2ARKA

Structure of a flavodoxin from aquifex aeolicus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
b'SNAMGKVLVIYDTRTGNTKKMAELVAEGARSLEGTEVRLKHVDEATKEDVLWADGLAVGSPTNMGLVSWKMKRFFDDVLGDLWGEIDGKIACAFSSSGGWGGGNEVACMSILTMLMNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVDGRKELLEKIRKDPARFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Structure of a flavodoxin from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Electron transport
total genus 52
structure length 187
sequence length 187
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2arkA00
4ZVMA 3B6KA 5JROA 1AKVA 5EAIA 4U7FA 3NHWA 5FA6A 2XOEA 3QFCA 2OHIA 3OX1A 3ESYA 1D03A 3F6SA 3N3BC 2R96A 2MOKA 2FX2A 4C14A 1JA0A 2MWMA 3OX2A 3K1YA 1FVXA 1C7FA 4DIKA 1YDGA 5LLDA 4LAFA 3K20A 3EYWA 3F90A 2FCRA 5LBTA 1YCFA 1CZLA 3NHSA 2Q62A 1YOBA 4DILA 1CZNA 2KQUA 4NLLA 4OXXA 5F4BA 3L9XA 5ULLA 3NHRA 1OBVA 1RLIA 4D02A 1VMEA 4LTNA 4C0WA 4BMOB 4XDGA 2HPVA 2V9CA 1J9EA 4FGLA 6NULA 2WC1A 4PTZA 2V5UA 1QBGA 1CZOA 1FLDA 3GFQA 3R6WA 3N3AC 4LTDA 1F4PA 2QMYA 3GAMA 2FLVA 5B3KA 1DX9A 3OJXA 4BMPB 3QE2A 2FVXA 4PTYA 1ZWKA 1CZRA 1J9ZA 4DY4A 3FX2A 4N65A 3SVLA 5LMCA 1H69A 4GQIA 4YAUA 3W79A 4ESEA 3KAQA 2FOXA 3UXEA 2FZVA 2N1MA 4CETA 4Y7CA 4QOEA 1AMOA 1SG0A 2R97A 1QR2A 1XYYA 2QR2A 4PU0A 3ZHOA 4ZVNA 2BPOA 4ZVLA 1DXQA 1AG9A 4C0XA 5A4KA 2RG1A 2BZSA 1TIKA 3QFRA 3F6RA 3JSXA 1XYVA 4H6PA 4U7HA 3NHLA 3O2NA 1FLNA 1T5BA 3U7RA 1AKUA 5FUQA 3G5MA 3P0RA 4H2DA 3EDOA 3RPEA 3OVMA 1FUEA 5F51A 4Y9RA 1YCGA 3O73A 1OBOA 3ESZA 3NHJA 2D5IA 2B3DA 4QOJA 4QOFA 4QOGA 1AHNA 1KBQA 2M6RA 1AKRA 4FGJA 5LVAA 2ZKIA 3S2YA 4U7GA 4GR9A 2M6SA 3TZBA 1ZWLA 1CZUA 1FTGA 1JA1A 1RTTA 1TLLA 3W77A 3HR4A 4F8YA 2Z9BA 1RCFA 2W5UA 3NFRA 4YALA 1XT6A 3ES9A 2QX4A 3N39C 4YQEA 3W7AA 1AZLA 3FJOA 3HA2A 4XDHA 1WSWA 1X77A 3OWXA 1CZKA 4N82A 2ARKA 2V5VA 2QX6A 3NHKA 2HNBA 1WSBA 5F12A 4LA4A 5LBUA 4GI5A 1GG5A 2A5LA 2FAXA 2Q9UA 1CZHA 5BUCA 4YAWA 3ESXA 2Z9CA 4YAFA 3NHUA 1BU5A 2XODA 1D04A 4ICIA 3NHPA 4N9QA 2QX8A 1KBOA 1FLAA 3W78A 2QMZA 3NLLA 3NHYA 3D7NA 3FVWA 5TGZA 4R81A 4C76A 2KLBA 1YRHA 4FX2A 1FLVA 2AMJA 1RLJA 3TEMA 3L9WA 4Y9UA 3KEGA 1QHEA 3GFRA 2X2OA 2QX9A 3OWHA 2Z9DA 1QRDA 2OHHA 4M0CA 1YCHA 4QODA 1T0IA 3OJWA 1D4AA 1AKTA 3UXHA 4LTMA 3LT5A 2OYSA 3FW1A 2MTBA 5B3LA 4J8PA 3GFSA 5LJIA 5NLLA 4FGKA 1J8QA 1XI2A 4NULA 5FX2A 1C7EA 3B6MA 3B6IA 1YKGA 2BN4A 1ZX1A 4YAOA 4ZVKA 3OX3A 4HS4A 5EMNA 5NULA 1OFVA 3KAPA 2FDXA 2HNAA 1J9GA 1H66A 2FZ5A 3NHFA 4QOIA 3TE7A 1FX1A 2QWXA 1V4BA 3HLYA 3B6JA 1AKWA 4S24A 3F2VA 2MT9A 4CF6A 2GSWA 4QOHA 2BMVA 1DXOA 2Z98A 1BVYF 4HEQA 2X2PA 1B1CA 3FNIA 1I1OA 1NNI1 2F1OA 3U7IA 2BF4A 3LCMA 5EA2A 2OHJA 1SQSA 5LJLA 1AKQA 3KLBA 1E5DA
chains in the Genus database with same CATH superfamily
2J4CA 2AFHE 1FYFA 1Z8HA 1W4CA 2I78A 3H9BA 4XUGB 2C4TA 3FCUB 4N8DA 1PAUA 3T7JA 1Q0QA 3PGA1 5AKKA 3G1UA 2Y66A 1MT3A 4G6ZA 1YJBA 1BOOA 2JHAA 2R8RA 1CHDA 3DV2A 4G9GA 1RWQA 4UBOA 4N3BA 2AG1A 5FFFA 1AMUA 1M9NA 3ZQ4A 5JJKA 1JHMA 2W71A 4ALNA 4LRXA 3SLRA 1GLNA 1N2BA 3LSYA 1NLMA 4KN9S 2B4KA 2VNAA 5M7EA 1LSOA 4XCVA 5AVSA 4LRWA 3DE1X 3QFCA 1I4TD 2VJNA 2YJ4A 3D8BA 3ESYA 2GK4A 3QF4B 4I55B 3SC3A 4GS5A 3M81A 1F60A 5JAUA 2BHSA 3E5HA 2WSYB 2QAGA 4HF7A 4KZPA 4YHHB 1PLJA 1YRQA 4DLXA 4AW9A 2HU8A 5JYCA 5CFRA 4JLUA 1H5QA 2V3WA 3F98A 4P4UA 3WK4A 3EQ2A 2CL0X 4WFIA 5CW2A 1AS3A 3H5LA 1D2AA 3KJGA 3BM5A 3ONVA 2P9JA 3ORSA 3Q9SA 5ALNA 3OSZA 1KDYA 2DVMA 4Z4IA 3OT1B 2DKOA 4BASA 2JFUA 3FCYA 1GA4A 5AJWA 1UK6A 3IQGX 3GLFE 1Q1EA 2GESA 2FGJA 3H1GA 1HEUA 2I8LA 2DPHA 3A37A 3NIBA 2WVHA 5FBHA 4DHEA 5EP1A 2Q8NA 2JKVA 1HT0A 5IM5A 1TQ2A 1E69A 1NU6A 3ME5A 3RSGA 2G71A 1LTKA 2G7ZA 4FMDB 3WXBA 1GYPA 1YJAA 2ZWOA 5K8JB 3IYLW 1LX6A 5D6NA 3ZBPA 4K8RB 3HB5X 4ZMRA 1XXHE 1HKUA 1C9NA 3CJTA 3OI7A 3B1KA 3PA6A 4K26A 5BYJA 4B87A 4BVLA 3COPA 1XDDA 3DBIA 4M37A 3AVXA 3R76A 3OTHA 3DB1A 3IMFA 4BNIA 2WU1A 2NW6A 1JEQB 3HXMA 4ZEOA 4MPTA 5JUWA 1KVRA 1ESDA 3GI1A 4F2GA 2RI6A 4JKYA 4MOWA 4XLTA 3L5OA 3RHSA 1G20B 4Z54A 4CXMA 3HZHA 1SGWA 3AESB 2BM8A 4DCNA 2F43B 1U4SA 4FDMA 3ONWA 5E8JA 3RJZA 3AR2A 5DFAA 5ULLA 4X64B 3ZHBA 4PICA 4ZYVA 4BZQA 1WXDA 1DO8A 3RBZA 2IS4A 1NXVA 2GZ2A 2HOQA 1P9RA 1RYMA 3U44A 1X1QA 3N6RA 4N3CA 1MO3A 2IXTA 4C0WA 2H08A 1QO0A 2FPIA 1XZ8A 2O23A 4YC7A 3DQQA 4HP8A 3A05A 1SKQA 3LDAA 5LU8A 3NQ41 4K8OA 3TFWA 3E35A 4L22A 4QSHA 4K88A 4DUPA 1JPUA 2QN8A 3PHJA 5DISB 1J49A 2W2QA 1QU3A 3IBYA 1F4LA 1Y9AA 1C1XB 3ETHA 2FPGB 4KQWA 4NBWA 4DCVA 1QTQA 3QELA 1VJ0A 2JLQA 4MW1A 1EFRA 5FUVA 4B6GA 4CI0B 3V34A 1KZ6A 4TGLA 2WIKA 5KWJA 4BO1A 4OAPA 5EHGA 2I8AA 2NV0A 2P69A 4MQ5A 3VPBA 4OI1A 4M9RA 3MT7A 4M46A 1PS9A 1WG8A 2Q50A 2SKCA 4HXFB 4R8VA 5FADA 4GZ5A 1SK8A 3CF2A 3GAMA 1G8HA 4Q19A 3ENNA 1GZHB 1CUAA 3ZV3A 2ZPUA 3J81A 1JDNA 1PFVA 2D74A 5BN5B 1XHLA 2HKIA 5DXAA 4AJHA 3I8XA 1YKSA 3QUQA 4D26A 4Q1EA 3GGJA 3QA3E 1JHZA 3P26A 4OA8A 4QPPA 1TO6A 3OFVA 4KSYA 4B3CA 4MI6A 5A5GA 4TWAA 1L7BA 1YRAA 4RK7A 1EWRA 3SZOA 1UQUA 3WQQA 2PE5A 3AFGA 3ZD7A 2VBFA 3RG8A 2P7IA 3JYHA 1NMYA 1COZA 1QC5B 3FD8A 4AJOA 4CG2A 4NZYA 2PCJA 4CEHA 2ZJ7A 5JJLA 1K2WA 5IJAA 1NVMB 1XTIA 5EE0A 2AS0A 1R9NA 2QPAA 