3GJ6A

Crystal structure of human rangdp-nup153znf1 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 62
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj6A00
1ZNYA 3IQXA 4IEIA 1Z2CA 3VTKA 4B3DA 4XSHA 4YMUA 1TQ4A 2ORVA 3SJAA 2NZ8A 2FDCA 2J41A 4UNNA 4C4PA 5HPYB 2AHOA 1Q1BA 2KI5A 2NIPA 1YZQA 3LA6A 5J40A 4AK9A 3U5ZB 1XPOA 1C4OA 2IYUA 2CNWA 5LDDC 3IHLA 4Z1MA 2O0KA 5J4LA 2ANBA 4N0EA 2ZSAA 2DWQA 3LW8A 1QF9A 1DE0A 3BC1A 1LY1A 3IIMA 3QUSA 4YC7A 1W44A 3DMDA 5FL7A 3RS3A 1KHTA 2RGDA 2IEYA 1XEXB 2YHSA 4GPTA 4QJ5A 5FOXA 4M9QA 1E96A 3V4FA 2Z4RA 3GLIB 4BRWA 1E4VA 4L15A 4JMPA 421PA 4Z8XA 4GRAA 3FFAA 2QA5A 2MSCB 521PA 2BJWA 3UWKA 4QGAA 2R44A 1AQUA 4GZMA 4WIAA 4DLWA 4PAMA 2UZIR 3B1ZA 2VHJA 4CW7A 2D2EA 5ANRB 3A1SA 1VTKA 3KJIA 3P4XA 4URUR 4LYFA 4PO8A 4ILEA 4U5XA 1KI6B 3CNOA 2QTFA 1XZQA 3JVUA 5EXPA 2XXAA 4RKFA 5UKDA 1G3MA 1E9FA 1KI7A 2G77B 5GADl 4ARZB 4DLVA 4I1UA 4TZ0A 3AVPA 3KL4A 3JVVA 5CITA 3I72A 4HI0E 4ZI2A 1XD2B 1SXJE 3K1JA 4B2PA 1JJ7A 4LJAA 4V0ME 1KNXA 2VP6A 1KAOA 1LTQA 2XNSA 4B76A 2GZAA 3IHWA 3LX8A 1XB2A 4GBMA 3K9NA 4AD8A 5L3SA 1Q22A 2GAAA 2CK3D 2IF2A 3P1JA 3KKNA 1J8YF 3THWA 1Q21A 1UDXA 2ZU6A 2FEOA 4PQFA 1ZIOA 1W0JD 4IOMA 4KVAA 1DAEA 2AWNA 2J5XA 2V8OA 3K0AB 3KKPA 1LF5A 4F38A 4PX9A 4PHTA 1KO8A 2P0EA 3UATA 1ZYUA 4DEYA 1OE0A 2BOVA 3OESA 1DEKA 1KI3A 1DG1G 2GZDA 3HJNA 2KBFA 2SHKA 2ZE7A 1NF3A 1TTTA 2FSIA 4XH9B 2D7DA 3RHFA 4TL6A 4LYJA 4DC9A 3ZVMA 4F93B 4HLUA 4JT4A 1G7SA 1MR3F 4OQLA 4IOKA 2BKUA 2J1LA 4OI0A 1N5JA 4Q7JB 1ZM2A 2WWHA 4IFEA 2V55B 1QHYA 1TAGA 3NEYA 2J0UA 4YMSA 2CL6X 1G8HA 2WWIA 1XTIA 1ZM4A 4H1VA 3KKQA 3RAPR 2HEIA 2ZAMA 2F55A 5KDLA 4TTQA 1S2MA 4D6PA 3WYAA 1F2UB 3FMIA 3I8XA 1T91A 2WSMA 5AJVB 4PANA 3IUYA 3CONA 2XB2A 1LS1A 3DZDA 2GILA 2BM1A 1MKYA 1DAIA 4CVNA 4HUTA 1SVWA 3QG5A 4FIDA 1UEJA 1UFQA 2V6JA 4M0LA 3K0EA 4PHGA 4ZKEA 3VMFA 821PA 1XTKA 3RYTC 5JRZA 1SVLA 1TF5A 3X2SA 2JLVA 2AFIE 2CVFA 4RZ3A 1JAHA 2GJ8A 2ZI6A 4I1SA 2ZSBA 3LX5A 1XDBA 4KBGA 4IDOA 2NOAA 1D9XA 2BDTA 1JALA 1W1WA 1YR9A 3PUZA 3A6PC 2REXB 4JJZA 2IF0A 4HAYA 4B47A 4LI0A 3VAAA 3B78A 1QHNA 2OHFA 2HUPA 1XMVA 1N6RA 4KLNA 1XPRA 5F3WB 4ERNA 5J5CA 3VNUA 1FMJA 3QBVA 3VX3A 1PJRA 2QRNA 1QVRA 2HXSA 3ZDQA 3SYNA 5FPKA 1IHUA 1G8GA 1OFHA 4TN1A 2BWJA 1HURA 1FZQA 1GP2A 4PC1A 1QVAA 1N2CE 1W4AA 2VHUA 2FA9A 3VX4A 2H7VA 3QVUA 4XVQA 2XNDD 1ZNZA 1MH1A 4PC3A 1X8LA 1NKTA 2JASA 1YZGA 1KY3A 5TV2A 3T5GA 2GK6A 3U7EB 621PA 2ZVPX 4TSFD 4AG5A 1H8HD 1YVDA 5JECA 2WMNB 1ZM3A 4B73A 3LAWA 4DIEA 2GHIA 2CMKA 3F3YA 1I4LD 4RZ2A 5JSZA 2WAYA 4JLVA 4JT2A 4EJSA 4PZLA 1XWIA 2D2FA 2G6BA 1ZIPA 2QQ0A 4JYCA 3CPHA 3BB1A 3NH6A 1GWNA 1E9EA 1TQ2A 2A3RA 1ETUA 4A82A 3NXSA 5JJKA 2ZRJA 2VP9A 4QGHA 1GNRA 3PG5A 2FH5B 1NY6A 4LZZA 1NVVQ 4KV9A 4CRWB 3TSWA 4B6EA 1KAGA 1WRBA 4C2TA 2GA8A 3PQCA 2H16A 3B5JA 5BW8A 2EFCB 5EJEA 1ZJ6A 2BCJQ 2W0SA 2JJ2A 2R62A 1AKYA 4FMCF 1D2MA 4BFUA 2ZI7A 2ODEA 4XD7D 3UANA 3WNBA 1G4UR 5FBVB 3MWLA 3EARA 2ZSEA 4LDJA 1P9NA 5CJ2A 1M7GA 1JPNA 4O3MA 2OLKA 3V00A 1R0WA 3AKEA 2C98A 2GRJA 4D26A 3EWSA 1G64A 1Z06A 3RS7A 1M2OB 3RRNA 3Q8XB 5HKKD 4HAWA 4A8JB 3AVVA 1F2TB 1ELOA 2WJGA 3PEVA 4NYMR 2BV3A 4YLGA 2VIIA 2V7QA 1W4RA 4MA4A 4TQAA 2Z0MA 4O25A 1AJEA 3JZAA 3MMPA 4ACBA 4L16A 1AGRA 1CJTC 2XITA 4A8JC 2GKSA 3B1WA 3V9PA 3GLGB 4IVPA 2QUZA 1L4UA 2ORWA 3LVQE 2B7BA 3RSLA 4PAQA 3TK1A 1PV4A 2A5GA 2ANCA 5LB2A 2O5VA 2QMHA 2WJHA 4LHVA 4D0NA 4PFSA 3EZ9A 4OQXA 5KSYA 2JCSA 3ZS8A 1II8B 1BOFA 2C9OA 3GLHB 4MITA 1W2HA 4PPNA 5FTJA 5TARA 4A0RA 4W9MC 1Q3TA 4FMCB 1VG0B 1XEXA 5CM9C 1UJ2A 3BS4A 4F7WA 3GLIA 2DCUA 1F3OA 4C9BA 1G16A 1AZTA 3TSZA 2NO9A 3LBIA 1AS3A 2ZRKA 4KLZA 1AN0A 5SZJA 2FJUA 2VP2A 4GDFA 4C2UA 1OF1A 3WRXC 1S9HA 1CULC 1IXRC 1OW3B 4HDOB 4MUBA 3ADCA 1WQ1R 4LBWA 1DARA 1KI6A 2RGEA 4B3GA 1Z0JA 2ECKA 5HKKA 3KUDA 1QHIA 2R6DA 3LO5A 4J0QA 2EWWA 4EKDA 3TBKA 1E98A 3K9GA 1YRAA 4JBYA 4ARZA 5AWFC 4UXIA 1I2DA 1W36B 1OIWA 1UKEA 1G4AE 4Q00A 1XD2A 2BKEA 4WZBE 4B48A 4BFWA 4PPFA 3A1UA 1AA9A 1IJFA 3BK7A 5JWHA 1BYIA 4XWOA 2WM9B 4F92B 3BORA 4DCTA 4C30A 4JL8A 3DOEA 5FOVA 3DMNA 2AK2A 5H1YA 3SFZA 3WYFA 1PLJA 1G3RA 1YR6A 3RABA 3OEED 4P4UA 2NO1A 1II0A 4HDCA 1AZSC 1ZUIA 1SZPA 3K0AA 3TRFA 3K70B 4DIDA 2AR7A 2FF7A 2MSEB 2QT0A 4V0NA 1P2UA 4ON9A 5DN6D 1B23P 4LJYA 5TB5A 2ZRLA 2EWVA 3WHLA 5C2JB 1O87A 1COWD 1Z0KA 4MKHA 3GLIE 3OIUA 2GBLC 2HCJB 5J47A 1M74A 1ZM7A 4OHWA 3K70C 2HJVA 4Q5IA 1KI4A 4RZUA 4DKXA 1OFIA 1W5TA 4P4SB 1XJQA 4WA7A 5LD2B 4EPVA 3M1IA 5M04A 4RD0A 4XJXA 5FR1A 3NBFA 2IX3A 2I3BA 1UPTA 4BZPA 1W46A 3KUCA 1L4YA 1NJFA 1GFIA 2ZJBA 2XZOA 1E2EA 4UNPA 5LD2C 2IWRA 3WXMA 1M7BA 2OO7A 2QP3A 3TR5A 2WICA 2ZJ5A 3QEOA 4Z8YA 3W3AA 1E0SA 4TT3D 1F2UA 5AJZA 1DAKA 2UVQA 5E95A 1P9WA 3GJXC 3CZQA 4MGYR 4F91B 3B9PA 2WWWA 1E2PA 4YXWA 3DM9B 3VHLB 2WOJA 2XAUA 2ZI4A 1CR2A 1ZU4A 4W5WA 4D2IA 5CDFA 4JL5A 1FW6A 3SJBA 2VLIA 3MRSA 2ZS8A 3X1ZA 2GEDA 2IYTA 2C78A 1VG8A 3L2OB 4URVR 5BN3A 2ZSFA 1X8KA 2HLDA 4PC2A 2ZYTX 1TQDA 4RFSB 4EIWA 3QXXA 2MMGA 1TUEA 2FX3A 1E32A 4A0GA 2IYSA 1LV7A 1L8QA 4DDTA 4D4KA 1E2GA 4KSBA 3ND9A 1LVGA 4CF7A 2A7QA 4TMXA 2O0JA 2VEDA 3BERA 4TLDA 