3GJ6A

Crystal structure of human rangdp-nup153znf1 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj6A00
3UG6A 3ICQB 4PTLA 3B2EA 1SVLA 1CEEA 2QP4A 4FMCF 1E2KA 3W5IA 1DO2A 4AURA 1NIJA 2FMXA 4Q7JB 2VIIA 3RS5A 3W8RA 3TSZA 4B6FA 3ADBA 3GLGB 3K0CA 4DLWA 4TWZA 1D6JA 1Y3AA 2BWJA 1MO5A 3H1TA 4BLPA 1HURA 3TK1A 1GL7A 3W8NA 2O5VA 1XZPA 3LFUA 5H1YA 3RS3A 4AIIA 3JVUA 3QKTA 5GJVC 2C98A 2R6DA 3SEAA 4DIDA 1H8EA 2J0VA 4ZPXA 3OAAD 3QPUA 5DSZA 4Q4JB 5JSZA 2F7SA 1S9DA 2BBWA 4EPRA 1QHXA 1VYTA 2ZYVX 3CZQA 1N5IA 1NMXA 1KAOA 2WJVA 3LLUA 1HA3A 2IF2A 3TVTA 4N3NA 3SI7A 1G8YA 4DC9A 3FKSA 2GBLA 1YZGA 2A7QA 3SBDA 3GLIE 2MMCA 2BCJQ 2JLZA 1G20E 1XU4A 1XJCA 1NLYA 1ODFA 3CNNA 1CR1A 5E7MA 1L8QA 1XEXB 2ZJ8A 5EUQB 4IVPA 4W5WA 1XB2A 4QGAA 1DAGA 4AYTA 2ZRHA 2XTMA 4JBXA 4Q03A 2ZQ5A 2R2AA 4LJ9A 2VP4A 2CHVA 4JL5A 2V54A 2Z5FA 1Z6XA 1TQ4A 3FMFA 3K0CC 4HLDA 4XTCS 1AA9A 1SQ5A 5BYKA 2ZE6A 3KKNA 2EFGA 4UXHA 1JJ7A 4WA7A 4HZUB 2JDIA 4LV8B 2W6IA 1IY1A 4BRUA 1X1SA 3GLHE 3WMEA 3NEJA 5GJBA 3B1YA 5AUQA 2GJSA 4XSHA 3I5YA 1R6BX 3N70A 1KI2A 2AWNA 4US0R 3HU1A 1G3QA 1IN5A 5FH9A 4XJXA 2WIAA 4MDFA 1XX6A 2XB2A 4ESVA 4M8NE 3VU9A 1QHHA 1M8PA 1IN4A 2BVNA 2GBLC 1ZM2A 2C8VA 1RYFA 2H92A 5EE5B 3W9YA 3IEVA 3CIOA 1CTQA 1R8SA 2JAQA 5CLQA 2YKGA 2FN4A 4WIAA 3UMRA 3MLEA 2IHYA 221PA 2W0MA 2DWQA 3QI2A 3KUCA 3KTAB 1U8ZA 4LBYA 4URXR 5TV2A 2QMEA 4QL3A 4IJMA 2AKAB 3ZGXA 1CBUA 4I4LA 2EFCB 4URWR 3FMIA 4LPSA 2G88A 3L0PA 1QBKC 4C9BA 3GLIB 2FV8A 1GDDA 1RKBA 5CYPA 4LJ8A 4C0JA 1S1MA 2GA8A 4M9ZA 4A36A 4DSUA 3GJ0A 5HZHA 5SZIA 1OH8A 4QGHA 3U6BA 4EUNA 3OEEA 3FFBA 3KQNA 4RD2A 4UQOA 2F9LA 4YXWA 4XOIA 2R6AA 1GNPA 3NVAA 1DAIA 5LB2A 1U0LA 1T0HB 1YZKA 2A5GA 3LVQE 4J0QA 3I4LA 4MRSA 3EPKA 3NTUA 2P6RA 1W0JD 2VH5R 2QTHA 1YRBA 1NBMD 1KI1A 5LD2C 2KI5A 2QEQA 4PSKA 1KO5A 4F91B 4LSGA 1EWRA 1M1YE 1Z0JA 1E2HA 3FHOA 3OFND 3GLHB 4LJ5A 1XMIA 3N5CA 3VKWA 2FSIA 4WZ6A 4MRRA 1J8YF 1YHNA 4IEIA 2H18A 4BLSA 1N6OA 2W2VA 5L3SB 2FZLA 2XXAB 3H4MA 1TUEA 3I8SA 2ZUBA 3MWYW 3HPRA 2O8BA 1SHZA 4MA4A 4O0MA 4A0FA 2CBZA 3GPLA 1BMFA 4A2QA 1U0HC 3A1VA 1J2JA 2OESA 4N1AA 2ZE7A 2IYUA 3KFXA 1QF9A 4BFVA 2D4HA 3KQKA 1D9ZA 1KKLA 2YWFA 1JPNA 2VQSA 1PLLA 1GFIA 5IK2A 4TL8A 5JEEA 2V1UA 1AS2A 4B48A 2QBYA 1IQPA 3MD0A 4M9SA 5KNDA 4D0GA 4PO9A 1KJZA 4IHQA 4KJZA 4RSGA 3EZ2A 3GQBA 5BN3A 4CEHB 2IC5A 2QT0A 4CRWB 2IYVA 4OI4A 3X1YA 1E2GA 1Q57A 2FG5A 1SKQA 3S1AA 3K8YA 4MGYR 4DCSA 1YR8A 1OXSC 3AF2A 1GVNB 4BFYA 1E0JA 4MGZR 1LW7A 5H68A 3AQ4A 2QN6A 4XVUA 1UBGA 3CM0A 4KV9A 4DSNA 3WRYC 1E6CA 4R98A 4CT5A 4B34A 4GL2A 1YR7A 2NPFA 1NI3A 2ZJBA 1E94E 4EAQA 3TMKA 3VNVA 1FNNA 4TYPA 1KI6A 3KJEA 3ZIAA 2PCLA 1T5LA 1IN8A 1KO4A 3B60A 4GOXA 1YE8A 1KHTA 2DPXA 2J7PA 4NTZA 2D2FA 4UNNA 2R6FA 2ZRBA 4TQUS 5AK0A 5BYJA 4QBIA 2DFNA 1K6MA 1G21E 1Q12A 3WRXC 1W36D 1UDXA 2JEOA 2HDNB 1R0YA 4H9GA 3EPHA 4G5GA 2FGKA 1SXJA 1GUAA 4JLOA 4OQNA 4V0NA 5B2ZA 2ZJOA 3KZ1E 3IDQA 3AKDA 3LDAA 1RE0A 1EGAA 4PX9A 2MSDB 1XXHA 4KVGA 3WYAA 1XBTA 4IOJA 2GJ9A 4LYHA 1E9BA 1ZM4A 2RGNA 4S35A 2JLUA 1Q0UA 2PLFA 1E79D 3HR8A 4A9AA 4OJKA 1AGRA 3EPLA 3U7FB 3BB3A 2Q6TA 2Q9AA 3NBXX 3NH6A 3LW7A 2F3TA 3KB2A 3LRPA 4PPFA 4B3GA 4M1KA 2NOAA 2PEZA 5GADl 5IDVA 2ZYUX 3OAAA 3M6AA 2ATXA 3R7WB 3PJRA 1NSTA 3L8ZA 3U61B 3LD9A 4BLRA 3TW4A 1COWD 4BLTA 2JJ8A 3BOSA 1ZUHA 1ZD8A 1ESNA 4YONB 3QKRA 2RGAA 3BH6A 4Z8YA 4DDTA 1NVVR 1U99A 4AKIA 3MG9A 3CPJB 2ZTSA 4QXAA 3QVUA 4IFBA 3GLFA 1NJGA 4POAA 5AUNB 1KYIA 4AKHA 1UF9A 1SXJC 3CWQA 3B7GA 4FWTA 1L7VC 3VFDA 1KNXA 4EPWA 2GCOA 1OXUA 1AQYA 1KI4A 5JZVA 4B71A 4KLNA 3GJ5A 4ABYA 1OW3B 2EQBA 1Z29A 2X8AA 1E2JA 1KO7A 4QGGA 3EPJA 3TSOA 2JGNA 3KQLA 4IDNA 1Q3TA 2VO1A 1XPRA 1IAQA 4FIDA 2RGNC 2JLRA 1E1RD 4EIWA 3F8TA 4JBWA 2D74A 4GZMA 4LRWA 1BYIA 2IYZA 2WV9A 4LY6A 4DEXA 4TZ6A 4LV5B 1VG1A 1A2KC 3QE0A 3DEFA 4FCWA 4BGDA 2OCBA 1ESMA 3TQFA 1XEFA 3EG5A 1R0WA 1G16A 3U3RA 4BE7B 4ARZB 1VMAA 1SVOA 3DMDA 2DWPA 4OK5A 4Y0AA 2YNMA 3A1WA 3KFVA 4IVQA 4RZ3A 4V0MA 121PA 1IHUA 2FH5B 2QE7D 2ONJA 3TE6A 1OFUX 1X1RA 1D5CA 4N0DA 5AWFC 4LI0A 1XTRA 4GP6A 4C3ZA 1JR6A 1B0UA 2PBRA 1P9WA 2KB0A 2IYWA 5A0FA 2QRZA 2VHCA 1R0XA 1Z08A 2ANBA 2PZEA 2JLSA 2HCBA 1UKEA 3NG1A 1QZXA 3TUJC 2OZEA 1TADA 2QTFA 3PITA 3SC3A 2DB3A 1TU3A 4AG6A 3SQXA 2ERXA 1VCOA 3KJIA 5C2JB 3I5XA 1F5NA 4KVAA 3AVWA 3CRQA 1W44A 1OIXA 3QF7A 4A4DA 4WW0A 5JEDA 5ELXA 5E7JA 2G0TA 2QL6A 4OK6A 2PZGA 1PUJA 2JATA 3GJ4A 1IJFA 4KFRA 4QJ5A 1S0UA 1XFAA 2HUPA 4ZIRB 1JR3D 2H7VA 2Q21A 4TMZA 1QDEA 1OH7A 2ZS8A 2CK3D 1KK3A 4TL6A 4AC9A 5JHHB 5HTKA 3VMFA 4RCZA 1HQCA 1CS4C 5TVKA 3SHWA 1W0JA 1WA5A 2ANCA 2VF7A 3GJ3A 4EPTA 1NBMA 2ODWA 2QQ0A 2V8OA 5JECA 2QP9X 5FL7D 3FVQA 3CUEF 5JSZB 1NIPA 4QC2A 3SJCA 1G3MA 3SNHA 5JRJA 2PT5A 3OESA 1ZIPA 3V4FA 3OFNA 4RFVA 3BD9A 1DVRA 5CDFA 3T1VA 3U3JA 2VHQA 1VHTA 3RYTC 1OHHD 3K09A 3L8YA 3RC8A 4AKGA 2ZRKA 1IM2A 2ZE8A 1NY5A 2XTZA 4HLCA 2Q3HA 1LF5A 3D31A 1UJ2A 1KAGA 4HB2A 1GILA 1N6NA 2FE4A 5AJYA 4BZQA 3QY0A 3EZFA 3VHXA 1HYQA 1DELA 4X8LA 3CF6R 1FNMA 1WRBA 5JS7A 3JZAA 2IS6A 1GRNA 2QGZA 4PPQA 5IHPA 4QM7A 1ZVQA 4DSTA 4F38A 1IOZA 1QHSA 3NIBA 3L82B 4BFSA 2WWYA 