2ARKA

Structure of a flavodoxin from aquifex aeolicus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
SNAMGKVLVIYDTRTGNTKKMAELVAEGARSLEGTEVRLKHVDEATKEDVLWADGLAVGSPTNMGLVSWKMKRFFDDVLGDLWGEIDGKIACAFSSSGGWGGGNEVACMSILTMLMNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVDGRKELLEKIRKDPARFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a flavodoxin from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Electron transport
molecule keywords Flavodoxin
total genus 52
structure length 187
sequence length 187
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2arkA00
1AKWA 4ICIA 3JSXA 2QMYA 5LJIA 1WSWA 2Z9DA 3NHYA 2Z9CA 5BUCA 5LMCA 2FZVA 2M6RA 3GAMA 5JROA 1H66A 3O2NA 4GI5A 4C14A 1C7EA 1CZLA 3OVMA 4F8YA 2N1MA 5NLLA 1ZX1A 1J9GA 3QE2A 1J9ZA 1KBOA 5TGZA 4LA4A 5B3LA 4U7FA 1F4PA 4YQEA 1X77A 1D03A 2ARKA 2KLBA 2BN4A 4FGLA 1OBVA 3HR4A 1AG9A 1D4AA 5NULA 1FLDA 1YCGA 2OHHA 1YKGA 1J8QA 3FX2A 1FLNA 3NHSA 3NHRA 5EMNA 2FCRA 3B6KA 4HEQA 3K1YA 4ZVMA 5LJLA 4PU0A 4U7GA 2MWMA 1AKTA 3OX3A 4C76A 2F1OA 3GFQA 2FVXA 1B1CA 2QX6A 3NHJA 1AKVA 1WSBA 3R6WA 3ESYA 5FX2A 4QODA 2OHIA 2KQUA 4ZVNA 3U7IA 3W7AA 4HS4A 1BVYF 2BMVA 4NLLA 2A5LA 3HLYA 3OX1A 1AKQA 1JA1A 4BMPB 5A4KA 4J8PA 4YAWA 1T0IA 4OXXA 4BMOB 4YAOA 2OHJA 4ZVKA 2QX9A 5B3KA 2D5IA 1AKUA 1I1OA 2WC1A 3D7NA 3P0RA 4QOFA 4DY4A 1AMOA 1QHEA 1CZUA 1AHNA 3OX2A 3KAPA 1CZNA 3KLBA 4LTDA 2RG1A 5LLDA 1FLVA 1QRDA 1XYYA 1VMEA 3F90A 5LVAA 2M6SA 5LBUA 3HA2A 5F51A 1NNI1 4QOEA 3FW1A 3NHFA 3OWXA 1SQSA 2W5UA 4ZVLA 1V4BA 2Q62A 2QX4A 1J9EA 1CZHA 1YCHA 3ESXA 4GQIA 5F12A 4DIKA 1QR2A 3TE7A 1SG0A 3B6IA 4D02A 6NULA 2AMJA 3U7RA 1FX1A 4FGJA 3G5MA 3ES9A 1RLJA 1RTTA 4S24A 3NHWA 4FX2A 3K20A 3FVWA 4ESEA 3KEGA 4N82A 4Y7CA 3W79A 1ZWKA 3EYWA 3GFRA 4PTYA 2R96A 4CETA 3FNIA 4QOHA 3W78A 2FZ5A 3B6MA 1FVXA 3N39C 1GG5A 3NHUA 4H6PA 2BF4A 1JA0A 2HPVA 2QMZA 3QFRA 1BU5A 3L9WA 1TIKA 5EA2A 2FOXA 2V9CA 2GSWA 4H2DA 4QOIA 2BZSA 1TLLA 4XDGA 3W77A 2XOEA 4CF6A 1DXOA 2QWXA 2Z98A 1DX9A 1FTGA 1YOBA 1OFVA 2FLVA 3B6JA 1FUEA 3F6SA 1RLIA 1DXQA 1XT6A 3F6RA 3LCMA 2Q9UA 3N3BC 3N3AC 3OJWA 2FAXA 1C7FA 3SVLA 3OJXA 3ESZA 4C0WA 3OWHA 1CZKA 1T5BA 5FUQA 4GR9A 2V5VA 4LAFA 2V5UA 2MT9A 3UXHA 2X2PA 4YALA 3NHPA 2OYSA 3TZBA 2FX2A 4Y9RA 1XI2A 5F4BA 4U7HA 4PTZA 4YAUA 5EAIA 4QOGA 2QR2A 2ZKIA 3GFSA 4LTNA 4M0CA 2BPOA 2B3DA 4XDHA 3KAQA 1H69A 1ZWLA 1CZOA 3NHKA 4C0XA 2MTBA 2QX8A 2FDXA 3EDOA 1YCFA 1YDGA 3L9XA 3ZHOA 3F2VA 1OBOA 4DILA 4NULA 4Y9UA 5LBTA 3RPEA 4LTMA 2HNAA 4R81A 3UXEA 3NFRA 1YRHA 2MOKA 3NHLA 3NLLA 2XODA 1D04A 2X2OA 2Z9BA 3QFCA 5FA6A 3S2YA 2HNBA 4N9QA 4N65A 1FLAA 4QOJA 1AZLA 1KBQA 3TEMA 4YAFA 3O73A 5ULLA 1QBGA 1RCFA 1CZRA 1E5DA 2R97A 1AKRA 3FJOA 4FGKA 1XYVA 3LT5A
chains in the Genus database with same CATH superfamily
4J0GA 2E6KA 5HJ7A 2YRFA 5LSAA 2JLSA 4QUBA 3O1JC 4FSXA 1FS6A 2QVYX 3MAAC 3N2ZB 3AL0C 3FYUB 5AK3A 4YMGA 4I55A 4G0XA 3ZDFA 2H4ZA 1OVGA 3GEEA 4K2HA 5AW3A 2VBCA 4PSDA 1YA6A 4YP5A 1W2WB 3TAUA 2GJ9A 5K0TA 2IYOA 3S1SA 4DY6A 5F52A 4P31A 4Q4DA 2CDNA 1Z82A 3MBKA 3TTWA 4NJMA 4DM7A 1YDMA 4EJSC 3LY5A 2JFYA 2PRJA 2XXAB 4GX0A 1OBVA 4QPJC 1A27A 4CIAA 4RY0A 3ISTA 3KHKA 2VXYA 5HQ3B 2GLUA 1RR6A 1YIOA 1T8TA 2C5HA 2QUKA 2O7NA 4KIGA 1K7SN 2ZXEA 1Y8QA 2UVQA 3GMIA 4BQPA 5LP1A 3P0HA 1EDDA 2I4MA 3BWVA 2PGDA 3CNNA 3JASB 4NBSA 5AYVA 3TNDA 1SEVA 3GP8A 3Q0TA 1UXGA 1VZ3A 2YZNA 1Z8HA 2DHCA 2EW2A 3G5UA 3I0NA 4Q6BA 4QODA 1N3BA 1O58A 3K1TA 3ACCA 2W6NA 3N07A 1PBTA 2OE2A 1ORWA 16PKA 1DDOA 4XSGA 1YQTA 3Q9LA 4PIMA 3G0CA 1LSOA 1GPBA 1RI3A 2IIQA 1AUPA 5I9LA 2P2CA 2IEZA 3G6WA 3HCWA 1O94A 4L3VA 4LPKA 1KJZA 3SF8A 1WMEA 4MVXA 5L40A 4LCJA 3R3HA 3HXMA 1YS7A 1YQXA 2NXNA 4LK2A 3IP8A 4M98A 1KO5A 3BWEA 5BWNA 4GFDA 4XQ0A 4ZTBA 4LDZA 2R6FA 3OT1A 5DNYB 4Q1VA 2X41A 1KE1A 2G09A 1KSGA 1A50B 2LE0A 4PC2A 3RCBA 2BEKA 2QX4A 3ESXA 4GQIA 1G98A 4BXOB 5LQSA 5M04A 4JLDA 5FWDA 1JB1A 5KSWB 3EVGA 1BE0A 1SUBA 2ADOA 2C5AA 1GQOA 2FF5A 2FYTA 3MJEA 4ML3A 2ZT8A 5SZJA 4DV6B 2AK2A 4PYNA 2I8LA 3GEHA 4Z3DA 4EF6A 3ZS9A 1QO9A 2GYYA 2VDNB 2XWQA 2JI8A 2JZNA 4OUKX 1AM4D 2DCUA 4Q05A 2G0TA 2LDXA 1FPMA 3KQQA 5CXXA 3OLXA 2WYOA 4GYKA 2AYYA 1QHGA 4CV3A 5I7WA 3P9PA 2WB2A 3PQ7A 3AFNA 4IV5A 4IW3B 2IYZA 3AP1A 5JXHA 2IYYA 2BHTA 3GCXA 2GEJA 4JEMA 1G8SA 4WLFA 4KR7A 3OOEA 3ZGYA 2V6FA 2R1ZA 4S1NA 3E4DA 2I3AA 4GNKA 4J0FA 4R01A 3W9UA 1XZPA 1OWLA 5ALVA 2PYDA 2XQJA 2WWGA 3CF4A 4DIEA 4I50F 4Z53A 5DU2A 1EK2A 3ZNNA 2JJ2A 1GEEA 3K16A 4Z5XA 3IOYA 4QVGA 3VU0A 1KJ8A 2VJMB 3D1VA 4ZAFA 3TN7A 4F3NA 1JFLA 2CHGA 1N75A 1Z75A 2QP3A 2N0SA 2QG9A 3VR2D 1FTSA 5I3ZA 1DX6A 4D8WA 4BGUA 3JQ7A 3QZUA 1GUYA 1Z6TA 3D4IA 2ZIGA 4IHKA 4X71A 4B74A 2PMFA 5IW8A 4IV0A 1VHLA 1VGQA 4BX0A 4BBJA 1FLAA 4YRCA 3R20A 3HDQA 2JD0A 1QSGA 2ZRMA 2JK0A 1V2GA 4M1TA 3H4VA 4WLOA 2WMOB 2AUTA 2IDJA 3ZE6A 1XZKA 4P7BA 1KQOA 1OZ0A 1ZM9A 3CHYA 3LIPA 3KYCA 3KTOA 4FBMA 4S1VA 1W30A 5ICFA 2PLAA 4DC0A 3LKBA 4A5SA 4DV5B 5ELXA 1Q17A 1IJEA 4G07A 1T4CB 5FPPA 1VJ0A 1DKNA 3QHPA 2Y66A 4UMDA 1QIMA 1QVRA 2WG1A 4JH0A 4UNSA 4D4JA 5GZ3A 3K9CA 1FFYA 4XOIA 1JQBA 3OZXA 3PXDA 4IWNA 4NZZA 4BGDA 1QK4A 2Y4NA 1SKQA 2HJHA 4QOSA 1A9ZA 2QAGC 5AOAA 4I5FA 