1I9CA

Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQENFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTAMATE MUTASE
publication title Radical Shuttling in a Protein: Ribose Pseudorotation Controls Alkyl-Radical Transfer in the Coenzyme B(12) Dependent Enzyme Glutamate Mutase
pubmed doi rcsb
source organism Clostridium cochlearium
total genus 47
structure length 137
sequence length 137
chains with identical sequence C
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1i9cA00
1I9CA 4HH1A 4REQB 1E1CA 3KOWA 1BMTA 6REQB 3IVAA 4JGIA 2XIJA 3EZXA 1K7YA 4HH3C 4Q37A 1BE1A 3REQB 1E1CB 3KP1A 3BICA 1REQA 5REQA 1CB7A 4HEHA 5C8DA 2REQA 3IV9A 3KOYA 4HH0A 7REQA 3KOZA 2XIQA 4REQA 1XRSB 1FMFA 1CCWA 3KOXA 2I2XB 6REQA 1ID8A 3BULA 1REQB 5REQB 1B1AA 3WHPA 1Y80A 4R3UC 2REQB 2YXBA 7REQB 3REQA 1K98A
chains in the Genus database with same CATH superfamily
1EXNA 4OK5A 4HSEA 2VJPA 3NNDA 2VUHB 2O0LA 3N3AC 4B4OA 1H6CA 2C4MA 2GHQA 4UFNA 4C87A 1SA0A 1F2DA 1ILEA 3UYKA 2K7FA 4XLLA 3KXPA 1NUPA 1SQ6A 2GPAA 4ZT6A 3WBFA 5I47A 2QM3A 3O82A 5CVVA 5HTKA 2WP0A 4MWZA 4C78A 4ENUA 3M2TA 2DR2A 1ZPDA 2PXAA 2CLIB 2HXSA 3CUKA 5CA1A 1ZCFA 2VDWA 1EB9A 2HTEA 1F12A 1AB6A 4YT2A 2GHIA 3GNQA 4CXMA 1ZG3A 3FRHA 1CUVA 2E5WA 3EBOA 4QT4A 1E3SA 1COZA 2QJOA 3NYWA 4URUR 3U81A 2AFHE 3L7AA 2WSSD 1YAHA 1A5AB 3WL5A 2TMKA 3OM1A 4IUDS 3FI0A 4PPYA 2PUFA 2OCLA 2Q28A 3Q5GA 4RVUA 1B3RA 2Z6QA 2OYCA 2I2BA 2HNAA 3PVSA 3QVSA 2PWYA 1UODA 1N2EA 4L28A 4A6EA 3IDOA 1SKQA 2OXRA 3SYRA 4DLTA 3IQGX 3MLAA 3H8VA 3LUBA 2GA9A 3F3KA 2ODNA 3CZRA 4CLEA 2VZEA 1ODKA 2VFAA 2E4WA 3A4VA 3MTDA 3O8BA 4DM7A 5BW8A 2HUPA 3QE9Y 1IPFA 2CFTA 2WYHA 3U5ZB 3L1HA 1E1QA 1RWXA 1SU6A 2JBWA 5L95A 1NVEA 2EHDA 2Q27A 4J2TA 4YAIA 4D0SA 5FLXA 5BSMA 2LKDA 1K92A 1E3TA 1AC5A 1M1UA 3U4AA 1EUDA 1K06A 2EJWA 1NIJA 4W9NC 5DT2A 3QPVA 5IC5A 5ICFA 5TQVA 2AQIA 7REQB 2Z98A 2A5YB 1O0SA 2EQBA 3THWA 5ADVA 4OGLA 3QX7A 3I04A 2JCSA 2O05A 1ADFA 3QMVA 3T5TA 3ZY5A 4BNYA 3Q98A 5ED4A 4V2IA 1MHTA 4QE3A 3VYRB 2OSVA 4EGCB 3HWX1 5KYWA 3EVTA 2BFNA 1O94C 3RYHB 1PHPA 1YL6A 1W25A 3QWHA 3AR2A 4IIGA 3PFFA 5TMBA 2FPOA 3EGCA 2QTGA 2Y05A 1YCHA 3NYQA 3R0XA 3ZJTA 1R0XA 2XNJA 3OCVA 3H9QA 4ZT7A 3H1FA 3IOBA 3WFZA 3R09A 4IP0A 1QH9A 3EPPA 4J0KA 3SFZA 4FYVA 3ZZNA 1E4EA 1NF2A 4P2GA 3E9DA 4Q1DA 3VR1A 2DPMA 1USVA 1V8DA 5BSEA 4CQLA 1DHRA 3NH6A 4GGPA 4PLZA 3PKJA 1IAQA 3ADOA 1IHPA 1JDZA 3F46A 4IZ6A 4LRYA 4WGFA 1ZRHA 2UAGA 4XUGB 1EMDA 3E9NA 3PRJA 2BGNA 2YBEA 3TTUA 4UCXA 3SQMA 4RO0A 4HH0A 4R84A 2C9DA 3FPLA 1I6MA 1S2OA 2X0KA 2E37A 4KQ9A 4AMVA 3CR3C 1OWLA 4HFJA 4EMTA 3JD0A 1OI2A 1T1GA 1X3SA 4RMHA 4GI2A 5CJPA 1CUBA 5EP1A 3ZV6A 3PXDA 1JWAB 3JVEA 1PFQA 1AMUA 4KJZA 3WDKA 4RZ2A 1RVDA 1BS9A 4V24A 4D44A 2ZS7A 3BTUA 1Q6YA 1E9SA 1MH1A 5E7MA 5FPSA 3AHGA 2DC1A 1G5RA 4WFKA 5KS2A 1DCFA 5EJEA 5C52B 4H9GA 4X92A 1CQPA 3UPUA 1Z8HA 1MTOA 2C1EA 1O5IA 2EU8A 1DZIA 1Q14A 2H52A 2WJZB 4Y18A 1GCGA 4MP6A 1FZQA 1WBDA 1OBFO 1TU0A 2QMYA 5BXQC 4D57A 1PLLA 5G53C 3JVIA 4GPIB 4LZAA 5LPNA 2A5FA 2WSLA 3HZZA 3HL0A 3KOYA 4JI3B 2ZKIA 1OV4A 1R10A 2WWWA 1L5KA 1GV1A 1ZMXA 4H6XA 1SBQA 3K8QA 5EY5B 4FYKA 5KNBD 3OU7A 2EGGA 2W2PA 1XQVA 5E2BA 4DLKA 3O75A 2C7BA 1VKHA 2XTNA 2H2AA 4HTFA 4XWTA 3THOA 4CL2A 5FPHA 3Q7EA 4OQYA 1ZM7A 3I23A 4YV1A 4DM4A 1M34A 4WADA 3KSZO 2F3RA 3PQDA 4Z3OA 2AFIE 3HDVA 1Z5VA 1D3AA 2ISCA 3KDSE 5DWQA 1SXQA 1P5FA 4H7EA 3V2IA 4HATA 4HNRA 4BB9A 1SCBA 1OPXA 1UPTA 1VA4A 2KW5A 1Y9ZA 5IZCA 4H1HA 1YJ5A 5JARA 3V3KA 3A1TA 4UPEA 1VBMA 1TGYA 1W1WA 4ND5A 5ANRB 2CXUA 4B3JA 1GPJA 1FUIA 1U2ZA 1EINA 2H63A 2OAGA 1VLHA 5AM4A 4CKBB 4EBBA 3UW3A 3L07A 2B8JA 2NN3C 1H6BA 4LDRA 2YXPX 4NESA 2UZ1A 3TBKA 5KYXA 3HDTA 3WB9A 3WKEA 2GRJA 2NU8B 4FDVA 4KP7A 2JVKA 1UBMS 3KZNA 3QH4A 4EY7A 4NV0A 4QLBA 3MTBA 3OOYA 4QTYA 1C80A 1DOHA 3G5UA 4HS9A 1NLUA 4AUNA 1P5ZB 2FSFA 4F86A 5LJIA 1GQOA 3WL3A 1RCUA 3NEYA 4Z3DA 4DCUA 4JLMA 4PZZA 4EEKA 2B5WA 2IDJA 4QDXA 1Z17A 3IE1A 3HO6A 5JJKA 5HNKA 1TD9A 2BWJA 1H2WA 1U6KA 2WIAA 3DEYX 1Z6AA 3PR1A 4H3SA 1IHDA 3UY4A 4BFUA 1XNQB 3FHTA 3K6SA 2FP4B 4BX3A 2ZIEA 4IQFA 1TT5A 1LC3A 2HMWA 2Q41A 3X1KA 3BZWA 3BH0A 3Q7TA 4UTXA 3QIVA 1G5IA 4CFZA 3MD0A 2EBWA 3MJHA 1B43A 2P2LA 3VNVA 1I3KA 2JGAA 4RPHA 1N2CE 2EC5A 1F51E 3BRWA 1IH8A 1RMTA 4P92A 1TW3A 4WNAB 4YUWA 4ON9A 1NY5A 2GXSA 3QPDA 1NW8A 2DFNA 3RG2A 1CKEA 2IOFK 1RKUA 2BD0A 3E7PA 5K8CA 5EEHA 3NG1A 1GZSA 1Q91A 5LQKA 4FMBB 1KBOA 1VB5A 2HCTA 2VT6A 1XKLA 1MVLA 1C7JA 2IEYA 3VZBA 1Y8QB 1XZIA 1YJCA 1S8OA 3WE7A 3GDFA 3JVVA 5I4CA 4TLCA 4F38A 5L53A 1CUYA 3C7KA 1EUQA 2RGEA 3QVOA 3TAXA 1FQJA 2ERCA 3P2KA 4HAIA 4NIMA 3X1WA 4D6YA 5C1BA 5CIYA 1BX3A 4RTPA 4RVHA 2O7NA 1DO2A 4YFVA 3RWBA 4CEHA 4LYDA 1E1NA 1R5BA 4LRQA 5ESWA 3S44A 5K3SA 3G0BA 1IEVA 3TZCA 2EJVA 3WMXA 4AJJA 3GPLA 3H16A 1IYZA 1FXSA 3FFBA 3K6KA 3O4IA 4KWIA 4ZYZA 3CSDA 3L46A 5A6SA 5CH3A 3WJ1A 5CEFA 3W6ZA 4DCTA 2C9ZA 4OQDA 4PQRA 2ZWPA 5F9MA 4CW7A 5HZMA 3V8MA 4ZA2A 3T1VA 4TMXA 5CX1A 4DC0A 1LJLA 4LRUA 3ZE7A 3C3EA 3O93A 1NZJA 2QR5A 4PRLA 4DZRA 3JVDA 1ULBA 1N8TA 2VQFB 4UFPA 4C9BA 5K8JB 2DB3A 2RGXA 2EGUA 3EISA 1SBZA 3IRVA 2VYVA 4AJ2A 2HA6A 9MHTA 