2ARKA

Structure of a flavodoxin from aquifex aeolicus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
SNAMGKVLVIYDTRTGNTKKMAELVAEGARSLEGTEVRLKHVDEATKEDVLWADGLAVGSPTNMGLVSWKMKRFFDDVLGDLWGEIDGKIACAFSSSGGWGGGNEVACMSILTMLMNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVDGRKELLEKIRKDPARFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Structure of a flavodoxin from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 52
structure length 187
sequence length 187
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2arkA00
4N65A 4Y9RA 4C0XA 4BMOB 3OWXA 2BPOA 3R6WA 4LA4A 3KLBA 2FLVA 1VMEA 5F4BA 4C0WA 4QOGA 2D5IA 3GAMA 5LLDA 4F8YA 1XYYA 4ICIA 4U7FA 2Q62A 3HR4A 1OFVA 2X2OA 2BF4A 1AKUA 3HA2A 1WSWA 3TZBA 3LT5A 4C76A 4Y9UA 1X77A 1YRHA 2B3DA 4LTMA 4LTNA 1AMOA 3D7NA 2KQUA 2RG1A 1BVYF 4CF6A 4U7HA 3K1YA 3KAQA 1FLDA 5EAIA 1KBQA 1CZNA 1YCFA 1TIKA 1RCFA 5LBTA 3NHUA 2Z9CA 2QMYA 1FLNA 3N3AC 4N9QA 3B6IA 4FX2A 1CZUA 3O73A 1KBOA 1AKTA 3QFRA 4BMPB 1AZLA 4FGJA 4YAFA 2QX8A 3GFRA 3KAPA 3O2NA 3OX1A 3TEMA 3F6RA 3UXHA 2KLBA 3QE2A 1QBGA 3U7IA 1V4BA 2OHIA 4XDGA 4C14A 2FAXA 3UXEA 3ZHOA 4M0CA 4H6PA 4QOIA 2FOXA 2FX2A 3L9XA 3FX2A 1DXOA 2R97A 4LTDA 1AG9A 4QODA 1AKVA 3K20A 2HNBA 3B6KA 2BZSA 1XT6A 5F12A 3ES9A 5NULA 1BU5A 5LJIA 6NULA 1YOBA 3W7AA 1SQSA 3NFRA 4H2DA 3W79A 4QOHA 4DY4A 5B3LA 4ESEA 1H66A 5FA6A 5LMCA 1OBVA 2MTBA 4QOFA 2N1MA 1FLAA 4DIKA 2Q9UA 1YCGA 3GFSA 1J9EA 1CZOA 1AKWA 1NNI1 3OWHA 1QR2A 3FNIA 2QX6A 1J9GA 3LCMA 1TLLA 1JA1A 1B1CA 2AMJA 2QMZA 3F2VA 2X2PA 1D03A 3OX2A 5LJLA 2GSWA 3FJOA 3HLYA 4ZVLA 1ZWLA 2XOEA 1AKQA 2F1OA 2V5VA 5F51A 3RPEA 3N39C 4S24A 1FUEA 4GQIA 4QOJA 3EDOA 2MT9A 2FZVA 3GFQA 2QR2A 3ESYA 1XYVA 1C7FA 3NHJA 3L9WA 1T0IA 2QX9A 2R96A 3OX3A 1GG5A 1RLIA 3W78A 3NHPA 3FVWA 1ZX1A 2FCRA 1YDGA 4U7GA 2OHJA 2W5UA 2MOKA 4FGLA 4HS4A 5TGZA 1RTTA 1ZWKA 1OBOA 1D4AA 1CZRA 3ESZA 5LVAA 4YQEA 1E5DA 1H69A 5A4KA 5FUQA 1I1OA 1AKRA 1D04A 3OVMA 2V9CA 5NLLA 1YKGA 3NHFA 3JSXA 4ZVNA 3NLLA 4Y7CA 4ZVKA 1AHNA 2HNAA 5BUCA 3TE7A 2M6SA 2A5LA 2ZKIA 1T5BA 1SG0A 2WC1A 3SVLA 3QFCA 1WSBA 1DX9A 4YAUA 1C7EA 5FX2A 2OYSA 4QOEA 4PTYA 2Z9DA 2QX4A 4XDHA 1RLJA 2BMVA 4YAOA 3OJWA 1QHEA 1FVXA 3FW1A 3F6SA 1FLVA 4LAFA 3OJXA 2HPVA 3B6JA 2M6RA 3W77A 3N3BC 4J8PA 4GR9A 2BN4A 2Z9BA 4HEQA 2FZ5A 2Z98A 5LBUA 3NHRA 3S2YA 1XI2A 1FX1A 3NHLA 1DXQA 2FVXA 5JROA 4OXXA 4DILA 3NHWA 5EMNA 3NHYA 2QWXA 1J9ZA 4ZVMA 1YCHA 4YALA 2XODA 1JA0A 4PTZA 3F90A 2V5UA 1F4PA 2MWMA 2OHHA 3B6MA 4CETA 3ESXA 4YAWA 3EYWA 3NHSA 4GI5A 4N82A 2FDXA 3KEGA 4PU0A 1CZKA 1QRDA 4NLLA 2ARKA 5B3KA 4NULA 3G5MA 1FTGA 1CZLA 4FGKA 4R81A 3U7RA 4D02A 3NHKA 3P0RA 5EA2A 1J8QA 1CZHA 5ULLA
chains in the Genus database with same CATH superfamily
4BO0A 4GBED 4PC6A 2GXAA 1V11B 2NYRA 1JA9A 3O9MA 1AS2A 3PL1A 1CBUA 4HFNA 1R0BA 2CXRA 5FCDA 4M49A 3NX4A 4RVHA 3FYUA 2KPOA 1UFVA 1NW9B 2DG2A 2OKGA 4K6GA 4YIKA 1TTTA 1CDZA 4RZ2A 2D2VA 2XT9A 3DWFA 4D41A 3DDNA 5JSHA 3DYBA 4JITA 4XGIA 3X3HA 1HG1A 1MIOB 3D6UA 3EQ9A 4EEKA 3TFOA 1F0PA 4GZ5A 2P1DA 1AF7A 5B7GA 2ACVA 2VP4A 5FHRA 1CY6A 2X0RA 1IE3A 3M9LA 3NBAA 5ALHA 3SS8A 5FL7A 3WDLA 5IT5A 1IWBB 2FPKA 3P2JA 4XD7D 5T4FA 1UAAA 3TXXA 4C22A 5CA0F 3WKDA 3HK2A 2GLTA 3B1WA 4PHHA 5LQDA 1PFQA 2Q2VA 3DBLB 5BW5A 4R31A 4ICIA 1AXRA 1RR6A 3IHKA 4E09A 4M6WB 4QOSA 5I5EA 3VZQA 1FQOA 3NASA 4KPUB 3BJEA 3JW8A 1R0XA 1N7JA 5BNTA 1O94A 2IEZA 4OXNA 5JSKA 3A6DA 2OQVA 4I36A 1HDXA 4MYRA 5AVSA 1LPPA 1WABA 3OQ1A 5AP9A 1L5RA 4Y9UA 2I6GA 1CNMA 1KK0A 2TRSB 4MGIR 4D4KA 4MS1B 2PUHA 2Q0HA 3AL2A 3T7RA 1GGMA 3UZUA 4F0JA 2HF9A 5IZCC 1RWPA 5BV1A 4DCNA 5DJ5A 1A9XB 1T2CA 1BVYF 3RH0A 2BKEA 4DQKA 4L8VA 1TVKB 1DLJA 1LLCA 5J5CA 3ZXYA 2W8BA 4L1KA 3R76A 5AKJA 1OA1A 2W11A 4CM6A 4EB0A 2PYIA 2HRDA 4N7JA 2CZCA 2EP7A 3R40A 3JQ8A 5AKLA 3TKLA 1ZRSA 1A5AB 2QK4A 3K0SA 3ODPA 4OJMX 3R3JA 2HB6A 4TZTA 1PS8A 5TV2A 3DUFA 1YRLA 4S04A 3AJEA 5ALOA 4MMZB 5K0FA 2H4FA 4CM5A 5IXJA 1VHDA 1HE1C 4CMEA 4PRLA 5LBTA 3GA5A 2HY7A 1I7SB 4LJAA 3U6KA 3L7DA 2PT9A 4WEOA 4F71A 3PNMA 4BBZA 3D1JA 2FPSA 3W5UA 1SKMA 3OZRA 3FF1A 4KXXA 4LC1A 4BL5A 5DWQA 4KFCA 5BSUA 4DR4B 5HS6A 1E99A 1I2DA 2VBFA 2ZJZA 4I4TF 1P17A 5T4EA 3SIRA 1NRWA 4BLOA 1A77A 5C7YA 2ZXEA 3FLMA 3I1JA 4FSDA 4ZVQA 1NVGA 3ZOKA 1LZKA 2BFCA 1MEEA 2FOLA 1MC4A 2ZJAA 2J0UB 3BE5A 1LRLA 4BWGA 4E2FA 4Z4EA 2VHVA 3JQ7B 4ASUA 4TMWA 3HKEA 4UMEA 3KS9A 3MT0A 1XVAA 1L4KA 3FHCB 1BYIA 3WL8A 3VU8A 1E2DA 1Q1EA 3FPJA 5IANA 4ZEWA 1E2QA 1GSOA 2PRZA 2J9GA 3LDGA 4MHOA 2C2KA 2XKBA 2YWCA 3P96A 2D4HA 4DN6A 5KYXB 2VF4X 1ZDMA 4B6FA 1Q22A 2V6JA 1ZU5A 1PG0A 5KYUB 4JI3B 3BIWA 3NNDA 3DEIA 4GMXA 4TS1A 5H16A 4BLPA 2G76A 2WHRA 4TXMA 2YMQA 3TNLA 3NVAA 4G81A 1H2BA 4N1AA 4X00A 4HP8A 2WAXA 3PNKA 4KHPB 1RRVA 4C14A 3AV3A 4OBBA 3TCNA 2R8YA 3HUTA 1C0PA 1GU1A 5EJ9A 1WPXA 1IRXA 4MR7B 3RVDA 3RC8A 3V32A 3HXTA 5JNVA 3HB4X 3PHCA 1JDZA 3ZHCA 2JG3A 3HNOA 3GWZA 5CLLA 3M2TA 1EFRA 1R0ZA 5JADA 1L9XA 2FSHA 1ZP6A 1NY5A 1S9HA 2GPYA 1X3SA 1C3VA 3FVVA 1L4UA 1ZVKA 4ZI3A 3D2BA 3FX2A 5TJHA 4AF6A 4XRGA 5A1TA 5IK2A 1ZESA 1KP2A 5AWFC 1M2VA 1T1SA 5I5GA 3DV0B 2J67A 4LJ9A 5ECGC 3K09C 1TEHA 2CLFB 4AU1A 5J2TB 1G4AE 