1I9CA

Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQENFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radical Shuttling in a Protein: Ribose Pseudorotation Controls Alkyl-Radical Transfer in the Coenzyme B(12) Dependent Enzyme Glutamate Mutase
pubmed doi rcsb
source organism Clostridium cochlearium
molecule tags Isomerase
molecule keywords GLUTAMATE MUTASE
total genus 47
structure length 137
sequence length 137
chains with identical sequence C
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1i9cA00
3KOWA 3KP1A 4HH1A 3WHPA 6REQB 1FMFA 1BMTA 3REQB 7REQA 1ID8A 1E1CB 1CCWA 3BULA 1BE1A 1I9CA 4JGIA 1XRSB 2XIQA 3IVAA 1REQA 7REQB 4Q37A 4REQB 1E1CA 3KOXA 3KOYA 5C8DA 4R3UC 2YXBA 2XIJA 4HEHA 1CB7A 1Y80A 2REQA 5REQA 3IV9A 3KOZA 4REQA 4HH0A 3BICA 1B1AA 3REQA 1K98A 6REQA 2REQB 4HH3C 1K7YA 3EZXA 5REQB 1REQB 2I2XB
chains in the Genus database with same CATH superfamily
4MRVA 4AICA 2QD1A 2NSLA 2QX6A 2WAAA 1ZVVA 2CXRA 4GFDA 1F8UA 1FEZA 4BFSA 1NVEA 1ULHA 2JJ8A 4Q03A 3KR2A 5ALLA 1SCKA 3K32A 4NAUA 4B35A 4CLRB 3SQNA 1U2EA 5ICSA 1AZTA 3WJ1A 1IUNA 1NUQA 1R6VA 1V8DA 4MQUA 4G4IA 4P53A 3EEIA 3T7TA 3KTAB 3Q7EA 5FWXA 5AI0A 2QRUA 4UVIA 1W4RA 2QTGA 1MD9A 1CJCA 1TCVA 3BAZA 4LQLA 5DW0A 4F9TA 1XF9A 2CD7A 3B6MA 3DMRA 4KG7A 4C78A 1ZINA 2PPLA 4MUHA 4BMZA 5F1KA 3ZHBA 1SPXA 3C6BA 2ZRQA 4BJ3A 5KB3A 1OA1A 4WEQA 2NO5A 3ZI4A 2N75A 5G0SA 3TPFA 4D3FA 1ZM2A 3BZBA 5GOZA 1J24A 1QZUA 1P2TA 4MPPA 4MUYA 1TUBA 1JKFA 1YB4A 4TQGA 2GWRA 2R47A 1MJFA 3AOEA 4ML3A 3WYDA 4LTMA 1EA5A 4INOA 5AYVA 2N47A 5A5FA 2OORA 2Z09A 3DJFA 3K1YA 1MO2A 3UWDA 1P9RA 2JH3A 4WW0A 1RJFA 3GMTA 1YJ5A 1G98A 4LV5B 2F8LA 5T64A 4BU1A 4C0SA 4EG4A 3O5AA 1B26A 1P73A 2CFOA 1GQRA 5E9AA 4ZVLA 5EUQB 1AZWA 1IQPA 2ZJBA 4M99A 3T7SA 1KI2A 1S2LA 2GKSA 4IP0A 3UV3A 3VC2A 3S2IA 1XMPA 2ZSAA 3U7HB 2M2IA 4G25A 1XSEA 2VDLB 4REOA 1LXCA 2IHTA 2C9MA 4HVTA 3ANTA 3O9MA 4EKYA 4GKBA 5I9TA 1REQB 3MINB 4QXOA 3GPLA 2A4MA 1OVGA 4E5YA 4O1MA 3EMDA 1RP7A 1KMQA 3B13B 3CLTD 4XOIA 5EAIA 1U8XX 5MGBA 5H9VA 2Q6IA 3PICA 1RXIA 1YQGA 1NKTA 5LA6B 3RGGA 3V4FA 4ENWA 3NTXA 3AY3A 2H1RA 2Q2QA 4B71A 2LDBA 1FW8A 3E58A 2G1PA 3TZBA 1WQ4A 1X0VA 5K3CA 3W4JA 1OH7A 1KYWA 2P6OA 3VR3A 5CVJA 1R4NA 1PJ3A 3IDAA 2IH5A 3GLQA 4H3HB 2G08A 4IPTA 2IBMA 3H84A 2IEYA 3ZW7A 4P83A 2F8SA 3BTUA 4QUGA 3GAZA 2FJ0A 1EAMA 3IPYA 4BAGA 4K6FA 3GWGA 1UUFA 5EI5A 1EM8B 2BRUC 3C3XA 4FPXA 1UM9B 4Q5IA 3KAQA 4S12A 3TLMA 1YU6A 3W5CA 4DSAA 1YZGA 3GK3A 4I6GA 3GLTA 1IBCA 3LHKA 3MLAA 5HZGA 3VR4H 4EATA 2HM7A 2ZTHA 3W06A 2Z2JA 1JGTA 2Q4BA 2KQUA 4YAGA 1U6JA 4DZZA 4KVZA 4WH0A 3PGLA 4M9CA 4Y2GA 3KL2A 5FBVB 1ILEA 3DO5A 3VC7A 4UFNA 4EGFA 1BE8A 4FOTA 1QIFA 3A10A 3JQFC 4OB8A 4AYXA 3TBFA 3V4PB 4CFYA 5AUNB 2G80A 2POQX 3FI0A 4FDVA 4ND5A 3TOCA 5JBIA 1GJRA 5BN1A 3EPPA 3NHBA 5HBRA 4G9GA 2EEZA 1N7HA 4BFVA 1VKJA 3FDZB 2UV8A 2UZ4A 1K7FB 1E2QA 1IRIA 3MMZA 4CF7A 4YONB 1PE0A 3DBHA 1D2HA 4OYRA 3RO7A 4D56A 1DSSG 1XCOA 5FWAA 3BMOB 1EB9A 3G5TA 4HGQA 5CNJA 2AJDA 3DAHA 5DSZA 4M8LA 4I4TA 4W99A 1YZQA 3DMFA 3T06B 1CUSA 2QMEA 4YT4A 2R1ZA 5D3MB 1SCAA 2CJPA 2YCLA 1FNSA 1K1EA 5JNUA 1LY1A 1S2OA 3TR0A 2PV0A 1Y6QA 3PA6A 2YY5A 4I46A 1O1YA 1NPDA 4MQFB 1V7ZA 5F5LA 3DFFA 4UBLA 2FSVA 4BNTA 1U7XA 5THXA 3KAPA 5J1SB 1QJ4A 4ZAVA 4J2OA 5A7HA 4CNQA 4UVHA 4GUDA 2BGKA 1BHJA 5DNDA 1IATA 5AW3A 4MB0A 4K3UA 4ZQIA 5CFQA 2IQ5A 3DXFA 4OKIA 2P91A 3HBAA 3L1KA 3C7CB 1WPQA 2GPYA 3OF5A 4UEKA 4DIMA 4KR2A 3DW1X 3UCXA 2P5YA 1ODCA 3RC8A 3WWDA 1W2GA 3AK4A 3JWJA 4DLBA 1RCTE 1X80B 3UJ6A 4Q93A 3R3XA 4RA6A 5LIRA 2Z95A 4YJ2B 4C30A 4MDFA 4H3KB 1S2NA 4FD3A 1EGAA 5F7OA 5F12A 1JLHA 2YJGA 2XCIA 2QRVA 3WLMA 4ENRA 2QX8A 4DEYA 1WBJB 2BW0A 3CX6A 1FJHA 4H6WA 5KNLA 4V0NA 1SK8A 4UQOA 4MS3B 3K6RA 3PUYA 4IGKA 3PUKA 4M1TA 4MICA 2QS9A 2F3SA 3KDAA 3DTVD 4NYJR 5CDUA 1EP1B 2A78A 4FKMA 3ZTYA 3PQ5A 1EQUA 1K0UA 1F6WA 4LE2A 3WZMA 1VQ1A 2E4WA 3KLOA 4FCVA 5K0JA 3G7SA 2EZ8A 1A9ZA 5EIHA 5KJ1A 4FFSA 3V1YA 1SCUB 3A9UA 1U3WA 1NYRA 5BWOA 1HEUA 2R4TA 4DBZA 1N3BA 1JX6A 4JI2B 5BWLA 3HVRA 1OU4A 1NBWB 2C94A 2JLSA 3QUAA 2OE2A 2QA5A 2JCYA 2CFCA 1ULBA 1O0CA 4NU0A 2OAP1 1Z7EA 3G2QA 4NX2A 4DCNA 5CEFA 5I4IA 1HRKA 2QE7D 1O6ZA 3C74A 4LDNA 3STHA 1A4RA 1L7NA 3GLGA 4WUVA 1MABB 2I22A 4HX5A 3EIHA 4TL7A 5CA0F 5JVDF 1BXGA 3MTEA 1KAQA 2F67A 3R23A 4Q34A 1ZICA 2RI0A 4XWOA 2VHJA 3ZZUA 3OUTA 5IAOA 5JU6A 2O4CA 1TT5B 2AOWA 5G02A 2OXCA 4HMOA 3O91A 3IMCA 1IYZA 2OECA 1XZNA 1SVIA 4RTOA 3IHLA 2XI4A 3VR6H 5JS7A 3R8FA 3F5FA 3AF2A 3LBAA 4HX2A 3STWA 3E1KA 1LRLA 3QVGB 1UK6A 2C77A 4AXBA 4DRXA 1PT7A 4B8YA 5HKBA 4KPUB 1K3TA 3U4GA 1B0UA 2VPZA 4M37A 2WEKA 3SFTA 1G8SA 4G67A 3R9XB 1C2TA 2GJSA 1YRYE 3Q9SA 3NDPA 4QRDA 3M33A 3G59A 3WB1A 4OHBA 3ELYA 5FULA 4MRPA 3AR3A 1USUA 1Q0HA 3CTMA 1XZEA 2PH3A 3LX4A 3K09C 3A9WA 4FJ0A 1DX9A 3TSZA 3WKEA 1YZKA 4N3BA 2JJ2D 4XUCA 4DV6B 4B09A 1GTMA 3G23A 1AS0A 5DYTA 2CHQA 4KTTE 3GNSA 1RYFA 2KMLA 4X8HA 4EKDA 4QZVA 4GE0A 3SR0A 3COWA 1G2PA 5AW0A 4KMMA 3HADA 4QOFA 4U0KA 5IJAA 1Z82A 3D2LA 4Q9LA 1CIVA 5JWOA 1APBA 1T0IA 2WSIA 2YWCA 2EFYA 2QQ5A 4QOHA 4ZU1X 4B6OA 5F64A 3BICA 5EXXA 1TIPA 2XYHA 4QXMA 1R4MA 2VH1A 