2DUMA

Crystal structure of hypothetical protein, ph0823
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
143
Chain Sequence
b'MFRKVLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMELKDIKEKLKEEASRKLQEKAEEVKRAFRAKNVRTIIRFGIPWDEIVKVAEEENVSLIILPSRGKLSHEFLGSTVMRVLRKTKKPVLIIKEVDEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0823
molecule tags Structural genomics, unknown function
source organism Pyrococcus horikoshii
publication title Crystal structure of hypothetical protein, PH0823
rcsb
total genus 41
structure length 143
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dumA00
3I05A 5H7XA 2RD2A 3BL5A 3A05A 1G8GA 3G5AA 1FYDA 2CSXA 1YIAA 3DV2A 5LLTA 2DXIA 1N2IA 4UZFA 2X3FA 2Z08A 3IDFA 1M8GA 1N2BA 3KT8A 3VU8A 2YWBA 2BTEA 2PFSA 4KPUB 1ZH0A 4EF6A 3ZIUA 4ZCSA 3RHSA 1N2JA 3TS1A 3CLTC 2PG3A 1N2EA 1M83A 3HV0A 1ZJWA 1EJ2A 1M1ZA 4PBSA 3ILVA 3RFFA 3C8ZA 2CV0A 4DDKA 3ZXSA 2D13A 1XNGA 4AS1A 1NI5A 2CYCA 3D6VA 2HZ7A 3MLAA 1JIIA 2JANA 5BNZA 3IH5A 4MUJA 1IFXA 1VBKA 1MAWA 3H97A 4U7JA 3IMEA 1N3LA 4L2IA 1I2DA 1JILA 2O8VA 2A1TR 1TEZA 1U3DA 2GOYA 2VXOA 4MUFA 1IQ0A 1MBZA 5FO0A 1M8JA 1YUNA 1TYBE 3ZUGA 4EG6A 3TZLA 5HG0A 4EG3A 4CQNA 3AG6A 1F7UA 3KT6A 1O6BA 2X1LA 4MUEA 2CV2A 1JEEA 1MJHA 1TYCA 4GU5A 1J1UA 1U7DA 1X6VA 1RQGA 2WQ6A 4MWBA 2CYAA 3OP1A 1UFVA 4MQ6A 2QJFA 5KCMA 3UMVA 4ZT2A 2QTRA 1G59A 4JZYA 2WSIA 4BWVA 2V0GA 4MVCA 3IMGA 2J08A 4MWEA 3SZGA 2DERA 1NUPA 1GAXA 1T6YA 4MWDA 1QNFA 3HMQA 3CLRD 2H2AA 3Q10A 5J5AA 2PZAA 2E0IA 4OJMX 4A91A 3ZXIA 3RK1A 3MXTA 2PZ8A 5F23A 4MUNA 1O97D 1IRXA 3G59A 4MW1A 3DO8A 1KR2A 2J07A 1WXHA 1OBCA 3IOEA 4J75A 4NZPA 3ZJVA 1H3EA 1PG0A 1Y42X 2ZUFA 3SDBA 3N2YA 1JZQA 3P0HA 1MB9A 5DEOA 1EXDA 1SURA 2CT8A 1J09A 4MUKA 4RUKA 1JECA 3P52A 5HUHA 1K4KA 3GLVA 2X1MA 2DEUA 1IH8A 4EGAA 1KQPA 1KH2A 2PXHA 1QU3A 2EL7A 4YMIA 4DNXA 1GTSA 1MOPA 1EFVA 2QUJA 1YI8A 4MW2A 4MW0A 1MAUA 1OWPA 1KQNA 2A4MA 3LCJA 1BS2A 4DDHA 1ILEA 3H05A 4ND7A 4F4HA 3A2KA 2VTBA 4DDMA 2DLCX 4P2BA 3IUBA 4ZT7A 4DE5A 4YBRA 4KPUA 1F7VA 5EKDA 1QTQA 2RE8A 4R0NA 5JBNA 2O5RA 3IVXA 1QQTA 4MULA 1ULHA 2A84A 4FZJA 1WJGA 1JIJA 1O97C 3FY4A 2E18A 5AHWA 1TQ8A 4K0RA 2D54A 3MMXA 1O96A 3CLTD 1WKBA 1KKUA 1GN8A 3U1VA 1NZJA 2IJGX 1T6ZA 2J4DA 3KT3A 1WY5A 2Z3VA 3ND5A 3COWA 3LOQA 4MWCA 1GLNA 2HGZA 1WOYA 5DK4A 4EG4A 1EUYA 1YIDA 1N78A 2QUHA 1CT9A 4L2IB 3F3MA 4AQ7A 2XRYA 4NATA 2YWCA 1VLHA 2XRZA 5TEWA 1N1DA 3D6UA 3HFJA 3JXEA 4DJAA 1NP7A 2A1TS 4KR9A 5LFAA 1VBNA 3SEQA 2EJCA 4HPWA 4RPIA 4E1AA 1O0CA 3OTWA 1R6XA 