4L07A

Crystal structure of the maleamate amidase ami from pseudomonas putida s16
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MSQKEVYDAAGFGNPVSRGVHPAIIVVDFSYGFTDLQYPTASDASLQMSRTKEICDLARALEFPVIFTTIAYHPGEIPMLPWLEKSSGMAALLYGSRLVEIDMATGIQPNDVVVVKKGASSFFGSTLSSLLAGTNTDTVVVTGATTSGCVRATVVDAVQSGFKVLVPADCCADRAKGPHEASLYDIQQKYGDVTDSDDILKWLRSVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, isochorismatase family
publication title Structural insights into the specific recognition of N-heterocycle biodenitrogenation-derived substrates by microbial amide hydrolases.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 75
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4l07A00
1YACA 3OQPA 3EEFA 3TB4A 3IRVA 3O92A 3O93A 3TXYA 3UAOA 3O94A 3R77A 1NF8A 3HB7A 3LQYA 1XN4A 2WT9A 1NF9A 3HU5A 4L07A 1YZVA 4WH0A 1IM5A 2WTAA 3S2SA 3OT4A 1X9GA 3O91A 2FQ1A 1NBAA 3MCWA 1J2RA 3R2JA 3PL1A 4L08A 3O90A 4WGFA 2A67A 2B34A 2H0RA 4H17A 3TG2A 1ILWA 3V8EA 3KL2A
chains in the Genus database with same CATH superfamily
4OH1A 4P2GA 2VJMB 1GA6A 3AXSA 2OM6A 3IULA 4OQZA 2WFLA 1SCKA 4ZZ2A 1AF4A 5HE8A 1NMQA 2WA1A 2G1JA 3DJYA 3IKMB 3JX9A 1MN6A 2QIOA 2OUIA 4HK4A 4RFSB 2VYND 3AJAA 3WDLA 3HDJA 2WAYA 4JQYA 1GQRA 3I73A 4P4GA 4CCYA 4ZI7B 4CEIB 2Z8YA 1XVAA 4BVLA 2BFAA 3G2KA 2CBZA 5CLJA 1JAXA 4F71A 4GOOD 1L7DA 1TM3E 4QXQA 2P9GA 3M5DA 2HSEA 3GN2A 1U3DA 4LYFA 2CLDX 2G25A 4YP6A 1HQCA 1EXDA 1UK7A 2PGOA 3IT2A 4QYTA 4XVQA 3WZ2A 1T3ZA 4IR7A 3AQIA 3JQRA 3TLCA 3K5WA 5TMBA 3UJ3X 2H11A 4ENSA 1BFDA 1KKLA 1BWQA 1RWKA 1ITZA 1YZGA 1T2CA 1N0IA 3TZ6A 4GOLD 4RELA 2FSSA 2OVFA 3BMNA 6PFKA 1O8CA 1WTAA 3ZHVA 5AR1A 1M2JA 2A57A 2VSXA 3LC2O 3IMEA 2XUGA 4AS3A 1IN8A 4EA8A 5HIAA 1D8TA 2RKBA 2VXCA 4GLOA 3REQA 1P0QA 1TU4A 2DHRA 4F85A 1YDEA 2F67A 2PL9A 3LHDA 2GNAA 3USES 2IS4A 2CJWB 3ENQA 4L0CA 4NFHA 2QLTA 4PSAA 1TL7C 3O74A 4DUYB 2H7VA 1YHNA 2M1XA 1V9CA 3TNLA 3TZCA 3UMGA 3VJKA 2CT8A 1AHHA 2R6AA 2P4UA 4FDLA 3SHVA 5B6PA 1H4QA 1TCUA 4XIGS 3RLIA 3DHEA 3K0CA 4R2HA 5BSKA 3K8YA 5FV4A 3U5TA 3VPXA 3DYVA 2QTTA 3EJ6A 3G5TA 3RSLA 1XEXB 3WRVA 1WMBA 4ZIRB 4HN4B 2G28A 3RWOA 4H0CA 5EQJB 2YR0A 4BBZA 4KFCA 1KIMA 3Q9LA 4K81B 1Q91A 3SQWA 3IQIX 1C7FA 1US8A 1HTBA 2YMMA 3AEXA 3EYAA 1I4TD 3PA8A 2GCOA 1N1DA 3QGMA 4AQ7A 2QD3A 2PPVA 3LBFA 3BXXA 5H9WA 1MC8A 2CNOA 3HEAA 1JF8A 1MDBA 1T3GA 2R6DA 4TS4A 2PIAA 4RDHA 1Q0ZA 4FVTA 1ZZEA 2XT9A 3OE4A 1VI6A 3P9RA 5JDCA 5LPNA 1QB7A 3KS9A 1Z35A 2WWRA 5BNTA 4GRAA 4MVJI 2FEAA 1TQDA 1DKUA 1XE3A 1OXTA 2WM3A 5BSVA 2RI6A 3RYFA 1SQSA 3FLBA 1M0EA 4C78A 1EM6A 1WZNA 2FUG6 2YINC 4GNRA 2PKXA 3MLAA 2G5GX 2R1VA 1HLDA 3FYTA 3OA2A 4FBLA 3IT1A 1Q7TA 4YTEA 4IQGA 2MSKA 2VXOA 5ETJA 4BFVA 4XGNA 2Z4TA 4FGLA 2MIIA 1EX6A 3BMXA 4JJGA 2QVBA 4MDYA 4X44A 4S12A 1HFWA 3ZWQA 1C4XA 3SF8A 4AJ9A 1AB5A 1YC2A 3DSRA 1E1QD 3C3DA 3GVPA 2TMKA 4RENA 5DGXA 3PHCA 1KYIA 2MT9A 5ECWA 3ETHA 2Q27A 4RSGA 4JI2B 2YXBA 1HWYA 2G0TA 3W8DA 4RSHA 2C00A 1F4VA 2HTEA 2RC5A 4YQEA 2V54A 5HFJA 3CVYA 3PNYA 3E9ZA 1EGAA 4L78A 2GFQA 1GZSA 1HRDA 2BJHA 1XLVA 3GHYA 2H2WA 4DLKA 3ME5A 3P94A 2JFGA 2O7VA 5SYAA 1EVQA 1NMYA 4N12A 1R4NA 1AGYA 3RTDA 1U9YA 4BO8A 1J9EA 4KQ6A 2CUNA 1BW9A 3OF2A 2FSVC 4AULA 1KFJB 1N7JA 4P5EA 4OCZA 2YRFA 1O0SA 2A3RA 1C2TA 1YL7A 2ZWPA 4PBTA 1QQ5A 4XM1A 4LV8B 1PJRA 2POQX 3CKYA 3OESA 3OT1B 4G25A 4EL5A 2ZUEA 2M6SA 1DV2A 2YN4A 1QZUA 1X74A 5EQFA 2H5IA 4TRJA 5KWIA 2PJRA 1MRSA 3GFVA 4C29A 1HH4A 5KSOA 3PX7A 4O63O 1JHXA 1R0YA 5B12A 2PHZA 1VCNA 1AT1A 1L6RA 2P41A 1U2DC 4YT5A 1JXAA 3PLNA 3V1TC 4E2FA 5TLSA 1U8TA 4BQNA 1E2BA 3KLBA 3RJ9A 3T4UA 5F1PA 1PQPA 3FPSA 3UK2A 3EWNA 4IRUB 3CCCA 4A3SA 2RIPA 2CXXA 1SY7A 1U5AA 3DM5A 3IP6A 3KLMX 2Q3MA 3ONWA 4LYYA 4XYGA 4DY6A 4ZFNA 1F6BA 1JHZA 4LYJA 4WEQA 1TJPB 1EVZA 3P0FA 4IUYA 2Z58A 1OAAA 2F17A 1OT3A 2P6MA 3EUWA 4G5XA 4OHFA 2FF7A 3JTMA 3IKTA 2FEXA 3IOEA 3FI9A 4R2JA 1ZEMA 1YCFA 2JLYA 4IGKA 3UK7A 3FWKA 4DUPA 2E89A 5HYVA 1ZUD1 4UFNA 2XOKA 2I54A 1QKIA 4RD3A 4RGVA 3ZEAA 4EEXA 2E87A 2OO3A 2QYTA 2V7VA 3SDZA 2W2LD 4H7PA 3PHLA 3L9WA 3ORQA 1ZEJA 3ENWA 3X1DA 1Z5GA 3KBBA 1A5SB 4CL8A 1K7YA 3MHPA 2FFHA 3GMSA 5FP0A 4BFSA 5EEHA 3HCNA 5ALVA 3K9LA 3IEMA 3CFYA 3SXUB 2J0VA 2EQ5A 2NX2A 3U1TA 1DRKA 1NF8A 5BW8A 4TTJA 2O2JA 2HSGA 1L4LA 1Z8HA 2GO1A 2ZRIA 3EWSA 3IHLA 3RPEA 4DWWA 4EL0A 3H5VA 3ZXUB 1JEYA 2HRZA 3VJRA 1GNRA 1PZNA 4NAUA 3DAOA 3FKSD 4QPPA 5BSMA 1TM1E 3AEUB 2JGKA 2ZPUA 1KOFA 1VHQA 4EY7A 5FLYA 2HLDA 2YZ7A 4KQCA 4FNGA 3ZPXA 3H8SA 2QTRA 1UKEA 2H1FA 3R3XA 3CEPB 2EHDA 2W6JA 1Q6ZA 5LA6A 1RP1A 4UCXA 4ITUA 5JXHA 3CTPA 5EINA 1EK2A 1DAPA 2J3JA 1EI9A 1I7PA 4XPIA 4D2IA 1CYEA 3C6QA 3HXMA 1NQWA 5IVKA 3CUYA 2EJWA 2FSVA 1E2PA 2NTEA 3MS7A 4CQMA 4CL2A 3UMSA 4G0NA 3TEJA 2CSXA 5FUBA 4W82A 3QITA 3DMPA 1QHEA 5BSEA 3NOVA 3UWMA 4G9EA 5I7HA 2V8BA 1C9KA 3STWA 1Y8ZA 2OZLA 3Q72A 2QUIA 2P0AA 1M6EX 4AY6A 4WNCA 1DNPA 2D1TA 3GPIA 2FOLA 1FUIA 4OHVA 4F92B 2ABWA 1DTSA 3PGJA 5GJBA 1Y33E 2B0JA 4LTNA 4XQ9A 1MPTA 5ALJA 4EIWA 4BYMA 1CPYA 3GNQA 2J5BA 5K0SA 1XVLA 4XIYA 3WAKA 4B81A 3H18A 4DZZA 4K9MA 2FNAA 4YIKA 5EE3A 4IMRA 3BDVA 5JZ9A 1RXWA 2ADFA 2J87A 4CVNA 5KNLA 2Q9BA 3LG2A 3U1VA 5A03A 3Q7TA 