4L07A

Crystal structure of the maleamate amidase ami from pseudomonas putida s16
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MSQKEVYDAAGFGNPVSRGVHPAIIVVDFSYGFTDLQYPTASDASLQMSRTKEICDLARALEFPVIFTTIAYHPGEIPMLPWLEKSSGMAALLYGSRLVEIDMATGIQPNDVVVVKKGASSFFGSTLSSLLAGTNTDTVVVTGATTSGCVRATVVDAVQSGFKVLVPADCCADRAKGPHEASLYDIQQKYGDVTDSDDILKWLRSVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, isochorismatase family
publication title Structural insights into the specific recognition of N-heterocycle biodenitrogenation-derived substrates by microbial amide hydrolases.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 75
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4l07A00
3O94A 3V8EA 1ILWA 1NBAA 1YACA 3O90A 3O93A 1J2RA 3IRVA 2A67A 2WT9A 3MCWA 3TG2A 3O91A 1NF9A 3OT4A 3R77A 1IM5A 4H17A 3HU5A 1NF8A 4WH0A 3EEFA 3TB4A 3UAOA 3R2JA 1YZVA 2B34A 3TXYA 1X9GA 4L08A 4WGFA 4L07A 3S2SA 3HB7A 2H0RA 3LQYA 1XN4A 2FQ1A 3KL2A 3OQPA 3O92A 2WTAA 3PL1A
chains in the Genus database with same CATH superfamily
2O8FA 1Y8AA 2GZRA 1VSBA 4AZ0A 1VG8A 5G3YA 5TX7A 2G4LA 3PFBA 4JITA 1T29A 5E7IA 5CIWA 3RVOA 1QC5B 3K5PA 3OFKA 2A58A 3M70A 4V38A 4KRFA 3JYOA 1A2QA 2LW7A 1H6CA 1P2UA 4I5DA 3EY4A 2QL5A 4BZQA 5C3MA 1L7VC 3AJ8A 4D0NA 1ZVKA 1KH2A 2I2FA 1N7GA 2C4KA 1QV6A 2HGZA 1JHZA 4OI1A 5JAMA 1E0DA 4LJ7A 4DIDA 1PGJA 4BVBA 1SBHA 3IB3A 4O5AA 3RDPA 5IXSA 1GGEA 4LNUB 2ENUA 3EUWA 1Y34E 4IVNA 2HUPA 2ZR0A 1KJZA 2Q1TA 3P19A 3PX7A 3ESDA 4B6RA 1U7DA 1NR1A 1SD5A 3TG8A 4YEDA 1KAGA 3R3UA 1P0IA 5CA1B 1W8IA 2VRWA 1CIPA 4ZMSA 1J1ZA 3R7WB 4ED9A 2BF7A 1DELA 1F17A 2Y2UA 5EEHA 1PFWA 3ZK9A 1ZL2A 2D2VA 3ZLTA 4UKDA 4JI2B 1E69A 1Z47A 3SOZA 3WL8A 1RTKA 3AG6A 5DDIP 4EZIA 4F38A 3EDQA 5EMLA 3KKEA 4CEHA 1HE4A 4K9NA 3L06A 1V6SA 5FULA 4YMIA 4Y9DA 2C3PA 4RSGA 4JI5B 3QVXA 4I4TB 3HKEA 3FDZA 1DJPA 1WW3A 2FXVA 2XCIA 5LQUA 2CV2A 3DB2A 5AUNB 3IJ5A 1N32B 4AUKA 4CETA 3NBKA 2JH9A 5FH9A 1DAIA 1EX1A 1ODSA 2EV9A 3P96A 1F12A 2XOXA 1V26A 2M98A 7AT1A 3NFYA 2VKQA 4LFAB 3RD5A 3NBYC 3SZ3A 2IP1A 3S2FA 3BMOB 4DQXA 5JH7B 1Q0ZA 3EZXA 5IHXA 3KJNA 4R8VA 1KHTA 2QAGB 5EP3A 3FKSA 4LGYA 1UBFA 3EOZA 5AKLA 1GFZA 1E0SA 3EF0A 3PE3A 5CB4F 1I7SB 2YMMA 1JYEA 4IHAA 1MUUA 3AIOA 2R3SA 3O4HA 1DRVA 2MINB 1V5WA 4UZSA 3L43A 3ZI4A 4U2DA 4PCAA 2ZBUA 1SHZA 1HL7A 3F0TA 5FR2A 4G1EB 4YXFA 5AVTA 3GQBB 3G1TA 4Z0PA 3PXCX 2DEUA 2AXQA 4G1UC 2X0JA 1PJ4A 2WF6A 3KSBC 3NB0A 3MW8A 1C14A 1ISSA 1J21A 2BFDA 3C1AA 3MPUA 4JUBA 2VDOB 5CR9A 5EMMA 2RAFA 4TXLA 3O3MB 4BWFB 4JYCA 1THMA 1I30A 4Q37A 4UMVA 1JEEA 1DRUA 1P1IA 4P3YA 4M7OA 2XB8A 3GLFA 1WTAA 2VJOA 4N76A 4JCCA 1RXWA 4HAVA 3A14A 3UQZA 1FLVA 2O2ZA 1MZVA 3N28A 4OSEA 4YJGA 4WT7A 2WM3A 1CP2A 1GSOA 4FXOA 3SKYA 3RC9A 3ZKAA 2ZWIA 2O57A 3KUCA 3QEKA 4D8TA 5KKCA 2F7SA 3AHIA 3Q9NA 1BAPA 5P8WA 1OH7A 4I9GA 1MTOA 2WJ6A 2CZGA 5K8TA 1E5VA 3DE0X 5DYIA 4AO8A 1EESA 4G89A 4XRGA 1GRCA 1R0RE 2VK8A 1NF9A 2Y1CA 1XCJA 4PS0A 2O3UA 3BRWA 2C2BA 5J1SB 4B6SA 3A1FA 3GJSA 1JHQA 4D0RA 1XPJA 3DHWC 3VDNB 1CUXA 3LCJA 5GZ1A 2OV6A 3GEIA 4N6NA 1U5CA 3MUNA 1RWPA 3GUYA 3L7OA 4Q00A 4DLAA 5C32A 1NU8A 5LOVB 3KKZA 2HPZA 3IJRA 2HV9A 4O4IA 4Q93A 4LJ4A 1RXVA 3AGQA 4LC9A 4M0EA 4BGVA 2GK4A 3STTA 3AVPA 1WIWA 1VRCA 1FRNA 4KKVA 1G1AA 3ANLA 4K6FA 4LY0A 2XTNA 4MMYB 1ESZA 1PGPA 4Y98A 3THSA 1HH4A 1PYDA 3C74A 3TFWA 5DLEA 3AY0A 2O0JA 4HRYA 3UJNA 4Q15A 5TEVA 1Y1LA 3GZJA 4U2BA 4F1WA 1GSHA 1Z5GA 3IAEA 4D57A 1R8YA 3R24A 2AUTA 3V1YA 4CKEA 2I6GA 4DWWA 1Z0JA 4ICIA 3NV7A 4YFYA 3PXBA 2OXIA 4YVFA 2QRUA 5A7HA 1OZHA 1SWWA 2A78A 3K09C 4B3SB 2C5SA 3E9MA 3KAPA 1B0ZA 3WHPA 3E9CA 2O2DA 1NYLA 2C07A 1BHQ1 1UBLS 3ON5A 1PFYA 1W76A 2DPMA 2VKTA 5CH3A 4Q7QA 5BYAA 1P4JA 2E9SA 4I8XA 3EYWA 4XPIA 2GARA 3LUAA 3SWWA 2PJRA 2H3EA 3PL1A 4YDHB 2C04A 1US8A 1E6LA 4RDHA 1C50A 2AR7A 3OPYI 4DXHA 5BSHA 4BXOB 1G4AE 3IHTA 4FI3F 1ZEJA 3BIOA 3GFQA 1GITA 3TLJA 4EATA 4KO4S 4ZHQF 3G2QA 1XRQA 4HNTA 3FIJA 2W4QA 2IYUA 1P9RA 2JGLA 3IP9A 3ETCA 2A9KA 2PIAA 2ZTLA 3GZ4A 3KZXA 4LHEA 4LSGA 1FUKA 1WPXA 2CL6X 1X42A 3KX2A 4RENA 3SSNA 3R0JA 4GPBA 4UTNA 4BECA 2R7MA 3ZDAA 5TF0A 4L08A 1QHHB 4NBWA 1T9GR 1UOOA 1V8DA 1EFLA 1YMUA 2D0OB 3PHJA 4H60A 4RVOA 4UBNA 4WWHA 4C4XA 1AHPA 4DV3B 3E7PA 3NPAA 2DAPA 3LY8A 1TB4A 2YY6A 4QA9A 4ENRA 4WAUA 1YA6A 1JDPA 2IIPA 5CCDA 1JXQA 3NLLA 3QLTA 4OOFA 2EKDA 3FRHA 3E4CA 3RU9A 1P9OA 1G6Q1 4C7JA 1VHQA 3DYBA 4A7PA 1UPCA 1PJCA 1Z3CA 4M1TA 3OOJA 2VAVA 2ZSAA 2P4UA 3UHAA 1JFVA 4IIEA 1P8AA 3N8KA 3OCXA 5EJFA 3EXIB 3ELUA 4COKA 2HNAA 1QH8B 4JOBA 1RABA 1U0TA 1AK2A 1AXRA 1HLPA 1ITZA 1QGDA 1CDZA 2X9QA 1Q15A 3F1LA 4NZNA 1CIJA 4DC0A 4NL4H 2JG3A 5HKKA 1XDSA 3OJLA 5B36A 1W7AA 5A03A 2Y1OA 5KYWA 2DBVO 1Q11A 3T3PB 2WZCA 1YK1A 5A1JA 3ZNQA 2QJFA 3I32A 2ZBDA 3N2GA 2FN3A 4QM7A 2ZW9A 3K5IA 5HKAA 1GQ2A 4FR2A 5HGJA 1BCRA 2CYAA 3F5MA 4Y2VA 3B3JA 1Z8DA 3U3DA 4LYHA 3UGKA 2I33A 3Q0IA 4JGIA 4DSTA 1K7CA 1BWPA 1JPVA 2BMAA 3FTCA 3F6BX 3L7BA 4OL0A 4XIYA 1IY2A 2ZJFA 4NMLA 4GO1A 5DK4A 1MQSA 4Y2HA 1W0KD 2NZUG 4US1R 4OXKA 5EWLA 3GRRA 5C80A 1KY2A 4IQFA 1L4GA 4EPVA 1WZIA 4ZJUA 3QHQA 3WK9A 4NXNB 1IJBA 1Q7TA 3DAYA 3ESQA 1TVEA 3E8SA 3LKVA 4H7FA 3WX0A 1M2HA 5FNZA 