3VKFA 2DM6A 3E9QA 5IN4A 2XLCA 1QO0D 3CR7A 2I4OA 5JNSA 1XNGA 1SVLA 2KYRA 1FPQA 5ITSA 3I3SR 2C3MA 5B1YA 5BPHA 2P2SA 1CUXA 5CG2A 2PKXA 3R41A 4TTVA 1TDJA 1VMKA 1HE8B 3OLXA 4HPWA 4EMUA 1FBNA 1Y8RA 1LGYA 2XCOA 3CLKA 4QZVA 1QGZA 3ZXIA 2I34A 4JS0A 1EFRD 3T12A 2YJTD 3NP9A 4FWBA 1ZR4A 4F1WA 3F73A 2VYVA 2Z6UA 2IXBA 1XNQB 4U2DA 2BUBA 4MVJP 3FTFA 1FP6A 1NVDA 2VJMB 1NRJB 3AZPA 3TOSA 4BNFA 4RQAA 4DLYA 1QZUA 4JOQA 3B7PA 2X1VA 3NB0A 1IHYA 5ERXA 1NN0A 2B98A 3LCVB 1XJ0A 4BNUA 1FSGA 4P92A 2QG4A 1OLXA 2W6IA 3N8GA 4DAEA 4EA6A 3BORA 3RSHA 3DDSA 4OMUA 2IXFA 4JYPA 5JXIA 4HMQA 4MEJA 2DOKA 5L4SA 4R0VA 4UVDA 3D3WB 3DGFC 3PQEA 1X8KA 3FXAA 1IVNA 1Z4MA 3EWAA 4GZLA 2V65A 5ARCA 3SSMA 4B3XA 4BUJA 2HHJA 1NW5A 1VMAA 2LIPA 1VCIA 1R0RE 3VVMA 4E7OA 3FCCA 3PD7A 1B3RA 1XZBA 1VCHA 2QZZA 2D8AA 5EGSA 3HS3A 2ABWA 2OD7A 3DMYA 9LDTA 4JR0A 1UZMA 1T8YA 3HCAA 1WW8A 2VDRB 3RJ9A 1E3JA 1XC7A 3SY8A 2YS7A 2PUBA 1ZDMA 1TEHA 3TRKA 1EAYA 2UYYA 3EDOA 1GG2A 2QGNA 2ZYTX 1B76A 3LGSA 1ZUD1 1ZD9A 3CLRD 5FF9A 1GY8A 5CDGA 2QTLA 3LU1A 4EVQA 5CH3A 1VIAA 2CZCA 3ZX4A 1OBOA 1YBHA 2GJAA 3H2GA 4LSZA 4X71A 1D6SA 1GQRA 4M3NA 2OGTA 5AW8A 2EDCA 1MG0A 2IELA 3OLZA 2C8VA 1GOTA 1CU1A 2VYVD 5T7BA 1A9RA 3I2YX 3MRXA 3AETB 4QOJA 3W4KA 2IYEA 2SNIE 4C2TA 3T35A 4WXHA 3WL6A 1Q0SA 3IIIA 1KO5A 2I1WA 2IEDA 5AXBA 4ZEXA 3ZS9A 3HABA 1NURA 3WRXA 5EHXA 3Q5GA 5K20A 1FFXA 2OCYC 1Y3FE 2OHGA 1AKRA 2W6ID 4K05A 1A95A 1QVVA 2PAFA 2CNWA 2CDNA 1V3VA 2GD2A 2VQDA 4M53A 4U7GA 2H4XA 5ESDA 3V55A 3ZLJA 2OMEA 2EFJA 3H8WA 1CLUA 1SB9A 1K06A 3MWEA 4NBUA 4WZBA 1H94A 3MTDA 2PBLA 3I2FA 3K6KA 2Z30A 2QTMA 5TE9A 2BEJA 1RKQA 4MJXA 1PVDA 1X7XB 5EQTA 5FEUA 3M9LA 3PXCX 3WRWA 2EFYA 4C3VA 4IQ8A 4HTFA 4KO1S 1TZJA 3TAXA 4F4DA 1QUFA 3FDZB 4J9UE 3NFRA 3L79A 5HCUA 1WTAA 3HWSA 1TQ6A 4MUXA 4RFLA 2JI4A 3FOFC 1Y5LA 5CDUA 1WD5A 1U1EA 4Q9IA 2P68A 1FJ2A 3GGDA 3HKEB 4ID9A 1CV2A 3JALB 4YLYA 2PEYA 2AMLA 3RVMA 3QTTA 4MR7B 4R2MA 1YR6A 4Z9AA 3W3AH 3ORRA 3WNCA 5AVUA 5HZMA 5D3ZA 3I01M 4Y2UA 4BFWA 4UMDA 3DOIA 4R9UC 4J0GA 3HDQA 1PQ4A 1NW4A 1L6RA 2FMFA 1XRLA 2JS7A 3KR9A 3VR5H 3BMQB 2YYZA 4LMAA 1YIOA 3FSRA 6Q21A 1WCIA 4YRTA 2XUHA 2QT0A 3O3CA 4NJOA 5JMOA 4HI0E 3TDNA 1AZTA 1TLFA 2BUAA 4JUAA 3C1TA 1I01A 1MEOA 1ODIA 2GN2A 1VGVA 4WY5A 4AP5A 4TVKA 3WB2A 5JD4A 3NHKA 4JHLA 1U3WA 4F9GA 1JFTA 4G5RA 4HDKA 4K6KA 1XR3A 5GZ3A 3DAGA 1G5FA 1TLTA 3QM1A 2CNWD 5CT4A 2XH8A 2PL3A 4BRZA 1XU4A 1VL6A 5F1KA 5B6IA 2JB9A 3AJAA 3PJEA 1KEVA 1Q11A 1Z4NA 2B7CA 4NI5A 4WFKA 2VCYA 3ZIAA 4MDEA 5G40A 2O0KA 1U5AA 1PGPA 2GFHA 4D9JA 1SXQA 2QM8A 4MGKR 4V0NA 4YAWA 2SICE 2VPWA 2WSBA 3CVOA 3PNLA 4EA8A 1UQRA 3R3WA 2DB3A 1Z75A 3K53A 5IT5A 3OTIA 5IWAB 1PFGA 1HEYA 1FFAA 2VPZA 3LUGA 4NBNA 2IHUA 2FPRA 1VE1A 3Q3JB 4MNTA 3UHOA 1ZK2A 1S2IA 1O3YA 2IUTA 3AG6A 1YB1A 3F5FA 4PQGA 5FTNA 3UAYA 3VPXA 4HVAA 4ZGBA 3O1JC 1QV6A 2OGZA 1I0LA 3NTLA 4WBSA 3K8ZA 4EZBA 2IBSA 2ZRKA 5E6SA 3WAGA 4RY9A 1NC3A 1L8XA 3GLVA 3FTEA 1V1RB 5CX1B 3CVYA 3PXBA 4FDTA 5FLKA 3SF8B 4MR8A 2NVUA 2JLBA 3MJ4A 4HAOA 4X8HA 1QOPB 3VU1A 1N5IA 1N7HA 3HVIA 4MUBA 4J90A 1DELA 3ZK9A 2FK8A 2GAIA 3D3NA 1YTLA 4CM4A 4RTOA 1GZVA 4PLTA 4TLMB 4IMJB 3ZD6A 4DIDA 1PG0A 3DCNA 2ZSAA 5BSKA 5KOJA 3R8CA 3DW1X 1E4EA 2B21A 2ZQYA 3Q3HA 5JRJA 4WNIA 4FOOA 3TPCA 1LDEA 2QMOA 2R7MA 1KDPA 3Q15C 4RE6A 1MUUA 3OLWA 2FP4B 3TEMA 4MJ3A 3FZEA 4NQZA 1PZMA 5CFPA 4R9SA 9ABPA 2ZBFA 3P9SA 4FILA 3GFRA 1RBQA 1FDRA 1Q2XA 2J08A 2YN4A 3QBVA 3WIDA 4PO8A 3AM3A 3N0RA 9GPBA 3B12A 3G8YA 3R5TA 3P0EA 2O0HA 1XEWX 3VSBA 3WRVA 1AKMA 4XYBA 4E6EA 1OH7A 2F3QA 3T5CA 3WA6A 1XVIA 3R0VA 1YFJA 2H2AA 4RD3A 3ESCA 4OOFA 3FMPB 3T9FA 3AB3A 3ZV7A 4C7KA 1YVDA 2BONA 1DX4A 1PX2A 2XMGA 4FTWA 4KKXB 4OL0A 3HYLA 4QLAA 3JWEA 5AKGA 3WL7A 2IEYA 2VTDA 4MITA 4BTEA 1Y48E 4PO1A 4DL9A 4BY9E 4IIJB 6REQA 1RT9A 5ELXA 4P3PA 4YRGA 4QDJA 4ZOAA 1NJSA 2I62A 4HNVA 2FG7C 1KI9A 5KYWB 4H9GA 1EFLA 1ZN9A 3BIOA 1CJCA 1X7GA 1NVWQ 3GRRA 4WKOA 4K81B 1TMGE 2TRSB 4BKOA 1O0CA 1S9DA 1W48A 2J3HA 1XL0A 4LTMA 4Q3OA 5IUNC 1FJGB 1U2GA 3NPMA 3OZCA 4W6ZA 2OYSA 4PS0A 1E6KA 3W9UA 1PFWA 3QUSA 3O3MB 1SRQA 2ZUFA 4K0KB 2B36A 4HAXA 5IAGA 2O19A 2IDKA 4JC4A 4P2BA 1URPA 4C89A 1TF5A 5AVWA 2ZGVA 4JT8A 4A27A 1K75A 1ZY2A 4ZEMA 4QG3A 4EVSA 1FUIA 3JQAA 1Z2NX 3FRJA 4QG7A 2HPAA 2NTYC 2OXRA 1NLFA 1ZK3A 1ISMA 4E5SA 3IUEA 4RHEA 5SICE 1KAOA 5F9HA 4X92A 2AG6A 1CY1A 3FCXA 4HWKA 4TZTA 1TGVA 1PV4A 3FR7A 2C5FA 5DOVA 5CG1A 2AN5A 3NTQA 2R2AA 4H3SA 4OK3A 1HDXA 2R48A 2BFAA 1HH4A 2FSVC 4U02A 2B1GA 3D6AA 1SD2A 3PNOA 4HHEA 2P11A 4ZDWA 1E1RA 4I55F 4GUDA 1EEXB 5CCBA 1GUAA 4CEIB 3BE8A 2CVOA 3WR5A 1NASA 1N6KA 2IJGX 1AY0A 1YGYA 4FFBB 4ZANA 5L3QA 3MFQA 4CKWB 4MUNA 3IE0A 5AQEA 4I36A 4BGDA 3BZBA 1HE4A 4LDAA 1YS9A 4PRZA 4BX2A 1XP8A 1BE0A 1E7SA 3D6JA 1BROA 3KFXA 2BFCA 1IEXA 1SUBA 1PK8A 3IDAA 4MW6A 5I9BA 3U4HA 5BR1A 3K71B 1L7OA 1KJNA 1PR3A 3CIOA 3EVZA 3MA0A 3CEPB 4LZAA 4O02B 5DCLA 5JJBA 3U5TA 2ZB4A 5CTAA 1E60A 1XZQA 3ZWPA 5FORA 3PXDA 4IDHA 3QVGB 1V5FA 3P32A 2YYYA 4QT0A 3VC1A 2CE7A 1YB7A 4FDVA 2Q21A 4FMDF 3R4VA 4Y30A 1ZHOA 3REGA 4A0GA 2EP8A 4Y6QA 2GPAA 2KHZA 4BS9A 3AXTA 3N2EA 1V1MB 4LNUB 4EKIA 1KFBB 1TQ4A 2G36A 2VZLA 3U16A 2VNJA 