3CR8A 3GCGA 5B30A 3BE4A 1R0ZA 3RLFA 5GVRA 1II8A 4QOSA 2PT7A 3QOFA 2QMOA 3AVYA 1EFRA 1GNQA 2DR3A 2E87A 5DYIA 4LHWA 4F7WA 2A30A 4M9QA 5EXPA 3AF3A 1NVUQ 2YWHA 3ECCA 3LVRE 4DLUA 3MJHA 3L2OB 4TYWA 5A4JA 1G4AE 2GCPA 5EE3A 3AP2A 3PV0A 4XVRA 1FPMA 1TL7C 2UZ3A 5J5CA 3K09C 1Q22A 4JLDA 5DH9A 5LD2B 2BKUA 2ZI7A 3RSLA 1WXQA 3ETLA 2L0XA 2WWXA 3ND8A 5KUTA 4OI0A 1N3BA 2IT1A 2QG6A 3QKSA 4P31A 1U0JA 4HLUA 4KSBA 3OHMA 4LZZA 1HV8A 3WBJA 4PAQA 5FTLA 4OQXA 2P3SA 2KBFA 3DDCA 2C78A 1OB5A 1NY6A 3D8BA 4HEJA 2ZR7A 4NP6A 3NBYC 1ELOA 5J4HA 5C1BA 4RZXA 1DS6A 1FTSA 2ZJ2A 4G1UC 3LH5A 2F9MA 3BERA 5JCPA 1C9KA 3P26A 1BIFA 2RGCA 3KX2A 2BMFA 2WMNB 3PUWA 3PG5A 4BFWA 3KQUA 1Z0IA 1E79A 4JL8A 4TTPA 4B76A 2J3EA 2OXCA 1YZQA 5H70A 1NMYA 1JBKA 1II9A 1G3UA 1WBDA 4NCJA 4B44A 3DKVA 4NCIA 3O8RA 1YQTA 1ZMXA 5C18A 2ZANA 2J59A 3IIMA 4JBYA 3PR1A 1COWA 2ZITA 4IOKA 4HLUC 1KMHB 3K9NA 3FMOB 1NP6A 1W36C 2FPLA 2Q3MA 1OV4A 4JLBA 2WBLC 4NCKA 3U4QA 3H2YA 1F2UB 2OLKA 1CR0A 2N1BA 4DLSA 4JZKA 4RFSB 3UXMA 2JASA 1EFHA 1G7TA 2QUZA 3HYRA 5KPDA 4Q00A 4URUR 1UPTA 3KXLA 3UKDA 3E2IA 3EA5A 3MRSA 3AVUA 5KPJA 3B78A 3Q7PA 1MKYA 3BJIC 3VTKA 2PJRA 3OIVA 5EZ5A 2AR7A 4ZKEA 1XTQA 2KSQA 2PX0A 4UNRA 1ZAKA 1ZM3A 1HUQA 1E9DA 2DY1A 1E1RA 2GEVA 2H17A 3O47A 3PXGA 5FOWA 3CWZA 5FUWA 4DT1A 2VP2A 2OAP1 3FDIA 1KI8A 4HB3A 3TAUA 3MJRA 1NVVQ 1VG9B 4DXAA 4JSYA 2NPIA 1QG2A 3QF4B 1ZUIA 4LBWA 5JLJA 2ZI9A 3T1OA 2WSSD 2IX3A 3Q9LA 1RRPA 3IIKA 4Q1DA 3RAPR 4A6XA 2HLDD 3O8BA 2WVJA 3ZD6A 2KBEA 4JSTA 1R4AA 4AG5A 4B73A 5KU1A 1GKYA 1P60A 2C2HA 2J7KA 4MRNA 3WY9A 4TSFD 3R9XA 1Q44A 1P72A 1XTSA 4LC0A 4ON9A 3PEYA 2P6NA 4XWAA 3THWA 2QTVB 3O8DA 4QGFA 1KZGB 4CVNA 5HCNA 1B23P 3OE7D 1G18A 5K8UA 3HJNA 2QMUA 3DO6A 4BZPA 4P4UA 4ACAA 1P7CA 1BMFD 1SHKA 1ZCBA 4Q9LA 5HCIA 3QJYA 4DWJA 1BOFA 2BEKA 1RRFA 3QEJA 2FSFA 3FWYA 3RANA 3SS8A 1ZM9A 1BS1A 3GLGE 3NHAA 2XEXA 4B2IA 4E5UA 4C30A 3B9QA 4Z51A 1XXHB 2RAPA 1TQDA 2ZROA 2ZI3A 4MKGA 5CJ2A 2X77A 1HEIA 1E2IA 3FGNA 4EPYA 4QHTA 4PZZA 4ZI3A 1Z6YA 1JR3A 2RB4A 3AF0A 3RRMA 2VF8A 3AGQA 2IW3A 2WPDD 2CK3A 2O0KA 2ZRFA 4B3BA 4NH0A 1IY0A 4MITA 3DL0A 4WXPA 3K0AA 4YDHB 2ZREA 5J4VA 4B32A 2O8EB 1YU9A 4L9SA 2CXXA 4Q4AB 3G0HA 4TYYA 3BBPA 5FL7A 4RD6A 521PA 2WKRA 2OFXA 2G3YA 4MQBA 4M22A 3X1WA 4TMWA 4P3YA 5G3ZA 4OQFA 2ZRAA 2F43A 3SQWA 5HE8A 1EFUA 1E2QA 3OIWA 3GLFB 4IXMA 1VDZA 1TF5A 1KY2A 3GEIA 1F48A 1LS1A 4M1OA 4UJ5A 2VHUA 3ZZTA 4AY2A 1GG2A 3AH8A 1X6VA 2GDJA 3GFPA 2DFTA 2I1QA 1KJYA 1OXVA 1P2TA 4QG7A 1US8A 3W6OA 3P4XA 3TAHA 2C03A 1DG3A 1S2MA 1LNZA 1XTJA 2A5JA 3EIHA 3C5CA 3OEHA 1E2PA 2CCKA 4DSOA 5FR2A 2NZ8A 5JCZA 3T12A 4TLCA 1W1WA 1R5NA 2BC9A 1MO4A 1A1VA 3EASA 2WSMA 3I8XA 5JJKA 3CH4B 5L3VA 1NN0A 3Q5DA 4LJ4A 3RSOA 3WMFA 1G5RA 1GL6A 1KK2A 2VSXA 3VR2A 3C15C 4YMUA 4JLKA 1PZNA 2BCGY 4US1R 2J87A 2KE5A 2QSYA 3LQRA 4XWKA 3T15A 4DB2A 3RNLA 5L3QB 4MDEA 1CKEA 1G4UR 4KU4A 1F3OA 2IK8A 1Z83A 5BW8A 4CZ2A 4M2LA 3TSWA 3FOZA 5JJLA 2QAGA 2ZJAA 3SJZA 2GKSA 4V03A 5DYGA 4DCVA 2ONKA 3BK7A 4DLVA 3EC2A 1SZPA 1T0JB 4DLXA 5A5GA 1VCNA 1N0VC 4B75A 4EJSB 1KK1A 3P32A 2C96A 3QPVA 4JLMA 1MT0A 2CNWD 1E9SA 4A0HA 4PC6A 2BJVA 2JLYA 3SJBA 4FWIB 4URYR 3I72A 1J8MF 3U60B 1HT1E 4R71A 2K5UA 4GRAA 1OYWA 2VP9A 3QENA 5J4YA 1A4RA 5EQTA 4Q4HB 4A8JA 1JI0A 4CEIA 2F6RA 2ODEA 3AVVA 3ADCA 4Q7MB 1GRQA 1E9FA 2YYZA 3RWOA 3ZD7A 1EG7A 1FW6A 2IXFA 4OYHA 1ANKA 3B9PA 3BORA 1YRAA 2ODBA 3GEEA 5KSYA 3W3AA 1TU4A 1P2SA 4ZDKA 1GRRA 2A3RA 2AL7A 1VPLA 2H1LA 2V55B 4PSVA 4QNMA 4XSGA 5HE9A 1MOZA 1FP6A 1WE2A 1L2TA 1PUIA 2O8FA 4TLEA 1KSHA 5CK5A 1VIYA 5F2EA 5KHOC 1OXTA 2QAGC 4M4SA 4PFSA 4Q1FA 4D0LB 4D26A 1EX6A 4HUQB 3ZVMA 2IBMA 1NN3A 3AUYA 2WWGA 4BEBA 3AKEA 4PHGA 3B6EA 5DLQC 4OK3A 1E4YA 1W4BA 2BBTA 4N0EA 2C9YA 4C0SA 5F98A 1M7HA 3KQHA 1KOFA 2WJHA 3PUZA 1E0KA 2WTUA 1S96A 3LNCA 4Q48A 3IQXA 3UMSA 1ZNXA 1E0SA 2R9VA 4CW7A 3WP0A 4A8JC 4B3FX 1XEWX 3A4NA 3EARA 1HE1C 2FF7A 4KHZA 4Q47A 3Q85A 1AS0A 1Z6TA 2J45A 3BH0A 1NF3A 3CONA 4TLAA 1WDTA 2NGRA 4I99A 4KBGA 3HU2A 4ZKDA 2A78A 2FFAA 3GD7A 4WOPA 2OBNA 2FFQA 4MKIA 4PQYA 5JWHA 3QBTA 2Z4RA 621PA 1JJVA 4IDOA 1JEDA 1Z2AA 4WZAE 2Z43A 4ASUD 3MFYA 4NBSA 5LBIA 3P20A 2WSSA 4HZIA 1UBFA 4NYIQ 2ZYTX 3A1SA 2HLDA 2VLIA 2ZEJA 5CIWA 1LY1A 3K53A 4HAWA 3IHWA 1TEXA 5JRZA 1E2NA 2QM7A 1CRQA 4TSFA 4LUCA 2REBA 2GXSA 1TEVA 2ERYA 3QVVA 2A2ZA 3IPXA 3J81k 4MRVA 4LCBA 2J1LA 3QKSB 3OE7A 3BXZA 4KFSA 2H16A 3UK6A 2W0SA 3EW9A 5BWMA 2PMKA 1OH6A 1XWIA 3JVVA 5GJWC 1XEWY 1DADA 4JT2A 1KK0A 2V4ZA 4ILEA 3SYKA 4JYBA 4GP7A 1QVRA 2GXQA 2XSZD 4IOMA 1N0WA 4FCVA 4RKEA 1OIWA 4YMSA 2J0UA 1KSGA 2LWIA 3RRNA 2OILA 5IT5A 4OHYA 1U94A 5EZ6B 2AWOA 2G83A 4L16A 3CX8A 1EFRD 5TY0A 4M1YA 2WPDA 4HAZA 2O8CA 2BJWA 4PO8A 2HJGA 2CJWA 4KAXA 5EUMA 3SR0A 3EWAA 2FSHA 4KFUA 2IYQA 3FE2A 1A7JA 5FBLB 2V3CC 1P73A 1IXZA 3Q7QA 2GZDA 2ZRPA 3C41J 4IEEA 4WVFA 4DLTA 2CVFA 4HDCA 4LJYA 1RRCA 2CLDX 4RCYA 5EXSA 2Z4SA 1XD2A 2CHGA 1R5BA 4B47A 4D4LA 1N5JA 1A2BA 1XMSA 2GNOA 3U4QB 3SU8A 4U5XA 4EPXA 1UADA 4HAUA 1Z0KA 1KDOA 3OIYA 3GMTA 1T9HA 2BBOA 4L4UA 2WKQA 1ZU5A 4PHTA 4L5BA 1Q1ZA 1NG9A 3C4JA 3HYTA 3L0SA 2E1RA 