3GJ6A

Crystal structure of human rangdp-nup153znf1 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 62
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj6A00
2QL6A 1H8EA 2BJVA 2C77A 2I1VB 3IBGA 3SOPA 1U8ZA 1ZC3A 2XNDD 2NOAA 4ACAA 2OO7A 4FMBB 2W83A 1DO0A 1TF7A 1XCMA 1JNYA 2ZUDA 3PENA 4FMCB 3BB4A 4EPWA 1E2MA 2GF0A 1N6IA 2H7VA 4AG6A 1UAAA 4ZKDA 5FOVA 1S3GA 4DUGD 2J7PD 3AKCA 4HB4A 2D62A 2RMKA 1HUQA 2GA8A 3E5HA 1W5TA 2YVUA 2AKAB 5DI3B 2X1VA 4DLVA 2I4IA 3U7HB 2UZ3A 4DT1A 4MRSA 4Q1AA 4HAUA 3F5FA 1ETUA 4WZAE 4YDHB 4DB4A 5IK2A 1FP7A 1TU4A 3K9HA 3HJNA 2Z43A 3ZD7A 3VR5A 4JS0A 4M1OA 2J46A 1YZTA 2ZVPX 3VX4A 2O8CB 2P6RA 5L3SB 4LOAA 3IIJA 3KX2A 4KYIB 2VA8A 1DBSA 2OCAA 4OHWA 2XZLA 1QF9A 1T91A 3OESA 1DE0A 2A78A 3ADDA 4F4JA 2VP0A 3JVVA 1P9NA 2RGNA 3BORA 1AS2A 3IO3A 2DWQA 1KY2A 1UEJA 4TLEA 5DGXA 4PC6A 2C8VA 4LCBA 3BAFA 4KVAA 2UKDA 5L8VA 5IT5A 2KE5A 1P75A 1SXJD 3JZAA 3PEWA 3ZZUA 3NEJA 2XXAB 1I2DA 1BMFD 1ZU4A 4A6XA 3K9NA 4NCIA 2JLZA 1UBGA 3R7WB 1LVGA 3ZGXA 3TRFA 2V8OA 3CRQA 1WBDA 1Q1BA 2IXEA 4QJ3A 1KSHA 2BM0A 2QPOA 5GADl 2BMFA 1XTQA 3OHMA 3SBDA 1H8HA 4JLPA 4TMTA 4MGIR 4Q4AB 2DWPA 3SE0A 3HU1A 1N5LA 1OV4A 1RW4A 1XBTA 4B3FX 2QAJA 1DADA 2GJ8A 4DCTA 1QHHB 5JBQA 1T6NA 3CRMA 2YJTD 2YV5A 5F2EA 2F3RA 5BXQC 1NIJA 1YR9A 4QBHA 1VYVA 5FR2A 1EFCA 3AVXA 1KDPA 2RAPA 4TT3A 4G5QA 1H8ED 2FX3A 3I8XA 4Q9KA 1G20E 5G41A 3AVTA 4HZIA 4O25A 2FNAA 3CX6A 3DL0A 2WSMA 3G82C 3C5HA 4CEHB 4U02A 1ZW6A 1QHYA 2B7CA 4BFYA 4L8GA 5HKKD 4B33A 3FFBA 5BQ5A 4KFSA 4OHXA 4YC7A 3C7KA 1P9RA 1GWNA 1Z0IA 2WWXA 1EX6A 1OFHA 4HLUA 1ZMXA 4ON9A 1E9FA 1HT1E 1Z6TA 2D2FA 5M04A 4CZ2A 3SC3A 3QF4B 1YZLA 3VTKA 3BC1A 1IY0A 2FFBA 3EA0A 2ZJAA 4MKHA 1NKSA 3S1AA 1XEXB 1NN3A 4FI3C 3FOZA 4QM6A 3LW7A 3M0EA 4FXPA 3W3ZB 4PPQA 2JAQA 3Q5DA 1GRNA 1L2TA 2ZSBA 4BRUA 1KO7A 4LC0A 1IHUA 4E22A 3DOFA 4ZPXA 1QDEA 4LHZA 1NJGA 4A9AA 5KUTA 1M7HA 2PCJA 2R44A 1NY5A 4B35A 4L15A 5D3QA 3UG7A 1SXJE 1E2EA 2REXB 3WP1B 1UBFA 3NH9A 1OH6A 1E9CA 1CR0A 3GJ8A 2WAYA 4QGHA 1Z47A 4O0MA 3K1JA 1XRJA 2PL3A 1XD2A 3L0PA 4XWOA 1KZ7B 2DCUA 2XJ9A 1N6OA 1H8HD 3TAHA 3PEVA 1SULA 4DIEA 4Q1FA 2X2FA 5J47A 2DR3A 3A37A 2ANCA 4RD6A 4OI4A 4JBWA 4HLQB 1ZM9A 3UIEA 3TKLA 1JJ7A 2BOVA 4CVNA 2VPPA 3SU8A 3TR0A 1BYIA 1N0UA 4QBFA 4TT3D 1OXUA 2RGCA 2YZ2A 1JR3A 1JAIA 3GFOA 4KFRA 4XH9B 2IBMA 3SDZA 3GLHA 1D9XA 3EIQA 4NKRA 3NEYA 4RY2A 4UNRA 4URVR 2GETA 1ZNWA 3MFYA 1XTIA 1G8FA 4UJ3A 4LUCA 2ZE5A 2QTFA 1G5PA 1W2HA 4HAYA 5JWHA 1M1YE 4PANA 1ZD9A 2VP9A 3TJZA 1RKBA 2BBSA 3A1UA 1OYWA 4NYMQ 3H2YA 5AUOB 5DN6A 2WOOA 4LJ8A 4GPTA 1U8YA 1E96A 1ZVQA 2D7CA 5CDFE 5GVSA 3OFNA 1AKYA 5G40A 5H8WA 2FDCA 4M1TA 2NTYC 3RVBA 4Q03A 4XVRA 1VG1A 2YWFA 1G7SA 3MAAC 3UWKA 4PC7A 2YWGA 3QQ5A 4A4DA 3K70D 2VF7A 4TYNA 3A1TA 2V3CC 3WMEA 5KNBA 3PUXA 1NN1A 2HEIA 4G5RA 3GJ5A 3CNOA 2WOJA 3ZH9B 2GDJA 4PHHA 1OH8A 1RJ9B 3IILA 1GP2A 1EX7A 3GCGA 4FMDF 2G3YA 3MG9A 5H70A 5L3QA 2BJWA 4ZV4A 1KI6A 1NI3A 3ZQ6A 3GLFB 1W0JA 1XZQA 2GKSA 3RS0A 1QVAA 4ZKEA 1E3MA 1QHIA 2B92A 2PMDA 2XOKA 2CL6X 1E9DA 2QAGA 4JJKA 2XJ4A 4BLQA 1P9WA 2R9VA 5TMPA 1YQTA 2VF8A 2XZPA 2O8DB 3FMOB 1VKJA 1E2PA 4M21A 5FUYA 4A0GA 1MABA 1KOFA 1E6CA 1R5OA 2W2XA 4RD3A 4B3DA 4W5WA 3K9GA 2QGZA 4BFZA 1IJEA 4D80A 4TWZA 4JYBA 5C4MA 3NBZC 2WIAA 3I62A 1HQYE 4EQ6A 1A82A 5G53C 3OZXA 1N6KA 2W0SA 5AUQA 4FWTA 1JEDA 1TQ2A 5E7IA 3HU3A 2OAP1 3IGFA 1Z2CA 3FMFA 5FPHA 1YZNA 2ZR9A 1KK2A 2IC5A 1QHGA 1D2NA 1Z0FA 3RS3A 4MKIA 1KO8A 3PITA 4G5OA 4WA7A 4Z54A 2GVDC 2FGJA 5SZJA 5SZKB 3PXGA 1KI7A 4LPKA 5KPJA 4DDVA 1XTRA 3OAAA 2RHMA 2OM2A 1E2QA 4DCVA 5AK0A 3CKLA 2HF8A 1Z63A 3TQCA 1GDDA 1Z6GA 4TYYA 4HLCA 1UKVY 1UM8A 721PA 4L16A 2CE7A 3W9YA 5DN6D 2X8AA 4AY2A 1F2TA 4DEYA 3QG1A 4US1R 3G5UA 5CK4A 4B3BA 2QP3A 1XDBA 2CL0X 3FWYA 3GJ7A 4QBIA 1EGAA 1E0AA 1KJWA 3CRW1 421PA 2ANBA 2C04A 4C30A 3QEJA 1E9BA 3OIWA 2W6JD 1UF9A 2AXPA 2Q3MA 4MH0R 3SFZA 1SKYE 3FGNA 3PVSA 3THXA 3SI7A 3EZFA 2CLSA 2FPLA 4L9WA 5FR1A 4Y0VA 1W0JD 4B71A 4V0ME 1NKTA 2KB0A 2QG6A 3B5JA 1W4RA 4HUTA 1SZPA 2XOKD 4JVLA 5FUVA 3CIOA 2JJ8A 1KAOA 2AFHE 2W00A 5KDOA 4RD1A 1CBUA 3PEYA 1U0HC 5JHGB 2ZYUX 3K53A 3MD0A 1P5ZB 4ZI3A 2IF0A 4C0BA 1G3IA 3FTQA 4AG5A 1JPJA 2JIZA 4OBEA 3AP1A 3HPRA 4BFVA 1SQ5A 2FFQA 2ZRDA 3Q5EA 4P32A 1Z22A 4P4UA 5E7MA 2KSQA 1II9A 3GJ6A 4FN5A 3U61B 4KLNA 3KKNA 3K09C 2GNOA 5CITA 2NZ8A 3K0AB 2ZJ2A 3NIBA 4N1AA 4BLTA 1FTSA 3LXXA 1DOAA 2ZYTX 2DFLA 3KB1A 2J0VA 1D9ZA 4NONA 3TGPA 3KQKA 5EE0A 1JBKA 2WJYA 1CXZA 1XXHE 3K0CC 2ZVQX 2BBTA 3EIEA 3VKHA 2EFGA 4LDJA 1J2JA 2EWWA 3QENA 4LBZA 4KSBA 4KV9A 3SJZA 2QU8A 4AWXA 3ADKA 4Z1MA 3MWYW 1ANKA 2QORA 3M1IA 4TMXA 3QKTA 2XZOA 4IVPA 4MYUA 1RZ3A 1I2MA 1A4RA 3CWZA 2XTMA 1G19A 5IRCD 2JLXA 1M7BA 5A4JA 1XWIA 2ZRIA 4HYYA 1IN8A 1L4YA 1CTQA 2ZAMA 3QIAA 2IUUA 3CBQA 3UXMA 1MT0A 2C99A 3I72A 2ZUBA 5EE5B 2ZJYA 4LV8B 3WNBA 4V0LA 1OKKD 4P33A 3QBVA 4KVGA 3NVAA 4A36A 2WICA 3K0FA 1NG9A 4IDPA 5E95A 5G3ZA 4KLZA 4DWJA 1HQCA 2D7DA 4KAXA 3LWNA 2BC9A 5KPDA 4TYPA 4BLSA 1RRCA 4D0LB 2IL1A 5KO2A 1Q22A 2IXGA 3OIUA 4OYHA 4TMZA 1FZQA 3RWMB 2JIZD 1CIPA 1LS1A 5DH9A 3GJXC 1AS0A 5BYKA 2JLVA 1Z0KA 