3GJ6A

Crystal structure of human rangdp-nup153znf1 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 62
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj6A00
1I4TD 3IPXA 2FSGA 1VCIA 1XX6A 4OHZA 3J81k 1U90A 1KHTA 3CIOA 4F38A 2R8RA 4G0NA 1MO4A 3BFKA 3U3JA 4XSGA 1ZU5A 1JNYA 2A9KA 1DE0A 1KIMA 4ERNA 5CDFA 1HY3A 3W6NA 3OIWA 4MYCA 5SZIA 4YQFA 2ANCA 1LS1A 2GVZC 2Q6TA 3B85A 1G41A 2I4IA 2O8EA 1G18A 2JLZA 1N5KA 2GAAA 4N0EA 4YDHB 1Z6GA 5B30A 2PX0A 2FSFA 2XAUA 1FUKA 3GEHA 2NMVA 2CVFA 5FH9A 2H7VA 1CBUA 2ZXUA 2XJ4A 4DVGA 3K0CA 5FR1A 2DWOA 3TW4A 1KK3A 3QKTA 2NOAA 1LVGA 2JJ2A 1ZNWA 2J3EA 1U98A 1E1QD 1KY3A 1E2NA 1W1WA 4TL9A 2REOA 1XTJA 1KYIA 5LD2B 2BMDA 5L3RA 2QORA 5CYOA 4JYCA 4M1MA 4TLCA 4P4SB 1MH1A 3QBTA 4AG6A 4B6FA 5EP2A 1I2MA 2ZREA 1W2GA 3OFNA 1M2OB 3AGPA 1U8YA 2G77B 2ODBA 3RSOA 1UADA 4KO8A 3AF2A 3GFOA 3IGFA 2CHQA 4RFSB 4PANA 1OXSC 4V0OA 1DEKA 3U2QA 3MG9A 4G3XA 3HYRA 1G4AE 3SYKA 1JR3E 2ECKA 3C41J 3L0PA 3HP1A 3M0EA 1Z5ZA 1NRJB 3PEWA 4IVRA 2ZAOA 4JT4A 2BM1A 2V7QD 4DUGD 2ZRGA 4LHWA 3RAPR 4A0RA 1FQKA 2ZROA 4JYBA 1CLUA 2XXAA 1KZ7B 4WA7A 1SQ5A 3QOFA 4NCIA 3VNVA 4IJMA 3RNLA 2HCBA 1UEJA 5DN6A 1JPNA 1NIPA 2Q9BA 4V03A 3WRXC 5G41A 3H0KA 3EASA 2OAP1 4HYYA 3QEOA 3HU1A 4LHXA 3ZD6A 1VHTA 3TMKA 1TEVA 4FI3C 4HLUC 4YXWD 5DI9A 2X8AA 1ZMXA 4ZDJA 1RRFA 3JZMA 1CR2A 3FVQA 2RGGA 1ZBDA 2CCGA 1EFRD 5LPNA 4Q9HA 1B0UA 1L4YA 2JIZA 3CWZA 4NE2A 3B60A 1B23P 4F92B 5AUQA 5L3SB 4DSNA 2IF2A 4HLDA 1E9SA 5LB2A 1I4LD 3Q3JB 2ZU6A 4QG7A 3KX2A 2AD1A 2IWHA 1QVRA 1ZD8A 3MRSA 4MDEA 1YR6A 1Z29A 3DOEA 4Q4HB 2GK7A 4TLEA 2BHRA 2RGCA 4OBEA 1KI1A 2ZJ5A 1KAGA 3B1XA 3EZ6A 4XTCS 2IYQA 1ZCBA 2DB3A 1ZINA 3UWOA 5FUXA 1YZNA 2XITA 1VYUA 2XB4A 2UZIR 3SOPA 3RS3A 1AZTA 2IWRA 2AXPA 421PA 2EQBA 3GLFA 1S1CA 3FE2A 4FXPA 4US1R 1M34E 3HDTA 3UKDA 3AVYA 3H84A 3W3AA 5AJVB 1R6BX 3K53A 2GETA 5EE5B 4HAUA 2OG2A 4JVLA 1OE0A 5KDOA 2EFCB 3AVQA 4GZLA 1EFCA 2IHBA 3ADDA 4JLNA 4LGMA 3X1XA 4NCHA 3TRFA 2DYKA 3T15A 2WVJA 5HE8A 1U0LA 4FMCB 4O0MA 4R9UC 1XEFA 4XD7A 1AKYA 4JSYA 3ICQB 5AJXA 3I3SR 1HURA 1OXTA 3P4YA 3KB1A 3K8YA 4HUQB 1G5RA 4XWKA 1ESMA 2ODWA 5F9HA 3QQ5A 3SI7A 1T4GA 1ZM3A 3EZFA 3KTAB 3B1ZA 2QZ4A 2VP5A 1U8AA 1H8HD 4QKQA 4RD3A 3A58B 2SHKA 4Q19A 3BIFA 3AVTA 4HDOB 1XD8A 4TT3D 3ZDQA 4BFUA 3HWSA 3L82B 4L4UA 3NXSA 2JLYA 1YR9A 4QGGA 4E09A 2ODEA 3AUYA 3L43A 1U99A 2OCBA 4BECA 1D2MA 3X1YA 2WWIA 4WOPA 4NBSA 1R8QA 3M6AA 4MKGA 1UJ2A 2AWOA 1G20E 1W36B 2GJSA 2AHOA 3DPUA 1KSFX 4UNSA 3PG5A 3CR8A 3IIMA 4RKFA 3K9LA 1G8FA 1XTKA 3L0OA 4MYTA 2FEOA 2YOFA 5GVRA 5FI0B 1KI7A 3V4RA 5FOTA 2IYTA 4ESHA 621PA 1GRQA 4C0KA 3GLIB 1M7GA 4JMPA 2QBYA 1MO3A 4Q4JB 2D74A 1Q1EA 1KO8A 3THYA 4HAYA 1XEWX 3A6PC 2FWRA 1FP7A 3TUZC 2DFKB 3WHKA 2KWIA 4MGIR 4UXJA 2BEJA 2EYUA 3QXJA 5A5GA 2JLRA 3EPLA 2YOGA 2A2ZA 4CYMA 1E2MA 3W6OA 1NSFA 1D6JA 1OXVA 2OEPA 4BFXA 2Q0HA 1NL3A 2GJ9A 1LW7A 2GHIA 4YC7A 1E32A 1KK0A 1W5TA 2HXSA 1SVMA 2BCGY 3OEEA 5FTNA 4PZZA 5F98A 1IN8A 3RS0A 3F5FA 2D4HA 4RVCA 1II9A 4C0LA 3LH5A 3U6BA 1E9FA 1VHLA 2C04A 3QKRB 5JRZA 3I8SA 1CJTC 3B1WA 2Q3MA 1CKEA 4UNNA 4Q1CA 2GBLC 2ZIAA 4XTRA 3SJAA 2J7KA 2ZRFA 4QBFA 3RRMA 3K0SA 4N3NA 1P60A 4NP6A 5FPTA 2RGDA 4DT1A 3VNUA 2BMEA 5DN6D 2P2LA 4JL8A 1NI3A 4G5QA 3I72A 1QHXA 2CCKA 4TL6A 5CLLA 1XWIA 3GJ5A 2QT0A 4Q21A 3VHXA 5EXTA 4QXAA 3WBJA 4C9BA 3EPHA 2QGNA 1NJGA 1KK2A 2PBRA 2WOOA 1CJKC 3BK7A 2ASEA 3H2YA 3NH6A 1KO7A 4JBYA 4MKHA 2GK6A 4U5XA 1GZSA 2PH1A 1ZM4A 2WM9B 1AQUA 1E9DA 2AKAB 1N6LA 4LJ9A 4GL2A 1S0UA 2XZOA 4LV6A 1BOFA 1GIAA 2VP4A 1IQPA 2EVWX 3MWLA 1NP6A 2R6FA 3BXZA 4LYFA 1HH4A 5J4LA 1OSNA 2GTPA 2CMKA 2WIAA 2BOVA 1S2MA 4M9XA 4TN1A 4A2PA 1SKYE 1CR0A 2D7CA 2ATVA 1XFAA 3I92A 4F7WA 2OFWA 4Q9IA 2YWFA 1N6KA 1KJYA 1IY0A 3ZVLA 1M8PA 3AEZA 3ZIAD 3GD7A 2P65A 2FG5A 1A2BA 2NIPA 3FYHA 1UKYA 3GQBA 1U9IC 1VG1A 1ZNZA 4Y0VA 3U60B 3KKQA 4C2UA 4DZZA 1VYTA 4TYPA 2E9SA 2WJHA 2WKQA 3EIQA 2IYRA 3OEHD 1PZNA 2CEAA 3LWNA 4CVNA 5EE1A 1XJ0A 1W36C 1KO1A 4XD7D 3M1IA 5KSYA 1FP6A 4II7A 3QXHA 2ZSFA 3N70A 3K09A 1FNMA 4PO1A 2VHTA 2ZS9A 3RANA 1QHHA 4JJZA 2QQ0A 4QJ5A 3PITA 1Z0AA 4URXR 5IF9A 2BM0A 1PLLA 1UBCA 2VHQA 5KSOA 2ZAMA 1HT1E 2W83A 3UMRA 3LFUA 4DLZA 1Q20A 1IJFA 1E2PA 2HV8A 3I61A 1E4VA 2V6JA 2EFGA 2HXYA 4Z8YA 2QN6A 3WYFA 3HYTA 4FMDF 1OB2A 3PEUA 3VQTA 5KHOC 2BKEA 3SHFA 1MR3F 1WBBA 2ZRKA 1E2LA 1YZLA 2G1JA 1M74A 1PLJA 3QSYA 2O8BB 4RZXA 2F9MA 4DLVA 4OI1A 1ZM7A 2UKDA 4PR0A 4Q4AA 2ZI6A 1Z3IX 4LSGA 2WHXA 4NYMQ 1R0XA 2EFEB 2JIZD 1WBDA 1NMYA 2J9RA 3QF7A 4PZYA 2ZITA 4CEJA 1GRRA 1XTQA 1L8QA 3KDSE 3OE7A 4AD8A 4BLTA 3VR5A 1R2QA 4BFSA 4EPWA 4D4LA 1R0ZA 4PSAA 1TQDA 2ZRBA 2HJVA 2JJ8A 1GSIA 3K0FA 3MWKA 2V4ZA 3MSXA 1II8A 2B7BA 1E2IA 1G21E 5C1BA 2P3SA 3A1VA 3K0FB 4YONB 4QM7A 1T8TA 3CO5A 5AK0A 3HR7A 4FCWA 4L8GA 3NEYA 4IEEA 1AS0A 1EX7A 2G3YA 1DVRA 5C46F 4PO8A 1KSJA 3AKDA 4LHYA 4KCGA 4DXAA 5K8LA 4Q1FA 1OYWA 1RFLA 2MSCB 3O8DA 2V7QA 4CT5A 1ELOA 1N25A 4DLTA 2HDNB 2GDJA 4TYYA 1VCNA 1ESNA 1OJLA 4PX9A 4B33A 3CZPA 3TIFA 1UDXA 4B43A 2L0XA 2GCPA 2X2FA 3CX6A 2C96A 4JJKA 1TEXA 1X1RA 3NG1A 2ZI5A 2AN9A 3TAHA 4A2WA 4BUJA 4B32A 3O47A 2J0UA 