2RHTA 1JPJA 2ILTA 2XWPA 1X94A 2XF2A 2X0FA 4UM7A 2DHRA 2JAXA 5JNWA 4HFNA 5JQGF 4HJRA 1NGSA 4ZCLA 3VU3A 5DV9A 3GR6A 1YRQA 4U3JB 3ONEA 3GGDA 1E5VA 1YDWA 3B1FA 4J76A 4C6HA 2VF2A 1NWCA 4UOZA 5T3UA 1PV1A 2Q5LA 1Z88A 1DXQA 2QMZA 1NR1A 3C3MA 3DZ8A 3GFVA 1K8RA 4MRMA 4UUOA 2O3JA 2YL2A 2FUKA 3E0QA 3E61A 5D3MA 1W5BA 4NBKA 2C5HA 2CV0A 5KWSA 3WKDA 4ZCRA 2P40A 3AT1A 1P0PA 4LXQA 4OHMA 3VDQA 4Y2QA 3OOHA 5EI5A 5J2TB 2PJDA 4GHWA 4IVNA 4FC6A 3A7DA 1CPYA 1TUBA 2ABWA 3L7MA 4DV3B 3HXQA 3FN4A 2H5LA 1ZIYA 3QOFA 4BV8A 1YBFA 2R44A 3DTVB 3O2QB 4E03A 2TRSB 3ACCA 3IMGA 1OYVA 3GRUA 2BFCB 1IY2A 5CU7A 1T6BY 3L0ZA 4ODIA 2HWYA 1QH1B 3MCVA 5DHTA 3BB1A 3HU1A 3R7LA 1QGED 4DYDA 3DDZX 2WWHA 4OKIA 2JD1A 2ZKLA 5CA0B 1D09A 4LRWA 2XUZA 2VRNA 4DG9A 1WMDA 3V4OA 3ZZUA 4UD6A 1GN8A 5JD4A 4G01B 2P62A 2B94A 2GAJA 3GEBA 3O0DA 2R11A 1JLLA 4G1CA 2F8TA 3L8GA 4Z51A 1JAIA 4P4TA 1CRWG 3M81A 1KWGA 2OQIA 4KDEA 1G291 4FOTA 2ZUBA 3SZRA 1FXWF 5EHQA 2K7ZA 3NT2A 1BXRA 3IT0A 2QNRA 1R9GA 4JB8A 3RD5A 1ADJA 3WRXA 1F7UA 3PR2B 1G7CA 1M33A 2Z4TA 1JE1A 1J8DA 3MC1A 4TT3D 2BVNA 3ZDZB 3QVVA 1YIOA 2OB2A 1JX6A 4X62B 3U7GA 2WWGA 5CXQA 1VG8A 3E1KA 2LNDA 1D0SA 2YXEA 4FZRA 4QATA 4ZVOA 2LP4Y 2QP9X 3VR3D 3L0YA 1NXXA 3FCAA 3TNJA 2YWRA 4G1FA 1ZJWA 2ETVA 2IPMA 1CF4A 5A4MS 2O8DB 1BE1A 5DRYA 4MULA 1X7GA 2VDUE 4DC1A 1LA2A 1FMFA 3GRYA 1OASA 3F7NA 4P7FA 4QUDA 3F4KA 2CHQA 4R40A 2WIKA 1RD4A 2JLWA 4ND7A 4F45A 4MVWA 4Q1FA 1DFHA 1MOZA 2F3QA 3BJRA 3HYRA 4Q93A 4QDKA 4YCNA 1YS2X 4D1YA 4W1QA 3KS9A 4Y1EA 4CKEB 1OI7A 5GTDA 3BILA 4Z8YA 5KPDA 2PLFA 3RRXA 1HEYA 1V3UA 4K6KA 4X7MA 4CTMA 1XYGA 1KI1A 1K4YA 3I2FA 1SC4A 1T36A 5J1TB 1DEKA 4R2XA 2JI8A 2XVZA 4AQDA 2HDWA 1US8B 1SZDA 4KLAA 5FUBA 4HDSA 5GVRA 4CQNA 3O3MB 2GEJA 2I29A 3H1PA 4E5VA 3EIEA 3N0TA 2ACWA 2V7PA 3A6DA 3Q9NA 4R41A 5ED0A 3QX3A 4G63A 3B1KA 1MRZA 4MA5A 4ZZ0A 1NBAA 2BBWA 4G85A 3MAJA 4KLRA 4R98A 3NTUA 3S7TA 3TWOA 1ZAYA 3E6AA 3EJ6A 3KT0A 5B1SA 5M7EA 3S2EA 3LT5A 4S1VA 5IBPA 5KTPA 5BMOA 1LGYA 4WXEA 3L18A 1TJPB 2ACVA 4XPZA 3KQYA 4QPCA 4YVFA 3GUCA 3D1JA 3TRDA 4KI7A 2PS1A 4Y2HA 1WF6A 3KKEA 5JY1A 4JLSA 2YIDA 4LGMA 1RR6A 1XWWA 4NOMA 1JHYA 4CUZA 4I6EA 2D5BA 1T5LA 3PF9A 4JBHA 4BQIA 4E70A 1N77A 2QE7A 3K9QO 3GMIA 1WZNA 4C5AA 1S2IA 3P2IA 4CF6A 1KZYC 3HCNA 3UJBA 3ROEA 1EUYA 1GZ4A 3W0LB 1NQOA 4IKEA 3DEJA 4P5PA 3A04A 1D5WA 1CJVC 1B8UA 1LI5A 4GR5A 4KBYA 4MW9A 2A7XA 5AIAA 1JJVA 3L7IA 1O8BA 5DIFA 1PWZA 3CJRA 3QUAA 1YBHA 5H4GA 3BHJA 4FWIB 4NENB 1W8IA 1ZOOA 1H8HD 1UADA 2WJ3A 2AN1A 2HT1A 3CLTD 2Q4BA 1DADA 1K6IA 3K1AA 4LS3A 4DSZA 3ICWA 2QB5A 3R24A 4DANA 2NACA 1YR7A 1QHXA 2RGYA 2MSCB 3UXYA 4C7OA 1QOQB 1NQWA 1MO5A 2WF5A 2YQ4A 3KFVA 5GJWC 2P3SA 5C80A 1WW2A 2LV8A 4MCAA 5TMDA 1Y1RA 4IYJA 3HV2A 4P7BA 4W8GA 1M2FA 3FCEA 4CTOA 1MAVA 2HA5A 1MX5A 3FX2A 1YF3A 1QF7A 4NONA 3A2NA 3HLYA 4EDFA 3B53X 4W7IA 1ZSYA 1B2LA 2VK1A 3D3NA 3R3HA 2VF4X 1AKUA 4KZKA 2FY8A 2IS6A 4X5OA 1VIYA 4MUJA 4ZVTA 3FWKA 4JA0A 4H3VA 1W5AA 5KQMA 3G2LA 4MSUA 4FCTA 3ZX4A 1LW7A 4JLKA 1VB3A 2BI4A 1FDUA 3CX7A 2H9AA 3I0ZA 3JQAD 4RFSB 3ZD7A 3I6ZA 4A3SA 3VR4D 2G4VA 1Z6GA 1ZH0A 2MINA 2ON6A 3G59A 4U00A 4XX0B 4ZHQF 2P3QA 3CPHA 4KFRA 5CBPB 3ZKWB 3KJEA 1XD8A 3NEJA 3PNLA 4BNUA 5JC1A 4RD1A 4DOMA 3EMKA 3BERA 4N65A 4ZMRA 5AOAA 1SH7A 1SULA 2AB0A 1QU3A 2GEDA 2I0FA 1ZVJA 1ZXXA 2ZU0C 1CZLA 4KE6A 4LI3X 4IDBA 4OOEA 3FBGA 4IWYA 3I9MA 1TJ3A 2HLNA 3HTXA 1XVTA 2ZJ2A 3NWPA 1PWXA 4ZVRA 4JQZA 2CVFA 3CVYA 3S68A 1HLDA 2GCNA 2VK2A 1VJCA 3EEBA 1JKXA 1OXXK 2EAUA 1CXZA 1MC1A 4H7HA 4B33A 1G21A 1JQDA 3O38A 2O2CA 1KOLA 2IPLA 3PA6A 4WY8A 1G8SA 4B6EA 3ZWDA 2X41A 4BXOA 2G0NA 3ES9A 4TL7A 4HWRA 1X7DA 3GRPA 1RAAA 1JFLA 5J9FA 1NBOA 1N5JA 5ALEA 2ZAYA 3GU3A 2X8JA 4L9SA 1I0LA 1KQ3A 2QJRA 3FD8A 1AXRA 4IZOA 3CWQA 3RUEA 3TQIA 5HZKA 1FRQA 3B48A 2I1QA 1SN7A 4JEUA 3V6MA 2Y66A 4LNUA 2ZBPA 5KVCA 1WKVA 4HRXA 1OAKA 2AMYA 3PF8A 3ND8A 5BR8B 3I62A 4NCHA 2CUTA 5DBHX 4HKTA 4EAQA 4FU0A 4OFZA 2QGNA 1EI9A 1IZYA 1THZA 2QX8A 3E2PA 4U0KA 3W6OA 4DCGA 3HGMA 3NS7A 4LDJA 5IK2A 4BFXA 4W99A 2FWNA 2ZB2A 4BLUA 1PLJA 4B85A 2QUIA 4M86A 4L6IA 4NYMR 1MIOB 4OA5A 1J9GA 1PIWA 4E11A 1SURA 1U1FA 4GF5A 1MXFA 2B20A 2QYHA 1RT9A 2OCDA 2INGX 1HEIA 2VP3A 3M3PA 2WJAA 4K6GA 3EXG1 3DBIA 1VDZA 1CZUA 4PSDA 1IEXA 4F3CA 4D4LA 2H4ZA 5KPJA 4E5UA 4XTRA 3I9V1 3WL8A 1RMQA 2YVUA 5JCOA 4HBZA 1ISJA 4AF6A 2ID4A 5TB5A 1AQNA 2CVZA 3JYOA 1MKYA 2CJWA 4LJ5A 2PAAA 4A92A 3TN7A 2FSVC 1QC5A 1MP0A 2DH6A 4HK4A 3T61A 2BJVA 4EDHA 3RGWS 2FR8A 3NHJA 2GVDC 4AJ1A 3WRYC 1PJ8A 1JKFA 3R6GA 4OHCA 2ZSUA 5LQMA 2FQQA 1KI3A 1MV5A 2JVJA 1RSZA 4FNMA 1CP2A 3QHPA 1XBTA 1EXMA 2AX4A 2D1RA 2XKKA 3PDWA 4Y30A 2A94A 5BN5B 1CRZA 4UHKA 5ITVA 5AXBA 5KNCA 3SEAA 1ZISA 4IDOA 3AUUA 4KQKA 1WBBA 2O06A 4TZTA 4A0FA 5LR6A 2RHMA 5AI4A 3TK1A 3NHMA 2OV1A 3GGGA 4JYCA 1RWQA 5TEVA 1I10A 2X6QA 4HGPA 4DMLA 3EGIA 3LRXA 1OGJA 2D59A 4FMDF 3WJ2A 4AO7A 1EB8A 1A3CA 4D02A 4PZYA 4RD0A 1Z29A 2EBFX 4YQZA 3F3YA 2VP5A 2J0QA 3MELA 4TPKA 4OHYA 3LNCA 5IF9A 1Z0KA 3QKRA 4HX9A 3RIXA 4QYSA 5SYMA 4MMZB 3PFNA 1IVYA 3LPDA 3PG5A 4XUCA 3WGJA 1TIKA 4JC4A 3U4QB 3A6JA 4F5DA 3ENNA 3RIHA 4C4OA 3LYHA 3T9DA 1VYVA 2C5BA 4BNLA 