3TGWA 1PR3A 2AH5A 1NXSA 5AW8A 2OXCA 1KI2A 2O1XA 1G8AA 3WLQA 4PAWA 3EK2A 4EKEA 3E8XA 4CKEA 2BY4A 2DP4E 2YDXA 4RF4A 5A4DA 5LXTA 3FMIA 4J75A 2AG6A 4BKOA 1UBKS 1KYYA 3W04A 1KRWA 3IR5A 2XR1A 2J9GA 1P3Y1 1NN1A 1NN3A 4F4JA 3RROA 5DIZA 4P3NA 3BT7A 3TRJA 1V3UA 4ZANA 2DEUA 3GEPA 4I0WB 2HK8A 4N0MA 1T4DA 2CLLB 3U17A 3L1IA 1I8TA 3EMDA 1ODFA 1Y7LA 3IBCA 2IHUA 3L7NA 3S28A 4BL5A 1NQXA 1VE3A 1KS2A 5FQNA 3IP7A 4F8JA 2WHEA 2P3QA 2I55A 4X00A 5EFOA 1X70A 2DQKA 4N6NA 4Q00A 5HILA 4HX5A 1D2GA 4ZJPA 4WZAA 3VI3B 4Q7QA 4M4SA 3VDNB 2QRGA 5EP4A 5KJFA 1JR3E 1C1YA 3D31A 3JQFC 5BVHA 4RY8A 3RV4A 1VRCA 2O50A 2XZLA 2JKVA 5E7QA 3NWPA 3KT6A 4L5JA 4YXWA 1VFPA 3DFUA 3UF0A 2QJTA 5M34A 2X4GA 1M1NB 1V1MA 4OSOA 5DM4A 2QG6A 3HE3A 3M4YA 5HMMA 2RD2A 4IFEA 3GNSA 5KBYA 3TLZA 1D6JA 3QV1A 3ADBA 2OP0A 2SICE 3QXCA 4H4CA 4UULA 1PNOA 3NXKA 4QU5A 1Y6GA 2Y1WA 4U02A 2G6TA 3BH6A 1GG2A 3CSSA 1NUAA 1WVGA 4KYUA 5FWDA 3OF5A 1YHZA 1IG3A 4QT0A 2DFLA 2VK2A 2WIGA 1T0UA 3SR0A 2FVYA 3QY0A 3VR2D 2BCJQ 3PXEA 4XD7A 3HV0A 2P8JA 2MSEB 1X9HA 4FE7A 4DE5A 1PJ3A 3HVKA 2DFPA 2G17A 4M1ZA 2WWXA 3TIXB 4BVGA 4KIGA 5D7BA 1WV1A 2PLRA 1ZU4A 1L5HA 4KMSA 4OHKA 5A4KA 3LL7A 1Z07A 1GA1A 5JD3A 5J4VA 2VAVA 4NFSA 5KYYB 3HNRA 3ZDDA 4L3WA 2HWUA 1FFBA 2ZAMA 4CT4B 3TKLA 1WXFA 1YOVA 2EWWA 3EUFA 3I5UA 5BYKA 1CETA 3IUYA 3QE2A 5JJBA 1G9SA 5EMMA 5K4GA 2HO5A 3UB2A 2WWFA 4KQWA 3TAXA 4WBXC 621PA 1FK8A 3HPRA 3L84A 3CE6A 3SIPA 4Q37A 2H2FA 2PZBA 1QFZA 2QJRA 4N0QA 1ISGA 3GGSA 5FTKA 1U5CA 3VDXA 1RIIA 3N2KA 1MF7A 3NRCA 4PQFA 2A14A 4WMLA 1QFMA 2QXTA 4BFTA 3BILA 1Q84A 2BHSA 3M0EA 4EO4A 4N54A 5AVKA 4BVJA 3LUAA 3Q7EA 4TT3A 4DSUA 1JN0A 4CIVA 4G5HA 4L7QA 4JS0A 1K5GA 5AVXA 1RXSA 5TC4A 2C0CA 3AP2A 2Z5GA 4NENA 3OC6A 4AY5A 1A72A 1U2PA 2AGVA 1Q0SA 1SH7A 4PLCA 5ESWA 4QD3A 5FHQA 3WLJA 4CKCB 1OH6A 3PEWA 4LC1A 4M9SA 1CZUA 1YNOA 1BOOA 4LHWA 4HNAA 3QWIA 1TYBE 1OFVA 1RRFA 5AVSA 3R6WA 3PPXA 3AVWA 2A9RA 4EG5A 4OGFA 1X7YA 2XNJA 1YXMA 3H42B 4RM3A 3K0AB 5LOVF 2IKSA 1F9AA 1QLJA 4DC9A 2Y1OA 4DZRA 2OBNA 1P8AA 3BL6A 3SSNA 4MVCA 5IJAA 4ILKA 4AC9A 1KI6A 2FPIB 5B36A 1B00A 3GUVA 2X5OA 3SNHA 2NSHA 1GUFA 3LLUA 4HS4A 3EPRA 4KXLA 3VVLA 4DLBA 2MCFA 3QSYA 4IS2A 4P83A 2BW0A 3C97A 5CLHA 2FZ5A 2ONCA 4UNIA 3TX6A 2BKUA 2R3SA 4DPMA 1DBQA 2VDUE 3LDUA 2IP2A 1OHHD 4WLVA 3ZBUA 1D09A 3JSXA 4R0MA 5KKCA 1GG5A 1LB1B 3TOSA 1ZFNA 1NVEA 3TRFA 4YUXA 2IEZA 4RTPA 4WGGA 3BDAA 5EWLA 1DZ3A 1O96A 3F2VA 5SZKB 2B25A 3P26A 1QFYA 2C83A 4TX1A 2HMAA 2OXEA 4GX1A 3NTVA 3HDVA 3COVA 2H1RA 4QTUB 1BS9A 1D4FA 4R1TA 5E1BA 2OCAA 3RSGA 4DAOA 4H1UA 5EIEA 2PZLA 2Z3ZA 1TAGA 5JCJA 1F8UA 3EXIB 1QU2A 2WUGA 3CMCO 1Y8RB 1USKA 2H9IA 3Q6MA 4FDTA 1U0HC 1NRIA 3F46A 1Q12A 4OFBA 4O3FA 4V0OA 1IQRA 1USVA 3CZAA 3EE6A 2QJFA 1PLLA 5A9SA 5BN3A 4GWGA 3TXYA 2AN9A 3HA7A 3LP5A 2Q2NA 1Z6ZA 4K9DA 4XVHA 4EI8A 2G76A 1T6XA 4HVTA 1X13A 3E2MA 2EW1A 1JHRA 2XCUA 3PD0A 3BJRA 5H16A 3IMCA 3F2IA 1ZK1A 5EZQA 5G40A 4H3SA 4MW9A 3KKZA 1XR3A 3KB2A 3LCCA 2JFVA 4O5OA 1AXRA 4MPRA 4PLFA 2BTQB 3IIMA 2FKNA 1XPJA 2ZYHA 3NM5A 3SHTA 4OXXA 2GMWA 1L4YA 3TCKA 2V0CA 5B2FA 2FA9A 4IYJA 4AURA 2AD5A 3C6KA 1Q17A 4NR0A 3PFFA 4TWIA 3FCSB 3AVTA 3C7KA 3PRYA 3CLSC 3DWFA 4KQEA 2GAIA 5KMGB 5D7NA 3P1JA 4E5UA 2AE2A 3OUUA 3CWZA 3IA7A 1QIIA 3KEQA 1BVRA 3S2FA 1LU9A 5AW7A 2WD8A 2AMVA 2DJ5A 2NGRA 2XPCA 4IFIA 1DCTA 4RS3A 5HX7A 1LLUA 1FEZA 3R6TA 4RV5A 3UW1A 3C8MA 1BHO1 2DY0A 4W6QA 1ODSA 5DE3A 2CVPA 1A5AB 3C6MA 4ZO8A 5CP8A 3PTZA 1RLJA 5J5CA 1ZHFA 1L8XA 2C29D 4IIXA 3TRKA 2YVLA 4UNQA 4GOND 5B6JA 2J48A 2VK1A 4BYGA 1GITA 2Q46A 5A3RA 2CNNA 3ND6A 2W00A 3EAGA 4AY2A 3E3AA 3GVIA 4FC7A 1RDFA 2XIJA 1Z8NA 2RGWA 3WMWA 2GVNA 2ZANA 4UEWA 1VBMA 3I37X 1XPUA 2ESRA 4P7KA 3WGKA 2QZPA 3T7KA 4Y9SA 1U2EA 3KXIA 1H3EA 4XRRA 5PNTA 5KX5F 3HABA 3MMXA 3CNEA 1RQ7A 2FQYA 4NOJA 4FD3A 1GARA 3S55A 2F00A 3EPJA 2FTKE 3ZYCA 2Q0HA 1K27A 4D3ZA 2OORA 3SC6A 2PUAA 1KFKB 3PXDA 2G4CA 4EG4A 2JH8A 4KDRA 2GBPA 3OJFA 1AKQA 4IG4A 4WT7A 3NWOA 1BVUA 1UDXA 2QGZA 2X4LA 1HQKA 3H0EA 4TXLA 3EVEA 1KE2A 4BIMA 1Z5WA 2AMYA 2QAGB 1T1IA 3O1JC 4OHCA 4D9JA 1U0OC 4EQZA 3FVRA 1KRXA 3UYKA 3NHZA 1VG0B 3PNQA 4FHCA 2P1RA 3JARB 4YAOA 5JTUA 4KSYA 3GOHA 2CUTA 3SEFA 1YQXA 3HTXA 2Y6VA 1SA0A 2Q3DA 2RCYA 1OC4A 3BEDA 1NBME 4GPEA 4M9RA 4RF3A 1UT5A 4F3CA 1REQA 2HJVA 1JG4A 2UVDA 1ESZA 3A9TA 3UH0A 2PX2A 4CM6A 4EFDA 4Z1MD 4CF7A 2OYSA 3R3SA 4J6FA 4KGXA 4QUHA 4BNGA 3H9BA 1AQNA 3KOMA 2OGZA 1MAAA 2DSNA 1D4OA 3DM9B 3IQZA 4JXKA 3VR5A 1ESMA 2FPUA 3WY9A 2FPXA 2V7GA 4J0FA 1KJYA 3MCTA 5H82A 1ZD3A 3R0XA 3VPHA 1JIUA 1BDMA 1BH2A 1GTJ1 1UWLA 3OE7D 4R2KA 5FRDA 3TW6A 3HA3A 5CYPA 1HE8B 1W76A 2V55B 2QP4A 4DZTA 4YP1A 2M6KA 1L7PA 2VQ6A 5KYKA 1IDN1 4LBZA 5IRCD 3DXFA 1GNPA 4YLGA 1A5BB 3EDOA 2VL7A 5LYJF 1HX7A 1KOJA 1Y6JA 1Z06A 1MNAA 4DHEA 3DNMA 1P39A 3I01A 3PX2A 2RB5A 2ZE7A 5ES3A 5CB8A 2OKCA 4B3MB 1SXQA 1WB6A 2D3WA 3PHBE 2I2AA 3MBIA 2AEEA 2CLHB 1RMYA 2XGSA 3RM3A 4BE9A 3RT7A 5LUAA 1YS2X 2OFPA 3R3VA 4Y2YA 5A9RA 3U37A 4YH1A 1VHWA 3NOOA 5FL3A 4CCSA 4TRRA 4N48A 1F38A 3IKVA 1GL7A 2EG5A 3NP9A 4DPKA 3LSYA 1LS1A 3HO8A 2A9VA 2A5DA 2ERYA 4AKEA 4EOGA 4HGYA 3AIKA 4TVBA 3WMRA 5JC1A 2OPHA 5KDLA 4XWOA 1KO5A 2HAEA 2R48A 1XELA 