1JECA 1KO7A 2GTPA 4HDQB 4BLPA 5J4HA 4L8GA 3UG6A 3R8FA 3ADBA 2JLQA 3ZIAA 2N42A 3M0EA 1X86B 4BLOA 4Z54A 2WTUA 1HY3A 4NDZA 4LJ7A 2IW3A 1G21E 3QKSB 1NNEA 1UBEA 1E9SA 1WXQA 1EFTA 2YJTD 4JJKA 4TWZA 1NSFA 3TMKA 2XEXA 5ELXA 4KVGA 5KSPA 1NI3A 2ZITA 3AVUA 3TW8B 4NPHA 3L0OA 4NZYA 3L82B 1A82A 1GKIA 4NU0A 3U3KA 2BMEA 2RGGA 5SZKB 3TVDA 3HYRA 3SS8A 4ZI3A 2ZYVX 1VHTA 1F6BA 1EWRA 3TUIC 1P61B 1OXSC 2P3SA 1D9ZA 3AKDA 2QBYB 2ZRIA 2VSFA 2QG6A 3D6TB 1E2QA 1HYQA 1WE2A 4H9GA 4BFYA 4BECA 2O8FB 4YQFA 1E99A 2PMKA 1JEEA 3U4QB 1VHLA 2XB4A 1PUJA 3T35A 3O8BA 4Q7KA 4P0TA 1OB5A 4OQFA 3EC2A 3GJ7A 4ZPXA 3VU9B 1KZGB 2WJJA 3Q3JB 5JCZA 3AF2A 3TGPA 3PJRA 3FKQA 4ZO4A 3OIVA 4M22A 2IS2A 3FE2A 1KKMA 2HXYA 2XJ4A 3C15C 3TSOA 3FMOB 2LWIA 5FPTA 3ONWA 5GJCA 3UG7A 1MO4A 3C14C 3ETLA 4U00A 1HQYE 5KTYA 1UF9A 3ZZUA 2C5LA 4GZLA 2V54A 3DEFA 1OHHA 2R6CA 3ZYCA 5TY0A 1DAGA 2QEQA 3THYB 2DFTA 1G5RA 3BJIC 1RW4A 1UBCA 4CT4B 3IDQA 3SQWA 1TEVA 4U02A 2ZE5A 1HEIA 4JZKA 3NG1A 1VG9B 3KFVA 1SGWA 4EPTA 3U6BA 1XD9A 3L8ZA 1C9KA 3F8TA 4M1TA 1ZC4A 2GJKA 1FTSA 2OXCA 3CH4B 1AK2A 3W34A 5AUPB 2MSDB 3K8YA 4MGZR 5KHOC 4OI2A 4FWTA 1R7RA 2J45A 2JJ1A 4TL8A 1PLKA 4A8JA 1F2TA 2V1XA 1CRPA 1CF4A 1CP2A 2O0HA 5FOWA 3AUYA 4LRWA 4N1AA 1T4GA 1DADA 3QXHA 2YNMA 3X1XA 2VBCA 5EXTA 1OPXA 3GJ6A 3U61B 4LV5B 1UAAA 4KCGA 4L4UA 5JFGA 4GL2A 2D3WA 4PO9A 3FYHA 2GEUA 5JS7A 2RGAA 3GLGA 3K0CC 3FPAA 1R10A 1C1YA 1U98A 3LLMA 4DT1B 1ZU5A 1D2NA 1GRQA 3TAUA 2O8CB 1E9AA 3P27A 4QJ3A 3MLEA 1UEIA 1HH4A 2YINC 1II8A 3GLHA 1JI0A 3N2IA 3AVWA 5DI3B 4PXAA 2E9SA 5BN4A 1ESMA 1KSFX 1SULA 4LOAA 4Q9KA 4RZXA 3GJ5A 2WPDD 4PO1A 4JVNA 1XEFA 4PTLA 3HP1A 2DY1A 4Q9LA 3NTUA 4HATA 2FGJA 4L5BA 4LX0A 2C04A 1HE8B 3W8RA 2WKQA 2EFEB 4XVUA 3X1WA 3IIJA 3KXLA 3PFIA 3SQXA 1XEWX 5CIQA 5FOSA 3GPLA 1DAMA 5JZVA 2CNWD 2N1BA 2ZYWX 3WNCA 4Z1MD 2BBSA 3FVQA 1XCGB 1LW7A 1J7KA 4BFSA 4V02A 1EK0A 2JLUA 1NKSA 4R9UC 1CR4A 1T8TA 1TF2A 3JZMA 3QF4B 5FL7D 4QXAA 3BB4A 4B3XA 3GLFB 3VR3A 1CS4C 2GETA 4D80A 5HZHA 2RHDA 1ZINA 1SVKA 1JR6A 5TMPA 2P65A 3AVYA 1U99A 3EIEA 2C96A 3B9QA 3T1VA 3A1TA 3NC1C 5EE1A 1G20E 1G7TA 2VP5A 1EESA 4RCZA 2J7PA 2CLCX 2GBLA 4DLXA 8OHMA 2G3YA 3SC3A 4MUAA 3ZJYA 4JLAA 2YKGA 1GDDA 1AS0A 4G1UC 5IDVA 5EE0A 3REFA 4LC1A 3FWYA 4PZYA 3OHMA 4UQOA 2DFKB 5BYJA 5FTMA 3QSYA 4EFMA 5DHFA 2GXUA 4IDQA 2NMVA 4KAXA 2PJRA 1IN6A 2GCPA 1FP6A 1KDTA 3MWYW 4G5SA 1IONA 2J0VA 3BRWD 2IBMA 4DLUA 1ZP6A 1TU3A 4MGIR 1OSNA 3R7WB 2NZJA 4P4SA 2XSZD 5B58C 4URXR 3HU3A 2IYZA 2C77A 4LYHA 4Q01A 4EPYA 3CRW1 3KQNA 4C0LA 1QHXA 2GVDC 2X1VA 2IEZA 3CRQA 3ZVNA 3CBQA 4G0NA 2IUUA 4JKIA 4PHHA 1A1VA 2A78A 3H1TA 4XWAA 3UPUA 4DSOA 3GEEA 3SNHA 2KWIA 1IBRA 2RGXA 3QQ5A 1YRBA 2WJVA 2JLYA 4V0OA 4M4SA 2Q9AA 2VSXA 5EQTA 1DELA 3D7MA 3NDPA 3VR5A 2BBTA 3SI7A 3AGQA 4JIMA 2P6UA 4DLZA 3L0SA 3P32A 4XOIA 3AVQA 2R6FA 4I1OA 2FFQA 3B8HA 1KO1A 2WMOB 2YZ2A 1DS6A 1RRGA 2BEKA 3QE0A 3HU1A 4S2EA 3ZD6A 4N0DA 4LYAA 3TQFA 4NTZA 3X1YA 2VHTA 4RFSA 5JI3E 4RVCA 5JHHB 3EPJA 1TADA 3GCGA 2PL3A 4QM7A 2WWGA 4YMWA 2IXFA 1GM5A 1IN7A 5A5GA 2BVNA 2XSZA 4JLPA 3T1TA 4QBGB 3CLVA 2HF8A 4DUGA 1NVVR 2OCYC 2O8DB 1ONBA 5BXQC 1AS2A 1R0XA 3LH5A 4A36A 4DJTA 3THOA 1KMQA 1T8UA 4KFSA 3GJ4A 3QKSA 2Q9CA 4V0LA 2JIZA 3BOSA 3RDPA 3W6NA 4LJ9A 1RFLA 1M6NA 1VMAA 4BFTA 4I99A 4BPBA 1HT2E 1CR0A 1Z2AA 2ZR9A 5AJYA 1G8YA 5KUTA 4L9SA 5KOYA 1JXMA 5IK2A 2OE2A 4HLCA 2UZ3A 2ZU0C 3RC8A 2YC4C 1MV5A 1NIJA 4DBLC 3K09C 3LFUA 2QENA 3D31A 3KKOA 1W7AA 1YZTA 4C3ZA 3EPHA 3HR7A 1XX6A 3OFNA 4PQRA 1KIMA 3SEAA 1VCOA 3ASYA 2QBYA 3RRYA 2GAOA 4C0JA 1Z07A 1IM2A 2WWFA 1XCPA 3IPXA 3U4QA 2DBYA 4P32A 4RKEA 2PLFA 2ZJAA 3ADKA 1Y3AA 1SKYB 3VU9A 4KYIB 2Q3HA 1D5CA 5HE8A 2WIBA 3QKRB 4CZ2A 3GEIA 1D8TA 2CE2X 2IT1A 3IEUA 3R20A 4D4MA 1G291 1Q0UA 1QG4A 3I3SR 3BWDD 1GNQA 4BZXA 3CRRA 2V4ZA 1KSGA 3CPJB 2ONKA 1Z6XA 1TMKA 4ASUA 3PIRA 4IEEA 1YJ5A 4LJ5A 2AL7A 2FZLA 2JLXA 2FNAA 1ESNA 1Q1ZA 2PBRA 3AP2A 3RRZA 4A1FA 3THYA 2DFNA 3LD9A 2H5EA 3H2YA 5EE5B 3GJ0A 2WV9A 1I4TD 2R9VA 3GEHA 2G1KA 1E2MA 4ZCLA 2IYQA 1AQYA 1Z0IA 1Z83A 5G3ZA 3RS0A 3R9WA 3FTQA 3AVTA 2AFHE 2AXPA 3UWOA 4RJLA 2R65A 4B43A 1VECA 5C4GB 2YWGA 4OK6A 2ZUCA 1R8QA 1E1RA 3VR2A 2GJ9A 1IN5A 5FPYA 2ZAOA 3CWQA 3K0CA 2FWRA 3TH5A 4QHTA 5FPSA 1US8B 4GOKA 1N3BA 4DXAA 1FNNA 2JDIA 2IHBA 4QJ4A 1JNYA 2OEPA 3BFKA 1WP9A 4TQ9A 721PA 5GJBA 3CWZA 5EP1A 1KJYA 1WBDA 1O3YA 4TLEA 3TAHA 4EFLA 3BD9A 4RD6A 3KJEA 4HAXA 3VKGA 2OBLA 3QENA 2CE7A 4PQYA 2L0XA 5EXSA 1XJ0A 3MWKA 1NP6A 2I1VB 4DT1A 1Z0DA 2JJ2D 2O8CA 1EG7A 5EE3A 3RSOA 5FUXA 1R5OA 2GVZC 1RVDA 2VH5R 2XTMA 4LHXA 4Q21A 3U60B 2D06A 4FD2A 2B8WA 5CK4A 3CIOA 5DI3A 1A7JA 2O52A 4HYYA 1G18A 1BS1A 4JLNA 5CJPA 2H8KA 4Y0AA 5A0FA 1E0KA 1W4BA 1XEWY 2I1QA 2B7CA 1W48A 3EZ2A 2VRWA 4MQBA 3FOZA 2V7QD 3QBTA 1GVNB 2EYQA 4TYNA 1R2QA 1JAIA 2F7SA 2YWEA 2OLJA 1E2NA 3CX6A 3E1SA 3QXSA 4DSUA 4D4LA 4LV8B 4Z51A 5EZ5A 1K6MA 3C5HA 4AKEA 2QP4A 4LJ4A 1IY2A 1DO0A 1GL7A 3IBYA 4TL7A 1QBKC 4R98A 1MO6A 2WIAA 2XZPA 4YDSA 4MRRA 4DB2A 1E2IA 4TYWA 5FBRB 1KDOA 3QF4A 3O8DA 3RANA 1XTJA 1P3JA 2IYYA 2NGRA 2ZRMA 3N70A 3GLFA 1GKYA 4NYIQ 1GUAA 2ZRFA 1BMFA 