3FRIA 4UXHA 3HCRA 3E0QA 4E51A 1JPUA 1DJLA 3HVKA 3D0QA 3OBIA 3SJZA 1ST2A 4OAOA 1DG9A 2FZVA 1MOSA 2JDIA 2Q5HA 4NNJA 3ZLBA 5HKKD 5K2OA 4YA6A 3G8BA 4S2UA 4EDHA 4YJGB 3ONDA 4X1YB 3CXRA 3QX3A 4MYUA 4TT8A 5EKDA 4DBLE 5CCDA 4DM3A 1F60A 1KI6B 1M72A 4BX0A 2PXXA 4GGOA 4O0MA 4XYGA 1ZJJA 3ORQA 5HDBB 4ILEA 3S81A 4OVKA 3HYSA 1JHUA 4M8KA 3DB2A 4N7MA 3FIUA 4ZVSA 3RIHA 4JUBA 3TMYA 3DV0A 1RE0A 2AR9A 2WSYB 2IV7A 5JCJD 3ERCA 4BMSA 2X2OA 4BV2A 1JKJB 1UFOA 1W46A 4LVUA 3T4UA 5K8JB 1N0UA 2REXB 2FUEA 2VQ3A 4GEGA 1RAGA 4L8LA 4M0LA 2YASA 1N2HA 2YFYA 2PEYA 4JA0A 4FZ5A 1OFUX 2Y1WA 4DG9A 3ZWDA 5FUQA 1I0IA 2FP4A 4FU0A 5H59A 3ESYA 4RKEA 1BHSA 5H9WA 3EGXB 3SOPA 2UVDA 1TVKB 3UB3A 5K8CA 4S05A 1PNQA 3WGOA 1EDBA 2C8LA 1V41E 4IAOA 1MAAA 1NXQA 1O08A 3OCZA 3MN1A 4ZT5A 4NBRA 3WLSA 3PE3A 4C7KA 1GZ7A 1W2WB 2PNFA 1Q74A 2ORYA 1Y5IA 4N8DA 5FA5A 5IEBA 4QAQA 4U2FA 4ARVA 4OB6A 4DMKA 5IT5A 5E1MA 1XIVA 3R3UA 2X0JA 2NO4A 1PW7A 1UBMS 3G5UA 4L27A 4LWOA 1CPYA 2XT6A 2A30A 3VSDA 3ZLJA 2Z9CA 2IYVA 2MR6A 2UVPB 2EFJA 1V4BA 3BCHA 4XYBA 4DN6A 1T8PA 2BP7A 1TM3E 2H2HA 1JIJA 2X5XA 3VTAA 5CK4A 2FJUA 2HWUA 3FTCA 3G02A 1R2QA 2J7PD 3B1KA 3L82B 2O2SA 1HH4A 4OBXA 2JGKA 2EKDA 2Q1YA 5LA6F 1C80A 3WGLA 3E3AA 5CFMA 1NW4A 3DAPA 1SU4A 5COQA 3K9BA 1SCJA 3QVSA 4RIIA 5AVRA 1RLTA 3X2EA 4EHAA 3CUWA 1VRWA 4O4JA 4ZI5A 4J0CA 1YTUA 5J2UB 4FWIB 2FXIA 3Q7PA 2WUFA 4HEA1 3GLFB 4YPVA 2YVKA 1FFYA 2L19A 2ACWA 2QUIA 1YUBA 1A5TA 2Y2VA 3KYDB 4BJ1A 5IT9A 2NTJA 2HA7A 5IDVA 2OD9A 2GZDA 1VE9A 2HMVA 3MWEB 4IX1A 2AFHA 4G0WA 4NHOA 4EYQA 2FU5C 1W73A 5BSMA 3EPHA 2GSDA 2AXNA 3D5EA 4YJHA 3IAM6 4K81B 1UEXC 4Z4CA 2ZZMA 4RK5A 4FOPA 3HJAA 5HUJA 3WLFA 3CSUA 4CF6A 4ZGBA 1J7KA 1A9TA 1U9IC 3KHSA 4ZDWA 2WU0A 2XCTB 2RH9B 1XHFA 5IMBA 1TF7A 2W2XA 3K73O 5E1OA 4B43A 1J07A 3KD2A 4DAOA 4Q01A 2IDJA 2RH8A 2E87A 3E7FA 4PQYA 5TS3A 3IVCA 3LT4A 4PAWA 3LTNC 3GVXA 1GA1A 1EJBA 1AX9A 1SUCA 3I9V6 3ENVA 4OHUA 4Q7MB 2P2DA 3HKDB 4B3FX 4HAWA 4BC1A 3TG2A 1OLUA 2VEDA 2QQGA 3P27A 1IWBB 2CXSA 1M6HA 2GN2A 2P9BA 3KZNA 5AJUA 3KLNA 1M1YB 4L4RA 4E12A 3NHMA 4PHTA 4WCVA 1G4HA 1NRIA 2BIFA 2QE7A 1BW9B 1K08A 2C2GA 3DFIA 3KUCA 1JFFA 1X2BA 2WWHA 3GNQA 5IJWA 4ENVA 1U9CA 1DO2A 2XTNA 2Z98A 3NC4A 4HPJB 4RWZA 5EIWA 2HWKA 1SVOA 1Q0QA 4YRBA 3V4RA 2V96A 2O2YA 3K8OE 2HBYA 4P8RA 4B6FA 2R66A 5IHPA 3ESXA 2B1GA 1YS7A 3OA2A 1NI4A 2VT6A 1Y37A 2GLXA 1O7JA 1KJZA 2BGNA 2Y93A 3WK7A 1NTOA 3BH6A 3H9JA 2IP2A 3OJFA 1VOTA 4ROSA 3RS5A 3ZCQA 4W8OA 4KXQA 3QU9A 3R3ZA 4FEYA 3ZG6A 5JJ5A 4EG6A 5K4HA 2XA9A 1U0TA 2WUVA 3X1MA 2B2NA 1ISGA 2JHPA 5EP3A 2JVKA 3QP9A 3LQ1A 3D0RA 1HLDA 2X4DA 4GM0A 5EJ9A 1I9CA 1SG9A 5JMOA 4RTRA 3COJA 4F2GA 2WFLB 3F6YA 5E6SB 5JANA 1PT9A 4DV0B 3P9KA 5BN4B 4DIUA 1B16A 4GYKA 2XUZA 2FQXA 5HF8A 1HPLA 4ZI2A 2XNHA 3ANLA 3RS9A 2ZBUA 5FTJA 3TD2A 2Z3WA 1KDOA 3BGIA 3L6EA 2C61A 1GKYA 3MYRA 3SX4A 4EO9A 1ADFA 5EHXA 4EB8A 3ZC3A 4DZTA 4PSUA 1G8AA 5L3VA 3TOVA 4AN4A 5AK3A 2ZOSA 4DT1B 4RX1A 3I72A 4AUKA 3E22A 2IYTA 3FLBA 1Q0TA 3F98A 4CIVA 1EFLA 1E3EA 4O8CA 5EJ6A 4NR0A 5ESWA 4JBGA 1TCCA 2A1TS 3EGCA 2O8NA 2YVUA 3H1BA 3OBBA 2DQSA 2QAGC 2R5FA 5C51B 2IUSA 4D0GA 1T9KA 1N0IA 3K53A 2HF9A 1UANA 1FA9A 5E38A 2WM2A 1XNHA 3WGTA 1TKRA 1Y1KE 3SF8A 1CY1A 3O4IA 3J7AC 2QTHA 3DE7X 2XUAA 3AR5A 1F1JA 3BE6A 2RGEA 4V02A 1GZ4A 1G8KA 2FETA 1ZMTA 3NDIA 4LZOA 4WESB 2RI6A 3CRRA 3UMMA 1Y7TA 1X92A 3NTLA 2VTBB 1K86A 1ZQ9A 2XBLA 3JU3A 3HR4A 5BSGA 4FX2A 4IGFA 1WDLA 4LW8A 4MUEA 3REQA 1RLMA 5AK5A 4O2AA 1JQJC 5H4GA 4OQFA 5AXCA 4CMHA 3FNIA 4G1UC 4I3GA 3I01M 4EG1A 4F11A 3MGAA 1RCFA 1XV5A 1XXHB 3I83A 5DLDA 5IAJA 4DXHA 3EW7A 4Q16A 3SXJA 2VDPB 1ABEA 1KPIA 4MCHA 3BILA 3CLHA 3HB5X 4UHEA 3K1AB 4DLRA 5IU6A 2QB5A 2IHBA 1FNCA 4LRYA 2AG6A 2DBVO 3ABQB 1V4VA 5ALWA 1D6JA 3EJWA 1NVVQ 3ILHA 5K6RA 4RVDA 3S29A 1R3DA 2BHRA 3GDWA 3K5IA 4RCVA 4UHJA 4BEVA 1FUYB 3DXYA 4D9FA 4B17A 3T0FA 5T4FA 4QFBA 2GBCA 2JZNA 1P1RA 4L9RA 5BV8A 1GA6A 1O4WA 2Y68A 2Q41A 5BR7A 2WFMA 1WZEA 2VH5R 4R54A 4QRHA 2ZLBA 4C4YA 3OFJA 3WK5A 3DP7A 2EQ5A 4TT3D 1KMCA 3EDYA 2A59A 1GVNB 3LNCA 1R4NB 2OLJA 4QWMA 4WI1A 5CM2Z 2I3AA 4KI7A 1EYZA 1NIJA 2QY6A 3ABOB 1WB5A 4JROA 1KH3A 4C43A 1PG0A 1KTIA 3KLPX 4KKVA 1V5IA 2H9YA 5EP4A 1KEKA 1U99A 1JV2B 4GX0A 3OPMA 4YO8A 4ZANA 4S24A 1L7PA 3ISVA 2B4YA 3VH4A 3D3EA 1UM9A 1DUIA 1NUHA 4C6HA 3M70A 1NOJA 1SHLA 2AL7A 4CKCB 3SX0A 1Y6GA 1FLVA 3L6RA 2AYXA 4KAJA 3U7RA 1MIOB 4IRUB 1WQ1R 3EVTA 3OURA 5ED0A 1M2EA 1OAOA 4UAVA 4C0LA 4Z0HO 5TE9A 2W8ZA 4OJYA 2J4DA 4EG5A 3ZGOA 2YQ5A 3A6HA 2VFAA 1QHXA 1PP4A 2ZB3A 4YCDA 3SS7X 4A5SA 4GR4A 2CXXA 4QUEA 3RS7A 1PGJA 5FWYA 4QUDA 1QB8A 3LPDA 2OG1A 1I4OA 1A71A 2RI1A 3GJ4A 3KJHA 1ESMA 1HZZC 2QX9A 4LJ4A 2ZYSA 5ENDA 4EDFA 1Q0UA 2GZ3A 3OLYA 1H05A 1C1HA 1XTPA 2DPXA 5UKDA 3UM9A 3T7IA 4C5CA 4PIPA 1VSUA 4UAUA 3ONWA 3ZHZA 1NIPA 2BGWA 1E94E 2J0EA 1BD3A 5K0LA 5CDSA 4RE5A 5KKCA 3WBKA 1G3UA 2RHHA 5ARBA 3AI7A 3BHIA 1ZUHA 5ILQA 5DWQA 1XYYA 4K87A 4DJ5X 2X8LA 4GWGA 4MROA 4TTRA 1DWQA 4NWIA 2JFBA 4RSMA 3WNQA 3FB1A 4M1ZA 1UBHS 4NBNA 1SOUA 5EE9A 3JASA 1S3GA 3L0ZA 1KDRA 4KIJA 1E4VA 1U3TA 1PJ2A 4B2IA 3VPGA 3LCUA 5LZ4A 5CVUA 4F3KA 2OCXA 2WWWA 4UNIA 2ZAOA 3CONA 5C7OO 