4BX3A 3PJRA 4XXHA 1YU9A 2H2FA 2ZCJA 3MUEA 3CKLA 2POQX 3WC4A 3S40A 4QYTA 3LOUA 3Q85A 2PZJA 3DWEX 2VTBB 2NU7B 5ALQA 2RJNA 5IJ9B 1GKYA 4G0XA 5K4HA 4ZT5A 3STXA 2V5AA 3AQIA 4IKPA 1U2PA 1E1RD 4DLRA 2J46A 1XNJA 2WP8J 3PXAA 4GOND 4MV8A 1QHHA 3KBBA 1KJQA 1XAHA 1YACA 2HA5A 3CZPA 3SHFA 2R751 5KDOA 2MSDB 4KQJA 1JFRA 5FUXA 1XZCA 1GZUA 2R4UA 2UKDA 3YASA 4F6RA 4NENA 5I7RA 4FFRA 4ZRMA 1JH9A 1GU0A 1LPBB 2F9LA 3EVEA 1NW8A 1YL6A 2ANCA 1GXSA 2VC2B 3THSA 1U8ZA 4L02A 5BVGA 2P6RA 1GRQA 2XWQA 1OZAA 3X1ZA 4K6HA 1ZU4A 2Q5OA 4MDYA 2XKAA 5BSGA 1ICEA 1AXGA 1RQNA 1SY7A 4J75A 1KBZA 1B00A 2CXOA 2NADA 1MZVA 2RONA 3CY6A 2ZB2A 1QAQA 3LDGA 1BJRE 4Q3AA 4DNQA 2CV2A 1DXHA 2DG2A 4L85A 1O95C 3TSWA 5T3YA 2VJPA 2PLAA 3N3BC 4B47A 3O8RA 4NU8X 1QLJA 4GX5A 1SHLA 3SR3A 4NV3A 1Y1KE 1QDEA 3FJYA 4DUZB 1QIJA 4KDRA 2NX2A 4BP9A 4M6WA 4YJGB 5ABPA 3ITEA 4RA6B 5LQDA 1SBZA 1QU2A 4PX2A 4LC1A 2JJ1D 3IVRA 1VYUA 2Q5EA 4M0PA 4FT4A 5CX4A 2EJUA 1KDOA 3ZDYB 3GVHA 4BX0A 3MPOA 5EERA 2Q6VA 4KQCA 1FZQA 4LBYA 4YUYA 2GPTA 3DOJA 2EP5A 3CFYA 4L08A 4N3NA 4AY6A 5TY0A 5BNZA 4BTVA 5BV8A 4MGIR 1JHOA 2C9BA 3NHSA 1TZBA 5JTUA 2GO7A 2ZJ0A 4ADSG 4EA9A 5BSWA 4UD2A 1E2BA 2ZREA 1NRXA 3LBHA 4BVHA 1B8VA 1GUFA 2GZMA 5ES3A 4KGVA 1WNFA 4UAUA 5K0GA 4RF4A 4NLLA 4YONB 3AP3A 5KVSA 3MSCA 3HB7A 1JQKA 3KYDB 1YR9A 3KLPX 3RRFA 3T7IA 5LQUA 1PJ8A 1UBSB 2LDBA 3EXHC 2OHVA 2P35A 1P0MA 4GSYA 2WJAA 3V5NA 3O93A 3WSTA 3HWX1 3CXUA 1O4VA 2R6GA 4PZUA 3NNSA 3D7MA 1E2EA 2I67A 4R40A 3AYXB 3BXZA 4PXSA 5ITZB 1PNQA 3DF7A 3ZQJA 4FOSA 1S0UA 1RXCA 4ZKEA 4X1KB 3FIUA 4R71A 2IKQA 5EOVA 4KRXA 3K0FA 4ZRDA 3UBMA 3WB1A 4ZYYA 2EF0A 1TXGA 3GL9A 3ODPA 3BGIA 6NULA 4IV5A 5KOYA 4KSBA 4DA8A 4YCDA 2VHEA 5T41A 1RI1A 4MK4A 1DC6A 3DZFA 4H0FA 3OT5A 4TKVA 2JZNA 3GMIA 3Q7SA 3WLLA 1RWVA 4NCAA 2O6LA 4HAYA 5FLYA 1PT8A 3Q3IA 3H6HA 1I8TA 1DRUA 1GPH1 3R6WA 4EATA 4IRMA 2Z1NA 4AP6A 5KNBH 1PQUA 3BB4A 4US0R 1J2YA 1PLKA 4ARZA 1CY8A 2Q2WA 2WTBA 4RXMA 3ILSA 4OJQA 5A3VA 4H6XA 5B3KA 1X3LA 3KB2A 3U3RA 4DMGA 3QVWA 1Q17A 3R3VA 4WRRA 2IOFK 4E5PA 2Y1EA 4EBBA 3MAGA 1R00A 3P2YA 5J4KA 1ZFNA 1IHOA 1RKXA 2VNKA 1NHWA 4QECA 1CF9A 4TWIA 3U26A 1F6BA 3UBTA 1ZWKA 3HNRA 4RH0A 2K7ZA 1F0YA 3EEYA 4BB9A 3HTXA 5D5PA 1OXKB 4BATA 4A5SA 4I5EA 3D7LA 3IGFA 3GCGA 1RMYA 2J9GA 2O8BB 4R41A 1NLZA 1T6NA 4BFXA 1QFZA 2C1XA 2XOKD 3OG9A 4JL5A 5EIBC 3BILA 3LZDA 1N2JA 4OJKA 1RXSA 1X94A 4QXQA 1H2AS 4JJ6A 3FYUC 1EINA 3GJYA 3ZK7A 4Z1MA 1Y8QB 3T6KA 2X5OA 3BREA 3ZE1B 3KZCA 3MG9A 2DHDA 4OEHA 5T8KC 4B6SA 3GLTA 1NDHA 3TD9A 3O9VA 4NNJA 4F38A 1XTJA 3TE6A 3IVXA 1XA4A 4ND7A 4MQBA 1U04A 1XPUA 2A57A 1NI4B 3SG0A 5THQA 4BRUA 2CJYA 3PR1A 1FRZA 1RLMA 2DHCA 1E61A 4JLPA 3G9ZA 1NQOA 2KE5A 4NESA 4Q6WA 5DWDA 1AK2A 5BV7A 5IULC 4TRRA 1WWKA 2JLAA 1WSAA 5CB6A 5CM9C 4RVSA 5CU7A 1E6MA 4WKPA 3R3UA 2AVDA 4HWOA 3QKUA 4RH3A 4KO2S 2ZBDA 5KKAA 4EEKA 4NX2A 4XB1A 1QB8A 3DDWA 3LV8A 3VH4A 1AG9A 4CLOA 1ISFA 1SQGA 4D6PA 4PLCA 2NOAA 4C0XA 3CHYA 2WYOA 5KNDA 3IB6A 5CTJA 4YQZA 1M2NA 1Q15A 4C6RA 4JYZA 1FP7A 1KAGA 2J1LA 3KB1A 4K6FA 4XWTA 4D98A 3LP5A 1N92A 2VHTA 4FKBA 1ZEJA 3L0CA 3RTCA 1J2JA 2HCBA 3AVWA 1JLKA 2P9CA 3O8QB 1HLFA 3JTMA 1OYYA 1IJFA 3F6RA 4PW0A 3X1YA 2VDNB 3V4OA 5HJ5A 1FSFA 4FZVA 5TGDA 1N3LA 4RENA 2OQRA 4RM2A 3VAZA 2CVPA 1UJBA 4HQKA 4ACAA 4F46A 4UBMA 1W5FA 2GCNA 1T5IA 1DT5A 2OECA 3CZ4A 2KPOA 4Z1MD 5BUQA 2Q4EA 3U6KA 2WIAA 4GPAA 4H4DA 2ZP1A 4XQCA 8LDHA 1ATIA 3M6WA 1R5OA 5IEJA 4KR0A 2XUQA 1EVQA 2OQ2A 3KUCA 1Z6PA 1P7PA 1ZA2A 2YQ5A 4YFYA 4CV2A 3NG1A 3INYA 4LSGA 2X6TA 3C6MA 2DSTA 1SQFA 2Q8QA 3CRW1 4KXQA 3NHJA 5E1DA 4ZU1X 3HHPA 5F7OA 3JYNA 1L5YA 4JSTA 5CYOA 4MQLA 5LKAA 3Q9NA 3KKEA 4WKNA 1KE1A 1FUYB 3VHRA 4OVKA 4ZGGA 1G98A 1Y1RA 2R1ZA 1W0JD 3RW9A 1VBMA 2R8XA 2ZR9A 4QQKA 4TTPA 1UJNA 1DFGA 4XM0A 1AA9A 4ARSA 5HZGA 2ZKIA 3V4ZA 1UBEA 1O6CA 5G3YA 1XP5A 1KGSA 4DNPA 1WL8A 2VZ0A 5FPYA 2QM3A 3MD0A 3DFUA 2VT3A 3GA0A 4Y2PA 4DXAA 1JKJA 3D6NB 1UP7A 1L5KA 2PKEA 4IDOA 3OCYA 3W0LB 4WZAB 2GTHA 3E70C 4YUZA 2DQKA 3QE4A 3ZG6A 4CDMA 1C0EA 1KQFA 1M7GA 4N3GA 5DP1A 3A0RB 1MLDA 4AJ1A 4IS2A 3JWIA 4PPFA 2CMFA 1ZIPA 2EJVA 1L7MA 3GZ4A 3KT6A 5H0IA 3ZKWB 2O8EB 4P5PA 4TTQA 4BNJA 1T24A 1FSSA 2JGNA 5JU6A 1E66A 4FFOA 2FPPA 1GFWA 4IHAA 1C41A 4HWGA 4RH1A 1E4VA 3FDFA 3EMDA 3K0HA 5JH7B 2XCQA 2AE2A 4HNTA 3FSJX 3K3PA 4OJTA 1TO1E 1JAYA 4U4AA 2IYAA 1IUNA 3G49A 4ALIA 3WAJA 1VZ3A 1W4AA 4BTLA 1HI9A 4HB4A 1RXWA 3HYSA 3UATA 2ENWA 2Q5LA 5HKKD 1MJHA 1JLHA 1ZEMA 3ON5A 1RMTA 5DMHA 2AYZA 1MJNA 5LR6A 1HF3A 3IS3A 3K35A 4HYQA 3OPYB 2A5LA 1DBSA 1SOUA 4IIJF 4RUKA 3OA0A 4ER0A 2ACWA 3QOXA 4FKZA 4X91A 3RVJA 1E9DA 2YWRA 4HFRA 5ILGA 4TRMA 4EY3A 4O2RA 3DG9A 2Q45A 3T5TA 4RJTA 2QMEA 4LRQA 3ZBQA 5LP6A 5M34A 5BW5A 3ECCA 4IGFA 2Z9CA 2M6KA 1VPVA 1M2VB 1EWVA 1ZIOA 1YDMA 1PVVA 3U80A 4E4RA 2YC2C 1MBZA 3LVRE 1Z07A 5KHLB 1D1QA 4D6YA 1N2HA 4LXTA 3FSEA 5B4UA 3H11B 3AHFA 2CXNA 2NNWB 3PB3A 1F17A 4AROA 4QREA 1DI0A 3BTSA 2HT6A 3PT5A 4LXQA 3B9RA 1H22A 5CVEA 5I4BA 3KT0A 4NCIA 3GLGE 2QL6A 2FUNB 2AJDA 4UTNA 1FY2A 3AOEA 1ZIYA 4QVIA 3VZBA 5JADA 3K4QA 1DOAA 1SKAA 4NARA 1EM8A 5IYZA 1WZEA 1E1CA 4Z9FA 3DEKA 2J4DA 3FWPA 1ISJA 1U8TA 2PSFA 1JQBA 2FN8A 3U37A 4K86A 