRA 5JJIA 1EX6A 2H57A 3QPVA 5HKKD 4Q4AA 2C9YA 5DI3A 3KZ1E 2LKCA 2OAQ1 4K46A 1KI6B 3F8TA 4KI0A 2F1IA 1DO0A 3IQXA 4DT1B 2RAPA 2ZSBA 4PSVA 2O8FA 1MV5A 3ONWA 1S9HA 4OK5A 4PTLA 4AC9A 3DMDA 1M7GA 2ODEA 2J0UA 2IYRA 2CNWA 1FTSA 1DPFA 2ANBA 3PITA 4O2LA 1R5NA 1G8PA 3ZH9B 3I8XA 2HEIA 4LY6A 1FUKA 4G5QA 2VPPA 4OL0A 1ZIPA 5J4LA 4UXIA 4I1UA 4BZXA 3OIVA 2IYZA 3ADKA 5AR1A 2WTUA 4TSFA 2V3CC 1Q44A 4Z54A 2A2ZA 3I4LA 1Z0FA 1KI9A 2ERYA 1IXZA 4LV6A 2XOKD 4LOAA 1JEEA 721PA 2R6CA 3GLFE 4AYXA 3QXHA 1MKYA 1Z0JA 1DVRA 4TLAA 2JASA 4TSFD 3PXGA 2ZR0A 1XEFA 1CXZA 2V6IA 3K9HA 4PO1A 3NHAA 3U60B 1BOFA 2QP9X 3IPYA 4FCVA 1GWNA 2PJRA 1YVDA 2ZVQX 2ODWA 1NLFA 2V1UA 1MR3F 4ESVA 1LV7A 3A36A 4QGGA 2H8KA 4YQFA 5KDLA 3V4RA 4AYWA 1XNJA 3DO6A 1OB5A 4Y0AA 4GT1A 1E79A 1OH7A 2RGEA 4HDCA 4TMXA 4MUBA 3H86A 3W5IA 1XPOA 1S4QA 2QAGB 3VMFA 1OIVA 1YJ5A 3AM1A 3T34A 3ZIAD 2AXPA 2KB0A 1X1SA 2GF9A 2J0VA 3WBJA 3W34A 4LBZA 3UMSA 2GXAA 5AJWA 2D06A 1HH4A 4OHXA 4MRVA 2F9MA 4NL4H 5HZHA 1J70A 1D8TA 2R2AA 2GJ8A 2A5GA 5G40A 3NTUA 3NDPA 1RRCA 1YR8A 1KI4A 5J4YA 3A4LA 2GJKA 1OHHA 2W2XA 3QENA 4JLMA 4IXNA 2ZS7A 1DG3A 3CRVA 3FKSA 1YQTA 5G3YA 2P3SA 4PQYA 2FZ4A 2L0XA 3BB3A 5DIFA 2QM8A 1P7CA 1TAGA 1KI3A 2FN4A 3SU8A 4EPRA 4A9AA 1YZNA 4DLXA 2C04A 2FX3A 3IEUA 2CHVA 2RGCA 3RAPR 3B1WA 2REXB 1XZPA 3R7WA 2NO9A 3JZMA 4LJ4A 1ZU4A 3PV0A 1W47A 2B8TA 3FHOA 2MMCA 4FMBB 4QGFA 2AFIE 5TMPA 3MFYA 4C30A 1CJUC 1OIWA 1GRNA 4D4KA 1IXSB 3T1QA 1K6MA 4D0GA 5FL7A 4PC7A 2XNDD 4O3MA 4MDEA 5AJZA 4BPBA 4RCZA 2JCSA 3IO3A 1E2IA 1M8PA 1TU3A 1UBEA 1VCMA 2IWRA 2FSGA 3S1AA 5SZJA 3UATA 1W36B 2JGNA 4XVQA 4LZZA 4ZV4A 1NN5A 2ZJ5A 2ZUDA 2FFBA 4B6FA 4DSNA 1HT1E 2FEMA 3AF2A 2PCLA 3KFXA 4NP6A 1R6BX 1E0KA 1QF9A 4KVGA 3EWSA 2J7KA 3MD0A 4UJ3A 4E5UA 3JVVA 3W8RA 2PJZA 2ZRKA 2ZJYA 1W36C 4EPTA 4OJQA 1O3YA 1F2TA 2BCGY 5KNDA 1NMYA 2ZRGA 3LW8A 3U2QA 2FWRA 2V9PA 1IN5A 1I4DD 3KXLA 2YC2C 3OE7A 2HF9A 1A5TA 3BH7A 4ZIRA 2R6DA 3RANA 4TTPA 1OYWA 3MCAA 4JKYA 3DHWC 2F55A 3CKLA 3ADDA 1G6OA 1ZUHA 2OBLA 5LB2A 3UWKA 5EUMA 4C0KA 4DRZA 2GILA 1ZRHA 4NH0A 2GTPA 4CW7A 5EE3A 4DLYA 3WNCA 3UANA 1WE2A 3O47A 4DEXA 1KJZA 2BMDA 2O8BA 3TRFA 3QJYA 2AHOA 4LDJA 1KMHB 1RJ9B 4DWJA 1Z6TA 5FL3A 1OKKA 3KDSE 2IL1A 2XNSA 4XOIA 2XEXA 4B35A 3P20A 3G5UA 1ZP6A 3B6EA 3WP0A 1A7JA 1NVVR 2HCBA 3AKDA 2BOVA 3LBHA 4MYUA 2ORIA 3N5CA 5FTJA 3SNHA 2PMKA 1EESA 3LDAA 2WJJA 2Q3MA 4H1UA 4Q5IA 1KDPA 3I73A 5BQ5A 3SHFA 4URXR 4Q01A 3E2IA 2ZS8A 1Z29A 2F1JA 4OQMA 3HYRA 4GPTA 4JVMA 3AF3A 1UEJA 5IHPA 1E9RA 2UZIR 5IRCD 3OESA 2FE4A 3NWJA 5EJEA 5IF9A 5LD2B 2BCJQ 4UQOA 3PG5A 3WMFA 5JS8A 1XXHA 3CF2A 3AVXA 1N0WA 3O8DA 1K8RA 4KCGA 4BLPA 1M6NA 4G5RA 2YV5A 4JT2A 2QBYB 4LGMA 1E1QD 3PR1A 4V0OA 3RNLA 2BBWA 1W2HA 2RCNA 2JLZA 1U0JA 1KMQA 1P60A 2KSQA 1QG4A 2V7QA 4QHSA 4UJ5A 4UNQA 4U7DA 1N5KA 4HZUB 2FOLA 1DBSA 3EW9A 4OQFA 1M2OB 1QHNA 2FPLA 1G19A 2QSZA 4LJ8A 4B3XA 2DWQA 1RKBA 1A2KC 1R5BA 1W2GA 3X1YA 1E2PA 2ASEA 4QXAA 1ZAKA 2RGGA 1NMZA 2W2TA 4RD4A 3K9NA 2RGNC 2BWJA 2D62A 3O8BA 5K8LA 2IYUA 3A58B 3REGA 2ZE5A 1FX0B 4HSEA 1EK0A 3CR7A 1JI0A 3B85A 1W0JA 1E4VA 1ZBDA 5GVSA 5JRJA 1Z0DA 5FBLB 2HLDD 4TMZA 5FTNA 3RRMA 3T35A 2V6JA 2JJ1A 4KO8A 3F0TA 3CBQA 3WNBA 1JR3D 3ZGXA 4A4DA 1ZM7A 3HPRA 4NZYA 1G3MA 5FPSA 4FIDA 4B33A 1N6HA 2UZ3A 3U6KA 3B9PA 3FVQA 3QPUA 1N3BA 1RFLA 3WMEA 3CF6R 3GFOA 5DSZA 2GZHA 3RDPA 1XEWX 2ZE7A 3V00A 3U4QB 2F9LA 5UKDA 4G1UC 1KKMA 4MKHA 1G3QA 2DFTA 1QHSA 1BH2A 4BFTA 2YC4C 1IOZA 2OV2A 1XJCA 3UK6A 3X1ZA 4KVAA 1KY2A 3D8BA 1FUUA 5AWFC 3EA0A 4A2WA 2Z83A 1VHTA 2WIBA 2VSFA 5D3QA 1E2JA 5FR1A 5BWMA 1G7TA 4RZUA 2IX3A 4DDUA 3RS5A 3NC0C 3KQHA 1G5RA 1GOTA 2FGJA 2Q6TA 1W48A 5FTMA 2W00A 2QNRA 2PT5A 1G4AE 3FFBA 1QDEA 2BBOA 3VKHA 2Z4RA 4D80A 3EIEA 1QVAA 2H17A 4OBEA 4W5HA 3AGQA 2O8BB 4Q02A 1HY3A 3TK1A 1DAEA 1HT2E 4E03A 2MMGA 3LVQE 1XJQA 221PA 1FTNA 3QVVA 3ZD6A 3TVTA 5M04A 1JAIA 2UKDA 1SQ5A 2WICA 3PCRB 5IDVA 3RYTC 1L2TA 4M2LA 3PVSA 2YWHA 3REFA 2FGKA 3QBTA 2D4HA 2R62A 3QKSA 3KX2A 4JMPA 1NN3A 2WIAA 5CDFE 4MRPA 1LS6A 5AUQA 1Z5ZA 4CEIB 5EXSA 5CM8B 5JS7A 1UBFA 2NPIA 4CVNA 1IN4A 4TMVA 4C4PA 1UJ2A 1HV8A 1H8HA 3CX6A 4DBLC 3NBFA 3EC2A 1TMKA 2WMOB 3GJ7A 3NEYA 4W5JA 3WYGA 3PEYA 1Z63A 3B1YA 1CS4C 4QNRA 2EW1A 2OSBA 3IGFA 4LUCA 5EQTA 4W7SA 5D3MB 5KSYA 4EPXA 3C5CA 1R5OA 5B2ZA 4B3CA 4I1SA 1BS1A 2Z43A 4X8MA 3RS2A 4JIMA 1GSIA 1WBDA 4TQ9A 1B0UA 2JAQA 1R0XA 1E3MA 1CLUA 4LC0A 1NLYA 4PO8A 2A5JA 2ZS9A 4ASUA 2EFHB 2QGZA 4LI0A 