3ICEA 1XD9A 1NMYA 1G7CA 5TVKA 4M1WA 2FN4A 3THOA 3MWJA 4OK3A 1NG1A 5FBLB 5HCIA 2OILA 4II7A 4EJSA 1U99A 1SVLA 1LV7A 2R6CA 3SNHA 2IK8A 5F3WB 1SGWA 3RNLA 2CBZA 2G83A 1UDXA 3ZLJA 4C9BA 3RS5A 1SKQA 4G0NA 2GEDA 1XPUA 5K8TA 1FNNA 2PZGA 2ZIAA 3LA6A 4MDEA 5DO9A 4MRVA 1G4AE 1WQ1R 4LJYA 4W5JA 5LD2C 2OXCA 1LNZA 4TLBA 2GWHA 3X1XA 3L2OB 1W2GA 1T3HA 3B6EA 4PO1A 3RC8A 1KGDA 2OBMA 4S35A 1RVDA 3FFAA 4BUJA 4ARZA 2IYUA 4IOJA 1JI0A 3PCRB 2GCOB 2EU8A 1U98A 2OBLA 4LJ5A 4K46A 2CLCX 2VP5A 2ZXUA 3A58B 1P62B 3WRXC 3ZS8A 1E4YA 1XU4A 2GILA 4PC3A 2ZYWX 4XVUA 2IYZA 2BMEA 3J81k 1G7TA 5HR5A 4EDHA 3HU2A 3T34A 5DNYB 4AURA 3IPYA 1IOZA 3N2EA 2NO0A 4LJ6A 2WJIA 2VL7A 1O87A 4GL2A 1LF0A 3B8HA 2IYQA 3FB4A 1X86B 2WVJA 4I1SA 4YONB 2Q3HA 3T12A 1SVOA 3CF2A 4X8OA 5C4GB 5TB5A 2C9YA 3O8RA 2GZAA 4A1FA 4IVRA 3EARA 1TU3A 1U0JA 2FG5A 3GLHB 3P4YA 1D6JA 3WP0A 5AUNB 1ZNYA 2QBYA 2AD1A 1U9IA 2PZEA 1OE0A 3REGA 4Q5IA 3VX3A 2ZRKA 1RE0A 3X2SA 5FFMA 2A5DA 4B34A 3KXKA 1T3LA 5FOUA 2DFKB 2JJ1D 4ILEA 4KITB 4OQLA 4P3YA 5J4YA 1SHZA 5JS7A 4JLVA 3LXRA 2ATXA 4NYJQ 3ZIAA 2JDIA 3AEZA 4DDTA 1YZKA 1JPNA 3TVTA 1E1RA 2H18A 2R6AA 3BFVA 2EFEB 3BD9A 2A5YB 3CO5A 3WRYC 1OT3A 1S9DA 4G01B 2V54A 1KMHB 2R65A 1TX4B 1F2UB 3BS4A 3CX8A 1GIAA 2CHGA 4X8MA 3QXHA 2QM7A 1IXRC 1SVIA 2Q6TA 2L0XA 3FDIA 5BN5A 3C8UA 4JBYA 1R8QA 4JL5A 5F98A 2ZRCA 3U3OA 5L3QB 4D0NA 4RVCA 1KI6B 1J99A 4YXWA 1S96A 1A7JA 1QG4A 3RYTC 3ECCA 3SN6A 4CEIB 1E9EA 2OCYC 3U2QA 1XFAA 2J87A 4OHYA 3CZPA 3W6OA 2DHRA 4PAOA 4QGGA 4DUGA 2ZEJA 3RRMA 4D2IA 5EP3A 2ZRJA 4RKFA 3Q72A 3EC2A 4NYJR 3EPKA 5CM9C 5E4FA 2IYXA 2YWHA 4B48A 3LD9A 2V55B 3RS2A 4BLRA 4WVFA 3WMFA 1G1MA 4MGKR 2O0HA 1PV4A 1XD8A 4B2LA 1CP2A 3TUZC 4EQ6B 1N3BA 1R0ZA 4AKIA 1VCMA 1WMSA 2HYDA 2QRZA 2YHSA 6Q21A 3KQNA 4NCHA 4AKGA 4NYIR 2ZRFA 2YNMA 1M8PA 1E1QD 4A2WA 2WTUA 3LO5A 5B64A 4Z8XA 4NPHA 5DHAA 4Q4JA 2IS4A 2KBEA 4AYWA 1GOTA 3B85A 2E1RA 5KDLA 3BERA 3SQXA 4O2LA 2VH5R 4OKSA 4Q9IA 1T3SA 5JCZA 2K5UA 3DM9B 3CRVA 4P0TA 1SXJA 4AC9A 4E03A 5JI2E 1P61B 3W5IA 1BMFA 4BECA 2ZI7A 3X1WA 4FMCF 1DEKA 2O0JA 1LS6A 2QA5A 3A1SA 1OSNA 4UXHA 1F2TB 2JDID 2NG1A 3ASYA 4HDCA 1G64A 1G4UR 3OEHD 1E1RD 5LPNA 4KJZA 4RD0A 2WWIA 2I3BA 1G9XA 3PQCA 2H1LA 2OUKA 3WBKA 4G3XA 2D06A 3EPLA 2JLWA 3U6BA 3WNCA 1W7AA 1XMSA 2AKYA 4HUQA 4UJ5A 3GEIA 3KJGA 5JRJA 2UVQA 4MRRA 3R9XA 3M4YA 4OI2A 3ZJYA 2VHCA 4RFSA 1H65A 5JZVA 4DC9A 3THXB 3FHOA 1CJTC 2VP2A 3QG5A 2ONJA 4M22A 4NCNA 1GVNB 2IWHA 3WHKA 4YXWD 4GOXA 2G77B 1UDWA 3THYA 4OHZA 5UKDA 1KDOA 4CIDA 4MUAA 1NVVR 2ONKA 2V4ZA 4QXAA 4JYCA 1FPMA 1VCNA 2JASA 1DVRA 1T9HA 2RB4A 5HKKA 1IAQA 3LW8A 4M1SA 4ESVA 3B7GA 2BKUA 2AWNA 2IXFA 2EFDB 2QTHA 2CMKA 3IIMA 4DCSA 1E9SA 1P3JA 4Q4HA 1ZUIA 1YR7A 3FPAA 3E2IA 5L3RA 3OF5A 1AGRA 2DB3A 3N70A 1K8RA 2ORVA 2GXAA 4BLPA 1VTKA 1TUIA 2HV8A 4JL6A 5CDFA 4ZIRB 4TTQA 3QBTA 3NHAA 4FINA 4QGFA 4UNPA 3TK1A 5GJWC 4GBMA 4TTPA 1Z5ZA 3TNFA 4GOKA 2GRJA 3HPQA 2PX0A 4V02A 1OXSC 3AKEA 3AVQA 1Z3IX 3T35A 4X8HA 2GAOA 3IQXA 1CR1A 2W0MA 3C5CA 4F93B 4MITA 2C96A 2RGXA 1YVDA 2MSCB 3MUFA 1F48A 3CWQA 3BFKA 3RS7A 2FSGA 5D3MB 3UATA 2ZRMA 1AIPA 2GTPA 4KCGA 4NP6A 1KDTA 2OCPA 1SVMA 3TSZA 2IS2A 3LQQA 2H5EA 1KNQA 4D4LA 4A8JA 1EG7A 1W1WA 3B9PA 4NHOA 1IN4A 5K8IA 2F55A 1JAHA 4AI6A 2VP6A 1YRBA 4Q48A 1JECA 5KTYA 1MRSA 4FIDA 3JZMA 3CUEF 4KI0A 1QHXA 2ZI4A 1XEWY 2CL7X 2ZRNA 2ZROA 2J0UA 5FOXA 4QL3A 2VO1A 4PQFA 3TIFA 2ZU6A 1DELA 3SHFA 5TY0A 4RFVA 2N46A 1AZTA 2ZITA 1DO2A 3AKDA 3TW4A 1IM2A 4UXJA 2G9NA 1RYFA 1CF4A 1II0A 4MUBA 2ZJ5A 3UWOA 4F7WA 3CNLA 1R7RA 3C41J 4MRPA 4QHYA 3GEEA 4I1VA 5H1YA 2IYYA 2ZRAA 2XTNA 3EASA 1PLKA 1SHKA 4ASUD 1G17A 3GLFE 4MDFA 1XPOA 3K0FB 1LB1B 3LRPA 1Q57A 3N2IA 3HWSA 1GL6A 3RAPR 2G0NA 2ZTSA 1KO4A 4MGYR 3W8NA 3GLGB 1W44A 1N2CE 3IUYA 3LAWA 3KTAA 3EZ6A 1UADA 3QKSA 1Z8FA 4Q7JB 2IYVA 2VHUA 4IEIA 1XCPA 2AD5A 3NDPA 3FE2A 4EKDA 1DAGA 4EJSB 1HTWA 1R8SA 4M9XA 3TH5A 4C7OB 5KU1A 1D5CA 3AKYA 5SZHB 4LJ9A 4ACBA 2NPIA 3AGPA 1LY1A 1E79D 3QOFA 3TLXA 4DXAA 2Z83A 4LGMA 4EPRA 1VMAA 4XTRA 2XX3A 4JT2A 1NMZA 1SVKA 3X1YA 4HDQB 1EWRA 4Q7KA 4C3ZA 1COWD 3QY0A 3LBHA 3ZVMA 2QI9C 2ZRHA 4QKQA 1Z0JA 4V0MA 5KNDA 1FMLA 2HT1A 1S2MA 4XTCS 2P2LA 1BS1A 1JQLB 5G3YA 2Z4SA 5FUXA 3LY5A 4OJQA 4IXNA 4M0LA 1OXTA 121PA 2FMXA 4PZLA 2A2ZA 2WSSA 2QUZA 2J3EA 1Q1EA 3U7FB 1OB2A 3WHLA 3EG5A 2IHBA 4WZBE 5EXXA 1TQ4A 4LWZA 3L43A 2IX3A 3I5XA 4KFUA 1BKDR 1G3QA 1NLFA 2AL7A 2P3SA 4HATA 4IRUB 3L0SA 1D2EA 4WW0A 4DCUA 5C1BA 5FTLA 5JJLA 3V9PA 3NXSA 3WY9A 1ZM2A 4RZ2A 2RHDA 2OG2A 2V1XA 3KQLA 1C4OA 2KJQA 3C4JA 1LTQA 4NBSA 2JGNA 2WM9B 3DMNA 3SS8A 1S8FA 3QKRB 1KI9A 1IN7A 4GRAA 2HLDA 5FTKA 5J5CA 1UBCA 1XJ0A 4DLYA 2C95A 4M8NE 1ZP6A 1ONBA 3B1YA 3AGQA 4IDQA 3BRWD 4Q02A 4D25A 1II8B 3ASZA 4M9QA 4A92A 2FWRA 4LHXA 3IEUA 4K8OA 5KSPA 3AUYA 1T5LA 5BN3A 3SEAA 2NGRA 3MLEA 3BOSA 4QJ5A 5TDHA 4OQFA 2WWGA 1OB5A 1B23P 3GFTA 2D2EA 2ZSDA 4ZDJA 1XXHA 4KHZA 3AVYA 1CJUC 3DMDA 3DM5A 2H17A 2QTVB 2ZETA 2WPDA 2GBLC 5CLLA 4TZ6A 4MKFA 4GZLA 3ZDQA 1NVWQ 3CW2A 3QKUA 4P4SA 2OLJA 2PLRA 1B0UA 2QY9A 2J7KA 3DOEA 4JLAA 1WB9A 2W6JA 5EZ6B 3B78A 4RD4A 4BEJA 5HPYB 5AJZA 