1T0JB

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
215
structure length
187
Chain Sequence
FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
molecule keywords voltage-gated calcium channel subunit beta2a
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 59
structure length 187
sequence length 215
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0jB00
1LNZA 2WICA 1AS3A 2OXRA 3LFUA 4C0LA 4LYJA 3OEHD 3IEVA 2PZFA 2V1XA 1YRBA 2H1LA 4JBYA 5EE0A 1R8SA 1CRPA 1KDTA 4Q4JA 1GSIA 3PXGA 1TF2A 821PA 3QPUA 2G83A 1Z06A 1OFUX 3Q7QA 4ACBA 1HQYE 5L3VA 2BEKA 1SULA 1JR6A 1NVWQ 4KU4A 4M2LA 3L43A 5L3QA 2IYSA 4LZZA 5J47A 2GJSA 3U7HB 221PA 4HUQA 4LK2A 3CM0A 4QM6A 4LUCA 3ZZ0A 1XPOA 5TMPA 2ZI6A 3FPAA 1EESA 4TZ0A 1KIMA 2Q3MA 4OQFA 1UBGA 1MRSA 5CB6A 2F1HA 3VR1A 3ND9A 4AI6A 2JA1A 3U3OA 2FSFA 5C2JB 2FDCA 2H7VA 2CLSA 1J8YF 2MMCA 4QGAA 4TT3A 5GJWC 3ZLJA 2J1LA 2XOKA 1E9DA 5AJWA 4DLVA 4V0ME 4WZAE 3A58B 2WJHA 1ZM4A 4URYR 4RFSA 1US8B 4MKIA 4CVNA 3EA5A 1KSFX 3GLFB 3I5YA 2GVDC 2YINC 3TK1A 1FX0B 2VP0A 2OCYC 2OLJA 3LVRE 4B76A 1CR0A 4DRZA 4DB4A 3AVWA 2F9MA 3CNOA 1KO5A 4OI1A 3THWA 4QOSA 1KK3A 4XD7D 3GEIA 4HB0A 5CM8B 5EP1A 3K9LA 4DB2A 3PG5A 3GEHA 3DHWC 2YHSA 3EC1A 4UNPA 1QHYA 1VG1A 4CZ2A 2CJWB 3UWKA 4DLWA 2ZR0A 3TSZA 3RS5A 4LWZA 1W4AA 2Q0HA 3SOPA 2FN4A 2VBCA 2VSFA 1KK0A 1ZC3A 1LFDB 2CE7A 1GITA 3AUXA 4OHXA 4B3FX 1W44A 1HA3A 1OB5A 3ZQJA 2ODNA 3VHLB 1XTIA 1D9XA 3AQ4A 4G5OA 2WTUA 4NCIA 3MFYA 4KVAA 1OXTA 3HPQA 1XPRA 4I99A 1HE1C 1QHNA 4PO8A 1WQ1R 5ANRB 1EWRA 1E2KA 2CCGA 2XB4A 2ZJ2A 2DCUA 4E09A 4Z1MD 1R0YA 2GXSA 4U02A 1E9BA 5FL7D 2PBRA 3MSXA 2B7CA 4FIDA 1P9RA 4M9SA 2IWHA 3W34A 4PAMA 2QAGC 4IRUB 2G9NA 121PA 2MSEB 1II8A 1IJFA 4YMWA 4C0AC 1S8FA 1OB2A 3GPLA 5IT5A 3B1ZA 5HE9A 5BW8A 3BERA 4D4MA 3W6OA 2KBEA 4EPWA 4GBMA 3CNLA 1CU1A 3CIOA 3AF2A 4ZCIA 4ZI3A 2ODEA 4YMVA 5G3ZA 1GM5A 2C2HA 3Q85A 4JYBA 2YWEA 421PA 2OZEA 4C2UA 1Q21A 2R6DA 1C4OA 3VKGA 3ADDA 4D0NA 3IIMA 5LPNA 1W36B 1QHHB 2E9SA 2ZR7A 3AP1A 4QJ4A 4N1AA 2X2FA 1YVDA 2V54A 5IF9A 2IEYA 2CCJA 4A1FA 2Q9AA 2ERYA 1Z63A 5FR2A 1YZTA 1F3OA 3A4MA 1VCOA 1IOZA 1SVSA 1P75A 1G6OA 4NYJR 1DADA 1M8PA 1SKYE 1T8UA 5G3YA 3SC3A 4JT4A 4GP7A 4M1TA 2YJTD 1LF5A 3R7WA 5GVSA 2Q6TA 2QTHA 1QHIA 2P2LA 4TMWA 3CPEA 4O2LA 4FW9A 5JWOA 2RGDA 1KSGA 1K6MA 4BFYA 1ZD9A 4LHYA 1KI8A 1U9IA 5JEEA 5M04A 4W5JA 3ADCA 3EIQA 4L9SA 3U3MA 5GJBA 4CEHA 3X2SA 4PHHA 1W36D 1RKBA 1G5TA 2VF8A 2CVHA 4KITB 2JDID 3SQWA 1YQTA 1BO6A 4JLPA 1ZC4A 4LV6A 4QNRA 1YZQA 1AKEA 3WNDA 4F93B 4I1VA 3KZ1E 4LBYA 5DYGA 5CITA 1LTQA 2V4ZA 1G3UA 1Q0UA 3BB1A 621PA 5JZVA 1GRNA 1SZPA 1XCGB 2JAQA 4PO9A 2ZXUA 5JRZA 1T6NA 2DFLA 2RCNA 3KDSE 3LBHA 2RGNA 2DB3A 3IBGA 2FSHA 1NVXQ 1B23P 4L16A 1XXHB 1G3RA 5B58C 1HY3A 2IW3A 1KTVA 3GLFE 1WA5A 1OLOA 2QGZA 5L3SB 3O8CA 3Q9LA 5H8WA 1JR3A 5TXGA 2V7QD 2VP4A 3D6TB 1MO5A 1EX7A 4V02A 3UANA 3UXMA 3ZVRA 4Q1DA 4C0KA 3I1FA 1E4YA 1ZU5A 2GJ9A 3RWMB 3AM1A 3EG5A 4TL8A 5FUVA 2JJ2D 5TARA 2EFDB 3P32A 2AXNA 3PV0A 4OJQA 3HPRA 1E1RD 4RZ2A 4BFVA 4B33A 4DWJA 2CDNA 1COWA 1A5TA 1ZNYA 3EASA 3N70A 1KSHA 1E32A 2WAYA 3C4JA 5AUNB 2IUSA 3EPHA 1KI3A 4PHFA 4CEJB 1QHSA 3H1TA 4JZKA 2QBYB 4BLTA 1LB1B 3IBYA 1PLJA 1AQYA 3NTUA 3DZDA 4TLDA 3QNUA 3KKMA 4PQFA 2W0SA 1Z6AA 3HU3A 5KSOA 1KI6A 4Q18A 1MABA 3A36A 1QG2A 3FYHA 3LNCA 5H70A 5BWMA 2ZTSA 2IYVA 2Z6VA 3RANA 3SQXA 1Z08A 2EFHB 4JLDA 5E7MA 4DBLC 1GL7A 2PEZA 3UWOA 1YZGA 4HZUA 1E2PA 1CR4A 1ESMA 3O8RA 3M1IA 4EDHA 2GXUA 4QKQA 2WSSA 4FMDF 4MYTA 4MYCA 2ZM5A 3K9GA 4XWAA 1MRNA 1U2RA 5FPHA 1UKVY 2ZYTX 3REGA 1S9HA 3BB4A 3LX8A 2AKYA 2DFNA 2J9RA 1TPZA 1R8QA 1X8KA 2B8TA 3CX7A 4XWKA 3DZ8A 1QVRA 1CP2A 5EE9A 3BBPA 3UIEA 5DIFA 1XP8A 1ZYUA 3VR2A 2WWXA 4ILEA 1U9IC 2IYTA 4PZLA 3RRNA 4DXAA 3B1XA 3MWJA 2WJVA 2WPDA 1FTSA 4XVRA 1P7CA 2XNDD 3FKSD 1WMSA 2HT6A 2YNMA 2W6JA 4IFBA 1T9HA 4MRVA 1KZ7B 1BMFD 3FTQA 4NL4H 1N6NA 4JYCA 4P31A 4TYPA 4V03A 1W4CA 1IONA 1P4SA 3PUWA 1UBFA 3SS8A 4Q4AA 4BRUA 4AKHA 2ZSBA 2BMDA 4Q7JB 4QRHA 5F98A 3QVUA 1GUAA 4S2EA 1XD2A 1WB9A 1T91A 3AVQA 1CLUA 2QEQA 1S0UA 2ODBA 5FFMA 2RGNC 3W9YA 3IQWA 1YR7A 4V0KA 1W1WA 1OKKD 3RDPA 5EXXA 4DJTA 2J3EA 1OXSC 3G82C 4G1UC 4Q48A 3C7KA 1SXJA 2QT0A 3TUJC 1IN7A 2RMKA 4NE2A 3B60A 1G6HA 3FDIA 4I1UA 1V5WA 3L0OA 3LX5A 1ANKA 1OV4A 3EXAA 3LDAA 4YC7A 4WW0A 1LY1A 1EFRD 5AR1A 4DCNA 3AVVA 1CR1A 2DYKA 4MGZR 2VHTA 4WBSA 1E98A 1Q44A 1U0JA 2ZRLA 3QXJA 4AYWA 5P21A 2FEMA 4B6FA 4NH0A 4ZIRB 1XZPA 2GESA 3CZPA 2ZRDA 2D7CA 1XXHE 2X8AA 2ZANA 3CO5A 4JLOA 2PZGA 4ASUA 3KXIA 5JHGB 3TVTA 2A5YB 1AGRA 2ZS8A 2GBLA 3B13B 2H8KA 2I1QA 1ZIPA 4A0HA 1CJMA 3IIKA 2WMNB 2W2TA 3AUYA 3EC2A 2JIZD 3R9WA 1G291 2IYZA 3KL4A 2GZHA 1PLLA 4GPTA 4UNQA 4MRRA 2JLSA 2NPIA 3E2IA 3LV8A 3W3ZB 1VG9B 2R6FA 4EPTA 5AJYA 4LHVA 2NO1A 2PCJA 4ERNA 2A5GA 721PA 1Z83A 1GRRA 1X3SA 2BCJQ 3WYFA 4YMTA 4ITRC 2AWOA 4OQNA 5CYOA 1A2BA 2O8FB 4TLBA 4GMXA 3B7GA 2XXAB 2EW1A 5BYKA 1PJRA 1QDEA 4KLZA 1NF3A 2JLQA 1IY0A 1X8LA 2AN9A 2C03A 4ZI2A 5G41A 2EU8A 1E2DA 4PPNA 2Q9CA 1GFIA 4PSKA 4LJ6A 1I4TD 2ZRFA 5TY0A 2YYZA 4FMDB 3CZQA 4M1WA 3T1TA 3NBYC 1E2MA 4OHZA 1XCMA 1MT0A 2QPAA 4QXAA 2A9KA 4FMCF 