2B0JA 3OOSA 1HRDA 3G5TA 5BNTA 3O8BA 3R23A 4X20A 3A10A 4ARIA 2B2XA 3B1ZA 3K9CA 3QSGA 3FPHA 4D2IA 3WLHA 1LPMA 1SBIA 2J33A 4R9RA 3WYDA 4AJLA 2IZ7A 1NUPA 2H7VA 1FNMA 2FZGA 5EKXA 2C2YA 3AF2A 1CRPA 3LFHA 1CR1A 2FHPA 3FB1A 2WZDA 4WGGA 1WPRA 2W58A 3R3ZA 2G88A 3D7KA 1BA2A 2J9RA 4HAUA 2AZXA 1OWNA 4X93A 2QBYB 5H80A 2VN8A 5G0TA 1CQZA 4U2GA 1ZXBA 1E1MA 3DMPA 4PQFA 1JAIA 2XYPA 3DCIA 3NI2A 4TV9A 4ZQEA 4ZQFA 3RWMB 5GOZA 3DXFA 3L8EA 3QXCA 1FMCA 2AG5A 4F2PA 1SELA 3KM0A 3LW7A 4AO7A 5EJ7A 4P7FA 1ETHA 2OHHA 2EL9A 3RFUA 2ZE7A 3RRZA 1BDMA 1VE9A 2FEWB 2HB6A 3PWTA 3IAUA 3NC1C 4B32A 2V7QA 3QEBZ 4Z53A 4ZC8A 5C8YB 2UZAA 1RQGA 2DX7A 4D8UA 1REQB 2WTNA 4QJBA 3L1KA 2DUNA 4LZWA 1HDGO 2PNFA 2FSGA 1DAHA 2BM0A 2YW9A 1V95A 3L6RA 3Q7RA 1VCNA 4N0PA 2IOYA 1QRAA 5C4IA 3DTVA 4KPUB 5ICEA 1OF1A 2QM0A 1KQNA 3HA7A 3WIBA 5DV9A 1YO6A 1LV7A 1VIVA 2GJ8A 4IL5A 1HQCA 1Z4JA 5FH9A 1Q3HA 4HK4A 4CKCA 4CV0A 3KWLA 3JZMA 4H3KB 1J7KA 1L3CA 2FY8A 4I4NA 3RV3A 5MGBA 2HTFA 1XJCA 1XF1A 1RRKA 2QROA 5A4JA 4DT1B 3D6TB 4JGBA 5C81A 2QRNA 4LYDA 3F9CA 3JRNA 5BQXA 3TW4A 1NJ8A 1OSNA 3LO5A 2NN3C 4KQKA 5A06A 5ITWA 1XVAA 2W6QA 4BNVA 2ZBGA 3L8ZA 2NZ8A 3I23A 4R2KA 4BNDB 3EVGA 1KK1A 2P2ZA 1Y4SA 3KRTA 3T61A 4DE5A 3ADDA 4HDOB 3B6IA 1XMVA 4HB2A 5LMZA 4X24A 4ON9A 3ONNA 2TMYA 4RKRA 3ZJ5A 2YNMD 4D44A 3CBQA 3G7NA 1A5SB 1KOJA 3CNHA 3WLQA 1PR4A 4EJ6A 1Y81A 5LIRA 1IM2A 4EO4A 1UFOA 3PLNA 1K1EA 3BMOB 2KB0A 3F2IA 4MGEA 1P73A 1UANA 5J43A 3G68A 4ENSA 2PZMA 5E2AA 2UUPA 2WKPA 4YMWA 1NN1A 4PANA 2IZ0A 2XIQA 1R2QA 3O1HB 1HK7A 3K09C 5DGXA 1E2IA 3WYGA 4D8VA 1IXYA 4UFNA 2H1FA 3AF6A 4JLVA 1KSGA 4ZKDA 4Q39A 2G9QA 1JEAA 1BQ3A 1TE2A 1CY2A 1P74A 1T2AA 2BC9A 3DTVD 1MP0A 2ZUDA 4WD3A 4XQGA 1H4SA 1PYDA 1BXKA 1B8UA 4ZOLA 1VLZA 4GYJA 1K0UA 3IEKA 1GCAA 1NVVQ 4PGMA 4S24A 2A4KA 3L40A 5EXEA 2OQIA 2J0QA 2GWHA 4IWYA 1GPJA 1M1NB 4Q4JA 5TJ9A 1U2TA 5TNXA 1XTKA 2PRJA 3WGQA 1EK0A 2FPSA 3PYLA 2AHRA 4O4JA 4P82A 4RQTA 3K9FC 3FCAA 3KJXA 2UAGA 1BNCA 2Y4NA 4JVLA 4TUYA 2FW8A 3I3OA 1JSXA 5LUBA 1QUEA 1ZUNA 2HF7A 4OXQA 1FTQA 3KK0A 3NALA 4ZT7A 3CX8A 4MYSA 4NMXB 4ODIA 5BYAA 3NBZC 2JIZA 2X0EA 2QV0A 1MXHA 3DMDA 3K6RA 1G3UA 1KKLA 3RIEA 4NR0A 1E94E 1I1OA 1P2GA 1Y3BE 1NF9A 2IHYA 2IS6A 1L9XA 3RBXA 1D2NA 2D2IA 4M1QA 5LQMA 2D3TA 3ND6A 4U2EA 4PWYA 1ZCJA 3HV2A 2IWRA 1OH5A 3ZU4A 3G2MA 1TZCA 3RE1A 1T5TA 5ER6A 3PDWA 4LJ9A 2CJWB 1NXSA 3H4VA 3L0SA 3Q3VA 4K9RA 3WLTA 1VG0B 1D0IA 1SIUA 1SUWA 2PBRA 3ADBA 2R86A 1QP0A 2P27A 3IC5A 1S8NA 4GRIA 3VKWA 3NKFA 1KJ9A 1EHCA 1M8PA 3I2KA 3NBMA 4WY8A 3U0BA 3W4JA 3E7XA 3TRDA 4DABA 3MCUA 1PYOA 1TW2A 2IYNA 3RIMA 5BP7A 5H8WA 4RMIA 5ALUA 3OO1A 1EPUA 1P6QA 3ROXA 2XBMA 3O31A 3RBVA 1SUPA 5T4FA 4I4TA 2C4HA 5A4FS 4D1YA 5JLAA 3K70C 4NYMQ 2PSSA 3CG0A 1IRIA 5BWMA 3MCTA 1NVFA 2X4GA 4AAYA 2NZWA 3KKOA 4GDFA 1C2TA 4OD0A 5IAKA 4BVKA 4PG8A 1O89A 1A2QA 2F8LA 1PFKA 2WUWE 1NJ5A 5IF9A 5HF9A 2AN1A 3HFSA 3ZLBA 2JK0A 2V6BA 3K92A 5IP5A 3H6KA 3G9UA 2G72A 1T91A 2GZRA 3R7AA 5FDFA 3MSXA 4ZVQA 2KWIA 1OWLA 4GOLD 3SIRA 2Q2QA 3L7IA 3WTCA 4E11A 5LYJB 2DP4E 1Z7WA 2XCRB 1USUA 5K0EA 2QRHA 2M1ZA 3EYWA 3RUIA 3A25A 1T3ZA 1YI0A 1RFLA 3G5AA 1YCFA 2O07A 1H0RA 3A1NA 4G8DA 4HJRA 1SN7A 2Q5CA 4DNXA 5CEJA 1C8VB 1OYVA 5LQCA 1J20A 2DULA 2G8LA 3BAZA 3IQIX 3MVEA 4JZKA 2VHQA 2MYTA 4ITVA 4L27A 2O8DA 5DVZA 4BCCA 1JJBA 1MGPA 4HQRA 3IE1A 2YASA 3K9BA 4II3A 3RT9A 3RVKA 5LDHA 2VYND 4R1LA 1IRXA 4TXJA 1W5SA 4CCYB 4JYMA 1LU9A 1U1GA 2KBFA 4QHSA 4UE2A 5JQGA 5KWIA 1H6AA 3HKBB 1ODFA 1NXXA 5A6SA 3OT4A 5CNMA 5KX5A 2VQSA 1OLUA 3LD9A 1NUUA 5BVHA 1KHTA 3VVLA 3UYKA 4YAIA 5A71A 5F4BA 4CMIA 4HUQA 5F2NA 3UWDA 2A0FA 4MO2A 5DK4A 5KVVA 3BB3A 3CZAA 4L74A 4QATA 4E13A 1C3EA 1RYFA 1E9RA 2A5FA 3MS2A 2CLCX 4C21A 4CKYA 2GN4A 3UMCA 3LAWA 2D5LA 3B48A 2AN9A 3GPDG 2R65A 4D02A 4OREX 4R9VA 4C88A 1U31A 1GZSA 2CVHA 2E4UA 4WUVA 5SYAA 1IMOA 1DKPA 1I4OA 4EMTA 4ZT3A 4UM9B 3AR3A 4I7EA 2V9CA 3IAXA 1GSIA 1UKYA 2YDXA 3INRA 2DFNA 3TNYA 3U17A 1CUBA 3GQBA 1N5RA 2V5UA 1TD1A 3L4BC 1SUAA 3KFLA 3HDYA 4A82A 2QSUA 1PBNA 4EYGA 2Y2VA 2C4WA 1U5BB 4PX9A 1V8OA 1Q12A 4ZCMA 3KSUA 7AT1A 4AT1A 4F3NA 1SCNE 2BTEA 2ZRJA 5DIFA 5I6DA 1J22A 5CYPA 4P7BA 3K6SB 4MGZR 1F2UA 3P1JA 2XIJA 2C7OA 3WKDA 4AZ3A 3P2OA 2J9FB 3M6MD 3DAFA 3OJXA 1O5TA 4Q5IA 1EX9A 1E2JA 1QYXA 4J0EA 5D86A 3UHFA 3ZZUA 4F5DA 2F8SA 3NH6A 1CRZA 3OIFA 1H9AA 1O58A 2QIOA 3AG5A 4ZMBA 2P9EA 3UJPA 2GCPA 2RHJA 4Z8XA 4Z4FA 2JH9A 2W8BA 5FHQA 1M1YA 4NH0A 4H08A 2OV1A 1HDIA 1JWAB 2OBNA 2XDWA 3DT8A 1A8PA 1CZRA 1HBJA 2CW5A 2M2IA 3PQ6A 1JPNA 3WMRA 3AVYA 4WOKA 4D8YA 3E1KA 5FWYB 3I5AA 1ZIDA 1R4NB 1A76A 3NT2A 1SCQA 4C4XA 1R5JA 1A5BB 2NGRA 3CGGA 2OCLA 4I9GA 4B6RA 4UEWA 1V16B 3BA6A 3IJPA 3ONDA 4DTCA 2FOXA 1Q7BA 3HCOA 4IZ6A 5L7WA 1EESA 3PFNA 1F2VA 2BP7A 2G9RA 3MWEB 4GE3A 4WZBB 2O1WA 4LDNA 1S9HA 2V0NA 3KJQA 4IF6A 3ZEIA 2J0EA 4G5QA 3UKDA 4BVAA 1ULBA 1ADYA 5HRCA 2PWAA 4KAJA 4WECA 5JHGB 2FZCA 1T4BA 5HUHA 4D92A 3KQKA 3E9DA 1IHUA 1C9DB 1CE8B 2C7BA 3FLBA 1UKBA 4PU0A 2CKMA 4Y2SA 4CTOA 3NIGB 2TSYB 4QIHA 1WDTA 5B1HA 3E27A 3P96A 3WLPA 3X3HA 1D9ZA 2BCEA 4Y1EA 3OJOA 2IOQA 3TQHA 3B7GA 1MT0A 4J2TA 2PUVA 4MWBA 1EQ2A 1NX9A 1QVZA 4RDHA 4B5KA 4GNRA 1STOA 