4C2TA 2IS1A 3R9WA 2PT7A 1E2HA 2QMUA 1S3SA 1E2FA 4IFBA 4A0RA 2IS6A 2O8BB 2IYLD 2NQ2C 4D81A 1RC8A 2WJHA 1VIYA 2VBCA 5ANRB 4U7DA 3LH5A 3GLIB 4DLRA 1QRAA 4IOMA 3T5DA 1PUIA 3RC3A 5K8LA 3AF1A 4NYMR 2ECKA 4AKHA 2ZR7A 3I73A 5FL3A 5F9FA 3CR8A 2OESA 4A15A 2WSSD 4JSYA 3PJRA 4F91B 2QGNA 2F43B 4BFUA 3ADBA 4JLKA 2O8EA 4URUR 2KBFA 2WV9A 2R6GA 1M2OB 1IONA 3E70C 2QQ0A 3PUVA 4P31A 3TW8B 4NE2A 4ZO4A 4NH0A 1UJ2A 1NN5A 3B1VA 3GQBA 4ZDIA 4CEJB 1W48A 4RSGA 4EPTA 1UEIA 2AXNA 1EWQA 1R2QA 1RIFA 2HLDD 1EFTA 1N25A 1E2KA 1ZM7A 2AK2A 4A2QA 2ODNA 3BK7A 1TF5A 4TTRA 3U3KA 4PHTA 2ZI3A 3UANA 1CULC 1ZD1A 1Y63A 2EFHB 1PJRA 2Q9CA 2WKRA 3EZ2A 4Q4JB 1OXXK 3AVUA 1GL7A 3VR4A 4OI0A 3IDQA 3ND9A 4LJAA 4URYR 4TYWA 1G7RA 5HE9A 3LFUA 1NLZA 4EPXA 3SYNA 1SXJB 1KNXA 3WXMA 1NRJB 1OFUX 1RRGA 1SVSA 2ORIA 2WPDD 3K0SA 2BIFA 1T0JB 4D4JA 1RPZA 3AVOA 4PC2A 4I1UA 2C03A 5E3HA 4ESHA 1U90A 4KSCA 1V5WA 1JEEA 2FPMA 2D74A 4LZZA 2FGKA 3GD7A 1MO5A 2IYSA 3NTUA 3UMSA 5A0FA 2J5XA 3VHLB 1XJCA 5JCPA 3U6KA 1JXMA 4D82A 1E2IA 1Q21A 2YWEA 2NPFA 4DSUA 1DAIA 4OJKA 1TTTA 1CLUA 2ZJBA 4RFSB 1YZGA 3CR7A 3WBJA 1BIFA 2FE4A 1GNPA 2R6FA 3KKQA 1OKKA 1ZD8A 1W36D 5FBQB 2ZRLA 3THYB 4TL8A 4ZCIA 5CYPA 3H86A 2V6JA 2F1IA 3QI2A 3GP8A 4DLZA 2QE7D 1CEEA 1I4TD 3NBYC 3U5ZB 5FI0B 5JI3E 2GK6A 1ZCAA 1GKUB 4R2IA 3EC1A 5DSZA 4DT1B 3EWAA 1O3YA 3LX5A 3MRSA 3P4XA 5JJIA 3NH6A 1L4UA 4CW7A 3KQHA 2RH5A 2FPKA 3REFA 1OIVA 1R0XA 1VG8A 5DI3A 1E0SA 2FFHA 4JKYA 1M34E 2RGNC 4FW9A 2DWOA 4TL7A 4WZ6A 4B76A 5IHPA 1EFRA 1OIXA 1EFUA 4MA4A 1KZGB 1CJMA 4PPGA 4DSOA 1TEVA 1KO5A 2NO6A 1X8JA 2GHIA 3KZ1E 4Q00A 1W49A 2ZI5A 1OJLA 2CDNA 2REBA 4GNKA 4PHFA 4PZYA 4LV5B 3AV0B 3R8CA 1XNJA 1MH1A 1NBMD 1NMXA 3H4MA 3QPUA 4JLDA 4PXAA 2B8TA 4YMSA 2FV8A 3KKOA 2QN6A 2G1KA 1AQUA 1VCOA 4Z8YA 1MO4A 2ZQ5A 2VSOA 1PVOA 4GDFA 4LY6A 3BB1A 2HCJB 1G8HA 4A8JB 1IN5A 3Q9LA 4TLCA 1P6XA 1J8YF 2OFOA 1FOEB 4HEJA 4C0KA 1ZNXA 2ODBA 2ZSFA 3NBXX 5GJBA 2QPTA 4YDSA 1G6HA 5HTKA 2LWIA 3V4FA 3DZDA 4B3GA 4JVMA 4BFXA 1D2MA 2J0UB 3R7WA 5CJ2A 1ZIOA 4PAQA 4HAZA 1CKEA 3D8BA 3IEVA 2A5GA 3CB4A 3I3SR 1TAGA 2C9CA 2CLDX 2Z5FA 3TVDA 1QZXA 521PA 3KUCA 2QP4A 2ZM5A 2J0QA 1E2LA 1N6HA 2OAQ1 4ABYA 3Q7PA 3KJEA 4Z51A 2WJJA 3GJ0A 1OFTA 1AA9A 4C0QC 4HLUC 1XTSA 2RGBA 3CF0A 3Q7QA 2KWIA 3RS4A 3VU9A 3FHTA 2UZIR 1I4LD 4LBWA 2FH5B 1J8MF 4BQSA 2JLSA 2ORWA 3CM0A 2QT1A 3KUDA 4XWAA 1A5TA 3QPWA 1VHTA 1GKIA 2JJ1A 2R62A 3A4NA 3DPUA 1U94A 4BWYA 4YMWA 1JXOA 4BEBA 2JATA 2OV2A 3FHCB 4PSKA 2GXUA 4HAXA 1UKYA 3S1AB 4RJLA 1F6BA 3NBFA 4LPSA 2MSEB 2RGGA 2X2EA 3TSOA 4JL8A 3U3MA 2BWJA 3RWOA 1UKZA 2IA5A 3TBKA 1AM4D 1EFRD 1Q3HA 3D7MA 4D4KA 4QBGB 3A4LA 2F6RA 4R98A 3QF4A 3U3JA 4F92B 5KOYA 1E69A 2FEMA 3C15C 4LI0A 4M1KA 1G41A 3LDAA 2ZUCA 3IO5A 3D3QA 2CVHA 2XB2A 1GKYA 4L5BA 2FZ4A 2H8KA 4JIMA 4BGDA 1NBME 3C14C 2CEAA 1KI4A 2R8RA 2WAXA 3A36A 3OEED 2O52A 5AJWA 3H0KA 1SKYB 5J40A 2G88A 5FOWA 4GSYA 4BFTA 2BHRA 2ZAOA 2WIBA 3CZQA 4WIAA 5EE3A 4RD2A 4FCVA 1XD2B 1HV8A 1G8GA 1YE8A 1Z83A 1YZUA 2F7SA 3T15A 3H1TA 3EXAA 3K0EA 3KFXA 4GT1A 4JLJA 3U7GA 2GESA 3K8YA 3D6TB 3RSOA 5DIFA 1BYUA 4Q4LA 1ESMA 1IY2A 1FP6A 3PUZA 3L82B 1EFHA 1US8A 4Q9JA 2XAUA 1N6NA 3NC1C 3SHWA 1P2UA 1W4AA 4KBFA 2QEQA 1OW3B 1VG0B 4KO8A 1P4SA 5DISB 4JVSB 4XSGA 4D0GA 4GOJA 1RRPA 3PG5A 5DI9A 4G5GA 4M1YA 1E2NA 3IPXA 2ZS7A 2QT0A 3KKMA 1E1QA 2P67A 4RZ3A 4WBSA 2IT1A 4YMUA 3EW9A 1P72A 4FWIB 4B6EA 1Q1ZA 1HT2E 1Z6XA 1UPTA 2FFAA 3VAAA 2QSZA 2AK3A 4PO9A 3FKSD 3F8TA 3I4LA 1P60A 1OLOA 1Z29A 1NN0A 3ZZTA 2WWHA 1K6MA 3UMRA 4CT4B 2E87A 2LCFA 4OQXA 2QM8A 1KMQA 2CCKA 4PTLA 3UPUA 4UXIA 3ONWA 3OEHA 4GMXA 4OHVA 5JJKA 2WWFA 5EJEA 2NO1A 1MOZA 3PFIA 4HB0A 4JBXA 3SFVA 4Q9LA 4NMMA 1UKEA 1GM5A 4DLUA 5B58C 4B74A 4H9GA 4R71A 1JALA 1GRQA 4UNQA 1XCGB 2GEUA 1CU1A 4PO8A 4KFTA 4UNSA 3B9QA 3VFDA 1YR8A 4R2HA 5JSZA 1GNQA 4CRWB 2GK7A 3BJIC 4Q21A 2QAGC 2C2HA 1N5IA 4U5XA 2GVZC 4WXPA 4DLWA 3V4RA 2PZFA 4LJ4A 4WOPA 3CLVA 3SJAA 2A3RA 4OK6A 1RJ9A 4HI0E 3DZ8A 1YJ5A 2QAGB 1CJVC 1F5NA 4IOKA 5TXGA 5BN4A 5C2JB 2ZJZA 2ZREA 3GLFA 2CE2X 2B8WA 2R2AA 3E1SA 1LW7A 1VG9B 5B30A 1VYTA 5EQTA 4C0SA 1MABB 1LF5A 2IUSA 4AD8A 5DE3A 1MKYA 1G3UA 2O8EB 1IQPA 3DKPA 2FF7A 3NC0C 3AM1A 2PJRA 3IBYA 2HUPA 4L9SA 3QEOA 5FI1B 4H1VA 5E7JA 1KSFX 4GFDA 1N0WA 2GEVA 3FKQA 621PA 2BVNA 3B1WA 3NHBA 4DLSA 2OCBA 1L8QA 4QHTA 4B75A 4KU4A 1ESNA 4H1UA 4B43A 4CGZA 1HYQA 3PEUA 3D31A 1KI1A 1E32A 1ZJ6A 1TQDA 1Q0UA 1G3RA 2PJZA 4NL4H 3IIKA 2Q9BA 4IW3B 2NZJA 1HEIA 3VR3A 2ZS8A 3I8SA 3K9LA 3QPVA 4B3XA 3KKPA 3GLGE 2F9MA 5JMTA 3FMPB 5L3VA 1CJKC 1OFIA 4DDUA 4XD7A 3ICQB 1BOFA 1KDRA 4PQRA 4M2LA 3MSXA 5ELXA 3MJHA 4MYTA 4OL0A 2ZE6A 4X8LA 1XJQA 4DSNA 1IJFA 5FUWA 4U00A 2Z6VA 4F4IA 5JECA 4G5SA 2ZRGA 1ZAKA 4URXR 4C0JA 3EIHA 3SYLA 4HAVA 3ADCA 2OT3B 4GZMA 3CPJB 3W6NA 2DFNA 3AVWA 1KK0A 3DVLA 1G16A 5LB4A 4C0AC 3EA5A 2V7QD 4AKEA 2WJVA 4NCKA 2D3WA 2G0TA 3ETLA 4V0KA 5FTMA 2DFTA 2JLQA 3TSWA 4AIIA 4PZZA 4ASUA 4Q1BA 4DLXA 3RABA 4AK9A 3O8BA 5J4HA 1NY6A 1YZQA 2EWVA 4BZPA 2ODEA 3KJIA 3VKWA 1MV5A 1R0YA 1U81A 2W6IA 5FH9A 1G18A 3T1OA 2MMCA 2PEYA 1E2GA 4LBYA 3HYRA 4HSEA 3TMKA 2VEDA 4EPYA 