1T0JB

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
215
structure length
187
Chain Sequence
FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 59
structure length 187
sequence length 215
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0jB00
3Q9LA 3BFVA 3GJXC 2BJWA 1UAAA 1R2QA 2QSYA 4LSGA 1U2RA 2MMGA 3UATA 3SBDA 4JKIA 1A4RA 2C99A 2HYDA 4FIDA 2YZ2A 1XBTA 2EYUA 3VU9B 5JZVA 4HAYA 2X2FA 2RGXA 1UJ2A 4KV9A 3FHTA 1HYQA 1ZC3A 4LWZA 4C9BA 5AK0A 3OFND 2KJQA 1F2UB 4TT3A 3UIEA 3SHFA 3G5UA 1KO8A 1OHHA 3QNUA 1E32A 2GAAA 4FMCF 3LBHA 4MA4A 4PQFA 4Q66C 2AD5A 4WXRA 1E94E 5FPHA 3E70C 1GKUB 1HT2E 1DO2A 1GKYA 4TLEA 4ZCIA 2FX3A 4MRSA 2HF8A 3NVAA 3P27A 1JR3D 3ZVMA 1G3QA 3QEJA 1AQUA 1SXJB 1N5JA 4NCIA 2JCSA 3K53A 3HU1A 4JLJA 2LKCA 3MCAA 4JJKA 2IWRA 4MRNA 1E96A 1JI0A 1TF2A 2ZITA 5JHGB 2VP4A 2ZU6A 3TSOA 1H8ED 2AK3A 1TAGA 2Z5FA 4GZMA 4Z54A 2ZU0C 4GP6A 4JYBA 1AS2A 3D6TB 2BM0A 2XJ9A 4DLZA 3D8BA 4MYTA 1WA5A 3SJBA 4Q7LA 2O8EB 4GFDA 1G19A 1L4YA 1XD8A 2B6HA 5SZJA 4G0NA 3EPJA 2WIAA 4UXHA 4DXAA 2RGCA 4DT1A 3VR4A 3I5XA 1TMKA 2Z83A 4DCNA 3EPLA 2A2ZA 3I61A 3R7WB 3BJIC 2WJVA 4OI0A 2JGNA 3SYLA 2YOFA 4FCWA 1G3MA 1N6IA 1DVRA 3NG1A 5G41A 2ATVA 3HPQA 2J87A 5KPJA 4RZ2A 3AGPA 1U0JA 1ZIPA 1F48A 4KITB 3SQWA 1AS3A 4TMKA 1OFUX 2FGKA 2REXB 2FSGA 4P4SB 1G4AE 5KNCA 5FOXA 2PL3A 2A5GA 4BLRA 4C0HA 1NVUQ 3KTAB 2X1VA 1P2SA 5CYPA 1SKYB 3QI2A 5IDVA 1DTSA 2A30A 4UKDA 3ICEA 5JCPA 3U44B 3QKUA 3VU9A 3PUZA 1CEEA 3T12A 4C2TA 1KMHB 1XMVA 2W0SA 4Q7KA 1FMLA 1H65A 2NO9A 3NBZC 3ZS9A 1NVXQ 4RD2A 3FMFA 3RAPR 2QENA 3VFDA 1ZUHA 3LVRE 1XJ0A 4B35A 2GRJA 2VH5R 4RCZA 2OT3B 2QG6A 4DSTA 1EFHA 3B1ZA 3GJ8A 1VG9B 3ADKA 1A5TA 2FZ4A 1SXJA 2KBEA 1XTRA 1I4DD 3P4XA 2ZJYA 4MGZR 2J7PD 3GFPA 2GHIA 5KDDA 4GRAA 1Z0AA 4PFSA 2CBZA 1EWRA 3M6AA 2VHJA 1M7BA 1G8PA 1EK0A 1ZM3A 5ANRB 3U4QB 4QHSA 4FCTA 4X8OA 4PHTA 2BC9A 2FPLA 1US8B 3AUYA 2CL0X 4KODA 4BFZA 1BO6A 2O8FB 2JIZD 5B2ZA 3LNCA 3FB4A 2FSFA 1CR4A 1E2EA 4B71A 2V7QD 1N6KA 1XCPA 4JSTA 3SDZA 421PA 2O8EA 3WNDA 2GA8A 3WMFA 4ASUD 3NDBB 1G20E 1R0XA 4O25A 1XCGB 3TQFA 4Q19A 2FFHA 1FX0B 2ZR7A 1XEFA 4LJ5A 2ZTSA 4XTCS 1F3OA 3H84A 2ZE5A 2W2XA 3I8SA 3R7WA 4OBEA 2GCOB 1OLOA 3OEHA 5JS8A 3U7GA 3WMEA 2A3RA 5DI9A 4P33A 2QUZA 2QGNA 4G1UC 2HT6A 4YDHB 3SR0A 5AJVB 3CRMA 1OJLA 3ZLJA 3C4JA 3W3AA 4P4SA 4OJQA 2ODWA 3N5CA 3KTAA 1QDEA 2JLQA 1KDOA 1X1SA 5KPDA 4Z8XA 1FP6A 4JS0A 1GL6A 1X6VA 3FKSA 3I8XA 3DL0A 1G8GA 2YOHA 2VO1A 5SZIA 3U44A 5AJWA 1BS1A 2JEOA 2ZE6A 2EVWX 3GLFE 2ZRPA 4EDHA 1KMHA 1OFIA 4DIEA 1BIFA 3TE6A 3WP0A 3CX8A 2DR3A 4KFSA 1SVOA 5JCZA 2CJWB 2R6DA 1CULC 2XZPA 1E98A 3K09A 5JEDA 1N6OA 3IIMA 4AK9A 4XVUA 4GI7A 2WJYA 4Q7JB 4A8JC 4EFNA 1T3SA 5C1BA 3U4QA 2MSCB 3PUVA 2Y8EA 4WOPA 5J4LA 1US8A 3AKYA 2ZUBA 1F2TB 1G7CA 3NBFA 4WAUA 2O8FA 3L0SA 2QE7D 2CXXA 5E3HA 1X3SA 2IUTA 1XTJA 4NYIQ 4ZCMA 1ZU5A 1NMXA 5KUTA 3UWOA 1KHTA 2YNMA 3OAAA 2Q21A 3EZ6A 4KYUA 5G53C 4CEJB 3T1OA 1XZQA 3U7HB 1KDRA 1YQTA 1MO6A 1B0UA 1FX0A 5AR1A 2WV9A 2WWFA 1GKIA 3LXXA 3T15A 4NBSA 1J2JA 1GRNA 5F9HA 2CVFA 2GCOA 3CW2A 1AKYA 1FZQA 4IDNA 3SJAA 2FGJA 1XB2A 4W5WA 2NO1A 5FBLB 1KSGA 3VR3A 1A2KC 1EFTA 3OE7A 5EXPA 1XMIA 3ICQB 1IOZA 2HXYA 4KFTA 1WBBA 4L15A 2BMFA 4QJ5A 5EUQB 2IS6A 2VA8A 4M8NE 1I4LD 3NC1C 4TQAA 1CBUA 3SYKA 4Q1EA 2OFXA 3RWOA 2VYFA 4B3DA 1OH8A 4X8MA 1L8QA 1UEIA 1VCIA 2OE2A 3LD9A 4JLBA 2O8CB 5LD2B 2ODNA 4O3MA 2PEYA 1GITA 4HZIA 1JNYA 1KY2A 1XJQA 2D74A 2CCJA 3KZ1E 4MUBA 3RS0A 3BH0A 3NEJA 4CVNA 5JECA 1KKMA 3H86A 5CK5A 4Q9JA 4L8GA 1NP6A 1P4SA 1AZSC 1VDZA 2YHSA 4AKEA 4ACBA 4RY2A 4YMUA 2CJWA 3IPXA 4LHXA 4PHGA 2AWNA 2RH5A 4EJSB 3P20A 1E9SA 5EQTA 5TDHA 3U3KA 3BRWD 2FPKA 3I72A 2JJ1D 3KJIA 3P32A 5AUNB 1GG2A 1EG7A 3BFKA 4AIIA 4DDUA 2G0NA 1Z6TA 1GRRA 4JBYA 2ZIAA 3VR1A 1MRSA 3K0FB 3BS4A 2JLXA 2QM7A 5FR1A 1G7RA 3QEOA 1W36C 1VIYA 1AZTA 2ZVQX 2IBMA 3LWNA 1F2TA 3FGNA 1MV5A 2GTPA 4I1VA 4KVAA 1YHNA 1RPZA 1XU4A 2PLFA 2XX3A 4NE2A 3IIKA 3SOPA 5J4VA 3IIJA 1W0KD 2AWOA 1G6OA 4LJ9A 4CEJA 4OK6A 1NVVR 3QVUA 3EZFA 2FMXA 1SVWA 4M1SA 5DIFA 1RJ9B 3KXIA 5CIQA 4ZI2A 1S9HA 4LK2A 2E1RA 2QM8A 4LJYA 1P61B 1A7JA 3X1WA 1K5DA 5EP3A 5EZ5A 2JLRA 5JI2E 1CU1A 3PEVA 4L4UA 3SE0A 2YVUA 1S9DA 4YMWA 2HUPA 2ANCA 5D3QA 4LHVA 1Z0DA 2AHOA 3L0PA 5GJCA 3Q3JB 2G1JA 1AIPA 2OFWA 1MRNA 2ZRLA 5K8LA 1YU9A 3U6KA 4LJ6A 4XTRA 5AJXA 1NBME 5IK2A 5CDFE 5FBRB 2O8CA 3KKNA 4LBYA 2F3RA 1NG1A 3CIOA 5FH9A 3I5YA 4ABYA 2ORIA 4B48A 1K8RA 2PX3A 1JXOA 4IFBA 1D9XA 1NF3A 2W6JA 1TEVA 5J5CA 1XWIA 2BHRA 3KQLA 3C5HA 1IBRA 1IJFA 3PFIA 3WRYC 1SULA 4B34A 2WJHA 1E1RD 2EYQA 4KSBA 4EJSA 1J70A 3Q72A 2RAPA 4M1MA 5CLLA 4Q1AA 2GF9A 1IXSB 3KL4A 1ZNWA 3THXB 2GJ9A 3B9QA 3AVPA 4B76A 4TQUS 1IN7A 3MMPA 5P21A 4WIAA 1NKSA 1KI8A 3X1ZA 4Q02A 2ZJ5A 5KDLA 4FN5A 5EZ6B 2VP6A 4RD1A 1D5CA 2Q9AA 3IQXA 1BKDR 2IF2A 1UF9A 3VR5A 4XWOA 5JFGA 3QPWA 1MT0A 1NLFA 2BCJQ 1Q21A 1U99A 3EA0A 4Z1MD 5GJVC 1EX7A 2PJZA 2OO7A 3EXAA 3FMIA 2JJ2D 4PO9A 1OH7A 3KJHA 1G7SA 2FN4A 4XD7A 2ZETA 3A4NA 1G17A 2Q3HA 2RGAA 2W2VA 1C9KA 1RJ9A 5HKKD 3CF6R 2GJ8A 1RRGA 1GNPA 2P67A 3IQWA 4Q4JB 4A0HA 3EW9A 2CNWA 4MDEA 1OYYA 4I81A 2ATXA 1SVSA 