3UQYS

H2-reduced structure of e. coli hydrogenase-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
265
structure length
265
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydrogenase-1 small chain
publication title X-ray crystallographic and computational studies of the O2-tolerant [NiFe]-hydrogenase 1 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 80
structure length 265
sequence length 265
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3uqyS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3uqyS02
5A4MS 1UBJS 2WPNA 5A4IS 4URHA 1WUJS 4UCWA 4U9HS 3RGWS 4UPVA 1WUIS 5JSKA 1WUKS 4KN9S 1UBLS 5JSUA 4UD6A 4UE2A 3CUSA 1WUHS 3CURA 1H2RS 3UQYS 3ZEAA 4KO2S 1UBTS 3ZE9A 1YQWA 4UEWA 5JRDS 3USES 4IUDS 1UBOS 1UBUS 4OMFG 1UBRS 1UBKS 1YQ9A 4GD3Q 4UPEA 5ADUS 5JT1A 4UD2A 4IUBS 1WULS 1CC1S 5JSYA 4U9IS 2FRVA 3AYXB 3ZE6A 5D51S 4IUCS 1E3DA 4KO1S 3MYRA 4UEQA 3USCS 4CI0B 5JSHA 1FRVA 4KO4S 1UBMS 1FRFS 3H3XA 1UBHS 4KO3S 4UE6A 4UQLA 4UCXA 3ZE8A 4UCQA 4KL8S 4UQPA 4UE3S 4TTTS 4C3OB 1H2AS 1YRQA 5A4FS 3AYZB 3ZE7A
chains in the Genus database with same CATH superfamily
3IDSA 3GUYA 3IAUA 1LPOA 2CVHA 3ELYA 4BO0A 1QHIA 1RP7A 2H2HA 1CVRA 1SUDA 3BRSA 3R20A 4H3VA 4HOYA 4RZXA 1Q1NA 1TB4A 4QOFA 4L9SA 3WGYA 5AI8A 3RSQA 3CIOA 1HDRA 4F2DA 2CDNA 4WNYA 1ANKA 2R1TB 3RHTA 2Q28A 3DNPA 5IBQA 3GBPA 5JSKA 1U5BA 2XWJI 4YPFA 1IQUA 4IM7A 1H4QA 5CG2A 4NMWA 1JFRA 3O4JA 5IKOA 1HKUA 1SIUA 3JQ7A 4JUIA 4X6UA 3IMKA 4RTJA 3HGQA 3S8YA 5I8ZA 3WHPA 2X7JA 1R0LA 3RLFA 1VHTA 1YAHA 3P0HA 3PJDA 4EG0A 2G8LA 2WJPA 5BSMA 1M72A 3B3QA 1JXAA 4JJKA 5K3SA 4CUJA 4D8VA 3N8KA 3WHIA 3E27A 5FTLA 3ZDRA 3L6RA 1RE0A 1FQOA 1NT2A 3H3JA 4ZU3A 2BF7A 2PRYA 2VF5X 1W4ZA 2JZCA 2YL2A 4YDHB 3E53A 3FSJX 1AUOA 2AFVA 1V25A 3W4IA 3Q11A 1FU8A 2GXSA 2H1IA 5LU8A 1JDUA 3OM1A 4JJAA 3BF8A 4DDUA 1P19A 4ND8B 2J0UB 4OFZA 3H5LA 3PR2B 5K0FA 1FRQA 1LSOA 1G63A 1L5YA 3LUBA 5AK4A 3W4JA 1VL6A 1XQXA 4B6GA 4R8VA 1GLVA 3AUAA 1Y1KE 1E3JA 2HBRA 5JG7A 3AETA 3CH7A 1TQ6A 2C8VA 2VDKB 4E3WA 3DEYX 4EPWA 1E66A 1DX6A 1OYOA 1EWVA 3NX4A 1B15A 2AN4A 3GGJA 3OT1A 2HL6A 3DR3A 4YQEA 5TVKA 1RI3A 3TLGA 1Q7CA 2QDXA 2X6QA 3B7GA 3G0OA 5C8VA 3GLIA 3HNOA 1DDIA 5DKFA 2NXCA 5AI0A 3Q3JB 1A5ZA 3W2HA 1B42A 4YPOA 3HTXA 2QRNA 2PZ8A 4PIVA 2QQFA 2YNMA 5DTEA 4HVAA 4BN4A 5DNCA 5HOQA 1U02A 1O1YA 3MMNA 4ZP1A 2R7MA 4BY9E 1K88A 4TRRA 5GPBA 4HQLA 3S5UA 4MRNA 4CCSA 2D1YA 5DLEA 1GA1A 1RP1A 3PTZA 3FOEC 2JLVA 3TLEA 4NE9A 2IF2A 1E79D 1WEHA 1FTWA 2VDUE 2VT3A 3ADOA 2DBVO 3C45A 4ND7A 3N9IA 5LXTB 1KWKA 1QU2A 4OHUA 4GG1A 1V8FA 1W85A 5IXJA 1UANA 2ZVPX 5FOTA 3RSZA 1O95A 3BRCA 3SR3A 3ZK9A 2QBYB 4AY4A 1YULA 3E3LA 4TRJA 4PGHA 1AY0A 2C5HA 1TCCA 1YI8A 2VS1A 3N2LA 3NJ8A 4IIJF 2QY6A 3MUNA 3J7AC 2VK8A 1BMFA 3WBBA 2I3DA 3R7WB 1XKXA 2Z2XA 3U16A 5JZMA 3LHIA 1SA0A 4H27A 4MP6A 2AOUA 1MB2A 1WHSA 2WFLA 3RYHA 3WK9A 3SMVA 1VKOA 3ILXA 1MB0A 3JXEA 4FX5A 3DULA 1B0AA 4GH5A 4WUVA 5L4NA 2G0AA 5B1YA 1TYEB 2PT9A 3RAPR 4BQOA 1V37A 3H2ZA 4BBJA 2WHPB 4E3ZA 1EE1A 2AC2A 1J90A 5JLAA 2OAEA 2BTOA 1J22A 2C3OA 2MSEB 2WJJA 3DAYA 5K8VA 4GWLA 1DC7A 4ALMA 4XTRA 1BD3A 1JG4A 4PYRA 4EY5A 4YDRA 3IBCA 1TIBA 1NW6A 2PO5A 2J1LA 4ZEVA 3CWQA 4C4SA 1E61A 4XWKA 5I9MA 1T2DA 4GC5A 4O2AF 1U4SA 1CCWA 3EODA 1I2AA 2WB4A 2GKOA 2PRJA 4TPKA 3RJ9A 1UIMA 5F23A 5FDFA 1NN5A 2WWYA 4EW6A 3FYUC 3I1FA 2OECA 4WINA 5HMMA 2NPFA 4Y6OA 4BV9A 1AQYA 4ZK2A 2EKLA 2XHEA 1ILWA 1H2FA 2JVKA 1NBMD 5LQRA 3SDSA 3CF4G 2FZGA 4B6QA 3PUJA 4WD3A 4DCNA 2JRCA 2V9ZA 5AVTA 2QY9A 2BJHA 2OE2A 3C41J 3HYCA 4PSAA 1RC1A 3TW8B 1WUHS 5JASA 3W3AA 3KJXA 3GLFB 1CRWG 2CLFB 2FEAA 3GA0A 3MIIA 2DSTA 4RY9A 3GO4A 2V7XA 2GX6A 5DE3A 3BCRA 4JYBA 5JNSA 5SY4A 5LQCA 1OXUA 4A15A 5HE9A 1U2PA 3W77A 3PEWA 1NDUA 2EATA 2K2WA 1WO8A 4QT0A 3ZE9A 4UHKA 4CF3A 1BS1A 3N53A 2PU5A 4RQBA 4ZREA 3OCYA 3WNCA 1VMAA 2QE7D 2Q0QA 5EXXA 1N9KA 1NFFA 4BX3A 4YACA 1FPQA 1WZNA 1HRKA 2JLQA 3SX4A 1VE1A 2I2WA 1WRBA 2FVYA 5JATA 2C2YA 4BDTA 3C15C 4ZO8A 3ETHA 1NC1A 1ZDMA 2PDAA 5H59A 2PLNA 2P4EA 4WLUA 2HV9A 4O8ZA 1P1RA 4QWMA 2FZKA 4P3YA 5KWEA 3L8FA 4J9UE 5DLPA 5C1PA 5HZGA 2R8EA 3KZVA 1HSZA 2K87A 2JIRA 3HPRA 3MJ4A 5EIXA 1SCUA 1IBSA 1BQ4A 5FLEX 3H04A 3OCCA 1OWPA 3GLHB 1ZK1A 1EWQA 3ML1A 2XF2A 1RZ3A 4L50A 2NSLA 3ASYA 2BHSA 5BO5A 4IQ0A 3KS9A 4RK1A 1A2BA 1Q1QA 2NZVG 1RWXA 4G56A 5GOZA 4DA8A 1QTNA 1NVDA 4NV0A 1DKRA 2EFEB 3N58A 3GX1A 1UP4A 1T0HB 3KKNA 3CO5A 4IW3B 2JFBA 3KEMA 4L6CA 1R8QA 3LLUA 4HO1X 1Z22A 1DJLA 1KI6A 3K0FB 3VXKA 5D84A 3VR5A 1BDHA 3ABOB 2H8KA 3U0VA 2VWGA 4JEMA 5LLDA 4H15A 1H2WA 2POCA 3DVAB 1XWFA 4BX0A 3JQ8A 4R54A 1MT3A 3B13B 1DV2A 4TTRA 4JJGA 3RSSA 3TBFA 2AI3A 4MDEA 3FZNA 5L9AA 1KMHB 1NI4B 4JLBA 4AI6A 1DO2A 1T6YA 2EF1A 4KDFA 2FPXA 3MGAA 4BWVA 5FJIA 4RK5A 3ENVA 4UNRA 1NAHA 4D2IA 4ARAA 4HYQA 3F78A 5JJIA 2Q1YA 1FTNA 2BGTA 4F86A 1TJYA 2IEIA 3GNSA 4M7RA 4WLNA 3QY9A 2CUKA 2J9ZB 5ESWA 2CLEB 2VA8A 3QHAA 3WWEA 4B2YA 2JI9A 3IAS1 2BEJA 2G4CA 3LM8A 3AVVA 2N1BA 4LRXA 4ECAA 4EPXA 1TKAA 2XITA 5PNTA 2A0XA 1FLNA 1YZYA 1KVQA 3O4FA 3ZGNA 3CNBA 3PZBA 5F4ZA 5I7EA 2P6NA 5KQSA 4YR9A 1CLUA 1QYDA 4IO0A 1VTKA 4PSDA 2IU3A 4GPEA 3WGKA 