1T0JB

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
215
structure length
187
Chain Sequence
b'FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 59
structure length 187
sequence length 215
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0jB00
2WHXA 4TLBA 2FDCA 4W5HA 4BASA 5DYGA 3CW2A 2GEVA 4RCYA 2GTPA 1U9IC 1L7VC 1E9FA 2B7CA 4A15A 4NCNA 1MOZA 3O8DA 3N70A 2DCUA 4RZUA 5CM9C 3V00A 1SVSA 2CL6X 2FE4A 3KKQA 3BOSA 1R8QA 3BK7A 2CNWA 2HF8A 1DAFA 4EUNA 3FHTA 2ZIAA 2QI9C 2Z83A 4OHVA 2O8DA 3MD0A 4R2IA 4DCSA 4IW3B 5H70A 1W4BA 4DHEA 4C0JA 2WV9A 1ZJ6A 4OHXA 5FH9A 3REFA 2KBEA 1CJVC 5B64A 2ZUCA 3KQNA 1N6KA 3OF5A 4WIAA 3B1ZA 1JQJC 5BQ5A 4WXPA 2PZFA 2R2AA 5LPNA 4Q9IA 2JLRA 4M4SA 5GJCA 3K0SA 3ETLA 2NO0A 2VHTA 2QGZA 3ZQ6A 2GAAA 1GNRA 2IYSA 3ZDQA 2ZE6A 1MO5A 4RD1A 5FOWA 4BLQA 4A6XA 1ZINA 2G77B 1WBBA 4LHVA 1SKYE 2CEAA 4LHYA 1E2FA 4JKIA 4YMTA 1DEKA 3NH6A 3W5IA 4AYWA 2G0NA 2Q6TA 3NC1C 1G7RA 4A2WA 1MT0A 1E9RA 3WBKA 1CULC 3ECCA 1TEVA 3ADDA 4QHTA 4XD7D 2IF0A 2OBMA 4G5OA 4MUBA 4HZUA 5ELXA 4TYWA 3KJIA 5JHHB 1HT2E 4CEHA 2QT0A 4P33A 3QVVA 1LS1A 2GXAA 2XSZD 4XTRA 1XMSA 4LYJA 1E3MA 1AJEA 3KFVA 3PUZA 2C9CA 1U0JA 1LF0A 1UDXA 3JVVA 2I1VB 2YNMA 3L0SA 4OQLA 2YZ2A 4EKDA 4EPWA 4OYHA 2BKUA 3GLIA 3NDPA 1ELOA 1AQYA 4HLCA 3T1QA 4Y0VA 1H65A 1MRNA 1GTVA 2NZJA 3QXSA 3U44B 1SVWA 4PZZA 3MG9A 4JBYA 5AUQA 2YOHA 1IY0A 2QAGB 2XNDD 4RSGA 3SJZA 2D7DA 2IS2A 4KFRA 1MO3A 3K70C 2FU5C 1XEXA 1IBRA 1SVIA 2XAUA 1IJFA 4YXWD 3RS5A 3CPJB 4BWYA 4MYCA 1G20E 4LJ5A 2CCJA 4BPBA 4L9SA 5EP3A 2IYTA 4BGDA 2JASA 4IOMA 1WB9A 3FOZA 3UANA 4DEXA 1L8QA 2QE7D 1GOTA 4ZO4A 1VG9B 3DO6A 5CB6A 3N2IA 2J41A 2IS4A 2W2VA 4WW0A 3Q7PA 1FPMA 4LY6A 3RRNA 3RYTC 2EW1A 3QKSB 1MV5A 1UDWA 4KFTA 1PLJA 1VG8A 2Q21A 4JJKA 1GP2A 4XOIA 3FFAA 1XBTA 2JEOA 4URXR 2WICA 1EWQA 1LTQA 5DGXA 4RFVA 3VX3A 4AIIA 4LYFA 1IM2A 1MKYA 1G21E 2ZS9A 4OK6A 4URVR 3BXZA 3KZ1E 1N2CE 2OV2A 4RFSB 1ETUA 1CR1A 5LBIA 1RRGA 3K8YA 3NC0C 3OAAA 4HLQB 2RGXA 3EC2A 3QOFA 1NY5A 4KFUA 2ZRIA 3E1SA 1PZNA 2AK2A 5K8LA 5FL7A 1U2RA 2WMOB 4LPSA 4OQXA 1E9BA 2LKDA 2OG2A 2V6JA 1ZNYA 1GNQA 1R0XA 2B6HA 2F9LA 1ZM9A 4KHZA 4G5QA 2PEZA 4LWZA 2F1HA 2B8WA 2C5LA 3BH6A 4DDTA 4PC2A 3TUIC 1E2PA 1J2JA 2BBWA 1CF4A 1DAEA 3C16C 3MWYW 4N0EA 1NJGA 5EP4A 2CL7X 4Q5IA 3DMDA 2JJ8A 1P2SA 4EPTA 1YZNA 1F3OA 1E0JA 3PEUA 4DLZA 2XOKA 4U00A 4FI3C 4XSGA 2R8RA 4I1UA 2NGRA 2OO7A 1ZIOA 5FPHA 4IHQA 3A37A 4QNRA 1KO7A 1DVRA 1SVKA 1XJ0A 2GK6A 2NO1A 4M1OA 2IWRA 3UG7A 3TGPA 2ZRAA 1DARA 1DS6A 4Q1DA 4LK2A 4PPFA 4V0NA 3KTAB 1Y63A 4Q1EA 1VIYA 4ZKDA 4RKEA 2QNRA 2JLVA 5EQTA 1ZMXA 2V3CC 1IXRC 1EFCA 2HCBA 1IXZA 5EUQB 1R6BX 4DXAA 3IEVA 4WVFA 3ZVRA 1M6NA 3U44A 2FF7A 2OCBA 1SHZA 4MGZR 2LCFA 4LBYA 3NBZC 4X8MA 3VX4A 2QAGA 4URWR 4PO8A 1BKDR 3VKGA 3B1YA 4Q18A 4PO1A 1NY6A 1F48A 1DO2A 1N25A 2ONKA 1FUKA 5C46F 1M2OB 2QL6A 3C8UA 4M0LA 4ON9A 2BM1A 3W5JA 3AVPA 4DWJA 1R0YA 1XXHB 3MMPA 4NONA 3SFVA 2Z4RA 2QTFA 2ZJ8A 4IFEA 3I61A 1QHNA 2CK3D 1E4VA 4V0ME 3TR0A 4E5UA 4Q7LA 1Z6GA 4PPNA 1HQYE 2VBCA 2VHCA 1G3MA 3MGCA 2ORWA 2H7VA 4URYR 2XZLA 2QP3A 4RD3A 3VNVA 4YMUA 4QGFA 4A8JB 1NL3A 4IOJA 1I4DD 3U7GA 1TADA 5FOSA 2I3BA 2YWEA 1OYWA 4M53A 1OXTA 4A0GA 5C18A 1SVOA 2G1KA 2BOVA 2OT3B 1A2KC 3KKOA 4LV8B 4KSBA 4PZLA 1OKKA 4HDQB 2ZI4A 4B44A 3EZ2A 1CEEA 2BVNA 4A0HA 2BMEA 4TL7A 3CUEF 3AVQA 1ESMA 1S3GA 4RFSA 2WWFA 2OCPA 2OILA 4TSFD 5G41A 3P1JA 1J7KA 2RB4A 2OM2A 3W6OA 4TQUS 4WXRA 1G16A 1ONBA 2VP2A 4BECA 4G01B 2FA9A 2NO6A 2QTVB 4CIDA 1P2VA 2IUTA 3R8FA 5TV2A 4ZCIA 1Z28A 2VYFA 4ZCLA 2GJSA 1IN4A 4TMTA 1T4GA 4CDGA 5IHPA 3UMRA 1XWIA 2ZSEA 4DLRA 3VHXA 4CT5A 3QSYA 2DFKB 3EZFA 4PHFA 3K0EA 1W36D 2ZI9A 5A5GA 1ZW6A 4AWXA 2DFTA 1KZGB 4B74A 1UADA 3FMOB 2YC4C 3KJGA 4ASUA 5DNYB 3FFBA 2CL0X 3CM0A 2JLZA 3BWDD 3IPXA 2WSMA 5AJWA 4PPQA 3PJRA 3IPYA 2O0JA 3EX7C 2GXQA 5AWFC 4NCKA 5JHGB 3I3SR 2P6UA 1RJ9B 4LDJA 5F9HA 3QKUA 3QXJA 4KSCA 1FTSA 1YR6A 3BJIC 4H1UA 4HUQB 4QM7A 1TU4A 4FIDA 4QXAA 3FHOA 3TMKA 5AUPB 2CNWD 1LFDB 1NVVQ 1G18A 5TDHA 3ZQJA 2R9VA 3KTAA 3CPEA 4FXPA 1GG2A 5K8TA 1ZU4A 4TLDA 4QBGB 3I5XA 4HYYA 1VMAA 2A30A 3BERA 2E1RA 3SZRA 4OI2A 2PMKA 2F6RA 4DLXA 1UKEA 4PHGA 4KVGA 4ESVA 1KOFA 2GAOA 2RGDA 3ASZA 3R9WA 2EFGA 3X1ZA 4AK9A 3B1VA 2GCPA 3NDBB 1QHHB 1SVMA 5SZIA 3B13B 3L0PA 3S1AB 4C2UA 4R7ZA 3Q5EA 4MKIA 3GJ7A 3GD7A 2CCGA 4DCNA 1XXHA 3OZXA 5CIQA 2QPTA 5KDOA 2GK7A 3C4JA 2BC9A 2EYQA 3AF0A 1DAHA 3HPRA 3QPWA 4Q9JA 4D2IA 2ERXA 1F2UB 2IA5A 3RLFA 1K5DA 2ZYUX 2EFHB 5DHAA 1X6VA 3LW8A 3OE7D 2PMDA 3SU8A 3QJYA 4YMWA 2EWWA 4Q1CA 1X3SA 2AXNA 4PFSA 2C96A 4B75A 3A4MA 4BRUA 3MJHA 1Z07A 1ZC3A 2WOJA 3SE0A 4TYNA 2O0KA 3ZLJA 1KI7A 4A1FA 1P9WA 3PVSA 5B30A 4LJAA 3QF4B 1NBMA 2D7CA 2L0XA 2A78A 3FMPB 4TL9A 3FTQA 3DM5A 3LO5A 2J5XA 1XTIA 2A5JA 2Z43A 3KX2A 4K8OA 1QVAA 4DEYA 4A8JC 4DDVA 4GRAA 2ZXUA 4WZ6A 2ZYTX 1BYIA 2IT1A 1UEJA 2C9OA 3EPHA 3R9IA 4FMDF 2C8VA 1S96A 3QBVA 3KQLA 2QM8A 4MRVA 3SBDA 5JZVA 1G8YA 4LBVA 1XF9A 5JWRA 1UFQA 1YHNA 1MH1A 4XWAA 3SYKA 1G8GA 3T12A 3QF7A 4LX0A 1R5BA 2G83A 3RNLA 5JI2E 4PQRA 1S9HA 3Q7QA 1LW7A 2GEDA 1EESA 1JPNA 1ZNWA 1VPLA 2WJHA 3SHWA 2BV3A 3CWZA 