1CUIA 3E15A 2WNIA 5CB4F 4HEHA 3L0IB 4JXXA 2BM9A 1A9XB 2B21A 2FMIA 3AV0B 3JAKB 4W99A 2OCGA 3OURA 1R7RA 1ZD5A 2WM9B 4PTYA 2B37A 2NNWB 2XLCA 3C16C 1QF6A 721PA 2ZBUA 1LX6A 1QK3A 3FIJA 5KDDA 1U7ZA 2BBWA 5G0SA 1JG2A 2O1SA 4HQNA 4LX8A 1GPMA 2AT1A 3FROA 4NNPA 3GLGA 1CF4A 1UFVA 1UBSB 5CDSA 3PVZA 1Z15A 3JAWB 4MQUA 1UBUS 2KW5A 4H7HA 4IXNA 2WJ3A 5KYVA 2GDZA 2GM5A 1RKQA 3L18A 3PIRA 5B3JC 3ECSA 4GT1A 1Z37A 3BOSA 4UUAA 4IHAA 2AXPA 4J1SA 3ZHSA 4HRYA 2XMBA 4ND7A 1B4DA 2PG3A 4LE0A 4TYPA 1E2MA 1Q7CA 2C03A 2ALJA 2GZRA 2Q4RA 1WOYA 3DZDA 3RYHA 2JLVA 2GESA 3H1EA 5KNCA 3MWLA 3IEXA 1EIZA 2HCBA 3IILA 1YS6A 1QMPA 1W85A 3IPXA 2W6ZA 1O5TA 2WWGA 1L4EA 3T0IA 4ZI3A 2A9JA 2GHIA 4MVJG 1GGVA 2QYOA 2V6JA 3IP8A 3OX4A 4L5CA 4Z0TA 5C81A 4XXHA 4YJ3F 3NGXA 2W43A 4DA7A 5T41A 3ONVA 2ZUSA 3N75A 5LOVA 2GD0A 3P2OA 4ZJUA 5LP1A 5AQ1A 2VH2A 3ZI7A 1I2DA 4MDEA 3LHKA 1W5BA 2X7HA 3CT6A 4DR6B 3BAZA 1IOLA 5F2KA 3C70A 4V1CB 1H2AS 3D4BA 4P9NA 1D6SA 3FVQA 4EJ0A 3K70C 8AT1A 4Q7KA 1XRSB 1E2GA 4K9SA 4MV8A 2IU3A 5JR3A 3F74A 4DLSA 4HZUA 4CM9D 1HXHA 1NOIA 3PCTA 3RRFA 3RO7A 4CTMA 4JBHA 3H9GA 5LMZA 3BA6A 5G02A 1RKXA 4R4JA 1F8XA 2V7PA 3S68A 4J1QA 2IPOA 1A9QA 1AGNA 2NVUA 1Q1BA 1VHDA 4J0IA 3CHYA 3LQRA 1B1CA 1J7KA 3UO8B 4I3GA 2JCSA 4CXMA 1NKTA 4GMHA 1QYVA 2VSYA 3SR3A 2A9OA 2C88A 3UOAB 3ROKA 3RJMA 4CGZA 3LY9A 2GILA 1Z73A 4M3NA 4ODIA 1RPTA 3M34A 1HFJA 5F3WB 3HJRA 1R0KA 2ZK7A 3MPUA 4J7CA 4KC0A 4NX2A 5SY4A 5TS2A 5LDDC 3H4IA 4AF8A 4BAUA 1FJ2A 3HVHA 3KTAB 1V5EA 2VCEA 1U11A 3L01A 1NOKA 1U9ZA 4DLLA 2FOXA 2VSFA 1EESA 5E1DA 3U4HA 1ZMTA 1SU6A 4ND8B 1A98A 4HWSA 4P3KA 4BLPA 1T3TA 2FI1A 3HNOA 2YXDA 3PNMA 1O95C 3E27A 3BWEA 4J1NA 2AOUB 2FUG1 3G8BA 1H3NA 3GAAA 3HP7A 3L7JA 3Q88A 3QI7A 1CR1A 1NF9A 5JSZB 5A0VA 1YS7A 4MSUA 3E1GA 2A4MA 3MSCA 1OXVA 2IBMA 2R66A 1N2XA 5F9HA 1DOHA 2BKXA 1CV2A 4HDSB 3LX6A 2GCIA 4XH9B 3WGIA 2C8JA 1SKYE 4QYIA 1NW8A 2PCLA 4IKEA 1WETA 4Z8YA 3TQCA 4U0KA 4JLDA 3OFND 3JASA 4A6DA 3PNSA 3EEIA 4JNCA 2ON6A 3MOGA 3OY2A 2H00A 3E9MA 4LHSA 4ASUD 3T3NA 2Q5JA 1VPVA 4PX9A 1XXHE 5IK2A 1FSFA 3NO4A 5FPPA 5AHKA 3I9KA 1CUXA 2ZEJA 3TSWA 4PE5B 1Z0IA 4YT8A 3P96A 2XDQA 1O5IA 5HRUA 1UOEA 3P7MA 4PYRA 3WNBA 4U39A 2W4QA 1Z4JA 1ETUA 1JHVA 4F6RA 3ZKAA 4GRIA 4E4YA 1ZJWA 5L6LB 2XYGA 1V1RA 1KSGA 3WE7A 3P71T 4OJQA 5J40A 3ZHQA 1P31A 1W0KD 3RRBA 2OC9A 4BGIA 2ZB2A 4KV9A 1EFPB 4N5MA 5K1ZA 1JW9B 1DBPA 3MWJA 4IYRA 4EB8A 1CLEA 1Q1QA 3IUJA 1SXPA 4BZWA 1JKJB 4BQPA 1UINA 2ECQA 2BAGA 1II0A 4ZYXA 4D7AA 1PR9A 2GTPA 1I3CA 1GNSA 3Q3VA 4G0PA 4MHOA 1L1FA 4A8PA 3L41A 3AHEA 3EXHC 2VF4X 5BOSB 2G0AA 3TFQA 2YWGA 4JVSB 1G21A 4RJLA 2MR5A 1U6JA 4C1NA 5IC5A 3FNRA 1Z2AA 4BFWA 4UXJA 4IIVA 3E82A 4ZVMA 5DGDA 1V8OA 1A1VA 4Y1RA 4FR0A 3FDFA 4D74A 3NAGA 2VHEA 3CEJA 3OEHD 4MI6A 3RS2A 4BC1A 5KX5A 2RHJA 3VZCA 2ZDGA 2Y0DA 2BR4A 1BROA 3PR2B 5ANRB 1AUOA 1UPUA 5CW1A 4INZA 3H13A 1L4NA 4I6EA 3UA3A 1KVUA 2XNCA 1WDWB 3LWZA 5A9TA 2XCSB 3FUTA 4O4LF 4Z0HO 5K3FB 3ZGLA 4F4HA 1HDXA 7ADHA 2R5NA 3F96A 4QUEA 2IVFA 5EPUA 5F7ZA 4JLSA 3P9XA 4YDHB 3ABOB 4MMXB 4DMGA 4Y9DA 3FMOB 4RLHA 3VU9B 1Q1AA 1TUIA 1PL8A 1XZBA 4DQUA 4I4NA 5B7PA 2PH5A 2Z5FA 1VG1A 1RYMA 1NNI1 3SSAA 2G9UA 2AOTA 4F9TA 3AYXB 1IONA 3AVOA 1PF7E 1LFAA 2GXSA 5AJTA 4QGSA 1N9ZA 3WA7A 1EWVA 3F8SA 5DASA 2C8LA 2OQRA 3D8SA 1E1LA 2P9HA 2PT9A 3UWKA 5ESXA 3O8CA 2ZRPA 1SKYB 4WBNF 2ZTMA 4EGQA 1P4GA 4YCSA 4CI0B 3ZV4A 3K94A 4UCQA 3TB4A 2BSAA 3I04M 1IM2A 5B4VA 2UUBB 3TZQA 4OIMA 3B38A 1GWNA 2AEFA 2CXPA 2FWJA 2IYWA 5D01A 1NONA 1YJCA 2AFVA 5HDQA 2WKWA 2Y3IA 5T4HA 3KQNA 5IXYA 4YGXB 1K7XB 1FTGA 3QX7A 3FYSA 3G1WA 3K1YA 4IMJB 1CE8B 1FQJA 3ESRA 4GI7A 4ZEVA 5EJ4A 1L5GB 1VSBA 1CJUC 2PCJA 5LYJA 3X1ZA 4DCMA 2WOOA 3CZRA 2G7ZA 3QPAA 3GH1A 4LFCB 5AJVB 4KGDA 1WPXA 4A5SA 1JAZA 3F49S 2DQ4A 3S2ZA 3JWJA 2PKQP 2IUFA 1TM7E 1Y3HA 1C9YA 1Z4OA 1ZNQO 1YR3A 2CXUA 2PSSA 2VTDA 3E9NA 1XZFA 3IVGA 2VRBA 1XZNA 4Y6PA 3RBXA 3T0GA 2E5LB 4UFOA 3CUSA 4UW9A 1S2MA 1HE5A 1E63A 2G04A 1M83A 1PZHA 1VHLA 3JPYA 3ZHCA 1XN4A 5C4MA 3EXHA 3RK1A 3QPUA 1M5UA 5FJJA 3GEHA 4EJMA 2WPNA 1OLUA 2REQA 3DD5A 2NO4A 3N8KA 4FC6A 5KJEA 4BV9A 2G63A 1UT6A 4P3XA 4RY9A 1Z26A 4OQ4A 1UZLA 2YW9A 4ZICA 1SVUA 5I7RA 3PEYA 4ZOEA 1B6SA 2FQXA 1SJ9A 3SZLA 5BVGB 5HF9A 2XWJI 5CB4A 2H16A 3NORA 4J4BA 3TXXA 1R9MA 3D8RA 1H0SA 4V03A 4A2CA 1Y9EA 4TTRA 4MVJE 1W4ZA 4D3DA 1YU9A 2NVWA 5EXSA 3KFVA 5H81A 1UBHS 3OQIA 3DB1A 5EESA 5IDVA 4M8NE 3SP1A 4B79A 4GYKA 4JFRA 5T57A 4KKXB 4DRXB 3ICEA 3VR0A 2OZVA 2BSXA 1OLXB 3HWX1 3M82A 3V4FA 3PQ2A 3DBOB 1DBVO 1G0OA 4RULA 2CDNA 1MV8A 4ZVUA 1EK6A 1WLSA 4ZZ3A 3CONA 3U81A 1E9BA 1L7OA 2Q1UA 3AH8A 4JBYA 2JGEA 2H1IA 4DGQA 2IGBA 4CI9A 2FRDA 4XGIA 3E03A 3CLTD 4HLUC 2YDYA 1OX6A 4DF3A 2A86A 1G8HA 1ZOIA 2WABA 1C3LA 2XE7A 3QFCA 3LLCA 4NYIR 1WUTA 1GZ4A 4R84A 3SOPA 3M81A 1OI2A 4GVPA 4UU8A 1V7PC 4EUNA 1R8JA 4RD1A 3D64A 2A8YA 4OP3A 1NXQA 4GECA 4YRJA 2MSLA 5LQNA 1QTNA 4MR8B 1FJXA 1Y3CE 1J2JA 1VL6A 4XRGA 1RWVA 1QQ6A 2XRFA 5J58A 2EKLA 4L76A 2BL4A 2I65A 4YJGA 3CZ5A 3OM8A 3G0HA 2H54A 4RCYA 1SC6A 1SCAA 3ROXA 1PK9A 2K6GA 4YJ3A 5I47A 4JOSA 2BH2A 1LFDB 2FEWB 3PHIA 1GR1A 1YQDA 3PZBA 4LYHA 4X60A 4AG3A 4F5YA 2JPDA 4TLBA 4TKMA 5JOQA 2EKQA 