4X7PA 1DWOA 1DDIA 4F6RB 2O4CA 4L85A 2ONCA 1XL1A 1PZFA 2QOEA 3TAUA 4BVEA 2FXIA 3LWNA 5DKFA 1WULS 2HYDA 2OKGA 4CYMA 3PNSA 2HDHA 2ZVPX 1RE0A 4R8LA 3FZEA 3BZUA 3IHTA 1ECLA 1AURA 4S0XA 4WMLA 2UYYA 3TE6A 4C4SA 4Z0PA 3I4FA 5JFGA 3FUUA 3D4NA 1ZJ5A 4QDZA 4B0OA 3GJSA 1RHQA 2X4DA 3RYFB 2R6ZA 3A11A 3IE2A 2FMFA 3GF4A 4FJ2A 3WFJA 4IIJF 4DHWA 3P52A 4UBLA 5DGCA 1OFUA 3OAAA 3P9RA 4GLBA 3EQ8A 4K1XA 4PYIA 3TQHA 1G5FA 3EBLA 1GA1A 3DMRA 3FR7A 3A1CA 4AZSA 1U5BA 3AMVA 5ALOA 1B6GA 1E6CA 1J90A 1K7YA 3FNBA 3HGQA 3HY3A 5C1IA 1Q0LA 1VI5A 4Q1EA 1JPNA 1W75A 2RCYA 4PRKA 1OV6A 3SC2A 5LU8A 1EVQA 3WAGA 3NHBA 3ZVLA 3CT6A 2PGXA 2NZJA 3QKSB 4NNPA 3K9LA 3UB4A 5ELXA 5EWJA 1GP2A 1NBHA 5D2CA 2WU8A 4F97A 3VPCA 2OBMA 1A8HA 1Q0UA 1U3UA 1QQ6A 2QY9A 1L5MA 2PYDA 3DE7X 3DF7A 5A9SB 5JYDA 1YJBA 4M8LA 5GJCA 1DS6A 3ZDCA 4RZQA 1RM0A 1T5TA 2WAXA 1IUNA 4CCAA 3PJGA 5JW6A 1Z74A 3FVVA 4TTAA 2PUAA 4QDJA 5JRZA 5FPTA 1H5QA 2H2FA 4FMCB 3ZGNA 2OXCA 1TRHA 3LY7A 3BWYA 3KOUA 4UU1A 4F8JA 3EXHB 1XG5A 2Q3EA 4QYWA 2OBNA 5ILGA 2NU8A 1E6WA 3RFFA 3L0IB 3OCWA 3WLFA 5FWXA 1EPUA 1YK0A 2QHXA 1RCTE 5FP0A 5ITZA 4MEJA 4QGGA 2XCTB 2ZQ5A 2OBXA 4FFNA 4YRQA 1DELA 3QG1A 3UCXA 5DBGA 4M1SA 5HUHA 3AHFA 4W9MC 4NRDA 3TZLA 3L8CA 5L7TA 1I1HA 3IA2A 2P9CA 2YICA 1HE2A 2KM1A 1PJRA 1UMBA 1QCYA 5EZ6B 4B3MB 4DVGA 1Z15A 4G8JA 2B25A 3IUYA 4IHJF 1K8XB 1CUGA 1KO1A 1MGOA 1KDZA 1UP6A 2CCGA 2ZSDA 3FNIA 4FW8A 1NW4A 2HHAA 3G0IA 3FI9A 3NIBA 4JR1A 3JQCA 1NSTA 1SKBA 3GRZA 4N0QA 4TV9F 1I7LA 2BEVB 2VWGA 1SVIA 2TMYA 2XDQB 2B4TO 2IJGX 1CUWA 4XIJA 4C88A 5B2FA 3U44A 5FULA 1NX6A 3FLAA 5IABA 3IOYA 3BFXA 5BV0A 4UU0A 1QIHA 2XQKA 1I4LD 4XQ9A 2GVZC 3DUFB 5G4KA 1KF0A 1B14A 4MQFB 2JI4A 4ZO8A 3NASA 3K72B 4MGHA 3ZLJA 2GD2A 4YRBA 2FSUA 2QTTA 1RHUA 4LHSA 3ZI4A 2W43A 4XEUA 1OD6A 1YBVA 5K5EA 1V39A 1R0CA 3DZIA 3L49A 2ZPTX 3PEEA 3DHWC 3OD5A 1M2JA 2I6TA 1DLJA 2I4RA 4ZMBA 2QAGB 2DHEA 3E15A 4EUFA 4D9CA 4F4JA 1P2BA 3DJYA 5FL3A 1YUMA 1Z0ZA 1DKUA 4PZ0A 3A6FA 5KYUA 5HF9A 4NYMQ 3K9GA 5ESRA 3A37A 1U2GA 1W1UA 4IDGA 2CDBA 4R0MA 4EFMA 4F91B 3HACA 3FNQA 4YFYA 3FUTA 2WSIA 4JITA 2EFCB 3I2JA 2PS9A 3SLKA 2FPIB 3PGVA 4JXJA 4ARIA 4N76A 1E2QA 3LBFA 1KP2A 4QPJC 3OEYA 3IE0A 4FKZA 1KS9A 5JANA 1KPHA 2XGGA 5ER6A 5T4HA 4GKVA 4EI9A 3JSXA 1Z63A 3C98A 4C22A 2QD1A 3FA2A 3W3AD 2YHBA 1GG2A 1B41A 1MPXA 3E58A 5CM9C 5LSAA 2CNWD 7MDHA 3ZJVA 3IQXA 1LDBA 1T2VA 2I8AA 1XCJA 4GX1A 4WKCA 6NULA 3VSCA 3LPMA 4UHDA 4C0XA 4EABA 2WPDA 1CJSA 1I9GA 4GU5A 4XWKA 4RAQA 4Y1RB 1W29A 3MMSA 3RIGA 3WIBA 3AM1A 4M7RA 1CUHA 2QD3A 2IEIA 2VP6A 1O6ZA 1W4RA 3A0UA 3KTAA 3LUFA 1O9HA 1JHPA 1E1YA 3NJ8A 4X54A 3KWFA 5BVHB 2FG5A 3RK0A 3WQHA 3PHLA 2QVYX 4WEOA 4BMNA 1GRNA 2J1LA 1QRAA 3URMA 3AC0A 3IEPA 3DHNA 4D81A 2E4AA 5FI0B 4GX0A 3DMPA 3OZIA 2BFEB 5KKNB 1YV9A 3LHKA 3MGAA 4AYTA 4MJ7A 5CVJA 3A7EA 4HNQA 1PBTA 1BD3A 3UB2A 3WA6A 3PX7A 1QO0A 4OXYA 1A2QA 3N07A 2V6MA 2ZRKA 1TQ2A 3K2QA 1KEPA 2C4TA 1RAGA 1J0BA 1TQHA 5HIAA 2H4WA 5C7YA 4CF3A 4HEHA 1NAHA 4URWR 3MSCA 3QFHA 4R9VA 3ZV4A 1SUFA 3T3OA 1U3FA 4HLUC 4JSTA 3BFKA 1P72A 4YJFB 4DR3B 1EGQA 4BNKA 2Z30A 1E3LA 1X7YB 2JB9A 1RNLA 1ZH6A 4L8VA 2I71A 3JQ8B 4ZAZA 3IAFA 3MZ0A 3NOOA 1S9DA 5HIIA 4MKHA 5DNDA 3ROZA 3N05A 1G20A 1SHZA 2Y0EA 2L18A 1NJGA 2ZJOA 3BD6A 1YZUA 3SMQA 1FSGA 1GZ7A 1T3LA 2N75A 5I4KA 5CFOA 2G6BA 3I9V6 4EYQA 3F67A 1OWMA 3CNHA 1PGJA 3EQ6A 3ZE8A 4BQRA 3DXXA 5JVDF 4KAFA 5M2QA 1J5XA 3CTPA 4ZO4A 2NV0A 4US0R 3VDXA 1OWNA 1SUIA 2HIMA 3L1IA 3IVGA 4I9NA 1QYIA 1U99A 2J6BA 5C4GB 4A6DA 3L0BA 1JZQA 1UP7A 1ZQ9A 3SX0A 4PLHA 5CK4A 2BR5A 3O73A 4G0UA 3FSEA 1C4WA 5KQSA 2HO4A 3CUYA 5HMMA 2VAWA 3R7BA 3HCWA 4MVCA 1AKMA 2Q3JA 3FWHA 3DVLA 3LGSA 2PWBA 4R2HA 5JISA 1XNHA 1LLDA 2BUCA 3CKYA 3CUEF 3KD3A 3L8FA 1RZ3A 2WJ6A 2QSZA 3MXOA 3VR5A 2EX4A 3P26A 4WUTA 4DSNA 2BHTA 4E3ZA 1T4CA 4O2AA 1FX0A 4QOJA 2AZXA 1W9HA 3RASA 3DHVA 3PKZA 4MR9B 5ICMA 3TOVA 1O9BA 4MR7B 1PW7A 4I9HA 3K9BA 4UU7A 3DFKA 4B09A 2QVCA 2R48A 1DXHA 3SG0A 3VYWA 4Q4HB 4HRAA 3LT0A 1R8JA 1KAOA 2G28A 3SDZA 1T8PA 3EG9B 3ZWYA 1ZWKA 5AW7A 3GLHB 1LU9A 2WIFA 1NOKA 1PWEA 3W5DA 2NU6A 2DUMA 2WZBA 3V1NA 4EB6B 3GFTA 1UANA 2X4IA 4DLVA 3D02A 5AK4A 4OJNA 4YASA 3UJ9A 2ZYUX 5FNVA 3LH5A 2FGJA 5GQSA 2HCRA 2YBDA 1LLCA 3ZV5A 3AJRA 1WCV1 3DE6X 4NK4A 4DL9A 5JYBA 1BGVA 3ZI7A 2GJKA 4PLYA 3E5MA 4Q7LA 4ZALA 1D0IA 3WDMA 4YDRA 5A3SA 3WLLA 4G4SO 4CLOB 2HPVA 1BAPA 2XBLA 4OFXA 5JZOA 2UZ4A 4X8OA 4PLWA 1QCDA 1M83A 3OQIB 1LDYA 1BJKA 1J9EA 1JFFB 1TYCA 3SX4A 2WDPA 2XVXA 2XXJA 3PKIA 4R9NA 1OXBB 2OQ2A 2O2ZA 3BMQA 4B83A 5I4BA 3RANA 1NT4A 2QUBA 4G8CA 1KPGA 1TYEB 1XVUA 2JLYA 2O3QA 2O8EB 4J07A 4J3FA 1UKCA 3OQ6A 3J81k 1U7PA 2H4JA 4K7JA 4CEIA 1SVSA 5CDSA 1A5TA 2ID9A 1AG9A 4WT7A 4DT1A 3DCIA 5TQ0A 4UAGA 5JTUA 1UDBA 4MVJP 4EUSA 2QRVA 5CK5A 2IHNA 1XEAA 3HCBA 4ZQEA 3GMTA 4F8EA 3W9SA 2NU9A 1OCEA 3EH1A 2XWJI 2I33A 3DLCA 4MLPA 4AZTA 3LUJA 2QMOA 3HJTA 3HMQA 4MPPA 1JJAA 2SCUB 2Y1XA 3VR6A 3D4BA 4L8WB 3T1QA 4EZIA 1X80A 3I5XA 1A82A 1GZVA 3B13B 3MQ4A 5TE9A 4AO6A 3HA7A 1H85A 4HL6A 2H1CA 1OGIA 1L0BA 4JLPA 1DBQA 2PIAA 4K6FA 4TKZA 2CFRA 3U7EB 4D45A 5EPUA 1F0NA 1W4LA 4ED9A 5BT8A 2JFWA 3AR4A 3NFRA 4H16A 4TKMA 1NG9A 