1DOAA 2QP3A 4ZKEA 4HUTA 1W2HA 4C4PA 3KKMA 3VKHA 4IDPA 2G83A 3AUXA 2HLDA 2MSDB 1II8B 1WCV1 1N3BA 1OKKA 2NZ8A 2GXQA 2NOAA 3ONWA 3QG5A 3QKSB 3ZDQA 2O0JA 4WVFA 3BH6A 5E95A 4HB0A 4D26A 3NEYA 2D62A 3EIEA 2H1LA 1SXJC 2OBMA 4GSYA 2WAYA 1U9IA 4BEBA 3UG7A 1VYVA 5FBWB 2O0KA 2GZHA 4HLCA 4LYFA 4B75A 3L2OB 5JJIA 5K8UA 2ZRAA 4DCVA 3IHWA 3B1VA 1VIAA 2I3BA 5A5GA 4Q4LA 4TLBA 3DDCA 3TW8B 2IW3A 4DUGA 1EFRD 3IILA 3WNCA 1HE1C 4IOKA 2A78A 3O8DA 5JHHB 2N46A 3PUXA 5JBQA 1TX4B 1Z28A 5FOTA 3THXA 3KXLA 4YC7A 5AJYA 3RS2A 2ZRIA 3AEZA 1W4CA 3OIUA 4ZDIA 2VLIA 3AB3A 3ZH9B 2RGNC 3OIWA 1R8SA 4IFEA 4QC2A 1DO0A 2BBWA 2EFEB 4NHOA 3FOZA 3QXXA 1ANKA 1P9NA 1E9CA 3AF1A 4ZDJA 4PPGA 2OLJA 4RVCA 2C9CA 3DOEA 4M1TA 2FZLA 2WJJA 5JLJA 1I2MA 5A0FA 2B7BA 1JALA 4LI0A 1AN0A 4D4LA 1NN5A 4OQNA 2LKDA 4BPBA 3P26A 2NPFA 4B43A 4HDCA 4NCKA 4OK5A 4N3NA 1X8JA 1DADA 2GAOA 3A37A 1FL9A 4YQFA 3NBYC 4Q4JA 5DN6D 3DZ8A 1HURA 1SQ5A 3BAFA 5C4MA 4ZV4A 2N42A 3L8ZA 4N0EA 2JLVA 5AWFC 3AF2A 1ODFA 1GIAA 3NHAA 2J45A 3K8YA 1YZTA 2JLUA 1KIMA 4L9SA 2IUSA 2ZM5A 1W36D 4IDQA 4IDOA 2Z4RA 4DLWA 1WB9A 3CZPA 1II8A 3THOA 3K0CA 2YINC 1TNDA 4OHXA 3SC3A 1XNJA 3GLFB 5IK2D 4DC9A 4IJMA 3QKSA 4ARZB 3EIQA 3TR0A 3AM1A 2ZE8A 2ZXUA 5DHFA 4MKGA 4D4MA 3ZZTA 2C2HA 4DVGA 1S3SA 4A92A 2BEKA 2OILA 2ASEA 5G40A 3PR1A 3VAAA 5GVSA 2GBLA 1P73A 4C0AC 2OM2A 4BLSA 3AV0B 1JPJA 1NY5A 1Z07A 4EPVA 2ZI5A 4JYCA 3EWAA 2BCGY 4BRWA 3ADBA 3CPEA 1A82A 2D7DA 5HE8A 4Z51A 2MSEB 5E7MA 3N2EA 4MGKR 4MH0R 1YR8A 2B92A 4LC0A 4PAQA 4DLRA 3AGQA 4TT3D 2EFGA 1QHYA 3U3RA 4D81A 2H18A 1P2UA 4EPWA 1R6BX 2FFQA 1GNRA 4R71A 1E9RA 6Q21A 4LBWA 3CKLA 3O8CA 3W3ZB 2EFHB 3IPYA 2AXNA 3P4YA 4ZIRB 3KQNA 2QTHA 4NH0A 2EFCB 1YR7A 4AKGA 2V55B 3F5FA 3UG6A 4LHWA 5BYKA 2F9MA 4PXAA 4Q4AB 3S1AB 4E07A 4JLMA 1GSIA 2WKPA 3AF0A 1SGWA 3EZ2A 4K81B 1ZINA 2QQ0A 4TMVA 2HT1A 3GJ3A 1W49A 3SI7A 5B64A 2XZOA 2FJUA 4C0JA 4OHZA 2XJ4A 5KHOC 1KO1A 2AKAB 3CO5A 1RW4A 3LV8A 3VX4A 2WJGA 521PA 4JBWA 2BIFA 3EAQA 1OPXA 4JL6A 2QTVB 1WDTA 4BWYA 2P6NA 2NMVA 3BH7A 4LZZA 3RRZA 1E79A 2QPOA 5J4KA 3AKDA 2ZR9A 1UBGA 1NMYA 3GLFA 2ZSAA 5BN3A 4ARZA 3HU2A 3VTKA 3ZD7A 4LJ4A 2ZSDA 3FKQA 2BBOA 3THWB 1OB2A 1R4AA 4A36A 2D2EA 4P4UA 2Q3FA 3FE2A 4EKDA 1F5NA 3W6NA 1IN6A 3KB1A 1V43A 1FTSA 4JVSB 1O87A 5EE9A 5FOVA 1W4RA 2NTYC 4RZ3A 1KJZA 4BRUA 2W00A 3WMGA 3TNFA 1M8PA 4A1FA 4L16A 1E4YA 3NKVA 3FPAA 1E2FA 1T91A 1XZPA 2GESA 4MKFA 1OXTA 1M6NA 4H1UA 1U8ZA 2GJKA 4BLTA 5TMPA 4TWZA 3VKWA 1TTTA 2Q0HA 2R44A 2GJSA 1SXJD 2J46A 3K9GA 3TRFA 4ZIRA 5EXSA 1P72A 2DYKA 2EFDB 1JAHA 4P32A 1TL7C 2HXSA 5KYKA 2VQSA 5DNYB 4Q4AA 1DARA 4MDFA 3S1AA 3W90A 4D4KA 1ZJ6A 4Q48A 3B2EA 3AF3A 1UM8A 3I1FA 4GZLA 3FMOB 3TAHA 1WBDA 3C41J 4TMXA 1UFQA 1FW6A 1IN4A 3G0HA 3RYTC 5KDOA 1CRPA 2GVZC 1KYIA 5AUOB 1CKEA 1UKYA 4W9MC 3HPRA 2NO7A 5L3VA 2XNDA 4CW7A 2QEQA 3B9PA 4RFVA 3WRXC 1E9DA 1X8KA 3LAWA 1S0UA 2XOKA 3REGA 4AURA 2W58A 1VCNA 4JKYA 4PO8A 4DEYA 5H8WA 3W34A 2GILA 3SQXA 2ZE7A 3HYRA 1C1YA 5IF9A 2JLWA 2DFLA 3NH6A 3OEHD 3QXJA 5D3MB 4DEXA 4URVR 4YLGA 3R9WA 2B8TA 1OIVA 4NCHA 1OSNA 2GXSA 4C0QC 1VG0B 2ZJBA 3VMFA 5CB8A 3THWA 3AQ4A 2QSZA 5TVKA 3V4FA 5L3QB 3B7GA 1N0WA 2IHBA 3BB4A 3FKSD 1AA9A 1QHIA 2ZYWX 1VMAA 3L0IB 2FU5C 5FUVA 2QY9A 2OESA 3CUEF 2FEMA 2REOA 1FNMA 3L43A 3U2QA 4AI6A 3REFA 4DJTA 3CX7A 3DMNA 1KAOA 4FW9A 2WWHA 4OI1A 2C04A 1L7VC 5KSOA 3TR5A 3QJYA 3M0EA 1E9FA 5K8TA 3AP1A 2QAJA 1TQ4A 5DI3B 1DAEA 3QKRB 4FD2A 1W5SA 4ON9A 4KSCA 1GDDA 5DO9A 4EUNA 1XPUA 1DELA 4V03A 5DLQC 1GL7A 2PCLA 4JT2A 4KI0A 1L4UA 1QG4A 1OXSC 3K0EA 4HATA 3UKDA 5FI0B 1T3LA 1G5TA 2P5TB 2IS2A 1JXMA 2IYTA 1L2TA 5H1YA 2GNOA 1KJWA 1DEKA 1DG1G 2QU8A 4XOIA 5F98A 1MH1A 2A7QA 3IDQA 1KI4A 2VHTA 2YWGA 4URXR 2W2TA 4MKIA 2FDCA 2BDTA 1RRFA 3FVQA 3QF4B 5UKDA 1IN5A 3GLGE 2FSIA 2GZAA 4YMSA 4HZUB 4OK3A 3A36A 5AJZA 3RC3A 4QM7A 1UBCA 3E1SA 4KLZA 5BWMA 4G5QA 2IXEA 1NVWQ 4JLPA 1R7RA 4LCBA 3MSXA 4WA7A 1Q20A 5CDFA 1NBMA 4GOJA 4EFLA 4DDWA 2WKQA 4OL0A 4PSKA 1G3UA 3IUYA 1N6RA 2ZI3A 1FQKA 5D3MA 4A6XA 4CYMA 3LO5A 4MUAA 5FFMA 3OE7D 1BYIA 3SU8A 2K5UA 3QBVA 4US2R 2GXUA 4WW0A 1IY2A 3KKQA 4F4CA 1ETUA 1GTVA 1E69A 3EPHA 2A5YB 2PT5A 4UJ5A 1TUEA 2EW1A 5AUQA 5L3QA 2C9YA 2DWOA 5KU1A 2J9RA 2ZYUX 3MRSA 2JLSA 1NN0A 1Z5ZA 2W6IA 1HQYE 4FWIB 1QF9A 5GVRA 3UANA 3DHWC 5BXQC 3I3SR 4LUCA 4OI2A 4KHZA 3F3YA 3RNLA 4DCSA 3BK7A 4A9AA 1FMJA 4BLPA 1HT1E 5CJ2A 1GRQA 2CLCX 1Z2CA 1UDXA 2NIPA 4W7SA 4BFVA 4N0DA 5H70A 4TZ6A 5DSZA 2WWWA 4QG7A 4M4SA 5DI3A 1R5OA 4LYAA 3QKRA 4IW3B 4HI0E 3VKGA 4EQ6B 221PA 4IOMA 4JLDA 4IOLA 4AG5A 4CDGA 1DAMA 4UNNA 2G6BA 1D8TA 1ZIOA 4F4IA 4PPNA 1II9A 4D0GA 1VYTA 1CS4C 5BQ5A 2ZREA 2ZRDA 2ZRJA 2P5SA 3EASA 4U7DA 1DBSA 3T1VA 1KO4A 2E9SA 3AP3A 4TTPA 2DWPA 1P5ZB 1ZMXA 5DGXA 5EE1A 1T0JB 1S1MA 4GOXA 5KOYA 3JVUA 2EWVA 4JT4A 1OW3B 3QF4A 5JWOA 2IS1A 3CF2A 1UEJA 4HZUA 4POAA 2DWQA 2XXAB 3OIVA 3IO5A 2AR7A 2CHQA 2B8WA 3CM0A 3O8BA 2CK3D 2KSQA 4PO1A 2PEZA 4LYHA 4B3FX 1YZQA 3TW4A 2YV5A 2OEPA 2AD1A 4F91B 1GNQA 1IXZA 5EE3A 1KSHA 2PMDA 3CNOA 4TLCA 3TBKA 2JLYA 1GM5A 4CEHB 3CWQA 1LNZA 1OF1A 2GDJA 3R20A 1IM2A 2ZRFA 3LQQA 4UNQA 2ODBA 1JR6A 1N5KA 1C4OA 