1W4AA 2UZIR 1IN6A 3T06B 4LYFA 1IXSB 4ZCIA 4CEJB 3SZRA 2O8DB 1XDBA 1KIMA 1N6LA 2YINC 4TL7A 2AXPA 1FMJA 4EQ6A 5G41A 5KTYA 1KMQA 1RW4A 1HQYE 3KL4A 1DE0A 1R7RA 3LXXA 3RRZA 4LJAA 2NO9A 3E70C 1TX4B 2FDCA 1FUUA 1VKJA 4QHSA 4GOKA 2NQ2C 1ZNZA 5DGXA 1G8FA 5K8IA 3LW8A 1Z63A 4RD0A 2WOJA 4QFMA 1JXMA 2BHRA 3A6PC 4P4SA 1XJ0A 4DHEA 2V7QD 1GL9B 2ZRDA 4PC1A 5FTNA 4ERNA 1AK2A 2ZSDA 2ZI4A 2IF0A 3VR1A 3WYFA 4C0HA 2NMVA 4GMXA 4PPGA 1JAIA 3NBZC 4L8GA 4MYTA 1ZNYA 3A58B 2CL0X 4OKSA 3B85A 1JEEA 1IBRA 3B82A 3GJXC 4K46A 5DISB 5JWRA 3K0SA 4LHXA 4Q9HA 4BLOA 2NO6A 2OV2A 3TR5A 1U81A 4PC3A 2RCNA 1KNQA 2CNWA 2REXB 2IS2A 3LBNA 2GAAA 4JJKA 1RIFA 4HATA 4MYUA 4TN1A 3U3KA 3UPUA 1VYUA 1FMLA 1ZYUA 2D06A 3K0FA 1OKKD 3PCRB 2EWVA 4KI0A 1KJWA 3K70C 2WM9B 4NMMA 1BKDR 3LY5A 2GJKA 4UXIA 1YJ5A 2WWFA 4LHVA 4U00A 3H0KA 2D7DA 1T6NA 1MABA 2OAQ1 1NNEA 1DBSA 4GSYA 1G17A 4LOAA 1G6HA 2NG1A 1F2TA 2IL1A 4GNKA 5FPYA 4BEJA 3THXA 3EIEA 4Q9IA 2F1RA 2GHIA 3AM1A 5TDHA 4M1SA 5CM9C 4D25A 5EXTA 2ZRNA 3B1WA 1WP9A 2DFLA 2VP0A 3VNUA 4A0GA 4G5QA 5JMTA 1N5LA 1NN1A 4DBLC 2A9KA 3GFTA 2A5DA 3KXIA 1CULC 4UKDA 3R20A 3LA6A 2P65A 1DOAA 3LAWA 2EFDB 2XZOA 2J9RA 1AKYA 3VR3A 4CT4B 1KDRA 2XGJA 1YZUA 3TIFA 2ZXUA 2IYTA 2F1IA 4GPTA 2ZM5A 5DE3A 1GKUB 3VR6A 4C0AC 4BFTA 1UAAA 3QXHA 3VR5A 2FJUA 4XWOA 2VL7A 4C0LA 3WHKA 3KKQA 4XD7A 4IVRA 2KJQA 4RD3A 3VX3A 2P5SA 2AHOA 5FBQB 4Q4JA 1G1MA 4OHXA 4O3MA 1W48A 1G3RA 2WICA 3DVLA 3U7HB 2GTPA 3HWSA 5JI3E 2NIPA 2EFEB 1R8QA 5JWOA 4BQSA 1DO0A 1OXXK 2H8KA 1YZLA 2QQEA 3IQWA 3X2SA 3ZS8A 2J5XA 2W6JD 4DVGA 4RKFA 3E1SA 3R9WA 5JS8A 1PLKA 2GRJA 4E22A 4DRZA 1UDWA 4EDHA 4ASUA 1XEXA 1N6KA 1LVGA 3BFVA 4PC7A 3IIJA 1G8HA 2DWOA 3CB4A 1U98A 3Q72A 1Q1QA 1J99A 1VCMA 1NSFA 1G7RA 2XJ9A 5G3YA 3T5DA 1OJLA 4A6PA 3VKGA 3EZ6A 2ZSAA 3A8TA 5SZKB 3DM9B 3KKMA 1XMJA 4Q1CA 3AVOA 3D6TB 3MUFA 4WZBE 1KSJA 2R6CA 4PANA 1TF7A 2XITA 3K9HA 3I73A 1W46A 4JVNA 2BEJA 4LC1A 1JXOA 2Z6VA 4OHWA 2E9SA 3A1TA 3KXKA 2ZJZA 3DPUA 1XMVA 2V6JA 2FOLA 4H1VA 3TLXA 3TUIC 1J7KA 2SHKA 2WZQA 3CH5A 2ORWA 4WBSA 2ZVPX 4W9MC 4TT3D 1I4LD 4Q1EA 4BLQA 1QHIA 5CITA 1TTTA 1OB2A 3REFA 1O3YA 5FUVA 2XSZA 3EX7C 3NC1C 4A8JB 2AD5A 2OFOA 1FFHA 2QY9A 3OEHD 3T61A 3TH5A 1GZSA 1M7GA 1T3HA 2VRWA 1S9HA 2YHSA 2RGXA 2EU8A 1A82A 5D3MA 2REOA 2GEDA 4BUJA 3F0TA 2XJ4A 4KO8A 5KSOA 3DHWC 3ADDA 3KTAA 1S1CA 3A1UA 1KZ7B 1N6HA 1KGDA 1WF3A 1P4SA 3BB1A 3CZPA 2WIBA 4B3CA 3VU9B 3GLIA 3R8FA 3NDBB 1QHHB 3I92A 2ORVA 1Z0FA 2HEIA 4K81B 1PLJA 4JKYA 3MSXA 5G40A 3BAFA 3BWDD 4ACBA 2XNDD 2CCJA 3KKPA 1K8RA 5EE0A 3IEUA 5K8TA 2JCSA 1XF9A 3C16C 4I1OA 5E95A 1FQJA 4DCTA 2OBLA 3CNOA 1W4RA 2GZAA 2VSOA 2WWWA 2CVHA 2WHXA 2XZLA 3CR7A 2GEUA 2VHJA 5JJIA 2CL6X 2HYIC 1E69A 4H1UA 2AXNA 5HKKD 1MO6A 4G5OA 4IDQA 1N6RA 1E2FA 2QPAA 2ZVQX 3GLHA 5B57C 1UBEA 2OT3B 2YZ2A 2ODNA 1EX7A 1KI7A 4NHOA 1ZBDA 3U7GA 4B33A 2ZJ5A 1Z6GA 3SDZA 5HR5A 5JFGA 3KJHA 1II0A 3NH9A 5F9HA 2YOHA 2BV3A 4F4JA 2FX3A 2JJ2D 2ZAOA 1UEJA 1ETUA 1H8HD 2JA1A 1GSIA 4IKEA 4FMBB 4Q7KA 3QSYA 4CIDA 2ZR0A 5JHGB 1VHLA 3EXAA 1I4DD 2B92A 1Q1EA 3CNLA 2Q9CA 2V7QA 3A4LA 3LWNA 4NCNA 4RJLA 3AV0B 4HUTA 4CEHA 1SXJE 3CPHA 1I4TD 2BBSA 1FQKA 4MRPA 3UWKA 1LS6A 4AWXA 1PVOA 4U7DA 3BC1A 1DAEA 2O8BB 2Y8EA 4BPBA 4R2HA 4IOLA 1DPFA 3QG1A 1XXHE 1YZNA 5D3QA 4NYIR 2B7BA 1E9RA 3V4RA 2AKYA 2JLQA 5TB5A 1OYYA 2VTKA 3ND9A 1OKKA 2GESA 2IUUA 2QBYB 1GTVA 3SFVA 4ZCMA 4C0QC 1E1QD 5DNYB 3RHFA 2F3RA 1VIAA 5KYKA 1PV4A 1ZNWA 3C14C 3I61A 3S1AB 5BXQC 1OFIA 4NU0A 2OG2A 2X19A 4HAVA 3VAAA 5FOTA 1FOEB 1P75A 1Z06A 1E2EA 2GK7A 2ZS9A 2R6GA 4W7SA 2N42A 3U5ZB 1DG1G 1N6IA 4DKXA 4G01B 3CX7A 4JLNA 1CJKC 1SVMA 1FX0A 3GLFE 1E0AA 4NPHA 4O25A 2CLSA 2FU5C 3FKQA 2FEOA 4TLBA 3WNDA 5IRCD 1CP2A 3LXRA 2ZU0C 3ASYA 4PHFA 2HJVA 4KYUA 2RKOA 5CB8A 1KI6B 2HT1A 4PO1A 5FI0B 3IUYA 3ZVRA 1XD2B 2EYQA 3U3OA 4DDUA 1P9NA 3P1JA 3LBHA 5EE1A 2J46A 3SFZA 2WJYA 4BZXA 3QPWA 4U02A 4LGMA 1E4VA 1W2HA 2P5TB 2OCPA 4Z54A 2NO1A 2RGEA 4NZYA 1SXJB 1T4GA 2GJAA 2GZHA 4F92B 1XRJA 2XAUA 2HF9A 2D3WA 4AK9A 3MWKA 3R7WA 2OUKA 1M74A 2HT6A 1CXZA 3VR4A 3NEYA 4G5SA 4Z1MD 4OI2A 4KFTA 2Q3FA 4QRHA 2ZETA 3F3YA 1HT2E 1E96A 1QVAA 1XD8A 2VEDA 2ZSFA 2ZUDA 4V0ME 4X8HA 5C46F 1X8KA 3CPEA 2OLJA 1U9IA 2W6JA 3SJAA 4YMVA 1KDPA 5EP1A 2IYYA 3DZ8A 2X2FA 3LLMA 1AZTA 1QHYA 3SN6A 1CLUA 4KCGA 4I1UA 1RYHA 1AN0A 5EP4A 2HXYA 5J40A 1QHNA 2IHBA 4JIMA 5J4LA 2J0QA 3TKLA 2O0HA 4ZI2A 1P62B 2VA8A 4LDJA 4P4SB 2BMJA 5KNCA 4W5JA 2FFHA 1CIPA 3OZXA 1EWQA 1FUKA 2W00A 2OO7A 2PH1A 2XNSA 3QBVA 3CF2A 4PC2A 4Q4LA 5CK4A 5FTKA 3F5FA 3RS4A 3O8CA 3QKRB 1AKEA 1NG1A 3DKPA 5CIQA 4KBFA 2GXAA 2MMGA 3WBKA 1E98A 5FI1B 4GZLA 1CJVC 1C4OA 2GCOB 2PX3A 1BH2A 4HI0E 4TT3A 5EE9A 4DDVA 2YOGA 1XCMA 3H84A 3K0FB 1Z0AA 5E3HA 2CDNA 4TL9A 1OT3A 4QKQA 2AD1A 1A5TA 2ZR9A 4RD1A 4YLGA 4A2PA 3U44A 4W5HA 3UWOA 1TQ2A 2ZSEA 3RS2A 4P4TA 1U9IC 2FWRA 4PSAA 3IGFA 3T5GA 1MABB 1NBME 1IN7A 1U2RA 3K70D 2X2EA 1X8LA 3N2IA 4JL6A 1G291 4D2IA 2PCJA 4MUAA 1T5IA 1Z3IX 3RS0A 5KDDA 4CYMA 2GETA 1LFDB 3AP3A 3WNBA 5CDFE 1TAGA 2D7CA 4JKIA 1E9CA 4JJZA 1VG8A 4JS0A 2QROA 4JLJA 4NCHA 4C0BA 4HDQB 1RJ9A 4RZUA 4AD8A 