3R9XA 3P1JA 3OFND 4RSGA 3U4QB 3ND8A 5GJWC 4QBHA 1YZGA 2J7PD 1ZM2A 4ZDKA 4OL0A 3DDCA 2ZVQX 3CF6R 4F4CA 5GJVC 5L8VA 3LLUA 2CL0X 2WJGA 3CLVA 5JSZB 1KGDA 3BBPA 2G1KA 1DARA 2ZJZA 3I5XA 3X1WA 1Q21A 3DM9B 1Y3AA 2FX3A 1OT3A 4W5WA 3HR8A 5CM9C 4A8JA 4C3ZA 4B74A 1XBTA 5KDLA 2ZR0A 3QXCA 4QBIA 4X8OA 4GMXA 4A2QA 4DDWA 2ZRLA 1LNZA 5G3ZA 1BYUA 4FMDB 5FPHA 2EFDB 1UM8A 1HQYE 4TQAA 2RGNA 2WSSA 5FBWB 2OBLA 3VR6A 3A1WA 2A30A 4BLOA 3GLFE 1F2UA 3FDIA 4IOMA 1XPOA 1E1RA 2QPTA 4Q7JB 3AP2A 1P9NA 2WTUA 4PHGA 3QNUA 1E98A 2CNWD 2IL1A 2ZI9A 5FUYA 1Z6AA 3LV8A 1S3GA 3GLIA 1XD2B 4B3DA 5J4KA 1G3MA 1F2TA 4TYNA 3DZ8A 2IEZA 2JDIA 1P4SA 2C77A 3CKLA 4IEIA 2YWGA 4QGFA 3BB1A 4DBLC 1H8HA 1UF9A 3BH0A 1JQJC 2DCUA 5TVKA 3CH4B 4H1UA 1QF9A 2QM7A 4MUBA 1BMFA 3WMFA 2RB4A 4TTPA 3V4FA 1CULC 4MYHA 4DLRA 2BCJQ 3T1TA 2IA5A 2EWVA 3WNCA 4KFSA 1LY1A 1DG3A 5E4FA 5DE3A 3BWDD 2XTNA 3DMNA 2JEOA 3LY5A 1NG1A 4OHYA 2F1RA 3KJHA 3O8CA 4JKYA 5J5CA 2DWPA 1GNPA 1O87A 2VHUA 3B78A 1E99A 4HAZA 1IN4A 3LO5A 1W44A 4QNRA 1XP8A 3FFAA 2FEMA 4FCVA 5CLQA 1H65A 4PC7A 5DYGA 2Z0MA 2X2EA 3UIEA 3MAAC 2YOHA 3D7MA 2VHCA 5DSZA 1XCGB 2FPMA 1G6OA 3CH5A 5G40A 3OEHA 3QE0A 1FNNA 3B1VA 1S4QA 1G3UA 5F9FA 1DADA 4JLMA 2OCPA 3DKPA 2FFAA 1OFHA 1X3SA 2VSFA 3NKVA 4IFEA 4RZ2A 1FW6A 3EWAA 4JLPA 4KFUA 5HTKA 3V9PA 1DAEA 4LV5B 2N46A 4L9SA 4DJTA 3THWB 1VPLA 4H9GA 3CNOA 3C5HA 1IN7A 2B21A 2XSZA 2VP6A 5HKKA 4AWXA 3ADKA 4BLSA 4ZV4A 2XJ9A 1Q0UA 1TNDA 1U81A 1WQ1R 2RGNC 1EFHA 3LXXA 2P5TB 2P0EA 3KQNA 2A5JA 3Q72A 2QA5A 1Z47A 5SZHB 4EQ6A 1DAMA 1FOEB 1KZGB 2HF8A 2ZSAA 5FUVA 4UNPA 4C7OA 1T91A 3TSWA 3Q8XB 1U8ZA 1KNXA 3I5YA 3I32A 4I1VA 3RWOA 1KI3A 1OKKD 4GRAA 1MOZA 1VKJA 1F60A 1GUAA 1U9IA 2C9OA 2WSSD 4I4LA 4POAA 2HLDD 3NC0C 3UK6A 3QVUA 1XPRA 4HSEA 1Q22A 3GCGA 1X8KA 4QFMA 1K8RA 1F2UB 5JFGA 1NVVR 4A1FA 1E2GA 4NPHA 4JLKA 1XCMA 5EXXA 2OCAA 2Z83A 1Z2AA 3REFA 2VP0A 4IDHA 2LKCA 3F0TA 3SFZA 3RWMB 5EJEA 4UKDA 3ZQ6A 2ZS8A 1JI0A 2JCSA 4ZCMA 2ATXA 2NTYC 2O0JA 4A92A 4JLBA 1H8EA 4M1SA 2B8TA 4JZKA 3AKCA 1KI4A 1KMHA 4KLZA 1IN6A 1JECA 1T3LA 1FUUA 1N5JA 3CRQA 4KSCA 1ZUIA 4DEXA 3K9NA 4BLRA 4GP7A 2VO1A 3EPJA 2GZHA 1JALA 3QIAA 3MJRA 4RZ3A 5HCNA 5SZKB 2BEKA 4AG5A 4EPXA 2RGXA 4IOJA 4LUCA 5JI2E 5KPJA 3LBNA 3EA0A 4OJKA 4WZ6A 2JJ2D 3PXGA 3TSZA 2KB0A 3U7HB 2Z43A 2G0TA 3PENA 3Q7PA 3QF4B 1M6NA 4PPFA 2OBMA 3UMFA 2F1HA 4HI0E 4CEJB 1SKYB 4DLYA 2B7CA 3Q85A 5FL3A 2A3RA 1ZD9A 1E9CA 2WWWA 4LPKA 4PAMA 2EYQA 2CJWA 3OESA 4P4SA 2AK3A 3IIKA 2OZEA 4PC3A 2J0UB 3N2EA 2GXSA 3QG1A 5SZJA 4NONA 4B3FX 3H4MA 2ZETA 2Q3HA 5KYKA 2A5DA 2FN4A 5E7IA 2WWFA 1R8SA 4MITA 3B82A 4Q4JA 1G1MA 1N3BA 2F1IA 4TL8A 4KVAA 3GFTA 1P72A 2IC5A 1E2FA 1RVDA 3QXSA 3WXMA 5HPYB 1II0A 5H70A 4I1OA 1HUQA 2REXB 4LJ7A 1Q1ZA 4HAXA 3SJCA 3VX4A 4TSFA 2GRJA 1E0AA 2B6HA 3GFPA 1V43A 2ODNA 2H16A 2I1VB 2N1BA 2XNDA 3PQCA 1NY6A 3S1AB 3UATA 3WNDA 5L3QB 1C1YA 2FPLA 2GVDC 4L9WA 1CP2A 4RD0A 2R2AA 1EWRA 5B2ZA 4XVQA 1IXZA 4PQRA 1T8UA 1IJEA 5CIQA 5K8UA 2D2EA 1OIXA 3SR0A 3TUIC 3SFVA 2W2TA 1Q12A 2NZJA 2A78A 1XJCA 4TMKA 3BS4A 1OH6A 2HF9A 2W0MA 4MGYR 1CJVC 3X1DA 4CDGA 1NBMA 2DFTA 4NHOA 2CHVA 4IHQA 4TL7A 3NC1C 3QPVA 3ZJYA 4KV9A 1BS1A 2TMKA 5FFMA 1HYQA 4TMVA 3TBKA 1KNQA 2P67A 4HUTA 1ZIPA 5FBLB 2XX3A 1EG7A 1K5GA 1ZAKA 2YWHA 2W6JA 4A6PA 2PMKA 1K6MA 4I99A 4D4JA 2ZUBA 1TU3A 4LV8B 5EP3A 3QVVA 3L8ZA 1TADA 1KOFA 4EUNA 3ZVMA 1RYHA 3DO6A 5CB6A 3G82C 1EK0A 4DC9A 4CEHA 2GEVA 3KJGA 2QY9A 2PLFA 2RHMA 3D3QA 1CR4A 5AR1A 2QTFA 2FOLA 2FGKA 1RRGA 4CGZA 3NEJA 3CW2A 2O8BA 1GL7A 2ZJAA 1AM4D 3A4MA 5DI3A 4B3BA 1YZUA 2W6IA 4I81A 1OV4A 1ZUHA 2IHYA 3L0SA 3NH9A 5BN4A 4ZO4A 1W46A 1GG2A 1SVSA 4NYIQ 1ZCAA 3B8HA 3VR1A 2FSIA 3A1SA 1JJ7A 1P61B 4KHZA 5F2EA 5TB5A 4DWJA 1GILA 4B2PA 1ZVQA 4W5JA 5L3QA 3SDZA 2YINC 1E2EA 4PSKA 3NHAA 2O8EB 1UBEA 4KFTA 2AL7A 5AUNB 4IW3B 2G9NA 3T06B 5JHHB 2WKRA 1HV8A 3U61B 3KKMA 3RVBA 2BMJA 3U4QA 1PUJA 3U3OA 1E9AA 1DAHA 1GAJA 3CRVA 4CZ2A 2C03A 2PZFA 4D0GA 2BMFA 3NDBB 4K46A 3FTQA 3HJNA 3TKLA 1HT2E 3TQFA 2WJIA 3QEJA 5DH9A 4DLSA 4ZI2A 3KQKA 4NYMR 4Q1AA 1DG1G 2C5LA 2V1UA 4O2LA 4A0FA 3TLXA 4TLAA 5DISB 2ZU0C 1FMJA 4NKRA 1NVUQ 2IXEA 1Q1QA 4C4PA 2LWIA 1KDOA 1JB1A 3WRYC 2FNAA 4UJ3A 2EWWA 2R6CA 2KBEA 1OFUX 2J87A 3KXKA 1P9WA 4TMTA 2IK8A 4BFVA 3LNCA 3CX8A 1YHNA 4MGZR 5FUWA 1C9KA 4QBGB 4HB0A 1CRQA 4TQ9A 1S9DA 1X86B 1GNQA 2OLKA 3P27A 3BH7A 4OK6A 1FTSA 3LX5A 3ZGXA 1E94E 4KXFB 2IX3A 4WW0A 1VDZA 4HZIA 3PUYA 4HAVA 4LBYA 2ZSEA 2C8VA 3GJ4A 3PFIA 4PTLA 5TY0A 4EFLA 1PVOA 4EPVA 3BFXA 4R98A 2QQEA 4S2EA 1HA3A 3SJBA 2YJTD 1R0YA 1YR8A 2GAOA 3IHWA 4JVMA 1KJWA 2CHGA 4OHXA 3B13B 1J8MF 5CK4A 4Z54A 2N42A 3AF1A 2WWYA 1KI6B 1XU4A 3BOSA 2GILA 2VHJA 4I1SA 4AY2A 4JLDA 5CDFE 3TE6A 3G0HA 4MUAA 4RY2A 2ZSDA 1QHSA 5DGXA 4M53A 4ZIRB 5BWMA 3KQLA 4V0KA 1W0JD 4OHWA 5KSZA 5EZ5A 3KJIA 1UFQA 3E70C 3NBYC 3THWA 5JEDA 2FZ4A 2Y8EA 4B2IA 4M1YA 2V6IA 1WE2A 1NMXA 1XTRA 3NTUA 4PPNA 1NNEA 3RC8A 1GITA 1T9HA 3QENA 4WIAA 1E79A 2IUUA 3GPLA 1Z83A 3K9GA 3R9IA 2RHDA 4UXIA 4YMUA 2PL3A 5J47A 2CVHA 2H1LA 1P5ZB 5C4GB 1XZQA 1UBGA 3IO5A 3A1UA 3MMPA 1Z28A 2QRNA 4IVPA 1Z0DA 4D82A 2QMOA 