2YJTD 3GJXC 2GWHA 5DHFA 1KDOA 1DG1G 3FKSA 1CXZA 3O47A 1AS0A 2FOLA 1FL9A 2VP9A 3U6BA 5TXGA 5L8VA 1RJ9A 1XFAA 2ATVA 1H8HA 1P2TA 1HYQA 1K8RA 1YR8A 2H1LA 4DJTA 1IOZA 4HUQA 5JEDA 1YKSA 2IL1A 3A58B 2R6DA 4NH0A 3KKPA 4OJKA 3KQKA 2ZU6A 2NO9A 1ZM4A 1LS6A 1XDBA 3CZQA 4PQYA 4M9SA 3BFKA 4TMWA 5G3YA 4EIWA 2IS6A 4P4SB 1KTVA 2JLYA 2RGEA 4HSEA 4EDHA 4D4MA 3WNDA 4JL6A 4LV5B 1T9HA 2F3RA 4O0MA 2FSFA 4JLVA 5JSZB 4MQBA 3GJ4A 3QVUA 4TTQA 5FL7D 5FPYA 3T15A 3DHWC 2WJYA 3TW8B 4HAWA 2JLWA 1KYIA 2GRJA 4NYIQ 1VHLA 3PENA 5DSZA 2GDJA 1UF9A 4HZIA 1W4RA 4Q4HB 4JL8A 3S1AA 2GJ9A 3IGFA 4RVCA 4C4PA 4S35A 1X86B 2HYIC 5FUXA 5IRCD 5M04A 2GCOA 2ZSAA 1HV8A 1OH6A 1E99A 1G291 1GDDA 1AM4D 3KJEA 1F2UA 3W9YA 4UXHA 1X8JA 1I2DA 3U7HB 3VR2A 2P67A 4WZBE 2WOOA 4HAYA 1Z6YA 5C1BA 1WXQA 2ANCA 4F7WA 2P5SA 4QM6A 3D7MA 5J5CA 1E6CA 2FPMA 2XOKD 1AS2A 2X1VA 1JJVA 1SXJC 3P4XA 1JAIA 4URZR 5HE9A 1E96A 2GZDA 4JVLA 2VTKA 3TSOA 1KJYA 5KHOC 3B8HA 4B3GA 2CMKA 2QZ4A 4DDUA 1G17A 1ZP6A 4IDPA 2ZJBA 3X1DA 3RS3A 4GDFA 1G8PA 3HR7A 1UBCA 4GI7A 1ZAKA 5CITA 2FZLA 1BMFD 4ILEA 4L16A 2ATXA 4Z8YA 1VDZA 3PR1A 1PJRA 4ABYA 2QRZA 3CZPA 1UPTA 3KKNA 4C7OB 3T06B 4AKIA 1Z29A 2CVFA 4DLYA 2DWOA 3UMFA 2JLQA 3WNCA 1RE0A 2PH1A 3SEAA 1T0HB 4UQOA 3ZZUA 5JI3E 1E0AA 1GM5A 3AV0B 4BLSA 3ASYA 3N2EA 4O2RA 3A4NA 1Z0FA 1F6BA 1I4LD 5KDDA 1T3HA 2ZU0C 2WJIA 3ZD7A 1VG1A 2YYZA 1YZLA 3CRW1 1MO4A 4U5XA 3X1WA 1HT1E 4LOAA 1XPRA 2AK3A 2W2TA 1UBGA 3RDPA 2NIPA 2B92A 3TBKA 2ANBA 3NIBA 4JT4A 4L5BA 3QENA 3E5HA 2CE7A 1AK2A 3GLFB 5AJVB 1RIFA 1DADA 1OKKD 5TVKA 4M1SA 4UNPA 1N6PA 3C7KA 2XTNA 3CX6A 1GNPA 4P4SA 3FYHA 3GJ5A 4RD6A 3PV0A 4B6EA 5G53C 3K9LA 2FZ4A 3KQHA 5JSZA 5H8WA 821PA 2QA5A 5JFGA 3ZZ0A 3U3RA 3AP2A 1C9KA 1OH7A 3PFIA 3UPUA 5F3WB 2W6IA 3BAFA 4Q7KA 4DCUA 4MYTA 4DT1B 4OI0A 2ZJ5A 4E09A 1R10A 2YC2C 4Q4HA 1J70A 3BGWA 4P31A 2G9NA 3M0EA 1K6MA 4D0LB 5FPSA 4ESHA 4YC7A 1UKVY 2MSCB 4L4UA 1OH8A 1OXXK 1D2MA 1Z08A 1KJWA 4R9UC 4BLRA 3R7WB 1A4RA 4C30A 2ZI7A 5FL3A 4ASUD 3R20A 1XTKA 4A36A 2RH5A 1MR3F 1VIAA 2J9RA 1NMZA 2VEDA 2BBOA 1RYFA 4C0QC 1GFIA 1TUEA 1HTWA 2AX4A 3QEJA 4HLDA 1TTTA 1I4TD 4R98A 4GZMA 4US0R 3AVUA 4KCGA 1G8HA 1W49A 1JXOA 1NLFA 5TY0A 4DSNA 4TTPA 1NNEA 1XTSA 4DLTA 2ERYA 4BFSA 1NIPA 1T3LA 4QGHA 2RKOA 4AKHA 1G7TA 1NMXA 1CRQA 2W58A 1SKYB 2J7PA 2X2FA 1YZTA 2E87A 3UK6A 2AHOA 4KAXA 1YR7A 1KK0A 4KJZA 4D80A 5AUNB 3DZ8A 4M9ZA 3RAPR 4PR0A 2DY1A 1U9IA 1JR3A 1NJFA 1T5IA 1RFLA 1WMSA 5EXSA 4ARZB 4BFYA 1OIXA 4C7OA 1OYYA 2HT1A 3VAAA 3AGQA 1NRJB 4EFMA 4K46A 4TMVA 4IDHA 2WPDA 3THWB 1J8YF 2O0HA 5GADl 2W00A 1DPFA 1KMQA 5P21A 1WE2A 3AQ4A 3MWLA 5GJWC 1GL7A 4LZZA 2QMEA 4KODA 1I2MA 1EX7A 3GFPA 1W4CA 4JL5A 2IWHA 1J8MF 2GZHA 1EXMA 3SN6A 3T35A 5EXXA 5HTKA 1ESNA 5SZKB 3M4YA 3RSOA 4FCVA 2Z4SA 1D5CA 3P20A 3OIUA 2IYUA 3ICEA 3TRFA 1A5TA 4IDOA 4Q00A 3KJHA 4GP6A 4CVNA 4X8OA 1KK2A 1ZCBA 4NP6A 1YVDA 3QPUA 4JMPA 3GLFA 2R62A 3SQWA 3CBQA 1LNZA 3TH5A 3IQXA 3RSLA 2BJWA 2DHRA 4DUGA 1NBMD 1W5TA 4MYHA 2WKRA 2WWXA 3F5FA 4PXAA 4M1YA 2BHRA 2OXRA 5C2JB 2XB2A 3W8NA 4YMVA 1A7JA 1Y3AA 2H16A 3OEEA 1US8B 1FMJA 1KMHB 1B23P 2XGJA 1VCIA 3LY5A 3AF2A 4EPVA 2VL7A 1KI2A 3NTUA 4ZI2A 4MGIR 4DT1A 3DMNA 2KWIA 2O8CA 1P4SA 1KNXA 3IIKA 221PA 5H68A 2REOA 3UWKA 4BFXA 2HUPA 1XMIA 4B3BA 2G0TA 1N0WA 1AGPA 1K5GA 4F4JA 4B43A 4BFWA 2R44A 3R7WA 4ZDJA 3PUXA 2FSGA 2H5EA 2VF8A 3NKVA 5AJXA 1XJCA 2AD1A 1ZM2A 4IOKA 2JJ2A 3EZ7A 4ZDIA 2JAQA 1TF2A 4FMCB 4II7A 1L4UA 1SGWA 1U8AA 1D2NA 3SOPA 3ZVMA 5F9FA 1XD2B 3B78A 1NI3A 1PVOA 1H8HD 2ZR0A 1BO6A 4PTLA 3PEYA 1V5WA 1OHHA 3IO3A 4W5JA 1CJMA 5EP2A 3NH9A 4LJ4A 3C14C 3BRWD 2O8FB 1RC8A 5LB4A 4GSYA 1COWA 3W3ZB 3RHFA 1KI3A 4DKXA 4U7DA 2BCJQ 3U60B 2JJ1A 2RHDA 2FNAA 2P6RA 2VRWA 2ZRCA 4NYJR 2ONJA 1PV4A 3AVWA 4O3MA 4K81B 2HCJB 4PQFA 1W0JD 1P60A 5FFMA 3LAWA 3WMEA 4RKFA 3UKDA 5IDVA 1Z47A 4FD2A 1CR4A 3VU9B 1G3UA 4ARZA 3EW9A 4YDHB 1X8LA 4N1AA 3THXB 3AP1A 5C4MA 3Q3JB 1H8ED 4DIEA 1JBKA 3LWNA 1KZ7B 3THWA 3I4LA 4MGKR 4JSYA 2GF0A 3DDCA 3K1JA 4MH0R 2ZRLA 3ZIAD 2RGGA 5HKKA 1DBSA 3I73A 4C0HA 3K0AB 4MKFA 4OQNA 1KI9A 2HJGA 2V55B 1P9NA 1ZUIA 1W0KD 2C77A 2UZ3A 4FMCF 1G4AE 4C9BA 3B5JA 5E4FA 2GKSA 3LD9A 1KI6B 5F98A 3CNOA 1NN1A 4B32A 3KXKA 5EZ6B 4TT3D 3L0OA 2A7QA 1JALA 5DO9A 2J1LA 2CHQA 5DISB 1E79D 3CF2A 3I92A 5CJPA 3U2QA 2HLDA 3JVUA 3FWYA 4Q1FA 2ZAOA 1N5IA 1ZD1A 4A6PA 2C03A 2P5TB 5TMPA 4WBSA 1II9A 3CKLA 4Q1AA 2DWQA 1QDEA 3TAHA 2H18A 2OFOA 3OIWA 4B34A 2D4HA 3ZZTA 2D06A 1US8A 3VHLB 1KMHA 2FN4A 2FSHA 3PQCA 4FINA 3NHBA 1Z0JA 4BLTA 1KI1A 4FN5A 1IY1A 4CEIB 2NZ8A 1YZQA 1NSTA 3EAQA 4LJYA 5FUVA 3ZS9A 4B6FA 4Q7JB 3A1UA 2ZROA 2ZJYA 4EFLA 4JLDA 2AFHE 4G5RA 3BD9A 2YWFA 1JEEA 3NVAA 1BS1A 4M8NE 2WIAA 2VO1A 2RGNC 4E07A 4F92B 1U90A 3SYNA 3D8BA 2GETA 4NTZA 5DIFA 4BUJA 4TN1A 5HCNA 1TL7C 2XXAB 1XD2A 3IDQA 4EJSB 3RC8A 1ZNXA 1W7AA 4L9WA 5KO2A 4PSAA 1E0KA 5EE1A 3AH8A 5AJZA 2GNOA 5DE3A 4D81A 1YRBA 3ZVLA 1SULA 2O8FA 1R0ZA 2O8BB 1NVWQ 1GIAA 3QUSA 2P0EA 5J47A 2PCLA 1CU1A 4RD2A 4OK5A 4JLBA 2EFCB 1II0A 2EYUA 1YZGA 4HAZA 5BW8A 2XTZA 1ZNZA 5BN5A 2QMUA 2WSSA 1XPOA 5DI3B 2J0UB 3VU9A 1P61B 1NN5A 3OFNA 4RJLA 2XZOA 2ZRJA 