3I8SA 3ITDA 4QXMA 1HOTA 2B5WA 1AN0A 4K9NA 4R2WA 1UWVA 1PW5A 2P9YA 5I9LA 1B0ZA 3TBKA 1ULSA 4OOEA 1N9ZA 3MF4A 1T4MA 4H7EA 4QPCA 1GFZA 5BR7A 1YHZA 5JH7F 5AJUA 1PRYA 2FWPA 2IPLA 3QLUA 4FN4A 4RCZA 4EI7A 1HR0B 5KUTA 5K03A 3BXHA 4AO6A 4QOSA 1V6CA 2WG1A 1NJFA 4HDKB 5AYVA 2V9ZA 2FXVA 4V0LA 7MHTA 3M34A 2IX3A 5HBGA 3OQPA 3P5SA 4UUOA 1D3AA 2Q7XA 3L8YA 3JD0A 3LUPA 3U7RA 4F56A 5HTKA 5M29A 2QKYA 3F8TA 4BV9A 1HUQA 3KOWA 1N2IA 2AI2A 1T5LA 3WLKX 3DFIA 5BV0A 1MX3A 1GIAA 5KQRA 3WOHA 2JLCA 2ZDGA 1FXWF 2CN1A 5IMBA 5JNRA 3CS3A 4ZDIA 2L69A 4E88A 3VR6D 2VHWA 3GF4A 1U7XA 2WIDA 1H0KA 3OCUA 2UZ0A 4FYYA 2Z2IA 5FUWA 4EWLA 4GI7A 1IG0A 4ZAFA 4FIZA 1GQ2A 4Q7LA 4GVLA 2Q6TA 3KHUA 3DBRB 2NU9A 3PFKA 3PGXA 5K8CA 2IDJA 4B9AA 2D5IA 1EE9A 1XQYA 2AFIB 2WUDA 2Y4OA 4HUJA 3QOYA 4JJ7A 2CV1A 3L8GA 1UJ5A 4GMDA 2GKOA 4MLZA 1SC6A 5FWNA 2GCOA 5FHRA 2YJGA 4Q9JA 3M33A 1N25A 5DH9A 2P2CA 3EA0A 4CIWA 2H1VA 4AS1A 1QCYA 3PC7A 3SYMA 2DJIA 2G8NA 1EP3B 4GRDA 1NUHA 3TOZA 4BNGA 4EPRA 2XE4A 4GR9A 3RIGA 5JXJA 2NVUB 2NZ2A 4K2HA 1F12A 4QBFA 2WMYA 1ZWLA 2AFVA 1GADO 1JE1A 1DAGA 2OZLB 2V58A 4FEGA 3WYFA 3A4TA 1M0WA 3UJ7A 1LI4A 3H75A 1FTWA 2P4SA 5CK4A 3VI4B 5I9IA 4JT2A 1N8KA 1ZG3A 4L78A 1LBSA 1Q6YA 4OQNA 1OIVA 5FYQA 4PIVA 3QV1A 4D4JA 1K8RA 4L6IA 3OTWA 4I46A 4UNNA 3TI7A 2ZS7A 1I9CA 2PG3A 4QXAA 3RS3A 3CQ9A 4UDOA 1TT5A 5B3JA 1XT6A 3PTLA 1Z2OX 5JXHA 5E4YA 4IDFA 1QSGA 3WKBA 4BX8A 4B6QA 4G0NA 3PSAA 2VH1A 3Q3EA 4J43A 2WOJA 1P80A 4JN6B 3JXEA 4M1TA 2ZWAA 4AP9A 4NCKA 3VNAA 5HEKA 4CN9A 4AYWA 2PWYA 4PFJA 5DEIA 3R7WB 5A0TA 3DWIA 4MYHA 4UPEA 1OJ7A 3AI3A 2WE8A 2YWHA 4D3ZA 3HA2A 4RO0A 4E15A 1DU4A 1FQKA 3TBFA 4OGLA 1CBUA 5EJ8A 4OG2A 1YJCA 1NMQA 2P2NA 2X23A 4UUMA 1FYDA 4QDZA 2A78A 3B3GA 4PN7A 1P8AA 1NMXA 1YS7A 2YINC 1DKLA 1M67A 2XUPA 2YVAA 4IWNA 3SGLA 2PXAA 1V3UA 5L40A 2C2OA 4E07A 5FV7A 4MI3A 3T4EA 2IEIA 1E32A 5B2EA 4B3TB 2XT0A 3D0RA 2YYAA 1G21A 1WSBA 4QRHA 4REQA 3AJ8A 4EQ6B 1XELA 2H92A 3ICWA 5BYKA 2QP4A 3HZOA 3A6DA 4L73A 2FPUA 1JR3A 1LFAA 2VJYA 2Y1FA 5C8YF 3NUZA 3WGMA 1DRVA 5KQPA 2MINA 4WTOA 2R1VB 1O94D 3ZZ1A 2R6FA 3E9MA 4MEBA 2ZBPA 3S2UA 2Y99A 4N39A 5DDIP 1ZNWA 4IV8A 1RVV1 2G5TA 5JDCA 3ESXA 4B1FA 3U4IA 2FE1A 4GXQA 1R8QA 3DS8A 3WGLA 3NHUA 2CXXA 3HN7A 2QXUA 1J06A 3EQ6A 3I12A 4UCWA 4Y9DA 3RJTA 5BURA 2ZJAA 1NX6A 3TTTA 3NDJA 2ONJA 2BFDA 3JQAB 4FSXA 1A7AA 1IUPA 3B5EA 1NW3A 3AUUA 3H42B 3NBQA 5FBQB 3DBOB 5J5CA 3GAAA 2XCTB 4KJZA 5KVCA 2VR1A 4HATA 2GMWA 1TM1E 3GV0A 1EFVA 3OZGA 1DIGA 2RD2A 1WMAA 2DE0X 2AW5A 4GWGA 4WFJA 2RHMA 5B2ZA 1KC1A 4E1BA 1XNHA 4P86A 4OIFA 4PYIA 2HA6A 3NHYA 4P9NA 2VTVA 3W90A 4FPXA 1W36D 1W0KA 1O03A 1UK9A 2FN9A 2QEQA 5DLQC 3THYB 4V02A 3G2IA 2N3ZA 1SC4A 2QQEA 3EGXB 3FVWA 4Q9AA 5GINE 2QTAA 2QVYX 2QVCA 3RYHA 3TF5A 3H2YA 1OZ0A 2Z4SA 4A26A 4B73A 3PENA 3IPRA 3ZGYA 1T2DA 3ZK8A 2WSMA 2A0WA 3RS5A 3IUSA 5KAPA 1RAGA 1KYZA 3A2MA 2FMHA 4GGOA 3T1NA 3VV3A 3W8NA 1UFQA 3B38A 3ZN2A 1JR3D 5IDXA 3AVUA 1U8XX 1TNDA 4HDMB 1ITZA 1EX6A 1DRKA 1QKIA 3E7WA 5F9MA 4BFLA 3F1KA 4BMDA 3T4PA 1JFLA 3SI7A 4BCDA 3Q0TA 5KTNA 3IR5A 3QE3A 4PLVA 2FH5B 2RHHA 4PSKA 3BVPA 3L7YA 4U1RA 1A2BA 3ZHZA 4ERXA 2DTDA 2OXTA 2C9ZA 1TU3A 3AFHA 4YUXA 4KIWA 1JU3A 1U80A 1YE3A 4P7KA 4ZMSA 4C08A 3VHLB 1KEUA 5COBA 3JQGA 4DJTA 2WVGA 4O2BA 4D3FA 4NYIR 2AE1A 3ICQB 3DOHA 4WL0A 4GL4A 2VSQA 4BDTA 1YULA 2WOOA 3TI9A 5LC1A 1A8UA 1JEOA 2CL7X 3I39X 4RD1A 3F6PA 1YJXA 1NXPA 2PSJA 1M8GA 1YMUA 2X0IA 2WVJA 1KZYC 1RNLA 3B53X 3GOHA 3IT0A 1ZL0A 1E3DA 1IJEA 1H1TA 4GM1A 4JUCA 3C3PA 4P36A 5IAOA 5L8VA 1BFUA 1W0KD 4HMOA 2B4YA 4MRRA 1P2FA 1M5TA 3UWPA 5DWVA 4XCQA 4ME6A 3U61B 4XW2A 1SVWA 2L42A 2MMGA 2ZT8A 1C29B 2ZXEA 4ZO8A 3WIVA 2FF7A 1JHYA 4LVUA 4MXDA 1U1CA 5CFZA 1G8GA 3MWYW 1ZNZA 3LDHA 4PLYA 3WZLA 1ZSNA 4EELA 5KKNB 4PZLA 5F7XA 5JWRA 1N0UA 5B5SA 4P33A 1CUZA 1YK0A 2WF8A 3H5VA 3RC9A 3IOCA 4CIDA 1E98A 2Z09A 1H6CA 1SCIA 3M1YA 3TNFA 5HPYB 3WQHA 4R54A 1W75A 3UAXA 1E99A 3HI6A 2FSFA 3GJZA 1M2EA 3BL6A 3UT5B 4TTAA 3S0JA 4DADA 4FGKA 1M2OA 3WB9A 1U6IA 1BYIA 3AFMA 4FCTA 3QYJA 4LFAB 5M2QA 3DR5A 3MJHA 3VZCA 1N6HA 2DJ5A 2QYOA 1WXHA 2X5JO 3TR0A 1W8DA 2PUAA 2BN4A 4OQYA 4LBZA 4ZO7A 1QFXA 5EMNA 3QIVA 1RPTA 2CYCA 4LCEA 1EXVA 2WD9A 3AWIA 5I9NA 4L0CA 1IZ0A 2JZOA 2PUTA 1B42A 1N8SA 3GRYA 4D7AA 2O2ZA 3TCXB 3KAPA 4DV2B 4GOXA 4GR5A 3GUYA 2Q1WA 3NM6B 3CZMA 3VISA 3D43A 3IKTA 3IUNA 4PIMA 2BGTA 1A5AB 3NWBA 2R6R1 4RMNA 3E3MA 4X94A 3KJFA 4DA7A 1RLOA 3MJVA 1G38A 3W5VA 5AOVA 4EL5A 1GFSA 2IUSA 2QUKA 1YUMA 5GJVC 4QUBA 4MVCA 5LYJF 3QBDA 2E48A 4N1AA 1MU0A 4EARA 4YRFA 3JARA 1X1RA 2ILTA 2TMGA 2JVKA 3IVMA 3O8OA 4MRNA 1T2VA 2YZ7A 4XQ9A 2X13A 3ETEA 3EZ2A 2DHQA 3ESDA 5TT0A 2VQFB 5FA5A 1ZD4A 2ZAMA 3PGLA 1YE5A 1RYBA 1PEDA 3LT1A 1PJRA 1DAOA 1M2GA 1ZP6A 1ES9A 5SV2A 4DV0B 3WGVA 2O7VA 3SM9A 2VRBA 3DLIA 4HEQA 1EZ1A 5ALJA 4RHUA 3K1TA 1JG3A 2H8KA 1II8B 2F67A 1XOIA 1UXKA 3X1JA 5CA1A 1AN9A 3OHPA 3HK2A 1GQYA 3GR6A 4LJ7A 3E5RA 2B7BA 4FU0A 4PYJA 2J48A 1ECFA 1ZNYA 3R7FA 3WHPA 4F9TA 4M9CA 4MWTA 4RKYA 3ZY2A 2VSXA 3X1WA 4QGSA 3CU5A 1M76A 2DT8A 1EBBA 1LSUA 2OBFA 4Q1FA 3TNJA 3UWKA 1AKEA 3ZDQA 3MBIA 1G3QA 1LCIA 1KJWA 1NFRA 1NV8A 4YLGA 2X7XA 3QLVC 1UBJS 4EJ2A 5JQWA 