4FINA 1XEXA 3GEEA 3PVSA 5G53C 3B1YA 4PHHA 3EW9A 2WMNB 1BH2A 4LC0A 2QGZA 3ONWA 2RAPA 3EXAA 3A4NA 2XTZA 1GWNA 1VG9B 4LJ8A 4XSHA 1G9XA 3WMEA 2DBYA 1Z0FA 4Q4AB 3PUWA 4Q4LA 2IBMA 3THYB 3T1OA 2QP9X 4P31A 3EZ2A 1AS3A 5H68A 3T34A 2ZI7A 1N6RA 3OHMA 2VEDA 4MRVA 2EW1A 2FMXA 3QF4A 3ZLJA 1QHHB 1KMHB 1I4DD 2C99A 3EA5A 3PIRA 1NVWQ 4DRZA 3H86A 5H8WA 3BJIC 1ZNXA 3CPEA 4I1UA 4US0R 4K8OA 2VTKA 5A0FA 4AI6A 1Z0KA 4D0LB 1G64A 4LPSA 1VCOA 1IOZA 3AP1A 4JL6A 4MKIA 4BEBA 1ODFA 3BRWD 2BBWA 2ZRCA 5JI3E 4FWIB 4ZIRA 3SS8A 4P0TA 2AK2A 4JT2A 1S3SA 4D80A 2ZRNA 1MV5A 4QHYA 1WMSA 4LBZA 5JCPA 4LOAA 4MRNA 5EP1A 1G3RA 1Q57A 4KITB 5FOSA 1XCPA 2BC9A 5FOXA 2CNWA 3L8YA 3R9WA 3GJ0A 5EZ6B 1R10A 2CL6X 2YZ2A 4GI7A 3GLGA 2UZ3A 3SHWA 4E03A 2IEYA 3IKJA 3ZVRA 2CBZA 3U6KA 2WZQA 4TMWA 5JZVA 4O3MA 1EGAA 2B92A 5EUMA 1TF2A 1VIAA 2Q3FA 2NO7A 1KTVA 2F9LA 2ZJOA 5AUPB 4CIDA 4CRWB 2PX3A 1XXHE 1Z8FA 5FR2A 2IW3A 3A8TA 3W5JA 4FW9A 1JJVA 1US8A 2H8KA 2F3RA 2VIIA 4BE7B 5K8TA 2RGBA 3GJ8A 4KODA 1AIPA 2BBTA 3VX3A 1KDTA 4D81A 2KSQA 1EX6A 1FZQA 3NDPA 2OLJA 4LBWA 3EC1A 4LJ4A 1NKTA 2PZGA 2GJ8A 3CUEF 3R7WA 4W7SA 1SXJC 1TL7C 3KKOA 3PR1A 5DLQC 2GZAA 1J8YF 3ADCA 2ORVA 2RH5A 1P75A 1FPMA 4R71A 3VR2A 1SXJE 1DPFA 2C9YA 2OFXA 2ANBA 4DB2A 4X8LA 1E2DA 2R65A 1E4YA 4KLNA 4V0MA 4A4DA 5HR5A 4TYQA 4AYTA 2ZR7A 5JJKA 4LDJA 2XEXA 2ZJBA 2VF8A 3TGPA 4XOIA 4BZPA 1GTVA 2GXQA 4URZR 2IXFA 3CNNA 1WA5A 3P20A 5HE9A 2IYSA 1G7RA 4B73A 1KDPA 4A9AA 2JJ1A 3SBDA 4MGKR 2OUKA 4Q1EA 4CW7A 1LS6A 3K9HA 3ASZA 1E1QA 1FX0A 4LJ5A 2P6UA 5KNBA 1C4OA 2W6JD 1F3OA 3AVXA 3Q5DA 3NBZC 1G291 4DLXA 4V0NA 1RJ9B 2FGJA 2PT5A 2FPKA 3B9PA 3PEVA 1GKIA 2W2VA 3UG6A 2H92A 3R8CA 4JVSB 2XZPA 3FHOA 4RKEA 2MSEB 2PCLA 3AVWA 4OK5A 2AFHE 5FL7A 3LVRE 1E3MA 4NMMA 1UPTA 2IT1A 2REBA 3LDAA 3UXMA 3MGCA 4F4JA 5DHAA 1JBKA 4Q7KA 2AD5A 4Q01A 3CR7A 2OE2A 3RYTC 3KTAA 2J0QA 4OQMA 2WKPA 2OO7A 3OAAA 1ZM9A 4KBFA 2JA1A 4LYJA 1SVKA 4MH0R 3VR3A 4TTQA 1G4UR 4HB3A 4H1VA 4OI0A 5AJYA 4B3XA 2VYFA 5DIFA 5BYKA 2HEIA 2I3BA 1KO4A 4F4IA 4QNMA 3W34A 3WMGA 2H18A 2ZEJA 5EP4A 3W5IA 1JAIA 4BLQA 3C16C 4JLVA 1F5NA 1P3JA 1G7SA 4TLDA 5TDHA 1Y63A 1YRBA 3D31A 1CJUC 2FSHA 4O2RA 3SN6A 1MABB 1YVDA 2W2XA 1F48A 5GJBA 1Z0IA 2DY1A 4Z8XA 4HLCA 4US2R 2QMUA 3DL0A 4A0HA 2Z4SA 2FFQA 4WAUA 3C4JA 3JVUA 3DZDA 3THXA 4LI0A 2BJVA 2PJRA 1JEEA 2J46A 2ZRHA 3P4XA 5DHFA 3VAAA 2OHFA 1W0JA 2GEDA 2V9PA 4DSTA 1TQ2A 4PPQA 3C7KA 4CEIA 3VKHA 2ERYA 3DMDA 5JECA 2OM2A 2BV3A 4FCTA 1E0JA 1GOTA 3KXIA 1U0JA 4OQLA 2VA8A 2EFHB 3LQRA 3ICEA 4AK9A 2QU8A 1XXHA 1G8YA 1L4UA 4YMSA 1VG0B 2BIFA 5IHPA 5KO2A 1E9EA 4OKSA 2WICA 3AV0B 3Q5EA 1N5LA 3FMOB 1SZPA 1DAIA 5CM8B 1MABA 2NO9A 1NY5A 2NO1A 1N5IA 2WWHA 3IBYA 1NVXQ 3DM5A 1Z08A 4KI0A 3A1TA 2QROA 2F7SA 3ETLA 4M0LA 3MD0A 4DHEA 5AWFC 1KMQA 2ZJYA 3GLGB 1U2RA 1QBKC 4ZPXA 5M04A 2ZJ2A 3FMIA 1GNRA 2HT6A 5J4VA 1TX4B 2X19A 4NYJR 1DAKA 3CRMA 1OH7A 3MJHA 2P6RA 3S1AA 2WAYA 3SC3A 1QRAA 1QHYA 4TTRA 2GKSA 4M1TA 4V0ME 2C2HA 3ZD7A 2ZUCA 3BORA 2Q9AA 1CTQA 5IDVA 4D25A 1XPUA 4G5GA 2CLCX 1T0HB 5JJLA 4NCKA 5KU1A 4QGHA 5BN3A 4URWR 2F3TA 3BERA 1W36D 3AM1A 3EWSA 1XNJA 3LA6A 1M7HA 1DBSA 1Z2CA 2JLQA 4NCNA 5FBVB 1Z63A 4EJSB 1CJMA 2AKYA 3WP0A 5J40A 2HUPA 2QAGC 1NSTA 4GOXA 4HDQB 1ANKA 4Z1MD 3CPJB 2O8FA 3TNFA 5ELXA 3SQXA 3IIJA 2VQSA 3THXB 2DR3A 2VSXA 2DFLA 1I2DA 4FMBB 3IILA 4MYUA 4Q03A 3SJZA 4PC2A 1VIYA 3GLHA 2O5VA 4M1OA 1Z07A 1TU4A 3FFBA 1G17A 4LHZA 4OQFA 5GJCA 1KI6A 4E22A 2EU8A 4ZDWA 4JKIA 4LYAA 4BEJA 2F6RA 1EXMA 2JATA 3CF2A 1JPJA 1SVWA 2GCOA 4OI2A 5FTMA 1XF9A 4A15A 4URVR 3AVVA 2Q21A 5L3VA 2JLSA 4M4SA 4P4UA 2VL7A 1D8TA 1T0JB 1Q44A 3IDQA 1ETUA 1RRPA 2RGEA 5ANRB 4DKXA 4EIWA 1KSGA 1HQCA 3LW7A 1ZU4A 1XEXB 3KUCA 1EESA 3SE0A 1E96A 1P2VA 3A36A 3B2EA 4Q9JA 2DWQA 2XOKD 4J0QA 2PLRA 3U7FB 1OIVA 4IXMA 4ON9A 3KKNA 2MMGA 2XTMA 3DKVA 4PAQA 5EQTA 1JR6A 4CF7A 2OBNA 3CPHA 1OB5A 4LC1A 1NVVQ 2GF9A 1D5CA 2RMKA 4NTZA 4FN5A 2IUSA 2H57A 4WXRA 3TQCA 4ABYA 4B71A 1MRNA 4XWOA 1NLYA 3K1JA 3FHTA 2PEZA 3GJ3A 4MRPA 1RIFA 4DIDA 1T6NA 2CJWB 3GLHB 1IAQA 1ZD1A 3IHLA 4A0GA 3LVQE 2K5UA 3QUSA 1N0UA 1TAGA 5LBIA 4ZDIA 3CRRA 5DO9A 3T61A 4P33A 1YRAA 4RCYA 1OXUA 1UKEA 4Z51A 3DVLA 1VTKA 1AK2A 4BQSA 3N5CA 4DCNA 3GLFB 2CLSA 3OIVA 4IRUB 4WXPA 3P32A 2ORWA 1NBMD 4AYWA 3U5ZB 1NN0A 1NN3A 3BB4A 3K70C 4IFBA 5G3YA 1FMLA 1MRSA 4B34A 1DS6A 4M9QA 4TT3A 4KFRA 1OH8A 3AUXA 5HZKA 3T1QA 2QPOA 4URYR 1X1SA 2CK3A 4IDNA 4DB4A 5FOUA 1XMVA 3LXRA 821PA 4ASUD 4BFYA 2HT1A 4ZKEA 1XDBA 2R9VA 2CDNA 4LX0A 3TAUA 3PUXA 5JBQA 4C0JA 2GCOB 2G0NA 1E2KA 1X6VA 1QG4A 3I4LA 4NYJQ 3T1VA 5BQ5A 1YZQA 4PXAA 1E2JA 1VG8A 2O0KA 2FF7A 1SVOA 3KFVA 4TQUS 4WVFA 5EXSA 2W58A 2JDID 1AS2A 2IYLD 5D3QA 1ZW6A 1NLFA 3SEAA 4FIDA 2NPFA 3ZZ0A 2RKOA 1G5PA 1R4AA 3BFVA 3CF0A 2CLDX 3PCRB 4YMVA 4AC9A 2QAJA 2JASA 2BKUA 5FL7D 1XEWY 2YNMA 3RABA 3LAWA 2MSDB 2YC4C 4YXWA 3ZH9B 3AVUA 1YU9A 3OIUA 1WP9A 2R44A 1W4BA 2ZANA 3RLFA 2QUZA 2JLXA 1Z22A 1FTNA 3NBXX 4JLAA 5D3MB 4NYIR 2GCNA 1WXQA 3OZXA 1CU1A 1VMAA 3BGWA 4RD6A 4TMZA 3GP8A 5BN5A 1K5DA 4C0SA 3FPAA 2ZVPX 1NN1A 1ZNYA 3BC1A 1G8HA 3JZAA 1JEDA 1W4RA 3AKEA 4PO9A 1R5BA 