1KDZA 4JIGA 3RT9A 3ZXSA 4DSAA 2JBHA 3IIIA 1DWOA 1Y5IA 3LP8A 4O1HA 4G0QA 4DJJA 2RHHA 2ZU6A 5L4SA 1H8HA 4ZGGA 5FWYA 1RABA 3QLTA 4IQFA 4KQ1A 3F3SA 1Q21A 1Z6AA 3E0XA 3VTFA 3CYFA 1VCIA 2GPNA 4WUTA 1O4VA 1F0KA 2A0KA 3QPDA 3V7WA 3VYUB 5FLEX 3BHJA 3FVWA 5FXMA 4BQEA 1OZAA 4BNJA 4WH0A 1TEZA 4P84A 1AZTA 2HI0A 1PSZA 3E3NA 4O1IA 1TEHA 2IYSA 4QNRA 4EARA 4PIPA 2JI8A 3NRBA 1M8FA 4G3XA 4KRXA 2KBFA 3GLHE 1QOQB 4I36A 4WOBA 2XOEA 4CMGA 1IY9A 1A04A 1XALA 1I4WA 3TVTA 1DC3A 3VYWA 5CFRA 3K5HA 2I4NA 3KOZA 2V5UA 4GR4A 4AXXA 1NG9A 5HUJA 2BZ0A 2C95A 3P20A 3T54A 2XXBA 1AKMA 5EJ2A 3UJ6A 3VBEA 3VU3A 1ZMRA 1BMFD 2C0PA 3C0KA 8OHMA 5BW5A 5IMBA 2FX2A 3D4OA 1AQYA 1KEEB 4K2HA 4Q1VA 3UV7A 2O8DB 1KMCA 4J9UE 4RGQA 3KQYA 4U7HA 5IW8A 3U3OA 2WYIA 2GS9A 5D3QA 1VLVA 2ZU0C 1KEWA 1UMBB 2ZCVA 4ZU3A 1X1BA 2XQKA 5G4KB 1RAHA 2ZAOA 1FP2A 2ACVA 3ZCVA 2FK7A 4CBVA 3BH0A 2AG8A 2AXNA 4FOLA 1PNQA 3ZIUA 3EG5A 4PQRA 2ZI4A 3VDMA 4WY2A 3DCJA 3ZBPA 1KDRA 5HK9A 4PVDA 2JGDB 3DEKA 3M6MD 1B3RA 2A1TR 1W4AA 4HLUA 4OIFA 4U2DA 5HCNA 3DTVD 4Y2PA 5DW0A 1JFRA 1KJNA 1BRTA 4E14A 4MYTA 4MUFA 2Q0SA 3WB2A 2FPPB 2QRPA 3D59A 5LP6C 3H7IA 4AZ0A 5I9BA 5JRJA 4QQ8A 2PWBA 5E9AA 1AKYA 4E5MA 3CURA 2VWPA 2HQSA 4FUQA 3VHXA 3ELYA 3WB0A 2W4IA 2X9NA 1ZONA 3QMPA 3VAZA 1Z5PA 3CO5A 4U7FA 3GC6A 3PICA 3T61A 3GLFE 4MRNA 4BZQA 3WGGA 3EQ8A 5IX8A 4B45A 4HEA6 1NBOA 1FSZA 2OV6A 1HYHA 4UC0A 3UWSA 2XQGA 4A7PA 4B33A 5LFAA 2VPQA 2ZIUB 1W88A 5D8DA 2C20A 3URKA 5BUQA 1Q20A 3CUVA 3I8SA 2CSUA 1P0CA 1B73A 3DBVO 3FB4A 4MV1A 1B0UA 5DTJA 2WB2A 3THXB 4HOYA 1YQ9A 1ZMOA 2BC9A 2GSWA 2CLOB 3F90A 3S81A 4M7PA 1FTSA 1ECPA 1JR3D 3MGAA 5AYVA 3FCEA 5FA8A 3CX3A 2BDEA 3HCBA 5HCIA 2X22A 5DCYA 5JS2A 3ZLVA 2D0IA 5TEWA 4RTKA 2QE6A 1C1DA 4F6CA 2PLFA 4XEUA 3NBKA 5J1TB 3AI1A 3I9LA 2G71A 2I6QA 4Q01A 3GBVA 3V97A 4H1TA 1XL1A 2D5BA 1X7WA 1WHTB 3SE0A 4KQFA 4BLUA 4EYEA 1ZGHA 4RKYA 2H2GA 3ZQUA 1YVPA 1G17A 2OECA 3X1JA 4JJ6A 1JHMA 1P60A 3AFOA 2BE7A 1CR2A 3MSXA 1UBNA 4RSRA 2QX6A 1SBYA 1EZ4A 4EDHA 1W6RA 2XRYA 2D59A 3KWFA 5J4HA 4AIRA 3D0RA 4QFDA 4KODA 1E4EA 5J5VA 4LV6A 3HJHA 3V5NA 2QLFA 3RBVA 5JSQA 4O4LA 4YRFA 3N9IA 1I5EA 3CVUA 2J3HA 3QHAA 1GFSA 2XNDA 5CD1A 1GTMA 3ORYA 4ZVRA 5LD2C 1PK7A 3BERA 4E5KA 4ABTA 2JI6A 4J76A 1KAQA 1TK9A 2PXXA 3UK0A 1GV1A 1BX1A 3S2IA 4KXVA 1Z6TA 2MSDB 3W5UA 5JECA 4JLWA 2YBEA 3H8WA 3P2KA 4MIOA 1DADA 2AL7A 5EL0A 1T5SA 2FHPA 2LW7A 3Q5GA 4MEBA 5I7VA 3IT0A 1I9CA 2AG0A 1E8MA 2PJDA 4G0OA 4I1OA 4IXDA 2KB0A 2JCVA 4O59O 2P2DA 1JWBB 3GJZA 1VOTA 3ILSA 1J25A 2WVHA 1KK2A 4R9RA 3RKRA 4BVFA 1E3TA 1RJGA 3FR8A 4K40A 4L8VA 1MG0A 2AYZA 4P7JA 3SIXA 4WBNA 2G77B 4DKJA 1GQOA 4RCVA 1GGEA 3GUCA 4A8JB 4JENA 3U4AA 1LCIA 1TVEA 4G4GA 1F7VA 2WJ6A 2RHGB 2EYUA 3TJMA 1U8EA 2QQ5A 4MTCA 1U3GA 4TXNA 3I09A 2G8NA 3PK0A 2VP5A 3SKVA 5JS6A 2E49A 13PKA 1XZHA 3N76A 4FEAA 2SKCA 1U8FO 3IUEA 4ZQCB 1TMGE 4C01A 2QTAA 3GLFB 1Z2CA 1WPGA 1Z62A 2QT1A 2ZYWX 3B20A 3D6AA 2H9YA 4FINA 2ZB8A 3TLGB 3UFBA 4AZ3A 3ZCPA 1BKSB 1QTRA 1V0JA 2VDQB 4UNPA 4BZPA 2ZJBA 3OT5A 2NYRA 4BB5A 4BBAA 1YQEA 3K92A 4EUKA 2H0RA 1OU0A 1NU6A 2YHBA 4ATNA 2BFDA 2GCGA 3KLPX 3Q8XB 2BFFA 3H8JA 2J46A 3N7UA 5EZYF 1C30B 4RXUA 2NZWA 2B8JA 3GEGA 4XGQA 3ROPA 1S7CA 1IBLB 2O3RA 4DMKA 3DT6A 3E7XA 4OHYA 3PITA 5ECYA 4UPDA 1SXJD 3FTPA 3R44A 5YASA 3B8EA 2FLWA 5A02A 2KLBA 2WWTA 5E3HA 1MB2A 2NUTA 2PBZA 3FTDA 4URXR 2H85A 5A3SA 4N18A 1Y3BE 5CA1F 3HLTA 1WU7A 2RB4A 3A37A 3QKTA 3EBPA 3X1KA 4D92A 1BMQA 2ZE5A 4M0CA 1E6CA 2IOYA 3TS1A 3AG5A 3UWOA 1MQAA 2BFMA 2R8YA 5KJ1A 1G8MA 3N6XA 1ZLXA 2HD4A 2I22A 1LQ2A 3I2HA 2IW3A 3O1IC 5JD5A 5CYFA 1XX6A 2VHJA 3CU5A 3QWFA 4TN1A 4OG2A 4YP5A 3PSHA 2QGFA 1EDDA 1I3OA 3F7OA 5DULA 1UWVA 1C50A 1Q11A 2B8NA 2VBCA 3ANTA 3R6GA 4N9WA 4UAJA 5DPMA 3V3TA 3AR4A 2UYCA 4TYWA 3QV2A 5CK5A 4LG1A 1WMAA 4J16C 1XRLA 1U81A 5KOJA 3EA0A 1TX4B 2UZ0A 4ROSA 3ZEIA 16PKA 1T5OA 1BQ4A 1MVNA 2ODQA 2PA3A 3CRVA 1TD1A 3VOSA 3DE3X 5BMVB 2P1DA 2A0FA 3WHKA 1ZD8A 4XJVA 3E53A 4ER3A 3M6IA 2ZJ4A 5BNZA 3MVEA 3NATA 4I50F 4EW3A 1FY2A 4PG4A 3UXMA 4BWFB 2OBMA 3ZDCA 1F7UA 5E6SA 2GD2A 3DHWC 4PG7A 5C1BA 1E1DA 1G20E 2I3BA 4DG8A 2J5XA 2CGEA 2XVYA 1I5RA 1OKKA 1LC0A 5DEIA 2JD1A 4HDAA 3QA9A 4KR0A 3F9IA 5THXA 5JBIA 1RAGA 1PKEA 4B6SA 2HRCA 4LNUA 4MJXA 1U1IA 2YUIA 4JJ4A 4NPHA 4OBEA 4QYXA 4ER5A 3HJAA 1SBIA 3V8VA 2WAMA 2P69A 1R4ZA 3ETNA 2ID7A 2WWHA 4JJKA 4EQ6A 4B4WA 4RAOA 5CNIA 3ILVA 5FDFA 2XCRB 4G07A 4IOMA 4Y7DA 3BB3A 1Y4UA 2HY7A 3KX2A 1KU6A 1JDPA 1VE7A 3P32A 3QPBA 3KU1A 2QN9A 3WGMA 3A3NA 5DB4A 5KPDA 1KI9A 1QVAA 1JJIA 1A50B 3QX8A 4C7JA 2FQ1A 3PEUA 1II8B 3BDIA 4RIGA 3D6UA 1OZHA 4P80A 1DHRA 2OWDA 2XQIA 1HT1E 4AUNA 1H93A 2GGSA 2ZRLA 2HPZA 3LUBA 3H9QA 3PR1A 4IVNA 1Y6ZA 3BWDD 2Y9PB 3IBYA 4M0EA 2BEWA 2OTCA 2WZDA 2BGUA 4QPZA 5C53B 3FH0A 2BM8A 4KVZA 3DDNA 3LDGA 4TT8A 4FMDF 4XJXA 2FW0A 4EG0A 5CNJA 1ZC4A 3T7SA 4LVOA 1AS0A 5G1PA 1T1EA 4RPGA 1EXVA 2OCIA 3SLGA 2B9EA 3BIXA 2C9CA 1WQ1R 3RFCA 1BYIA 4FHEA 1HYBA 1N9KA 4UNSA 5K0BA 4YP9A 3ZQJA 1EK0A 5JWOA 5FI0B 1EXMA 2AYXA 4E0BA 5BWBA 4PCLA 2ZTVA 4OU5A 5K45A 3K0HA 4A73A 1IG0A 1I94B 4DWVA 2KHZA 5G3YA 3R5SA 5L3SA 3O6VA 1PR1A 1X80B 4I66A 4Y6RA 3ZXIA 4G1CA 4AY3A 4N01A 1QH1B 3N58A 