1WXGA 2HKIA 4P32A 2IP1A 1SZDA 2W4IA 2ZRCA 3CX8A 3O8LA 2OG2A 3AJ8A 1R8SA 3P9QA 4HZIA 4B32A 3L8FA 3C6YA 5TJHA 1WTAA 2PSJA 3T3PB 1YHZA 2O0KA 2XQFA 3FPAA 3BL6A 3PRYA 3R7FA 3TW0A 3BERA 1POXA 4PYNA 1E3MA 2LIPA 1KKMA 2C1XA 3R7BA 3GUCA 3AP3A 1DJQA 4YP7A 3EH2A 4MSUA 2CN1A 4HDSB 4CIWA 3NUQA 3F4LA 2I8LA 4RY2A 1H2AS 4IG4A 1PWZA 1UC4B 2QNBA 3UH0A 1W4ZA 3HDTA 3ISTA 3KZVA 3RYCB 2DERA 4EAAA 5K0TA 1OBCA 2I7XA 4BVBA 1PL6A 3HEAA 3I37X 1UKYA 3FZEA 3KXIA 3HY6A 2BY4A 1YR3A 1J8QA 2C2OA 4UW9A 5TXGA 3ZDFA 2EFEB 1OFIA 5CK5A 3HJHA 1Z07A 2D7CA 4ZCIA 1V5WA 3L5KA 2RHMA 2Q6LA 4ARBA 1ZPDA 3ESAA 1ITZA 1I1QB 2I9PA 1DKQA 1SUWA 2C5BA 4R6WA 4NULA 4XYMA 4MRNA 4QECA 4JIGA 4NE7A 5J40A 2Z6VA 4RHEA 1IZZA 5BRNA 2DUUA 1W1IA 5AW1A 2I2AA 5BRJA 2FG5A 4RL4A 1SBNE 2XUDA 4JN6B 1BSVA 4N6GA 3L93A 5A7GA 2PFGA 3STVA 3KOWA 4B3BA 3RBZA 1WVMA 2OK7A 1NBME 3GEGA 3KXLA 2WJJA 3PNQA 2ZTUA 2DM6A 1G5TA 5C8YF 4C4PA 2YWFA 4ND8A 5A9RA 2EFDB 2O3RA 4JP1A 621PA 5AW6A 5A0TA 3KB2A 2QLBA 4F8YA 3P19A 2G63A 1E59A 1ZI6A 2JFOA 3EBLA 3H5IA 1Z7GA 4WKBA 1DPFA 2GEBA 4EG3A 3RFCA 2FLVA 5DK4A 4DW8A 2CL7X 1E2DA 3G7NA 3QMMA 5I45A 3QM1A 4PYMA 1KI1A 1YO6A 5GZ3A 1ECCA 1CRQA 3I9OA 1DARA 3C5WP 1EWTA 1J2EA 4ZTUB 5FTMA 2O8FB 1N1MA 2YWJA 1XDBA 2D2VA 1U0SY 1EK1A 4YMWA 1HYQA 5KHAA 2J31A 3B6IA 2IE0A 5KVCA 4KPUA 4HEJA 4BNMA 2OB2A 1K06A 2BT4A 4AY5A 1SBHA 4R3NA 2IHNA 4U3JB 4PZ9A 3EDRA 4UREA 3IBYA 1LPNA 3BJMA 4I8DA 3ACBA 1JHVA 3VJKA 2MYNA 2BBOA 1L8OA 1T5DX 2AQHA 2ROQA 3P4YA 5BSKA 5CBPA 3AVTA 2JFUA 3KJEA 4K46A 2C2ZA 2R68A 4F1KA 3AGPA 1DKOA 1XKQA 4BMVA 1I5EA 1SHTX 3EMKA 4D3DA 4N8EA 1SG0A 1FP1D 2PWAA 4EFLA 5IZ4A 1VXRA 4IXMA 3OHPA 3ZWNA 4E3WA 4DNFA 1Z2OX 2PWBA 2NP7A 4IJWA 4IINA 2ILVA 1N0VC 3O3NB 3C3CA 1QSGA 4J1QA 2W43A 3K5WA 3JV7A 4QU8A 2JFGA 4YIKA 3ND5A 3EWIA 2JHGA 1Y1RA 3T1TA 2O1WA 1NVUQ 3D3QA 3H42B 4L07A 2HIGA 2QJRA 1NV9A 3HVHA 3ZCVA 1SXJA 3QVWA 2HNAA 1ZKMA 1S01A 1Q1QA 1RI2A 4LYEA 2OXRA 5FOWA 3B9BA 2WKRA 4KXUA 1T2NA 3AKDA 3SR4A 4CKEA 4CTOA 1N8NA 1IJEA 1Z0FA 2Y67A 3NM6B 3LC1O 1UEIA 4X1IB 5HG0A 4F3YA 3S2EA 4NENA 2B3DA 4YJ2F 3UV7A 1RLIA 2IIPA 2XF2A 3HDHA 2JH9A 3K4QA 2DP4E 3QG1A 2A5YB 1E3LA 1BE0A 2E4UA 2HSZA 4W9RA 4ALMA 1C3OB 1W88A 2F4VB 3C1OA 5HIKA 4NOLA 4WBSA 3NUZA 2BTQA 4AJIA 3ABZA 2B78A 2BZ1A 1SMKA 3QRWA 1J9EA 1THTA 3CPEA 3IIIA 3KFLA 3PIIA 3K30A 4HQNA 4O2BA 4Q3BA 5AKLA 4IHAA 1ND6A 2PQ6A 4I6JA 2C3PA 2I71A 2ZU6A 3QU5A 3T5MA 2XB2A 2ERYA 2DFPA 1CSEE 4IL5A 1QHIA 2YOHA 3X1YA 2PL5A 1AUOA 2MR5A 2YNMD 2YV1A 4OG2A 2IFTA 4YAFA 5AW7A 3ONNA 4YUXA 5CU7A 4IHJF 4D4JA 1VJTA 2EW2A 1ESDA 2PLWA 4RGVA 4WPGA 5JG7A 2BFOA 2QU7A 4E32A 3T5AA 4YMTA 5DM70 3RKUA 1NP7A 2RAVA 2M1ZA 1T2UA 3BS4A 4UBIA 3I2KA 5J23A 1LFDB 2VPYA 1QDUA 4RGQA 4A10A 1A04A 5JQWA 1SA0A 2YXEA 4Y1EA 1QO9A 1EFTA 3FFBA 1KEZA 2F90A 3IUPA 4RK7A 4MZDA 2A9KA 1NT4A 4MWCA 2IF0A 3AV3A 1K6XA 3QPWA 1EFHA 5B6PA 4TRRA 1NQ5A 3FETA 1WDMA 4TL6A 4QHYA 4A5OA 1FIUA 1BGVA 3I23A 3RTEA 2LTAA 3ZD7A 1PTJC 3FCOA 1P4RA 2E4ZA 2D1QA 3DDCA 4B83A 1GAXA 5J3JA 3CM0A 4G5HA 2GM9A 4PANA 4E15A 4LHZA 5AVZA 1P3Y1 3F5MA 3GX1A 4TWAA 2O7QA 3VYSB 5L95A 3V9AA 4L16A 5FPSA 1GCAA 3I3SR 1FSPA 3BKWA 2BFCB 2CLOB 2XXAB 1V1JA 3CR3C 3N86A 1FRVA 1DG1G 2C9OA 2HF8A 4A73A 2YJ4A 4UXJA 4P92A 4ZCRA 2YRXA 2X2EA 4LECA 5EJGA 1MPXA 1HDIA 2WAMA 2WZCA 3HUTA 3KYCA 4BMPB 3CO5A 3GJXC 4CIXA 1QC5A 1WKVA 3PD1A 2H4ZA 4GGMX 4HGOA 4OA8A 4ZVQA 4W5JA 1NBAA 5KKAA 4CLRA 1TXGA 121PA 3WQHA 4TTVA 4TM8A 4HLCA 4YACA 1IN4A 1Q95A 5GONB 5BPHA 2MSEB 3I1YA 4TV9B 1HT2E 2Z5VA 1OWPA 4BDSA 2HAEA 2CXOA 3R5FA 4BNYA 1QZTA 3V4ZA 3ZHQA 2OQRA 4IYJA 3EBOA 4N7JA 4RIEA 1OLUB 3C1TA 5JCJA 1CJSA 3KOOA 3ZBUA 1WSBA 2Z4TA 3Q9NA 2OBXA 1GTSA 1OZ0A 3KV1A 2VHCA 2ON6A 2ZR8A 5KYYA 1UAAA 4UJ3A 4LXUA 1Y82A 3OZBA 4XWKA 3GVCA 1IH8A 3U44B 3HJFA 1PKEA 1PR4A 3E9QA 4YAEA 1TYEB 3IUSA 1KA9H 1KOJA 1P33A 2IP4A 1DC4A 2ZAIA 3DMTC 3G2HA 3OZVA 4L72A 2IX9A 2V97A 3CF6R 1GUBA 3OM9A 3DM9B 4OXNA 2DBRA 2E82A 3WXMA 3RI3A 4C4RA 4ENQA 4QRIA 3WJAA 4Z7OB 1C3JA 5KVQA 4G07A 4TZKA 5I3ZA 1T2DA 1X8JA 5BT9A 2F1OA 4OAPA 1ECPA 2C5HA 5EWMA 1RHMA 4Q4HA 1QGUB 3SYRA 2YHUA 4DDKA 3VVCA 5HGXA 1TZBA 4K03A 4CIDA 2R6HA 1JMYA 1ADJA 2GDZA 4U2KA 5K7SA 4HSEA 2O2EA 3JQRA 5AUOB 4C7OA 1M3SA 2BKLA 1E9DA 4X1KA 3E7XA 3M5CA 4MUJA 1ZD3A 2HK7A 5KU7A 2XDYA 5EJ8A 1REQA 4DR4B 1LTKA 4J29A 3OU6A 1Z74A 1HOXA 5JAIA 4HNQA 3EH1A 4F6LA 1YFJA 4RH0A 5AW9A 2WUEA 1GN8A 3I58A 3IKJA 1GRVA 1VYUA 2HU7A 2BMFA 1G64A 3QVMA 5IM5A 4DTIA 5ALZA 3QNWA 4HNAA 4U8HA 1JAZA 4YXWA 3SEQA 5T4HA 2CLDX 1ZUNA 2IH2A 4X6YA 1Z4KA 2IELA 3EWAA 2IEGA 3EK2A 3ZLUA 1PWYE 1U6KA 1GITA 1IIBA 1T9BA 3OG9A 2X9VA 2AW5A 5FL3A 4D9IA 3KELA 1TC2A 3RYFA 3GJ8A 2PLNA 4FFBB 1ZU4A 3SM9A 4Y1RA 4FW8A 4MUFA 1VA4A 2Q49A 4G5QA 1HEYA 1OX4A 2IHUA 2Z1MA 1TMGE 3O2JA 4RKRA 1N7GA 3OQHA 2QVZX 4BC0A 5B2FA 1KZ6A 1QFXA 2RGDA 2CEKA 4P34A 2BE9A 2VATA 3LBYA 3UOWA 4F5WA 5IC4A 3KQTA 1XB2A 4ZOLA 1ZJWA 1M34A 3FXAA 4IIGA 4D4KA 4DEXA 3MXTA 3PTZA 4ZHSA 1NL3A 4HG2A 4B3CA 2HPAA 1KEWA 3M81A 2IV2X 4UQLA 4NI5A 2OLEA 5J4LA 1BWPA 3RKSA 2RAUA 4RVOA 2KSQA 3KQKA 1J25A 1L4NA 3AWIA 3CKKA 4G41A 1QK4A 1E96A 1GNRA 5KNBH 4A0SA 4PLHA 1DXYA 1QPBA 1PLLA 