1DAKA 2ZI9A 1S1MA 2CCGA 4KBGA 3B13B 3ZD6A 3TQFA 3AF0A 1VIAA 1Z08A 3DEFA 4V0NA 5J4KA 4A2PA 2EYUA 2J45A 2VIIA 3IHLA 2YC4C 1WE2A 4J0QA 4JSTA 3L0IB 2FJUA 4D6PA 2RCNA 1HE8B 3SZRA 4IEEA 1E79A 4HDOB 4E09A 4E5UA 2HT6A 1GRRA 1Z6YA 3UKDA 3LBIA 2F9LA 4DKXA 2BM1A 2ERYA 1COWA 2H57A 1U0LA 3K0AA 2J41A 5AJYA 4N3NA 1P73A 5EZ5A 5GJCA 2YINC 1GILA 1GUAA 1DTSA 2A30A 3X1DA 1GL9B 1X6VA 4N0EA 1BO6A 2FOLA 2OXRA 5EXPA 1PZNA 3RLFA 4WAUA 3K09A 3VR6A 4MQBA 1CS4C 2ZJOA 1FX0A 4XD7D 2FZLA 1S0UA 4TZ0A 3TE6A 2NO9A 3QXXA 4OK5A 1RFLA 4TMWA 2QMHA 4IDNA 5EP2A 1S1CA 1Q3TA 1AZSC 1KK3A 1OH7A 1CR4A 1NSTA 2B21A 3B2EA 1U8AA 1KI2A 4URWR 2XSZA 5DYIA 4B44A 1TF2A 2CHQA 3BBPA 4LV6A 3UMFA 5J4VA 1KO1A 3K0CA 2BV3A 1VECA 1NSFA 3L8YA 2P0EA 3HYTA 4BZXA 2VYFA 3QNUA 4XOIA 1I4DD 2J9RA 2P6UA 4R9UC 5JRZA 1AGPA 1EK0A 4DBLC 2OLKA 3ZZ0A 1DS6A 3LVRE 4BFWA 3X1ZA 2C98A 1MO3A 3NKVA 1OPXA 4FCTA 3MCAA 3QUSA 4C4PA 3U7EB 1KY3A 4JVNA 1G3MA 1FNMA 1NLYA 4OQNA 4TMVA 2W6ID 4QGAA 5EP1A 1WDTA 3PUWA 3VU9B 3GLIE 3KQUA 4PC1A 5FBWB 1XMVA 4WXRA 4EJSC 3QXJA 1DARA 4M4SA 4A0FA 4JLNA 1TEXA 1NVXQ 2Q3FA 4TYQA 1DAEA 2B7BA 1Z0DA 1KTVA 2N1BA 3FYHA 4PPNA 1OYYA 2WKPA 3DO6A 1F3OA 3QXCA 4K81B 3U44A 4EUNA 1ZUNB 1E0KA 3O8DA 2IUTA 1GZSA 3AVPA 1MR3F 5J4LA 4PX9A 1ELOA 2NIPA 3CH5A 1N6RA 3BWDD 4IDOA 5AUPB 2CVFA 2QSYA 4M53A 3B60A 5IK2D 2BMDA 1OIWA 2HXYA 1X3SA 1X8LA 5EE9A 2ZS9A 4HZUA 3A6PC 4A6PA 4GP6A 1AKEA 2AN9A 3MGCA 5BWMA 3OIYA 2ATVA 4URZR 3RHFA 1FUKA 4DZZA 1R0WA 4ARZB 2YKGA 2VHQA 2BBWA 5LB2A 4N0DA 1TADA 3QJYA 4PR0A 1NIPA 2PMKA 3VNVA 1HH4A 2FSIA 1CRPA 2H16A 1X1RA 2FEOA 2IYWA 1X1SA 1EESA 2GCOA 4I1OA 4EFLA 4B32A 1XB2A 1R10A 2XSZD 4OQMA 2GJ9A 3R8FA 1E99A 3AF4A 5KSOA 1US8B 3GJ4A 1N0VC 4XVQA 4TQ9A 1ZM3A 2FA9A 3EPHA 1WA5A 2JLUA 2ZPTX 4TQAA 1U9IC 3HR8A 1DAMA 1GTVA 2WWYA 3BB3A 3Q3JB 4JMPA 4ZCMA 5DLQC 1KI8A 1G8PA 4BE7B 3SJCA 1KYIA 4B2PA 3U4QA 5KSZA 3CRRA 3Q85A 2VTKA 4Q7LA 3UG6A 1N5JA 2QBYB 1R5BA 1S4QA 3AF3A 3NWJA 3QF7A 3HP1A 4MGZR 4IFEA 5CB6A 4B6FA 2Y8EA 4ZI2A 4AYTA 1L7VC 4DLTA 1T8UA 2ZE7A 221PA 2ZU0C 1ZM4A 1AJEA 2QROA 5B57C 3T06B 2WZQA 1E9AA 1FQKA 3P1JA 1P7CA 4Q18A 3T61A 4LJ7A 1DAHA 5CIQA 5BYJA 2VQSA 5A5GA 2ZRPA 3IHWA 1XF9A 1F60A 2QMEA 3P20A 4Q1DA 3O47A 1E98A 1XMJA 3SR0A 4TLDA 2JLRA 4NU0A 2PX3A 4LYAA 1E0JA 1ZBDA 2NMVA 2SHKA 4ZCLA 4QOSA 2FU5C 1ZNZA 1ZYUA 4TLAA 5CJPA 5JSZB 3G0HA 1JJVA 2PLFA 4OI1A 2BDTA 3QVUA 1FL9A 3T1TA 1KMHA 3IKJA 1F2UA 5EXTA 1IN6A 3F3YA 2C5LA 2FSHA 2GCPA 2W2VA 821PA 1DG1G 2O8FA 2TMKA 1FTNA 2Z0MA 4B2IA 5AJVB 1N6LA 1XEFA 4ZDWA 3VR2A 4DCNA 1P2TA 4RKEA 1M6NA 3W90A 2QE7A 4E07A 3VNUA 2OEPA 3GJ3A 3CPHA 5DYGA 1X8KA 3OIVA 1J7KA 3ZS9A 1IXSB 4KXFB 3W34A 1KJZA 2F3TA 1XX6A 4BLOA 4CYMA 2FSFA 3THWA 4CEIA 3T5GA 3QVVA 3THWB 2HXSA 2EQBA 4TL6A 4ERNA 3QSYA 2AR7A 1TMKA 2DBYA 5FPKA 2ZI6A 1A1VA 3LV8A 4DVGA 1GSIA 4ITRC 1M74A 2ODWA 2GJKA 4TQUS 3P32A 1WP9A 1YU9A 3CF6R 2WHXA 2BKEA 3VQTA 4B47A 4DHEA 4LC1A 1SXJC 1Y3AA 3BE4A 4Q1EA 3A8TA 5HE8A 2HF9A 4UKDA 2ASEA 4AYXA 4DEXA 4LBVA 1TPZA 1YR6A 4FMDB 4C0LA 1JR3D 1Q1QA 2O5VA 1UBEA 4LYJA 1KIMA 1PUJA 3ZQJA 4LYFA 1WF3A 1NBMA 4US0R 2ZR0A 3VHXA 2WWWA 5KSYA 2QPAA 2X19A 2N42A 1MO6A 1VYUA 4DDWA 1AQYA 4C2UA 3AUXA 4QNMA 2G1JA 4C0HA 4S2EA 4IKEA 4YMVA 4D26A 3I5YA 2YOGA 2A5FA 1W46A 2PEZA 1Q20A 4RZUA 3NDBB 3B1XA 3EWSA 1KAGA 1XTKA 1Q44A 2RKOA 4Q9HA 3M6AA 2DPXA 1YHNA 5AWFC 4DB2A 2IEYA 4BASA 5K8UA 2R6DA 3OFND 2IWRA 4HUQB 1NJFA 2IEZA 2VHJA 4I99A 1GITA 3L0OA 4TSFA 2VHTA 2CJWA 2I1QA 1KHTA 1Z06A 2IHYA 2REOA 2AFIE 2XNSA 5KDDA 3AVVA 5FPYA 2AX4A 1R5NA 2GJAA 3LVQE 4QG7A 1WCV1 2OSBA 4PSAA 3DKVA 5KYKA 1JR6A 1KKMA 5GVRA 4NTZA 2XGJA 3W5JA 3EX7C 5JWOA 1K5GA 1ZC4A 3HDTA 3QXSA 2OBNA 2GF9A 1P2VA 4LHVA 4M9SA 5FTNA 1DG3A 1Q12A 3CNNA 4FCWA 2IYRA 2E9SA 2GXSA 1R6BX 5CLQA 1FUUA 5DHFA 1Z0AA 4NDZA 3R20A 3SJBA 3TUJC 4Q4HB 1KK1A 4HLDA 4YLGA 1XEWX 1G5RA 2MMGA 1RRFA 2Q21A 3TR5A 4RCZA 2BEJA 1GG2A 4GI7A 1DAFA 3ZYCA 4QHSA 1WBBA 5FOSA 4ZDKA 1G291 3W8RA 3ZVRA 2PBRA 2ZJ8A 1N6PA 4RCYA 3P27A 3MWLA 5FBRB 3I32A 1OF1A 5HCNA 4CT5A 4IXMA 2QMOA 3BXZA 1JR3E 2HDNB 5LBIA 3BGWA 3AQ4A 4ZIRA 3RRNA 2O8CA 4MYCA 5L3SA 3GLHE 3U60B 1W0KA 4GMDA 4A8JC 3OEEA 5LDDC 2O0KA 3EPJA 4LRWA 3CX7A 3BFXA 3I92A 2WKQA 4G1UC 5IDVA 4HB2A 5GJVC 2VSFA 1E94E 3OAAD 4EIWA 1E2DA 3V00A 1PLLA 1HY3A 2BBOA 1VHLA 1ZUHA 3RRYA 3RDPA 4DIDA 4I4LA 5D3MA 2VP4A 3ND8A 4MKGA 5TV2A 4LX0A 3UK6A 3GPLA 1M7GA 1T8TA 3I1FA 3A1VA 4R7ZA 2DYKA 2XXAA 4QM7A 1FFHA 2NO7A 5JEEA 1FX0B 1LFDB 4V03A 1RYHA 4XSHA 5EXSA 2JJ2A 2JA1A 5H68A 4F4CA 2JCSA 3RSLA 3AP2A 1WXQA 3PUYA 4TSFD 3BIFA 3AB3A 4EFNA 1QBKC 2IF2A 4Q4AA 3MWKA 1KSJA 2MSDB 2BCGY 1UFQA 3CPEA 2ZE8A 3A4MA 1QHHA 1QHSA 3AP3A 2WJGA 4TL9A 3HR7A 2ERXA 1FQJA 1HURA 1AN0A 1T0HB 3R9IA 1MRNA 2BEKA 1Z6AA 1NVUQ 4A82A 2RGEA 1E4VA 1QHNA 4JT4A 3H84A 4FD2A 1XTJA 4XJXA 4TMKA 2A7QA 4W5HA 1XMIA 2WBLC 4QFMA 1KKLA 1WRBA 1J90A 5EUQB 3CONA 2W2TA 3FKSA 3TUIC 5KHOC 2HYIC 4CEHA 1DPFA 2AHOA 4Q7MB 5F9HA 3KTAB 3CH4B 3K70C 3QKSB 4EAQA 2EYQA 4HB3A 4Q19A 3O8CA 2LKDA 3GEHA 1AS3A 2YC2C 5FL7A 2GAAA 4BFSA 3PV0A 4XWKA 2CNWA 3P26A 1AK2A 3WYAA 3U44B 3GLGA 2WMNB 2IW3A 