5J4KA 4DLZA 5KDLA 3I3SR 1SGWA 4JYCA 3M1IA 3PUXA 4LBZA 4V0OA 3RWMB 2W2TA 1L4YA 1EESA 1TQ6A 3ZZ0A 1EXMA 3DMNA 4LJ7A 2QT1A 2MSCB 1CJUC 1NJFA 3LX5A 3L43A 4RZ2A 4PHHA 4D4JA 1N5KA 5TARA 5FOSA 5FOXA 4ZIRA 2XNDA 3OF5A 3ZH9B 2ZRGA 1HE8B 3DOFA 2H57A 3CRVA 4II7A 3CRMA 2VSFA 4UXJA 4MGKR 1DAMA 3VQTA 3B13B 4Q02A 1YR6A 5AJWA 1WB9A 5FR1A 3UG7A 3AKCA 1FL9A 2GXUA 3WMGA 5FOUA 3L0OA 2RGGA 1WCV1 2Z0MA 4X8MA 4AI6A 3QEOA 1JNYA 3HP1A 5HKKA 4DJTA 2RGDA 4NL4H 1AJEA 1G8GA 3H86A 4V0LA 2W2XA 3C8UA 2FFBA 2PZFA 1R5OA 4NYMR 5DIFA 3B1ZA 3CO5A 2YWGA 5HZKA 2WMOB 1YKSA 4BFXA 1MR3F 2XZPA 1J70A 4D4MA 3THYA 2IS1A 1KSFX 1X3SA 5AR1A 2JJ2A 1KI3A 3NKVA 4UNSA 4OI1A 3RABA 1H8HA 1Q21A 4DCNA 1Z8FA 5FTMA 1DEKA 2VBCA 3HDTA 5DI3A 2V9PA 3U7EB 2I3BA 1KO1A 2B21A 2G1JA 2OSBA 4M21A 5K8LA 1E99A 4Q66C 2X1VA 3T1TA 2FPKA 1RC8A 1YR9A 2OCYC 2YOFA 2ZUCA 4RD4A 4DEYA 1M6NA 1XP8A 3TW8B 4ZV4A 3FTQA 1QRAA 1OLOA 5B64A 4QNRA 4A82A 4DLRA 3ZVLA 4MKFA 1TNDA 4I1SA 1ZJ6A 4L9WA 2J0SA 4TZ0A 2ORIA 3FFAA 1Y63A 2QM8A 1YVDA 3SOPA 3WHLA 4XD7D 3BGWA 1N6PA 4Y0VA 4EFNA 1HTWA 3EIQA 4DLYA 4NYJQ 4OQMA 2C5LA 1W5SA 2QNRA 4KODA 1Z28A 2ZI5A 5BQ5A 3DM5A 1RZ3A 3ZVNA 4FI3C 1FZQA 2FA9A 1T3SA 1E1QA 1GIAA 4UNPA 5GVSA 2ZRMA 1T8UA 4M53A 3R8CA 1ZRHA 1UKZA 5JBQA 4A15A 1I2MA 5D3MB 4HAYA 1II8B 4KYIB 1AS3A 1U8YA 2OM2A 3EWSA 1G3IA 3AVQA 2ZS7A 3QNUA 3TR0A 1BYUA 2C95A 2ZRCA 4GDFA 4US2R 1E3MA 3DZDA 2G1KA 3T1QA 2YWEA 2UKDA 2B8TA 1DAKA 1WMSA 1XCGB 5AJVB 4D81A 4I1VA 1W0KD 3BB4A 1XD9A 3MAAC 4MKHA 5FTJA 4P32A 3WXMA 3RC3A 2R62A 1G19A 1NKTA 4AYXA 1SVKA 1Z2CA 2W83A 1CR4A 2QRNA 2WWIA 2DCUA 1N2CE 2MSEB 3W6NA 2JJ1D 2I1VB 4V0KA 1SKYE 2FGJA 1ZINA 1GOTA 4XTRA 2EYUA 2EWWA 1QG4A 1NVXQ 1W7AA 3KKOA 4F93B 3ZQJA 1G6OA 2XOKD 2ZRJA 1W36B 2C77A 3QIAA 2QZ4A 2ZU6A 1ZU4A 1EFCA 1JQLB 2WJGA 2WAYA 3P4YA 5CB6A 3K1JA 4D4KA 1O87A 4B3DA 3PUYA 2ASEA 4PAMA 2FZ4A 4JMPA 3W6PA 2EVWX 5LB4A 2GCNA 3EC1A 3LO5A 4B35A 1AIPA 2GVDC 5DHFA 3GJ7A 1VTKA 2V1XA 4Z1MA 1OFTA 1ZUNB 3T34A 4E03A 3VKHA 2QPTA 2BM1A 1W49A 1S3SA 2IEYA 2G6BA 5FPSA 3K0EA 2AFHE 1NLZA 1KMHA 1CJTC 5EXXA 3A37A 2NO7A 1KKMA 2V6IA 1BO6A 4Z8XA 4R9UC 4OBEA 4PQRA 3RS7A 3X1DA 3QG5A 2VHTA 2RHDA 4TLDA 2HYDA 1F2UA 3HU3A 4FW9A 2ZIAA 1MH1A 2HXSA 4RFSA 5AJXA 4OHZA 5TXGA 2ZRLA 2WWHA 3B5JA 5JI2E 1D8TA 1OPXA 4BASA 3EAQA 4NE2A 1NRJB 1N25A 4LX0A 1Q20A 1OF1A 2ECKA 1AQUA 4P0TA 4YQFA 2AX4A 8OHMA 2QGNA 5F9FA 4DUGA 1ZP6A 1AM4D 3MWLA 1DARA 3GJ6A 1OSNA 1UBCA 3AF1A 2VP5A 3AUXA 4C7OA 1UEIA 1D2EA 1MRSA 5GJCA 3EA0A 1G7SA 3LX8A 4TMXA 3GP8A 2JLVA 2GJ8A 4A0RA 4AKEA 1JPJA 4B6EA 3BFKA 4PAOA 4A1FA 1P5ZB 1K5GA 5P21A 1NL3A 1XPOA 3QF4A 4XVQA 3QQ5A 4OL0A 1MV5A 3NHBA 1KI9A 1Q1BA 4PPNA 1JR3E 3ZS9A 3QUSA 4PZYA 1SKYB 4D0NA 3V9PA 4DZZA 1Q3HA 4GI7A 5DN6D 4CGZA 1G9XA 1HH4A 3N2EA 4LPKA 3PQCA 3DOEA 3QXJA 3I32A 3R9IA 2OBMA 1LTQA 5BN4A 3G82C 4DT1B 3W34A 1UKVY 1LV7A 2P0EA 5TMPA 3V00A 5BN5A 3X1XA 4LJ6A 3UIEA 2RMKA 3AVTA 2JLXA 2OXRA 2IWRA 3E5HA 1MRNA 2NTYC 2ZE5A 4UJ3A 1W5TA 4HAXA 3IKJA 3AF4A 1OE0A 3SYLA 3THOA 5KNBA 3EZ7A 1FX0B 1H65A 4O2LA 2ZRIA 5E7IA 3B1XA 4DIEA 3I1FA 2BM0A 1G64A 4YC7A 5FUXA 4QJ3A 3UANA 3THWB 2CE2X 3Q3JB 6Q21A 4FD2A 2IS4A 4V02A 4FMDB 4K8OA 3SBEA 3PFIA 2R44A 1P2VA 4MYCA 3CKLA 3D7MA 3HR7A 4C0KA 1S3GA 2C04A 4EKDA 2O0JA 4URVR 3AVXA 4NONA 4Q1AA 5FFMA 2HF8A 2YJTD 1XCPA 4ZDIA 2O8EA 1C1YA 2WKPA 4Q5IA 4Q4AA 5FBWB 4DB4A 2LCFA 2JLWA 2A5FA 3HPQA 2CE7A 2DHRA 4M0LA 2Q9BA 1TF2A 2AFIE 3CLVA 1UKYA 4S2EA 3TJZA 1CRPA 4QM6A 5KSZA 5F3WB 2IYLD 5AUPB 1ZC4A 1D2MA 2B7CA 2QPOA 3ASZA 3RVBA 2VYFA 4O2RA 3MMPA 1ONBA 1EK0A 2GWHA 3CX6A 1E9AA 5C4GB 3K0AB 5B58C 1OFHA 2DFKB 4HYYA 1RFLA 1Z5ZA 2D2EA 4LHYA 3PUVA 1PJRA 3QXCA 2N46A 4M1WA 3FHTA 3I62A 1M7BA 5H8WA 1WQ1R 1F60A 4D82A 2NO0A 2F43B 4GBMA 4LWZA 2R8RA 5KDOA 4TTQA 1E2DA 3U6KA 2PJZA 4NYMQ 1FP7A 1G5PA 3GLGA 1CR2A 2F1JA 4RVCA 1JECA 4IDHA 1AZSC 4WAUA 3CRRA 1P9RA 3QXSA 2I4IA 4HSEA 4TMKA 4TQAA 3VX4A 2WJIA 4KSCA 3A4MA 2CCGA 2QA5A 3PEVA 4TTRA 5L3QA 1E2LA 1UM8A 1DTSA 1US8B 2DBYA 2QORA 1DAHA 2ZYWX 3KUDA 1S8FA 3U44B 1IONA 3SE0A 4EFMA 4HB0A 5IF9A 4JLAA 3QKUA 1G5TA 1KDTA 1ZD1A 4ESHA 1GAJA 2RH5A 2F1HA 2OFWA 2C99A 3ADKA 4YMTA 4GT1A 1GM5A 421PA 5FPTA 2Q0HA 4QBHA 4Q1BA 1R2QA 4M1MA 3WP1B 3CW2A 4M1TA 1RJ9B 1EFTA 4EJSA 4D80A 3KB1A 4B2LA 2GVZC 3IO5A 2GK6A 1W0KA 3G5UA 1U90A 4OQLA 1ZC3A 1G7CA 2OE2A 1U8AA 1KO8A 4KXFB 1J90A 1ZIOA 4BWYA 2FPMA 4Q4HA 4B43A 2BMDA 2CHQA 2H5EA 3Q5EA 3NDPA 2QAGB 2VPPA 2YC2C 1X86B 2JJ1A 1F6BA 3RDPA 1T8TA 3IBGA 3MCAA 4LV6A 3UATA 2PL3A 4DDWA 4HZUA 2G9NA 4PR0A 4E07A 4GMDA 2TMKA 2JIZD 4JLVA 4B3XA 3IBYA 3JZMA 2XOKA 4EPVA 2WOOA 2B8WA 1NKSA 1QHGA 1TPZA 3Q8XB 4X8OA 5FPKA 5FBVB 3AB3A 1SVWA 4FINA 3TRFA 2QI9C 4OJQA 5G53C 5FPHA 5HPYB 4GFDA 2GF9A 1CU1A 3MGCA 1JAHA 4CEIB 5J47A 4HUQA 4QHYA 4WXRA 5FBRB 1GITA 1D9XA 2BIFA 1K5DA 2HCJB 2RHMA 3AKYA 3ICEA 4EJSC 2CEAA 4ZDWA 1IY2A 3THYB 1P2UA 3FYHA 2IYSA 4HDOB 3U2QA 4RY2A 5SZHB 3W90A 3T35A 1W4CA 5KSPA 2IXEA 5FL3A 5DI3B 1ZD9A 4F4CA 4BRWA 3PIRA 2O8FB 3PENA 1GWNA 1V5WA 1CJMA 2ZAMA 4M9XA 4JLPA 1JB1A 3VHLB 2IYXA 3IPYA 2GF0A 4YDSA 2IXGA 3ZZUA 1GNRA 3EZ9A 1L4UA 