3UQYS

H2-reduced structure of e. coli hydrogenase-1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
265
structure length
265
Chain Sequence
b'KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 small chain
publication title X-ray crystallographic and computational studies of the O2-tolerant [NiFe]-hydrogenase 1 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 80
structure length 265
sequence length 265
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3uqyS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3uqyS02
1UBLS 4UEQA 4UPVA 3UQYS 4IUCS 1YQWA 4UE3S 3AYXB 5JRDS 4KO3S 5D51S 4KL8S 4UQLA 3AYZB 4IUDS 5A4IS 1UBHS 3USCS 4UCWA 4GD3Q 4UPEA 1UBJS 3ZEAA 3USES 5A4MS 4KO2S 2FRVA 4KO4S 3ZE8A 4UCQA 4UEWA 5JSKA 4OMFG 4U9IS 1E3DA 1UBOS 4KN9S 5ADUS 3MYRA 4IUBS 5JSUA 1YRQA 1UBMS 3CUSA 3ZE9A 1WUIS 1FRFS 1FRVA 1UBKS 3CURA 4UCXA 4C3OB 1H2RS 4CI0B 1UBRS 1UBTS 5JSYA 4UE2A 4UD2A 1WUHS 3ZE7A 4U9HS 1WUKS 4TTTS 4URHA 1WUJS 4UQPA 3ZE6A 3H3XA 4KO1S 4UD6A 3RGWS 5JT1A 1UBUS 5JSHA 2WPNA 1CC1S 1H2AS 4UE6A 5A4FS 1YQ9A 1WULS
chains in the Genus database with same CATH superfamily
1SC3A 5YASA 2ZLBA 4PLYA 5B3AA 3AOEA 3VVLA 3TLMA 2W8ZA 1RYZA 1JQLB 2V59A 3ADCA 2TMYA 4IBOA 5IVIA 2Q28A 4I6JA 4JLAA 4OI2A 4UBLA 2RHRA 2FJUA 3PQ7A 4EZBA 3UAGA 4OFWA 4L5AA 4PQFA 3HYNA 1ILWA 5K51A 2CLHB 1TGYA 2I22A 2QROA 5G4LA 1IB6A 2PE5A 2I71A 1CVRA 4S1WA 4LYEA 2ZSIA 2DUUA 5I7VA 4B2PA 3DTVB 3LC0A 4J0QA 4DF3A 2VJMA 2JVIA 1XK6A 3M81A 4MV7A 2L69A 5JPIA 4POOA 5K9ZA 4LMRA 1GYPA 1SBTA 4GW3A 5I5GA 5KTYA 1XKLA 3DE3X 4C2UA 2E89A 3AI3A 4I81A 1SOVA 2BM8A 3CLRC 1FP4A 2F3TA 2YDXA 4IH1A 1XEWX 1P5FA 4XLZA 2J8ZA 5I7UA 1M0WA 2XB2A 2YNMA 2J46A 3PC8A 2QRKA 5HQJA 1T8WA 1IUKA 1UOQA 4P33A 2O54A 1B41A 1TVEA 1NX6A 4KRFA 3LBHA 4GNRA 4MPPA 4PINA 2WABA 4PPNA 5KTTA 3K6JA 3E7FA 1KDPA 2H3HA 2W98A 4MCJA 1ZX1A 2I2XB 5DK6A 4C4AA 3WGJA 1WF6A 3IDAA 3JARB 3KZVA 1YKGA 2D13A 2IH4A 1FNNA 1II9A 1DQZA 3K2QA 3DF9A 3FMIA 1ZN2A 2EEPA 4DN6A 2EZUA 5CCBA 5KYUA 4FT2A 2HCFA 2A88A 3GEHA 1Y9DA 2ZTSA 4LKOA 1FMTA 2CNWD 4YJHB 2AN9A 4DNXA 2OV1A 1GQFA 3GEBA 2BJVA 1ZM7A 2OM6A 5KX5A 1Y82A 4J29A 4DLBA 1X70A 1T8SA 2HQ1A 3X1JA 2FCRA 4XB1A 1FFBA 3RRBA 2CE7A 5CVUA 3AONB 3PEVA 1J7KA 3PBKA 3D6UA 4MZDA 2WRZA 5FI5A 3IA2A 1JBQA 1U7UA 5LPNA 3RS3A 2FP4B 3O1IC 4GBMA 1PUIA 1YRWA 3KHUA 2CT8A 1L3IA 1MA0A 3N6XA 2B8NA 2JA2A 2UVPB 3FJYA 4HXYA 3WFJA 1PZEA 4A82A 1ONSA 3U4CA 4BTEA 1TZ2A 4OMUA 3F3MA 1F6WA 2OK7A 4KU4A 4YCSA 5J4VA 2FR8C 1GUBA 2NN3C 3QJ5A 1A97A 3ZHRA 4ND7A 2O23A 1FJGB 3SX2A 3KAPA 4P92A 1AKWA 4QOHA 5DT2A 1UJCA 2RHMA 2RH9B 4JCCA 2W4MA 2LPMA 5KAPA 1SY7A 3WP0A 4OLBA 2H07A 5JECA 4D9JA 3GRCA 3P4XA 3PTLA 2OV2A 3GGPA 5CLHA 3ZIAA 1K3UB 1YASA 3BMXA 3LDGA 3OQNA 4PHCA 2WKRA 4A15A 1Y80A 2IUEA 4NE9A 4UMEA 2ZYAA 4N0DA 4Q37A 3O3OB 3EZNA 1X7WA 3IT0A 1U9IA 1W85B 5J63A 1N2CB 4P3PA 1QCZA 4L1KA 5BVGB 2ZM6B 5FB3A 2A9QA 2OSBA 4M8KA 4JLSA 2Q99A 1R8YA 1VHJA 1ZD5A 2Z6UA 4H16A 4OYYA 5DNEA 3RT1A 4B3CA 1RMYA 2P9QA 4UM8B 2Q5CA 2PHZA 3QLUC 3JAWA 4FYPA 3TSOA 1LDBA 1Q6YA 3P32A 3PE4A 4Y6RA 3AUYA 5D1HA 5EXTA 3RWOA 3N2GB 3AYXB 3OURA 3K53A 3IBSA 1NL3A 5EJAA 4TXNA 2BKUA 3UUWA 3K9CA 1FSGA 1M76A 5CNIA 5JOQA 2P6UA 3NGXA 3GLKA 4BHTA 4DPMA 2CLKB 3N5CA 4MROA 4MMZB 4RNCA 4Y2UA 2LRHA 4JJ6A 2OO7A 3A8TA 3LW8A 3ANXA 4DWVA 3QXCA 2C95A 3G68A 3TNFA 3O74A 4FNAA 2PS0A 1IL0A 1OYOA 2BFCA 2CBXA 2QE6A 2VUSA 3DAYA 1ANKA 4JLUA 5IW8A 4DAOA 3UC9A 3DV0A 5TSDA 1AM4D 1A0OA 1QR6A 2R25B 4GNKA 4LJ5A 3CRZA 4KK4A 3ETJA 3Q2OA 4E31A 2O9JA 3MT9A 4LA4A 4YHHB 3IQDB 1CUGA 2CFIA 4DIOA 2PJZA 1BRTA 1RBZA 1LLDA 4ALLA 1YVUA 2H11A 2R60A 4LZOA 3R9XA 5F77A 1C8BA 1R12A 4JJAA 4IVNA 3QG5A 3ESCA 2B34A 5CDGA 3AEQB 4YMVA 4AP9A 2J3QA 1E9AA 2C96A 4FD3A 2A59A 1NI4A 5LA6B 2QMHA 2E9SA 1LW7A 5JUWA 3GLFB 4KXWA 1LI5A 4NNPA 5KNBH 5JVDB 3QVUA 2AMJA 3B6KA 4NK5A 1P0CA 3V00A 2HSEA 5EMLA 4QNMA 4KN8A 4KTVE 3TQOA 3ZDFA 2AVDA 2CMFA 2B1IA 5JZVA 2W6JA 2IL1A 4FKZA 4WXYB 3LBIA 4Q01A 2XMPA 3R0XA 1KWKA 1XPJA 3KL4A 4Z7OB 4H7DA 1RJDA 1VPTA 3TBFA 4YRQA 1DRVA 2C82A 2YMQA 3AZPA 4Q3DA 3RI3A 4E11A 3OY2A 4ZVOA 2BHNA 4M8SA 5FOQA 2FEMA 4WZBB 4LOAA 2M6LA 2BHLA 1E32A 4QECA 2YX1A 3CVVA 4FR5A 1QGAA 2TMKA 2BFBB 2XMDA 2P65A 4P4GA 1D0SA 1Z6ZA 4UAUA 1GTRA 1G2IA 4ML3A 1E3LA 3VU3A 1WMFA 3EXHC 3QWBA 3TLXA 1IHDA 1V4NA 2ODWA 4RDCA 4AXBA 3ACCA 5D6OA 2CMKA 2RK6A 3UV3A 2AFHE 4EEXA 4OK3A 4URHA 3RPEA 7AT1A 2CXSA 1PT5A 3EWSA 1ZJ4A 1DUVG 4MAMA 1LK7A 4IIJF 4JXKA 2WAYA 1Y3BE 1I4WA 1ZCFA 5A62A 1KI8A 4TKMA 1TTQB 3F3YA 1NAIA 5E4YA 5AW8A 3BGWA 1RVDA 2W6QA 4D26A 2B25A 1QE3A 4X92A 4DY6A 1RFGE 4CTNA 5JISA 3AEZA 2FOXA 4FCTA 5B55A 4Q7MB 3WA6A 2CHGA 1IZYA 1U3GA 1P1JA 2R751 4GYKA 3ONVA 2JFPA 5C5IA 1E1RD 1VLLA 2ILTA 5B4VA 4O25A 4S35A 3V48A 2PWZA 5FUWA 4IRXA 4YT8A 4GOOD 1QE0A 3G9QA 1FP7A 2HWUA 3O9VA 5D3MB 1M75A 4MVWA 3HH8A 4ZVKA 1YUNA 3SHWA 4HL6A 1Y4ZA 3CZCA 1A7KA 3HB4X 3U4MA 2ZVPX 2XIJA 4QTZA 3T9EA 1G9SA 1MGPA 1J8FA 4PONA 4DQDA 3QEOA 1YR9A 3TCNA 4DLUA 5FR1A 4XGIA 1UPUA 1NR7A 4BZXA 4RU1A 1BQEA 1U0FA 2MJLA 1YSCA 5CB4F 4EHDA 2M6KA 3W5AA 1Z5NA 2R2GA 4UXHA 2IZOA 2W2VA 4C76A 2ZKIA 4QQFA 