2D06A 4G5SA 1Y63A 5DHAA 4PC3A 3BXZA 3KUCA 5E4FA 3KFXA 3ZVRA 3V4RA 4TYQA 1RFLA 4FMBB 3R8CA 1JAIA 1XP8A 1KO5A 1YZKA 5LB2A 1CJVC 3TAUA 1ZM2A 2QAGC 2KI5A 4ITRC 1H8HA 2W6JD 3TJZA 3WBJA 4GT1A 3SNHA 3TIFA 1HY3A 5H68A 1P2VA 2ZS9A 1S96A 4JVMA 4XWKA 2WICA 4EPTA 3MG9A 2H57A 3RRNA 4A2PA 2V1XA 1RIFA 4EQ6A 3X1XA 4EFMA 2QPTA 3G82C 4JL8A 1OXVA 2WOJA 3DVLA 3MJHA 5FOUA 1JQLB 2A5FA 5G3ZA 4Q1CA 3RS5A 4JVNA 4YXWA 2YWEA 3NDPA 3R8FA 3T34A 3KQUA 1JEEA 2WOOA 1S2MA 3PG5A 1Z6AA 4QBHA 4XSGA 2P65A 4RZXA 4QGHA 2IK8A 3I62A 3GJ4A 2KB0A 3B85A 2PBRA 3Q85A 1HTWA 2GEDA 2V6IA 1COWA 4LBVA 2ZR0A 3ASZA 3LRPA 1LF5A 3QG1A 2NQ2C 4NYMR 4TMTA 4XD7D 2ORVA 4IDHA 2XXAA 3HP1A 1IY1A 1QVRA 1IN8A 4LYJA 1UDWA 2BBSA 3K9LA 2AFIE 1QHXA 3C5CA 4M1YA 1R5NA 4IOJA 2CNWD 2PJRA 4DLXA 5CLQA 2ZSEA 3AF4A 4QL3A 3FWYA 1E9AA 4E09A 4OHYA 2PZGA 4YMVA 1XMJA 2ZANA 4QBGB 2HLDD 4CEHA 1OKKD 3E5HA 1KSJA 2Q3MA 1ZD1A 3T1TA 2VPPA 1V5WA 5JI3E 5C46F 2WM9B 2G0TA 2HDNB 1J90A 4PC2A 4BFSA 1HQCA 3NWJA 4KO8A 3RSOA 4C0KA 4NMMA 4LHYA 3W6PA 1VPLA 3AKCA 3ETLA 4DCTA 4QM6A 2J1LA 3UPUA 1XEWX 4GPTA 1WMSA 4TTQA 2EWWA 4NCJA 1QHHB 2YJTD 2ZEJA 3EC1A 2PCJA 3O8RA 1E2JA 1E0JA 1FOEB 3EARA 3UWKA 4DUGD 1SVKA 2IX3A 1KNXA 1ZNYA 2RMKA 1KK1A 4FXPA 5KNBA 4TMZA 4TMWA 3HR8A 5FR2A 3PUYA 4HYYA 2OHFA 3RHFA 2WWYA 4JLAA 1MKYA 1WQ1R 2VSFA 4HB2A 1EXMA 1FP7A 4DRZA 4DB2A 4HB3A 4RD6A 4C0BA 4OJKA 2F6RA 4XJXA 4PHHA 4F38A 1BMFA 4MYCA 3K9HA 621PA 4TQ9A 3GFTA 1HH4A 1HEIA 2GK7A 2GVDC 1DAGA 3BB3A 3KDSE 4JJZA 4R98A 3B82A 4F4JA 2XTZA 2BV3A 3CZQA 4KXFB 3Q8XB 4IHQA 2CHVA 4IXMA 5B57C 4GOKA 3OF5A 2IYZA 1GFIA 2DCUA 3HJNA 1M1YE 3K1JA 4IXNA 2QE7A 4XWAA 4JZKA 3MLEA 2QN6A 4URZR 2WSSA 4W5JA 2BVNA 4D2IA 1HUQA 1VYUA 1LFDB 3PEWA 3RS4A 4B3GA 3Q5DA 4EPYA 4PQRA 2WMOB 3GD7A 2FWRA 1TEXA 1MO5A 2F1JA 1RVDA 4PZZA 2CE7A 5HPYB 2F3TA 4G5RA 1VG8A 3OEEA 4WZ6A 3ZYCA 5IRCD 1KI9A 3NH9A 2RKOA 3TGPA 3LDAA 2VBCA 1N25A 4L5BA 2JATA 4LY6A 4W5HA 2O8BB 2R62A 1DE0A 1YR9A 2IYYA 3DMDA 4GMXA 2VTKA 3HR7A 1JR3E 3ZZUA 4L9WA 2ERYA 5DYGA 3VNUA 1E2PA 2CE2X 3QXCA 3CX6A 3QXSA 1QHHA 3GP8A 4F93B 2C5LA 2XSZA 3M4YA 1OXUA 2ZRNA 1G291 3ZVNA 5FOWA 3EZ9A 1F6BA 4QFMA 1G16A 2D3WA 4Q01A 4DBLC 1Z8FA 4I1UA 4TYWA 4FMDB 4RFSB 3LFUA 3LW8A 3L0OA 2BKUA 2ANBA 1GVNB 4BFTA 4B74A 5HCNA 1UBFA 4MRVA 3V9PA 4EPRA 2WPDD 3LLUA 5JEEA 3CRW1 4RCYA 1Q57A 1JJ7A 4TL7A 2JAQA 4EIWA 1NNEA 5DH9A 4DSOA 1WP9A 2ZAOA 1KK2A 1ONBA 3GLGB 3L8YA 5HZKA 3PEYA 5EP4A 5JMTA 2BOVA 2QMOA 4HAXA 4YONB 2QRNA 1G3RA 1TPZA 4B3BA 3PENA 4BZQA 2R6FA 5EXXA 5FL7A 3PJRA 1Q1BA 1KI6B 4DLYA 2P0EA 4C2UA 4V0LA 1W5TA 2WWIA 3FHOA 3H4MA 1NG9A 1W0KA 4TYYA 1KK3A 3QKTA 3M1IA 1QHSA 5KSZA 1ZYUA 1FPMA 2VF8A 4K8OA 5DYIA 3U3MA 4PR0A 2YYZA 4E03A 1E2QA 3TK1A 2WMNB 3CRVA 3MWYW 3NC0C 3QF7A 5LBIA 3K70B 4AWXA 2BMEA 2QPAA 2FE4A 2J0SA 4PZLA 1EFCA 1E79D 4LX0A 2C77A 3GPLA 3QXHA 4D0NA 2C9OA 3O47A 4ZPXA 3LX8A 2O8BA 2AKYA 1XX6A 4UXIA 1CLUA 1PUIA 1OE0A 2IS4A 1PLLA 2PZEA 3QQ5A 2HF9A 2GF0A 2ZRGA 4F7WA 1PVOA 1XF9A 4LPKA 3ZIAD 5EJEA 5EP1A 2V9PA 3PV0A 3VR2A 1NSFA 3CRRA 2XB2A 1ZNXA 3BB1A 4Q9IA 4LV5B 1CJTC 1N5IA 2IEYA 4DLVA 4QJ3A 3P1JA 3EA5A 4WBSA 2EQBA 2F1HA 2ZRBA 2IA5A 1Z6YA 3H2YA 5DE3A 2UVQA 2BMDA 5E7JA 4RFSA 1S8FA 5JWHA 2OXCA 3WP1B 2IYXA 1XXHE 3V00A 1GP2A 4OQLA 1ZM9A 3K09C 1NLYA 3D31A 3RSLA 5J4HA 2YWHA 5C2JB 4M22A 4BEJA 2Z43A 4R9UC 3SZRA 4DLTA 4RD3A 5L8VA 4QHYA 4X8HA 1CJMA 3N2IA 3GLGA 3WHLA 2CL7X 1J8MF 1R0ZA 1QZXA 2H5EA 4MYHA 2GXAA 1LS1A 1YRAA 3NHBA 4BECA 2FV8A 1Q44A 1NRJB 5G3YA 4HUQB 2IT1A 4ESVA 4R7ZA 1KDPA 3PUWA 1R0YA 2CCGA 5BN5A 3K0SA 3ASYA 5FUWA 1I4TD 4B47A 2VEDA 2YC4C 2IL1A 1KI6A 4GNKA 4QJ4A 4Z1MA 1OHHD 5FTMA 1G41A 3NBXX 3WYAA 4LRWA 1SVMA 4BFUA 5F9FA 4QHTA 2NO0A 4AY2A 5FBVB 4BLOA 4CRWB 2RGGA 2FFAA 4KU4A 2XNDD 4A2QA 1OB5A 3U61B 3ZJYA 4BFWA 4KBFA 2XOKD 5SZHB 4DDVA 3QPUA 5KTYA 2AXPA 1W1WA 4U00A 1UBEA 3CB4A 2CMKA 1P75A 1E4VA 2OV2A 1TF7A 1G3IA 3I92A 2ZUCA 4ESHA 3MUFA 4JLOA 2VHQA 4NYMQ 5SZKB 2P6RA 5JRZA 1DAIA 1W47A 4KJZA 1D6JA 5J4YA 1G18A 5JJLA 1CXZA 3R9IA 3CF0A 5ELXA 3QUSA 4JLKA 1SHZA 4G5OA 2A5DA 3KJEA 3UMRA 2YC2C 1QHNA 4D4JA 2REBA 4PSAA 4TLAA 2IYVA 3NTUA 1SVLA 1Z29A 3GLIE 1DG3A 1N0UA 1AGRA 3PQCA 4RD0A 2R6CA 1AJEA 3AVOA 3TSZA 5FTJA 2G3YA 3ZGXA 1XTIA 2OAQ1 4TL9A 3JZAA 3QENA 4ACAA 2J3EA 3OZXA 3A1SA 1OH6A 4P4TA 3KKPA 1Q1EA 1GOTA 3CR8A 4Q4HB 1X86B 3C15C 3GJ0A 2IF0A 4DLSA 5LDDC 3B6EA 1UADA 1DS6A 2IXGA 5E7IA 4KFRA 4AG6A 3TSWA 4AYWA 3W9YA 4CT5A 4HAWA 3SEAA 4B2PA 3SHWA 3LBIA 5KSYA 3U6BA 1KZ7B 2OCAA 3MWKA 2DPXA 1K6MA 4HB4A 1AS0A 3IHLA 4HUQA 4PPFA 4OYHA 3AP2A 2V3CC 2AK2A 2QT1A 1IJEA 5FPKA 1G64A 4XIGS 4AC9A 4ILEA 721PA 3ZD6A 2X77A 2QGZA 2GEUA 1T9HA 3GJ6A 1BH2A 1YZUA 5FUYA 4PC7A 5CK4A 4C30A 4XSHA 3F8TA 5FI1B 4MYUA 2ZPTX 1RRCA 1ESNA 2L0XA 2WIBA 3DO6A 4DIDA 3THYB 1NBMD 2FNAA 2R6GA 2VSOA 1OH5A 2C96A 1XCMA 1T5IA 3TVDA 3MJRA 4R2IA 5EE0A 3RS7A 1D9ZA 1GUAA 4TN1A 4R2HA 2ZS7A 2DBYA 2HEIA 4RD4A 1HV8A 3TH5A 1Z0KA 4BUJA 1XFAA 4JL5A 3I32A 2D7CA 1NY6A 5LD2C 2W6ID 2QBYB 3WY9A 2UZIR 2KBFA 3LXRA 2GJAA 4QGAA 2V54A 5IT5A 5L3SB 2C98A 4JIMA 1OIXA 1P9WA 5FL3A 3U3OA 4B32A 3GLHB 3TVTA 2Z6VA 1Q22A 2IYWA 2JDIA 