3GFOA 1VYUA 3K9HA 3H86A 3LBHA 1TF5A 3PEVA 4G5SA 3THXA 4GOKA 2J7KA 2H57A 1OPXA 1JPJA 2HT6A 2QQ0A 3BORA 3DZDA 4A92A 4Q4AB 3MWJA 1E9EA 4XVQA 1E2LA 4DDWA 4DLWA 2P65A 3SDZA 2FPLA 2B7BA 5BYJA 5FR1A 3K0AA 3KB2A 2D2EA 3CNNA 1Z63A 1VHTA 3GEEA 5CYOA 1DAGA 2CE2X 4BFTA 1UAAA 2WAXA 2R6FA 1KI6A 4ACAA 2QAJA 6Q21A 5KOYA 2QN6A 3QKSA 2Q9BA 1R5NA 3K0FB 2VP0A 2G1JA 3QEOA 4QJ5A 2RCNA 1QRAA 2AKAB 2JIZA 5JJLA 5LD2B 4UJ3A 3CX8A 1Z0IA 2WTUA 3Q9LA 3N5CA 5EE9A 3F0TA 1KJZA 2W6JA 4HUTA 3TK1A 3DL0A 1XCGB 4XJXA 4I4LA 3VR1A 1W48A 4HB2A 1ZU5A 4GL2A 4LV6A 1UKZA 4Q4LA 3SNHA 2JA1A 2CCKA 4CEIA 1KO1A 3ADBA 5FOUA 2PT7A 5FBWB 1E2KA 4KLNA 4V0MA 5D3MB 3UIEA 1ZVQA 3B6EA 2Q3FA 4M1TA 2ZYVX 3GPLA 1VYVA 4A82A 2WPDD 2J46A 2WBLC 4GMXA 3DVLA 2F43B 2QT1A 1XCMA 3CO5A 3CNLA 1N6LA 1S4QA 5CDFE 4O25A 1P6XA 4HDCA 3WP0A 3VKWA 1RPZA 2C99A 4JSTA 2X77A 2ZRPA 1RW4A 4CEJB 4TLEA 3TIFA 1SZPA 2XXAA 1RVDA 1T5LA 4KV9A 1N5KA 3OEHA 4EJSA 2JDIA 2ZVQX 1CR0A 4CF7A 1YJ5A 2NTYC 3D3QA 3OIYA 4LYAA 3W90A 4D26A 2PLRA 4Z1MA 5J4KA 3RWOA 3G82C 1N5JA 4M22A 3U5ZB 3LX5A 2PZGA 2WKPA 5J4LA 1KSGA 2O8BA 3J81k 1W5SA 1C4OA 3RANA 2C95A 1XPUA 4BRWA 2V1UA 3B60A 2ZJ2A 1JI0A 2ZRHA 1LVGA 1XD9A 4Q03A 2QBYB 4CRWB 4F4CA 3LRPA 4BLOA 3NG1A 4EJSC 1LV7A 2BCGY 4MA4A 1E94E 3OEED 1KKLA 1CS4C 3GLHE 2VH5R 5DI3A 5DH9A 2J0UA 3THYB 2A5DA 2XB4A 4QBIA 2OBLA 1F2TB 5FOVA 1XNJA 1IJEA 2QORA 3X1XA 2ZS7A 2NG1A 2H92A 1M74A 2IYZA 1RRFA 4Q1BA 1XXHE 1DAMA 1G6HA 3B9PA 4Q4AA 1F5NA 3FVQA 4N0DA 3PUWA 1Q44A 4H1VA 4KVAA 2PT5A 1NN3A 1SXJB 1E1QA 4LHWA 1AGRA 1GSIA 2A5YB 3KDSE 4PC7A 2F1RA 4OJQA 4V0LA 3H1TA 3TSWA 3M6AA 2Q0HA 2CVHA 4QL3A 3T5GA 4TQAA 3NHAA 4EFNA 3L0IB 5JRZA 1JAHA 3HU3A 2FFBA 2AN9A 2VQSA 1MABB 2ZSBA 4A8JA 1U8ZA 1ZM7A 1NBME 2FX3A 2DFNA 2OUKA 3K0FA 4D4KA 1DTSA 1G5RA 1E2GA 1G1MA 4FCTA 3AVXA 2HF9A 4UJ5A 2PL3A 2RGBA 5E3HA 1GRRA 2CLCX 3GJ0A 3I8SA 2V7QA 2ZREA 4Q9KA 4ZCMA 3K70D 2AXPA 2OBNA 4XSHA 1N6OA 4ZDKA 3GLGE 4M1WA 1WDTA 1PLLA 2IXGA 1XB2A 1S8FA 4M9XA 4QFMA 1XEWX 4GBMA 1U0LA 3BH0A 1AKYA 4WZAE 4BFUA 2IEYA 4KYUA 4G1UC 1G4UR 2EFEB 3KB1A 4C0KA 2F7SA 1HURA 1FX0B 1QHSA 5D3MA 2RHMA 5FBVB 5LD2C 1CBUA 1NLZA 3AKYA 3E70C 2PJZA 3CONA 1L4YA 4Q21A 1OXSC 1CP2A 5G3ZA 3A1VA 3EG5A 2F43A 4TTRA 1II8B 1S3SA 2RGAA 4IVPA 4F91B 3Q72A 1EG7A 3TSZA 3A36A 1GL9B 3VR6A 1Z0KA 5LDDC 1CLUA 1ODFA 2XJ4A 5FOXA 4DVGA 3HU1A 4B76A 4OK3A 4NHOA 3TR5A 2QROA 2JCSA 521PA 4B3DA 2CBZA 3O8RA 4B2LA 3VR5A 3QNUA 5FBLB 2IUSA 5K8IA 2IYVA 1N6IA 4IXMA 1Q20A 3BFXA 2QU8A 4UXJA 3T5DA 2QBYA 4BLPA 1WCV1 4P4UA 3WYGA 2K5UA 2VP5A 4URUR 4KLZA 1XTQA 1FUUA 4DB4A 1UJ2A 4MYUA 4RZXA 3EASA 4B3XA 4TMXA 1Z6AA 5CLQA 1U99A 2GZAA 3OAAD 4AYTA 2BKEA 1ZRHA 3THYA 4ITRC 1U8YA 2BEKA 4XD7A 1F2TA 3PCRB 3DEFA 3LA6A 4GT1A 5FPTA 3W8RA 3X1YA 1QHHA 5SZHB 3RVBA 3UATA 2XSZA 1NSFA 3E2IA 3SS8A 1P62B 1E9SA 2REBA 4NDZA 1D9ZA 2IS1A 2OFWA 5KSZA 1SXJA 2OE2A 1G64A 5KNBA 1TU3A 3U7EB 1OFTA 1E2EA 4JLMA 3PUYA 1GKUB 5L3QB 3PITA 4IEEA 3TUJC 2ZRKA 2CHGA 1TPZA 4XWKA 2QTHA 5KUTA 1E9AA 2DBYA 1T8UA 2F55A 1WP9A 4BZQA 1GRNA 4TZ0A 2J87A 4Z51A 1IXSB 3WMFA 2RGCA 3GJ3A 2IUUA 4DLSA 5JRJA 2Q3HA 1Q1EA 2XNDA 1NVVR 4YMSA 2VSXA 2VHQA 2GVZC 2XTMA 4TYQA 5KSPA 3L43A 2WJGA 3RABA 4LPKA 2A2ZA 5BN3A 5TARA 3MRSA 2ZAMA 2MSEB 2JGNA 1GITA 4NU0A 3ZS8A 2J59A 3QF4A 3SI7A 721PA 3ZJYA 1ZYUA 1GL6A 1Q3TA 4I1OA 3FE2A 4Q48A 2O8EB 3QKRB 2WSSD 1T3SA 2ZJAA 4NYMR 2QE7A 5JECA 3QBTA 3GEIA 1UBFA 2WJVA 3AEZA 5FTNA 2Y8EA 1SVLA 1P5ZB 4IVRA 4IXNA 4BEBA 3JZMA 2V1XA 1MRSA 3EWAA 1A82A 5KNDA 1IN5A 1Z3IX 3LH5A 3OIVA 2X8AA 4MKGA 4US1R 4B73A 3H84A 2F9MA 4DIDA 1NLYA 1DAKA 3M1IA 4LC1A 2NO7A 2A5FA 3RRYA 4MRNA 1G3QA 1G41A 2IHBA 3LX8A 4MKHA 4MRRA 4AKEA 5B57C 3VQTA 3FMFA 1IN7A 4IDQA 4PSKA 3AGPA 3WRXC 3FB4A 4QC2A 5EE3A 4PAMA 1QG4A 1LB1B 2OAP1 1W1WA 2ZITA 1NKSA 4ZPXA 2FMXA 2JATA 1HH4A 4GNKA 1G7CA 3NEJA 4I1VA 3PIRA 1W36B 3MSXA 1IONA 1P3JA 2GJ8A 2WWYA 1KI4A 4TYPA 1KK1A 2BBSA 2BM0A 2FWRA 5CJ2A 4RD0A 3OESA 2CHVA 4G3XA 4LI0A 4NL4H 1D8TA 3LBNA 3RRMA 2IX3A 3AM1A 2FSIA 3P4YA 5KSYA 3ZD6A 1EWRA 1M1YE 2IW3A 1E2QA 3R9XA 2KB0A 1Z2CA 4Y0AA 1M7BA 2V4ZA 1N0UA 5B2ZA 3AF1A 3FGNA 2YKGA 3C5HA 3CRQA 4CZ2A 1VCMA 4V0OA 3K09A 2WIBA 2GJKA 4D82A 3T34A 4HDOB 4RY2A 4QJ3A 5EXPA 4FCWA 1IAQA 4UXIA 1F60A 1FOEB 4KITB 2W0MA 2ZSFA 1CJUC 3G5UA 3CR7A 5L3SB 4PC6A 4QHSA 4PX9A 1JEDA 4ZI3A 1P2UA 2ZEJA 3ZVNA 3EARA 3DOFA 1QG2A 3F8TA 4KU4A 4C3ZA 4EQ6B 4Z1MD 3U61B 4V0KA 2EFDB 3ZH9B 3K09C 1U81A 2YWGA 2BDTA 4KO8A 3BS4A 5AR1A 5JEEA 3DOEA 3SJCA 3GP8A 3W34A 2WJJA 5IK2A 5FI0B 2GESA 1WBDA 1HE8B 3VFDA 1NKTA 1RYHA 4BZXA 3VNUA 1N5LA 1OFUX 2O8EA 4B2IA 3LVRE 3QKRA 2CLDX 4N3NA 4TLCA 1KSJA 2VPPA 3B1WA 2PX3A 5KPJA 1XP8A 2ZTSA 3TNFA 2UVQA 4CYMA 4JBXA 4F93B 1TUIA 4WA7A 4QBHA 4YQFA 4B3FX 2IYYA 1E0SA 2R6CA 4H9GA 5FBQB 2GCNA 3AKEA 1JJ7A 3IILA 3DM9B 1GUAA 3WBJA 1ZIPA 3K53A 421PA 2EU8A 1E1QD 4PO9A 4P3YA 2P2LA 1ZD9A 5FTLA 3ICQB 2REXB 8OHMA 1NG9A 3I72A 2QY9A 4Z8XA 4TSFA 5A4JA 2P6NA 4MUAA 1G9XA 2ZQ5A 1SQ5A 1JB1A 1QF9A 4W5WA 4RZ3A 2QG6A 3IEUA 2V9PA 4TWZA 1E1RA 2YOGA 3HYTA 4F38A 2VF7A 1S9DA 2IYXA 1KK3A 4LSGA 5JS8A 2QQEA 1XEXB 1TAGA 3A6PC 3ADKA 3V4RA 2OLKA 