4HAZA 4OK3A 1UBFA 4UJ3A 4NH0A 1CEEA 5DH9A 1XNJA 221PA 1UKZA 1KK1A 3AF4A 1NVWQ 3QY0A 4KHZA 4BE7B 3KQHA 1Z6AA 2HT6A 3U2QA 1OKKA 2FE4A 4JLBA 2HF9A 1VYUA 1NRJB 1OB2A 1KK3A 4D82A 3GFTA 1OV4A 2DHRA 2VPPA 3AVOA 2EVWX 3DKVA 3SFVA 1E3MA 4XIGS 1OFUX 1NJGA 3ICQB 3OE7D 5LB4A 5D3QA 2GXSA 2BBWA 3GFPA 3NBYC 2P67A 2ZEJA 3TUZC 1GZSA 1NVUQ 2A5YB 3EW9A 4MKFA 4NBSA 5GJWC 4HSEA 3FGNA 1N0VC 3R7WA 1S1CA 2OZEA 3K9HA 3DDCA 4A6PA 3BBPA 2XJ9A 2ZRCA 4US0R 4XVRA 1MOZA 4DWJA 3CKLA 1KZ7B 3OEHA 3MSXA 2J3EA 2NPFA 5BN5A 4GOXA 2XX3A 4P3YA 2FPLA 5HCNA 1KI9A 1XBTA 2HT1A 1N6IA 2ZJ2A 2ZRAA 1EX6A 2O8BB 2IXEA 4B44A 1HE1C 1OIVA 4TTPA 1HQCA 3U7HB 5JHGB 3MJHA 3WHKA 2QI9C 5IRCD 3G5UA 1Z0AA 5FPHA 4G5OA 3RNLA 4MDFA 4AYWA 1V5WA 2QT1A 2IYXA 3GLFE 1TL7C 3KDSE 1KSJA 1G6HA 1RPZA 2C2HA 4A9AA 1XP8A 4ZCIA 2VQSA 1Q12A 1QRAA 2J46A 4RD4A 3AGPA 3SJZA 4BFZA 3MFYA 4D81A 1R0ZA 3UMFA 4B34A 2ATXA 3BH0A 1GAJA 3OE7A 3F5FA 1ZNWA 4UXHA 4A0HA 5B57C 2GF0A 2ZS7A 2H17A 5CLQA 5BYKA 5AUOB 4Q47A 4MGKR 4AC9A 1IOZA 2A30A 3PVSA 1PZNA 5FOTA 1OH7A 4LSGA 2OESA 4LCBA 1H8EA 1CRQA 2QORA 2WJIA 3LXXA 4K81B 4NCNA 4BLTA 2ZQ5A 3PUWA 2O8DA 3W3ZB 3WBKA 3VKHA 1P2VA 4TMVA 5CYOA 2PX0A 3VR6A 2ZI3A 4O2RA 3TUJC 1U8YA 2IC5A 2A9KA 2FU5C 2IK8A 3K09A 4YXWD 5A4JA 5K8UA 1W36C 1NL3A 4OHXA 2AD1A 4A2QA 2QPOA 1E9DA 1E79A 1D6JA 1OIXA 4JLKA 5FBWB 4C7OB 1Z0FA 1TNDA 4M21A 3ECCA 1T0JB 5E7IA 2EQBA 1NN3A 4DSNA 4X8HA 4X8OA 1U0LA 4NYJQ 2HLDD 1TU4A 4PPGA 3VQTA 2GEVA 4E03A 4IDNA 4FMDF 4Q1FA 3X1DA 3AM1A 2OFXA 5C18A 5E7MA 1RE0A 4GP7A 4DCVA 2ZM5A 5EP2A 3VR4A 4Q4AB 4XSGA 3AKCA 5JMTA 3GJ3A 5KNDA 3BB3A 4C0BA 5DI9A 5AR1A 1U94A 3C41J 1X1RA 4C0AC 1FTNA 4I81A 1E0AA 3ZIAD 5EP4A 1XMJA 4Q7MB 3UXMA 1Z08A 1W0KA 2RGBA 3Q7QA 2PX3A 3QKRA 4Q4HB 1XXHB 5JLJA 2IUTA 4QNMA 1N0WA 4C0SA 5F98A 2VF7A 1EGAA 1K8RA 1SKQA 1U90A 4IOLA 1OH8A 3KB2A 2P6NA 4ESVA 1SXJB 2RB4A 2ZE8A 3P20A 4R2HA 4LPKA 2ZUDA 2P5TB 3V4RA 2J0SA 1P9RA 5DISB 4JVMA 4AG6A 4S35A 4EAQA 1Z3IX 2CHQA 4JLDA 4OL0A 4WAUA 1YKSA 3QI2A 3EC1A 1RRPA 1SXJC 4AYTA 4HZUB 3RS4A 2NO6A 3FB4A 4IW3B 2OFOA 3RS2A 1GITA 3SHWA 3PUVA 3PR1A 3BGWA 2FSHA 1I4DD 1NBMA 4IRUB 1AM4D 4FMDB 3SBDA 1VCMA 3QOFA 3NH9A 1FX0B 1MABB 4BQSA 2QMOA 2X19A 4B35A 2TMKA 1YHNA 2WKRA 4IXMA 2X8AA 4Q4JB 5L8VA 2OCPA 1JR3A 2WJYA 1US8A 2P5SA 3AQ4A 2OT3B 4IJMA 3OIYA 2AD5A 3DM5A 4NHOA 5GVSA 1IQPA 1CLUA 4FWIB 2CVHA 4FW9A 2C9CA 2QAGB 4OHYA 4MH0R 1DOAA 1DTSA 2KJQA 5FTNA 5LBIA 1OHHD 2XGJA 1SHKA 2PT7A 1SKYE 2ZRNA 3LDAA 2FG5A 3SR0A 4R2IA 2LKDA 1OH5A 1EWQA 3P4YA 1T5LA 4M2LA 5KPJA 3TIFA 3HPRA 4MRSA 2W2VA 4G01B 2QAGC 3H86A 2Q21A 1IY0A 1G17A 1ZBDA 3LW7A 1NLYA 2WSSA 1CKEA 2PEZA 3IPYA 4NONA 4ZKDA 3RVBA 3EZ6A 4B2LA 5JS8A 3EASA 1KGDA 5EXXA 5FR2A 3TKLA 2B8TA 2ERXA 3TVTA 4FCTA 2JJ1D 4TYPA 3G0HA 2J9RA 4Q1AA 1WF3A 3KKMA 4QGGA 4HB4A 2KB0A 5CDFE 1KMHB 1LS6A 4C0QC 1IAQA 1OXUA 2BBOA 2RH5A 4HB3A 4DRZA 1CJKC 1P2TA 1T5IA 1XMIA 2LKCA 4DCUA 1E2JA 4G5GA 3CX7A 4Q02A 5DGXA 1VG1A 2H1LA 1Z47A 2JATA 4KFRA 2QE7A 2R6GA 4AKGA 3UKDA 1Z6YA 5GJVC 4PSVA 3PV0A 1VCIA 1P60A 2V6IA 3GMTA 3U3OA 1JR3E 2K5UA 2OXRA 3MJRA 2OBMA 2IL1A 2QPAA 3NC0C 1ZM9A 5L3QB 1P6XA 3NBZC 1KKLA 3I61A 2IXGA 3I8SA 3S1AB 3SHFA 1EFRA 4PSKA 3AUXA 5P21A 4B3BA 1J8MF 3KJHA 2J87A 2F1RA 1ZCBA 2WZQA 4DHEA 1KTVA 2EW1A 3QG1A 2ODNA 2Q0HA 2UKDA 2W6IA 3MG9A 4HAUA 1F48A 1P4SA 2ZI5A 4GT1A 4KXFB 4GSYA 4DLRA 5FTKA 4ESHA 3CR7A 2Z4SA 4AURA 3NHBA 4GMXA 5AK0A 5KSZA 1RIFA 2WKPA 5TXGA 1OXXK 1FNMA 1S4QA 2JEOA 2FFHA 4RSGA 1M1YE 2EFHB 4NKRA 2WOOA 4H1UA 2VSOA 3NIBA 2AXNA 2BM0A 2G88A 3QPWA 1G9XA 2F1IA 4EPRA 1BH2A 3I5YA 1PVOA 2F43B 3TE6A 2QSYA 4JVSB 4R7ZA 3IQWA 1W36D 3LXRA 4II7A 1MT0A 4K8OA 1UDWA 4Q9HA 2XTNA 2Z5FA 4QBHA 1G3QA 2HV8A 3LBHA 2VTKA 1RC8A 4GFDA 1F5NA 2BIFA 2E87A 3A4NA 4MYUA 2BC9A 1SVSA 2A5FA 4RY2A 4CT5A 4EPWA 4HAVA 3R9IA 1JB1A 1BYUA 3CF2A 4PC7A 3B2EA 2WAXA 2O8BA 4OHVA 2ZI9A 2J7PD 4ACAA 1GSIA 2FOLA 1DO2A 3LRPA 2LCFA 5C46F 4PHFA 3K70D 1RYFA 1G1MA 5DIFA 1U2RA 2GZHA 4KODA 3KQUA 2Q3MA 1Q57A 4BFVA 1JEDA 1N25A 4RFVA 3HR8A 1G7RA 4HEJA 2EFDB 3BH6A 4GMDA 1NMXA 3MUFA 3B13B 2HJGA 4HB0A 3GD7A 3RLFA 3H84A 3NDBB 4Q19A 1GL6A 3PUYA 4YDHB 2IHYA 5L3VA 1MO5A 4Q9JA 1P72A 1CJUC 3T5DA 4A92A 1X3SA 4GOJA 4W5HA 3SOPA 4I1VA 3WY9A 2F1HA 2CLSA 2PLRA 2IUSA 3I4LA 5KU1A 4AYXA 2ZTSA 1HV8A 3DL0A 1XZPA 3A37A 4RD1A 2FPKA 2FGKA 2VF8A 4G5RA 4GI7A 2HDNB 2GDJA 4B3FX 3QIAA 1A2KC 3EPKA 3WMFA 2YVUA 1XU4A 1QHHB 3EIHA 4DZZA 1DAFA 3AV0B 1FPMA 2ZRDA 1E2FA 3GLGE 1G19A 1XD8A 3CR8A 1NVXQ 4IDPA 5JEEA 2Z6VA 3L43A 5DLQC 2VYFA 2W6JA 3KTAB 2IWHA 1E9RA 4IXNA 4OI4A 4C7OA 2KE5A 1EFCA 1ZVQA 4IOJA 4NCHA 1NLFA 2P6RA 1W2GA 1TF7A 2X2FA 4DSTA 4AKIA 3ADDA 3FKSA 5IF9A 3A36A 3GLHE 2VP0A 1E2HA 4JYBA 5K8LA 2PZFA 3PUXA 4DDWA 1TUIA 4LV6A 4PPQA 5F2EA 2QGNA 3UMSA 4BASA 2QMUA 4Q9IA 2ZJOA 5AJWA 4TQUS 3DPUA 2HYDA 3HDTA 4KSCA 1JBKA 3IEVA 3NVAA 4Q4AA 3DOFA 4ZIRB 3Q85A 3NHAA 4DUGD 1IXSB 3HWSA 4XTRA 4XWKA 2VA8A 1WMSA 2A5JA 1FUUA 1EX7A 3GJ8A 2AWOA 2F3TA 3AVXA 5E4FA 4Q4HA 1XXHA 2CJWB 5EUQB 2G0NA 4V0KA 3WP0A 1XTQA 4DLYA 2WWYA 4HLDA 1OXVA 1YZUA 2JIZD 4JSTA 3H4MA 4O0MA 1NSTA 1UBGA 4LBZA 3T1OA 2OBNA 