3WNVA 4Y7DA 4AZTA 1P1RA 1XA3A 3DBRA 3PG5A 4KH1A 4LGMA 3D5TA 4AMVA 4TZ0A 1Z45A 1DBQA 2CNKA 2HBQA 4MW7A 4UKDA 1G17A 5BR4A 2PA3A 4OGGA 3UQYS 4GW3A 3KTDA 3JTMA 4I5DA 4ZOCA 3ZW7A 4INAA 1M0EA 4MGHA 1VSBA 2R8BA 2AK2A 1YZKA 1YDMA 1LQUA 3ONNA 5CYFA 4MARA 1NNSA 4XGNA 2IS2A 5B64A 3AFHA 4IP0A 1G41A 5KOHB 2JANA 1B8NA 3MCUA 1QE0A 4FDMA 1UF9A 1P2BA 2XA2A 3PX2A 1OHHA 1ZXLA 1Q0UA 5EJ7A 2VUSA 2WU1A 4FIZA 5GGXA 2C95A 1UBLS 1Z07A 4HAWA 4M21A 4XFDA 3L0ZA 5A4FS 3NAZA 1G1AA 3U37A 3PC2A 4QGGA 2EJCA 2H07A 3TBFA 1Z5OA 1U0OC 4L50A 3L4BC 3T0GA 5ALYA 1CRWG 3FMPB 1UANA 5AJTA 3SHQA 4ZT4A 4QRIA 3IGFA 3GK3A 5K09A 4J0JA 5CFQA 1O96B 4MROA 1M5TA 4LISA 5KSOA 3R7LA 2Q8NA 4D4LA 1W76A 2PLFA 4AMUA 4LF7B 1ZN2A 2DPXA 1Y4AE 1C8VB 3FOCA 4Z99A 3EA5A 4B45A 2NTNA 1OUMA 2B25A 3BIXA 4GXRA 5LZ5A 4EI8A 4TLEA 1I7QB 5K5EA 2I2BA 1G63A 1BNCA 5L6LB 2XUGA 1EFTA 1XVTA 4HAZA 4AUNA 1TX4B 1RYYA 3GT0A 4AY5A 3RVNA 3I5AA 1PP4A 1JHRA 4NK4A 2I78A 4RKQA 2XNHA 2Z4TA 3FIUA 3RJ9A 4HSGA 3ZV3A 1I10A 4TQGA 4JCCA 3UBMA 4H0CA 1OYYA 4CMCA 1JA1A 1MVLA 1M8JA 5KJ6A 2WD7A 2X8BA 2Y67A 4BLTA 5IJXA 3VAZA 1JSXA 2TS1A 3W5BA 1B1CA 3UJDA 1TUBB 2IIBA 3TLMA 1TIBA 5I51A 2QG6A 3AB3A 3PHJA 2G1PA 3EHDA 4RW0A 2IV7A 5F7OA 4DA4A 1DARA 3LOPA 3PCXA 3Q0EA 3QZUA 1DDGA 4FFVA 3OBBA 4L72A 3FOBA 4GQBA 4U9HS 1JHPA 3GR6A 3N2GB 1PLKA 3NT5A 2HRCA 2WZQA 4Y0VA 2XCOA 1ZW6A 3T7KA 3IS3A 2GS9A 2HREA 3M33A 3OBIA 4I6GA 3S2FA 5JRZA 1WPGA 3FJOA 3QBTA 4OQNA 4HXFB 1GG8A 4NDAA 2EEZA 5CYGA 5HIIA 2RGAA 1GCOA 5FJJA 3W9YA 4Q4HB 4HAVA 4A26A 4C78A 2GCGA 1Z18A 2EKBA 3I4CA 5MFPA 2OQIA 1CF9A 1X13A 4UHBA 4CLOB 5E7MA 3HYNA 4QGAA 4NOKA 1DIAA 1RLMA 3CF2A 3OM9A 1QKKA 2LR0A 3GL9A 4WTOA 4B32A 1KAHA 2C2WA 3FTFA 2WF5A 3HA7A 2CE7A 4CM8B 3CEMA 3I6BA 3L93A 4LDQA 1JG4A 4M88A 5F51A 4HBGA 3GY0A 1P18A 4QQ8A 4AUMA 2FPRA 2HC9A 1J0AA 2QJTA 3HO8A 4EJ0A 1KMMA 4HATA 3E7WA 1JLRA 1FUKA 1R2QA 4KTVE 1ZGHA 3OQIB 3UTDA 1MB2A 1MA0A 2XBUA 2XKJE 2G80A 3COVA 1Z6PA 4Z86A 5AKKA 4R54A 2AYZA 3CCBA 1ZNWA 2NYAA 1LK0A 2PMFA 5CEEA 1TQ4A 4O2AA 4FFDA 4HWTA 1XKXA 3K2BA 4K03A 4QDTA 4RK5A 4DQUA 2QSZA 1GQYA 4JR1A 4BVJA 3IVAA 3RRZA 3VNBA 4PGGA 2E6UX 4UUNA 5E3JA 2BDUA 1KOFA 1DPFA 3D64A 1AXGA 1D4FA 2R84A 3I05A 1WM1A 4TOIA 1TM4E 2P7HA 3TOVA 4B85A 1BGXT 2JGJA 1D6SA 1MEJA 1NBMA 1NI3A 3FAZA 3IELA 4M87A 4PVDA 3WGOA 4ZI7A 3AB7A 2BJVA 2I2FA 3QUBA 5AM2A 1AA9A 2FR8A 2HF7A 3OA0A 4OF4A 5E3IA 3T0FA 1UDXA 1E2BA 1LGYA 3VJMA 1ZMOA 4NC9A 1MORA 1S3IA 4Q3DA 4B34A 1DEXA 2RGWA 4DLVA 3FNRA 1I6MA 5ICFA 1CC1S 4CQMA 2GJSA 1N2SA 1WUTA 4C03A 4WBXC 3GPCA 3U5ZB 1JYSA 2AR0A 3OQVA 3C6ZA 3KO8A 4ARCA 4X9XA 2CUNA 2FSVC 2OV6A 3I6IA 3CE9A 4CI0B 3ESZA 5U9CA 4Z4IA 5T5QA 5ADVA 1M34E 2GK3A 3JAKB 3ILXA 5I3CA 4AF8A 5TY0A 4RF4A 4JGBA 3D4IA 1AKRA 2B34A 3A7EA 3GLVA 4ON9A 4L73A 5KAMA 1EZ4A 3S2EA 4LJ8A 3K0CC 1E3WA 1RM3A 5JBIA 4UAGA 2XGJA 4FKBA 3C70A 1O95A 4XEHA 4GX0A 1BCRA 3NPMA 3O38A 1TE2A 4MWDA 4IEIA 3SAJA 1XZDA 2C9CA 4P1ZA 2HJWA 3FVTA 5FLXA 1T8TA 3U3XA 2H3EA 5JIBA 4OY3A 2FU5C 5AICA 4TXLA 5HE9A 1OBHA 3ID6C 3S28A 5L3SB 4GMKA 3E8XA 1MX5A 3OWOA 1RJFA 2XKKA 2V0GA 2OORC 1YJAA 5JHHB 3L5OA 4CEJA 1JE1A 2ZE7A 1G16A 2FPXA 1GAEO 1FY2A 1GQQA 3C4QA 1OILA 3HU5A 3I4FA 3LD9A 1DVRA 1Q0HA 2QMEA 4QDJA 3OCVA 4RIEA 3D6JA 2V1UA 3ZD6A 4JV5B 3EMBA 4KQCA 2ZI9A 2H06A 2M9MA 2NM0A 3OPYI 2RC5A 4IDFA 4IQ0A 3ZG6A 4D8WA 3B3JA 2J6IA 1GPBA 4G0WA 3BILA 5DASA 2CVZA 4COKA 4MI6A 3DDSA 3L18A 3I09A 1F9AA 1UKYA 4O4HA 3SX4A 4MV4A 2CWDA 4KV7A 3ZBPA 2D0PB 1GQSA 1Z8HA 5E8RA 5DW0A 4LFAB 4LJRA 1TVCA 3PZRA 4PX9A 1DO2A 4BP8A 1RLJA 3HZHA 1J5XA 3K9BA 2O8VA 3QYPA 4JL6A 4WZAA 3I6MA 3AVUA 3HDHA 4YAOA 4MLPA 1F51E 2IHYA 2VP0A 1QHEA 3HFRA 3IMKA 3GXOA 4JVOA 3VOSA 4HUTA 1MA3A 5L3ZA 1NG9A 1C1YA 3C7TA 5JCOA 2ZANA 2V0NA 2O3JA 4JQCA 2VLIA 5JWHA 3EGWA 3DKVA 5C7IO 2IODA 4M0LA 1PTJA 4GM1A 4KKVA 3CVXA 3RJTA 4A8JB 2BEWB 1QYCA 2HPVA 3DS8A 4LQCA 3V2GA 4OLBA 2I6UA 1M6EX 4NBTA 4R7GA 3ZW8A 3FLEA 5F2KA 1Q44A 2PH7A 1AK1A 4RIHA 3CFYA 5DBHX 3RARA 2QE7D 3N58A 3OCUA 1YVDA 4Q6WA 4BYMA 3EMVA 2E0IA 1KI7A 2VL7A 2ZUEA 2ANCA 3SMVA 2OCPA 4JJ8A 1XDZA 3DPUA 4J4TA 3AESB 1D9XA 2ASVA 3FJYA 1C0KA 1FNSA 4WN9A 4F2HA 1E2IA 5JCJD 4KDEA 3VDXA 1ODCA 1XI2A 2XTMA 2QORA 4C01A 3WRYA 4IIBA 5LSAA 4UFNA 3RE1A 3ND8A 1X9GA 3FJ1A 2QQ0A 2PNFA 3CLSC 4G5FA 3GF4A 4XVQA 2FVXA 1FRFS 1KSFX 1VL0A 2FUG1 4Z49A 1D3AA 4OSOA 5KHOC 4A15A 1U2DC 2F9FA 2F3SA 5REQA 2UYCA 3ZZTA 4BKUA 1U7HA 3HCAA 1YR7A 4WJKB 4EMTA 5BT8A 3L41A 4G5QA 3S1AB 2JGAA 1SXJE 1NHGA 3JY6A 3ECAA 2JLYA 4V0KA 1NM5A 4OGLA 1NJ6A 1MV8A 1QCDA 1XMXA 3EG9A 2EDAA 5C8YF 2O8DB 1IEWA 1Y3HA 1GKYA 3RT9A 2GA8A 4TKUA 1GY8A 2Y1FA 4TRMA 1T10A 2EZUA 3KEQA 4K6FA 4RMHA 4GRDA 4Q4JA 4RKWA 2NSLA 2NPIA 3W2GA 1GPYA 3C3PA 1N7HA 3EF3A 1VYVA 3JWGA 5KHLB 1BWSA 2C2XA 4OA8A 5HW0A 3B6MA 1ITZA 3DEJA 1PU2A 4TYQA 3A37A 1UMCB 1IZ0A 1UFKA 3FLAA 1B0ZA 1VE6A 5IMBA 4EY8A 1DG1G 3RYCB 2J5BA 3Q9SA 1D2AA 2A1TR 4EB6B 4CIYA 4FI3C 2JH9A 3R3YA 1CJMA 1U9CA 1QK4A 2FMIA 1KI6A 4KK3A 2GT1A 3LP6A 1E9SA 2BFDB 3H05A 3K8OE 3WGQA 1S8OA 2GPJA 3QKRA 3TL2A 1X0XA 1TECE 1U3DA 2G08A 4B3JA 3CPEA 4NE9A 5HOQA 1N25A 1HOXA 4YJGA 3U9TA 3A36A 4TLMB 4BN0A 2C1EA 4TYNA 1DMSA 