5FR2A 5J4VA 1P75A 2ZM5A 1A2BA 2XZPA 5JLJA 1BIFA 4UNRA 2HXYA 5HZKA 4R2HA 1NG1A 1VG0B 2SHKA 3MLEA 4RZ2A 1VCNA 3W6PA 4M21A 2O5VA 2GXSA 5CK4A 1TF7A 1OIWA 1DAIA 2ZSDA 3NBFA 1NVUQ 4MRSA 1YZKA 2FG5A 4QOSA 1EFRA 2H17A 1WA5A 4C0LA 4YONB 3I1FA 3ZGXA 4I99A 5GVRA 3UWOA 1KNQA 4IJMA 4JIMA 4A2PA 4DC9A 2W0SA 3AF3A 5EZ5A 4DBLC 1W36C 1QHYA 4LJ9A 4LBWA 4HAVA 2OCAA 5GJBA 4ZKEA 5AUOB 4Q4JB 1KAOA 5JMTA 2KE5A 1NVXQ 2XJ9A 4DSOA 2QPOA 4QNMA 2OFXA 1Q1BA 1JR6A 1HEIA 3EPKA 2AL7A 1TNDA 4E03A 5HPYB 5L3SA 1VTKA 3FKSD 4AY2A 1RKBA 4Q47A 3NEYA 5JWOA 3HPQA 2AR7A 4EQ6A 1TMKA 4QHYA 4U02A 4HB0A 2WAYA 5AK0A 1R4AA 4HEJA 1KHTA 2IHYA 4MDEA 4NCIA 1AQUA 1FTNA 1M8PA 1OXUA 3CF0A 1DO0A 1SHKA 4B71A 3WRYC 2NPIA 3GLIE 5BWMA 1AKEA 1Z83A 1XJQA 1T91A 1VECA 1BOFA 1ZBDA 3HJNA 2OCYC 1IHUA 2AWNA 2OEPA 2DR3A 3NBYC 1E2NA 3TW4A 4LHXA 3U7FB 1ZC4A 1Q1ZA 3EIQA 3OE7A 1HA3A 3W3AA 2ZRFA 4WOPA 3V4FA 4QRHA 2HJVA 2FFQA 1M7HA 4GOXA 3IQWA 4GP7A 1QHXA 3AKDA 5G40A 1OB5A 2GBLA 4LBZA 3CRRA 2PJRA 3LXXA 3SBEA 1SXJD 3Q85A 1E9CA 4KBFA 1VKJA 3MAAC 5JJIA 5EXTA 2VSFA 2IC5A 2ORIA 1KAGA 3VR3A 2KSQA 4LC0A 2ZE5A 1E2MA 2ZVPX 2Z6VA 2ZS8A 5A0FA 2DPXA 2X19A 4Q7MB 4JVMA 3RS4A 3SYLA 1Z5ZA 4PANA 1N6RA 4AG6A 2A3RA 1X8KA 4JLNA 3U3JA 2GBLC 2TMKA 4UNNA 4BFZA 3BH7A 5GVSA 5J4HA 4Q02A 5DN6A 3UG6A 1XEFA 1Z06A 4GFDA 1WRBA 2N46A 4MITA 1RZ3A 2ZR7A 1ZD8A 2IK8A 1G5TA 4BZPA 3BFVA 3W6NA 2PBRA 4TMKA 3BB1A 2YWHA 5ANRB 3O8CA 1Q22A 5C4GB 2OAQ1 2QM7A 3GJ8A 1R2QA 3HWSA 1QVRA 1YRAA 4AKGA 1VCOA 1E32A 2BMJA 1N6NA 1PLKA 3UXMA 4LUCA 4KBGA 4ERNA 2RGNA 1NN0A 4BE7B 3ND9A 2NQ2C 5L3VA 3JZAA 4ZIRB 1AN0A 4P32A 5FBRB 1OFHA 4GZLA 4Q66C 4AC9A 1G7SA 2JLSA 2HV8A 4KYIB 1E2DA 2MMGA 2Q9AA 3C15C 5J40A 2QPAA 3PUVA 2BMFA 1N0VC 2ODBA 2I4IA 2DWPA 3TVDA 2LKCA 4Q4JA 2AKYA 2Q3MA 1O3YA 2G88A 2LWIA 2V6IA 3LNCA 5JCZA 4QGAA 1TQ6A 3SQXA 2PX0A 3QG1A 4DSTA 5BYKA 2QSZA 4TZ6A 3QQ5A 1OF1A 1RRCA 1KI8A 2YHSA 3MFYA 3WMGA 4L15A 1V43A 4PHTA 4JLJA 5L3RA 2R6AA 3LLUA 1ZUHA 3AF4A 2F1IA 1E69A 2KI5A 4I1SA 3F3YA 3CB4A 3H4MA 4DCVA 4QJ4A 3DKVA 1U94A 3C5CA 5FPKA 5BN4A 2ZUBA 4HAXA 5FI1B 2J0QA 4XH9B 5FOTA 2AD5A 1CR2A 3LW7A 4PAQA 1TQDA 4FWIB 1X1SA 3BC1A 4OKSA 1R0WA 4IEIA 5CYPA 2DB3A 3CIOA 3TE6A 4D6PA 4JLOA 3WHLA 1OJLA 1XD8A 5SZJA 3QE0A 3U4QB 4TMZA 4NCJA 1G3RA 2QP4A 2YINC 1OSNA 3CF6R 3D31A 3REGA 3VMFA 4C0SA 1NP6A 5HZHA 2Q9CA 3GMTA 4I81A 2ZPTX 3MWKA 5J4YA 1Q3HA 2W6ID 1R8SA 4IKEA 2VA8A 2IYRA 4ACBA 2GXUA 3QG5A 2EQBA 2HXSA 2ZE7A 4GMDA 3WY9A 1W46A 1GZSA 4KI0A 3VTKA 1CRPA 3SJAA 1OT3A 4V03A 3AB3A 3CR8A 5EUMA 1TEXA 3K9GA 1X1RA 4HI0E 4OI1A 5IF9A 1ZCAA 3A1WA 4BEJA 1HQCA 2QMHA 2QENA 1BMFA 3IO5A 4OL0A 2ZI5A 3EIHA 2GF9A 1XRJA 1G3IA 2IXFA 5EP1A 2RAPA 2FPKA 5CK5A 2H8KA 3GLHB 2HDNB 4NE2A 4D4JA 2QP9X 2OHFA 4L8GA 4G5GA 1YQTA 2N42A 4JT2A 2VIIA 5IK2D 2WVJA 2QSYA 4TLAA 3T1VA 4F4IA 1OFIA 1UEIA 3QXHA 4B35A 5CM8B 1IQPA 3EIEA 1Z0DA 4B47A 2XNSA 1Z22A 1AZTA 1IN6A 4JVNA 1GVNB 4LGMA 3DKPA 4XVUA 2B21A 2QAGC 3G0HA 3FKQA 3LV8A 2J7PD 4JJZA 1OXVA 4ZIRA 3EPJA 1P9RA 2BIFA 1OIVA 1JR3D 4NCHA 3LXRA 1R7RA 2J0SA 5EE0A 1Q57A 5JJKA 2QUZA 2ZRMA 5HCIA 4LJ7A 1NF3A 4M1KA 4AYXA 2AWOA 3RC3A 1DELA 3HDTA 2EWVA 1FQJA 1QBKC 3D6TB 3BE4A 1S0UA 2GHIA 3A4LA 5UKDA 1FNNA 1Q12A 3LDAA 3KQUA 4O2LA 4XIGS 2XEXA 3GLGB 1C1YA 1UM8A 3T1TA 4B2PA 5FUYA 3VKHA 3KUDA 1E1RD 4Q9HA 4C0BA 4HAUA 3KUCA 3TQFA 4FWTA 4IOLA 2XITA 2PCJA 2JLUA 1R5OA 5E7MA 1KDRA 4DUGD 1PUIA 3EWSA 1W2HA 1QHIA 3ZYCA 1T8TA 3NBXX 3P26A 4X8HA 5D3QA 3U4QA 1FP7A 5GJVC 1JQLB 1Z6TA 1OH5A 1EFRD 1J99A 5JS7A 5CDFA 5BXQC 4M2LA 3L82B 2R6GA 3I8XA 2AFIE 2WWGA 2O52A 2KJQA 3QI2A 3LLMA 4NPHA 1GRQA 1YR9A 4OQMA 2WZQA 3QXCA 5LB2A 2C04A 2ECKA 1AIPA 3SHFA 1XEWY 1XZQA 2FFAA 1N6HA 2GEUA 1Q0UA 1E2HA 1CJTC 4B33A 4DB2A 3LVQE 4C2TA 4AI6A 2ZUDA 1ZUNB 4RD4A 5E7IA 4Q01A 3EC1A 5KPDA 2JJ2D 2FGKA 2F1JA 3NXSA 4A0RA 1S1CA 3RRZA 2QRNA 1OV4A 3CX7A 4NYMQ 2C9YA 3IBYA 2J3EA 4FMDB 4QKQA 2VHUA 3C41J 5KYKA 3AUXA 2QGNA 1WF3A 3AVOA 3TVTA 3GLHA 1OHHD 3L8YA 2I1QA 3A8TA 2EVWX 2D3WA 2E9SA 4A4DA 2KBFA 2IXEA 3CPHA 2J0VA 4C0AC 1COWD 3U3MA 2GCOB 1PUJA 1OB2A 5IT5A 2JJ1D 1FMLA 4XVRA 5DYIA 3MUFA 1DE0A 4GPTA 4ZDWA 1E2JA 3HYRA 1G8FA 3TAUA 1HUQA 1OE0A 3TUZC 4QGGA 3EPLA 3U6KA 1T6NA 3KXLA 1XX6A 4UNSA 3CLVA 3QIAA 5KTYA 3AVVA 4KXFB 1JECA 3CWQA 1CKEA 1KO8A 3HP1A 3KXIA 4LRWA 1KO4A 5FTJA 1IY2A 5KNCA 1XZPA 1VYTA 4AD8A 2CJWB 1FQKA 1M7GA 3H2YA 1KY2A 4PC3A 3MJRA 2ZE8A 3T1OA 3KKMA 5H1YA 1GKYA 2D74A 1T0JB 2VHJA 4TL8A 5HKKD 2ZJOA 4JLPA 3B9QA 4CEJA 1ANKA 5DI9A 4CW7A 1Q21A 2A5GA 2ASEA 2ZRNA 3TJZA 3GLGA 2HEIA 3PG5A 4S2EA 1GWNA 3BB3A 1IN8A 1WQ1R 2ODEA 3EA5A 3B82A 3IIMA 3K9NA 5CIWA 1W44A 2GA8A 4YDSA 3QXXA 4E22A 5DN6D 2UKDA 3UMSA 1KSHA 2JLXA 4IVQA 1JXMA 2IBMA 4D4LA 1YU9A 4NKRA 3RS2A 2G6BA 3KL4A 3PXGA 4OI4A 1AS3A 1UKYA 2HLDD 2FV8A 2VSOA 4DLVA 1E9DA 5EJEA 1J90A 4JLAA 1KSFX 2UZIR 5TB5A 3PEWA 2C2HA 1EGAA 1EK0A 3AKCA 3EZ6A 4Q19A 4PZYA 2PZEA 121PA 1CJKC 1SXJE 3LQQA 2VLIA 1CTQA 3FHCB 4DSUA 2RMKA 4QBFA 4EPRA 3SR0A 4GOJA 4US2R 3IHWA 1P73A 1M34E 4LYHA 5HR5A 4IRUB 2CDNA 5CLLA 3ND8A 1TQ2A 2IEZA 1YE8A 3NWJA 3L2OB 3RS7A 3QY0A 1XTJA 3IBGA 4CT4B 4PC1A 1Z8FA 2FEOA 