4D9EA 2FOIA 2CMDA 2GH1A 5BWOA 4YRNA 2BM9A 3KM0A 4CM4B 5BOVA 2VHEA 4ESOA 1XROA 2X1VA 1I5OA 1BDJA 2C3UA 3DPIA 3HB4X 3IBTA 4HH1A 4HWTA 4TT3D 3SP1A 3ZCTA 1ZD3A 4EJ2A 1KDRA 4DV7B 4KNWA 3EIUA 2FEOA 2HK6A 3G3EA 5IKPA 2XT9A 3U7FB 3STXA 3DHWC 2V97A 1RKUA 3HUFA 1JXOA 1GTG1 1KRWA 2J59A 1IJKA 3KVNA 2HO4A 2ZFUA 2PSHA 2EHDA 3CZPA 3HXTA 1G42A 3B6ZA 3HKCB 5I8WA 3WJ2A 1YHYA 3UAVA 2ZZNA 3G82C 1BD4A 2NAFA 3HFJA 3LC7O 3ZHSA 3QE9Y 3QK7A 1K1EA 4ITUA 2PQ6A 1DCFA 2HBZA 3CV3A 4GOXA 3PHIA 1J2JA 2H0AA 2HQRA 1E3WB 3JZDA 4FE7A 4Q3AA 4W9RA 3S2EA 1SCAA 2Z6QA 1KOGA 4QRDA 4G0MA 4D3ZA 1UMCB 1HL7A 5D5PA 4EMTA 2FSHA 2PNFA 4NFSA 1HTTA 2WHEA 1ZKMA 4IUDS 1MJNA 2Q1UA 5AK0A 1Z29A 1XMVA 4RMJA 1KZ9A 3ZCRA 2BSQA 3NHUA 1JIIA 1GLGA 5E1BA 2W2PA 1OA1A 3RV3A 1EKXA 2IQIA 4LWQA 4LCEA 1CQJB 1KEWA 1Y3IA 4EKGA 4YXFA 3AI2A 3L1UA 2B3DA 1ST2A 2MSKA 1MA3A 3VR6D 121PA 2AX4A 5NLLA 1TZMA 3D8UA 5ADUS 4PY2A 4D25A 1IZ8A 3HV0A 3WR5A 5C1DA 1YS2X 4A8PA 2H5JA 1AGRA 4G07A 2VYVA 4WY2A 4D9NA 2ZJ8A 1CY1A 2WUDA 3SK0A 2QMQA 2ORWA 3NFRA 5U1PA 4J49A 1YZKA 3HXKA 4FOLA 1Z4MA 3LT1A 4H7DA 4MUJA 4DV4B 1NMYA 2AZDA 3ZDFA 4F71A 4Z4FA 1DP4A 1TJ3A 1U2DC 3E9CA 3V8NA 3NMUF 5JHGB 1RBQA 2C5BA 3UAYA 2EKBA 3FGOA 3ROGA 1FFXA 2W71A 3OEHA 4M8LA 3FFBA 1OTXA 3GFFA 3K15A 3ZGYA 1FSPA 3FLBA 4NBKA 4L72A 4BCCA 2WWRA 4WEOA 2HQOA 1Y1PA 3DV0A 1H66A 3C3MA 1FRNA 3L05A 5LDGA 2W7TA 3TNJA 3LDGA 3JS5A 3GUVA 2HPZA 4IV8A 1CSEE 1JEQB 2BHRA 1OREA 4ASUD 2A84A 3OWHA 3T3EA 4NDAA 1XV5A 5F7XA 3NR2A 5BVHB 4YA6A 3GGOA 3VOAA 1C7ZA 2ZIZA 4RDCA 3HA2A 4TMFA 2J30A 5EJIA 2Q4TA 4Z4GA 2QTVA 4UASA 3GLGE 4YJGA 4GPIB 3FYSA 1I33A 2IIVA 4B09A 3QOYA 4ZZ3A 1RWWA 1NLUA 3GRYA 4KFTA 2ZSAA 1F8GA 1N2CB 2IS1A 1E1CB 3MLEA 2Q8NA 4F04A 1YQUA 5BNIA 5GJBA 4FWIB 3NH6A 3WXMA 4BC1A 5CM9C 5F1OA 1OOEA 1XQ9A 1QH1B 4RACA 5LZ2A 4GKAA 2CV0A 1M34A 4BLOA 3OE5A 3PFBA 4LDJA 2I8CA 3AV3A 4NEQA 1K7YA 1XIVA 1T3HA 3NTLA 4MIKA 4MO2A 5DHSA 2J48A 2NQ2C 4BVGA 4YUYA 5K0SA 4UCWA 2CXOA 2R97A 1E4VA 3O31A 1NVMB 4IZOA 3KXDA 4C06A 3CVUA 5GINE 4NYJR 4N41A 1FOEB 3D4LA 3H5IA 1ZK2A 2HF9A 3NALA 4X6LA 5FI5A 4HVTA 3WADA 2C4TA 2RHHA 3UMCA 3V8MA 2F1HA 1P0QA 2P3OA 2WW8A 4HRVA 2FWBA 4Q4DA 1WM1A 3CRW1 5KNDH 4AYTA 2X3YA 3QMMA 4FE3A 1T36B 3FWHA 2ZS9A 3BSFA 3H5WA 3KYCB 1ENYA 3IDOA 1MOZA 3RS3A 1B26A 2H4HA 4C4ZA 2FI1A 1TEHA 3AF5A 1FNBA 4TRMA 1KSGA 1WPXA 4URYR 5AK3A 5I3ZA 5LQMA 4DUZB 4COKA 3S68A 2EV9A 5H80A 4DBLC 3GN1A 1YDGA 3Q7EA 3T1YB 2FLKA 3BB3A 3L6BA 1C5KA 1WCYA 3W5IA 4AG3A 3DXFA 5EGSA 1JW9B 3ZE1B 1IK4A 1KR2A 2G77B 5AJZA 4AQYB 4BZPA 3ZHCA 5HKBA 3IELA 3V1NA 1DBWA 4WCFC 1PVVA 1UC5B 3UPUA 2HXSA 4OK6A 4GSKA 3VR4D 1GGFA 4TYNA 3H4TA 1QQ6A 3D6UA 3OZCA 4RGVA 5JVDF 3TMYA 3DCYA 3PI7A 3QVJA 4PNEA 5CA0F 3O2NA 3L07A 5EESA 5JYBA 2MDTA 2JGDB 1L4FA 1W4CA 5FQNA 1KO4A 4LE0A 2IODA 4INOA 3SBEA 4WZZA 1V48A 2AK2A 4CMIA 3CBQA 1EAMA 1KMNA 4HDMB 1SBIA 1PQ4A 2DBZA 3H16A 1IBMB 2NWQA 3FJOA 5HUJA 4OL0A 3A1DA 3AOEC 2OCDA 4M9SA 3QXJA 3MGKA 4EQZA 1NVUQ 4U7HA 1NSYA 2H1FA 3P4XA 3SXPA 3OX4A 1NUQA 3REQA 1BW9B 5FPQA 5H4HA 1IY8A 4A2CA 3U5ZB 1FTSA 3P9ZA 4N54A 5CYPA 3QWIA 4LYFA 4PG5A 3RU3A 1AMOA 5CJ2A 3GI1A 4PGMA 1G2IA 3IJPA 4JVSB 3R5XA 1HDXA 4NNOA 1NZJA 5KJEA 1W52X 4ENQA 3W2IA 2QUHA 1VJRA 4FDVA 4HNRA 1QK3A 3M49A 3L7CA 4MZDA 1HFKA 1MB9A 1EI9A 1YR6A 1PTKA 2RD2A 3UOGA 1UXKA 4B85A 2NV2B 3I92A 4K6KA 5C8YF 1VIDA 4IY1A 1L5RA 2C00A 3BMOA 4K6OA 4RVFA 3PFHA 3T06B 2FGKA 3V3KA 4C04A 5CDFE 3ESYA 1Z39A 1KZ7B 1XZGA 3H13A 3LP5A 2CEAA 4U7DA 1U9ZA 3KR9A 5JNLA 2PGLA 2PCJA 3RYIB 1TW3A 4J1TC 1MVNA 5J2TF 1D2HA 3PTAA 2GBFA 1ZR2A 1CDEA 2WC1A 3T7AA 3KJHA 3R4VA 4PG4A 5C2JB 1IY9A 1H6AA 2Y05A 2ZYDA 3R5HA 5CX4A 3W2FA 1NM5C 3DDSA 4KE7A 4FQ7A 5KX5F 4X1YB 3DFUA 1WS6A 1TJPB 2ODPA 2OHFA 4AUMA 2HW8A 1ADGA 2RKOA 1DIRA 4LJ5A 1MG0A 5EWJB 4RJLA 5KOHA 1WETA 2P91A 2Y3IA 3ND7A 1IONA 4QIHA 1P74A 3R44A 3JZAA 5G0VA 2PYDA 1AK2A 1OVMA 2SBTA 2VSXA 3D2AA 5EZYB 1XVIA 4AUEA 3L7IA 1HI9A 1CFJA 3V6MA 2DFLA 1MNQA 3QG1A 1GP2A 1Y4AE 4G5HA 5EZQA 3U61B 1KMIY 2GZ1A 2I7CA 5TGTA 1QS0B 3O4RA 3OHPA 4URZR 2R7KA 2GASA 2E4XA 4FFBA 3WJ7A 2B37A 2I7TA 3DUFA 3U48A 4YAWA 2ID7A 2ASVA 3LXRA 1MVOA 2PL5A 2W2TA 4HGRA 4M1QA 4NBVA 4E5NA 2R6FA 3M6IA 4EBBA 2NUPA 4Y2SA 1JIUA 1J7JA 5JFTA 3SHTA 5EFZA 2B0CA 5B1IA 4H7EA 2HX1A 2Z9DA 4ZVTA 5H8WA 2ZK7A 3JY6A 2IF0A 4DPLA 2X42A 2DM6A 1K8XB 1RYFA 3VPFA 3TRFA 3V3TA 4PS0A 1B3RA 2RGBA 4YYZA 4PPGA 3FB1A 2FPPB 1FUIA 1XDZA 2YX1A 4JD5A 3RQIA 3OLXA 5LFAA 2BMJA 2M1XA 3NBYC 1KEEA 3AVYA 3WQHA 5EJ5A 1ZGHA 3Q3IA 3W1WA 3GJRA 2FF5A 4A8TA 2I6QA 5AD1A 4WXYB 4D9GA 1FA9A 5EN4A 4Y2JA 1VMEA 2ESRA 1OQAA 4EKYA 4A92A 3JR3A 2PMCA 2REQA 3A9RA 1E7YA 1X2BA 4MQFA 1Q74A 3IUMA 3L4BA 4G65A 2P65A 4NCKA 1PNTA 2HBYA 1RJEA 1KJYA 4GZ3A 3A37A 5AXCA 3GRKA 5AKGA 1U63A 4JB3A 2ZIFA 1N0VC 1UMKA 2H2WA 3TPFA 3L9WA 3EXFB 3JQFA 3PENA 3VTKA 1N2IA 4B40A 3EC1A 3LNTA 5JJCA 2ZIVB 2RAPA 2HI0A 3H7AA 4BRZA 4JJIA 1M2OB 4HTFA 4ZT2A 5HPYB 2CUNA 3E18A 3HYSA 3VNQA 5JZOA 1USUA 3O1IC 4C7MA 4HD8A 1N25A 4BO6A 4B4VA 3PVZA 1IUKA 1UPXA 3R3ZA 2XWBF 4R01A 3BMNB 5DNAA 1VCIA 4KRFA 4CKBA 2Q9BA 1XA4A 4UREA 2VIIA 3ZHXA 1TLLA 1W93A 2A6PA 4RZUA 3LBHA 1DTWA 