2Q1XA 4P7GA 1RYNA 1UPFA 3CLRD 3EZNA 3ITKA 1HYEA 2WICA 4U39A 2AKAB 3ZUPA 3GXOA 4EY4A 3H9GA 5KNDH 4ZPXA 4XFJA 5EXTA 4TQ9A 3ZHUA 4E7OA 2GCGA 4TVKA 1Z4IA 3OPVA 2VRCD 4BCCA 5AW0A 2VDPB 3OX1A 1OFGA 5EFOA 1V1RB 3IIJA 2B2XA 2CMGA 2V3WA 3CEHA 3SJZA 2MMGA 1H65A 4NX2A 4CG0A 3K70C 1QRTA 2FDCA 2H18A 4LUCA 2XVYA 1E18A 3BSSA 4ZOBA 2CHUA 1S3FA 2QYSA 4FCWA 5JAHA 5IDQA 3PUHA 1TTHA 3U40A 3IVMA 1AY0A 4KMRA 3GFQA 5F1YA 2OGTA 1U28C 3CXRA 3DOUA 3DYIA 2YW9A 1KFBB 1W0JA 1TK9A 1YR6A 3BN3A 4WKOA 3Q3HA 5F1KA 3WQBA 4F9TA 3H9UA 2ZTLA 1USGA 4I2NA 1YU9A 5FWYB 3JRWA 3UUFA 3I9KA 1N2OA 2UZAA 1DUVG 1BQ4A 3IQEA 3M4NA 4FLEA 1LDMA 4IDEA 4UNNA 4GZLA 2AJBA 2PWAA 4CMBA 3U60B 1E7RA 1XZFA 2L17A 1BMQA 5EOVA 5EKTA 1IG3A 1DAPA 1ZKMA 3EX7C 3TQRA 1QPGA 2IL1A 3LQKA 4PSAA 1K8ZB 1RBYA 2JFHA 2QORA 1VE6A 1PUIA 2RHCA 2ZGVA 3F2IA 3GLSA 3L4BA 2QLNA 3FSJX 3R77A 1TB4A 2PZJA 2O54A 5F23A 2X5XA 2R3SA 1M3SA 4G4IA 5JAQA 4G8DA 3AEUB 3MS2A 5FA8A 5K2MA 5A0VA 4R2WA 3UWPA 2RDMA 5IAGA 4DKJA 1L8XA 2NVBA 2GZRA 3DM5A 3SS9X 3AETB 5CVEA 2HNBA 4XLZA 3TFQA 4ESHA 3CVUA 2KQUA 1J2TA 1N6OA 1GGJA 1R4ZA 1NX9A 2AMVA 3FZYA 2A0KA 5DX1A 2R96A 4DV5B 1HI9A 1VXOA 4MQEB 4JI1B 4Z7QB 1M2OB 1Y3CE 2XZPA 2YFYA 3G7UA 4R51A 5CLLA 1IXSB 1E1CA 2A59A 2JFUA 5IARA 4JVSB 4ETWA 5COQA 3P0JA 1A5BB 2WVGA 3LP8A 1R0LA 1UBCA 3A6EA 1IE3A 4K0KB 5B30A 5KC8A 1VPLA 3I09A 2PK3A 4B3SB 3G5LA 2BFMA 1Z2DA 1PZXA 2DKOA 4D92A 1ESCA 1P2SA 3HBJA 4AS1A 2ODBA 4TTSA 1NBWB 3HEAA 4FK8A 3KEGA 1RQNA 2IVFA 1DQZA 3N7TA 2NYUA 1TU3A 4WASA 3C5CA 4YO7A 3ZCXA 1T15A 2HXYA 3HJRA 4GAEA 4RLQA 3F49S 2Q62A 3QVJA 4CPDA 3R6DA 4KQJA 5I45A 2H17A 4R3UC 5E3HA 1JJFA 2WMDA 2V6GA 4GM4A 3R6WA 2WFLA 4EBFA 2YHIA 2J6IA 3ORQA 3FDXA 1KJIA 4TKUB 4YS6A 3VYTB 3OTIA 3WNBA 3ZU2A 3KDPA 1YNOA 3ZD8A 5KQPA 3ZLVA 1C1XB 1RW4A 3N2EA 4OLBA 3UXMA 2P1ZA 2WFMA 2X86A 3HDJA 3VKHA 2IRWA 1UPCA 2E6UX 1WCWA 3DEFA 1OFUX 3ZU4A 1YMQA 4JI2B 3DL4A 3U4CA 3B7PA 3H9CA 4K1LA 4AC9A 5BN4A 4IEEA 1RYYA 3ECSA 4YMLA 5LM3A 1DC8A 1DO8A 2QN7A 4IXMA 5E3IA 2YC2C 4HQ6A 4BQQA 4ZV4A 2BTQA 3OQNA 3AR8A 3PQ4A 4IGFA 1OA0A 2JL1A 1EE9A 4NOLA 3ZOKA 2OLJA 3DP7A 1YS1X 1L7MA 1OA1A 2FI1A 3PGJA 5HUJA 5KYYB 5JSUA 5LL6P 3QUSA 4AJKA 3W6NA 4P38A 5LDGA 1ZM4A 3HP4A 4KNWA 3RODA 4GVXA 3LW7A 2VAPA 1N6RA 2YJ3A 3HI4A 2LIPA 1VSQA 2WHRA 3NTXA 4XCVA 4OMDA 3L9WA 2IK8A 2Y93A 3KB8A 4TLLB 5AVSA 4MTLA 1HG1A 2PCJA 3AF5A 3C43A 1SC6A 1XMQB 3IPAA 3EGOA 2DBYA 5CXUA 3FSGD 5I4IA 5B1DA 4PNHA 4HC4A 4EZEA 3EZYA 2UZIR 2WFAA 3URKA 2XXAA 1ZO8A 2OFOA 1A9YA 1IY9A 3WK4A 1EWKA 3L7LA 3H86A 5DIZA 2ZRCA 1YOBA 1JBQA 3OCYA 3U4IA 2C58A 3B1WA 1GN9A 1UJNA 2CMHA 2FPMA 1BX0A 4BUCA 4A7PA 2XBUA 3ETEA 2AEEA 2FZ5A 3FHJA 2MU1A 4OKNA 1BCSA 4TYPA 4AZ0A 5JAIA 2CN1A 4L22A 5IYZB 4OQQA 1JTEA 1OREA 4OXIA 5A9TA 3RSGA 1UDAA 4BGVA 5KBYA 3BWXA 3T7CA 3PIRA 4AS2A 1OH6A 1M2GA 5AI9A 4Q24A 3ZHCA 4FDTA 2QIOA 2B1JA 2LWIA 4AY3A 4RK6A 3WYCA 5JAUA 3AM3A 2V0CA 3FZNA 2OAQ1 4LZPA 2C92A 5KQRA 5LP6B 1QQAA 4ETMA 1B76A 2QL6A 3BULA 3ICVA 2O57A 4M2LA 1WSDA 2YR0A 4Y9UA 4KR3A 1D6NA 2RD2A 2ZI6A 3WIEA 2BFFB 3B12A 1N5RA 2PLWA 3C5HA 3BIWA 4HH1A 3BGVA 3WSVA 1IUOA 3KOWA 2IQ5A 4XSGA 4GBJA 1AGXA 3RH0A 1YRHA 3I0NA 4MQ5A 1KPIA 3IP6A 1I4OA 1TVKA 3M82A 1D6JA 4NZYA 1ST2A 1JEQB 3N58A 1N2GA 5KAMA 4J7UA 4F7DA 4C20A 1WUYA 3L6BA 1ID1A 4LOKA 1QIEA 5BSUA 2HJWA 1VKNA 1M54A 3DMTA 3LFUA 2F1KA 5DASA 2PKXA 3E9CA 5HUQA 1CIPA 1N6PA 2ZIFA 5K03A 4NMMA 2QM7A 1U7UA 4WZBE 3GELA 1UJ5A 1G3MA 3TOSA 3VO9A 4Z1MD 1PD0A 1SHLA 3V46A 4E46A 2MYUA 1RBQA 1FS6A 3BEDA 3E9QA 3NNNA 1MZVA 5EINA 5KWVA 3ZC3A 1XEWX 1WDMA 1LKZA 2DECA 1FLNA 4W5WA 5ADUS 1RXVA 2JAOA 1T9BA 3MCUA 4KK4A 5EZSA 3ZVRA 2ZSJA 4YRAA 3DBOB 3Q12A 1W94A 3QBDA 3W8RA 2VRWA 3H1BA 5BORA 1GZHB 3H8WA 1FFGA 1X9GA 1L5WA 2W6MA 1RZRD 2AFIB 2VQ6A 2QTAA 2KSQA 5DP1A 5AHKA 3FGPA 1X8LA 2FXVA 3JRNA 3EDMA 3O8LA 3HJGA 4KXMA 3MLBA 4MI3A 4PO1A 1QH8B 3HFGA 4CTNA 1NUSA 1GUYA 2ZI5A 3RC1A 3CG0A 4X64B 5DTIA 3RIMA 4C07A 1P9NA 2YHUA 2HJSA 5E1DA 1ESMA 1W5FA 4OJYA 1L7EA 4OBEA 3U3XA 3KNZA 4DA8A 4R31A 1NJ6A 4CU2A 5IJ0A 1JALA 2A7QA 2PT9A 2WAYA 4JJ7A 1CNFA 3VAAA 3QEOA 1JEEA 1YQTA 3QE3A 1UZAA 1OLOA 3RC7A 2WINI 3VZPA 1PFUA 3ZZTA 1WB9A 2EKQA 1GCOA 1PX0A 1NN3A 2HD4A 2RAUA 3G2IA 5BV8A 3SOPA 3IJRA 4O4HB 3A9TA 1WB6A 3DUFA 4E7PA 1UXGA 1TAUA 1S4QA 3ZE2B 1XFDA 2HF2A 4JQSA 4WX2B 5EHGA 3F4BA 3I39X 3D3EA 4DA9A 3DVAB 3GGCA 3ZBPA 4G5OA 4M1EA 4UXJA 5CR9A 1EM8A 1E62A 4YLGA 1NV9A 4TZKA 5TJ9A 1VGVA 1EBFA 1N6KA 2BMWA 3H2IA 4IIDA 5IVIA 3BXHA 3JQBC 4KUEA 3UEOA 1UPBA 4REQA 2JFGA 821PA 3BCSA 4LYEA 4YAOA 1RYDA 4H7KA 4K03A 5ILQA 2Q9BA 2R8RA 2YJTD 2C5SA 2PR2A 4WXHA 3MK31 1CQJB 1IHYA 1MJGA 3MYRA 5KWIA 2PE5A 1Q7EA 1DOZA 3ZWVA 1DT3A 1VJ5A 4OF4A 2CNBA 1JEJA 3P9ZA 2VTBB 4QBFA 1A8UA 1C9YA 2GN2A 4GM0A 1G2QA 1F06A 5ICEA 1XZKA 5F3RA 4CMEA 3VJLA 2Q4EA 1XMOB 4JJZA 2YMPA 3VKUA 2XRFA 3CMMA 3TSOA 5REQA 4UTZA 2ZYVX 1KAGA 5ALJA 3WK8A 5THXA 1W4BA 3ELYA 3G8CA 4PVDA 5EUBA 2YZMA 4AD8A 1VLLA 1CR2A 1XROA 3ZHZA 4ZOLA 1USUA 3JV7A 3P20A 1RRMA 3USZA 2Q5IA 3VVMA 5F51A 5AVWA 4IDNA 4E0BA 2ZUWA 3D8UA 1RXUA 3B5EA 1OFIA 2VWHA 4DR7B 2P5TB 4Q9HA 4YA6A 3QXGA 3TEJA 5ALIA 4DLZA 1CEYA 3C3DA 2B8EA 