5DOZA 2RARA 1NLZA 2QTCA 5ICCA 3HH8A 3KYCA 1L8XA 4TQUS 2HK7A 1EJ0A 3ND5A 3CF4A 2HXGA 1JGTA 3VR6H 1QOZA 2OESA 1CQXA 2ORYA 1FOEB 5GIPE 1SBTA 4JCOA 5HE8A 4LMBA 5AI0A 1GGKA 1NNUA 3N07A 2QDXA 3PFFA 4XH9B 4N6GA 5JDCC 1EWQA 2G8NA 4XFJA 5D6OA 1BW9B 2R4TA 3ELDA 3UO8B 1P1JA 2WHYA 1C0EA 1JMVA 2NX2A 1NX6A 3WSTA 1NZJA 1Y7LA 1IONA 4AMUA 1IJEA 1I1OA 3OWXA 4B6EA 4ITVA 1O4VA 6YASA 5DX0A 4V0KA 1MD9A 3M1YA 4TS9A 3TE6A 3ZCVA 5K0SA 3OE5A 1NYTA 3SF0A 1O89A 2R1UA 1P72A 1UZAA 2FKAA 3KUDA 2O5RA 4X8OA 1ZD9A 1SXJB 2R96A 2VNJA 3KPYA 1I3KA 1UPUA 1BMDA 4FGZA 5TQ2A 1B2RA 4YQEA 4ZANA 4TKUA 1T9KA 1WCIA 2TMGA 3HLYA 3OQ6A 5TJHA 3WTBA 1EFAA 1K63A 1GL9B 1SD1A 3I23A 3IQHX 2B61A 3PFKA 4HVAA 4ISCA 4I1IA 4JP3A 3TTVA 3IUNA 4CV3A 5JSHA 1T6XA 5TGTA 3ZTWA 1KSHA 1DBSA 4DRZA 1TTTA 1OI3A 5DNWA 3LNCA 2JNWA 4ZQGA 1JQKA 1DO8A 3VMMA 4J0GA 4ZI7F 5KVQA 3SQLA 4NEGA 4BIIA 4Q3EA 3W8FA 1XEXA 1EFUA 1ISIA 2HA5A 2HREA 4GWLA 4WVLA 2BM1A 3HVUA 3K16A 4KQGA 4U1RA 4DLUA 3ZKWB 3EIEA 4B17A 4BPRA 3A37A 4BB6A 5JZMA 4RXMA 4TMXA 1G20A 3KK0A 2VNIA 4PGGA 1EFDN 2EGHA 1G64A 3C5HA 4MP3A 2V0NA 2GERA 3FSRA 9MHTA 1BD4A 5DBIA 5CH5A 5B1EA 5WRFA 4EWLA 1T2VA 1SZCA 1AF7A 5JHGB 2ZUDA 2DFLA 2PLNA 3LBAA 1JEQB 1OBFO 1Q3TA 5IAGA 3T0GA 1ARZA 2VZLA 3OPVA 2EU8A 4JL6A 1PSZA 3K3PA 2F3SA 4GOXA 4G0VA 3IPYA 1G3MA 1RIIA 2Q1SA 2J7KA 3KB8A 2JB9A 2Y0PA 4L16A 1HG1A 2Z4SA 3M3HA 1QZTA 4JUCA 3E9QA 4YUXA 2IITA 1QYRA 4NOJA 4ETNA 4AO6A 2V6GA 4FQ5A 2O2GA 4QL3A 2YJGA 3JQBC 5IMBA 3U62A 4A1FA 1VYHA 3N2IA 4AN1A 4YI5A 1CEXA 2Y1KA 2W8BA 2FZ4A 1RJWA 1N6PA 3REGA 1H0RA 1HQKA 1EGMB 2VYND 4C87A 3GFTA 3OTQA 2E1RA 5GV7A 4MGHA 1FNDA 4RKQA 4CF3A 3C43A 1UKCA 3VXKA 2DKFA 4PINA 2J33A 4V39A 4UREA 4XD7D 3O4GA 1UBRS 3RUDA 1O96A 2HCJB 4FCVA 1U8CB 4M0CA 5BSRA 4MV8A 1QIDA 2Y93A 3PNMA 4I6JA 4QPDA 4Z4IA 5CFPA 5CEJA 3SDZA 4DY4A 3N1UA 2YR0A 2ZYAA 4J2TA 1PFUA 4H6VA 1D1TA 1FU8A 1COWA 2E4XA 1XX6A 4ZGGA 1I3CA 5SYAA 2M6KA 2Q5CA 1ISRA 3K09A 5FWDA 2CN1A 2ZVQX 4IV8A 5MFPA 1PEDA 2PUCA 1YWGO 3ZWNA 2JBHA 3RIEA 3ZGZA 2IYOA 3AOEC 1BH6A 4UTRA 4HUQB 2RGCA 3EGDB 5FPHA 1NTOA 2FJ0A 3H2IA 3HBLA 3K0FB 1AF4A 1SELA 1SKQA 2PV0A 3GR6A 3IAS1 3NVDA 4HQ6A 4E14A 2O8CA 1LQ2A 5JVDF 4IHJB 5FD8A 3O3NB 5JANA 5D7NA 2I6UA 3A1NA 3EXFA 3UJDA 1K6MA 4UM8B 3KFXA 1C1YA 1H2AS 1K4YA 2D4AA 3AI3A 3H6GA 4NWIA 3IV7A 5F35A 3T0FA 4EMSA 1O0BA 4AZ0B 1C8KA 2J08A 4QD3A 3LDGA 4OYRA 2PL9A 2CK3A 3ICEA 2BMFA 2YOGA 4QUEA 4RZHA 5EE0A 3D4NA 4GI1A 3T15A 2V7EA 4FDTA 1AO0A 5BWMA 5BSFA 2HV8A 3E1GA 4W7SA 3QMWA 1YOBA 3UEOA 4EUEA 4DABA 1M1UA 1WHTB 3I6QA 1ODLA 4V1CB 4TWRA 1SZPA 3A9CA 4A8HA 1GU1A 1G2PA 3ED5A 4AS1A 3O5AA 4UFPA 3T4EA 3HXQA 5AJHA 4G5YA 3GVIA 4A10A 2JEYA 2YXDA 4NKRA 1TT5B 1U2QA 5KNBD 4Z4GA 2EKPA 2PD4A 1H2XA 2XGOA 2BUCA 4LTMA 1V0JA 1V5EA 4PLFA 3MT9A 2ECKA 3KVOA 3I0ZA 5SY4A 1NUTA 2QN1A 3I6YA 2KWIA 2FEKA 5DWVA 5D3QA 3U0VA 4ZXPA 1W8DA 3BK1A 5ED0A 2R6ZA 3EJ6A 1U3FA 3FR7A 4MA5A 1H2WA 1G98A 2DLDA 2Q3DA 4X5OA 4E46A 3DE7X 3U7RA 3D2AA 2WYIA 5LQKA 2ESRA 2A86A 2X22A 1X7WA 4M9RA 2O3QA 4C7VA 3KQOA 3PKJA 2CVZA 2QUIA 4NNOA 2I22A 1JLMA 3EEYA 4WQMA 5JI2E 3O4JA 1RDFA 2Z2ZA 3ICOA 2XSZD 3LY5A 3OT4A 3S0JA 2AN4A 3G8YA 3HKEB 2M1XA 4KBFA 1WDTA 1KI3A 2FCRA 4JA0A 4OXIA 4X60A 5PGMA 4ER7A 2G9UA 2WPDA 3FYUB 3HUTA 4BCCA 4RIIA 5JU6A 1C1XA 1QG4A 1G3QA 2XWSA 3GPIA 4I55F 3QGMA 4S1WA 3ZEIA 4YHHB 3T9DA 3H8VA 4QOIA 3X2SA 3TH5A 5ES4B 4EB8A 5KQPA 4KREA 1UH5A 3AM4A 3CV3A 3PJEA 3FCSB 4IDNA 1I3MA 5DNYB 4L5BA 2HRZA 4M83A 5FLXA 4IJ6A 1FQKA 3PGJA 4IMJB 2H1HA 3ZWMA 4GM1A 4G0MA 4R83A 2PX5A 3STVA 2A0XA 3QE3A 4ZQEA 4V0MA 3RTDA 4EKGA 1GNVA 2C83A 2PANA 5FP0A 2NACA 3TQQA 3P9SA 1NG9A 1EAMA 1PV1A 2VYFA 4C5BA 1KFEB 1T9BA 4MWSA 2ZI5A 2E21A 1U0SY 3TXXA 3RYCA 1VLMA 4F91B 2GUGA 1JHMA 3ZJ5A 2DE0X 3A2KA 3V3TA 9LDBA 3C8ZA 1G8PA 1MV8A 2L42A 4L72A 3VH4A 4FX2A 3VPCA 3K96A 4JYPA 4ZVOA 4TT8A 1UJ4A 2C94A 2D2XA 2NZ8A 1JR3A 3I92A 2BFDB 1LU9A 2QZ9A 4V02A 5JDCA 1UKVY 1H3FA 5MGNA 1MOZA 1BDIA 3C48A 4IEFB 3VV2A 4BE7B 1W36C 4OLFA 1PWYE 3N8DA 3GLFB 2NU8B 2ZXEA 4GYKA 5HJ2A 1VLHA 3IOBA 3LX4A 4PQFA 1ESNA 4D0SA 5CYFA 2OQIA 4H7IA 5E1OA 3O8DA 5EI5A 1NQTA 2X9VA 1E0AA 1Q0LA 4EFKA 4EQ6A 1QIMA 2OLJA 2QD1A 2VJMA 2WV9A 2C98A 3F5FA 1YU6A 5CBPB 2BMEA 1ZG3A 5FBZA 2W2KA 1MRSA 2ZRNA 3UK6A 221PA 2GCOA 1NVAA 2ZBEA 1KSFX 4G56A 4AJ2A 4PZYA 2JJ2D 3RG8A 2YJ5A 5JXGA 3Q7SA 3E3AA 3D8BA 3WSWA 3ZHYA 5IAJA 3H1AA 3HSYA 4O3FA 4L0CA 1FCJA 4U7DA 4CCYB 3IBGA 3SFVA 1N3BA 2BGMA 1SBZA 3TSCA 1MQ9A 1CQZA 1BQ3A 5HSGA 2IS4A 1DFGA 4PBSA 3ESYA 4IWXA 5BOVA 4BVFA 4EA6A 3KOMA 2VPIA 4ZDKA 1L5NA 2VF5X 1UPXA 4LXUA 4FE7A 4NYMR 2A9FA 6REQB 3LECA 3W3AA 3OCJA 3A2NA 3OTHA 4G09A 2GAFA 3BK7A 1R9MA 1ZUD1 2DC1A 4O4IB 1E2BA 4XDHA 3VR5D 1T3SA 1SO8A 5DJ5A 3R1IA 1U63A 2DM6A 3C3KA 5ECGC 1EFPA 4UUPA 4D6YA 2A7QA 4HWGA 1Y5RA 1HQDA 1U80A 1DAEA 1M5UA 5DGIA 1ZA1A 2RHDA 4RTQA 4HXEB 2VJLA 4K6HA 3E2PA 2ZI4A 1UZLA 3CT6A 3KTDA 2G6TA 1Z07A 1NXVA 1Z18A 4B7UA 2WYHA 3R5KA 3LGAA 3SHVA 5K99A 3CR8A 3ZE0B 1OQAA 1ULUA 1ZOSA 4UTZA 3N70A 4MB0A 5HOQA 4CKEB 3KTFA 2JI7A 1EZ1A 4RKRA 2I1LA 3E27A 4E4RA 1UKAA 5B57C 1JDVA 1GUFA 1SC1A 2D1QA 2NV6A 2NVUA 4BNLA 2C8VA 3K94A 3EQ6A 1RLOA 4EVSA 1H4TA 3VTKA 3EQ8A 