3B2EA 4IDNA 3TKLA 3IHLA 1W0JA 4JBWA 1Q1QA 4JYBA 4EPYA 3X2SA 2PEYA 4XWOA 4PSVA 3THOA 4OHYA 1E2IA 3U3KA 4M1MA 2G3YA 5DLQC 1LY1A 2BMDA 2ZANA 3WYFA 1MABA 3B7GA 1OW3B 4HLUA 2ZYWX 1W4AA 4JZKA 2J45A 1HY3A 1H8EA 4YLGA 3WNBA 5EE5B 4AG5A 1B0UA 4TYYA 1G19A 4NBSA 1YZUA 2WWIA 5CB8A 4YXWA 2Z5FA 4OHZA 3B1XA 1XMVA 1E98A 1D2EA 1S2MA 2YV5A 3ZIAA 4IFBA 4W9MC 2ZR9A 1KIMA 1FZQA 1KY3A 1Z0AA 2A9KA 3L8ZA 3I62A 3AVTA 1W0KA 1JNYA 1XU4A 2X2EA 3AVYA 2DFLA 4HLUC 1HE1C 1QZXA 3EA0A 4TQ9A 3VR4A 4RCZA 3OFND 1MO6A 4X8LA 4TL6A 2WWWA 1FX0A 3CH5A 3V9PA 5F2EA 1N3BA 4TT3A 4A2QA 4G0NA 2OZEA 1W47A 5FTMA 3SJBA 4BFVA 4M9QA 5HE8A 3H0KA 4OHWA 1E79A 3RS0A 2CJWA 3TQCA 2WM9B 3EZ9A 3QKTA 4PPGA 1II8A 2ZI6A 4NZYA 4JLKA 3R8CA 1LF5A 3I32A 2ZRDA 2ODWA 3OHMA 2Z0MA 2NOAA 4JYCA 1EFHA 5B58C 2GJAA 2HYDA 2W83A 3IUYA 1D6JA 2ODNA 1AA9A 1FP6A 4W7SA 4Q9LA 3AUYA 4LJ6A 3SC3A 4UKDA 4LJ8A 3DPUA 3CH4B 2ZETA 2ZRGA 3HU2A 4MGYR 1G6OA 4PAOA 3FDIA 4HB3A 1TX4B 4P4TA 1D9XA 3SFZA 2C98A 4CGZA 3Q8XB 1L2TA 3FPAA 2JIZD 2C78A 2OXCA 1A1VA 4QG7A 5JWHA 2VP6A 5JBQA 5FTKA 1Z6XA 2W6JD 2XX3A 3A1SA 2YVUA 1CIPA 2ZI3A 3EXAA 3B85A 2OLJA 3GQBA 1BYUA 2YOFA 4KFSA 4AURA 4D0GA 1KDPA 2R65A 1XCPA 2V8OA 3ONWA 4D25A 4B48A 1BH2A 2QMOA 1W2GA 2CLSA 2PLFA 2NPFA 2FJUA 1OLOA 2GVDC 2MMCA 3BBPA 3TLXA 3WP1B 1NIJA 2OSBA 4A9AA 3FMIA 3WXMA 4R71A 2QEQA 4DLUA 2NMVA 1P72A 4NMMA 3I5YA 2FFHA 2W2XA 4JVSB 5L3QA 5E95A 4DCTA 1DOAA 2IYQA 2O8DB 3ADCA 2BJVA 2ZRBA 4FW9A 4P0TA 4UNQA 5KSOA 1U0HC 1DG3A 2B8TA 1AZSC 3AP3A 5FUWA 4NYJQ 1UBEA 4XTCS 4MDFA 1GKIA 3BB4A 3OEHD 2JDID 4MRPA 4Z54A 3A1TA 2F3TA 2FEMA 2V54A 2O8CB 4DRZA 4J0QA 3LQRA 4V02A 2VP4A 1XTRA 1FFHA 2D62A 2ORVA 5AJYA 621PA 4ZV4A 4HATA 1FNMA 2CXXA 2BEJA 1KGDA 1TQ4A 1P7CA 2N1BA 5E7JA 2WWHA 4A0FA 2WKQA 5K8UA 2WMNB 3U3OA 2D2FA 3K0CA 1G5PA 4DZZA 5JCPA 3P27A 2P3SA 1EX6A 1JR3E 2CK3A 3Q5DA 1EFUA 3KFXA 4LCBA 3LFUA 4JKYA 4NYIR 4OBEA 1XMJA 4WAUA 4BQSA 4HZUB 1GILA 3GFTA 4JS0A 1KO5A 1Z2AA 4CEHB 1E4YA 1S1MA 3LBIA 2DYKA 2IYWA 4EPXA 3GJ6A 3BIFA 3CRMA 3K0CC 4LHZA 3T61A 1NMYA 4HB4A 1O87A 2ZJZA 4FMBB 4OQFA 3MCAA 1EFTA 4EAQA 3K70B 3GLIB 1QHGA 4D0NA 1SKQA 2OESA 3RWMB 2FGJA 1ZM3A 4PHHA 3GLFE 2MSDB 1FW6A 3CRVA 3HR8A 2BWJA 1GAJA 2BBTA 3IKJA 4POAA 1KKMA 3IIJA 2IF2A 3QPVA 4B3CA 1KDTA 2GILA 3WYAA 3GCGA 3GEHA 1RRPA 2IYLD 2V7QD 3O8BA 3WHKA 2FH5B 1U98A 5KU1A 5KDLA 3P32A
chains in the Genus database with same CATH superfamily
3GGJA 2SBTA 1JTVA 3CW2A 4F5WA 4RCYA 4MV9A 4F2PA 4GKJB 2J85A 1QR6A 2WJZB 2B61A 3P0JA 4J0GA 3UMYA 2A9PA 1L7VC 3TLKA 7MHTA 1V1RB 2OZPA 3JV7A 3EIUA 4XR4A 2B7CA 4UUBA 1FSFA 3FUWA 2X4LA 3HYSA 2X13A 3K15A 3L1UA 2Y1KA 4A15A 3N70A 4HDSB 1TW3A 1MXFA 1KYTA 2QRPA 2W6MA 3GRVA 3M8KA 4NE7A 3S1LA 4O4IB 4ZREA 2CL6X 1VSVA 2BI8A 2C8LA 4XQ0A 2Z56A 5TR9A 1QG6A 2CNWA 1WVMA 3NHKA 4KQFA 2HQSA 4NS4A 1NI4B 4N9WA 3GBVA 4CQJA 3G5TA 2R68A 3UK1A 1NVGA 3OZFA 5HIKA 4TMFA 2NSDA 1K0UA 4GMFA 5DP1A 3CISA 3E9NA 4R2IA 4EW1A 1ZISA 3O74A 4IW3B 1W4BA 3DGFC 3TDKA 3G1UA 4OHXA 1HDOA 2VC2B 4WEOA 4F9FA 3UAZA 4F21A 1WXIA 2QE6A 4X00A 3REFA 2C0CA 3OJEA 4XJSA 5ALZA 4X3OA 3UEOA 3KQNA 2FLWA 3GJSA 3U7QB 5BQ5A 2GJ4A 3QEKA 1D2HA 1I14A 4WXPA 4CG0A 4CV1A 2DH5A 4M4SA 1XCBA 4Q9IA 5HJ2A 3TOVA 5K20A 2D6FA 4DLBA 3G88A 4DSZA 1IMOA 2QGZA 3VISA 4AICA 1GNRA 5KYYA 3USES 1UJCA 2ZE6A 4RKQA 1KYVA 4OB8A 3JQAA 4NDNE 4NV0A 1MO5A 4RD1A 3T5BA 1HPLA 2XRMA 5T41A 4B4UA 1ZINA 1E64A 4CMEC 1WBBA 1FDTA 5LCXA 3F7TA 2HSEA 3W5IA 1YCHA 3TCKA 2Q6TA 1UJ6A 1W9HA 3G9TA 4NK5A 5BSTA 4BB5A 3AESA 2FLVA 3ABIA 3CXUA 3GEPA 4QHTA 4XD7D 3ADDA 2GN1A 2IF0A 2OBMA 4FEYA 4I4TF 4MP3A 4MUBA 4TXHA 4WLUA 4EF4A 4Z4GA 2IDKA 1JAXA 2E4XA 3KJIA 1HT2E 1RHRA 4P33A 1HNZB 3PP8A 1I1OA 2SCUB 1B93A 1JEJA 2YN0A 4LOHA 3T7TA 1PGOA 1Z4KA 3IERA 3R3UA 2YMMA 4LYJA 5F3DA 4CLEA 4NI5A 3JVVA 1U0JA 1UDXA 2L42A 3L0SA 2YNMA 2BW0A 4YASA 2YZ2A 3RUCA 5CT6A 5HUHA 4OYHA 5TLSA 3GLIA 4LDPA 1A8PA 3OQ6A 2OORA 2R97A 4TX1A 3N8DA 3RH0A 1AQYA 4CQLA 2FPXA 3T1QA 1E92A 5J43A 3CUUA 4Y0VA 1N1MA 2NZYA 4RK0A 1E9VA 5C4IA 1H6CA 2ZR8A 4WBXC 3C48A 3U9LA 1GTVA 2GERA 4L7VA 3O90A 4P38A 1SC1A 3AY6A 3QXSA 3O83A 1PV2A 4BXOB 4DXHA 4DDKA 4MWTA 4JBYA 3H9UA 3PD1A 3L41A 2P3QA 4G25A 3SFTA 1U04A 1GG9A 1QSGA 1U5BB 5B6JA 2QAGB 4RSGA 3V4VB 3SJZA 1T8RA 2YNMC 2D7DA 2GBIA 4D3YA 4KFRA 1MO3A 1JIVA 2ZBDA 5E8JA 4OU5A 5D5QA 2XAUA 3E82A 1IJFA 3VBCA 3S2FA 1DL5A 3RS5A 4WN3A 3BD8A 1J42A 3GROA 4BPBA 4L9SA 2DQSA 3RJTA 3ZLBA 3W5BA 3JQQA 2QQGA 4Y6OA 4HCJA 4AO7A 1EGQA 2NSJA 3K3PA 4DEXA 5CXQA 3C7CB 1N2EA 2WNSA 3KVNA 1DAPA 2XRZA 4O6VA 3D54D 2HTEA 1B42A 3RJZA 3T9EA 4AW9A 1F8UA 3FSRA 2W2VA 4O4LA 1WB4A 2GNAA 2VR1A 1Q14A 2EW1A 1EI9A 3OZWA 1UDWA 2QDKA 2QVBA 1V45E 5FHQA 4JJKA 1GP2A 3HKCB 4XOIA 4K9LA 5LNK1 3HZHA 2XB8A 2WICA 5FAXA 4EY8A 4AJOA 2XE7A 4JJ4A 2PKQP 3VX3A 1IM2A 4ZEWA 1Z4NA 4ZN6A 3D3WB 3KG2A 3KZ1E 4DFDA 5JH7F 1DB3A 2LUOA 2OV2A 1ETUA 5BW5A 5LBIA 2H65A 3K8YA 3NC0C 3OAAA 1YIOA 3BFJA 3BRCA 4BJ5A 5I7RA 2PS0A 3PXXA 3EC2A 4TS1A 1YR1A 4KFUA 1M83A 4KXQA 1SU7A 2FUCA 3KJQA 1DC8A 1MOQA 4OQXA 2DGDA 3ZXXA 1NPTO 5JSHA 4N6OA 5DW0A 1ZNYA 2HU8A 3KAQA 2I5PO 3QEMA 2J5BA 4RSRA 2F9LA 