4LSGA 1G5TA 2F1JA 3NG1A 3K70B 1OHHA 4W9MC 3OE7A 1XEXA 4D4MA 1JB1A 4Q47A 4TN1A 3ZVLA 4PHGA 1W0KD 4C7OA 2J59A 2YOHA 1SVWA 4POAA 2EVWX 2QP9X 4UQOA 4MYHA 3KDSE 4HZUB 1HE1C 3T1VA 4UNNA 8OHMA 1TQ6A 5HZKA 4HAWA 4US2R 2J1LA 2G6BA 3T1QA 1S9HA 2V6IA 2X77A 4LK2A 5FPTA 3W6PA 4QC2A 4RZXA 1BH2A 1TL7C 4Y0AA 2QRNA 3JVUA 2P6NA 3EAQA 5P21A 2P5TB 2JJ2D 2XEXA 1E2JA 1G8YA 4M9ZA 3VMFA 2P5SA 3GFPA 2CCJA 3B82A 2V9PA 5CM8B 1ODFA 1HA3A 3LBNA 5CK5A 5LD2B 4BRWA 2JEOA 3KL4A 4JLMA 4Z1MD 1OH5A 2LKCA 3WNDA 1W5SA 3A1WA 2F1HA 2C9OA 3LLUA 1U2RA 2QQEA 1XZPA 1ZRHA 4XIGS 4QNRA 3BH0A 1D8TA 5JFGA 1KSGA 1NNEA 4DJTA 4PPFA 4PSVA 1IY1A 3SBEA 1IBRA 4W7SA 3U4QB 2OFXA 4L4UA 2BCJQ 3AH8A 3F0TA 3WYFA 3MMPA 2IYTA 3QKRA 1FMJA 1IXZA 2CK3A 2OFWA 3C16C 1JQJC 1VPLA 3IQWA 3W3AA 4EFMA 1KI3A 4CF7A 2ZRBA 2ZSEA 3AF2A 1XXHB 1GNRA 5FL7D 1II8A 5C46F 2CNWD 5FTJA 1CRQA 1NF3A 4V0OA 1OHHD 5CIWA 5EP4A 3OE7D 2A9KA 3DHWC 4JLBA 4P4SB 4QRHA 4A0HA 4DSTA 2XTZA 4EPVA 2DY1A 2F1RA 1C9KA 3KXIA 2H92A 3VR1A 2C78A 1W4BA 4F38A 4CDGA 2GJSA 3LNCA 2B6HA 4Q66C 4DRZA 1W36C 1N5KA 4I81A 1G21E 2YOFA 1ZINA 3PIRA 4B73A 3N5CA 1A2BA 2OHFA 3Q8XB 1CR2A 1K5DA 3B1ZA 5JHHB 1ZCBA 2V7QA 2AWOA 5FOTA 2GBLA 4MRNA 2OZEA 1R4AA 2WMOB 4IDHA 5C18A 2P65A 2Q0HA 1VDZA 1W36B 2YYZA 1YRAA 1T5IA 2O8BA 5TARA 5FBVB 4NYIQ 2O8FB 3SYKA 4IOLA 4JLOA 1QVRA 2CHVA 3BH6A 5JS8A 5BW8A 4P4TA 4IVQA 3GLIA 4NCJA 4YMTA 3SQWA 2ZANA 1ZU5A 2XNDA 4KYUA 2QNRA 1OXVA 2XB4A 5AJXA 3KXLA 1XP8A 1C1YA 2QZ4A 2HJVA 5EUMA 3RRZA 3WYGA 2PCLA 2VLIA 3KB2A 2O8DA 1Z2AA 2GZHA 3EZ9A 3U3RA 2EW1A 2J7PA 4IJMA 1TNDA 2F43A 1EXMA 2RGDA 1P2SA 1W47A 4GP7A 4NZYA 1YKSA 2GXQA 4M1MA 2PH1A 3GMTA 4QJ4A 5CYOA 1E9RA 2EFCB 2CXXA 2XITA 4BZQA 2VSXA 3LQRA 2D4HA 4JKIA 1J70A 4CEJA 5JLJA 5EE1A 5SZIA 2W58A 2J0SA 5AR1A 3KJHA 1NP6A 3QE0A 2HCBA 4IHQA 1ZIPA 2CK3D 5HZHA 1XPRA 1NL3A 2GCNA 4PQYA 2Q9AA 2VRWA 2KI5A 2JLYA 2A5JA 3FVQA 1VCIA 3ZVNA 3TAUA 2RGAA 4BPBA 2ZYVX 3L8ZA 4B3CA 2GZDA 4PAMA 1T4GA 3LX8A 3LLMA 4LHWA 1NVVQ 4JZKA 4YQFA 1QG2A 3WMGA 3BH7A 5B2ZA 1Z28A 2OE2A 2QENA 5FPSA 1KJYA 3ZIAD 5IF9A 5JWRA 4PFSA 3KFVA 4KODA 1FW6A 4JJZA 1G6OA 3DDCA 2HJGA 1GFIA 3RANA 2V1UA 4O2RA 4O3MA 2CJWB 1W4CA 2PT5A 4Q1CA 3VKGA 1A2KC 5JEDA 1V43A 2ZSAA 3I61A 3MJRA 5KNCA 4LHYA 3FMIA 5CB8A 1TUEA 3PR1A 3EZ7A 4LYHA 1Z07A 2BMJA 1GAJA 2Z4RA 4Q01A 1PLJA
chains in the Genus database with same CATH superfamily
2QL6A 5F7JA 4CIAA 3U7QA 3NHFA 2BJVA 3VSEA 2I1VB 5H4HA 4EEZA 2NOAA 4GE0A 3LHSA 4KE9A 1XCMA 2PKQO 2OQ2A 2ZUDA 3PENA 4EPWA 2VAXA 4MRMA 4QQFA 5CFQA 4J75A 5LMNB 2DKFA 2H7VA 1NVTA 2LPMA 4MWZA 1UAAA 5FOVA 3FHTA 2QM0A 4YCNA 2J7PD 3AKCA 3KC2A 3M6IA 3WWDA 2RMKA 1HUQA 1OI7A 3FJYA 4YT2A 2UUAB 3UXYA 1OBVA 4YRDA 3ACCA 2GPSA 2J6IA 1DL5A 4JYPA 4Q1AA 3RTCA 2VYND 4YDHB 4BZWA 1ZR2A 2BD0A 1EGHA 2E6KA 4FDLA 4KNVA 1Z2PX 1QR2A 1R74A 4HH4A 1L4FA 1ULTA 4JS0A 2J46A 1TT5B 2WDZA 4UTPA 5DTMA 4M76B 3ZR4B 5BSWA 4W5NA 4UHKA 2BI8A 2I4NA 3CTMA 3QA9A 2HWKA 3ZWBA 4B8WA 3TWOA 1LDBA 4LOAA 4KYIB 3SIPA 1I7SB 4NBLA 4DYDA 3WLKX 2WF8A 4Q0MA 4EGFA 3IJRA 1YIDA 3ZV4A 1NMQA 1PQWA 1SOWA 3G9ZA 5EMHA 1QRTA 3DE4X 1GARA 1P9NA 2ST1A 1AS2A 2Y0CA 3BORA 2DWQA 3IAM1 4OQDA 4TLEA 3EGDB 2C4TA 4KVAA 4C4TA 1GNSA 3UAZA 4EG3A 1ZIXA 4PLTA 4KHPB 4G8CA 1P75A 1T9GR 5IXSA 2AI3A 2EP5A 3CUKA 4Y2SA 1PJ2A 1I2DA 3IAUA 5DNDA 5AK6A 1WEHA 3K9NA 4NY1A 1DBWA 4HJRA 5D7BA 2JIDA 1WV1A 4GNRA 3P4UA 4OH7A 3R7WB 4D46A 1L4BA 2G9RA 4HWSA 1PWHA 3ZGXA 3K2QA 2IXEA 3CUUA 1P1HA 2BM0A 1IHYA 2C3UA 4QJ3A 2BMFA 1YB6A 1ABFA 1F1JA 2QN2A 3WL5A 1G60A 4TMTA 4M8LA 4X3PA 1U28A 3HU1A 3NTRA 2GJ8A 2ADMA 2ES4A 3MW8A 3VR4H 3HZOA 3MYRA 3OZAA 5T67A 3DOHA 4PONA 4EF4A 1NIJA 3WK8A 3KOWA 1YR9A 4QBHA 4L8YA 4FBMA 1A7UA 3AVXA 1Y3IA 3N8DA 3R6GA 4G5QA 4H7IA 4TT3A 5D1HA 2G76A 3JALA 3WZLA 3GGJA 4XASA 3UCFA 2YV4A 3SYRA 2AN1A 1R50A 4YRQA 4O25A 2FNAA 3HNPA 1LDMA 3P9IA 2NPFA 4DY6A 4OFZA 4WT7A 3V5NA 4QPNA 2JGDA 5JZMA 4U02A 3R7SA 5CR9A 2DFPA 2E49A 4MZDA 3X3HA 5HKKD 5AVRA 4TS9A 2VHVA 1NNUA 1UJ5A 1HE3A 1VKZA 3QEAZ 1WB4A 3VI4B 3ZDYB 3T1YB 4S1NA 1Q0QA 1WDLA 4IS3A 2B9VA 2RIPA 3ROXA 4MPDA 4ON9A 4U6QA 1E9FA 3FUWA 1U2ZA 4YTEA 4YT8A 1HT1E 4B7UA 3SGLA 5THQA 1YJCA 2DF8A 5BV7A 3VRHA 1NKSA 3WKDA 5DM1A 4YJHA 3MMSA 4A73A 3FPCA 4IH4A 1YFJA 4ALJA 4OEHA 1OGIA 5A3SA 4GF5A 2BEVB 3IUEA 4Q93A 3V3TA 2OCGA 2AMFA 3KTFA 1M1NA 2HMYB 4X7BA 4BRUA 4R1TA 4E08A 3L8FA 4BOYA 3PKZA 4ZPXA 1NJGA 1U1IA 5JSYA 2JFZA 4A9AA 1M7HA 1HYEA 4FS3A 1G38A 3GFRA 3ZE7A 3CF4G 4KQHA 1NY5A 4LSWA 3CUSA 3QWFA 1QH1A 5JDCC 4OMUA 3M49A 4B35A 5MN6A 3UG7A 1UQTA 2REXB 5I9SA 3LYAA 4F9EA 1IN1A 1E3WA 1O95C 2B99A 3NH9A 4H7FA 3OTGA 1E9CA 4DNPA 4PSCA 1U0NA 3GJ8A 3WBBA 2WAYA 1Z47A 2R7KA 1ZRNA 4IXDA 3K1JA 3NAGA 3PNQA 4IJVA 3ZU2A 1XRJA 2IV2X 3LUGA 4AJKA 5JMOA 2QL5A 3EMKA 3NASA 5CD1A 3OEWA 1EA5A 4ZVPA 5I7UA 1B16A 3PGKA 2PRJA 2AZXA 3SKYA 1DJMA 2YFQA 4L4SA 1ORVA 4LX8A 3UB2A 2PT6A 3RSHA 4ZAXA 1ZJJA 4RNCA 3HSSA 1MBZA 2QQFA 5DXJA 1KJQA 4ZALA 2ANCA 4Q05A 5BT9A 4OI4A 1O77A 2HY7A 4MWCA 1I4EB 4XIYA 3VO2A 3N2ZB 1ZM9A 1CVLA 4PRYA 3V8NA 5JYDA 3CIFA 4XEHA 1JQ3A 3ZY4A 4TT3D 1OXUA 1XAHA 2RGCA 5JCXA 1FS6A 