4Z1MD 5IK2D 3R7WB 1KMHA 1RJ9A 1PVOA 2JA1A 4NYMQ 2G83A 1XTQA 2MSDB 1ZM4A 1S2MA 4L15A 4A0RA 1W4CA 3GEIA 4RD6A 1DAMA 4YMVA 3TR5A 4B3GA 1A4RA 3SBEA 1DAFA 2WSMA 3ASZA 2GAOA 3CRW1 4PFSA 3RRZA 4A6XA 3I72A 3PQCA 3BWDD 2ZRCA 1QHHA 3QY0A 2V54A 4PAOA 2NGRA 2JATA 2H7VA 1ZC3A 4LPKA 4RFSA 3BGWA 3QXJA 3VR4A 421PA 4ESHA 3MG9A 2JLQA 4TLDA 5K8IA 5JHHB 2IXGA 2XSZA 3PEUA 4TQAA 4Q9LA 3C14C 2QE7D 3VR6A 5E95A 2JLUA 2VBCA 2Z0MA 3NDBB 1XXHE 2ZITA 3QVUA 1BKDR 2G1JA 3AKCA 5DHAA 5GADl 4FCWA 2QORA 1XP8A 1LF5A 2R6FA 1DO2A 4RSGA 4HEJA 1QHHB 3NHBA 1W36D 1MO3A 4FMDB 4HLUC 3LAWA 1LVGA 2ZM5A 2VP4A 3I5YA 4WXRA 2F43A 1XMVA 4MH0R 3SFZA 2KBFA 2FDCA 2FEOA 3DOEA 3OF5A 5SZKB 2OBMA 1T8UA 4NYJQ 5H68A 2VF8A 4Q48A 3K70D 3QKRA 2IF2A 4AKHA 2CHGA 3NVAA 1DAKA 4Q1EA 3T06B 1KNXA 5KDDA 2BKUA 3PENA 3CNNA 2BVNA 3EIQA 2ZYVX 1W4BA 4CYMA 2OFXA 4L9WA 5JFGA 1G7CA 2HT1A 2AL7A 2QI9C 4JSYA 1NNEA 3VR1A 2AN9A 3L0SA 4MUAA 5KYKA 5HR5A 1Q1QA 2WBLC 3K70C 4AG6A 3ZZ0A 4OHZA 1O87A 4AIIA 4A8JC 4TYWA 4Q9JA 3U44A 3MWYW 2CDNA 2QEQA 4EPVA 1X6VA 2W6JA 4D0LB 4LYJA 4PSKA 2Y8EA 2VQSA 4CEIA 3T5GA 1OV4A 1P2SA 1XEWY 2RGXA 2GCPA 2ZPTX 1FFHA 3KKNA 1KZ7B 4NPHA 3TKLA 1Z2CA 4ARZA 5L3QB 4C0LA 2WSSD 1DAGA 1Q0UA 3IIJA 1SXJC 1CTQA 8OHMA 3DDCA 3NBXX 3CO5A 4I1OA 1ESMA 4PPNA 4WBSA 3AVUA 1CR2A 1QG2A 2C5LA 4CEJB 2R6AA 2GXSA 1CR1A 3CH5A 1KK3A 1T5IA 2GXUA 4B6EA 1IAQA 2W6ID 1N0UA 4KAXA 2GVZC 5JWOA 4M1WA 2D7DA 2QPOA 3TQCA 1YZLA 3U44B 3WHLA 4RKEA 3IEVA 4CDGA 4TL9A 4M21A 4IW3B 1TF2A 5TDHA 1VTKA 4N1AA 4Q1AA 4US1R 4CEHA 4QM6A 1KI2A 2K5UA 4LHXA 1N6OA 2CEAA 5HE9A 1EWQA 5HE8A 1AJEA 1UM8A 4D2IA 4AKGA 3OE7D 2VSOA 1S96A 5J47A 3FYHA 1ZNYA 2G0TA 1E9FA 2Q3HA 4WXPA 4KFSA 5HTKA 2GHIA 4AYTA 1SKYE 1D6JA 2TMKA 3AF1A 4JLVA 4XD7D 1B23P 2FMXA 3PEWA 1RZ3A 3P32A 2E87A 5G41A 1UFQA 2P5TB 3FKSD 4V0NA 3K0FB 1EGAA 2N42A 1YRBA 3QPWA 2GNOA 2KWIA 1E9SA 4JVLA 4CIDA 4HUQA 3RVBA 2XTZA 1R0YA 4PC6A 4QJ5A 5L3SA 5EE0A 1KDOA 2VP6A 3H1TA 5GJCA 1WA5A 4EIWA 3GD7A 1W46A 4MGIR 4PHHA 4Q47A 2JLWA 2ZAMA 1NBMD 2H18A 1AZTA 3AUXA 3K0SA 1VECA 4DXAA 1RPZA 2C78A 2XITA 2WAYA 4M9QA 2IA5A 5B57C 4MYCA 3MSXA 1AQYA 1U94A 3K8YA 3CLVA 4RFSB 2GAAA 3H4MA 1KTVA 4IOKA 5KUTA 3SFVA 3GLHA 4M9XA 3B7GA 4Q9IA 4DUGA 1N5LA 1XMIA 2ERXA 4QHYA 1FPMA 1RRGA 3LBIA 2OAP1 1DAIA 1VYVA 4W5WA 1UADA 3LXXA 3KQKA 4B3BA 4RY2A 4B2IA 4PPFA 4B3FX 2ONKA 2ZJOA 1AKYA 1Q1ZA 1HYQA 2V7QD 1E1QA 3FMPB 3M6AA 4GP6A 1IJFA 4C9BA 1XCMA 3KJGA 3RS0A 3FHTA 3P26A 4XVUA 2CLCX 1US8B 2QP4A 3RSLA 1II8A 4BGDA 3U6BA 2NQ2C 4L4UA 1XX6A 2HCJB 3OEHD 4Q18A 5JI3E 2A5DA 2QM7A 4JL6A 1CR4A 1IJEA 3MJHA 3QXSA 4M8NE 2G9NA 5A5GA 3QKRB 4ASUD 2ZR7A 1UBGA 3AH8A 4QFMA 5KSPA 2QGNA 3BC1A 3ZDQA 1AA9A 1NIJA 2RH5A 4I4LA 1I2MA 4A2QA 5DISB 4OK3A 4KLNA 4B75A 3OAAD 4DCVA 1XRJA 2CNWD 2GDJA 1DEKA 1JNYA 1ONBA 1TQDA 4NKRA 3W3AA 4U02A 1SULA 1E2MA 1R8SA 3WRYC 1W0JD 3KQNA 2GXQA 2LWIA 4R2IA 2VF7A 1MOZA 1W4AA 4PHGA 5H8WA 1R0WA 1ZNXA 2D2FA 1IXRC 2GVDC 2ZRFA 5JBQA 1IY1A 5TARA 2QPTA 1TX4B 1NKTA 4HAUA 1U2RA 4JYBA 5F98A 2ZVPX 1Z07A 1OH5A 1EXMA 2AD1A 1OFTA 5FI1B 1DS6A 4KBFA 4A8JA 4B43A 1J90A 5C18A 2ZI5A 1A1VA 1NSFA 1UF9A 1E9CA 1UKEA 4UNPA 1OPXA 2FSHA 1IY2A 4IDOA 4LX0A 4BZPA 3FTQA 5K8UA 2NG1A 5CJ2A 2DFNA 1LY1A 2CJWA 1GUAA 3W5JA 3F5FA 1JBKA 4YDSA 3OIWA 4OYHA 3FGNA 1AS3A 1J2JA 2AK3A 3QIAA 5CLQA 3TIFA 2PEYA 3AUYA 5KSOA 3QOFA 1G7RA 1FX0A 1PLLA 3T1OA 4B44A 1XD8A 1YU9A 1X86B 1XMSA 3FPAA 1L4YA 1Q3TA 1XTJA 2QMUA 5BYJA 4MRNA 2PBRA 2IW3A 5JEEA 1TL7C 3IQWA 1XZQA 4RZXA 4C0BA 1G17A 4IDNA 1GL7A 2W0MA 4OK6A 1OIXA 1NBME 1CJVC 4Q7JB 4TLCA 2WJIA 4D26A 3AP3A 5DYIA 2WV9A 1TU4A 3ASYA 5F9HA 2F3RA 3RS3A 4GNKA 3T1TA 2QMOA 4EQ6A 1E9BA 3VHXA 2CK3A 2RGAA 2O8DB 2O8CA 3QEJA 4ACAA 1JJ7A 1X3SA 4C0SA 1UDXA 3ND9A 1XXHB 1OXVA 5CIQA 1S1MA 5KDOA 2QA5A 1KO4A 2H16A 4RCYA 5C46F 4IOMA 1CBUA 1E2GA 4XTRA 4ACBA 4NHOA 1OXTA 4G0NA 4CGZA 1AS0A 4DSUA 1GKIA 2YYZA 3HWSA 4JLPA 2WAXA 5FFMA 2BM1A 2CVFA 3Q8XB 1XTRA 1GG2A 4EJSB 2ZU6A 2ZI9A 1NY5A 3UG6A 1SVLA 1S8FA 2GCOB 1TNDA 2WWXA 2C95A 2P67A 3BFKA 2NO7A 3K0EA 4V0MA 3TMKA 4A82A 2GWHA 5DHFA 5C4GB 2J0SA 4LBWA 5KHOC 2CL6X 1FP6A 1US8A 3U3MA 5AUNB 4A36A 4S2EA 3IBGA 4LJ5A 3AVWA 3IIMA 2FSFA 2ZR9A 4ZKEA 3L8ZA 4W9MC 4V0ME 3LV8A 1FNNA 2GETA 2QL6A 5IK2A 2I1VB 1GNQA 2YJTD 1VPLA 1LB1B 1Z0AA 3DM5A 1BMFD 1QVRA 2BBTA 2ZRNA 3NG1A 4L16A 4WIAA 4IEEA 1JJVA 5FBVB 1KAGA 2CCGA 5EUQB 2HV8A 1T0JB 5FPTA 2VLIA 4LHWA 2RGBA 2REBA 3K0CC 4Q4HA 2JJ8A 4KFUA 2NZJA 4XIGS 