1ZOIA 2O2CA 2IPOA 3DA8A 2HL6A 2JI4A 1VLJA 4M2LA 3ZXXA 3WRYC 3H8JA 5TQ0A 2F8TA 1AKYA 3UXYA 5HKAA 4O2BF 1MQSA 3V8VA 1C30A 1Z56C 2BL4A 4BO1A 3DO6A 1V8BA 1QPGA 3ZHVA 2UUBB 4HRYA 4J0QA 2HI0A 4RTKA 5JVDB 1GQQA 3ETDA 3CLUC 1ZHOA 2XNDA 3DFMA 1CQPA 1HE1C 3FMGA 2J6HA 3AP2A 3BE4A 2H3EA 4XDGA 2AOTB 4CU5A 3KFXA 4FFPA 4HTAA 2AFIA 2K87A 1NQAO 2VWQA 5ELXA 2WYWA 4H1VA 1YK1A 4DC9A 5I7VA 1BX1A 3UPDA 4ZVOA 2JB9A 2ORWA 3F46A 4WXEA 3LLVA 1M5TA 1TECE 2W93A 4GD3Q 4JQCA 4HAOA 2BF4A 1FFDA 4RD1A 4LRTB 3RJ5A 3V7WA 3QEMA 1OI7A 1WCXA 3WAKA 4JKOA 3GLUA 4DDVA 4JBIA 3K0KA 4YRMA 1DELA 1SQ5A 4HRAA 1C8VB 4H7HA 4X0EA 1KC3A 4HT3B 3VBEA 2O7NA 3VOSA 3SQDA 2WE8A 3SZGA 2XAUA 4K26A 1YE8A 3U9LA 1C3EA 3GGOA 1OLSB 4HUTA 5HZKA 1KJIA 2A86A 3OX4A 4TLEA 1AK9A 1ZL2A 3JAKA 4ONEA 3CG4A 2KX7A 2WSLA 4XB6B 1TADA 3QVTA 3U56A 2BEUB 3ZWBA 4CKXA 1U4SA 1X80A 2PGLA 4CM8A 2J9RA 1WW2A 1XVUA 1GG8A 1OOEA 1GDHA 2AI3A 4GNRA 2WKQA 1AKRA 4QWWA 5JJKA 4GLFA 3SN6A 3K8ZA 5LPNA 3O2QB 2GRJA 2Q9BA 1O94D 1L6IA 3KHKA 1Q5PA 3MCVA 3ADBA 3KPUA 4KHPB 4A0FA 5FFFA 1MO6A 1LKZA 1LZKA 3B9QA 4KEAA 5FNZA 3GV0A 4R1QA 1WB9A 2HBRA 2FGKA 4KQIA 5EJ7A 4QXPA 1LPPA 3WNDA 7ADHA 1HI9A 1JDNA 2G4CA 1FMCA 1OHHA 1SHUX 2VAPA 2HGSA 1MA3A 3E23A 2B8EA 3LYUA 5TT1A 1VM6A 5A1TA 1NXTA 2G07A 3O4JA 1T36A 3MGBA 1P5ZB 4K40A 2A9FA 3N87A 2I6XA 4W9MC 1DAKA 4PSKA 4QPJC 4F06A 1ZL0A 2FPUA 4A2WA 2OBLA 2LNDA 1I51A 3HK2A 2WB2A 1AY0A 3HKBA 3D6TB 2AGVA 4F84A 2AKYA 4A0HA 1BDJA 2J08A 3ZW9A 3GLGB 4LWZA 2HV9A 1N9ZA 3HU5A 1PT5A 1R8QA 1XQVA 2JG3A 2DPHA 2VQSA 1NNSA 3RUPA 4LEIA 1HYEA 3KETA 4B7XA 4ZVRA 3GJ5A 3KHUA 5C8XA 1HE2A 2B3TA 1PL8A 2ZSJA 3D3WA 4G0QA 4CMJA 4FOLA 4K9LA 5ICFA 4PZ0A 3FOWA 5C9ZA 2I65A 4HH4A 1ZNQO 2FMXA 2H0RA 2MSDB 2O7VA 5A3SA 4F60A 2FN8A 3OIFA 5FLKA 1Z6XA 1T3TA 3ND6A 3LSYA 1WS6A 1NUUA 3MNFA 5KJFA 3H0EA 3CURA 3UJ9A 1ADBA 2QLLA 1HYBA 4HDSA 4U2CA 2J3JA 4OBBA 4LYGA 4DMCA 3KSAC 5ALEA 5ES3A 2AKEA 3ZDAA 1QH8A 5HTKA 2ASVA 1CR1A 1XWWA 1I4EB 3I34X 2EL9A 4A92A 4R5HA 1FNBA 3A6EA 4FBGA 3OAAA 3UPTA 2QY9A 3INNA 5EYPA 3B2NA 4IOKA 1JDJA 2AEMA 2G6BA 5IAAA 5KOIA 1FCJA 2DH6A 4TN5A 4CPDA 1ORVA 4PXYA 2QL5A 3P5BA 1K6JA 3IAS1 4MOWA 1U9ZA 1C1XA 2PL9A 4L4UA 4DLUA 1BX0A 1K3UB 1H4TA 4QUAA 2V1XA 2XOEA 4BQOA 3GPDG 4FOSA 1HDCA 5AJXA 5HF6A 2JLUA 4Q37A 4CLDA 4B82A 4ID3A 2G40A 1ZO8A 3UG6A 4JLVA 2XE6A 1QM5A 3UO8B 4L9WA 4B7UA 4IUYA 3VPDA 1G8PA 1SZJG 1V2GA 1QHHA 4W7SA 4TV9F 2J8ZA 3MRVA 3G0CA 5AUPB 1MKYA 5FPPA 3M6FA 3AL2A 1MH1A 1EWKA 1M8GA 1M8PA 1FFBA 2GBPA 2UVQA 3NVAA 2FPOA 4LMAA 5DOZA 3WGHA 1X7YB 3BM5A 2ANCA 3U13A 4FEEA 1G20E 3NPMA 3VU9B 3DV0B 3R77A 4GMGA 1W36D 3NHZA 4DWVA 1W49A 3N0VA 5TS2A 2DPLA 4RTJA 4UVGA 2FUCA 4HQ0A 3WG9A 1ZITA 2OR3A 2WT8A 2ZTMA 3PFIA 3UT5B 1I7SB 3NW9A 3AF4A 2WNIA 2EW1A 1L5RA 5KYWB 1EE1A 2WJGA 3K4HA 4X8LA 3TUIC 5AXBA 2XY4A 2OOSA 2IOQA 3DOOA 3HFSA 1C4OA 4U7HA 2CXUA 2JD2A 1RQNA 1Z2DA 3AR2A 4LTDA 3GFVA 2JFNA 4HAXA 2Z5FA 3Q41A 3KQWA 4CMIA 5BQPA 3IBGA 2V58A 3ZYCA 1XZMA 3KSBC 2XGJA 2OESA 1H5NA 4JBYA 5KVSA 3NZEA 4W5OA 2XLCA 1HQKA 3F78A 2JGEA 4D9CA 5GZ1A 1TEZA 2A1IA 2PQ0A 2FMHA 2RHWA 3PFWO 4IMIB 3U1BA 3P9NA 3GGGA 4KVFA 1T3HA 3INYA 4YRSA 1GCUA 1OC2A 4QDXA 1TRHA 1YBAA 4DRYA 1PLKA 4HATA 3O73A 4KR0A 2XIQA 2B9VA 2BONA 1LC3A 2GBGA 1OZFA 2ZWVA 4IIFA 4MP6A 1WMFA 1GYPA 2V5VA 4MA5A 3PVSA 4UU8A 5H1YA 3RFXA 2EX4A 1X1EA 2Z1DA 4CLHA 4TYPA 3ZZNA 1SQGA 3MUNA 4U2EA 3RJZA 3TL2A 4UFPA 1S8FA 2GPWA 4E6PA 3H5VA 3B6ZA 3DYBA 2WF7A 4G8CA 4J76A 2IVZA 1P60A 3I30X 3VDXA 3L1JA 4A1OA 1P9LA 2VYVA 3FZYA 1UFVA 2XZTA 4PO8A 4RJIA 4XZ3A 4B6PA 1ZVMA 1KZ7B 2GYVA 3ESRA 2FEOA 2ORED 3V34A 1VLZA 4G81A 2HNKA 4DA0A 2WWYA 4BZZA 2P8JA 1NHGA 5FOQA 2WTMA 2ZATA 3CE6A 3N3AC 5EJEA 1HE4A 4F45A 5IJ9B 1ZG3A 2W6JD 4BNIA 2AFRA 4HTFA 4IBOA 4HCJA 3SQLA 4ESEA 1IZ7A 1J9GA 3U40A 1JSRA 1LC0A 3BD7A 4HS9A 5EQTA 4DKXA 1I0ZA 1XDGA 4JJ7A 3N8NA 1XLTA 4C87A 4RVFA 3I62A 2ZBVA 1KRHA 3CXUA 4X95A 1PG2A 4Q1AA 2I6FA 4ZV7A 1EFKA 2YICA 2A9RA 3AERA 4DPMA 5ITWA 2BJVA 2GF2A 1JDBC 1YQ9A 1KL7A 2W6ZA 3NVMB 1VPLA 4RVUA 5FA8A 4KN8A 1T9GS 2VSNA 1U7TA 4I7EA 3WL6A 3I76A 1DAFA 2YX1A 2RE8A 2HPHA 1ZX1A 4QFDA 4B3SB 4WECA 5BYAA 1K92A 1ZSYA 10MHA 3F4BA 3JVUA 1WCIB 1K27A 4L0CA 5LUBA 1W9MA 1Q0ZA 1J4AA 2PT9A 2JI6A 4HC4A 4IILA 1YS1X 1H3NA 4NF2A 5CH3A 5BSTA 4S1OA 4F3NA 3DKKA 3GRFA 4I5FA 3RVDA 4KXMA 2CHFA 4RHTA 4I66A 2C3OA 5JMWA 1OH6A 3VXKA 5KDOA 1RLOA 1KNXA 2DQYA 4V03A 4LRUA 1O6BA 2DKOA 2IPMA 2YVAA 5FNVA 2CB9A 5JYDA 5HKLA 4WFJA 1ODTC 4MYDA 3AOGA 1J2YA 2W2NA 4JU8A 4HJXA 4AJEA 4GGPA 4LUCA 1WPGA 4H7EA 2Q45A 1CUAA 1UPFA 2JAXA 3L8EA 4K6CA 4N5IX 5CDFA 1N0HA 1ZOPA 1MX9A 1WXQA 2CLHB 2QTNA 3C3JA 3CW2A 3N2KB 4RSHA 5F73A 1OA0A 2JGDB 4IIEA 4M9ZA 2W70A 3OEHD 3HGTA 1N6NA 1ZK2A 2IOYA 3ZR4B 5LOVB 3IESA 3FJ1A 4IDOA 3O8CA 3O94A 1VYHA 4L50A 4A8HA 4YUZA 5E6SA 1D4ZA 4IIJB 1A9SA 3CSSA 3NS7A 4RV9A 1WR8A 4JLDA 2HDNB 3TBHA 5C2JB 3Q8LA 1V3VA 3L7LA 2ZRNA 4GLOA 1EWQA 4F6RB 2YKGA 1RKUA 2JJ1D 4OY3A 3R7WA 1M5UA 4EUSA 2WY2D 1Y6JA 2IY7A 4DMRA 1UBFA 1EFVA 4Z54A 4UTZA 3LXXA 5A4IS 4DUGD 3K94A 1PBTA 3DPSA 1LQUA 1CTQA 1NXXA 1RWMA 3EC2A 3WA7A 4BZWA 1JECA 3L7BA 3LTEA 2D06A 3H05A 2NVUA 4ARZA 4EYOA 8GPBA 