1GU7A 1GG9A 1U9IC 2OV1A 4PRZA 1ZCAA 1JR3D 3AR3A 1F2UB 4BO7A 2ZT6A 1G8KA 4XPIB 3SXJA 1PE0A 2R4QA 3KWMA 3G6KA 3R9KA 5ADHA 2NX2A 4QPZA 4Z4EA 1DJNA 5DWDA 5EKDA 2ORYA 1M0EA 1U3TA 1IBRA 2YRXA 3WQSB 5JI2E 3R41A 5C52B 3H5VA 3D9QX 4AKSA 3FN4A 3PLAE 2P9ZA 3AUXA 2YV5A 4DIEA 2JFYA 4FGJA 2ZYAA 2XZOA 4WK4B 4X71A 2CVOA 4MKIA 1Q0ZA 1UJ2A 1UK9A 2VOEA 4ZMSA 2A8YA 2I66A 2O7SA 3FUUA 1NF2A 4UHCA 5CAEB 3N8GA 3G79A 2XMQA 2FPGB 5B53A 3C4JA 2FSFA 4MEJA 3GOQA 2Z09A 5EFOA 5FO0A 4OQ4A 2HFKA 3DMDA 4JSRA 4FFRA 1T0PA 4MKGA 4EP1A 4B7UA 3WTCA 4FD3A 2FWPA 4NMHA 5A4IS 4I9FA 1Q3TA 2CHGA 1PT9A 4TT3A 2XUDA 4CL0A 4TV9B 2GEKA 4H3SA 1SXHA 3QHPA 2RGNA 1W5EA 4IHJA 3TQOA 1JKJB 2IELA 3PFGA 1T9ZA 3FHJA 4MRRA 5FL3A 4IRMA 3A4VA 1OR8A 3OCJA 5LP6C 1CEYA 1FEZA 1ZH2A 4LRUA 1URPA 5CR9A 4IXWA 4UTPA 1A98A 1GPLA 1TM3E 1TUGA 3U9TA 4W99A 1XALA 1ZUWA 2X8BA 4YP9A 3E61A 1Q0TA 4AJ4A 1SH7A 1A9XA 3TCNA 2CFRA 1Z4QA 3PYMA 3U7IA 3GAAA 3UWPA 1JFFB 2CJWB 2AGVA 4ND2A 2FTKE 3HBFA 2W00A 1NI5A 3EGOA 1X3LA 3AFIA 4U2DA 3KU4A 1L3BA 4XSHA 5AKJA 5IJ9A 1U2GA 2EHJA 1SKYB 1JMKC 2IV3A 4LS3A 1R6VA 4YT5A 3FFAA 4WA7A 4A0FA 4YV0A 5FI0B 5LNK6 4Q3EA 4BQRA 3VDMA 3BILA 4HYTA 1KO1A 2O2GA 3KZMA 4J3NA 4GR9A 2AMFA 2YXBA 3KELA 1XRMA 2G67A 2OR3A 4QVGA 4QPJC 3RT1A 5EJ4A 4W9MC 1LFAA 3VH2A 2DU8A 3IP8A 3PQFA 3A3NA 1RCUA 2FDCA 5HK9A 4DUGA 4YXWA 1G1AA 4XM1A 3JAKA 3UH1A 4E14A 4KR6A 4AO7A 3HB7A 1WE2A 4OHOA 4R3WA 1HZZA 4RVDA 5EXDA 2GNPA 4V2UA 3NHMA 1ECGA 4D0GA 4N9WA 1YRYE 4XGIA 1JECA 2B3TA 4DL9A 4CXMA 3PX3A 1OZ0A 3DOFA 1M3SA 3CEHA 4LJ8A 4TOIA 1G8AA 4WN9A 3FYCA 3DE3X 2H2GA 2IW3A 2PZGA 3GZNA 4P83A 4U39A 3GLQA 2RAUA 1SVIA 3DBOB 4PHFA 3LW8A 2EKPA 4UJ5A 4E4RA 2NUAB 3BJMA 2ONYA 5I9NA 3RUDA 1SQ5A 1DS6A 3U80A 2OO5A 5LQAA 5LOVA 1N6LA 5B2FA 1HT1E 1FVXA 2BDTA 3D7MA 1M8KA 2DKNA 4ZTZB 1QBGA 4FS3A 2J7KA 4D26A 3ED1A 1IRIA 5DM4A 1UK7A 3D6MA 2BF4A 5DN6D 3D1LA 4JI6B 2PD6A 3PQDA 2W8BB 4J16C 4QODA 4MWEA 4H7IA 4GUAA 5KJFA 2H08A 3F2IA 2FDXA 4BNXA 1A9ZA 1XMXA 2R47A 5DZSA 1KZ1A 1M1NA 2P62A 3RAGA 3B1WA 5IAEA 1N4AA 3KOYA 3WE7A 4B79A 4DKJA 3ZWBA 1SBZA 2O0HA 1GT6A 3M8KA 4G3XA 4AF8A 3DWGA 5E38A 4UU7A 1MEEA 1U5AA 5EIBD 1G5PA 1U3FA 4XDZA 2NZXA 2CHQA 4E21A 1GG5A 4K03A 1NNLA 2DTEA 3KZCA 3QTBA 1ZGGA 1CY6A 3U13A 2NU6B 3MLBA 4AVYA 4CM9D 4BN0A 5KVSA 1C8BA 3Q9UA 1ZD9A 3FF1A 1O87A 4L2IB 3CX7A 3FJ1A 1LD3A 3LY9A 1MO3A 2EQAA 4LHWA 4MAMA 4BV2A 2CXUA 4R9NA 3ETLA 3GLUA 4EIWA 1AQUA 4G1FA 2C7VA 2H4FA 1H0HA 2RGGA 5F7JA 3SEAA 2W0MA 2X1LA 4L4SA 4AZTA 3PYXA 3IPLA 2ZR8A 1E58A 2WSMA 2HF8A 2I3GA 5AW0A 1S1CA 3FCAA 4RJKA 5IAAA 2ZM6B 3WLPA 5IC5A 2YASA 4H1HA 4CMGA 2G28A 4FSHA 1EDDA 2EQBA 1AM4D 3AHCA 4M89A 5G4LA 1MAAA 1NRIA 2Q1SA 4C89A 4E11A 1DL5A 3ZWCA 3OX3A 4GLJA 5K8TA 3SDZA 4EEZA 4KBGA 2R1TA 2Z3WA 4OLAA 1MHTA 2PUTA 3GJYA 1JF8A 1IXSB 2UKDA 4TLEA 1AZTA 3DE5X 2EBFX 2VVTA 4EGQA 1JBEA 3VSBA 4DRXB 1FZQA 3D3JA 3DCIA 4KPYA 2HNBA 4KQJA 3I8OA 2BIFA 3NORA 5JDCC 2O1WA 2JAQA 5I7FA 1HX7A 1R12A 1QAQA 2YMPA 5TJ9A 2P2DA 3W5BA 4DAOA 1RLIA 4GMXA 1PT5A 4LJ4A 1NN0A 3EGWA 5FA6A 3DXXA 1J99A 4I50B 2R65A 1CUEA 4YI3A 5JNVA 3KOXA 1HETA 3OOYA 5AQEA 1APBA 5AKYA 5LBTA 4YV1A 4IMJB 3WVNA 3BIWA 4QHYA 3TWOA 4XVRA 1TEZA 3K0KA 2GYVA 1BFUA 4OSPA 5LWQA 1V5IA 1JHZA 3TINA 4KCGA 2EDCA 2H0QA 2J0UA 4ND8A 2WWWA 4KGZA 4N8DA 5C37A 2QL6A 3CJRA 3FSEA 1D7AA 1X15A 1V26A 4K9MA 1T6XA 3HBMA 4J4TA 4CL2A 1TKBA 4F91B 1WKCA 2BFEB 2R4UA 4XH9B 1TO6A 3B1FA 4MGYR 2I7XA 1DBRA 3MGBA 1Z82A 3L01A 5ITVA 5C4IA 4DGQA 1PGOA 3ESRA 3ER8A 4MLDA 4MUYA 4G9BA 4NHOA 4PN3A 1GRQA 1R0ZA 2PCLA 3LLCA 4WZBB 3O1JC 2JIBA 4P7KA 1U2EA 2GXQA 3DEAA 3LZ6A 4REMA 2VHWA 5G0UA 2J0SA 2I4NA 1ZG3A 4FLMA 4GMHA 4EY7A 3HKBB 2PBLA 3WIUA 1NI3A 1HEYA 1JU9A 5TX7A 3V4ZA 5ISMA 1G6OA 1HT3A 1XJQA 2X8JB 1ODJA 2OESA 2Q5EA 1A8UA 3R5FA 1DKNA 1QG6A 1GG8A 2BAGA 3PRJA 5BMVF 5LXTA 1QOQB 1RM0A 2J0EA 4XD7D 4ZOAA 4BLQA 1HLGA 1FCJA 2QZJA 4C7VA 2QBYA 1MOQA 1XQ6A 1UBFA 3OKFA 5DNEA 4FCVA 1B8OA 4UUQA 2UZ3A 3N3BC 4IH4A 4YO7A 1XNRB 3OQIB 4O1HA 2PWAA 4RH1A 1YDEA 3RSCA 3SVZA 1T0UA 3GUZA 2WE7A 2YINC 5CBKA 3GIDA 1LSJA 1IMOA 1GZ5A 2DH5A 1EP1B 3HZRA 3I4LA 4MUGA 4TMKA 3R7WA 3Q9NA 2H52A 2VTKA 3K9HA 3PCTA 4QNMA 2EFDB 4ZPJA 1O8BA 3IUNA 1G20E 3B1YA 4ENTA 1CF4A 4Y6QA 2G0TA 1CD5A 4LSWA 2PZMA 1F20A 5AMXA 1IN1A 3WLNA 1ST3A 2WHPA 1XRJA 3CZRA 5K3CA 2GDZA 2X23A 3KAKA 4CLXA 5K0TA 2C42A 1EPUA 3A1TA 1HDZA 4J03A 4HJRA 1DBPA 1PL6A 2XDAA 1UK8A 3T6KA 3C2QA 1MAHA 3AERA 4LK2A 3A1CA 2YFKA 4M8NE 4U1RA 2D7JA 5LQKA 5JTUA 3Q2OA 3HYTA 4GI7A 5IS2A 1PTJC 3MOSA 1U94A 2QL9A 5I7SA 2X41A 1CR0A 4OPMA 1NXWA 1S8NA 5EIHA 3LY5A 5K8LA 2PLAA 1S2LA 4RDIA 1UXGA 3LRTA 3WFZA 1PR9A 4QULA 4CF5A 2OKGA 2AFIB 2G25A 2ZB4A 2O6LA 3N05A 3ZS9A 1RRKA 2KLBA 3AZOA 1J20A 1N2OA 2VSYA 2H1CA 4KQXA 1CZRA 1KI8A 3DEKA 3SC4A 5GONF 3I45A 3F3KA 5EYPB 1W59A 3QW4B 2B1QA 4NECA 1SBCA 5F9HA 3H2IA 1Q44A 1Z4IA 2I3AA 3KFXA 3NNNA 2EW8A 1HNNA 1FL9A 4OU4A 1AB5A 2G9ZA 3U9LA 1JR2A 2FJPA 2RI1A 4QU9A 4QREA 4WOCA 2RHJA 3TRHA 3TW8A 3URKA 3A6KA 2VHJA 3GFTA 4R7ZA 3GLFA 1X1SA 3H19A 3A1UA 1VI2A 4PG8A 4XKJA 2ZB2A 5AUOB 1GEEA 3LYHA 3PGA1 2WSLA 4GVLA 4KVZA 1GNQA 3RK1A 4DIKA 3K70D 2XCQA 2Y1GA 1R4ZA 