4OHMA 2AFIB 3DMPA 4U4AA 1JNXX 2ZT7A 3MSCA 2BKEA 1BXGA 2PUWA 3C8UA 3P2YA 4HJRA 2IHVA 4UE2A 5CGQB 1TE2A 1BTOA 1US8B 4REOA 3W0LB 1VL8A 3FCXA 2O23A 4UTVA 4DDWA 1PUIA 2I54A 5F33A 4N82A 2C5GA 3MGKA 4PO8A 2JLCA 3NHYA 4UM9B 1S2GA 2ORIA 1GTJ1 2P9CA 4B5LA 1PKEA 4QDTA 3CRVA 3LQ1A 4Y2XA 2HRQA 3BOSA 1IPFA 2I2AA 1MT0A 1JG6A 3D4PA 1KMHB 1FIUA 4RJIA 1V8ZA 3IKMB 4MPRA 1KY3A 5COAA 4ZWNA 2PMCA 1JU4A 1NXWA 1XWIA 1R16A 3QVTA 4KAFA 4JVOA 1PZHA 4M86A 4UDNA 5EXEA 2BRUC 4XQ9A 2F3TA 3AOEA 2J3JA 4NYJR 4RNDB 2F9FA 4TQAA 3MK31 3NHMA 5ICSA 2F43A 1NC3A 1VP3A 3O38A 1RRGA 4C20A 3PTZA 5LU9A 1ZVQA 1KRXA 1CS0B 1OD6A 1DJLA 1TQHA 4TL9A 2GLXA 4LRYA 2C1EA 5B6PA 4A1OA 2IIBA 5GV8A 2R8YA 5J4YA 3P9NA 3VVMA 1KXZA 1Z0UA 4MK4A 2XJ4A 2ZU6A 4EITA 1WR8A 1T9ZA 3V55A 2RD2A 3NBXX 1IN1A 2VDJA 2QROA 1QYDA 2Q1XA 4G5FA 3G7UA 1AA9A 1OBHA 1XBTA 5MGBA 1W5TA 3E8MA 3K6RA 2FEMA 3N2GB 4P7KA 3DL4A 1E2EA 4FT2A 2J87A 5IVIA 3KPUA 1AKEA 3IL2A 4IVQA 1NT2A 4QXOA 2FWRA 1BCRB 2IH5A 2C4NA 3LG2A 3NP9A 5D5HA 3IAHA 1PYOA 3KUUA 4LWOA 1Z29A 4E5NA 1Y1KE 1QP8A 3KD3A 1BU8A 2HPHA 3FPFA 1TF2A 3H9JA 5F2KA 4DOMA 4BLRA 1DC3A 1TC1A 1YB4A 5TNXA 4EG0A 1CD5A 4Y9TA 1I7NA 3ZDCA 1GRNA 3GXBA 1P1HA 3MCUA 1YDGA 4QUKA 5EWLB 1G21B 4HAZA 4X6YA 3LK7A 3Q1KA 3USZA 4C0KA 4R01A 4F4HA 5B2ZA 3WE7A 4M1WA 3FLAA 4FS8A 7GPBA 5FWAA 4XTRA 4ZQBA 1ECBA 5JXHA 4B2LA 1UBKS 4X8LA 3N8NA 3DNPA 2CV1A 1OBOA 3UAVA 1FA9A 4LHWA 5EZ5A 2ZSDA 2WVHA 3PV0A 2W37A 3KYCB 4G0OA 2GI4A 2HDNB 4LWZA 4N9WA 5TXGA 4Q4JB 2C03A 3TBKA 5JD6A 1HDIA 3H84A 3ZV7A 3D7KA 1PQPA 3X2EA 1DAOA 2B5OA 2JF0A 1S8NA 5BXQC 2VSOA 1GA4A 1EU1A 2JGRA 4XWOA 5KX5A 3OE7D 1RADA 1RLMA 1G4HA 1TPYA 1YKGA 3BERA 5GM1A 4BUJA 1EK0A 3URMA 4L27A 5KIAA 1TXGA 2JBAA 2UYGA 1CWUA 3EG9A 3JWIA 2FWBA 1TLTA 4MUNA 2AOUB 5EP2A 2KM1A 1SQSA 3G0DA 4QUJA 1X7ZB 4NHOA 4CTJA 1YRAA 2AKEA 5IF3A 1AIPA 2DWCA 1R8JA 4KQIA 3PVSA 1AUVA 1NHGA 5EHGA 4MMXB 4R81A 3Q98A 2WG2A 2IH2A 2DQKA 2RKOA 4X7MA 3ZZUA 2FWNA 3DG9A 3L8EA 3A7EA 2IXBA 3KOWA 1DJQA 2VCYA 4DWJA 5BWOA 1E58A 1IHXA 5FTJA 2Q9UA 3D2BA 4XDYA 4BBZA 4MI1A 3CLSD 5TQ2B 3C5EA 1GA6A 2G0TA 5T3YA 3SVZA 4EHDA 3AXSA 3A9TA 1HPLA 4FHEA 2IY9A 2VP6A 1QK5A 1J7JA 1K7FB 2GFIA 2IKSA 1YVRA 4GLBA 4MRPA 4FEAA 1KU0A 5EAIA 2PUAA 4GVXA 1GU0A 4DMFA 1TO2E 3KR9A 4AB1A 3L7MA 4PZEA 1E6WA 3WLLA 3WJAA 5AVWA 4OKSA 2LCFA 1YB6A 1MRZA 1PZFA 3U7EB 1A5SB 2Q0HA 1PGOA 1YRWA 1Z2EA 2R86A 4BQOA 1JUDA 3FPHA 3G7NA 1AKRA 4IY1A 4J2HA 4JVSB 3MWEA 5F7ZA 4DG5A 2F3QA 2QMUA 4ZMRA 1XK6A 1DJNA 3FGZA 3OWHA 4HGOA 5KHAA 3FCYA 4A8TA 4DMHA 1G20B 3WBKA 4YYEA 1T4GA 1VMAA 3L04A 2G06A 2Z8XA 3TLZA 3UJ3X 4E7PA 1CRPA 3K2EA 1XVLA 4PPGA 1J0DA 4JKIA 1SC9A 4J7CA 5SZJA 2GZAA 4MW9A 1G8KA 2BFMA 2ZQYA 1YS4A 3EC2A 2L17A 1E2LA 4LW8A 5FBWB 1KH3A 4QGSA 1BMFA 3U26A 2DWPA 3OTWA 3ORYA 5CVUA 2ZUEA 4Y7DA 4JBIA 5HS6A 4UUMA 5EMHA 4MKXA 3RS8A 4M9UA 4DDUA 5KOYA 4PLCA 3AL2A 3RRJA 5JECA 4KLZA 2I1VB 2RGWA 2R84A 3IUQA 1G6HA 2ORVA 4WXPA 1UFKA 1F3OA 3DJFA 3QMMA 3EWSA 5ERYA 1E2UA 3FOCA 1SXHA 1G59A 2Y92A 5FFNA 3WLAA 3QPDA 4R31A 1CUYA 3QFFA 5IHPA 5JPDA 3CLHA 1HQCA 5IC6A 1GKIA 4NOLA 2JKVA 1PKXA 2PJDA 4HPJB 3R7AA 3UK2A 4LI3X 1Y4DE 1NQVA 4GPZA 3LP8A 3K73O 3DEZA 5EUBA 5AOAA 4DF3A 2QSZA 5IH7A 1ZIDA 3EXEA 4ZVMA 2ZITA 2APJA 3JSXA 6ADHA 4X7BA 3UWKA 1UMDB 1FRZA 3F5QA 5FTNA 2C8LA 1T8WA 1N6KA 3FI0A 3AUFA 3R6GA 4DA6A 1PJTA 5AXBA 3AKZA 3HN2A 5D51S 5AKHA 1OB5A 4DR4B 1B3RA 2IS1A 1ZD8A 1NMQA 2TSYB 3DWIA 1KNXA 1E7YA 1HNNA 1S4QA 3RQIA 3WL4A 3WNVA 4G81A 3L7JA 4PYRA 3AKDA 5JFOA 2OAQ1 3DUFA 1GCOA 3X1YA 3NTXA 3I4FA 4OKNA 1B74A 1KKUA 2O8CB 4B09A 1HDEA 2AJTA 3RS5A 1Y5IA 3EXFB 1EFVA 3EHEA 4WFJA 1C0KA 3ELWA 4M8SA 4D79A 4ENPA 3G1UA 1HEYA 2JFQA 1NNLA 1MX5A 4NBNA 2VCEA 5J4HA 2CNBA 4A0FA 4XWAA 5ISMA 1E1YA 5K20A 2AF4C 3IKJA 4TXJA 1XRJA 4FK8A 3NU1A 3RASA 7MDHA 1U4SA 2H4XA 1OXMA 3TI9A 1P7PA 3BXHA 4FUQA 4JFAA 2VYQA 4LXHA 4TMYA 1BXRA 5TVKA 1F0NA 1UZUA 2WD7B 4DNPA 5KSZA 2BGIA 2R6DA 2GLUA 1JB9A 4MUEA 1X1DA 3NUZA 1XRSB 4NX2A 3VKVA 3ROEA 4LA4A 3SU8A 2BRUA 3B8EA 4PXAA 5TDHA 5B2FA 3MJDA 5MN4A 4BP3A 5GJCA 2QVZX 1XTIA 5IJ0B 1UCFA 5M04A 1D3AA 2WWTA 5DHAA 3M5WA 3HI6A 1NULA 4MYUA 4RS3A 5KYYA 2O3JA 1WA5A 3GWZA 1OOEA 2D2FA 4II2A 4YALA 1AKNA 1B16A 2ZATA 3HFSA 3LPCA 4CTKA 5EKSA 3SVTA 2XQVA 2I34A 2P6MA 1I2DA 1X7WB 1NI4B 3IV6A 4R68A 2DSNA 3P9XA 3G02A 4S24A 1T0PA 1GZ5A 4LCBA 2PV7A 3NAMA 4Y6PA 3T5BA 2OM6A 2XEDA 4B6FA 2YVAA 5JNVA 2YCLA 2CLMB 3A9SA 3FMVA 5BT9A 4HVLA 1RJ9B 3LIIA 1K6JA 4GBJA 3TIVA 3W5JA 3BZUA 3BULA 3NJRA 4DLNA 4I46A 4J07A 1YCDA 4MX8A 3ETLA 1XEWY 3M89A 4LHXA 1ZZEA 1ZIOA 3ZWPA 3B7GA 3TEMA 1Q19A 2CB0A 2CMHA 1KO5A 2XMQA 1PLLA 3RC1A 1GZDA 3CZMA 3QV2A 1KQ3A 1SUAA 4UVIA 3JZFA 3WA7A 1FDOA 2W6IA 5IAKA 2O5CA 1TU0A 2FW8A 2Q5HA 4M1QA 1TCUA 3ITDA 5FCDA 1QIKA 5CG2A 4DV5B 3CZ4A 1XPUA 4F3CA 2B99A 4X20A 1Q77A 3I9OA 1UKYA 2QL7A 4EP1A 2IU4A 3GHYA 4MUXA 1O6CA 2WU3A 1DG1G 1EZZA 1PAUA 2P2LA 2XWJI 3KU4A 3ZYZA 1XZIA 1NNI1 3MTAA 1WZUA 3HYNA 1GRQA 1MOQA 3KYBA 4XIGS 3SHQA 1C41A 1B0UA 4D97A 3S8YA 2L18A 1PHRA 3OT5A 5EQTA 3VH3A 4AJ4A 2IPLA 1H2RS 2NVWA 1G5HA 4BQSA 3MAGA 2QTBA 2D62A 1DRWA 2GKSA 4OJTA 5ICMA 5JWHA 4KO2S 1ZEMA 4NBSA 2BPOA 4C4YA 5LWQA 2RGRA 4Q4DA 