4C7OA 3AV0B 4LYHA 1NBME 4URUR 3A4LA 2GJAA 1J90A 3PENA 3OEED 3CX8A 3ZQ6A 1XMSA 1RJ9B 2VHQA 1E9RA 3FFBA 3ZS9A 2CMKA 1N6PA 3S1AB 4YQFA 4BEBA 3HDTA 1S96A 2IF0A 3BC1A 2ZVQX 5JRJA 1JJVA 3K0EA 5EP3A 2NPFA 2C9CA 4LY6A 4R7ZA 1AZSC 1N6OA 1SXJC 1UEIA 1E79A 2D4HA 1GG2A 3JVVA 1TF5A 2IT1A 2P5TB 4IVRA 4KXFB 2REXB 1E2IA 2ZSEA 3DVLA 2FFAA 5FOSA 5AUPB 2UZIR 4EFMA 2GETA 2QPOA 2XX3A 4WXPA 3T5DA 2VL7A 4C4PA 3KB2A 1QHXA 1R4AA 1S3GA 4B71A 3UG6A 2J87A 1KDRA 4AKIA 1OW3B 2BBOA 1N6KA 5C4GB 1J70A 4TYYA 2NQ2C 1CJUC 4LI0A 2GBLC 2IF2A 5EE1A 4NKRA 4Q1FA 5B30A 2ZSFA 4GSYA 4CEIA 1PVOA 1N5JA 5CK5A 3CF0A 1G4AE 1G3MA 3ICQB 1M1YE 5G40A 3THXB 3LO5A 1NSTA 3EPJA 3KQUA 1KO4A 2HV8A 4KFTA 3W8NA 2NO6A 4G01B 1LVGA 1YU9A 1G7TA 3NWJA 2KE5A 2VA8A 1RRFA 2IBMA 3TSOA 4BLQA 3NG1A 2PZEA 3IEUA 3AVYA 4JKYA 1UM8A 1NY6A 1FQJA 3U7FB 4D4JA 4DSNA 5JJKA 3QUSA 2XSZA 2JLYA 4HLCA 1GP2A 3CWZA 1G16A 1MO3A 1E9EA 1UFQA 2ZJAA 1RFLA 5DISB 1IN5A 1T3SA 1Q3TA 3X1ZA 4NCKA 4AK9A 2ZU0C 1U0HC 3TQFA 2MSCB 1JAHA 1L8QA 2C9YA 2JLVA 2MMGA 3QKSB 3TGPA 1II9A 4A0RA 4DLRA 2ZJOA 1DELA 4TTQA 3RRMA 2IYYA 1GL6A 1X6VA 4US0R 4JLNA 4E03A 2XGJA 2ZJBA 4B2LA 2QTFA 1N5KA 4D25A 4PTLA 4I1SA 1HH4A 4ESVA 2FNAA 3VHXA 1ZM7A 3QXXA 3RS3A 4DLTA 2VP9A 4XVQA 2OSBA 4LGMA 2NIPA 3RRYA 2B6HA 3M0EA 3K70C 5EXPA 2PCLA 1E9CA 2VYFA 2YVUA 3RSLA 1E2NA 1Q22A 3EW9A 1R2QA 4PC3A 3ZZTA 4AYXA 3GLIB 4D26A 3I8SA 3U4QA 3BWDD 2ZAOA 1Z0IA 3GJXC 4Q7LA 2GNOA 3WHKA 5JECA 4DHEA 1ZM9A 1F48A 4B6EA 3VKHA 2FOLA 4TMKA 5D3MB 4ON9A 3GJ7A 4BUJA 1UDWA 3AF4A 1XEFA 4MGYR 2P0EA 2HLDA 2P3SA 2X2EA 4O2RA 1Z0DA 1EFCA 3GLGB 4WZ6A 1P2SA 3OESA 2VO1A 3LLMA 4CIDA 5CJ2A 1X1SA 3NHAA 5FUXA 2Z4SA 5HCNA 3OEHA 1KJZA 4IKEA 1VECA 2EWWA 3B8HA 2JLRA 2F6RA 4JT2A 5DI3B 3AVPA 1YJ5A 4I1OA 2O8CA 2Q3FA 4H9GA 3W6NA 2OBMA 3TIFA 3KTAA 1P73A 2CXXA 3DMDA 5KDDA 3ZD7A 1TMKA 1N6RA 4LBWA 4NYIR 2WWGA 3IUYA 4M4SA 2LCFA 3QIAA 2O0HA 4YMUA 3CR8A 3QI2A 4ZDJA 2BV3A 1JXMA 1OXXK 2ZS7A 3H0KA 3TUIC 3AEZA 1YHNA 3UG7A 3U3JA 5EP2A 1W0JD 4HB3A 5L3RA 4NTZA 3A1SA 1P61B 4AG6A 4X8LA 1F5NA 2CHGA 4EKDA 1HUQA 4LJYA 4QBFA 3ECCA 1A82A 2R9VA 3SN6A 5DGXA 1U94A 3TJZA 2ZS9A 4ARZB 4Q21A 2P67A 5F9HA 4NPHA 4EFLA 2ZE5A 1J99A 3AB3A 6Q21A 4G3XA 4MRNA 3SYLA 4P32A 2OT3B 1N3BA 1CJVC 2VP5A 1E9FA 4F4IA 2IYUA 2WWFA 3VTKA 3PEUA 4Q19A 5EQTA 3BS4A 4B3CA 1Z0AA 1W5SA 2CK3D 4IFEA 1DAGA 4Q7MB 4LPSA 4LYFA 5CDFE 3H86A 4R2IA 4MGIR 1E2FA 4TQUS 1RPZA 3A1UA 2N1BA 3VAAA 4HAZA 4Q47A 2GA8A 1SKYB 2AK3A 1Z2AA 4JL5A 4RD4A 3T15A 2FFBA 3AF3A 4RKEA 5H1YA 3RC8A 4KBGA 1P60A 1AS2A 3C15C 3IO5A 1F2TA 1M74A 5TV2A 1EGAA 4EAQA 3ZYCA 4B75A 1YRAA 1X1RA 2VSOA 4NCNA 3BK7A 4PHGA 5FI1B 4Z1MA 1CTQA 2OFOA 2YOFA 3KUCA 3VQTA 1OJLA 1L4UA 1CXZA 4Z8YA 1GOTA 1TADA 4TL6A 3GLFA 4BECA 3X1WA 2O8DA 1ZUHA 2JJ1D 2FF7A 3BORA 2NG1A 3VNUA 1E1QD 1CF4A 3E70C 3AH8A 3OFND 1S4QA 3O47A 1E2QA 1T5LA 2QGNA 5AUQA 1KI4A 4HLUA 2F43B 5FL7A 5HZKA 1E9SA 1JQLB 3FB4A 5C1BA 4EPRA 4JKIA 4A8JB 4A2PA 5BN3A 2ANCA 1P6XA 1NI3A 4R9UC 2J0VA 3G0HA 3TSWA 1MH1A 4XWOA 1DO0A 3GFPA 1T0HB 4DEYA 3RS2A 5JJLA 3ASYA 2C95A 2IX3A 3TBKA 1Z47A 3GLIE 1XMJA 4OK5A 3IIJA 4PPFA 3LWNA 2FG5A 3KKOA 3LA6A 1F60A 4PPGA 5CIWA 2OCPA 2HDNB 5SZHB 4QC2A 1KMHA 2W83A 2OUKA 1JB1A 3E5HA 1PUJA 2OFXA 2BCGY 4IHQA 3Q72A 1HE8B 1Z0KA 2JCSA 4BZXA 1R7RA 3R8CA 3AGPA 3GLGE 1JXOA 5F3WB 4GRAA 4HAWA 3OE7D 2OCAA 1E3MA 4GOXA 3NEJA 1BKDR 5UKDA 1KMQA 5LD2B 2J7PD 3VU9B 2ZSDA 4Q02A 3CH5A 5FH9A 5KDOA 1N0WA 1VIAA 2QP9X 1R6BX 3MMPA 4PR0A 4JLVA 3P26A 5DE3A 2D2EA 4OK6A 5GADl 3PUVA 4P4SB 4EJSA 1DAHA 1F2UA 2J59A 2EFEB 4DIDA 3NDBB 2JEOA 3OAAD 4RZ3A 5SZIA 1KHTA 2REBA 1E94E 2JATA 3WP0A 2BM0A 3WBJA 4II7A 4RFSB 1VHTA 4Q03A 3SJCA 5AJXA 3KX2A 2ZETA 4S35A 3THOA 3VNVA 3FHOA 2AXPA 1NN1A 4D81A 1VTKA 2CL0X 3WHLA 3THWB 3QPVA 1GAJA 4BFWA 4DSTA 2QI9C 2J41A 2JDIA 2ZYUX 3IO3A 4NBSA 2AR7A 4IW3B 4GFDA 3TVDA 1UKYA 2RAPA 3SDZA 1A7JA 1ZD8A 5TVKA 1XJCA 1FMJA 4LJ7A 2ZQ5A 4MKFA 2CLDX 2ZI3A 3C14C 4MRSA 2WAXA 4RVCA 1ZAKA 2O0JA 4NU0A 4BEJA 2QT1A 3CRMA 1W49A 1MO4A 3BRWD 1NKSA 1TL7C 2VF7A 3DL0A 2IWRA 4BQSA 3LW8A 4KSCA 2GK7A 1NMZA 1IXSB 4HLUC 2JJ2A 1EX6A 3QF7A 1E1RA 5FUWA 1FP6A 3U7GA 1T3LA 4KFRA 1ODFA 5J4LA 3KJEA 4CT4B 1Q3HA 4KV9A 5FTKA 3M4YA 1XDBA 2CBZA 2GXAA 4PC7A 3TH5A 1SHZA 2I4IA 4D80A 2AWNA 4HZIA 2GCNA 1CKEA 3U60B 3K0AB 4AG5A 1ZUNB 2ONJA 1N6LA 2GCPA 2QZ4A 5L3SA 3L0PA 2PJZA 2BWJA 3UPUA 4B47A 2QSYA 4HAXA 4JLMA 1BOFA 4POAA 3UKDA 3DM5A 1X86B 4TL9A 5K8IA 3EZ9A 5IK2D 4K46A 2OBNA 1KJYA 1ZM2A 1M7GA 2A78A 2D62A 3CUEF 2WVJA 3SEAA 3KXKA 4IDQA 1XEWY 2A30A 3GJ6A 5BN5A 3NBXX 3PCRB 4F38A 2VH5R 3MJHA 4OHVA 4RD1A 2IXEA 3BFXA 2HYIC 3BE4A 1DAIA 3JVUA 4CF7A 1SVWA 2P5SA 4CEJA 2QBYA 4IXNA 3ZH9B 3V9PA 3L82B 5JS7A 2RKOA 3R7WB 1XNJA 2R6CA 4EJSC 2E87A 1KI2A 1P2TA 3TKLA 4QHSA 2HXYA 3W6PA 2GWHA 4B2IA 2P6UA 2QUZA 3GLHA 3EWAA 4V0NA 1HTWA 1L7VC 2F55A 1G7CA 1DTSA 4G5RA 2XNDA 1GL9B 3AKCA 3FKSA 1W36C 1OH7A 2O52A 4MITA 1BMFA 2HXSA 2C8VA 1KAOA 3M6AA 3QF4A 4BLOA 2ZRNA 1DEKA 3V4RA 2WWHA 2GXQA 1UKZA 5JBQA 1E9AA 1CR2A 1KAGA 1G19A 3N2IA 3GJ3A 4BGDA 1ZBDA 1GNPA 1IY1A 4LJ4A 3WMEA 2FX3A 4AC9A 1G3IA 4FI3C 1SGWA 2R62A 3L8ZA 3HYRA 4MKHA 