3SQXA 5M5BA 1X1DA 1U28C 1BE8A 2OBMA 3WYFA 2SHKA 3UHFA 3SFZA 2JFOA 4L74A 1SRRA 1XN4A 4S0ZA 2IEAA 3SJUA 2Z57A 2GOYA 4R69A 1XPOA 1AGPA 2R3SA 2OGWA 5DN9A 1JAYA 1T1GA 1V45E 2VUHB 4O02B 3W9BA 1E2MA 4GPAA 1QX3A 4PTLA 1PJCA 4PX9A 4RVOA 5GIPE 3C4QA 1DEAA 1K3FA 1S4QA 1WWKA 1XKTA 4ZAYA 3WYNA 4RULA 1F8UA 2IYEA 3QKSB 1Z68A 2YCLA 1NL3A 5EY5B 1LW7A 4HNUA 5BSGA 1T1SA 3HACA 3T95A 5JOQA 1W96A 1Z6YA 1SCNE 4AKTA 1O6FA 3DV2A 4UBOA 4D9BA 3BHIA 4D43A 5IUJC 3GLHA 2FG5A 3HB0A 1QGDA 2A1IA 2VT6A 1ZW1A 1O9GA 1E89A 4LRSB 2O8DB 1VYVA 4JP2A 4N5MA 1PJ3A 5JMWA 1XEXB 1CQWA 3AF6A 1C9EA 3RS9A 2I6UA 2G4VA 3OH8A 3U3DA 5FPSA 2GGSA 1TI7A 1Z2NX 5GAJA 1XEWX 2NU9B 3TL2A 1KTVA 4KZKA 1BOFA 4YMWA 4YFVA 4MWSA 1T9HA 2GCPA 3LYUA 3K0FA 1MCZA 1X1TA 1Y7IA 1VCHA 2APJA 3CT6A 4MS3B 3ZHZA 4DXAA 1QIEA 5AJTA 3X1ZA 5FWNA 4DQKA 1PQPA 3MPOA 1HRDA 4G8JA 4O6VA 5JCJD 3R8FA 1V1RB 3DVAA 1LDNA 4UHHA 3WLJA 3SHVA 4OUDB 4FWTA 2WOOA 1LFDB 2YFHA 1TVKB 4IS2A 3DAPA 2PJZA 5ALRA 5EIAA 5LWHA 6YASA 1PSWA 2PGDA 1LCIA 3FKSD 4YHBA 5LVAA 3AI1A 1KMHA 3DT6A 1NI4A 2C2OA 1M6EX 4C6RA 2B8EA 1SPXA 4QYWA 1Y1QA 2LIPA 3SWWA 5ECWA 1ZGAA 1N2XA 3NTXA 3HCRA 3VYUB 1I9GA 1RTTA 1CZLA 4HX5A 4LCJA 3UG6A 2Q21A 4HWOA 3EFBA 1I6WA 3OOWA 3LQ1A 5CM8B 1C4KA 2CJYA 3TGLA 4X92A 2IDMA 1OPXA 4B8YA 1BVHA 1UK6A 3RT7A 3EDRA 3TLZA 4PM4A 3RS5A 2IUSA 4KAJA 4ZICA 2RHGB 4C6HA 1EZZA 3PA8A 4V0KA 4ZEOA 4UXIA 2VNIA 3MGGA 1KJIA 4D9HA 4EPTA 3DBLB 2JGKA 2IIQA 2WPNA 2H1WA 3KR1A 4XWTA 2ZVDA 2WICA 4CM4A 1M1UA 3FVWA 1XZCA 3IVAA 3P0EA 2OYRA 4N3BA 2X22A 4PCUA 1UQRA 3IILA 3OEEA 2VF2A 5D3KA 2XUAA 1EINA 2CLMB 1KI1A 1P7YA 2DQYA 2YVQA 5M2QA 1FXUA 1E98A 1VG9B 1T4BA 1QVAA 1XP5A 3NWOA 4MB6A 2O48X 3V7YA 3VOTA 1OWMA 4UHJA 5IJ0B 2JZOA 3EXHB 5HHTA 3NM5A 3PT9A 1X9HA 5FOUA 2V5UA 3V8QA 2V6BA 3PF8A 1PWXA 4XM2A 4OYYA 3WGTA 4NJMA 2XUQA 3CZQA 5F98A 3AFOA 4DSZA 2RBEA 1NG1A 4A2PA 4EKDA 4JYAB 1W88B 1V96A 2Q4RA 3A6EA 3C7DB 3DR5A 5AKKA 1U2RA 2WUWE 3L7OA 4YCCA 2NO1A 4LJLA 3HKCA 2B2XA 2EQ5A 3HXQA 4P80A 3AMVA 3UCEA 1K7EB 4TXMA 3V8VA 3OSUA 3GCZA 4G4SP 1PK7A 2F3PA 2VCYA 3ZWKA 3ZIDA 1W6UA 4O5OA 2QI9C 4JI5B 1D8AA 1E3WA 2FE4A 3LBYA 1CZOA 2WAYA 4I1VA 1MABB 1N3LA 4E5DA 4WTOA 1YRHA 3V97A 1UMCA 1SC9A 5T4BA 1Z9BA 3UV6A 1KPGA 1D4AA 1EHCA 3JQBC 4MCJA 4ENVA 1ZJWA 3TOSA 2AJLI 1KQNA 4E88A 2H63A 2PGNA 3H99A 1GPNA 4IGKA 1X1CA 3P2KA 1NJ8A 1NX6A 4PGFA 3ZY3A 4O4IA 2ZJ0A 2DH6A 2PMDA 5DHRA 1CX9B 3A06A 3TTYA 1QKIA 2CKDA 2FR1A 2O7QA 2ONZA 1V8BA 2WF5A 1L3IA 3P0IA 3AWIA 2FPRA 3F4BA 1BN6A 1OIXA 2XA9A 3HCOA 4OB8A 5SYNA 1ORWA 3RS7A 1G8HA 1PS9A 3VSAA 1G6HA 4D0NA 3QE4A 2BH2A 1Y6GA 4ZO9A 1EP2B 5BWLA 5DYYA 3SBDA 3WGJA 3I4CA 3LOQA 1JHYA 1JLKA 2JGMA 1N9ZA 3CW8X 5K6AA 1EX1A 2ZUBA 3O74A 4YAFA 1TYZA 1OIWA 1RWQA 4HGPA 4EY3A 1RHJA 5EVJA 3KPJA 5EJ6A 5IP5A 4UEOA 5JHHB 2AC4A 3UJNA 1T6BY 1D1QA 3MMSA 3STVA 2I34A 3EOBI 4D45A 3CG0A 3EVCA 3IQEA 3E70C 3GLRA 1GKYA 5CT4A 3RLIA 4F4IA 4ENUA 4WWHA 1AXEA 2PUWA 4AF6A 3ZDZB 3NASA 1Q91A 4HEA6 1JEQA 3WMWA 2VJAA 5ALOA 3OJEA 1IHOA 1Z26A 3GZJA 4P4TA 4RZ2A 2AEFA 3F7OA 5K0NA 1KC1A 3HMKA 4LXHA 5BVHA 1GR0A 3W5VA 2C98A 1NW9B 4OI1A 2XWSA 1CZHA 1Z25A 3QKTA 4AW9A 1W19A 2WG1A 1DUVG 2GZ3A 3ZEIA 3Q88A 4KE6A 2Z2ZA 4LFBB 3OJXA 1OH7A 1MRSA 1N2CA 2I1WA 3K09A 1E1CA 4WLEA 5CLLA 2RIRA 4BAZA 2HXYA 3K9LA 4C3UA 3SQLA 3B82A 4KQFA 3SQDA 3RFFA 3ZLBA 1L0BA 1QH1A 1FK8A 3AHEA 4G5YA 4MS4A 3W7VA 1SG0A 3I5YA 4X3PA 5FWAA 4QOJA 1ID8A 4HNAB 4FLEA 2YHAA 4PO3X 4QFDA 1CXZA 3IBGA 5HA5A 1DLIA 3NEYA 3UM9A 3O03A 3QQPA 4FCTA 3H2SA 5ECDA 3TPZA 5BQFA 3ZNQA 5AK6A 1ATIA 4OOFA 4PC6A 2A9RA 1II0A 2Z4SA 2J5BA 4YH1A 1PDWA 3ZVNA 3DMGA 2Q7XA 2OZEA 2VUIB 3A0UA 3HCEA 4MUKA 1W0KD 1UF9A 2F00A 2AX3A 3C5VA 2VBFA 3Q3VA 1BYIA 1T36A 3I9V6 4HWSA 2WM9B 3KZXA 1RRFA 2UVDA 2L82A 3MMXA 1OW3B 3QTLA 4FFWA 4NZ9A 5CLHA 3TTXA 5BNZA 5B5SA 5CDHA 3T94A 3O8NA 2PMFA 5DNUA 1WMEA 1OZHA 4JQSA 5F1YA 2J4FA 1NF9A 1WOMA 3MBIA 3OM8A 4JBIA 1XTIA 2GN8A 5IJAA 4R8KA 4P54A 2OFXA 1MIHA 3T4XA 2ETVA 4OAOA 1P80A 2A1TR 1W94A 2IYUA 4EF5A 4F4HA 2R7AA 3GDHA 4DWOA 3WWZA 2VXBA 4KKXB 1GNSA 3SBXA 2TS1A 3IBFA 1N3IA 1PWYE 5K0BA 1K8ZB 3M6UA 3MCTA 1WR8A 2OTCA 3COPA 4RE5A 4CV1A 3NHJA 2PSFA 4ER6A 2QVBA 3F7MA 2VYFA 3VZBA 2DBRA 5MGBA 3NVDA 4QUBA 4CKEB 1T6ZA 4BQNA 4J0GA 3H5TA 2JGDA 1Q92A 4RZHA 3E3MA 5HQTA 2MHCA 3X1WA 1LU9A 3AGQA 1Y3HA 1R6DA 4GSLA 1ZONA 1Z4JA 2GPNA 2P1ZA 4NQZA 5AYVA 6GPBA 4HDMA 3AM5A 4WZAE 5ALJA 1EIWA 1E2BA 1M54A 4JT2A 4MYRA 1ICIA 4Q1FA 2COKA 4L5CA 4UZSA 1BMTA 3JYQA 4RMGA 3CLUC 4BATA 2HPAA 1O6ZA 1EFAA 1R9JA 2D0OB 2JI4A 1BW9A 2X7HA 1LQTA 3ZTYA 4QL3A 3JX9A 1VP9A 3PR3A 3UIEA 4DYVA 2VXYA 2PU7A 2QN2A 4XD7A 3UZUA 3CKYA 4EJSB 2N9UA 1SAYA 4TXHA 2FG6C 1G5TA 4CLOB 3ONVA 4BFUA 2QN9A 3AFMA 4HX2A 2VZ0A 4AC9A 4R16A 4HHEA 3VNVA 4ZMBA 3BCHA 1N7HA 2AW3A 1W9HA 3STHA 4AO8A 2H54A 1AN0A 1R2QA 3EZFA 3RTBA 3UA3A 4KPEC 1VKJA 2B99A 4HWPA 2WHRA 1EXMA 3TZEA 1RT9A 4J90A 3ET5A 1P5RA 4R1MA 2VXOA 1BX1A 3C3WA 1NPTO 2BDUA 3DT8A 5I48A 1ZN2A 2FPSA 5KTPA 2GBLC 2DQZA 4DCGA 1CEXA 2IYAA 3ZV5A 1HT0A 1Q1ZA 3S6JA 2G36A 1XDUA 2A88A 2G5TA 3AF2A 3QVSA 4GXQA 4KXQA 5HMLA 4C7KA 2BUBA 3M6VA 4XVCA 3SICE 4IQGA 2QXYA 2YTZA 2XA2A 