4UMEA 3ZJUA 4YUVA 2J6BA 2X5XA 1E5XA 3SQMA 2BDTA 1Q1GA 1B0AA 2WMDA 2Z6QA 4N12A 4CQJA 4N6OA 4GKKB 3KVRA 3UAYA 3LE8A 1A7AA 4L95C 4IJVA 1H2YA 1HNWB 3H5AA 4Q16A 3LNTA 5C8ZA 3TAHA 1P9WA 3DOJA 3UKDA 3ZPXA 1XI2A 3SSMA 4E5MA 4RD1A 3GJRA 2OENG 3KOZA 2XNDD 2AHOA 2VJMB 1OU0A 1TMGE 3CINA 4LE1A 2JIRA 2E4WA 3UOAB 3ZGOA 4CM7A 2C2HA 3QFSA 2W2KB 4I9HA 4B73A 2EWVA 3OP1A 4V3BA 2X2PA 2X0NA 3QY9A 1NQOA 2VSFA 1MGOA 1Z0SA 1CR0A 1HZJA 2G76A 4LBWA 4RPLA 1Q0RA 3QPWA 4TXMA 1UXIA 4H17A 1YCGA 2LTAA 1IB6A 5ESWA 4BGDA 1N6HA 1OH6A 1O57A 1USKA 2CY0A 4BQPA 8AT1A 2W6JD 3LOQA 4IX1A 5DO9A 4HG2A 2WTMA 4TKZA 3OC6A 4G4SO 3FOBA 1U8XX 2Q5FA 1E6KA 4LBYA 4PX9A 2XWBF 3H18A 3ZK7A 1PDWA 4JUIA 2WF7A 2FCAA 4FYVA 4G0NA 3EZGA 1HDOA 3RSOA 3BZWA 4X9XA 3CO5A 4YB8A 4ZVPA 4BZZA 3MJTA 2W4IA 1Y3FE 1HTTA 3F7TA 3JAWB 3JASB 4OQFA 2P68A 1LPOA 1KVSA 2EZTA 1KJIA 1V1MA 1PO7A 2OLKA 2VH5R 2YOFA 4OQXA 1N5OX 1XZCA 5T4HA 1XZDA 4EX6A 4FILA 4BKUA 4G0ZA 3RF6A 3AM3A 3GIWA 1J2JA 2VTBA 3OTGA 1KEKA 2XZPA 4KIWA 5DYGA 7YASA 4DCPA 1IIRA 2H1CA 2YS6A 3CUUA 4BLUA 4AQ7A 5M2QA 2XEXA 2CV0A 1B8OA 5KEIA 4JB2A 1AKQA 1O97D 2NVUB 2JAWA 3DCIA 3OLXA 1DQYA 2CUKA 1DMSA 1U9IC 3T8YA 3HGTA 1HDZA 3HBNA 3LT0A 2FX2A 4TYPA 5E0KB 2CE7A 3UB4A 1BXGB 1NVMB 4DCVA 3K1TA 4F2DA 1CERA 4ZJZA 2XY4A 1JQLB 1SOVA 4FOTA 4HLNA 4A0QA 5HJ5A 3OICA 2HEGA 4C07A 1B43A 4O0MA 4F1JA 2A33A 3D64A 3T7SA 3GP3A 1TGVA 1V6AA 2P1DA 2YQZA 2A9QA 2E85A 4D5GA 1Y6ZA 2O0KA 2WVJA 3LUHA 3EGCA 4XYBA 3B1KA 3AMVA 4FMCF 4UNIA 2O2YA 4A82A 2R6GA 1P60A 2VHZA 4OI4A 5D00A 3H2JA 5DCUA 1SUDA 3WNDA 1WUJS 1L5FA 5C5DA 2NZYA 1JKJA 2ZP1A 1FMFA 1QO0A 2JD0A 3V1TC 4N3AA 2SKEA 1F8YA 3HPQA 2RBKA 1Z2PX 1CR2A 2A1TS 2O9JA 3KO8A 3GIDA 4HEA6 1RPZA 3E7FA 3V8MA 4DCUA 1MO3A 3M6WA 4YLEA 5EJ8A 3JALB 1L5ZA 1NZDA 2GZ2A 3INGA 3NVMB 5LNK1 2G80A 2EFHB 2W83A 2WF8A 4N5MA 1J2RA 3L7AA 1KE2A 1LB1B 1Y8CA 4BTEA 1YCFA 4CF7A 1IEVA 1XCLA 2F43B 4PAOA 4A4DA 4RZ2A 3L8YA 4C89A 4Y0VA 3WKEA 4EMUA 3RK4A 3TQSA 2PX3A 1SC3A 1J06A 3L8HA 4JXJA 5KTSA 1U0JA 4BP9A 1QFMA 2IHYA 1GYRA 1A4IA 2ISQA 1TPZA 1VHJA 3FDFA 3OIUA 3OMWA 1JHUA 1KS9A 1PFGA 3VKWA 5JSUA 1O6ZA 2F8SA 3QPVA 2YWJA 3PC8C 3U2QA 2KSQA 2IXGA 3B3GA 1KOJA 2EX0A 4Q48A 3IUYA 3ZR4B 1M2FA 1NOJA 2CJWB 3IMFA 1VDZA 3B13B 3BXXA 3FAKA 5LA6B 3ZI7A 3TUJC 3S1SA 4C4AA 1A7KA 2LE0A 2HNBA 3PT9A 4ZVKA 1YTUA 3SLGA 3SG0A 4LSZA 2DFDA 1D6NA 3U61B 3OJFA 1KI1A 4DB2A 2ZSIA 2VUHB 1ENZA 3LO8A 3KAKA 4KVFA 2WD9A 1ZYUA 4PPQA 3TDKA 4FM9A 5AHKA 1JKIA 3U3KA 3OF5A 2P9GA 2QD2A 3G2MA 2NZVG 1U2EA 5TJ9A 3S2UA 1VIVA 2J5KA 5IDXA 4J75A 3ID6C 4ZOEA 1C9KA 4G0YA 3UC9A 3WDMA 2Y0EA 1AQYA 5IM4F 3FXAA 3FWKA 2C88A 2ORWA 4WCFB 4EJ2A 5J2UA 1ZIPA 5BV8A 3RPEA 2EBUA 2VRBA 3UHPA 2AA3A 4R2IA 2RK6A 1NUQA 5EXDA 4QXPA 2C29D 1WUIS 4IDHA 4AYWA 5ANRB 3RBAA 4Y9UA 1QONA 5T64A 2NQTA 3IQFA 5IN5A 1YJ5A 3ROZA 1IIBA 4ZRMA 2P9FA 3V32A 3W9BA 2JFBA 4RX1A 5KREA 5A3QA 4ZU6X 3SIWA 3TL3A 5HFJA 2O5EA 3EIWA 4ESHA 3D81A 3ICCA 4WHMA 3BHNA 4BNKA 5KX5B 4XIIA 1BDJA 2YZ2A 3M4ZA 2FSVC 4RQTA 3EWNA 3NKFA 1U2GC 3SX4A 3L8CA 1B41A 2JBAB 1KZ1A 2PZGA 2B8NA 5L4NA 1N2CE 5KYUB 4RY2A 4RTRA 4O1HA 4GKVA 1QK4A 3IT3A 4GPD1 4CNBA 4RIGA 4RY9A 1DLJA 1CUJA 2OGUA 2VZ9A 1W47A 1I5OA 1MDBA 3I4CA 1FSZA 3GLHA 4NEHB 2MWMA 3PR2B 1BSVA 3JY6A 4Y6QA 3ZH2A 1KI4A 2CD7A 1SUBA 2YX1A 4HRXA 3AWDA 3UMMA 3OEYA 1JHVA 3PQDA 1E7QA 4KQXA 1X39A 1QH1B 1SXQA 3CX6A 4HQRA 3FLEA 3I8SA 3L5OA 4QODA 4E5YA 1XA3A 1Z4NA 5DBEX 3SBDA 3WS7A 1IWBB 1O7JA 3H3XA 4KVGA 4NU0A 2NXWA 3NUQA 4BMCA 5CYPA 5I7SA 5H9WA 1YIDA 1NW5A 1TYBE 3HCBA 2EJVA 4DJFC 3L01A 3ZHOA 1Z0IA 4M4SA 2OY0A 1SEPA 1WBJB 2R85A 4KIGA 4EHBA 2C9MA 3K0KA 4KQ1A 1GN9A 2BE7A 3CPEA 1KQPA 4HNRA 2NUPA 4QJ5A 5JAOA 4WVFA 4XUGB 4EJSC 3MWEB 1VL0A 3AFNA 1M75A 2PLAA 3ROMA 3AEZA 3ZCTA 4IKPA 3JTEA 2QYTA 4H3SA 3T06B 4XWGA 3A0RB 4LX8A 1JG1A 1AHNA 2R87A 5DW0A 4QGAA 4C0WA 4G41A 1B23P 1P33A 5AK5A 3VV3A 1OW3B 4E2XA 2PE5A 1N9GA 5EGSA 1Q16A 3MN1A 1PU2A 2X3YA 2XYRA 1GKLA 1X9IA 3NYWA 3PWSA 1TLFA 3TNDA 4L0QA 2QZJA 1P7YA 2PBRA 3DUWA 5BYJA 4L9SA 4R1QA 4CIDA 1V41E 3LBHA 1M74A 4D4LA 4KQFA 3ZHXA 4EDHA 3HFGA 4INPA 3PNQA 3L1JA 4WDQA 3SNKA 2JIZD 1NJ8A 4B6OA 1Y3IA 2JLBA 4MGEA 2WP0A 3WIEA 1ULAA 2CMFA 4JLBA 3U44A 3OQVA 2W93A 1FQWA 2PJUA 2KLHA 2ODWA 3KE9A 4R2MA 2VR1A 5GGYA 3W2IA 2GEUA 3I28A 3MBKA 4ID9A 3UMBA 2HT6A 5CB8A 5F76A 3EVAA 3FB1A 3BIWA 3GLUA 2AZDA 3REQA 4O5OA 1NW8A 2W2NA 1Y6GA 3Q6NA 1ANKA 1DO2A 1Z7GA 3E15A 3HDGA 1XF9A 1F8GA 3NIFB 1PWXA 3WK4A 3QJGA 4B45A 3ZDBA 1EEXB 3L8FA 3ROTA 2QEQA 1FXSA 4BN0A 2BZ1A 1M34B 3EXEB 5K3BA 3CPHA 3BXOA 1GZUA 3D3WA 1FX0B 3G8BA 3DTYA 4JZYA 5LMCA 3R5JA 4MWCA 1G5FA 1FP6A 3IBCA 1BHJA 4MVYA 1I8TA 3K70D 4YRGA 1EB8A 4HEQA 2QD5A 1M34E 2W70A 5I47A 2QTVB 3HZOA 3V97A 4DVJA 3ZWKA 4FYWA 2GBLC 1RE0A 1SCNE 2DR3A 1V2GA 3M1LA 4YRSA 4W8GA 2A0YA 3JS5A 1TADA 2PSSA 3CF0A 3EIQA 2O5VA 1AVTA 4HNQA 1H0HA 1HZZC 1U9IA 1ZX1A 4IHKA 3V7UA 1EHCA 3BJMA 4DFDA 1N2EA 4EAAA 3DUFB 5KTYA 3ZHBA 3LL4A 4TTSA 1MJ5A 1Q2UA 2BFWA 3AHJA 1U0EA 1ND6A 3N8HA 2DHCA 3CXUA 4WKPA 4FFRA 2XMRA 4A6EA 5CBKA 2HI0A 3H19A 1DRJA 3ABSB 4GMHA 3UJBA 3I1FA 3JQEA 5A5VA 4YYZA 3TJRA 3NDRA 3EF1A 3RI3A 1NDQA 4HMPA 3DFKA 2OAGA 5CT9A 1GLVA 3CUWA 