5FTKA 2BJWA 4RFSA 1MKYA 3WYGA 4HAWA 4C0HA 1VCMA 1DOAA 4M9ZA 1XTSA 2CE7A 1BYIA 4DSOA 2B8WA 1N6OA 5E7MA 2FZLA 4CEIB 3X1ZA 1DAFA 2J7PA 2R62A 3UANA 3A4LA 2V54A 1IN5A 5L3SA 1E2QA 2GBLA 2XXAB 1T3SA 3DOFA 1WRBA 4P3YA 3ZQJA 1RYFA 1X8JA 1KI2A 1UEIA 1N0WA 1ZJ6A 4MA4A 1Z6TA 4OQXA 2KJQA 4LK2A 4KVGA 2BBOA 3EG5A 3I8XA 4YLGA 4FWTA 3QBVA 2NQ2C 1OFIA 5BXQC 3TH5A 3I62A 1N6PA 4JLJA 4DEYA 2PT7A 3V00A 4GT1A 4A36A 3MWYW 3RS2A 3VTKA 4DT1B 3TJZA 2OFOA 3BAFA 4QJ3A 2RGAA 3QKSB 1YJ5A 1OKKA 2R6AA 3MUFA 4V0LA 4ZCIA 5C2JB 1AZSC 1A1VA 3GMTA 2ZS7A 3P26A 3EPKA 1GKYA 1Q3TA 3RS4A 2HYDA 3R8FA 2FDCA 4NU0A 1WCV1 2JLUA 1IXSB 2VPPA 4TYWA 2QPAA 1PJRA 3HPQA 4IDPA 1BKDR 1D9XA 2PZEA 2YVUA 2G83A 4UXHA 4BZQA 2J41A 2OXRA 2VP2A 4D6PA 4GPTA 2QEQA 4HB2A 1FL9A 1TF7A 1XD9A 2ZTSA 4Q66C 3DHWC 3RDPA 1NMZA 5FBQB 3RS5A 3SU8A 4B75A 2O8CA 2ZE6A 4ILEA 4AIIA 4PHFA 4ACBA 2WJVA 2XSZD 3NVAA 4MKFA 4Q1DA 1IBRA 3UWKA 1DTSA 3WYAA 4BZXA 3NIBA 1OFTA 1MT0A 4BWYA 3B6EA 1ZC4A 1KI9A 1RKBA 4PAOA 3U7EB 1NN5A 1XRJA 3FOZA 1IY2A 2PEYA 1FX0B 3PUZA 4Q47A 4DDTA 3K0AA 3CM0A 5JEEA 1E9RA 2ZYTX 4U02A 2QAGA 3OAAD 4LY6A 4BLPA 4ARZB 4MQBA 3H1TA 2IYZA 4EQ6B 1IM2A 3SYLA 1LF0A 5E7JA 4DLUA 3W8RA 3W8NA 4DCUA 1CRPA 1E69A 1S96A 2FFHA 1D2EA 1WF3A 2V8OA 1IY1A 4NL4H 2R6DA 2QNRA 3C5CA 3RRZA 3LBHA 5CJ2A 3B7GA 2WJJA 2FFBA 1DELA 1R5OA 3I73A 1L7VC 3IO3A 1A4RA 4A8JC 3HU2A 2BVNA 4IOKA 4EKDA 2ZM5A 2WWGA 1J2JA 1UAAA 1R5NA 3CONA 4X8HA 1XD2A 2OCYC 3IEUA 2BBSA 4N1AA 2YKGA 4DIEA 1KJZA 1JAHA 2AR7A 2ZRAA 2ZRMA 1KK1A 3A37A 4WZAE 4D4MA 3ADBA 1R0WA 2JJ1D 2OILA 3MFYA 4KAXA 4JBXA 4NH0A 1W4AA 1TMKA 4DSUA 1ZUNB 1W0KA 2ERXA 1G3IA 4PHTA 4K81B 4MDFA 4B3GA 2VBCA 2HCJB 3LRPA 4KU4A 2WWXA 4Q00A 1AA9A 1HEIA 4LJAA 4Q5IA 3VU9B 5IK2D 3WY9A 3IEVA 3KB2A 3ZIAA 5TMPA 1AJEA 4PFSA 4GP6A 5H1YA 2YC2C 4OJQA 2QP3A 4RD1A 1CXZA 5DNYB 1EFRA 5FPKA 2F43A 3QY0A 2XGJA 2DPXA 2E87A 121PA 1V5WA 2IS4A 3TSOA 1HTWA 1XMSA 4FMCF 4Q9KA 2QBYB 1XJQA 2ZRPA 1GDDA 2VLIA 4NCJA 3RS7A 3JVVA 3AVOA 3N2IA 4DDUA 1OYYA 3EC2A 5TARA 2CXXA 1UDWA 1YQTA 2D3WA 3UPUA 2ZPTX 2J45A 2R6GA 2QMHA 3LD9A 2QL6A 1ZIOA 4LBVA 3WP1B 3CB4A 3LQQA 4LJ6A 2V1XA 1Q1BA 3VKWA 1W7AA 3TR5A 3F8TA 4EDHA 2RCNA 4CEHB 4BFWA 3LLMA 4BFTA 1AQYA 5KUTA 4TMXA 1XZPA 2NGRA 2LCFA 4WBSA 2OAQ1 4EJSA 5DI3B 1KY2A 4D0NA 1LF5A 1COWA 4KSBA 1RJ9A 3AGQA 1COWD 2QM8A 1JR3D 2W0SA 2WOJA 4C0AC 2ZE7A 1W47A 2WIBA 2W6ID 3DEFA 3REGA 4C0QC 5JS8A 1BIFA 3AF4A 1FQJA 3EAQA 3NBFA 4JL5A 5TV2A 4XH9B 1IONA 3LW8A 2ZI4A 1JXMA 1Z6YA 3W6PA 2QSYA 2OXCA 2ONKA 1G5TA 5BW8A 2GXUA 5F3WB 4LRWA 4IVQA 3K70D 1YZKA 4PZLA 3C8UA 3RHFA 3W9YA 3R7WB 5AUOB 1A82A 3HU3A 3GJ6A 2GJKA 2KBFA 4U7DA 2QTVB 3D8BA 4D26A 1CF4A 2C9CA 4RFVA 3KJEA 4B76A 4IOLA 2D7DA 2IS2A 4Q9LA 3SNHA 2WPDD 3IQXA 5B57C 1XTIA 4QHTA 4ZI3A 2JAQA 1NF3A 3K09C 2IS1A 2QE7A 5D3MA 3WBKA 1QDEA 5CK5A 5C4MA 1SVIA 3BD9A 3SBEA 4TZ0A 1DO2A 2JLWA 5IRCD 1YR7A 5JJIA 1A5TA 3U44A 2NG1A 4B6EA 221PA 1OF1A 2FJUA 5B58C 4BRUA 1YE8A 4PC1A 1SXJD 4D4KA 2WV9A 2FV8A 5KTYA 1RRCA 1P7CA 2A5FA 1ZYUA 3QKSA 2XNDD 3TW8B 1AN0A 2OESA 1YZTA 3TVTA 4EJSC 2AXNA 2QAGB 3E1SA 4QL3A 3OF5A 1GFIA 1GP2A 5CYPA 4C7OB 3X2SA 2IXGA 2OV2A 1RPZA 3W90A 4MRSA 4YDSA 1RZ3A 1QHGA 2ZYUX 4HLQB 4AKGA 2Z4RA 3I1FA 5HCIA 4KJZA 4HEJA 1QVAA 2G6BA 1BO6A 1P9RA 4ACAA 1SVLA 4PQYA 4F91B 5FI1B 1N6IA 1IHUA 1US8B 2AX4A 1NKSA 4R2IA 4YMWA 3U44B 2ZR9A 3ZS8A 1PUIA 2WPDA 1HE1C 4G5RA 2PMDA 1J7KA 2ZSBA 1N0VC 2KE5A 3VKGA 4CT4B 3KQHA 1QG2A 1R7RA 4BRWA 4HLUA 5IT5A 5KPDA 5AJWA 1QZXA 3CBQA 3AQ4A 5B64A 5KOYA 5JSZA 3E5HA 4QRHA 2YHSA 1G8PA 2YWEA 4M1WA 4ARZA 2WJYA 1D2NA 3C15C 4BGDA 3QJYA 3ZVNA 4KYUA 4TSFD 3WHLA 3FKSD 3CRW1 4Q7MB 2GXAA 4XIGS 1SULA 3SYNA 2C95A 1KDRA 4OI4A 1ZRHA 4M8NE 1KI8A 2BWJA 3FGNA 5CITA 3CNLA 1OPXA 2UVQA 4GZMA 3E2IA 4W5HA 3AH8A 1JQLB 1KKLA 3SQWA 1MO6A 2QE7D 2FE4A 4BPBA 1HE8B 3CWQA 2GNOA 1T5LA 4IDOA 4KBGA 4RJLA 4F93B 2IYWA 4MRRA 1ZC3A 4Z1MA 4Q02A 1ZP6A 3OIYA 2O52A 4EAQA 3B5JA 3T5GA 4AKEA 2DHRA 4ITRC 1QHIA 3FMPB 2HYIC 4LCBA 3EIHA 3RRYA 3KZ1E 1SHKA 1S9HA 1SHZA 4UNQA 3ZZUA 4ZCLA 1WB9A 4M1KA 5EE9A 2JLVA 2C78A 4BFZA 1G16A 2GA8A 4LJYA 5BYJA 1P2UA 3U3KA 1G19A 1W4CA 4UJ5A 4JBWA 5CIWA 4QGAA 1II8B 3VFDA 2VF7A 1RW4A 3AF3A 3FB4A 2XB2A 1KAOA 1CIPA 3ND9A 2J0SA 2GF0A 4EPYA 4GSYA 5JWOA 4IKEA 1MO5A 4AYXA 2QTHA 3BB3A 1X8LA 5KDDA 1TTTA 1OHHD 4M22A 2CCJA 4Q7LA 1W2HA 5AJZA 3QI2A 3TR0A 4ESVA 1JR3A 3LBIA 1KSHA 2WSMA 4GMDA 3KL4A 3FKQA 2QENA 4JSTA 3T12A 1TUEA 1AGPA 2CL7X 2G88A 1H8ED 4B44A 4M9SA 1GL9B 1UKZA 5EUQB 4B47A 5HZHA 3EARA 1UKVY 5JWHA 1CR1A 2J0VA 1AKEA 5FTLA 3RSLA 3IBGA 2ZE8A 1J90A 5FTJA 1G6HA 4X8MA 2AFIE 5A4JA 2V3CC 2H5EA 2OT3B 3PJRA 4HZUB 4JLOA 3AP3A 4LHVA 4QC2A 5C18A 3L0IB 3GEIA 1CEEA 2QG6A 2F1JA 2A5YB 2VP9A 2IUTA 4GOJA 2NZ8A 4XVUA 4AKHA 1P62B 2J5XA 1NIJA 4QJ4A 4DCSA 3QKRA 3PUVA 3K70B 2O0HA 4XWAA 3R20A 1AGRA 2OSBA 4GBMA 2D2FA 1E0KA 4PSVA 1OH5A 2XZLA 3FWYA 1VYVA 1XMJA 4OYHA 1TQ6A 3IPYA 4A8JB 3U3MA 1TQ4A 3NHBA 2VRWA 3OE7D 3K0EA 4G5SA 4R2HA 3PV0A 1XB2A 3K0AB 2IS6A 3KFXA 4P4TA 1KO5A 4O25A 2X77A 5KNDA 4PC6A 3KKPA 2IYYA 3FKSA 3EIEA 4G5OA 5FPYA 5JRJA 5E95A 5P21A 1N6HA 