2YZ2A 4QGGA 1W0KA 1XD8A 2H16A 1R0XA 3TE6A 2Z0MA 2WWWA 1VCMA 1D2EA 1OKKA 1U90A 4IOJA 2H92A 3HR7A 4KYIB 1ZINA 2GJ8A 3PUYA 1FFHA 4KI0A 4M1KA 4R2HA 2JLXA 3T1VA 2GCOB 3ADBA 3BH6A 4KO8A 2OO7A 1JPJA 2QRZA 4PC6A 1HT2E 1BYIA 4AURA 3PUXA 4ACAA 1NVVR 4B35A 1EFRA 2VRWA 4BFZA 3RS0A 3KFXA 4PSAA 4LOAA 1YR9A 3VR5A 4V0LA 3K0CA 2UVQA 3CPJB 1WBBA 1H8ED 1MO6A 2ZRPA 1TQ6A 2FE4A 1N2CE 1OIVA 2JLUA 2QM7A 2XAUA 1GNQA 4YDHB 2KWIA 4CGZA 2AD5A 2G88A 4NP6A 4YLGA 2J0SA 1CS4C 3HU2A 2CL6X 2FH5B 3QBVA 2O8BB 5KPJA 5H68A 2IC5A 1JEDA 2C77A 1DAMA 1DG3A 1JAIA 1XWIA 4IJMA 1S1MA 1G17A 1VG0B 3DMNA 1MKYA 4GI7A 2RHMA 2WOJA 1W2GA 2GF0A 2ZIAA 2ZI9A 4DCSA 2JIZA 3U5ZB 1OH5A 2G0NA 3B1VA 1Q12A 2AKAB 1OH6A 1Z2CA 3UMFA 2RGXA 3QENA 3KKPA 3ZGXA 3GJ0A 1NBMD 2TMKA 3D8BA 4OQLA 4B3XA 1OHHD 4PQRA 4Q9LA 4ZPXA 2P6NA 2YWGA 5KSYA 2QMEA 2ZRBA 5JJIA 4DT1B 1Z22A 2R6AA 2W2XA 4WXRA 3PR1A 1ZD1A 2C9OA 3L8YA 4A6PA 2YWHA 4Q1BA 4ZIRA 5C18A 2XJ4A 1Z3IX 2C99A 3NEYA 4DC9A 1TF7A 5LB2A 3ZZUA 3NDPA 2CEAA 1NMYA 3I4LA 4LDJA 3MWLA 3LH5A 3EIHA 4D4LA 4OI0A 1KI1A 2X19A 3CB4A 3EARA 1IM2A 4JVSB 1Y63A 4AKGA 1XTSA 2ORWA 3VMFA 4OJKA 3DOEA 3HU1A 1G8YA 4GZLA 4C9BA 4WOPA 1MOZA 1VMAA 4L9WA 4QBIA 3OIUA 2PL3A 2ZRCA 4QGFA 1N5LA 4B32A 3EWSA 4IDHA 2GZDA 5KHOC 2YOHA 4UJ3A 1NLZA 3SHFA 2BMFA 2C96A 2YV5A 2IUUA 2QU8A 3DOFA 3ONWA 4DSOA 5DNYB 1XEXB 2R44A 3ZJYA 3LVQE 4Q4AB 4DDTA 3KUDA 5DO9A 2AK2A 3OEEA 4QBGB 3TUZC 2FMXA 3NH9A 3CBQA 1XFAA 1GWNA 2RHDA 3RWOA 1G8FA 2PMDA 2DR3A 3HYTA 3PITA 1AS0A 2N42A 3QJYA 2G6BA 3RS4A 3L2OB 3TLXA 4B74A 5KUTA 2BHRA 2WOOA 1AZTA 3PJRA 1JECA 2PX0A 3MLEA 4M8NE 1G5PA 2OV2A 1P3JA 4GZMA 1N6HA 1AIPA 4F4JA 1XTKA 3EA0A 5FPTA 3DM9B 3E1SA 4RY2A 3KFVA 3SZRA 4X8MA 3VX4A 5AJZA 3T1QA 3U3KA 4B3GA 1U8ZA 3RABA 2NGRA 2KJQA 3OZXA 1U8AA 1UPTA 3MG9A 4LBVA 2WIBA 1IN8A 2ZR9A 1G7RA 1Q1QA 2I3BA 3K0CC 1EFTA 1R0WA 4W5WA 2ATXA 1G3QA 5HKKA 1G4UR 1SVLA 4TLCA 1Z6TA 3KQLA 2FZLA 2N46A 1K5DA 3Q8XB 1RJ9A 3GFOA 2ORVA 4R71A 3QE0A 4RZXA 3WY9A 3S1AA 1VCIA 5JS8A 2RGGA 1EG7A 2QM8A 4DLXA 3QG5A 1U81A 4Q66C 5KYKA 1RYHA 1PLKA 2VQSA 2WJGA 3K1JA 4XVUA 2ZAMA 4M9QA 1GTVA 4RKFA 4ZKDA 3L0SA 4P3YA 1I2MA 1OIWA 3F8TA 3MD0A 3BH0A 4P4UA 3WYAA 2ZVPX 3BOSA 4FD2A 3KJGA 1Z6GA 5HCIA 2X1VA 2BC9A 4GNKA 2G77B 3FMIA 4BLSA 2DFKB 3BD9A 3TR0A 2DBYA 2ZJ8A 2F3RA 2A2ZA 1GDDA 4LJ5A 2ORIA 1FNMA 3AKEA 3FMPB 4DCTA 1NP6A 2HEIA 4CYMA 1AGPA 3LBNA 4GDFA 2QE7D 1EXMA 3SFZA 1N6IA 2J0UB 2BDTA 2VP2A 3FKQA 3OF5A 3I72A 2WJYA 2EQBA 3GCGA 1YR6A 4YXWD 2C5LA 3QKTA 2B92A 2YWFA 3A1TA 3WYGA 1XTQA 3FE2A 2GHIA 3H2YA 3AVOA 2D7DA 4M1SA 2FU5C 1KSJA 3KB1A 1JNYA 1M34E 3X1DA 2A5FA 1ELOA 4HLDA 1Q1ZA 5B57C 4XSGA 4HAYA 2WZQA 5FTJA 5K8TA 2Z43A 3LLUA 4F91B 5JI3E 3THXA 1TEVA 1AM4D 3I3SR 3QEOA 1P9WA 1YZNA 5CDFA 2C04A 1KJWA 4HAVA 1FUKA 1ZM3A 2PMKA 4C7OB 1NVUQ 4MYHA 3AF1A 3LQRA 4JSYA 2K5UA 4D0LB 3V4FA 4F4CA 3QKRA 1YE8A 1D5CA 4E5UA 2KSQA 5FUYA 2L0XA 3A4NA 4A6XA 1UF9A 2ERXA 1E6CA 3K0FA 2NO7A 2KI5A 3LXRA 1UJ2A 5FL3A 1ZP6A 3RVBA 2H57A 2JJ8A 2JGNA 1CBUA 2RGEA 4NYJQ 2JLWA 3AVXA 3FVQA 4GT1A 1RYFA 1R5NA 4V0OA 4P4TA 4LHWA 5K8LA 4EFNA 4FWIB 3AVTA 1IN6A 4ESHA 2MSDB 4Q1EA 4U00A 5E7JA 4DDWA 3BIFA 4IEIA 4LBZA 1KDPA 1U98A 3TW4A 1GIAA 4DKXA 2EYQA 3GEEA 3MUFA 4MDEA 4V0MA 3PIRA 3T34A 1E0KA 1YZUA 3K09A 2QROA 5A5GA 2YC4C 4JSTA 3QBTA 3BB3A 3IGFA 4PO1A 3GLIA 5JSZA 1E96A 3IHLA 1CJTC 2UKDA 4RJLA 2ZI7A 2QMHA 4HDQB 1ZNXA 1Z5ZA 4KVGA 4Z8XA 4B44A 2GEUA 3FOZA 2CHQA 1X8JA 2ZI5A 1ZW6A 5D3MA 4EPYA 2PT5A 5K8UA 4B73A 2ZJ5A 3GFTA 4U5XA 1RW4A 3DKPA 1D6JA 4TSFD 1D2NA 2REOA 1M2OB 2PEYA 3BGWA 2WBLC 5EE5B 5BQ5A 3QEJA 2ASEA 5FOWA 5JWHA 4O3MA 4QHYA 1NIJA 4JMPA 1VYVA 2ZRJA 4O0MA 2PJRA 1ONBA 4PX9A 1W7AA 5CIQA 4MRPA 1DE0A 1K5GA 3CNNA 4M1YA 5EXSA 1D8TA 4JVNA 2DWPA 4FMCB 1GKYA 1KO7A 1Y3AA 5CYPA 1E2EA 5DN6A 1M6NA 3GJ8A 1XD9A 2PH1A 5J40A 4BWYA 4PAQA 1IAQA 1LS1A 5GJVC 3SR0A 2CK3A 4BLRA 2V55B 3WNCA 2BVNA 1ZVQA 3Q5EA 4IEEA 1E0SA 1OH8A 2XITA 4Q00A 3KQKA 1XJ0A 4TN1A 3SU8A 1JJ7A 3NBFA 4DUGD 2FPLA 5KNCA 4U7DA 1XB2A 3L0IB 1EFUA 4K81B 2OG2A 2ATVA 4DEXA 3T5GA 4TLAA 1JI0A 2HF9A 2QAJA 3T12A 5EZ5A 1OPXA 3TAUA 4ARZA 3Q7PA 4ZO4A 1PZNA 2CNWD 2F1RA 3SJAA 1TAGA 5HZHA 4YONB 1XPUA 4NDZA 4Q4HA 4Q9KA 5J4YA 2ZRKA 1D2MA 3VKWA 2HJVA 3N5CA 2FA9A 4M22A 1DS6A 1XCPA 5FI0B 2JJ1A 3U4QB 2XEXA 5E7IA 3I73A 1T0JB 2VIIA 4JLBA 1E1QA 2H5EA 1QRAA 2O5VA 1L2TA 3NXSA 4R98A 3OFNA 2Q21A 1NVVQ 2ZJZA 1U99A 2R65A 3LRPA 2BBTA 2BJVA 4UXIA 1N0UA 2CE2X 4TQAA 4XOIA 3ZDQA 2A5JA 2WKPA 3IDQA 3WXMA 4C0BA 3QPWA 3TMKA 3Q5DA 3OIWA 5D3QA 2ZE7A 2O8EB 3THYB 5FBQB 2QORA 2ZRIA 3AF0A 1AKYA 4LSGA 2IUTA 3P4XA 1H8HD 1OF1A 1RE0A 4BASA 1GVNB 4Q1AA 1DO2A 4B48A 1XTJA 1KY3A 4UNNA 3U44B 4W9MC 3K09C 4HLQB 2A5DA 1OSNA 1FTNA 3WP1B 3BJIC 2OBLA 3W3AA 1B0UA 2WSMA 1E0JA 4H1VA 2IK8A 5FPYA 4XD7A 3KQHA 3KTAB 4EQ6B 5GJCA 3P20A 4F7WA 1P62B 1WCV1 1ZMXA 1TU3A 4URVR 3RC3A 4DZZA 3QOFA 2F43A 1JEEA 2NO0A 3UMSA 1A2KC 2HYDA 1LV7A 3OE7A 2HLDD 5J4VA 3NH6A 2V3CC 1E2JA 2ZRGA 4DLYA 2VHCA 3LAWA 2W6ID 2J7PA 4Q9JA 3R20A 2ODWA 3AVUA 2R6GA 1EK0A 5FOTA 4NZYA 2ZUDA 5AK0A 5J4KA 1US8A 1M7HA 3W90A 4BFTA 4DLSA 2Y8EA 3CH4B 4Y0VA 4A0FA 1FX0A 3R9IA 1OXVA 2FSGA 