3JD2A 1H2WA 2OXRA 5EOVA 1PT9A 4YP5A 3CKYA 2GEBA 2EEPA 4PBRA 4MDEA 3S2IA 5JZSA 2O5EA 1H5NA 1MOPA 4HNRA 2QZJA 2ZREA 3DYVA 2X4GA 4G4SP 5K8VA 2JDID 4P4SB 2C5BA 2JGIA 2Y1LA 3AKDA 1GL6A 3Q4GA 1LI4A 4RPKA 4F38A 5LPNA 2HQ1A 5SICE 1R37A 1OI4A 4DB2A 2C4MA 3EGVA 4PRYA 4V2UA 1NSYA 2VXOA 3LCCA 3KVOA 4XJTA 4PGAA 2UYGA 5G0VA 3UAZA 4Q3NA 3UV7A 1NR1A 4DARA 5KYWB 4C0WA 4JZYA 1CNEA 4BDTA 1FYFA 3CZ5A 1ELOA 2UU9B 1LX6A 1YASA 1FK8A 2X58A 1TCUA 4R71A 1RAFA 1YK0A 3DE3X 3ZWVA 3S27A 1ISGA 2G67A 1WB4A 2IFTA 3C5EA 2O2EA 1I5RA 3QPCA 3UG6A 1BXZA 3UUFA 3RSCA 4F8YA 1GA1A 1ZQ9A 3A6GA 3DH0A 3S2GA 1F2TA 5JISA 2GUGA 4TGLA 1UIRA 4EKNB 3A2MA 3D7SA 2RH4A 4WD3A 5DHAA 1C14A 1V8OA 4G37A 4ISCA 4BRZA 4QL3A 2PBRA 4A16A 2COEA 4OQDA 5D85A 4F1KA 1S5PA 3GOHA 5BQPA 5EUBA 4ZO4A 3URKA 5K3CA 3F9RA 1X7XB 3HA2A 1PK9A 4H7JA 1UFQA 3H8JA 1QOPB 3IA7A 3Q6MA 2VH2A 2ASEA 5EVCA 4ZT7A 3VX4A 5C8ZA 1WLYA 4HDKA 4KQMA 2XNDA 2HSGA 2AXQA 2VDNB 3R3SA 4HRYA 1E3LA 4D97A 3V8PA 3D31A 1R88A 1AMOA 5F35A 3RSOA 4BO5A 2J3KA 1Z37A 3ABZA 1CUFA 1Y3DE 2RJOA 3WOVA 4RJLA 4K8RB 2HLDD 3CLSD 1VG1A 5FKJA 2ZDGA 1PQWA 2SECE 2G4LA 2HHCA 1ORIA 2OCKA 5B2FA 1AQUA 1IY0A 1Q7GA 3SN6A 3WQSB 4BP1A 4DS3A 1RADA 2GJAA 1PJ3A 1K2VN 2I2WA 3EEOA 5FV7A 4M89A 4C21A 2GPBA 3IEIA 1KBQA 3EIOA 3NM5A 4GZLA 3V4ZA 1Y6RA 1TIKA 2PKCA 5EPOA 2H85A 2Y77A 5EZYF 3Q3VA 5MHTA 4WXMA 1D2HA 4JEUA 2XZOA 1I94B 1WAMA 2BTQA 4NBWA 1S2OA 2BZ1A 2OQ2A 3ZXUB 4NV1A 2LUOA 3T9EA 5BWOA 5AO9A 4HFRA 1FLNA 2OGZA 1Y9ZA 1FMLA 1WP9A 4E7PA 4JIMA 2FHSA 3UW1A 5JNSA 2NU7B 3O73A 2H63A 3AWIA 4YJ2B 2QLMA 1UC9A 1ODTC 1KZ7B 3E5HA 1AIPA 5G4LA 5D6OA 4E33A 1N92A 1MN6A 3ICVA 4PONA 1IMJA 1WCXA 2DOKA 1A50B 2G9ZA 2X42A 1KJWA 1CQPA 3L1VA 1RP1A 3PQ4A 1WHSA 4Q9JA 4LHSA 1JZTA 2P78A 4UOZA 4YP9A 3BE4A 1FQWA 3PWSA 5EG5A 3AR2A 4RF5A 3UB4A 1J4AA 1SULA 3ESDA 3R2JA 4BVFA 2X15A 4BO7A 1KI8A 2OFOA 2HHHB 1VMIA 4OHCA 4OH7A 1MUUA 2ZJ5A 5BSKA 3L6OO 5ENVA 3ILSA 3Q3IA 4DLNA 4ZO7A 3A6EA 4URZR 1U2TA 5JR3A 2HK9A 2REXB 2CXHA 1Y48E 2PZLA 3T3MB 3CNQS 3AKZA 1A9PA 2B35A 4FLEA 2VYND 1NWCA 3H4IA 1XZIA 4FWIB 4RFSB 4HLNA 4UMFA 3LTEA 1Z74A 4R83A 3HUFA 1WB6A 1NDQA 1U90A 1KTVA 1XMIA 2GK7A 3PFFA 4CCWA 3MK31 1NQUA 4IILA 3ROFA 1MOQA 3W5VA 5BVGB 3LXMA 3ZLTA 2NSYA 4C2BA 1NW3A 3Q6NA 3KQTA 2R0QC 2ZE8A 1YQ9A 5BQOA 3H65A 4KO2S 4NV3A 4BNMA 1BGVA 2Y2UA 4JEMA 4BEVA 2DH5A 2V5AA 2PL3A 4ZO8A 5B36A 4EG1A 4DSZA 4KZPA 5ALIA 1E4OA 2GCNA 4G8CA 5TPZA 2F17A 1P0PA 6REQA 4FCVA 2HHLA 1F20A 4EA8A 1ENZA 1XP5A 3UGTA 1NXTA 2O4CA 1C81A 3F6YA 1AKVA 1P2TA 3VPAA 3J81A 1TYZA 1S2IA 3LKVA 1ZM3A 3OC6A 1GOTA 3IODA 2HNBA 2DLDA 4OD0A 5G40A 2ECKA 3ZK7A 4BAGA 1CIJA 3PE6A 3PNBA 1C0EA 1L9KA 4YWJA 5ALUA 2XWPA 3ABQB 1TMOA 4JVMA 2VT6A 3RF6A 4ENRA 2Q6IA 5AUQA 1NPTO 3WGLA 1YUMA 2K7ZA 1X19A 4N6OA 4UMVA 1EDOA 3HPRA 4J3FA 4JSYA 4TMFA 1K6MA 4KCGA 6NULA 2E89A 4O29A 5EERA 2Q4RA 2XHZA 1RLOA 2YZNA 2J9YB 3C98A 4W5HA 4FHDA 5DHQA 1VBNA 3VO1A 3DZ8A 1DL5A 4BIMA 5K0CA 1W2HA 4WE3A 2M6KA 3C3XA 2OBFA 1T36A 2VR1A 4HNAA 3W79A 1J8DA 4MQBA 1U8UA 1DIGA 3WO1A 1VL2A 1Z2DA 5L7WA 3U4QB 1WB9A 1QIMA 2A58A 4XOUA 2QR5A 3DZKA 2ODQA 4TVOA 2IHVA 1Z6GA 3QU4A 4P7KA 3W0LB 5J2UF 4AY6A 1JR6A 4JOQA 4HJRA 4D6PA 1M1XB 3PCRB 5AUPB 1AVTA 4P7JA 1VBKA 1HGXA 1H94A 2HO5A 1VTKA 4M54A 3WKCA 4H27A 5JQGB 2E5FA 3TRIA 1QK3A 2H7YA 2ZRMA 3LJKA 3NBKA 3PJEA 2NXJA 4I9HA 4XUDA 4G5YA 3TX6A 3WLEA 5EHXA 2C5GA 2SCUA 1XRLA 1ZRNA 4M1KA 4QUEA 5ERGB 4HDSA 5EIAA 4QUHA 3Q85A 5FBVB 1KZ9A 1II8B 1TA4A 4ZZ0A 5DSXA 1CUWA 5IKXA 4AM8A 1PL8A 1KEZA 2X19A 1SCAA 1UQRA 2YV5A 3EXG1 5GV8A 5EXEA 3GW8A 1L4GA 2AOUB 4I55A 3IEKA 3G17A 5CXXA 4JHXA 1J9GA 1E4EA 4HDRB 2AVDA 4M38A 5FTLA 1N6HA 3Q11A 4DZZA 4N8DA 1PG5A 2O3RA 1ETHA 2UZIR 4GVPA 3EOAI 4OA5A 4U2BA 3EIXA 4LY3A 3MTIA 4M0FA 5SY4A 3M49A 4R1OA 3QJ5A 4R2KA 4DA8A 1CY4A 1THMA 4P35A 1DKPA 3EGDB 2BRUA 2KLHA 3DBOB 5LZ7A 4D9GA 1H5UA 1OGIA 3UT0A 2BR5A 4UQPA 3OE5A 4LDAA 1L4YA 1N3BA 3DO8A 4RA9A 4WVLA 3V8RA 1PZGA 1R6TA 2ODBA 4XVUA 4LX0A 1AX9A 3U09A 3HU1A 3IA2A 1HETA 2RHDA 5IPFA 3UPTA 4F3RA 2QMOA 3NO4A 4A0RA 3ZWMA 1XXLA 2XF2A 3FFAA 2QXYA 4RL6A 3DM5A 3SZUA 1V7PC 4MRRA 4ZAWA 3T99A 1SKAA 3MFYA 2ZJFA 1P45A 1MKYA 1M2WA 3TZCA 5DNWA 1PYGA 3A9SA 2I8AA 1CRLA 1C1DA 1TM2A 1N2JA 1L5SA 2YQ4A 3CT6A 4HDMB 4MA5A 1R6UA 1IY8A 1YMVA 3JAWA 4LZNA 4HQLA 1J07A 4MVJG 5I9IA 2V5VA 2BLNA 3KB2A 4GPAA 1EGMB 4IXNA 5TVKA 4B4VA 1OC4A 4LF8B 1JVSA 1I51A 1U0TA 4JJ7A 4BE9A 1PFGA 4IFIA 5HKKA 3VNSA 2NTYC 4XZ3A 2RAPA 4J4BA 4NX2A 2GWHA 4K86A 2O8EA 4YROA 2FMKA 3WGHA 1PJ8A 1T9GR 4B0OA 5LN1A 1PE0A 2C96A 3BD9A 4M8SA 3SWWA 1KBZA 2XCUA 3IP3A 1T2NA 2B2XA 1KJ8A 2R6CA 1DWPA 3H83A 4TVKA 4EKGA 2QM7A 2XJ9A 2BGNA 2WE7A 4PYNA 5E9QA 4CEIA 3L9WA 1WF3A 1HDIA 3MF4A 3BK1A 1BJTA 1G9XA 2FSPA 5BQFA 4JY7A 1FJGB 1UKEA 4Y9TA 3OX3A 3RQSA 4DYVA 2CNLA 2ZRQA 2ZBDA 4HGOA 2LGJA 4C6TA 4F8EA 1SUFA 2BSXA 4KVZA 3KT3A 4KBFA 1W0KA 4M4SA 2XRZA 4NG4A 1QV9A 5E6RA 3TGPA 1IEXA 5J4KA 2YTZA 1EFPB 4MLCA 4UM9D 3WC4A 3L8HA 4U7GA 5KDOA 4KLCA 1ZBDA 2I7TA 2ACKA 1JTVA 2ZWIA 1QO0A 1WETA 1P9OA 3GP5A 2UUCB 1KP9A 1YUNA 5DHRA 5GAJA 3SYTA 3TTYA 5IXYA 1J99A 3JQGA 3KFLA 1N2CA 1JB9A 3ORHA 2G9RA 3D3KA 1KJ9A 3WNZA 1IXRC 3PLNA 