3ZGXA 2FEMA 1SXJA 1X6VA 4V0MA 1GRRA 3IGFA 4UNRA 5IK2D 1QG2A 1U8ZA 3ZVLA 5KNBA 1E1QA 2IS4A 4AI6A 1RZ3A 1V43A 1Z6GA 4HLQB 1IN4A 2RMKA 2IS6A 2GCOB 3OFND 4FINA 4CDGA 1S0UA 4MYCA 4TYQA 2O8EB 2RCNA 4HZUA 2YV5A 2JA1A 5G3YA 1GILA 3HU2A 2ONJA 1FUKA 4EDHA 3KFXA 3RRMA 4QFMA 1GL9B 4BWYA 3Q9LA 4WBSA 2ZUBA 2ZVQX 2GNOA 4ABYA 4Q03A 1U0JA 4Q18A 1FX0A 1MABA 1TQ6A 3BAFA 4ZDKA 3SDZA 2PCLA 3CNLA 2D7CA 2RGCA 3B60A 2BMJA 4OK5A 4Q4JA 1FP7A 4JLOA 3FHCB 2ZANA 3PXGA 4F4JA 2F3RA 4KJZA 3N2EA 5CIWA 4EQ6B 2QAGA 3A1WA 4ASUD 2GJAA 3THXB 3FFBA 3OAAA 3C16C 3WYGA 5F9FA 3DZ8A 3K0FB 4MRNA 3L0PA 5H8WA 1OFTA 4OHZA 4NYIR 3LY5A 3KX2A 4NMMA 3E5HA 1FFHA 4M9SA 1XXHE 4US1R 3T12A 2RKOA 3QVVA 3ZVRA 1E69A 5B64A 1U9IC 4GP6A 4OYHA 1U8AA 4FCWA 1IY1A 4W7SA 3GQBA 4JL6A 1CXZA 3PEUA 4WZ6A 1E1RD 2QZ4A 5CYPA 2FSGA 1R0YA 1NN5A 1X1SA 4WOPA 5D3MB 1E2KA 2Q3FA 5G53C 3WNDA 2REBA 3PCRB 3QPUA 2O8FA 1KMHA 5JBQA 3TLXA 1TEXA 2JDID 3LWNA 3CO5A 1JJVA 3UK6A 1E2DA 1E4YA 2MMCA 1NN1A 4QOSA 2G9NA 2J7KA 1E9BA 3T06B 2H92A 4M1OA 1LF0A 3KQLA 1NLZA 3CW2A 2KBEA 3UIEA 5KSOA 2JLRA 2PT5A 4TLCA 4D25A 3TW4A 3H0KA 5HZKA 4QBFA 3MAAC 4URYR 2B6HA 5AUQA 5JI2E 3SE0A 1KJZA 5L3QA 3ZH9B 1KO5A 4ITRC 1IJEA 3S1AA 2QTHA 4Q66C 4NL4H 1P62B 3I73A 2PZGA 2W2XA 1ZRHA 2JAQA 4M9ZA 3SYLA 1CJMA 3QKUA 5K8IA 1AIPA 1N6LA 2A2ZA 3FHTA 1DPFA 4I4LA 2JLSA 1K5GA 1IXZA 3LVRE 3U44B 4F4IA 1NMYA 1S8FA 1SVMA 3K0SA 5J4VA 2NTYC 3EZFA 2YWHA 2ZREA 1LNZA 4L9WA 1S3GA 2V9PA 2ZR0A 3QPVA 1ODFA 3IIKA 2EFGA 4AY2A 1ZW6A 3C5CA 4D4JA 3ZZTA 2CK3A 1ZD8A 1EXMA 2A5DA 3A4MA 3CF6R 4TLAA 2F43A 5BWMA 3ICEA 2EYUA 1W0JA 1I2MA 2QTVB 2ZSDA 3U3RA 4G3XA 4JBXA 1J99A 1DVRA 3PITA 5JJLA 1U81A 5JWOA 2F1JA 1CR1A 3GFOA 1X8JA 2ODWA 4PR0A 3CB4A 4E09A 2F6RA 1WDTA 1R5NA 3NWJA 1BMFD 1JQLB 2OILA 4IVRA 1SQ5A 4CEHB 4LJ6A 3CRMA 2C9YA 2R2AA 1KSHA 1N5KA 1KO4A 4FXPA 2H57A 1TPZA 2W58A 1OKKD 4W5JA 4WXPA 4DLTA 4BUJA 4QM6A 5FBLB 5G40A 1DBSA 3NEJA 1L2TA 2YC2C 1VIYA 5DSZA 4M1YA 1YZLA 2NQ2C 4AWXA 4WZAE 4POAA 4NYJR 1EFHA 2WBLC 4KO8A 3CRVA 2CCGA 3BXZA 2YOGA 1Q1QA 2ZJYA 1Z6TA 4A2WA 1E6CA 2OUKA 3OZXA 3KXKA 1CJVC 3I1FA 1QZXA 1RRFA 2Z43A 4M1WA 5FOUA 3OEHD 3J81k 1M34E 4B33A 1HTWA 2ZE6A 4AIIA 3EA0A 4OBEA 2X2EA 3U7FB 2V1UA 4HB2A 2VO1A 4C0HA 4KFTA 4FI3C 4JS0A 3ZQ6A 3W5IA 3W6PA 2Z83A 1CIPA 4QGFA 2FFBA 4TZ6A 1VCNA 2Q9BA 4E07A 2G83A 1OH6A 1ANKA 2IYVA 4M8NE 3CF0A 1IN8A 4KITB 4Q7LA 2NG1A 2ZRGA 1QHHA 1P7CA 1SHZA 3VHXA 1E94E 5SZIA 4X8LA 1FQJA 2B92A 3AH8A 4FMBB 1S96A 3KXIA 1P5ZB 3KTAA 4OQMA 3CPEA 2VHQA 3IBGA 2ZRBA 4M53A 3FMFA 3MCAA 2QNRA 4AKHA 2DPXA 2AKAB 4A2PA 2IYRA 4LUCA 2P2LA 4E5UA 3ZD7A 3PEYA 4CYMA 1FL9A 5GVRA 4HUQB 2RHMA 1AGPA 5HTKA 2BCGY 3I32A 3ZS9A 2DWPA 2QMEA 4LHWA 2PH1A 3SZRA 1H8ED 1W5SA 4ZIRA 1GIAA 1R6BX 1OYYA 1W47A 5FUVA 4B75A 4A0FA 2PMDA 4QG7A 3REGA 3O47A 2QM7A 2XNDA 2CCKA 3C7KA 5J4YA 2N46A 1VPLA 4NCJA 5EZ6B 5KYKA 2XOKD 3HPQA 3DKPA 1G5PA 3RWOA 4TSFA 2CJWA 3QEJA 1H8HA 2JJ8A 3IO3A 5E7JA 3Q5DA 4BFXA 1GNPA 1L7VC 5TVKA 5EE9A 2OCAA 1HUQA 1Z8FA 1E79D 2OM2A 5K8TA 1UM8A 3AP1A 3LNCA 3DVLA 1N6NA 2CDNA 3TR0A 6Q21A 2GCNA 1QHSA 3EAQA 4U7DA 3TNFA 3TJZA 4JLJA 2V3CC 2GCOA 1OT3A 1NG1A 4IVQA 3E70C 2O8EA 2DWOA 2D4HA 3T1QA 3L0IB 1S3SA 2BHRA 2W00A 3K53A 3QF7A 1RJ9B 2ZJ8A 2DYKA 4KFUA 1T3HA 4CIDA 1Z5ZA 1DAHA 2R6AA 4IFBA 5JRJA 3EWAA 3W90A 1N0UA 5F9HA 5J4KA 4MYTA 1W0KD 1J90A 4XD7A 1NIPA 2ZETA 3UMRA 1NG9A 3B85A 1ZAKA 4BGDA 5TDHA 4GNKA 4B74A 4EQ6A 4NP6A 5SZHB 3AP3A 1OYWA 3THXA 2XOKA 2PZEA 5HCIA 2QN6A 2W0MA 1U9IA 1Q3HA 4B6FA 3D8BA 3K0FA 3EX7C 2CL7X 3CM0A 1N6PA 1FQKA 1S1MA 2VL7A 4JLMA 1W49A 3C4JA 4DVGA 3SBEA 1CBUA 3QJYA 4QHSA 3SYKA 1WB9A 4IHQA 5JWRA 4P33A 1G5TA 2ASEA 2C95A 3OF5A 4LWZA 4BLRA 1YZNA 4TTRA 1NBMD 2PCJA 3DHWC 1JQJC 1MRSA 4KU4A 1P73A 3CX8A 3G82C 1XRJA 2OCBA 3MWJA 3W5JA 4URZR 5DNYB 4BLQA 4EFNA 5D3MA 4XTCS 1VYTA 1LFDB 5CLLA 1Q44A 4G5QA 2DR3A 5EUMA 1XTRA 2X77A 1JR3D 1E0JA 2GK7A 4CEJB 4E22A 1G3IA 1NN0A 2YYZA 1XFAA 4LHYA 2JLZA 3CUEF 1MO3A 3L8YA 4TL9A 5CK5A 2QL6A 1KYIA 2FSFA 3HYTA 3A1VA 4CEIB 1KOFA 4M1KA 1GG2A 3RS5A 1KDPA 2QPTA 2BJVA 2OFWA 3W9YA 3WMGA 1N6OA 1KNQA 1ZNXA 2G1JA 2BMFA 2G0TA 3U3MA 3ZZ0A 5KNCA 1BKDR 2GF9A 4LBYA 4Y0VA 3EA5A 4B2IA 1G41A 1R4AA 2XTZA 2KSQA 5B2ZA 2JLWA 2CHGA 3I92A 1PLLA 1RRCA 1CU1A 3LBNA 5FUYA 2WSSD 1II9A 3C8UA 4MYHA 3ZLJA 2RGNC 2F9LA 3K9LA 4WXRA 4OJKA 4K46A 5KDOA 2WHXA 4M9XA 2PJZA 1T9HA 4P31A 5CM8B 1N5IA 2PEYA 5H70A 4DCNA 2Q6TA 3IKJA 5DYIA 5FBQB 3ZQJA 3U44A 3F0TA 1YQTA 3RC3A 4UNSA 1SVIA 3GP8A 1XPUA 2FN4A 3BFVA 3FHOA 3RWMB 3WP1B 2ZRPA 3QXCA 4IKEA 4LJ8A 5DHAA 5KO2A 4KBFA 2CL0X 5IT5A 1NY5A 2IYWA 1KY2A 2JGNA 4Q1CA 3B1YA 4A15A 4BEJA 4JKYA 4ZCMA 1A2BA 3QKTA 2FPMA 2QE7D 3TQCA 4TMZA 1XCMA 3OEEA 2ZXUA 1PUIA 3AF3A 2FMXA 2OAQ1 4LK2A 5BQ5A 4DLSA 1RKBA 4JSYA 1G6OA 1KK2A 1N6HA 4URWR 4D0GA 1AKEA 4NE2A 4TMWA 1K5DA 2VHCA 2HYIC 1VDZA 5DN6A 1EFRD 3B7GA 4CEHA 3R9XA 2XXAB 4DEXA 3N5CA 1COWA 3R8CA 4NYMQ 3I5XA 2AKYA 1B0UA 1XJCA 3B82A 1BIFA 2ZROA 4DB4A 4UXJA 2ZR7A 2Y8EA 1N6KA 4ZDIA 5DE3A 1KJWA 1ZUHA 2W6ID 4FCVA 4B71A 5FUWA 4BRUA 1YZKA 2B21A 2D62A 4M1SA 5FI1B 121PA 5B30A 2FFAA 1RYHA 2BMDA 