1QF9A 4N0DA 4NONA 3X1YA 1TX4B 1BH2A 4KFUA 3B82A 1NY5A 3EZFA 3OAAA 2RB4A 4KBFA 4Q7KA 2KBFA 4AIIA 5JLJA 2LKDA 4ZKEA 3T61A 5CK4A 4A0GA 1HV8A 2QG6A 4OKSA 2QAGB 3HJNA 1NN5A 2AHOA 2WKQA 3QXSA 4WZBE 2UZ3A 4ZCLA 2IXFA 2CJWA 2QENA 3N2EA 3WRXC 1XRJA 1P2UA 2W00A 2FWRA 2AL7A 2BIFA 4HYYA 3C16C 1UKEA 3LD9A 3F3YA 2OHFA 4TMVA 5E95A 3W5IA 3VU9A 3HP1A 2VSXA 4A2QA 1L4YA 4BFSA 1FOEB 4Q4JB 1I4DD 4D6PA 3A8TA 3HWSA 1DPFA 5AWFC 3WRYC 4D0GA 1YZKA 4W5HA 4IXMA 2P6RA 3TW8B 1F2TB 4DCUA 3MAAC 2QY9A 3ZIAD 2XB2A 2IYQA 4P4SA 4A36A 5J4HA 3NKVA 2VHUA 3B85A 3I8XA 4DDVA 2FEOA 3QSYA 5L3QB 2B7BA 1IJEA 4PZYA 4KFSA 2CHVA 4LJ8A 3K8YA 1OIXA 4HUQB 2QL6A 4IDNA 2QN6A 2V9PA 4RCZA 2O8DB 1AN0A 2QA5A 3EZ2A 3TR5A 1R0ZA 2ZRMA 3RYTC 1R10A 2I1VB 2W0MA 2BEJA 2FFHA 2B8WA 3C8UA 5TDHA 2Z4RA 2PLRA 1TQ4A 3IKJA 1T3HA 3AKYA 1IY2A 1XMIA 3CW2A 4D2IA 4BPBA 4LCBA 1Z0FA 3W8RA 1W4RA 1BYUA 4JVLA 5E3HA 1WBDA 4RD0A 1VDZA 1XJQA 1LF0A 2O0KA 3REFA 1XEWX 3U2QA 3V00A 2BMJA 2C98A 4N0EA 2J0QA 1QHHA 3I61A 5EUQB 4JVMA 5JFGA 2IXGA 4LPKA 1G8PA 1XF9A 4PAOA 2HUPA 3CLVA 3U61B 1C1YA 1J8MF 5AUOB 4ZDWA 4TWZA 1KMHB 5IK2A 2GTPA 4Q9IA 1E2GA 1M7BA 1KI9A 3FFAA 1IXZA 1D9ZA 4XSHA 3F0TA 2WM9B 5EZ6B 1E99A 3A1VA 4JLKA 3K9NA 4O25A 1KGDA 5DYIA 2YC2C 3C5HA 2WJJA 4NMMA 1KKLA 1YR8A 2E1RA 4DLUA 4OBEA 3T06B 3UK6A 5J5CA 4TT3D 3SYNA 4A8JC 5G53C 4BZQA 2XOKD 1NLFA 1KNXA 3T1OA 5LBIA 4A4DA 5CB8A 2AD1A 2FGJA 3ASZA 1UBCA 1XX6A 5JWRA 1Z28A 4RSGA 2V7QA 3GJ5A 3CPHA 3TNFA 3QVVA 2D74A 4NCJA 4EJSB 5BN4A 1F2UB 3K0AA 1OFIA 1VIYA 2GEDA 1ETUA 2XTMA 5CLQA 4HEJA 3RNLA 3CONA 1T5IA 4QHTA 3OIVA 2GKSA 5KNDA 3AGQA 2AX4A 1AJEA 4MUAA 3WMFA 1N0VC 1II8B 2Z5FA 3EZ6A 4EPXA 5KOYA 3GP8A 2BBSA 3A6PC 4DIEA 1XMVA 2R2AA 3KJHA 2QNRA 1KK2A 2KB0A 4HSEA 2V6IA 2CVFA 3D3QA 4Q1CA 3QY0A 1IQPA 4XTRA 1XXHA 5LD2C 2EWVA 5FBVB 4X8OA 4M21A 4NYMR 2XZLA 3KXLA 1R5BA 4PPQA 8OHMA 1RC8A 3B9PA 3IPXA 4TMTA 2RH5A 3DPUA 2HJGA 3FMFA 1ESNA 3SI7A 4DSUA 4MUBA 3O8DA 3SBDA 1QHGA 1K8RA 2HF8A 2ZREA 1GKUB 4GL2A 5A0FA 1WXQA 3MWYW 4A9AA 3ZVNA 3Q3JB 4LJAA 4WAUA 5BYJA 1C9KA 4C0JA 5IHPA 1GRQA 5FTNA 4TZ6A 2ONKA 4I81A 2OAQ1 3SJBA 4OL0A 4QJ3A 4M9XA 2CL7X 4TQ9A 2LWIA 1KZGB 1PUIA 2ZI4A 1NJGA 1H8EA 1GNRA 3NC0C 3DDCA 4C30A 2ZPTX 3GJ4A 5CJPA 2DY1A 2ANBA 2DWOA 2GVZC 5KSPA 4TTRA 2BM1A 4M0LA 1XU4A 2VEDA 4FXPA 4KCGA 4L4UA 4MDFA 3W5JA 2OILA 2FJUA 5GVRA 1DG1G 1RRPA 3LY5A 3QXHA 1XBTA 4CEHB 1Q57A 5DH9A 2WV9A 5B64A 2GCOA 2A7QA 1S9DA 4QJ5A 521PA 1U0LA 3DEFA 5HR5A 4QM7A 3O8BA 3QG1A 1SHKA 1Z29A 3GD7A 4BZPA 1WDTA 1NBMA 1UEJA 1DARA 1KOFA 4JL6A 4OQXA 4RD3A 4UKDA 5DSZA 1OHHA 3U3RA 5BXQC 3SNHA 1PV4A 3D31A 1DAKA 2CCKA 2IYLD 3D7MA 1W47A 2ZEJA 3T35A 3TAHA 3IPYA 4BE7B 5FR1A 3H84A 4URXR 1FPMA 1W48A 3PEVA 4GMDA 3TQCA 4ABYA 1J7KA 2QPTA 4IOKA 4LHXA 1E4VA 2OESA 1JPNA 2O8BA 3GQBA 1CEEA 1NG1A 4Q01A 3RLFA 4B43A 2IS4A 3I32A 4CDGA 2AFIE 3IILA 2W2VA 2OLKA 1V43A 2VTKA 2NOAA 3KQNA 2GJKA 4A82A 4A92A 1IXRC 2H17A 2J5XA 2V1UA 2GILA 2V8OA 5C46F 5JI2E 1TUEA 3GLHB 3CR7A 4DVGA 2OAP1 2BOVA 1P2VA 2B21A 2GAAA 3B1WA 4BRWA 3ZD6A 1HYQA 4LHZA 5FTLA 3ADKA 4PXAA 4QNMA 4QL3A 5F9FA 1G1MA 1RZ3A 1DOAA 4KODA 4HDOB 4QGHA 1NMXA 3B1YA 1OE0A 3RRZA 4MGKR 4PFSA 1KNQA 1VG8A 5HE8A 4M1MA 1HURA 4Z51A 2QSZA 3QF4B 4DT1A 3C5CA 4D4KA 1GKIA 4PC1A 4AYTA 2BJWA 5HPYB 4NYIQ 4JBXA 4RCYA 4TMZA 1G18A 2XJ9A 4KYUA 1G8GA 4Q4LA 4KLNA 4C3ZA 1T4GA 1TTTA 1KI6B 1EFHA 1TEXA 2GZAA 1MABB 4LV5B 1JR3D 3FWYA 4G5SA 3IQXA 2QTVB 3BH7A 2BKUA 4BFUA 2Z83A 4RFVA 4UJ5A 1U8YA 4URWR 5DHFA 2XZPA 1DVRA 4QFMA 4WIAA 4HZUB 2VHJA 3B5JA 3AP3A 4XTCS 1CRQA 3CRVA 3MRSA 1AA9A 1IHUA 1FMLA 2NZ8A 4KJZA 1COWD 3KJIA 5EE3A 3I62A 1A4RA 3SHWA 1W46A 2ECKA 4L15A 4LX0A 4B3BA 3U6KA 3AP2A 4PQYA 1IBRA 4P33A 1TNDA 1ZIOA 2IYXA 4OYHA 3SFVA 1XEXA 3EX7C 2WWIA 2RGBA 4TTPA 1HEIA 3IHWA 4BFXA 1FQKA 3ZS8A 2EFGA 4H1UA 1G5RA 3CF2A 4XJXA 4PHTA 2ZITA 1OFTA 4YDSA 4LC0A 3B78A 2FV8A 3ZVLA 1FNNA 1W0KD 1UBEA 2FFQA 1KO8A 5C4MA 4F92B 3A1WA 5EXTA 1ZNZA 2ZUBA 4TYWA 3FGNA 2WSSD 1YZLA 4HI0E 4ZCMA 4C2TA 5EUMA 4FCWA 4GP6A 1KDOA 1G7SA 1OYYA 4LV8B 1LS6A 4IDPA 2O8FA 1XD2B 3VFDA 1NJFA 3P27A 3RSOA 4AWXA 4TMXA 3B9QA 3ETLA 3VX3A 1N25A 2JLZA 2XXAA 1MV5A 2NTYC 2QE7A 5FPSA 2IS1A 5JCPA 1FP7A 4AY2A 2HCBA 1G64A 4CRWB 4N3NA 4YXWA 3B2EA 3SJZA 4FN5A 1HQCA 1TU4A 2XTNA 4UQOA 3UMRA 1SXJB 5DI9A 3SBEA 2WPDD 2PLFA 2HT1A 4Q5IA 1QG4A 4IVPA 2W6JD 1SVOA 5DLQC 3FHTA 1NIPA 3RS7A 4JLAA 1W5TA 2DHRA 5KO2A 4I4LA 5CM9C 2G1KA 4AD8A 4OI4A 1KY2A 4RZUA 4L5BA 4XIGS 5L8VA 1RVDA 2J46A 3KKQA 1EWQA 5EJEA 5IRCD 1E2LA 3NIBA 3K0SA 5CLLA 2F3TA 2WMOB 1JBKA 5B2ZA 1NRJB 1Z07A 2J0UA 1JR3E 2WHXA 3CRQA 5FTMA 2X77A 2EYUA 1S3SA 5TB5A 3CKLA 2OFWA 1SXJD 1WP9A 1H65A 1VYTA 4OHYA 1FW6A 3LW7A 3GLHE 1SVMA 5F2EA 3VR6A 1DAEA 5JHHB 4CW7A 1MR3F 1UDXA 4HB4A 1HT1E 4FINA 2FPMA 1AK2A 2IA5A 5KU1A 3CRW1 2WWYA 1G9XA 4UXJA 1R5OA 3H4MA 2GRJA 3FMOB 2F1IA 3JZMA 2FPKA 4RD2A 4JJZA 1G41A 3EIEA 4TYQA 2NO9A 4C0QC 2IS6A 2GK6A 3BFVA 1VYUA 1S1CA 5FPKA 1I4LD 4TL7A 3VR3A 3RAPR 3AKDA 4ASUD 3G5UA 1ZCBA 2ZSAA 3P1JA 1KYIA 4LJ9A 3QQ5A 4D82A 2VP6A 3BXZA 3MJRA 1SVIA 3PQCA 1SQ5A 2ZJYA 4DCVA 3TRFA 1VKJA 3NC1C 3C41J 3DKVA 3I92A 3QKUA 3SE0A 