1UBOS 2N75A 5F9FA 5EE0A 1GTZA 1MVOA 4NQZA 1Z16A 4ZI5A 5JEEA 3PGKA 2CV2A 1YF3A 2F64A 2RCNA 2WEKA 3KTOA 3LY5A 3OCYA 5JCZA 5JAMA 4FSHA 1JEOA 3LBAA 1E3QA 2Q9AA 2IEIA 3MUEA 3OVMA 1HG0A 3EQ6A 3WBFA 1TRHA 2BBTA 5DNUA 4L22A 4QYMA 2W6OA 3GWGA 2QU7A 1JHVA 3WGGA 1HZJA 1WXWA 2UZAA 4AROA 4DJEC 2ZCUA 4RCYA 3DV2A 4EZEA 3N7AA 1CJCA 1XMVA 2OAEA 1NLUA 4L2IA 4TLLB 4Z9XA 1RJDA 4Y98A 3TMAA 2VJCA 5JAHA 3LHIA 3EEYA 5TPWA 2GD1O 3B2QA 3IPRA 3ICPA 4EHKA 2R87A 1VJCA 3B82A 2QRKA 3E27A 4HWPA 1PQYA 4AI6A 3SZGA 2WTAA 4HHEA 2EG9A 3CLRC 2QN1A 3F9IA 4C6HA 3GJ8A 4FHEA 4LBVA 3RW9A 1H8HD 2ZXUA 3DB1A 3HUEA 4KO8A 3H2KA 1YZGA 3IE2A 1LY1A 5SYNA 4OI0A 1UQUA 5KWIA 2H1LA 3KWMA 5BMVF 1PFWA 1QRRA 2B4AA 2R8ZA 4TLBA 1TC2A 4DUPA 1C7EA 1J24A 4RH1A 1IN4A 4NZMA 1XWWA 3P1JA 1V43A 3LQFA 4L15A 1MO3A 1CY7A 5JG7A 4PTYA 1D0SA 5ALXA 1UBGA 1CEQA 1IZ8A 1HEYA 4G0XA 2OYCA 4W5RA 4F3TA 1WMAA 1UKBA 1XCJA 2FZGA 4LRSB 4MV5A 1HYGA 4E08A 4NFSA 3WSWA 5HUJA 4DR1B 4H1UA 4PC2A 1YQTA 3IAS6 3INNA 4FD2A 1TGYA 4TTAA 4E13A 2CJPA 1CX9B 2EZTA 4D79A 2GCOA 4B76A 1PR1A 3ELYA 4KQ2A 1Y4ZA 2ZIXB 5K8CA 3KCNA 3GJ5A 2O06A 1FFBA 2EHJA 4P0TA 2FEPA 1V3QE 2OZLA 4KAFA 3R0QA 2PS9A 4L9RA 4CL2A 5I7WA 1LPNA 3L84A 4LAFA 1T0BA 2M6RA 5FJIA 4MPRA 1I6WA 2OO3A 2ERYA 1QHFA 4MK4A 2VDWA 5DN6A 1W94A 2L17A 2NT4A 1NKSA 3WJ2A 1ZH8A 1A1VA 1B0PA 4RMNA 4BWVA 1L7PA 4KUHA 1U4SA 1YS2X 2LV8A 4YRCA 1X6VA 4H7KA 4RELA 4UTXA 3CS3A 2ONZA 4LJ7A 4ZZ1A 4PX5A 5KU7A 5G3ZA 1BX3A 3HA5A 1C9YA 2A2ZA 1DG9A 4R2XA 2PGDA 5LWHA 2IF0A 3WVNA 2PLAA 4EPVA 2DR0A 1NVWQ 2BE9A 1JR2A 1XSEA 1P7PA 2IUSA 3PC3A 4DMUB 3SVTA 3I04A 2FWAA 4K6OA 1R0SA 3OKAA 2W43A 3KUXA 2F43A 5LB4A 1LRJA 4CL0A 1G8YA 2J46A 4XQEA 2G36A 3GLTA 3UPUA 4I8IA 3PQ2A 3FPAA 5E6UA 3BWMA 2V74B 3ML1A 1J33A 1U7PA 3MQFA 3PD0A 3NH9A 3TLCA 1NE7A 2H5LA 1ZIOA 4D44A 1MVNA 4I46A 3EGXA 3GLIB 3HJFA 1I5OA 2NUAB 4IHQA 3JCZA 3MXTA 1CUJA 4ZVMA 3UCEA 3LSTA 1OLXB 1OYVA 1P9NA 1QFYA 1TYAE 4MMYB 1HKHA 2M32A 3E1GA 1P3DA 3EFOA 3DR3A 3FWZA 4RWEA 4WXPA 4HDOB 3ZK8A 5AKZA 4UBNA 1Z7GA 2VF2A 1HTTA 3BFVA 2J4DA 3B3AA 4O4JF 2DU8A 5JUWA 4PZUA 3OD1A 2VQ6A 3KX2A 2QD1A 1O89A 2R8EA 3BMXA 2MWMA 4J0DA 4NL4H 2C82A 5AW6A 4FWTA 5ABPA 1KI2A 1MO6A 2HK8A 2JEZA 1KYZA 1X7DA 4JLSA 3FHOA 2QYHA 2YY5A 3BM5A 3AUXA 3CKLA 4R84A 1H6DA 4YBRA 2A5YB 4TKMA 4AJ1A 3KVRA 4DAEA 5LQNA 1AS0A 1OTYA 1POXA 3EYWA 5HIMA 2PUFA 4E12A 2OZEA 1KEWA 3WLSA 1M74A 2BGLA 3U1TA 1GPNA 3ZIAA 4EMBA 2ZUCA 4RX1A 4KNVA 4RHXA 3KFXA 2BONA 4MS4B 1QDLB 3EGCA 3LQRA 1EK5A 1N6IA 1TM7E 3PIIA 3KSDO 5KYGA 2WW8A 5KNDD 5T57A 1FIUA 1D0VA 2O3QA 2RGDA 2VDKB 3IMCA 1SU7A 3FKJA 3T35A 5B3KA 4ND5A 1VPLA 3CLRD 2WI8A 4NBKA 1E7WA 2AMVA 2RHRA 3VZSA 3ZV6A 4E07A 1K6JA 3SC3A 2RHLA 4FNAA 4X85A 3QKWA 3O8NA 4LXIA 2F9MA 3L7OA 1CZHA 1QR6A 3B8HA 5CYPA 5I9MA 3UT5B 3ZDYB 5CW2A 3ZW9A 3HM9A 4Q05A 2OPBA 3OX4A 4BC1A 5HVNA 3RASA 2OC4A 2F1HA 2IA5A 3IBYA 3RS9A 2QI9C 5B1YA 1YZYA 1MFPA 2PKQO 3H16A 3IUBA 3JQPA 4KIJA 3S0JA 1I4TD 3MAJA 2FTKE 3EPHA 3CZQA 4W6ZA 5TXGA 2DKFA 1ICIA 3K8QA 1RIIA 2FP4B 4YRKA 1TW3A 2IDMA 4I7EA 1UPUA 4ZV7A 5JLJA 4XLTA 4KN8A 1FDTA 4OJKA 4QVGA 3AF1A 5K0EA 1H3EA 2QL5A 4FE4A 3TMKA 1RE0A 3CIOA 3ZVRA 2JJ2D 2DY1A 1Q0ZA 3OEYA 4GMFA 1KQ3A 4ZODA 1O58A 1HTWA 1PZXA 5BSMA 4IZHA 1RYNA 5IN5A 3ZDEA 4V1CA 1IVNA 2GFHA 1SXJD 1UDAA 4I6JA 2VSOA 1U65A 2HFKA 2ZJ8A 4LXGA 5I4IA 5JH7F 5T8KC 4JJIA 5H3LA 1QDEA 3A6HA 4KXMA 4V0RA 3MWKA 3QHAA 4CR8A 4F9TA 1EZ1A 1UM9B 4UBMA 5TF0A 1E89A 3RU9A 2UZ4A 2XE4A 3DEKA 3E2MA 4A6PA 1JHAA 1L4FA 1YTLA 4R6WA 3FFBA 4ZQGA 4D43A 4BLQA 4RPIA 4HLQB 3CF0A 2VS1A 4KLRA 1YDWA 5C52B 1QHNA 3QEAZ 3C8DA 3U6BA 1AZWA 3PT9A 1U7UA 1M2FA 2I65A 2A0FA 1CEEA 4GO1A 1A0OA 1YZLA 3N6RA 4U7TB 4UQLA 4JI7B 1G3RA 2BMAA 2CZGA 1J97A 1B73A 2AJCA 3ICOA 3LDUA 4J0GA 4V0QA 4DM3A 4DLLA 2X4IA 2C9DA 3Q98A 4KFUA 4NE2A 1JNXX 1FCJA 3VU0A 3U31A 2QQEA 5CG2A 5CTJA 2EWMA 2VP2A 2H5EA 3JARB 1IHOA 4EVRA 1XZKA 2ISCA 1NUAA 4DQDA 5CBPB 4QHSA 1QFMA 2G17A 3OPYB 2WFAA 4FS3A 5C5DA 1SHTX 4RTMA 1FJXA 4R3WA 2EJVA 1Y37A 2BUCA 4BWFB 4CMAA 4TX1A 2JF0A 4HQFA 3P9RA 2Z30A 1YJ8A 1S4QA 1WMEA 4KV9A 5ESRA 3I53A 3IEXA 3G9ZA 4WVFA 3GFBA 3BGSA 1K88A 3KZNA 5CX4A 5AFSA 3KOWA 5E9JA 1N5OX 1WW8A 2NU9B 3CLVA 3FYCA 3K9LA 2VTBA 3IIKA 3GEDA 1AM4D 4PHCA 3ZWBA 4Q7KA 1DTWB 1NBIA 1ZL2A 4QVIA 4JJGA 2G71A 1HNZB 5CA0A 2XCQA 2WQ7A 4EX7A 3KP1A 5A7FA 4P5EA 3QTBA 1SOMA 3OQOA 3I61A 3FDZA 3H2ZA 4R16A 3ZU3A 1QG2A 2LCIA 2QT1A 1SRRA 4M8IA 3FSJX 1IBKB 2HRRA 4IH9A 2Z3WA 1WZCA 4KU4A 1J70A 2I3GA 2P0AA 3MMSA 4W7IA 1RKVA 4TL6A 3O4GA 3C6QA 2PUDA 3DZIA 3GH1A 1C50A 4WK4B 5K99A 1JIKA 5IRCD 3JQFC 4JDUA 5HCUA 3W6PA 1MHPA 2AN9A 2C4UA 2R7AA 4MW6A 4JB8A 1WR8A 3U9LA 2VNSA 4IVRA 2IV2X 3JQ9C 4C7XA 3EQZA 1G8JA 4ADSG 4BJ1A 4NMXB 3GJQA 3IURA 1KSJA 4QO8A 2PCJA 3AW8A 1QPGA 1E0DA 1XEXB 3VR2D 1ZGGA 3ZV4A 2OAP1 2ZSKA 3CX4A 2VAVA 2DTDA 1EE1A 2FPMA 5A6SA 4GYKA 2LWIA 1T4DA 2IYOA 3VDRA 3R3WA 2Y1OA 2CNWA 3MLAA 4BQIA 4HXGA 1JLLB 3L0DA 5EE3A 4UASA 1YONA 1NW6A 1OFHA 4BJ3A 1SBNE 1WG8A 1E6WA 2O7RA 4WCFA 1L2TA 4AWXA 2QW8A 4LGYA 4Z0HO 3RUEA 3RM3A 5BY2A 2XWJI 2VTVA 3L7MA 2EFJA 4NV0A 1U0LA 3AG6A 2FOXA 1G21A 3CUSA 3AK4A 1TU3A 3IQIX 3LV8A 4JI2B 4B35A 