2R7NA 4TL9A 1LA2A 1ND5A 1Q7RA 1R74A 1I2CA 2QZ4A 2WAMA 1JU3A 1DQYA 1TDJA 2XCOA 4NCNA 1X7YA 5C51B 4IIEA 4CG1A 2PZ8A 4J4BA 1IN6A 1JAZA 2DFNA 4K6CA 4QQ8A 5AI6A 4ZQHA 1AS2A 4RIGA 4H7EA 1DINA 5CDYA 4BNTA 5GINE 4PLHA 4U2FA 3R7FA 1NQ5A 1D8TA 2JJQA 1AKVA 1X1EA 3GJ0A 2OQIA 4PX3A 1FTNA 3QVSA 1NDUA 2WKPA 2XH8A 3IQXA 2C2WA 1YR7A 2VUUA 4O8ZA 5D5HA 3SJUA 4HRAA 1M6WA 5J3JA 2XUGA 3A9VA 3UK6A 2C7PA 2I2FA 3DLHA 4R1SA 3CB2A 1Y7IA 5C1PA 3MB5A 2FUCA 2WHXA 3EJWA 1GQFA 1YBMA 1H9BA 4OU5A 2OV8A 1OI3A 4NV3A 4ON9A 1UWKA 2ZKLA 2VEDA 1R5OA 3FHOA 2NO4A 1JW9B 3AZQA 3GL9A 4K6HA 3ZHYA 4CE6A 5CA1B 2XVXA 3QBVA 3SYRA 1RQRA 2YVUA 3KB8A 3ZGLA 1JHVA 4JVOA 5DOZA 3GZJA 1WU7A 1N5LA 1ZMTA 4UVHA 3TKYA 1V0JA 1ZGJA 1YS1X 1PGQA 1REQB 4BGEA 1VB3A 4BFLA 3C15C 2HJWA 3DGFC 3QKUA 4NBVA 1WF3A 5DI3A 1SCBA 3A3PA 3EC7A 3F67A 4FNGA 1ACJA 2EF1A 3EIHA 2NV0A 4JT8A 4L74A 3LX5A 4LZLA 4P36A 3CX8A 2C94A 1RRMA 4LIPD 2VDMB 4HDQB 4BZWA 5EP1A 1CV2A 4FU0A 2P7HA 5AM5A 3KAKA 1E3JA 5DMXA 5AW7A 4BE9A 1XCMA 4FE3A 5LC1A 2EKBA 3WLTA 5FUMA 3U4QB 1P8JA 4CIWA 5E1DA 1HFWA 3BMXA 2YHSA 4M38A 5M3BA 3CTMA 2GFQA 1WKVA 2I4OA 1E3QA 5COBA 4M0DA 6GPBA 3X3HA 3L0YA 2VJPA 4OY3A 5BW4A 4L7VA 1B4DA 3Q8MA 5K8IA 2LW7A 3GD5A 2YWRA 3I9NA 5KTYA 2Q0SA 2QEQA 5BR4A 1U9YA 3GT0A 2QTLA 5DCYA 1GQYA 2Q46A 1P2GA 3FI0A 1K7EB 1Q6ZA 2BKEA 2VWPA 3D4LA 2B3DA 3H2ZA 2VWHA 2OCBA 1ST2A 4HNRA 1V3UA 2EGHA 1WQ1R 1A82A 4JX8A 5I7UA 3GEDA 5C7OO 1AK9A 1SD1A 1YVUA 1Y5MA 3PCRB 2XB9A 4F6RA 3MN1A 3Q3JB 1AU9A 1QH8B 3HFRA 4IWYA 3SR3A 1J20A 1Q74A 4TMXA 1YMUA 2NYAA 3TXXA 4B75A 1YI1A 4N65A 5FPYA 1W5BA 5CYPA 1EGQA 1U02A 2HHAA 1QTQA 3KIPA 4WZAB 1VI5A 2CUZA 5EIAA 4CM4A 2Q1TA 5G0VA 5ADUS 4YAGA 2FW7A 3COZA 3AM3A 3AR4A 3PDUA 1JSXA 1ZOIA 2O57A 1ZGAA 2OV2A 1CRLA 1IK6A 1Y9AA 4M8KA 1JDBB 4YWJA 3Q11A 4WOCA 3SVZA 2H5EA 1DJLA 3JQEA 3G8DA 5CLHA 4CMGA 4MUIA 1BO6A 2QYTA 3N2LA 4JT2A 5AM1A 3SHOA 5BR8B 2F8TA 4V1CA 1OTYA 1RKBA 1J2EA 2EP7A 3AF0A 2GXAA 3B7WA 4N8DA 2QIPA 4JIGA 3A1SA 3B1WA 1E0KA 2CLMB 2TMDA 1E5VA 1OPRA 3ZWAA 1GG2A 2RSLA 3DD5A 5HXAA 2FPPB 2RGDA 1PYDA 3Q87B 3X1KA 1U1CA 1P1BA 5DHTA 4ZT6A 2R8PA 4E51A 1NMYA 5JCXA 4OLAA 5JQWA 2JRLA 2WU1A 1I01A 2HU5A 1VIMA 1XQYA 3GFQA 4GP6A 2JEOA 4P53A 4X7PA 2D8MA 3UWDA 3ZU2A 4F5DA 2X1MA 3U44B 4WY5A 2HAEA 4V39A 1EIWA 2Z58A 3DOFA 3BQNB 4RS4A 1QG2A 4OF4A 4OMDA 2A94A 1D0VA 1KGDA 3JYOA 1C50A 1XZAA 4WN3A 4XX1A 4MMXB 4X94A 5I7SA 1PGJA 2G0NA 1VHWA 1MJGM 3EWSA 2VHWA 3DMYA 4MUHA 4WTOA 2JCBA 3DTVD 5J59A 4RTRA 4KRYA 3WA7A 1NL3A 3IE0A 2QDKA 4M8IA 3KKZA 4IDCA 1K7CA 2W2VA 3O92A 1S4QA 4OGWA 4UATA 1JDBC 4ZQFA 1Q84A 3MM4A 2EJBA 1QHIA 2HRRA 2OHXA 3ESDA 2RBGA 4LVCA 1OH6A 1UBLS 4RK6A 1ODJA 5G1NA 4INZA 3UMSA 4YXFA 1D3AA 5DIZA 1JT9A 4X62B 5ICCA 1TMGE 1SBIA 1T1EA 4G2TA 3M70A 2GF9A 4HXYA 3W79A 4Q15A 3WB9A 4CV2A 3VSCA 3SE0A 3TQRA 3OSUA 1Q0HA 5IDVA 4V1CI 2XMSA 3CUVA 2YVQA 3F6BX 1EG7A 1WUJS 3E48A 5KNDD 3D0KA 1EVYA 4IXDA 1E5TA 1H0SA 4DQLA 1VJRA 5ILGA 2SCUA 1N92A 1NJ2A 4FK8A 5DT2A 1SBYA 1KYXA 4FDVA 4HAUA 5CLGA 3QLUC 3KQHA 2BONA 1ZVVA 5DLYA 5T8KC 3U9TA 1WKBA 2Q5CA 5HHTA 1XMXA 1WO8A 1AQIA 1JSZA 3RHTA 4D98A 1PT8A 1W34A 2PS0A 1VG8A 3QX3A 5CB4A 2XMQA 5JAIA 2FSPA 1QTNA 1O6ZA 1I94B 3NO4A 1F0KA 3FM9A 4CF5A 5KI6A 1RYNA 5JATA 1LF5A 1X8XA 2RC6A 1YF3A 1ONNA 1FMJA 2FX2A 3TTVA 4AUKA 5A06A 4QOGA 2RI0A 3E82A 2VH5R 2ZUWA 1M54A 4LVNA 3ME5A 1KDOA 4R1MA 1YRLA 3RIYA 5FPTA 3A32A 1EFUA 2CFCA 4PLWA 4BAUA 1UFKA 3BPSA 1RWPA 1ZP6A 3RIXA 1AKEA 4LDAA 3ANLA 3EXFA 4MPTA 3U09A 5FI1B 3LBAA 3D54D 5FWXA 4L5BA 5FJIA 3G5AA 4C1BA 1T5OA 3UJNA 1GUZA 4AXBA 4MKIA 4D3DA 1BD3A 1HDZA 2GGSA 3DYBA 1Y9EA 4UE2A 2FUNB 3K8YA 4YV1A 1THTA 3QXJA 4HB2A 4KN6A 4KQ1A 1GFIA 1W88A 1OD6A 1YKSA 2ZCVA 3FYUA 4O4IF 3VYVA 1TLTA 3FNBA 1U1GA 1MJ5A 2I76A 2WA2A 4IMPA 5E6UA 4WGFA 3QPVA 1E32A 1FFXA 1WXXA 2G36A 2QF7A 4JA0A 4RVNA 1ZDMA 3URMA 4YCMA 3WGVA 5BR1A 4QDZA 1FE8A 5HEKA 1F2TA 1C7RA 2ZYUX 1R0WA 5BR7A 3TQHA 1DEOA 5BURA 1Z36A 2YUIA 5BVHA 1NT2A 1GHTA 5ENZA 3B9RA 1UJMA 1YB7A 3E3OA 4X95A 2O52A 4D1YA 1NXVA 1S2GA 2QMOA 3V46A 4RA6A 4UOZA 4ZDIA 2YBEA 5LJLA 5IM5A 3KB6A 2JRCA 4GPZA 2IZOA 4JVNA 4EG4A 2UVPA 3JD4A 2FVXA 2AI1A 3JQQA 2D1YA 1UAGA 1N5KA 3AZOA 3H5TA 1RKVA 3FCOA 1WCWA 1TEVA 4GM0A 4LJSA 3AVTA 3G8CA 1QGAA 4V0MA 4YQZA 3LRTA 4TVKA 1TRKA 2QLTA 5A4KA 3QRWA 4AM8A 1X42A 1DJPA 4MEAA 3T7IA 3TPFA 2A30A 1P0MA 3VPDA 2M1XA 3G8YA 1FFSA 1IIRA 2GZSA 2YV5A 3F90A 1U2RA 1C8VB 5JSKA 1E66A 1UP6A 3LNTA 4OMFG 3ACDA 3L8ZA 4M7OA 4XWYA 2H92A 4GHWA 4KGZA 4QOEA 4B6FA 1N1MA 4RDXA 4MWOA 1LRKA 3MD9A 3JWEA 3ZWKA 3AOGA 4DIKA 4F4IA 5LZ4A 5AJYA 2OGZA 3THYB 4CKZA 3N8GA 4BNJA 1VB5A 2Y2VA 4R2IA 1ZHOA 4FYHA 1WABA 3DH0A 2DOKA 2VPXA 3ZJTA 1DAPA 3V1NA 3EWIA 1JT2A 3DDNA 3CBQA 4FXPA 5LXTB 4DUGA 5FBRB 1YZQA 4W4TA 5ALJA 4PAOA 4YYEA 2YN4A 1T36A 2Q0QA 1DV1A 4IXNA 2JK1A 4EJ6A 5D8DA 3ZWVA 3TAXA 4Q4JA 4X1KA 1S1MA 3OPMA 5CK5A 1GL9B 1PK9A 3F5FA 4MCAA 1C9EA 5EMJA 4V0KA 5F7OA 3V6LA 3BRQA 3N2GB 4KPYA 1T3LA 1R6BX 3FR8A 3JATA 2G82A 4PAMA 1IN5A 3OMXA 3FWHA 1ZH8A 3RBZA 1OYYA 1XNGA 3EGXA 3IT1A 3HO1A 2XQGA 1UT8A 4JVSB 4KVFA 2JGJA 1G16A 2ZS9A 3PTLA 4IDOA 3LD9A 4PYQA 4U2DA 2NIPA 1FU8A 4RGBA 3ZCXA 1YK1A 1MZVA 