1SXJD 1C4OA 5H70A 2GEDA 4ZIRB 3U4QA 1PLJA 4BEJA 5JSZA 4KSCA 3CRMA 4RD0A 5JCZA 4AKIA 3HU1A 4KODA 4KBGA 1GNPA 1E2LA 4LC1A 3KXKA 2REOA 3E1SA 4Q1CA 2XSZD 2DBYA 4Z8YA 1LTQA 1R8QA 1E0JA 3IDQA 3BBPA 3W6OA 4GBMA 2GBLC 1WMSA 1GM5A 3IIKA 4M53A 4QGAA 3K09A 2V8OA 3AKYA 2FFHA 5FOUA 2WOOA 2A5FA 4UKDA 1WDTA 4IFBA 3OHMA 1E9EA 3P27A 5E7JA 3LXRA 2ATXA 3C41J 1U81A 4M1TA 2PL3A 1VG1A 4ABYA 3A1VA 1ZU5A 2X1VA 4C0HA 1M74A 4NU0A 2O8EA 2OBNA 2J1LA 4GZMA 4DCUA 3NH9A 3DL0A 4DUGD 5E7IA 4OHYA 3AEZA 3CB4A 4FMCF 1KOFA 4QBGB 2PH1A 3GLHE 4QBHA 3W9YA 2D7CA 2C98A 4ERNA 3ZS9A 3L82B 2OCPA 2GZAA 2QU8A 1GILA 4Q7LA 4S35A 1ESNA 4B48A 1KO7A 4OHVA 5GJWC 1JR3E 1YKSA 5EE5B 3GPLA 1DELA 1V5WA 1Z6GA 4K81B 3LBNA 2UVQA 3ETLA 2ZUCA 1RE0A 3GJ5A 2O8DA 1NF3A 3SJAA 1G291 1K5GA 4D4MA 4Q1DA 5JWRA 3ZVRA 3ADCA 1VMAA 1ZMXA 2DYKA 2RKOA 3U7GA 1EFCA 1GZSA 2DFLA 4HAWA 1NN1A 4Q9KA 1SVMA 2IS2A 2ZRHA 3QNUA 4BQSA 4A92A 3I1FA 3EPHA 3GJ8A 4HZUA 4F4IA 3ICEA 2WWYA 2F1RA 2FJUA 1R10A 3GLGE 1YZKA 1T3SA 3P1JA 3UWOA 4JLOA 1IN7A 4Q7MB 3HJNA 3SS8A 1ZUIA 4OJKA 2WWIA 5A0FA 2HYDA 1U98A 4EPWA 2O8CB 1S1CA 1G3IA 4C7OA 3X1DA 1M7BA 4BFVA 4R7ZA 5K8TA 1ZW6A 2PT7A 4DC9A 4DLVA 2HYIC 1TPZA 2IK8A 2Z4SA 5EP1A 3THWA 3BB1A 2DWOA 4ZDKA 4JBWA 4GOXA 1VCNA 3QF7A 1TF5A 2B7BA 3CZPA 2WKPA 3CZQA 4GZLA 3SYNA 1ODFA 3NXSA 2XNDA 3CWQA 4P3YA 3CIOA 3MAAC 3WP1B 4DKXA 3CPHA 5DNYB 3TH5A 3T5DA 3WYFA 4A8JB 3U3RA 3CW2A 4LPSA 4YMUA 1T4GA 1OXSC 3EG5A 3P4YA 3B2EA 4HAYA 4ZCLA 4F4CA 1KZGB 2BM0A 4XVRA 3BORA 1VIAA 1EFUA 4JLDA 3U7EB 4TYYA 1CJKC 2ZQ5A 2GK6A 3IO5A 2GZDA 3FMOB 2ZAOA 4POAA 2YOGA 2CE2X 3C5HA 3UKDA 1D2MA 1E69A 3EASA 4PR0A 4EFLA 2ZYUX 1F2UB 2DHRA 2ZI3A 1U99A 3EPKA 2W83A 3R20A 5DYGA 4LYFA 2FU5C 2IXEA 4LV8B 4TYQA 1GKUB 4Q4HB 3ZS8A 4WA7A 2J59A 2GA8A 3BK7A 3VU9A 1Z08A 2O8FB 2IF0A 3KKOA 4DB4A 1E2HA 1CEEA 3HPQA 1Q1EA 3QBVA 4LBYA 4OQLA 1F2TB 5DH9A 1KI6A 3Q5EA 1FZQA 1QHYA 1A2BA 4MDFA 1SXJA 5HZKA 3K09C 2R8RA 4ZKDA 1P73A 3BFXA 4GDFA 2GJAA 3FFAA 3PUVA 1R7RA 2X19A 1W49A 2P2LA 3EPLA 1XTKA 3QSYA 4AD8A 2WM9B 3D3QA 4EFMA 2RB4A 1XWIA 4L9SA 4FW9A 2CLDX 3A1UA 4NONA 4HYYA 5JMTA 5L8VA 4B76A 2OLJA 3AQ4A 4RVCA 3JZAA 1IBRA 5IT5A 1XPUA 2I4IA 4XSGA 1H8HD 2J41A 4NCKA 4KFRA 2EQBA 3LH5A 3M1IA 5A4JA 5FBQB 2J3EA 1F5NA 3RRYA 3LX8A 3AKEA 3TR0A 3BE4A 4URZR 2QBYA 3OEHA 1QHGA 2ZANA 3OIYA 4IEIA 2YOFA 3KKPA 3X1WA 1E2EA 4UNNA 2GEVA 2VIIA 1WP9A 1ZJ6A 4F38A 4BFZA 2ZRIA 1UKVY 1W5TA 1CIPA 1Z28A 3EZ6A 4HUQB 4CT5A 2GRJA 2O52A 3CRQA 2PZEA 4LJYA 2QT0A 4Z1MA 3CF0A 2OLKA 2X2FA 1GNRA 4G5OA 1YZQA 2JLRA 4Y0VA 3WHKA 2V1XA 1NJFA 1QBKC 3DKPA 4H9GA 4FI3C 3VR3A 4BUJA 1VIYA 1N5JA 2WPDD 3OEEA 1NLZA 2VP0A 3GJ3A 4WOPA 4JKIA 3QF4A 3WMGA 2OILA 1WCV1 2AFHE 4M1SA 1MO4A 3EWAA 2FG5A 4H1VA 1Z83A 3DEFA 4NYJR 3MUFA 2IYTA 2C2HA 5EXPA 1COWA 3H0KA 3QG1A 2I1QA 1CF4A 2QAGC 3B82A 4LJ7A 1ZM9A 4RFVA 2NPFA 1MABB 4MGZR 4JLJA 2KJQA 1HUQA 1MH1A 2ZUBA 1JR3A 2VSXA 3A37A 3KQLA 1E2DA 1CR0A 3IHLA 1XTSA 3LW7A 1D9XA 3HP1A 3L2OB 4HLDA 2G6BA 5EZ5A 2YKGA 4JLKA 2HXYA 5KOYA 1HE1C 4TN1A 1AQUA 5CITA 3ZD7A 3LX5A 4R71A 4AURA 2ZU0C 1KK0A 3K53A 3LVRE 4TZ6A 1II9A 1Z0KA 2ONJA 2BMFA 2ZRAA 4AY2A 2HXSA 3BXZA 5E7MA 3I61A 2A3RA 2DR3A 5FOTA 5FBRB 4B32A 4C2TA 3A6PC 2GK7A 1WQ1R 2GJSA 1WRBA 2C9OA 3SYKA 1NVVQ 1ZNWA 1TADA 5J4KA 5JSZB 2BKEA 2JJ2A 4XSHA 1E9AA 3GEEA 1T6NA 2Q9CA 1N0VC 3THXB 2CK3D 3B5JA 4MRSA 2AD5A 2OUKA 1GL6A 1SVIA 4KYUA 3ZLJA 4TMTA 3BB4A 3QE0A 1Z47A 1ZVQA 4FMCB 2C77A 4Q00A 1G3UA 1JQLB 2OO7A 1U8YA 2W0SA 2ZSEA 3VHLB 1VHLA 4RD1A 5JZVA 4PHFA 1MT0A 4JLAA 4TT3A 1JXOA 3EIHA 3EX7C 2IHYA 3B1XA 4QL3A 2WJYA 2XTMA 3VNVA 4XJXA 1XTIA 3BAFA 1D9ZA 2EWWA 2V4ZA 3I3SR 3X1XA 2ZROA 1UDWA 3MLEA 3SJCA 4DLZA 1MRNA 2XOKA 4JSTA 1W1WA 2O5VA 3EZFA 3U3OA 2VHJA 1CJTC 1JALA 4WW0A 1Z6AA 1CRQA 4F7WA 1VYUA 2BEKA 1XD2B 2J45A 2IYLD 3NBZC 4P33A 1CU1A 4DHEA 2GCNA 4B2LA 4ZCIA 4MQBA 5FOWA 4OI2A 5FPYA 3RS4A 4NMMA 3P4XA 2AKYA 2R9VA 5B64A 2NIPA 4D6PA 2JLSA 1JEDA 2CBZA 1W44A 2QENA 4I81A 2OE2A 1G64A 2QAJA 1Z2AA 1P5ZB 2IXFA 1L4UA 2BJWA 2VYFA 1AS2A 2VHTA 3LFUA 4R2HA 2D3WA 3Q7PA 2VO1A 4IDQA 5KO2A 1OB2A 1VKJA 3LQQA 2JLVA 2OM2A 3LWNA 2KBEA 1CULC 1E0SA 3VKWA 3K9GA 1JPJA 4LSGA 3VR2A 4KLZA 5BW8A 5L3SB 2NMVA 2CL0X 3VX3A 4G5GA 2Z6VA 1ZD8A 3OAAA 3H84A 1I2DA 3IBYA 2QN6A 1E99A 3NKVA 4PX9A 4KJZA 2ZE8A 4BFUA 4QBFA 1MRSA 4BFSA 4DLTA 5KSZA 5LD2C 5FOSA 2EWVA 4HB2A 4U00A 4WAUA 3AB3A 5LBIA 4ZDIA 4LV5B 4QOSA 1Z3IX 4LHYA 2J9RA 4C0QC 1XD9A 3DVLA 1OH6A 4HUTA 