2IA5A 3A58B 4NCKA 1HT1E 2ZIAA 2IS1A 2E1RA 2WWXA 1H65A 4TMKA 4QRHA 5FL3A 4DDUA 2H18A 3NKVA 1UADA 3SU8A 1UKVY 5EP3A 5L3SB 2C8VA 2ERYA 3THWB 3FDIA 3AEZA 1E9CA 1N5LA 2OV2A 2J59A 2ZJZA 3P26A 4MRVA 4MKGA 3VKWA 4A6XA 1ZD1A 2QAJA 4BEBA 1KI2A 3ASZA 2QROA 2R8RA 3EZ7A 4TT3A 5E3HA 3AKYA 1NBME 3FMPB 4WVFA 4LPSA 3VFDA 3W8NA 1GKUB 3DO6A 3EPLA 3U7GA 4OQNA 2FV8A 1Q20A 1A5TA 2GESA 4QNRA 2DFLA 1S9DA 2XZLA 3EXAA 3VNVA 4M1MA 1WBBA 3T61A 2AX4A 3BE4A 4IDHA 2GJSA 3T15A 2WVJA 2QU8A 1G8PA 4FN5A 4RD2A 4LBVA 4PZZA 5C4MA 5JEDA 3LQRA 4EUNA 2AN9A 5KPDA 4B32A 5FTLA 3VR1A 5CB6A 1ZCAA 2J0UB 1XF9A 1G7CA 4CGZA 4Q1DA 1G3UA 4OKSA 5JCPA 4BZQA 3ND8A 3Q7PA 4HLUC 1ZUNB 2C03A 4ZDWA 3CH5A 2C99A 1HA3A 2W2TA 4LHZA 2VP4A 1YR8A 2J0QA 2W83A 3MGCA 1ZC3A 4QC2A 5LPNA 2OAP1 3KQKA 3WMEA 4EPXA 1ZD9A 3O8RA 2QGZA 4TYYA 4A4DA 5HE9A 1Y63A 4HUQA 1NMZA 2QY9A 4UKDA 2ATVA 5IHPA 3T34A 1DG3A 1J70A 1Z63A 4ZV4A 1R8SA 4PAOA 4QL3A 1YU9A 4US2R 2RAPA 2OSBA 3M4YA 4MRPA 1VYVA 2I4IA 1G8FA 2YOHA 3BIFA 3LLUA 1T3LA 4KYUA 2CXXA 1W4CA 1ZMXA 3QNUA 3SJCA 4HZIA 1FOEB 3OIWA 2ZRHA 1U0HC 2CCJA 5DYGA 4DDVA 4Q1EA 4QHYA 1OXTA 4TLBA 4YMTA 4OJQA 2EU8A 1J2JA 4JVLA 3D3QA 4PSAA 2W6JD 1EFUA 4PC6A 4RD3A 5G41A 2NPIA 3CZPA 4LGMA 4Q1BA 2FZ4A 3AB3A 1QDEA 5CB8A 4YONB 2ZYUX 3FKSD 3BFXA 4OI1A 4TMTA 3B1XA 2NO7A 2OG2A 1JXOA 3M6AA 4P4TA 1UKYA 3PEWA 3QXJA 3U3JA 3A8TA 1GRNA 2CLDX 2QQEA 4UNQA 4V03A 3WBJA 1SVOA 5AUNB 1D2EA 1T6NA 1Z29A 2REOA 4C0KA 1KI1A 3I62A 1M7HA 4RCYA 1RJ9A 1GOTA 1XTSA 2NO0A 4Q4LA 3KB1A 3KJGA 2IYLD 2GWHA 5H68A 4MDEA 4DCSA 1JPJA 4BLSA 4KI0A 2F9MA 3B6EA 3AF0A 2ZS9A 3EIQA 3EG5A 2YOFA 4NCIA 1KDRA 3W6OA 1KK0A 4Q48A 2QSZA 3BH7A 5FFMA 2AK3A 2CEAA 4QKQA 1P2SA 3LQQA 1SXJD 5JSZB 3O8CA 1LB1B 1WCV1 4EJSB 1YE8A 1E1QD 4JBWA 4R71A 1T3SA 1BO6A 5L3RA 1YR7A 1TX4B 1M8PA 3CNNA 1MRNA 2BEJA 5C1BA 1WA5A 3E2IA 4EJSC 1VIAA 2GXQA 2ZPTX 1GTVA 1R5BA 2QRZA 4X8MA 1QHGA 2GXAA 4MKIA 1A4RA 1Z28A 4WW0A 1F60A 3A4LA 2HCBA 3MD0A 3Q72A 5FI0B 4B3CA 4ZDJA 4O2LA 4F4CA 1E2LA 5JJIA 3KZ1E 5AJXA 1KI8A 1XMSA 2CBZA 1T0HB 3PENA 3B1VA 1CTQA 3IO5A 1Z22A 2QP9X 4UJ5A 3NBXX 5FH9A 4CEJA 4QBIA 5DO9A 3IILA 4LY6A 1VKJA 3Q5EA 2ODBA 3SN6A 1OLOA 2D74A 3WRYC 1Q1EA 1FMLA 2ORIA 5KDDA 3OAAD 3AF1A 2YWFA 4LC0A 2DB3A 3LV8A 4N3NA 2RGNA 2CHVA 2QM8A 4D0LB 4YMVA 5HR5A 1OJLA 4CEIA 2WPDA 3U6KA 1P75A
chains in the Genus database with same CATH superfamily
1SUEA 2J48A 2MT9A 4IEIA 1Z0SA 4XSHA 4EFKA 4YMUA 5BNTA 5AXDA 2NZ8A 2FDCA 2HBQA 3K70D 3DOUA 3OQMA 2J41A 1UR5A 4BNDA 3IB3A 4I2VA 1AH2A 2J3IA 1ODLA 4MV5A 4C4PA 1O6BA 1Q1BA 2AHOA 2KI5A 1YZQA 3LA6A 3G2PA 5J40A 3EXFB 4L07A 4F3RA 1A69A 1JNXX 3TZKA 4ALKA 1ZR2A 1V39A 3AKZA 3II6X 4Z0PA 3WGLA 4W1PA 4RHUA 4JGGA 3BCUA 5J4LA 2IDKA 1KBZA 1C9DB 2RHBA 4N0EA 4R84A 1FFDA 3NBQA 2H7YA 4S1TA 1QF9A 1W0CA 4QXMA 1LY1A 5A4FS 5I01A 4YC7A 2WF8A 2ZIEA 2RGDA 1BXRA 1UJ5A 5EJ8A 3EE6A 1L7BA 1ENZA 1XEXB 1Y6JA 4QJ5A 4BPRA 2EG9A 2WSYB 1E96A 3GLIB 3H5OA 5ES3A 1JP7A 4BRWA 2I76A 3RLIA 5KAPA 4W4TA 5K6AC 4JMPA 2OXFA 4L22A 2QTWB 2WZDA 4YAWA 1R9GA 2QA5A 3P19A 4ENVA 2WD9A 521PA 2PSEA 3K6SA 1XP5A 4FE7A 5JLAA 4QGAA 3V1MA 5GONB 2VHJA 3HCOA 5KC8A 1PE0A 5DFAA 3HMQA 3L1HA 1AHIA 5BQFA 4LYFA 2D5LA 1TM2A 2Z3WA 3OZAA 1TZMA 4G24A 1U6JA 2PWBA 1ZI9A 4DBVO 2FX2A 2QTFA 1XZQA 5EXPA 2XXAA 1IC6A 4RKFA 5UKDA 1SXGA 2NYUA 3DJFA 1DFGA 5HYVA 3D0KA 3I4CA 1A9XB 3WIUA 4MWCA 1U3UA 5KZMB 2G76A 5EMNA 4GKKB 4DLVA 1EP9A 3O03A 3EH1A 2JFWA 3KL4A 3I72A 3IP3A 4KRGA 4MWDA 2CJYA 4L74A 1T2DA 4F2DA 1E3WA 1SXJE 3D4IA 4LRYA 4LJAA 1KNXA 3SEFA 1DQRA 1LTQA 4LNHA 3X43A 5FWXB 4E5DA 3TL3A 3IHWA 3GJZA 1XB2A 3AUKA 3S99A 2WT4A 3HO6A 4ENUA 2H59A 2X2OA 1IVYA 2GAAA 3PRHA 4JLWA 4EARA 1K4MA 1L7XA 4RTJA 4LRTB 1J8YF 5KYKA 2FEOA 2I3AA 2CMFA 2JFXA 4IOMA 4KVAA 1DAEA 2AWNA 4YPFA 3KELA 2J5XA 3K0AB 4XWTA 2DUMA 2TYSB 5AI5A 1Z7GA 1WDLA 3DZHA 1FJ2A 1ZYUA 2GN9A 2X9NA 5AYVA 1XLTC 4DEYA 5U9CA 1NVTA 1O57A 5BR8B 4JXKA 3RI3A 1KI3A 3F6RA 1E1CB 4FFVA 4PX5A 1X7WB 1CQIA 4UPDA 3ZPXA 1HI9A 1DC3A 2F17A 3HJNA 4REQA 4IWNA 2KYRA 3LC0A 3GNQA 3LQFA 5LCXA 2AV6A 3ET4A 4MV8A 4YJ2F 2I71A 3RHFA 3V2HA 2WAMA 5THKA 3T0FA 3ZVMA 1Z6QA 1QYWA 1QK5A 3ZJ4A 1T6YA 2WKSA 5AM5A 1G7SA 1MR3F 3TCKA 4B40A 4D8UA 1XZCA 2C61A 2G40A 4E3WA 4E5SA 5KWSA 1MPTA 1Y1RA 4U7PB 1XQWA 2XODA 1XMQB 4LFBB 1YL7A 3JTMA 3H19A 3OWHA 1GV0A 1HOXA 2R5FA 3R7SA 2BR3A 4DC1A 1XTIA 4H7DA 5FO1A 3REQA 4IUBS 4MP6A 4Y2UA 2B4RO 3KKQA 3RAPR 4PCVA 4C21A 1ZUNA 4HD8A 4Q3NA 1Y8ZA 1UJ6A 3UPDA 3LWBA 4D02A 1MO2A 4YCBA 4F4UA 4L3VA 4BO0A 1EJ6A 3EISA 1T91A 3LUAA 3GRZA 5L7TA 2W9XA 4YV2A 3MT7A 4W8HA 3T7TA 1M6VB 2IZ0A 3IJ5A 3LUFA 4LF9B 3AFHA 4LC9A 1ODSA 1OZGA 3NEPX 1NLUA 4JU8A 4NBNA 2WYHA 5L45A 4CVNA 2FKNA 3OCXA 4DCPA 2B30A 2YUTA 3PL1A 1UEJA 1W8DA 1N4AA 3PYLA 2AT1A 3NT4A 1KZ4A 3ZWOA 3RTAA 1JDUA 1VL1A 4P2GA 4ZKEA 3PFHA 4KSYA 3FNEA 3VMFA 4CM7A 1JAZA 5BN3B 5K45A 2X8LA 3QNWA 2JLVA 2AFIE 3NWOA 1JAHA 4BNFA 1ISPA 3WL5A 1AOXA 1LTHR 1YUMA 3CX3A 3VM6A 2JFGA 2PUGA 3KVYA 1FCJA 4KBGA 2JG3A 4JH0A 3FCEA 3I6BA 4OMFG 3EJWA 3EVZA 4PCUA 4JJFA 3I2IA 1JG2A 2VYQA 2AZTA 1YR9A 4IICA 4X9XA 1UK9A 4WX2B 3RRXA 1YR1A 