3OLWA 4QDKA 4X1YA 2QN6A 5G1PA 3UGQA 4D4HA 2PKQP 3JCZA 3KK0A 1KIMA 1Y6ZA 2G1KA 3NBZC 4PSCA 3QPBA 1UDAA 4HUJA 4GLBA 2FPIB 5EWJA 1OFUX 1T2NA 1QYVA 2A94A 3N2GB 4QFBA 1H2AS 4BGUA 4JB2A 3TOVA 2YIMA 1D6NA 2Q2OA 1CUFA 5EZYA 3ZD8A 2P2ZA 4M1OA 4HN2A 1EHIA 4E15A 3T9BA 1I7LA 4DTCA 4KR7A 1DUIA 2HU5A 3V48A 3EGDB 4E94A 3T0IA 4BNFA 1LPAB 5T6MA 4C01A 1USGA 5C80A 3ERCA 2C8JA 4OUKX 5BWMA 1ZNWA 4UUBA 4AJHA 1I9CA 4QYIB 2WNHA 3MRTA 3KC2A 3D4BA 1SVMA 4C07A 4JI2B 1DOHA 4ZZ0A 3UQZA 2HFJA 2B7CA 1RPNA 4UUOA 2GFIA 4QAQA 3ZWXA 3GFQA 3VGPA 4FEAA 1HEUA 1ENOA 4FNOA 1E2DA 3I6MA 3PQEA 1T8RA 1V8DA 2PG3A 4AN1A 3DQZA 3PKIA 1AHHA 1E9DA 2FPPA 3VYRB 1T15A 3T61A 1U1GA 5IVDA 5KYKA 1AVTA 1J39A 5CEFA 2IYLD 3HS3A 4I9HA 2O54A 1A8QA 1ML4A 3L02A 1ICEA 4B8ZA 3PNBA 2OB2A 2WFMA 4JFAA 2GVNA 1S0UA 3W9UA 2J3IA 4GR4A 5JEDA 1H8HD 4C4YA 1VJTA 1N9GB 2H92A 4QTXA 2OXFA 3TFQA 5EHGA 4ZC8A 3OC6A 3I5UA 4YJ3F 2FCAA 1QHXA 3KT6A 1ZIXA 4WA8A 1E2HA 2J9FB 3EXFA 5EA2A 4D3FA 2FKNA 2YZNA 3HKDB 4CMKA 4FCWA 1XA0A 4WJLA 1M2OA 1TU4A 2QENA 4GD3Q 4NTZA 5H9VA 3WYBA 4FHFA 3JQEA 3N75A 5HKAA 1IWPB 1M73E 3B1KA 1E92A 1FJ2A 3CCCA 3LVFO 1Q0PA 2PD3A 5L95A 4G85A 3BMNA 3MWEB 1T91A 3L0IB 3DONA 2EFHB 3WGHA 4QUIA 1C1XB 3H86A 4FCCA 1GGHA 1HYBA 3I64A 2H4YA 1F2UA 4ODIA 1ECLA 4RMNA 5CHYA 3TAHA 3ZZMA 4F4DA 4OATA 4XPIA 2CT8A 1KY4A 1GUFA 3SS8A 3ZS8A 3HR7A 4B5KA 3H2JA 1SXJD 4J29A 3M2TA 2AWNA 1O3YA 1NLYA 1Z6ZA 2PYZA 1Z4NA 2ZANA 1VLZA 4LV6A 4RL4A 1RYNA 2DGDA 2FN3A 4MARA 1YVUA 4DA4A 4BV3A 2JIOA 2YRFA 1GPMA 2X58A 2XAAA 721PA 5TMEA 5IWAB 1E3MA 1J97A 4BNWA 1J06A 4ZOLB 4ZVUA 1XHEA 1EA5A 2HZBA 1JSXA 2HQ1A 4XASA 4ZT4A 3CY6A 3DEZA 1C7RA 1E2KA 2Z8ZA 2VJPA 1OLUB 2H5EA 1G9XA 5HSGA 1ESMA 3UMJA 3BH6A 1CP2A 2CBGA 3PEUA 2IDKA 2Q2QA 3UMMA 2RGCA 2JGAA 3VHXB 4MA5A 5CAEA 5JBIA 1IHUA 2OCBA 5CGZA 3ZE8A 1T5HX 2WAOA 1H2HA 1MAVA 3C7TA 1ISIA 2FPGA 1PNRA 3CONA 4MJ3A 2NQTA 3RIHA 3Q8MA 4PNPA 1E9EA 1AXRA 3NI2A 4UU8A 3TTSA 5B55A 1I7DA 2DYKA 3H8JA 3BE8A 1C0LA 3CX8A 3MJDA 1GKIA 1M9NA 2E21A 3EJWA 4IGAA 4M0MA 1EGHA 2GPAA 4RY0A 5LA6B 2LKCA 4DPKA 2IYWA 3KQLA 3ZDBA 3I9MA 3GRRA 2A7QA 1O97D 5F3RA 5JAHA 4MWDA 1NFQA 2W6JA 2IUFA 3KJNA 4TV9A 4Q48A 5AKEA 2YHIA 3AQIA 1GIAA 3U1VA 1JKJA 1V6AA 4C2TA 3DO8A 3PNOA 2ECQA 1BH2A 4U9HS 3IALA 4G0ZA 3HDHA 3G8CA 5E1OA 4WBNF 4NG5A 3ZNOA 2HCFA 3OOEA 1VMIA 5D3ZA 4EW3A 3EVEA 1OROA 3T34A 4BASA 1YQXA 3QPUA 1Y9ZA 2IYOA 3TR6A 3VJMA 3GUHA 4II3A 5A71A 1HUQA 1TZBA 1EUDB 1JFFA 2CJWA 2QMOA 5G3ZA 4CIAA 4D9KA 3X2SA 1OBHA 2EJTA 2QA5A 2YIDA 3PEEA 2ZYVX 4EHBA 1BWPA 1AKUA 3H9UA 4FYYA 4KODA 2XXBA 2TMGA 3PL5A 4O4LF 4ZAXA 1CR4A 1LI4A 4KB5A 1P2VA 1V7CA 2I4TA 3IA7A 3RG2A 3HVRA 3VJRA 1HYHA 3GVHA 4WKNA 2VH2A 2Y1OA 4H4CA 3C8UA 2SCUB 3I9JA 4OV6B 2AVNA 4BX9A 1LLQA 2FQXA 1MBZA 3H18A 1Z2OX 3I73A 2PK3A 3W6OA 2VXCA 1E9AA 1T9KA 4WH0A 3I9KA 4W1SA 2HH9A 3DYBA 5I51A 3IGFA 1QIDA 2QRVB 5TC4A 5L8VA 2HSZA 1IC6A 3BFVA 2KJQA 4OGKA 4CL8A 4G1UC 3F6RA 1OGJA 4WK2B 1W5BA 1ZLXA 3MT0A 4R0VA 1EFTA 2C4WA 2E2WA 4NIMA 3BD6A 4LQ4A 2C96A 5FHQA 4F96A 2Q07A 4B3MB 2Z1MA 5TEVA 4EG1A 1FU7A 2QV7A 1KC3A 2NUAA 3CUWA 1BDMA 3P32A 3QUTA 1WG8A 3GUCA 1P5ZB 4I4LA 5A3RA 3CUVA 4EHHA 1G5RA 1WMSA 1XC7A 1PJQA 2AN1A 4YDSA 4B3XA 1P45A 3IO5A 5B64A 2CZQA 1ZHFA 4OJYA 3QVXA 2E9SA 3IXLA 4ES6A 2I6FA 3MT8A 4TKLA 1N92A 1N8NA 1F5SA 1NYQA 3R40A 2PN1A 2W8BA 4MUNA 1ENZA 1XLTA 2ZYTX 5ESXA 3LWNA 2QORA 2VNAA 1TGYA 3PPIA 5I8PA 4KIGA 1J0BA 5JI3E 3EF0A 1FYWA 4KIJA 4F5ZA 2BKLA 4XUEA 2WJAA 4GWKA 4YUVA 4QT4A 4C1BA 3HGMA 1Q1AA 2IZZA 2IITA 3IMCA 3K96A 4N7JA 2UUAB 2ZRQA 1O4VA 3IP9A 2CZGA 3EZLA 5BRJA 1ZICA 3QWAA 2NU6A 4MV1A 3GJ7A 4HWRA 5GZ3A 3R7NA 3ECSA 3SG0A 2WVGA 4L2IA 4BNIA 3AEKA 3EPPA 3DLPX 2GO7A 3KVYA 4J0FA 3B85A 2EJVA 3C39A 3WJ1A 1HDEA 1KDYA 3FXAA 2B9VA 3CUKA 2X3FA 3R3YA 3L7DA 3HA7A 3LL7A 4LECA 3DBHB 1K5GA 3OP4A 1E4OA 4KNYA 3FDXA 2QMYA 5CW2A 1KDPA 4BKPA 1SELA 1I3LA 5DK4A 3BWYA 3LDAA 4GZMA 4E7PA 3CCBA 2HSWA 2RIPA 3FMIA 3H9BA 2CHEA 3TZCA 1UFOA 2UUOA 3HRHA 1ARZA 2Q49A 2V7PA 3UA4A 5IZCC 1T1RA 3VPDA 3GRPA 3BK1A 4RQTA 5AKXA 3QFRA 1SBNE 1MC5A 1XB2A 1YGPA 1K7FB 3MCAA 2G5CA 4DN6A 5HK8A 3Q5DA 4DRXA 3BFJA 1BG6A 4MJ7A 1XAGA 3BCUA 3UWOA 4A91A 1ZITA 2JIMA 1NZDA 2MYUA 3EWSA 3LPNA 3VV2A 2PPLA 2XUJA 1CVIA 2AUTA 4IMPA 2VQFB 4MHTA 4FXPA 1VFNA 2Q1WA 2YOFA 2C1XA 2CVZA 2QD2A 4S1OA 5D6OA 4ZARA 4B87A 4ZZIA 1FW6A 2IL1A 2V1UA 4J0EA 5HE8A 5JZBA 4JROA 5DWQA 1YC2A 2XZPA 3TTTA 2BI8A 3TIFA 4MYCA 4JVMA 3RSLA 4W9NC 1XJWA 1LRLA 4IXNA 3OD5A 1TQDA 5EE5B 1D1TA 2JDIA 4WGGA 1Y4DE 3HNRA 1Z5UA 2Y1FA 2GUWA 3AT1A 4HBGA 4G23A 4S1TA 3UMGA 3Q0EA 1QO7A 1RMQA 4PBSA 2ZR0A 1D4OA 5BP7A 2X5XA 2NZJA 4QC2A 3VTAA 2BFEA 4MRMB 3OZBA 4UFPA 4Q1VA 2Q6TA 3PDUA 4FOSA 1ZX1A 1SCQA 3KLOA 2F1OA 2FZEA 1NLFA 1PJZA 3EGXB 3JRXA 3PHCA 3OIUA 3UK0A 4ZHQF 1DFGA 4LV5B 4YCMA 5KNCH 4DNXA 2D13A 3K73O 2VF8A 4MQ5A 2FUKA 3NKFA 4JV5B 4PRKA 4A03A 4WZBA 2XXAB 3LCRA 1C7JA 4ZAVA 3W2EA 5JJLA 3IVMA 3IV9A 4OSOA 4PYNA 3GN2A 1JALA 3G5TA 5KQMA 3G68A 3E5MA 3L8CA 2BKXA 1U99A 3OE7D 1CQPA 1GN9A 1XQWA 1PGJA 2XUIA 2X8JA 3QEJA 5HIAA 4HQRA 4FN4A 1AQ6A 2D2FA 2FU5C 2HRRA 4WASA 3NWEA 1OXTA 4XFJA 3IAHA 1NC3A 1RYMA 2CLSA 1I5RA 