1O3YA 4HATA 4RD2A 5EE3A 4C2TA 4E5UA 2NO6A 1NLZA 3RRNA 4YMTA 5LD2C 4M2LA 1LFDB 1S1MA 1Z06A 2A7QA 3EZ7A 4P32A 4QOSA 1NJFA 1BMFD 2J59A 2P6NA 4G1UC 4TLBA 4ASUA 1SXJB 3ECCA 4GNKA 3GLGE 1LTQA 4V02A 3GJXC 4JS0A 5KNCA 4B48A 2CK3D 4C0BA 2AWNA 4GOKA 2FU5C 1Z0JA 3MCAA 1M7BA 1P2SA 2Z5FA 3B9QA 4U00A 1M1YE 3RC3A 2C98A 1N2CE 4FD2A 4A6XA 3SZRA 3L2OB 5KSPA 4XJXA 1TF5A 4GFDA 3M4YA 2LKDA 3T35A 5E3HA 3C14C 5EXPA 2O8DA 1E1RD 5FOVA 1F6BA 1VECA 5JHGB 5GADl 4IDQA 4EFMA 4DLWA 1CS4C 2PCJA 2QSZA 4URUR 1G7CA 5JS7A 4IXNA 3GLIE 4S35A 1W48A 2GZDA 1F2TB 3CZQA 2YYZA 2KI5A 2ZYVX 2QI9C 2ZYWX 1DO0A 5DYIA 3U3RA 2JGNA 2V55B 1SXJA 5FOWA 4AURA 2ZRJA 4KYIB 2GJAA 4QM6A 4AKIA 3GLHE 3QPUA 4LWZA 4TWZA 1P6XA 1IXRC 1LV7A 2ORIA 3O8BA 2A5GA 3D6TB 2GEUA 1G7TA 2XOKA 4OK3A 1OLOA 3EZ9A 1OIWA 3VU9A 721PA 2MMCA 1LB1B 1G3QA 4PPGA 5EE0A 3EX7C 1DAGA 4HZUA 2ZE5A 2QP4A 2WAXA 2GWHA 1OW3B 1OHHA 1SKQA 2QMEA 1U0HC 5TXGA 2P5SA 4EPRA 4UNRA 1UBFA 8OHMA 5GVSA 1NBME 2XNSA 3TVDA 4L16A 5K8IA 3K0CC 3VHLB 1W49A 2YV5A 2NPIA 2GESA 3GJ7A 3TK1A 3TUJC 4N0DA 4BASA 4Q18A 2NO0A 3IQWA 2IYUA 521PA 4PQFA 3W3ZB 4DCVA 1ONBA 4Q4HA 5CB8A 4RD4A 4B35A 2D62A 3MWJA 2HLDA 3FMFA 1E2HA 1GM5A 3AB3A 3MLEA 4UQOA 1EFTA 1KKMA 2PJZA 4EFNA 1P73A 1WDTA 4A82A 4DUGA 5JWRA 2ZUDA 3ZZTA 2E1RA 4JVNA 3FHCB 3UMSA 3ASYA 2QT1A 2ZJ8A 4Q1BA 1T3HA 4G01B 3T5DA 1RE0A 5J4YA 1D9ZA 1L2TA 3OEED 4HDCA 1EFUA 4Y0AA 3ZS9A 1E0SA 1T5IA 2WMOB 6Q21A 1P2TA 1E6CA 5J4HA 3QPWA 4RCZA 5HKKD 4B2LA 1PV4A 4GDFA 1FFHA 1QHNA 3AKYA 2Z6VA 4QHSA 2CE2X 1A7JA 4L15A 4M21A 1TUIA 2F43B 3ZYCA 4HUQA 1OXXK 5FPSA 2O8DB 4JIMA 4LYHA 4W9MC 2FA9A 4TZ6A 1S8FA 4D2IA 3KUDA 4WZBE 1A2KC 1GRNA 2BDTA 5LDDC 1GL6A 2Q9CA 1PLKA 2FH5B 3PEYA 2W00A 4L5BA 5LB4A 3O8RA 3UG7A 2ZQ5A 2X1VA 1Q3HA 4HB4A 4NZYA 5CJPA 2ONJA 3KQUA 4B3CA 3AF0A 3BH6A 3QXXA 3VMFA 4XVRA 3LX8A 3THOA 4RZUA 3IUYA 5JMTA 2WBLC 4C30A 3HPRA 1U94A 2IYXA 1RC8A 1G8GA 3Q7QA 4OQNA 3CX7A 4EPTA 1J99A 2ZRDA 3NWJA 4LZZA 5JCZA 1GKUB 2VH5R 3BE4A 5IK2A 1E9BA 2I1QA 1GVNB 2D06A 1W0KD 2ZRIA 3Q9LA 4DCTA 2DFNA 1XXHB 2IF0A 4OHVA 2O8CB 5FBRB 4R7ZA 3U7GA 5JLJA 2ZI3A 3VR4A 1TPZA 3KXLA 1JXOA 4Q48A 2J1LA 2H17A 1E79D 1XMIA 3QG5A 1Z6XA 1SGWA 1J70A 3QKUA 2IYVA 1W5SA 2O8FB 1YKSA 3F3YA 2HJGA 1N6NA 4E07A 4ZKDA 2F55A 1EWQA 4DDVA 1NG9A 2VSOA 2QRZA 3G5UA 3AVPA 3WNBA 5UKDA 4NDZA
chains in the Genus database with same CATH superfamily
3OQPA 3IPXA 5DPMA 5G1OA 4AY4A 1O5TA 3J81k 4MYDA 1EX1A 2P9ZA 3VYRB 1C8VB 1GZDA 2A9PA 4G0NA 1G20B 3BFKA 5JROA 4CLDA 1ZU5A 4HEA6 4ZVTA 4I14A 1KIMA 1XMPA 1OAAA 4J16C 4YQFA 1U3UA 1Z8DA 2V7PA 3FNFA 3UXHA 2Q6TA 2MYPA 1G41A 1Q0LA 3H87A 2Y1WA 4OLFA 1G18A 4YNBA 1N5KA 3U9SA 2P27A 4HCJA 3ZV6A 4ZZ1A 4M55A 3Q7RA 1GAXA 4XYMA 1Y7PA 1MT3A 2ZB3A 1P80A 4OGKA 1DEXA 1P5JA 2E4YA 3IDSA 5C7YA 1ORWA 2NMVA 5FH9A 1W5BA 2PFKA 2ZXUA 2VDWA 3NJ8A 3PU6A 4ARAA 5C7OO 1VXOA 5CAEA 1LVGA 3ZY4A 1Q0SA 1E1QD 4TL9A 2PU5A 3DOOA 1F0KA 1VC2A 4U2FA 2REOA 4YO8A 1KYIA 4E14A 2BMDA 1Z0SA 4MW4A 1QHEA 5CYOA 2IUFA 3Q8WA 3V4SA 2O5EA 4DJJA 3DBOB 4P4SB 4WSOA 1MH1A 4B6FA 4AG6A 4LNUA 5C8ZA 3A32A 5AJTA 2DBVO 3CXUA 4Z4GA 2BGGA 1LX7A 3K8ZA 3PNLA 4Z4CA 3OFNA 4CE6A 1M2OB 3RJZA 5HZGA 1VE1A 3DMTA 3UPTA 1YUBA 2G25A 1YK0A 4YRRA 4KO8A 4YCCA 5K01A 3CF4A 3O4VA 4PNEA 3OCUA 4FHDA 4OM8A 1XZBA 4DR7B 4D0RA 3QWFA 4PANA 4UVDA 5AYVA 2XRFA 1DEKA 3AM4A 2Y92A 3AUAA 3FXAA 3MG9A 3WJAA 1L6IA 1XRMA 2BKVA 4G4IA 1XF1A 5I9BA 2ECKA 3C41J 3HP1A 3M0EA 1Z5ZA 4GMGA 3G7NA 3VYVA 4YAFA 4W6QA 4PX5A 3E48A 3ZKWB 4DUGD 2V7QD 3D6UA 4OYRA 2E4ZA 2ZRGA 4PYLA 4R6WA 2HGZA 1FP2A 2HTFA 3GFVA 3FTCA 5A3JA 4QG3A 3V1NA 2XXAA 2RSLA 1M8JA 4JYBA 4FFBA 1SQ5A 3VNVA 3VSDA 1IQUA 2ZJ3A 2W2MA 3RC1A 4W5OA 1JPNA 8LDHA 3ESDA 1LBEA 2X8WA 3R3HA 1A9RA 5G41A 3V42A 1WY5A 2HA2A 4B5LA 3HZZA 4UE3S 5K8CA 2OAP1 3TDKA 3ETGA 5H02A 5FWYA 2PS0A 3HU1A 3ZDEA 3DMPA 3GXBA 1PBNA 4FI3C 4J76A 3QVWA 4YXWD 2X8AA 1ZMXA 3SIRA 4ZDJA 1IDN1 4CCYA 4Y2XA 3OBIA 1C7QA 5LXTA 4PVDA 5AHOA 1ZX1A 3FVQA 4P3PA 4HH4A 1LPAB 4X93A 3EGOA 3K2IA 3KJZA 4YASA 5B1EA 1CUIA 1PJSA 4KO1S 1YVPA 2D0OB 1CUGA 2AF3C 3CWZA 1TIBA 4PWZA 1ZK4A 1OZGA 5L3SB 3ENVA 1RWKA 1LTHR 4DSNA 4YO7A 5B7QA 1N7HA 4BVFA 3CS3A 4IFTA 5LB2A 1OYVA 1IMOA 3LUHA 1OI4A 2IWHA 4MDEA 4DW8A 1NRIA 2VDKB 1GTZA 2RHRA 1UFVA 4RM3A 5K3AA 2ZSIA 3UJ7A 3QNWA 1WXWA 1KI1A 4K0RA 3UK7A 2J3KA 3FYSA 4HEHA 3FBTA 4J6FA 4BJHB 1KAGA 4OXNA 3DZFA 1K7XB 2QUAA 3TQOA 4D98A 1IUOA 3DD1A 3NS7A 4ND7A 5FUXA 3UWOA 4IX1A 2XPCA 4BX9A 1V9SA 3K5WA 1A88A 1Z4IA 3SOPA 1HORA 1GCOA 1ZD5A 2FPGB 1RPNA 3K4PA 3K6RA 3GLFA 3WGMA 2L82A 1MQ8B 1BQ4A 3HDTA 621PA 2HCFA 2Y76A 3JPWA 1YF3A 2CUKA 4X97A 3H84A 3T7TA 1R6BX 5LC1A 2GHQA 3L0CA 1U0BB 3L49A 4DV2B 3PWKA 1OE0A 1R6UA 2MSKA 2VTEA 4FUQA 2ZIEA 4ZCTA 2A1UA 1V8BA 3FTNA 2IHBA 4GZLA 4ZCQA 2WUWE 4MQEB 4NCHA 3TRFA 1HRKA 2DYKA 3EXEB 4J0CA 2H1VA 3T15A 3TE7A 2YTZA 3E8XA 4IIBA 2RG7A 4F3NA 3V7NA 1L8XA 3I3SR 3MCVA 1H1DA 2R7NA 3DAYA 2LCQA 3T54A 3SC2B 3NBMA 2JEZA 4CMHA 5JG7A 4ZOAA 1OWMA 2C20A 2P2CA 2CLFB 1XALA 3QQ5A 5IBCA 2FWPA 1HDOA 1XMQB 2Z57A 3ZDCA 1QGUB 3E6AA 3KB8A 2G70A 3DC7A 3WLAA 1HKHA 4ZAGA 1FRNA 2Y6UA 4YVFA 