3NEPX 3SYRA 1YDMA 4IEIA 3PYLA 4NJOA 3TTYA 3W7VA 2AN9A 4W5JA 4N3GA 3S1LA 2QLTA 3VTFA 2QJTA 2NV2B 3T7AA 1A9QA 1R6UA 2QN2A 3OFSA 2YKGA 1AS0A 1PD0A 2IELA 1QKIA 4OQEA 4N4AA 4TVKA 1GCAA 4FC7A 3DC7A 1EGQA 3B1YA 2DKNA 3QMPA 1QHYA 2NP6A 5GAJA 2VF8A 2X8JA 5DE3A 5I4BA 3B85A 3RR2A 3PEYA 4Y3UA 1L4FA 3IDOA 4U2GA 5BN3B 2ZZKA 3OCUA 3MRTA 4CG0A 1LBSA 1AXEA 1RSZA 4AY4A 4HLQB 4CLEA 4INZA 3ROGA 2QRQA 5CW2A 3TS1A 2P5SA 2AMVA 2HK8A 2R7NA 3ZWAA 5CFQA 2P0AA 1XZEA 3FD8A 4LJYA 3ZY2A 1G66A 3SR3A 3WGVA 1DX6A 2E18A 2FTKE 4YUWA 3PC8A 4J0QA 2XCTB 2DB3A 1E8NA 4MO9A 4MVJM 2A4MA 3MOGA 4GLFA 1R5OA 1L1EA 3P9CA 2PWYA 4FE4A 2R1VA 3MG9A 3G2JA 1F4VA 2G70A 3PGLA 3I45A 3ND7A 1SH7A 3C8MA 4ZARA 3GLIA 1L1QA 2Z58A 1A77A 2JANA 4BC1A 3UPDA 1JFTA 2QI9C 4M8LA 1JA9A 1K7SN 3UJ8A 4S04A 3SJZA 1DADA 2JIBA 2BUBA 3AR3A 1PNRA 1DE0A 1QO9A 3PGA1 3LT2A 1DFHA 2OQVA 4BVAA 4BLOA 2H06A 2XMZA 1KMMA 2XNKA 2DQYA 2QYSA 1FW8A 3VR4H 3CE9A 4CIXA 1D0IA 1OV4A 1UM8A 3IP7A 3RU3A 5JEDA 3UKJA 2J9GA 3CFYA 1MV5A 3QWAA 4LZAA 1H9BA 1XZJA 3VR6D 3H3FA 1F7VA 3WLJA 2XVYA 3SXUB 2BBTA 3WAGA 1PBNA 4Q3KA 4KIFA 2QT9A 4XGKA 1SQGA 4GECA 4X94A 2RHLA 3V00A 5ICEA 4NCAA 3A6EA 2EQAA 1MJGM 2V7VA 5LPNA 2H1RA 4IF4A 2D13A 4MS4A 2IV3A 2H92A 1Z62A 3T99A 3TEJA 2H65A 2JLYA 3G6KA 5K6TA 3WY9A 2V3CC 1F7UA 1U7ZA 2QZSA 2XMPA 3K9GA 4HQOA 4Y6GB 4YP6A 4HDMA 3FAZA 1LV8A 1FDWA 3MWGA 3WAKA 2FSVA 4OB7A 3JZAA 1U2GA 3GV0A 1HI9A 5AVZA 4V0SA 2IOHA 4RXTA 3OA2A 1UT5A 3DXXA 3DOFA 2WKQA 1RPAA 4EECA 1CU1A 5IYZB 1ESEA 3R0ZA 2OOSA 4Q4HA 4EUSA 3DJYA 1A8PA 1M7BA 2V45A 5JZ9A 2G5CA 2YYZA 4X1KB 5IWCA 3LAWA 2FUCA 1RRPA 4R1UA 4NJMA 1E5TA 3IQDB 2PNFA 3F8SA 5CNJA 5FF9A 1MP0A 4UQPA 4FPXA 4HL6A 2K6GA 5HZMA 2NN3C 4X8MA 1MAUA 4F9FA 1NBHA 1ZESA 1CJVC 5EE1A 1KDYA 4UEOA 3IB6A 1X1AA 3NC4A 4HH4A 4CU2A 1XXLA 3N2ZB 1IOVA 1J22A 1UWLA 3F1KA 3TIGA 2M32A 4NCNA 3T5DA 3F46A 5HF6A 3GELA 7ABPA 4YDQA 1E1QD 1AURA 1WUHS 2B2NA 4XLTA 3V7NA 1QF6A 4BFLA 4KI0A 1CB0A 1R0LA 4JLJA 1ZICA 4KXNA 4BL5A 5A2GA 2VYVD 3QX3A 4FEYA 3KSRA 1X8JA 2VQFB 2E4UA 2BH9A 2UZ1A 4LNHA 5DH9A 2Q27A 4JNCA 2VVTA 3ZXYA 4OHYA 5H81A 1L6IA 3C0KA 1D09A 2EARA 3MB8A 4FKMA 4OHCA 2G1JA 4J9VA 5FJJA 5I7UA 5KVAA 4EJSA 1QKJA 1N5RA 3AW8A 3L6UA 2IBMA 3CPSA 2WKRA 2VHYA 4UE3S 1LLFA 1N5MA 4BTVA 3H5LA 4HDAA 3N2KA 4F9TA 4FNGA 1ZCBA 3R6TA 2HFJA 1X74A 3IQWA 1V1MB 4Y8VA 1A9XA 4MVJP 3G88A 2XTAA 4IILA 5DPMA 1P5FA 1DVRA 4L6CA 1PLJA 1QJ4A 3A6KA 3L0DA 4R1MA 4TS3A 1BG6A 1CFJA 2WHPA 3CS3A 5C81A 2VTBB 2DERA 3VZCA 3ZCUA 1PQWA 4Q21A 4RO0A 2AB0A 5TSDA 3AVYA 2O8BB 1P3Y1 2W0MA 1Q1AA 4NDZA 4A0RA 1SUIA 3GJYA 2SICE 1BJRE 1XMVA 3QX7A 2BSXA 2FK8A 2Q50A 2B21A 3P0RA 1ZISA 2ZYWX 4QNRA 5KDLA 4O2BF 4JI0B 1GKYA 2SKDA 2VJKA 3EZ7A 4PHTA 3L0CA 4JBHA 5EIFA 4DJAA 4ZJPA 2WWRA 2X1HA 2IT1A 3MAAC 4PYNA 3OPXA 1PEKE 4D44A 1Q6YA 2FPMA 2PKQO 1KZYC 1SZDA 3OFVA 1H6DA 2UZ0A 3R40A 4GM4A 5CVDA 1E3TA 1C80A 3MC1A 4Q66C 1T2NA 1UJBA 1AQ6A 1XD8A 3MYRA 2CCGA 3SE0A 5JJIA 4YCAA 1JT9A 1XJWA 3IUBA 1FLDA 1X15A 2WU4A 3F3KA 3K1AA 3QVWA 4QTXA 2QG6A 1F60A 1WXWA 2CD9A 2BMJA 2ZJYA 3BB1A 1JW9B 3Q4GA 4JLOA 1JKJB 1LPMA 1OLXA 3ZZ1A 1R9GA 5AVVA 3R0QA 3B70A 1V11B 3LDHA 2F17A 2W2TA 1YE3A 3P32A 1H85A 4Q5IA 4WCVA 3UIEA 1VL6A 1E6EA 1GCUA 1GL3A 2AI3A 2GBLA 3BL6A 3KD2A 3GL9A 1GZSA 4L78A 4GLLA 3SJUA 2YFKA 1UMKA 1YB1A 3MMXA 3O8QA 5HJ7A 4ARCA 2FVXA 2CJXA 1HZZA 4R8RA 2A9PA 3HVJA 5EESA 3ZOKA 1OIWA 1XO1A 2ZR7A 3SLKA 3MINA 5FQNA 3G9TA 1IM2A 3AEQA 3AVOA 2WHRA 4ZREA 3K05A 2YZNA 3RRMA 2RAPA 2NW6A 3RYFB 3KYIB 1Q83A 1XZBA 5EEGA 1DIOB 3UV3A 3RODA 4EEZA 4Q4CA 2XD9A 3I2HA 1HBJA 4AKEA 4D3ZA 3OC0A 3A28A 3ZHQA 2ZB8A 4QG3A 4G9GA 5C9ZA 4V0QA 4OUDA 2AFHB 5B1IA 1GAJA 3VOTA 4GSLA 4RPGA 1XQ1A 3CZAA 2C4HA 4ZO6A 4MDFA 4H6XA 2XODA 3R75A 3A1CA 3QUTA 3LLMA 2XB9A 4Q24A 4PN7A 3QI7A 5CHYA 2BHSA 2C3UA 3DYVA 3DKVA 3LBIA 3PSHA 4JOSA 1Z28A 1J6UA 1EDEA 3NW9A 3UHOA 3W6ZA 5HIAA 1DWUA 1TEVA 2ZBRA 3ZBPA 5IUNC 3M6MD 3NTRA 2BEWA 1SRQA 3VR0A 2J3MA 2Q9BA 3IP8A 1KR5A 1CUEA 1OC4A 2A9RA 4PBRA 5ABPA 3GGCA 3EIFA 2PO5A 4ND3A 1Z5NA 3ITKA 4V2IA 5BQ3A 3T1HB 2P0EA 1CZOA 1I9GA 3K30A 3M5DA 4D9EA 2HRBA 4FSXA 5DRTA 3FTDA 4TV8B 1QPZA 2R2AA 2R48A 1U9ZA 3M2TA 4G5XA 5K2MA 4BBJA 5FLYA 4DE5A 1ICIA 1MB2A 1IOZA 4ZAFA 4MP8A 1MJNA 2PNJA 2ENWA 1ZY2A 3RWOA 4PQYA 4U9HS 5CXSA 3SIXA 1IXRC 2P9HA 2GJSA 2WVGA 3ECSA 3OQ1A 1UP4A 1XD2B 5ALHA 4YMGA 2Y1EA 5AJXA 1D9XA 5TARA 3TW4A 3Q11A 1KQNA 2WWXA 4F3YA 4NFSA 4Q03A 5IJ9B 4TL8A 5KTKA 5IULC 3ANYB 4EUNA 4Y2SA 4HWPA 3U81A 4DUPA 3OX2A 3ZCSA 1T3ZA 1NVEA 4XM0A 3LBNA 3STXA 5CD9A 3OIVA 3LH5A 5K5EA 3LQKA 3RFXA 4W9MC 1GQRA 2HCRA 4F0JA 1YJCA 2AC4A 2AV6A 4O1IA 2W4MA 1OHHD 2FQYA 3GFBA 2V7QA 1RBZA 3UQYS 1VXRA 3DWFA 2D3WA 2IYQA 1IBSA 3KEGA 3OX4A 3FSJX 1OIXA 1GWNA 1UMCA 2QXTA 3D8UA 5IARA 3GLHB 3FROA 4URXR 3AO0B 2VP4A 3QVMA 5K6AC 2YN4A 3EARA 1CRWG 3X1JA 4MNTA 3WHKA 3IV9A 3C5WP 1I0LA 2H52A 3A25A 4F12A 1UBTS 3ORHA 2H7CA 3AVUA 5DNUA 2RHTA 5IXYA 3AH8A 1JIJA 1J90A 4IGKA 5JBNA 3TZEA 3OEHD 5COQA 3P9PA 2FPWA 3UENA 4XI9A 2YZ7A 3VH2A 1CY1A 4JK3A 1A50B 5T3UA 4DWVA 4DV7B 3GGGA 4Q7EA 3CY6A 1JLSA 1BFKA 1M6VB 1SK8A 1ZINA 2JW5A 3AETA 1EGHA 1DT5A 1JRLA 2G9QA 5L8VA 5EINA 1YOVB 3JX9A 5BW4A 1UBMS 