2FH5B 1F6BA 2EU8A 4B73A 2BJVA 2H1LA 2QE7A 4C7OB 4LYHA 2G88A 1CKEA 3AVTA 5JEDA 1II0A 2FSIA 4D82A 3TSWA 4JZKA 4YONB 1G18A 1R4AA 2F7SA 4HLUA 1ZIOA 4V03A 1AGPA 4F93B 1IY0A 1FQJA 1N6IA 4RKFA 1EG7A 4QBIA 2XZPA 2MSEB 2VH5R 4Q66C 1S9DA 4JT4A 3MJRA 3I92A 4ITRC 1TF7A 2O0JA 2JDID 2ZRDA 3AF4A 5EP4A 5AUPB 5FPHA 4Q19A 3S1AB 3RLFA 3GCGA 3VQTA 2P0EA 1KSJA 1E0AA 4PXAA 1YR7A 3L8YA 5CIWA 4OHWA 4PHTA 4PPQA 4JYCA 2VP5A 1P3JA 5GVRA 4ZCMA 1GRQA 5LPNA 3VAAA 4GMXA 3KFVA 2JDIA 1NN0A 2PEZA 4DT1A 4CZ2A 4MGKR 3VX4A 1KO5A 4ARZB 3BJIC 5L3QA 2ODBA 3GLIA 3GLFB 3KKQA 4TTRA 4PO9A 2OG2A 3SJZA 4FN5A 4WZBE 2FNAA 5TY0A 1A82A 2GJ9A 3CM0A 3FHCB 2O0HA 3BRWD 3D6TB 4JL5A 5C2JB 4P31A 1J8YF 4NTZA 1RVDA 4QM7A 3PJRA 3CUEF 5CK5A 4GP7A 2LCFA 4BECA 4E22A 3THYB 3SBDA 3L0OA 5ELXA 4DCSA 1M1YE 2Q9BA 2WVJA 4PAQA 2EFDB 5AK0A 1HA3A 3TUJC 3SQXA 2OZEA 2E9SA 1G6HA 5KTYA 2WWGA 1NKSA 2F3TA 3TQFA 1ZD1A 3GMTA 4DLUA 1NJGA 3D7MA 1S0UA 4B71A 3LY5A 3ZIAA 1UAAA 1GDDA 1LW7A 1IM2A 2VTKA 2Q21A 2PLFA 2VEDA 2ZEJA 1AM4D 3HU3A 4P4SA 4NYMR 1KK2A 3LNCA 1RW4A 1ZYUA 2QY9A 1NVXQ 1YZUA 4IDHA 3Q9LA 2JIZA 4L5BA 5HCNA 1NL3A 3M4YA 2PCJA 2ZJ8A 1Z22A 2P6UA 1Z6XA 3FWYA 3D31A 3FKQA 1R0ZA 2LKDA 1OE0A 1TQ2A 3G82C 3PUYA 2W2VA 3HR7A 3DPUA 4I1VA 1RYHA 2ZI7A 4R98A 3M0EA 2ODNA 2ORWA 1P2VA 3ZYCA 3FB4A 1DAHA 5CLLA 4DIEA 4EPYA 2GEUA 3SN6A 2BV3A 2IYYA 4NBSA 5DLQC 5EZ6B 2OCYC 2W6JD 4CEHB 1GP2A 3B9QA 4PC1A 1RYFA 1P2UA 2ZSDA 3U5ZB 1NG9A 1OT3A 3AVQA 4GL2A 3EA5A 1WBBA 4MKFA 3E70C 4R9UC 4JJZA 4X8OA 3MRSA 3Q7QA 4LBVA 3THOA 1XU4A 3HR8A 1HURA 2ORVA 2YNMA 1NSTA 2FFAA 5TB5A 3Q5DA 4F4JA 3DZDA 2OCBA 1YHNA 2J0UB 2VHQA 4EDHA 4FWIB 1SXJE 5FL7D 3N70A 2XZOA 3A1SA 4LWZA 2D2EA 4PQRA 1XEXA 2ZETA 4G01B 1H8EA 4B34A 3TUZC 3Q3JB 5BXQC 1OXXK 6Q21A 4HDOB 2XZLA 3GJ6A 3FOZA 2YHSA 1KAOA 5FPKA 3QKUA 3QXCA 2G3YA 3VKGA 2SHKA 5F2EA 4GFDA 2B21A 4JVSB 4Q7KA 4Q1BA 3PUWA 4G5SA 4ZO4A 3W3ZB 1E96A 1C1YA 4GMDA 4XWAA 5CK4A 2C03A 1GAJA 1IN8A 4HDQB 4HLQB 4LHZA 2A30A 3C7KA 3RSOA 2BIFA 1RRFA 1G8YA 2BMJA 2IUTA 5SZHB 3EXAA 3KTAB 4MGYR 4BFWA 1L8QA 1DARA 2WMNB 3CX8A 3OIUA 4Q4JA 1Q12A 4TLBA 4TL7A 2F1HA 2HUPA 1W4RA 2XAUA 4MKIA 1T91A 4PZLA 3ZVMA 3KB1A 3NC1C 4LJAA 4BLOA 4DIDA 3T1VA 3ZZTA 4XWKA 4C2UA 1TTTA 4F92B 2C99A 1E6CA 4GSYA 1VCIA 1YR6A 1Z06A 1I4TD 5JCPA 4J0QA 3KL4A 1IN6A 1GFIA 2ZTSA 3C8UA 3DZ8A 1G7SA 4D4LA 5DE3A 4Q03A 4Z8XA 4P0TA 1S3SA 1ZD9A 1KI7A 1J7KA 3NIBA 2IYVA 1I4LD 3IHWA 2A5YB 3THXA 4EAQA 5DGXA 3U7FB 1F2UA 2R65A 3IUYA 521PA 4Q21A 1EFRD 3SHWA 2WWWA 4YXWD 4M9SA 1QHIA 4MYHA 3N2IA 5EE1A 5GJVC 2J46A 3GLGB 2IYXA 4BFYA 2AX4A 1PUJA 2KE5A 4BLQA 1E1RD 1IHUA 1G5TA 3LLMA 121PA 2PX3A 1FMLA 5J4HA 4MYTA 3VU9B 1AIPA 1EFRA 3GLGA 3KB2A 4IFEA 3RHFA 3AVOA 3AF0A 1U90A 2NZ8A 2NO0A 2YVUA 1VYTA 4M4SA 2J7PA 1OXUA 2PZGA 1Q22A 4DSOA 1FQKA 1NIPA 1F48A 1M34E 1XFAA 2QAGA 5BYKA 3AVVA 1U8AA 3GLIE 3A4MA 2R44A 3HU2A 2DFKB 1PZNA 3SYLA 3OZXA 3QI2A 2JEOA 4HAVA 2VRWA 1KJYA 2CMKA 4GRAA 3CPJB 3AGPA 1YR9A 5KU1A 1Q21A 1ZM2A 3TUIC 2XXAA 2QRZA 4GI7A 3BD9A 2EFCB 4QJ3A 4URWR 4TYNA 3TSOA 4ZI3A 4KU4A 2ZI6A 4QC2A 4X8LA 5FUYA 4A0FA 4OQXA 4C0AC 1BO6A 1JQJC 1P6XA 1V43A 2WJGA 3AP2A 5J40A 3KUDA 4AKEA 3QF4B 4D25A 3KTAA 1VG0B 3BFVA 4TZ0A 2WOJA 3B78A 2ZXUA 2ZSFA 1GVNB 4QKQA 1YRAA 3AVYA 4HB3A 3B13B 2IYSA 1VG8A 3GJ0A 4CF7A 4Q4LA 1S3GA 3CH4B 1N6PA 1OFIA 1ELOA 1N5IA 2IC5A 4PZZA 3FE2A 3BH6A 3GLIB 4MRRA 3MWKA 2OEPA 2XB2A 1KHTA 2QUZA 3PUZA 4D0NA 2WKQA 5FI0B 3FMIA 3OEED 3V9PA 2NTYC 1GKYA 5AJYA 3GEHA 3EZ2A 1Q3HA 1UEIA 4DSTA 2WJVA 2QTHA 3CONA 3TVDA 3BERA 1OW3B 2BBSA 5DI9A 5TVKA 3CX7A 3WYAA 3SQWA 2WSSA 5B58C 4URVR 2J7PD 2IUUA 1KDRA 1XF9A 4II7A 2EFEB 3IILA 1Q57A 3RC3A 3H2YA 4HLCA 4DEYA 2QMEA 3GFPA 5FUWA 1BIFA 4A0HA 5H1YA 5JRZA 5JWHA 4IHQA 1E2KA 4MITA 2KI5A 4JS0A 4QJ4A 4ILEA 1XBTA 3A4NA 1E32A 3L0PA 5GJBA 5JHGB 3WRXC 1WF3A 1FOEB 1SXJB 4IJMA 1G20E 2A7QA 4BLSA 5CB6A 3QQ5A 2IEYA 3CRRA 1KIMA 1TUEA 5EXXA 5HCIA 3B1ZA 1FNMA 2FA9A 4AG5A 1SHKA 1OKKD 5BN3A 2F43B 3O8CA 1TQ4A 4BASA 2JLXA 1CJMA 1P9WA 1E2NA 2Q9AA 4TL8A 3OFNA 1P62B 2HJGA 4PANA 4URYR 5B30A 5JJKA 4XD7A 2QRNA 4O0MA 4MA4A 5FBWB 5AJXA
chains in the Genus database with same CATH superfamily