3ZYCA 3BS4A 1G8PA 1ZCAA 3M4YA 3AVPA 1P61B 3PVSA 4B74A 2QAJA 3W5JA 1E32A 2Z83A 1HY3A 2XB4A 5L3RA 1V43A 3X1ZA 3LQQA 4LHZA 4EFLA 4FMCB 4PQFA 1P3JA 4MUBA 2OEPA 4G0NA 2VP6A 1IJEA 721PA 2AK3A 1H8ED 1JALA 1E2MA 4C2UA 1LF0A 5FUYA 3CF0A 3LV8A 4FCTA 4KITB 5DN6A 2FSGA 2PEYA 3LBIA 2XTNA 3FPAA 2XX3A 5C4MA 1KY3A 4QBGB 4BFZA 1VECA 4HLQB 3FKSD 4KLZA 5L3SA 2IEZA 4IXNA 5KOYA 2XXAA 2FNAA 2QSZA 4F4IA 2QU8A 4TYQA 4CDGA 5CM8B 2BDTA 3C7KA 4LBVA 5M04A 1IXRC 2B6HA 1Z07A 4A2WA 4NYJR 2OCAA 4Q21A 2IA5A 4FMDF 5CYOA 4Q19A 2FEMA 1GP2A 2BKEA 2HV8A 5ANRB 1TMKA 3ZQ6A 2F55A 1D2NA 1VYVA 2R65A 4JVLA 1NLFA 3U3MA 3FB4A 2RGBA 3GFOA 4Q18A 2JDID 4NDZA 4MYHA 2W58A 2W6ID 1CF4A 1S4QA 4LYAA 4G3XA 3FMPB 5SZJA 1P6XA 3GJ8A 1T91A 4GOJA 5DI9A 2GAOA 4BECA 1XTKA 4R7ZA 5KO2A 1NN5A 1XJQA 3SYNA 4MH0R 2IUSA 1ZW6A 4TMVA 2P67A 4G5RA 3TUZC 3D3QA 4URZR 2P6UA 4TYNA 3P27A 2J0UB 4Q01A 3CBQA 3ZLJA 3AEZA 1RVDA 3AP1A 4MGIR 3IO3A 2BOVA 1GKIA 4DCUA 1Z47A 1SULA 4NKRA 3NBFA 821PA 3M0EA 5FOVA 2YC4C 3ZDQA 2PLRA 2O8CB 1MO3A 2CJWB 4AYWA 3B8HA 3TGPA 1WBBA 1AGPA 5DHAA 1VCIA 1UFQA 3PEWA 3NWJA 1M34E 1RPZA 2PMDA 2ZI6A 1SVSA 1Z0DA 4LK2A 5E4FA 2WAXA 2YV5A 4LYJA 4PXAA 4XIGS 5EJEA 4JT4A 4CEJA 3K9LA 3BFXA 2O8DA 3CRW1 3IHLA 4C7OB 4L15A 1NMZA 4C4PA 5CLLA 1N0UA 3OEED 4B2PA 4ZO4A 4YXWD 2OHFA 1VG0B 1ZM7A 3ZJYA 3TNFA 2CMKA 2KWIA 1X8JA 2J41A 1KTVA 3KJGA 3BRWD 1RRGA 2QE7A 4ITRC 1SVIA 1G41A 4JVMA 4D6PA 2EFHB 1TUIA 3TQCA 4FXPA 4Q7LA 4IRUB 4YMWA 3UMFA 2BMEA 1XNJA 2C9OA 3K70B 4Q9JA 1FTNA 1W2GA 1M2OB 4EQ6B 1YZTA 3NC0C 5EP3A 2LKCA 1JQJC 5CJPA 2EW1A 4ZDJA 1XPUA 4HB4A 1E9EA 1XZQA 1W47A 5EP2A 4R2IA 2CLCX 2O52A 3BIFA 4QJ4A 5IK2D 1I2DA 3PEUA 2AK2A 4IDPA 3QXXA 3C5HA 2D62A 5UKDA 2IWHA 2QP3A 4DUGD 1OH5A 3KDSE 3WYGA 1T3LA 3IILA 2QENA 2IYRA 3MWJA 3A36A 3NXSA 2JIZA 4JVSB 4QBFA 3AGPA 4A92A 3WNCA 2DYKA 1OIVA 3TVDA 5DO9A 4Q9KA 3ONWA 4I81A 5AUOB 4P33A 4ARZA 2P2LA 2ZPTX 2A5YB 5L8VA 2NZJA 2ZJYA 3L0IB 4IFEA 4C2TA 3TBKA 5AJZA 4E09A 3W3ZB 4XH9B 3REGA 1OHHA 1NVWQ 4TMTA 3ZIAD 1XTIA 4UNQA 4CF7A 3K9GA 2IUTA 4BFUA 2J7PD 2UVQA 4IW3B 2YVUA 4TQ9A 1F2TB 1R10A 3OIUA 2AN9A 3THXB 2C9CA 4FN5A 1DAFA 3RRYA 2ATVA 2G0NA 2WJJA 3B1VA 3FHCB 4OHVA 3BH7A 1SXJD 1Z22A 1LB1B 2ZSBA 2QMHA 2LKDA 3GEHA 4PZLA 4ZCLA 5LPNA 5LDDC 2G77B 3SHFA 2CL7X 2GILA 1Z6AA
chains in the Genus database with same CATH superfamily
2JD1A 3FJ1A 3W1EA 3ICQB 5CT8A 4JP1A 1I0ZA 1GN9A 4DSZA 4N82A 1D4FA 2FEKA 2QP4A 3N75A 4RV5A 1X2EA 2V59A 2X5NA 3K4QA 3T9EA 4AURA 5AW8A 1DTWB 1NYLA 1PEKE 3JYPA 5JYEA 3GWGA 5C53B 1KFBB 1QGUB 2OGUA 3JYLA 2PS9A 2G5TA 1MG0A 2PJUA 1W30A 4HQ0A 4TWZA 5IDYA 4B45A 4BLPA 4BNVA 4UC0A 4OB6A 3HNOA 4I66A 3HKEB 2W6QA 3LFUA 4KQCA 3JVUA 3M6IA 4MW2A 5GJVC 2REQA 1ODCA 1F9AA 1I7NA 4TS4A 4I46A 4JBNA 4KN9S 4PYKA 4CM1A 4QJIA 3IP8A 1XCBA 3M4XA 2F7SA 4MZXA 5JSZA 2BBWA 1PGNA 3FNFA 3FD8A 2JFHA 4I50B 1QHXA 2XE7A 5HTOA 2CXPA 2FHSA 5A4JA 1NMXA 3ROTA 1K6XA 2G04A 2WJVA 1YCDA 3SZUA 3UT6A 1DWOA 3SKYA 4KOEC 2EAUA 4JI6B 4CLEA 3H3XA 2NWQA 1PDWA 2V7BA 1X94A 1X9IA 3CZAA 4URHA 3A6ZA 1NXSA 1LQ2A 4MCAA 2QM0A 1SG6A 2BCJQ 4TXLA 5AVQA 1U0BB 3HO1A 4U0KA 4PG4A 4JX8A 3GGSA 2PAAA 4E6EA 1P0QA 2WWRA 1L8QA 3TZBA 2ZJ8A 4BMSA 1VLJA 5F33A 4M86A 4QGAA 1DAGA 5DYYA 3JSAA 2R11A 4CF5A 2FPOA 3FB1A 4Q03A 2WYWA 1B16A 1IMOA 2CZQA 2R2AA 3MWGA 4HWOA 4I5GA 2QMYA 3L8DA 4QECA 2VP4A 3TIIA 1RYYA 1DHRA 2CHVA 1BDIA 3GXBA 3RVNA 4BIIA 4NY1A 1IB6A 1QNLA 1JEQB 3D64A 5BYKA 3UJ7A 2QD2A 2EFGA 2PUAA 2JKVA 1HL7A 4UXHA 1KMMA 5K0SA 3N2KB 2JDIA 4P84A 2PZ8A 1UMCB 2P90A 4BRUA 2CD9A 4NV1A 1JDNA 5HRAA 3KB6A 4MVJP 3G9TA 5FHQA 5A3SA 5BVHB 1NHWA 4EG6A 1P1RA 4REOA 1Z62A 3I5YA 3JQAA 3JZIA 1UT5A 5HOEA 3H0EA 1KI2A 3UFXB 2WLTA 2X13A 2YNMD 2FZCA 4YQYA 2VG8A 1NMQA 4XJXA 4MVJF 1RAGA 2XQKA 3C6XA 1L5FA 1SIOA 1E3TA 2W22A 5LOVB 4TM7A 2H2IA 3U4IA 2A9JA 5TQ0B 1EMDA 1EVQA 1GUDA 2H92A 1GPH1 4R01A 4S3MA 3D3EA 3FPGA 3GZNA 1X7ZA 2SKEA 3BL5A 2YWCA 4WV3A 2J4CA 4NV0A 2QV0A 1TA4A 4RVUA 5EEHA 2BFFA 1B15A 3PJGA 4AS1A 4W99A 1NXOA 2DWQA 2W0MA 4DUPA 2Q4OA 4HNRA 4DHWA 3PNVA 4HNVA 1U8ZA 3ETJA 4URXR 5CD1A 2ZUUA 5TV2A 2DTEA 2QMEA 5BNTA 1CBUA 4URWR 2EFCB 1HGXA 1O9BA 1YJ8A 3VVLA 4JNKA 3EIWA 3SQOA 1PJTA 1QBKC 1JJIA 2FV8A 1FPQA 4RU1A 2Q5CA 2AW3A 4KB5A 2C2GA 3ZLBA 2VDWA 5A9RA 3FLBA 1MAAA 4B80A 5CYPA 2B4RO 3OQIA 3G8DA 1U1GA 3MEQA 4C0JA 4BNIA 1S1MA 2GA8A 4M9ZA 4Z86A 4DSUA 4A36A 1GQSA 2IY7A 1L3IA 4CM3A 3FFBA 3KQNA 4UQOA 4AJNA 2EKLA 3OPQA 2FJ0A 2QTLA 1MA3A 1JZSA 4OO3A 5HUQA 2AZXA 4NMHA 4IEFB 1YZKA 3LVQE 4UM8B 4BB0A 5JCJA 3I4LA 4Z53A 3RK4A 5HQJA 5L3QA 1W0JD 2QTHA 1IB0A 2BGUA 4L72A 3G9ZA 5ETJA 5KNCH 3W06A 1MB3A 3EOZA 3TG8A 2PV0A 2QEQA 4PSKA 1KO5A 1Q7EA 2VCYA 3RT9A 3RIEA 1EWRA 3HHEA 4TXMA 4LJ5A 3WRYA 1VLHA 4MR9B 1R4NB 2OKCA 2Y0PA 4RL6A 1OQAA 1EB9A 2VDUE 2C7OA 1I51A 5A2QA 5L3SB 3UB2A 1VHDA 4CUJA 4CMGA 1TUEA 2EF1A 2WHYA 3PGLA 3UENA 1D0SA 1SHZA 4MA4A 1GPUA 4F8JA 1BMFA 4A2QA 3A1VA 3GRKA 3HUDA 5DT2A 4DPKA 1PEYA 2IYUA 3B1JA 3KFXA 3WRXA 2AXEA 2D5LA 2EJVA 3KAKA 4PLTA 3EGIA 3IUNA 3F8SA 3PLRA 4U7TB 4D8VA 1P4RA 5JEEA 4KUHA 2WHPB 3EULA 2DULA 3LO8A 1IQPA 1F20A 1QC5B 