3OJEA 3GRCA 4IHKA 5AW9A 2HA5A 1QIJA 1N2EA 3GLHA 1ZLXA 5DM2A 4GM4A 5AW8A 2DOKA 2WWRA 5K4GA 1SC1A 3NEYA 1QKIA 2PJUA 4JUCA 4LTDA 1NGSA 2GETA 4INPA 1G8FA 4IM7A 4YO7A 1BN7A 3KAKA 4UJ3A 4LUCA 4C43A 5BV0A 3INNA 2Q1UA 4LXQA 1G5PA 3KJQA 4OJMX 1N9ZA 1M1YE 2FK7A 1E4EB 4IINA 4PANA 2W71A 3SR3A 4EQZA 5L4SA 3O4HA 5HNKA 3A1UA 1TAQA 3HM2A 3ZU3A 5AUOB 2BISA 3KEGA 4GPTA 1NX6A 1U8YA 5D85A 2PQMA 5GVSA 1USIA 3TZBA 1CX9B 1QGUB 3OFNA 3TM5A 5IT4A 2G7ZA 5H8WA 1BQ4A 4JUFA 4ZTBA 3RVBA 3DR3A 2YWFA 4UHBA 3MAAC 3WRWA 1N1DA 4PC7A 3K70D 4B84A 1H69A 2ZZMA 3KDAA 2QZJA 5IARA 4YR9A 1IZ9A 1PWEA 4G5RA 1P5RA 3GJ5A 3B1FA 1XTPA 2WIJA 3CNOA 3PGA1 4FR2A 4U7PB 2WOJA 1VSBA 3ZH9B 3JTMA 4PHHA 4NZMA 3V1LA 3ZPXA 2AGVA 1RJ9B 4AXBA 1GP2A 4JJIA 5B1DA 5LA6A 1ZVVA 2O8NA 5H70A 3MG9A 1V7CA 3OJLA 1L6RA 5L3QA 1I5RA 2XUKA 3HBFA 1OAOC 4MA5A 1AXGA 3HRIA 3ZH2A 2VF2A 3GLFB 3CT4A 4GPIB 1PZGA 1XZQA 3EB9A 3OJXA 1M2VA 3DZKA 4GW3A 6YASA 1ENZA 4MKZA 1E3MA 1QHIA 3UB4A 5HF9A 2A1UA 2FW8A 3OX1A 2P1ZA 1JSRA 1EHIA 3G8AA 1PS8A 4YECA 3QY9A 3ZX5A 1C9YA 1XWWA 2BZ0A 4BLQA 2EXXA 1P9WA 2R9VA 2J48A 3PWZA 5B58T 4IJWA 3I2GA 2YW2A 1EUCA 3MQ2A 3I01M 1XDGA 4M86A 1NP3A 5DSTA 2ECPA 1UANA 3EIFA 4X71A 3ZJ5A 4A0GA 4MP8A 1KOFA 3ZCPA 1YVUA 2ZKIA 4W5WA 4Y9SA 2QGZA 1NXOA 3QUCA 3K1YA 4JYBA 2POQX 3JD1A 5K0CA 1G5FA 1QYIA 3NBZC 3S8YA 3LM8A 4EQ6A 4Z4EA 2ATCA 4XM2A 3O7MA 1N6KA 4IIJB 1D5WA 5AUQA 3T1NA 1OILA 1TQ2A 3VC2A 5CXQA 5E7IA 5G2OA 4J90A 3UBTA 2JFNA 2WJZB 3GNLA 3HU3A 1CVRA 3FMFA 3IGFA 4GBED 2ZR9A 3D8TA 2H1RA 4XM0A 5FPHA 1D2NA 3RS3A 4DC1A 1WUKS 1KO8A 2H00A 5BR1A 1DC4A 4PBRA 4Z54A 2QJRA 2FGJA 3WBFA 1KI7A 5KPJA 4TLMB 2OM2A 1E2QA 4DCVA 2Y71A 2ZIXA 4YJ2F 1J9EA 3CKLA 4CM8B 2NXJA 1F4VA 3TQCA 1RJFA 4TROA 1JH8A 4OM8A 1X14A 4HLCA 5EYPB 4GLFA 3T6KA 1UM8A 3RYIB 4N0MA 1W88A 2B25A 2CE7A 1BCSB 1BXRB 1JKIA 1F2TA 2EJUA 5IUJC 2XUGA 1XAJA 2GDZA 2XQIA 3O2QB 4W8GA 3G8DA 5CCXA 4H3SA 3C3BA 3M6XA 1HWYA 3U9SA 4UOZA 4HS4A 2H1HA 3K35A 1BVUA 3WGIA 4R83A 1BAPA 1O5IA 1WV0A 2P78A 5T4BA 4LJLA 3HQ4O 2JGKA 1ODTC 1EGAA 5J5AA 1KJWA 3CRW1 4N3CA 421PA 2IEBA 1YS9A 2ANBA 3H7AA 4C30A 3RB8A 4ZMBA 1R3UA 3V9AA 3SSNA 3WK4A 4TS4A 4XFJA 2H51A 3SFZA 2AOUB 3FGNA 3PVSA 5E2IA 2XYHA 1RQPA 3EZFA 1CQIA 4AY4A 1F0NA 2AVNA 2H4ZA 1ULBA 4Y0VA 1YUNA 3X1JA 1LBIA 4TTIA 1FQWA 5KQRA 5FPPA 3UOWA 4HUTA 4L9AA 1CQJB 1DNPA 4XVHA 3CIOA 1RDFA 4BMSA 1P0CA 3LHDA 4NOMA 1N8SA 2BT4A 2C42A 3GO4A 3L6EA 3ZOZA 3QMMA 5KDOA 4WERA 4RD1A 4ECAA 2A9QA 1MFZA 3PEYA 3A2NA 2Z3VA 4NG5A 4FGLA 3MD0A 3GQVA 5I48A 4O02B 4PLYA 4ZCPA 3FTQA 4AG5A 1JPJA 2JIZA 2PR2A 3GGCA 4S0ZA 4KTTE 5CYFA 5CVVA 4PFKA 4NBRA 3HPRA 1HQKA 4N3GA 1W6RA 1EXWA 2ZRDA 2HHHB 3BK1A 2FN8A 3SHTA 2B37A 2I2CA 3WK5A 1JYFA 2OUIA 3GJ6A 2O20A 1GTZA 4M1ZA 5GWXA 1H9CA 3M5CA 2Q4OA 3KKNA 4JGGA 3K09C 1HT3A 1ZHHA 2ACVA 2E4ZA 2NZ8A 1EFPB 3ZY5A 4HLNA 4KI7A 3KQTA 2WYWA 4CKEB 5KREA 3GEPA 1T9CA 4AQ7A 3RHSA 2H54A 4K6CA 3U4DA 3A28A 4UM9D 4ZGGA 1I2BA 4OX9Y 2NSHA 4EOGA 3LX4A 3KB1A 1DKUA 1NOJA 3DCYA 2PE5A 3WGHA 1DI0A 2J0VA 3UVEA 2MOKA 2CDRA 2G07A 4UQLA 3G13A 4FB5A 3OC0A 1WVMA 1K66A 2VPIA 4HT3B 3K0CC 5CB4A 1S01A 3QNMA 3EIEA 1PYDA 4IMRA 1J2JA 2ZIUB 2PPLA 3KALA 4MMZB 4F8JA 3WMWA 3R2JA 1YNSA 1JAXA 3M9WA 3ASVA 2YIMA 4C01A 3U09A 2HWWA 5CFRA 3W06A 3E27A 3M1IA 1M67A 3G5MA 3TI7A 1KQFA 4KXUA 2JHPA 3GXBA 3ZGNA 1XWIA 4X3OA 4HYYA 5JD3A 4BHTA 3UPDA 3AT1A 1EJ6A 3OC6A 2R4QA 3EPPA 1MT0A 1LC0A 3OMWA 1BDHA 2JAOA 1E3EA 1O58A 2H7XA 2R1ZA 5EE5B 2VJDA 1OZHA 2ZJYA 1V95A 4V38A 3OE1A 4BV2A 5BW5A 4FFDA 2OMEA 4B6RA 2B61A 4MUYA 1OKKD 1NYRA 3COZA 1PJLA 4GI1A 2C3OA 1DB3A 5B7PA 5E95A 5TE9A 1M76A 5EMMA 2CNLA 2HBQA 2AQHA 4KAXA 3A11A 2BC9A 1PFKA 3MHPA 2R97A 2HSGA 3QOXA 3PYMA 1Q22A 4OYHA 3I9V6 2X9VA 4TMZA 4ZA2A 4ZV7A 2YW9A 3ETCA 4IX9A 2JIZD 1YVPA 2X4LA 1HDGO 3NDRA 1LS1A 1WULS 2Y66A 2HNKA 5CMLA 4C1BA 2X15A 3HH8A 3WLJA 5BYKA 1STOA 2SKDA 4RDCA 3ICEA 2PGJA 3SVZA 2XMGA 3K1AB 5DBIA 2XTJA 2P68A 5C32A 5HCIA 2OILA 4R9RA 2UYHA 2XI4A 1MW9X 1SVLA 3ZWQA 2Z3ZA 1SGWA 2EFYA 4RK5A 1E2UA 4RIFA 4YALA 3AFIA 1V11A 2XVYA 1E7SA 1CZHA 2OHHA 4RK6A 4ZO7A 2HN9A 3QKIA 1N32B 1WSDA 4Y1EA 3LA6A 5DCLA 1SD2A 2ZIAA 4MDEA 2XGSA 3E7FA 4EA8A 3H5NA 4W5JA 1WQ1R 3C3DA 2XD4A 2VEOA 3L7YA 2YJ6A 4ODIA 4TLBA 4AUKA 5KJ1A 4B09A 1W2GA 4I7EA 3WLSA 5LU9A 3GK3A 1GDTA 2FKAA 1AHPA 3GARA 3UHOA 4JC4A 4PO1A 2V7VA 4QPDA 3TL2A 4WXMA 1LZLA 4BUJA 4UMEA 3U1VA 2EU8A 5E0OA 2OBLA 3FRHA 2TMDA 1OLUB 2Q27A 1AK9A 2OCXA 2VP5A 4IV0A 4MA0A 4ND2A 3N2LA 3ZS8A 1UMDB 4X66B 1CP3A 2ID8A 5BQOA 3J81k 2QTAA 5HR5A 4EDHA 3T34A 5ER9A 1IWBB 2WJIA 4RETA 5DP1A 5D5PA 4F7DA 4JOBA 5JUWA 1O87A 1FUEA 1H2FA 2K87A 1DEOA 3LSYA 1LF0A 2PX8A 4GL2A 2IYQA 3FB4A 1XRRA 3LCUA 4K1LA 2Y27A 1EFKA 4I1SA 1NF2A 1ZL0A 4BVBA 3T12A 5H3LA 3FGOA 1A9TA 3LG2A 4KUEA 1AE1A 1N92A 3ESDA 5JR3A 2P6PA 3N0WA 1GN8A 2JH3A 2C9YA 4DIFA 4Z6KA 1NDQA 3W04A 4A1FA 1RPNA 2QMQA 4MCHA 3P9SA 2FG5A 4K40A 1D6JA 1QZZA 1A9SA 1ZGCA 3C24A 3WP0A 1MN6A 3IV9A 2QBYA 3WXBA 3DE2X 1JG4A 3LKDA 4OJNA 4IJUA 4ROSA 4BWGA 1RJDA 2UYQA 3JQ9A 1EP9A 1SOMA 1UR5A 4F45A 1YK0A 3LDFA 3X2SA 2CFSA 1LPAB 1PFWA 3EBPA 1PJTA 1T3LA 5FOUA 