3DEFA 3RS3A 2Q9CA 2N1BA 4EJSC 4PQYA 1N6NA 1QVAA 4ZDWA 2V6JA 1Q1ZA 4ZCLA 4Q4HA 1N5LA 1ZNZA 2AX4A 2H92A 2P6UA 4Q5IA 4B6EA 1OYWA 1W46A 3ZQ6A 1LVGA 5JS7A 2IC5A 4URUR 2AL7A 4TL6A 1E0KA 3ZQJA 2CLSA 2O52A 3UK6A 3DKVA 1Q0UA 1N6LA 2YOGA 2ZRCA 4TSFA 1G1MA 2ZVPX 4JMPA 5BW8A 4MGYR 3RDPA 1MO3A 1CR1A 3FDIA 4V0ME 1W44A 2VRWA 4V0NA 3SFZA 3FFBA 3EWSA 5C18A 5FBQB 1ZM4A 1LF0A 1YZGA 2ORWA 1OV4A 1W2GA 2ONKA 2OUKA 2YWFA 3HYTA 1U90A 3KQKA 3GEEA 4MKHA 1K5GA 4Q00A 4KBGA 2IYRA 4OQFA 4XH9B 1R5BA 3RC8A 3T5DA 1TADA 2WHXA 4KCGA 4Q47A 3WXMA 4PTLA 3U60B 1PV4A 1W0JA 5FOSA 3EIHA 5FPSA 1ZCAA 5FUXA 3IEVA 2XNSA 2ZAMA 4FMCB 2JASA 4OI4A 1XRJA 3THYA 2IEZA 1P2TA 1S3GA 4LV6A 3T35A 3H1TA 1RKBA 4QBFA 1X8LA 2H7VA 3D7MA 1E0SA 1AQYA 1JJVA 3OIYA 3RVBA 1ZAKA 1NJFA 3B60A 3SN6A 1CJKC 4KYIB 4NZYA 1IAQA 1O3YA 1TQDA 1Z6GA 3J81k 1NLZA 3OAAD 1TQ2A 1U98A 4GDFA 1VCOA 3GQBA 1U9IC 4DHEA 2QBYA 3VHXA 4Q1FA 4M21A 3TQCA 1OT3A 3A1UA 5L3SA 2VSXA 3DZDA 4YMTA 1Z08A 4CIDA 4M1KA 1QBKC 2F1RA 4URYR 1E2HA 1PUJA 4F92B 1H8HD 2CHGA 3GLHA 4HAZA 3A8TA 4URWR 1Z22A 5B30A 3FMPB 3AVXA 4CGZA 2ZJ8A 1QHGA 2XITA 3CNLA 821PA 4II7A 2QTFA 1F2UA 2QRZA 2GCNA 1QRAA 1A1VA 2FPMA 1XMSA 3MGCA 1KZGB 4V0KA 1CJUC 1E1QA 4D0LB 5J47A 4BFXA 3CBQA 2ZROA 3B13B 3LH5A 4M53A 1NL3A 2ZJZA 3TLXA 4LC1A 4HLUA 4Q9HA 1W48A 1N0VC 5HE9A 4YXWD 1ZU4A 4DWJA 1FUUA 3RANA 4Z8YA 1E2MA 2OCPA 3LW7A 3C14C 3HWSA 4WZAE 3RWMB 1CR0A 1XPOA 2G77B 4AD8A 1DAFA 1U8YA 3BBPA 1D2NA 1VG1A 1Z83A 3HDTA 4UJ3A 4A6PA 4NYJQ 1COWD 4AYXA 1D2EA 3OFNA 2CCKA 5FTNA 3KXKA 2XTMA 3GFOA 5FTLA 2DFKB 4IKEA 3BOSA 3EG5A 2I1QA 4QNMA 4NL4H 1EGAA 4PAOA 1SKQA 2E87A 3IBGA 1GL9B 3UMFA 2DHRA 3WBKA 1XTQA 1JR3A 1CR2A 1RYHA 1XD2B 1E2KA 1XTSA 1TU3A 1Y3AA 2RGNA 4GP7A 4LHZA 2P2LA 4PC1A 2OFOA 1KNQA 1G6HA 1MR3F 3GEIA 3K0CC 3TMKA 4B73A 4IEIA 3A58B 1KAGA 3PVSA 4Q18A 4CF7A 4B3XA 1QG2A 2V4ZA 4P31A 5CYOA 1UKVY 1Q3HA 4NONA 2FEOA 1U8AA 2F1IA 3ADCA 1H8EA 4LV8B 2J0QA 2V1UA 4PPQA 3GEHA 5EXTA 5M04A 1D2MA 2OCYC 1XXHB 2AFHE 3B5JA 1XD9A 2QMHA 4IVRA 2GBLC 5K8IA 3KFVA 1N6HA 4LJ7A 2IWHA 1CP2A 4BZXA 1AGPA 4CZ2A 3W5JA 1KDTA 4NP6A 4NTZA 3W5IA 1E9BA 1W7AA 2RHDA 3KJGA 3ECCA 4PHFA 5JJKA 1YR6A 3VHLB 1KY3A 1ZC4A 3VR6A 4LBZA 4S2EA 1VECA 4M9SA 2P3SA 1DAHA 3PEUA 4I1SA 4ERNA 3K0AB 3AKEA 5HCIA 4E5UA 1YJ5A 1NIJA 3X2SA 3CPHA 1Q12A 1OFHA 2HJGA 4P0TA 3C8UA 3X1YA 3R9XA 4M9ZA 4TYNA 1JB1A 3IKJA 3K70C 1EFUA 4HAUA 3GMTA 2PMKA 4C3ZA 1NKTA 4MGIR 1BMFD 1KI3A 2NG1A 1E2GA 2XTNA 4U02A 3QSYA 3CONA 4TYPA 2QORA 5C4GB 4KFUA 3PITA 4A0FA 4JLNA 4TLDA 1P9RA 3PXGA 1AK2A 3UMSA 3B1WA 2QL6A 1ZBDA 3TUIC 4TTRA 4ZO4A 2WTUA 2WSSD 4MRRA 1RC8A 2J59A 3DPUA 1NIPA 3B78A 5LB4A 2C95A 2DB3A 2WVJA 4AKIA 3AVUA 4IRUB 1KK0A 2GKSA 4HLDA 1X1RA 3B8HA 1G7TA 4Q03A 2ZSBA 1XD2A 1E2NA 4A4DA 2Z4SA 1JECA 1IHUA 5FPTA 1KI7A 3AVYA 1E2DA 4NCNA 2J7PA 3OEED 2KWIA 1Z63A 3BGWA 4QRHA 1ESMA 4Q9KA 5DISB 3KX2A 3GLIB 1CIPA 4LOAA 1RE0A 3UXMA 1I2DA 1KKLA 3CNNA 4JBXA 3QVVA 2JIZA 2A5JA 3GJ5A 2QT0A 1XXHA 4LDJA 2V7QA 3LLMA 2XB4A 4D25A 2F43B 4JLVA 3CRQA 4ASUA 1OIWA 2ZS8A 2XSZD 1Z0JA 4H1VA 1FFHA 4M2LA 4JSYA 2YKGA 2J0UB 3PCRB 1Z3IX 2HCBA 1FUKA 4BLQA 2R8RA 1G5RA 3RABA 3E2IA 3KKOA 4Y0VA 4DB4A 4D82A 3BD9A 3K0AA 1DAKA 3N70A 4RKFA 3VQTA 1EX6A 2JA1A 4XVQA 3QY0A 2RCNA 4QBIA 1UKZA 1XEXB 4CT4B 3TUJC 2XGJA 2Q9BA 3U3JA 1BYUA 1MABB 1ZUNB 5JSZB 3X1DA 2ZRKA 1PZNA 3BC1A 3DM9B 2JLZA 2IYQA 4KVGA 121PA 1OXXK 4Y0AA 1XJCA 1NMZA 2OSBA 4HAVA 4AKHA 1NSTA 4US0R 2R9VA 3B1XA 2R6AA 2ECKA 4US1R 2X2EA 4H9GA 2WAXA 3NXSA 5FL7D 4G5GA 1T4GA 4A2WA 2VL7A 3EX7C 4JVLA 4M1WA 2I1VB 4P3YA 2BWJA 2UKDA 2VIIA 2BKEA 3GJ7A 4WXPA 5EP2A 3T06B 2BJVA 1P62B 3H0KA 2GEVA 3SBEA 3SFVA 2NZJA 1LY1A 1TQ6A 2J7KA 1RYFA 3GLHE 2CVHA 1RZ3A 2GK6A 2NO6A 2OAP1 3TUZC 1T8UA 2O8DB 2WSMA 1A2BA 1ZCBA 4PAMA 5FPYA 2ZYVX 1KSFX 1VCMA 1Q3TA 2CK3A 2UZ3A 5KO2A 1G8FA 1XTKA 2W83A 1IQPA 3GLIA 4J0QA 2ZI7A 3ND8A 5FTKA 3SJCA 5TB5A 3WNBA 5CIWA 1ELOA 1YVDA 3Q7QA 1KOFA 4NDZA 3FTQA 4O2RA 2VP5A 4OQXA 2Q6TA 2R2AA 3KQHA 1KMQA 1SXJE 1ZD8A 2F43A 4FCVA 1JPNA 1M2OB 2FFBA 2FOLA 4N1AA 1CF4A 3L82B 1XDBA 1CRQA 4D80A 2CEAA 3CH4B 3IEUA 3OHMA 2J0UA 4FMDF 4OHVA 2BMJA 2GWHA 5GADl 1E3MA 2HJVA 2F7SA 2IYUA 4FWTA 1E0AA 2VHCA 1JQJC 2FF7A 3GCGA 2BEJA 5TV2A 1T5LA 1KO7A 2I4IA 2IYSA 3K9NA 2X19A 4U5XA 1P60A 1T8TA 1GAJA 1AM4D 3U7FB 2G1KA 3AH8A 4WZBE 4D6PA 5IHPA 2BBTA 5HZHA 1XEXA 4ZKDA 4GL2A 3AVTA 3FFAA 1LB1B 1G4UR 1MABA 3LA6A 1YZNA 5JSZA 3K0FA 5CM9C 1S1CA 2LCFA 4RZUA 5CJPA 3W8NA 8OHMA 2B7CA 3AVQA 4IVPA 4O2LA 2WBLC 3CR7A 1YRBA 2QI9C 4HLQB 3I73A 3T5GA 2SHKA 4UQOA 4IEEA 3T61A 4NPHA 1NN1A 3MFYA 1N2CE 4BASA 2C78A 3PIRA 4LGMA 2OCBA 3JVVA 2O0HA 2HYIC 1U81A 2VP9A 1G5PA 3F0TA 1SKYE 2GETA 2VP0A 3B1YA 3SJZA 4C7OB 2NPIA 2PT7A 1NN3A 2CDNA 1DPFA 4M1OA 3FYHA 1B23P 2O8DA 1SVIA 1Z0IA 3IO3A 2JJ1A 2ZYTX 3LY5A 5CM8B 3K70D 2VHUA 1UPTA 1XPRA 2OZEA 3LBNA 4HDQB 4KLNA 2Z0MA 2ZI4A 4G3XA 4I4LA 1HA3A 2LWIA 3Q7PA 4LJAA 1AKEA 4X8LA 2XZLA 5HR5A 5KNDA 3SYNA 3DOFA 5CITA 5CB6A 4C0LA 4Q7MB 3A1WA 3D3QA 1G21E 1LV7A 1ZM7A 3QOFA 3MD0A 1M7GA 1BOFA 2RGBA 2CLDX 2VF7A 2JJ8A 2QQEA 4A82A 1XEWY 1M74A 4HLUC 1YKSA 1KI1A 4NU0A 1FTNA 