1FY2A 3FDFA 4PO9A 1YRYE 5AKYA 1XZEA 2XMSA 4MO2A 1W5EA 4RSGA 3EZ2A 1ZFNA 1BFKA 5CX1B 3TZKA 1E2GA 2FDRA 2XUIA 1FBTA 7ADHA 2O9JA 3S1AA 1QMPA 2EW8A 2FP3A 2VT7A 4UCWA 4AMUA 1GVNB 5DXJA 1QHFA 2VT6A 3CQ9A 1VE5A 3AQ4A 1LV8A 4ZC1A 2ZB4A 3HGMA 2H0RA 4WX2B 4NDAA 2ODQA 3PGA1 4DSNA 5I7HA 4CT5A 5HKBA 1YR7A 4BV9A 1VPDA 4ZOLB 1U0FA 1U4SA 4XOUA 4ZRMA 3DJYA 2X8JB 4M54A 4N48A 1AKRA 4J1QA 3RU2A 3ESXA 1WIWA 4EAQA 4H4CA 1KI6A 4WZAB 4KWTA 4E21A 3MQ2A 2CFTA 1RBMA 3LIPA 4G8BA 5HS6A 3KLOA 1P80A 4GOXA 1UIRA 4RLQA 1KHTA 1FLNA 1HDZA 4QU9A 2R6FA 4TQUS 3KKZA 3L1KA 2PRKA 2DFNA 4B5LA 4DN6A 4QNNA 1PAUA 2HDNB 1XDGA 3V1LA 1RTTA 4UUQA 1C4KA 2PZJA 2FWPA 3MW8A 1I4EB 4YGXB 4QATA 4XDYA 1DC4A 1CRZA 4PLHA 2XKJE 5BSMA 5IJWA 1XVAA 3RC9A 4D6XA 4BQFA 1M66A 1SVNA 2IHVA 3AKDA 3LDAA 4YAJA 4D9FA 4I8IA 4EJ6A 1UJMA 3ZWOA 5I51A 2FRDC 3TM5A 2J3IA 1TK3A 2Y1OA 5H02A 4UNIA 2X4LA 1TB4A 4IOJA 1XZGA 1X7HA 3B6KA 4LYHA 1E9BA 4UU1A 4S35A 5GONA 5LP6A 1FF9A 1Q0UA 2PLFA 4BRZA 1XL1A 2VXBA 1J0EA 1RAAA 3I6YA 1FMTA 3JASB 4I50F 1MX9A 5B3JA 4ZEMA 4WDRA 3NBXX 5AHKA 1C50A 3KB2A 2PSFA 3JQBC 5A1TA 4M1KA 2NOAA 1E5VA 4GL4A 4OJMX 5GADl 1LC0A 3NHFA 4XYBA 3OAAA 1J06A 3M6AA 1DCTA 2I22A 2WR8A 3R7WB 2QNIA 2V8BA 3PJRA 1NSTA 2H4XA 2YCLA 4KGVA 3TW4A 3ZCUA 4BLTA 3BOSA 3VU0A 2XD4A 3L9XA 2PX6A 1ESNA 1OZ0A 4H15A 4M8IA 2RGAA 5CMLA 4YONB 1JW9B 3OZAA 5FJIA 1U99A 2QV7A 2VHEA 2YY6A 3MG9A 4AKIA 3CPJB 4J90A 3QRWA 4KR3A 1M5RA 1WXXA 4IFBA 4POAA 4DJAA 1WY5A 1FYFA 1JKFA 1SXJC 4J0CA 3B7GA 4BJ1A 4H1WA 4DV1B 4FWTA 2B3DA 1KNXA 1P1KA 1W59A 2GCOA 4NFLA 1W93A 1OXUA 5AVVA 4CF4A 3WKCA 1QPGA 2JGJA 4LF8B 4ABYA 2X8AA 1Z29A 3OBIA 5E9AA 2GPBA 3TSOA 2EHJA 3W5AA 4QTZA 1NBEA 1Q3TA 5IWCA 1R6AA 3TPFA 4NK5A 3WWDA 4CR6A 1UBNA 4FB4A 5EJ4A 4F9EA 1E8NA 1G21B 4FIDA 3ROQA 2JLRA 1E1RD 2GZSA 2Z1NA 4BCBA 3F8TA 5C7YA 2IHNA 4NJOA 3VH4A 4D57A 2Z08A 1XKLA 3QYAA 1L4BA 4LRWA 4QTTB 2QTWB 3PEEA 4FHZA 4B3HA 1DIGA 1LJ8A 4LWQA 4A8TA 4NJMB 5EPUA 1E63A 1T6ZA 1ESMA 5LOVF 4ZMSA 4E31A 3EG5A 3UMMA 5G4KA 4NX2A 3EMVA 3U3RA 3ROGA 4BE7B 2AEJA 1JWLA 1VMAA 5IDQA 3CN9A 4OK5A 3KFVA 1XHEA 1Y98A 2RHJA 2V74B 3B8EA 4IVQA 4V0MA 3LYHA 2ONJA 3RFFA 3L7NA 1RMTA 1TA9A 5BQ3A 4N0DA 1D5CA 3LA8A 4MS4B 2BUCA 1XTRA 4HNGA 1HYBA 2KB0A 4QJBA 1ESZA 1C8LA 5KVVA 4N5NA 1CWUA 3O9MA 3ZE8A 2H1FA 2RB5A 3E9EA 2J4DA 2PGDA 2PPVA 3JY6A 2ANBA 4MOWA 1U7DA 2B5VA 5A6VA 1V1JA 3NG1A 3WL5A 3L49A 1QZXA 4EATA 1H5QA 3DBRA 2GN9A 1T9AA 1TADA 3TUJC 3DEIA 5LQJA 1USWA 2QTFA 1JJFA 4CQNA 4ALJA 2HRDA 2I67A 3SC3A 2WF7A 2YN0A 5JYDA 4NQZA 3P2KA 5ITVA 1ZA2A 3WWEA 1YZVA 5IN5A 1X92A 2BSAA 5EMHA 1PW5A 3CRQA 1VMIA 1YI8A 5HJ2A 1LBTA 3ZUPA 1E92A 2NAPA 3L93A 2PZGA 1ACMA 5CFQA 4GMHA 3OMXA 2JATA 3GJ4A 1X77A 3OPMA 4FNGA 3UB4A 2J3LA 4KFRA 1RM5A 3ENWA 3KYDA 1IJBA 3M3HA 3KSMA 1VIVA 3LPNA 3CVJA 2XCRB 3M6LA 4TMZA 3TPCA 2ZS8A 2CK3D 4EVQA 1H22A 4LMPA 4TL6A 1BAPA 5JHHB 2PTHA 4LOJA 3P9YA 3PGKA 5G1OA 3EXHA 3SHWA 3TECE 2V7WA 2ANCA 1WA5A 1A2QA 2VF7A 3LCMA 4EPTA 4D3YA 1A77A 2QQ0A 1XUOA 3ZLVA 3FTFA 1DIHA 4R8VA 3CUEF 2UYHA 3DLHA 2D8MA 3KPWA 1G3MA 3NYRA 3P45A 3V4FA 4ZJZA 3OFNA 5HMLA 1WZNA 3BD9A 3GDWA 2IU0A 3U3JA 1HXHA 2VHQA 2FPUA 3RYTC 2HQRA 2N47A 3K09A 4MZDA 2BL4A 1AV7A 4I0WB 4CCYA 4G97A 3WK5A 2WWVD 2AOUB 3E5NA 3ZDRA 4QT4A 3VOSA 1NY5A 5LR6A 4QXQA 3SZLA 3FW1A 4PYOA 1GKLA 1LF5A 3EY4A 4FSXA 1F6WA 1WBJB 3DLIA 3I5MA 1Y6FA 3I01M 2WC1A 3IQIX 4XFDA 1EFPA 1N6NA 2FE4A 2IODA 3QY0A 4GOLD 3EZFA 4BAUA 1SOWA 3ILVA 1HYQA 2WU4A 3ZU5A 2Y0EA 1FFWA 4M9RA 1WRBA 4BGVA 3JZAA 5BSWA 3COJA 4M0DA 3PX3A 2JG3A 1GRNA 2P9HA 4QM7A 2BF7A 3N0WA 1B0ZA 2LDBA 4F38A 1IOZA 2XTAA 3BD7A 4TXHA 1JQKA 2QLFA 1Y3IA 5GY7A 2WWYA 4DEVA 3CR8A 4C5AA 5B30A 3UC5A 3A4TA 4CU2A 1QIHA 3E2PA 5BMVA 5C8YB 1R0ZA 2PT7A 4G0VA 1LLDA 1GTRA 4ZOLF 1EFRA 2DR3A 2EX4A 2GHTA 4RMJA 1LDEA 4F7WA 3G0GA 3JPYA 1T43A 3JAKA 2PBLA 4KE8A 3SQLA 3AF6A 3VR2D 3AF3A 5C8XA 1YQWA 3LVRE 4JBIA 4C4AA 2XECA 3GGJA 1L8AA 2LXNA 4MVJE 1PTKA 1VE6A 3AP2A 3OCZA 1SCKA 1UXHA 5EKUA 2FUG6 2A88A 3N5KA 3GCDA 4JLDA 3AR8A 4H08A 3W5DA 4I8DA 4DCGA 5LD2B 3WLRA 1WCIA 1L4LA 4FNAA 2L0XA 5FWAA 3DL4A 5TPZA 1GO2A 1ORIA 4L5AA 1R3DA 3O4JA 2ID7A 4DC1A 5IJ9A 4ALIA 2ZXFA 5EFOA 3P9QA 4ZVVA 1SNYA 5IYZA 4QUDA 1DKNA 2CYBA 2RK3A 4PAQA 1A9XB 2VUSA 4Q15A 5FTLA 1PFQA 4AS2A 2H65A 3CMCO 3DDCA 1ZHFA 2C78A 2ZTUA 3A7EA 2OCGA 3OC0A 4G5XA 5L6MB 1OB5A 1JEYA 3B3QA 3L8HA 3S5UA 2AOTA 1TO1E 3C7TA 4NP6A 1YJAA 3UT0A 3F1LA 5C1BA 4Z4IA 2Z2IA 1T0IA 4B79A 1FTSA 2KS6A 1Z75A 4QUGA 1PR9A 2XRFA 1A71A 1YZYA 1TI7A 1ZN2A 1QJ4A 1OWPA 2WUGA 2YZ7A 3Q9SA 2OO5C 3LY9A 5JCPA 1YQGA 2QVXX 1BIFA 1J5XA 1Q14A 3KX2A 2VWGA 1NT4A 4S1WA 1P31A 3OP4A 4BFWA 5I7VA 1R8JA 1UJNA 3KQPA 1Z0IA 3CTMA 1GTG1 4K6HA 5IC4A 3SM9A 1VE1A 1FK8A 2OHIA 2OGZA 4B76A 3PU6A 4BE9A 2OXCA 5LZ5A 1YZQA 4O1IA 2J3HA 2PU7A 2HA6A 2ZYRA 1G3UA 5FI3A 1MQSA 5BSTA 1WBDA 4DJEC 1SXQA 2VKTA 1QU2A 4RHUA 1KRXA 1V3QE 4Q6BA 4LCEA 3IIMA 3LUBA 4E4TA 3STVA 4XWWA 2VPQA 3GWZA 4HLUC 4IOKA 1KS2A 1QR2A 4RFLA 5U4XA 3OUZA 4QYWA 1APBA 1NP6A 4PAWA 2XT6A 5C5CA 3VNBA 1L5YA 3U37A 4QXPA 3R23A 4DIKA 1F5SA 4AJOA 2BFBB 1SD1A 3U4QA 3LT1A 