1G60A 1DQZA 1J1UA 2PSHA 1JA0A 1UP4A 2SHKA 3KS9A 4Q19A 4NULA 5DHQA 3S81A 4HDOB 4MI6A 3ZDQA 1QFXA 2CZCA 5A5EA 5B58T 2C83A 2PV0A 1B73A 3NXSA 3ROPA 2C7BA 2JLYA 4GM4A 4KXNA 5TS2A 3QKIA 4AUNA 3ND7A 3AUYA 2B2CA 2IEAA 5DBEX 1TEZA 2IEIA 4BECA 3PK0A 5FUMA 4E6EA 4QYIA 4E5PA 4WOPA 1T2AA 3FPGA 4NV3A 3L6CA 4NBSA 3W79A 3M6AA 3MJHA 1UJ2A 3YASA 1Y9ZA 2AWOA 1W36B 4BRZA 3PI6A 1E60A 1RABA 1ZI8A 3DPUA 3C1OA 4JENA 3P0JA 4KSYA 6ABPA 2A0FA 1P2DA 1QH1A 3CR8A 3T4UA 2D1QA 3IIMA 3VDXA 3K9LA 5BWNA 3STYA 1H0KA 2D1SA 4MYTA 3EXHB 4KUHA 2NU7B 3LUFA 3T7SA 4GPAA 1QYIA 4LOHA 3EMKA 5FOTA 3V4RA 1EP1B 3JALB 4ESHA 2XKAA 4C4YA 1GRQA 3AOEC 4C0KA 1YB5A 1YQDA 3GT3A 3GLIB 4KFCA 3VYSB 2G6TA 5T64A 5CT9A 1WDWB 2D74A 1Q1EA 3A28A 3JYHA 4AJHA 4HAYA 4BX0A 4IG4A 4N0MA 3KTFA 3WHKA 1I4OA 4C7VA 5DWQA 3OCXA 1HR0B 1RCUA 4F46A 3QXJA 2V97A 2B0CA 3KVNA 4C01A 5KX5A 2NADA 3EPLA 3SX2A 4CCAA 4CYMA 4IZOA 1NSFA 3OE4A 5HXAA 1QPBA 1L7AA 3I6IA 1HI9A 1V11A 1W5FA 1WXHA 3I6BA 4LF9B 1T24A 4KOEC 3Q10A 1OFUA 1I6KA 4NNJA 3PI7A 4RPKA 2ID4A 4EW3A 5E6SB 3DFUA 1K8QA 2YY7A 2YBEA 4UQPA 4C0LA 4E5VA 2DJIA 4U2BA 2HCTA 2VXOA 1E9FA 3KSUA 4DIMA 4ZICA 1A8QA 1Q7GA 7GPBA 3AEXA 1M1NB 3QKRB 5AW9A 3IEKA 3I8SA 1ZVJA 2X0FA 4QYSA 2WE8A 3PUJA 4LKRA 4Y18A 2J0EA 1DJLA 4GNRA 1E1CB 2ZB7A 4CG2A 4YI3A 1M2EA 1MC4A 2ZIAA 4MO2A 3L93A 2QDXA 3AR8A 3UHPA 2BTOA 1WMBA 4B4WA 4B5KA 1QCCA 4JBLA 3TD6A 4CR8A 4KXWA 1P60A 4NP6A 1U3VA 5FPTA 4S2UA 2XMBA 2BMEA 2IGTA 2JZNA 2WIDA 1OBFO 3L0BA 3PWTA 4RKRA 4H1WA 1JW9B 3R3SA 4G5QA 2BGNA 1QHXA 2CCKA 1FSSA 2IIBA 1XWIA 4Q21A 2XMPA 4RE5A 2GA9A 4H0FA 1B6SA 5AM5A 3AWIA 4C9BA 1LLUA 4C5BA 4DMKA 2DF8A 2PH3A 1Z7BA 1CJKC 4JBYA 5TT0A 3HB5X 3EDOA 1SK9A 1Z7YA 2ZB4A 4I5DA 3AHEA 4ZN6A 5HQ3B 4M98A 3VXKA 5IJZA 1AUPA 3H2ZA 1E9DA 2VUSA 4V3CA 4CWAA 4LJ9A 1BFUA 4XB6B 3IB3A 3FSGD 3SR3A 1AKNA 4WCDA 1NP6A 1Y89A 1ECCA 3L9XA 3QPBA 3CUYA 4F2PA 5ILGA 1OSNA 2DUWA 3EFHA 4XUDA 4EHKA 1UH5A 5L40A 1R0BA 3AEKA 4M9XA 4TN1A 4EYQA 1CY8A 2Q46A 3MRTA 1SKYE 2FB9A 1EK2A 2WP0A 4JUBA 4Q9IA 1WW2A 2KX7A 2WE7A 3ANNA 2NUAB 2YWFA 4BKPA 4MUGA 4J0FA 1JAZA 4G63A 1YFJA 4A6EA 3AEZA 1YA6A 2VK8A 1SM4A 3K6JA 3ZIAD 4L7VA 2P65A 2FG5A 1PL7A 1F0PA 3Q0EA 4LC9A 3INYA 5EZSA 4F9GA 5T7BA 1V1JA 3ZI0A 2PKQO 3FYHA 1NP7A 4MUIA 1U31A 3LC7O 2BGJA 1DKRA 3KLBA 4DLKA 3H16A 1EBBA 3N6VA 3GARA 3KKQA 4JLSA 4O59O 4C2UA 1VLZA 2P3QA 2E9SA 3EIQA 4ZEVA 4NBUA 2VK4A 2GK4A 1GR1A 3SHQA 3LKBA 1V71A 4H7IA 2XW6A 3PKJA 3GDWA 5EE1A 1E7QA 1XJ0A 2BTQB 4XD7D 3UT6A 2HZ7A 3M1IA 1SIUA 2WC1A 4RIEA 1QAOA 4II7A 4HAOA 3JQ9C 2ZSFA 4O2BF 2ZDHA 3S7ZA 4F6RA 4RDHA 2PKXA 1FNMA 1XAJA 4PO1A 5FV7A 1R3UA 5K3OA 1J5PA 2BE9A 3I0MA 1ENZA 3GYBA 1QHHA 5TPWA 4P3NA 3TRIA 1VE9A 3FVWA 1JHZA 3MOIA 4HX2A 2V0CA 4CQLB 2VHQA 4CN9A 3DW1X 2W83A 3IE0A 3PFWO 4DIUA 3T7CA 1ZVKA 2XTJA 1RZVA 3LPNA 5KYWA 5EYPB 4W7IA 1Q20A 3JYQA 4JDPA 1QP4A 4Z4HA 5K0GA 1RYBA 3LECA 1E4VA 1NDHA 5K45A 1T5BA 1T4BA 4K86A 3UICA 5ILOA 2Q0QA 5F35A 3NIDB 4BO5A 4DGSA 1WXDA 4NQRA 3W5BA 2QN6A 2Q7XA 2EL9A 1YDWA 2YQZA 2UV8A 4IO1A 3VZDA 1E3JA 4F85A 2BGWA 2YXPX 3MLAA 2BKEA 4R4JA 2WYOA 1MR3F 3O2SB 4XX0A 1CZUA 1KZ1A 3EIXA 3PXEA 3MJ4A 2EZ9A 1L5LA 2VYND 1WBBA 5HVNA 1PLJA 1BWPA 4G0QA 1L4BA 2F9MA 4FE7A 4DLVA 4GPIB 2AX3A 2W6PA 4ODIA 2QB5A 2UKDA 3NKFA 4P58A 1JEYA 4MW0A 2WKWA 3GPCA 2IZ6A 3BWVA 4JLUA 3HYCA 3UJ9A 3LRTA 4U2KA 1ZICA 1MDFA 2Z95A 3MD9A 1Y8RB 3UOWA 2CXSA 3SSOA 5HQTA 2VDQB 2YN2A 4RQBA 1NFRA 4ESOA 1EP9A 4IQFA 5KJ6A 2FW1A 1NYRA 1GRRA 3WSWA 4GUDA 3OE7A 3ROFA 4BLTA 1R2QA 4I3FA 4NABA 4AZTA 1PS8A 1ZOPA 3BMOB 1QYRA 5HKLA 1R0ZA 1YONA 5T3UA 1N2BA 1TLLA 2JJ8A 3MSXA 2B7BA 1XDDA 2N0SA 1WDLA 3RVKA 1UXKA 3O93A 3VR6D 5E0KB 3WWCA 3NEYA 4IEEA 4RADA 1PKEA 3LPAA 5CRIA 2G3YA 1V3QE 1XVTA 3LCUA 1KSJA 4B85A 4DM3A 5JC8A 3Q7TA 1LD3A 3QE9Y 4R1NA 5BV1A 1GLGA 4YXFA 3O8DA 1CZOA 1TZ2A 2XADA 3A14A 4FGLA 4X60A 1N1DA 1E89A 1PL0A 1JDUA 4W8HA 2HNKA 4YP1A 5ALOA 1BCRA 1UDXA 2L0XA 2EOAA 2EC5A 2XVAA 3CX6A 5FYQA 4OKNA 4D57A 1L7PA 1TEXA 2ZI5A 2AN9A 1F14A 2B6NA 3EGXB 2EG5A 3NETA 2J67A 2P30A 4FK8A 1QCDA 5B1SA 2YHIA 4B32A 4D6YA 1QANA 3ZWAA 4L73A 5LU9A 2PA0A 3OFND 1OBHA 3U4QB 2BEWA 1JDNA 2V7EA 1CV2A 1YZGA 2C82A 3PWZA 2IUUA 3EODA 5TGZA 3LUPA 3ESZA 3LYAA 4F4CA 5L8VA 1NXOA 2Q5EA 4ZEMA 5JSZB 3MINB 3OMWA 4Y2GA 1VJDA 2XCQA 4QARA 3TECE 2B1IA 1AKRA 4V2IA 5I9MA 3HYLA 3OFVA 1OVGA 3IXLA 4CM8B 1Q21A 4W5WA 1BHQ1 1FQWA 3OF2A 3HR8A 1NQAO 1RAHA 2X15A 7AT1A 2B1JA 2JGRA 4JELA 3FKJA 4M46A 1B8PA 3OHSX 3BCUA 1JG4A 1USUA 2IITA 2SCUB 1HQYE 4G8BA 5FPHA 4E4RA 4LAFA 4TQAA 2CC2A 3P45A 3L7KA 3OSUA 4UD2A 3DCYA 3PFNA 5I7SA 2ET6A 2VUHB 3RSSA 3GN2A 5IM4A 2I6FA 3LI2A 4KK3A 2A30A 4HGZA 5CB0A 1E1RA 4KTTE 1E7YA 3S70A 3AP2A 2I4OA 4H77A 1O6BA 2TMYA 4HXGA 3ILXA 1W76A 3LV8A 4MWSA 3GLIA 1DZ3A 1V16A 1RJDA 5DXAA 1NXWA 1K27A 4MLCA 3ZJVA 1P4SA 2BDUA 4L3WA 3L84A 3TSAA 1ONSA 3B89A 1QAMA 4K9OA 1IWBB 3NHJA 4EI8A 3BH0A 1XELA 1WXFA 3EIFA 4LF4B 4H1UA 5A6SB 3GLTA 4HYQA 4MUBA 2QM7A 3WMFA 3V4FA 1CULC 1Q7TA 2P75A 3UEOA 2VYNA 2JCGA 1M6VB 4G1MB 4N01A 5T8KC 1D5WA 2IA5A 5B4TA 4UTNA 4DUPA 2XNKA 3PIDA 4TUYF 4D74A 1NYTA 3OTWA 3H5LA 1NDUA 