1QKJA 1LA2A 2OO3A 1QHNA 1H2WA 4S2UA 4DLPA 4KLNA 2QLFA 2AGVA 4EEXA 3PC7A 4R9VA 1FMJA 3L1KA 2MYUA 3QBVA 3VX3A 3EZLA 4BATA 4ZU1X 4UOQA 3O4FA 5JADA 1A1SA 3SYNA 2J5BA 3IV6A 3RJTA 4RGQA 2PX4A 4TN1A 5MN4A 4OPMA 2X0RA 2JAXA 1FZQA 3C7DB 4NR0A 4PC1A 4XD2A 1R4ZA 1SC1A 2YHAA 1QVAA 3PX3A 2VHUA 5BMVA 2FA9A 3VX4A 3DTNA 1TA9A 3PQ4A 1Y98A 1JMYA 5GAJA 1FNBA 3G23A 1GAWA 3QHAA 4QRDA 1AT1A 1D09A 4QQKA 5HFNA 5EJIA 3WDMA 4Z6KA 5C1OA 2DERA 2DF8A 3WGJA 3T5GA 3QBEA 621PA 2ZVPX 1O08A 2J3KA 4TSFD 2KHZA 1H8HD 2RFLA 1OC2A 1MQ9A 3EXHA 4FYJA 2VTEA 2W7TA 5JECA 5LJIA 1NVFA 2QUIA 2FN7A 3IP6A 2CMKA 5F21A 5DBOA 1V1RB 2W8BA 3NOVA 2WAYA 3O82A 1G8KA 1WHSA 4EJSA 3CHYA 1ZFNA 4PZLA 3H1GA 3UYKA 3DH0A 3G0GA 4MB2A 2G6BA 2A9JA 4JYCA 2HWKA 2EW2A 1AUXA 3CPHA 4QATA 1DWPA 4U3JA 4Y0NA 3GCXA 3OO0A 4MEAA 1ICIA 1SD5A 4L5CA 5A6VA 3OE1A 3P2EA 4K9DA 1Y42X 3WLIA 1MZVA 1TQ2A 4YDQA 1QBGA 3MQ4A 2A3RA 1RKQA 1XGKA 4CU5A 4D92A 1QS0A 1YI0A 4K9OA 2ZRJA 4P34A 4EVIA 1G55A 1GNRA 3NHWA 2FH5B 1GPAA 2C00A 1Y9EA 3E7WA 3PG5A 2HHCA 2NXEA 4CM8A 1M2VA 2ZSHA 4LOLA 1JE0A 2RKWA 3HZOA 4I5FA 3SF8B 4BCBA 5ICSA 5IVPA 4NCBA 1O7JA 3R1IA 4Y2XA 1UDRA 4MV4A 4AS2A 4C2TA 1XZBA 2GA8A 1TAQA 2QUKA 3O75A 3A6JA 3H8JA 5K3OA 5BW8A 5EJEA 2CFOA 4MEBA 3AUSA 2Q2NA 1MHPA 1WMAA 2JJ2A 2W0SA 3E9CA 1AKYA 3OJWA 3PB3A 5F7JA 2I2XB 1QQAA 4G2TA 2J9XB 3ZGOA 3UXYA 4LF5B 3RSQA 1EIWA 4HVAA 1RYNA 1N8TA 1EXVA 4E21A 4PNPA 4LDJA 3UBMA 1P9NA 3OEYA 5CJ2A 1GAEO 1N92A 1P9OA 3AHIA 2NM0A 3C1TA 4L02A 1RCUA 1W29A 2ZTMA 4X24A 4Y2RA 5CVJA 1QP4A 3K7EA 3SZLA 1I3KA 2CDCA 1ORVA 2ZWVA 3KPUA 3OJEA 2X3FA 2ZAYA 3PDUA 2RHOA 1EFVB 3EULA 3UUWA 5HKKD 4HAWA 4A8JB 4QGBA 2CV1A 3AVVA 3TRHA 1L3BA 2WJGA 4MUJA 5ENZA 3F73A 1VI6A 2QW1A 1CX9B 5FV4A 1YTUA 3DDOA 1JVNA 1W4RA 3EXG1 4ER0A 3HBNA 2CUTA 3IMEA 2G1UA 3DE6X 1NBAA 3D4NA 3HU5A 4MW5A 1D3AA 4WKNA 4DNQA 1RM5A 1YQEA 3JZAA 4HNSA 3EXFA 3MMPA 4ACBA 1P44A 3PWKA 1ZONA 1AGRA 2Q62A 4XYGA 4D9MA 5H9WA 3NV9A 3K16A 4NULA 2GB4A 3V9PA 4E11A 2H2GA 4OP2A 4IVPA 4H59A 3GLTA 1PV4A 3HNOA 3BSYA 2A5GA 3DVRX 5LB2A 3RYIB 4D0NA 3QE3A 3HL4A 2D8AA 4FT4A 3G68A 3NNNA 5JMPA 3CNBA 3O2QB 2QL7A 1GCAA 4N82A 1WUIS 1W2HA 3GVXA 3CG0A 2ZTLA 4FMCB 1XEXA 4FWBA 1B0ZA 3GARA 4BTLA 1E1YA 3KWFA 3PXUA 4R41A 5HNKA 3GLIA 4LE0A 4YROA 3U3ZA 2CLIB 4C9BA 1ILEA 4G26A 4YRIA 1O95D 2GPTA 2I03A 3TSZA 3TRJA 4TGLA 5HBGA 2ZWOA 2EGUA 4JC8A 4LXHA 1RACA 2FJUA 4DVJA 4ZAGA 2DJIA 3ZGLA 3ISTA 5BV0A 4C2UA 3Q1LA 5FWNA 1WZ2A 5GONA 2CYBA 3G2QA 4L8WB 5B36A 4C3ZA 3BKWA 4R83A 2ZDGA 4TVSA 2FPOA 2G5TA 3ADCA 4LBWA 1HM5A 3O9VA 3EY4A 1V4VA 1DARA 1YD7A 4B3GA 2A33A 3CLUD 2ECKA 4WKCA 2XCOA 4HGPA 5HKKA 1QHIA 2EWWA 1JE1A 1TO2E 3EWNA 3TCNA 1A9XA 4GRDA 2ZATA 4Q82A 5CTJA 1YRAA 1T3ZA 4PO3X 4RHTA 4XA8A 2IOFA 2BGKA 3A1FA 1WEKA 1I2DA 1XOIA 3ETHA 1E6MA 1PX0A 3FPSA 3I04A 4MWGA 4UXIA 4AZSA 4G8CA 1G4AE 1FMFA 4HGQA 2ZDHA 5C52B 4NOLA 1N34B 1DZIA 5ALFA 1G59A 1AA9A 2HPZA 3R41A 1R0LA 5FWXA 3HEAA 4GSKA 2ATEA 2VK8A 4X6LA 2WM9B 2OL4A 4F92B 3BORA 3IA7A 4V0RA 1X80B 3DOEA 5CCXA 2NV0A 1VLQA 2ZIZA 3D4LA 1P3Y1 4BU1A 4H6VA 1YR6A 2ZIXB 3ABOB 5K3FB 2YHIB 3K9QO 2G07A 3K0AA 4UPVA 5B3JC 1NXQA 2IKSA 1BU8A 1J56A 1WB4A 2P4SA 2QT0A 1X13A 3COVA 4BQFA 2IXDA 3IKLA 3Q6MA 2GBGA 2Y9PB 4O63O 4ON9A 3S44A 1N75A 4K9SA 5HKLA 2ZRLA 2EWVA 1BFKA 3U4DA 2RAVA 1E1CA 1O87A 2X9VA 1X7WA 3HY6A 3J7TA 1DFHA 1G5IA 1PF7E 2GBLC 4R40A 3L41A 1M74A 5D86A 1ZM7A 5J47A 1CEQA 1XKTA 3GRRA 1VRCA 2DBZA 1Z4JA 1XCOA 1J23A 1OFIA 1LVHA 1DIRA 1BXZA 4LDQA 4P4SB 4RAQA 4WKOA 4IH4A 3WYCA 1LI7A 3GD5A 3UCEA 4WK4B 1BGVA 1GQ2A 3M1IA 1P1BA 3LY7A 2WB2A 4F85A 4XJXA 1RKXA 5FFFA 2P9YA 2C7PA 1TEZA 4A6DA 4ZALA 4EGFA 4BZPA 5EHIA 1Y1SA 2X3YA 5K0NA 1NFQA 2EZ9A 3HFGA 2XA1A 2WHPB 2XZOA 1LLCA 2GFHA 4UNPA 5LD2C 1YVPA 3WXMA 4OJMX 2QP3A 3TR5A 1QNFA 1CVLA 4IG9A 3QEOA 1KC3A 5HS6A 1FFGA 4QAQA 5T5QA 1PHPA 4TT3D 1E1DA 1ONNA 2FQ1A 3A70A 3INNA 4JMLA 4J0EA 5LQUA 5GV8A 5E95A 4YRZA 1IG0A 1CHNA 1I1OA 1E2PA 1M6VA 4Y2SA 3QE4A 1ABBA 1CZRA 2BTOA 5I7VA 4HL6A 3FAKA 4UZEA 5EKTA 3HDYA 3W8FA 3DWIA 2CYAA 1VBFA 2GGSA 2NLOA 1UMBB 5CDFA 1BDHA 3SJBA 1IHXA 1PNOA 2VLIA 5H16A 4E2ZA 5I4IA 5JSUA 2VAVA 3MRSA 3P0RA 2ZS8A 1Z5UA 3RF6A 4N0PA 3X1ZA 2C78A 5BN3A 3GF4A 3K2EA 3H4IA 5INTA 4NFHA 1FP4B 5EIHA 2DQZA 2HLDA 2QRVB 4LCJA 2WM2A 3GAMA 3RRFA 4NOKA 3FWHA 3QXXA 1TUEA 2NACA 1LJUA 4Z9BA 4PYOA 1AGYA 1VRVA 3I9JA 2J8ZA 3N5KA 2ZBPA 4DV6B 4BB0A 4CF7A 5EIBC 4TMXA 4J0KA 3VI4B 4TLDA 3LPNA 1A4IA 2P2SA 3Q0IA 4TWJA 1JECA 5E3JA 4UTNA 2VJMB 2C3PA 2C3YA 2PUJA 3DOIA 1M2KA 4WJLA 3R8FA 4G41A 4C4SA 1X86B 2OZVA 2JK0A 4NZ9A 4BX3A 2FEAA 2VPXA 4I7EA 3PD1A 2WTUA 2HHAA 2XNJA 2QSUA 3N86A 3WB0A 4XW2A 2X0NA 3UK0A 1UBEA 3WICA 5DOVA 2G80A 1WXQA 2HHLA 2AFHB 2HSJA 5IXSA 4JJKA 5TF4A 4TWZA 2B61A 4G37A 3TMKA 1WO8A 1ATIA 3EC7A 2P2ZA 3KK0A 4ZCSA 5KSPA 1NI3A 4EECA 3HUEA 1N2BA 4UNIA 1GTRA 1BRMA 2GVNA 1SURA 1VGRA 1QRRA 3CJQA 1QONA 1R8JA 1V1MB 4NZYA 3HJTA 1A82A 1E20A 3L82B 3WQHA 5L4LA 2BUCA 5DSXA 1Y1PA 1Q77A 4QXQA 5DM2A 1J0DA 1Z34A 3I5UA 3A4VA 1EWRA 1TFRA 3LLCA 1KP3A 1IHOA 1OXSC 1D9ZA 3JQAB 4FKMA 3TUIC 4YUYA 2VCEA 2VSFA 1Y7TA 1E2QA 3ZG6A 1L1EA 