1QRAA 1T5LA 2R48A 3R3JA 4X3PA 4EK9A 5B6JA 2UYHA 4MJXA 1UDRA 2G72A 2KBFA 1B1CA 4TQAA 1G20A 2JCVA 1GNQA 4N7RA 1FVOA 3HBJA 4GWLA 2HQOA 1ZONA 5HJEA 4PYIA 3A2MA 1RI1A 1YOVB 2EWVA 3WQBA 1EXMA 4QFMA 3IULA 3MS4A 3K5HA 5ITSA 3H7IA 4NP6A 3AHGA 7AT1A 1P9NA 3NC0C 3WWEA 2IOFA 5FRDA 1RI4A 3DEHA 5LYYA 2YHIA 2X1HA 2BFBB 4O1IA 5ALVA 2PRJA 2V9ZA 4H31A 2VJOA 4YRIA 3OX1A 1DTEA 3HYNA 3PC2A 2GRUA 1BVRA 1A8UA 1RAAA 4AQDA 1TA9A 2HMTA 2KHZA 2NU9B 1GEEA 1O87A 2VPXA 4X1KB 3X1WA 3HXOA 2F3RA 1F8XA 1RXEA 1CQJB 3K1AA 1LUAA 4ZRMA 1NLUA 1G60A 1Q2UA 2IXAA 3KTOA 2I3BA 4NFYA 3ASYA 4OHRA 2WAOA 3UZUA 3ZV7A 1P72A 2W2PA 1VECA 4H0NA 1NVBA 1Q22A 2QBYA 5LMNB 5JS6A 1SKYB 4UM9B 2H1WA 2B8JA 4GYJA 4WY8A 1U0FA 4PX5A 3FTDA 1OQAA 4ECAA 5B4VA 2OYSA 1L4GA 4L5CA 3JXEA 4QBHA 3DWIA 4II3A 4X91A 2J0VA 3L6CA 4E88A 2CD9A 3CZ4A 5AJWA 4JCCA 3SVLA 3T6KA 5GM2A 4L7VA 4UNPA 3W3AD 3JD2A 9GPBA 4G8BA 3AR9A 3E9MA 5T57A 4A23A 2UVPA 2WG2A 5EWJB 1NUAA 1CY8A 2NVBA 3C2QA 1E9AA 3B3GA 1XP8A 2AC7A 1VBMA 2MHCA 1ZJYA 4FQ5A 1HYGA 3N6RA 4MGYR 5KPJA 3ZVLA 1L7XA 1H94A 4W82A 3WIEA 3KU1A 5JZVA 1G21A 2X6TA 3EG9B 5FWDA 2R96A 3D81A 4UPEA 1LF5A 1FE8A 4R9UC 2NO0A 1MHTA 1JTFA 4JWTA 1Y5LA 5CHEA 4O4JB 4ZOEA 2C4TA 4WASA 2I2FA 2H07A 1PJTA 3B1FA 2ODBA 4M7PA 3P2IA 3V3TA 5ICGA 1P1HA 4BX3A 3I61A 4BKOA 4E4RA 3VSBA 2PGOA 1NW3A 3KSUA 1MDFA 3KVOA 4BV3A 1Y48E 2F9FA 3KZOA 1JU4A 2H9AA 1N34B 4YDRA 3D1VA 4FLFA 1E1KA 3OUUA 3GLRA 1TO1E 2FOXA 4HB4A 2PH5A 5ALFA 1SGWA 5ERGB 3PFNA 1Y42X 2Q4OA 1HL7A 2VRCA 5EQDA 1X94A 3GRKA 1VPWA 3DWGA 1SXIA 2HC9A 3KQHA 4MEAA 2HD4A 3W5BA 4LCEA 2AI2A 3TNDA 2EYUA 5FOTA 3N9IA 4M8NE 3IAEA 3BMNA 4ND6A 3UG7A 3THYA 4R84A 3DQZA 5EP2A 5KNBD 4ZV4A 1QP4A 1I0LA 1H2RS 4KOAA 1US8A 4BRZA 1R0YA 3F6CA 3BB4A 5HS4A 4E22A 4MVJM 1NBMA 3VUFA 3MAGA 5DCYA 1CNEA 3CRMA 1T2VA 1SUEA 2AFHE 2ZSFA 4MKFA 5FPQA 1HMPA 3OQJA 3VDRA 4CV1A 1D2EA 5KNCD 5LQNA 4XUEA 1NP6A 5EPOA 4CM6A 4UHCA 3D2CA 1ISJA 1P9OA 4ZAZA 3R3HA 6NULA 3LFUA 1YI8A 4FZJA 3S44A 5ECGC 1KEEA 4W5RA 3IA2A 3WAJA 4ZYTA 3UMYA 1DEHA 4BFCA 2JKZA 1PZFA 1XD2B 1STOA 2WZQA 4JJGA 2G82A 3A3KA 2FDRA 2BJHA 3T9EA 2NYVA 2I7DA 4GMFA 2WW8A 3KKLA 3A3PA 3O0TA 4MULA 3W5HA 1BA2A 3M49A 4CIAA 3ZWPA 3HB4X 3F73A 4MRRA 2VSFA 1SAYA 1IN7A 4X44A 3H9CA 4JKYA 1X38A 4AZ3B 1XTIA 4KPYA 4QPNA 3ITEA 2BM1A 1A8PA 5FI0B 3AHCA 3TIFA 3BXHA 2JEOA 2EHJA 3KQVA 4D41A 5M34A 3PL5A 4D9HA 4YMHA 5IDXA 2NSDA 1FDOA 4JB8A 5L45A 4H7FA 4GOOD 4TLBA 1E8NA 3PD7A 4ZGGA 2WTEA 2OCLA 4B4DA 1BO6A 4PW0A 4B34A 4D6XA 4L8YA 4P22A 2G06A 2XOKD 3ZX4A 4WJLA 1LV8A 3USCS 3PNLA 4AKIA 4Q05A 4UHFA 2FFAA 1A69A 3I45A 1DQPA 4BX2A 1NZJA 2RK6A 3FAZA 5T5QA 5IDQA 4DIKA 2PZAA 5CX1A 5SYNA 2EERA 2Q1TA 4GBGA 2HLPA 4XIIA 4EZBA 1WCYA 3BRWD 3HZZA 3JQGB 3M6VA 5GWXA 1IZ8A 1DBSA 1JA0A 1XRLA 2I4IA 3I12A 3ZCTA 2IRWA 1WDWB 2RCYA 4A36A 5AVTA 1GSIA 4B4OA 1EFPB 3PXAA 4OSPA 1P75A 2DY1A 3WRWA 5LQDA 4P4GA 3PSAA 4Z9YA 3FVWA 2YINC 1Y7PA 4I50B 1U0HC 2V0NA 4GM1A 2BSXA 2B6HA 4J1SA 4N47A 4EPXA 2HRRA 1VPDA 3F9CA 4PG6A 4XR4A 3ER9A 2WLTA 3FPSA 1OGJA 3FDIA 4MI3A 2O8VA 3AFOA 3UHPA 4AF6A 1AKVA 3W6UA 1F14A 4ZAXA 3TKLA 4V1CI 4HYEA 2NZ2A 3T15A 4EI8A 4D6PA 4Z7QB 1VSBA 5AVVA 4QU0A 3W04A 2C2KA 2GX6A 1JNYA 4W1SA 1AQJA 3DWEX 1ZMOA 3FDXA 5BN5B 3RQIA 5DMHA 4I50F 1WZNA 5CGZA 3G0GA 1CT9A 2QN8A 5F9HA 2IS6A 3LDAA 3QX7A 2GS9A 4K86A 1BCRA 2XXBA 2TMKA 4BN0A 2KI5A 5LN1A 1X74A 4D92A 3I1IA 2V98A 1COZA 5FV7A 3QYJA 4UOZA 1U2RA 1J42A 2P62A 4EY5A 1YRAA 2IWHA 4BLOA 4TWJA 3S2SA 1WOMA 4L74A 4H1WA 5JJBA 3OTQA 4TXMA 4Q7JB 1V9LA 2ZT6A 1WABA 2Y1OA 3E9EA 5JNLA 1LW6E 2XJ9A 2C0CA 4QTXA 4DUYB 1T8WA 3GAMA 4W9NC 2IIVA 5DBFA 5EPEA 3PQ7A 4ALLA 3HHPA 5ALJA 4BQIA 4P98A 3WTBA 2OCAA 5D3MA 1NZDA 1TI7A 2DEUA 1BXRA 2ZYTX 4OMUA 1CP3A 4Y67A 3NONA 4RULA 3ZGNA 1DDGA 3KEMA 1R4ZA 1CQIA 1VLVA 2QEQA 2OGWA 1B3BA 1N5OX 3F9IA 4XPZA 3PU6A 4BKMA 3K70C 1BU8A 2DFVA 2L69A 2QLTA 3ONFA 2V03A 5DWDA 5IUKC 4P82A 4DCCA 3LE8A 1BCSA 3DVAB 2IEDA 2IYLD 2ZBFA 3I1JA 4KWHA 3T9FA 3UHAA 4ZYXA 5A04A 2AH5A 4DMUB 1JIKA 3HSSA 2ZUBA 1U1FA 3D1JA 3OP1A 4PZYA 3V6LA 4MQLA 2XNJA 5IARA 1TQ4A 3HCBA 3ITNA 1CV2A 1VLHA 3JZDA 2JKVA 3LIIA 5F1YA 1LLUA 1PCXA 2Z2KA 3TYXA 2J07A 3WMXA 3TZCA 5EIAA 4W5TA 4BMXA 2CDCA 1TVEA 4G2NA 2WF5A 2C58A 1C3OA 1NJ8A 1W88B 3FKQA 4XH9B 3HP1A 5K03A 3KXKA 3R3WA 4Q3DA 1XMJA 1VGRA 3T34A 1EXVA 1BXZA 3VDNB 3GRAA 1ZXXA 5TPZA 4WLUA 1NNEA 2P4UA 2PKWA 4LISA 3N0RA 4WXPA 3QMWA 2Q3EA 1VB3A 2CNDA 1UCFA 1IU9A 1TZCA 3K0AA 5DDIP 1EFRA 2NQ2C 3CISA 4I4TB 4UEQA 4ZAWA 1TEXA 3RYHB 3IAXA 1C9MA 1QWSA 3IEIA 1E3QA 4BLSA 4BIMA 1FJGB 4AUEA 4KRFA 4IZHA 1CUIA 3SC4A 5LMZA 1M67A 3EVDA 1OCEA 3EVZA 3OWXA 4S3MA 2CHVA 2VEOA 1CUEA 3IO3A 3MWJA 1NSTA 3GW8A 4OGKA 5TEWA 3HA7A 1S4MA 3KDPA 5FFNA 1DJPA 3TZQA 4C4TA 2A5GA 4KGVA 3L7MA 4E5MA 4JODA 4CDNA 1OFTA 2GXQA 3WNBA 1YQDA 2FOIA 1XAIA 1C14A 3C97A 4RELA 3WSWA 4IFEA 1JHZA 1HE5A 4FDLA 5AIAA 1T6NA 3NYWA 1DLJA 4U9UA 1KSJA 1W25A 2C8VA 3DLAA 3ZKWB 1HDZA 4TXHA 2BEKA 3SPXA 2FR0A 4KIUA 1QGED 2A84A 4NAVA 5JAQA 5BYBA 1XELA 2PZGA 4HAZA 3G85A 2GEVA 4JSTA 2ZWIA 4RFLA 1OC4A 1NAHA 2VHZA 5JHGB 4Q1EA 4DPKA 3BXXA 1JIVA 1T2FA 3EZ9A 3VZPA 2LGJA 1U7PA 1ZM9A 1AUVA 2QUKA 