5KQRA 2BBOA 5J47A 4RCZA 3EIWA 4M83A 4UCWA 5EE3A 3CX8A 5JZSA 3T7CA 4DLXA 2ZI5A 3OZGA 5KQMA 3R0JA 1DP4A 2FV8A 5C31A 3RSSA 1JEDA 2FF7A 2RMKA 4NP6A 5AK3A 4YV7A 4U8GA 1RRVA 2SCUB 1T10A 4UBIA 3BWEA 1ADGA 2J0UB 2QP4A 3AB3A 2XWBF 3AHJA 3ZY6A 3K70D 3OU6A 3N5KA 2JFGA 4D8TA 1KDOA 4EPYA 1AHPA 3G7UA 2J3LA 4B6JA 3V8BA 3ZYCA 1TFRA 1P8AA 2QD1A 2HSWA 5ABPA 5IABA 1QYXA 2HTFA 4OJNA 5A6SA 2W6ID 3BMCA 3G8AA 2V9PA 1MTOA 5I3ZA 5LWQA 1UJ4A 1YR3A 2JHGA 3QV2A 2HDNB 5FEUA 1V5GA 4MARA 5ESDA 1EA5A 4HF7A 9ABPA 1BHJA 2DEUA 3GEEA 3GXBA 3BXFA 2QXYA 1MOQA 5CT6A 5C5CA 1XA4A 4F1KA 1BVRA 5CLQA 3TGLA 5CYOA 3QBTA 1CJSA 1XEFA 4QASA 5A71A 4PFSA 2RBEA 4OK5A 1VE7A 3O8BA 5C3MA 1PJ2A 2QLJA 3ZY4A 2YZKA 2QJOA 5JS7A 1FDRA 3PDIA 3NBMA 1J8YF 4QTXA 3IJEB 4OQPA 5KCZA 3V2IA 4EGAA 3HYTA 1NSFA 1NXPA 3TLJA 4UHDA 5BSGA 2Z2KA 4IV8A 3D7NA 3OQOA 5GM1A 1IZ7A 1XLTC 1Q2UA 5TPZA 4FFLA 1VGVA 1ND5A 1ZMOA 2XBUA 3UWKA 1AMOA 1U3DA 1KVTA 2P30A 1E96A 4FFSA 2HMAA 4QLAA 1KZHA 1MF7A 3OJXA 4OREX 3REGA 3B9BA 5K4AA 3WBBA 1U2RA 1SBHA 3E1KA 2Z5LA 1G5HA 3FUTA 3ACBA 4ALJA 4Y6GB 5CIQA 1FTYA 3NV9A 4EYSA 1JZSA 1N8NA 3ENZA 4HX2A 1BFUA 1NUPA 1Z73A 5DWVA 3L1KA 4L72A 3PUVA 4RPJA 2P2GA 2V03A 4G63A 4PZPA 5GADl 2ZGVA 3NJRA 1M7BA 4P3YA 1BYIA 3K0KA 4W9NA 2PKWA 3R3ZA 4W1PA 5LLSA 3C43A 1KNQA 4Q1VA 1L9XA 1N2BA 3ET5A 1CY0A 1FVOA 2CBZA 1CS0B 3OOYA 4Q18A 5E4FA 3D4OA 2ZSUA 1PWZA 3UJBA 1F17A 5ECGC 3VH1A 4HH0A 4H1WA 4F3TA 1VB5A 4TXLA 4UASA 4ZT6A 3GEIA 3K0EA 3VTZA 2ZVQX 3LNCA 3UXMA 4URWR 4MUAA 4Q3OA 1IY9A 4O8CA 5JJLA 3SLKA 4TV8F 3OZRA 2FN3A 1FS6A 3FYUC 4BLUA 4CT0A 1EG7A 4FW9A 3I5XA 1ZK2A 1UBLS 4RW0A 3NHSA 4C0HA 2H5JA 1EWYA 2ZJ6A 4BMNA 5ALMA 2R0QC 1P4SA 3RR2A 4F8JA 4EW3A 4MGZR 3JD3A 2VR1A 4UZSA 3UMVA 2QX9A 1FPQA 1U0OC 2IYZA 4KRYA 1DSSG 1HYHA 3RU9A 1ODLA 1U8AA 3KAQA 1PJRA 2PMKA 4R8SA 1CUUA 1J9ZA 2HV9A 3JU3A 4XCVA 1F5NA 5CT8A 5IK2D 2G09A 3IA7A 4JNCA 4IO0A 1OT3A 4URUR 5E2BA 4RZHA 3CX4A 4M4SA 4IG9A 3SD7A 1OH5A 3NRBA 2J5XA 3I1JA 3OD1A 2JI9A 4BLRA 2FDXA 4BQQA 3WYCA 5ARDA 1FFGA 2ZQYA 2A1UA 4W5HA 3ZUPA 2QTFA 3IBYA 1G60A 4Q6WA 3GUUA 3G49A 2QZ4A 4MKHA 3C3JA 2KI5A 3TCXB 4BEWA 4UNRA 4PZDA 1REQA 3F6YA 3HG7A 1PSWA 4E1BA 5FEMA 4GL2A 4JB8A 3OCCA 2XJ9A 1D9XA 5JSKA 1KI9A 3I5AA 1T5IA 4FMCB 3H5AA 2QRLA 2H4FA 3P9ZA 2QTVA 2QF7A 1ARZA 1H3FA 1SHZA 1KI6B 2CJYA 3M2PA 1L5LA 3ZBQA 1N2OA 5EWJB 2CDRA 1NVTA 4TZ6A 3IKMB 3QUQA 3C5CA 4N0QA 4FE4A 2POCA 1GDDA 1C4OA 4N3GA 1A5ZA 2X7XA 4U8HA 1M74A 1AXGA 3PUKA 3DS8A 4UTRA 3D8SA 3B13B 3FWKA 3PQ3A 5ELLA 5UKDA 3WJ1A 3ITNA 3HTXA 4LBWA 5I9MA 2H85A 4B9EA 1I3LA 2ONCA 1MG0A 4Z1MA 3SBXA 1EE2A 2JFQA 1A4RA 1GRRA 1K6MA 1OFVA 1ZA2A 4G5HA 1CERA 2P75A 3CKKA 1JTFA 5CDHA 2FPPB 2JS7A 4Z49A 4V03A 4ER3A 1XNJA 2WM8A 4W9RA 1NBME 1UJ2A 1PKXA 3H9QA 3BHMA 4HDRA 1AO0A 3BK1A 1Z62A 5LOVF 1RWQA 5HP4A 1LTKA 4CM3A 4NENA 2F8LA 2FR8A 3M6WA 1YVPA 2Z6VA 4D74A 2G5PA 3R7AA 1YS1X 4X1IB 1L8XA 3OU2A 2IXEA 5DM1A 3X1XA 4L08A 2Q5EA 3FRJA 1XMSA 2WYIA 4XWKA 1D0VA 3EA5A 4JT8A 421PA 1FVFA 4JJGA 3VSBA 4PO9A 4B45A 1GRQA 2CE2X 1L7BA 2GHTA 1Z13A 3GQBB 3QG1A 3EH1A 1JJAA 4BFTA 5LDHA 2JRCA 2GJ9A 4LECA 1OYYA 1VIDA 3MTGA 2OFPA 4J7UA 5CLIA 2WAMA 3V6LA 3ZYZA 5IS2A 3V1MA 4KO1S 5JTUA 2NO9A 1LNQA 2UZ1B 3E18A 2FN9A 3H42B 1UM9B 4FKMA 4BWVA 2H1WA 2Y4OA 3I2GA 3LRTA 3OY7A 4WY2A 3R5TA 4GBED 3SF8A 5NULA 4BEBA 2GBCA 5AW7A 3AI2A 1RQRA 4RYDA 3FA2A 1IWBB 2GEDA 1UT5A 2HWWA 1RDFA 2NVBA 2XMQA 3E15A 3LD9A 4IEFB 4OF4A 1U1EA 1E2QA 1NKSA 3GUVA 4YECA 1H05A 4KZKA 1GPWB 4MS1B 1RW4A 1TJPB 1Z8FA 2XA1A 4BVEA 4D0SA 1VJGA 1ADFA 4O8ZA 4AULA 1TJ5A 3G5TA 5C32A 1N8TA 1ST3A 3ILVA 2C0CA 1KO5A 2Q6KA 3GJYA 5AJTA 4CKXA 5AD1A 1KOJA 3GMIA 4P4SB 5IJWA 4Q3LA 2PFGA 1CQWA 3R7DA 4NTZA 2GBIA 1H2HA 1NW8A 2QVCA 4IDGA 1FP6A 2QLNA 3DE7X 3PFKA 4L8GA 3DEIA 5TQ0B 1DIRA 2H1HA 3A32A 2OCXA 1SURA 2C77A 2C4NA 4CUKA 3JQAD 2P2CA 1CQPA 3D2BA 1U0GA 3KSUA 4TRRA 3DUFB 1AB6A 4N5HX 3IUQA 4AF8A 4EUSA 4K9OA 4G1VA 5K6RA 3A6KA 1WD5A 1KQPA 1MV5A 3VO2A 2EG5A 3HJCA 2OFOA 3DJFA 3ZKWA 1II8B 4YHBA 2OSVA 4CM4A 3F2IA 4KXFB 4A27A 2CVPA 1I2AA 3AVUA 2J07A 5K0JA 1X7ZB 3HS3A 4YRRA 1VHLA 4Q3BA 3A1VA 5BR1A 3PNSA 1U8YA 3OWXA 1JBEA 1UANA 3DVSX 3L0OA 4MSUA 3SHQA 2WNIA 3IV9A 1XXHE 1GPNA 3QH4A 3S1SA 2Z8XA 2YXLA 4BP8A 3KQWA 1YA4A 2WW8A 5BQ5A 5AUPB 4ILKA 4JUBA 3WGMA 2XTNA 3JVEA 4I1SA 3GBVA 4EF5A 1S5PA 2QNIA 1MXFA 2YUTA 4GVPA 3G59A 1DDOA 1C7IA 1I10A 1GGVA 1P9LA 2DT5A 3JQ9C 4C4TA 4MYHA 2GEFA 5GV8A 3VR6A 1RQLA 3SLGA 2VYND 4A0SA 1SCKA 5H70A 3UHOA 3ZKAA 4JVOA 3OA2A 1NLUA 3GRFA 4WNAB 5D1NA 1XG5A 3WLFA 2QQFA 1B2LA 1P0QA 2QN8A 3AR3A 3HP4A 5ALIA 2XAUA 2FQQA 2H7XA 2J5KA 2L2QA 4FYWA 4WN9B 3WYEA 5CB6A 1ZHHA 3TZ6A 4U5QA 2J7KA 3HFSA 2FUCA 5IT4A 2GF9A 3V1KA 2AOWA 4GI3A 1RADA 1WPQA 4LBVA 3EXHA 1KAEA 1A95A 1GT91 3I83A 2BHRA 3IDSA 5TJ9A 4MP8A 3A58B 4WXPA 2NZWA 2A0WA 1NOKA 4AJ2A 4BN4A 2XWPA 5L4SA 2BFFB 3IODA 4CMEA 2C29D 2DFLA 2FWRA 2HO5A 1DAPA 2CMHA 1C0LA 2IVFA 1F3OA 1NLZA 3AHDA 2OCPA 4TV9F 3O91A 5CRIA 4B3BA 1SULA 4RKYA 5AHWA 4B73A 3KFLA 5GONA 2R47A 5CCDA 3M1AA 4XTRA 1LVUA 4E5NA 2C03A 1WW8A 5EZQA 1F8FA 1VMEA 4XVUA 2B3DA 4QGBA 1WE2A 3FFBA 1DKPA 3W79A 4HSEA 3V97A 2ABWA 3EAGA 