3LVBA 4C2TA 4WKCA 1H23A 1QYXA 3ZJ4A 1E1KA 4M76B 1JKMA 3ZDRA 2Z1DA 2EW1A 3AL3A 3JWJA 2C2OA 2HUNA 5FFFA 5C3UA 2C7OA 1P2BA 5CPFA 2DHQA 3JARA 5AVRA 3ABQB 3VHRA 1VCHA 2Y66A 4W7HA 2GA9A 2LV8A 4QGHA 1S3GA 4L7VA 3QVGA 3LX8A 2WJJA 1N9GB 1C8LA 4MIOA 4QUDA 4F06A 1T5SA 4BASA 2HF7A 4QPZA 3FNIA 3UY4A 1EIWA 4Y2TA 4DKJA 3I2FA 2OE2A 3BMXA 1J0CA 1EXMA 1SCDA 2A92A 2B4YA 3I52A 5EIWA 1BVRA 2YZKA 4TVOA 1YC5A 4QDZA 2ZRLA 3TG2A 4UDOA 3A27A 1JHAA 3ETDA 5F2EA 2ADMA 1I32A 1R9JA 2WFLB 3H6HA 4GU5A 1AGXA 1OC2A 2PGNA 1UQTA 3L05A 3R74A 3IAAA 4DPLA 3U44B 2XQJA 2PUHA 4YREA 1I6LA 2G7MC 3LW7A 5AT1A 4XQEA 3U3JA 5I48A 5LOVF 1LSOA 1L3CA 2AC7A 4LK2A 1P2VA 1GHTA 5CT4A 4MGZR 4D3XA 3I6MA 2OC4A 1ONOA 4MKGA 3REQB 3I5MA 1MVLA 3UM9A 3CVOA 2AW3A 3MMPA 5G0SA 4E2YA 4CQLA 1UIRA 1X19A 3AVQA 5LQSA 4TMKA 4GX5A 3WR5A 5JWRA 3HCEA 3D8TA 4RJKA 1OWOA 2V4ZA 4HGPA 4N01A 4FDAA 3AUXA 4UCQA 1JHXA 1DV2A 4XWTA 2O8FB 2WT4A 2G0NA 1BZYA 3CH4B 4PRYA 1T36B 4ZYLA 1AK1A 4CMGA 3NYIA 4D9NA 4K88A 3UZUA 3W5SA 5K0JA 4K9RA 3KBBA 3Q8KA 1ATZA 3DO6A 3D7SA 2Q7DA 2VDMB 3VHXB 4EY4A 3RJMA 4ZAYA 3AR9A 4F11A 2QRHA 1RQLA 3QM1A 3R5SA 3QXHA 1K75A 3CKMA 5B58C 3T3GA 1HFKA 3T3OA 3LVQE 3WHIA 1R0ZA 5LKAA 3K5WA 1QLHA 2RG1A 3PQFA 3EGWA 4KXWA 5FUWA 2J5XA 5KMGA 2JEZA 2CDRA 3MTGA 4OEHA 5F12A 2VC2B 2X0RA 3KT0A 5KOIA 5LJLA 4C1NA 2VJNA 4G6ZA 3RKSA 2WKSA 1F9EA 2I4TA 3LWBA 4Y6OA 2Q9AA 4KH1A 5EKTA 1B14A 4KBYA 1LDGA 4ZPJA 1CULC 3V33A 3VSBA 5HRAA 5FBLB 3L6EA 4LFCB 2HLDA 3OOHA 2CHEA 3FJOA 2FLKA 5H4HA 4NYJQ 1OFUX 3RSQA 1FFHA 4AF7A 3MD9A 4J6EA 3RUHA 4MP6A 5A9TA 4YMVA 1W0JA 1GILA 1YUNA 4AJKA 4EB6A 5TS2A 2X14A 1B2LA 4UUOA 1W581 1SR8A 1J2UA 2ECFA 2X8JB 3V2UA 3WLKX 1A4UA 1RKQA 1Y1QA 4N7RA 4R6XA 1G8YA 4Q4AB 2E4ZA 2A5GA 2UVQA 2GD6A 2RHHA 3MS4A 4M0FA 3SSOA 3V1KA 421PA 1P0FA 1JN0A 2R6HA 2B4TO 3OAAA 3KIPA 1L5MA 4IL5A 4CM9A 1I80A 1L7PA 4PRKA 3VMFA 4BB9A 4PU0A 2GFHA 4BRSA 1SCQA 4MARA 4ZT6A 2J8ZA 1G60A 3DE3X 3R44A 1CR4A 2E49A 4Y9RA 2I4RA 3QI2A 3OQJA 5DFAA 3IIEA 4ZCIA 2IEIA 1YS1X 1T2EA 3SYLA 1P19A 3N76A 4WEQA 2IDKA 2R1VB 3AHGA 4J90A 3LY9A 2GPNA 3GT0A 3H9CA 4BNWA 4NK4A 4KFSA 2Q1YA 4QAQA 5DNCA 1JLRA 4JASB 4YQZA 2ZJZA 3NBMA 4M1EA 4YXWA 2AEEA 3WBFA 1QG6A 1X86B 1F0KA 1ZM7A 1ZJJA 3OIDA 2OG2A 2CUTA 2VO1A 1RQXA 2E89A 3E5HA 3ED1A 1CR6A 2ZWOA 5FWYA 2CLCX 2NU6A 3KUKA 4P38A 4MW6A 3IR6A 3DC2A 1HE3A 3K9CA 5CU7A 3NC1C 2ILTA 5CX1A 3U40A 2WWIA 1CPYA 1ULTA 1XRLA 2GEFA 3IYLW 2H1SA 4IUDS 1K8YB 3IC5A 1UJ6A 2WNIA 3N39C 2A5LA 3LQ4A 4CT5A 3IBFA 3Q0TA 3RUAA 2KMLA 1K6XA 4GXQA 2CLEB 2IU6A 2W2VA 1P77A 3TFQA 3A32A 2QVLA 4EO4A 4S2UA 1YJAA 4ARBA 1L5HB 4K6MA 4MS4B 4Q9HA 4RTNA 3QVVA 1C1HA 4P32A 1CDEA 2XUQA 5JYBA 4QREA 3U7IA 2J0VA 1P7CA 1BGVA 1M1NB 2GAJA 4YT5A 4X8HA 4E03A 2NSHA 2WG0A 3F5SA 1I6WA 3NZEA 3SEZA 5HR5A 4OYYA 3JQQA 1V9CA 3L49A 1ZNWA 2GZMA 3QUSA 4P58A 5HE9A 3REOA 2QIOA 4B80A 1W73A 2R5FA 3HDTA 3HP4A 1WKBA 3C70A 5E3HA 5I8PA 4MW4A 1I4OA 2GZ1A 3OLCX 4NJMB 4EYKA 3BFKA 5K6AA 3LL7A 4DLWA 5DEOA 4QPJC 3T1NA 4MWDA 1JBKA 3WGQA 2XAAA 2QP9X 3HL0A 5DISB 3TOXA 5KWEA 4IXDA 4DCSA 4EI2A 4H08A 3WLNA 1HKHA 4U3JA 1FSSA 1WE2A 5IKEA 1ISHA 2P2CA 2Y05A 1RMYA 4LDQA 3CLTC 3GLRA 5EP4A 3KKPA 2X2OA 3M33A 3VU9A 1IY9A 2C2GA 3GROA 2OBXA 4IXNA 1E4EA 1JR2A 2UZ1B 2BR4A 1KE1A 4CLRA 3CX8A 4HCJA 4IIJB 4XSVA 3JATA 4KMMA 2P2YA 4AO7A 1XPOA 1YE5A 2D7DA 4DZRA 3OSZA 1BVYF 3T9FA 2YBDA 3USCS 4EJSB 1L5KA 3CF2A 4MRVA 1VL2A 3EZFA 5AKEA 1VRVA 2GEVA 2ZYHA 2G04A 3CNHA 5IC5A 2I2WA 4CTMA 1QZXA 4WZAE 3K4PA 1Q0HA 2ZTUA 1OKKA 3L0BA 4JMPA 3G2IA 1JIQA 1YQXA 1AUQA 4PR3A 2BY4A 3UB3A 4DSOA 3CRQA 3M6IA 1II0A 2WHPB 5CA0F 1U8TA 2ZS9A 4MZDA 3D7RA 4WBNF 1BDBA 3HFJA 1DKMA 4JBLA 5HRCA 4JI4B 3KQVA 3L6CA 1XROA 3DVQX 4U63A 1A04A 3M82A 5E1MA 4MRRA 1S8OA 3FA2A 1FFYA 2VAWA 4YRBA 1JXOA 1G3RA 4JR0A 1RMQA 2W6PA 2ZUFA 1XVTA 1OAAA 1C8VB 1O4WA 1EJ2A 2CW5A 2DBQA 3GFOA 1Z08A 4F6RB 3TTWA 4KMRA 4D9IA 5DM2A 2PYZA 3LXMA 5D3ZA 1PL8A 2WT9A 4M49A 1T43A 2CE2X 3F6CA 3S1AA 1ST3A 3T5GA 3KSMA 4ENWA 5LMNB 3GI1A 4J7AA 2FYTA 2CF6A 4RVGA 2WF9A 4JI1B 3LOUA 4FYXA 3T6KA 4CM4A 3MNFA 3OPNA 2I99A 3OZ7A 3R5HA 4JLVA 1EIZA 1ZMXA 1REQA 1RS0A 1WL8A 4PLPA 5GP1A 3V8RA 1L4YA 2PZAA 5HBGA 2GVDC 2PMKA 3AR8A 2WJWA 5LIRA 1R0CA 4XX0A 2HQOA 2P79A 1LRLA 3R3XA 2YYYA 1WOYA 3SX2A 4WZBA 3E6AA 2RSLA 5ICGA 2I3ZA 2CDBA 3DEKA 3C7KA 2EQ5A 3T12A 1QORA 3SHTA 3P5BA 3KS9A 4KOAA 3O8QB 4YRPA 4C2BA 2PKXA 4MI9A 3OF3A 2HGSA 4DIKA 2WLTA 3LQ2A 4POOA 5AFSA 4ZTBA 1I0IA 2DRIA 3HC7A 3PWTA 4RC9A 5GZ6A 2X0EA 4HDRA 1OA0A 1U5BA 3I8XA 3MINB 4LV6A 3AEQB 1YVEI 4MQ6A 4M3NA 4PPFA 4IHJF 2DR2A 2QQFA 4IDCA 3I34X 5HCNA 2VP3A 3MB5A 4JT8A 5LP6B 2J41A 1BE0A 3PXAA 2PSDA 3Q3CA 1FX1A 5TGZA 1H8ED 1DG3A 2ZBGA 2G88A 2YUTA 1E64A 1ZN2A 3C3JA 4FKZA 3R7FA 5H4GA 1S02A 1T13A 2P2SA 4QARA 1J9GA 3GRVA 3NHZA 4OUDB 3LLCA 4JROA 1EUZA 3M3DA 3Q1LA 3QU4A 5G0TA 4B7ZA 5KUTA 2LDXA 1XVIA 4MKIA 5JYCA 1SBYA 2O6LA 4RLQA 5CRIA 4KGZA 3HCWA 3FFBA 4BHTA 4HAXA 3BRSA 3IKLA 4Y30A 5P21A 1YBFA 4TVSA 3I62A 3F4BA 2VDLB 4B7AA 3KKMA 2E48A 5FNVB 2ZVDA 4PC7A 1B6TA 1OX4A 3GHHA 3TPFA 1NV8A 3CRNA 1QE0A 2CF5A 2BEWB 3GEDA 2GH1A 1RYMA 3GCGA 1EXVA 4DDHA 1K5PA 2XCLA 4IO1A 4M7WA 1TJ4A 1JV2B 1SQ6A 1CUWA 