2VK2A 2ZBEA 3H1AA 4HDMB 3T38A 1M2OA 4PSDA 1JHOA 1FTYA 2GJKA 2HJVA 2NGRA 3V8RA 2P6PA 3IEXA 1X9GA 5AK6A 5TMEA 4KNVA 4DBVO 3F5SA 3OWOA 1BEUB 5F76A 4AP9A 4L78A 3RANA 1NX6A 4IEFB 4WBXC 3CZRA 3FW1A 4BP8A 2L17A 5M5BA 1JJBA 4CEHB 2RJNA 5EIOA 4NZMA 4EB6A 2V5UA 4P58A 3U31A 4PHGA 2W00A 4QU5A 1R1DA 4KFRA 2ODAA 4WNAB 2RGCA 4P3PA 3AJRA 1C7FA 1DFHA 1MIHA 4D9KA 3AR6A 1Y1LA 3HH8A 2A3NA 2QRQA 3RIMA 1NRXA 3IDSA 5DP2A 3DVSX 1LK5A 3LCMA 2G9VA 5KOJA 3RTCA 3PQ6A 4FEGA 4R8LA 1NQTA 1O95C 3E7WA 4Q3KA 4R41A 5CPBA 2DH5A 3EHDA 2B2XA 5CAEB 1Q0RA 3SU8A 3N74A 5LWQA 2JCGA 2KWIA 2H18A 1GLNA 5CB0A 2AA3A 3HP7A 3Q10A 3H11B 2YMPA 5HQ3A 3PIDA 5IJ0B 2QX4A 1YRBA 2CLMB 2ZE5A 1CE8B 4EY8A 1HX7A 2RJ3A 2CNBA 2GK7A 1DV1A 2WQZA 4ZV9A 5KINB 1JB1A 4BASA 5B7NA 4L6AA 4MGKR 1AT1A 1DAHA 5AVXA 1WCIA 1IBRA 1W1WA 2BR4A 3G9QA 3OOWA 4WNYA 4XJSA 3WIVA 5IBCA 1MG5A 2N0SA 1XZHA 1Q3KA 3ZD6A 3OHMA 4Q1FA 4XIGS 1O6FA 1F7VA 5ALSA 3HLKA 3AY0A 1SY7A 3PC4A 4DLXA 2B7BA 1RWVA 3BB3A 4R1UA 3D8NA 4R4JA 2BCGY 3KPYA 1I5OA 3IP5A 1WUJS 3T5BA 4N3GA 3SDSA 1L8AA 2GCOA 1WW8A 4ZOCA 1NWCA 4YUVA 4G0XA 3ZCUA 5KMGB 4N03A 1B0PA 1YA6A 1W5FA 2VYFA 4QE3A 2ZXUA 5BXYA 2XGMA 1YR1A 2ETXA 3LMKA 1ZQ1A 4LSMA 3VPBA 1GAWA 2F00A 3KOZA 2TRSB 3JQAA 3P0FA 4PQEA 4QX6A 2W2KA 2TMYA 2YZKA 3EIEA 2UUCB 1Z0JA 3LP6A 1DXOA 2K7ZA 2PSDA 3ZWMA 2C31A 1AGYA 2YJ5A 1Z5GA 4PZEA 3ZWXA 3EGXA 3AKZA 2FDCA 2YY7A 4KK3A 5CFRA 2H63A 3U62A 1ACJA 3FPCA 2PH1A 4MV3A 4W5HA 1V6SA 1FUUA 1XAJA 3FHOA 3AOEC 5AOBA 1SC6A 1NUSA 3V80A 3M6WA 2H4WA 4NMLA 5JWHA 1PEDA 2CV2A 4MV5A 4YYEA 1NMEA 1W1UA 1Y5RA 3FPLA 3O0DA 3PXBA 3CZ9A 5SICE 1UBLS 3C5CA 1Q21A 1JJIA 1V7QA 3NXKA 4WHMA 5IVIA 4GR9A 2Q62A 4YBZA 3LD9A 1E7WA 3PLRA 4YGYA 1T4GA 2IHZA 1U1GA 4ADSG 2DPYA 4LGVA 1EKXA 2ATXA 2JBHA 2D5IA 4ESHA 4NESA 4JI7B 1UKZA 2FAXA 4HN2A 4MMZB 3ZS9A 4AJLA 1MP0A 2Z56A 1N9KA 1RMQA 3U7FB 1FMTA 3L9XA 2EP5A 4LF7B 2WU3A 4PTYA 1T0PA 4GU5A 3R7AA 2W6NA 3OKAA 3K3PA 2DMRA 3QQ5A 1FNNA 1I6KA 3O84A 1J8VA 4IIHA 2IXTA 2V7BA 2CW5A 4IJMA 1C4XA 2Q3MA 2VOJA 4Q1BA 4AJOA 5DGTA 5JI2E 1KJQA 3H1PA 1YCHA 4OYHA 1QOZA 2FQQA 3T3HA 3BTSA 3R7NA 1V43A 2MWMA 4H0FA 4XASA 4MA4A 3L46A 1UOQA 5LB2A 4L5AA 2IYZA 3GVPA 1V48A 2X5OA 3L7IA 2P68A 5DXJA 2G0TA 4JNKA 4K0KB 1WXXA 1GKKA 2ZSKA 1T35A 2XWPA 5AKGA 3NAGA 2V0CA 4Y9SA 1GVHA 4EARA 2NPOA 5IN4A 4KJXA 2FXVA 3CW9A 2DUNA 1KETA 1OXXK 3GEPA 1XMIA 1H6CA 4M7WA 5JAUA 2CK3A 1AF7A 4H2DA 4P6VF 3WB0A 3QWFA 4ENSA 1R18A 1GCOA 2CDRA 1W0KD 2Z4SA 5IRCD 1DI0A 4ZVNA 2V6FA 1Z4JA 2D5AA 4ODIA 2O2ZA 3QH4A 3ZWCA 4I8XA 2BH9A 3JYHA 3UICA 2OP1A 2JNWA 4W63A 2QTVB 2GYWA 4B75A 5CFNA 2DGDA 2ECOA 5EXDA 4L3VA 3RYTC 1JI3A 4YHBA 1QYDA 1WY5A 3JARB 2DY0A 1XMVA 2RGAA 5B53A 2DR2A 3ZOZA 4RORA 5K0BA 2GDJA 1KSGA 4NBWA 5CW2A 1RM4A 1BW9A 4POAA 2MYPA 1GDTA 1C4KA 3EG5A 1LS6A 3CF2A 3ZDYB 3QU2A 4YQZA 1QLHA 3HACA 5DNVA 2KE5A 1BYUA 1TJNA 3K70D 4Q9HA 3FY4A 4IRXA 3VOTA 1ULZA 4NXMB 2FH5B 4U2DA 5JSQA 1DIHA 4QTYA 5D1HA 3PGKA 4G0PA 3AYXB 4YFVA 3DCNA 3TQSA 2FW9A 3I8SA 5JH7B 4O2AF 3D8TA 2I87A 1G18A 2Q7XA 2VYQA 4QHTA 4JOSA 1LSSA 1Z6ZA 3A25A 4GOJA 4OYLA 2WFZA 2VT2A 3WLEA 3F3SA 2FGJA 4MVXA 3KUKA 4D9MA 2GOYA 3NNNA 3PFFA 2J0QA 1M0SA 1Y1QA 2X8JB 1ZD9A 3HUDA 3L07A 4RKWA 5FADA 4BEWA 5AFSA 2FSVC 1NXVA 3L4JA 1GUAA 4F2PA 3LT5A 2HK8A 2WICA 5FPHA 5IC5A 5F2KA 4OX9Y 3UUGA 3IP8A 1RMYA 4GDMA 5DHSA 1T8SA 3HL4A 1FP2A 4DKJA 1G21E 1XHEA 5KSYA 4JWKA 3FNQA 4RKFA 1CEEA 3BFKA 3EZ2A 1YDMA 3KQMA 4OSOA 2A14A 3C43A 1QP8A 4ARCA 5LDHA 4B6QA 1M0WA 3KYBA 5K51A 1RJDA 2PRYA 4G5SA 1US8B 3WAGA 1YASA 4J91A 3NHPA 3H6HA 2P5SA 1LSUA 1U5BB 3IT3A 3MMPA 3SM3A 1U04A 2LR0A 1W30A 3IH5A 5KYXB 3BD8A 4PAGA 2ONKA 3BGSA 1B7GO 3H9BA 4MWGA 4O29A 4IWXA 2I4MA 4N5NA 2NNLD 4LJYA 4PYKA 4B79A 2AK2A 2Z08A 1PSWA 3EF1A 1L4LA 1NLZA 2XLBA 1J22A 1KBOA 1T4CA 2E5WA 3H1FA 4J1NA 2AG0A 4WZBE 5JBQA 1DTWB 1VL8A 1ZCJA 2QOEA 4FFVA 5DTIA 5EEHA 3TWOA 3WYNA 4JAVC 2D7DA 2YDXA 2FR1A 2P78A 4K6HA 3RC7A 3TUZC 3EXHB 1U8AA 3THRA 4MO2A 4CHGA 4YCBA 2QI9C 2YV5A 1HURA 3GGSA 3THWB 4GOLD 4X63A 3O8OA 2EATA 4O4IA 2CHGA 1FP4B 1JLLA 5E1BA 5ADVA 4ZTZB 4AURA 3BGOS 2P0AA 2HQBA 4DJEC 4ARIA 3HO1A 3QITA 1ZRSA 2GAJA 3TFQA 3HDGA 2OYCA 4JT9A 3IX7A 1JZTA 2OY0A 3HC7A 4ZRNA 4UUQA 1PJ4A 4DLWA 2ZYIA 3T3EA 6GPBA 1UIMA 2IJGX 5KNDA 1ZH0A 1C4WA 1I3OA 1H0KA 1Z5WA 4IJ5A 4J7UA 1PL7A 5LB4A 2BV3A 3GELA 4HNUA 1P7PA 2RHJA 2ZUCA 3H5LA 2XH8A 4J0EA 3ZWKA 2W2LD 5B36A 1KQGA 3K6SB 3DBRA 3IRVA 4UATA 1EM8A 3PX3A 2HXGA 4MW9A 1E8MA 3IVMA 1J0XO 2F2TA 3OFSA 1TJYA 2CWWA 3DGFC 4OXKA 1MXHA 1YQEA 4BNLA 3Q3VA 4WERA 3JATB 4YEDA 2NTNA 3Q11A 3TNFA 1G59A 3IBSA 2OFXA 3LLUA 3TFOA 3EDCA 5FHQA 2GGSA 3L4SO 1TK3A 3I6MA 4MB6A 3VPAA 1K68A 4K2AA 4LJLA 2LW7A 4RVHA 4KV9A 1I2DA 1HNNA 3NORA 2XOKA 4OQ4A 1Z73A 4WBNF 2GZAA 3BK2A 3FGPA 4PY2A 3MCUA 3D8BA 1OJLA 1MX5A 2I76A 2LIVA 4G9EA 4LS3A 5TMBA 5TT0A 3SSNA 4RQUA 1ODLA 4KIGA 1XL1A 1K2WA 2VNKA 1PFYA 1W5BA 4G0NA 2IHJA 2DVMA 3W5JA 1Z7BA 3CH4B 4MEJA 4URXR 3I6BA 4QAJA 5IDYA 5BN5A 2FMTA 1FFXB 1PKXA 3IAM1 1JNXX 4I5IA 4OIFA 1M7BA 1QOQB 4RAQA 3T0GA 1JALA 1RR6A 3EGVA 2R62A 2P7HA 2WI8A 3BE8A 3MRSA 4BJHB 1NVTA 2QP3A 4TSFD 5FWYB 2QJTA 2REQB 4ZDIA 4XCXA 5KHOC 