5DEOA 4DFDA 4O1HA 5G0VA 3O8CA 2XSZA 4FUQA 2QGZA 3DLBA 1FYDA 4BZPA 3BTSA 3W1VA 3IV7A 1FMFA 4UU1A 3ZNPA 4DT1A 4HVLA 3ONFA 2ZJZA 3SMQA 2ENWA 2ZTMA 3IKLA 2XWQA 3OCYA 3MLBA 4XFDA 3V8RA 5SYMA 5DCWA 1LH0A 2VJQA 3C3DA 3DZJA 3UMJA 4ND1A 2NUTA 3RIXA 2VT7A 2RHLA 3V34A 2ZYSA 5EAIA 4X3OA 3P52A 4OMDA 4UTPA 1WLYA 1G55A 4L4ZA 2PUFA 4J2TA 3MTIA 1OWOA 1T4BA 3U7HB 1DWOA 2VS1A 5AQ1A 2YXPX 4X6LA 4BTLA 1AS0A 4IFTA 5KOIA 1XVUA 4HZUA 4AQDA 5DI3A 5F4BA 1J00A 1P7WA 3UOGA 3ESZA 1GZ4A 2C2KA 4H59A 1QHFA 3KKLA 4JDPA 5K0SA 1I14A 2JRLA 4N76A 2Z6QA 1MAUA 3FDIA 1JXQA 3VO9A 1ZC4A 3EZ7A 5I4IA 4ZANA 3F9RA 3LFUA 3ZBTA 2ZRPA 3U7JA 4NYIR 4O2LA 3TZHA 1P3DA 2IEZA 1EFLA 5EP2A 4CDGA 1ZRSA 2Y99A 1P73A 4IDHA 2NVUA 3CJRA 3O21A 2WHEA 2WVJA 9LDBA 1FNBA 2Q4RA 2QSZA 3OZBA 1M1YB 1L4KA 1VL8A 1X9GA 2QM0A 1N9GA 1MAAA 4E22A 2OE2A 1YL6A 1C1YA 1VCNA 2BMFA 1FLAA 5LQSA 3ZD6A 4AF7A 3LX6A 2YWBA 1AU9A 3K8QA 1NMZA 3OOWA 4BNUA 4DAEA 4PSKA 1GCAA 5JEEA 4DRXB 2GPNA 4DLVA 1T24A 1KAHA 3H17A 2XYVA 2MIIA 2BE9A 2WUVA 3WISA 2NO5A 2ORWA 5L6MB 4N5NA 3ZN2A 2JBHA 2W00A 5CVVA 3T15A 2CB9A 2MMGA 2FZEA 1RJFA 2Q0SA 4YTEA 4GRAA 1BJKA 3LF2A 3QGMA 4IUBS 1Y1QA 4MKGA 1G18A 4X41A 1SUEA 4B4VA 3V33A 4YMIA 3HXLA 3NBYC 3UT5B 5DW0A 4B3DA 3HEBA 4IQ0A 4AJNA 1G21A 4NWIA 4K9MA 2PRKA 4D9BA 1ULSA 3FKSA 1RD4A 3K15A 1J1UA 4PCUA 2WM2A 2R1VB 1YHNA 5EPEA 4BKRA 1W36B 1IVYA 3CHYA 1OTXA 4RE5A 1A9YA 5TF4A 4AMBA 4B76A 2DECA 3I61A 1Q74A 2ODPA 3NEYA 4ZKEA 1AA9A 4QAQA 1T9KA 3ISJA 1JFVA 2AMLA 4RKEA 1RLUA 4YROA 3J81A 2CLIB 4AJLA 5K4HA 1MZPA 1IMJA 2JGFA 4NMLA 1BVHA 2WU3A 4IIDA 2IODA 1E6WA 5LL6P 1MJFA 1Y4AE 2NPIA 2DQZA 5T57A 1DC3A 3GDOA 4RNDB 2Q49A 1XF1A 4OQ4A 4L8LA 2GN1A 4EJFA 4MW0A 3MVEA 4ND5A 5JAUA 2BBTA 5DLYA 1G8HA 4EHHA 3C8HA 1O77A 5JCJD 2QY9A 3SYKA 1M2HA 1QBKC 3DL2A 1GAWA 1QG0A 3R0ZA 1NVGA 3BGSA 4EM6A 2Q5LA 3AY0A 3FYUA 4IMIB 3WZ2A 3ZDAA 1NXSA 4ZQCB 1I4TD 4FI3C 1KTIA 2IYSA 3G2MA 5TEWA 3WLEA 5EXEA 4WASA 1KY5A 2NTJA 2O2DA 3L7AA 1WW2A 5IT0A 2ATXA 4YRZA 2HK7A 1OASA 2HWYA 3G8YA 4HAIA 5I4KA 2ZI4A 4NZOA 4BAGA 5LLDA 3VU9A 3EXIA 1WDMA 3L43A 3VR0A 5A5EA 3QQPA 1D7AA 2WUWE 1VIMA 2ZG6A 3L92A 1NNSA 2VXOA 2WB2A 1QTIA 1I32A 2WP8J 4Q4AA 4YBRA 1KHHA 3PS9A 4H1HA 5E0OA 3UJAA 1ZJWA 2WIBA 2HSZA 2OCDA 1SKUA 4QTTB 1TJYA 2NV0A 3TW8A 1TIBA 4FGZA 1KL7A 2JDIA 4KXQA 3KOYA 2OQIA 3AYZB 3W34A 2ZRFA 3DOOA 4ZVPA 3L8YA 2ECOA 1IYZA 3E61A 5F76A 1GUZA 4GI1A 1N6LA 4Q05A 4XWAA 1XZHA 3O4VA 1TYDE 3S27A 3VMMA 2GCEA 1W88B 5GGYA 3HSSA 4O2AF 4E6PA 4ZZ0A 2Z1DA 2VTDA 2D06A 3FB4A 3AUUA 1U5BB 3QNUA 4F4JA 3ME5A 2BMDA 3T6KA 4GYJA 3T9BA 3AR9A 1KO4A 3D8BA 5EZSA 3QPAA 3L8EA 3VJKA 2BUCA 2FMFA 4XPIA 4J2HA 4R3UC 3UJ6A 1EWTA 2IW1A 1O9BA 3SM9A 5EUCA 1P7ZA 2WAOA 3QUAA 4WINA 3IVXA 2HK6A 5LXTF 4D3DA 4BBAA 3GI1A 1C3XA 4K9NA 4O33A 5BW8A 3HY4A 4RDXA 3ETHA 5GV7A 2ZUWA 3PVSA 4OH1A 3E05A 2GJ4A 4IM7A 1QX4A 3FCEA 1PR5A 2YMPA 4X1KB 4L07A 2DTEA 4D4JA 3MHTA 1LLCA 1NBMD 2OG2A 3IRVA 4FN5A 4Y30A 4CU2A 3GJ3A 1SHUX 3GMSA 3PQCA 9LDTA 2GTPA 1E77A 4NOMA 2ACWA 1JZTA 3BA1A 4LV5B 5HS6A 2GB4A 3RYFA 2HRRA 3K73O 2VDJA 1JYSA 4OA5A 3RSHA 4E2WA 1F4VA 1N5LA 2NP7A 4GLOA 3RVOA 3O0TA 3KUUA 3FSGD 1QUEA 2DH6A 2ZT7A 2QRMA 4L3VA 2IPMA 3HCPA 3VOTA 1SOAA 4HDNB 1SXJB 3A6EA 4IWYA 4RL6A 4BO9A 5I8PA 1EE1A 1BRMA 5INTA 2V0CA 1EFUA 3SICE 3G2NA 5ERYA 1GN8A 3SVLA 1JEJA 4DXHA 2CCGA 3VR2A 3M4ZA 1H6CA 4RIGA 5IC5A 1JLLA 1W0CA 5BOSB 4IJVA 4ZT4A 1YJ8A 3HUFA 2HPVA 4R9RA 4YONB 5KPJA 2J85A 4E5VA 3UV6A 4QXQA 4B2IA 2JAOA 3QU9A 5DHSA 1X3LA 3DTTA 2CSXA 5L3VA 1EVQA 4ND8A 3AVWA 1ZM9A 1EB8A 3WQHA 2BGJA 3NYWA 5FUVA 4TL8A 2AJDA 5CH8A 4F92B 3A6HA 4MHSA 2WU0A 4HO1X 2JFBA 4PLPA 1ISFA 3L6RA 3HKEB 1OU4A 1C7FA 1A76A 1OXMA 3LIPA 4GI7A 5BT9A 3WYGA 2HMSA 4GWGA 2BFAA 1N0UA 4E46A 3DZHA 3QXHA 4QKQA 1NMXA 1R0KA 2Y1FA 1JPJA 1OFGA 1VP3A 4ZC1A 1J49A 3S2GA 3S1AA 3EVDA 3S6JA 3TM4A 3M82A 3B6EA 1S4MA 3RARA 2H7VA 1F8YA 5J5AA 3CVXA 3OLQA 3FVVA 2FSSA 4MPTA 5G1NA 4LQ4A 2WTNA 4GI5A 5JHHB 4QRDA 4Z8XA 1P2TA 1D1QA 3RTGA 1GD1O 1HLPA 2W2LA 4ZO8A 3NPMA 4MR9B 5CNMA 3OX2A 3H6KA 2R79A 4A92A 4F8EA 1Z4NA 4KL8S 1TXGA 1X94A 3TINA 3QYJA 4BLQA 4WEOA 4WESB 4E14A 4YV1A 3NHJA 2C99A 2XOEA 3FI9A 1Z33A 4GOKA 3PYXA 3K09C 5IYZB 3DF7A 2JH3A 1TJNA 1QVAA 4WZAE 1S8NA 3MUEA 4NJOA 4BE7B 4F45A 4V38A 2P9TA 3EVGA 4RPCA 4TS9A 3WWPA 1Q50A 3BL8A 5JASA 4PQEA 3AQ4A 1Z75A 4B33A 3L1UA 4EJ2A 4LYJA 2JG3A 5SYAA 4LJRA 1QHXA 4X00A 3EZ2A 2IYRA 5EJMA 5A4AA 4B3IA 1NQOA 3ZWPA 5BSWA 3I0ZA 3Q6MA 1W5FA 4RTQA 1NVXQ 2ZZKA 1SXIA 1CD5A 4HDQB 8MHTA 2G70A 1MDBA 1DEXA 2AG6A 3TEJA 3ZUGA 5HF8A 4UKDA 3AFNA 3SJUA 2CFRA 3FNIA 1GWNA 1BMDA 1WPRA 1P4RA 2BF4A 2QJTA 1NX9A 3OCUA 4Q9IA 3GPLA 1UBOS 3QZUA 4DUYB 4IVQA 9MHTA 3UH1A 4LZPA 2WD8A 4RL4A 3KCNA 1D2HA 1QP8A 4KSBA 3ZBPA 3A6FA 3CIFA 2AFRA 1ETUA 2R7LA 5ALDA 3TUIC 1THZA 3OE7A 1Y0BA 1UOOA 3WWDA 2RGXA 3COPA 2QT1A 4ERNA 3DV9A 3H9EO 5TLSA 2CXUA 1JA0A 2AR7A 3F2VA 1D2GA 2H1LA 4WBSA 5ECYA 1D7OA 1GQOA 4OHFA 1R6BX 4ZO7A 3DW1X 5B53A 3IALA 4MB2A 7ADHA 1JFTA 3W8RA 4P22A 4ACBA 2O0MA 4JGBA 4RV9A 1SBQA 3LAWA 3TZKA 3WGHA 2AEJA 3R7NA 1MW8X 1GNLA 1NVBA 2E5WA 4TXMA 4UBOA 1WSWA 1ISMA 4XXHA 2IK8A 1QO0D 3U3ZA 1FU4A 2VJMB 