5BYAA 1EVLA 2ENWA 5LQRA 1ZRHA 3AM5A 5M34A 1BHQ1 2B2NA 1AG9A 2XWSA 1S3SA 2CKMA 4MS3B 4N6GA 4TS4A 4TPKA 4DCMA 3QVMA 2FV8A 4EFLA 3RVSA 5FIUA 3K20A 3O0DA 1NVVQ 3TLKA 3WIBA 3GVIA 3D3QA 4E32A 4E4YA 1BCSB 5KYKA 3H1GA 2OSBA 4I4TA 1XTUA 2G40A 4RC9A 5D2CA 4YCDA 4IMPA 3VFDA 3LY8A 1QHHB 2GEDA 3PUHA 4C7VA 5JSQA 2QA5A 4EKIA 5G53C 1H22A 1O1YA 1JG6A 3WJ1A 2LW7A 4D2IA 4F60A 1WBJB 2CMFA 2H1RA 1R9JA 1P9LA 4MLZA 3LVRE 3NTQA 1J8FA 3G2PA 1WUHS 4MUGA 3RUDA 5B5SA 1YQEA 3W2HA 4CN8A 3W7AA 5JEDA 2R9VA 1SQSA 1G64A 2QZ9A 4JLVA 1F5NA 3M4XA 5K03A 4LSWA 3ZHZA 1UC4B 1T8PA 4Z4GA 2GBPA 2PZMA 4DY4A 2WB2A 2HK7A 1RZUA 3HN7A 1Y1QA 1NX9A 3EHEA 3LPLA 1KQFA 2EJBA 1YZNA 3D7RA 4O2BB 1C7IA 3VYSB 4MRNA 2XUJA 1VJ1A 1T5HX 2F8LA 1QO9A 2I99A 4TXNA 4DA6A 3QA9A 2RGEA 4CKWA 1JYEA 2CJYA 1UADA 3C6KA 1QVRA 4KXVA 4NDZA 4EL0A 2RGRA 3R6DA 2HL6A 2IT1A 1NXXA 2FETA 3FHJA 4KYUA 1RQXA 4PQYA 4ZCSA 4IUDS 3RC9A 1Y1PA 2ZRHA 3KQYA 4Q18A 3UJNA 2XZLA 4JLBA 4G5XA 3DVAB 2CXQA 2IIPA 1SVWA 4F86A 3T95A 3BIJA 3PT5A 2GF0A 4J9UE 1YZQA 3JATA 4XAQA 4JC5A 4OHPA 1U31A 1F6DA 1I4OA 4MRMA 1GPWB 3OTOB 4IZ6A 4RGQA 3ZDZB 1M72A 3EIUA 1VXOA 3E9CA 2D3TA 5BV8A 2CYBA 1EVIA 2B5OA 1AKWA 1FX0A 1X9IA 3AOEA 5B6IA 5HK8A 4H9GA 1NNI1 4HZGA 5IYZB 3FNIA 3I9KA 3M7IA 1P72A 2P8SA 1SELA 1NBEA 5IDVA 5C81A 1DIBA 4DLSA 1QH1A 3HKCA 2YS7A 2PQMA 2JFUA 3I9V6 5ECWA 1MX9A 2WKQA 2YHIA 4EBBA 1XA4A 2YXPX 4X6UA 2M6LA 3UGQA 3EISA 3NV7A 3CKMA 3K4HA 3KPUA 4G1FA 4IIYA 4MP6A 1JPNA 3CEPB 5L3RA 1JZQA 2DHCA 4DCCA 4X66B 3GVXA 4BGIA 1M6VB 3H5IA 2A1UB 3CGWA 3KT0A 3LWBA 3M1LA 2F8TA 4C08A 1J2EA 2ZTUA 2JFWA 3COWA 1RRPA 1IPFA 3FCCA 1L3BA 3DMYA 4DMRA 1JSRA 1D1PA 4EA9A 1QGUA 2CGEA 5K3SA 3FUVA 2A9QA 3QLEA 4ZCMA 2WB4A 4XKJA 2BISA 2Z8YM 1JX6A 1G3UA 4QELA 1CR4A 1FNCA 2OHXA 3H2BA 3KXIA 2VWQA 5IW8A 5CG1A 5I4CA 3NBMA 4WZ6A 1MV5A 5JCPA 2WBLC 4WDRA 2JGMA 2OK8A 1SZJG 3K92A 4HYTA 2RHOA 4BB0A 4LRYA 4C29A 3HCPA 3RNOA 1WD5A 4HZUB 4MULA 2XOEA 3QX7A 4ZQBA 3ECSA 5KKNB 3O31A 1MX1A 5A9RA 3BWVA 1VE7A 1BQ4A 3EXFA 1A8SA 4JC0A 2VSFA 3CBGA 4V3CA 4YEDA 3VV2A 4KDFA 2RHHA 3L3BA 3OTWA 2GFQA 4M8LA 4UBOA 2HMSA 5HQJA 1EIZA 3BL6A 2YC4C 5ILGA 3X1MA 4D3XA 3OJLA 3L4EA 3IO5A 4OSPA 4TV9B 5ALGA 4G8JA 1ZC3A 3FYUC 2XWBF 1L5MA 1N9GA 1PT8A 5FPYA 1IHDA 5COQA 2XAAA 1CRPA 3THWA 3PPWA 4N0QA 4DXHA 4RVOA 3B2EA 2F7SA 1W88A 4DCUA 4D4JA 2QR2A 5G3YA 3USES 5IUNC 5A5VA 1XYVA 2OBXA 5F1YA 4C1BA 2FN4A 4G89A 2FEOA 2X86A 1Y5MA 3EARA 2P8JA 3N9IA 5ALNA 2W6QA 5GOTA 3S5UA 3SHFA 5K3OA 3CURA 2IX9A 2GHIA 1Q83A 2R96A 3EUWA 5ARCA 3K94A 1E6UA 1U3FA 4ZCPA 4DMHA 1QX4A 3FWNA 4KEAA 2FJPA 1S8AA 5EXDA 5F5NA 1X9HA 2WA1A 3KZOA 3DL4A 3QNWA 3OT1B 1TPYA 3WNQA 3GROA 2E4YA 3T94A 5EE1A 5AVRA 3SZOA 4D9BA 1XQ1A 1FVHA 4X41A 5DCYA 4F91B 2VYVA 3KKMA 1C7ZA 4PR0A 2EFDB 1JYFA 1YDGA 4RKFA 4FOTA 1KOLA 3H5VA 3S7ZA 4PLTA 1A4UA 2J87A 1GIAA 2MOKA 4RSMA 3LYHA 1BH6A 2Q3EA 1O94C 2P11A 1NTRA 2DUNA 4RQUA 5EJMA 2V96A 2FMUA 3ZY2A 3F5QA 2NO0A 5IP5A 3WWPA 4V03A 4A82A 4AAYA 4DDVA 3GQBB 4DSOA 10MHA 4ZOAA 1A3CA 1CUYA 4YT8A 3NONA 4DWWA 1AKYA 1H9BA 3HU3A 3IUSA 3AYZB 1WHTA 1YQUA 1QRUA 3T1VA 1BIFA 1ZKMA 2HN9A 3QPUA 4MAMA 1O54A 4WFJA 2HV8A 2VDRB 3RVMA 5K0SA 4UUPA 1Z8DA 4AQDA 1C8LA 5B6PA 5FOQA 1KK2A 1XRMA 1KR5A 1E62A 1TUBA 3IQXA 4H1HA 1RXUA 2ATXA 2O0KA 2WZDA 4QXAA 4ZVKA 4A0SA 5I9LA 2H9IA 1XAGA 4JASB 4Q9NA 4G2NA 4ZHQB 5IJ0B 1XZHA 4WMLA 3WLKX 3MMZA 4F6RA 3T1QA 3N2GA 5HOEA 2H2HA 4JYZA 1AB6A 1OC2A 4KSBA 3L77A 3ER9A 4M8NE 1UJMA 4CMEC 1MRZA 3HCBA 4QBHA 4FKMA 4WH0A 1RYFA 3ROMA 2NUTA 2O7QA 3LQKA 5BNZA 5JJCA 4EKEA 2FPIB 4GEKA 5BN4B 4C7OB 1BZYA 3WV4A 4Q4HA 2O8FB 4EFDA 1R9MA 1Y8AA 2FQWA 4EO4A 1R8SA 3NM6B 2GBGA 1PNQA 1V7CA 3O8DA 3PP8A 4ZK2A 2HUPA 2EATA 3FSEA 3NIBA 4LF6B 2WICA 3EEBA 3ZOZA 2Z8XA 3KZMA 1BE8A 2XB2A 1CS0B 3GIDA 4A2PA 5A71A 3ZGZA 1A5TA 4DLRA 4R1TA 5FBHA 4J1QA 4JUDX 5LA6B 5IWAB 4LQ4A 4NCBA 3BCHA 3NJRA 2BMVA 3DVRX 3A4MA 4UTVA 3AVVA 4AMBA 3VZBA 3DCJA 2HQRA 2FGJA 4MI1A 3V7FA 1OH8A 1VA5A 3P94A 4LWZA 1I0IA 2Q0XA 3PFHA 5I4KA 1XPUA 4YQZA 1JP7A 4HGYA 3HP1A 3U7EB 3I5UA 2PX2A 4E2ZA 1DQPA 1Z5PA 4FNGA 1DIHA 4AXBA 3I2IA 4NYMQ 3JYQA 3H1BA 3FW1A 4NJOA 1N4AA 1PX0A 1KVRA 1SXGA 5HWSA 2AH5A 4GBMA 4YPVA 3OI7A 2C7OA 2HQBA 4F2GA 3QUAA 3VHXB 3ECCA 4J91A 1NVFA 1KIAA 5EWMB 1FF9A 4TYPA 2G9VA 4Q1EA 1XMPA 3V6LA 2BN4A 4IWNA 1N5DA 4GGOA 4FIDA 1L5ZA 1YR6A 4ETWA 2FZ5A 2WWGA 2R00A 1D1QA 2F8SA 4IUYA 2XF8A 4Z1MA 1OWOA 3CNLA 1CB7A 3GRCA 5LB2A 5KTNA 1YC5A 4BRWA 1T9HA 1VPDA 3DEFA 4RVFA 5FL7D 2GZRA 2GN1A 3L7YA 2ONKA 1XA0A 2CL0X 4BLRA 3S70A 4NICA 1QVZA 4NSNA 4PV7A 4LYJA 3F8SA 2PUVA 4JYCA 5HFAA 4BNDA 3JYLA 5DWVA 4KPYA 2EOAA 4RMGA 3BH7A 1ZK3A 5TMEA 4DILA 1ID8A 3R5FA 1YR1A 3IPAA 3HDJA 1OB5A 1P61B 4GAEA 4M1EA 2RGNA 5M29A 1IQRA 3NHYA 3EVCA 2QWXA 4INPA 3JYNA 4MVJM 2GCPA 2Z1DA 5E1MA 2VQEB 3FCXA 3ZWXA 4Q9IA 4E88A 1O94D 2V59A 3ETDA 4EI2A 1ATIA 3RWOA 1NYTA 5JHGB 1C4WA 1S01A 2SKDA 3RTAA 4E5YA 3M6WA 1IL0A 4MXDA 3K70C 5C8DA 4V0SA 5K0GA 2KW5A 1JA0A 2QRPA 3OZAA 4G5OA 1KEEA 4C7KA 2IC5A 4IKPA 1K27A 1VLHA 4NECA 2O07A 2PT6A 5B30A 1YRAA 3IT2A 4NEQA 3TE6A 5D3MB 1KNXA 4U2FA 4YRNA 5J58A 1GA4A 3UFXB 3AUFA 1MIHA 5JTTA 3AEXA 4PLPA 4UEOA 3MQ2A 