3D31A 3PA6A 3DKPA 4JI1B 3WJ7A 4OB8A 2VNKA 4ROTA 3Q10A 2AJLI 3UEOA 3CMMA 1B76A 3UCXA 1VJGA 3FGZA 3MMXA 4KO3S 3QUSA 2QTAA 4JYBA 3MBOA 5LMNB 3ASYA 1XMJA 2HNBA 4B71A 1ISJA 1FVOA 2G7ZA 2J4FA 3QOXA 4AYXA 1E5DA 2N9UA 2AG6A 2N1BA 1DIBA 4YNBA 2O2DA 3PD7A 4ZKEA 5T3YA 2ISSD 5JCPA 1OC4A 3JTEA 5CH5A 5FO0A 5LMCA 1XMPA 1U2EA 2C5SA 3V2GA 3HJTA 1Y5LA 3DTNA 4HHEA 4E2YA 5I01A 3BRSA 5JTUA 1RWNA 1U2GA 1G0OA 5KJ6A 2E37A 4MUGA 4N0EA 4TWAA 5T4FA 2ZROA 3OC0A 3UYLA 3EF3A 3AM5A 4R1NA 4PS0A 4EY5A 2Q7XA 4JDPA 2BM1A 3CWZA 1NUAA 4KVAA 4I1YA 1BROA 1SAYA 2C00A 5K6AC 4PQEA 2QW8A 1BE1A 5BSEA 3EOAI 1W4RA 1PE0A 5AHXA 1VLHA 3SE7A 1H23A 4A8HA 4BEBA 1UZMA 1ZIPA 3OIUA 3KPVA 3U17A 4K0KB 2DUNA 3QUTA 1YE3A 3K8QA 3UH0A 4BX9A 2AEJA 1M6YA 2W4MA 2G5TA 2JKYA 3DL0A 2F1OA 3AEUB 1FNDA 4MQ5A 3EZGA 1E1CA 3DNFA 4FKBA 5LZ5A 2ZUCA 3R7SA 4RFLA 5FX2A 1XOIA 1O77A 4EG3A 3WA6A 1OFTA 4M53A 2C7VA 4WZBB 2RHGB 3UF0A 1NPYA 4AJOA 2H7VA 1GAQA 3ZK8A 4Y1EA 3LC2O 2J46A 5ADVA 3PNQA 1I30A 1ZOPA 3KKMA 4PZUA 5DB4A 2QRVA 5IVDA 4AU1A 4Y67A 5H68A 3D6FA 5E1BA 2ZRDA 1SXGA 2P65A 4EJSB 4OIFA 1V26A 4FPXA 4PINA 4NMHA 3Q4GA 4CWAA 4DR4B 4ZOLA 3DE0X 2H65A 2IODA 1ZXBA 1RNLA 2CT8A 3D64A 3LBNA 1LDNA 1FW8A 1J8DA 1I6MA 4RENA 2ZJ5A 3A7EA 1AS3A 5BMVF 2AR0A 3AI3A 1Z18A 1PEAA 1T6BY 3KJZA 3OLYA 3Q8LA 4HDKB 2PO7A 3DCIA 1IAVA 5BVHB 4PCUA 4WA8A 4UDXX 5AKYA 4PGMA 4CEHA 1GZUA 3SX2A 4Z8XA 1MAVA 5E7QA 3BDAA 3TOSA 2XT0A 5HWSA 1SZJG 1XCGB 4DR1B 1WULS 2GHIA 2X5OA 2ADFA 1U7OA 5E8RA 4DDWA 4G63A 4KVGA 2XKBA 2B83A 4F1JA 3TUZC 2KLHA 3GDWA 1XT6A 5LB4A 1HM5A 2GK4A 3AR5A 4RKRA 2D74A 1B3RA 2I3DA 4HH0A 4XQ9A 4U6SA 2VT6A 4AO8A 3QV1A 1A7UA 3C16C 2FZWA 1TAHA 4YUAA 5I3CA 2BFCB 3NBUA 1AGNA 1GY8A 4KBGA 4WLVA 4TL8A 4JNCA 3BSSA 4B4DA 3G0HA 2J3JA 3OF3A 4UM9D 4LN1A 5L4NA 4Z1MA 2PUVA 4RYDA 1ZIDA 3HCEA 5ISMA 4OXIA 4B3HA 5KNDA 2O0JA 2QLNA 4LXHA 3SP1A 1C7IA 1Q3HA 3CA8A 4OHPA 1U8UA 3BK7A 4UREA 3TG2A 1N5JA 4MXDA 5K4GA 2VJKA 3DHVA 5FOVA 1XZFA 4XPIB 5K7SA 4OEHA 2MIIA 3NOQA 2KW5A 1JG7A 4U9UA 1OLUA 3NLLA 1FUUA 3R0IA 2J45A 1BS9A 1H6CA 1POXA 4YBRA 4C9BA 4E31A 3NGLA 1U65A 4XWWA 2OKGA 3CVJA 3QMVA 2V4UA 4QNMA 4QICA 3C97A 3LQRA 1AKRA 2CEKA 1WIWA 2OT3B 1SCUB 4B4UA 3GNLA 3QKIA 1APBA 4W1QA 4BC1A 3H65A 4J6FA 3GH3A 1NVDA 2YIMA 2ZSJA 2ABWA 2H51A 3BILA 4HBGA 1NI4B 4JENA 1Z47A 3X1MA 1JUDA 3OESA 1M2JA 4P08A 2BTEA 3FOAA 3WKBA 4JJIA 1CC1S 3V8NA 4JJAA 2XMCA 5D51S 1C7ZA 3K9HA 3RUCA 5A4FS 2VUHB 1E0SA 4K9LA 5EPUA 3I32A 3LF2A 5ILQA 5CFQA 1V8PA 5HRUA 4DJDC 2JIPA 2W0MA 3INYA 5F2EA 4C30A 1QM5A 4FEYA 2XXJA 4DDVA 2VJAA 3TPZA 4Z7QB 2A9RA 2ZRFA 4RF4A 4WZBE 1G17A 4OMUA 4O2AF 1ORTA 1J33A 3OQPA 3RAFC 4P5DA 1PX0A 2DP4E 4FQ5A 4NBUA 4ZZ3A 2C20A 3A1NA 4WN9B 3CLVA 1YOVA 1T29A 1TZBA 4JEUA 3ILHA 1ZH4A 2PLNA 3R8CA 1R9GA 3C1UA 3D0RA 3UUFA 3WJ2A 1U5AA 4CIXA 4CF7A 3A9SA 4TV9F 2V6GA 1E3DA 2ZRPA 4ALJA 5IFKA 1UOQA 2BLNA 1AKQA 1PUIA 1XMSA 2NWQA 3AIIA 3B52X 3WYNA 5LL6P 4MIYA 1I7LA 3MCUA 4L02A 5CVVA 3ODPA 2BEJA 3LH5A 2GR9A 3DTYA 5DM60 1U3GA 5HG0A 4XWAA 1SVNA 1ULZA 4BX8A 3DXYA 3TGPA 3KX2A 3RADC 5B30A 1EFRD 4HH3C 2HMWA 4KXXA 4AQYB 3PFHA 2W8BB 3L8MA 1SG0A 1OH5A 1HWYA 1Z0SA 4YB8A 3DBRA 3G5MA 3GUCA 1R88A 2LKCA 2QLMA 1U3VA 3ANXA 4J1TC 3WJ1A 5JAUA 2X6TA 4ZODA 2FRVA 1XJQA 4D0RA 4DB4A 4N82A 4I3FA 2HYIC 2EFHB 1U4NA 5IC5A 1NMEA 4C3VA 5GJWC 1MB3A 5U1PA 1XRMA 3ZDCA 5JUWA 1M7GA 4DYHA 1SQGA 1U1FA 3V1UA 5LDDC 2SKDA 4C0LA 1YVEI 2HCRA 2CV1A 1F2UA 2VUSA 4GZ3A 2BRUC 2CLCX 5E0OA 4TV9A 1PJSA 2PA0A 4YIKA 1XZDA 5AJVB 4D99A 2C0CA 3P2YA 4HN9A 4MCIA 1NOKA 5KMGA 4CQMD 2I6UA 1YMQA 3I9FA 3FAZA 1ZITA 2RGUA 4IF4A 4OM7A 1L7XA 1T9DA 4IHJA 2VTVA 4AO7A 5BW6B 5BV0A 2JGLA 5HM8A 3MT0A 3DAOA 3EUWA 1QKIA 1UT6A 2FSSA 1JFTA 3QKWA 3NFYA 4CNBA 3DULA 5JAZA 4GSYA 1RLOA 2G6TA 4PWZA 3JARA 2R62A 3VZBA 3WGTA 1L7DA 3OQVA 1W46A 2C8KA 3GJZA 3C8DA 2BFWA 3FDJA 3OY7A 1WB4A 4RA9A 3H2GA 2XRZA 3MRSA 2WD7A 5I8PA 1E62A 1NBEA 4AKTA 3EZNA 2RMKA 4GKKB 2VP9A 2ZVPX 2OCPA 1V6CA 3IAUA 1IPEA 1P4JA 5DKFA 5TS2A 3JRXA 4NP6A 4ARZB 3CSSA 4HQ6A 3IELA 4W6ZA 4Q3DA 4A8TA 5JXIA 8ADHA 3QUCA 3LVQE 3H1EA 2JH9A 4TTQA 4UULA 1YUBA 4KXWA 2OEPA 5BN4B 5CLJA 2CV0A 1SU8A 1XJCA 3QIAA 2SHKA 4AKEA 5ITWA 1YK0A 5LD2B 3VBEA 2HK7A 3ON5A 2CUTA 4PHHA 4DDMA 5JARA 1GPNA 1JZTA 2H7CA 4HLUC 5LU8A 3HPRA 3NYQA 5FTJA 3GAMA 2QUBA 2CLSA 4GI5A 1S96A 1YR6A 2QM8A 2I1VB 2GCOB 2BEWA 2F1JA 4F4CA 5NLLA 4R6WA 1A3CA 4G5QA 4IKOA 4O4LA 3RYCB 1OASA 2AFIB 3OFVA 1DG9A 3PQEA 1UEJA 4LDJA 1GKLA 5SZHB 1ODCA 2ARKA 2WSLA 5ERYA 3MA0A 2QZPA 4MHOA 1NIJA 1IOVA 3EXFB 3VDQA 3IAM1 3SVTA 3GROA 4ZT3A 4AZVA 5JCJA 1I5OA 1FUYB 2IUTA 2CXXA 5F1YA 1M7HA 1P3DA 1T13A 3HA3A 4N5IX 1T15A 1X8LA 1VLLA 3CZQA 1JZSA 3I28A 3P9IA 3PGMA 4GKAA 1N7HA 1CJSA 4HPWA 3PEWA 1XTIA 2O50A 2CXPA 1V8BA 1WSBA 5F35A 3RREA 3IILA 1W0CA 3N7AA 1KQGA 1DLIA 3V7YA 3GARA 2ZSIA 3DCNA 3W6ZA 1K5HA 3HK2A 1A8HA 1IOZA 2GPWA 4OXXA 2Z4TA 4YACA 3GLGB 1SH7A 2B1GA 2OLJA 1T9GS 3IDOA 3X44A 5C8XA 4X41A 3KJGA 3S7TA 4QTUB 5DULA 5HKKA 5JNRA 3T1VA 1V7CA 5CAEB 4CF4A 4URHA 5T4BA 1LTKA 1MJGA 1ZI6A 3CIOA 4FINA 1AN0A 2VZ0A 4LNAA 3HCDA 3T5DA 4IY1A 4HGZA 5H3HA 3FTEA 1BGVA 1RHUA 2CK3A 3B5EA 2V59A 3DZKA 1IB0A 4HOYA 4ZD6A 