1NI5A 3K70C 2OO5C 3T5TA 3WOVA 1LQTA 4XWWA 4CF5A 4R8MA 4JXZA 2VJKA 3HCEA 3AUTA 3VGJA 1Z63A 4W5TA 2UKDA 4PQGA 3VVMA 5IUNC 1J2EA 1FRQA 5LDGA 1FP4B 1YBHA 3W5IA 4OI4A 4PIPA 4QDOA 5CP8A 3FTFA 4MRMB 4QOEA 3M70A 3B1ZA 5A7FA 2CUTA 2PM8A 4HAOA 2RARA 2PZKA 1YDMA 3CZRA 4RWZA 1E2UA 1KE2A 3DD1A 3QEAZ 5GJCA 3H8WA 3AZOA 1MAWA 2MR5A 2QRGA 2PQMA 1E2GA 2YICA 3P94A 4MV0A 5C2JB 1MA3A 2GNAA 3SIWA 2O8DA 4JJ7A 3Q8KA 1J42A 1UOEA 2V8OA 1PFWA 1NNEA 1RWOA 3BDVA 5ES4B 5JO9A 1MC8A 2WSYB 2FUNB 4HMOA 3D0OA 4B2YA 4U6NA 1X8JA 2K5UA 1UPCA 3N05A 3F74A 9GPBA 3G8CA 1TCCA 4KR3A 4K03A 5KYUB 2G07A 2NACA 2VNSA 3QF4A 1Q6ZA 5FL3A 2FN7A 2FW1A 3PWTA 2OHHA 4QHTA 1IBLB 4ON9A 2Z8YM 3GR6A 4GZ6A 2I5PO 4JENA 1RJ9A 2IH5A 3Q6NA 1SBNE 1ZH8A 2R97A 4FYXA 2XMCA 3NWEA 4WEQA 4MKIA 5KNBA 3GG9A 3K4PA 2PX3A 3CCFA 4FSDA 3FMFA 3TDMA 3KPUA 5I4BA 1J5PA 1YE8A 2Q2OA 4B0OA 4LGYA 3EEYA 2XV1A 1LI4A 3N2IA 3NANA 4KLAA 1Y8QA 1CUEA 5F7JA 1N6HA 2PTHA 2ZPTX 4EHLA 4YUZA 5KEIA 1NZJA 1QIJA 1Z28A 2OGSA 2PKQO 3CLVA 1X0VA 2G40A 1SKAA 4MVXA 4JJ8A 1EFVA 3T5DA 1PO7A 4PX3A 1PR6A 1GSOA 3KRTA 2A9VA 4NZNA 4BPRA 1Q2XA 3VTFA 2VSQA 2RHOA 2BWJA 3VNRA 3LT5A 3G9ZA 2K4MA 3LXMA 4YQEA 5JSFA 3GMDA 1WQ3A 3FOAA 3P1JA 5AKGA 3WGUA 3JYQA 2QLMA 3HCAA 1EGMB 1PFYA 4RMIA 5F64A 1JMYA 4DOMA 3L4BC 3QKSA 3KWJA 2A57A 2O7VA 4HN2A 4B4OA 1SIWA 1ZSNA 1KC3A 3CPJB 3NGMA 2C7PA 2HJRA 3PICA 1XNGA 4KDRA 5BSTA 4M0MA 4OMFG 2G83A 3EFOA 1UDBA 3QI7A 3VUEA 4RVNA 1EK1A 2JCSA 2PJRA 4GMXA 3SGLA 2VHVA 4W8GA 1TIPA 1X1AA 4LSMA 2OOKA 3KZCA 1V5WA 4AKSA 2FMXA 3KWFA 1B0ZA 3DBRA 4NDNE 2P0EA 4RH1A 3QX8A 5CB8A 2FX2A 5C7IO 1LFDB 1YCGA 3LRXA 1IZZA 3GWZA 3Q7QA 2OGZA 1TEVA 2AWNA 4I0WB 2Y93A 5HKOA 5COAA 1ECBA 2FXIA 1S0UA 4HDAA 5DM4A 1RRMA 1MHTA 4I6GA 1O08A 1YB6A 1EVEA 1VSTA 3AG6A 2C2BA 1E4OA 3D5EA 4RJKA 5I9SA 4PQYA 4MWGA 1TTTA 1O03A 3EOZA 5CYFA 4TRMA 1IG0A 1KH2A 4IJWA 4ZTBA 5EWMA 1Z45A 3AVXA 3OZIA 2BFCB 4RZIA 4OHZA 3SX0A 3TE7A 1EVYA 1LPSA 1NW7A 2MINA 4MINA 1N1MA 3DV0B 5E2IA 4II3A 4OCZA 3TGPA 3NW9A 1WBDA 3KLOA 4I46A 2Q3MA 3LUPA 2P5YA 2Z08A 3WIBA 3OOJA 1QVWA 4GQAA 3PP8A 4LKRA 2CNWA 3B36A 3ZJYA 4DYVA 4ZZ1A 4QVKA 2E4AA 3DHNA 1O0CA 2ZBEA 1IQUA 3A4MA 3HZZA 3KWMA 4TM7A 4ZXFA 5JZBA 3FWHA 4HUQB 2ANCA 3R9XB 3AUXA 3GFSA 5KVVA 2CVFA 3LZ6A 1XDWA 2C9DA 3TKYA 5IZCC 5IXYA 1O9HA 1X86B 2GJAA 2QUHA 1NSYA 4RIHA 5CUQA 3SJCA 4TYQA 1F14A 4NZZA 1NI4B 3N2ZB 3SQMA 2EKBA 4BO1A 2ZE8A 3JRWA 3QHQA 4BGIA 4DCJA 5H9WA 1IG3A 2BM0A 3DLAA 3HN7A 4JHLA 2A0KA 3DZCA 3RSGA 4EABA 4A1FA 1KQNA 4OVKA 4M1KA 1K2WA 1KYXA 2BGNA 2XMRA 3FDJA 4ZOLF 1EVJA 4BNIA 2V65A 4GKJB 5TC4A 1E4EA 4TTJA 3VJRA 1NULA 2YHSA 2YR0A 3LUFA 1WP9A 4CG0A 1KMHA 2M32A 3U9TA 1QG2A 2OILA 4XQ0A 5K03A 2LTAA 3OIYA 4GBJA 3ZK9A 3I4CA 4GWLA 4V02A 1U2GA 1QRSA 5EJFA 1AC5A 4UPVA 1O8BA 1ZH2A 1DINA 1L4NA 2MHCA 4ZC8A 3SKXA 4DM3A 5J23A 1XZ8A 4Z4EA 2NTYC 4P3XA 2IF0A 2TMGA 2OORC 4GOJA 4LSWA 1A96A 1XTKA 4FCVA 1MC4A 4TS4A 3IS3A 2GD2A 4MV6A 1CEYA 3FFAA 1L4GA 2BN4A 3ES9A 4L9SA 4UBKA 3HXOA 4ZCTA 3CWQA 3MTQA 2NSJA 4I1OA 4NOKA 1P18A 4Y1RA 2R5WA 2V7GA 3HE3A 1SOMA 4RGQA 2DAPA 1TCAA 4KXVA 2EW1A 2OAP1 4PC2A 1EM6A 3HZHA 2Q0QA 4EB0A 2RB5A 2X1MA 1UKVY 3EPJA 3PEEA 1SG0A 3I58A 1BTOA 1DKQA 4GR4A 3NTRA 1PGNA 1KYWA 3WGTA 3RRJA 1KAQA 2PIAA 4Q9NA 7MHTA 1N5JA 5AHRA 2RB4A 4CJXA 3NH9A 1BCSB 2VLIA 1ZEJA 3FIJA 3NONA 4W82A 3RGGA 3MBIA 2RGRA 3Q12A 4HFMA 5DGHA 3WLIA 3INRA 1YOVB 4PSCA 1C0EA 1Q19A 3B8EA 2ST1A 5EZ5A 1H9AA 1O94A 2IIBA 2RHJA 3P9XA 3VPBA 1K9SA 5BNWA 2B20A 1WVMA 4M86A 5A4KA 4ZI2A 4P0TA 1JF8A 1DQYA 1ML4A 3ZQUA 2DQ4A 2VDMB 1QQ6A 4E2ZA 3RADC 3ZCXA 4CIBA 1EX9A 1W4RA 2BH9A 5COBA 4J1TA 2LWIA 2VCYA 1T3LA 3KUXA 5F5XA 3WA7A 4NV3A 3LG2A 2OV8A 4XQEA 5FORA 1Z12A 5FXMA 2I4IA 2XWSA 2CFOA 2WMNB 3N7UA 5B1SA 2VSNA 4MTLA 1OWNA 2Z6AA 1JDBC 2I66A 13PKA 1T0BA 2OUKA 3QKWA 1E4VA 1U0LA 4O4HA 3VKWA 3EQ9A 2H16A 3NAQA 2BFEA 3BE6A 4DLTA 2ZR8A 2G25A 1JG1A 4BX9A 2G3YA 1EX6A 1YUMA 3A9TA 3GLFE 1TQ2A 1TVKA 5HTOA 3GLQA 5HWSA 2O8FA 1SQ6A 1XTQA 2E21A 2PNFA 1RS0A 3ODGA 4GXTA 1U04A 2X0FA 1RRFA 2WNSA 4QSMA 4RHUA 3IAS1 2WB4A 4Y8VA 2QLFA 2VNKA 3DBLA 2V4MA 1JIQA 1MXHA 2OCIA 2PSJA 1BGVA 3ORYA 2QN1A 4RVDA 5AKLA 4G01B 4GO1A 3JQEA 1GQYA 3BXXA 2MYUA 1QTNA 4B9AA 3U4DA 1QP7A 1Q1NA 2MSWA 2JAXA 2R65A 2WJPA 4MGHA 2Y71A 1HOTA 1LPBB 3HJTA 3L04A 4WZBE 2YS7A 3OC6A 4O2BF 1YRAA 2R6R1 3ZWKA 4BRWA 5IU6A 2D1TA 1SH7A 4GSYA 4NHOA 1ZQ9A 4A9AA 1L5GB 3CBQA 4I14A 5KNDD 1O0SA 3SWWA 4LYHA 3AGPA 1LNZA 3LNTA 5JALA 4Y0VA 2J4FA 4CV3A 1JAIA 2ZJBA 4ITRC 3MNFA 1Q0HA 3BMCB 3R3VA 4GU5A 4QBFA 1C50A 2RK3A 1MNAA 2B1JA 2BFWA 1G6Q1 1CETA 4DSZA 3A06A 1EGHA 1CHDA 1WCIB 1II0A 2JBAA 1P5RA 3H5RA 1WEKA 5FLKA 2IOYA 1ZCBA 2CNBA 4IZOA 4MKRA 3IVGA 2ZI3A 2R4QA 4YJ3F 2A8YA 2H2IA 4ZXPA 5JAOA 3MOGA 2Q5QA 3IMKA 2AG1A 3KOZA 1BVUA 3PDIB 3OT4A 4PVDA 2X0DA 1NP7A 3HJAA 5C8YB 4L95C 2C4MA 1J6UA 2H2DA 1XD9A 2KLBA 1XYYA 2VDRB 1QCYA 5BSRA 5DHRA 3SM3A 3A1WA 4BP9A 1YR6A 5I5EA 3UCEA 3MA0A 4DCUA 2AG5A 2PXAA 3K09A 3LL4A 1EBUA 3JQ7A 1T8YA 3LT4A 3WBFA 3GRUA 4NYMR 1G41A 1ZD2P 2MU1A 3U1VA 4HDMA 2ZSBA 3EFBA 4KYUA 3GDHA 5AJHA 3Q4GA 3LOPA 4WN3A 4YB8A 4EARA 2NZYA 2ZWIA 2C9CA 1FTNA 1OI2A 2FLWA 4KOEC 