1YNSA 2WZCA 3A14A 2O8DB 1F2UB 3RV3A 1CR0A 1ECLA 1A97A 2YDYA 3FPFA 4B85A 1UBKS 4JZKA 3UXMA 1IZ9A 2VLBA 4R2XA 4OJYA 2OD7A 3GDHA 1UPTA 2Q2QA 3KXLA 2OTCA 3MRSA 4C7XA 5KPJA 5G0TA 1C0IA 1T9GS 3OIVA 2AR7A 4ZKEA 4P92A 5AJTA 5BN3B 1ZM3A 2I4NA 1E9DA 4Q34A 4WNAA 3V7YA 4YRZA 3H13A 3IVXA 4RVGA 2O7QA 5IZCA 1DI0A 3IVMA 2R25B 2J6IA 4TWBA 3WBFA 5GIPE 4GZ3A 1YJQA 1COZA 5G2OA 5FV4A 2HD4A 4EHNA 3PQ4A 2I78A 2AR0A 5HBGA 2OZKA 3HDGA 5HDBB 4OATA 3S7TA 5HGJA 1PT5A 5ECGC 5IJAA 1ZSYA 1LK7A 3QF4B 1M1NB 1AG9A 4QRIA 2PVSA 4CI9A 1ULUA 1ZRMA 3EDOA 4J16A 4XWGA 3T1OA 4Q1DA 4A6XA 3OFKA 2AFHA 4ARAA 3ZD6A 3D6JA 4AG5A 3X43A 1S2OA 3V80A 1GKYA 3QKWA 1C9MA 2C2HA 4JC8A 5D86A 4MRNA 4RK0A 3TFWA 3UF0A 3VSDA 2IIPA 3O2JA 3QUBA 4LC0A 4ON9A 1F4LA 2P6NA 4RELA 3VHRA 3LF1A 1J21A 5BWLA 1A2OA 1SQGA 5CA1A 3F46A 3LGSA 4EI9A 3M3DA 2V45A 2ZYAA 1B23P 2NAFA 3JYNA 1GTSA 3A1DA 3PQFA 5K8UA 2QMUA 4P2BA 4TUYB 4P4UA 3UK2A 4ACAA 3CINA 1UJ6A 4Q9LA 3QJYA 3ZI0A 4ENRA 3NR2A 1L0BA 2BEKA 1RRFA 2ECQA 3HJTA 3NS7A 4H59A 3FWYA 1ZM9A 4UBLA 3JVEA 3RF7A 1NI4A 1W19A 1KYZA 1DIOB 1Y34E 2WF6A 3NHAA 4B4UA 3OF3A 2ESRA 4C30A 2O2GA 2PTGA 2NXNA 2WUWE 4G25A 1P1IA 5ADWA 2PWBA 1GSOA 5LA6A 5CXXA 3RTEA 4X1IA 2ZROA 4BVBA 2X77A 4B5KA 3O2NA 3IE0A 3TJMA 4ZI3A 3GFVA 3G8AA 3KSDO 1AUOA 4ADSG 5E6SA 3RRMA 2NXJA 2VF8A 3LPMA 3NHLA 3SYTA 1Y9AA 1JA0A 5ALGA 1ZH2A 4LZOA 1XELA 4WXPA 3IT1A 3W5UA 4IMPA 1E7RA 4UUNA 1YBVA 1U9ZA 1ZGAA 5KBYA 2O8EB 3OQBA 1TUGA 4Q4AB 4U7WA 3G0HA 4UU8A 5FL7A 4MWSA 1R0CA 3CXUA 2OFXA 2I8AA 3NIDB 2G3YA 4LWOA 4BVFA 3HEMA 5F2KA 4OGLA 2YHBA 4AMVA 2UUCB 4P3YA 4Y2XA 1EG2A 4E3WA 2Y9MB 5BSGA 1EFUA 4FS8A 1QK3A 1NR5A 3RG8A 2WG2A 3VVBA 3WDSA 2GEJA 2OL4A 1VDZA 1GARA 1KY2A 3NDJA 3OKCA 4LOIA 1HZJA 3N3BC 1NUQA 1YCFA 2PD6A 1GU0A 1LS1A 4J0DA 4Y9DA 1U0SY 3STHA 4EM6A 3ZXYA 1QO0D 5KS2A 1GPAA 1RYNA 2GDJA 1P45A 4IPTA 1W8DA 2G7MC 5C8YF 2GM5A 5KJCA 4A91A 1P2TA 4QG7A 1I2CA 3P4XA 2YWDA 2C03A 3EIHA 1S2MA 1LNZA 2GN0A 2PWYA 3C5CA 1V11A 3N2LA 3PFKA 1SCJA 4DTCA 3OEHA 3Q8MA 1OZFA 1QH8A 5FR2A 5JCZA 2PGNA 5IAKA 3BMQB 3GRYA 3T12A 1X7XA 1W1WA 4TLCA 2JFFA 1NDHA 2XUFA 2BC9A 4Q9DA 1R3UA 3I8XA 3LYAA 1RHQA 5JJKA 3CH4B 3NDIA 5KAPA 1NN0A 4LJ4A 1CUGA 3RSOA 1CJCA 1A9YA 4A2CA 4ENTA 2PKWA 5BYAA 1X15A 4TRNA 2VSXA 1CZRA 1NE7A 1X2BA 4IXWA 4E5MA 4OA5A 1SA0B 5JD5A 5F9FA 4JLKA 4US1R 1FX1A 1TFUA 1ULZA 1UXKA 3CVOA 2H0QA 4GX0A 3RNLA 1CKEA 1G4UR 1W2WB 2EDCA 3EQ7A 3LUAA 1TCVA 4KU4A 5HQ3B 1PV2A 1Z83A 4CZ2A 4KP7A 4M2LA 2XD9A 1BZYA 4UDOA 1DJPA 2OHJA 2ZJAA 1BS2A 1NJ5A 3HKDB 2WSBA 3FFWA 3OD5A 3SFTA 2JIRA 3ET4A 5K9ZA 3JARB 3EQ9A 2BE7A 3OU2A 1UC8A 1I2BA 4F96A 4DLVA 3EC2A 1KVUA 5ECWA 1SZPA 3QXGA 1MX1A 2VHYA 1HWYA 3ZE0B 4DLXA 1ZVMA 3MMZA 1L5VA 1VCNA 1N0VC 5T6MA 2YVQA 4B75A 5JNWA 5F76A 4EJSB 1KK1A 2C96A 4LHEA 2V03A 1E9SA 3GYBA 4IQ0A 4J1TC 4PC6A 4A0HA 2BJVA 5L7YA 4H0NA 5K05A 2JLYA 1Q74A 2WJAA 5G1PA 3SJBA 1PFWA 3EPPA 2J9XB 4CMEA 6REQA 2I7DA 2PLAA 2H3EA 2XOXA 4C4XA 2EZ4A 4MWCA 4J9VA 3KQMA 3QENA 3F90A 4EO4A 1C30A 5C7IO 4EH1A 1P5RA 1CK4A 1JG6A 3I83A 4ZODA 4C6TB 1HNZB 2ODEA 5HF5A 2XQVA 2B1QA 2UVPA 3TTTA 3AVVA 1N32B 3IESA 4YCJA 4J94A 5ALLA 3RWOA 1RQNA 2Y1LA 3DZJA 1NVFA 1ZY2A 2AR9A 3FGOA 2H2DA 4Y3UA 5KYVA 2OLEA 3BORA 4UTPA 1YRAA 2OB2A 1XHLA 3W3AA 1TU4A 1P2SA 2A59A 2RJ3A 3X3HA 2A3RA 2AL7A 3OQNA 2VN8A 1KAHA 4HPJB 3T3NA 2XVMA 3CLHA 3PNLA 4FMPA 4ICIA 4ZVKA 1SXGA 2YRWA 3DBLA 1WE2A 1P7VA 3WL6A 1LTKA 3DMPA 2O8FA 2HBRA 4KXUA 3OLVA 5KHOC 1HTBA 1YAJA 4PFSA 3TI7A 4D0LB 4D26A 1CEYA 1SUAA 4DV7B 5HIAA 1FDVA 3QEMA 4C4YA 2Z09A 4BN0A 3RF6A 3E18A 2JLAA 3AUYA 3DSRA 5A7HA 4OK3A 1W4BA 3K4HA 1BX1A 2Z04A 4H6WA 2C9YA 5I7UA 1IY9A 5F98A 3C3YA 3KQHA 3RUCA 4HNTA 1KOFA 5DHSA 3UAGA 4U2KA 4RO0A 5A0TA 2WTUA 3Q3GE 1MTZA 3IQXA 3PC8C 5LMNB 4X6LA 4I1YA 1RC1A 3AY0A 2SICE 3WGIA 2Z3VA 4G26A 3ZZMA 2LDXA 1V6CA 5E0OA 4Q47A 3JR3A 2NVUB 5B6PA 4DARA 3EW7A 5JAMA 2GYVA 2I7VA 2YJ5A 3E15A 3O21A 1X0XA 1YAHA 2AQIA 3AC0A 1VJCA 2H54A 4MW9A 4R6WA 2IHZA 4D97A 2X5KO 3R4CA 4I99A 2FFAA 3IAXA 3GD7A 2OBNA 3T9FA 3MJDA 3MRXA 5KQRA 2CSUA 1A9TA 2AI1A 3K2IA 2COKA 2WVHA 4PRKA 4BQIA 1CUHA 2AE1A 2VYQA 3GEBA 4P98A 1TW3A 2IHTA 4X63A 3DNPA 4DCJA 1Z2AA 4WZAE 1ECJA 2IEGA 4HX2A 4ASUD 3MFYA 3K94A 4FFLA 1L3CA 3IA7A 1DKLA 2C3OA 1N9GA 4QYIA 2Y0BA 1EYZA 2ZJFA 3A1SA 2VLIA 2ZEJA 3FROA 4MI6A 5CIWA 1DFGA 3HSSA 3K53A 4HAWA 4ITVA 1VIMA 2QVGA 1XZ8A 1K7SN 4IHJA 4MUHA 4TUYF 3F5QA 4YT2A 1IHXA 2QM7A 5AO9A 4DQVA 5C3MA 5L4NA 1CNMA 1UP6A 1JAXA 1A0OA 1QSGA 1TEVA 2QQFA 2VTEA 3IPXA 1E0DA 4FOSA 4RZIA 3RIXA 1JPUA 2BZGA 4R54A 4YQZA 4LCBA 1E7YA 3QKSB 1M0TA 1F4PA 3BXZA 3ICOA 1SB8A 1FFYA 1IBLB 2HF2A 4PQEA 1ZICA 3B3GA 3ONFA 3EW9A 2PMKA 3GUUA 1CF2O 1GPMA 1VBKA 1VGQA 2BZ0A 5FFNA 1XWIA 4B0PA 4KHPB 3JVVA 2Q5FA 3NVMB 5FO1A 1BVUA 2H2FA 3CC8A 3SYKA 2FUNB 3BIJA 4O29A 1Y8ZA 2X1HA 4I6GA 2JHAA 2NZVG 4GPZA 3RUPA 3WAKA 1CE8B 1QG0A 1BQEA 1E20A 3V7WA 2PX5A 3HBLA 4AKSA 3V5NA 3F6YA 2P2SA 3A9VA 4BC0A 4E4RA 1RBZA 5JSUA 3UJPA 2ZCJA 2J0UA 1J25A 2R6JA 3R3UA 1T1EA 1WW3A 3RRNA 4RABA 1OLXA 5B37A 1KMNA 1YR3A 3L1JA 4JP8A 3ZBUA 3O4IA 5EPOA 5EZ6B 3ZX4A 3OFJA 4AXBA 3CX8A 