2CGEA 3HJGA 1PFGA 1L5MA 3OIGA 1O0BA 1WJGA 1Y4ZA 1P9LA 2Q9UA 1R0CA 2EL7A 4O33A 1P7WA 2PZBA 3OQIA 1QMGA 3RRZA 2ALJA 2I54A 4FZRA 1ND6A 2DKOA 4HFJA 1ZC3A 4CKWB 4NYMQ 5TS3A 1YZTA 3V55A 1U8UA 4KTVE 1EFLA 4B45A 3ZW7A 5KSWB 2ZJAA 3AUYA 4EY8A 3LUKA 4PVDA 3NRCA 1DG3A 1W4AA 3QE0A 4UHBA 5CVEA 1XPUA 1SMKA 3GFGA 3COWA 5L7TA 1EX9A 3W8NA 3AVWA 2CFOA 1K66A 4BNYA 1L8QA 2EYQA 1NRXA 2BFNA 5JLJA 2C5EA 3X0DA 1RAHA 1HSOA 2HU8A 1SG9A 3CEPB 2JCVA 3JW8A 3VTZA 2ZUFA 3UV3A 5LBUA 1MAWA 2OWDA 2P90A 4KFSA 4YRFA 2JK0A 1C0EA 4PC1A 4QU8A 1SHUX 2ON6A 5E6RB 2ZUDA 4PLTA 2WU3A 4TZKA 4HKTA 3I34X 2HRZA 2V9CA 3DPUA 3PX2A 2AFIA 3JQRA 3A9TA 1QGAA 3CRMA 3WMRA 2B5OA 2A0YA 1PS8A 4KGVA 2Y1CA 3ZD9A 2QPLA 5J3JA 2C03A 2FWJA 2OHXA 3ONDA 5G0WA 4BGDA 3J80A 4L7VA 3DG9A 1LGYA 1CHDA 3WC4A 3AP1A 5IDQA 4DJTA 5C18A 4S1NA 3G13A 3MYYA 3BZBA 5EVCA 3TLYA 4PHCA 1FIUA 1KY2A 3VZRA 3L8DA 3B5JA 1COWD 4AP6A 1N1MA 3KQKA 1Q0SA 1KEKA 2ZAYA 1FDIA 4WDRA 2PUCA 2VR1A 4U02A 4PLCA 4TLMB 5DLQC 4DR5B 4KQGA 3VPSA 1EEHA 1HG0A 2O2ZA 2H1OA 4R7TA 4YMIA 2HHHB 2WYHA 3A70A 4GX0A 3WTBA 1KS2A 3WWDA 2DPGA 2ID9A 1BFKA 4ZJUA 2GD2A 3SR0A 1J0DA 3JQGB 3EB9A 4ESVA 4O2LA 4LGYA 5T3UA 4AL4A 3ELDA 2EZUA 4XCQA 2DHRA 1BAPA 5AW7A 1FSZA 4JN6B 2F3QA 4ZQFA 2V65A 3UAGA 2JA2A 3ND8A 3GLIE 1KOFA 2YFQA 4Y1GA 3FYDA 4OYRA 3Q12A 4I8XA 3QKSA 3GFPA 5THXA 4FDLA 5KWVA 1MNAA 2Q0HA 2XTJA 2RGDA 2XQJA 3NETA 4MLPA 5IM5A 4NBRA 4H7JA 4FMCB 3G5AA 1DADA 2VYQA 3FVQA 4GZ6A 1J2EA 3GMDA 4XTCS 1Y8ZA 1CUDA 2O8DA 9ATCA 3SBOA 1XEXA 1C0PA 3OECA 1JZTA 2X7XA 3A3PA 2LD4A 1CC1S 4MB0A 3UO8B 3ZHBA 3M0EA 1P1BA 1PQWA 1WX1A 4G2NA 5I5GA 5K4GA 1G9SA 2NU9A 1C1YA 2VTDA 3GJ5A 5CNIA 4CTJA 5SZKB 3UBTA 3SPXA 4W7HA 3P2OA 1GGKA 4GECA 4DCUA 4MS3A 3ZLUA 4O2AB 4X6XA 4GWGA 4NOJA 3NHZA 2NO7A 3I9FA 5IAJA 3BGOS 3IP1A 1THGA 1W1WA 5J59A 1SXGA 5FPKA 1V1RA 4IIEA 4Z1MA 3HM9A 4CZ2A 4OUDA 3FKJA 1TVKA 1GQSA 2NP7A 1R1DA 3G2JA 5HG0A 3GP5A 3GEHA 2I6TA 3C6QA 4NU8X 3WG9A 4CF6A 3C1TA 4YJ2A 4LRYA 2B4QA 3DMTA 3HABA 3IUEA 1DRVA 1MJFA 4WJKB 3KOZA 1FFYA 1DELA 1XJCA 2BGKA 3MAJA 5LOVF 4I1UA 1P5FA 2ERCA 3KOOA 3UAOA 3HCAA 1E3IA 2AG0A 3PNMA 1T9CA 4PYLA 5E6UB 1GNRA 4XQ9A 1AGNA 1JDVA 2Q3HA 1CDDA 1YS7A 4FFPA 4GYYA 2WB2A 3MRSA 3S2SA 3WGOA 4CQJA 2POQX 4EG4A 2PVSA 4FZJA 3ZCVA 4FR5A 4MW6A 1RI5A 5HBRA 3ZDXB 1G4UR 3DBLA 4PNZA 1BU8A 4YLGA 5LR6A 1USIA 2BMDA 3SGLA 3AYZB 2WJWA 4FEGA 3WI7A 1LV8A 3V2HA 3ZE7A 3IKMB 4PYIA 2VQEB 4IWXA 3HO8A 4R2JA 3PUZA 1ACJA 4ZKEA 1QYWA 2CB0A 1CYEA 4UXHA 4KMOA 5C0OE 3RKSA 5IJ0A 3BF7A 4K5QA 5JPDA 1RRPA 4BO5A 3BTUA 1GZ4A 3KQOA 3EXHA 5IVPA 2PV7A 3F8SA 5IF9A 1P81A 1JA9A 2YXPX 3MC1A 3UJ3X 1W88A 3BAZA 1SUSA 1QZXA 1HQCA 1UZLA 1P8JA 4R41A 4UULA 4ZI5A 1LNQA 2VP5A 2VA9A 1E4EA 4ZALA 5LYYA 5TPZA 4BVAA 1BTOA 1YDHA 2R96A 3U3KA 2A2ZA 2EGUA 2FZ5A 1TIPA 1HV8A 2O2CA 5A3QA 4HN4B 2Z5VA 3JD2A 2EF0A 5JDIA 3W5JA 5D85A 1Y5RA 1F60A 1JWAB 3FSGD 3GPCA 2B4AA 4NSNA 3T7DA 4MYHA 5EQDA 1MABA 2E4VA 2L19A 1RCFA 1I7NA 1Z47A 3H9CA 3ZDEA 3BDIA 4A27A 4CT4B 4E6EA 3SCZA 4BLTA 1W7AA 2ZR9A 3MFYA 4PYOA 1RXEA 1G66A 4HLCA 4IDGA 1K08A 2FA9A 5EJAA 1Y9DA 2XRFA 4KOEC 5MFZA 4LSZA 5INTA 1YQWA 2GK6A 5LZ7A 2WVHA 4AAYA 2AG5A 1N77A 2XZLA 4GVPA 2CK3D 3GAFA 3OJLA 2QJRA 4E4YA 4YCBA 4N3NA 2QYTA 1DFHA 4B9AA 1MHPA 3DHEA 1QRTA 4PZYA 2B92A 1WY7A 1DBSA 2MYNA 3K9QO 4M0DA 3KHTA 3DBRB 4OLFA 3ZG6A 4AIIA 1PR4A 1GRNA 3BSYA 3C85A 1T5IA 2HCRA 4FYIA 4GGPA 5IEJA 5KQLA 4BUCA 1WMDA 2QTBA 5EIWA 2N1MA 3QIVA 1CZKA 3GZ4A 2VN8A 5DB4A 1HBJA 1P4SA 3TTVA 5AFSA 5CEJA 3O1LA 4NOLA 3NV7A 2IPMA 2UYOA 1W49A 4U2KA 5GV8A 3PGMA 4RSMA 3GLTA 2DETA 2W43A 1Z0AA 1NJFA 1UADA 2ZRCA 2W8ZA 3KPYA 4R9VA 5DCLA 4DFDA 1ZOSA 3SZLA 2P0AA 1RQ2A 3B36A 1ISPA 3H0CA 4OI4A 2FZ4A 1P2TA 3EARA 1E1YA 1ZWKA 2CCKA 1H1DA 4G9GA 4Q03A 2PS1A 2VATA 3L41A 2BH9A 2OCLA 4FBLA 3KB1A 5SZJA 2QX8A 3RS2A 5TMPA 4LDPA 1QUFA 3NGLA 1ZA2A 1ZESA 4GW3A 1EDEA 2B1IA 5HJ7A 4Z51A 4FGUA 1KWGA 2XE6A 3KEGA 3JVEA 2HA7A 3SEFA 2NP6A 4IP0A 2Y1WA 1G21A 2IPXA 2YICA 1ZY2A 4FGZA 4KLNA 4HI0E 2WAAA 1V95A 2FK7A 2FJ0A 2NSDA 3A6LA 1NXQA 3I0NA 4JBXA 4L16A 2F1IA 3X1DA 1ZIDA 1YOBA 2YY7A 4GYJA 4Y2RA 1Z38A 1HO3A 1I01A 3FZEA 1GPDG 2VKTA 3DZBA 3LOUA 4A8HA 1QQAA 5BW5A 3K0AB 1X3SA 2P4QA 2QWXA 3DHVA 4FTWA 3STUA 3THSA 2B4YA 4BB9A 3WL4A 2R8YA 3ANMA 2FW0A 4YMGA 1JFVA 1MN6A 3SDBA 4NS4A 1ODTC 2C5FA 3JATB 4IDCA 4HNAA 3TQFA 5IT5A 2PZKA 4JJZA 4BMZA 2QTMA 2Y76A 3H9EO 2WWFA 1BXKA 4UVIA 1F51E 1CKEA 2GJ4A 2VAXA 1EJ2A 3AXSA 2CNWA 4V3BA 4GVXA 4KPUB 1TW2A 4FHEA 1F6WA 2VL7A 1JE0A 4IVRA 4KVAA 5JD6A 3RSHA 1JIKA 3QYJA 4N7MA 4RGYA 1R4MB 4WKOA 1ZZGA 4XGKA 3WL8A 1MDFA 4XLTA 3LXMA 5I7OA 2HJVA 3K6SB 1CUVA 4BRUA 2RHBA 4NBSA 1JYFA 2VDMB 3R3UA 2HIHA 3C3YA 4PZAA 4RKWA 3UT5B 2HXGA 1KJ9A 2GCNA 3WMEA 3ZHVA 5GM1A 1G8PA 2QLJA 5JS7A 4DR3B 3EVZA 2OUKA 1YS1X 3IHKA 3NBAA 4ZVKA 3W34A 3W2TA 4EB0A 2ILTA 1E2QA 1PR5A 2VH5R 2PMWB 3BSSA 3OF3A 4DIMA 1WMBA 3PI6A 1FFBA 2O4CA 4YBZA 4UBIA 4RTLA 1JQAA 2HA4A 2CSXA 4JK3A 3AM3A 1IUNA 2HK7A 3JQDA 3QXCA 2ZATA 3PPVA 3KKMA 2GAOA 2C0QA 3AI7A 1TCBA 1BU5A 3V8RA 3QLUC 1WLSA 1H4VB 3KV3O 4K6FA 1TJ4A 5ECYA 1H1LB 1JX6A 4CKEA 1TK9A 2XT0A 3GA7A 3NAGA 1H5UA 3K5HA 3NT4A 4K0RA 