2X1VA 3H2SA 4UHEA 1ZGGA 1DBRA 1L5LA 4EUFA 4TZ6A 4PSAA 2DU8A 4G26A 2HRDA 4ETWA 3FOZA 2X9GA 2HN9A 2E4VA 2I1QA 1UKBA 4EHIA 1PT5A 1A9ZA 2E4YA 3AY6A 4QRDA 5DP2A 4RTJA 1RZRA 5FOWA 3P7MA 1NYQA 2MYPA 4OQPA 3AF6A 4RU1A 3RQSA 3ROXA 2DTEA 3R7NA 3EDYA 3P27A 1Z4MA 2N9UA 3B48A 1KKLA 4XOIA 3KJFA 2A1UB 4UXIA 3JZMA 3BGWA 4Y18A 5JAQA 1CUBA 3Q3JB 4J7UA 1QK3A 4UNPA 2XGJA 4OF4A 3VHLB 1RWOA 2ZT5A 3ZV5A 2MU1A 3FOFC 4UVHA 3AR2A 4BMXA 4CGYA 3N5CA 3TR0A 5CVTA 5U9CA 2EKZA 4L8VA 4E30A 2EGUA 3CUEF 4TYWA 2GD2A 4RAOA 5AHRA 1V3QE 4GMKA 1IU9A 1R50A 3CG0A 4IINA 4QFCA 4TWZA 1WX1A 5BWLA 1P7WA 2BKUA 1HGXA 2PX6A 3PK0A 1BWSA 2QQGA 4JR1A 4B3XA 4DT1A 2A14A 2CKMA 1UT6A 1EUCA 1UMCB 1L3BA 4KDCA 5BMVF 1OZFA 3MTJA 3AUAA 5HA5A 1LI7A 1NVXQ 2QENA 1HSOA 4QWWA 2B37A 4M8NE 4NRDA 1I4DD 4MCJA 3OTOB 5BUCA 1SKMA 3CEJA 4ZK2A 4CLOA 1A9TA 1DUVG 3OIFA 5BR4A 2HCFA 4A8JA 3QXJA 4HLDA 1P5RA 1SPBS 2FFRA 2B1RA 2QZPA 3MMSA 1ODJA 4L3WA 4RF5A 2Y0CA 2BFPA 4E2ZA 2HBZA 3CLUC 4OX9B 4J1TC 4GX1A 5I7AA 2VNAA 4F6CA 3FJYA 3MERA 5L4SA 2QE7D 1CJUC 1N2CA 1XCGB 3VPAA 3H17A 2FR8C 2VQ3A 3RO7A 4IRXA 4CM3A 5IUJC 2HA3A 4A2CA 4KODA 3KEMA 1KMCA 4C6SA 4FTWA 2AG0A 3EXHC 3P94A 2EFGA 3JARB 6LDHA 1LSSA 5LKRA 3IEUA 2XQGA 1JSZA 3M6LA 3O4RA 1FTQA 3PEFA 4REMA 4KDEA 5BR8B 2FE1A 1QGUB 2Q7XA 2VJCA 3QVGB 3TR5A 3ZLUA 5J4LA 2ONKA 3LW8A 2PGAA 3A3OA 5G0UA 1IB0A 3RFFA 1I6MA 4F6LA 1C0PA 4XQ0A 3WZMA 1N5JA 2O2IA 1ECCA 4ZU3A 1W49A 5GOTA 5EMNA 3DOIA 2PGOA 1ZAYA 4GXRA 1N2XA 4R9VA 3I3SR 5EFOA 3CUYA 1AZWA 4KN5A 1QRSA 1T26A 3F67A 3F2VA 1GGHA 2N42A 3OHPA 4C0XA 1PJ3A 4B43A 2EFJA 4D9JA 3WIOA 2EW8A 5LBUA 4B7XA 2PX0A 3UUEA 5BWNA 2WIGA 4Z4HA 3D54D 3IDAA 1BOOA 1YASA 2JI9A 3E70C 3WLQA 1ZRHA 1AQIA 3C15C 3IR5A 5DEIA 3HRHA 2WG1A 4NS4A 5SY6A 1W5AA 2BEUA 4KOEC 4CW7A 3F3MA 5AOCA 4CQLB 4Y2RA 1IN8A 1C1DA 1YQWA 1JFLA 1GRVA 2HF9A 2PDAA 2W9XA 3KPJA 3N87A 4C88A 3U39A 5I9TA 3JQAB 3H8SA 1DTWB 4RQUA 3H2ZA 4XCXA 4NSNA 5ALXA 4ARAA 1SURA 4BJ5A 3ROFA 5EWJA 1NF3A 4MCIA 1HKUA 3EXG1 1N0HA 1SIOA 1HL3A 2D7CA 2QJOA 2TYSB 3QNMA 1BKYA 4DLLA 1G6KA 3L46A 1BIFA 1EUDB 4GUDA 2HHCA 4O2LA 1UOPA 1LS6A 2VUSA 3EVBA 3K0BA 3O4IA 1VC2A 3E3LA 3HDQA 1H05A 1RPNA 4NMHA 1LEHA 1ZRMA 4ZODA 2SCUB 3X2FA 3HGQA 1VKHA 4RDIA 2DPHA 3V7YA 2ODEA 1C9DB 4RJ2A 1N7IA 1VLQA 4DG8A 5DM1A 5E4YA 2RIRA 2DPXA 1C7ZA 2JCBA 3WO0A 3DT8A 1X3SA 4E2WA 3K9WA 4X00A 4KYIB 2BAGA 5E38A 3PEEA 4E2FA 1VXOA 2ZZNA 2F4NA 4JHLA 1KJWA 5B1HA 1J8QA 3VNAA 4CIWA 2ZKLA 2ZG6A 2YNMC 3TMYA 2HB6A 2QRLA 1TVKB 2ISCA 2KJQA 2NVBA 1EG7A 2I4MA 4J1NA 4BWGA 4UVDA 2J5RA 3QU2A 2ICAA 3W8DA 4EB6B 1W29A 1FY2A 4FMPA 3T3IA 3G8DA 2CZCA 3IDFA 5HZHA 1ZK4A 4IZ6A 2DQSA 1WW8A 4RNCA 5HRUA 2OHVA 4OMDA 4BRUA 3TB6A 3ZGYA 4FNMA 4PQEA 1X6VA 2J9YB 4S12A 2GRUA 4B34A 1NI3A 2YW2A 4Z1MD 3LQRA 2H8GA 1RXSA 4L4RA 1OTHA 1VPDA 3RRYA 3KXDA 4IJ5A 3SDSA 3LFTA 5HJEA 4OI0A 2YS7A 5BOSA 1WUYA 2AVDA 1R4MA 3ZN2A 3CX4A 3WLMA 2QUHA 1NVUQ 2B4AA 1LWNA 1Y3CE 3ODGA 2X77A 2RKWA 2GETA 3IGFA 1HEUA 2PS9A 3EFOA 3WAJA 3K20A 1WBDA 4JX9A 1CK4A 2OHXA 2ZIAA 3AV0B 3QQ5A 4RHCA 3AP2A 3T3EA 4YAUA 4EF6A 2JKZA 2EAUA 4OAOA 1K6EA 1WVIA 3IVXA 4BO0A 4JL5A 2ET6A 4AURA 1YR9A 2HQ1A 4HFRA 1RXEA 4NESA 2ZKIA 4ER0A 1Q92A 3JRNA 1N5IA 2JLXA 5JS7A 2HO5A 4J94A 4NH4A 3BH7A 3ZJTA 4NLLA 1K9SA 3LCVB 4L07A 4NBTA 2G67A 4ZDIA 4AN4A 1RLTA 1TAQA 1U99A 4KWCA 5TEWA 1NQWA 3S8EA 2Q4BA 3BDIA 2F48A 1PIWA 4D0GA 4U5QA 5FWYB 1WB6A 1T2FA 2K5UA 3HVHA 3KDSE 3P0FA 2E37A 4HNAA 2PX2A 1QAOA 2EDCA 2H63A 3DXZA 5E7JA 5J63A 1S2NA 3PNVA 4DV0B 3GDHA 1GGNA 1E8MA 2I7CA 3AB3A 3T7RA 5EZYA 3GW8A 2ZPTX 2F59A 3NT2A 4OJQA 2ZUWA 3OJEA 5HS4A 1FLNA 4KQMA 4Q3OA 1D6MA 1HQYE 2OFXA 4CMCA 3ESZA 4NHEA 4NICA 3GGDA 4RCZA 1J8MF 1C4WA 3KT6A 3NCHA 3O03A 4HQ0A 4K9PA 1E1NA 4Y2PA 1C30A 2DUJA 1DDIA 5A06A 3B5JA 3NALA 4XLLA 2AWNA 2QUKA 1J23A 2XRMA 3BXZA 1MQ8B 4ALLA 2OBFA 4J6FA 3ZHSA 4RYDA 3DCNA 4AKGA 4PPNA 5CB6A 4Z2YA 5IDVA 4LDAA 4J91A 1YA4A 4LS3A 4QQFA 1FS4A 1C7JA 4AX4A 3HO1A 3W5VA 4AQDA 1B15A 1SFRA 3C97A 2GPBA 2P41A 1LUAA 1GVNB 1YIOA 1K86A 1PLKA 3BFPA 4WUVA 1NBMA 3B9PA 4FU0A 4RTOA 3WGGA 2GJ8A 1JPNA 1OLUA 4RH0A 1YBMA 2V6JA 3FW1A 2XUGA 2J5BA 2UYQA 1LV7A 1OFVA 2X6RA 2H5IA 4YFVA 3UKOA 1G5TA 3SS7X 4DBZA 5ITVA 2AX3A 2R8RA 4U3JB 1CC1S 4DLSA 4JODA 4B71A 1F4LA 3G23A 3GLSA 4CNQA 1Z9BA 3K9NA 3RFTA 2VSNA 3CJRA 3GGSA 2PUFA 2EWMA 3QTBA 1FZTA 3EUEA 4MV1A 3E5RA 5IEBA 3M5PA 1MBZA 3DDWA 4J1TA 2FPRA 4X6LA 1KK3A 1LVHA 4M1OA 4YJDA 3G7SA 4NZYA 3KXIA 3P2JA 1FYEA 1JTVA 2FR8A 2O05A 4R9RA 3ZK8A 4YCMA 1Y48E 5HQTA 3T1YB 2NADA 4WH0A 4PG5A 4C4TA 3J81k 4O63O 1E7WA 5HBRA 3TX6A 1W93A 3BF7A 3R2JA 4OSOA 5K01A 4P81A 3A04A 4UXJA 3EXHA 2I76A 4N54A 5LIPA 4HN4B 4JP8A 1VJ0A 1TF7A 2ZJ7A 3Q5GA 5K8CA 4DJ5X 2V7BA 2JATA 4P54A 1ZN8A 2QTFA 4W1QA 4M1KA 4RGYA 3WZLA 4DQLA 1YI8A 2Q6IA 4HWSA 4OBBA 5T6MA 4JC8A 4LNAA 1TEXA 2C96A 2OWDA 4ALJA 3KLNA 4PSCA 2W6MA 1ZPDA 4DVGA 2Q2OA 2WIAA 4Z3OA 3QXSA 5FYQA 2UUPA 4HWTA 2W42A 1R66A 1IMJA 3Q72A 1SBNE 4OGWA 1G3UA 5ALTA 2RGGA 4AXXA 3UAWA 4Z8XA 1H2HA 3ABRB 4E51A 3ME5A 4KGXA 1GPNA 3SY8A 4WJLA 3IAM1 3L40A 1QHNA 3HU1A 3OZUA 4X7PA 3LO5A 3ZHTA 4UBLA 3FGOA 3CSUA 1J9EA 4ESOA 4BJ1A 3CGGA 1QU2A 2D2IA 1TQDA 3PNLA 4WKGA 4BC0A 