1VOTA 2AJTA 2XUKA 1CDEA 1R9MA 4ZQIA 1NOKA 5FCDA 3NC0C 1G2OA 1FYWA 1YHNA 4WCFC 3MTQA 4NZOA 3TMYA 1N0IA 1C50A 2XNCA 2ZIZA 5DT9A 1RQ7A 3P9XA 3ZQUA 4B8YA 4I6GA 2PY6A 4D4IA 1L5HB 4MX8A 2NSLA 2GK3A 4MB0A 2RB4A 1VSVA 2HF8A 3IV6A 4FLFA 1XZIA 5LU9A 1QRTA 4GXNA 4DLNA 3GJSA 4ZPXA 1Z5GA 3K9QO 2H18A 2QI9F 2YY7A 3AIKA 3BH7A 3DOUA 4RHXA 5K8UA 4ZOBA 1IK6A 1N75A 2HBZA 4GLBA 3KZ1E 1ZOOA 3MWJA 2XPCA 4ZZ0A 4D42A 1LDYA 5FUYA 3ZHCA 4YRPA 2FFJA 1U8AA 1O7JA 3IIMA 3N7AA 1L5RA 2PZFA 1NY6A 3GJRA 5JSFA 2ZM5A 4XJSA 1ORDA 2XZDA 3VNRA 3DFFA 1RC1A 4RWZA 2RH4A 1S8FA 1MF7A 3HSSA 4DGQA 3FKQA 1JHQA 1E58A 1JJAA 1IULA 4KXMA 2IRWA 5LXTA 4GFDA 1E92A 4NZ9A 1FTYA 1FFWA 1NONA 5FEMA 1UMCA 3P2KA 1KXZA 1QH9A 1DKQA 4RK1A 1P77A 3VR3A 3NWJA 2YUIA 3CH7A 1B8OA 4JYBA 5PGMA 2SBTA 1Q1ZA 1UOQA 1CZLA 3CMCO 2XNJA 2M1XA 2WM2A 3RROA 1N9GA 1Y6JA 1NXTA 2W2KA 1EGMB 4C0LA 4ABYA 2OV2A 4IGAA 1U4NA 4C2BA 4J0DA 4HQOA 1X70A 2XQGA 3VDXA 4DM3A 2YN0A 1CDOA 3GT7A 4Z0NA 4YUVA 2LV8A 3OICA 3G13A 1D7AA 3RVLA 3SC2B 4DLWA 4DQ0A 3THOA 5DHTA 4RK6A 1A9SA 1VPTA 3FR8A 1E3SA 3KZNA 2WFMA 4NWIA 4MVWA 2FW1A 4FLMA 4GBED 3PS9A 2JCXA 2NT4A 1HOXA 2J6BA 4M0EA 3WV5A 1Y3HA 2C2XA 2CNNA 3DOEA 4IHQA 2A2ZA 1MOZA 2JFPA 3DD1A 1V7PC 4NFHA 4F8EA 2AZTA 1M34A 5I7EA 1M5UA 1Z28A 4TRJA 3TB6A 1SUSA 1VFPA 1EGVB 4FT2A 2LDXA 1LSSA 2N9UA 3ZWDA 3L43A 3L8DA 1SULA 4OJMX 5LBIA 1NSYA 3D6FA 4KR6A 1HPLA 2AN4A 1XMQB 2RHCA 4KVZA 4K6MA 2BEWA 2JD2A 3PDUA 3NH9A 2A3NA 1NZDA 4P32A 1JJVA 4PG5A 3EG5A 1ID1A 3DPSA 2OPHA 3G0GA 2FHSA 2H5LA 3I62A 2PQ6A 1FS5A 1YC5A 5EKSA 1XALA 2UYQA 3I76A 4AY2A 1JDPA 4IGIA 3N3AC 5CPBA 1KC3A 2C42A 1BVHA 4BQQA 3AJRA 2ZYGA 1QVWA 2EBFX 4LY0A 3Q1KA 1YRWA 3C15C 2EV9A 4JC5A 1ZJZA 4FJ2A 2UXBB 1DBRA 4YRRA 4BLPA 1FMJA 3ETGA 4G0VA 1YNSA 1ZN8A 5FO1A 2QJFA 2QL5A 4HH1A 1U0SY 2V55B 2FVXA 5G0UA 1K97A 1Y7PA 4Z49A 1ENOA 4K6GA 4TM8A 1Z4OA 3G0CA 3VFDA 4TLCA 1B15A 3A2LA 1FMFA 2WWHA 3QYAA 4CIYA 4DDHA 3GROA 2ESRA 4DLPA 1GZDA 2Q0SA 2G1KA 3SSAA 2Q9BA 5AK0A 1U6KA 1WABA 4TOIA 4DCUA 5CB4B 3K4HA 2HF2A 1A8SA 2IEAA 4FZRA 1FE8A 4NNPA 3EWNA 1ZK1A 4EYOA 3QVLA 3ROFA 1GNRA 3SSNA 1GTJ1 2ZRHA 5EQFA 1W1UA 2WNSA 1Y89A 1JHUA 3ZUPA 4CMBA 3KYJB 2WAAA 2ZI7A 4TL7A 1RRPA 2SKDA 3H4TA 2PAAA 3W2GA 4NBKA 3SOPA 3X0DA 2EGHA 4DSZA 2NO5A 3GYGA 1LPAB 3AC0A 4EHBA 4EB6B 2NPFA 4YAGA 1ZD8A 4MVJF 3VZDA 1XYYA 5LZ9A 1R6DA 1SVOA 3HU2A 3O83A 1L4FA 4PVDA 1P0PA 2NP6A 3DP7A 2ZJBA 3FGZA 4MS3B 4ETNA 1A1VA 2PQ0A 4EHKA 1KY5A 5IBPA 1M2WA 3R0ZA 3GA5A 1JGTA 4CL8A 3EHEA 2FPPB 2H4HA 3N0XA 3IELA 1X7WA 3MXTA 4EY4A 2VPTA 2DKNA 4GYKA 4PSAA 1R64A 2MIIA 1RLUA 1Z2PX 3G9QA 3FYHA 1J2TA 3PKJA 1YFLA 2CB9A 1K5GA 1T0PA 5C8XA 5EYPB 2QVXX 5FOXA 4ES6A 1XDBA 3BK7A 3EPJA 3VDMA 1VZ2A 1Z12A 3EGCA 5C80A 4NZMA 1TIKA 5EIHA 3DVAB 4Q37A 1YGPA 1MV5A 1MTZA 1G8PA 3HC7A 3OF3A 5ALEA 4KFUA 4D3DA 5GVRA 1RWNA 1UAAA 2UVQA 2B8JA 1D9XA 1G7CA 1VG9B 3CB2A 4V0MA 4ZO9A 5ELLA 4DMFA 5A5FA 1GL3A 4M9SA 4MRMA 1N1MA 3WHIA 2DTXA 3L6DA 2JANA 2W48A 4IOJA 4URYR 4CR7A 1N2CA 5DWQA 1M5RA 1Z29A 1LW6E 1LNSA 2CXPA 2H6EA 2JHCA 3HFJA 3ONEA 4GGPA 4I08A 5T57A 1JIIA 4DBLE 4MWEA 2HN9A 8MHTA 1H1LA 2XMCA 1IYZA 2DY1A 2IIPA 2ZTMA 3EUAA 3HB1A 4W1SA 4Z8YA 1WHTA 1ODLA 1NQUA 2LKDA 3O73A 2QR3A 2OK7A 4C7VA 3MWLA 2D4HA 3VR4D 2RFLA 4KGXA 5K5EA 1TZKA 5LVAA 3F7NA 2XYVA 4CM9D 1IAVA 3E82A 3LYLA 1RIIA 1Z25A 1KZ9A 1LVUA 3PG5A 3KD2A 4FFDA 2PZGA 1IUKA 3QKTA 2R1TA 4MHOA 5JY6A 5EVCA 4FDUA 3TEFA 1UXHA 4HC4A 5DNYB 4ESVA 4D79A 4E08A 2I5PO 3WIOA 3O38A 1JFSA 1IH8A 1W52X 3ROEA 4OHMA 1GPLA 3SYNA 5L3ZA 3M6FA 5JNTA 1MR3F 4LHYA 2VATA 1TOAA 2YS6A 3EXEA 3IMEA 4KP7A 3O21A 4NK4A 4NYJR 1DEOA 3BWCA 3LLUA 4CRWB 1MGOA 4BO6A 4Q4AB 5L4LA 3MRVA 2Q3MA 3L7JA 2D7DA 4J0FA 4EBFA 1RJGA 2ERCA 5FLEX 5CDHA 1H0HA 2VPQA 4HN4B 3W77A 1EP9A 4H1HA 2EAUA 2BEUA 4JWKA 5TLSA 1NWHA 1N6PA 2YVQA 1RCFA 5D3MA 4DLZA 4HN9A 1AK1A 2HPZA 1P0CA 2X19A 3CWQA 3HUTA 3UJHA 4WACA 3ES9A 3TYXA 2PS3A 3OF5A 2QX4A 5AJHA 1UMKA 2HADA 1YVUA 3TBHA 4TQ9A 4DR2B 4QU0A 1SCKA 1DAKA 2R6JA 4G1FA 3IALA 3HGQA 1B74A 1UZUA 1GP2A 3TLAA 4RHTA 3W7AA 4DHWA 1NNEA 4II2A 1VSQA 1AZLA 2X0NA 4YAEA 4ZARA 5EVJA 1JIQA 2DQYA 2OZEA 3AVOA 4FGSA 4TV9B 3SE7A 4M1WA 3LTNC 2XWPA 3ZHUA 4YRMA 2BZGA 2J30A 1RZVA 2OGUA 4CHTA 1A2KC 3FH0A 4JL8A 3RK1A 5B7PA 2VQ6A 3WL3A 4DIBA 4E6PA 1S2MA 3U09A 1TJNA 1H8HA 4TS1A 1D1SA 2IVZA 1FF9A 2Q6OA 3WLJA 3VA7A 3ABRB 4FYIA 1PZFA 2PJZA 4BNWA 1M8FA 3FIJA 4WXYB 2E89A 5D1HA 4CE6A 3H9UA 4YNBA 1W29A 1IL0A 4DZZA 3TL2A 1GLGA 2RGCA 1RXIA 2DY0A 3D4IA 4P08A 2C8KA 2D2FA 3AKCA 4LEIA 3RHFA 3WLRA 4P0QB 1YU6A 4F5WA 2J3MA 4YRBA 5AIBA 1BXZA 2NTNA 4GVPA 4B2PA 3A32A 5HK8A 4O29A 3IDSA 3FZGA 4EX6A 3MHTA 1Z6AA 3TJRA 2QY6A 2XTNA 3N58A 1JBQA 4DCOA 1FP1D 2CYAA 3OM8A 3GMSA 4DMCA 2FSVA 4GECA 1RDFA 3GLUA 3CINA 1L1FA 1TU0A 4C29A 4R8KA 2Y1OA 5IHXA 1VDZA 2EHDA 2AD5A 3RANA 2GI4A 3ZU3A 3ZZTA 4XQ0A 1F5SA 4AU1A 3ZGLA 1Z4KA 3MS7A 3E1GA 1OAOC 3VPSA 1NL3A 1VI5A 3DO6A 2JAPA 2FQYA 2VO1A 2FN7A 4EFDA 1X8LA 1ONSA 3ZWVA 1TC2A 2AIRA 1PZNA 121PA 1IE3A 3TLJA 5BWBA 1G8KA 3EHDA 3GVIA 2RMKA 1J0DA 1OJLA 1Y4ZA 4QPJC 1U9YA 4ATNA 1EP1B 3JQPA 4IIGA 5DYGA 4D4KA 3NHAA 3PFFA 3RO7A 3VNVA 5HHTA 3GRPA 3WGHA 13PKA 3WLSA 