1NQWA 2NSJA 4UD2A 5D3ZA 2QDXA 2QNRA 3ELUA 5DM0A 3VHLB 4TMFA 4C0QC 4DA9A 1O9BA 2DY1A 3A2NA 5EP2A 3IV7A 2L0XA 3LWNA 4X1YB 2CMDA 1XZLA 1EDOA 3LC0A 3RLIA 3NPMA 4E46A 3FR7A 1VL6A 4PC3A 1GRNA 3V4RA 1WOMA 4EYKA 1M2FA 2KBFA 1YJ8A 1VYTA 3F5SA 4RMJA 1OKKA 1H8HA 3QKSB 4RIEA 2OFPA 3GJ7A 1U9IA 2EQAA 1T2FA 2QIOA 1ZICA 1X86B 3AQ4A 3BJEA 4JSYA 4OCZA 4Q6WA 4RVGA 4ZAYA 1ZD5A 2Q3EA 6Q21A 1KK2A 3NU1A 4Q48A 1Q3TA 1KO4A 2RH4A 2WFLB 4PZLA 4MSUA 2IYWA 3PDJA 1VA4A 3ZU6A 5LWHA 4CLDA 3H5WA 3L7DA 3MK31 4GRDA 1GPJA 3RS0A 2NNWB 4AP5A 1BXZA 2F00A 4CM7A 4GVPA 3WKDA 3N8IA 4M9XA 4CL8A 3EODA 4QUKA 3X1JA 4B0PA 4MVJH 1TKRA 1ILWA 1NP3A 1P19A 2A4MA 5DX1A 3FMGA 5HBGA 3UB3A 1T9GR 3RRJA 4YXWD 3WRXC 3ZHOA 4MP8A 3Q1KA 3G5TA 5D84A 3RLFA 3MG9A 1UJ6A 5I8ZA 2IXTA 2FZCA 3OF2A 4I8IA 3RPEA 4DHWA 4ZDKA 4XQGA 2HHHB 5CGZA 1C3XA 1ZW1A 3T4EA 1HK7A 3BXOA 1XTKA 3C85A 2XWJI 1OSNA 3WB1A 4RKYA 3EGWA 1WVIA 1OE0A 1WVGA 2R79A 4AJ2A 4MW5A 4QEKA 1O5IA 2NUAA 3PXUA 4TZ0A 4ICIA 3GGPA 5ALEA 2I2AA 5KJEA 3WAKA 2GWRA 3T3PB 1XRJA 3LCVB 2J3QA 3AEKB 5AK0A 1I14A 1CW2B 3VJKA 4ZYWA 1BU8A 2XJ9A 3L01A 4HAZA 4TT3D 3HXQA 2IQIA 3QWBA 4HFRA 1X7DA 3LC7O 4CLRB 1FDSA 2X58A 3O8RA 4M4SA 4RHUA 2VCHA 1SXJE 1U3CA 2ATIA 4HGYA 5DN6D 5JSUA 3C87A 4WCFB 2ZANA 3JYNA 3II6X 2A92A 1HTBA 2DFTA 3JVUA 1R9MA 2GAFA 2O54A 1PWZA 1XF1A 3PPYA 5FPHA 4QSMA 3HB4X 4F9FA 1UJ4A 2OBYA 3C5EA 4UXHA 3RBVA 5EKUA 1FBNA 4NXNB 2BFFB 1Y3DE 1BFDA 3B6KA 4LYAA 3M2TA 4ND7A 3U26A 2J3IA 1ZN2A 4NOJA 5JCOA 1E8DA 1JQDA 3IUYA 3KT8A 3FI9A 1L4YA 1NP6A 2B92A 4EQ6B 1K6EA 4BMCA 1SIWA 3ILVA 4RM2A 5TT1A 1UM8A 1EGHA 1LS1A 2VDOB 3EDYA 4ZCRA 4X20A 3VFDA 1Q19A 3NIGB 1IAQA 2F3PA 4Q9LA 5J5VA 3OEHD 3IHKA 1IBRA 2HSDA 3FPCA 3GLQA 2EJCA 2G9UA 3UBMA 2QBYA 3IUJA 1SIBE 4C05A 1DEAA 2HA4A 4NICA 2WRZA 2YFKA 2EV9A 3M3PA 2DCMA 1H2XA 2WTBA 2VDQB 5IMBA 5BY2A 4S05A 3R76A 2PWYA 2O20A 2B78A 4P80A 1LNZA 1JVNA 3LCCA 4L4UA 1NUPA 1Z5PA 5BYAA 2I4NA 3ETNA 1B8OA 1G3UA 1WP9A 2OGSA 2NSYA 3L8YA 2LPMA 4I9GA 3UB2A 5DOVA 4O2LA 4IINA 3TR5A 2QUJA 3VR3D 5FDFA 2P4EA 2HV8A 3EZ9A 4YV7A 3K20A 4IAOA 3ZQKA 4NJMB 3CVWA 4WUTA 3RI3A 2GK7A 1VFNA 1NJ1A 2JANA 3HSYA 1LJUA 2HSWA 3F3YA 3KRTA 3O4FA 4KWIA 4G4SO 5CURA 2VZ9A 2ZYWX 2LRHA 2FZ5A 2IY7A 1KA9H 5EJGA 4YWHA 1PWYE 4EI7A 4H59A 1B0ZA 2XI4A 3OH8A 4MR7B 2UYQA 1YL5A 3FNFA 1ORHA 4XIYA 1OFUX 4HVAA 3SJ7A 2GBFA 3BL8A 3V1KA 4G5GA 2FU5C 3TB6A 1S9HA 4Z86A 1SVLA 3CZMA 1COWA 2BSXA 3M9LA 5ITZB 5BV8A 5KOIA 3HZHA 1QP0A 2OLEA 3KEFA 3LYLA 1U0BB 2UXDB 4GR9A 1Q77A 5FLYA 2ZI5A 3WIEA 3WMRA 4E1BA 4JBXA 1IQUA 3WQQA 4PEVA 1HT0A 2H1SA 4U7HA 1SIUA 1QG0A 3BH0A 5B1YA 2JA1A 3WRYA 4KVZA 4XE5A 4F7DA 4UCWA 4US2R 3SCZA 3E81A 4LF5B 1G6Q1 1UEXC 5FNVB 4U7PB 4K9NA 5C52B 3IALA 2ZPTX 2BJWA 1XDZA 4O5OA 2YHIB 4FYKA 5C3UA 2OY0A 3Q9SA 3SPXA 3GJ3A 3L0CA 4X85A 1G5QA 1NYRA 3BXFA 3LLVA 3BB1A 4Z1OA 5LQRA 5FOTA 2ZUFA 3OE1A 2WG2A 2ZUUA 3E22B 3NHLA 5YASA 2D1RA 2XMBA 3JPYA 3SZOA 3V8VA 4TTPA 5ITZA 3AUXA 1RZRD 1C8LA 3WSTA 3RTCA 4LOHA 2C3YA 1XRPA 3AFMA 3CG0A 4RHTA 3T9DA 1YR2A 4XCQA 4I4IA 4TTIA 1PUXA 3T7EA 5CD1A 2F1KA 4C22A 5THQA 4QNRA 1GTJ1 1PZNA 3IA7A 3K9LA 2A78A 3A9UA 5F2KA 3EDMA 1SUWA 4JBLA 2DMRA 1J00A 3HP7A 3RJ5A 5LA6A 2XGSA 1QKJA 5ELMA 1KQPA 4XD2A 4HC4A 1MC4A 4R68A 1Y7LA 1SR8A 5FBKA 3HB0A 3OM8A 3EF0A 3AEQA 2GVNA 3R5SA 4QUGA 3IIIA 3F71A 1ZJZA 1UJNA 4ZQIA 1RWMA 1RQLA 1AKMA 5L3QA 3TTXA 2XMGA 4FJ0A 3CXRA 1MJFA 3WV5A 1I3CA 2F59A 3OCUA 2VBFA 2NU9B 1C30B 2FZEA 1N2HA 1CUDA 1TM3E 1KXZA 1VHTA 2L69A 3AVQA 5HZGA 4P86A 1NT4A 3SHVA 4L3OA 2XD9A 4C76A 2V1UA 4A2CA 4BFVA 4UTVA 2HYDA 1N2CB 1H1DA 4UE3S 4IIUA 1U81A 3K2IA 2C07A 3GO4A 1MAUA 1NF9A 4OQYA 4QXOA 3RK4A 1E69A 4BNFA 1M74A 4NZYA 4YJ2A 3IPAA 3IMCA 3JSAA 4W8OA 2CLEB 1C1XA 1F12A 4U00A 5AOVA 1I51A 5LB2A 2FWNA 1GU0A 5IJWA 4KR0A 3FYTA 4BO7A 2O8CA 1PW5A 5IH3A 1U8ZA 3RW9A 2AXEA 1P9LA 1V16A 1OZAA 3CIFA 5AIAA 1XZBA 3DOOA 2B8NA 1OFIA 3QF7A 4UNNA 4BB6A 3D4PA 3FPEA 1CR4A 2A9FA 3TQTA 1K5GA 1YCHA 4B5KA 2ANCA 5CA0F 3M4NA 4UMVA 3H6KA 4YAEA 4FHEA 3I0MA 4CDGA 5HUQA 4B3GA 1CFZA 1GPH1 2O7RA 1HGXA 2ZT5A 4CKEA 4MAAA 1XBTA 2NU7B 1E8MA 4IIXA 1UBNA 4MW4A 3GPLA 5CCXA 2ZVJA 4EPRA 2CVFA 1EQUA 1K98A 2DM6A 2P3SA 4KTVE 1NTOA 3B9PA 4QU9A 4UUPA 1VHQA 4N0MA 3CKKA 3D3JA 3HGMA 4JZYA 2ODPA 4EKIA 1D7OA 1Q95A 1IOLA 4BB9A 2CFSA 5HCIA 1YWGO 3JZMA 1TVKB 4RO0A 5HA5A 4BQSA 5JZMA 4Q7KA 2NW6A 1A4UA 5GIOE 4YIHA 5EKSA 3WLMA 3CZAA 1PDWA 3PS9A 2NO7A 4Q66C 5JAQA 4NAUA 5TNXA 2JEYA 3NONA 1A2OA 4EHFA 4DR5B 1VE9A 3U19A 1PJZA 2GVZC 5K0EA 4FHCA 2OZKA 1T91A 5AJZA 1N6LA 1QPBA 4I1RA 5SY6A 2PKRA 3PENA 1DO0A 3R09A 4LZJA 1RYEA 5IKEA 2XVMA 3EVTA 2WKQA 2AZXA 2BP7A 1POWA 4G8JA 3OJ0A 4I3HA 1GADO 1UZAA 5LMZA 1X3LA 1GG9A 2Y0BA 4OAOA 3TL6A 1MIOB 1RQGA 4L4SA 3CEAA 4J75A 4NYJR 4BS9A 2QP9X 2BUBA 4NEHB 3CR3C 5BSVA 3RUHA 1UOOA 2FR0A 2YHAA 3LVRE 3B1VA 2MOKA 4PQRA 4E15A 4EX6A 4AUNA 3RS4A 5CMLA 5DWQA 2OSVA 3SQDA 1TQDA 4CR8A 3LPMA 1ZBQA 1KAOA 3CPSA 2DSNA 3SM9A 4JB3A 5FNVF 2X7JA 4G89A 4U2EA 1TAQA 2Z0MA 1UXJA 1ZUIA 1E5LA 3ODGA 4ZOQI 1PFVA 4WLEA 2FMKA 3C45A 1V5EA 4YUVA 3RG2A 1ZK1A 3F3KA 2Y1LA 3K30A 3MUEA 4MJLA 3VR5A 3X1WA 1GXSB 3MJCA 4R31A 2IYQA 4IUCS 2AJBA 1QMGA 4FVTA 4D4KA 