1QG4A 4E94A 1J09A 4M76B 3H11A 1JEYB 1TK2A 4FZVA 5SZHB 3V8QA 5K0EA 4DR2B 3OWHA 4FD2A 1IUKA 1OFHA 3AR7A 4QD3A 4UPDA 3Q72A 4G36A 1G60A 4BV9A 3B3GA 5CPBA 2YWEA 3HA2A 3D0KA 3INRA 3NHYA 2G08A 4EELA 1SCQA 4PR3A 5JNSA 3KXIA 1M2VA 3JXEA 3FOFC 3Q3GE 4RQAA 3P0EA 3KKNA 1K6JA 3QFTA 1YQUA 3TSYA 1JQJC 3U7IA 3MMNA 4TMTA 4WNYA 4FFBB 1QIDA 4CODB 4COOA 2AI2A 4QEZA 4IQ0A 4RK7A 4MMYB 1GGNA 4PG5A 3D3KA 4ZYYA 1G3RA 2H4HA 4JYMA 2JJ1A 5TR9A 2FEXA 1A8IA 2XUPA 1M7BA 2JJ2D 2A9KA 5EJ6A 1KEEA 3V4RA 2RGNA 2C2HA 1FF9A 3G1TA 2I22A 1FNCA 4ASUA 3UCFA 3I4LA 3ILSA 4MUFA 1U2DC 3HUTA 4F84A 1IEQA 1JSRA 2FW7A 1A4UA 3GDOA 3T99A 2EEPA 4BGIA 4ZJUA 3MJCA 3CINA 4R5MA 1OY1A 3UGQA 4I1YA 5JG7A 4LY0A 1AV6A 1R16A 3FTCA 4G65A 5I3ZA 2VYNA 3AM5A 1AH2A 3KPYA 2PHZA 1CR6A 4Q16A 2VKTA 2QG6A 4MCIA 4RSRA 3AESB 3V2UA 3WHKA 4JHLA 1L5YA 2WAOA 4YWHA 3T3IA 1F8XA 3MCAA 5A0FA 1RPZA 1FW6A 5K0JA 4LOAA 4CDMA 3PYLA 3OFKA 3OA2A 1U8UA 3MS7A 2J32A 3C6QA 1P4RA 1X13A 5JWHA 1K9SA 5EUCA 1QQ5A 2E0IA 1DKRA 2GERA 4BO8A 4OHWA 4FFMA 4BQNA 1GUFA 2V0NA 3I76A 1B3BA 2Q6VA 1HNZB 3K05A 1X38A 1YRLA 2RGAA 2H5JA 2YQZA 3IAS1 3TQQA 4BIMA 1FE8A 4D4MA 4O4JA 3HWRA 1RC1A 5CHEA 4EHLA 4I36A 3ABSB 4CM3A 4N47A 3ROMA 1UPUA 1H1LB 2YWCA 3H6KA 5K3EA 5HQTA 3OF2A 4BO5A 1U9ZA 4M46A 1N8KA 3NWJA 3O95A 3QLTA 5JAOA 3H3JA 2BKEA 3T94A 2UYOA 4JL6A 1FBNA 1GQ2A 3AU8A 3B1VA 4U1RA 2V97A 2VIIA 5ALRA 1NVGA 5LMUB 4NSNA 1SXJE 2DFDA 3QVTA 3ACDA 3BRWD 3T7KA 3G0OA 2JHGA 4URFA 4DR5B 3IB3A 4BNNA 1YSCA 3MGBA 1I7NA 1EIWA 3V7WA 4KIGA 1JH8A 4BIIA 4LECA 3JQDA 4B9EA 1P2VA 4C3ZA 2R60A 3K2EA 1VI2A 5D5QA 4PICA 4O3MA 3JQQA 2YN4A 3KM0A 4ZGBA 2LUOA 2WMNB 4BJ1A 4P34A 5CUQA 4ZEMA 2EBHX 3C0KA 3QX8A 3JS5A 2D2EA 4DBVO 3DMNA 2R7NA 4H4EA 4MW6A 5E6UA 2WU4A 3UCEA 4C5CA 1DQRA 2UUBB 4Z99A 3SYMA 1W0KD 2VSYA 1K98A 4IMPA 2QX6A 2AG8A 1FRZA 3A9RA 3DO6A 3OM9A 3UOWA 1UMDB 3VVBA 4M60A 3R7WB 3UAGA 3WIVA 4M9SA 3VKWA 1ISSA 3AVTA 2XCSB 5CIWA 3HBMA 1CUAA 4N7RA 3MT0A 4G5RA 1P0FA 2XMCA 1L6RA 2JDIA 2HOQA 4WA7A 3TVTA 3WL4A 5KO2A 1A1VA 1TM2A 2O8DA 5CG2A 2ISSD 2JAUA 4P4SA 3INNA 5MFPA 2F2TA 1B1CA 2O07A 3KLNA 5E2IA 3DQPA 4RTRA 3FUWA 3R7DA 2DFLA 4DUZB 4MP8A 4L4SA 3SIPA 4B4UA 2QW0X 5DI3B 2GO1A 3SF0A 4BP9A 2RAPA 1AM4D 2EARA 2VYVD 3GG9A 3GRKA 7ABPA 3P9YA 4NZOA 4WBNA 4C6TA 2C57A 3NBXX 4PV7A 4MKIA 3U61B 2X9LA 1S2MA 3VU0A 2ZTSA 4NULA 5JY6A 1OXTA 4FONA 3TEFA 2PZKA 1L4FA 2W6PA 4C4PA 4GX2A 4XR9A 4HDNB 3GD5A 5MN6A 2VNHA 4Q1CA 2O5CA 2V6BA 2QU7A 1H0KA 3OG9A 2DMRA 5HFAA 3UWOA 3L0DA 2RC6A 2PO5A 3TLKA 3GUVA 2IHKA 2GHTA 1L9XA 3U7QB 4BEVA 1HXHA 3VZRA 3IUMA 4BZZA 3E1GA 3ESQA 4RTQA 1E1KA 2PKEA 3IAXA 5CXXA 2VP0A 1X9HA 4MB6A 4MW4A 5CXSA 3TLEA 2P7IA 3LQ4A 3N5CA 4ABTA 2BN4A 4OHKA 4ENVA 5HOEA 3HI6A 4QECA 3FUXA 4FKMA 4K26A 4DIFA 4DNXA 1JQKA 1DG1G 4GQAA 1T8SA 4RA6A 3R6LA 1O6BA 4Y98A 5IC4A 2ADOA 1MH9A 4MYTA 2X1MA 221PA 3NALA 2FWJA 2AF4C 2AJTA 2XIJA 2L0XA 4JBYA 2D6FA 1ZI9A 1RM5A 2PKQP 1J4AA 2EBUA 4IKPA 4FTWA 1XTZA 2BM1A 3RDPA 2DEUA 2PUVA 3DZCA 1T0HB 4LC1A 4Y2XA 4B46A 3HBNA 5LP6C 5CDFE 1RQPA 3KETA 1T0PA 1Z2EA 1RJ9B 3H5IA 3SICE 2H08A 5EXPA 4Z9FA 5BYKA 4QOGA 4NHEA 1MLDA 5FPQA 3VPXA 1DAHA 4RVOA 1Q16A 2ZQZA 4GUAA 3U4HA 2CWDA 1E1LA 4CMGA 1W0CA 3DUWA 5JEEA 1N1DA 1R4MA 1W6UA 1TNDA 2FVYA 5CG1A 4P3OA 4LHYA 1QYRA 4LYJA 5DHFA 5GOTA 2BYTA 1XDGA 5A5DA 5JNRA 1CT9A 2ZDQA 3UN1A 1H2BA 2BCEA 4XVUA 2DUWA 3BTVA 1NURA 4QTTB 2W6ZA 3PJEA 1N9ZA 3N53A 4XPIB 2D7DA 3DGEC 1NMYA 5FBHA 2ODWA 1GNPA 1W5TA 3D0RA 1XPJA 5EUMA 3WWEA 1ZXLA 2YIVX 1TPZA 4N6NA 1HBJA 3C41J 5E1MA 2NPFA 3U56A 5LQJA 2GSDA 3C6KA 4UMDA 2O1WA 3ORYA 5A7GA 1A27A 4DIUA 3ZN2A 1R6TA 2VAMA 1ZD8A 2PLNA 2REXB 2YVQA 1OTXA 1KFJB 3I01A 3OFVA 4UHJA 3TXAA 3OJLA 4AX4A 4BEWA 4IIVA 1RRKA 3IAM6 1BKYA 4BB6A 3AEQB 1T6YA 5GONB 5HOQA 3W5JA 3OEHA 1H9AA 5HZHA 4BKMA 4RZ3A 1S6YA 2WWXA 3IXQA 3NMUF 4MWCA 1RI3A 3ZDQA 2OAEA 1Z9BA 5JCZA 3OCXA 4I5IA 1JIXA 5KOHA 4PG4A 2PD4A 2QUHA 2X2PA 1JIIA 1JDUA 1J0XO 4IG4A 5DZSA 4EY5A 3ZW7A 3EIWA 2PL9A 5MDHA 1PL6A 1Y6FA 1YS6A 2V6FA 2CE2X 4IDCA 4DIDA 1Y7LA 5KHOC 3AR5A 2I6SA 4MJXA 4CRWB 4F3KA 1X1CA 3AFGA 5BV7A 4K46A 1N2SA 1M8KA 2DULA 4INAA 4ERXA 3RSZA 2OZEA 3MIIA 5KOJA 4MA4A 2ZUFA 2HRRA 1NU6A 3WKBA 1EVYA 4CKCB 1CU1A 5DNWA 1C8LA 3P2MA 1PP4A 1T91A 1ZN2A 3GZ4A 1T5IA 4PTYA 3RREA 3TLMA 3LBNA 2YY5A 1K5GA 4V38A 6ABPA 5B3AA 4IDFA 4W8OA 1D2AA 4HAVA 3JQ6A 1Z0IA 4CM7A 1PJBA 4OMUA 2BMDA 4QDOA 1MABA 1FQOA 2J9FA 3NV7A 2AGVA 1A9SA 3EWNA 1K89A 3DTTA 1H1DA 2P9YA 1ST3A 2B7CA 4PZLA 3RBZA 1CB0A 3JTEA 3N5KA 3LXXA 4JI7B 2QRJA 3KKPA 3GJ3A 1WXIA 3E03A 2OP1A 1GZ5A 4LAFA 4MPDA 1XX6A 2XMDA 1RQ7A 1YZ3A 1OH7A 3CN9A 1OAOC 3OJCA 4MVYA 1SIUA 1A9XB 3HN2A 4FVTA 4OO3A 2OSBA 5J5CA 6REQA 1ZH8A 1M76A 2F6RA 2BP7A 2O6HA 2ZSHA 2VF7A 1XR3A 3IVXA 2Q21A 3LOPA 3ET5A 4O2AF 4QXAA 5HS4A 4OB7A 4PPGA 3HXKA 2JGFA 4JB2A 2C5EA 4NU5A 4E32A 4C14A 2RH9B 3EWIA 3Q4GA 4FKBA 2Y2UA 1L4YA 3Q9UA 2R7AA 2EW2A 2AS0A 3QEAZ 3V34A 1ONBA 3EPHA 2XXBA 2P27A 3CGWA 3SKVA 7YASA 1SBTA 4B3XA 4Q9LA 2RH8A 2QQ0A 1AN0A 1L7XA 3B3AA 4MPJA 3VR5H 4Q4JA 4B6FA 4EP1A 2APJA 5FNVF 5GZ1A 4JP3A 3HB7A 3NP7A 1TQDA 1OXMA 3K9CA 4BFSA 1F1BA 4DLAA 3A4IA 1V9LA 1DJOA 4ZV7A 5KX5A 