2EVWX 1G8HA 2IL1A 4PANA 5A4JA 3R8FA 4QG7A 4US1R 1Z8FA 4GOJA 4MH0R 4JLJA 4A15A 1WE2A 3KKNA 2CLCX 4TSFA 1OFHA 4W7SA 4MYUA 2WKRA 1W2HA 1YKSA 1P5ZB 2J45A 2YKGA 3P4YA 3LQQA 1UAAA 3K70B 1OT3A 5FOUA 4FWTA 1KK1A 2WIAA 2ZE8A 2EFCB 3OIYA 4GOKA 4M53A 5HKKD 1GILA 2F1JA 2OM2A 4KAXA 2OXCA 3CRRA 4HATA 2D2FA 4EPVA 1FUUA 2DFTA 2OEPA 4DDUA 1SKQA 2XZOA 1II0A 1G20E 4M9ZA 2ZRHA 2DWQA 3CF6R 3QKSA 3X1XA 4FMBB 4RD6A 5SZKB 2D06A 1NSFA 3F5FA 5DHAA 4JJKA 5KTYA 2XNSA 4WVFA 3VR4A 1N5IA 2F9LA 3NHBA 4G5GA 1RIFA 2ZRAA 4LYAA 3PEYA 3LBIA 5KPDA 4Q9HA 1JQJC 5SZJA 3I5XA 4KHZA 1KO1A 2BMEA 5FOVA 1VHLA 2G0TA 1ZJ6A 4DUGA 1UADA 3R9XA 4PZZA 1NKTA 4E07A 1FZQA 2SHKA 2QP4A 1QVAA 3BAFA 2V6JA 4TYNA 4K8OA 2ZROA 2VLIA 3EZ7A 4NYMQ 4L8GA 2J7KA 3K70D 3U6BA 4Y0AA 4NCHA 1NNEA 1Z0JA 3GMTA 4IDOA 4EIWA 2G3YA 4M1OA 4UNRA 4JL8A 5KNBA 3ZVMA 1ZU4A 1SXJE 1F6BA 5FBRB 5HTKA 2CNWA 4CEIB 1RRCA 1NLYA 5ELXA 4TLEA 3QKRB 5JEDA 5EP4A 2QP3A 2H18A 4IVQA 2R8RA 3EPLA 4Z54A 2C78A 2VPPA 1E79D 4BLPA 3PUZA 3WBKA 1BIFA 1DBSA 4EUNA 1W0JA 3GLGA 1XTRA 2FZ4A 3K0FB 2DPXA 1OXUA 1GZSA 2PT7A 4OI2A 4X8HA 1NN3A 2AFHE 4XH9B 3CX6A 1Q20A 1WRBA 5DI3A 4JBWA 1QBKC 2QQ0A 1IN4A 2FSIA 4OHWA 1A1VA 1P72A 3FHCB 3QXCA 2RGAA 3PEWA 3JZAA 2OCBA 2QMUA 1E69A 2IHYA 3WNBA 1H8HA 1S2MA 3CWQA 1ZNWA 2A3RA 3K53A 1JALA 1W4BA 3SYKA 1KI7A 2GEVA 1NG9A 1TQ2A 4FCVA 1T8TA 1J2JA 3A37A 5FBWB 1ZCAA 2D3WA 3MWKA 4HUTA 3EPKA 1E0AA 1XZQA 2W58A 5JSZB 2GF9A 2GDJA 1TQDA 4YMSA 4DLZA 1NL3A 4B2PA 5FOXA 4JIMA 3ND8A 2Q3HA 2ZYWX 2RGCA 5JCZA 3J81k 4B34A 1P9NA 3U7EB 2F7SA 2IHBA 4LC1A 5AJVB 1RRGA 1ZUIA 2P65A 2W6IA 2O8EA 2GAOA 2XSZD 2ZU6A 3THYA 2OE2A 1SVKA 2ZUCA 4G0NA 4AKEA 1E2HA 3K9HA 1TUIA 4KSBA 2ZYVX 1O3YA 2Q9BA 2QRNA 3MGCA 4B3DA 4PSVA 1O87A 1CULC 3MCAA 4NHOA 1Z6YA 4ZV4A 1DAFA 4MQBA 3U44A 1NN0A 2QMOA 4HAUA 1Z6XA 2FGKA 3OHMA 4LRWA 3EAQA 4OK3A 3NBZC 4IOMA 1Q1EA 4JS0A 2WJIA 4EQ6A 2BKEA 4G5QA 1LW7A 1ZRHA 4HB2A 2HCJB 2NZJA 1G21E 1VCNA 1FL9A 1OYWA 4UNSA 1Q1BA 2IEZA 2ZE6A 3PFIA 4E22A 4OQMA 2IYRA 4IOLA 5KDLA 4US2R 5FBLB 2BBWA 1BS1A 2PX3A 2NMVA 2LKCA 4QBHA 4UXHA 2IYWA 1CJKC 1I2DA 2O8CB 3WMGA 3UATA 4MA4A 4ZDIA 2G1JA 4CT5A 3ICEA 2XTZA 3BFKA 3PVSA 1CIPA 4PC2A 4ZDKA 3ZIAA 2QQEA 5LB4A 3HR8A 3LXXA 4WA7A 1VPLA 3RHFA 3DO6A 1AQUA 5IDVA 2YOGA 3B6EA 4URZR 4FCTA 4Q4HB 1QZXA 4P0TA 5DN6D 3NVAA 5JMTA 5LDDC 4J0QA 2JASA 2QAGA 4MKGA 4HDCA 4C0HA 5E4FA 4A8JA 1KKMA 4C0SA 5KSZA 4A2WA 1WF3A 2IS2A
chains in the Genus database with same CATH superfamily
3COPA 3CO0S 5K8CA 3R5HA 3UAXA 1AS3A 2OXRA 3Q3IA 1XZKA 3OEHD 2R7KA 1PQYA 2V1XA 4JBYA 4RABA 3HDQA 1R8SA 4EHJA 2HBRA 5CVJA 3IJRA 1FRQA 2GTHA 3S2ZA 3TL3A 3VISA 1XU7A 2I4RA 3D4IA 3RJ5A 3CVOA 1A3CA 2G83A 4H6WA 4U7PB 4D3DA 1OFUX 4AX8A 3UICA 2OCDA 4ZD6A 1QQAA 3MWFA 1OASA 2R00C 4EI9A 1CZRA 1I3CA 2Y0DA 5JMWA 1S2LA 2GJSA 3AR3A 1FP1D 3C1UA 4JA0A 3U7HB 1HL3A 1YGYA 2IXBA 2YIDA 3PFKA 3DZJA 2GAFA 3QA3E 2B8JA 4LK2A 4N3CA 3ZZ0A 4ZP1A 1DCKA 4WGGA 2VCYA 1ZESA 4IYJA 3IHKA 4FGLA 4EKEA 2WU3A 1YDWA 4U2BA 1QFJA 3CT6A 4GX5A 5A71A 2ZWVA 4OQFA 5C5IA 1GCAA 2WYIA 4EGFA 4A0SA 3JQQA 4ZVQA 5CB6A 3ND9A 2JAWA 3TTWA 3ZHUA 1QORA 4MVJP 2VTBB 5JAUA 3RC7A 2MMCA 2PUDA 4CL8A 4GL4A 4A2CA 4FIZA 3O9VA 3UB2A 3WFIA 5BY2A 3PNBA 5KVAA 4M9UA 3TQSA 2QG4A 2YH2A 4DOMA 2WJHA 1ZM4A 4URYR 2Q3CA 3RU2A 4CVNA 3GLFB 4ZOCA 4QE3A 1SG9A 2X58A 4TV8A 1Y6FA 3D2BA 3ZE0B 3UJ9A 2OLJA 3W0LB 3DV2A 4AS2A 1OQAA 2JFNA 3F90A 2F9MA 4IUDS 1WHSA 4L8WB 4RY0A 4OI1A 4DRZA 3AVWA 4KN5A 4KGVA 2YFHA 3PJFA 2AFIA 4R41A 4XUCA 3THWA 5EY5B 1V4NA 1CS0A 4XD7D 3WFJA 1DBRA 4BNIA 4O1HA 3GEIA 3ONDA 2C3OA 4BLVA 3BSSA 4DB2A 3GEHA 1EPUA 2YHSA 3HEMA 4ZZ2A 3QJGA 3W1VA 4XSVA 5GY7A 1D0VA 2WINI 3NU1A 3PVZA 4CZ2A 1KOGA 1IM8A 1R9GA 2ZR0A 1S01A 4QUDA 1GPJA 3RS5A 5CBPA 1PJ2A 2PIAA 3OLWA 3HCEA 4KIUA 3L1KA 2VBCA 1KK0A 5FUMA 4DCPA 1JR4A 3P2OA 2ZZKA 4JUFA 3PXAA 3OZCA 4DA6A 2VN8A 3A2KA 4OHXA 1NVMB 3ZU4A 1OB5A 1UH5A 1WLSA 4HO1X 1RWQA 3I5AA 4KP7A 5IDXA 1WTAA 3T9AA 2PX8A 3WB0A 2WTUA 4NCIA 2G7ZA 1QR6A 3MFYA 3NVDA 1OXTA 3HPQA 5AJTA 4WN9A 2VJYA 4L4YA 5PNTA 1XZMA 3FPCA 4EABA 2ZJ2A 1DKMA 2PS3A 5BT8A 1P6UA 4X71A 3OHPA 3V1KA 5C32A 1JSLA 2JAUA 5J2TB 1AXGA 3ZV4A 1E9BA 1XQYA 1L4EA 1G9SA 5BQXA 1XZ8A 4FIDA 5KTNA 4PAMA 3P2EA 3R3JA 5FQNA 3RH0A 1II8A 4YMWA 4C0AC 4YMLA 1OB2A 4L3OA 3D8SA 3FPLA 3R7NA 2BFPA 5LLTA 3B1ZA 5BW8A 3UPDA 2DHQA 3AJ9A 4RSMA 3RFVA 3T3MB 6PFKA 4QOJA 3CEJA 1OZFA 1CU1A 1O4VA 3CIOA 1T8YA 2CNOA 4HC4A 2ODEA 3ANYB 5HS6A 3OCWA 3QYAA 4K9KA 3WIDA 1ZOPA 1I5OA 4AY4A 4WESB 4BKUA 3H9GA 2W22A 4W82A 4JU9A 1L4FA 2H9YA 4N39A 4XUEA 2YWEA 2ZT6A 5JW6A 4CE6A 3WA6A 3W5UA 4ZC8A 4WCFB 2WB2A 4ZQGA 2BTEA 1MGOA 1ZOIA 1G5QA 3FNEA 4N1AA 2X2FA 5T4FA 5IF9A 4AMYA 4PY2A 2CZQA 2V3VA 5FXMA 4HPXB 3RYHA 5JS1A 4TTIA 4A1FA 3NHWA 1Y89A 3B9RA 1DHTA 4K9LA 1QO0D 2NSLA 4UAUA 3T94A 4XPIB 4PBSA 2J07A 2CVOA 1Z36A 1G6OA 3C6QA 3DP7A 5GV8A 3HCRA 2JJMA 5G3YA 3GPCA 1I10A 4QOHA 1IOWA 3R7WA 1Q0HA 2Q6TA 3KO8A 5G4LA 3K05A 4JH0A 3B89A 1L5KA 3RUHA 2QTBA 2NZXA 3L1UA 1KSGA 1U6KA 1K6MA 2F62A 5IT9A 4IIJF 3CLTD 4QTUB 1DXHA 5JDCC 3VU3A 2LGJA 4CNQA 1PF7E 2HM7A 3P2IA 4W5JA 5JEEA 5M04A 2QQFA 4BNXA 3G2MA 3IMKA 