1KQFA 2VHQA 2ZUEA 3CY6A 1SK8A 3DUFB 5A0TA 3L7IA 5DYNA 1OT5A 1SXJB 4JBWA 2ZUSA 5EUQB 2G0AA 3FZGA 3OZSA 4ABYA 4JI8B 3O31A 2Z04A 2B4TO 3IT2A 4XQEA 3R75A 5LQDA 4Y0NA 4R8LA 3U37A 3WRWA 1IZ8A 3E27A 5T6BA 1KI1A 4KQXA 3N6RA 3BWDD 5DM2A 5ALYA 4Y8VA 4EO9A 3MJDA 1PLKA 4GZ5A 1KYVA 2I03A 2IP4A 3S2EA 3JRWA 3WGMA 1YZVA 2FZLA 2EL7A 1KH3A 3DKVA 3TSAA 5KKNB 5ALRA 3KTDA 5D6NA 1LF0A 1RLUA 5JS7A 5MF6A 2JBAB 2SECE 2EATA 4G84A 1NNSA 3EXG1 4B84A 2ZYGA 1D0SA 2VBIA 5AHRA 1DHRA 5FXMA 1B7GO 1XPRA 1TKCA 1B16A 4JL5A 1TEHA 3NBZC 4P22A 3DEZA 4R2HA 3CUYA 3BJRA 1O2DA 3HYTA 4LOKA 4KR3A 1QQ6A 4U2CA 1CQIB 1SXJA 5D00A 2HWYA 3OZGA 4LOLA 4ENWA 5F51A 1UBKS 3F6PA 5B58T 3STYA 3TNJA 3GZNA 4FZVA 4RJIA 2J6IA 3FNGA 4XUCA 3EQZA 1AXEA 5LYJA 4QQRA 4CGYA 1JDPA 1FDTA 4W1RA 1FJGB 1NLUA 5DCWA 2P3QA 1CRWG 3IOMA 5FL7A 3ES9A 2J67A 2EF0A 3G49A 3KD2A 1SXJD 2YUTA 1ZH6A 2KPOA 3AUYA 3ZOZA 1KOGA 2QL5A 4O4LB 4A2PA 3RU7A 1HH4A 1RPZA 1EVQA 4K1LA 1RBYA 2QSYA 3X1YA 4ZI5A 2H4FA 4IJ6A 1XZ8A 1PZXA 3FRJA 1NJ8A 3KALA 4P3NA 4DKXA 4WK4B 1XVIA 2O2JA 4IIHA 4TS3A 5JWRA 3R9XB 121PA 1YDHA 4OX9Y 4G23A 3E8XA 3FRIA 3MWDB 5CW1A 2R6CA 1RJDA 2E82A 1C8KA 4Q01A 3WGKA 4HDCA 1DG1G 2CJPA 4GWKA 3IKLA 1N9GB 2HA6A 2Q9AA 3IHTA 3AL3A 2OO3A 4JL6A 4D4IA 4WHMA 2DHRA 2XPCA 3N74A 5KPDA 1G21A 2JCXA 2XYVA 3DEYX 2X9GA 4E70A 3HCNA 5EUCA 1ZCZA 3BMQB 2BWJA 4WNCA 2V8OA 3REQA 4JJEA 4XGKA 4B73A 3PHLA 1Q0LA 3SJAA 4DZRA 1N4AA 3OOHA 4XGIA 1N6OA 1SUPA 5FYDA 1TCBA 1VLZA 1Y5IA 5REQB 4NYJQ 3SZUA 2ZUTA 3OTQA 2YOGA 4KI0A 1QE3A 4IQFA 1ZUD1 5CP8A 4OLHA 4K9QA 2ZBRA 2CWDA 2DWOA 2PZLA 3WL4A 4WACA 2FZGA 4XAQA 4OU4A 3SHWA 1Z6GA 2P2YA 4F85A 1L9KA 2DLNA 2XF2A 3FE2A 3H5IA 5IDYA 2WPDA 1E2KA 3QI7A 1TFRA 3KT3A 2VK4A 2VIIA 1SZDA 2X8BA 3GUVA 1QV7A 1P80A 3JATB 5FOSA 4DW8A 1XA4A 2R66A 3ZXIA 1FU4A 1R1DA 3DBHB 4QM6A 1CNMA 2AN4A 3BBPA 1H5QA 2FZVA 3R74A 2BCGY 1FTQA 2X4LA 4JUCA 4O4HA 4YRSA 8AT1A 3UHOA 4H7JA 1C0PA 5KSYA 2YJ6A 4OHVA 4YQEA 3ZNPA 3JQRA 4CM9D 3ETEA 1ZX1A 1IEXA 2VCYA 3KXKA 1HG0A 4WVLA 1KBOA 3H2HA 5DGDA 1YUMA 2J08A 3ZE0B 1ECGA 5E3IA 4BO3A 1LZLA 5FJJA 3ZHQA 5J5AA 4U7WA 1QP7A 5DYGA 2YBDA 1Y6RA 3EAQA 3NWJA 1HEYA 3TOZA 2GJSA 2XWPA 4NU8X 2ECKA 3HVUA 1FRVA 1GGEA 2XNDA 3PPVA 4DCUA 4N12A 3I61A 1Z7WA 3FLEA 4NATA 4BO9A 4QUIA 2UYCA 1E1LA 1RMYA 4RACA 3ADKA 1LWOA 3L8EA 3PFBA 3PB3A 2REXB 1OQAA 3KD3A 1TMKA 3MWFA 3RT1A 3U7EB 5FV4A 3MUFA 2RHOA 3BOSA 5KOHA 3EBPA 3ZY5A 2PIDA 1E1QD 1UKZA 3KB1A 1LX6A 4YQYA 5JS1A 2GETA 3FZYA 3FN4A 5JDIA 4E4TA 2DKOA 2WTUA 4BLWA 1PEYA 2BBSA 4YAOA 1JDZA 1EVIA 2CXTA 3P0RA 3OM9A 4OREX 3SQXA 3Q3VA 1TF2A 3TGWA 1I7PA 2HMTA 3GAFA 1VMEA 4RCZA 2IPNA 1MH1A 1WKCA 3PV0A 4PYLA 5ALQA 4DA6A 1CVLA 2EGUA 5F9FA 4BNHA 1OI7A 4GKBA 4OLJA 1L7OA 3IMKA 2MU1A 1SCJA 3ZHVA 3E7FA 5LQNA 2BYTA 3M5PA 5G4KB 1CF4A 4W8HA 3WGOA 5K6TA 1P5RA 3P9RA 4AD8A 1U7PA 2J6HA 4ND6A 4FFPA 1N0IA 1ZS9A 4RH0A 3BXPA 1GYPA 1SU7A 4F4FA 2B6HA 2G3YA 1NVUQ 4ZQBA 3U7QA 3M9WA 3ZCUA 1XKXA 4N39A 5K3FB 3T7DA 3R9XA 1G9TA 1S4MA 1N5DA 2XV1A 4PZDA 5DNVA 3D1LA 3FZEA 2FMIA 2PQ6A 4K03A 1EFDN 1U3TA 2NO1A 3HU5A 3DQPA 4BN4A 2IK8A 1L5RA 1XAJA 2X5KO 3N3AC 4RWZA 3PU6A 2C58A 4QDUA 2EZ8A 3N59A 4ZT5A 4CN8A 4CUKA 2JLQA 3PEEA 4PHCA 4US0R 3FOEC 3BRWA 3L2OB 3EGDA 3QE3A 1T8RA 3KKNA 1MP0A 2Y68A 4R84A 2IIBA 4PTZA 5H3CA 7AT1A 2IS6A 3ED1A 3K72B 3DO6A 3OZTA 4JGIA 3AJAA 1WMDA 4KFCA 4AXXA 2ORWA 2PG3A 5FBHA 1QF9A 2VHJA 4OBXA 2W6CX 4OJYA 5LBTA 1P62B 3GGSA 3W5VA 4IICA 1EWKA 2BFEB 1JFVA 3UMJA 3B7GA 3BD7A 3FPBA 1X80A 3DOCA 4LCBA 2GHQA 2YZ2A 4J07A 5J2TA 4GWGA 4LYDA 4GYYA 3FUXA 1F8GA 1FF9A 2GN9A 4R9NA 1P17A 4B3XA 1U8FO 3UJPA 1W1IA 4GLJA 1U8YA 1VXRA 1CEQA 2B9EA 4L16A 2F7SA 5KYUB 1MW8X 2JNWA 1SUAA 2O8NA 2ONCA 2ZTHA 3CX4A 3L6UA 3PNLA 3TLBA 3COJA 4NONA 3QXCA 1FNNA 5EZ6B 3PUYA 5LDGA 3P27A 3WBBA 1J0XO 3CLHA 1KMCA 3A0UA 4N18A 2ONJA 3QG1A 4GBJA 3CNOA 4R2WA 4C7MA 3L49A 4G5SA 1TX4B 3HR7A 3PNMA 2EFYA 2QA5A 4XYEA 4FKMA 1ZC4A 4Z7OB 1ZUWA 2A0WA 1NC3A 3GA0A 4JP3A 1IXRC 3JQ8A 1EB9A 2R2AA 3K2BA 3LECA 1N3LA 3RRFA 3UGQA 4C01A 5DTEA 5DJ5A 2FN7A 4ZOLB 1E9AA 1E9RA 2A9KA 3K6KA 4MGHA 3SBXA 1ZGCA 5IJXA 2G5CA 2AN3A 1H6BA 1U11A 1DC6A 3ZU3A 2E4ZA 2ZRJA 1DQPA 3GGOA 3OZEA 1NV9A 2K4MA 2Z2XA 3LGXA 4H7IA 2GOYA 1N0WA 1DAHA 1K8RA 5D85A 1PNTA 2V58A 5ABPA 2XCLA 3D7NA 3PPIA 4PRKA 1OV4A 3EIFA 4LNHA 2BMWA 2OENG 4IIGA 2BSAA 3NM6B 3GLFE 3LLUA 3T3NA 2BM9A 5LN1A 1NSYA 1PIWA 3V1YA 3RAEC 2ZCUA 3MOIA 2F90A 2R86A 3DM9B 4NAVA 4P81A 4ZVLA 2FUEA 3G9XA 3GRZA 5EJMA 4IQ4A 3DVAB 2JH8A 4HWKA 2R25B 3FCSB 4CODB 1BQ4A 2CHEA 4K8OA 1RJEA 1ZH2A 4IS3A 2V74B 3B6EA 5K45A 2VK1A 3T8YA 3K1JA 2GKGA 2C4MA 3AEYA 1QGZA 4HD8A 1UANA 1ZI8A 1ZMRA 1OKKD 1Y5NA 1KI3A 3O94A 1A9XA 3G2OA 3VPXA 4D44A 2XOEA 1WBDA 1MHPA 2BR3A 4ARUA 1N8KA 3MTDA 5DLDA 3W8RA 5CFZA 3VR6D 1RD4A 3VO8A 4II2A 1O97D 3UAOA 3ZX4A 2P2LA 2JFUA 4R9VA 1BZYA 1IZ9A 1V1MB 1OZHA 1M1ZA 5AT1A 4CKEB 4F5ZA 2IYTA 3WGHA 5M7EA 1WXHA 2QD4A 4J0KA 4KV7A 3IE2A 4ZHQF 4XGRA 3VX3A 3QITA 3FD8A 1MA0A 3IEVA 1N1GA 3E23A 3T12A 2ZTLA 3H3XA 3ONDA 5HF5A 1YJCA 4H9GA 4XFJA 3ZGNA 3H1GA 1W2GA 3I76A 4LV6A 2I1LA 3L0BA 3LTNC 1HR0B 3INNA 1I3NA 3D8TA 3TZCA 1FU7A 1EAMA 1V16B 4UJ5A 1XEAA 4Z4FA 2Q6VA 