4KHZA 1ACLA 5B2EA 2ZXFA 4G5QA 2VHXA 2ZWVA 2C59A 2F1HA 4TXLA 2B8WA 4IIXA 1QIDA 5JMPA 2CXSA 3DLTA 2FX2A 4M37A 1YAHA 1Z8DA 5FNVF 1XR3A 1DAEA 5FLKA 4E15A 3NIWA 5E6UA 5FLEX 3KV3O 4ZT3A 5KKAA 1PJCA 5EP4A 2Z3ZA 1AC5A 3DMDA 1KEKA 1F3OA 2A0YA 1ECJA 1E0JA 4DLZA 2XOKA 3UO8B 4GR4A 3FDZB 2DLNA 4N5NA 3C3WA 1ZIOA 4EI2A 5FPHA 4IHQA 2ISCA 3A37A 1LC3A 2EDAA 3OEWA 3FPKA 3OLZA 1SVKA 2GK6A 1G9TA 1RDFA 2FP3A 1UXKA 2QRMA 2VJNA 1FRQA 3BZUA 4Q3NA 3DUWA 1DS6A 3GBSA 1L5GB 4ZKDA 2KS6A 2LGJA 1Y63A 1NLMA 1S4MA 4RKEA 3M3HA 1N4AA 1ZMXA 4K6KA 1PL7A 4HYQA 1IXRC 1EFCA 5LZ9A 1Z88A 3I39X 2WIFA 4M1ZA 3VYUB 3ZVRA 1YUNA 4AWAA 2NV0A 5FV7A 2FF7A 3BMNA 4U39A 4PF1A 1CHDA 2VYVD 4P86A 4PYKA 4X8MA 4YA6A 4N47A 2DUJA 1D4ZA 2Y0PA 2C9BA 1YA4A 4URWR 3H17A 4BAGA 1H0KA 1BKDR 1QM5A 2V96A 1ZIYA 4V1CB 3VKGA 4Q18A 2Z08A 5C46F 1WDMA 1N25A 3T38A 5KVSA 4G24A 1PSZA 4FZ3A 3B52X 3OZSA 2QL6A 3C8UA 2JLBA 1FS5A 3E1KA 3OY7A 2R5NA 1T4CB 3AVPA 5DYYA 5I7HA 1C9YA 2HLPA 4JK3A 2WT9A 4IFEA 4A5OA 3I61A 1K4YA 3LUHA 1ZFNA 4RK5A 5AYVA 3RYFA 4Y6GB 4TKZA 4UCQA 5IAGA 1KRWA 2VBCA 2VHCA 2IV2X 4FD3A 2ZYAA 4Z6KA 2H7VA 5ILOA 5BUZA 1UPAA 2E7ZA 1EM8B 1V35A 2B0JA 3GL9A 4DC1A 3UCFA 1O94A 5ERXA 5TX7A 3ZCSA 1CX9B 1MG5A 1OTHA 2W2LA 1OYWA 3BXOA 4MCJA 1NPDA 1SHLA 1V4VA 2AG5A 4OHCA 4RPGA 2BOVA 4URFA 4TYMA 5C18A 4KSBA 4OLJA 1XZHA 2SKDA 2ZI4A 4BBZA 3EZ2A 5LN1A 1D1SA 1EGVB 1ZO8A 1EE1A 2BVNA 2OHOA 3HLTA 3NGMA 4XARA 3AVQA 4YACA 1ESMA 1PKEA 4A0HA 3B36A 2O2SA 4OXQA 3AOEA 4AB1A 2OILA 5JDIA 1YE5A 1M8KA 4FNMA 2WQ7A 2ZJ7A 1JFSA 4XGKA 1C30A 4IO0A 1J7KA 1NOJA 2EJWA 2RB4A 2Q4TA 3P0FA 4TQUS 5AHWA 4W9RA 5JY6A 2NO6A 1J9ZA 1C7FA 1P2VA 2I7DA 2IUTA 1V8OA 4FKZA 1JN0A 4JI0B 4ZCIA 1MN6A 1Z28A 2VYFA 4ZCLA 5IHPA 4YR9A 1XWIA 3HM9A 2VZEA 2O05A 3PXUA 4Z9YA 4Q3EA 4CT5A 5JDIC 5CA1F 2YZKA 4LAFA 3AOGA 1E3WA 3IAS6 1YJAA 1DBIA 3B89A 2YV2A 4QYIA 1KZGB 4UUPA 4B74A 1W8IA 1EWVA 4ETIA 3P52A 1ZG3A 2ORYA 2D1SA 3HB7A 3O95A 4W99A 4UBIA 2VRNA 3KTFA 3NXKA 3P9PA 2CN1A 4YH1A 3UENA 1KP9A 1KVRA 2BKAA 4HTAA 2JLZA 2Y1DA 5AVKA 3GRRA 1SO8A 2WSMA 3PJRA 4GM4A 2XKAA 2BM9A 2GXQA 4AKTA 1E1KA 1Q0HA 2KMLA 3I9KA 1LXCA 4NCKA 3NHPA 2Z5LA 2P6UA 4PCUA 4LDJA 4X20B 5A71A 4Z7JA 5AVVA 3F74A 3A27A 3LLSA 5F9HA 3ZGZA 1NZFA 4JUFA 3LMKA 1XGKA 4RMJA 1V9SA 4H1UA 1LSUA 5G4KB 4QM7A 1DV2A 2B4YA 2HHCA 5DBIA 3TMKA 4LDRA 3OLYA 3NI2A 1YD7A 3H2ZA 5CVEA 5ECYA 3JXEA 1LFDB 1NVVQ 1GR0A 4QASA 4HQ6A 5TDHA 1TIKA 2R9VA 5SY4A 3B3FA 2BFOA 3CPEA 3O8OA 3W79A 4DDMA 2JFHA 3C98A 3T52A 1ZU4A 4TLDA 3I5XA 3OA2A 4HYYA 2CWDA 1Y6GA 4CBVA 5K0CA 5JJ5A 3Q1LA 4HF7A 2F6RA 3QX8A 1NC3A 2CNDA 3PGVA 1UKEA 4RXMA 4YLEA 2BF4A 1KOFA 2PRKA 1TAUA 4YRMA 5KTMA 1JIIA 1Z5OA 1R88A 3LY9A 3UMCA 3X1ZA 4UTRA 1AKUA 2YYAA 4ENWA 3VU8A 3DVRX 3B1VA 4RDXA 2GCPA 3PUKA 3CX3A 5ARCA 1XG5A 4FONA 4DWVA 2AG6A 5SZIA 2ZIXA 4C0XA 1OUMA 5C7LO 2ECOA 3MTIA 1TZMA 1WABA 1Z18A 3H1PA 4R7ZA 1JHPA 3HA2A 4QYXA 1CDZA 1S2GA 4G0YA 1CF9A 2CCGA 1XXHA 4YUZA 4NCXA 5CIQA 3RRBA 2VEOA 2WSBA 3C4JA 2Q6LA 3HPRA 3AF0A 4KXMA 4EZBA 4Q9JA 3Q1KA 1M34B 2EIHA 3AZPA 4GBJA 5IVKA 3CKKA 3NCHA 3BGSA 3Q7TA 5AVQA 3R7FA 3QJYA 4YMWA 3OZBA 5AQ1A 1TCVA 1Q15A 2BGLA 3SVZA 2ECFA 4BRUA 3DEAA 4ZK6A 4QQNA 5KB3A 2AG1A 3TXXA 3BDIA 2HCFA 2IU6A 1CZKA 2O0KA 3BK2A 5H4HA 4WUTA 9MHTA 2O1WA 3L5KA 1FP4B 1P9WA 4P5EA 4PINA 3EOZA 3CGGA 4BHTA 3VDNB 4PN7A 2A6PA 4Z7OB 4HNVA 3AERA 5J2UB 5HWSA 4CR8A 1FF9A 2D7CA 4TL9A 3VR3D 1GTRA 4KQHA 4MLPA 4QFCA 3BICA 5A4AA 2PPLA 2J5XA 1NF9A 1XTIA 3NIGB 4TV8F 1VSQA 2A5JA 3EGDA 3E22A 2PT6A 2RIRA 5BPHA 2PU5A 4DDVA 3JD2A 2WLSA 4FGJA 5DMHA 1DNPA 4FFMA 2G63A 1N1EA 1I8TA 1E62A 2DBZA 1TT5A 2Y1GA 3R0IA 4EG3A 1P0FA 4CIAA 3JWPA 2NU6A 4EA6A 3ZH2A 2VCYA 4X3PA 3SBDA 1G8YA 2D59A 3LQKA 4LBVA 1VYHA 2VSQA 3BJEA 4V0QA 5AKXA 7GPBA 2YIMA 4NATA 5E3IA 3QF7A 4KP7A 4S0XA 1JVSA 2P6OA 3G8YA 5HRAA 2BP7B 4B40A 1TXGA 1R74A 3DBIA 3GRYA 5CFZA 2YJTD 5BR1A 2IPXA 3FKSA 1PL8A 3L77A 3T9BA 5FADA 2FOLA 2G07A 5I9LA 2R5FA 1QFZA 1ORDA 4PZ0A 5TXGA 2BTQA 1RJ9A 1XFAA 2HSZA 1HYQA 1K8RA 4HH0A 2H1LA 2ZFUA 1IOZA 2WV7A 4HUQA 4LDNA 1FX1A 1XNHA 2IL1A 4UMEA 5THKA 4BOYA 4X3CA 4NH0A 4Q05A 2BGMA 3KKPA 1X7DA 3C3AA 4R1UA 4F9GA 1ZM4A 4S1OA 1H9AA 3U9TA 1OILA 2XRYA 2QRVB 3ET4A 3BFKA 3GPCA 4UCXA 4YAKA 3O4RA 3IQZA 1EHYA 4P4SB 1C80A 3GN1A 1KTVA 3RIEA 5KOJA 1R8JA 2WU1A 4J0HA 1BDIA 4WA8A 1XNRB 1LU9A 1H2HA 4JA0A 5HEKA 5JVDF 2V45A 2W8BB 3KUKA 4AJEA 1FTGA 3FIJA 2F3RA 4LV5B 2CDAA 4O0MA 1RYNA 2V4MA 3SSNA 1MA0A 3JW8A 4XYEA 1Q1GA 3GJ4A 2YQ4A 3TW8B 3HXLA 1HO3A 1D1QA 1XOIA 3IMEA 3T5AA 2OTCA 4NYIQ 3EVFA 3PSAA 5DSZA 4RVHA 1V11B 2VT2A 4B8ZA 4ZK2A 1W4RA 3L49A 1XZDA 2GJ9A 4KE8A 4Y2GA 4CI9A 4HNAB 4YP7A 4GVXA 1ZA1A 4JB2A 5E4TA 4S35A 3WHIA 4D9KA 2AMYA 2GCOA 2ZSAA 1HV8A 4KIUA 1VLMA 1G291 2JS7A 5FFNA 1GDDA 1EFDN 2XUDA 3KJEA 1OC4A 1G5QA 2LV8A 4UXHA 2EX0A 3CU5A 5C53B 3VR2A 1PW5A 3A6FA 2VDRB 3ZOZA 3IR5A 4BY9E 1RI5A 4EO9A 2ANCA 2P5SA 3D4LA 3D7MA 1I3LA 2C4WA 1J2EA 3QWIA 3MLBA 3MUNA 4IZHA 3DDNA 4AMUA 2GT1A 5JASA 1UC4B 3CLSC 3P4XA 3ES9A 1IM8A 1BXKA 2YY7A 3PFHA 1E3IA 3GVHA 2XD4A 2PVPA 2WFLA 5TQJA 5KHOC 1JQDA 1ZH8A 5E0OA 3IHTA 2CMKA 4HVCA 4G0PA 4W8HA 3ZKWA 4DDUA 