4JOQA 4EB6B 2JEOA 3LY5A 1M67A 2N75A 2F1RA 4MQ6A 3M9XA 3BT7A 2H6EA 2V7GA 5CPFA 3PSAA 3VOSA 4IIDA 3U0BA 4JC0A 3B78A 5CXSA 2GZRA 2Q3BA 4M7RA 5KX5B 1V1RA 2A0WA 4FCVA 3FFAA 2HSWA 4AG3A 3HJFA 3MF4A 4DDKA 4IDFA 3MAAC 3D7MA 4F8YA 2EZ8A 3LMKA 3SZ3A 2JGLA 3GT0A 3GEBA 1NW8A 3LL7A 1U7DA 3CH5A 4RV5A 5H59A 3OEHA 4JHXA 4M1EA 5CP8A 2EKPA 3B1VA 3WKBA 1S4QA 3N0VA 5F9FA 3NU1A 1XRLA 3CVJA 4GPD1 5BSUA 2RH9B 3GCWA 4IFEA 1X3SA 5C51B 3G9ZA 4IDBA 4RZ2A 1AMOA 3EWAA 4JLPA 1P77A 4KFUA 4OGFA 4RY8A 4LRYA 4TKMA 1R18A 1U7OA 4LV5B 4NI5A 4W6ZA 5IG2A 1H2FA 3THWB 4JXZA 1C4WA 1J20A 1DI0A 2YJNA 2F64A 1MQAA 3A04A 5JMPA 3ZLBA 4FE4A 1EWKA 2FK8A 2B21A 1A27A 1EUCA 2WU8A 2VP6A 2XSZA 3O8QB 5AI6A 5HKKA 3IP3A 3OD1A 2XJ9A 3I2YX 3ZC3A 2QMZA 3FNRA 4H1TA 5I7FA 1NP3A 1ZHFA 4B3JA 4A03A 1CQWA 3QPDA 1MHPA 2P5TB 4YCMA 1QFSA 2VT7A 3OTIA 1B8VA 1W85B 2QA5A 2XCIA 3L79A 4FE3A 3WO1A 3GDFA 4ML3A 4RPJA 4UM7A 5SZHB 3RUDA 4CKWA 2ZSAA 4CR7A 5FUVA 4UNPA 2R1UA 2PO7A 5FWNA 4K9MA 2X23A 3NTVA 3H11A 3BD6A 1MN6A 3KAJA 3LYUA 1U8ZA 1JHYA 1KP9A 3I32A 3U7QB 2PPVA 3EZNA 1VKJA 6REQB 4JQOA 1F60A 4MMZB 4MI3A 4AF8A 4R2XA 4POOA 5KTOA 4FBGA 2HLDD 1FUEA 1YKFA 3OURA 5DEIA 3UK6A 1XPRA 1Q22A 3GCGA 3MWFA 1TKCA 2ZJ0A 4HDKA 3WLSA 1M1NA 3DONA 4ZXPA 1Z38A 5AOVA 4YCAA 3VVCA 1XZLA 3DDOA 3VU8A 4ZO7A 2OCAA 4N47A 2P62A 2HGSA 2LKCA 5FWAA 3SFZA 1KJIA 1NWHA 1PR6A 2ZS8A 1ZRNA 2IOFK 3AQIA 1GQFA 5HF9A 3A10A 1XTZA 4B81A 1IEQA 2DH6A 2O0JA 4QYTA 3SNKA 5I8ZA 3TN7A 3H0EA 4HVCA 1X80B 2B8TA 2C4NA 2Z8ZA 1KYZA 3LDUA 2A9QA 1KI4A 4TXJA 5D3ZA 1HE5A 3D4BA 3EGVA 1T3LA 1FUUA 2OBFA 2GN4A 1OLXB 3QW4B 5DP2A 5C8YA 4MLPA 3OOJA 4LY3A 4RLSA 1CIJA 3TTVA 3DDZX 2GZHA 4JQZA 3U48A 3MJRA 5IT9A 2GB4A 1G2PA 1WSBA 4HNTA 4E0BA 4E11A 4LUCA 1LI4A 1G55A 3O9MA 4GGMX 1CZHA 3K5IA 5K20A 5HP4A 5DYWA 2PKQP 2X41A 2JNWA 4WZ6A 1N2EA 1SQGA 1KSGA 3WHPA 2KB0A 1S2DA 2PAAA 2A1UB 2G0TA 3U7HB 3PENA 4BCDA 5LKRA 2PWBA 3ZHBA 3HS3A 2P6MA 3NLLA 4F2DA 3LHIA 2EFJA 2O7QA 3LYLA 3UMFA 2F1HA 2HWWA 4HI0E 2Z2KA 3ZBTA 3ZGNA 5AVXA 4DLYA 2B7CA 1ZCJA 3U3DA 1WUKS 1U1EA 3Q85A 5FL3A 5KOJA 1T1RA 1E9CA 1D6MA 2P2ZA 2HJ9A 1F2VA 2A58A 3O90A 5AJUA 2CJWA 4KC0A 4CU2A 1L5SA 2VAWA 1ZBQA 3B6IA 2X4LA 4KX5A 1IFXA 1JMKC 1W35A 3FLAA 3NHYA 2J0UB 3RUEA 4Z9FA 3PS9A 3G8BA 3THSA 3QG1A 3SXPA 4DCPA 1NWCA 4B3FX 3P5SA 2PUFA 2Q3HA 3C1TA 4S1NA 2BGUA 2A5DA 1OI3A 1U3WA 4MNTA 5HJEA 1U7WA 1WO8A 2I3ZA 3RFTA 3UJDA 1N3BA 3GZNB 5LA6F 1KOLA 2R8ZA 1P5HA 3GFTA 1P72A 3G7UA 1RVDA 1UQTA 1K98A 2O4UX 3QXSA 1UJBA 5HPYB 2VS1A 2ILTA 2P35A 3R6GA 2HLHA 3VX4A 1GUDA 1L5WA 1Y82A 4HAXA 4TSFA 1Q0RA 5ITZA 5DVZA 2VPTA 1FFSA 1V43A 2MR6A 3QE4A 2ODNA 4ADSG 3UATA 3DEZA 5L3QB 2FQXA 1Q5PA 1H0SA 3EW7A 3TQQA 2GVDC 4JUFA 1NUHA 3ZZ1A 4PZAA 3QFRA 4M88A 2WQ6A 4O4HA 4WNYA 2ORED 3CG0A 2OGSA 1EFPA 2R751 4HKTA 4GM1A 5JCOC 1PFUA 4PQRA 3HL4A 1UK7A 1HT3A 4FYHA 3HEAA 4Y1EA 2JIMA 1GU7A 2D2EA 4JI0B 3QTBA 5HUJA 3HCCA 1KMNA 1MNQA 1OAKA 2NZJA 2A78A 2XNHA 1DJPA 4R51A 4RGBA 4XASA 4K9LA 3IE2A 1Z13A 3AHCA 5BW5A 1X7DA 3QMPA 4FHCA 3E84A 4RNDB 1QK5A 3PX2A 4MGYR 1CJVC 1JU3A 3X1DA 2HXGA 4V0RA 3ISVA 4CDGA 4RA6B 4FX5A 3V8VA 2W22A 1YRWA 5HKOA 1J1IA 3ED1A 5F2KA 2XT0A 5EY5B 5H83A 3SVZA 3LHKA 3ZJYA 2DT8A 3PF9A 4BKUA 2TMKA 2AS0A 1BKYA 2LGJA 3TLJA 1UM9B 2GRUA 3IBSA 4QU5A 1Y0BA 2OKCA 3TBKA 2CLMB 5FBLB 3TMAA 3KLMX 1O9HA 1H23A 4O2BB 1E1YA 1F0NA 2RIRA 2P11A 2H9IA 1UFOA 1WPXA 2VUIB 5CVCA 2FPOA 3WWPA 4A6PA 1C7EA 4D4JA 2ZUBA 4L50A 1JHQA 2RK4A 2HWXA 2I2FA 1JDBC 2Y68A 3K32A 3N0XA 1FA9A 4B3IA 1Z5NA 3DO6A 3QQPA 2WVAA 1KP2A 5IAAA 1EK0A 4DC9A 1LDMA 3KJGA 1C3EA 2PLFA 4ZRMA 4AIRA 1GZ3A 2R1ZA 3QKWA 1I1HA 1O1YA 4UVEA 3H5RA 3RUPA 4TKVA 1E5XA 2EQAA 1ND6A 2IW1A 1OD6A 2H52A 3P9SA 2O8BA 4KGDA 7YASA 5BXYA 5DASA 4PLGA 2OQVA 5EJ9A 3KYIB 4F4DA 3V2HA 4O4IB 3BQMB 3GAAA 1IMJA 4ZO4A 3RKSA 4YV1A 3ASVA 2PIAA 3B8HA 2FPRA 3VR1A 3A31A 2FSIA 2WT9A 3L92A 3OT1B 3IURA 4ENRA 4DA7A 2HWKA 1PZXA 4DV5B 4N6NA 1F7VA 2G72A 4DWJA 5AXBA 3FBWA 3VZBA 3DMFA 4MVJA 3SDZA 5L3QA 4MHSA 3TRDA 3HCFA 3NHAA 5ERYA 4LQDA 3AUJB 1YNOA 1ZQ1A 2AL7A 3EIUA 4KFTA 4RQTA 3UTCA 4WZZA 4LA4A 2W4IA 4JUCA 5GWXA 4EDFA 2NZWA 2XGMA 2V6BA 1D2CA 1LJ8A 1YB2A 2WZCA 1B26A 2WKRA 2RHBA 3BM5A 3F49S 3BVPA 3GJSA 3U61B 3OPXA 3RVBA 3F9CA 5CLGA 1NE7A 4MV1A 2BHSA 3U3OA 3U4QA 1GAJA 4CZ2A 2PZFA 2BMFA 1FLAA 3RVQA 4KVFA 3KQKA 5DH9A 3ROZA 2OHGA 1QZ3A 3A9RA 4MVJP 2ZBGA 4WJZA 3CGGA 3LPDA 3OM1A 2VCEA 1N9GB 1PS0A 2ZU0C 3DBLA 1T0BA 3LBAA 1U2SA 3Q98A 4HH0A 5ALJA 1JH9A 1DIRA 2O14A 4UJ3A 1OXMA 5JSYA 3FBGA 5LIRA 2ZTHA 2AN5A 4KN9S 4O1IA 1GL3A 3G6KA 2B83A 3GLRA 3KXKA 4UPEA 1N9ZA 2TS1A 5KI6A 2HMSA 1U2DC 4DG8A 4KXLA 5FUWA 3VKVA 1BTOA 1K3TA 4IIYA 3IOBA 1ZEJA 5AVKA 4QBGB 2OFPA 2DGDA 3RHTA 1HMYA 4L4RA 2OLKA 3B6ZA 3V4OA 1FTSA 2R1TA 2IX3A 3WKAA 4WW0A 5BQOA 1KKUA 4L8YA 4Q16A 4EJ0A 3MJSA 2ZPAA 4LBYA 1HF3A 3GJ4A 5FJIA 3M6WA 1AUQA 2GERA 5AH0A 4HXYA 1TM3E 4NBLA 3BFXA 3L8CA 5JNTA 1E63A 1HA3A 1UMBA 4HADA 5DULA 5D1HA 4JOSA 2IU3A 4WV3A 1L4EA 4GL4A 5A3VA 1RZUA 5H3HA 2BRUC 2XH8A 5F52A 1Q7BA 3UWPA 1J8MF 2GO7A 1W1UA 2N42A 2JPDA 2V9CA 3G5AA 2WWYA 3BCRA 1KQFA 1CNMA 3BOSA 3DLTA 