4BNGA 4Z6KA 4IF4A 4LJSA 1EVEA 1U2DA 3UK2A 3F9RA 1N6KA 5DDIP 3VU1A 5HRAA 2R85A 3ED1A 3K1YA 3IVCA 4GIBA 3DFIA 4JBNA 3UGTA 1O8CA 2JK0A 5KMGA 5JNSA 1LLFA 1L5VA 3HYTA 1ZIDA 3MQ4A 4KK3A 1YE5A 2HGSA 4AN4A 5C7LO 2GHTA 3OTOB 4OB8A 4RVDA 1GGEA 3L8CA 1EIWA 1KK1A 3Q7SA 3O1JC 4ZZIA 4B4UA 1H2YA 2WWFA 2JCGA 2ZREA 3EEBA 3H5IA 1X7WB 4IWXA 3MXTA 4CEJA 4GR4A 3ADPA 2GN1A 4B2PA 2PGLA 4A5SA 4DJTA 1JGTA 1P81A 1XRSB 3DOFA 3NIWA 4B47A 2J87A 4MO9A 1ZVVA 3ZV7A 3HJRA 3UFXB 3ELBA 3AHGA 3AV0B 2D5CA 4TUYB 4A6EA 2EG5A 4JITA 5J43A 4CIWA 4HI0E 3RABA 4KQJA 5F9FA 3ZJYA 2O8DB 1X7HA 4GP9A 4JBXA 1EFPB 1M34A 3VHRA 1N0HA 1VC2A 1EWKA 5ALTA 1YKFA 9ATCA 4M9UA 2XNHA 2RBGA 4CDNA 5CB8A 1WG8A 5JXHA 1QGDA 5FDFA 3HE3A 5JLJA 1PSZA 1T5TA 2AC4A 3AC0A 4UM9D 1HT3A 3C1AA 4TYPA 2QTFA 4DN6A 1EG2A 2PGAA 3TRHA 4DDVA 4G9EA 1B4DA 4WZ6A 4LJKA 5D3MA 1M7HA 3VFDA 4E2WA 2GYVA 2P11A 1GU1A 1QHXA 2VHWA 2JRCA 3C6XA 2QQ0A 4FFBB 3QWFA 1L7MA 3IA7A 3M83A 5ALDA 4QLBA 1XIVA 1FW6A 2TRSB 1Y8AA 5TV2A 3GJ4A 2X4DA 3ORRA 3WNDA 1P9RA 1NNUA 4INAA 4M1MA 1BYUA 5E4JA 3P0HA 4I3GA 2VRCA 5ITSA 4G1MB 1ETUA 4UU1A 1EUDB 3RVJA 3D4IA 4DLLA 2PZAA 5ITVA 1BXKA 4YFVA 4HO1X 1OILA 1UKYA 4UCFA 4R9SA 2P9CA 2Y2UA 5EL0A 5JD4A 3CRZA 5J4VA 2BKLA 1P2BA 1TC1A 3R4CA 1OX4B 3C3EA 3A4YA 3TG2A 4KXFB 2CZGA 4UTRA 4WK4B 3T15A 4IIYA 2HY7A 5LQUA 3ROXA 1UBLS 1XZKA 4ZPXA 1AOXA 1GTMA 1SVKA 2ZRMA 4L0CA 4B4WA 3DTYA 4DLPA 2XUDA 5KTOA 3QTBA 2WIDA 1N6RA 1N25A 4QRHA 1GA4A 3ND5A 2VK2A 1C0LA 4YO8A 5AVOA 3TOVA 1NHWA 4EJMA 2VDWA 3G13A 3ITDA 3KXPA 3M6XA 2OK8A 3DKVA 2OXRA 3NBYC 2FLVA 1TMOA 4DJAA 4Y9RA 4FGLA 1DX6A 3F6PA 2A67A 4WJZA 4EK9A 2G77B 4P4TA 5JNWA 5EP2A 3R7AA 1XF1A 4KW7A 4NBTA 1H5QA 3ZDYB 2ZM6B 2EYQA 1MTOA 2Z2XA 1AK2A 3ZDFA 5ECYA 5THKA 5CJPA 3LWDA 2W6IA 4BO2A 3MD9A 1P4RA 4E2YA 3IQDB 2OHOA 4LS3A 1W5SA 2B1QA 4QHTA 4C3ZA 4DPKA 2J0QA 4UBKA 3TQQA 3G2MA 4D81A 5JNUA 1IEWA 3IR6A 4QUKA 9ABPA 5GOTA 4NECA 3NJ8A 1NLMA 3OJ0A 3WO1A 3E27A 3NIDB 4X94A 5DWDA 3RC1A 4ZVSA 1D4FA 1PWXA 3QYAA 2ZE6A 5F7XA 3K9LA 2FPMA 4AK9A 4E09A 4ETNA 2DCUA 3KLPX 2CJPA 2QVGA 2WJHA 1LS1A 3I53A 2P5YA 2QIPA 2ZFUA 3D02A 3QFTA 4FHGA 1K8QA 3L7BA 1H9CA 3KKMA 4MW0A 5L3VA 4CR6A 1SR8A 3CR8A 2IPLA 1RIFA 4GLOA 3RYHB 3NTRA 3S2EA 2XKJE 1FDTA 5B3JC 1SBYA 3JQRA 4D3DA 4NCHA 2CVHA 4F84A 1DCKA 3W5VA 1USWA 4D7AA 2KPOA 2PMBA 2Y1CA 3OMWA 5K4GA 5CCEA 3CG4A 2C9CA 5KQLA 1WF6A 2MYPA 4OJTA 1DADA 4N03A 2YCBA 1KH1A 2Q4OA 4X92A 4N0EA 2OPHA 4EHIA 3WJAA 1CJCA 1X39A 3HCOA 3EVNA 2P6NA 4KLCA 3C3CA 4RSMA 1SKMA 2AFHB 2L19A 4OIMA 3L0IB 3R7SA 1YS6A 4M7PA 2KLHA 3R9WA 5AUOB 5EJ7A 3I9MA 4UBIA 4P8RA 1DKQA 4E6PA 2NO5A 5JCOC 5AKHA 3JW8A 5CDGA 3PE3A 4LFBB 3TZKA 3SM3A 2VPTA 1YDFA 2I22A 3HBLA 4E51A 5LQAA 1SJ9A 2B8WA 3WLFA 3D7KA 3DYBA 1E2QA 1AK1A 1ISSA 2DC1A 3BWEA 3EVAA 3KR1A 3LQYA 3NV7A 2QRQA 2EJUA 3NKLA 4O2BB 2IPMA 1Y63A 3FTPA 1A95A 3OOWA 4V0KA 4JLWA 4X0EA 1N9ZA 5DRTA 5JAQA 4YMLA 3IKJA 1Z6ZA 3KVOA 4MGHA 2A9KA 1X1RA 3JQCA 3RT1A 1EX9A 4JC8A 3NH6A 2QVBA 3H1GA 3LFTA 1HQYE 4MLDA 1RYZA 2FP4B 4B79A 2W48A 4UM9B 1O4WA 2WE8A 2Q2NA 1GGMA 4OHUA 3MBOA 3Q6NA 5CM9C 1ECCA 5FTLA 1KSGA 1LDMA 3RRXA 4A26A 4ZMRA 1GTL1 1O6CA 2IEBA 3O7MA 3VR0A 3I45A 1LPBB 4IKPA 5TQ2A 5JECA 1P72A 2H07A 1IIRA 3FMFA 3A6HA 2QMHA 1YSCA 4HVAA 4JI1B 1JS1X 2H5EA 3K2IA 1R18A 4KH0A 4KRXA 5CR9A 4L85A 2GSWA 3G2LA 3I62A 3MWLA 4N8DA 4P32A 4TWZA 1QTNA 3VAYA 2CDRA 5ICGA 5FWNA 1U0RA 4TZ0A 1DRWA 3AR5A 3RR2A 1XMJA 3ZWCA 5L53A 4YXWA 2E3JA 3ZZUA 3SZRA 2BHLA 4KQ6A 3AYZB 2IXTA 2Q5IA 2QG6A 2W9XA 1BFDA 1F8GA 2GN9A 3BILA 3DBLA 1J21A 1X7ZB 2PAAA 3I8SA 2UYYA 4IX9A 4YMTA 1U4OA 1MOQA 4OLHA 1GL9B 1JU9A 2WG1A 3VR3D 2D5BA 3C3JA 3JTMA 2AKAB 2XJ9A 4XH9B 5KPJA 1KEUA 2FPPA 2AWNA 4GQAA 5EE9A 3LIPA 3EPJA 5AD1A 2RGYA 1GFSA 3BD6A 4QELA 3R0IA 4RIHA 4BAGA 2ANCA 5AVTA 2BZ0A 1A9ZA 2K7ZA 2D0PB 2DJ5A 3ABIA 4HNAA 1DX4A 4N82A 4ND8B 4E4RA 1SVWA 2EJWA 1RMQA 4ZQFA 2IH2A 1CRPA 3MWDB 4U39A 2PIDA 4V38A 2I78A 1AGRA 1V35A 2Z9DA 1ANKA 3G0DA 4OTZA 3HN6A 2VF2A 4UUPA 3LBAA 1QKIA 2PSDA 3D7RA 3PR2B 1YL7A 4JBIA 1CUHA 1XK7A 3ND8A 2PUEA 4M7WA 3M70A 1J8MF 3PQ3A 3KJIA 4S12A 4U9IS 3DD1A 2PX0A 1NUHA 2DR0A 3DOOA 4DGQA 2O07A 5I4KA 1J00A 4PC3A 3WLAA 3ZWYA 4F86A 1KNQA 1VCOA 4RJJA 1YQEA 4ZI2A 1E9VA 3ESQA 1JU4A 1SKYB 2AG8A 3IXLA 3MGGA 3HDYA 5B6JA 5E9QA 5I9LA 2CDAA 2NVWA 2GKSA 4HYQA 1NG1A 4IVNA 2PG3A 5H16A 4N5HX 2QPAA 2QK4A 3EDYA 4GXNA 3AV3A 5AM3A 1J8FA 2G5CA 3IR5A 3L0ZA 1CDZA 3ICCA 2IIBA 1RKUA 4ZAVA 3DXZA 4QYMA 5AIAA 3VH1A 2QN1A 2WB2A 4LJ6A 1RWPA 1ZOPA 2AR7A 5CFOA 5IVPA 4GYKA 3GLFA 2HA0A 1SQ0A 3RUCA 3NTOA 1YQWA 1SN7A 2O57A 4RL4A 4IMIB 5COQA 4Q34A 3L04A 4Y2RA 1GL3A 3ZCSA 1C8LA 1V3UA 4DLSA 1NXOA 2X2EA 3EHEA 4I50A 4NCNA 4S3MA 1G1MA 1W5EA 3ULKA 5KYXA 2Y1EA 3GRRA 