5FD8A 2NPOA 4XB2A 3SSOA 1V1RA 3HG7A 3HRHA 4H9GA 3ZV6A 5HZMA 2O8FB 4YQFA 2MYNA 1PWEA 1IJBA 1IOWA 1PUJA 4INZA 3T35A 4BIMA 3CFYA 2AOVA 3HB4X 1KORA 3VU9B 5JCZA 4ZOAA 3G8DA 3AF2A 2WLSA 3VNSA 4K6FA 4ZO4A 3FVRA 3OIVA 2GLUA 3LZDA 2A9RA 3LDGA 4NNOA 2XZTA 3U40A 3T5TA 2PLNA 2JZCA 2HM7A 3SNKA 2FHPA 4Y2HA 4DLKA 3DV0B 1PQPA 3O84A 2JIPA 3FMOB 3I09A 1MEJA 4RFLA 5EUBA 5FPTA 1BHO1 1QKKA 3SF8A 3DFIA 4ZEWA 3WK8A 3ZZUA 2C5LA 2V54A 2HK8A 5D7BA 5TY0A 3WWDA 5BSWA 5MFPA 1I7LA 3FZQA 3O1HB 1DAGA 3PKJA 1QZZA 2QEQA 4L5JA 2DFTA 3VNRA 2NAFA 3BJIC 1CRZA 1TZCA 1UBCA 3D8HA 4XGRA 4UEWA 4U02A 2ZE5A 2HN9A 3HI6A 1L5HB 4JZKA 4JOCA 1SGWA 3INGA 4EPTA 1W73A 1Y4DE 1A4UA 4LMBA 4M7WA 5BWBA 4NPAA 3LX6A 1QF7A 3PRJA 3RIEA 1GZDA 3F8TA 2C7VA 3T0IA 1QAQA 3WSTA 1FTSA 4MP3A 2QRLA 1CRLA 5AUPB 3K8YA 1KIFA 4MGZR 5SYMA 2ZZMA 4CETA 4FWTA 1EFVA 2HADA 3TR6A 1R7RA 4A8JA 2I2BA 1DXOA 1OYVA 3FZGA 1CF4A 4HDSB 1ZOLA 5CG1A 3DFMA 3WRVA 3LXMA 1JJBA 4WA8A 3CF4A 1DP4A 4LRWA 4N1AA 4PGGA 4R0MA 1XPOA 3QXHA 2YNMA 5JXIA 1FLAA 3JD4A 2AI1A 4AJ1A 2C7RA 1X7XB 3GJ6A 2Z8YM 4LV5B 1Y5NA 3U61B 8MHTA 1SNYA 4L4UA 3ROFA 4OJTA 1K97A 5JFGA 4E5KA 4MSUA 5CCDA 1ES9A 1SC3A 2HMWA 3OQBA 2H4HA 3AEYA 5JS7A 3K0CC 5ILGA 5DLEA 3UO8B 1F4VA 3QLJA 3V2UA 4XGNA 3CTPA 1JDTA 3YASA 3RYIA 2YXBA 4BQIA 2DAPA 4JKOA 1RS0A 4ZGWA 2ZR8A 1RXEA 3P27A 1F2VA 3T4XA 3VDXA 3HN6A 4A16A 1UEIA 3SIPA 5AKGA 3KHTA 1JDZA 3N2IA 3CZMA 3ANMA 1AKTA 2YV1A 4PXAA 5U4QA 3RT1A 2H54A 4BV8A 3PHLA 4IMIB 1SULA 1DIOB 1LC3A 4OD0A 3WOHA 1FSSA 2B3DA 2O3JA 4UDYX 1H1DA 2YL2A 1EKXA 1Q14A 4PO1A 4F5WA 4C6TB 3I01A 3HP1A 1OJ7A 3TOVA 4HATA 2EKLA 2FGJA 5LQAA 1UXJA 3SE7A 2FK7A 3W8RA 1MTOA 1YU6A 2WKQA 4XVUA 3KZNA 2JKVA 1IATA 1NW3A 5CIQA 2FLWA 4R6XA 3W6UA 2FQXA 1UXIA 3LHDA 3GPLA 2ARKA 3MK31 5JZVA 2F9FA 5JD6A 2JS7A 5AKEA 1UWLA 2HO5A 4HMPA 3WG9A 3AK4A 1WHTB 4YTEA 3FVQA 3SX4A 2EV9A 2QVBA 1XCGB 4GXQA 1LW7A 3VPBA 3WZLA 2JLUA 4MGHA 3UGTA 3IE2A 4B3HA 5F12A 3SJUA 1T8TA 2RONA 1YE3A 4YWHA 1TF2A 1QLJA 3RKUA 3ROXA 3OFSA 1H0KA 2CFIA 2QOEA 4K6KA 5FL7D 4BNGA 4QXAA 4JNCA 1Q83A 2FP4B 3FUVA 4NVRA 1BE8A 5JYDA 4QE3A 4ARVA 1O6GA 4XDHA 1W88B 1UP7A 4HNAB 1X80A 3MCWA 1DMSA 3K4QA 1ZINA 3PRKE 4QBKA 3AVYA 1D07A 3EIEA 2DUWA 4P9NA 5DK6A 4ZOBA 1YCGA 3B9QA 3BZUA 2ZIXA 2VFAA 3T1VA 3NC1C 1G20E 1G7TA 4C7MA 5K3FA 2YHIA 5FHQA 4RCZA 4ZCTA 2CLCX 1LWNA 3N3BC 5DHQA 4DLXA 1QHFA 1ZH0A 2O0LA 1B8VA 1T6BY 2OTCA 4ZCQA 1HMPA 1U65A 1UBRS 4JLAA 1M0TA 4Q3CA 2HA3A 4BV9A 4CODB 3RU7A 1GQFA 1GGKA 1KEEB 1O03A 3JZDA 5BVGB 5CA0B 3QXGA 2BFEB 2NT3A 3S81A 3OHMA 4P2BA 2DLDA 2COKA 2FCRA 5FTMA 3DOJA 3MOGA 2Q2VA 1HRDA 2GXUA 3KYBA 4IDQA 2WIJA 3X3HA 3ZGNA 2NMVA 2PJRA 3KCQA 1FP6A 1KDTA 3BTVA 3V80A 4MW2A 2Z2IA 3BRWD 3LGAA 3DEHA 2IBMA 2Q7XA 5FI3A 3UMMA 4KNVA 4P4SA 1USVA 2G0AA 5B58C 1R66A 3SSAA 4FHDA 5I9NA 1F6WA 2RGWA 3F5SA 2C77A 2TS1A 5H02A 4MNTA 2ECOA 4PGMA 3U1TA 4EPYA 2D4AA 2AC4A 3MJDA 4L9AA 3ZWWA 1Q15A 2X1VA 4JP5A 2H1FA 2YDYA 5BN5B 2NYRA 1NXVA 2F90A 3WWYA 4BQQA 1N3IA 1CUBA 1Z45A 3GP5A 3L7IA 4K86A 4PHHA 5FB3A 2WHPA 4XWAA 1T5OA 4GLLA 2BFBB 4M88A 3VAYA 5EWLB 3GEEA 3SNHA 2KWIA 1YRBA 3OJOA 3DAFA 2GD6A 4MB6A 1EM6A 1R4MA 5D3ZA 1K08A 4V0OA 3DO5A 1UPXA 2Q9AA 4IGFA 1FS4A 3QX8A 4HWTA 5FI5A 2PXAA 5T4FA 4YJDA 5LU8A 4OXKA 2IYFA 3P32A 1AKUA 4FLEA 5KTMA 3NR2A 1UMBA 3NTXA 1ZH2A 2GO1A 1KO1A 2E1PA 2WWVD 5L3ZA 3S29A 1DS6A 1CZKA 3IR6A 4LY9A 3ORSA 2C2OA 1SPXA 1GLGA 2VDJA 2ZYAA 3R8XA 2D5IA 1GU0A 3ZD6A 3HNRA 1FP4A 2QVYX 4FR0A 2QRVA 4KPGA 5IT9A 1EX1A 3KQTA 1O94C 5FXMA 2Q7OE 2ZTVA 5JHHB 3W2IA 4QM7A 4YMWA 2IXFA 1C4WA 3FM9A 1JYEA 4ZO9A 4YRCA 4CUKA 3T3PB 1MH9A 4IAOA 1PX2A 1VJTA 3C3MA 4ZZIA 1L5VA 2H29A 1X42A 1O9BA 4F46A 1PWHA 1RMYA 2I80A 4G9EA 1TJ3A 4QBGB 4WGFA 2VJMA 1NVVR 3T1TA 4G36A 3THWB 1W5BA 3DL4A 2CNBA 3OM8A 4ZOCA 1T8UA 1NNI1 3V8MA 1PIWA 2O7NA 1RZRA 3GJ4A 5LQMA 2YN4A 4Y2JA 2V0CA 4FZ5A 2G82A 5C8YA 4V0LA 4OX9B 2JIZA 2WZCA 2AFHA 9LDBA 2Y1OA 1M6NA 3P0EA 3WLSA 5ABPA 1J5XA 2BZGA 3T8YA 1HT2E 3RKSA 1EDBA 4FYWA 1Z2AA 5AJYA 1EGHA 3DOCA 2VH2A 3C6XA 1JXMA 3UMYA 1WQ3A 3AR8A 3MMSA 4F1KA 1XTUA 1YL5A 3C24A 1V1MA 2P9ZA 2FZKA 1P2FA 1ZH4A 2O7SA 3K09C 3LFUA 3OT1B 3PXAA 2P1DA 3Q15C 4U6QA 3UAXA 3DXYA 3G5LA 1L1QA 4TYMA 2ID8A 1WKBA 3DE5X 3HR7A 1K3UB 5CX4A 1PR9A 2O5RA 1VCOA 2P79A 2XA2A 3JQAA 4QOFA 5J23A 4UU7A 1WCIB 4RQTA 3ZUPA 1VI2A 5TSDA 4J7UA 2IHKA 2Y6VA 4EA8A 5K0ZA 3BWVA 1QK3A 1BAPA 4GX2A 5JAIA 1FYVA 5ECYA 1ULUA 3E5MA 2R5WA 3DAYA 1SXPA 4HJRA 3A6FA 1I5OA 4RKEA 3HJAA 1P2BA 1V8DA 2Y0DA 3QVJA 3R5XA 5IM5A 3ADKA 4D6XA 1CZNA 2FMUA 3VU9A 1OXMA 2QLJA 3WWCA 3EDOA 3GCZA 4AP6A 2ZK7A 2OAGA 5DRYA 1H0SA 4HWRA 5HE8A 4C89A 5J2TB 1NSYA 5KVCA 3DC2A 3FJYA 1RQGA 2AOUB 3GU3A 3DV0A 1QG4A 3HXMA 2B8EA 3HEBA 1DIHA 1P1FA 3HWX1 3IT3A 3H2ZA 4LJKA 4BZXA 1FLVA 5IAOA 3CPJB 4AUMA 3O90A 2JAOA 1QYDA 1Z7EA 3IVGA 3SY8A 3QMVA 3N6VA 3V8NA 3K15A 4LJ5A 2CZGA 3SHWA 2JLXA 1ABEA 1ESNA 2CXSA 3BHMA 1PR0A 2WSBA 4JUIA 2G25A 2VNJA 3A3OA 3AIMA 4GM0A 3AI1A 5ALSA 3H2YA 3CS3A 3GEHA 2JFYA 1F1BA 3V42A 5SV2A 1OUMA 2G1KA 3IIEA 2IYQA 1Z4MA 2XLBA 4TOIA 1RKUA 1L5HA 5SYNA 1P80A 2AXPA 2PGIA 5MDHA 1GADO 1UPCA 