3WFIA 5IN4A 3IAFA 1TO2E 5HILA 1WY7A 4MR9B 2VHJA 2H2AA 4DCOA 2XLBA 4XWYA 3KKKA 2YJ4A 3GQBB 4K6HA 2P1ZA 3DO8A 4TRNA 4HX9A 3TE6A 1ZH4A 5F5NA 3SS9X 4YREA 2FRDC 1H2ZA 4XIFA 1JHVA 3OCZA 2FZ5A 3K0BA 3B38A 1LPPA 1W0JD 4D3FA 4PZUA 1L5YA 4AJ9A 2XVXA 3IOYA 3NBYC 1K0FA 4M1ZA 1C7IA 3ZE9A 1TMYA 4OBWA 3THWA 1F6DA 2Y8EA 1ISFA 4F6LA 4A16A 1VLHA 2V6IA 1N7IA 3ZWBA 3OWHA 2G7ZA 4EKNB 1KU0A 5DWVA 3I1IA 3BYZA 4BQOA 5CFZA 1W85A 4HNUA 3RC8A 3KYJB 1E79A 3MXOA 4S0ZA 4ZC8A 2FRDA 1JR2A 1ULAA 2L69A 2JEYA 2C8JA 3KVVA 5FNVB 4YMUA 3IVMA 5J47A 2XVMA 2CVHA 2B5VA 2H1LA 3PD1A 1P5ZB 4MK4A 1TFRA 3ZE6A 5CVTA 1OC4A 1Z82A 1RYMA 1ZI6A 3S1LA 3HZHA 2G36A 1T9AA 4IVPA 1Z0DA 2R8XA 4D82A 2QMQA 4NSNA 4FINA 1XEXA 3PVSA 3R0JA 3OKFA 4BVKA 2PZ8A 2ID7A 4PCAA 3I6QA 4PHHA 4UUBA 2XKKA 2P2DA 4YQYA 2BUCA 3ZKAA 4ZVQA 1ZKDA 2C5AA 3A4NA 3TZHA 5CFOA 1JHDA 2BISA 2OV1A 4FDTA 3UC5A 5DXFA 3WK6A 3FF1A 4Q3LA 5KOHA 1Q6ZA 1IK4A 4X95A 2O1EA 5CBPA 2MSLA 3PUWA 4ZVLA 3PC7A 4Q4LA 2IBMA 3UGTA 2OZPA 3BWMA 5ERXA 4P31A 4PNHA 4BE9A 5DJ5A 4E32A 5LP1A 3J80A 4EI2A 5M04A 1I4EB 1YMQA 3OHMA 2PFGA 5EQDA 3ZHOA 4CMKA 1VE5A 2IYFA 4ID3A 4K7JA 4M9CA 2FUG6 3PIRA 3EA5A 2FSVC 3H3JA 4DMFA 1YFZA 4I1UA 1IQRA 2PNJA 4K8OA 2VTKA 3Q8LA 1FP1D 2E5FA 2PD4A 1WHSA 4D9KA 5A2GA 1FY2A 4D0LB 5HOQA 1FRFS 3F78A 3H11B 4OHCA 3LDFA 4TMFA 3U4CA 5ETJA 2IH5A 1PV2A 3IRVA 3O1HB 4RUKA 3BRWD 4UHCA 4DV3B 1UBJS 1GN8A 3FRJA 4L6IA 3SS8A 4P0TA 3V1YA 1SELA 2C61A 3REQB 3SDBA 2QJWA 2Q5QA 3O4RA 2QL5A 4IDAA 2XMQA 4QHYA 2RD2A 1ONNA 2YJGA 1LXCA 5IAJA 2FLKA 4HRYA 3EH1A 2IZOA 2R87A 3COPA 5EIFA 4HDNB 5BURA 5FOSA 5ALSA 5F73A 2BC9A 2DTDA 3CINA 5K3FB 4BO3A 3MEQA 5C52B 5EWLB 1R10A 1TFUA 2YZ2A 4RMJA 5BSFA 2OC4A 2XRMA 4L7QA 3WQQA 2BFEB 4EMBA 4O3MA 1NX6A 1FTWA 4O4HF 4EMTA 8AT1A 2QX9A 5H81A 1KTVA 2F9LA 3GNLA 2BZ1A 3ZU6A 1L5VA 1WSWA 1XXHE 3JQAB 3P97A 2IW3A 4IIJF 3W5JA 4YCNA 2AEJA 4U7JA 3BSFA 3ZDYB 3MPOA 1JJVA 3R75A 3T6KA 5GZ3A 1XAGA 1US8A 4UPDA 4ED9A 4KH0A 4ALNA 1VI5A 4BE7B 1OVMA 2RGBA 4JXJA 1AIPA 2BBTA 2G76A 3PRJA 2ZZNA 1ZRSA 3LHDA 3NDPA 1SUWA 1UK8A 2WG0A 2ZLBA 4LJ4A 3CT6A 4UM8B 3N9IA 4YIKA 1JKXA 5ENDA 4W7SA 1Y6RA 4QDJA 1DBPA 2R48A 3U39A 1TL7C 2C4TA 3AR9A 5DLQC 3WLJA 4DHWA 1IXKA 2VDMB 3IV9A 1P75A 1FPMA 4OH7A 5HSGA 4DG5A 3VR2A 1SXJE 4BQNA 1DPFA 3E58A 3M8KA 4N6GA 2ANBA 5JZMA 3LVFO 3D81A 5AP9A 4DMGA 3GA5A 5HIJA 3P7MA 2GARA 1D4OA 1T26A 1L8OA 3HMKA 4KDEA 2VJLA 1H4TA 1ZHOA 2ADMA 5E8JA 4AYTA 2BY4A 1SBCA 4LDJA 1YZYA 2W93A 3C8ZA 5A3SA 4DNXA 3TGPA 6LDHA 3ZZNA 1BEUB 1OA1A 2CXPA 1GTVA 3FAZA 4H7PA 3P9IA 2J8ZA 4BHTA 4HN2A 4LZPA 3TDMA 3FIJA 2WHQA 3CNNA 1WA5A 2GFHA 2I7DA 2OMKA 3A25A 1JBQA 3P20A 3LWZA 3SGLA 4NARA 2W2LD 3IUMA 5L6LB 2OUKA 1A7AA 3RRXA 2VRBA 3K9HA 3ASZA 3MBOA 1E1QA 4L76A 3MM4A 4LJ5A 4FDVA 1CZNA 4PYMA 1C4OA 2H54A 2W6JD 3A2MA 3GVPA 5HKBA 5HDBB 4PZDA 4R05A 4E2YA 2JCVA 2HF7A 3FDZB 4TROA 4NRDA 3B9PA 1Y6QA 5A4DA 3OPMA 4TV9F 3C3KA 3I23A 3UG6A 2H92A 3ZJTA 1G8AA 2XZPA 2J32A 4B3BA 3E5NA 4WFIA 4CODB 1EDOA 1MBZA 3LVRE 4LF5B 2B4RO 4C5AA 2GVNA 4U2CA 4RVGA 4WPGA 1UPTA 4AT1A 3VGJA 3M9WA 2REBA 3LDAA 3HABA 3KAQA 1H3EA 4F4JA 5DHAA 1LU9A 1QZTA 4KLAA 3CR7A 3RYTC 5A5DA 4LHSA 1A04A 1OILA 4UEKA 4ZAWA 5GY7A 3OAAA 1ZM9A 4CLOB 2HHCA 3CY6A 1WU7A 1B2LA 1SVKA 2YS7A 2P90A 3FGPA 3MJDA 2Q28A 3Q2IA 2GFIA 3R5KA 4MH0R 4RHTA 3SIPA 5CDSA 4H1VA 2R5FA 3GUCA 3CLTD 4KIUA 3USES 5LQKA 1ZGGA 4Y2QA 1KO4A 4EWLA 3R3JA 1JDVA 2H18A 4KAAA 1C8BA 1TAHA 5EP4A 1JAIA 4BL5A 4Q7QA 1XFDA 1JSCA 2V0GA 4E1AA 1F5NA 3IKMB 1Z2DA 4AN1A 4ARIA 2WJZB 1D04A 1QH8A 3EPRA 2Q7DA 3QUQA 3VR4D 3G0BA 2VHEA 1PZMA 1ECFA 1F4PA 4BMOB 1CJUC 1T34A 1OT5A 1F12A 2QLMA 1I1OA 3SN6A 1PJTA 1VPTA 2W2XA 3A3KA 4Q34A 5IKEA 5GJBA 5D7NA 2DY1A 2DVMA 3DAFA 2QX6A 5JR3A 2PQ6A 4E31A 1UPXA 3ITEA 4PWYA 4QU0A 2FFQA 4WAUA 2G5TA 3EF3A 1QKKA 3BULA 4MZDA 1BCSA 1UZUA 2PJRA 1JEEA 1A77A 5E2IA 1N8TA 1OZHA 2J46A 3EF0A 4P35A 2FWIA 1C1HA 1MAHA 4YUYA 1W0JA 2ST1A 2Y1XA 3RF6A 3HYNA 1ZH0A 2R7LA 2Q2QA 1TQ2A 3DA8A 3C7KA 4JJ7A 1GT91 3OJEA 1U28C 5AVOA 2WM2A 5BOSA 3COJA 4CEIA 3VKHA 2BV3A 4FCTA 1ZR2A 3TEJA 3KXIA 2FWNA 1UZMA 2EATA 1KAHA 2YWRA 4I50F 1BDIA 3QUTA 1QRTA 5C4IA 5JXWA 2QU8A 1J5XA 3OO0A 4UE6A 4IL5A 3O38A 2IV2X 4BKMA 4KMMA 2OKGA 1E9EA 4RV9A 1QONA 2FKAA 3P0EA 3HM9A 3QYAA 5AXAA 5KO2A 1N5LA 1TGVA 1ISRA 1CX9B 1SZPA 3QYFA 5DMHA 4CI0B 1MABA 2NO9A 1NY5A 2EJTA 2JGDA 2Y0DA 1ZK3A 2Q4EA 1G63A 5K4AA 3I1YA 3IBYA 3ADPA 3DM5A 1Z08A 4ZOLF 3A1TA 5CMLA 4B8YA 3MD0A 4HWOA 4DHEA 1XDZA 2C4HA 1QGDA 1W4ZA 3ZXIA 3MBIA 3U4IA 4FNMA 4XM2A 1OA0A 4RTKA 4EA8A 4LF6B 5AK6A 1JAYA 1TX4B 4NYJR 1RMTA 2HJRA 1Y3FE 1JJFA 1WU8A 1XLWA 2ECPA 2RDMA 4MUJA 4RKWA 1SR8A 1V7QA 3S2ZA 4DADA 3KU4A 2PUEA 4N41A 4A3SA 2Q1UA 1SN7A 1QHYA 3B9BA 1J21A 2GKSA 2CHUA 3LE8A 3TINA 3L4EA 4M1TA 3GD5A 1Q11A 2C2HA 3BORA 4PSUA 5HJ2A 3U9LA 2FETA 4U2EA 5JZ9A 5IDVA 4JKOA 1XPUA 4G5GA 1DJNA 5KU1A 4CQMA 5CFNA 3HKEA 4I4TF 4FX2A 1A9QA 1M2VB 2O57A 3BERA 4IFIA 3ZUGA 1KXJA 3AEUA 3EWSA 4KIWA 4ZMSA 3PA8A 3NXKA 4YGYA 2DPYA 1DBSA 1O6CA 3HRKA 1UPAA 4NCNA 3VZQA 1UXHA 3OZ7A 1W0CA 1INLA 2HUPA 4GOXA 3HH8A 1HG0A 5T57A 2DWCA 1WZ2A 4WMLA 4K6GA