4B9EA 4CN9A 2PS3A 2YWJA 3NETA 4DQXA 2B4RO 3RFFA 4JA0A 1J8VA 2ZBVA 1HC7A 2PWAA 4YO7A 3JSXA 4FOPA 2CHQA 3RRFA 1HNNA 1NJ8A 2ZJFA 4HGQA 4Q82A 3RIGA 4DLBA 3H9CA 1PV4A 1XTZA 4Y9UA 3DM9B 1V95A 4TGLA 1G8AA 2I3ZA 3B1KA 2ZRBA 3VR5A 1NW5A 3KQMA 4XGIA 2VAMA 4EW2A 3Q98A 2AOWA 3U61B 1P8AA 1RXEA 1X8LA 4LJ9A 5CXXA 5AKZA 1VZ3A 3WSWA 1K5HA 4QVKA 1VG9B 2I62A 4LHVA 2QUHA 2ZYGA 5FOXA 2CJWB 1CP2A 3CIFA 1RLTA 3OOJA 2QLJA 2VQ6A 1H69A 2YFKA 5AH0A 1KERA 5JO0A 2BI4A 2PANA 4PRYA 3IVRA 2OV3A 4TXNA 5JADA 3GT7A 5DHPA 4TL6A 2PUFA 1TT7A 3AI2A 2R6HA 3HCAA 4R0VA 1KI8A 1BXZA 2D2IA 4NFSA 4ZJZA 2XRZA 2PV0A 3QX7A 3C4JA 3VISA 3RE1A 3U7HB 5C8VA 1F8YA 1AN9A 4LISA 1DUIA 3OM9A 4G0XA 2VYVD 2GESA 4BNDA 3GLSA 5KPDA 3DL7A 4FJ2A 1LTHR 3IOCA 3PNOA 4TT8A 1JEJA 2BFPA 3ILSA 1QHEA 2GLXA 3RBZA 4DZZA 1ZC4A 4OB7A 2JZNA 3BBLA 1Y6GA 2FR8C 3K8ZA 5LXTB 3HU5A 3RIHA 3B6IA 5HUHA 1KI1A 2JIOA 2B35A 1EFHA 3GD5A 4Q9HA 3TW8B 1QU3A 3ABRB 3EEQA 1MU0A 1U2EA 3UJNA 5DGDA 4FMDF 1H2AS 1BMFA 4H27A 4WFIA 4YMSA 1G8GA 3WZLA 621PA 1MC4A 4IDBA 4WTOA 1IYZA 2VR1A 2XMPA 1VIDA 2DG2A 3QLJA 1ESZA 1JIJA 2P78A 5IXSA 2WTEA 3S7TA 4E21A 1YK1A 4AKSA 5GZ3A 2ZRQA 2R6JA 3TBKA 4Q4DA 4FYIA 4S1WA 4KV9A 4CMIB 2PMEA 2JFUA 5E3IA 1JDSA 3LQRA 4RZ3A 2K7FA 1SZPA 1CQXA 2XIQA 4LYAA 1PUIA 2QSYA 3RSGA 1NZDA 2H85A 3GA5A 3PUXA 2WUDA 3T0GA 3ZHZA 1ENOA 3ZHQA 4BO3A 4CLHA 2CJFA 2GHRA 3ABZA 2RC5A 1KRWA 1SG6A 1QOQB 4G8CA 4QOEA 5G02A 5FH9A 3Q9NA 1U3TA 4QO8A 4C7XA 2XMDA 3F3YA 3QKTA 4QU5A 3UOGA 3T3DA 2IBMA 2R8XA 3KQYA 4OHMA 1E2FA 1HYGA 1SC3A 3EZ7A 5K0LA 3I5XA 1TEXA 1IRXA 1JKJA 1XT6A 5AIBA 2IHJA 3T1NA 3HO1A 2YMQA 3UT0A 5JJIA 5JSYA 2H57A 3QPVA 4I19A 2C3OA 3OQBA 2CXNA 3FYDA 4HDRA 5DI3A 5EUBA 4AL4A 1VRVA 2LKCA 3KZ1E 3QUAA 4LDNA 2PXHA 2JEYA 4JDUA 1NNI1 1CC1S 4Y1FA 1KI6B 3RVMA 3UT6A 5CDYA 3DZCA 3TCXB 1LEHA 5GIPE 2GDZA 5LMUB 5TF0A 4ZU6X 4DT1B 2QLLA 2O8FA 4IIVA 5CEEA 1S9HA 3I05A 1W73A 1AHHA 2CN1A 1NRIA 3HUDA 2J3DA 1C9JA 1LBHA 1QFXA 2CNWA 4ZICA 3K05A 2ANBA 3PITA 3GNTA 3RSSA 2I0FA 2PZLA 3E5NA 1TW3A 1H1DA 1HL3A 2AZMA 3K6RA 4G5QA 4OL0A 3V9AA 1QRUA 5BR7A 3F74A 2WD9A 1CZOA 1XZDA 1ZIPA 2P4QA 3UA4A 1JEYB 3T99A 1WU7A 5JYEA 2BEVA 1CFJA 1YI0A 4DDHA 1Z5OA 3EFEA 4Z54A 3LYUA 2B98A 2PJUA 4HWKA 5LC1A 4XPIB 1FRNA 1M8KA 2ID7A 3CLRC 3OMXA 1JH8A 1NJ1A 2FW9A 4KN9S 3IV9A 1JEEA 4IAOA 3Q8LA 4UD6A 3FSJX 1JVNA 2WE7A 4BFCA 4TSFD 3PXGA 4TTTS 1YBMA 2ZR0A 3GCZA 3AL2A 3EDCA 3O26A 3QMWA 4PO1A 3NOXA 1BOFA 3UUFA 3TIGA 1MB4A 1UZMA 2H54A 1SHLA 2X7HA 5IC4A 4AMVA 3TZHA 1NLFA 2DRIA 3IKVA 4YJHB 3CUYA 2VPYA 1JT2A 2IU0A 3AIOA 4RY8A 3RVDA 4E2XA 1EVLA 3B8EA 4EYGA 4YQFA 2CNOA 3V4RA 3IAHA 4AYWA 4FDTA 2Q7XA 3PC6A 3F90A 3OIDA 4GT1A 2FZGA 1GADO 1E79A 2FMFA 3EXIB 2G8NA 3IE2A 1OH7A 2RGEA 2BHSA 3DE0X 3EG9A 2C59A 3W5IA 4CUKA 1UBOS 2YWDA 1E5DA 3U16A 1PDWA 2BSQA 3ES9A 5JO9A 3O74A 1TW2A 4I1RA 1O7JA 1JH9A 3EYAA 2KB0A 2J0VA 2JBAB 4OGWA 2BP7A 1PN3A 2PAFA 4UULA 1XRLA 3W34A 3RS3A 4KG7A 3WBJA 1LSSA 3BDIA 3UF0A 4DQKA 4RWEA 2D00A 3IB6A 3Q9SA 3FJYA 1GGKA 2BE9A 4RAQA 1Y48E 4L07A 1HO3A 1V8BA 2IODA 2ZWIA 4NL4H 4ZANA 1GU7A 2QNBA 3MTIA 2F59A 5DGIA 2P1ZA 3RBXA 1D8TA 4ZCRA 4ZHQF 3EZNA 3EDOA 3LJKA 2HMSA 2GJ8A 1HFJA 1TZ2A 2DSTA 3CJQA 3NTUA 4QWMA 3NDPA 1VHDA 4RKRA 5JH7B 1YR8A 4ZT2A 1PF7E 2GOYA 4RQUA 4X84A 1PT6A 1SXGA 4YUWA 2XE6A 3NHRA 4IP0A 2EBUA 2PL5A 2COEA 4GMHA 1B74A 1P2GA 4PQYA 3HY4A 3JZIA 5DIFA 5BSFA 2QM8A 4J91A 3RQIA 3BWBA 4EPRA 1EVJA 1YZNA 2C04A 3IEUA 2OBBA 1FS4A 4FFRA 4BX9A 5KQSA 2QTZA 3KKEA 3I2IA 3OU7A 1VPVA 4O0LA 4FOOA 5FI5A 5ALLA 2E4AA 3ORQA 3CVWA 4FZ3A 1WHSB 2B2CA 4F3NA 2FR8A 4G1FA 3ZHYA 2B8TA 3NB0A 1YHZA 2MMCA 4YDQA 4V1CA 2JEZA 2W4MA 1UZUA 4FMBB 4NU6A 4HBZA 2D7JA 2ILVA 2F55A 2FN7A 2IU4A 1C7RA 2O1XA 1H6AA 4EB8A 2C4VA 3AJEA 2QVYX 1GDTA 4AICA 2HF2A 3WFZA 2XNDD 1NQAO 4BPBA 2ZUVA 4RCZA 1K8YB 5I9TA 4AB1A 1E2IA 2YUIA 2GNPA 3V3KA 2IWRA 2FSGA 3I76A 1KH2A 1W36B 2DE0X 2RAUA 4Z4CA 3FSRA 1T2EA 1OLUA 2VG8A 1Z4JA 2XIJA 2ZUDA 1XRQA 3N8NA 1CYDA 1HT1E 3E0XA 3RTCA 3WQRA 5B3KA 3KFXA 3DLHA 3O0DA 1GCIA 5REQB 1B00A 4BO6A 3R6GA 4KVGA 5IKPA 4UJ3A 3MD0A 5BV2P 1JG7A 2Z8XA 4G2NA 1L5OA 3JVVA 2VTBB 2B7LA 4Z99A 2YCLA 2ZJYA 5KNDA 2BCGY 1F2TA 1U7TA 2IYNA 2FQQA 2ZRGA 5AVSA 2HA3A 4PFJA 3MJSA 4L4ZA 5IDWA 3OX1A 2V96A 5FBKA 5DBGA 2YC2C 4MK4A 3OE7A 2X7XA 4E11A 4NJEB 1RJDA 2PKQO 3I04A 1OYWA 1FSPA 3ADDA 3R5XA 1UMCA 3PXBA 1ZUHA 4GMGA 4O4IB 4E5DA 2WI8A 2OBLA 4YCBA 5EUMA 1Y8CA 1ZRHA 4NH0A 3KPVA 4MZXA 4BNLA 4KJXA 