3QE0A 3AVVA 3T1QA 3KB2A 2DFNA 1YZLA 2H17A 4C0SA 2R65A 2RB4A 3DKPA 1T0HB 4A8JB 1LTQA 3BERA 4EPXA 2PZFA 3W8RA 1J99A 1Z2AA 1P6XA 1ZP6A 4V0MA 2ZI9A 4A0GA 3OESA 1YE8A 2XEXA 2TMKA 2FH5B 4M9QA 4B33A 1TU4A 4B44A 3A6PC 5A4JA 1HE8B 2HV8A 3C16C 2J0VA 4QXAA 3ZVLA 4Q1DA 1PLKA 2IHYA 4M0LA 3A1VA 2O5VA 4QGFA 4RJLA 2ZUDA 4B3CA 4LJ8A 2X8AA 1UKEA 3WHKA 2HCJB 3RRYA 2QMUA 3QBTA 4BE7B 3A4MA 2RGEA 1SZPA 3LVQE 1KGDA 1LW7A 1P7CA 4A15A 4PC6A 1EESA 2QAGB 1W4AA 1MOZA 2QA5A 2QZ4A 2OBNA 1ZVQA 1JBKA 1IY0A 2H8KA 4TZ0A 5EUMA 4CEIB 2D2FA 2EU8A 1E1RA 1N6PA 4NYJR 1Z0FA 1J7KA 4Q1BA 4TL8A 3AVWA 2C03A 1E99A 3DM5A 3EC2A 4C7OA 1Z47A 2F9LA 1VKJA 2AN9A 1FNNA 1U0HC 2WJIA 4KAXA 4V02A 4NKRA 3BFXA 3LQRA 2J41A 2F55A 2PLRA 4M9XA 4A0RA 1R10A 2ZJ2A 3QPVA 3EPKA 1GILA 3MWLA 5GJWC 3CWZA 5JWRA 1M7HA 1FQJA 2ZRMA 4UXJA 3MWJA 1ZUIA 3W6OA 1WE2A 2KE5A 2QROA 3WYFA 1KI2A 2IYLD 2QP9X 4OQMA 2DFTA 2ZJAA 1W4BA 2OBLA 3FHCB 4PSVA 2JJ2A 3A4LA 1E2IA 4I99A 5J40A 4DDTA 2FG5A 5L3RA 4BGDA 1KJYA 5EE5B 5HTKA 5TXGA 1LS6A 2G9NA 5AUPB 1E9EA 1OFTA 5HKKA 4I1OA 2GCPA 2QNRA 3C7KA 3JZMA 4A8JA 4DSUA 2MMCA 5F3WB 4OKSA 2JDID 2OLKA 1TUIA 3BE4A 3BIFA 1II0A 4DSNA 5JRJA 3HU3A 2QP4A 1W36B 4O0MA 1NJGA 2ZSFA 4QNRA 2BM1A 1VHLA 2GZDA 3MAAC 4QOSA 4BQSA 4S35A 2CL6X 2ZRHA 2FSHA 1U94A 2J5XA 2QMEA 1NI3A 2G88A 2WKRA 3CH5A 5BN4A 2WPDA 2XAUA 1ZRHA 3QIAA 4Q21A 2ONJA 4TSFD 4XVRA 4MQBA 5GJBA 1WXQA 3EZ7A 4FINA 3VX3A 1SHKA 3LX5A 3VNVA 3NIBA 1R8QA 1VHTA 2QAGA 2ZI6A 1KTVA 2WWGA 4AYTA 2W0MA 2DY1A 4YDSA 1T6NA 5B58C 4GBMA 4CEIA 1EFRA 1U0LA 4PX9A 3IGFA 4RKEA 2B21A 1E6CA 1T3HA 1E2LA 1ZD9A 4NYIR 5LPNA 1W0JD 5KSPA 2ERXA 3ZZ0A 4RSGA 3BORA 2PH1A 3TKLA 2OG2A 4PZYA 4DZZA 3I4LA 1IXRC 1CTQA 1TF5A 4GMDA 4QKQA 4B2LA 3CLVA 1GWNA 1GZSA 2H16A 4LPSA 1WRBA 4G01B 5TARA 4OHWA 5BYJA 2A9KA 2IXFA 4FI3C 2NGRA 1G9XA 4V0OA 3RRMA 1PJRA 1S4QA 1WF3A 3IBYA 4IVQA 4EAQA 1ZW6A 4HSEA 1F60A 2RHMA 2RGDA 1NVVQ 4Q9LA 3U7EB 4B2IA 4DKXA 4DLUA 4DCUA 1PLJA 3ZIAA 1Q1QA 3BWDD 3KUDA 2WWXA 1MO4A 4B6FA 1R0WA 2V8OA 3CPJB 3Q5EA 5TY0A 2ZJOA 3SS8A 2VP2A 4BFYA 4ZI3A 5F2EA 1EWQA 1IONA 2C8VA 3RLFA 5DN6A 4DT1B 4HDOB 4QGGA 1M34E 4MRPA 3WYGA 2ODEA 4ZDKA 1P3JA 1RRPA 2D4HA 3ND9A 4HEJA 4UNPA 3ADDA 2OXRA 3ZS8A 4MITA 2WZQA 1G8YA 4K46A 4UNSA 2FA9A 1G8HA 2ZQ5A 2IUUA 4E22A 2PX0A 1E1QD 1JEDA 1Z06A 1VTKA 1Z6XA 4PANA 4UNRA 3U5ZB 1J8YF 3A1TA 4BZPA
chains in the Genus database with same CATH superfamily
3AR4A 4J16A 5TPZA 3I62A 3Q9LA 2HPHA 1JYSA 3PXBA 2PH7A 2BJWA 2OV6A 3MQ4A 4CMHA 4E3ZA 1E7SA 2MMGA 3Q3GE 4ALMA 1QNFA 1UR5A 4N7MA 1IK4A 1J21A 3LC2O 4QQRA 3UW1A 3WLNA 3X44A 4A8HA 1T1JA 4FIDA 1XBTA 1HO3A 2AEFA 4JBGA 4RV9A 4ZQEA 5B1DA 4IIVA 3WFIA 1XNRB 2NTJA 1WSAA 3FUWA 4J4BA 5CURA 7YASA 1ZC3A 4XQGA 4BFCA 3FHTA 3SF8A 4MAMA 4YQZA 2GCIA 5CG1A 3LCCA 4F5WA 1M73E 2JLCA 3MJVA 2NVOA 3QNUA 4RV4A 3UMMA 4PQFA 4QU5A 4Q66C 5TQ0A 5FPHA 4G0WA 1L1FA 1BC5A 3BL5A 1HT2E 2CVQA 2GGSA 3DKRA 3CUVA 3KQTA 3STVA 2FX3A 4BMPB 5JAOA 5IAOA 2YVLA 1H4TA 4RF2A 2PY6A 3KKEA 2PYZA 4MYDA 3UHAA 4Z3OA 1BDHA 5EKSA 1H9CA 2R87A 5KWVA 1HOXA 4OJYA 1Z75A 4IO1A 5AW5A 5EPEA 1CQIA 5EFOA 1W73A 1E2UA 1Y80A 3PDIB 4TS3A 3RTAA 2NTVA 2QZJA 2PO7A 2JCSA 2EP5A 1JKIA 4TMYA 2JIRA 3FIUA 4MRNA 5A02A 1T36B 1TF2A 2X8LA 1XDZA 3PX7A 1UBMS 1ZJYA 1LVHA 2XRYA 3C97A 3IDOA 2ZITA 1X9GA 2I34A 3TSOA 1EAMA 3TSCA 2A6PA 1RAFA 1R5JA 2AK3A 3KJQA 3D43A 5F5NA 2YXPX 4U7JA 4XVHA 2BM0A 4DMCA 2QVBA 3L6CA 2HTFA 2XJ9A 3GR6A 4MW0A 3VO9A 4MYTA 5LA6A 4DLZA 3KOZA 5AVJA 6REQA 3MOSA 1E20A 2HOQA 4HF7A 1QS0A 3H1BA 5SZJA 3IAFA 2CMHA 1PWEA 4KQHA 1ORDA 4DT1A 4JROA 3B70A 3ZLUA 4F3TA 4BNKA 1L5WA 2G1PA 2XB8A 5DWDA 1QIEA 2CXPA 3MYRA 3NIDB 3J7AC 4IIUA 4QD3A 3BJIC 4UUMA 2LCQA 2G08A 4OI0A 1U8XX 5EJAA 1O96A 3V6MA 4M87A 2JGNA 1OLUB 1QH1A 4I1RA 4FCWA 3VR6D 3ZNQA 1PT8A 1A9ZA 4V1CA 2AUMA 3HL4A 4PFKA 3TQSA 5K0BA 5EMMA 5K03A 1U0FA 2W6QA 2QRVA 1NUAA 1XDUA 1CRLA 1SUBA 2J87A 1RACA 2Q07A 1YA8A 2ST1A 3G23A 3HPQA 3AGPA 5LZ7A 3WGOA 5FWYA 2FMTA 2ENUA 2PLNA 1N2CB 1HNXB 4V38A 3O1LA 2FSGA 2PKQO 4P4SB 4TKVA 5EJ6A 2PL3A 4BLRA 5CHYA 5BO5A 3T7JA 3HBNA 3HFJA 1D6MA 1P2SA 1HLFA 2PZMA 1SKYB 2Q41A 1P7ZA 4HUJA 4ENUA 3ICEA 3RRBA 1Q6YA 5GGXA 4CFYA 2FVXA 2PH5A 4N7RA 4FZJA 5PGMA 1XA0A 3PUZA 2CF5A 5F51A 1JG3A 4IS2A 1KMHB 2GFQA 2HRBA 2N3ZA 3JVEA 3OT1B 1NVXQ 4D5GA 4RD2A 3RAPR 2QENA 4JJ4A 4BMCA 1E3LA 3NUQA 2JIMA 1KJ9A 1QQ6A 3TZKA 3NLLA 1DQNA 3VR0A 5JHHB 4RCZA 5KX5A 1E4EB 4KX5A 4LSZA 1CERA 4AJJA 3U56A 2XT9A 1SA0B 2QG6A 3WS7A 3RJ5A 3CZAA 1B16A 4NATA 2WIFA 3CE9A 4YDQA 3ADKA 1JDBC 2VHWA 4C0WA 1I4DD 3AG5A 2ZJYA 1MB9A 3B36A 3GFPA 4QUIA 4F4HA 4PFSA 1NP7A 3VPSA 5J9FA 1NXTA 2WE8A 3M6AA 4AP9A 5TGTA 4OLJA 1G8PA 5DOZA 2FJPA 3V3KA 3D0RA 2CB9A 4PHTA 3TAXA 5KJCA 3EH1A 1T9ZA 3TFOA 2OLEA 2O8FB 2JIZD 4JC0A 5B2ZA 2Y68A 3KOUA 4DQXA 1FJHA 4UUAA 4W6ZA 2FSFA 5IXYA 4B71A 2VLBA 3MB5A 3CKKA 4JSTA 3SDZA 2IH5A 5B1HA 4ECAA 4IDDA 4WNAB 4ASUD 4P36A 3ZX4A 3GT4A 4ZHQB 5KYTA 1JIXA 1HK7A 3NDBB 1CUEA 1XCGB 2CJPA 3M9WA 4G6ZA 5BRAA 5THXA 1TAQA 1FX0B 2NSLA 1UBLS 3I34X 1Y3DE 3ZLBA 4PZ0A 3H84A 4KH0A 3I8SA 4OBEA 1CNMA 2J9GA 1RYMA 2HLHA 1TJ3A 3URKA 4ZVNA 3SVZA 