5C53B 2QN8A 3UPUA 5LYJA 1HR0B 2B1QA 3IUJA 2CSUA 1Q91A 2LIVA 5DCYA 2NNLD 3UBMA 1O5IA 3I9V6 1TK3A 4IJKA 3S1AB 3ZWQA 2BHNA 2YRXA 2GZSA 3KHKA 3SFTA 3OM1A 1RXYA 5CDYA 3NBZC 2BMVA 3WQQA 3D2CA 3L0ZA 2VH1A 4Q3LA 4BOYA 3RS3A 1REQB 4WNYA 4JUFA 4PLVA 3E9NA 2HQSA 3W04A 4A27A 3PZBA 3MF4A 2P9ZA 5I5GA 5SYNA 4XX0B 2ASVA 3IFSA 2G1AA 1Q0PA 2AI1A 3CN9A 3HR7A 1SCBA 1TKRA 2FPUA 3UGTA 4EY3A 3RKRA 4WZBB 1IEXA 2DMRA 2IEAA 4EMBA 4YCNA 4ON9A 4MW5A 5F1PA 3FDJA 3OP4A 3CF4G 5B1DA 5I9LA 5ED4A 5IMSA 3PTAA 1MH9A 3NWOA 2IYNA 1WVMA 3O83A 2PEZA 1E3IA 2QX6A 3B1WA 2IHJA 3KKLA 4JQZA 3CVUA 1JZQA 2B7BA 3C3CA 3LA8A 5KVCA 1Z37A 4YS6A 3EF3A 4ZV4A 5IUKC 4BMYA 2RHMA 2ATXA 4G4SP 2PCLA 4UUQA 1GADO 2IYEA 1TL7C 1AOXA 3WZ2A 3DFFA 3KOXA 2IYVA 3LDFA 1KBQA 3Q15C 4LOJA 1GTG1 1M1YE 1YZFA 1MB3A 2YVKA 3TO5A 3HDYA 3Q6MA 1NW3A 3P9IA 1X70A 2YNMA 2K2WA 4CPDA 5JLJA 2FMUA 3MWDA 5DTJA 1QM5A 2N0SA 4TWJA 4HO1X 1FDUA 2XT6A 5D5QA 4CM8A 2Q62A 4AJ1A 4MYSA 1CP3A 3NS7A 3ZIAD 1Y3HA 2XLBA 5SZKB 4O8CA 3STUA 4CQMD 4D4HA 2XCRB 3CEHA 4ZEWA 3EBPA 4RZ3A 1CQJA 2Y9MB 3CLRD 3FRJA 1JXAA 4KQCA 1L1FA 4E08A 4XEUA 5FUXA 4PFQA 3COZA 4CE6A 3EEBA 5G41A 1XQ9A 1MEJA 5JQGB 1E79D 2QAIA 4QVGA 4DN6A 4NENA 1QQ7A 2AKAB 3KDPA 2GEDA 4BX2A 1MC4A 3QWFA 2HA0A 2IRWA 3CCBA 3T3MB 4GEKA 5IZCC 3QYPA 4GRDA 5K0GA 3AEKA 2DH6A 5JJCA 4EY8A 3ES9A 2QRPA 2VSQA 3CRRA 3S5JA 4LZLA 3TD2A 1NVFA 1P0PA 4ZI5A 1K7YA 4LXYA 1I3NA 3YASA 1ZK2A 2O4CA 2IW1A 3LDUA 3KB1A 4P5PA 1KXJA 1N0WA 5TMDA 3WWCA 2KQUA 2X0DA 2PWBA 3RFCA 2JA2A 4QU9A 4ETIA 2EWWA 1EXWA 2XE6A 5I8WA 4RQBA 3B1JA 5AMXA 1KP9A 4JOCA 1PL7A 3VR4D 4KFCA 3W5DA 3QWBA 3WYDA 5EIHA 2BEKA 2R5WA 3BYZA 2H2WA 3EDOA 3EMVA 3OOYA 3QJYA 4LGVA 1O9BA 2ID4A 2FF7A 1NNSA 1SUFA 3BAZA 4AF6A 3OSUA 5DTQA 3FTEA 3KVNA 4EELA 3TW6A 5EIEA 4AI6A 2W2LD 3SQNA 2AFRA 4DT1B 1LD3A 4KR7A 3TLKA 4FGJA 1EUCB 2Y4NA 4XX1A 3D6NB 2RI0A 1NVTA 4DBLE 1NXQA 4ZEMA 4ZHSA 1V5GA 4H1VA 5A4DA 1W46A 2I03A 2JCGA 4LQLA 4RSRA 4B3DA 4H16A 4GQBA 1D2AA 2X3UA 2D8MA 2AI2A 5IC4A 5IF9A 4CLOB 1OLSA 3KYDB 1Z8NA 2CWDA 1FUYB 4Z4EA 2R2GA 3CPJB 3OY2A 3OPMA 4U7WA 1A96A 2F9MA 5AW7A 5K0TA 3HJHA 1ABBA 2Z95A 4RHEA 1SU4A 4NABA 5L7YA 5C8VA 3I1IA 4OQLA 1J97A 4H4EA 1GPKA 1ZCFA 1IY1A 2RHOA 3BRCA 5D1HA 4QXRA 5DXJA 3TB4A 1JDUA 2O2SA 4AXBA 1F5NA 3HCOA 1E2FA 2JBWA 1T0BA 2MR6A 4HGZA 4ANFA 3F78A 4EABA 1H1TA 1OFHA 3T7JA 4F92B 1TFRA 3E9YA 4PFSA 1BGXT 1E94E 3PUJA 1Q7BA 4EG5A 1GU7A 2Q3FA 5CHEA 4JY7A 1PR4A 3RF7A 2XVAA 3FZYA 4N47A 1CX9B 1UANA 3REFA 1ZSVA 3FBWA 4YPVA 2YYSA 2Q4RA 4H1WA 4K9LA 3RT1A 4QQKA 3RADC 5FLEX 1NLFA 5B55A 3DE1X 5E6UA 1J2EA 2WR8A 4KRXA 7REQA 1W44A 1R2QA 3GRPA 3JQGA 4NBUA 4PZPA 2F3RA 2Q8PA 2BFEA 1JE0A 2WNSA 2Q99A 3KZOA 1GPYA 2WW8A 4B31A 1FP4A 1E1CA 1DRKA 5LFAA 1V8OA 2D0PB 4AZ3B 3MILA 1FMCA 2DWUA 4GG1A 4DPMA 5AM1A 2RHRA 3P0HA 2YIDA 3N58A 3ROPA 4L9AA 5A4JA 2WMYA 5JAUA 2G9RA 1RFGE 1CQPA 5AW2A 1LWOA 4HYTA 1GPUA 2GN4A 1C1DB 3CZ9A 3H5IA 1DJOA 1VL5A 2IY7A 3GJ7A 1XF1A 4UD6A 1KEVA 2FR1A 3P20A 2GPJA 3FNRA 4QUGA 5HM6A 5JTTA 3U9LA 5GONA 1GEEA 3PB3A 4Q39A 4C03A 1YI0A 2C5AA 3TEFA 3LKZA 5KS2A 1JEDA 2BP7A 2ZQZA 5KNLA 2XNCA 3ER9A 5HG0A 3PF8A 5ALRA 2C78A 3V4FA 2G4CA 2OT3B 1DBVO 5UKDA 1RQNA 4CFZA 4D7AA 4C3ZA 1DT3A 1Q1EA 2FQ1A 5BW8A 4ZC8A 3GLGE 1A4XA 4Z54A 2P9EA 2PGJA 1KJYA 1WUKS 4M8KA 3L0SA 4HV4A 1JNYA 2XCOA 3LKBA 1FU4A 1TMYA 4IFBA 3BJIC 3GN2A 1RQRA 1T9AA 4JT4A 2NUAA 1IXZA 1Y6JA 4N8SA 4QEDA 2Q6OA 3TMAA 4YRIA 3T1TA 3O0DA 1RC8A 4LZJA 3B1FA 4G5GA 5LQRA 3PC3A 4KPUB 3NOXA 4PRLA 2V0CA 3T5CA 5DHFA 5A7FA 1U6IA 3DEAA 5KKNB 3AKYA 1I51A 4KI7A 4M89A 2EKQA 4O4LB 4P3PA 1DCKA 2VPXA 1XTSA 3SYTA 3V2GA 3WMEA 2VXCA 1VMEA 3S55A 4PFKA 1EBBA 4AJ9A 3IODA 1F0YA 2ALJA 3D9QX 3GEEA 4M9QA 1C7FA 1UL1X 3FF1A 3W77A 4D3SA 3JWGA 4EO7A 4K3UA 3K0SA 4KX5A 3PQ6A 4DR6B 3TLAA 2HJGA 3U3OA 3WGIA 3JW8A 1J0BA 1I1HA 3JU3A 4J4TA 3HO8A 4KTTE 4DXDA 3QXGA 4YRAA 5ITZA 5E8JA 2QGNA 3D7NA 3W90A 3CH7A 5JZOA 3GUHA 4LOKA 5C8YF 1ECJA 1U3TA 2G36A 3GDOA 4BQIA 4TSFD 3MCWA 1UWVA 2DSTA 1M6HA 4KO1S 3H1PA 3FFXA 3O3OB 4G65A 1DDOA 2Z43A 2CSXA 4L7QA 1YGYA 3E8XA 1EVEA 1Z0ZA 4ROTA 3TL2A 4RXUA 3KPWA 2W6ZA 1B6GA 4G8JA 2B92A 2D5IA 3PVCA 4HSGA 4ZGBA 4WX2B 1ZWKA 3EFOB 1WHSB 2VDUE 2V8OA 2BIFA 3G1WA 2IY8A 4KYTA 2B0CA 1HLGA 1Z4JA 1M8JA 1Q1ZA 2QPTA 1XMOB 1II9A 1R1DA 3F6RA 5LA6F 4BLPA 2Z83A 2P1ZA 2QLLA 4MTCA 4E31A 4EY5A 1NRWA 4NJEB 3WYFA 4IOMA 3VKFA 1O87A 4OM8A 1XJCA 1ZOLA 3EA5A 3EVGA 4DQ0A 2ZJAA 2I71A 4HGNA 5CUQA 3WGOA 1PX2A 1H0SA 4PLGA 3RSSA 3KWFA 4J43A 3BMNA 1FXWA 5C5CA 1OILA 4Q3BA 5DI3B 1BFDA 4F97A 3EUFA 4RM2A 3FWZA 4DMUB 3FR8A 3HXKA 2F1JA 2C20A 4HNAB 4KLCA 1GJRA 4LRUA 3RE1A 4PZUA 5IZCA 1KC3A 1EG2A 1DP4A 4X1YB 5ESRA 1FP1D 4LYGA 4CGZA 2NNWB 3GWGA 3R5FA 2ID7A 2JGDA 4IEEA 2VF4X 3PFHA 3RWBA 2PL1A 3V9PA 1WVGA 5K6RA 1EQAA 2GSDA 2XT0A 3MUEA 1JMKC 3DTTA 1PW7A 4BNDA 1C30B 5JARA 1K27A 5KU1A 1CV2A 3B7WA 3ZV4A 3CN7A 3RVJA 3DMFA 3KQWA 5HDBB 1JSLA 5G1NA 1J70A 1G5PA 5IH3A 4ENQA 2O1WA 8ATCA 4BY9E 3RVDA 1GGVA 2QMQA 3SMVA 3KUXA 1U3GA 1XAGA 4RKEA 2LDBA 1OKKD 3NM4A 2HJSA 2FETA 4PLWA 3AEXA 3OPYA 1EX6A 1YB5A 2Z2KA 4IICA 4Q0MA 3WK5A 3WXMA 4EHFA 5I7RA 4P98A 3M6AA 1KSJA 1G1MA 4L8LA 4OXRA 5DM0A 2W00A 1XPRA