1VRWA 1QH1B 4MDFA 5JISA 1NWHA 3RIMA 2W9XA 2W6JA 3PWSA 5EWLB 1DIGA 1R16A 3O1LA 3N0WA 1Z7GA 2XMPA 2FFRA 2ZDQA 3T0FA 2YWBA 3N5KA 1ADJA 1SNYA 4TTRA 4DCGA 4EUFA 5AVYA 5ECWA 5P8WA 3RC7A 4DF3A 4HRXA 2IU0A 3OD1A 4UVDA 1BEZA 1K9VF 3SSNA 2I9KA 1IY1A 3X1DA 3FNEA 2WAAA 1Z8NA 2ZQ5A 2JI7A 1U98A 3JCZA 1T3TA 3D6UA 4PZCA 4W7IA 3RNLA 4F72A 1DCMA 1SCDA 2IDZA 3F8TA 3OZUA 2O59A 4DLPA 2A57A 2VJYA 1WTCA 5C4GB 3F47A 1T4GA 1M6HA 1LY1A 3TEFA 2NU6A 5FUYA 3H17A 1O5TA 4QHTA 4M7PA 3AUKA 4RETA 1Y3IA 2C61A 2X4GA 4LISA 1Y4AE 5I48A 3DZCA 2GUWA 3IBTA 3ZBPA 1ORDA 1XQXA 2VJNA 4KQGA 4QXMA 4AK9A 3A31A 4MVJA 1ADCA 3F7TA 4BN5A 3GLIB 2P9JA 1ZC3A 2W2KB 2AOXA 1FFDA 2H8KA 1KYQA 3VKFA 5H7XA 3EPLA 2B99A 3DV9A 2ZTMA 2X0EA 1W94A 1C3VA 1W581 3Q0EA 3SF0A 3LY9A 2J41A 1JQAA 4UZFA 1P2VA 1ZIYA 4KQ2A 1WR8A 1XO1A 1VLJA 2R6DA 2UZAA 2GARA 1DRVA 2GRAA 2LCFA 3EDCA 3MJRA 4NLLA 1WNTA 2HHCA 1KFBB 3KXLA 1GRRA 4Q1CA 1U7TA 5K3DA 3SYKA 5CIWA 2QI9F 2C4UA 1EEHA 2HCJB 4UBLA 3Q7SA 2BGUA 4FDUA 5ECYA 2DBZA 3HCOA 3KPJA 4IDHA 5FO1A 3X0DA 3KOZA 4A9AA 5DISB 2DEUA 4ARBA 3LSYA 3G2NA 3Q6NA 5LUAA 5FWYB 2UVPB 4XRRA 1HNWB 4IGEA 3PVZA 3T7TA 2FMHA 1H6AA 5LBUA 1UMDB 4C0AC 1T9BA 2AFIA 1D2MA 3DOUA 3L1HA 3NTVA 1NBMD 4I55F 1ZR2A 3K35A 5AXAA 3GQBB 1Z2CA 1KNXA 2PLFA 3HJHA 4JYPA 2BKUA 3OEEA 1JEEA 4FGJA 1P5JA 1EHCA 1EWRA 4II3A 1Y4DE 3DE5X 1B1AA 3FPGA 4Q12A 1F2TB 5AM4A 3WL7A 1YI0A 1Z4JA 3ROZA 3UV7A 3W7BA 2RI1A 1K75A 1VKNA 2FSVA 2QLFA 1SK9A 1RPAA 3HI4A 3JV7A 4DNFA 1VLVA 5KHAA 4RSGA 4EJMA 1D1QA 1K5DA 3ZHRA 1YTLA 1LDYA 4J9UE 5KZMB 3NVDA 5IKMA 5KU1A 2PE5A 2GSWA 4HDOB 1Q2XA 4DM4A 2WF5A 1D9ZA 2AZTA 1MB4A 1H2FA 2X8AA 5C34B 3ZWYA 5BN3B 3QU7A 4CL0A 4QWWA 2HT1A 3GFTA 5CU7A 1Z6ZA 2IEIA 3I4CA 4C0BA 1COWD 1YZ3A 5C4IA 1W52X 2OVFA 3HWX1 3M1IA 4RZIA 1JHYA 3QLEA 5JH7F 4KKXB 5E8JA 1J0DA 1SELA 1F6BA 1HE5A 1Q91A 3EVZA 3GV0A 3HKCA 4BLOA 4OQMA 1FP6A 3ZV6A 1XDSA 5H0IA 4YI3A 3VZCA 1W4BA 2VJMA 4JEHA 4LF9B 1EA5A 2SBTA 3W8NA 2PD4A 1KSJA 2CJYA 2GD6A 2YFHA 4PVCA 1EFCA 2JLUA 2W70A 3G0DA 4HWPA 1RP1A 1IBSA 1Q50A 2LXNA 4NECA 5CDHA 5EUBA 4HUJA 4C6TB 1L7RA 1JJAA 3NXKA 5J5CA 2NXJA 3A6HA 1RXEA 3GCGA 2PRZA 1WHSB 2E4UA 1NQXA 2AA3A 1RCFA 4AP6A 2ISQA 4OXYA 5CLIA 1CDDA 2JGAA 1T0UA 4N47A 1U0RA 3QBDA 3V1TC 3AUTA 2I7CA 3WO1A 3NWOA 5TQ0A 2HZBA 3DE6X 3ZOKA 4QHYA 3T6KA 1P1FA 4A8JB 4UPDA 2XUHA 1Z63A 4D0NA 2A33A 1ACLA 4NNJA 1OJLA 3LUBA 1G38A 2CN1A 1TXGA 1E1YA 3QU5A 2G9ZA 1EHIA 1ADFA 5I9IA 2GTHA 1PN3A 5TQVA 4X54A 3EE6A 2XQVA 2IBSA 3GGJA 3HCCA 1BGWA 2PVSA 1WMSA 3KZXA 4QRIA 1I4EB 2TSYB 3STWA 1FYDA 4E14A 5JJ5A 1WUKS 3UAXA 4I7EA 3S0JA 1BJKA 3R4VA 1LW6E 3DE1X 2X8LA 3LWZA 4NPHA 3SAJA 3VJLA 3L41A 1D5WA 3GWGA 1IBMB 4R3UC 4MS1B 4IMJB 4WPGA 3TW8B 1JX6A 1XCPA 5DM1A 1M5UA 1ZRMA 2WTAA 5HOQA 3Q2OA 3QE9Y 1EWTA 1O5OA 2DFDA 4RYLA 2VDPB 4DWVA 2EBUA 3DZIA 2ZIAA 4EGSA 1K3UB 3O7MA 2VAWA 1UBUS 3AV3A 4YASA 3EG5A 1GLVA 4JA2A 2WMNB 3CUWA 3H9GA 4X7BA 3T3IA 1PJQA 2AXNA 4E6EA 4C43A 2J5BA 4OHZA 1QJ4A 1SO8A 3I12A 1H9CA 4PLGA 4DGQA 3UPTA 1T9AA 3DOHA 4LSMA 3CVUA 1FRFS 4EKNB 2CVOA 2AFHB 1Z9BA 1JPUA 2B34A 2IJGX 3W5UA 1A9SA 1RM4A 2XLBA 1GVHA 2ZRBA 4MO9A 2XXAA 1W36B 4FOOA 5E1MA 1GAXA 2PWZA 3EZLA 4XSHA 4CTMA 4XWKA 1GUAA 1R10A 1SCUA 1Y33E 4DLUA 3T4XA 2QQ0A 3WLLA 3TVDA 3ACBA 2Z1DA 3UJ3X 3T3MB 4DC9A 5ESDA 5JQGB 3NZEA 2OPBA 2AJTA 4IDBA 2YHBA 1RWQA 3LBIA 4OG2A 1BWSA 4NQZA 2Y27A 4BNXA 5ADWA 1VCHA 1XZMA 1TZKA 1OLSB 1C9DB 1WHTA 4RD1A 2IV2X 5F73A 3TZBA 5A3RA 2JB9A 1HRKA 1TTHA 3KSRA 2PU5A 1TYCA 4HGQA 4X6XA 4CFSA 1CB0A 4WH0A 3EAFA 3KWJA 3H16A 1TIPA 1CJCA 4PQGA 5CFOA 4Z0PA 3I6BA 4O8CA 1RYDA 2PVPA 1O89A 4OUDA 1Y7TA 2RJOA 5GONB 1JXAA 1J49A 1U0HC 3NB0A 4E94A 4HP8A 4DR3B 3CRMA 3GP3A 5DHQA 4TVOA 1CJKC 3UY4A 3K9WA 3KOOA 4HTFA 2OAGA 3K0SA 3VZSA 3ZVMA 3I3SR 4RPIA 2D3TA 1OLOA 3PC8A 4IJWA 2JLWA 3ONFA 3T15A 2XUPA 4O4JF 4PNPA 1Q1EA 3QXSA 4RK0A 4IZHA 3T3OA 2Z1NA 3N53A 3PQ5A 4FQ8A 1DV2A 3O73A 1YA4A 3WK8A 3MTBA 4G1VA 4M9ZA 2BFNA 3WIVA 3WYCA 3FJOA 5CX4A 3LOUA 4XKJA 4QDKA 2E1RA 4LC1A 3IPRA 4HUTA 4ZO8A 4WBNA 1RI2A 3WWPA 4FM9A 1MRZA 2FEAA 1A98A 2ZSAA 2YOHA 5FWNA 4BLRA 4OAPA 1QFXA 2C2YA 4G01B 1FP1D 2V96A 3CNEA 4OKNA 4RE6A 1WDWB 5CGQB 5LQCA 3U4AA 1K88A 4B31A 2RKWA 4XUEA 2FPRA 1LV7A 3GLHB 2WD9A 4JWKA 5DNEA 4WLUA 1NJSA 4RM3A 2GJ8A 5EHXA 4P5EA 5ITSA 4B6QA 1YR1A 5JH7A 1DI0A 1Z62A 4FS8A 1O08A 3FVVA 3HRIA 1M10A 2VF8A 3JYHA 5FHQA 3FHTA 2WICA 2G67A 3CNHA 4OL0A 3UVEA 2HBYA 3QJGA 3GNQA 2I3BA 1I7DA 3OCZA 1HLPA 3O91A 1Q15A 4OYYA 1RABA 4U7DA 4LQ4A 1E3LA 1VYUA 5LBIA 3U2QA 3O8CA 1O97C 2RK6A 5EJ5A 5EEGA 1MIOA 1MAWA 1PFWA 2JEZA 2ZSFA 2QTWB 3H04A 3QP9A 2I4TA 4BP3A 2H17A 3STTA 4ENVA 2ZIFA 2AL7A 2Q3JA 1W0JD 3BA1A 5HCUA 4GAEA 4LRUA 2EZTA 2YWFA 1AMOA 4ZGGA 2HA2A 3QBJA 1QJCA 1RFLA 1NBWB 1S8AA 3HU3A 1Z45A 4HQKA 1FPQA 4DPLA 4Y18A 1VLMA 4J7UA 4O0MA 3SEFA 3I1FA 4HB3A 4U3JA 4MEBA 1LK5A 3PI6A 2VSXA 3QVLA 4GSKA 4EJ0A 4DSNA 3H1TA 3P45A 4XFKA 2E4YA 3HM9A 2C1ZA 3HL0A 4HRVA 3FUUA 1P18A 2FEPA 2YYAA 4RL4A 3DFZA 1Z16A 3GLTA 5L4SA 1PQYA 2AEMA 4Y6PA 1TADA 4Z0HO 4P3YA 3EEFA 1KAEA 4C07A 4EA7A 2VHVA 3O3CA 4X1IB 3LUGA 4JHXA 1ESNA 4NBWA 2BFMA 5ALMA 1EWVA 3AX6A 4LV8B 3ZYZA 4FDMA 2I6XA 1PTKA 