3RVKA 4XSGA 4HAXA 3ULKA 3V33A 1X14A 3X1XA 2JDIA 1QTIA 4DUZB 3BH7A 1MEJA 3H05A 3H2GA 1MB3A 3B2QA 2HWWA 4KKVA 4L5IA 5JWHA 2Z83A 3QVKA 1X1RA 2XI4A 1U99A 2FK8A 3A06A 4IJVA 5ILQA 3WA6A 3FCAA 1BJKA 2QNRA 1X3LA 3HI4A 3HZRA 3PLRA 1AKNA 2DZDA 2QLLA 3ELDA 4J16A 1Y7IA 4C4ZA 2GYWA 4TQAA 4RDXA 4H7FA 4I3FA 3DF9A 3BHMA 4PPGA 1XJCA 3RSSA 2E48A 2O0JA 4RGBA 1QQAA 3AUXA 3C48A 3A4VA 1HI9A 3CUEF 3G2IA 5HJEA 1W93A 2O0MA 4JYCA 4OXYA 1A9YA 3K6RA 5K01A 4LEIA 1JYEA 2OBBA 2XYHA 3BICA 3MTEA 2YV2A 3GDOA 4I4TB 1AXGA 2WFLB 1JA9A 3UK1A 2GD6A 2QMZA 1OSNA 1RAEA 4LQLA 3CUKA 3U7HB 2AXQA 4GE0A 1XUOA 1ZMXA 1W5AA 1ZAYA 3LE8A 3RASA 4CCYB 2QTGA 4O4IF 4WAUA 2J45A 4OQNA 2PSEA 3WMFA 3ZY4A 4X93A 2I6UA 4MWEA 3X1YA 4IDGA 2P9FA 5I6DA 3EZ2A 1NURA 2Q3LA 3R3HA 4FDAA 5IU6A 2DHEA 3NG1A 3Q3HA 5CFQA 1J56A 2G80A 1NHWA 2OD7A 4FHDA 3DXYA 3RVSA 4C4PA 5AVJA 3WGZA 4RCZA 1ZRNA 3HFJA 3DDWA 3WP1B 6ADHA 1MZVA 6LDHA 4U2EA 1DIRA 1JMVA 3RHSA 4II2A 2PJUA 4RIFA 3U3KA 3B8HA 1OFUX 1QKJA 3RCBA 2QF7A 4I5GA 1GKYA 2B4QA 1LY1A 2YJ4A 2YS7A 4PZEA 5KB3A 1J9GA 3FGOA 2WF5A 3S1LA 1XKTA 3H1PA 1A4XA 3REQB 4RZ3A 1XL0A 3PWKA 1SCDA 2Y1CA 5SY6A 1KMIY 5CX1A 3VSEA 4B46A 4Y2JA 2O0KA 3FD8A 4OBBA 4WQMA 1NJ2A 2EGGA 2DCUA 4HDOB 4PIMA 1ZK0A 5LQCA 3RVNA 3FMPB 4UE2A 5CJPA 1JX6A 2PX5A 3IAUA 3E8SA 5AXBA 4AYTA 4D0SA 1KXJA 2NACA 1I2ZA 1AGXA 3I8OA 1Q22A 4HGZA 3BIFA 1YB2A 1NYLA 5KOIA 3VU8A 4NU5A 3KOWA 4WESA 3N2GA 4FE3A 2XA1A 2DUUA 3K35A 1XA0A 3TQQA 4G0UA 3Q3CA 4L6IA 4FX2A 2A2ZA 1QHFA 4ID3A 4NOKA 3RIHA 4QEKA 4QXPA 2IUYA 3QXGA 4A0HA 3RK4A 3Q0TA 3BS4A 2GCOB 6AT1A 2BI7A 2P30A 2CD9A 2CLMB 2FDXA 4DRZA 1DMSA 1ZCFA 2NSDA 2HJSA 3B6KA 4HF7A 3SG0A 4E4RA 2JFUA 4KAFA 4ZA2A 3KSMA 5DDIP 4TWBA 4V0NA 3C3KA 2NU8A 2VYNA 4XDYA 4LFAB 3TL3A 1C9JA 2F1RA 5C5CA 1GUBA 2K7ZA 2I7XA 3ZCUA 5AKEA 4NDNE 1QZZA 2R1VB 2X8AA 1AA6A 5AD1A 5AUQA 5C2JB 5KOHA 1RADA 4IHQA 3FJOA 2O23A 3QELA 5DFAA 1KC3A 2WJAA 5D5QA 2CNBA 1NW7A 1PL6A 1UEIA 2DY1A 5DTMA 4MTLA 5DRYA 1SCBA 3L7IA 2WPDD 3T41A 4E08A 5AW0A 3VR4D 1AF7A 3TJZA 1VIAA 1WDLA 2FMXA 3L4SO 1CJCA 4NBSA 5EJ8A 3CWQA 4J90A 3VNUA 1XTQA 3ZGYA 3IPRA 4Z5XA 2OZPA 1JHUA 4XAQA 4C5BA 1Y63A 4C2TA 3O2NA 1M0WA 1D2CA 1CUUA 4WZ6A 3KDPA 2OPBA 1ZJZA 4U2BA 4R3NA 3AERA 3QFFA 3PNVA 2X0KA 2ZRDA 3MAAC 1PQUA 2NPIA 3LCVB 1R4NB 2OXIA 5C3UA 2MSWA 3B51X 2FSPA 4KCGA 4LDJA 4MK4A 5LZ8A 1IVSA 1M7GA 1BCSA 5WRFA 1RLIA 1SMKA 3OO0A 2WIKA 2VUSA 2BFEA 5JZVA 1PS0A 2IYEA 2HQ1A 1OBVA 2XEDA 3NQ41 4FNMA 2B8WA 2BMFA 3LOQA 3U61B 4HDKA 4DTIA 4E51A 2DG2A 2GZ1A 2QU8A 4GVXA 4PWZA 1XT6A 1GY8A 4M0LA 4WOPA 1V26A 4R68A 1DQNA 3O2SB 1IJKA 4KN9S 1AC5A 3BVPA 5FAXA 4A16A 4BGVA 3M89A 3UAWA 3I2GA 1OX4A 1SB8A 2AC4A 2I29A 4LSMA 2OXTA 5CA1A 2P78A 4TQGA 3BMQA 2VWHA 1TYEB 5ADHA 3S7TA 1F5NA 3N6RA 1XI2A 4GLLA 4KBGA 1O94C 3WLTA 3EDQA 2VNKA 2E2WA 4CTNA 2ZCJA 1JG3A 1F60A 1F9EA 1NVVR 1P1FA 4X61A 2NT3A 3ADCA 2PKWA 4AKHA 3IHWA 3WHLA 3E81A 4ITVA 1QQBA 3EH1A 3BTOA 4J0HA 1KBZA 1RQPA 2C5LA 2JZOA 2KX7A 3LY5A 2W42A 1HNZB 3WQSB 1Z3IX 3CIFA 5EWMB 1PL7A 3RLFA 5FR2A 4NI5A 3DDUA 1PSWA 4UATA 3OBBA 2X1VA 1V5FA 2J3QA 4W9RA 1XDWA 2BJWA 3FWHA 3ITNA 3MGKA 4G0XA 3AESA 4DNXA 3EASA 1A5TA 1N8TA 4Y6QA 4GSYA 3OMWA 4PRZA 2I4IA 5IVPA 5IVDA 1Z88A 3EIQA 1E1QA 4M6WA 4MEAA 4BP8A 1GT6A 2GPJA 1KAMA 4I50A 4RTLA 2NAPA 2OL4A 2ONYA 2GJSA 2Y66A 3IKJA 3O0TA 3QEMA 1CC1S 3A36A 3ONEA 1W30A 3HV2A 4FMCF 3WTCA 4XM0A 4QU8A 4JJFA 3NHPA 4DMFA 1K2WA 2IE0A 3FNIA 3Q4GA 3ES9A 3GN1A 4TXHA 2ONZA 1T5HX 3AKDA 4RPCA 5GPBA 3OPMA 2FPSA 2X8LA 4C3UA 2DWQA 1BN6A 2HA2A 2OMEA 4FDVA 1KGDA 1XEFA 4JQZA 2C1ZA 2XVZA 1JEYB 1OWMA 3QEKA 4D4KA 4R5MA 3UTCA 3DE7X 4WD3A 1D6NA 4XWAA 5DI3A 1YQWA 1J7JA 4DIFA 1CQPA 4W8GA 1N5MA 1XDUA 4Y2HA 4DLTA 4E15A 1T2DA 3KM0A 4JFAA 3QK7A 1QV7A 3AETA 3REGA 1RZVA 1XZLA 3EIFA 2BMDA 1GG9A 1GSHA 2E4AA 3JD0A 1BO6A 1C3EA 1FNSA 1K97A 1H9AA 3D1VA 4Z7OB 3JVIA 4J0DA 3ROGA 5L4NA 4GL4A 4BWVA 2FFBA 1IEXA 5DNEA 5F3RA 3ZLJA 3D4PA 5CM8B 2ACKA 4IJUA 3ZU6A 3ORSA 2QGNA 1FSSA 3LHFA 2XUIA 2R7AA 3TL6A 2VBGA 4KK3A 4TL7A 4KR7A 4CQMB 1PG0A 5JYBA 3L43A 3LBHA 1Y3DE 4XASA 1J22A 3FTCA 4LVUA 1Z0KA 2P4SA 4QJ3A 2E4VA 5A06A 5LWHA 4V0QA 1Y82A 3EXAA 1IZYA 1JR4A 2JJYA 1P2UA 2X86A 2IHTA 3PIIA 1CJTC 1GO2A 2Q7DA 5IFKA 3O4HA 2OZLB 5I01A 3D9QX 1X8LA 1GZ6A 1WZUA 2FSHA 4LXGA 2JFPA 1C3VA 2H5LA 4MV5A 5AJUA 4R40A 2B20A 2JFQA 5BWOA 3M4ZA 3AZQA 5KTOA 1TFRA 3BBLA 3LBYA 5LU8A 4CT0A 1D9XA 5DXAA 1O94A 4TVOA 1KXZA 4BGDA 3EGIA 4K9NA 4IUCS 1JFVA 4YRIA 2JAHA 3LM8A 4PYLA 2Q5CA 1U5BA 2XB9A 2C2KA 3FFBA 1ENZA 2W2LA 2HBRA 3GRFA 2FUNB 5A1TA 1T9AA 1N3BA 3TPFA 3T12A 5F5LA 2OUKA 1LK0A 2DGDA 2H3EA 3L6RA 2ANCA 3EPKA 4LJLA 2X6RA 4ENWA 1E2FA 1ADGA 4NV0A 3N8DA 3JATA 4WK4B 4V0RA 1TXGA 2IEYA 1Z34A 4C21A 3FCOA 4EZEA 2IZ0A 2H2HA 1GL6A 2FPKA 2VF5X 3OH8A 3L2OB 3Q7IA 2BEKA 2VT6A 4ZMBA 1LLCA 1E3WA 2IGTA 1OLSB 3Q0IA 3K0KA 3ZG6A 4B4KA 3V2HA 2VK4A 5AI6A 1L4HA 1JIVA 1IVNA 4UVHA 5BW6B 4JBIA 5HRCA 2P40A 1WMSA 4UTOA 4AJHA 3UAVA 4FOTA 4GUDA 2PTHA 1U4NA 4ZVQA 3DMDA 5K3EA 4B4DA 2YWCA 5CNMA 3ND5A 3BCRA 3AKZA 2C1XA 1OTYA 1FF9A 4O4IA 5AW1A 1NJ1A 1QCDA 2ERXA 3T5AA 1MAUA 3RWBA 4LE1A 1HDOA 1H6BA 1EINA 2YY5A 4MW7A 4PPQA 3DZBA 4Y2GA 4EGJA 5BVHB 4C7OA 