2P2ZA 3X44A 3OICA 1ZEJA 4GVPA 4K6CA 3O47A 4BP1A 2OYRA 5I01A 3QFCA 3ZE9A 4X97A 4ZYYA 4MYRA 2ZUWA 2AHOA 1IJBA 5AKJA 2XBLA 3C3BA 1ZKDA 4BJ1A 3GARA 4DWJA 5HKAA 2AMFA 5BUZA 2IL1A 2FUKA 3D8SA 4CM1A 3P20A 3JQ8A 1X9GA 5BUCA 1RE1A 3DQPA 2Y1DA 3PRJA 2HCBA 3LBHA 4CM8B 3U7QA 2SBTA 3N5CA 2WWRA 3ISTA 4IX1A 4X20B 5FTJA 2R25B 4G0WA 2QTGA 3SZGA 2GAJA 4HDKB 2Q5LA 1VA4A 1YQUA 4V3BA 1DC5A 5AK4A 5BQ5A 3ER6A 2NO4A 2PPLA 1ENZA 4Q01A 3WIBA 3UMYA 3ZJVA 1KC1A 4F3TA 1CEYA 1E6LA 5MN4A 4E08A 3KXDA 5I5GA 4I4CA 5AI0A 1ZZGA 5C32A 1UEJA 2V58A 5I45A 3AFGA 5IHPA 5IRCD 2GPTA 5EJEA 3AG5A 5DEOA 5FF9A 4U6SA 4AVYA 2GFIA 4IIFA 4UQOA 3KFLA 5FJIA 4EZEA 5JS8A 3D8RA 5ALSA 3WMFA 4CCSA 1XXHA 5EEHA 1VPDA 5JQGA 5FAKA 3O8DA 3F6YA 4KCGA 3T7AA 2QBYB 1PJZA 4G5RA 4JT2A 4KWTA 2ATIA 4DMHA 2Q0SA 3A9UA 3UAZA 2GD2A 3ZKWA 5AOCA 1W2HA 5IABA 1JHUA 2ZBUA 3FCOA 1PIWA 1RCUA 2KSQA 3B5IA 4IHAA 1QG4A 2RC6A 3A9SA 4QHSA 3H42B 3IT0A 4UTXA 2Z1MA 4JENA 3ANXA 2FOLA 4AS2A 1U2TA 3B53X 4I4TF 4L5IA 4NMLA 4G0MA 5H81A 3EW9A 4J7XA 2RHOA 3BWYA 1M2VA 1YR2A 4HRXA 4DG5A 2PUJA 3NPAA 5PNTA 4EKNB 1U7WA 2HPHA 3DKRA 3ENKA 1NURA 1VHQA 3KLBA 3OLXA 1V2GA 3HXKA 4UZEA 1ZMOA 1XTUA 1A2KC 4IWNA 3R7BA 1W2GA 3ERCA 1NUSA 4QTZA 4S05A 1J2YA 4QXAA 5FBLB 1ZAKA 4ZCQA 1NMZA 1C0IA 3ZD8A 3AVWA 2RGNC 5K8LA 1Z4NA 3A31A 3REGA 1O0BA 1G2OA 4HSEA 2YHBA 1WVMA 5AW4A 3A26A 3HKEA 5JRDS 2P77A 1FDUA 4HHEA 1E4VA 3N8GA 5JRJA 4QT4A 4O08A 3UT5A 1A9OA 3HFSA 3BIOA 2BH2A 2IOYA 5DTRA 3RKRA 2J0EA 3FF1A 1RKVA 3R9KA 1GPAA 1MVOA 3WNBA 4QXPA 3WR5A 2NAFA 3KETA 2ATCA 3HPRA 3QUBA 4RV4A 4Z9BA 4FIDA 1X8XA 3FPHA 5LYJF 1DQPA 4UEWA 2P2YA 2NZWA 1MN6A 1FNSA 2XYRA 3PQ6A 3GRYA 3HYLA 1RFLA 3CF6R 3RDPA 3U4QB 2ZE7A 1O1YA 3M6LA 5TEVA 5A5FA 2F9LA 1BCRB 3KOUA 1WJGA 4G1UC 4M83A 4MKHA 3TIVA 2Y99A 3W4IA 4RORA 1LNQA 1X7GA 2LUOA 2JIRA 1QO0A 2C2MA 3SICE 5IWAB 2IUYA 1JLRA 3FI0A 1WDKA 4G9GA 4IZOA 3V7WA 1VHTA 2F2TA 2YWCA 3HFJA 4U3JB 2AT1A 2C2KA 1COZA 2I6FA 4ZARA 2APJA 2G6TA 3T7JA 3RS5A 3SZ3A 3F6RA 2YN2A 5CMLA 3SAJA 1GQSA 3P0IA 1LXCA 2CKDA 3X3HA 5DSXA 4MR7B 4QYWA 2OCXA 4MW9A 5A1TA 3U1TA 5DM70 2NNWB 4UTZA 1NGSA 2Z4RA 4IV0A 2NUTA 3EIEA 2CV2A 4C43A 2DPHA 3K5WA 3HH8A 1Z3CA 2V9ZA 3WSVA 5AVRA 1IE3A 3TK1A 4R41A 2WHRA 3GP5A 1FXSA 1HT2E 3ASUA 4FEYA 4RU1A 2UUBB 4JC0A 4HTAA 1FTNA 4FFOA 3TVTA 4L4XA 2VJNA 5AVVA 5M04A 3K32A 5KWVA 1SQ5A 3R3XA 2ZWAA 5IDVA 4V0SA 2DLDA 5H5JA 5JTTA 3UH0A 5FA8A 1CRZA 1TOAA 1F2DA 1A5BB 3QUTA 2ZUUA 3HBNA 3ZDXB 1MHPA 3LU1A 3O0TA 3MNFA 2FGKA 2O1SA 2YRFA 2WJ6A 3QBTA 3MJ4A 4Y2VA 5AW9A 1B14A 2BR4A 4E5NA 3K8OE 3ZGLA 1I3NA 4JMPA 3HNOA 3PGA1 3N2GA 3RUFA 1PZEA 1QS0A 3PDCA 4M49A 4I9FA 2W6MA 2VK1A 4JDPA 2ZPAA 1T34A 2V9CA 3RVLA 4BMCA 2XV1A 1P18A 2ZBFA 3QU7A 3T5CA 3DS8A 5JS7A 1XZ8A 3BL5A 1NMEA 2XNJA 2IPNA 3I1YA 1V4NA 1X1TA 1UJ2A 3M2TA 4I5EA 3TI9A 4HWSA 5SY6A 1H8HA 3RYIB 1CJBA 3WYGA 4W5JA 4Z3DA 5JH7A 3HNPA 3H2HA 3ZXXA 4F8EA 2JVJA 1CS4C 1HKUA 5G0WA 3KSUA 3S2FA 2F3SA 3AQIA 3N2LA 2FFRA 1VL5A 3O2JA 3KD2A 1RIIA 3TW6A 3W05A 2DKFA 1CUAA 2FUG6 4EPXA 3DV2A 5D6NA 3FAKA 3AUAA 3H8VA 5B2ZA 1SUDA 2L69A 4JIMA 3OCYA 3T4PA 2I6XA 1R0XA 1E3MA 3EFOA 1ZR2A 3GF4A 4N7JA 1F5SA 3L0CA 1ADJA 3GA0A 3N53A 2QGZA 5FTWA 1V41E 2CLMB 4LI0A 4B3JA 4Z1MD 3R7WB 1CZNA 1KMHA 1RJ9A 1X38A 1Z35A 3VTAA 5MGNA 5IAAA 5IKXA 1TJ3A 2BFCB 2OHVA 1MNAA 3A9TA 4FTWA 4JC4A 4LE0A 4KO3S 4F38A 3N3BC 1XTQA 3C6ZA 3BJRA 4HFJA 4YAEA 1S2MA 4RDXA 4QECA 1I36A 3FOBA 1RYDA 2BGKA 2X0KA 1PS8A 4RX1A 4YJHA 4JUCA 1DAMA 3LBFA 3TR5A 3SBEA 1UKAA 1AA6A 1VE1A 2NUPB 3H9GA 2VH1A 2AEEA 1USVA 3RAJA 3RFUA 3N07A 3PBKA 1DTWB 4DQVA 1NTRA 1E1CA 2P68A 2POQX 2VVTA 1UM9B 2ZRCA 3D0KA 3QY0A 4PAOA 3WK6A 5KYYA 2JATA 4OYYA 2B69A 1H66A 3UGQA 4HMQA 5JASA 2IZOA 4K9OA 4PBRA 1H9BA 2F48A 2JLQA 2J30A 3RGGA 5JHHB 2PX4A 2XSZA 3QJ5A 5J63A 5KZMB 4GKKB 3WIUA 4DLNA 1MRZA 1Y9JA 4RETA 2WTNA 3C14C 4O1HA 2QE7D 4F3YA 3OUTA 3DTVA 3L93A 5E95A 3U0BA 4ECEA 1P45A 3GGCA 3K2BA 1L7PA 3NDBB 3GH3A 1CZRA 3L5OA 2G1JA 4Z0TA 3AKCA 4B1FA 4AAYA 1KJ9A 1V0JA 3DAOA 3WIVA 2V4UA 5EIEA 3OVMA 4HEJA 1ES9A 1A4XA 1KARA 1NVAA 1YRQA 2VDPB 3JD2A 1LRKA 1MO3A 4BC0A 2J5QA 3WKEA 3LAWA 4HWPA 5SYMA 3VZPA 2A84A 3KVVA 3ESAA 2ZM5A 3ZNPA 1DP4A 1DKPA 1WMFA 2P1DA 1HZJA 2X9NA 3KR9A 3LCRA 4LI3X 1A8HA 1U0TA 4QAQA 1P8JA 4WZBB 1U7XA 2GUWA 4DHWA 3M7IA 3MOIA 4RS4A 5H68A 4A8HA 1G42A 2C3MA 2ZJ6A 3TTUA 5B53A 3AESB 4AJNA 2ISSD 4TKUA 3HEBA 3W2TA 5KDDA 4MP6A 4IY1A 2B5VA 4B3TB 3PENA 5EJAA 2ZYVX 4EW1A 3W2FA 