3GVXA 3MFYA 4DBZA 4DILA 4DXAA 3EARA 3PXCX 4DNQA 4M54A 1XLVA 3QMMA 2PX5A 1UDXA 4RD3A 2WPDA 4WI1A 3O5AA 4DWOA 1ZI9A 5IDXA 3O92A 1G3UA 1SUCA 5EJ2A 3OUTA 2O8BB 3R7BA 2CHUA 4XR4A 3HA3A 2CKMA 1CWUA 2X3FA 1BE8A 3P7MA 5KO2A 3ONWA 1HYEA 3HWSA 3LTEA 1W2HA 5JAQA 5KNLA 2O07A 4S0ZA 2BMAA 3W77A 1DOAA 1CNEA 1KYQA 1V16A 2Q2VA 2XDWA 1AKQA 1L7VC 1B8OA 3DE4X 5JBQA 1E9BA 1DB3A 3OZFA 3QMVA 1RI1A 1MORA 3ITEA 1XHFA 1U02A 2XE6A 3LKZA 3D3QA 4YPFA 4L8FA 5KYTA 5DOVA 2X0JA 4LJ8A 2B2XA 2BZGA 3CYFA 3RRMA 2OL4A 3KSZO 1V9LA 1VRCA 3HC7A 4L4RA 4NDAA 2B4QA 2WG2A 5CFZA 2NYVA 2B98A 3WIVA 2G7MC 1ULUA 2COKA 3A9CA 3IJRA 4U2EA 1YRHA 2OO5A 1WXQA 4A91A 4PYNA 2FFQA 1HF3A 4OX9Y 3A70A 3EG5A 1QFYA 2FUG1 5DGIA 4CG3A 5JWHA 4BMPB 4EX7A 2C7BA 2W6IA 2B69A 3T1VA 4C08A 1DDGA 4LJ4A 4BV2A 1NR5A 2JIZD 2MYTA 2PMFA 4IZIA 4KIWA 4QQKA 5FL7D 2WJZB 4P3KA 2BONA 2DFTA 1NATA 4PZYA 3CB2A 2OCLA 1F38A 2EBHX 3DBHA 4OU4A 4M7WA 4RLQA 1R0SA 3M3PA 1W4AA 4CI0B 2FLKA 2TECE 1UBFA 4FEAA 4KMSA 4L0DA 4DYHA 2HH9A 2JVKA 5A3RA 2WNHA 3AFGA 3C1TA 2C5BA 1REQB 4QTYA 2XMGA 2ZJOA 5DXAA 4PS0A 821PA 3UGJA 1SUBA 1Z0KA 3EGWA 4TTTS 1B15A 1OTHA 3EW9A 3RVBA 2NGRA 4IIXA 2QTVB 3SJAA 3C7AA 1XK7A 2ZJ5A 2IP2A 2IPLA 4N3BA 4V1CI 1AZTA 3R20A 5E6SA 1VHWA 1WM1A 2E3JA 1LPAB 3MRXA 3DFZA 2I62A 5DXFA 1E9VA 1SU7A 1U0HC 2V8BA 2YC4C 4YRDA 1MB9A 1E18A 4C0BA 5KTRA 4AIRA 4L57A 2JH9A 5DBFA 4BNVA 2Q9CA 3BTVA 3T9CA 4YH1A 3K94A 4MVJG 1P4GA 4Q00A 1I33A 1H2EA 2C3PA 4ZOCA 5E7QA 4KFCA 1L4LA 3Q7EA 2DQYA 1A5SB 4HB4A 4AJ4A 3O93A 1TLLA 3IAFA 4JB3A 5ICFA 2WQ6A 2Q1TA 2FWNA 3E23A 1XJWA 4FDMA 4ABYA 4D0RA 1T6NA 3LJKA 4HDRB 4MIKA 3V42A 3OZWA 1E9EA 1VLMA 2FZVA 2O2JA 1I1NA 2A9RA 1RIIA 2PA3A 2PO7A 3SQNA 2L42A 3DO6A 2D59A 2EAUA 2LW7A 4L5BA 3GLVA 2AJCA 2P3SA 3I9V1 4JKOA 1HUQA 4HLUA 2EW2A 4M1WA 1IJFA 2QHXA 1QZUA 3HBJA 3K20A 3E7PA 1BW9B 1HWYA 3AF3A 1D03A 1U6KA 2O2YA 2P40A 4DY4A 5H8WA 3GEGA 3L4BA 4YCAA 3D2AA 3K3PA 1TPZA 4LGVA 3NBQA 3V55A 1OZFA 5KQPA 1RAIA 3AVYA 3QU2A 4FFNA 1NHGA 1MAHA 3CWCA 4GX5A 4PRYA 2ZE6A 2BCJQ 4PGFA 3HNOA 2Z2IA 3O8OB 3VHRA 1Q11A 3NDIA 4NY1A 5AI8A 2VDPB 3DTVD 1DAFA 1MG5A 1U1IA 2HRDA 2WLTA 5EP4A 3TIIA 3N2NA 3ROGA 3CF6R 2QX7A 3KHKA 4LS3A 3EXEA 1XR3A 1EFRD 4PIMA 1U65A 3HJUA 3NBFA 4RXMA 5IK2A 5L3SA 1CXZA 2GPYA 4GLFA 1ZUD1 4BQSA 1QLHA 3G7SA 4Y2RA 3VDRA 5TF0A 3DLCA 3SQWA 4LMAA 3RRZA 5KNDH 1E3DA 1S9DA 3S2EA 1V6SA 5HOQA 4U39A 3P9PA 4YRBA 5BP7A 3UF0A 4OMCA 3QIVA 3WGZA 4NJEB 4BLOA 2HLDD 1USWA 3WXMA 5L40A 1VLJA 2ODNA 2HHLA 1JQKA 3QWIA 5FF9A 3SZ3A 4NV0A 1FXWA 3GN1A 3BB1A 4NESA 2GO1A 4RC9A 4YC7A 5ALOA 4I8IA 3C4JA 2HFKA 2C7VA 2JIRA 4PC7A 5ALFA 4ZCIA 2PZFA 2DSNA 3NDRA 3OECA 3QY0A 2RH4A 4HB0A 5A6VA 2FUKA 2HA2A 4AYTA 5MHTA 1GTL1 1K7SN 3FRHA 4FWTA 3I34X 1E6EA 2GRAA 2H92A 3ZDBA 1ZXXA 3AUAA 3IB3A 1P6UA 3WV5A 4C3VA 1ISIA 1C9NA 3PTAA 4NCNA 4Z4FA 2WU4A 5FPHA 4HNVA 1A1SA 1FXSA 2NUPA 4H3HB 4F3CA 4FS8A 2B78A 5BV1A 3ZKWB 1TEZA 1TK3A 5FWNA 3FTDA 3NX4A 4CM4B 3K32A 4DCGA 2SNIE 4DC0A 3LOUA 4AUEA 4ETIA 2B5WA 2QVXX 3FNGA 4ITUA 3RS4A 5K8TA 2WJAA 1LFAA 4B31A 5KYYA 1EVZA 4JQOA 2GJKA 4CQNA 1RHJA 4MPRA 4LCBA 2AXNA 4JVNA 3QW4B 1OFUX 4FBGA 4MA5A 2ZIZA 2QIPA 4LFCB 1F20A 2NW6A 4KJXA 4LRYA 3W8FA 3DWFA 3W5VA 3Q8LA 4QYIA 4R41A 5CDFE 4Q02A 4EW1A 3DOCA 2UYOA 4YCBA 3DMTA 2JLAA 1S2IA 3K5PA 4D0GA 4OL9A 1DJQA 5B58T 3MGCA 3NV7A 4CNQA 3H1GA 2D4HA 1PHRA 1ZQ1A 3UW3A 5IFKA 3KOOA 4AKHA 4MS4A 3KSRA 3RHFA 4P0QB 4Y3UA 5AM2A 2ZUVA 4MJXA 1VL1A 3DR3A 4OP3A 4JCOA 2OORA 1DQSA 5E2AA 3R7WB 2XKKA 1QK4A 4IOKA 1IUOA 3GCGA 4Z86A 3GDFA 3K9WA 1GA4A 1RNLA 1X7DA 2DOKA 1EFTA 4RXTA 4DMGA 4OFZA 4HH1A 1A9QA 3SIXA 5IHPA 4X44A 3CT4A 3GFPA 1N6RA 2XKBA 1IQ0A 4QGGA 5B57C 5CD1A 1KHTA 1Z2DA 2YJ6A 2IV7A 2Y3IA 3Q5EA 5JMWA 1KK1A 1YI8A 5AW2A 5C5EA 1TMGE 5M7EA 1CG6A 4CL2A 3I8SA 3T95A 1SC9A 1O1YA 3GLSA 4QGAA 4XB2A 2R68A 1UK6A 1RJWA 3B1XA 3CO0S 3EEFA 3MWKA 1WXEA 4P81A 1SD2A 3VHXA 5EKUA 4F21A 1VL2A 1FU8A 3EGIA 5A4IS 1PZXA 1NG9A 1Q0RA 1Y1KE 5G41A 2PRIA 2FX3A 3BXEA 4JLMA 4KQXA 4C7KA 4HUTA 4G41A 3F1LA 1V47A 2DWOA 1CUCA 1RI3A 4R4JA 5DWDA 5L95A 1JWLA 2N42A 1Y89A 2QSYA 3UUFA 3TL2A 4D9NA 1RBYA 3DHEA 4F60A 1BKDR 3MB5A 2EV9A 5K0FA 3VBCA 3LT2A 2C3YA 4BVGA 1BDJA 4DDMA 1F1JA 2AOVA 4IHAA 4J9UE 2Z83A 2ZUCA 3ULKA 1KZ6A 2FQWA 3JQAA 2FPKA 2FQ1A 1ZM4A 4X64B 1XRNA 1Y7PA 2HWXA 1KYZA 2Z5FA 3DD5A 3LYAA 3PGLA 5DBOA 4IIJA 2NUTB 2CL0X 2IU3A 1GKUB 3GNQA 4EECA 5CA0B 1HYQA 3HACA 4Y6LA 1EHIA 2DCMA 3O9MA 4UMFA 5HIKA 2QW8A 4LYAA 4LNUA 2JKVA 1Q83A 1TOAA 1JXAA 3CEAA 1GLGA 4UXJA 1Z2OX 3EQ2A 2EHDA 4RVOA 1C14A 4KE7A 5DI3B 1N9KA 3W3ZB 2I6XA 1XTBA 3I9NA 2OXCA 1XHEA 2AZMA 1GY8A 1PAUA 5G4KA 3MEQA 1LLUA 1XJ5A 4PG8A 2NU9A 2CVHA 3UGQA 2PUDA 1PNQA 5FP0A 4TQUS 3T7AA 2IUUA 3VTAA 1O58A 3F9IA 1I3NA 3ROKA 4R40A 5A03A 3RTDA 1RKQA 3E5HA 2IPXA 4G37A 5JAMA 3TUZC 1AD2A 4W5RA 3OFJA 2NVUB 3KZMA 2VJPA 2NYAA 1KK0A 3JPWA 2VT6A 2HIHA 1L4EA 2QXUA 3CNNA 3FETA 1KJWA 4N4AA 1IEWA 3RRYA 3I4FA 3UMMA 1NPDA 5THXA 5L51A 1ST2A 3AR5A 4DBVO 3O47A 4HADA 2GEJA 2P5SA 2V55B 1R6UA 2HU2A 2C61A 3B7PA 1DAOA 1NTOA 1QO7A 4TTAA 2YZGA 3BT7A 1MEOA 1NDUA 1T2EA 2MSKA 3NGLA 4AURA 4YT4A 1F2UA 4ZAYA 4OJTA 1X80B 1Z6XA 4BNHA 