4UHCA 3HY4A 1R5JA 2UU9B 1R9NA 4KVGA 1QIMA 5J43A 5IC6A 5LBTA 2XMSA 1A2BA 3L04A 3TMYA 1V1MB 3CW2A 3DL2A 4R2MA 2EJUA 2VH1A 4H31A 1MPXA 2IY9A 3JY6A 5DZSA 2HZ7A 5DXJA 5ESRA 3T38A 1E2HA 4R6WA 3ZGNA 4DEVA 4JWKA 1DKOA 2GN4A 4KBFA 2IZ6A 3LKBA 4BRUA 4HQLA 1FNNA 4Y67A 3B1WA 2EBWA 3RC7A 1EB8A 3WOVA 2CV2A 5A05A 3W4JA 4GW3A 4JGBA 3BJEA 1DQRA 2GFHA 2Y1LA 3HS3A 4EAQA 5HKBA 5ALXA 1WW3A 3IH5A 3RJTA 3WNQA 4W8HA 3G7NA 3GRUA 4U7DA 2WJZB 3GPLA 1L5HB 1T5BA 1Y1QA 5DWVA 5TPWA 4MUXA 5EKXA 5IUNC 5JG7A 1P0FA 3RRNA 4QUKA 821PA 5IJ0A 3I5YA 1T4GA 3UENA 3E18A 4MQ6A 5KNBD 1HNWB 1T5LA 4JP8A 4EGSA 3RR2A 2ZVQX 1DIAA 1YCGA 2ENUA 2EX4A 3BCHA 5LQSA 4QUIA 2G5PA 2VG8A 4BLVA 2PMCA 1F3LA 4N5NA 4U9IS 2B5OA 3NTLA 1PK8A 1Y8QA 1TCBA 2OZEA 1CX9B 2EP5A 5G0TA 5CLGA 4A6XA 5AVZA 5DXFA 3OOEA 4ZDIA 2VSQA 1CZLA 1E7QA 1P7ZA 4QVIA 5DWDA 1JL3A 2XMCA 2OHJA 4RORA 4IIHA 2RHDA 3NIGB 5BN4A 3HN7A 3NGLA 3UIEA 1JU4A 3I8XA 1EGVB 3Q2OA 2C8KA 3RRMA 1L9KA 3ZVRA 3VKHA 2C5EA 4NENB 3K4QA 4JVMA 2YC2C 4O6VA 1ODIA 4AICA 4UTNA 2JCYA 3DLHA 2X77A 4Y2UA 4HEA1 1OYVA 3UFXA 4EHAA 2DQYA 5H5JA 3UNXA 5C18A 4PQEA 2I80A 3GT3A 4FW9A 2QL5A 5K0NA 3PQDA 2Z4SA 4HCJA 1IN7A 2Z2XA 4TQUS 2JLAA 3GNLA 4UEOA 3QEJA 2IT1A 4MPJA 2XBMA 1JLLB 3IESA 5B55A 1X7YB 1YJAA 1YRWA 3QU4A 1J8FA 1XDGA 2Y4NA 4JDPA 2FMKA 2IE8A 3LF2A 3AEKA 3O94A 1XB2A 2OFFA 2DBYA 5I45A 4QTTB 2AX3A 3MJVA 4MAAA 1HKUA 3RABA 3RS0A 2WUEA 1R2QA 3WWDA 4JL8A 4QBTA 1ONBA 3RYIB 1KI6B 2KMLA 1XKQA 3C4QA 1W46A 4X1OA 3KJZA 1A8IA 1PE0A 1KEPA 1WWKA 1H2BA 4KPGA 2IHKA 1XDDA 4Z3DA 3RRZA 3U40A 3QKUA 3ZU3A 4B1FA 3VR2A 1UJBA 1HURA 3A58B 3ZWNA 2IHNA 1IUKA 2W2KA 1P1KA 1L4KA 4NVRA 3C1OA 3UJPA 5I7FA 1RI1A 1RD4A 2LCIA 1KAHA 4OJTA 2AD1A 2QL9A 2C9ZA 2O2DA 3RGWS 1JI3A 4WV3A 3UEOA 4XEHA 3J7TA 3BUSA 4RH1A 3IE0A 1GPJA 6YASA 1OAKA 2R7MA 3TEMA 3CF2A 4MR9A 4AVYA 3DV2A 4L5YA 4FYVA 2HA4A 2P62A 5F33A 4XOIA 2WUVA 2PN1A 1ETHA 1BX0A 1L4GA 2XW6A 1MJFA 3N86A 2H1WA 3UC9A 4UUNA 2WTAA 4LY3A 1X77A 1TCVA 1OBCA 4QU0A 2ZDQA 5CNKA 5DLYA 1A9OA 1UC4B 5K3DA 2QDXA 1AMNA 2OCPA 3T3PB 1EWQA 2G6BA 1XOIA 2NO9A 2OHFA 4X6LA 5JPDA 5A9SB 1P80A 1XYGA 5BN3B 1NYTA 3EUAA 1D0VA 3VPDA 4E33A 1KWGA 1NY5A 2ZRHA 3Q3JB 1P74A 1YAHA 2ODNA 2IYUA 1N77A 2PZEA 3AHGA 2V58A 2F3PA 3IURA 4R1PA 3J80A 3U4QB 1NFQA 1LD3A 1VIMA 2VC2B 2Z9BA 4L4SA 3R7BA 4AS2A 4H7EA 2IQIA 3GT7A 4V38A 5EJGA 2VJBA 1FCJA 2ID9A 4X6UA 4B31A 4ND2A 4LY6A 1D5CA 1P61B 2YJGA 1G55A 2B8TA 3QPCA 2P9YA 3DTTA 3SPXA 3ZD6A 3L5KA 2FUCA 3CVWA 3KZXA 4NQZA 5FO1A 4ZI7F 3ZVLA 2JFNA 3LKVA 4RLQA 2CV0A 4M1YA 1P9NA 3TTXA 2OSBA 5KC8A 1VIDA 4N76A 4WGFA 3VAAA 4AW9A 4UBNA 1CZKA 3WAJA 3JRWA 3C3WA 1YQUA 4RMHA 1ISMA 1GILA 3KUXA 4KUEA 3RKSA 2IPAB 4BQOA 4R7TA 2JLSA 2YRWA 2ZYAA 3ACDA 4FBMA 4I5EA 5EP3A 1DGQA 3MJ4A 1GA4A 3QEBZ 1H6AA 5C37A 3EIUA 2YZGA 3D7LA 5HQJA 1LGYA 4J0QA 5ULLA 5JV5A 1M7HA 1U0RA 2PWZA 1IY8A 2R8XA 4OX9B 1OHHA 2BGMA 3B1KA 2V8OA 1N2IA 3C6XA 4S3MA 4FK8A 3D3JA 5K3AA 1JQLB 1FSGA 3KDAA 1JJ7A 3HXLA 3CEAA 3UW3A 4O0MA 1NQOA 1HF3A 2Y67A 1TTQB 4PNHA 3OOWA 3OZEA 3SZGA 4N65A 3UMVA 5IBQA 2VAMA 3DW3X 4ZO4A 1ZJ5A 1FNCA 4Y1EA 4WZBA 4BVEA 2VUHB 2OEPA 4D9EA 1OFGA 2Y1GA 4J3NA 1E61A 1AQUA 2BV3A 2PZFA 1DC8A 1GLGA 4LS3A 3O92A 3T35A 1QIHA 4IEIA 1MFZA 3FUXA 4ZRMA 2JAQA 3T1QA 3L0PA 4KPYA 2YHUA 4NBNA 4P0PB 4F4DA 1A8HA 1QDLB 1SRQA 1SVWA 3NHBA 1QH8A 1YQTA 3VSAA 4NBRA 2FWRA 3WX0A 1YFZA 4IDOA 3LIPA 4XX1A 2ZVJA 3RTBA 3UWDA 1RC1A 4FS3A 4OQMA 3SNKA 4BBPA 1FRFS 1WY5A 2GLUA 4DBLC 3DVAA 2WG1A 1FJHA 1EJ2A 2Q6VA 3BXZA 2VKQA 2AQIA 1S02A 3NBQA 4JCOA 1LRJA 3F8TA 3NNSA 1U1GA 4QOGA 5CK4A 2XOXA 4IG9A 1FYVA 2XQJA 2FXVA 2W6ID 4PNZA 3GCZA 5JNVA 1JQ3A 2ZLBA 4LZLA 5C35A 3SHWA 3EIHA 1Z8FA 2FZ4A 2WM2A 2XCTB 1SVMA 1KEZA 1VSVA 4EFMA 2LGJA 4MGKR 4GPAA 3T7TA 2RHWA 2BMWA 4HX9A 3DHVA 2CZCA 2O52A 5E7IA 5AXCA 4W9MC 3TCXB 3KKQA 2OCYC 3FRIA 1GGKA 1GQYA 2YJ3A 4XI9A 4EPRA 5HP4A 1REQB 3EGWA 3A25A 4QPNA 5DHTA 4ZQEA 3UT5A 1VGRA 2CFTA 1SR8A 4DYHA 5AOBA 5HIKA 5F1YA 2I66A 1UZUA 1U3FA 1SBHA 3DB2A 5I4CA 5KTKA 3GRCA 5F2NA 3A9UA 1K6XA 1OXMA 3F5SA 4CF4A 9GPBA 2ZZMA 3RUPA 1LS6A 1JIXA 1NASA 2BGKA 4LZNA 4Y0VA 5CDFA 1EDEA 5IF3A 5MFPA 1WNFA 4EMTA 2ZYDA 4AKGA 4DL9A 3M6WA 5A4FS 4HX2A 5F12A 5BT9A 4UDXX 4B7ZA 1D9ZA 1GQ2A 1LPBB 1BE0A 4WADA 4TXMA 4EX7A 3QKSA 1WSDA 3KPVA 3PTAA 2QRVB 3OEYA 4LDZA 1NNLA 5IULC 1DZIA 3A4YA 3C6BA 4GS5A 4Z4FA 5KUTA 4DRYA 1D4AA 1L2TA 3DWIA 3LY7A 3COJA 3MJEA 3MQ4A 2Q7XA 2P6NA 3ESZA 4HDQB 5AIAA 3ELBA 3OPNA 1E2UA 4G4SP 5G1NA 2HF9A 1DXHA 5FBVB 1ESDA 2YVAA 3BCSA 3IQGX 3JQGB 4UTRA 1JDBB 3IP9A 4L16A 4Y2SA 2EBHX 1M1ZA 3ZE9A 3UPDA 2A0XA 4OHUA 3WG9A 2IXFA 5FOQA 4F60A 1HYGA 4N3AA 2NYAA 1OILA 3H5IA 3ENZA 4BRZA 4HTFA 1DAHA 3CPHA 5FPHA 1UBOS 4ZCQA 4UM7A 2J3MA 3VNQA 4BWYA 4POAA 2DRIA 4F1WA 4IKPA 3NWBA 4ZCIA 4RKEA 1X2BA 5I7UA 1LW6E 1TU3A 2P8SA 3Q1LA 4RY0A 5SYNA 5GOZA 1WXDA 4JDUA 4K6CA 4YUWA 1EJ0A 5A7GA 4MS1B 5JSFA 2BMAA 3R7WA 2EDAA 3BX1A 4XDGA 3L8YA 2JLXA 4OLAA 1A8UA 3ESQA 1CQZA 1DO0A 3G9UA 4ZAZA 1S8NA 3GLGB 2Z2IA 4F5DA 4AUEA 1V6SA 2ATEA 1W5TA 3MM4A 3P0EA 3WGTA 3JQAD 3KZ1E 3L8ZA 3A1VA 1XLTC 2JFBA 2XMDA 3PDIA 1CJBA 2NWQA 2O2CA 3QIAA 5GM2A 3FNHA 7MHTA 2V1UA 3R7DA 5DNWA 4JUAA 1XQ9A 2NO1A 