1WF6A 2C57A 2B1RA 2QTNA 4M0EA 4BC0A 5DCUA 1L4EA 4PLHA 4EA8A 2JGKA 1G8PA 4GI7A 1VE1A 3VM6A 1SBCA 4BNUA 2OXEA 3KAKA 3P0IA 2WF6A 1FBNA 2NTNA 1AQIA 1T36B 3IUEA 3D2LA 2EKBA 3PC3A 3LKDA 2CLKB 2XMBA 2VYQA 3CZPA 4RMHA 1UPTA 2VYNA 3KKNA 3MJCA 2BEWA 4OBBA 4PLPA 2YH2A 1I4EB 4QA9A 4RGBA 1YB4A 1XTUA 2I2XB 3IOCA 1T2VA 4LQDA 2JFOA 2YXPX 1ONSA 3CLRD 2NU7A 4UQOA 2FRDA 3KU4A 5L95A 1E0AA 1EIZA 2GZ2A 3AV0B 3A9CA 3Q3IA 3TTYA 5G0TA 2I0FA 1F6BA 4P9NA 4R1NA 5KDDA 3D3KA 1T9DA 2FF5A 3EB9A 1UINA 2PQ2A 3RSSA 3RSZA 1U0GA 5AW5A 3TLEA 1ZS9A 4AMGA 4C4SA 1YZLA 4HBZA 1R16A 4U5XA 1ZN7A 3QLVA 1XPRA 4DA7A 4LOAA 4C3UA 1R9GA 2W2TA 4X1YA 2PVCA 4AMBA 2QK4A 3QVKA 5I7EA 3RDPA 3VV3A 2ANBA 3W7VA 5JSQA 2VDJA 3GV0A 4GEKA 1GQQA 3WGMA 2D1YA 4FB5A 3E5HA 3OO0A 1AK2A 1YACA 2W6ZA 1JQEA 5DXJA 1NBOA 3HFRA 3HSSA 4HK4A 1FTYA 1OKKD 5CDYA 4M1SA 1QB8A 1N6PA 2XTNA 3CX6A 3LGSA 3GJ5A 1UQRA 3Q7SA 1TIBA 2H1VA 2VF2A 3NX4A 2PGOA 2VHWA 4GG1A 4Y2SA 3TTSA 1XC7A 1NDUA 3PDHA 4B6EA 1C3OB 3BBLA 2I8LA 3QLVC 4K2HA 3GH3A 4MJXA 4MICA 3CR3C 4IQGA 4R41A 1L1FA 5TPWB 3P8ZA 2QA5A 3RS8A 4LVOA 1TIPA 4UHJA 4A26A 3AP2A 3PQ2A 4O3FA 5J5AA 3BWMA 3PFIA 4Q7KA 5ICGA 1Y33E 1IVYA 3HCFA 2OQRA 4QOJA 3NNDA 4YGXB 3SY8A 2BPOA 4DLKA 1R10A 4Q4HA 3PQDA 1QIKA 4JV5B 5DIZA 2C42A 2PH3A 3M0EA 3L7KA 1EH5A 1DQYA 1LV8A 4YQYA 1TZBA 4J16C 3TG2A 2FQXA 2XF8A 4L4UA 4X5OA 4BLUA 1D2MA 2YMQA 5F9MA 4KW7A 4BLRA 1A4RA 1S2IA 2F17A 2B5VA 2KM1A 2VPWA 2XLCA 2ZI7A 3LZDA 5FL3A 3RC9A 2BUAA 4ZJYA 5FEUA 4GF5A 1K6XA 4GPD1 2F1KA 1MR3F 1U65A 1OCEA 1AO0A 3JRXA 4BMOB 2CNNA 3KL2A 3X3HA 2FEWB 4NBRA 5FTWA 2Q3CA 4D7AA 1AO3A 4JXZA 1TUEA 2J6IA 4IGKA 2XMRA 3WLIA 1HTWA 1YCFA 2AX4A 2ZYRA 4HLDA 4OPMA 3EEOA 2AQ8A 1I4TD 2O1SA 5EESA 1DQSA 1RQLA 2I7XA 5EHXA 4EVQA 3ORHA 4US0R 1UXIA 4X91A 3WBFA 3FVVA 2H5IA 4KQMA 5BNWA 3EJ6A 3VR4H 2H4JA 5A7GA 4LHSA 1XTSA 4UHEA 5ADWA 1IHXA 2AUMA 4BFSA 3K2IA 4QGHA 2O0LA 5IJZA 5LLDA 1H2RS 5K0BA 1YA8A 4UREA 4REOA 1OX4B 2OHIA 4FGSA 2W7TA 1CUZA 2DULA 1TB4A 4G9GA 2EDCA 1QFMA 2AN3A 3EVAA 3FFXA 3WVNA 3GGCA 2E5LB 1K6EA 4GSLA 5DGCA 4KAXA 5LA6B 1X80A 1T9KA 1QCZA 2OBBA 3DZ8A 5DM0A 4G41A 4E3ZA 4PR0A 1U9IA 1PNOA 1NJFA 4AFNA 4EUEA 5IXYA 4C7OA 2O6HA 1OIXA 3GGSA 2HT1A 3AJEA 1NVKA 3OFKA 3PUIA 4KAAA 4L8YA 4R2XA 4ND7A 4EFMA 1NW4A 3FGZA 5CU7A 3THSA 3E2MA 2W00A 3GUUA 4CIBA 4ENTA 1TK9A 5D3ZA 3AJ8A 1M2VA 2P7IA 3QLUA 3UA4A 1RQNA 3V1UA 3PB3A 4LZZA 4JL5A 3RJMA 1DXQA 4X93A 2IWHA 1Z82A 3O1HB 2GZHA 4JI6B 3ZEAA 3SN6A 1TYCA 3T35A 2FJ0A 3FCCA 4JGIA 3VTAA 3ZZ1A 4DLAA 4ZYVA 1PFYA 2NADA 1EE2A 3C3BA 5SZKB 4FCVA 5C3MA 1O0SA 1FFWA 1GUYA 3P20A 3GEGA 2GQ0A 1HE2A 2IYUA 4P08A 3I09A 4IDOA 4Q00A 5A02A 1GQFA 2DPYA 3QNMA 4FDTA 1KK2A 2GD6A 1NBIA 2BELA 2YIDA 3QLUC 3NGLA 4JMPA 4CU2A 1SKAA 4C4OA 3HJUA 3WQBA 2BJWA 1Q0SA 4I9UA 2FW7A 5AM1A 1FFGA 1H2BA 1NBMD 3LU1A 3SKYA 5B4VA 3O75A 3HO1A 3FYDA 3F5FA 4PXAA 4IUDS 1U3DA 2OXRA 2X9QA 3W8NA 4EG0A 1V95A 1FRNA 1QOQB 3N6XA 3SX0A 5LP6F 5TQ2A 4E5DA 1PL0A 4IBOA 1DKOA 1FMJA 2IY9A 3REQA 1G20B 3IR7A 3LY5A 3AF2A 4EPVA 4FYYA 2ADOA 3VAYA 1KI2A 2FPUA 3O4HA 2HRBA 2FK7A 1FMTA 1P4SA 1PWHA 4HQ0A 3B1JA 3UWDA 5IHXA 1NRWA 3DKKA 4G63A 2HUPA 4LNUA 5EOVA 5B37A 4MP6A 3NONA 1AGPA 2EQ5A 2GN9A 5ECGC 4F4JA 3SP1A 3G7SA 4BFWA 3HRHA 4EEKA 4YPOA 1VL0A 2YJ6A 3IUPA 2GEBA 3R7WA 1MFZA 2E6KA 1YBMA 1GDHA 3NKVA 4ZC1A 2R11A 1XJCA 3CNBA 3EZ7A 1L5ZA 4MWOA 2WSYB 2Z95A 4K3UA 4ZDIA 5ARBA 1TF2A 3EVBA 4FMCB 5TSDA 1L4UA 1QB7A 2CZCA 5ERYA 3SOPA 4QT0A 3WQSB 4YJ2F 5C5DA 1PVOA 5JADA 1H8HD 1BO6A 4JQYA 1G21B 3E6AA 2O1XA 4PTLA 2D2VA 3CCFA 2G4VA 5TQ0B 1V5WA 5IAEA 1D7OA 4W5JA 2A9RA 1CQPA 3EJWA 3KZMA 2W90A 2QTLA 3OPYI 1RC8A 3DBLB 5LB4A 1T0BA 4WHMA 4BWVA 1H5QA 2C2OA 2C20A 3RHFA 1UZAA 3W3ZB 3ZHVA 4MJ7A 4U7DA 3U60B 1E2BA 2JJ1A 3HB4X 2FNAA 4LECA 5I48A 4GBGA 5LZ5A 3DV0B 1QE0A 1UC9A 4I66A 5A7FA 3IBFA 5KX5A 2HCJB 3E7DA 5IT4A 4JR1A 1W0JD 1E4EB 1P60A 3UPTA 3OUZA 2LCIA 1E1NA 1SBQA 5REQA 1YZYA 4IJVA 3VKFA 1CS0A 5IDVA 3UKDA 1Z5GA 2XKKA 4ML3A 5CLGA 1BCSB 4C01A 1B1CA 1A9RA 1ZOIA 2JFNA 2P6PA 3GA0A 4HD8A 4ZU3A 4ARZA 3R5JA 2JGJA 1G5HA 1G4HA 4N1AA 5C4MA 4XQ9A 1H8ED 3LOUA 4BVHA 4MPRA 3G9UA 2ZOSA 4JSYA 1WU8A 4KZPA 2H1HA 3SIXA 1Z5WA 5IU6A 1BW9A 3X1MA 4FHCA 3K1JA 3WK9A 5EJMA 1PT7A 4IIJB 4YAWA 1ISSA 3I73A 3LBFA 4ER3A 1O6GA 2X76A 4MKFA 4TPKA 2HJGA 5C8YA 1P1JA 4GR5A 2UZ3A 3EDYA 1KAMA 1J07A 1G4AE 1V1RA 4GL4A 5FXMA 4BDTA 2Y0BA 3GUCA 3B5JA 5JNVA 3TM5A 2GKSA 3LD9A 1MVLA 3CNOA 4IRMA 1U1FA 2O6LA 3KXKA 1WNFA 4C76A 1JFVA 4BO3A 4DV1B 2CHQA 1C0PA 3IAS1 1U6IA 3CF2A 3I92A 4ZQGA 4MVWA 2HLDA 1NI4A 1UBMS 3BTSA 3FWYA 1Z26A 4ZCQA 5HA5A 4Q12A 1ZD1A 2Q45A 2C03A 4EHFA 1CG6A 2J07A 3GT4A 1II9A 3O4IA 3CKLA 3OUUA 4J8PA 4ZU1X 2DWQA 1C1HA 4R1PA 2LD4A 3TAHA 4B34A 4FBLA 2QX7A 3RU2A 4RJKA 5EINA 3ZZTA 1SVUA 2QGFA 5BQ3A 2FN4A 3PQCA 4FINA 3STXA 3NHBA 4ZVQA 3VDXA 4HKTA 4ARSA 1QRSA 5ALRA 3RT7A 4CEIB 2MCFA 1YZQA 3D6UA 3EDMA 4LJYA 3KT0A 3F90A 3WIUA 5FUVA 4OQEA 3T95A 5H02A 4MS4B 4Q7JB 1DHRA 3VOTA 2ZROA 2FSVA 2ZJYA 5EEHA 2NTEA 2G1PA 5K3CA 3I9V6 1PJQA 4G5RA 4H4CA 4QVKA 3PU6A 4XGRA 1RVV1 4RY8A 3E61A 3IQHX 1DCKA 4M88A 3ROQA 2OCIA 3SYNA 4RDHA 2GETA 