4G0YA 3HBJA 3CEAA 1CUGA 3AVPA 4XEUA 3HNOA 5DLYA 5ALFA 1DC3A 1T8UA 1E3LA 2GEBA 2Q07A 3G6WA 4JJZA 2HCRA 4QELA 4TM7A 4ZI2A 4HH3C 4GPIB 4Z3DA 3L0YA 1MIOB 3QUBA 4Y9UA 3MTAA 4YRDA 1EUDB 1MRSA 1NUAA 4IIDA 4ZOLB 1J07A 4XVCA 5IBCA 4F8JA 2PKQP 3QKSB 4KFCA 1IBCA 5JANA 6ADHA 5CDTA 3PQ7A 5ED0A 1CT9A 2J0VA 2D00A 4WWHA 2H51A 3L1JA 1WUTA 1A77A 1TMKA 1QWSA 3UK0A 1Z3CA 4RJLA 2YL2A 3C14C 4O4JB 3M4XA 1DKUA 1UEIA 2BFBA 1UEXC 3ACBA 3E03A 3EZYA 4FI3C 3U7EB 2AKAB 1XFDA 1V7QA 3T9AA 1T5SA 2GBLC 4LVCA 4ZI5A 3L6EA 1ZMRA 3VSAA 2UUOA 5JDIC 2G09A 1LUAA 1NJ6A 4HAVA 3C6KA 4X6XA 1IZ9A 2QRLA 3AHDA 2EZTA 3GMTA 4IZHA 1NBAA 4QU9A 4EP1A 5CM2Z 4MW5A 3MJSA 2DBQA 2DBZA 1HETA 4LE0A 4IJ5A 2X1MA 3HXTA 4P3NA 3BAFA 2YBEA 3SKVA 3ID6C 3FTQA 5DM70 1GSAA 3STVA 4YR7A 4YRKA 5AVZA 3SNHA 3OZSA 2VIIA 1UBHS 4KOAA 1M2JA 2BV3A 3WJ2A 2BFEA 1AHPA 5L53A 1GG9A 4NV1A 4B48A 4A8HA 2CUNA 4HFNA 3KV1A 4UVEA 2WB4A 1OROA 2C3YA 2IA5A 1O95A 3PPVA 4C0AC 2MTBA 2IEGA 5LQAA 2C57A 2C2WA 2NVBA 2BFNA 2VJBA 3GD7A 1H3FA 4MJ7A 3X1XA 2X77A 2V3CC 1VIMA 1C3LA 1G6Q1 3R09A 3DP9A 4I66A 4O63O 4Q9LA 4N76A 4LYJA 4LK2A 1UZAA 1D8TA 1JV2B 2Y8EA 4DA0A 1M72A 3CISA 3K1AA 4MGYR 4TQGA 3CZQA 2NZXA 4DRXA 4NY1A 5FX2A 4XARA 1GTMA 3HVJA 4S12A 1ZVMA 3CKKA 2RH5A 1T1GA 1BHSA 1U3CA 4M8NE 3NX4A 1L3BA 4O1HA 2MYUA 2IWHA 4UUAA 2C7PA 1WBJB 4FK8A 3P8ZA 5I48A 1M1YE 5ICGA 5CB8A 1XJ5A 3NCHA 4D3XA 2HWKA 5NULA 2OCPA 4DTIA 1E6WA 3L07A 2XVYA 4ECAA 4U2FA 5K0BA 4JJEA 3BWVA 4NU6A 4N49A 5FTKA 3GDWA 3ZS8A 3EVNA 4TWRA 3GLIA 4MIKA 2JBHA 3M9XA 3FJ1A 5B1DA 1JQAA 2F59A 3NHFA 2QTCA 4DXDA 1XRMA 5DBIA 5TR9A 2VAXA 4ED9A 3RLFA 3F7TA 1I36A 3D1LA 1ULHA 4GPTA 5BN3A 2HJGA 1CX9B 1EM6A 1JEYB 2YZGA 2XSZA 4OUDB 1V4BA 3V7WA 4HDRA 3LDFA 4W5QA 3HL0A 1RZUA 2JFOA 2NACA 2PMWB 4Q4HB 1EFDN 4QYMA 3EXHA 2NG1A 2ZI4A 2DQZA 3HB0A 3ZZ0A 4NATA 5HKAA 1EJ6A 2Y0BA 2CFSA 1U0EA 4XYGA 2PD4A 5K3DA 1P4HA 4JXXA 1S8AA 3A1CA 3PFCA 4DYDA 3W34A 2CF6A 3PQ8A 5ELMA 1MB9A 4QOHA 4BKMA 1DXOA 1A97A 3BH0A 3PE4A 1YXMA 3C87A 4D4LA 5FQOA 2ZZMA 1T9DA 1SNYA 4LISA 2O2CA 3CN9A 3GZTB 2CJFA 1E2UA 2I9KA 1CJUC 2VUIB 1T2FA 3COZA 1WEHA 2HMTA 3LBIA 4BWYA 2P6OA 4ZAGA 4QTZA 1CJMA 2IPXA 3HJBA 3B6ZA 5EP4A 5IK2A 2I76A 3O7WA 3PYXA 2H59A 2HSWA 1D6MA 1E2LA 1T2UA 1TUIA 3HU1A 2NXEA 3QVOA 4JEUA 1E0JA 1HYHA 3DR3A 3RUEA 4LWQA 3ZDCA 1BDBA 3JQ7B 4DNOA 5BVHB 1JU9A 1K7CA 4R3UC 1ZOSA 4WBXC 2GAAA 3Q6IA 2OT3B 1E3MA 4GOOD 1C9EA 2W2LD 1UPXA 3QZUA 1QONA 4KQ9A 4PHCA 5AW2A 1DQNA 3LUFA 5C4GB 1OHHA 1M54A 2K2QB 1XE3A 5EAIA 2ID8A 2I3ZA 1BYUA 1MNQA 3JQEA 4E5MA 2FEPA 5KMGA 3JATA 4L57A 3HUDA 4X6YA 4IG4A 3I4LA 3RQIA 3WV4A 2DETA 2C0QA 1J97A 2Q0QA 3IA7A 3AKEA 3MINA 4OYLA 2XVZA 4ETWA 1ZXXA 1Y33E 3C70A 3H4MA 1DRWA 3F6SA 5CR9A 2FWAA 1HA3A 2X8WA 3QP9A 1NYRA 3FYUA 4FCVA 1IJBA 4BMYA 4FMPA 1HZZC 5HMMA 2W8BB 1L5SA 1O08A 3P0FA 4KI0A 1XK6A 5REQA 4C14A 2Y1LA 5T8KA 5L3SA 3OX2A 2J6CA 4RJIA 1JHVA 4ZI7A 3QMWA 1ZITA 4QEDA 5CT8A 3OJFA 1JJFA 3KQUA 3NAQA 1MCZA 3DB2A 2IP4A 2A1TS 2OM2A 4KBGA 4P80A 2EZUA 5E7MA 3O91A 1QQAA 3KKKA 4JI4B 3UM9A 5EY5B 3IL2A 4MR9A 2Z1MA 4AG3A 3SLGA 2GYUA 1EEHA 3O9MA 1IU9A 2PYDA 1H2XA 4TZ0A 2BP7B 2P4HX 4R1SA 1B16A 3RM3A 4B3MB 1U5CA 1QVRA 1HQKA 3QLJA 4K87A 5JECA 2TECE 4WEOA 2Y1CA 3A58B 3U3KA 4HRVA 2BKUA 4QICA 2AK3A 3Q5EA 3S1AB 3FI9A 1BEEA 1GG8A 5TIIA 1LX7A 3NS7A 5EJMA 2VG8A 2IPNA 1R9JA 4W5HA 1QP7A 1K8XB 2XUFA 1F8UA 2QPOA 4I4LA 2BGJA 1E9EA 2WHPA 4E5DA 1IATA 3GEMA 3QNUA 4LF5B 2NMVA 1C30A 5I7HA 2LTAA 3RJ5A 4G0MA 4JR1A 2IV7A 4BQRA 3U5ZB 4LC0A 1QYRA 5HQTA 3FUXA 1JT9A 4L07A 2GA8A 2YJ5A 3LBAA 4G07A 3FDJA 1CEQA 3ZY6A 2ZJFA 3CH6A 5AW7A 1JPJA 5IM4F 2FWJA 1I13A 5LCXA 4FUTA 2B0CA 3QQPA 2C5BA 2CHUA 2UZ4A 2UYHA 4UU8A 2JFXA 2LKCA 5AVQA 2YV2A 4UCFA 3GEBA 2C99A 1ADFA 2WBLC 4IXNA 4PAGA 5FPSA 3VUEA 3TGWA 1YNOA 2C2KA 3BWMA 2XUOA 2JHGA 4HWSA 4LVOA 4LQDA 3RF7A 3SHOA 1I10A 3C1OA 3N5KA 2ZAIA 3TSAA 3VX4A 3WMXA 1KYVA 1VJDA 1RJEA 4GP7A 1JR3E 1WD7A 3CF4G 1DG1G 1AQ6A 1OE0A 3P9PA 3S8EA 1ZH4A 4QE3A 4R2IA 3RUHA 3DE6X 4G97A 4FMCB 5HZHA 1ISSA 1N9KA 2HQBA 3NBYC 5GGYA 1H93A 1RXEA 2FZKA 3P5BA 1JILA 1XK7A 4O2AA 4LTDA 1TZMA 2O4UX 1VE5A 4HX9A 2QMYA 3IHKA 4L15A 3AHEA 5FL7D 1KARA 3IT2A 2W6NA 2IH4A 4C2UA 1RACA 3QXXA 3G1TA 2J7KA 1IEWA 2UU9B 4PZYA 2B8EA 1U90A 3NM4A 2J45A 1OBCA 3H5TA 1U2QA 1PL6A 3QVKA 4YFVA 4J76A 2GSDA 3LX8A 3DMFA 4IO1A 2VRWA 3N07A 4WDRA 1OU0A 3ORQA 4KXVA 2HIMA 5KTPA 4WOCA 2RG7A 4AJIA 3EGDB 2CHEA 2ICAA 1KVTA 3D6HA 1FP4A 4V3BA 3WGUA 2R7LA 3M6IA 5K3EA 3WK9A 1H69A 2WUEA 5JAZA 2H1HA 2VF8A 1DBVO 3N8KA 1P1BA 4BLWA 1ESEA 2XQFA 3KOUA 1E9VA 1HYGA 3PE6A 4B3RB 2XYRA 3JWGA 1QAOA 3GUHA 2O2JA 3IUBA 2H2WA 4DG5A 2HIGA 2J85A 4AN1A 3BERA 5C1OA 4J0KA 3C7TA 2B4AA 2NU8B 2R6CA 4N47A 2WAMA 2Y77A 4Y7CA 1TM2A 3EVFA 2SHKA 4ZT6A 2FZEA 2CBGA 1UMBB 4XJXA 4RTLA 3KNZA 4QYIB 1JVBA 4NDZA 4LZJA 3I5MA 4RSMA 5BXYA 1HG0A 3JU3A 5AVXA 2OG2A 1B3BA 1PGQA 1JIUA 4C7XA 1O57A 2B6NA 4UTXA 4L16A 2XZPA 5FA8A 2FWNA 3EIUA 3OHMA 2VZEA 3H3XA 3KUDA 2ZRFA 3IUJA 4CQMB 1CW2B 5C5EA 1DXQA 1F48A 3IEXA 3PHGA 3WGOA 5ICSA 1GVHA 1OB5A 4N5LA 1XZEA 4KO3S 1V0JA 4EAQA 2ADFA 3QEAZ 3AX6A 2BZ0A 4XOIA 4IH1A 3THWA 2ERXA 1YQGA 2ZR0A 5EWMA 4C20A 2JFVA 2O2IA 