1OPRA 2BKVA 1PWEA 3PFKA 1YBAA 3OIVA 5JJIA 2VPWA 3DOUA 3OE7A 1JG1A 3RANA 2JHFA 2PL5A 1GFWA 4QFMA 1S4MA 1QHXA 1KZGB 1ZN9A 4MQEB 3OA0A 5T4FA 4YY3B 3SDSA 3KELA 1ST2A 4A0GA 2J9XB 3TLAA 1W85B 1KZ4A 3MC1A 3QU7A 3TDMA 1PG2A 4LF4B 1G7SA 4W8OA 3R7LA 1QE0A 3ZWPA 3HUFA 4GM1A 2CK3D 3T7RA 3QG1A 4ZCRA 1FRQA 1KBOA 1YRYE 3R7FA 2Z8YM 1UAAA 4HP8A 3ISJA 4JQCA 2FE1A 1JZTA 1VPLA 4UD6A 1FUKA 4C06A 1R0CA 4FLFA 4YBZA 3EXEB 3JSAA 2PGAA 4ZCMA 4DJAA 1L7VC 1BIFA 2H63A 2RBKA 3LS2A 1E5VA 1KSFX 2Y1XA 2O5CA 4IDDA 2D0DA 2E9SA 3ZGOA 4I8DA 1TYZA 3VKUA 1NATA 3LO5A 2YASA 3P5SA 1LSSA 4OBWA 4DLAA 3HCOA 1XEWY 1TZJA 4NBLA 5B3AA 3AU8A 1RWMA 3CNQS 3PC3A 4WN9A 4IGEA 5EAIA 5JAOA 1SIUA 1HZZC 5FJIA 1ML3A 3IVXA 1UBEA 2NVUB 2A59A 4Q3EA 2ANBA 1X38A 4MWOA 3R3JA 3D3QA 5KKAA 1U80A 4LOJA 3TNDA 4CE6A 1LX7A 2FLKA 3I6IA 2YV4A 2QTFA 4OYHA 3QZUA 5DU2A 1NJFA 4Y9RA 2IDZA 3VKFA 3L6BA 2PQ2A 2B99A 4IVQA 4H6WA 2L2QA 4R1LA 2XHEA 1QORA 2DU8A 1QO0D 3JYOA 2Z98A 3OZDA 3WL8A 3CVOA 3HWSA 5IKMA 3WSTA 4W5HA 5IJ9A 3A6JA 3DEIA 1XYVA 1RWQA 1Y9JA 1YASA 4N6GA 3FNEA 3GFTA 5BRNA 1M34A 3HBLA 1KOLA 1C0KA 3IIEA 3NTOA 1OZFA 3PE6A 4DCVA 4OD0A 2ST1A 2XBUA 2A35A 3G88A 4C0QC 4U7GA 2PR7A 4O33A 4ADSG 3UMRA 3O75A 4OGKA 4FZRA 4YCNA 5AQEA 1O54A 2R8PA 3G2JA 5G0WA 2BHNA 2OR3A 3R6LA 1G63A 4FYKA 1YVUA 1MRZA 1MA3A 3B9BA 3SMQA 2OQ2A 2E18A 3OJCA 4L07A 1ZO8A 4IF6A 4QYIB 1GCOA 2WDPA 4TL8A 3CW8X 4YC7A 1XLTA 2O8FB 1MJNA 1PZGA 4MHTA 2VYFA 4QDUA 5EKTA 4ZI7A 2R1UA 1UAYA 3W4IA 1Z38A 5DHSA 2O5RA 3FSGD 4N03A 5JXGA 1XEWX 1K7EB 3QFTA 2OK7A 1ECGA 4Y8VA 3L49A 5ALRA 1I6KA 4NEHB 2C58A 2XDQB 2NXEA 5I7OA 3TG2A 3F7NA 3MYYA 3W1EA 1V45E 3WYDA 4CM9A 4YREA 2DLDA 3EB9A 2Z3WA 3QFHA 4WKGA 3HJGA 4F84A 4M7WA 4CCWA 5CFNA 2R6CA 4DNQA 1Z83A 1N78A 4H27A 1PBTA 1V1RB 2ZSKA 3BFVA 2ZXEA 4LI3X 5ALLA 1RWOA 1QAMA 3GLIE 3GLUA 3FFAA 4KVAA 4DR5B 1IXYA 4YONB 3GR6A 3NWJA 2OXFA 2X2FA 3IAAA 4FFMA 4WVFA 1XRQA 3VYRB 3I62A 3KAJA 5JMWA 4D8UA 5DP2A 1HTTA 1XMVA 4DSNA 4F5WA 3K70B 4TWRA 2HRDA 3C15C 1I1NA 1ULHA 2WINI 3D7RA 1GHTA 3PHHA 3QMMA 3TVDA 4W1SA 1QYRA 5LMUB 3UJBA 4LDNA 3MW8A 1BWSA 1YZFA 2OHGA 3V1KA 1G21B 4E6PA 4N6OA 4HTAA 2AA3A 3AFGA 2DF8A 4A2QA 3L79A 1P0PA 5BR4A 1VC2A 2AEMA 2ID4A 3E5HA 1HZZA 1XEXA 3H87A 2H5JA 4PZZA 5DK6A 3V2GA 4C0BA 1K8XB 5E8RA 2IUUA 4ZIRA 5JHHB 1IRIA 1DKPA 1C4OA 4BDTA 3KCQA 1K92A 4DLWA 5HHTA 5K4HA 4CWAA 1VG8A 2PUFA 4YRAA 2QP9X 4H0FA 1NX6A 2QSJA 1C3JA 1QYWA 4QTYA 4P7FA 1UODA 1E3IA 1GXSB 1R6TA 3DFZA 4QBKA 4JR2A 1U1DA 1ARZA 5DM1A 5HUHA 4MWZA 5DRTA 3OAAD 4UTXA 1AUQA 3PFNA 3IJ5A 2VSOA 1JVSA 4PV7A 4G8JA 4ABYA 3A6ZA 3AK4A 1IWPB 4YRDA 3ICOA 4V3BA 3IQFA 5A5FA 2GF9A 1L5RA 2DUJA 4W5QA 2ZIGA 4KDCA 3PT5A 4QDJA 4RTNA 3M70A 1BXRB 1NV8A 1P4JA 1ZRSA 2PWYA 4MRPA 1E7WA 2AXEA 2A5LA 1JNXX 1FNMA 4XLTA 3U44B 1MW8X 4NWIA 4U7TB 1LRLA 1RFLA 2PGXA 2VNIA 5C9ZA 1V43A 2BLNA 4ZREA 5A04A 2A1UA 5DTEA 4EEZA 1ZVKA 1NTRA 5HBRA 1RFGE 5IM5A 5TPZA 5INTA 1S01A 4IIYA 2OV1A 2XBLA 5LKRA 1TO2E 4TYNA 3ESAA 2BGGA 2H1OA 3VGJA 1NDQA 3FMVA 1M6WA 5CT4A 1D2AA 1KZYC 4TYMA 2YJNA 3G0IA 3I53A 1FZTA 2WE7A 3BFPA 4R3WA 1NJ8A 4YUAA 1Y98A 2LKDA 2Z3VA 1PNTA 1OBFO 2DR0A 3CMMA 3AF0A 2XQVA 1ULUA 3FETA 4KFSA 2X2EA 1AKUA 4MKGA 4UUQA 4XWWA 2GPBA 3OFKA 2Q5QA 4RE5A 4DREA 4J43A 2IEGA 1THTA 4LWPA 2BR5A 4WUVA 1W8DA 2OHIA 4R31A 2IIBA 5TEVA 5J3JA 3NKLA 4ZCTA 3FF1A 3OLWA 2JNWA 5LYJB 1EAMA 4F04A 4DCJA 1X7XB 5TGTA 3A1FA 2OCBA 4KEAA 3MCUA 4R54A 3W2EA 2P9CA 4MGEA 4F46A 1DLJA 1VJ1A 1QONA 4LJ4A 4LJSA 3WGOA 1FC0A 1Q83A 3GPDG 5B1EA 3L1VA 1Y8CA 2PSDA 2PX0A 1S1CA 2ZIXA 4R41A 3OEHA 4U2FA 8ABPA 4HNVA 1WX1A 2XECA 4TZKA 4AF7A 3EDMA 2P3LA 3B3JA 1F8FA 5DN6D 2F1KA 1EFKA 2UVQA 5TS3A 4CG3A 1UBJS 2FG7C 4EY8A 4QGBA 1GQQA 4NG4A 1APBA 4JR0A 1RKUA 1OLUB 3KPYA 3AEYA 4AP6A 4QM7A 3ERCA 1SHZA 3OZCA 2B1JA 1SVIA 1SD5A 4AP9A 2WG0A 3V1YA 4MUKA 2G9NA 3V4OA 3GFOA 3KKPA 2OLEA 3QPWA 5HKKA 3C1AA 3O4VA 4KGVA 4MVJH 3RRJA 1T6NA 3KOUA 4CNBA 1MQ8B 5CB4B 1A82A 4UHJA 2ECOA 3CLTC 3PYMA 4CU2A 5ITSA 3GUZA 5ILGA 4KSCA 2XITA 5AP9A 3GRAA 3FGNA 1ZSNA 3R24A 1J1UA 3R40A 4PYKA 1HDZA 2R1ZA 3GP5A 5IWAB 3LLSA 2A88A 3TUJC 4WOJA 4EUSA 5FBQB 4JXJA 1C3OA 5AUNB 2BH9A 5SZIA 1IWBB 4XYEA 2LV8A 4YGYA 4D96A 1H22A 2BKLA 5LP6A 4EW6A 4UARA 1DKRA 5EXPA 2HYIC 2G9QA 3MF4A 1H9CA 3LV8A 5CVCA 1E58A 2YWXA 2QOEA 2CHUA 3O38A 4KRGA 3SXUA 2C2YA 4YAIA 2VEDA 5HCUA 1PR2A 2JFZA 4EA7A 1FS4A 4RFLA 5JPCA 3T34A 1I3MA 4MA0A 4MRSA 3QE4A 4EEKA 2VDVE 1SBTA 4CJXA 1KJZA 4OA5A 1SC1A 5DGIA 4G0WA 1IULA 3IP5A 3DKRA 1QB8A 1Z12A 4H35A 4PC1A 4EO7A 4BV8A 4Y6SA 3ZHOA 3LTNC 3AEUA 1DWPA 3TLMA 4B09A 2F6RA 3CCBA 3TECE 2CHQA 3GA0A 2BVNA 4D6YA 4F97A 5A71A 3CZ4A 1AJEA 2AQKA 3ZTWA 4R8RA 2QTHA 3DV0B 3W9BA 4PSCA 1AKWA 5D87A 5CH8A 1A4RA 1MDFA 3C39A 4AG6A 3R5TA 5A2GA 4ZOCA 4IZ6A 2ZG6A 1RPJA 3Q10A 4G81A 4Q39A 3SI7A 2E6KA 5FPYA 3WSWA 5HZKA 4EUHA 1JQ5A 4CM7A 4B8ZA 4Q9KA 3I9JA 3A8TA 3FBTA 1JHAA 4BTVA 2NV0A 2C2BA 3HB9A 3BG5A 4AX8A 5FWYB 5MDHA 1M73E 1NVAA 1SZDA 4OATA 4AJ2A 4EW1A 1P81A 2YIMA 4GZ5A 1I51A 3SCZA 4FW8A 1V48A 1XTSA 1XTUA 3L0CA 3DOFA 4YALA 1YONA 2ZUDA 4U0JA 4PYMA 4B6JA 2R4QA 4P4SA 4C08A 4DDVA 1N5OX 4UCFA 5H83A 3HMQA 5J4LA 1VPTA 2XGGA 3HCAA 2WD7A 5CT9A 3T4EA 