3KQQA 4R5MA 4TRMA 4HGNA 5BN4B 3U37A 3U3MA 3RIMA 3EUFA 5B3JC 1NJ8A 3CVXA 2RAFA 2XCTB 2UYQA 3TOXA 2VF8A 1VBFA 4KITB 3T0GA 3L6RA 4BVKA 3M2TA 1BO6A 1CY6A 4EUSA 3N2YA 4D0SA 4QNRA 1ZC4A 1M1NA 4BP1A 4Y6QA 1HQDA 4F93B 4J2HA 2J4CA 1G3UA 1Q0UA 4D4GA 3BE6A 3FNRA 1GRNA 2VR1A 3EFBA 4PO9A 3UBTA 2L19A 2AI2A 1JHRA 3GLUA 2Y1GA 3FDZA 4GD3Q 3W5VA 1U3FA 3IBGA 4EB6B 2DB3A 1BFUA 1ZHFA 5LZ2A 2V7EA 1LNSA 5FQOA 1USWA 1CUGA 1DJLA 3QMMA 5G1NA 2M6RA 1RIIA 4L4XA 1NASA 1LBTA 3GRYA 3I01A 3S6JA 5T67A 2F8MA 3O8CA 1BRTA 3RG8A 2QZ9A 5H8WA 5TXGA 2VP4A 3F98A 3ZVRA 4JYZA 1JKFA 4EMBA 1QANA 1NVTA 3F46A 4FFSA 2Q1SA 1P4HA 2JKVA 1RKQA 4M0UA 2B3DA 3U9SA 3AEKB 2JJ2D 3CLUC 3P32A 2I5PO 2PH7A 2KPOA 3G2KA 3PV0A 4RZ2A 1V3TA 2XOEA 1BHJA 1COWA 1KFCB 2I4NA 1JG6A 1UL1X 1E32A 3H11B 2WAYA 1ULUA 3N5KA 3U80A 2B2NA 2Q2OA 5B3KA 1ZGGA 1QHSA 2I4OA 2C8LA 2QBYB 1LB1B 1ZK3A 2IRWA 1PLJA 3IBYA 3MIIA 3L7KA 4DBZA 1RLJA 4UM8B 1PNQA 1CV2A 3VHRA 4TLDA 3K1YA 4MR8B 2IZ1A 2W98A 3JWGA 3QNUA 5J58A 2BSXA 3Q7RA 1A88A 5HWSA 2M1XA 5DNUA 4FFBA 3W7BA 1ORRA 3OG9A 1OD6A 3RJZA 4P34A 4Q18A 4EGCB 3A36A 2ADFA 3FYHA 5HFNA 4Q4CA 5BXQC 5KTTA 4C5BA 4FKMA 1DEHA 2Z6VA 3WTBA 4WDQA 1AUOA 1Z08A 2PVSA 1L8AA 1KOJA 1Y34E 4ZK2A 3BJZA 1IHOA 3EFHA 3OJ0A 3PP8A 5E7MA 1GL7A 2IHTA 1NUPA 1TM7E 4TTSA 3WV5A 3COVA 1KJIA 3KKLA 4U7GA 2RI0A 2X0KA 3EG9A 4QKQA 3L7BA 4FMDF 3IQHX 1QFYA 4JA2A 4EBFA 3TNLA 1ZHOA 4RPHA 2ZM5A 2QZSA 3SSNA 3AYXB 5I4CA 2JCBA 4M1EA 4XWAA 4Z0TA 5D7BA 3REGA 1E20A 4B17A 1ISSA 2BHTA 2J5KA 3W2TA 1CIVA 2IQ5A 4H17A 1DQZA 2AKYA 3RYCA 3D6FA 1HX7A 3I37X 1L7BA 4PYOA 4PYMA 4YP6A 5JARA 2J9RA 1K7YA 1R8QA 1VKOA 4RYDA 4UE3S 4XWKA 4JI5B 1NRIA 1CP2A 5EE9A 1XP8A 1ZYUA 1J1IA 1J0XO 3LG2A 3N0XA 4P7FA 4PZLA 4WA8A 4YCDA 3RRNA 3OJOA 2ERCA 1K98A 2WJVA 1UXKA 2WPDA 2X4GA 1RWXA 3MWJA 4XVRA 3T52A 2BKXA 1P7CA 2XWPA 2R6R1 3NUZA 4AULA 2ZAYA 3FKSD 4U6QA 5I8ZA 2YNMA 2W6JA 5LL6P 2WUEA 4MRVA 1RP7A 4TYPA 4V03A 5B1EA 2GCEA 4DDHA 5KYYB 1IONA 2E2WA 3EXFA 5GONF 3HLYA 5F2OA 1UBFA 4Q4AA 1KZ1A 4BRUA 1U3UA 4F6RB 5SYMA 2NUPB 2JA2A 4NEHB 1QK3A 4MWDA 4WCVA 3D6UA 5JJCA 4KYTA 1YZFA 3LBFA 1D0SA 1EWKA 1XD2A 1T91A 1K7SN 2Z9CA 3MLBA 4IGAA 1E1NA 1L8OA 4FSXA 4OYRA 1DC7A 1S0UA 5FFMA 1MX9A 1YBFA 3LBAA 2O07A 1W93A 2YV2A 4OFWA 4XGRA 2C29D 5E8RA 1MHTA 3LGAA 3SSMA 2HA2A 2PGJA 3DT8A 4AJKA 4B84A 1P1HA 5EXXA 2C83A 1OXSC 4H3KB 4I5DA 4JZYA 3LFHA 3T9BA 4G1UC 4Q48A 3C7KA 4N76A 1U7XA 3F7MA 4YAKA 1W88B 1G6HA 3FDIA 4XVHA 1R0RE 5JFOA 2JGMA 2NTJA 1O1YA 3KQVA 2FPOA 5P8WA 3UC9A 2ZAIA 1AQIA 1EJ2A 2P7HA 3V8PA 1F06A 5H9WA 4OYYA 5AR1A 3VR5D 4AB1A 2PR7A 1Y6RA 4L3WA 4B80A 1IVNA 4OHRA 1CR1A 3HK2A 3HBNA 1D2GA 2ODQA 2PRIA 1E98A 2RHOA 4IGEA 3OQOA 2GSWA 5EMMA 3UOGA 2BF4A 4X66B 3HRHA 2Y68A 5HOEA 4NH0A 4LY0A 3AL0C 4JI4B 2HWUA 4I50A 4IR7A 4OAQA 1XXHE 3FF1A 3I05A 2Q9UA 4R3NA 1OX6A 1WD5A 3AFHA 3KXIA 4ER7A 2YZ7A 1AGRA 1DEOA 1REQB 1YQ9A 3B52X 4IG4A 4DZRA 2ECQA 2A67A 1UBMS 3OFSA 1U3WA 1R4NB 2J3QA 2VNJA 1CJMA 4M0FA 4OSOA 3WSTA 1P4JA 2WZCA 3EC2A 1RCTE 4R2XA 2YXNA 1VGRA 2IFTA 4W9NC 3EGDB 4P4GA 3ZHRA 4UNQA 3JQBC 2JLSA 2NPIA 5H02A 4BNDB 2VHZA 3DO5A 5I7WA 3DONA 4UULA 4HXFB 5HX7A 3KBBA 1VG9B 3UOWA 5K0TA 3OBBA 3F6CA 4RLQA 4IIUA 4FB4A 1MENA 2HH9A 1R0CA 1HDCA 4LHVA 721PA 2AN4A 4HRVA 2JW5A 3HKBA 3IAEA 1A72A 2KW5A 2BCJQ 4D46A 2O1WA 4E13A 4R83A 4B45A 4WFJA 1TO6A 2I3AA 5K3AA 4BVEA 4YMTA 1HF3A 1ESDA 1LLDA 2AOTB 2NYAA 2Q3BA 5CYOA 1JLLA 1G59A 1U28C 4HYTA 2CJXA 3QNWA 1PJRA 3CX4A 1NF3A 3QEKA 2AN9A 2QPLA 2H06A 3SEQA 4CMGA 4ZI2A 1LTKA 1E2DA 1P91A 2CFSA 4J6FA 4QEKA 4ALJA 2IKSA 1W5BA 2ZRFA 3N07A 3NT2A 4KR2A 2VOEA 3NBYC 3T7AA 2NZVG 3ILHA 4S1TA 3JQPA 5LOVF 2G9ZA 2TYSB 3AV0B 2OHHA 4D43A 5AW4A 4URUR 1XZHA 1T2UA 2J6HA 1IBSA 4FGZA 4I1IA 4EKNB 5KWVA 4DSAA 5LQDA 2AS0A 2O2EA 1UJ6A 1TIBA 5BR8B 4UPDA 3KSUA 2HREA 3FFBA 3ZS9A 3FOCA 4HMPA 2X4IA 1LBEA 3M4ZA 3JS5A 3GNSA 5IZCA 2AJTA 1YULA 1DXYA 3R0VA 2DBZA 1SB8A 4NABA 2C9CA 4LY6A 1N6OA 4ZHSA 5AKKA 1KQNA 4YCCA 4MEJA 1GG2A 5AOAA 2PGNA 3JVVA 3DHNA 4H1HA 4QYTA 5BR1A 4EB8A 1X7WB 4IVRA 4KXFB 1ZJWA 1DV2A 2AG5A 4N4AA 2GM3A 5F12A 5EJ7A 1UJNA 1Y5MA 3DVLA 1JHUA 4ETMA 5K9ZA 2FFAA 4QOFA 5FOSA 4G8CA 5A7GA 2R8OA 2UZIR 3H5RA 5IYZF 2QT9A 1L1QA 5BQPA 1X7XB 4NJOA 3T3NA 4OJTA 2R1UA 1EK6A 2YMMA 3Q9NA 4MR7A 1JUDA 2BPOA 4RE6A 1R4AA 1WS6A 3LPDA 4YK7A 4B71A 5A5DA 3MAGA 1RYNA 3FY4A 2WP8J 2LCIA 2PT9A 1ZDMA 1K27A 1RYYA 2QRVA 1CFZA 1DT5A 3HJUA 1N6KA 2D1RA 4ZHQF 1SUWA 1GPAA 2GPAA 4F5ZA 2NQ2C 3M6MD 4LI0A 2GBLC 4IBOA 2IXDA 2O2SA 3BGSA 4GSYA 4YJFA 3UKOA 4CEIA 1UAGA 2QYTA 1TE2A 1WUIS 1PVOA 4H4EA 2CDAA 3TX2A 4BRZA 4AN4A 4YQZA 4L9AA 4DYVA 1PR6A 1TZJA 3KJXA 4DM3A 2P35A 5G40A 4EG0A 4QASA 3THXB 4YYEA 1NSTA 3L41A 4EVIA 3KTDA 2UYCA 2B2CA 4ZVUA 4LNUB 1M2OA 1AMOA 3U1BA 1M8GA 3EGXB 4FYVA 2BY4A 1J56A 1RQRA 3ETDA 2KE5A 1UANA 2O2XA 2VA8A 1NATA 1HYEA 2P30A 2Q50A 4GYJA 4R1TA 4FYIA 3NG1A 3M82A 3WLKX 4NR0A 5DZSA 4IHJA 2H85A 4BB6A 2I55A 1JG4A 1TJ4A 4DSNA 3MS4A 4JDPA 4Q37A 2Y3IA 3GNQA 3IBCA 4R8MA 2Z8ZA 3A4VA 3KM0A 1A9XA 1JTEA 1LLUA 4REQA 4A5OA 4F1KA 2QZJA 1LPOA 3L06A 4QYMA 1C7EA 4GDMA 5ALSA 3OECA 3SLRA 1G16A 1MO3A 1NJ6A 4X1OA 3HKCB 4GYYA 