3HI6A 5DCUA 2YFKA 2LIVA 4HAZA 3EA4A 4G65A 1PVVA 1T29A 5F23A 2QMZA 3QI7A 4RVOA 5K0FA 1EA5A 3AI1A 5JAZA 1TTPB 2QG4A 5EXEA 2XB8A 1YUBA 4PXYA 3SGLA 1C1XA 1EVZA 5E4YA 1H85A 5FBLB 3H8WA 2A86A 3O1JC 3VH2A 4MEAA 1M67A 4X1KB 2X0EA 1QQBA 2GZDA 4IEEA 5FP0A 4JLUA 1I1OA 1MMFB 2YX1A 2CVFA 1QTNA 2ZWIA 4HDCA 1F2DA 2BZSA 4LJYA 4EYGA 1F0PA 2XCSB 1ENOA 2E2WA 5EXSA 1JTFA 1GUYA 1MTOA 3ELBA 1FMCA 1XD2A 1YBMA 2CHGA 2DSTA 4B47A 3BWBA 4FC6A 4I9NA 3T5MA 1ZN7A 4JZYA 1YS4A 1A2BA 1SBQA 4LDNA 3BA1A 2JHFA 1MCZA 3MXTA 4ERXA 5AM3A 3Q2OA 1RAHA 2JGRA 2ZATA 3X0DA 3T3IA 3AJEA 4G4SP 3UXYA 3N9IA 1T9HA 2BBOA 3RGGA 2WKQA 1VBNA 3AEUB 4W1SA 2I4OA 1KETA 3I6ZA 4RVHA 1RJEA 1RWQA 4KXXA 3TS1A 2PQ0A 3C4JA 2RH4A 4GSLA 3K4PA 1M72A 1QQTA 3FCAA 2UZIR 4JJEA 1IN6A 4O4IB 4FHGA 3CW8X 3OWHA 3OTOB 2JAXA 4YRDA 1MJGA 3OICA 1QK5A 2YINC 4QEKA 3DWFA 4D9GA 3T5PA 1JIJA 1TZMA 4TM8A 4F2DA 5G41A 1AZWA 3SZMA 3EGWA 3MMXA 4Z7QB 3L0YA 5KTYA 2A8YA 1FDSA 3AONB 1VE3A 1Y8QB 3DBIA 5MDHA 1LPMA 3RRZA 2NO9A 1NVDA 2R8EA 1TUBB 1MIOB 4GIBA 1LGYA 3BWVA 1FUUA 3OX3A 2NQ2C 2FG7C 3DE7X 5DGXA 4RIGA 5EWJB 2XUJA 3K0KA 3M5WA 3ZHTA 6AT1A 3TSAA 5K8IA 3GLTA 5IH3A 2YYSA 2IYPA 3PNSA 4EPYA 4WCFB 3RKRA 3A6PC 3IAEA 5D7NA 1GQRA 3EZLA 4P4SA 2GDZA 1C80A 2HZBA 4RNDB 5PNTA 4DHEA 2VATA 5JJ5A 3AL2A 3HXOA 3ZEAA 4ERNA 1C7ZA 3VR1A 3C0KA 1GT91 3L0DA 3HFJA 2Q0XA 2NP7A 3NBZC 1ZNYA 5KWVA 3B85A 3GJXC 1IBRA 1QGYA 1CC1S 2FSSA 2IYAA 5JWRA 2IZ7A 1LRJA 3EGOA 1SUDA 4LHXA 1Z82A 3K0SA 1OAKA 2NO6A 2OV2A 3CZRA 3O94A 1OU4A 3MELA 4WKOA 1EE1A 3TR5A 4C4TA 2VF5X 5HDQA 1L5KA 3T7TA 2WHEA 4E51A 4HATA 4TN1A 1VYUA 1FMLA 1XFDA 1YVRA 1KJ8A 1ZYUA 2D06A 2I66A 3PNMA 5DP1A 2EWVA 1KJWA 1KZ9A 3SMQA 3LY5A 3U1BA 1YJ5A 2BFCB 4LHVA 1NSYA 3CSDA 1RXEA 3FF4A 3QOXA 2D7DA 1YOVB 4EP1A 1ZJ4A 1MABA 4YRTA 4AB1A 3ZJTA 2V97A 1GD1O 2NG1A 4MW7A 4K6MA 1F2TA 2D1YA 2XUDA 3E48A 1CQWA 2CLIB 4L0DA 3PTZA 5I9TA 1Y33E 4R2MA 1WLYA 4MK4A 3AM1A 2R5FA 1E1DA 4IGKA 3TB4A 3K32A 4W8HA 4N54A 2ZRNA 1WP9A 2DFLA 2VP0A 1DUVG 1JIKA 4A0GA 5K6AC 1N5LA 1MU0A 4GD3Q 2X3UA 2PX2A 1CZUA 1V16A 1DGQA 3LCCA 2VWQA 1CULC 3KXIA 1Z6QA 3LA6A 3AW8A 3R20A 3M81A 2DETA 2D0PB 3OZVA 3O95A 4XX0B 2XZOA 2CB9A 1BVYF 1YZUA 2JFUA 3ZY5A 3HVUA 2IYTA 4XUGB 2Q4DA 2Z8YM 5TF4A 4F86A 3TLAA 4J76A 2ZM5A 2HCFA 4WOKA 3GNSA 4M6WA 3DP9A 4O2BB 1GCAA 3L41A 3VR6A 1LU9A 2EDAA 4BQNA 1U3VA 3ECAA 3QXHA 2ATCA 2VL7A 4QEZA 1BXGB 3DO8A 2WSLA 3ESZA 3UH0A 3IHKA 4EW2A 4FYYA 4RD3A 1XE3A 4FFPA 2P4QA 5FBQB 2CMHA 5LMZA 3C3KA 2PSDA 4Q4JA 3R7SA 2CV0A 3H5LA 3CLSD 1QANA 3QLJA 4CLOA 3DVLA 1BVHA 2YH2A 4EYQA 3HWSA 2NIPA 1VL8A 1R8QA 2PYIA 4J0GA 3WSVA 3HKBA 3H1PA 3B7PA 4K2AA 1DO0A 1LQTA 3ZY4A 1OXXK 3GPIA 4BVAA 2XKKA 5HVNA 1T5SA 3DOOA 2XF8A 1RYBA 4G1VA 5E8RA 4DVGA 2W9XA 3D7NA 3ZE1B 3USES 4MUKA 1QMGA 4AP9A 5JS8A 1PLKA 1XAIA 4E22A 2V4MA 4MQUA 1U28C 2TMYA 3B5IA 1AXRA 4EDHA 1N6KA 4XGRA 3L0BA 4XWYA 1G8HA 4BMZA 4K8RB 4B4VA 2K2WA 3IBCA 1NW4A 2C9ZA 5HK8A 2L19A 3DYIA 2GKGA 3EZ6A 1QCYA 4HMPA 4AJKA 3DM9B 1DOHA 3C45A 3PPYA 4FQ8A 4QAJA 4V24A 3D6TB 4X84A 1AO3A 1SQFA 2CDCA 2R6CA 3DE0X 1CT9A 4G0MA 4PANA 4GPD1 3EMDA 3SC6A 1JDBC 1LPPA 2BEJA 1FRVA 4Q3BA 2Z6VA 2X3YA 3WMWA 2QDKA 1TZ2A 2C20A 1QH1A 1E18A 1VMKA 3A6DA 4CNBA 3DHVA 1TYCA 1KEZA 1V5GA 3I4FA 1UKBA 6PFKA 3B89A 5DSTA 1J0XO 3ZWWA 1L8OA 1YACA 2EEPA 4CG3A 1TO6A 4WBSA 4W9MC 4TT3D 2P4HX 4WMLA 1D5WA 3R0VA 5GV7A 2ZYHA 3B6JA 1OB2A 1O5OA 3BULA 1TD1A 1O3YA 1VKOA 3H16A 1SPBS 3VTAA 1ZMOA 4A8JB 1I5OA 4NI5A 1FFHA 4JMLA 2QY9A 4JHXA 3G3EA 4DNFA 5DKFA 4ZAFA 5J9FA 2AYXA 4UVHA 3T3HA 3UC9A 3F6CA 2YZMA 1N0IA 2OHVA 2RAFA 2VRWA 4O4LB 2RGXA 4P2GA 4OGKA 3AX6A 4BUJA 2JAUA 1T2DA 3E9ZA 2AYYA 4KOAA 2K7ZA 4EGCB 2GLXA 3OF2A 4AMZA 3SIRA 5KSOA 3KR0A 1XKXA 4FR2A 5KWSA 3DHWC 2VI5A 1RWWA 3RYCB 3B52X 1KVSA 2IIVA 3UBTA 2IZOA 5K4AA 2PKRA 3O83A 4HH3C 3L1UA 1M8KA 2WIBA 4GHWA 3LQYA 3V1UA 3AL0C 5LZ7A 3VU9B 1T26A 1LBIA 2QJWA 4ZVMA 3E9DA 3I0NA 5CTJA 1Z0FA 4B7CA 2PGJA 1RWKA 4YUYA 2YYYA 3S99A 4N01A 3SXUA 1BGXT 5FYQA 4BAZA 1KEUA 1ZQ9A 3BWDD 5HRCA 3WVNA 5BOVA 2CCJA 4GMFA 1QXSA 1HDRA 1UZLA 5I9MA 1HZZA 5GWXA 4DREA 4E2XA 1DLJA 4X0EA 5K0TA 4MA0A 2E4VA 1RT9A 4OJTA 2XA9A 3GVPA 3LE8A 4O4IF 4UHCA 4DCTA 3CNOA 5ECDA 1W4RA 2NM0A 3JD1A 2HPHA 1UFVA 2PU5A 3CR7A 2GEUA 2WYVA 4RVSA 5EGSA 3VDXA 4B40A 5DBIA 3CT6A 3TXYA 1MO6A 2A6PA 3WWPA 3TZQA 1BOOA 2ACEA 1N6RA 1E2FA 2YFHA 4TSKA 5I01A 3QE9Y 3FWKA 4DR7B 3RS8A 2QZPA 1UM9B 2YQ5A 1CY8A 2X3FA 2YV2A 3USCS 1N33B 3ORQA 1H93A 1QZTA 2W2LA 1WABA 4ESOA 2ZJ5A 1OFVA 3BGIA 2ZBRA 4MI1A 5B3KA 3KJHA 1GXSB 1II0A 1K2WA 3NH9A 4RDIA 1OAOC 2HHHB 1X1QA 1VL2A 2OENG 4F4JA 1J4AA 1YZHA 2FX3A 3I2JA 3IH5A 4E12A 2PRIA 4KE9A 4RIIA 3HV2A 4TTIA 1GGKA 3O5AA 3GFBA 4IKEA 4ZANA 5C8DA 2VNAA 1YFLA 1P1FA 1ADGA 3PZBA 2PWAA 3QNMA 2OXIA 1ZLXA 1OX4A 4Y1EA 3USZA 2VYCA 3GFSA 4MQ5A 4CM4A 1Y37A 5DNVA 3LKVA 2O7SA 3FA2A 2VDKB 3FWPA 1I4DD 4QGBA 4PIPA 3CNLA 1MVNA 4IVNA 2WB2A 4NCNA 2Q8QA 2JGAA 3AV0B 4TWAA 1L5HB 5CGQB 3CPHA 1I4TD 4YBRA 4HUTA 5JNSA 4CEHA 3HJFA 4TROA 1B1AA 2C1XA 5K0EA 1LK0A 3BC1A 5I8PA 2UDPA 5DVZA 2Q5OA 4OQZA 2Q2WA 4IOLA 2BR3A 2XTJA 4D41A 1DPFA <