1SGWA 5AKJA 2O3SA 9GPBA 1U0EA 1Y4ZA 4HLDA 3TI7A 3W2HA 3L1JA 4DYVA 4KPEC 2AYYA 2HIAA 3A32A 2GF9A 1W88B 3NOQA 1LDNA 4MV5A 4PF1A 3LF1A 1TAGA 4XIFA 1QHYA 4FR2A 521PA 5FWNA 3GLGB 3I0MA 3LQQA 4Q4LA 4LWZA 1SD2A 2Q9UA 1YCDA 3HE3A 4UOQA 4I1UA 2AOUA 3V33A 3UK6A 2AE1A 5J2UB 2X9GA 1CNEA 2Z58A 2EP7A 1E2KA 2ZCVA 1BA2A 1YHNA 4I8DA 2ZVDA 1E2IA 3WOHA 1RI4A 3FIJA 4Z8XA 3IKTA 2J8ZA 3AOEA 1OZHA 1ZUD1 4MDHA 1PO7A 5BQOA 1DAEA 2IE8A 1WXXA 2BJWA 4M8KA 4D7AA 1X7ZA 1ODCA 4R1LA 1UKVY 1M6YA 2JFXA 1AHIA 1E9VA 4ZV9A 3ROKA 4IV8A 2FDRA 2I2WA 4MVJH 1A4RA 3KLBA 2WWFA 4RFVA 3TPCA 1O95C 4FNOA 3GN1A 3CTMA 1GL9B 1UDXA 3NVMB 1BWQA 1GGKA 2E89A 3EY4A 2YZNA 1LBIA 2W2NA 4F3YA 1X1TA 1SOMA 1YDMA 2ZYHA 4KUGA 3PT5A 2DFVA 4R3WA 5F5NA 3UHPA 2WB2A 1KY3A 1CCWA 1J39A 1L8OA 3ANMA 3C48A 4IOKA 2JZOA 4LDQA 1RM3A 1A9PA 3KKLA 3LZ6A 2P7HA 4BX0A 4QLOA 3IVCA 1Y9AA 1HA3A 1HSZA 2IIPA 2ZS9A 1U8TA 1GPH1 2VP2A 1F60A 1PW5A 2BHLA 4IWXA 1E1MA 4W6QA 3NJRA 3DQQA 3TQFA 4DDUA 3AUSA 2NUBA 4EEXA 5MGNA 1ZGHA 1B93A 4WXYB 5HYVA 5IK2D 4N5NA 1G8AA 1P44A 2NUAB 4QSHA 3OCCA 2V7GA 3H83A 2I7XA 1KKMA 4JP1A 4TUYB 2P35A 2R4QA 3CEJA 5TPZA 2NT4A 4JI4B 4PPQA 4JLBA 4X9XA 1FVHA 1HYBA 1Y82A 4EWLA 5A06A 3HDYA 1NRXA 2CCKA 2YV2A 3SZMA 1GL3A 1NVXQ 3C8MA 4EHHA 3H05A 4FYXA 4GNRA 4Q9NA 4DLSA 3PS9A 2EL9A 1GVHA 3QWIA 5EQFA 3RBAA 4JGIA 1P7ZA 5E7JA 3M2PA 1QTRA 1BRTA 3QF7A 4DLNA 3B38A 4F96A 4NJEA 1OGYA 2FA9A 1RVV1 3NGMA 3RB8A 3DOCA 5JD6A 2CXOA 2P65A 5FFFA 2VPXA 4BKOA 4V3BA 2ZJAA 3J80A 4GO1A 4AS3A 3ZGZA 2RBEA 4K9KA 3HHPA 1GOTA 1AN9A 1U98A 1SVUA 4FUQA 5DU2A 3RRBA 3IEXA 2BMVA 3AEKB 1X92A 2WYVA 4UVIA 2BSXA 1K7EB 1DCKA 1XCPA 4KSCA 2GGSA 1Y7IA 5DLEA 3D8TA 4ARSA 4PSVA 2XADA 5JZMA 4TXMA 5KNCD 1OMOA 2R84A 4R68A 4QZVA 1IN7A 1L4MA 4ISCA 2XQGA 3ZU6A 1XZGA 4U7JA 3TCKA 1AVTA 2PMEA 2RSLA 2CXRA 4R4JA 5B57C 4BQPA 4E1AA 4TM7A 2QRKA 3GCZA 3QKWA 1PNQA 2IXDA 2WG1A 4MB2A 1P4GA 5L4NA 4UM9D 4QLAA 4OP1A 3G3EA 2N3ZA 2QXUA 1YACA 2IW3A 2JGDB 4X90A 1L5SA 3RABA 4B7AA 1KZ6A 5DW3A 4TMKA 2I6FA 1U94A 3F6RA 1ETUA 1P18A 2BEWB 5AKKA 4O4IB 4ARAA 4ZPJA 3CEMA 2HSDA 3OF5A 4I1RA 5IH3A 4JP5A 5TY0A 1FNMA 3T9FA 2IBTA 3W78A 2X7JA 1NONA 1QGUB 1D03A 2GBLC 3QFSA 4ITRC 4L4XA 5E6RA 2XYRA 2IXEA 2ZWMA 3N8NA 4LVUA 4NAUA 1RRFA 3W5SA 3PR3A 2X4GA 4BZXA 1LCIA 4OTZA 1H2FA 2GLTA 4OVKA 3CG4A 4MB0A 1XHFA 4YRIA 1YUBA 1Y5RA 4AI6A 4M6WA 3G6WA 4HB4A 3QVGA 5EC8A 1C3OA 3HVKA 1M72A 1MIHA 5LXTA 1UMCB 4FZ3A 1TZBA 1X2EA 3LRPA 2W9XA 5K99A 5BQFA 1VLVA 2C54A 2DFPA 2G5PA 2JHAA 1II0A 2UZ0A 3H17A 5A6VA 4OAOA 5U1PA 5IUJC 4DQLA 2XB9A 1RRPA 3PEWA 2ECQA 3L8ZA 3PBKA 5JPIA 1E3WA 4HQFA 2KS6A 3L6DA 2IUTA 2QP4A 1WCYA 3R9XA 3D4PA 2GD1O 4RA9A 1O2DA 4KLCA 5DCLA 2CEKA 3EULA 4H0FA 3W90A 4AT1A 2ZE7A 3CKLA 5E2AA 5JH7F 4KGVA 3PGKA 1JA1A 1D4AA 3A9WA 3QXCA 3S99A 5LYJF 3HUFA 4Z0NA 4PGHA 4J7AA 5GWXA 4HX2A 5D6OA 1W2HA 4S04A 4JDUA 4J3JA 2XCOA 4RACA 2FFHA 4B8ZA 5TIIA 1M73E 1MJFA 5CEEA 3QPUA 2ZYWX 1DB3A 1W85A 1NW5A 3HJBA 3SHFA 5CLGA 4DJ5X 1J21A 2J9ZB 1DRVA 4ETIA 4UW9A 3GJQA 1PJLA 2NSJA 3W1WA 3CR8A 4OFWA 1EVIA 3JD3A 5EE9A 2PR7A 3FTNA 3OPYI 3TOXA 2OXFA 5F73A 4IXNA 4BVBA 4EGFA 2AKEA 5KSYA 4PGFA 3UW1A 4RVCA 2GYUA 2PZBA 2ZTMA 3VUFA 3WO0A 4JJKA 3K1TA 3R7NA 3QV2A 4NU8X 2EZ8A 2NVOA 2Y77A 3ECAA 3HL4A 4IV5A 4MS4B 2WYUA 5TEWA 1L1QA 4CFYA 2M6RA 3P19A 2HK8A 1LXCA 3S2SA 1G5QA 4P33A 5HKOA 3X0DA 1SOVA 4KQGA 3P71T 1QDEA 2BR3A 1WDKA 2R66A 2W6OA 3R0QA 3TZ6A 3H1AA 4U4AA 1P77A 3IDZA 2OESA 3HXMA 3HLTA 3FF4A 4FS8A 3VMMA 2VHTA 4U5QA 3NM6B 3L79A 1X74A 1XDUA 1N3LA 4PNZA 4WFIA 4IOLA 5AKLA 2C9CA 4LE0A 1QWOA 4S05A 2CV1A 1ZHOA 5G0WA 3JQEA 3KPUA 3GLIA 1LS1A 3GNLA 4DABA 1NBME 1E96A 3DH0A 1CD5A 1W96A 5TLSA 4L74A 3GGJA 1JKIA 3BEOA 2R8XA 3DULA 3GROA 4FYPA 4YUVA 1EZZA 4OLFA 4RE5A 4B47A 3G0CA 4JSRA 5FBKA 5D84A 2OECA 2I4LA 1IY1A 3AIIA 1G98A 2Y2VA 3TJMA 1SBCA 5CJJA 2DU8A 4ZVVA 4IVPA 3ZY3A 3AI2A 3HYTA 5THKA 4ZOEA 2ZAIA 4Z4CA 1B23P 4M8NE 4WNIA 1H6AA 2PX3A 2G70A 4HVCA 2PFSA 4MH0R 5KMGA 1NI4B 2ZRPA 4L2IA 3LWDA 4WZAA 1FJGB 1PGOA 1E98A 1SPBS 3ASVA 3QXJA 4GBGA 4GECA 4BLWA 3MBIA 1KEWA 3PNKA 4LJ7A 4K9DA 4QEDA 4EKNB 4F2PA 5IG2A 1OBCA 1QV6A 2NQTA 4YRRA 3QENA 5D1NA 3TNDA 4JI6B 1UDRA 5DI3A 2CNNA 1RXEA 2MR5A 4FFVA 3UMGA 2A0UA 3GI1A 1AZWA 1VGQA 4M38A 5H16A 1II8A 3TW8B 5LLDA 3BXGA 4LEIA 2VTKA 2WPDD 5L3QB 4F9GA 3A8TA 1K7XB 1XMIA 2XGMA 1FP1D 2IPOA 4IQ8A 3PCTA 1BA3A 4MI6A 4MQ6A 4AECA 2I6QA 4BZQA 4XWWA 2JW5A 3P96A 4JGGA 3N8IA 4O4LB 2KB0A 5TXGA 3ZS8A 3Q3JB 4KEAA 2ZBFA 2VUUA 5FWDA 3H4IA 3RRZA 1DL5A 3LQ1A 5A7FA 5DYGA 4YMHA 1RE1A 1G8KA 2DPHA 3MJEA 3NU1A 4MRSA 4YJ2B 4MV9A 3ZIAD 2AXQA 5CB4B 5JSZA 5JPCA 1CQIA 2PVPA 4D0GA 1BQ3A 1VLQA 4B1FA 2Q45A 4Y0NA 4CTKA 2Q5QA 4QFCA 2WR8A 4Q5IA 3RKSA 3UNXA 3J7AC 1V9SA 4ZU6X 3DVRX 1R6AA 3IPXA 4ZEWA 3E22B 4ZVPA 3BBPA 4ZCQA 4C4ZA 1YVUA 3RVBA 2CZQA 1G7SA 4MRPA 3GBSA 1ODSA 4X60A 1GJRA 4I50B 1BCRB 2VDRB 1KMHA 4ZK6A 5LQAA 4IHKA 3VH1A 2FN7A 1E2PA 3SN6A 4BHTA 2C61A 5E0KB 1G9TA 5EYPB 1YD7A 1G5TA 1YQGA 3MW8A 4L8YA 3UMSA 3QF4A 5EEGA 4YWJA 2UUAB 3AO0B 3RBXA 1URPA 2BGUA 4PZ9A 2QVZX 4I81A 4B9AA 1E8NA 2NTEA 3VDRA 3KQSA 1U7XA 1EEHA 1PZMA 2VUTA 4R9RA 4B31A 1SXJD 1MVNA 