4IHQA 1M2VB 1SQSA 5F1KA 3RGWS 3IAEA 2A5GA 1LBHA 4XVQA 2WILA 4F2WA 4GKKB 1TC2A 3OEEA 3M6AA 1CTQA 5AOVA 5EUMA 4EI7A 3B6MA 2JLUA 1NW5A 1AG9A 5DLQC 3U3KA 3CVUA 4Z3OA 4XGQA 3T3OA 4TTSA 1BCRA 3SKVA 1DC4A 2OXIA 4LOHA 1Z2AA 5D5PA 3DFMA 1W1WA 3T5MA 1ZVVA 3UKJA 2E1PA 3DKVA 2P4SA 3KR1A 2PUBA 1IOLA 1EZZA 2VH1A 1U4NA 1G21B 1JKFA 3GGGA 4IIEA 4AMYA 3R6TA 2FHPA 1X1BA 4KUHA 5J1SB 1PQWA 3QNMA 5HTKA 1OXXK 3BOSA 5E3IA 1ZRHA 1ZZGA 5E95A 4EP1A 2ZIFA 4OQQA 3K2EA 3KTAA 2SKCA 1ZO8A 2VOJA 4RMHA 4BQPA 5A9SA 1SBIA 1N0IA 3AB8A 4B4KA 3AY7A 1W0KD 2IXGA 4RMJA 4ARSA 1G8MA 2ZCUA 1IEXA 3A3KA 3H5NA 4HMPA 5AM1A 3VYVA 2Y1WA 2XB8A 2EL9A 1O4VA 2Y05A 1KH1A 4NYJR 4V0OA 3GZJA 4RD6A 3SJZA 1XKQA 1JW9B 1NY5A 4MGIR 5CYGA 1T5DX 4GE3A 3A7DA 1X8KA 4YRTA 1GJRA 2OYCA 1MOPA 3TFOA 5FLXA 1S8AA 1YH3A 4Y98A 1DIBA 2EW8A 2O2XA 5DEIA 1A9XA 3RJMA 1TKCA 4E7OA 2LUOA 4CQJA 4W6QA 4KO4S 1YDHA 3JQ8A 2GUGA 1YJQA 1CUZA 3RC2A 2OTCA 1U80A 2XY4A 3WGIA 3E8SA 3GYBA 4PW0A 5AJXA 5MN4A 2Y66A 2F8TA 1SNYA 3LK6A 3K0HA 1VE3A 3WAJA 2AW5A 2B83A 1W4BA 1SQ5A 1L8AA 1JVSA 1VL5A 2EG9A 2I76A 3CJTA 3LLMA 3M5DA 1ORHA 2AJLI 2O2CA 2ES4A 2B82A 2J09A 3QA9A 4L15A 4DLNA 1K3TA 4G85A 3IR7A 1M1YE 3TQFA 3VVCA 2HK8A 1TKRA 4XX0B 1T4MA 3N2KA 3R6DA 2A4KA 2CHEA 4ZI7F 3VU9B 3EXIB 3N53A 3U3DA 4PZEA 3BCRA 3SC2A 2YXDA 3GWGA 2ICAA 2V7TA 2B6NA 2W2KA 1XTZA 3R4VA 3WLAA 2ORED 2ECKA 3CF2A 4KFUA 4Q4AB 1UBCA 5DTQA 3BKXA 4EJSA 1L7NA 4C3ZA 3KTOA 1J2TA 1JU3A 2RC5A 4PZ9A 1ICEA 3ICQB 4TV8A 1MQ8B 1BH2A 3TW8B 1E7RA 1CZHA 4TMYA 2AX3A 3I8XA 1XTUA 2VCHA 3PJEA 2FEAA 5G3ZA 1HK7A 5KJCA 4WBNB 5J1TB 2O4CA 1BVYF 2PT9A 3TM5A 4LDZA 3RCBA 2IUSA 1XAJA 5EESA 4HGOA 3S29A 2XPCA 4Q4DA 4FWBA 2QX6A 3E2MA 4MRSA 5EKSA 5JCXA 3UHFA 2FE1A 4D6XA 3OWHA 4Q9KA 3ZV3A 1WY7A 4MYSA 1MX1A 5REQB 3ZU5A 4KBFA 4CVNA 2IHYA 4L27A 3W0LB 3G1WA 1TMOA 4A8PA 2UUCB 4JP2A 5JIBA 1QAOA 4KQ9A 3BB4A 5KQSA 2ZAGA 4OBWA 4PY2A 1T8UA 4LYYA 2AK3A 4RZ2A 4L76A 4XPIB 1X87A 5JCZA 1HQCA 1LWOA 1XJCA 4QDXA 2NQTA 5EFOA 4KVAA 1BXKA 1KEZA 3BXGA 4BE9A 4EITA 3I76A 2YMLA 5IAAA 4JMLA 3PC2A 5KC8A 1CFZA 2ZYWX 4WE3A 3FYTA 4FFDA 4R7ZA 4LSZA 1RPTA 1W4CA 1T2UA 3OIDA 1R88A 3UK1A 1S96A 3SC6A 1PL7A 3L8DA 2B2NA 1FP2A 1HYGA 4ABTA 1GAQA 5BUCA 1LV8A 1U81A 2P9YA 2ODTX 1TEXA 1OBOA 1OYVA 2UUOA 5KCMA 4IYJA 2XMSA 3LX8A 4XDHA 4XD7A 3ZDEA 2GDZA 4H15A 1AGNA 3IVCA 4MDHA 3UJ7A 4A0GA 1UWLA 5DNWA 4BV3A 1FC0A 1PG5A 2NZUG 1JQAA 4DLSA 1OWMA 3ID6C 2ZRCA 2FE4A 2J4CA 1Z35A 3QEMA 4GGPA 4WXMA 2PNJA 1QH9A 1NUSA 1NPYA 2RGYA 4FX2A 4M99A 5SY9A 2HJSA 5D51S 3IUPA 2F62A 2CLOB 1GFWA 5BWNA 1NUQA 1QYIA 1CUXA 2HQSA 3O8DA 4RPGA 2QD3A 4JBYA 4DEYA 4M0UA 3VRHA 3L7MA 2BV3A 4J0JA 1P17A 2HBZA 1E3WB 4CM9D 1I8TA 5BMVF 1HOXA 1OXSC 121PA 1JLKA 3PUHA 4RH0A 5JCOC 2XUAA 1VG8A 2QPTA 3FKQA 3K9LA 3LCMA 2HMUA 4HB3A 2ZRAA 5JSQA 3ADKA 1N1GA 4G8CA 5FA6A 3IHLA 3ILHA 4O02B 5BQPA 1VSUA 3G2HA 4JLPA 2QMUA 3AUSA 4R2XA 4ERXA 5H83A 5FX2A 5IBCA 1NVKA 4NNOA 2IY9A 1AS2A 1Q20A 2F43B 3O8LA 5GVSA 3IL2A 5HS4A 3R77A 1JKXA 4XQGA 4ND8B 4RS4A 1UC4B 3UOWA 4B75A 3AJ8A 1H0KA 1POXA 1ZIPA 3FYDA 3MINA 4M3NA 3QLVC 1G3MA 1GU0A 2VSOA 2ZYVX 3O6VA 1ISRA 4JBXA 2LE0A 3KOMA 1OV6A 1FYWA 1E1YA 1OAAA 1FXUA 4KXNA 4CKWA 2EFEB 4M9XA 2R7MA 2RGNC 2YBDA 4F04A 2AGVA 4D0NA 3D8RA 3K5WA 3OTIA 3KDSE 1WZNA 4DPKA 3UMSA 4EYGA 4HN4B 1XKTA 1MT0A 1LF0A 3E1GA 4M87A 4P3NA 4YO8A 5J2TF 2IOFA 2PMEA 3ASVA 3D0RA 4QEDA 1XU7A 2LIVA 4HQ6A 1J07A 2XE8A 2DKFA 4GSKA 3GLHE 2PH7A 1RP1A 4OTZA 4M46A 4Q9AA 3SXUA 2QRNA 1CDDA 2C3UA 3EZ9A 4HQRA 1XU4A 5IC6A 3OT1A 1NBWB 3K5HA 2GPBA 4WKOA 1U7DA 2IIVA 4NG4A 5JRJA 2JCYA 3QVTA 3NNDA 1SWVA 3AFOA 5HQTA 4K2HA 4LHSA 1ND6A 1L5HA 2XVAA 5JLJA 1UDRA 2UYCA 2EKPA 7REQA 1V4VA 4M1TA 3CE6A 4MS3A 3VZQA 2O2IA 3KXLA 1I1OA 3AY3A 5K8JB 1N78A 3IQFA 2I7XA 2C57A 3IIIA 3KQPA 2LP4Y 3RC9A 2ZXFA 1G7CA 1IQPA 1SVMA 1CSEE 4PBRA 2CD7A 2I6TA 4GE0A 3EC1A 4ZHQB 2Y68A 5I9NA 4DIMA 3C1OA 1JFLA 3P9NA 1WMBA 1JDTA 1NBMA 1Q44A 2JBWA 4HVCA 3EGDB 3IQGX 3Q3VA 3W5SA 1VI5A 5LYJF 4UUMA 3FNQA 3TAHA 1HKUA 1KYYA 4MUFA 3ZEIA 3OOSA 3RK0A 4RY8A 2D2VA 4AICA 4HEHA 5JI2E 1A77A 3ZCRA 4F2HA 3JQBC 1ZLYA 1SXJE 3LWBA 2FWAA 4PLZA 3ZZUA 2VOEA 3FSGA 4FQ5A 2AC7A 4Q39A 3M6FA 3ROXA 4YAJA 1N4AA 2C5FA 3ORQA 3B6IA 2DLCX 3VPDA 2DU8A 1HTTA 3HNRA 2GN4A 1YVRA 3V8QA 2JLXA 2VJAA 4LQDA 5IASA 1ZD8A 5EWLA 3QVLA 4DR4B 5DSXA 4TROA 4YDQA 2UYHA 1HC7A 1XIVA 4JYBA 4AX8A 1WJGA 5JFGA 1RI5A 3TX6A 3ADPA 1JMVA 3LPMA 1PT8A 1DG1G 5KNCH 5JAIA 1YZNA 4CCSA 4UNSA 4B2LA 3DVLA 1ID1A 3T4XA 4M88A 1SB9A 1CJUC 1R4ZA 1JR3D 2RHHA 2VQSA 3IQIX 4K81B 2B2CA 4O4IF 4YGYA 3U3JA 2WV9A 1PL8A 3MJVA 1GHTA 3WICA 1TYBE 2X86A 3THXA 2GF0A 3LY8A 2PQ2A 5KYXB 4IJQA 5AJUA 5HOEA 1GG9A 4BTVA 4E70A 2JFXA 4RK4A 2EATA 1GEEA 1USVA 3O94A 3QVWA 1OY1A 4NZMA 4RFVA 4YJKA 2UYYA 5KVAA 2HR1A 4TGLA 1WA5A 1L5WA 1FUKA 2HT6A 4LRUA 4MLZA 1E2KA 2W4QA 3BXOA 4CN8A 1M2JA 2WVHA 1R0CA 4ZQFA 3KETA 3E9RA 3N87A 5K5EA 1C7JA 3OOEA 3WS7A 1GV0A 4N8DA 5AK6A 2PYDA 2GBFA 2XNCA 2RD2A 1E9CA 3ZK8A 3DEYX 3NCTA 1GA6A 1GTMA 1JAZA 4L78A 1RM4A 4OQYA 2ZOSA 3RKRA 1U7XA 2ZT5A 3QXSA 5BXQC 1DGQA 1KMNA 1Y7TA 3CLSD 4V0NA 4HDCA 4ZYZA 1M8FA 2JGRA 2OVFA 1GZ5A 1ZI6A 1MB0A 