1U2QA 3CF4A 2Z6QA 1ZXXA 2ZBUA 1KMNA 4MLZA 2O0MA 3PE6A 1QKKA 4NSNA 1T3SA 1YDHA 3X1ZA 4MO9A 5TE9A 4NCKA 2FK8A 5AVOA 2JIPA 1U0HC 1XDZA 3DW1X 4LZLA 2C9BA 2HPHA 1XE3A 1MHPA 4UAJA 2CYAA 5EXEA 2L17A 3QKSB 4NZPA 3JQGB 3TGPA 1GU7A 4A0RA 4DLRA 3GJSA 3IDAA 2E4UA 4PZ0A 4KRYA 4BNUA 2IYYA 5EXDA 2B61A 1U0EA 2YJ3A 1EQUA 1T36A 1Q2XA 3SZOA 4E03A 2ZJBA 3ICOA 3JATA 5IM5A 1WU8A 3WJAA 4NZ9A 5ECWA 1DTWB 4CWAA 4UE6A 4D25A 1PK9A 1A7KA 1N9KA 3HUFA 4ESVA 1U6IA 5CX1A 4NFSA 4BC0A 5B2FA 1R88A 2VXBA 4AJ1A 4C4RA 1SR8A 3RRYA 3W2EA 4DJ5X 1DI0A 3FOFC 3UK7A 4NXNB 1DJMA 1IVSA 5EXPA 3B2NA 2YVUA 1V8ZA 1Z37A 1GGJA 4PC3A 1EBBA 1Q17A 1ZOSA 2QUIA 5REQB 5JASA 3BWDD 3DEJA 4KNVA 4Q7LA 2YHBA 3EW7A 3HXKA 5IANA 2UUCB 5HM8A 2WYVA 1OU4A 3D8UA 1KYXA 3OF3A 2C3YA 1H23A 5I7SA 4DHEA 4LRXA 3DE6X 2M6LA 3UK1A 3H3XA 2C61A 1YJQA 2Q62A 3HYCA 2V6FA 4L5YA 4MRMB 4ON9A 4RVOA 5D3MB 3VHQA 3VPFA 4BUJA 1UDWA 3KDAA 4PCUA 3OQHA 3C98A 4TLLB 4ZAXA 1J2UA 4KXMA 1EFCA 3OESA 3EVBA 3H05A 5ALNA 3VNAA 1RAEA 3ERCA 3SDBA 1KH3A 4IIGA 3INRA 3GT3A 1TMGE 1X1SA 1DG9A 2R8ZA 2C7BA 1KR5A 1VJGA 3ADPA 3R3HA 3R3VA 5FUXA 3S68A 4PBRA 3V5NA 1O9BA 1VECA 4IV8A 5B4VA 5EKDA 4RQBA 1Y1SA 4PTYA 4YFVA 2A0UA 1MB9A 3W6NA 1Q91A 1NJSA 5GPBA 5B55A 3HZZA 3T9DA 2FRVA 3DMDA 4QUAA 2VDWA 2VWQA 3L8EA 1UFVA 5IULC 3ZD7A 3FYSA 1NVKA 4FZ3A 2WWGA 1J06A 5IZ4A 1H2AS 3QI2A 1UK9A 5SV2A 5DBFA 4ZDJA 2HRBA 3FI0A 1L5MA 1GZHB 1PHRA 1YHNA 3OCXA 1IPFA 4CNBA 1MORA 3UG7A 3WWZA 1E92A 5AM1A 3QVWA 5JMPA 1M83A 3NDRA 4FQ7A 3Q0IA 1XHLA 4NTZA 4NRDA 4DADA 3KUXA 1RJGA 4RH1A 1CC1S 1WDWB 2HHLA 4QLBA 4F3TA 1P3Y1 4YJ2A 3SQDA 3PFBA 4M54A 1PO7A 3VNBA 5ERYA 4R8RA 1OT5A 1A1SA 1N8NA 1JSCA 3VH2A 2YVKA 5TS3A 2NU8B 4UVEA 1U94A 1S7GA 3TJZA 4ARZB 5CVVA 2P67A 2YHUA 4FOSA 3SF0A 5F9HA 3CZCA 2SNIE 4GKJB 3DQZA 2XMBA 4HBZA 4P32A 1F8UA 2GI4A 4W5OA 1RWBA 2EDCA 1B2RA 1N3BA 1OI4A 1A8PA 1CJVC 1ULHA 1UOQA 3V7YA 3ZQKA 1FDTA 3TLGB 4F4IA 5EQTA 2GS9A 4BMZA 2IE8A 1GCGA 1VJ5A 2XMGA 1Z0AA 3CX3A 3MGKA 5H7XA 2OORC 2PUJA 1XZLA 3PPIA 1YHZA 4L02A 1XZFA 3A04A 4Q7MB 2EKPA 3ZV5A 1XA4A 4LYFA 2FG7C 2QMZA 4BMYA 1H1DA 3GIDA 1U8FO 5FA8A 3K32A 4TQUS 3TRDA 4CQNA 2J31A 3PICA 3VAAA 1PVVA 2IVFA 3P71T 4HAZA 4KUHA 4Q47A 4JJGA 1NM5A 2PANA 1RZVA 4DJFC 2BEVB 4RD4A 1UT8A 2VBFA 4RKEA 5DULA 4I8IA 5H1YA 5TC4A 4KBGA 1G8KA 2YUTA 4EP1A 5TV2A 1EGAA 5GGXA 5TJ9A 4ZU1X 4B82A 1J8FA 1KVQA 5FF9A 1YRAA 4FZVA 2AG6A 3BDAA 3U48A 3JAKA 2ISCA 4K03A 3BK7A 4NCNA 3SY8A 2G5GX 2VG8A 2YOFA 2R4TA 2I6SA 1TYBE 4L08A 1L4UA 4MW1A 4P3KA 1T9ZA 1M6EX 4TL6A 3PNSA 4UCXA 4BECA 3X1WA 1Y5NA 4QYIA 2O8DA 2FF7A 5B5SA 3Q15C 4NJEB 1DC4A 3K9WA 1A9QA 1XRPA 3MRXA 1A04A 1K4KA 3H1BA 4MZDA 5H82A 3T7IA 1WCXA 3E53A 2F43B 5TF4A 2FMFA 4R5HA 2QRGA 3MCUA 1SD5A 4BE4A 1PFQA 1KC1A 4RWEA 4D74A 2OHJA 3DTTA 1K7FB 5BN3A 4BKPA 1SBIA 4S24A 3G0HA 3U7QA 3DPSA 3TSWA 2WT4A 3WZLA 1MH1A 3CQ9A 1YJBA 4INAA 2P9FA 1DO0A 3GFPA 1T0HB 1H4SA 1E8MA 3CZAA 4MDYA 4JI2B 5JJLA 3IT2A 3HBJA 3WIBA 1SOMA 1DRKA 1XMJA 1Z47A 3MUEA 4HG2A 4OK5A 5ELLA 3IIJA 3PDCA 4K6GA 3F4KA 5LXTA 1VXRA 3KKOA 8MHTA 1B74A 1F60A 3W9SA 2C7QA 2HDNB 1K08A 3KOWA 5SZHB 3OBIA 5BNZA 1BU5A 5KWEA 2OUKA 4N82A 4EG5A 1VBMA 4D79A 5AVTA 2OFXA 3RSCA 3LT2A 2AJ8A 3DCYA 3OA0A 2NUAB 4IHQA 3ONEA 1OOEA 1U2ZA 1N8KA 2JCSA 1RI1A 1ULTA 3BQ9A 4WY5A 3E1KA 3T7RA 3GOHA 4HAWA 2OCAA 4N5DA 5ALJA 1E3MA 1J0DA 2ZCUA 5UKDA 1M8JA 4TWJA 4MUEA 4TWAA 4C7JA 4UU0A 2ZSDA 4Q02A 3BK2A 3K0HA 5ICGA 1N0WA 1B15A 3A9VA 1SA0A 1YBHA 2G9RA 1IUNA 1J0BA 3MINB 3QELB 4P4SB 1JMVA 3DJFA 3QU9A 3KLOA 4FBMA 5KAMA 5KC9A 3GHHA 4BXOB 2R2GA 2N0SA 3PUHA 4G0MA 3G2NA 5CVCA 3GEMA 1WB4A 4UU7A 1PS8A 2REBA 2JATA 4G97A 4YJ3A 1TDJA 3WP0A 5ESDA 3WBJA 5FEMA 3KT6A 1IRXA 5B6IA 1TO2E 1A7UA 2X5KO 5JD4A 2I7VA 4BVJA 4G0UA 1NN1A 3TLCA 3ZE1B 1A5SB 3DOIA 4GQIA 3QPVA 2OCIA 4NBLA 1U7DA 2P2CA 3QE2A 1WZNA 2ZYUX 2H65A 4JOBA 3V46A 3IO3A 4NBSA 1AKWA 1HTBA 4B8ZA 1MUUA 2IGTA 3WOHA 7ABPA 4EUKA 4CU5A 3BXXA 3KWFA 4GFDA 4GF5A 3R7FA 3TVDA 4KQGA 3HCFA 2ADMA 1A9YA 3DNMA 4MW4A 4PFJA 5ARBA 2HTEA 3ZKWB 1GG8A 1E77A 1BMTA 4MKFA 5DB4A 4YWJA 2CLDX 2ZI3A 1M8FA 5IASA 1EWYA 4OP1A 2WAXA 5CD9A 1ZAKA 4Y1FA 4NU0A 1A7AA 5F76A 4YTEA 4OFBA 4GX1A 5FD8A 2BFBB 3UJ7A 2D59A 4TKUB 4JGIA 1T9CA 1VL6A 1CF9A 2Y4OA 5T4EA 1M8KA 1SC4A 3DL0A 4LKOA 3AXSA 3SQNA 1OC4A 3ZQUA 2IWRA 3LW8A 4DCJA 3M5WA 1RQLA 2AW5A 1YRLA 4HLUC 4TXHA 2JGDB 3P5SA 4RVFA 1DKUA 4UDNA 3WQSB 5CDSA 1SH7A 5LQJA 1EVLA 4LN1A 4F9FA 3NUGA 3PFGA 2IEBA 4AZVA 2HHAA 1JEJA 3MWDA 5K3SA 3SC6A 2ACEA 4KIJA 5ETJA 4KL8S 2QN1A 4O2BA 4KV9A 1UC5B 3LUFA 1XDBA 3PNPA 3ZWMA 2ICAA 1F0PA 4TVSA 1TXGA 3AXTA 1HDXA 3HDGA 3MWEB 4TV9F 2FW1A 2WU1A 3L04A 4D80A 3W5AA 2Y2UA 3FW1A 1GPWB 2ZCVA 3VC2A 3K6KA 3RTBA 4V0RA 3U60B 4J1TA 4LF9B 4KGXA 5CTJA 3EXIA 2ONJA 5E9QA 3EGOA 2GCPA 1FFXA 3L0PA 3PWKA 1OVMA 1ODCA 4I9HA 1X86B 1ZZGA 4TL9A 5SICE 5K8IA 5IK2D 3ZU3A 1YUMA 3EN0A 4B0PA 1JP7A 2D62A 2A78A 3JALB 3VGJA 4H6VA 1BS2A 1KH2A 3KXKA 2IZ7A 4IDQA 3TLMA 3UMGA 5DM70 2D00A 3HUEA 1UODA 1D2AA 2WT8A 4DYHA 1Z33A 3W1WA 3PCRB 4F38A 3HRIA 1D4FA 2IXEA 2WI8A 3IDOA 1WPQA 4IS3A 3TI9A 4C08A 5IWCA 3RTDA 5ITZB 1DAIA 1JEQB 3JQAB 3ROEA 1NMSA 3BQMB 2P5SA 