1SXPA 2E0IA 3FPBA 1R1DA 2WMYA 5B6JA 1H9AA 1SHZA 2ORYA 3KJZA 4HH3C 4KP7A 4XR9A 2LZ0A 2F9FA 3E4CA 3JPWA 3QU2A 5E9QA 3FDFA 2VLBA 2B82A 5COQA 3T4PA 3JWPA 2QLLA 3T7KA 4KFCA 1YS6A 2FPIA 4ARCA 2R6AA 2ZTLA 3LBAA 1L9XA 3BD9A 1KH2A 1PV1A 3CO5A 2HQBA 1VE1A 2WE8A 1S9DA 2HK7A 3I6BA 1KMHB 4ZEWA 3RF7A 1TX4B 4R51A 4XFKA 2Y4OA 3BS4A 5A3VA 5LP1A 4OHUA 4X8MA 3QXHA 3E3OA 2HKIA 2Q6TA 3FDIA 5BN5A 5F98A 3U3OA 5FFFA 4D0NA 4RVCA 4TWJA 4YXWA 5BYAA 7MHTA 4WCDA 4F2DA 3OQNA 3SN6A 1Q1AA 5BSEA 4CEIB 2FRDC 4RTNA 2O5CA 3BE5A 3PE6A 4H2DA 4PRZA 5C1IA 2MU1A 1USVA 3I8OA 3AR8A 4UW9A 4FOSA 2AZTA 1VBKA 1X0VA 4DUGA 1UK8A 1Y5MA 3R9KA 1DTWB 1EWVA 4HGQA 4D2IA 2UZ1B 2ZRJA 4EF6A 1OZ0A 1RCFA 4QUJA 5HK8A 4RKFA 3Q72A 2PUFA 3EC2A 2AHRA 3TNLA 1XZKA 4I5IA 5E4FA 3INYA 6REQB 2GN9A 5KWVA 3HBMA 3O03A 4NG4A 4B48A 1UBTS 2GK3A 3FFXA 4L5IA 5EQJB 3FPHA 4BLRA 4WVFA 2NWQA 1JI3A 2X7JA 3GW8A 5FNVA 4H3VA 5GINE 4U5QA 1C7IA 4HN9A 4AJ1A 4N7MA 2ZYGA 4AKIA 1HDZA 1XTTA 1KZ1A 1WMSA 1K4MA 2CXHA 2QRZA 2RG1A 2YHSA 1CUIA 3GD5A 5M7EA 1ZO8A 4CMCA 4NYIR 3P9XA 1GLGA 4Y2RA 4BRZA 1AHIA 1OY1A 3FKJA 4BKQA 2YNMA 3CVYA 1E1NA 3KYDA 4A2WA 1OXMA 2GVNA 2ZPUA 3O9MA 2GASA 3ELWA 3LQFA 1FA9A 5BSFA 4DJEC 5CA1A 4A8TA 3JWHA 2PT9A 2KBEA 3MRVA 3B85A 3RC1A 1LZKA 1RYEA 3E61A 3BERA 3HI4A 1G66A 4R5HA 3SQXA 1MEOA 2P6OA 4PX5A 1TDJA 1X7DA 1YFKA 4X60A 5FWNA 2V4UA 3A0UA 5E6UB 1R37A 4F85A 3KDPA 1YCFA 4K9KA 4FNOA 1BMFA 1UPBA 4I50B 2ZI7A 4BECA 1LS6A 2YIJA 3A1DA 1CPYA 1KE1A 1ZL2A 3LU1A 4I2VA 3WGMA 4UU8A 4KO3S 2I33A 3DFMA 4G4JA 4YRIA 4KJZA 4Q39A 1MX1A 1P4GA 2Q6LA 3D6AA 2EWMA 3PQCA 3UZUA 4EMUA 3U3XA 2H1LA 4YRMA 4V1CB 3UM9A 2WLSA 3VJKA 4DQDA 4MV8A 1W7AA 2AKYA 2GN6A 1CQWA 1PZEA 1ID8A 2PU7A 2C97A 3QFHA 3M4YA 1CT9A 4OLHA 1NJ8A 2X8JB 1RWMA 5ESXA 1FYFA 2ONJA 2VP2A 3RYCB 2WSYB 4FFSA 4YXWD 2FG6C 4PVCA 2P4SA 3THYA 1NR7A 3G79A 3WLTA 1PK7A 4CIDA 1EM6A 4S12A 4MVJH 1JB9A 4MUAA 3I42A 3R3YA 1Z15A 2V7PA 4AUEA 2Q0QA 5IU6A 3HA3A 1RWWA 4P5DA 1DVRA 2C1EA 2VYCA 4BDSA 1NRIA 3BG5A 3H2SA 1IAQA 2B94A 2I2BA 4HX9A 4JMLA 4M1SA 4PFQA 5DXFA 4EENA 5BNZA 3B7GA 4GMHA 4DM7A 4ESVA 3DOCA 2HX1A 2LVBA 2AWNA 3AOEC 2IXFA 2NYAA 2EFDB 1P8AA 5IM5A 2HO5A 4DMRA 3MILA 1M1YA 3BMQB 1K9SA 5KMGA 2IPNA 1EUDB 1K8RA 2GLUA 3DDUA 4RESA 2HV8A 3Q3GE 1WW2A 4ZVOA 2OPBA 3GVIA 3SS7X 1YU6A 4JJFA 1NJ6A 3QBTA 1KY4A 4UNPA 4Y6LA 5EGNA 3SEZA 3ZKAA 4C88A 1VXRA 4TTPA 1Z5ZA 4GOKA 2PSEA 1YSCA 5I9NA 1UBRS 2X0KA 3HPQA 1PNOA 1OXSC 1F12A 1QAMA 3AVQA 3U26A 3UK7A 4WE3A 2BH9A 4X8HA 3IQXA 4DLKA 5K6TA 4TS1A 2O05A 1KMCA 3K6SA 2O1SA 3C5CA 1E5VA 2C96A 1YVDA 2RGXA 4M87A 2MSCB 2SICE 3TIVA 1F48A 1UBSB 4ZAYA 3C3JA 3BFKA 3F90A 3K9BA 2FSGA 5B7QA 2G0AA 5BURA 5ITZB 1L5HA 1ZX1A 3N0RA 4J4BA 3FDJA 4L6AA 4UDOA 4NMWA 1SVMA 3TSZA 1UPUA 1BU5A 3GPDG 5JMPA 4KXMA 4N7BA 2YQZA 4XYEA 3TTTA 3VR3D 4A8JA 1FS4A 1W1WA 3PDHA 5EHIA 2F55A 2PD4A 2X40A 2VP6A 3GN2A 1YRBA 4Q48A 4AI6A 3BKXA 4C7KA 2YVLA 3CUEF 4KI0A 2AOTA 5F1OA 2B4YA 1QHXA 2ZI4A 2ZROA 3RS9A 2NUTA 3WLNA 4DCOA 2JFWA 2APJA 4PQFA 5GM2A 2VWQA 5TY0A 1JH9A 2W6OA 4RJKA 4A91A 3ZTWA 2ZITA 4B3JA 1U2DC 4UXJA 3O83A 4JI7B 1II0A 3BZBA 1T29A 2WNSA 3EZGA 3L46A 1IPEA 1NV8A 3Q9UA 3TTSA 1HYGA 2BFAA 2VDLB 1K1EA 3CNLA 4X0EA 3R6WA 5LKRA 1Q0TA 3F8SA 1Z5UA 2Q0SA 3DEZA 3FBWA 3ORFA 1ODKA 1UUFA 3GEEA 4I1VA 3VOBA 3WJ1A 4CLRB 3B3FA 4OVKA 3FROA 3H5RA 2XTAA 3AI2A 3KHUA 4FI3F 5DNVA 3ZW7A 1GGKA 2WFMA 1X80A 4W9NA 1Z4LA 2ZBEA 3ZWDA 4CCYB 2Q62A 4MDFA 4PM4A 2JLBA 2VH2A 3IJPA 2B35A 1Q57A 1LDNA 2AN4A 3HWSA 1GL6A 1SC6A 2G0NA 3KHTA 3LYUA 3ND7A 2ZRQA 3FVRA 3LUJA 2OPHA 2P9TA 5LM3A 1L9KA 3OP1A 2DBVO 3I0MA 1EZ4A 2CXUA 1T2VA 1UADA 2G5GX 4LDPA 3WJAA 2XA9A 4OM7A 1W581 4Q3DA 3VU0A 2AD5A 2FR1A 4KVFA 5HHTA 2QLMA 3EJ6A 3NDPA 3PFHA 3FE2A 5ULLA 4RIHA 1OWOA 3TINA 1CIVA 1JS1X 2HQOA 1B2LA 4MVYA 3BE8A 4XLZA 2G70A 1HTWA 2P9FA 2QI9F 2HU8A 4YAWA 4JJ7A 1D5CA 2WNIA 3MTJA 5EWJB 4ACBA 5KU1A 3AI7A 4J3NA 2NPIA 1P1RA 5GGYA 1LY1A 5JVDB 1A9ZA 3QOFA 2ET6A 4NK5A 1J49A 5HFNA 1GLNA 2OXTA 5K3DA 4LGMA 1UBUS 3GNQA 1G2PA 3KZXA 4OXKA 4HXYA 4WK2B 2XX3A 2QTWB 2C5GA 1HETA 4RZIA 5ECGC 1MUUA 4DGQA 1T5SA 1MJGM 4LXUA 3AR3A 3G9UA 2CB9A 3HXLA 3ZVMA 2V7WA 3DZJA 2LGJA 4TTSA 3A31A 5C8YA 2DHQA 4RHXA 3AEUA 1JIXA 2H6EA 4F21A 3NUQA 4JA0A 1BS1A 3ZVKA 2VF4X 2FX2A 2Z4SA 3VR6D 2Z8ZA 3QPAA 4QU8A 2WRZA 5FUXA 4BNDA 1V9LA 5BMVB 3TE7A 5DM70 2CC2A 3DFZA 1E63A 3EXEB 3HXOA 3LCRA 4G0ZA 2ZYSA 2QUZA 2B8EA 1GU1A 1Q1EA 3IKMB 5IJWA 1OB2A 3COPA 3AXSA 1M2NA 1NHGA 1UODA 2VHYA 4FLMA 2FVYA 2WB4A 3NIGB 2V9ZA 3DZGA 3U1TA 1BKDR 1L8XA 5LIRA 1UC8A 2AUMA 1NW9B 3IAM6 3QU5A 3QVKA 1USKA 4IRUB 4AL4A 4CUZA 3WY9A 1ZM2A 3M6MD 4TUYA 3KYIB 4UMVA 1J0EA 4A7PA 2H2WA 2OG2A 2V1XA 3BMCB 4TV8F 4D4LA 3KQLA 1Y7IA 3Q1LA 1Y37A 3C7AA 3O1IC 3QUBA 4QLAA 1HDYA 1S8FA 1OWNA 5FEMA 2IHNA 4UFPA 3R23A 3RRJA 1XJ0A 1IEQA 2R68A 3EXHC 4FFVA 3WRXA 4CKYA 3A4TA 3NQ41 5FBHA 1OA0A 3LPCA 1ZP6A 4OO3A 5LKAA 1IDN1 2GFHA 3L9WA 3TRHA 3IEUA 1FMTA 4XYMA 3ZIUA 3AUYA 3GZTB 4MS4B 1LDYA 3MTDA 3OQMA 1JIJA 3DEAA 4E2WA 1J4AA 4R16A 3MLEA 5C80A 1FB5A 2WWGA 2D1TA 2D2EA 2ZPAA 1DC5A 2YICA 1XA3A 3HFGA 4GWKA 2G82A 4J03A 1ZJYA 