4I36A 5BUSA 2O8EA 4AY5A 1PL0A 3JCZA 3T3MB 3TL3A 3QF4B 5LUBA 3LZCA 1CNMA 3CB4A 1FMCA 2R4UA 1GA1A 2N9UA 5ALVA 5F9FA 2ATEA 3HYRA 1D2CA 1RJ9B 3A4YA 3C3CA 3VUFA 5TPWB 2G6BA 3CPSA 4BO4A 2GI4A 2YYSA 3HZOA 5G2OA 1UH5A 1EK0A 3D7MA 3V3KA 2RI1A 5F35A 1SBCA 3A3PA 4N9WA 3MUOA 1HM5A 2RC6A 2R8RA 5E0KB 3BQNB 3CZ5A 3OEYA 4WDQA 4AYXA 1XAGA 3TJMA 4JJKA 2IA5A 3P2MA 4IVPA 4BMVA 3BH0A 4FGJA 3WLKX 1YQTA 3OMWA 5CJPA 4IGKA 3MJHA 5BN5B 4KREA 1EFVB 1NQ5A 1KIFA 2X6QA 4GPZA 5IAKA 3LLVA 4XEHA 1XCOA 2MYPA 4TWRA 4CE6A 2I7CA 3BZWA 2D2FA 1ZNXA 2YC2C 5AVYA 3DAFA 1QGZA 2IY7A 2G82A 1OMOA 3BRSA 5H4HA 3P9YA 4NHEA 1JFSA 1ILEA 1WHSA 1KRWA 1T1RA 3FAZA 5AVOA 3G02A 1AKNA 4I50A 1MT3A 1RIFA 3QKSB 4W5QA 1KSHA 4M8IA 4OXKA 1NXWA 4PHTA 2ZAMA 3G2IA 1C4WA 3I8OA 4WLUA 5FOSA 4CM7A 1MQ9A 5IDVA 3AVTA 4Q21A 1JWBB 2AHOA 1P44A 3Q41A 4IHJF 4TUYF 4YAOA 3QTLA 2LDBA 3ESXA 2ZB7A 3L4JA 4P6VF 3EFOB 4IH9A 4NE2A 2C88A 3VPFA 3WHPA 5CB0A 4RKWA 2NXNA 3H0KA 4LG1A 5DASA 1QO0A 1CZKA 4D82A 1QX3A 3I01A 2ERCA 4UEJA 1DBRA 2ZATA 4LF4B 3B53X 3IR5A 3GFOA 3DBRB 5H7XA 3OE5A 2NNLD 3WGKA 2AOXA 4JI5B 1YCDA 1O3YA 1DX6A 3NHLA 5I01A 1B3RA 2PS1A 4J6EA 3U1TA 4E4RA 3PNLA 3Q0EA 2V3WA 4QNRA 2ZRDA 4BP1A 5IXSA 3QELB 5HG0A 2FB9A 1OBHA 4WQMA 2HRQA 1CR2A 1PGQA 2ORVA 3DW3X 4RF2A 2FSFA 3H16A 5HE9A 4H08A 4DCPA 2VVTA 3DB1A 5ELXA 2WTAA 4J1QA 2Y2UA 4FEYA 3REOA 2BMWA 2FGJA 3AW9A 2CLFB 5EWMB 3B48A 1J23A 4ZQIA 1ZXLA 1C3OA 3LHDA 1E63A 2BGRA 3S70A 4IKPA 1JUDA 1KS9A 1NE7A 4AY4A 1DAHA 3WI7A 1AKYA 4ARIA 2RDMA 5EZYF 1GO2A 2X3UA 5G0WA 3ZDCA 4IUDS 2QW0X 3ZDDA 4DC1A 3ITKA 4GKBA 3GP8A 4HKTA 2P9CA 3H5TA 2XQKA 4WL0A 1JE0A 2W71A 1ZMRA 3GT7A 4ZYYA 1YA8A 3LQ1A 3AL0C 2PS3A 2V7PA 5TGDA 1T8PA 3GCZA 3SR4A 2CMDA 4TQAA 1YGYA 1HDGO 1LDNA 2FW8A 2GBPA 4BECA 1G3QA 1PVOA 2AI3A 1K86A 2DE0X 4KGVA 3BPSA 4AKTA 5A3SA 5LP6F 1EH5A 3EDCA 3RG8A 1M6WA 2NZXA 2YIMA 5ALQA 8ATCA 5FI3A 5KINB 3Q9UA 4LHEA 3UJCA 3THYA 4ZCQA 3BWYA 3ANYB 3SJBA 2WSSD 1Y6QA 3SR3A 1PNRA 1EK5A 3PJRA 3WHKA 3JRNA 3FGNA 3G2JA 4LX8A 4QJBA 1Q12A 4J3NA 4MKFA 4JJZA 3UBMA 4A5OA 4YIHA 1E7WA 4OI0A 1KMHB 4MVJE 4MWCA 3VPXA 3ZWOA 1IU9A 2IWHA 2OLEA 5NLLA 1TAHA 1YE3A 1J0XO 1PJTA 2C5HA 2VRWA 1Q92A 3U4IA 4H4EA 1CU1A 4MW4A 4NKRA 4OKSA 2HB6A 4OOEA 4RAQA 4OHVA 3RDPA 3ZWDA 3DDWA 3L18A 8ADHA 2D1SA 4V0QA 4JYCA 1SCUA 2JFNA 3FPCA 3ELBA 5IWAB 3ZHYA 1I6KA 1NQTA 4RQAA 1Z34A 2XMZA 4JYPA 1DEKA 3X44A 2BVNA 1DCTA 3ROMA 1YTLA 1ZPDA 3ND9A 4Y1RB 3C15C 5D6NA 1P0IA 2WWGA 4YP7A 4CG1A 3E5RA 2HZ7A 4CQLA 3QVKA 1WZCA 4BO6A 3LPCA 4IIVA 3DT6A 3LUGA 4YRGA 1BYUA 1PVDA 4R2JA 3R3WA 4Q0MA 3TCKA 1R9NA 3W4KA 1E6LA 1R0YA 1ZA1A 2G9QA 4WSOA 2ASVA 4GPTA 5F1PA 3A1CA 5E38A 2XYPA 5DX1A 5FPTA 5FKJA 1NWHA 5FOWA 4B7AA 3GVHA 4J0KA 1PEYA 3OM1A 4HLDA 1EAYA 3F7MA 1JR6A 3GMTA 2BFPA 2DWQA 2GO7A 1P9OA 4UMDA 5AK4A 2NYRA 1RPZA 3DKKA 5AM0A 1W9HA 2WE8A 1RKVA 3P9KA 3PI7A 1RJEA 1DU4A 1GGKA 2Q5IA 4FDUA 4C4SA 2UUBB 4DMMA 1JEQB 1SJ9A 1YKFA 2J67A 3DFIA 5CX1A 4CHGA 5DT9A 1WXGA 4LRSB 3HY3A 3KYIB 1FF9A 2Z9CA 3LCUA 3OCZA 3C6BA 4H4CA 2NO4A 1CUHA 3OUZA 4KUEA 4LY9A 1P1CA 4KX5A 1AN9A 4OP2A 3GV0A 3W1WA 1GYQA 3QQ5A 4YV0A 2ZIGA 1Z4JA 2ZI6A 4DWJA 2IYEA 3JWIA 4YXFA 4O4HB 4RTPA 3TNJA 4BNXA 4UVHA 4JUDX 4D4HA 3GPDG 4Z9YA 4U00A 4CEJA 1G6HA 3EC2A 4QVGA 1TVKB 2O8FB 2MCFA 3ZH9B 1TQ8A 3HUTA 2BEUA 3KKPA 3M6VA 3LWNA 3PNBA 4H3SA 4HR7A 5LXTA 2D1QA 3HCWA 2BCEA 2ZBDA 4IF6A 4PX9A 1T26A 4H1VA 2A5LA 2DM6A 1XMXA 2E6UX 1FDTA 2J3EA 1EFKA 5HGXA 3P45A 4DMUB 2XYHA 1XCPA 3DBLB 5EIAA 3W06A 2H2WA 5LBUA 1IJBA 3O1LA 4WNYA 3IQWA 4CMKA 3RS8A 1CQIB 2DHQA 1KVRA 3ZXUB 3LUKA 5FT9A 1GKLA 3MXOA 2GASA 1BXRA 2FK8A 4PX2A 5PNTA 1Y3HA 1G2PA 1QMGA 2YS6A 3DYVA 2P6MA 4ND3A 4EBFA 2IS6A 2VC2B 3GGOA 2PCLA 3U7IA 4P08A 1M2KA 3QLVA 4HLQB 4BJ1A 4R01A 1I2MA 1Y6JA 3O2JA 3SC3A 3LCVB 4IIYA 1W35A 3GP3A 4Y9TA 3UG7A 4NG5A 4GXRA 1XPRA 3RG2A 2RGNA 1IN4A 2VRCA 4G1MB 3KVNA 3AP3A 5B58C 4YQYA 1SUPA 3TQIA 2FXVA 5IUJC 2C9YA 1VCHA 3JD4A 2GCOB 1UXKA 1XDGA 2F4NA 2XQFA 3RIMA 5TV2A 4IDDA 3D8UA 1SQGA 3C48A 4CUJA 2D4AA 2BL4A 1F8GA 3L1VA 2DLDA 4XIJA 3UTCA 1HL7A 2RGAA 4UZFA 2I1VB 1KQOA 2V7BA 4H77A 4QUEA 4LDRA 4RLFA 4G5SA 4ZYVA 4M1ZA 8OHMA 2WTUA 3OF3A 4MNTA 5HXAA 3ICCA 3E5NA 4BQFA 2IDJA 1G66A 1GU1A 3HHPA 2ALJA 4PCVA 3A27A 5AKEA 3H97A 1RLTA 4O63O 2H6EA 3ZGLA 1GNPA 3RS5A 4CPDA 2GLUA 4BWYA 3PLNA 3JQ7B 1DTWA 3ZLBA 1COWD 2ZB8A 1Y6GA 1Y33E 2H0AA 4O4LB 2OFFA 3T7EA 2ID9A 4EG6A 3L02A 3CR7A 3KZNA 4HDMB 2H2FA 4ZEXA 3QW2A 2CLEB 2ODEA 2XXJA 1YV9A 2OGTA 5ALSA 3RTEA 5JBIA 2HRZA 4K40A 2PPVA 5H59A 3SDBA 3WTBA 4RV5A 5CEJA 3UENA 4JLWA 4FQ7A 3PRJA 2QZJA 3AJEA 4XASA 3KP1A 1RXUA 1QF7A 5CW1A 5ECWA 4D6PA 2F1OA 2YV5A 3K1AA 4KC0A 5ESRA 3LVBA 3WLSA 1RRGA 4DSNA 4I55F 4ZEOA 1OLXA 3W6OA 3OEHD 4JC8A 2XXAA 4M1YA 3PC4A 4J75A 3BDAA 4CGYA 1A8PA 3DPIA 4TYPA 2XGSA 2JFFA 3DKPA 3VFDA 2H57A 4MCIA 4MRPA 2OHVA 2ATCA 4E15A 3THWB 4N48A 2BUAA 1SXJD 2WU1A 2PXXA 2YVUA 4RXUA 2CC2A 1NJFA 4LC0A 2ZETA 3C6YA 5FO1A 1YACA 4KR6A 1NKVA 1U0RA 1PK7A 3I1IA 1S1MA 2R00A 2CYCA 5AW3A 3L7LA 2P4UA 4HMQA 4M36A 3K31A 2PXCA 1E3MA 1M34E 1PJBA 1XEAA 2GKSA 1Z0FA 1ONNA 2PX6A 1MQSA 3PYLA 4IVRA 5T41A 1CS4C 4GM0A 4O6VA 5A05A 1GAJA 