1CU1A 1M54A 1NA5A 3CEJA 3Q9LA 3DGEC 4K88A 2GEFA 4F46A 3OOYA 3SMQA 3D5QA 1SCUB 2AEFA 3HP7A 4PY2A 3JD3A 2XTZA 3FNEA 2FZEA 3FROA 1N6KA 3HDVA 5BT9A 2EF1A 3LBFA 3QMVA 3VVBA 3VJRA 4EUHA 3BTOA 4OI4A 1AH2A 1VDZA 1JMKC 2JLSA 3GDHA 3VC1A 2NOAA 4NNJA 3EVEA 5TT1A 2DT5A 4KI7A 4B44A 2Q46A 4QUIA 3N5CA 4FGKA 2O5RA 4B3IA 1ZJWA 2YMLA 3T5PA 3BXZA 3F5DA 1XX6A 4XDZA 2QRJA 3R6TA 2YWFA 5DT9A 2C9OA 4ZAYA 5HHTA 1LSOA 3IVCA 1RC1A 2NIPA 4Z51A 3K4PA 1PJQA 1R5JA 3DKIA 3K0FB 4PLGA 4LNUB 5L51A 1LBSA 4Y9RA 1DS6A 4FX5A 3F7OA 4DBVO 4O4LB 1JHDA 3GA0A 4OKSA 1XIVA 4R98A 2OZKA 3SXJA 3KETA 4GS5A 1RQNA 2BM9A 3KLBA 3OOSA 3VYVA 3QNMA 4ASUD 3FN4A 1QIHA 5KNBH 1E7QA 1YAHA 3MPUA 2QPAA 5I4BA 1SU4A 3ZDCA 1G8KA 4MKIA 3U4DA 4TMYA 3FY4A 4CKXA 1ORHA 1ZD2P 4JVSB 5C8YA 2OY0A 2XDQB 1PW5A 1WVGA 2AFHA 1RKBA 3TQQA 3U3RA 1DE0A 4NJMB 4RK1A 3T9AA 5KYWA 1R8XA 4TWJA 2ZRNA 1ZLYA 1Y33E 3AHDA 3D81A 2G4VA 4N3BA 3T06B 3W5IA 5ALJA 1EFUA 1DC8A 3I1FA 5EWJB 3AESA 1T6NA 3SXUA 4QPPA 2F90A 2IHNA 4YV1A 4QFBA 1Z5GA 3LCJA 3S7TA 4FNMA 2ZZNA 4OH1A 3V8EA 2WIDA 2HMYB 1R18A 4JQSA 5FDFA 4BBAA 1DBPA 2E1RA 2I2AA 1LDBA 3GDWA 2AZXA 4LOKA 5EQJB 4RY9A 1B41A 1T8WA 3WE7A 4BNLA 4DUZB 1KDTA 4I4IA 1MAVA 5EI5A 2IUFA 4C76A 4ZI2A 2VOEA 2BD0A 3EUFA 2FCAA 3MW8A 3VHQA 1CJBA 1EQUA 2J5QA 3S1AA 3V7NA 2CLSA 1LRKA 3FWPA 4LTMA 3T9DA 4F1WA 4JJ6A 4ZFNA 5JXIA 2V9PA 3ZIDA 3EIWA 4M7WA 4QU0A 1U0BB 2PUWA 3LH5A 5H70A 1IZ7A 2L0XA 3ABIA 3I6ZA 2EJTA 2W2VA 3CNHA 3BCSA 4FYKA 5IK2D 4TL9A 3INGA 3BZWA 3I2FA 2DCUA 3PI7A 2XOXA 5EAIA 2HMUA 1H23A 1I36A 3WKAA 1XL0A 4X1IA 2A57A 2OVFA 2BGUA 3LGAA 4BVEA 3JWIA 3LUFA 4C0KA 2P0YA 4NS4A 4BX3A 3EB9A 2V6MA 4G1VA 3KBOA 3SFVA 3K70D 3Q2IA 4Q1DA 4XGQA 2Q0SA 1Y3AA 2ZJ7A 3U0VA 4B2PA 4XFKA 4PTLA 1XK7A 4QO7A 1SCDA 4PPNA 4X71A 2ZEJA 2XH8A 3OO0A 1NMQA 1W4AA 4K3VA 4KRGA 2FR8C 4MQEB 1CJTC 2Z0MA 3B1KA 4PHGA 3HCCA 3AQ4A 5HK9A 2KB0A 4BPRA 2ZI5A 4R1MA 4EF5A 1WBDA 1CZUA 1WLSA 1BXRB 1SOAA 3CSDA 3QV2A 1OHHD 4LVUA 4M9UA 4WXRA 2A7XA 1V16B 3VSAA 2V58A 1QQBA 4C0JA 2LD4A 3GG2A 1EDDA 2EFCB 3BUSA 1ESDA 1OXUA 2PZAA 3PR3A 5KREA 1X7HA 4MQMA 3Q15C 5ADUS 2XNSA 5HZGA 1FNNA 2P5YA 1GZUA 3RRNA 3VVCA 1DELA 2BHRA 2IYSA 3UATA 5M2QA 2JGDB 3NEAA 3O2JA 3EPKA 3WMXA 1XRPA 3FWYA 4BGEA 5E95A 3L7IA 2QE6A 3KAPA 4QU8A 4DV7B 3DDWA 3Q3GE 1EH5A 1SUCA 2LRHA 5C46F 1O95C 4UAUA 3W6ZA 5I8PA 3EXIA 2YCLA 3WHKA 4EY7A 1IM8A 4F92B 1B0AA 4XIFA 1NQXA 2Q5HA 3IHLA 3MUNA 5E7JA 4I1RA 2F62A 5CJ2A 3NWOA 5F1OA 4DR7B 2Z6QA 1N2IA 4M1YA 1Z12A 2KLBA 2PD4A 3H1FA 1RWWA 3KRTA 1KFKB 1QBGA 1XZ8A 3E5NA 1I3NA 5BRNA 2V54A 3BRCA 3FE2A 1NNEA 4IBOA 4KTTE 1OXBB 2ZRDA 1J2JA 1KJQA 3FZYA 1D7AA 1SA0B 2WTBA 3LUBA 3QU9A 4HOYA 4BWYA 1JRLA 2A0KA 4FFLA 4FB5A 2I7XA 3UH0A 5J4HA 4A8HA 5KX5F 3EXAA 1CR2A 2J07A 1KEUA 3T7JA 5EEHA 3ZHOA 1NI5A 1S8FA 1AF4A 3T3GA 1P6UA 3CH6A 3DZCA 3T7TA 2A4MA 3D3JA 2FP3A 1YR8A 4A0GA 1FS5A 1NLMA 2AYXA 3LSYA 3G2LA 3A9VA 3S2SA 3C4VA 5FT9A 4Y30A 3VTAA 5A0VA 5JAQA 2VPWA 3T4XA 1TM5E 3GRVA 1BOOA 2MMCA 2P3SA 4TXJA 4CGZA 5F21A 2HF8A 2OTCA 4IDHA 3RYFB 1T3SA 3GRRA 5BUSA 2IUYA 1MB4A 3RB8A 3ONWA 3VU9A 1QWOA 3UJAA 4BLVA 1Z68A 5B2ZA 1XT6A 2H2WA 2NZ2A 4IDNA 3RI3A 5KNBA 1A5SB 4PLHA 3V55A 2AKEA 1EWKA 5JCOC 2EYUA 2HMWA 2IUEA 3N6VA 1HT2E 3L7JA 2X77A 1CWUA 1D2CA 3H42B 4UUMA 1PTJC 3A2NA 4ZIRB 4PE5B 1EMDA 3DOEA 1Z5UA 2ZJ6A 2BM1A 1IU9A 3OJCA 2FH5B 3SJ7A 3ETNA 1ZSYA 1ZICA 5CMLA 4ZOBA 3TZKA 1CFZA 2WP8J 1GP2A 1SXIA 5EN4A 2VHWA 2G28A 4B6SA 4GKKB 1W5TA 4AT1A 1DX6A 1HQCA 5EZ5A 4NF2A 3OMWA 4P34A 4UOQA 2P30A 4MWGA 4YCJA 3B38A 2G7ZA 1UPAA 4NENB 1SUBA 4HBZA 4CEHB 1C8BA 1Z5NA 3GZNB 4JJAA 1BMDA 2RIPA 2V45A 4RXMA 5JATA 4S1TA 3WRYC 1Q57A 4QOFA 1QHIA 1L1QA 3D6AA 2QTTA 1NBMD 1FLAA 1VYHA 2BYTA 4DV5B 2D2EA 2AKYA 2Y05A 3BXGA 4XQCA 3DZGA 4I9NA 4MQFA 1NGSA 1LFAA 1HDOA 1W4CA 1VSVA 5BRAA 3S81A 2GMWA 4AJEA 5LYJB 2QTCA 4YMHA 1KMHA 1J9EA 3W5HA 3WDSA 1NM5C 2ODPA 4UEJA 4OQEA 4XIJA 5DLDA 4EHDA 3ZU5A 4EKDA 5A7GA 4BE7B 4D25A 4P3XA 4LXYA 2C31A 1GPJA 2WIGA 2XUQA 4FUTA 2QRQA 3SZRA 3A2LA 4G65A 4PAGA 1C0IA 1VPVA 3NIDB 1RRMA 1LTQA 3VYRB 1KF0A 2F3PA 1TAQA 1UPFA 4RFSA 4A91A 1A71A 4LPSA 1I2ZA 5KAPA 4KAXA 5FORA 3F4BA 3TAHA 5D5HA 2G9QA 1XEWX 2QAGB 3GEHA 4PFKA 3TIFA 4CU5A 1GADO 1Z15A 1OE0A 2X2PA 3ORYA 3QVOA 4MZXA 4EW6A 1O95D 4N5DA 4PG7A 2MSDB 4TM8A 3ZWPA 1GEEA 3K1ZA 2OSVA 8OHMA 2VHTA 3DC7A 3M6IA 5GJVC 4X3OA 2UVQA 2Z6AA 4L5CA 4ZVTA 4Y1GA 2ZYWX 1UC8A 3OT4A 2XLCA 3MMXA 3X1DA 4EQ6A 5JXWA 7MHTA 3KTFA 3GRUA 2XMZA 4MH0R 2YMMA 2FN9A 3FOWA 2FUCA 4PSVA 4D56A 1L5FA 2XXBA 3AGQA 3B7WA 3IR5A 1E8NA 3WRXC 2AKAB 1YRWA 3URMA 1SQGA 3IIJA 1YQQA 5E7QA 3ZH9B 3A26A 3QVLA 3CPSA 2FW6A 4EA6A 1ESMA 2FN8A 1QCCA 2W4QA 2BP7A 2CC2A 3TN7A 3ZWDA 5J2UA 4HVAA 1BXGB 3FDJA 3WRXA 4EHHA 3NMUF 1T2AA 3HVIA 4P31A 4IHJB 1SC6A 4MCAA 1W4RA 3NYIA 2KBFA 3EQ2A 4DBLE 3JS5A 3RVPA 3QF7A 1B6RA 2O5CA 1JAYA 1ODIA 2HO4A 3NRBA 3AHEA 2ALJA 4LNAA 3DG9A 3N39C 5FBRB 2JI7A 5AK5A 1ZCFA 2I6FA 4XWWA 3ZCVA 1P4RA 4BV9A 4CFZA 4PZDA 2ZBPA 3KL2A 3U13A 1LVUA 1QVAA 2ILVA 3H8WA 2GF2A 3GN1A 4D3DA 2BKLA 4RYLA 2GVZC 1SUDA 4MPDA 1N34B 5EXSA 1HE5A 3ROQA 4LJKA 1OYWA 1KDVA 2YUIA 3U4QA 3DDCA 5KQRA 2O8BA 2P9GA 4TTQA 3E35A 4JLKA 