4NTZA 5DIFA 3INYA 2QTTA 2A0WA 4B3MB 1Y5MA 1TL7C 2J3LA 1G38A 5IBRA 2A86A 2YRFA 4JN6B 5T4BA 2JHAA 3RC8A 4RV5A 1VZ3A 1W7AA 3LQ4A 2ZB8A 5EE1A 2FSVC 3AILA 3BGIA 3E0XA 3PHHA 1GPWB 2GNOA 4IS2A 3NU1A 5J63A 3TZHA 1OXMA 4C1NA 1JDNA 1OAOC 2PFKA 3DC7A 1GZUA 4LMRA 4ZAFA 5ICCA 3D1LA 2P0EA 3FTPA 4EKYA 1CU1A 2AJBA 2XV1A 2R00A 2WFMA 1M0WA 2P1DA 1BN6A 2Z1DA 2BSAA 3NHSA 3ZU2A 1M66A 1A4IA 1EX1A 3C6ZA 3PT9A 4XYMA 5EL0A 3DAFA 1J1IA 5A3RA 3DLAA 1N9ZA 3H83A 3TSAA 1JH9A 1ORIA 5DI3B 1Y6RA 2J0UB 4A7PA 1V6CA 3OFNA 2VPIA 5EIBD 2Q5LA 3HVRA 3GFOA 1VYUA 1R0RE 3NBKA 4GW3A 1U5BA 1UMCB 4G5SA 1JSLA 3VU3A 3THXA 4GVPA 4CFSA 4YRJA 1OPXA 3BORA 2P2CA 2YFYA 1Z7EA 3DZDA 4JOCA 4NNPA 1JHYA 4RCVA 4MQ5A 2FP4A 3MWJA 1E9EA 1ECLA 4FYJA 4GHWA 5E9QA 5FWDA 1E2LA 5LQSA 4AJPA 5HJ5A 4MKRA 1R50A 2LP4Y 3M1AA 4OXNA 1NPYA 1RLJA 4HO1X 5FIUA 2HK6A 1TRHA 3IV6A 4Y6LA 2B7BA 5J1SB 5JU6A 1MB0A 2I8AA 3B5IA 1QUEA 2ZQZA 3K0AA 3CNNA 4YLYA 4YB8A 4ETMA 1VHTA 1ZXXA 3A4IA 2JGDB 1RCFA 5HHTA 3COSA 1DAGA 2A14A 3QFFA 4LDZA 2EFJA 5KTKA 2R6FA 3DEYX 4L8WB 1CZOA 3G79A 1GA1A 3PJDA 2WYUA 3KTDA 4BO4A 1M1NB 2HJ9A 5KOYA 4AXBA 3EN0A 3LC1O 5YASA 1CVRA 2Y66A 3L8CA 1UXJA 2H1IA 3DQZA 4LK3A 4QJ5A 3RFXA 2AKAB 4FU0A 1XZNA 5BORA 4DL9A 2ZUEA 2ATEA 4DWWA 3CX8A 4KXXA 2QUBA 1UOEA 3O3CA 1IZZA 3QFRA 3JQ8A 5D2CA 1PU2A 4HWRA 4KR0A 2XVYA 2HF7A 4UM9D 5ILQA 4PFKA 4DN6A 4KV7A 1X1QA 2QB5A 3WOHA 1DKMA 3P2YA 4PVCA 1KGSA 1VBNA 2VUSA 1CVLA 1N75A 3PUHA 1YGPA 3P97A 4NENA 4CMEA 1NVAA 1ODJA 5FLXA 4U4AA 2JA1A 1IPFA 2CCKA 4Q93A 3KWMA 1O9HA 3E9ZA 1C1DA 4BVJA 1L1QA 5D3MB 5ULLA 1YQUA 4QDXA 1X7YA 5AVZA 2J5QA 1VYVA 2WJ4A 2UZAA 4L3OA 3TNYA 1G8MA 2WPDD 3ZDDA 4BNDB 1SA0A 1GPNA 4GMXA 3DVLA 1EUCB 5LQUA 4CCAA 4B7ZA 2GHTA 4CKBB 2J5KA 3L1JA 4FHGA 1O1YA 1PD0A 4B5LA 1NTRA 1P6XA 4OD0A 3L92A 1Z4OA 1PZFA 2NX2A 2GHRA 2PSFA 3JYHA 3QJ5A 4HDCA 5TEWA 1RC0A 1R8YA 3RM3A 2BM8A 3DWFA 4TLEA 1SZPA 4I9NA 3TIFA 1RVDA 2Q2NA 3CTMA 5BPFA 1CR0A 2ZT6A 1I0IA 1YJQA 4YCLA 4CL8A 2PLRA 4KDCA 3IE0A 4Z1MA 3D2BA 5CTAA 3T3GA 4IPTA 4AJ4A 5IEJA 1JB9A 1MX5A 2PZGA 2WKPA 2XMCA 5D8DA 4DCGA 5J4LA 1KSGA 1PF7E 1P2BA 4IDFA 4DJJA 1P7ZA 1EZ4A 2V1UA 3B60A 1H2WA 2C7BA 2ZRHA 3ZE7A 2QBYB 4Q03A 2GLXA 5ITSA 1EMDA 1QONA 3GGGA 3ESCA 3J7AC 1R4MA 3NG1A 4DV2B 1LV7A 1FVXA 2B6NA 3MTAA 1OZGA 3ONNA 2Z30A 3OEED 1P1CA 1H94A 3SC2B 2XGSA 3B7WA 1K98A 2EZ8A 4QBIA 3B70A 2OBLA 3TL2A 1JSCA 1P0MA 2EP8A 8AT1A 1J39A 1Z3CA 4Q1BA 4JJ8A 1XCJA 5J58A 3REOA 1AX9A 1OZFA 3B9PA 1VGQA 3PUWA 1QANA 4F56A 1CVIA 4D43A 2PLNA 1LLCA 3EEQA 2ADFA 2HWWA 3LZ6A 2EBUA 1NN3A 4ZICA 5BV7A 3SVLA 1VLQA 4IEFB 1MIOB 4EEZA 2X3FA 4LVNA 3I9OA 1SCAA 3H1TA 3K1YA 2A1UB 1GPUA 4QL3A 1PJTA 2ZPAA 3T5GA 3UF0A 1BGVA 4G36A 3R0JA 1IOWA 3OQMA 4EFNA 3TTVA 3U0BA 1JT9A 4L74A 5JRZA 1JAHA 1KRHA 4XVHA 2AN9A 2FWNA 4OU4A 2QV0A 4YV1A 2VQSA 2GPBA 1EM8A 2ZSBA 4G4IA 2OUKA 1ZM7A 1NBME 5M3BA 4RTSA 2FPGA 4ZYZA 5L51A 1V6AA 1G5RA 2CHUA 1G1MA 2ZB4A 3D6MA 1DDGA 2HF9A 1HTTA 1U6JA 2AQKA 1VCHA 2PUGA 2X5NA 2K7FA 4FSDA 4Q9KA 2ZREA 4DMHA 1RRKA 2AXPA 1PFUA 2PZLA 2VHVA 1N5OX 5EEGA 4ZDKA 1VE9A 1CY4A 1WMEA 3EYWA 5LLSA 4HP8A 2XOEA 4OAPA 4GBMA 1LPOA 1PBTA 1Y37A 1VKNA 3GW8A 3CNEA 1JDJA 3WGTA 5K0ZA 5AI9A 3C8ZA 3EW7A 3UXEA 2EFEB 2CYAA 1Y9DA 3DXYA 5LXTF 1FX0B 5I7WA 1JKMA 3L79A 1CBUA 2EZUA 1CUXA 2W6NA 3GHYA 4HPXB 1NUTA 3KZNA 3L8HA 3R4VA 4MARA 2RKBA 1FNDA 4UVHA 3WOVA 5ES4B 1II8B 1QYRA 1S3SA 1M2NA 2H1FA 2RGAA 3BEOA 3KEFA 6YASA 4ZGGA 1CD5A 4RPHA 5L9AA 1EG7A 4D9MA 3WGKA 3A36A 4B4KA 1KYWA 1P0QA 1PWEA 2DTDA 2R8BA 4L75A 5L7TA 3VR6A 5EWJB 1ODFA 1KARA 3GLVA 1EDDA 3HU1A 4B76A 3BRQA 5E1MA 3WLNA 2FB9A 3TR5A 5IJAA 4OO3A 1L4LA 1SG0A 4O4JB 4KR9A 5HJEA 2YHBA 3O8RA 2AW5A 1RYDA 1A1SA 2NYUA 3FJOA 5FBLB 4CDNA 2VJLA 1SOAA 2EZ9A 2I7TA 2IYVA 4IXMA 1F5SA 1Q20A 1L8LA 2HK8A 3T5DA 5HJ7A 2FMKA 4G1VA 4YNBA 2ZGVA 3Q6MA 3FTCA 2K5UA 3LPCA 4GIBA 4P4UA 3V33A 1TJ4A 4LFBB 3FRHA 1FUUA 4DIMA 3TBFA 4MYUA 3EASA 3OD1A 2WIKA 4TMXA 4RKWA 5CLQA 1YRQA 3LT2A 2GZAA 3NDIA 3LBYA 4AQYB 1Q95A 4UFPA 4XD7A 2RE8A 1U0TA 4NEHB 1G8JA 1GYRA 3CH7A 2X0NA 3G8BA 4GT1A 3W8RA 1BQ3A 1PG5A 1MB4A 3C24A 5SZHB 2YX1A 4OATA 5EAIA 3V4OA 4YHBA 1NSFA 1WEKA 1JKIA 2P6MA 3QW4B 4PYRA 3UAOA 1XRPA 3AB7A 1S89A 2WW8A 4CGYA 1T2DA 3PXAA 4BZZA 1SXJA 2OE2A 3ID6C 1G64A 2W42A 1WHTB 1N2BA 4TRMA 1NQXA 4C4TA 2V7PA 1E2EA 4HWPA 5AMXA 3CZ9A 2HIMA 3VPXA 3PFKA 2G09A 4OKNA 1VXOA 4AAYA 1M34A 2YXBA 3AUAA 4CKZA 1XMQB 5JNRA 2BFMA 3RUDA 2E4ZA 3TDNA 5BRJA 5KKCA 2I22A 2F55A 5EMKA 5K9ZA 3WGQA 2A57A 1JU9A 2NV2B 3CW9A 4HT3B 3E3AA 3DVQX 2P40A 2PWYA 4WXEA 2B99A 3FOWA 4MVYA 3WJ7A 1NVVR 1F0YA 3IJ5A 4QOFA 3I3OA 4ZQBA 3UT5A 1T4MA 2XTMA 1QO7A 1BS2A 2AUNA 2CJPA 2WJGA 3Q3VA 4M1QA 5KTPA 3DR3A 5I4IA 2MSEB 1XZ8A 4NU0A 3RIGA 2W70A 2PUDA 3O8QB 2LR0A 2FK8A 4WD3A 1GL6A 1Q3TA 1NJSA 3MGBA 1JL3A 3FE2A 2Q8QA 4Q48A 4C06A 2WSSD 3NHMA 4ZHQF 2O8EB 4DAEA 2ZWIA 4JNKA 4YRGA 1EJ2A 3QBTA 5A9RA 1UBFA 5K4GA 1MO2A 2ZRQA 3JYPA 3MLAA 2WJVA 5JNTA 4Z99A 3ONFA 3HCWA 3DP9A 3R7DA 4BWGA 3PE6A 4DIUA 5AW7A 1QH1B 4WNCA 3MINA 1P74A 2YASA 3ZWOA 4M99A 5EKXA 3W9BA 3E9QA 1WZUA 2BMWA 3WRXA 1BZYA 3LH5A 2QVYX 1KKUA 4MLZA 5KAMA 3C97