3N2KA 3U40A 4FNGA 1V4NA 3OEHA 5JS8A 1QH9A 2X7JA 3QLVA 3LKVA 3ZLTA 2G5TA 3DOJA 5K0JA 4Q3DA 3TLYA 3SR0A 3ZX5A 1VL5A 1ZRSA 4NMXB 4A8TA 3CUTA 3LUFA 3PNOA 2ONCA 3E9YA 3C6MA 3W3AA 3BQ9A 4MTLA 4OJQA 3U9TA 1BFDA 1CUWA 2A0UA 5I9TA 1QDEA 2PVSA 5JT1A 4AJIA 1E7YA 2AOXA 3ICCA 4WINA 4Z8XA 5JO9A 1TAUA 1K6EA 3T8YA 3I6MA 2YOHA 3ND5A 1CZHA 5SZIA 2WMDA 1DKLA 4TV8B 4GLLA 4DNPA 1T0UA 2EVWX 1QTNA 1X7GA 4DIEA 1QOZA 3TE6A 4CIXA 2DR3A 1SVOA 3ZGZA 1HKHA 4IICA 2BGLA 1BU8A 3MHTA 1B6GA 4OUDB 1AMNA 1XLTA 1HQDA 3OCVA 4NZPA 4JZYA 1WUTA 3MK31 4LTMA 4DYVA 3E2PA 5E6UB 4IXWA 3I1YA 4K6OA 3C8MA 4N3BA 5G4LA 3V97A 2PWZA 4DSAA 5IN4A 2X86A 3OX1A 4EFNA 1L8LA 1ODJA 3RS9A 4QT4A 4HGZA 4L72A 3TCKA 2R4TA 3CZRA 4YROA 4RYLA 3PNMA 4ZYZA 4ARVA 4KC0A 5FFFA 5C1BA 3U4QA 1D4FA 4OOFA 1CQPA 4ML3A 2Y8EA 1US8A 3AKYA 4ANFA 4TWJA 1G7CA 2IPNA 3EVTA 5EINA 4DADA 1ETHA 1OR8A 4UTZA 1B00A 1XZGA 4WAUA 5L3ZA 1PZMA 3K0KA 3L0SA 3NASA 1NP3A 2EL7A 3L7NA 3OCUA 4NYIQ 4ZCMA 1ZU5A 1I13A 2OXEA 4RDHA 1NMXA 2P3QA 1RXWA 3H6GA 4N03A 2IDMA 5CLGA 3RT9A 4R2JA 1AXRA 4IIXA 1JMYA 3NWEA 1CY2A 5BYBA 5EEHA 1KDRA 3SICE 3QX8A 1MO6A 3OOJA 4HTFB 5CCXA 4HNVA 1N4DA 4P2BA 3LXXA 3D4PA 1DKRA 3T15A 5E4YA 1WHSB 1J2JA 4N0PA 2V7BA 3KLPX 1GRNA 4OGGA 5F9HA 1HEYA 1RABA 2CVFA 2GCOA 4IYRA 2FSUA 5HEKA 3G2NA 3RSCA 1DBPA 4XE5A 3SJAA 4JQOA 3KOXA 3VNAA 1XB2A 3N0RA 4M6WA 2NO1A 5FBLB 1F06A 3OPYA 4TZKA 2VYND 4J7XA 1A2KC 4BQFA 3IEKA 4HXYA 1RQ2A 2WTBA 3F2VA 1IXYA 4EP1A 2BGKA 4KB5A 3QSGA 3MCVA 4AMYA 5BUZA 2PUCA 1SG6A 4QJ5A 2GEFA 4N5NA 1JRLA 1AE1A 4M8NE 5IFKA 1XVIA 3ZZMA 3L3BA 1DLIA 5L7TA 3IAXA 3R24A 4U2BA 3WAGA 3RWOA 2NTEA 2VYFA 5HKAA 1UEIA 1VCIA 3DDHA 3OPQA 4JLBA 3TLJA 3DHVA 4RTJA 2ODNA 3M70A 5L4SA 5B4UA 1JLMA 1GG8A 3GRZA 3Q88A 4UHBA 3TPZA 4MNTA 1D0VA 2BGUA 3AI1A 1GPH1 4N49A 3WIOA 3BH0A 3C45A 3NEJA 3CURA 2WIJA 2NXJA 1ZY2A 3H86A 4UM8B 5CK5A 3RAJA 5JRDS 5KTPA 1PG2A 1YCHA 4AKEA 3OTGA 2P11A 4YMUA 2CJWA 4O2BA 2Z6AA 3PGKA 3QWAA 3M6XA 2ALJA 2WF6A 4J94A 1W8DA 3U3KA 3QWFA 4KR3A 2C42A 3A9VA 2FPKA 5CA0A 3BZWA 1IHDA 3KKLA 1QGDA 2P9BA 1NYQA 2ADOA 3P32A 5JAUA 2G0NA 1G55A 4JBYA 4LJSA 3K0FB 3PD1A 1C8BA 2QM7A 3EJWA 5FR1A 3OZTA 4FFNA 5F5XA 3ZUGA 2QTWB 4HDNA 3FYUC 4Z6KA 3FAZA 2WTAA 2IOYA 2JCYA 3FCSB 1F2TA 1WL8A 3SY8A 3EOZA 4LXQA 3G79A 5K51A 3TZCA 4Y2RA 3T38A 1IC6A 4GP9A 4XCXA 4A10A 2QN8A 1JMKC 4IWYA 4IPTA 4EGFA 3G7NA 1FDIA 5B6PA 4XB2A 4DZRA 4OK6A 3O94A 4DMMA 4YECA 3QVUA 3RTBA 3SYTA 5DIFA 2WWTA 3A2LA 4HYQA 5CIQA 3ASVA 5ILOA 5IASA 3H5VA 5DXFA 1CNFA 2QM8A 5ITZA 1TD1A 2CYAA 3LTEA 3LX6A 4R1TA 4V2UA 5ETJA 1A7JA 4DBLE 4GBED 1JEOA 5IANA 1K5DA 3DDOA 4GXTA 4X64B 4BHTA 3LLSA 1DEXA 3E53A 4QOJA 1JEJA 3ZI4A 3GPBA 1QK5A 1SCIA 3IUJA 3L0PA 5CX1A 1FP4B 4NV3A 1JEAA 1QRSA 5K8LA 4NQZA 1OI4A 1YU9A 5CH3A 4WTOA 3SEQA 3UYLA 3PXDA 1VE5A 2HWKA 3EG9B 5DP2A 1YCDA 3LUPA 5AJXA 2FEXA 4LBYA 3WK5A 4LJRA 1GUFA 4GKJB 4GECA 5B7QA 1H2HA 1NWCA 1W6UA 1R0RE 4KTVE 3V8EA 5IYZA 5LZ9A 1XSEA 3BBLA 3TOVA 1K89A 4ZTBA 1K8RA 4B48A 4BAUA 3PGXA 1BXKA 1X7ZB 2GYWA 3GB9A 1VJ1A 1YDFA 5JNUA 5D84A 3TLGB 1GPWB 1XWIA 3KQLA 1FJ2A 1IBRA 1K6JA 1PR2A 3MGAA 4MWEA 1ZH0A 2VT3A 2QOEA 1SULA 1RZUA 3OQBA 2WJHA 1E1RD 3SD7A 3WTBA 1SAYA 1FSSA 1QCCA 5ESXA 4PAGA 2RAPA 3VO1A 3KEMA 3HUDA 3UFXB 3JAMA 5ERGB 2EG9A 4L02A 2HGZA 1ZNWA 5GZ6A 3THXB 2OC9A 4YVFA 2GJ9A 3IPCA 4NE9A 4TQUS 1QJCA 3ETDA 3OURA 4QPDA 3A6EA 4E12A 2XMQA 1RWOA 4MW5A 3X1ZA 1M1NB 1KR2A 4BWFB 2VYQA 3QWBA 3BSWA 4FN5A 3O3MB 5EZ6B 5AVKA 1IB6A 4RD1A 3TW6A 2IJGX 3WFJA 4JQCA 4I9GA 3IQXA 3T7TA 5A6SA 1F0PA 2VOEA 3EY9A 1EUYA 1THGA 1T5DX 2V3VA 2ZRQA 2VXOA 1HEUA 3HCEA 3EA0A 3IOBA 1CLEA 1EX7A 4AKSA 4BVBA 3DAHA 1CR6A 2OO7A 1SU6A 3KQWA 4PO9A 4PWZA 4I5IA 1MJ5A 2FN4A 4G1BA 1PR9A 1XQ9A 4BU1A 1VMEA 5CNJA 1D1TA 1Z26A 3EIWA 3VPCA 1KP2A 2ETXA 2DWCA 3Q4GA 4FN4A 4HO1X 3ER9A 1RJ9A 1ML3A 3KTFA 4DJEC 3CF6R 3RCBA 3IR5A 1QM5A 3IQWA 1GV1A 4YUAA 3T7CA 3BTVA 2ZAIA 3UBMA 3EMVA 1SFRA 2CNWA 2ICAA 2BP7A 4XWTA 2ATXA 3OLZA 4J0DA 3PNBA 4GMKA 1GTL1 2C61A 1V1MB 3HY6A 3QUCA 1QYIA 4HUTA 3K4QA 5LNK1 1C0LA 5G02A 1P3Y1 3ZU4A 1L1EA 1QORA 4I4TB 1ISPA 2P4SA 4JA0A 5CVEA 3V8RA 4AWBA 1N3BA 2C97A 1JQ5A 1S7GA 2IOFA 1EH5A 4L0MA 2NOAA 3ANNA 4H3HB 3ZDQA 4DA8A 1CWUA 4Z4FA 1FY2A 2XGOA 1V3QE 3MTAA 4G0UA 4M0FA 2OBMA 3OA0A 2WAYA 1U9IA 2UZ1A 3OUTA 3UG7A 4BEBA 3MINB 1H0RA 2K2WA 3VYSB 4E0BA 1QP0A 3LDFA 4LYFA 1DKNA 1TPYA 3C3WA 3BPSA 4B75A 2EHJA 2ZRAA 5I48A 4DCVA 5A5GA 2I3BA 1U4SA 2AXQA 3PJGA 4TLBA 2VZ0A 4EMTA 3QM1A 1MOSA 4R83A 4DR6B 2LR0A 3IILA 1EFPA 1HE1C 3O4VA 4OBXA 3NHLA 5BOVA 4MWSA 2PSHA 1JIIA 2N46A 2VI5A 3C3CA 3FLAA 3INNA 3PUXA 4WKBA 3RRXA 3PWZA 2D5AA 5JBQA 1WF6A 3BK1A 3LHKA 1Z28A 4P7BA 3K8QA 2ZYGA 4L0CA 4YRGA 4L4ZA 2WG2A 3TTWA 2P77A 2ZRIA 4G37A 1QIDA 4PZAA 3UK0A 5KNBH 3AWIA 4X20B 2QRMA 2QUBA 4OPMA 3EXFB 4WD3A 4WV3A 4BKRA 3OIWA 1R8SA 3RSZA 1DO0A 1AQLA 2D1YA 2O6LA 3I9KA 4NHOA 4BKOA 3UPTA 4IDGA 4CM8A 1NUSA 1P9NA 2IODA 1HSZA 5G2OA 1GY8A 2COEA 3MOGA 4ZDJA 2ZB7A 5CA1A 2C9CA 3E8MA 2QXUA 4M1TA 5D6OA 1NVTA 3PRJA 1PL8A 4KQCA 4MS1B 5T64A 1HDCA 3L4JA 5ALVA 3PX2A 2QJOA 4UW9A 1KOLA 1L5NA 4DIUA 3AI2A 3HKDB 2DE0X 4ZGBA 1YQ9A 