2A3NA 4L28A 3SZGA 1A7KA 3GVHA 3L7JA 1Y3FE 3MGAA 2CW5A 4O4IA 1NXQA 3D6AA 5JR3A 3V1MA 4G8BA 5DYIA 1BFKA 2P9EA 5KVCA 1WB6A 3NGMA 2V9ZA 1FFCA 3M6WA 3KYJB 1H5NA 1QU2A 1GV1A 1YE5A 2O8CB 4Y2JA 1FS4A 5CBPA 2E5FA 1E79A 2HRCA 3DVAA 5TEWA 2ZRIA 3AG5A 3QF4B 4FNAA 4MR8B 2A1TS 4RPCA 2X22A 5EAIA 3W90A 2WT8A 3ANMA 1UBEA 4GOND 1EFLA 1P9OA 4L5CA 3L9XA 1RADA 1U1EA 4IGAA 4Q16A 2IV3A 3V4SA 3PNYA 4DILA 1GQRA 4QTXA 2X1LA 1HDEA 3EVBA 1PTJA 1RAAA 2BKXA 4AMUA 4ANFA 3D7MA 4EJ2A 3NKLA 3AGQA 4HQNA 4KQHA 3GRVA 3NTUA 5TVKA 5BP7A 5IDWA 3OZDA 5IJ0A 3S2YA 2HHLA 3HWSA 4TKVA 4LJ6A 3QWHA 5HE9A 5LQMA 1ECPA 3ZE8A 2YXLA 2WHRA 2JVJA 1VKJA 2R6AA 3I23A 2VG8A 3RVPA 1G42A 4HWGA 3IAEA 1TO1E 1JYSA 4Y0AA 2WMYA 2GVDC 3DAHA 4ZN6A 4F3RA 4PXAA 5HQTA 4UEQA 3WLHA 3GLUA 2IYVA 4X97A 2X42A 1XRSB 1MABB 1QANA 1EX7A 2WK1A 3MBIA 2HWKA 1MUUA 5AVRA 1A1VA 5D01A 4YC7A 1W36D 1L8OA 3L7BA 3UWPA 4RPJA 2I55A 1DFIA 1PNQA 2A9OA 2QYOA 3BDVA 5GM2A 2C03A 1P31A 4UMEA 2C9MA 4OI1A 4F21A 4WK6A 4R0NA 4P84A 1SHTX 2J9RA 5JAMA 5LPNA 4PC7A 2FQWA 4RTQA 1EVLA 3IJPA 3NEJA 2X5XA 5KC8A 1IONA 4M9RA 4QYWA 3USZA 3WXBA 2BM0A 4G1CA 1CDEA 1V5IA 2ADMA 2FK7A 3NHAA 5FB3A 2WSYB 4MVYA 2PVCA 1TT5A 1M1UA 1K4KA 5FQOA 1Q0RA 4Y30A 1A0OA 2O5CA 3VDMA 4BRUA 1E92A 2ZSUA 8ABPA 4MQBA 5E6SB 3FTDA 3WJAA 3GMDA 3ZY4A 4KK4A 2ZR9A 3RTGA 2BR4A 2AG5A 2DQKA 1C3LA 3LLSA 2X0IA 5I51A 1KI6A 1PEKE 1PYGA 3MCVA 5J2TF 3VO9A 4ENQA 3M5DA 3TCXB 3LPDA 3V8EA 1E9BA 1SVMA 4BZXA 3HJNA 5C53B 2XNSA 1CUAA 5HS4A 2QSZA 5EMHA 3VX4A 4V0ME 5F5NA 4B6EA 2NYVA 4OQDA 1FFXB 5I6DA 2J9XB 3LYAA 3QFFA 3RFXA 5HKKD 1SC4A 1UPUA 1KKMA 3DONA 1OZFA 3FYHA 4B9AA 1BX3A 2B5OA 4FIZA 4HQFA 2ODAA 1BSVA 1B43A 2JIMA 3P9SA 4MWBA 1GNVA 3NH6A 3WFZA 1H0RA 1T3ZA 1V7PC 4DCNA 3HA7A 4J9VA 2EAUA 1L7AA 3L7MA 4MRNA 4ID3A 4Q82A 3FCXA 4WZZA 2QN7A 3DHYA 4I9HA 1X9HA 2D5AA 4AW9A 2V9CA 5K3FA 3V2IA 3TIVA 4BLPA 1S5PA 1JHXA 4RIHA 3TSZA 2VOJA 1I0LA 1OUMA 1VPTA 3CUSA 4R8MA 5D87A 4M0UA 2OFXA 4MWSA 4U3JB 2AKYA 5BN4A 1AQ6A 3MWGA 1QXSA 5EL0A 3VNUA 3C1TA 4JR1A 3PIDA 1V41E 3RRNA 3ZD7A 4DA0A 3SX0A 4Q7QA 1JLMA 1CZKA 1AKYA 2JCYA 2PRKA 1NMZA 4KBFA 4QUAA 4ARZA 5JHHB 1AMNA 1WX1A 3NHPA 1QK3A 4EUEA 3FROA 4OATA 1KC3A 2F1RA 1X7HA 3BHNA 1LRJA 2HMYB 1AGYA 1DAMA 3AM4A 4ZANA 2PQ0A 4NQRA 3LDGA 2IU3A 1E4OA 5BNTA 2NT4A 2Q0HA 2IPOA 2IUEA 2WJJA 3ZWQA 4B7XA 4F11A 2WP8J 4TN1A 2CNOA 2A14A 3BB4A 1XA3A 1P9RA 3TYXA 2F4VB 1II9A 1M6NA 1R2QA 4LC0A 4BASA 5TMPA 1L5LA 1W0KD 3WL6A 1SM4A 2Z9BA 5KPJA 4PSAA 1CY7A 4JC8A 3IBSA 5BMOA 4YGXB 1QBGA 4RTMA 1GWNA 4IKEA 1PQ4A 4UJ3A 4XB2A 4C7VA 2Z9CA 4MA4A 4AG6A 2RE8A 3QYFA 1NRJB 1U2PA 1ZVJA 2C04A 1R3DA 2CZGA 4NEQA 1L3IA 1WXGA 2ZBFA 5CFMA 1MORA 4DYDA 1C14A 1D7AA 5HF8A 5A3JA 5TQJA 1RHKA 4AURA 5BPHA 3LBYA 5KREA 2XVYA 2W00A 3DKIA 1Q1GA 1XTRA 2QT0A 1PD0A 1YQUA 3COPA 4ZJYA 2FSUA 4P34A 1AG9A 3PGVA 5H83A 3BULA 2B4AA 1F9EA 5K9ZA 4XYMA 2HIHA 2W6ZA 1XZEA 3I5AA 3MQ4A 4JLAA 1YR9A 3E9RA 3LT1A 3NNNA 3Q9NA 3SYLA 5KC9A 2BH2A 4QJ4A 4BC0A 3LT4A 5AI8A 1ORRA 4E5PA 4CJXA 3VHXA 3OZWA 1E2LA 3W6OA 4J3JA 1Z5UA 2XTNA 1B6RA 1H42A 1BVYF 4M0EA 3UQYS 4WSOA 4LJ9A 3JZIA 8GPBA 5KNCA 3NC1C 4PANA 3I2KA 1PCXA 4L07A 4BBZA 3K70D 5IPFA 4KUGA 3EFHA 3PFGA 3DC2A 3A4NA 3AUFA 1D2RA 3A2MA 4EG7A 3LBHA 3WYAA 1VPDA 4HMQA 5CXQA 2O48X 3QFHA 5FYQA 5JZSA 5TV2A 3HLKA 2OFWA 5B4UA 2WYHA 1Z17A 2R6HA 3G9QA 3R2JA 4PZ0A 1XEWX 3AESB 4L0QA 4LE0A 4YP0A 4AZ3B 4KLCA 3PEFA 3ZCSA 2IEBA 3GN2A 2HDNB 3I8SA 4Y1RA 3J7TA 2AMJA 3PKZA 2J0VA 4AUMA 2XNKA 2ERCA 2Y67A 2ZJ8A 3CE6A 1A9RA 1GNSA 4O2AA 5FT9A 1K7XB 2QZJA 1I4OA 3AB7A 3I73A 5G4KA 2JL1A 2WU0A 4PTYA 1SVWA 2W2PA 3WNZA 5BWBA 4EY7A 1SFRA 4LGVA 1R00A 2FB9A 2HF7A 4WZAA 3T9EA 3GEGA 2PHZA 4Y6SA 3SC6A 3AESA 4AZ3A 2IU4A 3O38A 2NACA 3GEBA 4R40A 5CVCA 5TC4A 3GI1A 1DT5A 3HU1A 4QTTB 3U4CA 1G0NA 3HJGA 4EGFA 3DT8A 2I29A 1XGKA 1NLYA 3OIGA 3JWIA 4B35A 1LZKA 3I42A 1JAIA 4RMGA 1GSIA 3H0EA 3NJRA 2P0EA 3ESZA 3PXXA 1U7HA 4KWHA 3BXHA 1JLLB 1H3NA 2P6NA 5ALXA 3H11A 3K1AA 3O8LA 4F4UA 4JMPA 3CFYA 3PUZA 4RSHA 5U4QA 3FMIA 4FCTA 4LTNA 2HBZA 1D09A 2PUGA 1S0UA 2J9YB 2I34A 4Q00A 2R8ZA 3KUDA 5HMMA 3G2IA 1JAXA 4IDNA 4ZHSA 2J59A 2PLRA 3O93A 2HNAA 2PYZA 4RGYA 3LU1A 1LFDB 2BFCA 3G2JA 3OETA 5BWOA 2IX9A 6ABPA 3DL7A 1ZOOA 2OQVA 2NUTB 2DUJA 1AZLA 4WK2B 4ALMA 4YAFA 1XZHA 4W1SA 2IZ1A 4J91A 3N2NA 4XVRA 3SIWA 4F56A 1F7VA 4TKZA 2DERA 5AOBA 1LD3A 3TKAA 1MFPA 2Y77A 2CEAA 5T8KA 4JWTA 4MLPA 2WF6A 1W6UA 3ADPA 3Q72A 4QE3A 3DOJA 1IZYA 3JWHA 4GOLD 1ZY2A 5K0FA 4W5RA 3DMPA 4TVSA 3C8ZA 1SHKA 4ZQGA 4R1PA 2UUOA 3L6OO 5KVVA 2JG3A 3PNKA 1ZAYA 5K5EA 1RQNA 1NXTA 3H84A 4H7HA 3ZGOA 4JXXA 1YFLA 1YV9A 4NFYA 3BXGA 3WP0A 3KYDA 4ZAZA 3GCWA 1D4ZA 4V3BA 2H31A 3OZRA 5H3LA 1DWOA 1JAYA 3I64A 3U3ZA 2CKMA 1PR0A 5CUQA 4JB8A 4RK5A 4TXLA 1VTKA 1YKGA 4KHZA 4HDNA 1GLGA 3IPYA 2XDYA 5E0KB 3C3XA 2VPQA 3OPYB 4I1PA 3RC8A 4P3KA 2OP1A 4KITB 4ARCA 2JLXA 4LFAB 3PUXA 3PUKA 2EJUA 5DGXA 4OH1A 2NXCA 3FB1A 3RANA 1GZSA 3CVXA 1ZQ1A 3WDMA 3CG4A 3DS8A 1GGNA 2QRLA 2FF7A 1YHNA 1MQ9A 3HL4A 3BMQA 3DT6A 2Q9CA 3NBMA 2BAGA 1U28C 2NADA 3SICE 3HVKA 4KYIB 3E5HA 1X6VA 2PJUA 3OI7A 2CNKA 3PRYA 3RGGA 4MUMA 4WZBA 2CC2A 1R4ZA 3E03A 4MO2A 5CPBA 3TI7A 3WC4A 4XZ3A 