1EM8B 2XUDA 4QFCA 2ZT7A 2R65A 3FLEA 4RJLA 3S0JA 1EH5A 1XSEA 1L5WA 4PRKA 2W98A 1K0UA 2GN1A 2JRCA 4NC9A 1MW8X 2ZUCA 1RXCA 1V6SA 4Y1RB 1IN5A 1RWMA 5CEJA 2CDAA 5J2UF 1G1AA 2ZAOA 3VR0A 1RLIA 4HDSA 4NICA 3FYTA 1A5ZA 1IOLA 2SKDA 4RE6A 4WLEA 3TH5A 1WR8A 5JSHA 1QQTA 2M6KA 4QHTA 3O7WA 1R8XA 1US8B 2J32A 2PSHA 4GOKA 1AO3A 1N5DA 1U0FA 2RHCA 3C5VA 3LE8A 2IPAB 5LXTF 2IHBA 1X7XA 4QJ4A 1WP9A 2JANA 3C87A 3PLRA 4G2NA 721PA 5JTUA 5GJBA 5EP1A 4F9TA 1O3YA 3TAHA 4JGIA 1RYBA 3VKGA 2HNKA 4PQYA 1H9BA 1FP2A 4LAFA 4YK7A 5EXSA 3AJDA 5IDQA 3ZHVA 4ZXPA 5BURA 4PG8A 3NJRA 5GIOE 1A9YA 1SBQA 3MS2A 4TS9A 3ORHA 3RSOA 2P2DA 1E1MA 4QOJA 4LGCA 2OZLB 2XTMA 1RVDA 1TW3A 2VH5R 3F4LA 3LZCA 4LHXA 2D06A 4BVEA 3U60B 2W2MA 2IPXA 1Q7BA 1QX3A 2VNHA 5CK4A 4DLLA 3I64A 3RVMA 2H2AA 1I7SB 4YASA 1UBUS 2O52A 4UVDA 1QTQA 3UAZA 1Z26A 2TMGA 1EK5A 4WCDA 5LJLA 4JLNA 1AC5A 1DNPA 1N2ZA 5BSVA 4OH1A 2XVZA 4HGOA 3GQVA 4C6TA 2B7CA 3I58A 5I9BA 1H2HA 2BHSA 1PEKE 3ZHUA 2EBUA 4MQBA 2COUA 1GTG1 3S2EA 3U7QB 3CYFA 4RVFA 3ABZA 1JAIA 2VCYA 4JJGA 4EMUA 2F7SA 2PTGA 1T5TA 1E2NA 1V7QA 4ZJZA 3G0OA 1IQUA 3H4VA 1XZAA 2JFQA 2O2DA 4Z51A 4QFBA 5BO5A 3KV3O 3AFIA 3P2IA 3V48A 4LJ4A 4KPEC 3CEAA 5JAZA 3G88A 1QBKC 1WHTA 3CLTD 1MO6A 3GN2A 1ZJYA 3ZHYA 3T7RA 5EJAA 2WIAA 4L28A 2PA3A 2QTGA 3E9EA 3L93A 3IAFA 3DEAA 3PCXA 5IEBA 4I2NA 3T7JA 2BFOA 3HCAA 4WGGA 2YH2A 4GBGA 4TYWA 3KSAC 3AIKA 2P75A 3TINA 4D9NA 1HDCA 4ES6A 3O8DA 1P3JA 2JA2A 5DGTA 5AVQA 2FP4A 1ZK0A 3N70A 3ANYB 1BMFA 1T25A 1FS6A 1W88A 4HNAA 1QP0A 4BDTA 1B8OA 3ZU3A 2OD7A 5U1PA 4EX6A 1PR6A 3AF4A 4KHZA 3LKZA 2C8KA 3FCUB 3W8DA 2A7XA 3F67A 4FHFA 1OKKA 2JIRA 2VWHA 3NFYA 5GV7A 1SMKA 5G4KA 3ESRA 1RPAA 2JFZA 2EVWX 3R6WA 2PRKA 4XWYA 4AECA 3IA2A 5BVGA 5JD5A 5AKKA 5CA0A 1BEEA 1KEEA 1OFUX 4K9QA 2BFEA 1GLNA 2X8BA 1G2QA 2JJYA 3VC1A 3OE7D 5CYGA 1LBTA 4PYQA 3TG8A 1PNRA 4DQKA 1Q3KA 2Q5EA 5CB4B 4EA6A 3L18A 3A6KA 3GEGA 4L8LA 3TUZC 2YJGA 2A5YB 3MXOA 2JAHA 2WHQA 5C1PA 2DHDA 3FGNA 2A4MA 3MNFA 3WIVA 3K9HA 1XCLA 1YIOA 3AOEA 3H18A 4A6PA 3OQ6A 4PXSA 5ADVA 2ZRCA 4GZ5A 4MVWA 4PZAA 3SXUA 3D8TA 1KMCA 2VKTA 2Y99A 3HUUA 4L4YA 1NE7A 3MSXA 3B1FA 4DXDA 1DHTA 4N41A 1DC5A 1VJ1A 4E1BA 2DM6A 5BN5A 5IZCA 4N9QA 5A05A 1I01A 2XQGA 5DBIA 1E3EA 5HUQA 3CEPB 2Z9BA 5K2OA 5HCNA 3WIOA 3BPSA 1PAUA 3T3DA 2BFBA 3D6UA 3IUQA 1PJ3A 1CP3A 1HE1C 3EZNA 3D1JA 3JD1A 5ECGC 5EWLA 3SQLA 4B44A 1HQCA 1JEYB 3WHKA 1N7HA 1T0UA 1QKIA 1ENOA 4PIMA 4BN4A 5IRCD 5FPHA 1U0TA 1U2DC 5MF6A 4MDFA 2XTJA 4I1PA 3TLAA 2QT1A 3U19A 3MEQA 3KDSE 1UUFA 2GPAA 4AQ7A 1FYDA 3MIIA 3WNQA 4G86A 5JAHA 3GVHA 1X7YB 4A9AA 1XP8A 2E4VA 3WNZA 4ZCIA 3AGPA 4PV7A 3SJZA 3PXBA 2F2TA 3HDQA 1DT3A 3P9NA 1AKVA 1GAJA 3OE7A 1JG1A 4ITUA 1QANA 2GF0A 3MTAA 3M6UA 4Q3DA 3VPGA 5BWCA 1V8FA 4JYMA 5TR9A 1SCJA 3V4ZA 2A30A 4DXHA 3PQ5A 2PS3A 3WGMA 4LSGA 2BSAA 2HTFA 2OESA 3MUNA 1MBZA 1CRQA 2QORA 4BLTA 5CVEA 2ZT6A 1NAIA 4IEFB 4L4ZA 4O4HB 5JAMA 5L4SA 2FJ0A 2BKVA 2G17A 4LJSA 3DBRB 4B2YA 4LY0A 1PT8A 1NT4A 2CLFB 4TMVA 4KQJA 5CYOA 3N6RA 2BGUA 3LYHA 3PC4A 1U8YA 1SIOA 2AYYA 1QFZA 3EQ9A 1NL3A 4OHXA 4Q4CA 1BWQA 1F38A 1E9DA 2AE1A 3EHDA 4YJFB 1E79A 2XDQB 3MS7A 3NNDA 1J39A 2HSDA 1FVHA 1V2HE 5I7EA 1P5HA 3BMNB 2LXNA 3KXDA 4AJPA 3HCPA 1RLJA 4B6SA 4DSNA 1IBKB 4X8HA 4X8OA 2P2GA 1SK8A 2IPMA 3HA3A 4OU4A 2X0DA 3QJ5A 3OT1A 2DZDA 4O3FA 5M29A 1P1JA 4HV4A 3N39C 4S12A 2C2KA 2GEVA 1KBQA 2HD4A 2Y2UA 5A3SA 3VI3B 1WCIA 2FR8C 3CRNA 3LY9A 3FTCA 3ONDA 4DA7A 1Y1LA 3PPVA 1RE0A 4F2WA 2ZM5A 3JTEA 5B6PA 3ZV4A 3FTFA 2OV4A 1E3DA 4Q4AB 1C50A 5HQJA 3AKCA 3N76A 4BQEA 3MGAA 2N1MA 3FJOA 5F7ZA 3TRDA 4C0BA 1J0XO 1TMOA 1U94A 4C0AC 1QRSA 4KZKA 3UT6A 3CVOA 1GN9A 2Q50A 3DR5A 1W0KA 4C3VA 5AM1A 3ULKA 1V5GA 5J2TA 4Q4HB 4HQOA 1Q7CA 1RJWA 2HUNA 2WA2A 2ZYDA 3BDAA 3NHMA 3RO7A 4BEVA 1MA0A 4JYZA 4LCEA 2ZKIA 3OFJA 1FRVA 2AOUA 2VF7A 1MMFB 4IOLA 5EEGA 3JQQA 4ZK6A 1ULTA 5ITSA 3LL7A 1SWVA 4UAGA 3P20A 4R2HA 3NM4A 3LWDA 4LPKA 2J09A 4NMWA 1OWNA 2ZUDA 4D9CA 1I14A 5DEIA 3RUPA 2J0SA 1KBOA 3HDGA 2YQ4A 3L1UA 4OXQA 4S35A 4EAQA 3K71B 1F8UA 3C3BA 4JLDA 4WAUA 3RM3A 4HGRA 4OSOA 1NV8A 4G0PA 1SXJC 4AYTA 3JRXA 3KKZA 4HZUB 2C2YA 2DT5A 2NO6A 3RS4A 1KOGA 3LOUA 1GPWB 1GITA 1EM8A 4AS3A 4PGAA 4JHXA 1NVKA 2C84A 4TRMA 1I80A 1KXJA 1Y3HA 3QX9A 6REQB 2FSHA 1C9JA 2R6JA 3ABQB 2HLNA 3HO1A 5DOZA 1JW9B 3F9CA 1PL6A 4MTLA 3NNSA 3NH9A 2JGKA 3QOFA 4HAIA 4Y1RA 4ZRMA 5PGMA 3ZBPA 3GNTA 4BQSA 5JS1A 2TMKA 4IQ4A 1S8NA 1J07A 5L8VA 5CDGA 4DZRA 4H31A 2WJYA 1US8A 2P5SA 3Q88A 1LPNA 2OT3B 1Z88A 2EFJA 2ZUUA 1QTRA 4IJ5A 4IJMA 1Q0SA 2VT7A 4FWIB 1P17A 4C14A 2F1KA 2C9CA 2I1LA 2DUUA 4XX0B 1DOAA 1DTSA 2UYQA 5B1HA 3KOZA 3CVUA 3ECSA 3E22B 3HFRA 2CLOB 1NDUA 1ILWA 3O3MB 5A9RA 4ED9A 3SR0A 1XLVA 2O14A 3RARA 4QPPA 4DNXA 1EWQA 2ODTX 2WYIA 4YX9A 1ZIXA 4JU9A 1WABA 4MRSA 2OZLA 3USES 2XUPA 1ZSNA 1DBIA 1NJSA 2QAGC 1RT9A 3FPHA 3H86A 4J6FA 3F7NA 1T2CA 3GPIA 5JJ5A 1ZBDA 2NN3C 1NLYA 2H11A 4NAVA 4UEKA 4FX5A 1CKEA 3IPYA 3T1NA 1DKOA 3MF4A 4OLHA 3ZXUB 3EASA 1KGDA 1V3UA 3AHEA 4K3UA 1BCSB 1JLLB 1XQVA 3ZIUA 5F4BA 1R18A 3TVTA 3CBGA 5IM4A 1DBWA 2WF5A 4Q1AA 4JI1B 1GZHB 1XL1A 2Q4RA 1U0SY 5DLDA 1ONOA