2VP5A 2DUMA 2YOFA 4B7XA 4HVCA 3S1SA 2W6JA 3ZVKA 3N74A 3ZJTA 3JQ8A 1ADCA 5HQJA 3S99A 2OV4A 3ROZA 4TV9F 5H70A 1YWGO 3ZJVA 1US8A 4RF3A 1KEKA 1SOMA 1PWYE 2REQA 2X8BA 2GBFA 3CX7A 1PW7A 2IQ5A 2GVZC 1G21B 3R3SA 3TM4A 3TQOA 3W7BA 3ANMA 3WLNA 3S81A 1DJQA 3B36A 4K3UA 1B0AA 5KWSA 1JN0A 1B8NA 2BTOA 3UXMA 2MINB 1LK7A 4P8RA 1T35A 1TA0A 1AZSC 1ISIA 3OEEA 2QTRA 5K0NA 3JVUA 3L01A 3K73O 4LSMA 4NDNE 3T3GA 1DKRA 3KQQA 1W6RA 1N3BA 3DE2X 5BRAA 2PGIA 1NVXQ 1YZTA 2YV4A 1CULC 3FMVA 3GCZA 3N9IA 2BZ1A 4MVJM 3V4FA 2NV6A 3NHMA 2RGNC 3PHCA 4RDIA 4JEHA 3S2ZA 4JLAA 2ZRQA 3A1DA 4HVLA 1AX9A 4HS9A 4P83A 2Y6VA 2PUEA 4GU5A 2QLJA 3QU5A 4INOA 2Q6LA 3K8QA 4KO8A 2AT1A 1KP9A 4BNTA 3M6AA 2XYGA 2GEFA 4JLDA 3ZDRA 2FN4A 2PQ2A 2QTHA 2X76A 2M6RA 1P6XA 2ZOSA 2G9ZA 4LYGA 3FM9A 3MXOA 3M82A 4OGFA 3DLBA 2I91A 3JQCA 1PEYA 1YS1X 2GHIA 4UE6A 4Y6RA 4COKA 1E0AA 4BIIA 4LQCA 4R1QA 1RW4A 3ZI4A 1ZN7A 4HBGA 5LM3A 2B9EA 3PEFA 4JXJA 4D56A 3RYHB 1PFQA 4U3JA 4F4IA 4J9VA 4TN5A 4V0SA 3CSSA 2Z4RA 3B3QA 3EVDA 3ELWA 3GPBA 2EXXA 3K30A 3PI6A 4G1UC 4QGAA 4IH9A 2HIHA 1YBVA 3LNCA 3B2EA 4E3ZA 1XG5A 3RADC 5HMLA 1LDBA 1OZGA 2GARA 4Q3DA 3IBSA 4YALA 4W9MC 1P2VA 4XM1A 4Q9HA 5LP1A 2RHOA 1KERA 1ISPA 1M6WA 3PDHA 1TJYA 4B74A 4ESOA 3OEED 3NHBA 4PYQA 2F9MA 1BS9A 2H4JA 4P4GA 3TLZA 1OYOA 3TLKA 1Z6TA 3GWGA 1OGJA 1L9KA 2V97A 4LI0A 1KF0A 5H7XA 1YR2A 4ZOLF 3QMVA 3E48A 3JVIA 4YV1A 1SC9A 5EGNA 1SHTX 1R6TA 1TF2A 1OI2A 1Y3DE 3KO8A 2YCBA 3DTTA 3B1XA 3AIMA 3HO6A 3IHWA 3JQGB 3OAAA 3PQ3A 1RE0A 2QLBA 4H27A 1LXCA 2OL4A 4XVRA 3KT3A 4I1OA 2BLNA 1EFPA 2W2XA 3AM4A 3VPFA 4O4JF 1EXDA 4NZNA 1RZ3A 3DLCA 3GMDA 5HKLA 1H5UA 1CB7A 3AUXA 4O4LA 2ZE8A 4P1ZA 1TVKA 3SN6A 1UDXA 3JRWA 3V7YA 5AVYA 1T25A 3FPKA 4MUMA 5AT1A 3IE2A 1ZI8A 1KO1A 3L04A 1HO3A 3EF3A 3SAJA 1EVEA 1YZKA 3E0QA 3LUBA 4GI5A 3HY4A 4KQHA 2QTVB 3VUFA 3ZWAA 3N8NA 4UZSA 4DM4A 4YUAA 2GF9A 3AL0C 4GZMA 4JI2B 5HK9A 3FWZA 4Z9YA 1R9GA 2E55A 4HDNA 3BMNB 3O2QB 3NKVA 4YXWA 1AUOA 4BMSA 1FW6A 4WDQA 4Y1RB 3DBHA 1VHJA 3LPNA 5CXXA 4YCCA 1X1BA 2H7CA 1BW9A 2W93A 2WABA 2E5WA 3BK2A 1C4KA 5TF0A 1KI6A 2ZBEA 4JBWA 2HXSA 1SQ6A 2OYCA 5JO0A 2PS0A 1QXSA 3QXGA 1EGHA 3V1UA 5ED4A 1YBMA 1U1DA 4ICIA 2BFOA 3MTEA 1M6VA 3KXDA 1DJNA 3VU9A 2NZUG 1Z5UA 3K0AA 3UZUA 1M2OB 3QSYA 5F9FA 2YICA 5DLDA 2QDKA 5KNDH 4MKRA 5T6BA 3A6ZA 4RZHA 2ZVDA 1TM7E 4GF5A 3L18A 1EDBA 4G4JA 5JVDB 3K09A 3VTAA 2PLRA 2CEKA 3QVJA 5C8DA 1RQRA 1X0VA 2NYVA 4J3JA 4GAEA 2QGZA 2RB5A 3CGWA 4Q66C 3EJWA 2PU5A 1SKYB 3CPJB 3I1YA 4K03A 4LZZA 3NTRA 4G5GA 3NRJA 3AR5A 3O4JA 3IDZA 4NBSA 3F3MA 5FI3A 1CJBA 2PA0A 4IFEA 3VKUA 1T5HX 3VX3A 5C3MA 3EFOB 3BF7A 1I9GA 2FPLA 4E7PA 2AMJA 3W9SA 1B73A 3E58A 3HEMA 1LA2A 3PC6A 1MB2A 3SX4A 4B0OA 4PWZA 3OQNA 2C29D 3U60B 4QJIA 5TSDA 1RLJA 2VOJA 1PEKE 2QXTA 3H3FA 1V5WA 3H0CA 4YXWD 4LF9B 1NP7A 1P1IA 4FONA 3PCXA 1ZMBA 3PR2B 1LD3A 1V3TA 2P8SA 1QHEA 2XMQA 4CR6A 4KITB 1XTBA 4FVTA 4E2YA 3FLEA 2XMDA 1MEJA 3WKCA 3KDAA 3C74A 3V4PB 4RFVA 1GLVA 2ACKA 5IAAA 3HP7A 3BD9A 5LSAA 1Z2EA 1N2ZA 2I4IA 3A3KA 3UMYA 5BOVA 3GJ4A 1PLLA 3OIUA 5CCDA 5EJ9A 4CLRA 1MZPA 3MHPA 2PQMA 1CFJA 4KK4A 2P6PA 5SY4A 2WV9A 4BE9A 4LHVA 3KJEA 4XPIB 5JARA 5JQGF 3CX6A 1KPGA 2G25A 2HMSA 5ESRA 3H2HA 4UVHA 2D0PB 5F7JA 5KYVA 5A5VA 1KKUA 4FX5A 2ZTHA 3REFA 4PR0A 1PJCA 5ALOA 1ISGA 1R6UA 2OESA 4KRYA 4ZZ3A 2IE0A 2WT4A 3Q12A 4PHTA 2JLXA 4QGFA 1MN6A 1CIVA 2OM6A 4U7JA 4F6CA 1A7UA 2G77B 1WUJS 3IDQA 3ESAA 3Q7EA 4TLEA 3WG9A 2C9OA 4D81A 4QM6A 1Q1AA 1WZCA 2JVIA 4ER7A 3HVRA 1XLUA 4RLSA 2Z1DA 3U19A 1T3GA 4KUHA 4D46A 2GERA 4XWKA 1DHTA 2YJ3A 3CUTA 4XWGA 5KYKA 4H7JA 4MTLA 4XWOA 1RP1A 1XDWA 2C78A 1DFIA 3K9NA 3AF0A 5C51B 1RQ2A 3Q10A 3C48A 3IHLA 2XGJA 1NI5A 3DQZA 3TIFA 1LWNA 3FPAA 4IDGA 4RADA 3H1TA 2C7RA 4EPXA 1ZM2A 1GRCA 1NVGA 2G4LA 3IJEB 5NLLA 3TTUA 3WNDA 3TW8B 1JSCA 3HCNA 4UNSA 1QOQB 3GJ7A 1A9XB 4OXYA 1CS4C 4RIEA 1PJZA 2JD0A 5EE5B 1NFFA 4NV0A 5LOVA 3FNHA 3RAFC 3KQSA 2SCUB 1LC0A 4JP2A 4C2AA 4BLSA 4DPKA 5I01A 5CW1A 4ZTBA 5CD1A 4MV4A 5EESA 1E1DA 2VXCA 1X8XA 3EIHA 4J7AA 1P7WA 4KDCA 3QPAA 1E2GA 1PIWA 2IYYA 3I42A 3F3SA 3B1JA 3M1LA 1UKEA 1Z5VA 2AR7A 5A02A 2AFIE 1RPNA 2PMFA 2RCNA 3UANA 2Y71A 5LXTB 2E4ZA 4D9FA 1YDFA 4FYWA 1E7QA 4D9GA 4ZEVA 1I6LA 1H2YA 2REXB 3PP8A 1SG9A 4I4CA 4TSFA 3O4FA 1EJ0A 3C3JA 1ILEA 1N5LA 2OUKA 4BMZA 1XYGA 4J0HA 5JS6A 4MDFA 1PO7A 1UH5A 2BCJQ 4YGXB 3L46A 1G4HA 1N5OX 5BSEA 4YP0A 4S05A 1V35A 4I1VA 3HJCA 4HGYA 2ZJ6A 2W2KB 2YC4C 2C4UA 2J5XA 3CTMA 2VUTA 3EAGA 4ACBA 2Y9PB 5JS7A 3KQNA 1QIIA 3U7QA 3W5AA 4UPVA 4YMIA 4BAGA 5BQFA 2XCIA 1NG1A 4B33A 3DZDA 3ZH2A 2ZIGA 3L2OB 4ZCTA 2JFYA 3C97A 3KL2A 1OKKA 3E6AA 1NN5A 2A5YB 1S8OA 2A1UB 4DDTA 2IDMA 3VU0A 1UT8A 1U8UA 2H2DA 3S8MA 2IUFA 3BZWA 3TW6A 3DAYA 4Z2AA 4DEVA 2FEXA 2WD8A 3KWFA 2FDCA 3L4BA 5F21A 5A2GA 4AZSA 2C54A 3ASVA 3VJKA 1Z0KA 2ZR8A 3GQVA 3R24A 1Q0HA 5J9FA 5DM60 1JXMA 1NNI1 5IX8A 1IN7A 4PGAA 4OMDA 5EMJA 5IASA 2QVZX 4KLZA 2ZM6B 1KPHA 3G7SA 1M34B 1TM4E 3HRIA 3MYYA 1PHRA 1ZM9A 3QVSA 1SQSA 3OQBA 2I6FA 1EZ4A 4V3CA 4ETIA 4F72A 4MRPA 3JVDA 4GLFA 1CRWG 1TUEA 4I9NA 2XKJE 4QJ5A 3ZTWA 4V0ME 1OXBB 2BEWB 3ZNOA 3T9CA 1TF7A 3FCSB 1M0TA 5E3HA 3NBUA 4C0SA 5KCZA 3M1AA 2JKZA 3DHEA