3LQFA 4D4LA 1NN5A 3EDMA 2LKDA 2A33A 3RTEA 2FXIA 1O94D 1BU5A 4N3NA 1T1IA 4C4AA 3A37A 3NBYC 4Q4JA 1P1RA 3ELDA 4XW2A 1SQ5A 3BAFA 4P86A 4ZV4A 1UDCA 2N42A 3FCUB 3RFFA 3AR8A 3I52A 2PUDA 3AF2A 1AQIA 4R2KA 3CZ4A 3NHAA 4K5QA 2XQKA 3KSUA 3OLXA 3SXUB 5CXXA 1EM8B 3I04M 1QH8B 3K9WA 3OBIA 4KUGA 4AZTA 5GTDA 4DLWA 1ZZEA 3QEAZ 4KR7A 3CZPA 1UEXC 1II8A 3WMWA 5LP6A 3WGNA 2O1WA 3RVOA 2A4MA 4J0IA 1OAAA 4LN1A 1CJSA 2X4DA 3NFYA 3QKSA 4IJMA 3S44A 2CUNA 4KXWA 2FPGB 1VE7A 2B4TO 4FYHA 3TR0A 4ARZB 2ZBUA 4JSRA 1M2HA 4MKGA 1Z6QA 4PLVA 4D4MA 2C2HA 5IXJA 1JHVA 1C3OA 1KARA 1UPFA 3B38A 3C7DB 3FOBA 4CG2A 5H81A 3PR1A 2J30A 2J4FA 2WUEA 5GVSA 2AF3C 1P73A 2OM2A 2Z8YM 3Q6NA 4PRYA 3AV0B 4KEAA 4EPVA 2ZJ3A 2H1OA 4BRWA 1QU3A 2VWPA 2E6KA 3S3TA 2NUPB 4Z51A 4D9MA 4IQFA 1ZUWA 2MSEB 5E7MA 3R76A 3RFCA 3GY0A 4ZEVA 4FHZA 1P4AA 4LC0A 2PUVA 3AGQA 4LRXA 2PRJA 1HNNA 1R1DA 4XKJA 1DAOA 4HY3A 3EHEA 1U2ZA 4RIFA 4P34A 5WRFA 2H18A 4X1OA 1A7KA 3ZQKA 3OSZA 4R01A 1T3ZA 5C8YF 2O8DB 1G66A 1GNRA 2D2XA 3PWKA 2FW7A 5KVQA 6Q21A 3QX9A 4LBWA 4TS4A 2GARA 1N5MA 3W3ZB 2AXNA 2JD2A 4DR4B 2YWJA 4E7OA 3U4MA 4L50A 1XXLA 4BN0A 2V55B 5EZYB 3W4IA 1P2GA 2XWPA 3TYXA 3B6MA 5KS2A 2C58A 1HXHA 2FWNA 2HJWA 3LZDA 4Q4AB 3S1AB 3WZLA 1IBLB 4JLMA 1USIA 3MMZA 1BXZA 3A9TA 4C7VA 1KAQA 2X41A 4EHKA 3EGDA 4UD2A 2QQ0A 3COWA 2FW1A 4G65A 4PHCA 3DUFA 4RYDA 5ENDA 5CDYA 3GJ3A 1TIKA 4I5FA 3RNOA 4JP2A 2GM3A 1D5WA 1EKXA 3UKOA 3ESDA 3ZJ4A 4C0JA 3ZE8A 1LDGA 1KO1A 1QYVA 3I04A 1RW4A 1CSEE 3AIOA 3GCXA 4YFVA 2CEKA 2WJWA 3FKJA 4JBWA 2FQQA 4WK4B 4JA2A 3E5NA 4X1IB 3ZY3A 5JQWA 1HYHA 4DR1B 4FYVA 4P38A 4BAZA 2QTVB 2FQYA 4X41A 4BWYA 3FNQA 1YXMA 1DKMA 2NMVA 3BH7A 4P5EA 2CDBA 3S2IA 3AM5A 3DVAB 3L0CA 3RRZA 2HMUA 3ESYA 3IDFA 4DBVO 3ROKA 3Q8KA 1Z0ZA 2ZSAA 5BN3A 3ROXA 6GPBA 1B6SA 3UA4A 1H3EA 2Z8YA 2Y1WA 2A84A 4PPYA 5KU7A 3FKQA 1V6AA 3PHJA 3THWB 1R4AA 4Y98A 5KNCD 1EUZA 4C4RA 4A36A 3KT0A 3IPRA 2YRWA 5EUCA 4L5IA 1RC1A 3NUZA 2CL5A 4EG4A 2Q3FA 4RF4A 3TIIA 4OB8A 3AHJA 1IN6A 3KB1A 2A0KA 3T3HA 1JB9A 2ARKA 3DLBA 3T3IA 4JVSB 4X6XA 5FOVA 1W4RA 4ZRDA 1ES9A 4RHYA 2I87A 3HVUA 2VPWA 1NOKA 1PJ8A 2QMQA 4L6AA 5DVZA 2ZLBA 3FWZA 3HUTA 4YGXB 4EHLA 2V0NA 4EHDA 2O50A 3EXIB 5I7AA 2CY0A 4A1FA 2A1TR 1IEQA 1CF9A 1E2FA 1V5FA 4P7GA 4CQJA 2AN5A 1PP4A 4MA5A 1EBUA 1U8ZA 1EE9A 1QGED 4KV7A 4ZQFA 1N3YA 3M89A 2Q0HA 3BGOS 4ZAWA 1PQ4A 4CM4B 5AQEA 3R3JA 3TRFA 3TTSA 2YJ6A 1P72A 2DYKA 1JAHA 3KT8A 1TM2A 4P32A 4X71A 3WIVA 2VQSA 3P9NA 3H2GA 5IMBA 4AQ7A 2H3EA 4HDRA 3ZGVA 2Y0BA 3AW9A 4LJLA 3VISA 2AOUB 1PX2A 4WOCA 4QYIB 5T57A 1ZHHA 1UM8A 3TAHA 1K63A 2GEJA 4WESA 5F12A 3D7KA 4YBRA 1W2WB 3NGXA 3CEJA 1W88A 3VI3B 5TX7A 4TMXA 3VDXA 1MEOA 4M86A 5KYVA 1FW6A 4CLDA 1RQGA 2Q4BA 5KDOA 1O0CA 4J0KA 3GEPA 3A26A 1UKYA 1FDVA 3IUBA 3LK6A 1OLSB 2XNDA 3BTUA 4WNYA 4YIHA 4CW7A 4HEA1 2QEQA 3QI7A 4YJFB 4KPUA 1X8KA 3QFTA 3LAWA 3R09A 4BMZA 5H8WA 2W58A 4JKYA 4OGLA 3W34A 2X5XA 1HF3A 3HYRA 1DC7A 4NHEA 4AG3A 5IF9A 3CBGA 2C4NA 1PG0A 4YLGA 1DXOA 1DLJA 4XWYA 1X3LA 2EG5A 2IU4A 1NI5A 2QYSA 3FZEA 3PUJA 3V4OA 3ZWXA 1OSNA 5E4JA 4H77A 2GXSA 2UYOA 4ZJZA 2GTIA 2GA9A 2QRUA 3EAFA 4ZU3A 3U49A 1SOWA 2NUAB 4X7PA 2CJYA 1EK6A 4KN8A 3GZNB 4IL5A 5K3CA 3V4FA 1WM1A 1V37A 4NMWA 2E6UX 1TC1A 5K3DA 3BB4A 2W71A 2K7ZA 1DFIA 4E51A 2ZYWX 3L0IB 3PLNA 2FU5C 2H7CA 3AHGA 2OESA 1HT3A 2AFIA 4YI5A 1ZXXA 3L43A 4U3JA 4B3TB 3OIFA 1GDTA 3NKLA 2XE8A 1MB4A 1TFUA 2AI1A 2H2IA 1DHTA 3DMNA 4RK0A 2PD3A 4YJ3A 4FW9A 2G5GX 5KSOA 5K8TA 1TGVA 1E9FA 3PKIA 3AP1A 2QAJA 3WFZA 4X00A 1MNQA 4KX3A 3QKRB 4FD2A 1DIRA 4EM6A 1FK8A 2RE8A 1USWA 1DELA 4PTZA 1GL7A 4KI0A 2QD5A 3HA7A 4JT2A 5HYVA 2UUCB 2NV2B 2OGWA 1QG4A 5JZSA 3H5WA 2QJRA 4GX2A 1V0JA 1ZPDA 3UKDA 2QKYA 1UFVA 2P5TB 2JANA 1NHWA 3E3LA 2QUIA 5B6IA 4F5DA 4N4AA 1PEAA 1A97A 2HSZA 2GPBA 4J7AA 4LDZA 2QU8A 4YMHA 3WRWA 5F98A 1QR6A 1MH1A 1X7WB 2N75A 3IDQA 3TPCA 4EATA 1BDBA 2GPJA 2OKGA 2VR1A 5JVDA 2BDTA 1RRFA 1DRWA 2V6MA 4QJIA 4XJSA 2QU7A 5HILA 4JIGA 2HCFA 4YCCA 5JPCA 1SBZA 2O19A 2W6NA 3OU2A 1GSHA 5H9WA 1E3WB 1Y5LA 4AN4A 4W4TA 3KQVA 1GZUA 4JLPA 4M9UA 4JI1B 4BJHB 1PX0A 4LCBA 3H9JA 3OLCX 4PFJA 1OZFA 1VSTA 1RHMA 4GOJA 4EFLA 4DDWA 4G4JA 4ZO8A 1G3UA 3IUYA 1CQZA 4MUAA 2BEUB 2JHGA 3QKWA 3G85A 1UMDA 1Y7HA 4YS6A 3O75A 2K5UA 1BWRA 1FUEA 1VFNA 4K6MA 4WW0A 5EEGA 4US2R 5ALRA 3VTZA 3ESBA 1E69A 1M6EX 1T34A 4AX4A 1IDN1 4NU6A 5I7FA 2X9VA 1M1YA 4K7JA 5L3QA 3AY6A 3N28A 5CPBA 2DWOA 2ZSUA 2II6A 3GDGA 3HGMA 4TV8F 2HU5A 1J7JA 1X13A 1Z5ZA 2GHRA 3CEMA 1HQYE 1QF9A 2AZDA 2ZJ0A 1LBHA 3GROA 3H8WA 3OJFA 4Y7DA 1N2XA 5GVRA 3C85A 4KE6A 5LQDA 4KHZA 3MNFA 1GA6A 4MGHA 5ALPA 4E5SA 3BK7A 2CUTA 3N07A 4BLPA 1DV1A 3TGWA 3OU6A 4KMOA 7ADHA 4LZLA 3K5IA 1Z2CA 2FP4A 4FONA 2Y6UA 3TNDA 3UMVA 2P68A 1X7XB 1VYHA 2WWWA 4P3PA 2D00A 5DI3A 4XYEA 1R5OA 2DMRA 2DJ5A 4HG2A 4Y2GA 1TCAA 4EQ6B 1RE1A 3ROPA 1E8MA 2H59A 4AG5A 4PFQA 2OYRA 3U16A 1DAMA 3FSEA 2P75A 1JQEA 1ZIOA 4IF6A 1N33B 1DX6A 4DWVA 4JT9A 4KMMA 5IVDA 2J9YB 3AIKA 4EW6A 1PR0A 2ZREA 4J2TA 3EVBA 4C4OA 3GG2A 1DBSA 1ZOIA 4MJ7A 2H54A 3RARA 4RAQA 2XKKA 1MIHA 3AV3A 2DWPA 2WQ6A 4MP8A 5JNWA 4P4GA 5EE1A 3HLTA 3V7NA 4ALJA 4JMLA 5AOCA 