4URHA 3GVHA 3JVUA 2AN3A 4KW7A 4KZKA 3MMPA 3H9UA 1SC9A 4ITUA 4C7MA 1NVBA 1ZSNA 1WSAA 2KSQA 1GG5A 1BYUA 2QY6A 3BXEA 4MR9A 1IN6A 1CB0A 1YS1X 2D7CA 4GL4A 4HN9A 4AUEA 3BGIA 1TJNA 1WXXA 1PJZA 3U4GA 1RLTA 4ND3A 3RU3A 1PGPA 1E59A 2VYCA 2NQTA 3BAFA 1S96A 2ZYAA 3K1JA 3K5PA 1G7TA 3A14A 1U5AA 4L0MA 5TIIA 1T2DA 3V33A 5AK0A 1SZCA 1PGNA 2O2DA 2QROA 4AS3A 3RSSA 2EFYA 4S3MA 5C1BA 1RNLA 4JX9A 1SBYA 4ZIRA 1ULUA 3DBHB 1CZRA 5EY5B 4F4IA 3H97A 3MGAA 4DCTA 3TEJA 4TROA 4HRAA 5K20A 1EJ2A 4ZT5A 3G0HA 3DNPA 2VDOB 3LS2A 4MW0A 4R9UC 2JEYA 4NNOA 4UD2A 3C87A 1M9NA 2FI1A 3O6VA 2I6XA 1ULZA 1PZNA 2VK2A 1FP2A 1SKUA 3NHFA 1R27A 3RFCA 3TDMA 5TT0A 2ICAA 4PBSA 2Q3HA 4OX9B 3WIEA 5JS1A 5K2MA 3G59A 4XTCS 4BNUA 5MFZA 1C9NA 4CTMA 4DSUA 1IHYA 5EGNA 4HQOA 5LNK6 2ORWA 3WV5A 1CUAA 2VDJA 2VRCA 2AI2A 4M55A 2X7XA 1R0WA 3LI2A 4N5MA 1E7MA 1EG2A 1MRNA 3N70A 3P2EA 1JEAA 1JZSA 4L08A 1TQDA 1K0UA 4CHTA 1KC1A 1QH9A 4HS9A 5CHYA 3PEEA 4RPHA 2X6QA 1L5KA 3EPJA 1PKEA 2C7BA 1PKXA 3KKKA 4WI1A 1PS0A 3CQ9A 3AERB 3UTCA 1YKFA 1UH5A 1MB0A 2ZRAA 3A0RB 4AZWA 1UWCA 1GN8A 4DVJA 1N9ZA 2ZIZA 1E1CA 3S40A 3HJAA 3ZJTA 1POWA 2CCJA 5AIAA 4RVUA 4QFMA 4FXOA 1W581 1UAGA 1OTHA 1ODFA 2P9FA 4LMRA 2A35A 4WSOA 3W2EA 1RMYA 2Q5JA 2QVGA 4AWAA 2GD0A 2B8JA 3IBSA 3ORFA 1DAOA 1R8JA 2N46A 5ENDA 4ZCIA 5FLYA 5IDQA 2C2MA 4AZSA 3GC6A 4RACA 1GTL1 1V6CA 3D0QA 4YJFB 4XRRA 5F2NA 1YFJA 1B15A 3QQ5A 1TF2A 3REFA 3TL6A 2AFIA 4AZ3B 1Q1BA 3JASA 4DV3B 1XJQA 2XGMA 3IV6A 4OYLA 5AM5A 4MRPA 4W9MC 3E7DA 1DOAA 4B87A 3U17A 3CB4A 3O2SB 4QKQA 5I6DA 1HH4A 4FXPA 2EBFX 1TK2A 2FB9A 4Z0TA 1IBSA 1MT3A 3GDGA 3FHTA 5TQ2B 1RRKA 3MJFA 4BXOB 4FHGA 1ISPA 2HA6A 1KYXA 3V9PA 2ZCJA 5E2IA 2WWVD 4D3ZA 4QM6A 4Q9KA 5F1KA 4L6IA 3H0EA 4UJ5A 2RHCA 2MSLA 5F3WB 4ARBA 2C7VA 1T0HB 3BE6A 1EFPA 5TGTA 3VXKA 2WE8A 4P9NA 2BGJA 3RWMB 3V42A 4MGEA 4CMJA 5AM3A 1GYPA 1TXGA 1AUOA 2VEOA 3FNBA 5DIZA 5DXAA 3RTCA 3VC7A 1WCIA 1DEKA 2SBTA 3S2YA 3VOBA 2NN3C 4NCAA 2G04A 4IDQA 5G4KB 2IHTA 2NVUB 3UXMA 1QGAA 5BV7A 5KWEA 1R00A 1C9KA 4WESB 2VJPA 1KVTA 5EMKA 5JT1A 4ND7A 1H8EA 2EX4A 3KVYA 4FMCF 4NPAA 3FBTA 3C6YA 1Q11A 2FF5A 1GRQA 1VMKA 3N2NA 3OEHA 4F84A 1XFDA 1RBMA 2EV9A 2V6IA 1IOVA 2XHEA 3LIIA 3GAZA 3QF4B 4B6OA 4JBGA 4CLDA 5BMVA 4P98A 1R0LA 1I4LD 1H0RA 2ZWOA 3H6GA 5BW6B 3AJ8A 3RDPA 3UW3A 3ZQ6A 1Z2CA 4MIYA 4N7RA 4CKZA 3OKFA 2XNDD 1XP8A 2JGRA 1IPHA 1NJ1A 1W5AA 3GFFA 4ARSA 4JI0B 1X80A 3DLIA 2LCQA 3V34A 1N77A 3E22B 5IASA 1GQRA 3DAPA 3KR0A 1J8MF 2Z95A 5GONF 4QWWA 2ST1A 5TDHA 2C97A 1X1DA 2BH9A 1HBJA 2OB1A 5F5XA 5F3DA 3HVRA 3IP6A 3MLEA 4UHEA 5DGIA 4PW0A 4NU8X 1T8RA 1TIPA 2VK8A 2BFFB 1I9CA 1P8AA 4FCTA 1W46A 3PSHA 5A4JA 4G2TA 3EAFA 5L6MB 3N07A 2XIQA 3SNHA 2IU3A 1KQNA 2PT5A 1W36D 1FDUA 2AZTA 4D4HA 3MWFA 4RVCA 1KSGA 3BTVA 1N4DA 3VQTA 1E32A 3E8SA 2C59A 1YKSA 4HO1X 4J6EA 1PWEA 1NZDA 1Z35A 3QVVA 1YE3A 4PNPA 4RIFA 3RHZA 4EYKA 5CHEA 2E87A 3P0RA 3N7UA 4WK6A 2JB9A 4LOHA 4DR6B 2V0CA 3PV0A 2QI9F 3D6FA 1V5IA 4G0QA 4KOEC 4B5KA 4J9VA 2DTEA 2XVAA 4AVYA 1VJDA 1HZZA 1I3KA 3T12A 1TQ6A 3WADA 3E9RA 3PQ8A 1OFTA 4XPIB 1HUQA 1N2XA 1NJFA 2X0KA 5ALVA 1K7EB 1H6BA 2HRQA 3ONVA 5D84A 4KR3A 2H65A 2HYDA 1XQVA 4HKTA 1GTMA 1EBFA 2E4WA 5E38A 2ZJBA 5KVCA 2BRUC 4U9IS 2DT8A 3A9CA 3ADOA 5KYYA 1BHSA 5JY1A 2QTRA 1ENYA 2NUPA 3UK6A 4RV9A 1FYXA 4F5DA 3GT7A 2BH2A 2E21A 4IXMA 4FDLA 3BVPA 2PZKA 1ARZA 2XCIA 5C8XA 5EHNA 1OI3A 1WNFA 4KRXA 4OHBA 2VDQB 4AICA 3P9PA 3TLAA 3DOHA 4LBYA 3KZKA 1NMEA 5IBPA 3PJGA 4ILKA 2IPLA 3ZI4A 1GA6A 4AY2A 1EVQA 221PA 1VLLA 4TUYB 4BBPA 3HR4A 5LP6F 3L07A 4RV5A 1DIOB 5D01A 4HQ0A 2AWNA 1W48A 2JCVA 2PBZA 5DOVA 5J23A 4RXTA 4OK5A 4PG4A 1UDBA 5LOVB 1NQVA 1J06A 5EFZA 2BBWA 4DDHA 1FZTA 3QXCA 2EWVA 3G1UA 4PXYA 5I48A 1JQBA 2A0WA 2AXEA 3HEAA 1B3RA 3DAOA 5UKDA 1L4EA 4R5MA 2OMEA 3L43A 4RM2A 1E1RA 1JI3A 5B1EA 3SYMA 2VRBA 3P2YA 4KXNA 5T41A 1GUAA 5TPZD 1Q0SA 2BUAA 3UJ6A 4JA0A 3D3WA 4NCNA 1KA9H 5H3CA 1H65A 3LRTA 1ZJJA 1DQYA 1R3UA 1UK6A 5JVDF 1TQHA 2B61A 4BCCA 3K1YA 4YONB 3QSYA 3X1JA 4YV0A 1IC6A 5HFJA 5AK6A 4ZYYA 3RANA 4BKOA 1F8XA 2J3IA 3CMMA 3GRPA 5KWVA 5C80A 3RIMA 1TTQB 2H17A 4UMDA 4URXR 1LSUA 1GILA 2EC5A 3OIVA 1ZM2A 1W5SA 2GBIA 2WK1A 2WSBA 4IHKA 5KWSA 3DAGA 4YCNA 1Z28A 1LZLA 2HGZA 1FFGA 2ZUTA 4ATNA 1C1HA 2QR3A 5A3VA 4YA6A 2PK3A 2QMYA 1USIA 2GXUA 4UEQA 3TSAA 2VUTA 1JG1A 2WFMA 1UBRS 2L2QA 4HEA1 3CU5A 1KYVA 5CRIA 3PFNA 4L8WB 2OBYA 3GJZA 5HMLA 2P4SA 4H60A 4Q4DA 5H4GA 2FMHA 4RTRA 1XZEA 5B2EA 1COZA 1BWPA 4LE1A 4HN4B 3UAWA 3MXOA 1P77A 2YCBA 3LP8A 2OXCA 1UEIA 4XX0A 4YP0A 2YQ5A 3D8TA 2BGMA 4P2BA 4DXAA 3MJ4A 3UT5A 1U3GA 3KSZO 1IBCA 2ZT6A 3VR4H 3WIUA 1GJRA 4RH0A 3D1LA 5H59A 3EX7C 4DMFA 2Y0CA 5JH7A 2I34A 4JJ4A 4E5KA 4YYZA 1VKHA 3B6ZA 2C77A 3PNQA 3QBJA 4HMPA 3TS1A 3CUVA 4EELA 4EG7A 2PMKA 5JYCA 4R69A 3JTEA 3OFVA 2IOQA 2OKCA 1WZ2A 2CD9A 3D3NA 3SQDA 4CFYA 3U44B 3K5WA 3H9EO 5BN5B 4BKMA 1AD2A 2WIBA 4OREX 4RTLA 1VHJA 1JHOA 1REQA 1XQXA 3FUWA 4FBLA 2FUG6 2GPTA 3FFTA 2LDBA 3GJ4A 3OHSX 1P7VA 2Q99A 3FUUA 3F3YA 1AHHA 1XU4A 3JD4A 4BV3A 3MHPA 3HSSA 1G4HA 2YJGA 2GB4A 3BJRA 1G20B 1UXHA 4QXQA 2ZRKA 2NXWA 1LQ2A 1NYRA 2XUPA 3RO7A 3SZLA 4A0HA 3D6VA 2J6CA 2VYFA 3QWBA 1SXQA 1EFCA 1RTKA 