1FMFA 3GEPA 2VRBA 1XXHB 1AKVA 3MLAA 1S2OA 4EI2A 4ZD6A 3FZQA 1GQ2A 1M83A 1UKCA 5KYTA 5A03A 1RM3A 2P9TA 3Q7SA 2VJKA 3MILA 1YE3A 2R5WA 2YS6A 1UJ4A 1ZMBA 2ZTHA 3INRA 2WEKA 4H6XA 2YZ2A 4Y9SA 4F6LA 3TTWA 1OXVA 1WNTA 4OLHA 5TMBA 3F1KA 5A02A 4UC0A 1KQGA 2YC4C 3CVXA 4Q7KA 3CF0A 5PGMA 3PSAA 4Q3KA 2PX3A 4XRGA 2HT1A 3B38A 3ROKA 3VU0A 5EP1A 4D3YA 1R0SA 1AQIA 2YFYA 4GGOA 4PZLA 4TZTA 5J63A 4BVJA 4EJSA 4MVJA 4M76B 4P3OA 4CLOA 1XTJA 1W6RA 1B43A 2Y93A 4FGLA 4LSMA 5D51S 3Q3HA 3R6LA 2J5RA 4C6TB 3AR8A 2FEKA 3COZA 1GU0A 1PIWA 1RWOA 2AQIA 4IIXA 2EX0A 1U3DA 1IG3A 3P0JA 4GOLD 1GHTA 4J07A 5E7IA 3KT0A 1IU9A 4EELA 1G55A 3GK3A 1PI3A 2HQSA 2ZBPA 2JBWA 1FQJA 1RYZA 4HDNB 3BMQB 3VI3B 1CJTC 2ZI3A 3TRKA 2J3JA 2ZLBA 5EIBC 1NNEA 1QP7A 4JLOA 5SZHB 2ORED 3D0KA 1A50B 1P31A 2XY4A 5ALMA 1T5LA 1DAIA 1ZVQA 4URFA 5WRFA 3MRVA 4E07A 2ZYUX 1ZOPA 4IVQA 3CF6R 1H05A 1VPEA 2VAWA 3FIJA 3CLVA 3NRBA 4IAOA 4I4NA 4OJKA 1U0HC 4W4TA 4R1TA 3RJZA 4CM1A 4LF7B 3C5CA 3EXAA 4UMEA 1RHRA 2FPIA 3S7ZA 4PBTA 5FA5A 4NENB 1P6XA 3M3HA 3N2GA 5AI4A 1KVRA 1SCBA 3WB2A 2V96A 1V47A 2VNHA 4AUNA 2H29A 1N57A 1O6CA 1KRHA 1TCUA 2IYFA 2FPKA 3OU2A 1Q19A 621PA 1XTZA 5CA1F 4GKKB 1KERA 4I4TB 3EJ6A 3EGDA 1N0HA 2E4AA 5JAPA 1P4RA 3BJZA 5GY7A 3W78A 3VPGA 1A82A 3H83A 1LK0A 2CXRA 3BHJA 3L6EA 4UBJA 5GM2A 4DDHA 1OLOA 4QYIA 4W1PA 1KIAA 3GFBA 4K2HA 3GDWA 3UTCA 1HLFA 2ZI7A 3DEFA 2OYSA 3FFXA 3ZD7A 1ZC4A 3LUHA 1NMXA 8LDHA 2YH2A 1ZXBA 4IJUA 2UYHA 2GZAA 3DZDA 4B6JA 1KVSA 4HAWA 3UJCA 1NBEA 2REOA 2PHZA 1GDHA 4N6GA 3EAGA 4XLZA 4B80A 1WHTB 2FYTA 5ES3A 3UWSA 2QTHA 4MW1A 3KTAB 3H97A 4X5OA 3IERA 3WXBA 5EQTA 2HRDA 3E8SA 4DQLA 2IY7A 1XG5A 4DUPA 3MJHA 4YMVA 5K8JB 4NFLA 1TFRA 3ODGA 3UQYS 1Y6RA 4NOKA 1KYXA 1W36B 2C7PA 1HOTA 1TJNA 2P7HA 2J33A 2TYSB 3D64A 3OIWA 3PQCA 5JFGA 1RM5A 4MB2A 1YU6A 3IV6A 4RLFA 3AEQB 4BNGA 5C8YB 1N9GA 2ZJ4A 1X2EA 3Q7QA 3OKAA 5CB0A 2CYCA 1C3VA 2PEYA 5DBEX 5I7AA 1LV7A 4AJ9A 3O82A 2J9FA 1UINA 1U1DA 4RD1A 4TYMA 4TN1A 1H0RA 2RCYA 3HKDA 2J31A 5J2TB 3DL2A 7ABPA 5L4LA 1BNCA 5I45A 4OO3A 3ZPXA 4Q4AB 5M04A 1JFTA 3RNLA 4XWOA 1ZCBA 2GPTA 1QF7A 2I2AA 4IGIA 3E9MA 1Q95A 4JL5A 4CU5A 3IIEA 4FSXA 1YA4A 4C76A 4I36A 4KN5A 2CLLB 1GVNB 3E7PA 1DX9A 3RU9A 5EP2A 1WTCA 3MWEA 4HLDA 1LXCA 4D9FA 2Q3MA 1C1XA 5HJ5A 2FHSA 1DKQA 3R7SA 4LDQA 1U8EA 2FSIA 1VPTA 1EFKA 2GSWA 3MS4A 4MTCA 5B57C 3GJ4A 5IBRA 3M6XA 1S3FA 1F4LA 3E5HA 4F56A 4QDJA 2JVJA 3G7SA 1SU7A 4G37A 5COQA 3WLFA 3N70A 1VG0B 1B2LA 2GRJA 4NPAA 5TGDA 4JI0B 1Z88A 3OOSA 2GCOB 1ZI8A 3HSSA 2HWWA 4JOBA 3SJBA 4ZOLA 3PRYA 2OCIA 2PUDA 1BCSB 5JSQA 1BX3A 1K4KA 3JWPA 5K03A 1YZ3A 1AKYA 1OLUA 5D1HA 2FFQA 2RG1A 3LHSA 3RTDA 1YVPA 4IIHA 1X80B 5AJVB 1ZIOA 4G0YA 4DLNA 4MWBA 2Q5OA 1YL7A 2WTEA 5LP6F 3WAJA 3BWXA 3DLAA 1U3WA 3G0BA 1FRFS 3VHXA 3LFHA 1E69A 4HPXB 3W8DA 4EGFA 2IYPA 4QO7A 1TPZA 4OGLA 3HO6A 2ZQYA 3D8HA 5C5EA 4ZVPA 2GYYA 1BXZA 1MIOB 3DTNA 3NPAA 4RY8A 3LYLA 3SQNA 3PFKA 2F59A 4KO8A 5LA6A 3H5OA 3K70C 2E85A 2PL3A 2YVKA 2XMCA 1KARA 1IY2A 4UPDA 4WN3A 5D3MB 3ZDDA 1NBME 4OF4A 1C14A 4G36A 2NUTB 3NFYA 2CVFA 1RBZA 2F3TA 4LKOA 4CEHB 1Z34A 1DARA 1JHAA 1QGZA 1N7GA 3C3EA 4Z7JA 3N76A 1KK2A 5D01A 2WIGA 2CLOB 3T7JA 4BZXA 4CMHA 4EB3A 5CFOA 3MAAC 4WXRA 1SU8A 3N74A 4ZRNA 4KH0A 4RCVA 4TKVB 5DX0A 2VSOA 3KUDA 1WUIS 2BCJQ 3MWGA 3RUIA 1F7VA 2I2XB 4XYMA 3MOIA 3O95A 3ZVMA 4K9OA 1UFRA 5FOWA 4NJOA 5HNKA 5D2CA 4J0HA 3PP8A 5CTJA 2RSLA 1EUDA 3U2QA 3E84A 3WSWA 4A6XA 4HMQA 2P7IA 4BYMA 5LDHA 1ZGJA 4IOMA 4ML3A 5FNVB 1PL7A 2M6LA 3CGGA 4L75A 3PEYA 1ZH6A 2NTNA 3FSGA 4D4JA 2C95A 3EMVA 2XBMA 1E0DA 2VJQA 3BYZA 3BL5A 2H1LA 2DCMA 5AW3A 4OHVA 3HB1A 4RH0A 1MA0A 1PJ8A 1X70A 1ZM3A 2PT6A 2NVUB 3RC7A 1Z7EA 1E7RA 5AT1A 3O91A 1Y1LA 1JA0A 4TXLA 2BISA 2RK3A 1YZNA 2SCUA 3GXOA 4M1SA 4C22A 4F4FA 5L3SB 4ZVOA 3OHSX 1OYVA 1RBYA 2B61A 3EDMA 4G86A 3P7MA 4PR3A 3QU7A 2QEQA 4J43A 5HDQA 3L0PA 3QEAZ 2P35A 5JE8A 1ESCA 2QRVA 5C1BA 4FR0A 3DO5A 4C4PA 3GBVA 1XAIA 3OM0A 3UYKA 2JZNA 2OVFA 4OQFA 2RH9B 3L8EA 1WU7A 5E4JA 1T8SA 1WZUA 3A3KA 1PKEA 4BE9A 4CQMD 3L1HA 1KH3A 1TTHA 2R8BA 1E2UA 2BZ0A 3DVLA 3O38A 2JKVA 3RD5A 5LDDC 1WB9A 1Z5OA 5BSRA 3ZGLA 1JG6A 3QFCA 1OWLA 3LC2O 1FNDA 2UZ1B 1SQ0A 1YQDA 5AHWA 1EFDN 1OIVA 1TD9A 2BN4A 4H77A 1Q0HA 2FUNB 1V7QA 4MV8A 2OFWA 4RANA 4R83A 2HADA 3VR1A 1BSVA 1F3LA 1SBYA 1YVRA 3AYXB 4B3GA 1VLLA 1B0UA 4ME6A 4Q0MA 3TOXA 1ZEJA 4M0UA 3PC8C 4HSGA 1YS9A 3F9CA 3EPHA 4AJNA 3VNSA 4R0MA 4FZVA 2WNSA 1H6CA 1VJCA 4BGIA 1R6UA 4XDHA 3V00A 2J3QA 2X86A 2CNBA 1NBIA 1CUJA 2Q6IA 1DBVO 2I1QA 5HKKD 3MW8A 1MC4A 1OFHA 2B34A 2VRNA 1P0FA 4R84A 1T8WA 1KP2A 3GJ3A 3QGMA 1NVGA 3WAKA 2ODQA 5F35A 3C43A 4G63A 2B21A 3EMKA 4QVKA 3ROFA 4E1AA 1AV6A 3AILA 1P61B 4CE6A 3U5TA 4QQRA 5DO9A 1IM8A 4PAGA 4EHDA 1KFEB 3Q15C 1FDOA 4JHLA 4OMDA 3U7EB 3OIVA 2RGWA 1IB0A 2ZITA 5AW5A 1W48A 3DBHA 3BBLA 2D62A 1X1AA 4LQLA 5BSEA 1WXQA 1C7EA 5FPPA 3AY0A 1CY7A 1QP0A 3VC2A 4A8JB 2ASEA 1ZM9A 3KL2A 1J21A 1FXWF 1P29A 3PUVA 1XZHA 1RZUA 1NKTA 2FRXA 2ZI4A 3KXIA 3CW2A 4KJZA 1RZRD 1PFUA 3ULKA 5ILGA 3ZQUA 4OIFA 2C9DA 3RFTA 3ER6A 4DNQA 1U2QA 1ESZA 3E1GA 5FUBA 2BHTA 3NYIA 3BTSA 3BWCA 4QUKA 5HIIA 3AY6A 3JYOA 3PDJA 1DQZA 