3NHFA 4UBIA 1VHWA 3ON5A 4IXNA 4HDAA 2IKQA 4FEYA 2XE8A 4TWBA 3V9PA 3L82B 1R8YA 3NAMA 2DPMA 3OICA 4KYVA 4EJSC 2E87A 3SHQA 1P2TA 2HPVA 2H08A 4HQRA 3CNHA 3KVRA 1PJCA 4GGPA 5FCDA 4D9CA 1P1KA 1K3UB 4LYYA 3GLHA 5TT0A 1DTEA 5DVZA 4QEZA 5CURA 1IB0A 3DLCA 1HTWA 4V0NA 1O97D 1L7VC 4D96A 4WCFC 1MOQA 4KE7A 2PE5A 5KNDD 4EENA 2MINB 3EVDA 3GJRA 2OM6A 1UBLS 3KZKA 2GARA 1QCDA 1T5BA 2O52A 5DXAA 1GTMA 2C9ZA 4JX9A 5CFLA 4YGYA 1BMFA 2HXSA 4FHEA 3RJ9A 1YQQA 2C8VA 5HQ3B 1KAOA 5EWJB 5LJLA 3G6KA 1G5HA 3QF4A 4N65A 5AVJA 3TE7A 3HN6A 5T57A 2QUBA 5KYNA 1B8OA 3I2JA 1UKZA 2C2MA 3CNBA 4B3RB 2H4XA 4DCOA 1ZD4A 3ODPA 1NVDA 4F4DA 3N2IA 2GNAA 3TXYA 1GNPA 5FO0A 3QFSA 4GEKA 1K8QA 3DUFA 4LJ4A 3FGZA 4YMIA 1V39A 1RPNA 3RAFC 2GFHA 2R62A 4RIGA 1SQFA 1LQ2A 1ZOOA 2QXUA 3HYRA 4MKHA 3RS9A 1B7GO 4EFDA 3NT4A 1UMCA 1W5AA 4MYSA 4WPGA 4X94A 1ZINA 2XYHA 3PUYA 1RZRD 1LWOA 3AV3A 1FFHA 5AYVA 1XTBA 1H5QA 3V8NA 3T1VA 1B1AA 1MNQA 4CKWA 2NSDA 2OO7A 1C5KA 4PC6A 1I3NA 4PX5A 1PR4A 2QR5A 1CUZA 2WKWA 3RASA 2AOXA 2XE7A 4LDNA 1I94B 4CV1A 2HO5A 1RMTA 5J2UB 3VNSA 3EVTA 5JIBA 4B35A 1Z16A 1NFFA 4MYRA 4NBVA 1LPNA 1ABBA 1H1LA 1N0HA 1XWWA 3DSRA 3QU5A 3RS0A 1TUBA 4KQEA 3F71A 4JP5A 1U28A 2ZIVB 3CPJB 1KU0A 2CLLB 3SKYA 1C9JA 1XVLA 1ISFA 1RFGE 3LNTA 1YOVA 2FE4A 2WIDA 4GI3A 4NPCA 5ALWA 5HF8A 3QVKA 4B6GA 2A0KA 4DLPA 2QM7A 3EOZA 4R0MA 3WKAA 5ADVA 4IKPA 1EUQA 1CLEA 4NP6A 1X2EA 1KE2A 1CUDA 5JYDA 2YZKA 3ZJ5A 1FRFS 1QH8B 1DDIA 2FH5B 5IKPA 2IC5A 3SG0A 1Z4LA 3JVEA 3NAGA 3OHSX 1JAIA 3GY0A 2C20A 3E9NA 1G17A 1QKJA 1SOUA 2P1RA 5LQCA 1AX9A 4W1SA 4JD5A 2PX6A 4GI7A 1N33B 1TMOA 3HE3A 4BQRA 4QEDA 3IMGA 1TW2A 4O3FA 5TPZD 3U5ZB 2G0NA 4FFPA 1Q12A 2B20A 5CXUA 1GGEA 1XWFA 4EHHA 4RTQA 3LP6A 4I46A 2RGXA 4Q9DA 3KKPA 1T6BY 3WO1A 1V8DA 2GBPA 3GJ0A 3ZGXA 4EVRA 1QUFA 5AW2A 5IBCA 1V16B 1YRHA 4OQLA 1JAZA 5KI6A 2QUHA 4PQRA 1KPGA 2HQ1A 4GPD1 4ZPXA 2P6NA 1N3IA 2YWGA 3WGNA 4RM3A 4D6XA 1LU9A 3T7JA 2YMQA 3ED5A 1D03A 2ZJFA 2GD6A 4FLEA 4FNGA 5IXYA 5J23A 3KNZA 2YWHA 4Q1BA 1L7DA 4JHLA 4ZIRA 2ACKA 4EJ6A 2C99A 3NEYA 1NULA 5H3LA 2I6UA 5LB2A 2CEAA 1FA9A 3LX4A 2A33A 2KHZA 2OHXA 4D4LA 3WL5A 5G2OA 3NB0A 5K3FA 3EARA 2BP7B 4YMGA 1ESEA 4LE2A 4F2HA 3TZCA 4AKGA 1ZMBA 2VZLA 4Y2VA 3OKCA 5KQSA 1G8YA 1PR3A 1YJXA 3WQBA 3BVPA 1WDMA 4RK4A 2BDUA 4WOPA 5CA0A 3ER9A 4L9WA 5F73A 3CE9A 1C2YA 1GYQA 3OIUA 1XK7A 1GZVA 2O2CA 5KHOC 2C4TA 2PGAA 2QRUA 4LVCA 3ZDEA 4HWRA 4O4LB 5HJEA 1EMDA 4UJ3A 3SHFA 2BMFA 2CUNA 2YV5A 4EFKA 2QU8A 4KC0A 3DF7A 2QD5A 3FIJA 5DNYB 3ZEAA 5C1PA 3ELUA 3ILYA 1CUEA 1DC5A 4YRPA 2FLVA 3CLHA 4I1RA 2GN9A 4F21A 5CG2A 1USKA 3OEEA 3OCVA 3A06A 4QBGB 3CBQA 3CUSA 2G9VA 1A27A 4OEHA 3LLVA 4TOIA 5TR9A 1VIMA 1W0CA 2DR3A 2X86A 2R85A 2ZJ1A 4WXMA 3ZZMA 4R1NA 5AESA 5LU9A 4IJUA 5E0OA 1D6MA 2WYOA 1C4XA 2YTZA 1AZTA 4JEMA 1OXMA 1JECA 4KE9A 1LZLA 3HKEB 5CB4F 1G5PA 2OV2A 3ND5A 4H3VA 1N6HA 1ENYA 1QE5A 4HTFB 4ITUA 1XTKA 1BGWA 4DGQA 3DM9B 3M3HA 2WWVD 3E1SA 3WV4A 1BCSB 1I9CA 3LKZA 4RY2A 4C01A 3KFVA 1U2EA 3WK4A 4BVAA 4A27A 3KZNA 1N0IA 2NW6A 3G13A 3OETA 3T1QA 4BBPA 5HK8A 1JLHA 4IH9A 3LLCA 2KJQA 5E4JA 2VHEA 3RABA 3FHJA 2GLUA 2FOXA 2YNMD 2BGRA 3OZXA 3ZJUA 3MG9A 1JNXX 4HDNB 3W3AH 2XGSA 3TECE 4K1XA 2I3BA 3G9TA 1EFTA 1R0WA 2PV7A 4QODA 3EXHA 2CFIA 4G07A 4L73A 4BJ6A 1L3BA 2FK7A 2XVMA 3GGDA 4YJGA 2AOUA 4MTCA 5AI4A 1Z6TA 1E64A 2H1WA 5BURA 2B4QA 3Q8XB 3QOXA 1NBIA 1FYEA 4KXUA 3WVNA 5IG2A 1GU1A 3LQFA 4RNCA 1DFHA 1EIWA 2W2KA 1GY8A 3E1GA 2LCQA 2RI6A 3TTSA 1D3AA 5JS8A 2XPCA 1U81A 2BSAA 2V9ZA 1W75A 5KWSA 5KYKA 1UKBA 4N0MA 1RYHA 4P08A 2ID4A 4RMJA 1PLKA 2VQSA 3K1JA 4BNKA 4K0KB 1E1KA 1U65A 3EEIA 2ZAMA 3S7ZA 5KOJB 4CHTA 1GTVA 2PZKA 3K1TA 4RKFA 2YQZA 3ENZA 3GL9A 3OY7A 3BH0A 5JFGA 1H2FA 2I4TA 4MIKA 3BOSA 1I1HA 1BGXT 4YRBA 3K6JA 3BRCA 3ZGZA 2AG0A 2G77B 3FXAA 2A9VA 2NXEA 4HNQA 2F3RA 1CYDA 2A2ZA 4GWGA 4R0NA 3CJRA 3LFTA 1FNMA 1LBHA 3AKEA 4XJTA 3WWOA 3I9JA 4RVUA 2HEIA 3U1TA 3P97A 2ZUVA 3LBNA 3EEBA 2QE7D 4OY3A 4OPMA 4YRAA 2ZWPA 3CT4A 4IMPA 2VP2A 3FKQA 2MR5A 2R25B 5BOSA 2WJYA 2EQBA 1SUEA 2I4MA 3MBIA 1P9OA 2B1IA 3OQ6A 4L2IA 1NQXA 3QKTA 4OLHA 4YV0A 1IAVA 1KWKA 2WA1A 4R8KA 3A1TA 3S2GA 2BKLA 5JRDS 3WI7A 1Y9ZA 3INYA 1PAUA 3LIIA 1ECFA 5FRDA 2AQIA 2F8TA 1JNYA 1M75A 1WVMA 4Q4DA 5KYUA 2A5FA 2Q8PA 4K9DA 5H4HA 4CM4A 4EF5A 2WZQA 3EDYA 2FR1A 2BI7A 2QX7A 3NYRA 4PGHA 5J5VA 3VVLA 2LE0A 5A4MS 2P41A 5K8TA 2VFAA 3NORA 4E15A 5JI3E 1TEVA 1UK6A 2A88A 2N1MA 3K8OE 1AM4D 4CMIB 2M9MA 1KFJB 4QULA 5LSAA 4X3OA 3ER8A 1P2BA 2IITA 5HSGA 3WADA 3H2IA 3QUBA 2C04A 1L4GA 4HAVA 3LRTA 1ZM3A 2B83A 4C7OB 4MVJG 4ZVTA 2WNSA 1E4EB 4MYHA 2VDJA 1XOIA 1Q92A 3GI1A 2MWMA 2COEA 3ROXA 4CLHA 4GH5A 2Y4NA 4JSYA 4DXHA 3ZK8A 3OZWA 4LISA 3HYLA 1D7AA 2EX0A 2Z2XA 3LCMA 2J9FB 3MQFA 4PLZA 5AKJA 4CM6A 3RIHA 3PC6A 1ORVA 2VDRB 1D5CA 3W5HA 5TSDA 5I7HA 5FUYA 3EGVA 4PPYA 2XMSA 3DFUA 3H1AA 1UZMA 2EZUA 5BUQA 4U4AA 4A6XA 1CR6A 3ZJVA 1JFFA 1EXNA 4FJ2A 4F2WA 2AUNA 2IBSA 1OTYA 2VSNA 1AHNA 5EKSA 2PRZA 1R66A 3P9NA 1ZP6A 4YS6A 3G5TA 3RVBA 2CD7A 1CBUA 3ROMA 4HXEB 2CV1A 4M8SA 2NNLD 1JPUA 1RYFA 1R5NA 4KQ2A 4RIFA 4V0OA 1Q0LA 1RI3A 2AG8A 1PDWA 1XELA 4JOSA 4P4TA 4CUJA 2RK6A 2QX8A 4F