2EAUA 3A14A 3CF4A 3DBRA 3MJFA 4JLSA 4KHZA 4YNBA 1EVKA 1M2FA 2VDMB 2QTVB 3IC5A 2ZETA 3N05A 1GGHA 2E55A 4RANA 3RC7A 3NYQA 5E6RA 5I7VA 5IKMA 5L6LB 4TZ6A 4WLVA 4AN4A 3C1TA 1KQPA 1SBHA 3PC2A 4GZLA 2QU7A 1HE2A 4IXWA 3KKZA 4O4HB 4ITVA 4FFLA 4P4SA 4ZRDA 1VP9A 2IPMA 2PLRA 2QY9A 5K3FA 5HK9A 1L3IA 4OQQA 1EYZA 3DYIA 5F35A 1WB9A 2CNDA 1SZDA 2YZNA 2GD0A 2YYSA 3B89A 4R0MA 3B78A 3D5QA 1N5DA 3HCWA 3KLBA 4RD4A 3L7CA 3FTFA 3R9WA 3EQZA 1E2HA 3AJRA 4QTTB 1C9MA 5HMLA 2JFXA 2YY7A 2JS7A 1X9IA 5AVKA 3TRKA 3PNMA 4AW9A 3EVBA 3L02A 1QU2A 4D81A 4HGOA 4I5GA 4HUJA 2WJHA 3PPIA 4IIGA 3T3OA 2I4LA 2CYBA 3DDOA 4BMXA 3DF7A 4YAJA 2CW5A 4U7DA 1I1NA 3GLIB 4DLRA 4IOMA 3AW9A 2BUBA 3R3VA 4D6XA 5EJGA 1PUIA 3AL3A 3CLTC 3GRVA 1QCDA 3GMIA 3I73A 5F9FA 3MS2A 1W8IA 1KBOA 3AFGA 3CR8A 2EBFX 4QNNA 1NE2A 4Z86A 1K7SN 1X8XA 4JSYA 1FNBA 1NC1A 3PJRA 4F91B 3DQPA 4DA0A 2QGNA 4BFUA 5KOJA 3FA2A 4JLKA 2VCYA 2ZULA 4V24A 1EK6A 3HUEA 3RSZA 3W9UA 3K4QA 1Z0UA 3EVZA 1KEPA 2PL9A 2PRZA 1IONA 4GQIA 5DFAA 2PA0A 2QQ0A 2IH4A 1HF3A 2ON6A 2VSYA 3BWEA 4ZO4A 4E30A 1HYHA 3TIGA 3NI2A 2Y1CA 1S7GA 1DWOA 1VJ0A 4GZ6A 2WZBA 4M98A 4RSGA 4CEJB 3DR5A 3I01A 1UEIA 1EWQA 3O2JA 3DTYA 3K8QA 1HC7A 1NHWA 1YDWA 2IDKA 2MSKA 3U62A 4EJMA 1RIFA 4WDQA 2OZVA 3GFFA 5DBEX 4RZSA 1N25A 2ZM6B 3A2KA 1TVCA 4UTVA 1ZD5A 1ZM7A 2AK2A 1TRHA 3E15A 3H9CA 3PXEA 4FT4A 4Z53A 1Y98A 5TSDA 2P9YA 4NBTA 4U0KA 3C8ZA 2Q41A 1J07A 5T8KC 2FUCA 5ERYA 2NVUA 3CJTA 4R1NA 3V1TC 1V7QA 3AVUA 3T3GA 4HSGA 2O7NA 4JJAA 4URYR 4YP0A 5CX1B 2C5EA 4AAYA 1NC3A 3OO1A 4CG0A 5KTKA 5AHKA 3ZDXB 1UFVA 2IUYA 2CV1A 5AI9A 1P45A 2DCMA 1NRJB 2DM6A 4U7GA 2ORIA 3WXMA 1FBNA 1RJWA 3M5DA 2BIFA 2I7TA 5DN9A 1PK8A 1FIUA 5JY6A 4PC2A 4A2CA 2C0PA 5DGDA 2C03A 5E3HA 3LT4A 4M46A 2Y1DA 2FPMA 2A0UA 2KS6A 3GLRA 3ZBPA 2D74A 3TLMA 5IFLA 1JEAA 3AMVA 1VLLA 4RKQA 4FILA 5CXSA 3FPJA 4KDRA 4KWTA 4DRXA 4A1OA 3CVJA 5CFMA 3U6KA 3GA5A 2W6NA 5NLLA 4L08A 5D3KA 1FF9A 1SR8A 1W6UA 4D82A 5AH0A 3HLTA 3X1MA 1ECBA 3SF0A 3NHJA 3KKEA 1CLUA 1I3NA 3T7EA 1ONPA 3CR7A 3WKAA 1H5QA 3KKQA 2VFAA 5BSGA 2ZWPA 5C7IO 1T43A 3QYAA 4DMKA 4HTAA 1X3LA 2WZDA 4TL8A 5EUBA 4D3DA 2YV1A 4MV4A 2VRNA 1NOKA 3V4ZA 4B9AA 4DLBA 2V6JA 3VR2D 1VL1A 2F1IA 2CGEA 1T8YA 1N77A 4Z4IA 3ZNQA 1JZSA 4C89A 3KV1A 1GYPA 2PL5A 3BXGA 1SUCA 5FI0B 3U5ZB 1TEHA 1NBAA 3UBMA 1T6BY 1ZCAA 2BI4A 1M5UA 1H2XA 3OPYI 4R2IA 4U4AA 3AOGA 1M72A 4IYRA 5DSZA 1T2NA 4AJ4A 4DCCA 2UXCB 2V0CA 1O3YA 2I2XB 3MRSA 2GSWA 1ZITA 3PQ2A 2FG7C 3KQHA 4UUAA 3U39A 5ADWA 2RH5A 2FPKA 1N7JA 3DVAA 1VG8A 4YAGA 1UJMA 3ICWA 5TPZD 3RIMA 1J22A 2RGNC 4FW9A 3MLAA 4TL7A 3RK4A 4LMAA 4POOA 1BWSA 4JD5A 1ZY2A 2JD0A 1OIXA 4K7JA 3UGTA 1H4TA 4CTMA 3NV9A 1SJ9A 3Q0TA 4MGEA 4DSOA 1LK7A 2NO6A 1I7DA 2ZI5A 3OZSA 4X92A 1BDIA 2CBGA 2H1SA 1L5NA 3P19A 4PZYA 5HRUA 3OM8A 4FDUA 2OGUA 4HEA1 1FDWA 1MH1A 1NMXA 2X8WA 2AS0A 4JLDA 5J2UB 3DCIA 3PEEA 1PGNA 4PXAA 2YIVX 1LBEA 3ECSA 4COOA 1JKJA 1R4NA 3OF2A 3SXJA 1FRVA 3NWPA 3GRUA 1P19A 3H9GA 3Q0EA 2WU0A 4IH1A 4LY6A 4XQEA 4IDBA 1IN5A 3Q9LA 3FTPA 4TLCA 4TVKA 5IVKA 1ZNXA 2QPTA 3PYXA 4FYXA 1PL0A 4JEUA 1P2BA 4L73A 3OECA 4HDMB 3NBUA 4B3GA 3L1HA 4BS9A 3P0IA 3KTDA 3ZLVA 1ZIOA 3LUHA 2IUFA 3VV2A 1QC5B 2D00A 3D8BA 4UZFA 4PYQA 3IEVA 3CB4A 3I3SR 1VE3A 1P7PA 4CR8A 2WU1A 1BX3A 5JXGA 1TJYA 1M83A 4NHEA 5JROA 5MDHA 4HQLA 4Z51A 4HMPA 5FV7A 2B4RO 1JR4A 3GHHA 1OFTA 1X1BA 2YUIA 1MD9A 3MA0A 3QRWA 1EJBA 3CF0A 3HA2A 3Q7QA 5DWQA 3S8EA 4RK1A 1AKWA 2EIHA 2D0DA 2UZIR 3G8BA 3GFGA 3KBBA 5CLGA 1RZRD 2P91A 4BGUA 2BGJA 4L6IA 5ARBA 1J2UA 2FH5B 1J8MF 5FAXA 4BQSA 2JLSA 3CM0A 1FFCA 5G0SA 2QRVA 5JATA 4PLZA 3AONB 1J5EB 2XNKA 5JYCA 4M8SA 1RC0A 1YQGA 3AZQA 2JJ1A 3NTXA 4YMWA 2GNAA 1A27A 1XTVA 4KRXA 3RJMA 4MB6A 4BEBA 4ZXPA 1WXEA 3EBOA 4PSKA 4YI3A 2GXUA 1XA0A 1QQBA 4B5LA 2I2AA 4YJHB 5HDBB 1DUIA 1F6BA 3DKRA 2OR3A 4J0DA 4LPSA 3CNHA 3JQCA 3D54D 4EARA 1LQ2A 5KJFA 1UKZA 2HDHA 2IA5A 1AM4D 1DJQA 3HADA 3TBKA 4AJJA 3A4LA 3QF4A 4F92B 1YZFA 2NZUG 3GWZA 1E69A 2FEMA 3C15C 1U1GA 4NEHB 4TSKA 5TMBA 3UJ7A 1TW3A 1V8PA 1G41A 3EUAA 4JYMA 2B4QA 3VH1A 5KTRA 3IO5A 1NW5A 1ZGBA 3V4VB 2CVHA 4PHCA 2XB2A 4PG7A 4L5BA 4BGDA 1QH1B 1NBME 3C14C 1R0BA 1KI4A 2R8RA 2WAXA 3A36A 1NMSA 5AJWA 1M2JA 3VGJA 1E3WB 2X0FA 1GCUA 1C4XA 4RDIA 5J40A 1TB4A 4DCGA 4BVHA 3K96A 1N5OX 4BVAA 5F73A 2NU6A 2WIBA 1XHFA 2VCHA 1M33A 1O6ZA 2R5WA 5CGQB 2EJTA 3QPDA 3VZQA 5KNLA 4M37A 3R40A 2GO1A 4RK0A 3FBTA 1OWMA 5A7HA 3QJ5A 4KR7A 1DU4A 3U7GA 4MVJF 4KUGA 1QB8A 2GESA 4O63O 1B93A 4MINA 4E1BA 3O0TA 1GPLA 3G7SA 4Q9AA 1EFVA 3MAJA 2AXEA 4U3JA 1FYDA 5DIFA 4F6CA 3VR5H 1SM4A 1IY2A 1FP6A 2XYGA 2Y1LA 3FOBA 3GZJA 3PR2B 1D0VA 4ZVMA 3Q3EA 5LN1A 3L82B 1OCEA 4I6JA 1US8A 2XAUA 1Y3FE 3A06A 4UU7A 3NS7A 1W4AA 4KBFA 2QEQA 1OW3B 2O14A 3SHWA 3G0DA 3J7AC 1P4SA 4KDFA 1SRRA 3M89A 5DF1A 3OUTA 4I4CA 1MAHA 1PFUA 3EVAA 2VAMA 2VTDA 3QBDA 5DISB 3WLEA 4C4XA 5JBIA 2CUZA 4DANA 3B70A 2H3HA 2Q49A 2QV7A 1TA0A 2OYSA 1GQ2A 1DBVO 1AUOA 1QWOA 3ROTA 3IPXA 3CEJA 4JLWA 3R0IA 3IB6A 4BL5A 5GIPE 1E1QA 1LW6E 1U4OA 4J0CA 3RSQA 2P67A 3GT0A 4ZOEA 4N39A 3UAWA 1C1HA 1SB9A 3HVIA 4YMUA 1Q1ZA 3NBKA 1B1AA 1TAHA 3G8YA 3F8WA