3DEIA 5REQB 1J2UA 1Q6YA 2WUVA 4X00A 3PKZA 2HQBA 3ZY4A 4OXQA 4C7JA 4W8HA 1C29B 5H5JA 4ZYTA 4LF4B 1PQUA 4NPHA 4GP7A 3A25A 3FPEA 3A28A 3WKDA 1QYXA 3PFWO 3A2MA 4UVDA 1Q5PA 2PTGA 2TSYB 1QRDA 3WV5A 3OQVA 4JSYA 4GBED 2Q3BA 3KDPA 5E9QA 1D0IA 3X2EA 5EJ9A 4MAAA 5EZYF 5K4HA 3PE4A 4UM8B 1GOTA 4MMYB 3F7TA 3VKUA 2FFRA 4JHXA 4UZEA 2X2FA 2V9PA 2EG9A 1R9NA 2DJIA 2WDZA 3AR2A 1Y6FA 3QVWA 1AA9A 1MTZA 4FFSA 4M0LA 3G2NA 1NLMA 4C0JA 3UB2A 5AP9A 2FH5B 1K3TA 4MRMA 2OZVA 5AHRA 1CUGA 1OXSC 2IKSA 3FSRA 3Q98A 4OP2A 4RJJA 4XCVA 3RADC 2R6CA 3QVOA 4PEVA 3EGXA 3WL3A 4DABA 2PD4A 3ZWMA 3DDCA 4R31A 2W6QA 4Y9TA 3SKVA 3EQ6A 5FBZA 4DMCA 1FP2A 3OCXA 2OXTA 3VMMA 3GPBA 2NTJA 1JHVA 2JCYA 1F3OA 4KQEA 3RK0A 1TU3A 1RXUA 3VR5D 3WRYA 2PH5A 2QKYA 3U4MA 4IDPA 1HDIA 1MX9A 1VI5A 5DX8A 2ERYA 2ZVQX 1FNSA 4NXMB 1VYHA 4NBWA 1K8QA 1TJ5A 2OQRA 4LG1A 2OV2A 3P4UA 2J6HA 5J40A 1Z28A 1CLEA 2MU1A 4X54A 2EP7A 4IVPA 4G4JA 3R3SA 1T1EA 1UBCA 4HAVA 3D7NA 3WDKA 1CJBA 2YWRA 1L6RA 2ZB7A 4W5HA 5LZ8A 1JI0A 4YALA 2ZI9A 3NQ41 3OI7A 1J8VA 3FG9A 3T1NA 4AB1A 1CEEA 3C6KA 1P39A 4CKWA 1XZKA 1XHLA 2E55A 4RQUA 4YMUA 5H02A 1BXRB 4XUCA 2CMKA 3TM4A 4D80A 3UFBA 2OM2A 4REOA 4DSUA 1K5PA 2C5LA 2IH2A 3EIFA 2PSEA 1DC8A 4YMLA 3QSYA 2H5IA 4B8WA 4BKOA 4MVJG 1RYDA 2I7VA 4DV3B 3RHZA 3O21A 1V9LA 1JSCA 2K2QB 4CJXA 4KITB 4B46A 3B6JA 4R71A 1JKMA 4PW0A 3C14C 3H3XA 1OYWA 2PGXA 2JLBA 3OQBA 4R6XA 4KAFA 1QGUB 5KO2A 4Q9IA 2QJWA 3OQOA 4PPQA 2ZJYA 1YAJA 1T4DA 4DNFA 2DMRA 1Q3KA 1N4DA 2GZHA 2VQDA 2B69A 5THQA 4RNCA 4TVOA 3JQ6A 3F74A 3H2YA 2JIDA 4LBYA 5E6RA 3KT8A 3COSA 4K40A 3T3DA 3W9SA 1KYVA 2J67A 1LLUA 4ALLA 1T26A 3LXXA 2P1DA 2XKAA 4U9IS 3QLVA 3VPCA 3KFLA 2AMLA 1YJ5A 5ED4A 2ZWMA 3CXUA 1DZ3A 4L4RA 1Z0UA 4Q66C 5EMKA 1UM8A 3BK7A 4FFNA 2C9OA 4KLCA 2GHQA 4UTXA 4XGRA 3LQFA 4YAKA 5JCOC 4I2NA 2QOEA 4O3FA 4X84A 1OFGA 4ZI3A 3U81A 3MQ2A 2ZP1A 2W70A 2C29D 4A10A 2O8FB 4ILEA 3N86A 1DOAA 1BGVA 2C2HA 1CETA 2E6KA 4I5FA 4CCWA 5BMVB 4US2R 5AKZA 5ALIA 3WIEA 3KUXA 2X77A 1E1QD 2VRCA 4JNKA 5ALVA 3ON5A 1YJQA 5K45A 4KWIA 1W75A 2Q6VA 3C6ZA 1CPYA 2IYRA 2ZIAA 2I2BA 1OKKD 1UM9B 2OGZA 3HDQA 3I5MA 3JQGA 1WB6A 2FPWA 4QUHA 4UFNA 3RRMA 3S2ZA 3MCUA 2Q2VA 2NXJA 4BB6A 1QRUA 3KKKA 3HLKA 1TAQA 4Y1EA 1UH5A 3JR7A 4QYTA 3THRA 2QUKA 3DZKA 1C1HA 3F1LA 2E82A 2ZBVA 3NHRA 1P6UA 2OK8A 4U7GA 3AESB 4RTNA 1XTSA 2AJBA 1CUIA 4F92B 4F2WA 3CC8A 3R5SA 3LPMA 4WKCA 2RB4A 1QCDA 3T9FA 1JYSA 3FHLA 5EJGA 2RHOA 4HP8A 4P0QB 2XT6A 1DAGA 5EIFA 2XUPA 1JPUA 5EJEA 2Q9AA 1SB9A 4L8YA 2ZIWB 4WXPA 5KSOA 1H2BA 5BW6B 2KQUA 3IQDB 1UMDA 1WF3A 5KS2A 3WKCA 1U1EA 1NONA 4IXMA 4MKZA 4JT9A 1EDBA 4DM3A 3Q2KA 4HLUA 4U2EA 5LU9A 3O6VA 3UWKA 1X94A 1U8ZA 3HXLA 4P22A 4IYRA 1YCHA 3A9CA 4MS1B 1ZGCA 3NU1A 1HG1A 1E2GA 2ZJOA 4F97A 3IYLW 3LC0A 3BJEA 2AR0A 4K28A 2FRVA 4O2AA 4BB5A 4EHIA 3C74A 1UWCA 2OO7A 1JJ7A 1Q83A 1RRVA 3HL0A 2X4LA 3EHDA 4WNIA 4EUKA 5KJCA 3QEMA 4C4RA 2ATCA 1C3JA 2VH1A 3BRQA 1VSUA 1KL7A 2DFTA 2JEYA 1GA4A 2WYOA 3D7LA 3HCDA 4JL8A 3F0TA 4ZQHA 2COUA 3OJFA 5FEMA 4ZEXA 4F7WA 5A1TA 4YHHB 2WQ7A 4I6EA 1DBQA 3LT4A 4TTPA 2ZTMA 4H7PA 4W1QA 2NTVA 5CGQB 2OSVA 5T57A 4P3KA 5DP1A 1YJBA 2AIRA 3RHFA 2AG8A 1F2TB 3A6FA 4MEAA 3PC2A 4UAUA 2ZUTA 5JQGF 2Q4DA 2PM8A 4KAAA 4I3FA 1LPSA 4EVQA 1M6VB 4LI3X 1FQKA 2IYTA 2WI8A 4M0CA 1FFGA 2SICE 5E6UA 3BGIA 3BM5A 1TQ8A 1TTQB 1PK8A 3JWGA 4NAUA 4OBEA 2XX3A 4X90A 1Q11A 4UTRA 2CL7X 3CR7A 1XP8A 1QE0A 1GY8A 3IMFA 1FFCA 1P17A 3IR6A 4FWBA 4M9ZA 5F64A 4A6EA 4F45A 2XNCA 3FE2A 5C3MA 3VR6H 2OCAA 3JARB 1W87A 3IEMA 1D6SA 1YZGA 2C20A 2V8BA 2UZ4A 1YWGO 2CUTA 4HXGA 3HG7A 4GZ5A 4K6GA 4QELA 3VSCA 5LKAA 5I9IA 1W5FA 1E2JA 1I3NA 4XCXA 2PS9A 3UV7A 1NR7A 2XB8A 2QI9F 2GSDA 5HF5A 4F7DA 1YQQA 3SF8B 3R1IA 3OBBA 3BD8A 3GGSA 4KJXA 1PWEA 4OK3A 4R5MA 2QT9A 3MTQA 5JPIA 1NV9A 4TQ9A 1MU0A 2X3UA 4MYSA 4PGAA 3MUFA 5DK6A 5CD1A 3GNLA 4MH0R 3INYA 3K05A 3ZCQA 4GOMD 4MCHA 4RK4A 2E5WA 2PX0A 3ONWA 2O2SA 4KIFA 1CUZA 1VXRA 1NXPA 2JGLA 1VI6A 5EIOA 4MW0A 1VB3A 4P92A 4D8XA 3FOBA 4BVLA 1DRWA 4BNNA 2G1JA 1V1MB 2IDJA 3ESCA 4LHEA 1IY1A 3TQHA 1LNZA 3U4HA 2HKIA 2R48A 3L7LA 3IQGX 4QBTA 1DB3A 1XVVA 3ORHA 3W5UA 3HVJA 4ALNA 5IAKA 4BXOB 2HAEA 2ONKA 1VBFA 1FLDA 1Z37A 1R6XA 2CDAA 3FLMA 4HB4A 2H7YA 2FWNA 4PQFA 4FT4A 2Q3JA 4GYKA 4OQYA 4B7ZA 1GM5A 2K5UA 1LBTA 1THZA 3AL0C 3GVIA 3PXEA 4PX5A 4QXRA 3DFIA 2P6RA 2Y71A 5EKUA 4ZCQA 1Z8HA 1P77A 1RLJA 3OPYI 1XK7A 3OZAA 4UM9B 1PV1A 3FB4A 5HKOA 3GLHE 2WKSA 4CM5A 4OHCA 2HMSA 3RNOA 1AHNA 4Y67A 3KYJB 3AFGA 3QTTA 4CRWB 4TTJA 1KK0A 4W8OA 3P9IA 1ZMXA 1HFEL 4EW2A 4RIGA 4I50F 4RAOA 3ACBA 3CINA 3DBRA 2V1XA 3B20A 4XGQA 1RAGA 2VWHA 1HYGA 1JR3E 1S8FA 1ACMA 1G7SA 3LQ2A 1Z6AA 3T15A 4L6AA 4U7TB 4ZQIA 2DEUA 4H18A 4M4SA 1KFCB 2E3JA 1YZUA 3P2IA 4L9AA 2P6OA 3W6ZA 3DM5A 3THYB 4IFTA 1KQ3A 3SYTA 2Q62A 3D54D 2RHCA 1ONBA 4JC5A 1RSZA 4QU0A 3LUFA 2RK6A 2UYGA 3OZIA 5L3QB 5JWRA 3ESBA 1V39A 2JJ2D 1OWOA 3ZY6A 2QTNA 5LYJF 5L7YA 1GZVA 1WDLA 2PMEA 3EUEA 4M0FA 4DCSA 3NDBB 3DTVB 4P3XA 1X13A 3DB2A 1J9EA 4EYEA 3U26A 1KJNA 2EFJA 4H6WA 4B47A 1L2TA 3LIIA 3R24A 1FVFA 4N01A 1SXJC 3IO3A 4C3VA 4NYMR 2GHTA 3ZXUB 4U2FA 3S7TA 1L6IA 2IPAB 4R2WA 4ARUA 4ZTUB 1SU6A 1BVRA