4N7BA 4PICA 3U4GA 4C3UA 2HNKA 2J33A 3JATA 2QV0A 4JIMA 3UN1A 3AM1A 5C4GB 3ZOZA 3N39C 5KNDA 1CF9A 1SD1A 3C14C 4XCQA 2ISQA 4RTOA 2VBFA 2ZBUA 2Q1XA 1DI0A 4DA6A 2VCEA 5ALNA 3B78A 1AUQA 5I51A 3CN9A 1AQUA 3QKRA 3CUUA 4PQRA 1OD6A 5FJIA 1OLSA 3MWEB 5JRDS 3UMYA 3DBHB 1X3SA 1QVRA 2H1SA 5EIBD 4ZJPA 5DYNA 2JD2A 1IPEA 2O05A 4WWHA 3G0HA 3LPLA 3T4UA 2OLJA 4IJ6A 3LGSA 1F7UA 4GS5A 1DFHA 5SZKB 1W6RA 1ZH4A 3ESYA 3HPQA 3OTWA 1HFWA 1OJLA 1MR3F 5FV4A 2UVQA 3FYCA 4PE5B 4BX0A 2BJHA 2QGFA 1J20A 1MOZA 2HU8A 4QPCA 1Y7LA 5E6SB 4Y1EA 5A4DA 2VHTA 3U4QA 2YN2A 4MW9A 2WWTA 1DUSA 4ZIRA 4ZO9A 1MJHA 1XTRA 4U6QA 4FC6A 5J59A 4WX2B 4LVCA 2C9ZA 4LJ7A 4QDZA 3OQ6A 4OFXA 1JA1A 4Z4GA 1ISHA 4R51A 4CM6A 1QG4A 2HD4A 1A2QA 2JHFA 2IE0A 4QFBA 3VVBA 3DDCA 4LYFA 2OV6A 4R54A 1K4KA 1YZLA 1PNVA 2X7JA 4H7FA 1WBJB 4JOSA 5HF9A 3W9UA 3K96A 4YUVA 3R8FA 4X9XA 2WV7A 2Y2VA 4JHXA 3B2EA 3IP7A 3E7DA 4BJ6A 2R6HA 2WZCA 3JVIA 3KTDA 1ODTC 4X91A 1JR4A 2ZREA 3T0IA 5KYWA 2PLWA 2GCNA 3DMRA 2EFCB 4JOBA 4QYMA 3CF4G 3AINA 2XDAA 5AHKA 5FNVF 4LXGA 5DYWA 4RFLA 1FE8A 2UZ3A 1S3GA 2VDQB 2R87A 4LWOA 4KI7A 2ENUA 1TZKA 2X5OA 4LZJA 4KH0A 5IJXA 4JFAA 1GZHB 2FEKA 5BQ3A 1T2CA 1EGQA 2W6ZA 4FMPA 3QE9Y 2W5UA 1XD2A 5BNFA 3Q7TA 2K87A 1EK6A 3WGLA 3OPXA 4KN6A 1PHPA 2J31A 3KZOA 3SCZA 2OD7A 3AR7A 3UFBA 1EHYA 2XGOA 1DNPA 2DR3A 1V5EA 2EBFX 3BD8A 3QU4A 1G2QA 3X43A 4BKQA 4LJKA 4N7MA 5IH7A 2C94A 4JAVC 4CMHA 1XQ9A 3EXEB 3AF0A 1MZVA 1DAMA 3BWDD 3H5WA 4N40A 1PDVA 4MW5A 2ZIXA 4C88A 5L3SB 2YV3A 3CNBA 4RZXA 4AS3A 4EG5A 1J0DA 4GFDA 4E4YA 2B92A 4JC4A 2JIZA 3RSZA 2V97A 2R66A 2X8JA 3RROA 1H0HA 3EVFA 3PE3A 3OQJA 3RABA 1BG6A 1AMNA 3SBOA 1P1IA 1E3SA 3GH1A 2VJDA 4D97A 3IKTA 2ISSD 2ZWOA 4B3MB 1IPHA 1YZFA 3E9NA 4N5LA 1HDIA 1B43A 3CH5A 1N3IA 4Y2PA 4KBGA 1YBMA 4KE6A 3GCXA 3FMOB 3KKOA 5JE8A 3QUTA 1WEHA 1EP1B 3OX4A 2BKVA 3L7DA 5TR9A 2PZJA 1Z08A 2DY1A 3WRWA 1S3FA 3GJ6A 4KUGA 1JG6A 1QBGA 1W25A 1RYMA 4QU9A 5DN6A 3UTDA 1AKRA 2PGNA 5D7NA 2WE7A 3WYFA 2Y1CA 3AEUA 3TRKA 4KKVA 3PRHA 1NVUQ 1QHEA 2I54A 1IHXA 2YDYA 1XBTA 3HP7A 1EP3B 2YYAA 4MRNA 1L5ZA 1V5FA 4W5NA 2NUPB 2X42A 1IDN1 4NVRA 1YGPA 3A04A 2JB9A 2YW2A 2EJVA 3AL2A 3PXEA 4YT2A 3G5AA 4HWGA 3NBXX 2YHUA 3QBDA 2P91A 5EPOA 5AXBA 2QEQA 4JI1B 4BNFA 4E1VA 5KTNA 3K72B 2QRQA 4YBZA 3WGNA 2V58A 1RI2A 4ZREA 1VPWA 1M1UA 1GPYA 3AXSA 5TRTA 2R6GA 3VXKA 3KLBA 3FNFA 3MS2A 4K9QA 2FZWA 3TI9A 3NO4A 1NJSA 3V1LA 2IF2A 3WYAA 4U7PB 4ZA2A 2Q2QA 3T12A 3GZNA 5BSFA 4HRAA 3KEMA 2E7ZA 2DBVO 4NH4A 4Y2JA 3JQFC 4DJFC 3OD5A 4A36A 1L6RA 2FMKA 3DCYA 1RYEA 3VKHA 4EPVA 2WFMA 3KVRA 4FGWA 4MVJD 2XODA 5DHAA 4KLCA 3BQ9A 2BFDB 2HU7A 4FS3A 5KHLB 3DP9A 1FQJA 4NS4A 1JT2A 2VO1A 3L0DA 2RHWA 4QBKA 4WGFA 4CU5A 1TM1E 2CNLA 2G9ZA 2OHFA 4NBLA 4F3NA 4Z3KA 4X62B 2LDXA 1B74A 1NJGA 3L6UA 3V4PB 2WKWA 1Z38A 1KGSA 3KR2A 3MWFA 4YIKA 3DTVA 5FBWB 5HIJA 1ISGA 2X19A 1XZGA 2IYAA 3EA4A 2NU6A 4C2TA 3CA8A 4NAVA 2RI6A 5EE9A 4LC9A 5JNRA 4JEUA 4TTPA 1EFRA 2PMBA 5IKPA 4JDUA 2ZUFA 3U39A 1J1IA 1IN5A 1KPIA 5CXSA 5FTLA 1BX0A 4I4TF 3QVGA 5B1YA 1OGYA 2QZPA 1U11A 3N0VA 4YUXA 1CIVA 1JNXX 2AN3A 1X14A 3UAYA 4CTJA 3VHXB 3VOBA 2ARKA 3W2FA 4YRIA 2B0JA 3LRPA 4IWXA 1LY1A 2W22A 2Q50A 2WKQA 2XGGA 2RI0A 4JNKA 4RA9A 2NZ8A 3NCHA 3Q3HA 2HA5A 3ILSA 5D86A 3GFRA 2BM1A 1OVMA 4ZEWA 1P62B 2RAFA 2HDHA 3CTMA 2H8GA 5BMOA 1T43A 1VMDA 5BN4A 1QUFA 1QVZA 1ZRNA 2BISA 2O7QA 2XNJA 3B6ZA 4GWKA 3U26A 3UXYA 4QUHA 1I1HA 1JQBA 1RCTE 2GOYA 3N3AC 1VFPA 3O2QB 4GH5A 4MYRA 4YGXB 1T2NA 4IXNA 3BL5A 3VBEA 3ZW9A 2Q7OE 4BFWA 2PGAA 4J07A 3ICEA 2PFSA 1MVNA 3IEPA 2VF2A 3E4CA 1K9VF 4WA7A 1I80A 3JQAB 3IHTA 5TQ2A 4F96A 1C9MA 4H4DA 3HCBA 1CHNA 1JDBB 3KQYA 2ZIWB 1JKMA 4IIJB 2O7NA 3DH0A 4LXHA 4YJHA 1UBUS 4IH4A 5C7OO 2GAOA 1LBSA 4X3CA 3VH4A 1CE8A 1U28A 4L5YA 1Z2CA 3ZV5A 3BD6A 4NZYA 2JPDA 4LNUB 5H16A 1UKZA 3RFVA 2P11A 1RZUA 1ZCAA 4EX6A 1JAHA 3VC1A 2CZQA 4CTKA 1QFSA 3F6CA 4JC0A 1RRPA 1QJCA 3U0BA 2FP4A 3L84A 5T8KC 1MPXA 5FCDA 2KJQA 4FHEA 4MLPA 5I7RA 4LI0A 1ZN8A 3H1PA 3PG5A 5G4KB 2NU9B 3V46A 1L8QA 2ZB3A 2ETVA 1YQ9A 3NWJA 1MMFB 5I9TA 2UUAB 1Z4MA 2UVPA 3IMFA 5CM2Z 5C0OE 2H7CA 3SVTA 5JH7F 4OO3A 4D79A 3ET4A 2XLBA 1MBZA 4NU0A 1A9TA 2ZQZA 2XW6A 1U0TA 2GNPA 3QFRA 1NVDA 2EWWA 2O3TA 4F7DA 1XV5A 3OI7A 3L0YA 2B7CA 3LT0A 3FDZA 1IN6A 5A4JA 3H7AA 4RD0A 2V1UA 3TZLA 5T7BA 2QUJA 3GFTA 1USIA 3OIWA 3U5ZB 3I45A 4UQLA 1X1TA 3G17A 4KGXA 2RAPA 4ZICA 1QHYA 2IYVA 4PC6A 1KFKB 5CB4B 1NXQA 1KNXA 2ZR7A 2F00A 2YCBA 1UOPA 4RHXA 1NMQA 1W85A 3RQIA 1RU3A 1RQPA 5BVGA 2VTKA 4PM4A 4AP6A 5C1PA 2XEXA 5L7TA 3TLAA 3B3JA 2G9RA 1SK8A 2AN1A 2PX8A 2EIHA 2JIOA 4KZPA 5K8UA 4J76A 4A16A 1WXFA 5EXSA 1JI3A 2J0EA 5EHZA 5KB3A 4OJQA 1XELA 1NYQA 3ZH2A 3L0BA 1BCRB 1KBQA 3DPUA 1VECA 3M5CA 4UVDA 1HTWA 2D1RA 4R1UA 4AG6A 1BAPA 4Z0HO 3KVVA 3N2GA 3GRYA 2G17A 3Q0TA 4GHWA 1BX1A 1T3ZA 3RFXA 3IUBA 2HCTA 4JLJA 3GLIA 4JUAA 1E1LA 3DWGA 4B3SB 3FPJA 2DXIA 3IPYA 2AKAB 4HRVA 2VHZA 3SSMA 1C7EA 4BGVA 5KPDA 1JB1A 3R8XA 5L45A 1JG3A 2WJYA 2XNDD 4KWCA 1D9ZA 1ZGGA 2GWHA 4H0FA 4D4IA 1JAYA 2FPXA 3KTAB 5ED4A 5EIOA 5A9SB 4YJ3A 2QE7A 4FDAA 4IUYA 2LCFA 3NEPX 2HF2A 2OBFA 4L4SA 4AN4A 1VG0B 2MDTA 2UXBB 5FADA 3LBAA 3HO1A 1C0PA