2DUMA 4CMIB 2JL1A 2QN9A 4WWHA 3LZ6A 2WABA 4ILKA 3SC3A 3IV6A 4IH4A 2YWDA 1YIDA 1E5VA 4TYYA 5IG2A 4BNXA 1BDHA 1ZM3A 3SSAA 3DUWA 3SWWA 4QBIA 3RVMA 4CJXA 1UBNA 1VI2A 1Y1PA 2G25A 3N2EA 3OCJA 2AX3A 4S1PA 2ZJ1A 5A3QA 3K9FC 2CVQA 1PQPA 3NETA 2J48A 4PO1A 1IY9A 1L1RA 3IDOA 4EB3A 4YECA 1RPZA 1DCFA 5FPYA 1P1KA 2QLFA 1L1QA 3ROKA 5JSZB 3G8DA 5REQA 1UPAA 3TKYA 2W9XA 3EUEA 4AAYA 2YN0A 3CNEA 4URZR 2A9VA 4ZQHA 3UFBA 1BU5A 3UKJA 4BMDA 4C07A 3IBCA 4KQ1A 3GGPA 3HKDA 2ZCVA 4XIYA 3B8HA 1KVTA 4CDRA 3H2HA 2RG7A 3E1SA 3LSTA 4JVLA 2WHPA 4LFBB 3V4OA 3G5MA 2FPGA 4IKPA 3R09A 3K71B 1TJ4A 3L43A 1O9BA 3BXZA 2ZS8A 4RK0A 2D59A 4Q6WA 4QL3A 3LKDA 4R3WA 4JI0B 2C7GA 2BGMA 1ZCFA 1A1VA 2CFSA 1XWIA 1U3GA 4YR9A 4MGHA 3MEQA 2ZUTA 4OMCA 3V8MA 2HJHA 1B15A 2GI4A 1DQSA 2DLNA 2YMMA 4TVKA 1JIQA 1UMBA 3BRWA 5AHRA 3WL5A 4AT1A 1DRVA 2W0MA 3CHYA 1B23P 2HCJB 4EEXA 1E8DA 1MA0A 1CS0B 5CTJA 5ALQA 3QFCA 4Q3AA 1P1BA 4M89A 3AM4A 4H6PA 3CVWA 4JJAA 1Y6FA 3LT1A 4TRJA 2J67A 4XWAA 1XD9A 2RC5A 6ADHA 3TCXB 1K8RA 1EVIA 3N39C 4UHDA 5FAXA 2I5PO 2V7QD 3DLIA 3GP8A 4IG9A 3OQ6A 1AUXA 2VPQA 2VJKA 3DQQA 1XEAA 3CZQA 3K96A 5U4QA 3QXHA 1FDWA 3GLHB 3QA3E 1U0JA 1S1MA 5ICEA 2DPGA 1MW9X 4JLOA 2B36A 2XWBF 1E1NA 1CUCA 3W1EA 3QHQA 3DOFA 2EYQA 3QOFA 2EV9A 1E3IA 3WLRA 4OFWA 1V1RB 2IPXA 4UM8B 4OLJA 4KE6A 1XMQB 4WZBA 4P36A 4BCDA 1GNLA 3O3MB 4DHWA 1UDWA 1QGYA 4EAQA 2QRGA 1XMOB 1K66A 1IJFA 1Q20A 1XQYA 5DTQA 4EWLA 3E9YA 1COWA 4FMDB 4XARA 2PYDA 5COAA 3ZHCA 4F8JA 2IYYA 3KQNA 1ECFA 4L1KA 3M4NA 1DAPA 1OZHA 4NICA 1O54A 2GEUA 4LDQA 1CY7A 4LJ8A 3O74A 1TNDA 1K3FA 1ZEMA 3PUHA 1VL5A 2Z2YA 1ICEA 1RJEA 3O2NA 5CJ2A 2QU8A 3I1FA 4Y30A 2FI1A 2WDPA 2J9XB 4K6OA 4DXAA 3AF6A 3TNJA 3S1LA 3H0KA 4MCIA 3TDKA 3W05A 4BJ6A 4BVJA 4JK3A 1QRTA 4JXKA 1F9EA 4P84A 3IUBA 4EW3A 2J4CA 3FSEA 4YRLA 4F4CA 4LBYA 2CEAA 4YBRA 3VZDA 4GX1A 2D74A 1JPJA 2QGNA 3AIKA 1R6XA 3UF0A 4M0CA 2Q4RA 5D86A 5GINE 1BH2A 4LGCA 4OI2A 1II8A 1ZW1A 3GUZA 4TZ6A 3O31A 3QA9A 4KDEA 5DI3A 1MR3F 3E9RA 2V9PA 4OP1A 4JP5A 2OA0A 1Z7YA 1MGOA 1GCIA 2DQKA 2RAFA 2ZYGA 1V39A 2B1QA 3FWYA 1OHHD 1XFDA 3LT2A 4X1YA 1LSOA 2Q1UA 3OMLA 3IP1A 1TRKA 2QG9A 3QLUA 1DRWA 2R8ZA 4D57A 3J81k 1ETHA 5IBPA 3WYFA 4JBHA 5ADHA 3M9LA 4JS0A 2DFKB 4OGGA 3QENA 4KZKA 3V7NA 3FCXA 4ZICA 3H8VA 4ZDKA 4PHHA 3L8ZA 2FF5A 2OFFA 1NASA 4O4LF 5J2TB 1VE3A 1Q1AA 4KJZA 4QPDA 4BWVA 4C03A 3EWSA 3LXMA 4OIMA 3GJZA 4QPCA 4QPPA 4F1WA 2ZEJA 3BRCA 5FLEX 1XEXB 1CUWA 4W5QA 3VVBA 2VJQA 1GKLA 4QHSA 5A02A 1OLXA 1ESCA 3RAGA 4TTAA 2RB4A 4X1OA 5G53C 2VXCA 1LPMA 2FCAA 4GVXA 4WINA 4BQSA 3HZRA 1XO1A 1VJDA 4YT2A 1O96B 2I78A 1SIWA 4LRQA 4C3VA 1KAEA 3OOHA 4MR8B 3RSLA 4CYMA 3PDCA 3Q15C 1CFZA 1KIMA 4JHLA 3SE7A 2IPNA 1TQ6A 2V5AA 3REGA 4EG0A 5B64A 1TC1A 1AKNA 4HO1X 1PNOA 2PMDA 3MWYW 3Q3GE 1ZBDA 2FHPA 1D7AA 3IPRA 3AY7A 2QAGA 1NW9B 5KYWA 3AF1A 1QKJA 1YMQA 1D1QA 3HYRA 1X1SA 4ZAGA 5JCOA 1QP7A 2GHIA 4DTCA 1R5JA 2JATA 1BNCA 3FKJA 3CV3A 1IAVA 5CD9A 4MVCA 5BSUA 1GPH1 1MFPA 2C88A 5HSGA 1DP4A 2PIAA 2R1VA 4NFSA 1HT3A 3CUSA 5HR5A 3HYLA 3DE0X 5C1PA 3AFGA 3SJAA 3L06A 1YJAA 1GGHA 1E1RA 2HIHA 2GKGA 1UOEA 1QLWA 3CRNA 1IEQA 4NQZA 4DILA 5L4LA 5HW0A 1V5EA 2R65A 3RODA 4NDAA 3FCCA 4PZCA 4EUEA 1R6DA 2QV0A 3S4YA 2I67A 1I7QB 1JG3A 5HA5A 2ZAMA 4RM2A 3S2ZA 3WK9A 1JIIA 1B93A 3LQRA 1ST3A 5YASA 3OD1A 3TM5A 4IQ0A 2NMVA 1N5DA 1PS8A 2HHHB 3JVVA 4RZXA 5JXJA 1UT5A 4H7JA 1X2EA 4HP8A 1FFSA 5E4YA 1PUIA 3OTGA 4KC0A 5FORA 5JJIA 2HNBA 2HDOA 2HA6A 3U3RA 4JSRA 1IE3A 2BHSA 3G8YA 2NT3A 1J0CA 1FQWA 1I7PA 2J41A 3TRDA 3WIDA 4ER0A 1LD3A 3NEJA 4CL8A 1T4MA 1AV7A 3VNSA 2HBQA 1A8QA 5CFOA 2VHUA 2MYUA 1PTJA 3PWKA 5DP1A 2WWXA 4IMRA 4NBLA 1KZYC 2P9EA 1VHDA 3LZDA 2X8AA 4XEHA 1IOLA 3A1TA 4Y7DA 3MSCA 2O4UX 1C3LA 2FWBA 4I4NA 1JR3A 3OPYA 3CRVA 4RZIA 2JGJA 3PDWA 2ONJA 4RC9A 2OXTA 3WJ2A 5NULA 4NY1A 4AS2A 1QQBA 1ZESA 1ZH2A 3KWJA 4I55F 3P2YA 5F21A 3TECE 2H06A 3KZ1E 2PKQO 2VDJA 3JTMA 4AS3A 2H17A 4EI2A 1KDVA 4Y2JA 4DGSA 1FLAA 2VRCD 1CVLA 1SKBA 4DRZA 1SUPA 2VQFB 3A7EA 2W98A 3EA5A 3E8SA 1YB2A 4HNSA 2ZTVA 2RK4A 4M0EA 3UQZA 1E6WA 2VDWA 4IUDS 3QJYA 2GN4A 2JK0A 3EA0A 1CY2A 1DADA 2O9JA 1EWVA 2VF4X 4JGBA 5EXEA 8ADHA 2FPIB 4K8RB 4MHSA 5DHAA 2ZIFA 3A4TA 5JZBA 3KZMA 2RMKA 1EX6A 2OB1A 1RYYA 2A7XA 3M2TA 4IUCS 2VDRB 5LA6A 2VJBA 5LP6B 3U44A 2RGXA 1XJCA 2P9TA 2Q1WA 1KI4A 1Z8HA 3MWKA 3NQ41 4ENTA 4P4LA 2HU5A 4NYMQ 3OKFA 1QDEA 2ALJA 1T0BA 3X1DA 3ROFA 1QANA 1ZIPA 1AC5A 1KI9A 1OZAA 3KJZA 4C3ZA 1KQOA 3IQIX 4JB3A 1JDPA 3EZGA 2VHEA 4NH0A 3IPLA 4P38A 1UJNA 3I0ZA 3LM8A 3U3KA 3VBCA 5LXTB 3COVA 4LJRA 2SCUB 3R5KA 1Z8FA 1F3LA 2PTGA 2NTEA 2PO5A 2PX3A 3MUFA 4KUGA 5I9MA 1AN0A 5FKJA 4GMXA 4DR3B 3QELA 4XUDA 4EYGA 3WP0A 4LI0A 4W7IA 3ANNA 1PDOA 1TUIA 2CLFB 3LZCA 3OZXA 4ZFNA 2V4MA 3SFZA 4W5NA 1T5SA 2EC5A 4QOGA 4QUHA 2MINA 1UF9A 4N8SA 3AL0C 2WYIA 2WK1A 2WYVA 1UFRA 3OZFA 2YYZA 2ERXA 5LBUA 1NE2A 3TK1A 1VHQA 1Y4UA 3EXHC 1QPZA 4KZPA 1S2MA 2DLDA 1FU7A 1Z2CA 2CKDA 3W8FA 3TNYA 3GC6A 3VAZA 5BP7A 5BT8A 1U63A 1Q1EA 3N8KA 2ZGVA 2P67A 4ZT4A 4BLQA 5M2QA 4Q82A 1W0JD 1CEQA 3KKEA 4MKXA 4JT4A 4MLDA 4JDUA 2F6RA 4KQFA 4RIHA 2ZVPX 4CKYA 5IJXA 4H7PA 1TJ3A 3TXXA 3BAFA 2OMEA 4QQFA 3A36A 1KEVA 