3ZDAA 2C88A 4QEZA 3IJRA 5AQ1A 4YRQA 2XB2A 4G4SP 4P8RA 1QLWA 3AEUA 1FJHA 3I39X 1RW4A 5GOTA 2YNMC 2NAPA 2IOFK 1H85A 1RYZA 2B6NA 5EERA 1Y4SA 5B3JA 1SRQA 2QV7A 2QORA 3DKRA 4R5MA 5TR9A 1YBHA 3Q2KA 2DPXA 1XZGA 3FMOB 4UFOA 3QWAA 1E63A 4N49A 4X61A 1MEOA 5CXSA 5ES3A 1XKLA 3LHDA 4U4AA 5G4LA 4AMBA 4YAIA 3MWYW 3P5SA 4HPJB 5C1BA 1FSFA 1S1CA 2WW8A 2QPAA 1VE6A 5EJ2A 1M3SA 1X1QA 2YMQA 1WB5A 2FXVA 2WJGA 5KKAA 4RQBA 2BCJQ 1UK9A 2BDUA 5J4HA 3TGLA 3SR0A 3NM4A 3OZVA 4L6CA 1QS0B 5SY4A 3GGDA 3VYSB 4JR2A 2YFQA 1SY7A 3WLOA 4RANA 3AF3A 1DC4A 3GNTA 4C4SA 4RABA 3DE3X 3U9SA 4TN5A 2ZITA 4IFTA 1C3JA 3AR2A 3UV3A 1FTGA 4Q1FA 1CEXA 2O8DA 4LJAA 2EX4A 2PBLA 3O8OB 2K2WA 3A6ZA 1U9JA 2EQBA 2HA7A 2A6PA 2EG5A 3HDVA 5FBVB 2AV6A 4LYJA 3DR5A 2HL6A 4DCOA 3DEKA 3NCHA 4G6ZA 3DDHA 5IJ9A 1PVVA 4BVAA 3AL2A 2C5EA 1F0YA 5EE5B 4L6AA 4RV5A 3EISA 2XVAA 1GNRA 4TLDA 3GFSA 3I09A 3TTSA 1FNSA 1E7SA 2WWVD 4EW6A 4XH9B 3OA2A 3AU8A 4HCJA 1O4VA 2OXEA 2YICA 4QQKA 2OQ2A 1T2VA 5C4MA 1ADYA 2B21A 2ID7A 4IJ5A 1X7XB 4GP9A 2J0UA 3VUFA 5F7XA 1LFAA 1O8BA 1OAOA 3QLVC 2BV3A 5FA6A 1F8YA 4ZALA 3ZKWA 2DQSA 2EP5A 3IB3A 2P35A 4CIDA 4YJ2B 1I7NA 1SVSA 2NZ8A 2IPMA 1XP8A 4K9SA 3GLIA 2E21A 4M0PA 4E5VA 1EVKA 2GD2A 3L82B 5C7LO 3ER9A 2HN9A 2G07A 1IHDA 2Z9DA 2Z8ZA 2VK2A 3MAJA 5G1OA 3UICA 4JEIA 3ZHXA 4AVYA 5BV2P 4V38A 1M5TA 2CHQA 3A4LA 2ONZA 1R8QA 4A5OA 4KACA 3UO8B 3WNBA 4IPTA 3FTNA 4JLWA 3FWNA 3TX6A 5C1OA 2PS1A 1KO7A 3AHHA 1UWLA 1KAQA 5AKKA 3KT0A 1SOVA 2EJVA 4AG5A 1PS9A 2FW1A 3H13A 1W2HA 1EWYA 4NFSA 1MC8A 1ZOSA 4BDSA 1UK6A 2YW9A 4KQ9A 4NZOA 3VJMA 1Q21A 5NULA 3SC4A 4CGZA 5D1HA 1YCGA 5B1HA 4MVJG 1E3TA 1J8QA 3AW8A 3UTCA 1WCXA 3GUHA 3MYRA 2BP7B 3LO8A 4P35A 2QR3A 3U39A 1T8UA 2W6QA 2DQZA 4XVUA 4F06A 1QH1A 4N6NA 5B12A 1NR1A 3HDGA 3ZLUA 4ZA2A 4DXAA 2ZTUA 1KR5A 5GTDA 5KDOA 2C7OA 2IUUA 2HJGA 1GSHA 5DGHA 2O7SA 5IBQA 3K2QA 5L3RA 5I7RA 3IP6A 2O9JA 3QPBA 3RYHB 1CU1A 1DUSA 1G6OA 2J48A 2A7XA 1D4FA 2D1QA 2ECOA 3NAMA 2AX4A 2WHPA 4ZXPA 2NN3C 2XA9A 3IUMA 3ORFA 5IJ9B 1NW9B 4C3ZA 5FRDA 1XVTA 1U9ZA 5CLLA 1KYWA 4GMDA 4JLUA 3R44A 4DLBA 2HO5A 1XNHA 2R48A 2RARA 5JPIA 3QELB 3HEBA 4MDYA 3CEJA 3EEOA 5B1EA 1N6PA 1KHHA 2P6MA 2R3SA 1EP3B 1QAOA 5K20A 5JLJA 4OKIA 5L51A 2CYAA 1BCSB 2C3MA 1Q7GA 3OTWA 4CR6A 2WQZA 4QDXA 2W83A 4R8KA 4CM8A 4G41A 3CCCA 3F6EX 4OQFA 2P2DA 3A3OA 2C1EA 5C81A 3UAWA 2CF6A 1WSDA 3QOFA 4QOIA 3U4QA 4FMDB 4FT2A 3QFCA 3H4MA 1Y34E 1N2OA 3IO5A 3NP9A 3CH4B 2P9BA 4DT1A 2P11A 3LDHA 3AETA 4M89A 1Z2OX 2RGEA 4PG6A 3H5LA 4B82A 4BOYA 2RAUA 4IVQA 2WZDA 2UU9B 3FG9A 1XF9A 3CH7A 3UXHA 5JECA 1AQUA 4J0CA 1XNJA 2RHWA 4GQBA 4N5NA 1BOOA 1SPXA 4C06A 4LY6A 4ALIA 4DG5A 4GEKA 4MDEA 1X2EA 4Q9HA 3TZ6A 4ALNA 3KAQA 3A25A 3U3KA 1IPHA 3VUEA 1ND6A 1NKSA 3DCYA 3E35A 4C6HA 4D9FA 4B87A 4D96A 2R60A 2ZAYA 3IP3A 4TQ9A 3LMKA 1R4NA 1PV1A 1T0BA 1UIRA 2PZMA 4MUJA 2QBYB 1D04A 1DKUA 1S2NA 1RJWA 3G9ZA 3E1GA 3QMWA 3ZKAA 1IY2A 3VO1A 1AH2A 5I4CA 3NT4A 5FI0B 1CZRA 3ZZ0A 4EGJA 4ACAA 1G19A 3R3XA 1RDFA 2IY8A 2Y1FA 4MUAA 4C7XA 1JJIA 1A2QA 1ORVA 1ACMA 3RSHA 5AW1A 4XM0A 1X1RA 4DG8A 4NCXA 1YB1A 4YJGA 4E5KA 4L4XA 3ZIUA 2DTEA 4W6QA 3TW6A 4QFBA 2IXEA 3I04A 1AN9A 2CXUA 2C4KA 4LDPA 4ROSA 1NNLA 3L77A 3SC2A 3AINA 4U7FA 4DDUA 1ATZA 2XGMA 3VISA 3PDWA 3OU6A 4KXNA 4O59O 4ERNA 4YFVA 3ICOA 1XC7A 2CDBA 2VKTA 2YY6A 3OOSA 3WISA 3N8HA 3SNHA 1UWVA 3PIRA 4R2MA 1IOWA 3RUEA 1GTRA 5A3QA 3D7KA 3M83A 2FCRA 2EJTA 4HEQA 4LXIA 4YCAA 1Z8FA 3BEOA 3IMGA 3GFPA 5HBRA 5BMVB 4CEIB 2GJAA 3R0JA 3OAAD 2PBFA 3ETDA 3LV8A 3TE6A 4PRYA 1RHQA 4B33A 1TGYA 1BE6A 4CZ2A 5LR6A 1LC3A 1TZCA 3VU3A 2ZYDA 4P7KA 4MICA 3ENNA 3OZAA 3T7AA 2OV4A 4E03A 3OEED 5CVDA 3JVDA 2H7XA 1I3OA 2PMCA 4ODIA 2DFVA 3F4BA 4V0RA 4AF8A 2ZG6A 1PR3A 1D6MA 1SC1A 4CW7A 1LPPA 1NR5A 3IJEB 2II6A 3MCTA 4Q19A 1DU4A 4LEIA 1EAYA 2DH5A 2QD1A 3GRCA 2P9FA 2Q5IA 4W7SA 4IEEA 5FAXA 1WP4A 1JEYB 5IVHA 4B7UA 3TMAA 4LY3A 2HU7A 4ZCMA 5KNCH 2G9NA 1WZIA 3KJQA 3N2IA 4PX5A 1JDNA 1EH5A 3NX4A 3B6ZA 4UHKA 4W9NC 5EXEA 4ZYUA 5CLFA 3NUQA 1VDMA 1PT7A 4QGBA 1RC8A 4B8WA 1WCIB 3BZWA 3ETCA 2TMYA 3B7PA 3GLRA 5DX0A 1L4FA 4ME6A 1ZUHA 5EJFA 4AJ4A 1NFQA 3PNSA 4H1VA 4H6PA 1SCQA 4MPPA 5LXTA 1J25A 1UBSB 4IVPA 4Y6RA 3HWRA 5JI3E 4J7CA 1Y1RA 4DJEC 3PNBA 3QKSA 2L2QA 3PYLA 3CJRA 3SQWA 1L7MA 2I1QA 3EEBA 2O3JA 1WW8A 4RD2A 4WE3A 3WY9A 3THYA 5EEHA 3JQ6A 2ZAIA 4OPMA 1GU7A 3MZ0A 4N0PA 4BAZA 1ZMBA 4JQYA 3CZCA 4D7AA 1TM7E 4GOKA 4URYR 4MKRA 2PZEA 2Q5FA 4M1ZA 4ZAVA 3LW8A 5A3VA 1PL8A 3PZBA 4XTCS 1B42A 1HYQA 1RYFA 3C1OA 1MJNA 4X20B 4RV9A 1XVAA 1RI4A 3SYTA 2FMFA 4B3DA 3VPAA 1GSAA 3PJDA 4RJ2A 5B6IA 3WTBA 1ECJA 1T2UA 3ZD9A 2ZAGA 4D3ZA 1C2TA 5E2IA 3EQ6A 1V9LA 4L6IA 1KJJA 2PWBA 4ND3A 1DTEA 2O2YA 2E18A 1NSFA 4R81A 4ZC1A 5JS8A 3DMTC 3OC6A 1Z29A 4CIBA 1JQ3A 4M6WA 4MA0A 3FAKA 1GZ5A 2CY0A 1GA1A 1UCFA 3C3AA 3LX6A 3OOJA 1NNEA 3EQ8A 4D43A 3C4JA 2FWPA 4DLTA 3NS7A 5C37A 3I37X 3I9MA 1EKXA 2GEFA 4UUAA 3PHIA 4A8JA 5G40A 1BNCA 1AV7A 3IEXA 3WAGA 1IY8A 3PC3A 1KVTA 1N1EA 1OJ7A 1Y8QB 1WXIA 3QHQA 1JBKA 1H2ZA 3IH5A 2OHGA 4Z9XA 4JJ4A 4I08A 4DCCA 4MYHA 4QLOA 1TO2E 5EPEA 4Z2YA 3KFXA 5IDQA 4K46A 4OHYA 2X0KA 4O2BF 5L3ZA 2J3HA 1TA9A 3UT0A 4G0WA 5IULC 1Z83A 3E2MA