2NO9A 1EVKA 2G63A 4HDQB 4YREA 1H5NA 4ZT2A 4LRTB 4BMOB 4BC1A 4IH1A 1GNQA 1UOEA 5C5CA 5JALA 1CQWA 1K7FB 4I1VA 1QGOA 1TA0A 2FW8A 2GDJA 4OQ4A 4PFSA 3TSAA 4KO3S 3BMNA 3SC6A 1GPDG 3UMVA 4A0RA 4L07A 4QNNA 4MO9A 3FVWA 5FXMA 4ZOLF 4W5NA 1KEZA 3DL0A 2NSLA 2V54A 5F9HA 5K20A 4D99A 1L3IA 3GAMA 5J5VA 4AU1A 5A03A 4EY6A 1JQ3A 3SSNA 5HRAA 4Y8VA 4QRHA 4D9FA 4C03A 1Z75A 1H9BA 1FTSA 1U1DA 3B9PA 3M6FA 2OQRA 2RGCA 3S0JA 2YHSA 5H3CA 4YJKA 5A9RA 3WJ7A 4KO1S 1XEXA 3L7JA 1TF7A 3C6XA 1G6HA 4RCVA 1YFZA 1Y3FE 4YBZA 3NC0C 5CLJA 1ZCAA 2IUUA 3WA7A 1YHYA 5KYVA 2HFKA 2CLHB 2Q0HA 4QJ3A 3OE1A 4TN1A 2WQ7A 5H02A 5DSZA 2XNKA 3C3PA 1TRKA 1OB5A 2WLTA 2XH8A 1UDWA 2I2XB 1USKA 3QU9A 1YE8A 1XI2A 1Z6PA 1V45E 1CS4C 2G9RA 2QVXX 2WJIA 4IIUA 4JOQA 4YI5A 1HQYE 3GEHA 2AQ8A 4D8TA 4YV0A 4G5FA 1AKNA 1OZFA 2E7ZA 2ASEA 4P81A 2ZRDA 2YYSA 1NVFA 2GN8A 3CZ4A 4JASB 2NW6A 4HUQB 2Y6UA 2FF5A 3DB2A 3KK0A 4G41A 4OI4A 4URYR 5B6PA 5K8VA 1J8MF 3ZXUB 1KTVA 2PZEA 3NM4A 3L8HA 3R3JA 2F43A 1ECGA 4TTVA 1KMCA 2A1UB 2G71A 3PQFA 3I73A 4FGLA 4AMGA 4N8DA 1YB6A 1FYXA 1ENOA 4MPRA 1QHIA 1V5GA 1XDZA 3EZFA 4U7PB 4MMXB 3G9TA 3KDAA 1K27A 1RJGA 4II3A 4FFDA 4N5IX 3RAGA 4E33A 4GE3A 1M2WA 4HYTA 4JC5A 5K6RA 1ORTA 1UXOA 2OG1A 2IITA 5EZYA 2YJ6A 3CW8X 3HRHA 4MUEA 3IURA 1YBMA 5B3JA 4TWRA 4EW1A 1KA9H 1JIUA 1P1JA 4JMPA 5H4HA 1A7JA 1XEFA 3O4HA 3NEPX 1QS0B 1KDPA 4D3FA 4GXTA 4D4GA 4FOPA 2F1RA 3EGVA 1TKRA 2FMKA 2PPLA 4LXHA 2CLFB 3L6CA 4UNRA 1CY4A 4PC6A 4Q1AA 2GEUA 2C5FA 4CLHA 3HP7A 3ER8A 4ZIRA 4B4WA 1TL7C 2AJLI 3TLGA 2HF9A 3OM8A 1PYGA 1Y1PA 4HAWA 1QG0A 1WXQA 4O4JF 3VA7A 1XQXA 3U39A 5LQNA 1W76A 3AKZA 1VE1A 2IF0A 2F90A 1PEAA 1GYRA 4R2IA 4MXDA 5LP1A 4I1OA 1Z4LA 2ARKA 4X63A 1KOJA 5ULLA 1HF3A 4WIAA 4N5LA 2ZI9A 3AP3A 1FXUA 4HR7A 1Q0RA 1WZIA 3FPGA 4HN9A 4MQLA 3WI7A 2WV7A 3O47A 3INYA 4DWVA 1YR2A 2FYTA 3ZW9A 1JTFA 3IR6A 2PUCA 1DX4A 2Y8EA 3AF2A 4NZPA 5CLIA 1UT6A 2RAVA 1Z06A 4Q3BA 5KDLA 1U7HA 2VK4A 5KJCA 1YQWA 2XHZA 3KHUA 4DQKA 4YALA 3VO1A 2NPIA 2PBFA 4E51A 3NRBA 4BKPA 4DNPA 4EOGA 1RKBA 1XVLA 2DTDA 5C5IA 5JJ5A 3G5MA 1XXHA 3UFXA 4DIMA 1NFFA 4AX8A 4V1CB 2QRUA 3E2MA 3PLAE 4HYEA 2G1UA 3LK6A 3RIEA 1U3WA 1CUCA 1GNLA 5ESDA 4BAUA 4X1KA 3D64A 4H7JA 4HGQA 6LDHA 4K2HA 3GLGA 4ARVA 1V4VA 2Q2NA 1NQAO 2VPQA 3ZDRA 4DDTA 2GRAA 1XHLA 4GPD1 1Q7TA 1RHRA 3PQ8A 3IAUA 4NEHB 2YCBA 4HD8A 4MINA 4PANA 1XAIA 5DF1A 5J3JA 4DRYA 2WU0A 3HBFA 2NOAA 3AV0B 3OX3A 1HETA 3AJ8A 4JU8A 1E58A 5EPOA 4C2AA 3U9LA 1Y89A 5AVXA 2QLMA 2IU6A 3EVNA 4IFIA 4B3RB 1YZFA 3EH2A 4GI5A 1GARA 1LBHA 2E85A 2ZWAA 1MO4A 2NTVA 3NJ4A 2R6FA 1MA0A 1BGXT 1KP3A 2IZOA 1WOYA 2VJYA 3BFJA 3JWIA 4LXXA 5EN4A 4COKA 3U2QA 3AHIA 2V65A 1UJ6A 1Y6QA 1MB2A 2JLRA 4KXUA 4YV7A 1JBEA 4EGJA 4DV7B 4NJOA 1Z16A 3V4FA 4RPCA 2X0JA 3AM4A 5H68A 2QPLA 4I4TA 4NZNA 4CNQA 5BNWA 3EASA 3QPAA 5JD5A 3W8NA 4Y2PA 4LVOA 3IHLA 4ND6A 2I67A 2PIDA 4QQKA 1I7DA 3WFIA 4IVRA 4L9WA 4EG8A 2FRXA 3LKDA 3P0IA 3Q9SA 3V42A 4Y6SA 2P0EA 4DBLC 4JLVA 1L1RA 3N2GB 4P86A 2HK9A 4IIHA 3D3WB 2VZ9A 2E6KA 1VJDA 1JHMA 2OVBA 4AMZA 1Q5PA 1D8AA 4JFRA 5J4VA 3OOWA 3LVFO 4EG5A 4EFDA 1STOA 3CLSD 1YRYE 2IZ7A 3LVRE 1SD5A 3I8XA 2QXYA 2UVPB 2YS6A 4URZR 4WZBB 1XGKA 1H9CA 1LLQA 1N0WA 3I5AA 4O0LA 5GMOA 4BWFB 5JJBA 2H1RA 2W22A 3H0CA 2MYTA 4L50A 5B58C 2WZCA 2GB4A 1ZMOA 2BBOA 4F4UA 4IOMA 5IAEA 1FFBA 2ROQA 2XUIA 4NYJR 5A4KA 5KZMB 3N6RA 4K0RA 1NSYA 2G9NA 4CL3A 2AWOA 2VDOB 2QG4A 5AJUA 5T41A 2QGFA 3NCHA 4EJMA 5HP4A 3EQ2A 4JC8A 4C06A 2ECFA 3RFTA 3JWHA 3AOGA 1N1MA 5I9IA 2II6A 3REQB 2C59A 2R4UA 2ZSKA 1UXJA 2BH2A 1DCMA 1E8MA 4N12A 1DIGA 2F67A 4KV7A 5A1JA 2IKQA 2FSGA 3ENZA 1FUKA 3KHTA 5KAPA 2I87A 1WZ2A 3G2HA 3MJTA 2OEPA 3ORRA 4LVCA 3W4JA 4ZI7F 5AHRA 1IQUA 1U0SY 2D8MA 3FETA 5CURA 2B9VA 3B2NA 3ROXA 3U3ZA 1Z2NX 2HIGA 3C5VA 3S28A 3JQAB 5FRDA 1XCBA 1GA6A 1VIDA 4KCGA 5D85A 3SF8A 1YUNA 2M9MA 3TIIA 4F9FA 2OBLA 1MJNA 4NU0A 5FI3A 2CNDA 4AJHA 1XQWA 3RUAA 4RJTA 4WV3A 4EARA 4BJHB 1JLHA 2WTUA 2R00C 5DJ5A 2I62A 2Y71A 3KWJA 3DT9A 4TXJA 5CX4A 4M1ZA 4N3NA 4Q0MA 1PT5A 1HWYA 2BFBB 3F1KA 2HU8A 4C0KA 1PTJA 2QD2A 4DUGA 4UTVA 3HKCA 3ZWPA 1TIBA 1AQLA 3R76A 1CLUA 1YDFA 4Z53A 1YDHA 2J4CA 5I7HA 5K9ZA 2B1QA 1YC2A 4EG1A 2H2DA 4OJTA 2NVUA 1P62B 2WHYA 4OL0A 2X8AA 2C4WA 5F77A 3NORA 3IODA 4UCWA 2NUTA 4BNWA 4I2VA 4RY8A 3T3DA 5TQ2B 2EYQA 2X19A 2GUGA 3EF0A 3F3MA 3ZHBA 4XGQA 4YYZA 3PC8A 2V45A 1UL1X 1W4CA 3A6PC 3H3FA 1X86B 2SKEA 4Q7MB 1KH1A 2LZ0A 3ANXA 1C9DB 1OLSA 1UC4B 3N7AA 4GZ6A 2GM3A 1M0SA 1P17A 4LKRA 4PGGA 3MT8A 4OU4A 4QARA 4WN9A 4UQPA 3WYDA 4N03A 4PG8A 4KPYA 1YS4A 2Z8YM 3D0QA 5GM1A 2WSSA 10MHA 3GDWA 2FKNA 2CNKA 3KR2A 1PZGA 1MGPA 3JYLA 3ODGA 1FMTA 1R1DA 1JEDA 1PTKA 2FUNB 2O52A 4IH9A 1XCOA 3UGKA 5HSGA 3PUJA 1NI5A 2PD6A 3WO1A 3OLWA 1YC5A 1DBRA 2GKSA 1LV7A 3SCZA 3LF2A 3KJXA 4AO8A 3T1HB 5BVGA 4K81B 2AVDA 3DOHA 9ABPA 5KTKA 2GK7A 4JXKA 2QS9A 2JD2A 2PQ0A 3HMKA 2PH1A 3QXHA 3SQNA 3FPJA 2QZPA 2PMWB 3IOEA 4QBGB 1YJXA 4KLZA 2Z2JA 1NN0A 2VNSA 4R1TA 2E82A 1GGVA 3DE4X 4X20B 4EJSB 1G7RA 3WYBA 5C7IO 3SXPA 1C3LA 2EKLA 4V3CA 2RI1A 4HLUA 1GSIA 1WZCA 1G8PA 1J2JA 3UT5B 5DTEA 2HJVA 4J4HA 3LT1A 1RYEA 4IHAA 1T8UA 1U0RA 2NADA 1YO6A 4KE8A 1JIJA 4EFKA 