1SD5A 2ZTVA 2OQRA 4KR9A 1G7CA 4LAFA 3Q0IA 4N5MA 2OKGA 3GV0A 2HT1A 4G4SP 4IYRA 1CVRA 1SEVA 3L0SA 1M1YB 1LJUA 4FC7A 4BNFA 4QEDA 2DLCX 4G81A 2C4WA 2EJBA 5AW1A 1TM1E 5CRIA 1L5LA 1C30B 3H5OA 3K70C 3OQ1A 4CM6A 4HVLA 2Z30A 2J07A 2VDLB 2Y6UA 3QFRA 3LDHA 2IZZA 5JOQA 1Y7TA 2CMDA 3MWYW 2CDNA 3F9CA 2OK7A 2O3QA 4TSRA 3DVAA 3L7OA 3WJ2A 4BO1A 4D0LB 2VSQA 2EKDA 3BWXA 4LYJA 3H0CA 1J0AA 2D1YA 4NIMA 4CEIA 1ZK4A 2FEKA 2GBPA 4RZIA 3H11B 4IDEA 4WHMA 3U4HA 3V1TC 1VBFA 2GCPA 4IO0A 1JHPA 3K31A 4O4LB 1PZXA 5A71A 1KZ7B 4NPHA 3CNBA 5IM5A 4ARZA 3INGA 1CUSA 4F5EA 2DHEA 3ZDRA 3IIJA 4JLUA 1SXJC 5BR8B 4MQUA 3HB4X 4D9KA 4I5DA 2C1XA 3JD3A 5KCMA 2ODAA 1T5SA 2XA9A 2B30A 1JA0A 3N74A 1QPGA 1VL6A 3VHXB 4COOA 5JTUA 3IKMB 3H9UA 1QG2A 2PH5A 1FYXA 4UMVA 3LIIA 2R6AA 2GXSA 3NGLA 4KE6A 4E46A 2Q50A 3CH5A 3KJZA 2WAMA 3LGSA 4K2AA 1POWA 2GVZC 5HJEA 1R8XA 3TQCA 4IQGA 3VAZA 4IHKA 1F1BA 1U8EA 1YZLA 2AOTA 3U44B 8MHTA 4HDKA 3G79A 4F97A 5CYFA 1FJGB 2MR6A 3WHLA 2HO5A 3B6ZA 3GROA 5T4BA 3ZK7A 3AWDA 4S1PA 2WG0A 4IW3B 4N1AA 1V71A 4QBTA 4TV8B 3MCUA 4CEHA 4QM6A 4LHXA 3RKSA 4EL0A 2NACA 1AJEA 3N1UA 2QL5A 1HFKA 4NEQA 2N9UA 3O3CA 1ADFA 3PC8A 1QKJA 2KHZA 1QLJA 1QONA 1AMNA 2AZTA 1R5JA 4YK7A 3V8BA 1E9FA 1IPEA 1HE4A 4G0VA 3VA7A 4WXPA 4KFSA 1DQSA 1DV1A 4FXOA 5HTKA 2GHIA 4ENRA 4AKTA 3IL2A 4K6KA 2GN0A 1D6JA 2I2DA 2JPDA 3WLTA 3NJ4A 3TQTA 4XD7D 1GLNA 3A6LA 1B23P 5GONF 1E7QA 1J97A 2I54A 3F8WA 3VYWA 4K1LA 3RF7A 1FSSA 2XGJA 2YJ3A 1VSQA 3U4MA 3BF8A 3R76A 3K0FB 1EGAA 3H9JA 1JJFA 1YRBA 2KMLA 4FFMA 4DJFC 1RHUA 2DCMA 2WLSA 1ZSYA 4JVLA 2AG5A 1JZTA 5BNTA 1BW9B 1NXTA 2O2DA 5BORA 1PHRA 4JNKA 4ZI7F 1UDBA 1T5BA 2VP6A 4FR0A 1C2TA 4RKWA 5GJCA 4ZI5A 3SX4A 4KQ1A 2H3EA 3PWKA 3ZWNA 4MGIR 4AF7A 2OHJA 4G89A 3DC2A 2CXUA 4LDAA 1IDN1 2H18A 4FPXA 3TDKA 1MJGM 4IJKA 3K0SA 3OETA 2O2IA 5TMBA 2JK1A 3D3EA 3SS9X 3GJTA 3S1SA 3M81A 4HH0A 2WYHA 4XFKA 1OR8A 2HJWA 3UMCA 1UBJS 4KO4S 2X0JA 4K26A 3F9IA 4E33A 3BUSA 1KTVA 2W90A 1CHDA 4IOKA 5KUTA 2BFFB 2O1WA 2X9LA 1XMXA 2X8JA 3ACDA 3BRCA 3MILA 2BHTA 4QHYA 4AZTA 2KYRA 1KA9H 4U0JA 1N2GA 2OGWA 3GDHA 3R0ZA 1EUZA 3BQNB 5KNBH 4MQFA 2FWNA 4B3BA 4RY2A 1ZJJA 4IQ0A 4PPFA 1Y5MA 4FUQA 2II6A 1AKYA 3WMXA 1U1EA 3MT7A 1GZ4A 2G9UA 2WYOA 1NW7A 3DNPA 4WESA 3V48A 3X0DA 4LWOA 2XB6A 4OXNA 3P45A 4RFLA 3ROQA 3RSLA 3U6BA 4LZLA 1PEDA 2NQ2C 2I3DA 3QLTA 3PI6A 5JXWA 2QAIA 4Q18A 5ITZB 1CR4A 2NTJA 1RM5A 2WC1A 1UKCA 4M8NE 3ZC3A 1JIQA 5JJ5A 4PG4A 4XCQA 4ASUD 3C7AA 4EX7A 1KFEB 2ZR7A 4JJ7A 2G9ZA 2GN2A 5KSPA 3QTLA 4YWHA 2YXDA 3BC1A 4H31A 4TV9F 2YYSA 5U4QA 2RH5A 3L92A 4GMKA 3HDJA 1ZHHA 2AUNA 4KLNA 1FJ2A 4B75A 1DKUA 2MR5A 3EF0A 3TEMA 4E7PA 2FPGB 5JNRA 1XRJA 1Z8NA 2WU3A 1JNYA 7MHTA 4FCCA 2QD4A 2PFGA 4JGIA 3W7VA 2X7JA 3DO8A 3ET4A 4EGJA 3WRYC 3KQNA 1R50A 4JOQA 4DPMA 1FDOA 4PXSA 4OHBA 2I7XA 1W4AA 1GAWA 3OC0A 4A6DA 4D4GA 2GVDC 5JBQA 3Q88A 4IF6A 1FLAA 4W8GA 5D85A 4MV3A 4ZV7A 5C1DA 3O83A 1K4MA 3U4DA 2VAPA 3SX0A 5F98A 4YTEA 4ZVMA 2Z3ZA 5GMOA 4OL9A 1OH5A 1YUMA 1ZHOA 5KHLB 1LC3A 4KBFA 1R0SA 2EZUA 2Q3CA 2ZI5A 1A1VA 2KM1A 1E9CA 4LNUA 3WA6A 2FSHA 3NORA 3S0JA 1IY2A 1X1DA 3TDNA 2DT8A 3L1JA 3HA5A 4LX0A 5K8UA 2X42A 2V03A 1DL5A 4R1SA 1H9AA 1PBNA 3PUIA 2GB4A 3ENNA 3NOOA 3C6KA 4YDSA 4EG5A 1YS2X 3QX9A 2A1TS 2F3UA 2H4WA 3BTSA 4BNDB 3SIPA 1SHJA 4RF4A 2HQ1A 3CY6A 5IJ0A 4R31A 5JSFA 4OP1A 3H65A 1GXSB 3QOFA 2LIVA 3HVHA 4M7OA 2XOEA 5TQJA 4M3NA 5KC8A 1Q19A 1AB5A 1PLLA 3TFWA 4DDKA 4Z4HA 3BFJA 3FPAA 1I1NA 4YPFA 1LVUA 1T9KA 2I8AA 4BNTA 4MRNA 4K8RB 4O8CA 5F3DA 1WEHA 2PBRA 3LRXA 3JAWB 5A6SB 5U4XA 5JS6A 4MUEA 2XMQA 1XZQA 4RZXA 2DAPA 3ZWXA 1GL7A 2H0RA 4BQOA 4M1ZA 4HYEA 2Z2IA 1CJVC 3HB1A 4PYRA 4TLCA 4BS9A 2HWYA 3DZKA 5IXYA 2EJTA 3P0RA 4D26A 1R0LA 4DA9A 2HQBA 2D1SA 2JHAA 5K0JA 1Y6FA 2AE2A 2KX7A 1WXXA 2WJAA 4L27A 2HSGA 2X86A 1RLMA 3CW8X 4L4SA 1HZZC 3IBCA 4RZSA 5CNMA 5DF1A 3RK0A 2ECFA 4XM0A 5CUQA 4TVBA 2G04A 3RTDA 4WBNA 2F62A 1MMFB 1HYHA 1YK0A 2FWPA 2RGAA 2M32A 2VS1A 5DM4A 4EVIA 2O8CA 2PYIA 2XDQA 3LDFA 1JJ7A 4ACAA 2QM0A 1X3SA 2Q1SA 3UXYA 5ELMA 3ND9A 1XXHB 3G8BA 2NYAA 4FHEA 1PWZA 4DNOA 1S1MA 1YOBA 3A6KA 4UUMA 1KO4A 2QRGA 4L73A 5A5GA 4DSAA 5KQPA 3KK0A 3KYCA 3EVTA 4ACBA 1JX6A 3SR4A 4MI9A 3O1IC 1N2ZA 1VLZA 1AS0A 4DSUA 4QQFA 5D01A 2WJWA 1U6IA 3DVAB 2V5UA 3BSWA 4PV7A 5AXAA 3S27A 4DMMA 2CVFA 4PR3A 3Q8XB 4XYMA 1CE8B 3M1YA 4JYAB 2E4WA 2ZU6A 1Q6YA 3KB8A 2F4VB 2C5GA 1NY5A 2QLFA 2ZI9A 4MWSA 3PWSA 2YL2A 2WDZA 5LUAA 1S8FA 1Y8QB 4M0KA 4MMYB