4ZZ0A 4P6VF 4DT1B 2HEIA 3ANNA 2ZYVX 3E48A 3LQ1A 5DNYB 2AZXA 4JVLA 2L82A 2WEKA 5C5EA 1O08A 2AR0A 2Y1KA 1T91A 4BUCA 4C3VA 2VZEA 2DYKA 4EG3A 1H42A 2YFQA 4JP2A 3T94A 1X0VA 4CF6A 3MLEA 2FVXA 3K73O 4A6PA 1ZICA 3UTDA 4TLEA 2W70A 1MORA 4EHHA 5JH7F 3AVVA 1PFGA 2CC2A 3K05A 2WHXA 4J9VA 3F98A 1U2RA 3ZKWB 3DZ8A 2O7RA 3MMPA 4IQ0A 5KS2A 2JK0A 4GF5A 4NESA 3F0TA 4FT4A 2ODWA 4P82A 1OWLA 1SUIA 2VT2A 1BU8A 3DDSA 5GJWC 4A5OA 5K6AA 3HJTA 4KMRA 1PU2A 1Z2NX 1VGVA 3WYEA 3WL5A 1NW3A 2XKKA 1XZKA 1R6BX 2JCBA 2Z1MA 3JQ9C 5IDXA 5IVIA 3G0GA 2JGNA 4OB6A 5AKIA 3L1HA 4O2AB 4TMZA 3KSUA 4BN5A 2YXEA 1A71A 1HYQA 1WMEA 4GR9A 3T4XA 3VZPA 5K0TA 4JB3A 4AZ0B 1S8OA 3CQ9A 2PY6A 3IHKA 1XFAA 3AHFA 2YVUA 4HWOA 5L53A 5BSGA 4QRDA 1IZ0A 2WQ7A 2E7ZA 3C1TA 2WJVA 4TTVA 5EA2A 1XZ8A 5EZ5A 1Q1ZA 3AZOA 3LX4A 3MB8A 3Q2KA 3GJ6A 1ZXLA 3L7YA 4X8LA 5SYMA 4XX0B 1PHRA 5ICGA 1BHSA 1UZAA 4DLVA 1J0XO 1F5SA 1EUYA 1SG0A 4JOCA 4R8SA 4RVUA 4UTZA 5DHPA 4L02A 4CPDA 5K3OA 3VZQA 2H06A 4J1TC 2ZJ2A 1R8XA 3WLIA 3MJHA 2H29A 3QVSA 5AW5A 4B2IA 4V3CA 1XCPA 3ZDRA 3WK5A 4L9AA 5JRZA 4B17A 1WPRA 1GAJA 3EA4A 5GJCA 4PPFA 1DOAA 3STTA 4RC9A 1C1DB 4REQA 1O6ZA 1WSWA 1IXKA 2QZSA 5H9VA 4MXDA 4PONA 3UJ7A 1YNSA 3EGOA 4J8PA 3VSBA 4AWXA 2O8CA 5I9MA 3DP9A 4LHYA 2QN3A 4EPWA 3KQWA 5KTSA 1AZSC 3QH4A 2A94A 2VTEA 3G85A 3OEED 1K3TA 1BMFA 4FN5A 4O2LA 2WF9A 3O9MA 1A7AA 5ES4B 4UUMA 1CUHA 2J7PA 4RTRA 3UXHA 5DSXA 5HTOA 3Q2IA 4DCPA 1UC5B 3QUQA 4AL4A 1UFQA 1MZPA 3ZHBA 3ZCTA 4IX9A 3I61A 3RQSA 4QGGA 1UIRA 4IP0A 1C14A 1E4EB 4GPIB 5JO0A 5KYNA 2FWIA 4UEJA 1Q44A 1SRRA 3OU2A 1N6HA 4Q6WA 1N1EA 3I72A 5HSGA 3CPJB 1JEEA 4KLCA 1RXCA 1V8ZA 1CNEA 2LWIA 5F3DA 5FWAA 2GA8A 4MLPA 1GNQA 4XFKA 4F3KA 5BV1A 3QOFA 4J2HA 1ESEA 2YWRA 3B3FA 3DTVA 1IJEA 4LC9A 3SYNA 3ZZ0A 4B7UA 1CVIA 1DXYA 2Y27A 4YECA 3TQFA 4AO8A 1RI3A 4R0NA 2ZI7A 3E5MA 3IALA 1DFIA 3NI2A 3BD7A 4G8CA 5E4TA 2V7QD 2JZCA 3T1NA 2PUHA 1DELA 3NEJA 4M38A 2XKAA 2GAFA 3IMGA 2GN8A 3EZXA 2HRQA 3K0AA 3LMKA 2ZSBA 1C7ZA 2QW8A 1IAQA 3DC2A 3JQ9A 3AB8A 2ZQZA 1XZEA 2YY7A 3NYRA 3R3WA 1OASA 3DE2X 2VP0A 2V45A 2W58A 1CS0A 1W0JD 2FPIA 2IHZA 1I0ZA 3DG9A 1LPAB 2TYSB 5LP6B 1SUBA 4P4NA 3DXXA 1YMVA 1SU4A 1B42A 5CPFA 4ZKEA 4D44A 3SWWA 1M66A 1M0TA 1CJSA 1YUNA 2NNLD 3THXA 4XVCA 4DM3A 4LQDA 2ZREA 1SIOA 5MGNA 1EUQA 3TRHA 1UP7A 5BURA 4AZ3B 1Y80A 1QR6A 2VATA 5B37A 4Q4CA 1WCWA 2LD4A 4ZYWA 1U3TA 5ALFA 3P9KA 2GPYA 1E0JA 2IYNA 4X66B 4L3VA 1LVGA 2R60A 3I2IA 4J1TA 4MWTA 2DJIA 1FOEB 4N40A 4E5NA 4JJ8A 1SHLA 4JX8A 3FZQA 2NV6A 3L7KA 4C87A 3EXIA 3D2BA 2A5GA 2OBYA 1UJNA 4YAGA 4EZIA 1L4MA 1SO8A 1Y8RA 3DOJA 3V6LA 3P0HA 2JFFA 5FL7D 1CYDA 1FE8A 4PX5A 2WM8A 3WNVA 2BGWA 3PVCA 1RQGA 1RQRA 1Z6YA 3QUBA 1MBZA 3O1LA 1VYUA 3K2EA 5TDHA 4KHZA 3OKCA 2V7BA 1QRAA 4G85A 5IJWA 2GR9A 4MYRA 4PRKA 4NH4A 5LQJA 1BFKA 1RWXA 4JEHA 1PW5A 1Z2PX 5BOVA 4KR3A 1O7JA 2VDLB 1YBMA 1PFUA 2VNSA 4KWHA 2VTBA 2QZZA 5CCXA 3VKGA 3KQOA 1BOFA 4QTZA 1ZGAA 4Y1GA 1E4YA 1MHPA 1QMGA 4BNDB 1KI8A 3SZUA 3VBCA 2BTQA 4IIJB 3UPTA 1Z6QA 1OIWA 3F5DA 3N2ZB 2CLKB 5CHEA 1BKDR 4OB7A 1U2GC 1L6IA 5EQTA 5CITA 5JXJA 1PEDA 4LZOA 2PBRA 4JI5B 2JASA 2ZRQA 2ZUVA 3I6YA 5TVGA 4LXHA 1P5FA 2H0QA 5FAKA 3PKJA 4ZDJA 2XTNA 2H17A 3TQRA 1SU7A 4CMJA 4KE9A 2FG6C 3SQMA 4FIDA 4HH0A 5KMGA 4M1SA 1KVQA 4PYOA 3G3EA 5E6SB 3H11A 5LIRA 4PYIA 1Z16A 2CCJA 4X24A 3GAMA 5CVTA 1HG1A 5K4AA 1N92A 3HDHA 3ZV5A 1UPAA 1P2SA 5A3QA 2FPRA 1JE0A 1H6CA 3BJMA 3IOYA 1W7AA 4LNUB 3QEAZ 2HT6A 2B0CA 3OFSA 1CFZA 1JMYA 1YOBA 3T0FA 2PH1A 5A1JA 2UVPB 5EC8A 4M7RA 2EW2A 1NRWA 5F52A 3N05A 3WOHA 1IZZA 5LC1A 2QT9A 4GKAA 1RBZA 2LDBA 2XUQA 3OM0A 2W8ZA 4FFNA 4JI1B 1E60A 3I01M 3OVMA 1P3JA 5HIMA 1T4BA 3GUUA 3T9FA 5EXXA 1B3BA 2DOKA 1MO5A 4AD8A 1W52X 2OHXA 1Z4KA 3JYHA 1MXHA 4QNNA 3AEZA 1G59A 4JBLA 1CUCA 4GBGA 3V4PB 4DNFA 3CW9A 4EI7A 3KQLA 2EFGA 4L9SA 2BEWB 3K09A 1FFHA 1IAVA 1NI5A 2DBQA 1CJMA 4AUKA 4LOLA 3DDHA 2NSYA 1D04A 1CULC 2NZ8A 2LUOA 3HZHA 3PYXA 5LB4A 3SQDA 4CN8A 1I33A 2O9JA 3G82C 3RFTA 2WIFA 1D2EA 2Z43A 2NZUG 3LRTA 2YNMD 1NYRA 2CXNA 2XCOA 4TMYA 1V5IA 3VH3A 5FUQA 2KBEA 3ZDAA 2C0QA 4P53A 3RKUA 4PC6A 3OJ0A 4AN1A 5AM2A 1ZKDA 2PEZA 4WJZA 5GONB 1HL7A 4PFJA 4D5GA 3SBOA 3THOA 5KVCA 1E1CA 3USZA 3QE3A 2N3ZA 3EHDA 4DXDA 2FJPA 5BORA 2HF8A 3VH4A 2VP2A 2C42A 5L3SB 3UT6A 4P38A 1IY0A 1AS2A 1BAPA 1HMYA 1TO1E 3NS7A 1FRZA 4JEMA 4CLRB 2HMYB 5JH7A 5LQKA 2V9CA 1CF2O 2WF6A 1K08A 5EJEA 4NEGA 1Q0HA 5IABA 5JMTA 4MICA 2PYDA 3K9CA 3SJCA 3RWMB 3CS3A 1S1MA 1NN5A 1M72A 1MHTA 2O8EA 1U2GA 1YDGA 2XADA 4DM7A 2JS7A 2FN7A 5JY6A 2XUZA 4DR3B 2WE8A 1KAOA 3HA5A 3OUZA 3R8FA 4M98A 5GP1A 2WU8A 4I2VA 5T8KC 2YFKA 2O4UX 4I7EA 5JNSA 2QSYA 5KHOC 3IDSA 3LVFO 5AVUA 2WVJA 1JR2A 3W2FA 3SIWA 2GJ8A 3UUFA 5CG2A 3RVDA 1Y4SA 4K6FA 3GVCA 5FOSA 3SXPA 2QMUA 2EOAA 3IAEA 3SOZA 2DERA 1A4IA 1ISIA 4QECA 4JI3B 3T52A 4B3IA 4FU0A 5B5SA 1TQ6A 4JXZA 3T06B 3S40A 3L7AA 5JS7A 4NYMR 4YDRA 1J20A 4I1VA 1SOMA 3RD5A 4BFCA 3O1HB 1EG7A 3WAGA 1H4SA 2WU3A 3IQHX 1E0SA 3LCJA 2V6GA 2MWMA 2BYTA 1O4WA 4XJTA 2PE5A 3S2EA 3INNA 1K89A 2C8VA 3STVA 1GQFA 1UKCA 2I67A 3ODPA 1R1DA 3D2AA 4GKVA 4EVRA 1RAIA 4QEDA 1KQNA 4INPA 1BCRA 1V7QA 4XGKA 5HW0A 2C7BA 4MDHA 4HV4A 1UPXA 4X3PA 3TUIC