1UBRS 1S1MA 3JVIA 5CYFA 2PO5A 3LBAA 4ESOA 3X3HA 1OW3B 2P0AA 1QVWA 4DQUA 2DR2A 3QF4A 1GPLA 1W5FA 3JTEA 4H3SA 1UEJA 2PANA 5BSKA 4FBMA 2G1UA 2OCKA 4POAA 4CBVA 3Q0IA 2R1UA 4LQLA 1ZMTA 4W82A 3DF9A 4HX5A 2BI7A 2CHQA 4IKOA 2GBPA 4S1VA 2FSSA 5BV0A 1W5AA 2EF0A 3CM0A 3DCNA 2D1TA 3JWHA 1S3FA 1ZONA 2H1VA 3GFRA 3PGMA 1FIUA 4COOA 4BCBA 4PO1A 4K26A 4U63A 2PEZA 4BDSA 4EBFA 1IBKB 2J3KA 2OEPA 4PGAA 4F91B 5DW0A 2ZIGA 2WFMA 3TBKA 3E3OA 1I1NA 4RHFA 1U31A 2PDAA 3CWQA 1JU4A 1LNZA 2P4QA 4YCMA 4YIKA 3PPVA 3R20A 2C4VA 3LQQA 3NM4A 1EIWA 2VKQA 1HT0A 1JR6A 5CFQA 1C4OA 5LQCA 1EUDA 4JBIA 3HB0A 2RCYA 2OXFA 3EXEA 1V5EA 2H1CA 1XR3A 4QUEA 1RFLA 1SUEA 2WHEA 4FMBB 4B9AA 3R8CA 1T1SA 3L6DA 1XP8A 3R5JA 1HETA 4KXNA 1KDYA 2H07A 1E3JA 1NPYA 2QAGC 2XI4A 3LFTA 1H9BA 2VAPA 3LQ1A 4U7PB 1AC5A 1Z7YA 2PPVA 4UU7A 4Z86A 3TJZA 4Z4HA 1HY3A 2AYYA 1NFRA 4JVMA 4XWKA 4YAFA 1YB7A 1NM5C 3EVEA 4C78A 3GGCA 3AONB 2H57A 3D6UA 4A2PA 3Q8LA 3E84A 1HLGA 1HPLA 1RIFA 1O2DA 1O6BA 3AR3A 2E0IA 3FPKA 3X1XA 1G59A 2QPTA 1DCMA 4RPHA 4MICA 1OXVA 1W59A 3ZEIA 2D5LA 4EVRA 1OX4B 4QWWA 3GOQA 4CMBA 3QVSA 5CXUA 3CX4A 3F7TA 5JS2A 2ZSHA 1CUUA 1O03A 4RXMA 2CXSA 2I3DA 4JVNA 4YXWA 4RPJA 2YWEA 3UK2A 3N86A 1LJLA 1VI2A 2C3OA 1T9GS 2CUKA 1S2MA 2WOOA 3FWHA 4LE0A 3EXHB 1UINA 4R1PA 4XSGA 1HDOA 4RZXA 2Y77A 4WOBA 2A9VA 2IK8A 2NADA 3INTA 3GJ4A 3S55A 2IUFA 3H2SA 2Y27A 4EB6B 3IT3A 1NQ5A 5JYEA 3B85A 5K6AA 1ZL0A 1HTWA 3E61A 2REQB 2V6IA 2HU8A 3AOGA 3DV9A 2BDUA 4Z9FA 3B52X 5AKYA 2JI6A 1LF5A 2SKDA 1W5BA 3WSWA 5CLFA 1Y4ZA 2B3DA 2HA4A 1JKFA 2ORVA 2Z2XA 2PG3A 3GBPA 4DIKA 4QYTA 4Z7OB 5TIIA 2XXAA 4RPLA 5EFZA 3I12A 1O94C 3LDGA 3K32A 4HWRA 3JWGA 2OZLA 4M9CA 3IAM1 1UDWA 4E4RA 4RVGA 1QHXA 2Q4TA 2C84A 1RWNA 1SK8A 4M1YA 3GUUA 4F3CA 1Y1KE 3ENWA 1SIBE 5AHRA 2YDYA 1NJ1A 2ZJ7A 4TLMB 1E9AA 2V7UA 4RGYA 3F74A 4J90A 1XMJA 2R48A 3OCCA 4QBGB 2HLDD 5IX8A 1K9SA 2H3HA 4YR9A 4CEHA 4YBZA 2AV6A 3L7YA 1KSJA 3BAZA 4EGJA 3IIIA 2I76A 2QY6A 2VPPA 5JI3E 1KGSA 2YZNA 2ZP1A 1DOHA 1XV5A 3CW8X 3ESCA 4BFSA 2PUJA 3RSOA 1BGXT 4NMMA 3R4CA 2GLUA 3CS3A 2P78A 2XWQA 4J43A 4LHYA 3UAYA 3GHHA 1GR0A 3GO4A 4YACA 4E46A 1CD5A 2EGGA 3W8EA 3DEIA 5MFPA 1XEWX 3LCMA 4PYMA 4E6EA 1FPQA 1FTWA 4ONEA 4LFAB 2DPHA 2YJTD 3W3AH 2I3GA 2ZEJA 2KYRA 5KOJA 3EC1A 2PCJA 4Q05A 3O8RA 1X87A 4GXRA 1V1RA 1XG5A 4DUGD 1SVKA 2RBEA 4W1QA 1UBKS 3G02A 4KQ2A 1KNXA 1F38A 1I0ZA 1ZNYA 4UMEA 2C4HA 2RMKA 1KK1A 2RHWA 4ND8A 3TIXB 3SWWA 4DV1B 3EQ9A 1LPNA 4F4FA 4EHBA 3VV3A 2DUJA 1JDTA 3ZDCA 3OJWA 1WOMA 1FP7A 2X6QA 3PP8A 4DRZA 4QUAA 4DB2A 4HB3A 3USES 3WLTA 3CH7A 4N6NA 1GRVA 2L82A 2QSJA 4FUQA 3GPIA 5BVGB 5ALWA 4ISBA 4Z3DA 3ZGLA 1QP8A 2GERA 4JJZA 1CHDA 4R5MA 4F4JA 1OU0A 3AM3A 3CZQA 2Q6LA 2QMZA 4KXFB 2BKXA 3TRIA 3C3BA 3W9BA 2XMZA 1KZYC 5B57C 4GOKA 4BN4A 5AQ1A 3KZVA 4XWAA 4DDHA 4NMHA 4PY2A 3MLEA 2QN6A 4R0NA 4RA6B 2OCGA 1UMKA 2WSSA 3NU1A 4TUYA 4UM5A 4W5JA 3X1JA 5HKOA 2BVNA 4D2IA 4LY3A 1B74A 3AG6A 3TPFA 3I09A 3S7ZA 5CEJA 4QTXA 2MT9A 2WMOB 5EIWA 2FWRA 3ZWKA 3F67A 4P7KA 3AO0B 4PQGA 4I4TF 3WGLA 2CE7A 1AB6A 3DXZA 4RANA 1ULTA 3RW9A 3A14A 5F2OA 3HJRA 1P0MA 2HDHA 4G5RA 4ZCRA 4FYMA 4KO3S 1HRDA 3A3NA 1VG8A 3OEEA 1MB3A 4KPGA 3IX7A 4L95C 1KI9A 3DJYA 3NH9A 5LYYA 4BO9A 2RKOA 2TYSB 3LDAA 1VGRA 2CVPA 5KMGB 1WO8A 1MAVA 2JATA 3AETB 3NORA 2G28A 4LY6A 5H7XA 2O8BB 2R62A 1KEEA 1DE0A 2IYYA 4GMXA 1UP7A 2R66A 5SYMA 2V74B 1JR3E 1D4OA 1Y4DE 3A04A 1ESDA 3A6HA 3PDJA 2H2AA 2OK8A 3FNIA 3L07A 1BRMA 3MCZA 5DYGA 4C4YA 2CE2X 3NFRA 4YV1A 3KVNA 4D8YA 1C1DA 1QHHA 3GMIA 4L8LA 4LDQA 4M60A 5LWHA 3M4YA 1RLTA 1UK7A 1Y5RA 3MS4A 3GP3A 3JD2A 4GW3A 2HRQA 1JVSA 5FOWA 5TF0A 2IZ5A 3VAYA 4UUQA 1G16A 2QTMA 4U2KA 4N76A 4DBLC 4I1UA 3AZPA 1U28C 3KSBC 2IRWA 1GL3A 2A92A 3DFUA 4HN9A 3HKBB 4RE6A 3WJAA 1OBCA 3H5IA 2VPYA 1GVNB 3GEBA 3OCJA 4OLFA 5DBIA 4BFTA 5L7YA 2H4XA 2AC7A 2I55A 4MQLA 4MRVA 2I65A 4NFSA 4F5EA 4RCYA 3TD9A 3ZBQA 4LQDA 4ZK2A 4EIWA 1PO7A 5DH9A 1YT5A 1QAMA 1KWGA 1FSFA 3BJRA 1P2DA 5HZKA 4AMVA 5EP4A 2VTBB 1XZHA 3F6CA 1NNLA 3IE2A 5JMTA 2O3UA 2VQDA 5E9QA 1AXEA 3PNPA 4TM8A 4JI3B 4BTEA 4WCFC 1JDUA 2YFHA 1OPRA 3PENA 4D3FA 2QTCA 2R6FA 3DMRA 4AUMA 4BEWA 3RV3A 1BCSB 4KMRA 3PJRA 1I5RA 1CY4A 1B6TA 2HQBA 5ALXA 5FXMA 1KI6B 3UHFA 4DLYA 1BHQ1 3LGSA 4AZ0A 3C3PA 4V0LA 2HN9A 2HWYA 2WWIA 4I4CA 5FRDA 3J81A 1BHJA 3DWFA 5DBGA 2CXRA 4M7OA 2D6FA 4REMA 1NZFA 5COBA 4R8KA 3UJPA 5JROA 4K8OA 2CJFA 3G6KA 4BVFA 1JL3A 1G2PA 4PR0A 1E2QA 2D0PB 3M8KA 3CTMA 3NETA 3NC0C 3PQFA 1J9GA 5ECYA 3K70B 4DG8A 1PSZA 2BMEA 2QPAA 3F9IA 4G5FA 4LXYA 3ZGOA 4B3HA 3MWDB 4C4XA 4PZLA 4HRYA 1N32B 4MULA 4LX0A 3VBEA 2VTEA 4K3UA 1FRNA 1IDOA 4OIMA 4BNGA 1NI4A 5JXJA 1UQUA 3VOTA 3HDVA 2C9OA 4D0NA 4E2XA 4R3NA 1CP3A 1JHOA 3PRKE 4J1NA 2ZCJA 4F97A 3TTTA 4XQ9A 3PFFA 1OE0A 2IS4A 1XZ8A 2RK6A 1TYEB 2H9AA 2ISQA 4F7WA 2GLTA 3JD4A 2I6SA 3C6QA 4EHJA 5K09A 4DWOA 1X0VA 2JH9A 2A4KA 1CJBA 2X5OA 3OZDA 2LBPA 4OY3A 4E70A 3Q1LA 4LV5B 1N7JA 4DLVA 3A3PA 4O4IA 1U3FA 3DAOA 2ZRBA 3W9UA 1Z6YA 3H2YA 3HP4A 4BC1A 2UVQA 1T2CA 5KVAA 1ITZA 2BMDA 3T95A 4GVLA 4L8YA 1OCEA 4DA9A 4YJHA 2F1OA 5JWHA 1U2QA 2ZM6B 4INAA 3TVYA 1NNSA 4OQLA 2QM3A 1NLYA 5YASA 2D