1DHTA 2X5KO 3RGGA 3RJ5A 1NVWQ 1LPAB 4ZYLA 1GO2A 4ENPA 3A9VA 1E9AA 2C5AA 2ODQA 5I48A 2NYRA 4EHDA 3KWMA 1JU3A 3BF7A 1DNPA 2OOKA 1QOZA 3TO5A 2FJUA 3NHPA 3WX0A 4A8JC 1ONSA 3O8QB 3BBLA 1Q0TA 2IPNA 3CLUD 2H3HA 4EG7A 4I19A 2HIHA 1NRIA 3GLFA 1SEVA 3RUPA 4UKDA 4UEOA 3BXXA 2VDVE 4BFZA 3PE3A 5DISB 2FPLA 4IGIA 2QD4A 3QE2A 1M5RA 2ADMA 3AWDA 3I04M 3C3KA 4LRXA 1EFVA 4WCFA 4ZQBA 3NDRA 1ZD3A 3WGTA 1U8XX 3G13A 5AKGA 5IM5A 8ATCA 2QDKA 1X7XB 1XDBA 5AM3A 5L4SA 5IDXA 4FCVA 1FMJA 5KTOA 1OLXA 1V95A 4OM8A 2P9JA 2P6OA 1EWQA 4ACAA 3EUAA 3MJSA 5DX8A 3K0EA 3I1FA 4WK2B 2PNJA 1A8PA 2G0AA 2ZT6A 5LZ4A 4Q7EA 3MTQA 2A5DA 3FYUC 4UULA 1EESA 1G8HA 1W49A 3DQZA 4C76A 2OV3A 2DOKA 3DCNA 3LG2A 4HRYA 3TX6A 5HZGA 2JHPA 1V5FA 3UMRA 2O8FB 2I6GA 4A2QA 1UOQA 4EENA 3QOYA 5C8YF 1ZMRA 5IVDA 1VCNA 1G64A 1BKDR 4OK3A 1KYTA 3WG9A 2YXLA 3QOWA 4GYYA 4LJ8A 5A5GA 2Z8XA 3A6LA 3IEVA 2BT4A 1SO8A 1EFHA 3MJRA 3ZXXA 3DVQX 1K88A 2NYVA 1PS8A 1RYMA 1W35A 4YP7A 5SYAA 3GT4A 4NYJQ 2IXAA 2AQHA 4PCVA 1BFUA 1XTPA 1D1QA 1DAFA 1V16A 3IUEA 2IX3A 3K5WA 3OICA 4RQUA 4DDHA 1O0BA 4QOEA 2VHQA 3AV3A 3F71A 3RU9A 2H2GA 4IDQA 5H0IA 3R3YA 4F60A 2V5AA 1G5PA 3QLVA 5AUOB 2XMSA 1V7ZA 2YV3A 4KFUA 3D4IA 4BPBA 5G3ZA 3IT1A 5KNBA 2BKVA 3DW3X 2Q29A 4FFWA 4DMFA 4ZQFA 4HH4A 1V3QE 3AKCA 1T13A 1A1SA 5ALUA 4WLOA 2NTJA 1R8QA 4MKGA 4RANA 4F4HA 4WN3A 3JR3A 5DNVA 3CCFA 3UWKA 4D3YA 1G19A 2W98A 3NTLA 3VOSA 5HRUA 1ZIXA 5T5QA 4B8YA 1DEOA 3P5BA 2BZ0A 3CPEA 4IBOA 3OZBA 1C1HA 3B3JA 4ZCMA 2GWHA 4JLDA 3KD2A 3LT2A 1J20A 3LC2O 5DTJA 2PSEA 2YDYA 1QBKC 1JR3A 2Q4TA 4JR2A 4DLLA 1SMKA 2FHPA 1VL1A 4BO6A 4BNXA 1Z0SA 4MPTA 1SRRA 2WD7A 3B82A 1KJJA 4P08A 2FW6A 3O9VA 3RLFA 3UGTA 3ZXYA 3ICEA 4GOXA 2NU7B 3DR3A 3LE8A 2AMJA 1Z35A 1ZVKA 3A25A 3W3ZB 3IO3A 1UM9B 4PX2A 1XTUA 2OGUA 5JE8A 4LHWA 1YBAA 1GRCA 1OW3B 1BG6A 1O1YA 1MW8X 2HT6A 2DKNA 4D4JA 1SCNE 3WLEA 4YQEA 5K09A 3DP9A 1VRWA 4I9GA 3KUDA 3AY3A 4TMZA 3X1DA 3KQLA 1QK5A 2B78A 1R9MA 1DP4A 1NLFA 2XOXA 4FR5A 1YDEA 4WH0A 4YIHA 2WOOA 2HMAA 3BH6A 3LD9A 3OEED 1EP9A 4PC2A 5J59A 3VOAA 4EHIA 2WYOA 2CLEB 3AFMA 3OZCA 3PNQA 5HM8A 4GNKA 1S9HA 2DKFA 4HDRB 4O08A 2O7RA 4L5IA 1XMSA 3GRVA 1ZL2A 2AC4A 3ORHA 2WNSA 4R01A 4TVBA 5CYOA 4LFAB 2F3UA 5KYGA 4GBED 1Y5NA 4ZAXA 4ASUD 3CBGA 1OU0A 1Z2AA 2JRCA 2C4VA 3HKEB 1E2GA 1I4TD 3I1YA 3LDAA 2IOHA 4KWCA 3RIYA 4ZJYA 4JFAA 3TD2A 2UVDA 4MZDA 3SBOA 3SKXA 4Z9YA 3FH0A 4JBXA 1L5HA 3VNRA 4GZ3A 3RFCA 3JZFA 4B2PA 5C53B 4YDSA 2VYND 5ALXA 2D8AA 2XI4A 1W52X 2OO5C 2JLUA 5T3YA 2ECOA 4ME6A 3SR4A 4FI3C 1D6SA 3ZE0B 2WKSA 2VT7A 4KQ6A 3LC1O 1G0NA 3BXZA 5H5JA 3RTCA 2DY1A 1JB9A 3SX2A 3OHSX 5D3KA 4AF7A 4HGNA 2Q5EA 2GKOA 4Q37A 4AYXA 5EMMA 2EXXA 1NBMD 4K6HA 3A14A 1KNXA 2HRQA 2X2OA 5BYBA 2PGLA 1WU8A 4YPOA 3MCWA 4NYIR 2KJQA 1QCCA 1YASA 1UZMA 3EYWA 3GLTA 2RKBA 2E48A 4ECEA 2P77A 5C34B 2D3TA 1WL8A 2RGRA 4LW8A 1V6CA 5ALSA 3I83A 4ZXPA 1PG2A 5K0BA 5H59A 1W36D 1PHRA 5ALWA 1Z0UA 4HT3B 5AQ1A 3H99A 1P19A 1PI3A 5KC9A 2WOJA 1S2LA 2FTKE 4YMVA 2FFBA 4M89A 1P33A 3RR2A 2EG5A 3EGDB 4RKRA 4XWGA 4BDSA 1ICEA 4U7HA 3MB5A 4D9NA 1OFVA 4CKXA 3CJTA 1ACLA 2PA3A 4HZUB 2JBHA 3A1WA 3U9TA 2A88A 1CIVA 5CCDA 1KNQA 4E5PA 4IEFB 1L7PA 2FWAA 2VHZA 5J43A 3QUBA 1IZ7A 5LXTF 4PAGA 3DLAA 1MG5A 2VH5R 3MWDB 1XPOA 4JMLA 2C1XA 2QQ5A 3ELUA 3OIUA 3PU6A 4K9QA 1OIVA 3JQGA 3PE4A 3EWSA 2FOIA 3MMPA 4PHHA 4WEQA 4X85A 5BN3B 1E64A 1UZUA 2HU5A 2WQ6A 2Y76A 2OZLB 1N33B 1XCLA 4QU5A 3A6GA 1W47A 1YQXA 1ODLA 5T6BA 1SQ0A 3K1YA 2E4YA 1TI7A 4R69A 2PKYX 5JDIC 2VP4A 1YRWA 3D0OA 1Z3IX 3PUVA 4IO1A 4MW1A 3KYCA 3O83A 3THRA 4GYKA 3VHLB 3ISVA 1Q17A 4G4SP 3ABRB 4CLRA 1IZ8A 1D6MA 4Q3AA 4TMYA 5K2OA 4HDKA 3AVUA 2WAMA 4C0JA 2Q46A 1QS0A 3JQ9C 1SKYB 1E3DA 2EX1A 3F74A 4EIWA 2BFAA 2RCNA 1UMKA 5IAAA 4GZMA 2P6PA 3QTTA 4HHEA 1S02A 1NMZA 4M0MA 1QFMA 1SC3A 3N2KB 4FIDA 2H29A 4UMVA 1YCFA 4KFSA 4TKVA 3ESYA 5LKAA 2H51A 1FSZA 2ACEA 4GUDA 4LMAA 5FTNA 5GOZA 3V8VA 4B75A 4UASA 4YI3A 4H18A 5HJ5A 2GDZA 4L57A 1OLUB 2IBMA 1Y7HA 3PDIA 4GKAA 3ZQUA 3ZE9A 4DA6A 2J3LA 5LNK1 4YAWA 4TT3A 4CMIA 4D98A 3COVA 3HDHA 3GFPA 3Q2IA 4MUKA 5K8IA 1DC7A 4KNYA 2WIBA 1AX9A 1QHSA 3PCXA 1K2WA 3PLRA 4B3CA 1HNXB 1E9CA 1QE3A 2I2FA 4OQPA 1JG1A 1QE0A 2GESA 3MINA 5T8KA 1KSGA 4CQMD 4MV8A 1RIIA 2IP1A 2H8GA 3A1SA 1W87A 3FFWA 4XARA 1E7MA 3B9QA 5AICA 1OSNA 4ACBA 1KAQA 3RT7A 1DQYA 4MQUA 3RSOA 5L3SB 1NRWA 1UK7A 4RVGA 5E4JA 3GMSA 4RLHA 3LUGA 1MHPA 1R3UA 1SVKA 2PA0A 3E7FA 3IUNA 1NLZA 5F2NA 3SQXA 4QU8A 2V9PA 3VO8A 3AL3A 2SBTA 1AUVA 3ETGA 3IGFA 1DT5A 4YRZA 3S81A 4AP6A 4KK3A 1HY3A 2J3IA 3C39A 5FUXA 4YJHB 2KE5A 2H2IA 3PEFA 2C2KA 3K0AB 4TLBA 1R0SA 4GFDA 4INPA 4N5DA 4LK3A 4DUYB 1PQUA 4UQLA 1GHTA 5JYCA 1ZOPA 4ZO7A 4TVSA 4PE5B 4EUKA 1DAOA 1MC4A 5EGNA 4KR6A 4H3KB 1L5NA 5DM60 1KR2A 4W1RA 5E4FA 3S1AB 4F5ZA 1EE1A 1QGZA 3R3ZA 3I45A 4HNGA 3OFNA 2ZUDA 3EAGA 3KJIA 5DN9A 4UBMA 5A71A 2MWMA 4G97A 3A9UA 3O6VA 3EMBA 4RNCA 3ZEAA 4DRZA 3NO4A 3X1MA 2Y1KA 2CE7A 2V8OA 4ZHQB 3D6MA 5KI6A 4AMBA 4NARA 4CM4A 1WMBA 3IDSA 4K3VA 4CUJA 3DSRA 5AW4A 3HCCA 2QM8A 2FEOA 3G49A 4U6NA 1CRLA 4GDFA 4MS1A 1FU4A 4UC0A 2PZAA 3RS9A 4WESA 5A2QA 1DOAA 4Y6PA 4WL0A 2CLMB 2QRQA 3E9YA 4BDTA 5AVVA 3SR3A