4RZUA 2RIPA 2ZS9A 4IXTA 1LTQA 2PMWB 4O5OA 4EUHA 1ZGZA 5KYXA 5JS1A 1JFRA 3KBOA 4V2UA 3OZSA 1H4VB 2NV2B 4UC0A 1B6SA 2PLRA 1VB5A 5A05A 1L1FA 3AM1A 2IOHA 4HS4A 3JY6A 4TUYF 2Y9PB 1EHCA 3H9EO 1QLJA 1A8SA 2G70A 2P2SA 1OU0A 1Z2AA 1H2WA 1VIYA 2CMFA 3AKCA 5FUMA 3NGLA 1EMDA 4D42A 1ICIA 1BMFD 1RVDA 3JS5A 3MRTA 4M46A 3Q4GA 2CSXA 1Z39A 3ZDRA 1SBQA 3L7NA 3PUVA 3GJ7A 1F8YA 4ZC8A 1RZRA 4DJFC 4RM3A 1ZC4A 5DH9A 1J90A 4BYMA 4F5YA 3EEQA 3L7OA 2GJ9A 3ORHA 2BSAA 3GEHA 4X92A 2HYIC 2QTRA 2JGIA 1Z0DA 2HUNA 1VKZA 4FN4A 4HAYA 3LBHA 1TD1A 4AO7A 1AMUA 5IH3A 4EW1A 3U4MA 2FPSA 2X6QA 2BFEB 4NZOA 3WRYA 1DUVG 1E2GA 2FFQA 3HWRA 4G8DA 1HZJA 1W6RA 1ZXLA 5DWVA 3SZUA 3TLKA 2QRVB 4P0PB 4OLBA 3GG9A 3LCRA 1XNRB 4MUKA 2OO5A 1JWLA 2VT3A 2L42A 4Y2YA 2DWPA 4EKGA 4ZZ1A 4L22A 3FGOA 1ZD2P 2B4QA 2XAAA 4J0FA 3RV4A 2LKCA 1QE5A 2ENWA 2B7CA 2H59A 2QYSA 3PKJA 4TMKA 5JC1A 2JHCA 1XZDA 3OM1A 4LWQA 2OHGA 3QYFA 3AWDA 1HK7A 4X5OA 1THZA 5EFZA 3UWPA 1QMPA 1OBOA 5KSOA 4MJ7A 4I3FA 1B2RA 4LQDA 5ALYA 2ZR7A 2VH2A 3HRIA 4BVHA 2WJAA 2UUOA 1CQXA 1QGOA 4K9NA 3N53A 4M1OA 2NSHA 1U5CA 1C1DB 1XAGA 3AJDA 3D31A 3WWYA 4C4OA 3PPYA 4TYWA 1UWKA 5K3SA 3CEAA 1QAQA 4MR9A 5GONF 2FWPA 5F3WB 1PJQA 4MVJP 2QE6A 3HNPA 2BEUA 3UXHA 5AJHA 1FZQA 2F4NA 2VNHA 3PR1A 4G85A 1EK2A 4B45A 3D6NB 1TVMA 5AOAA 1NR5A 1H2FA 3QHPA 3OT1B 5JZ9A 3V32A 3JWGA 1Y6RA 1IN5A 3DZHA 4M98A 1BC5A 1VMKA 3F6EX 4PLGA 3TN7A 3WHIA 2ZJ8A 3TL3A 5JS8A 1J39A 2ILTA 4B74A 3OFKA 5CVCA 5KBYA 3WNZA 5C18A 3WHPA 1V3QE 3PA8A 1MB0A 2CNWD 3MB5A 2ZUFA 1AUPA 3QBVA 1CF2O 1E7RA 3VGJA 3ZDCA 1XCBA 1Q92A 2Y0EA 1FFWA 1SXJC 3T7JA 3BMXA 2XYGA 1L1EA 3ZCSA 4PHCA 5DHUA 3K0CA 4ROTA 3E48A 1RPJA 1UZAA 4I1UA 5H0IA 2YYYA 2QX7A 2WTXA 1XLUA 5TQVA 4YUAA 3UW1A 1VJCA 4INJA 4F5EA 2YMLA 2ZUSA 4UMFA 5EJ5A 3BIWA 3EFOB 3VU8A 3U6BA 2H11A 2Q99A 5TGDA 1A5ZA 1V96A 1V26A 2C98A 2Y1GA 2CYCA 3BMNB 3EXG1 2B4RO 1GXSB 3IHKA 3K6JA 2AHRA 4MWTA 4MMYB 2P2NA 4MO9A 3H99A 1THMA 5IVHA 1BG6A 3HKBB 2N1BA 4DA7A 3N2LA 4ERNA 1WWKA 1QVAA 5DCUA 2IV3A 4TV9A 1DRKA 2G77B 1KQNA 3WS7A 1C29B 5KYTA 4K7JA 2OCDA 2FPXA 2WAXA 2PKQP 1OBVA 3DEYX 1SJ9A 2O05A 2RGGA 3DLCA 3OPNA 1SHKA 4B6SA 3U4QA 2W8BB 2BEWB 4UNNA 4KXYA 1CJKC 1N2GA 4YRQA 3VAAA 3T3OA 2ZJ7A 3T7RA 2A88A 3WVNA 3VZRA 2A9QA 1AZSC 5LQUA 1EUCA 1QF7A 1DZ3A 4ND4A 5C35A 3I39X 2MTBA 3OF3A 3RVBA 2QTAA 3A05A 2G5GX 3RT7A 2CUNA 3B1ZA 1NF9A 3VSCA 5HZHA 4GQBA 4WLFA 4HVCA 6REQA 1D03A 3PQEA 4NYIQ 3KT0A 2FN3A 2II6A 2CXTA 5L3ZA 2H9IA 3ZJVA 4HI0E 2CBGA 2BI7A 3B48A 4ZQEA 2LD4A 4JFAA 4D9EA 1SG6A 4OUKX 1QH1B 2JA2A 2GB4A 1HKHA 1HEIA 4NOMA 5CITA 4EY3A 4BY9E 2CJYA 2Q28A 3CWZA 1XXHA 1P3JA 1D2GA 2YWHA 5TV2A 3AUSA 3A58B 4OO3A 2VWPA 2YV4A 1ESEA 2VJDA 1E4EB 1A9OA 5EYPB 1CULC 1RFGE 4WUTA 2GKOA 1NU6A 1Z0IA 4E03A 1MRSA 4FFWA 4E14A 3CIFA 5JXGA 1M2JA 5HBGA 2PL1A 3BFJA 5A62A 1CZHA 1C0LA 2Z04A 4LNUB 4LA4A 4FONA 1GRNA 2PO7A 4R1SA 5KNBA 4LJKA 2KM1A 3L4BA 4BP3A 2P4EA 4GYYA 5FYQA 5JNTA 2GAOA 1E2EA 5C7YA 2X2FA 3SBEA 2HCBA 3AUKA 2LV8A 2NVOA 5DYYA 3WRXC 3M1LA 1NJFA 2J45A 3AC0A 2WB4A 3QXJA 1HFKA 4KFUA 1XG5A 2HSEA 1HNZB 4FYVA 4JX8A 4OMFG 4XDZA 5FBZA 1QKIA 2FN4A 1MZPA 1EESA 1UH5A 3VYWA 4FT2A 2ZRPA 5LKRA 1FSFA 5IS2A 3PYXA 1WZUA 4CTKA 1RIIA 5E1DA 1DIGA 2G09A 4XI9A 1VMAA 3P0JA 1GFZA 3A1CA 2R6GA 6PFKA 1GWNA 2H1LA 2WT4A 3PF9A 4RJJA 1P61B 3GVIA 5BW4A 2C7QA 3UJNA 3AUTA 4BQEA 1UPCA 1PWEA 1H8EA 2H1HA 3EEBA 1FPQA 4X00A 2EIHA 4OU5A 1PS0A 1ZI9A 2CDAA 2JS7A 3AINA 4Z9AA 3DMTA 3BJEA 1XRRA 2XADA 4H4EA 1N32B 5DJ5A 2OO5C 4TWIA 5FYDA 2PS9A 1IXYA 1J8YF 5FQOA 3OX2A 5SZJA 4YCNA 2QMHA 2D1FA 3KXDA 3NP9A 3QQPA 4BNUA 4AI6A 4MW1A 3UT6A 1SBTA 4K9PA 4G6ZA 1A77A 3WGZA 1TTHA 3Q8KA 1MC1A 4FI3F 3FB4A 4PCUA 1PQUA 2VA9A 3MGCA 3MC1A 5AVKA 4KYVA 1RRPA 4FFDA 4JVMA 2Y92A 4X85A 4RZQA 3VZBA 3D6VA 1EBBA 2VHXA 2BMDA 1WL8A 5ECWA 1FDTA 1P9WA 2WRZA 3M5PA 3JRXA 2DHDA 1M6VA 1YI0A 4AG5A 5IKPA 2AJBA 3KKQA 4JJ4A 5CFLA 3LRTA 1KOFA 1Q17A 3K9GA 1W85A 1WTCA 3QFFA 5KWEA 2QG6A 2FRDA 4ZODA 5TMDA 3PI7A 1MIOA 2GASA 4GMHA 3SYMA 4DLTA 3P94A 1D0VA 2BGGA 3FBWA 1BCSB 3DVAA 4UMDA 3UAZA 3IR5A 1FRFS 3UXMA 4Q1DA 1UBEA 1H2XA 2OV8A 1QE0A 1DJNA 3MCTA 3VR2D 3L77A 4PQFA 4Z3KA 2G76A 1ECBA 3FNBA 3D4IA 4FNGA 3NVKI 1E99A 1N2CA 1ADYA 2WD8A 3FYCA 3LUBA 1I7NA 3H2GA 1CP2A 3LVBA 3PR2B 3QOYA 5D3KA 3WADA 1V11B 4HV4A 2XV1A 1RAFA 5KOYA 1YZHA 2YNMC 3BN3A 3F71A 3O4HA 1M2NA 1VLLA 1P91A 3EF0A 1U1CA 3VR6A 1UC5B 2O3SA 3LLMA 3LPLA 3WHLA 4YDHB 1FDRA 4PBRA 3WIUA 3HPQA 3RYHA 3ZEIA 3FA2A 2JLYA 4GW3A 1OH5A 1KVRA 1WY7A 3H5NA 4EHNA 2Y0PA 3RIXA 3TSOA 1JJVA 1JVSA 4W1QA 1JFVA 4BNDA 1YZLA 3OQVA 4RS4A 4J0IA 4HQFA 1XLTC 4KIFA 2HQ1A 2WINI 3DQPA 3QXXA 1K7YA 3Q7TA 1JRLA 3Q3IA 4PWYA 1QH0A 4FFLA 2MSCB 5EGSA 4JT8A 4KWCA 2R9VA 4LMBA 2DKFA 1NYQA 2AOXA 1EZ4A 1KXJA 5AW8A 3L2OB 3VR4D 1XKXA 4AUMA 5DGHA 1TUBB 3KWLA 4WK6A 2YBDA 1JPNA 4LPSA 4O6VA 2MIIA 4X62B 2M98A 1CZLA 3NTVA 4J9VA 3UH1A 4ZYLA 3UENA 4P86A 2BMEA 4UD6A 4JA2A 3AF5A 4DT1A 3IB3A 3E35A 1TKCA 2XNCA 3PRJA 3U3MA 1A5BB 3P1JA 4XX0A 1TIBA 1G9TA 4IY1A 2UXCB 3PKZA 1K8XB 1JVBA 1MF7A 2V3VA 4KB5A 4QGHA 3RJMA 5BW5A 1M1UA 2O6HA 3TG8A 4RHYA 1IM8A 3L5OA 2MJLA 3EZ6A 2A0WA 5BWCA 1ZD5A 4QVKA