3CXRA 1NFRA 3EYAA 4Q0MA 1M2JA 2FR1A 4A27A 3IEPA 2P65A 4DNFA 4R8KA 5TC4A 5AW1A 3ENKA 4C43A 5B1DA 4BZPA 2YVKA 3TUZC 3ZE9A 5IBCA 2CHGA 1X42A 1TYCA 2XQVA 3FPCA 4FGWA 3BB1A 3NFYA 4AJNA 4PSCA 4AKSA 2UXCB 2YC2C 3HADA 2ZUWA 2WINI 8ABPA 4B4UA 1JNYA 1W85B 1V39A 2IZ5A 1IUPA 1JHZA 1GYRA 2GA9A 4GWGA 2GKGA 3TGWA 1GV0A 4L8YA 4LMBA 4NU5A 5CA1F 1IN8A 3O92A 3OSUA 3UJCA 4WX2B 1A8IA 1DADA 2CJWB 2EJWA 4PANA 4X1YB 1CY1A 2X6TA 1UXIA 3HWX1 3OPYA 3EFEA 4C3OB 1Q95A 2QVYX 3ZGYA 1BAPA 3CF6R 1L4BA 3F74A 3R24A 4FGUA 4GVLA 4O8CA 4BQSA 5AVYA 2FRDA 5LFAA 1DZIA 4X8OA 2REBA 4BEWA 1H1LA 5HKKD 4XB6B 4FZVA 3HYSA 3PXAA 4DNQA 4OATA 4BNNA 4RJ2A 1NYQA 3BDVA 3ZV5A 4PG5A 2RKOA 4KX3A 2VRWA 4HWGA 2Q7OE 4FGZA 4KITB 2INGX 4KXFB 2GESA 4MCHA 4K05A 1S1MA 2B98A 4G07A 1DTWA 5AI0A 4XUGB 3FLBA 2Q9BA 3I2JA 2BMWA 1RAHA 2X5OA 3RAFC 2YRXA 4AULA 5I7UA 2VNJA 2NU6A 1LFDB 4OQLA 2QRLA 4ZAZA 1SC3A 2NV0A 3H3FA 5FAXA 4G67A 5TQVA 1W0KD 4U0JA 3KNZA 1XMOB 4ITRC 1OU0A 4A5OA 3DBVO 1MB9A 2V65A 4GPD1 1X74A 1XNHA 1YHZA 5GTDA 3EZFA 2ESRA 1PR9A 3IAHA 5KTMA 2J5RA 1QO0D 3TB6A 2BBOA 4KE9A 4ALLA 3B85A 4WOBA 3ONDA 1HMPA 3JVEA 4JR2A 1WS6A 1X8LA 1H6AA 4FJ0A 4X84A 5IBQA 1EYZA 4GGPA 1LPSA 2AQKA 2AC4A 4X63A 1UXOA 2X40A 4U2CA 2VNAA 1DV2A 3AF5A 3DF7A 1ZM9A 3K0AB 5ALKA 3SDZA 4ND8B 3UMBA 1KFEB 1V1JA 5J4VA 3L92A 1C5KA 2IY8A 1J25A 1QGZA 2JHGA 3PJRA 5CCDA 4R51A 2VZ0A 5IULC 3G0GA 3PLRA 2OHGA 3IUMA 4ZDIA 4WBNB 1P91A 4TVBA 4JLOA 2G77B 3KQLA 4KQFA 4QJBA 4J1NA 5IKPA 2AD1A 3FNFA 2X3YA 3ERCA 3RRXA 1Q1NA 1TD1A 1DKNA 1NXWA 1N3YA 2WJVA 1SQFA 1W36B 4TKLA 5C3UA 1KZGB 1EINA 2CMHA 4NCHA 4NMLA 3RIGA 4ZTZB 3GLFB 3A3KA 4BMYA 1JXAA 5FUXA 3BFKA 3Q5DA 5T3UA 1F8UA 1YK1A 1I1NA 4R1NA 4I3HA 1SCNE 3VR4A 3G9XA 3UMCA 3AF0A 1PJ4A 4UE2A 3H5OA 3NGMA 5DYWA 4ARAA 2OOSA 3RC2A 5KQPA 1PX2A 2R1ZA 3SYRA 4M1ZA 3HXMA 1UINA 5AKXA 4I4NA 4O02B 4O3FA 5I7HA 5LQCA 2ERXA 1L7BA 4XYGA 2Z56A 1WZUA 1ZA2A 2GK4A 3GDFA 4YMWA 4U63A 1Q0PA 4EUEA 1X8XA 5DN9A 5ARBA 3KYIB 5K4GA 2Z1NA 2C5EA 1S4MA 3CNEA 4KLAA 2G07A 1W29A 5C0OE 1YI0A 5A6VA 3SLRA 1G8FA 1G2PA 1JR4A 2ISSD 2PR2A 3NAGA 1HLFA 2C3MA 3L01A 3R8XA 1XVLA 4FHFA 2XGOA 4ROTA 3ZU6A 3G0DA 1PR4A 5EPUA 7AT1A 3V5NA 3MAGA 3TQTA 3CA8A 2GJ8A 3ZXXA 3JYHA 3KYDB 3EC1A 1GUDA 2AG8A 1EM8B 4JD5A 4M99A 3PKJA 2JIMA 2PVSA 1P0QA 3HXPA 4DR5B 2A4KA 3DKKA 2H00A 4BMVA 3AL0C 1YAJA 3B2NA 4IZIA 3BWXA 2EERA 4GZMA 4NAUA 4Y2JA 3HJCA 4EHLA 5DN6D 1EXVA 1VPWA 1PCXA 3TRFA 4YRZA 3SQXA 2ZUSA 1WMFA 4US0R 3WK8A 1U5BB 4YUXA 2C7QA 5KSWB 2HBRA 3MTGA 4UTNA 1W1UA 1GN9A 1P2FA 4FFOA 3VPBA 2ZU6A 1UMBB 3R8FA 1SK8A 5DCLA 1G8MA 5HXAA 3SM9A 5JMTA 4X5OA 4J6FA 4Q9LA 2HHAA 3LHDA 3R7WB 3QPAA 4YQEA 1O5OA 3RVQA 4ZT6A 3WWYA 1XDSA 5EINA 5HA5A 1ML4A 3RS5A 1FDVA 1NYLA 2GK6A 5BN3B 1XLTA 4YN3A 4K0KB 4Q3EA 4CQLB 1EP9A 5DEOA 2PVPA 3VGJA 1IQPA 1XE3A 2JAWA 1JFVA 3LXRA 3LOUA 4R2MA 5FYQA 1SZPA 1EEXB 3V4PB 2ZM5A 1AHNA 2PO7A 1OVGA 2WM3A 4ZYWA 2AQIA 4QBTA 4ND2A 4HGZA 5C32A 2PS0A 1UDWA 3NZEA 2IS4A 3BDIA 5K3FB 1IJEA 4HY3A 2PKEA 2BKVA 3ZDRA 3MHTA 1F14A 4KRFA 1P0CA 1WV1A 2H9YA 2ZRCA 4TQ9A 4XXHA 5JXGA 1KVUA 3MJVA 2PS3A 3BYZA 3IKJA 4WDQA 1YI1A 2OXIA 1G291 2JCBA 1XQ9A 1MC8A 3AFNA 2GD2A 2QTVB 2ZUBA 1A9YA 2YHSA 1P60A 3VI4B 3OUTA 1TUGA 3GU3A 1ZGJA 2VJMA 1A96A 1E7YA 3BL5A 3IDAA 2RHTA 1G59A 4M2LA 1SVMA 2F2TA 3AH8A 4GP6A 4HWKA 5B3JA 3ZIAD 3LHFA 3RYTC 3BT7A 3TNJA 2QN2A 2C78A 4Y6GB 5ED4A 3WFIA 3G0BA 4QAJA 2I2DA 3K9NA 4BAUA 2V55B 4HH4A 2ZITA 4IIFA 2X5NA 3C3JA 1WP4A 3SYKA 3VH4A 1GDHA 5AK3A 4Y1FA 4EX6A 3G2IA 2FSVA 1EX6A 4TL7A 2OR3A 1K7YA 2RIRA 4W1SA 2RONA 5CVJA 3T9CA 1XDWA 1OXKB 3ZDAA 1RE1A 4FDAA 3UK2A 2WJZB 5KQSA 1E58A 3GBPA 2AV6A 4YLEA 8AT1A 2JVIA 2WYHA 2KBEA 3NP9A 4HAXA 1Z2EA 3STHA 5KTKA 3K0EA 2VRNA 4K9KA 4PAQA 3Q8XB 1E5TA 3DZHA 3FMVA 2CLHB 1OWPA 1VM6A 4GR9A 2LKDA 3A1VA 4BO4A 2Y1KA 4EO7A 4PNZA 4HPXB 4DDWA 1OBFO 3IEVA 1YJCA 5G1NA 4WCFC 1LJ8A 4YASA 2ZBQA 2FMXA 1HEIA 2OORA 2H1WA 3MELA 3R5JA 4BECA 3DQQA 3R77A 1XTJA 3CCCA 2ECFA 1VL8A 2P9EA 2EKZA 2V6FA 1SVLA 3CTPA 4PLWA 4RQBA 4P0QB 3QELA 4P80A 4KVFA 1QG0A 2P2NA 1JTFA 1HE3A 5LKAA 2CNDA 3S99A 3RREA 3I32A 3UOGA 3RUFA 1PFKA 1YFKA 2CW5A 4M1WA 3WL5A 3JZMA 4F2DA 2EVWX 3EBPA 4QYXA 4I1YA 1XEFA 1T5TA 4QPDA 5CFOA 1EDEA 5CT5A 1ETUA 3CRRA 5LWQA 1Y1RA 3E5RA 1A8QA 1GTG1 2HA2A 3CSSA 1DJPA 3WMWA 1XPJA 4WN3A 5AUNB 1J9ZA 1O6FA 1BS9A 2OAGA 5COAA 3L0YA 3TBHA 3UAGA 4AG5A 1E2EA 1GLGA 1HNNA 4CKEA 1PWXA 1YIOA 3OCZA 4UNQA 1Z7EA 2I4RA 2HWKA 4DGSA 4HNUA 3WBBA 1L8OA 6LDHA 2FDCA 2OO5A 2C7GA 1I4WA 4JEHA 2CVHA 2PAFA 3GFPA 3UC9A 3VTZA 1A27A 1E1DA 2EFEB 1S1CA 4PYJA 2Q5LA 3EFHA 4G85A 1SVOA 2JAPA 2VUUA 4GEGA 2G1UA 4V0ME 2NTVA 3TQIA 4NAVA 4EG6A 4D3YA 5DM1A 2I3DA 3SBEA 4FR2A 1WCWA 4YJ3B 4L5YA 4C06A 1JT9A 2ZYVX 3IB6A 2JGEA 2EU8A 2QF7A 4MP8A 3PL5A 3ACCA 1F1JA 2FXIA 2JH8A 3I6QA 1XHLA 1AK9A 3O1IC 2H2AA 1JJVA 4MVWA 5FR2A 4WLVA 5KUTA 1LLFA 4TTPA 2CHFA 3GDOA 3KYCA 4B3BA 3IOEA 1I3CA 4K6CA 4W82A 4DGQA 1OQAA 2J3QA 4LDNA 4URWR 3UICA 3WISA 1GTRA 3MINA 3DE6X 3K96A 4MV8A 3ZWAA 1YIDA 1U3UA 3T1YB 4OQZA 3UQZA 5HQTA 1AE1A 3AIOA 3LT2A 4U7PB 2BSQA 1G8SA 1M6NA 1D1TA 4BC0A 5L45A 1QJCA 2WYWA 4XW2A 4JYAB 1PG2A 3HSKA 3I73A 4A03A