3HZRA 4ND6A 2GKSA 4MAFA 4EG7A 3FHJA 1IVSA 4R2MA 2J09A 4CDNA 5KHAA 1YULA 2OV4A 2TS1A 3K9WA 4OUDB 5DASA 3INNA 3AKZA 3IOBA 5IJXA 4MUHA 3CLUD 2A88A 4Q16A 2GM3A 3N8HA 4CDMA 1T9GR 4JFAA 4ZCQA 5J58A 4JXZA 2WB2A 2J5BA 2DETA 1OWNA 1KP3A 3ZGZA 3X1JA 2QJOA 2DPLA 3IVCA 4XFDA 1LI7A 3TQIA 2JA2A 2IP1A 4F3RA 4X0EA 1OBHA 4S1OA 1M8KA 3ND6A 2QTMA 3X1MA 4G5FA 1J20A 1O96B 1KAQA 4MW5A 3CVWA 1Q19A 3TNJA 3TQOA 4MVWA 4PBRA 1D2RA 1KH1A 4U8HA 3P0IA 5K0SA 1O0BA 3ND7A 1YUMA 2B7LA 4MVYA 2BYTA 1EFPA 3L93A 1HYBA 1S4MA 1J70A 3HGMA 1MB2A 3PXUA 1I6LA 3E27A 2CYBA 4ZT4A 1EFPB 1IQRA 5FO1A 2E21A 3IODA 3FIUA 4XFJA 1ZUNA 2D5BA 2PIDA 3HL4A 1JEDA 1OWMA 1R6UA 1OD6A 3K32A 1JIKA 3RK0A 2JAXA 1V47A 4HJRA 3CLUC 1WXIA 2PZBA 1I6MA 5FNZA 1QRUA 1PFVA 4QRDA 3ZJUA 3X1KA 1IHOA 3QE4A 4GRIA 4I6JA 3SEZA 2DR2A 3CVXA 1WXFA 3UK2A 2YXNA 3IUEA 2H29A 2HMAA 2CFOA 1N75A 1WXGA 1MC1A 1PG2A 1EUQA 4HK4A 2C5SA 1FFYA 1J21A 3L92A 4PY2A 4YP7A 4KR6A 2OQ2A 3AIIA 3H99A 2A1UB 1PFYA 4ARCA 3PNBA 5HUJA 5TS2A 3IMCA 5TEVA 4ZT5A 5DB4A 3FNRA 1O95D 1COZA 1WQ4A 1WXEA 3COYA 3DLAA 3IOCA 1G8FA 1GTRA 3FWKA 3RJZA 1U7XA 1GPMA 1K4MA 3P0JA 3G6KA 4K03A 1B6TA 5LM3A 2VTBB 1F4LA 1KH3A 4MUIA 3FH0A 3CVUA 3NBAA 4J76A 1NUSA 4G6ZA 4ZT3A 2CV1A 1N2OA 2QUKA 4OUDA 4KR7A 3QTBA 1KQOA 1KORA 1PFUA 1TYDE 1N77A 4WNYA 1M8PA 2A7XA 3H9BA 4XSVA 4JXXA 4JYZA 3GUZA 4KKVA 3S3TA 2Z09A 2I1LA 3AFHA 3N9IA 3N05A 3CVYA 1Q11A 1V8FA 4ZT6A 4Q93A 1KP2A 2NSYA 4MW6A 1O5TA 1OWOA 4MW4A 3UY4A 3QTTA 4TS1A 3AG5A 1O95C 2QUIA 4EG8A 4I6EA 3SP1A 5TGTA 4DLPA 2QJTA 1H1TA 3CLRC 1A8HA 1U0BB 1NYLA 1WQ3A 3CLSD 3PRHA 1QJCA 1T6XA 3CA8A 3NBKA 3A4IA 3MUEA 1J1ZA 3A04A 2NZ2A 3Q4GA 3M5WA 4MW7A 1O94C 2QTNA 1K92A 3IVGA 3PNVA 4MUGA 4R2LA 3UOWA 1P7PA 2DUMA 1XNJA 1VBMA 1K97A 4EFKA 3PNYA 3FI0A 1EE1A 3ZJTA 1NUTA 3SZ3A 1O94D 2X0KA 2R5WA 4QREA 3CR8A 3KFLA 3CVVA 4ZCPA 4EG5A 2WQ7A 1X8XA 3NV7A 3TZEA 3COZA 1JHDA 1LW7A 5J59A 1N2HA 4HJXA 1TFUA 1MRZA 1VL2A 2ZP1A 5H16A 4ARIA 1LI5A 3VGJA 1GZUA 4ZCRA 1R6TA 1T9GS 3MLBA 4YP6A 3COVA 1ZH6A 2YY5A 1Q77A 1Q15A 1G8HA 5K0TA 1NSYA 1NUUA 4H3SA 1TYAE 1N2GA 4NX2A 4ZCTA 2IELA 3VRHA 1QRTA 1IQUA 1F9AA 1I6KA 1KAMA 1XJQA 1XNHA 4MW9A 3ELBA 4NAHA 4WSOA 4NDAA 4EG1A 2AKEA 4PBTA 4G5YA 1PFWA 2V0CA 1JZSA 1NURA 1M8FA 1NUQA 1JGTA 2E89A 2A1UA 3H9CA 4QBTA 2AG6A 4UZEA 3GMIA 4MVXA 4I6GA 3FOCA 2CUZA 3FETA 1H3FA 3FG9A 1H3NA 2G36A 4NAUA 3FDXA 3DPIA 3RBAA 1QU2A 4YP5A 1QRSA 3Q12A 2AZXA 1OWLA 3KT0A 4CT0A 2ZUEA 4MLPA 3UC5A 1U3CA 1DNPA 3AL0C 1EFVB 1JMVA 4U63A 5KWVA 5IHXA 1WZ2A 3LE8A 2A86A 3ISJA 3SYTA 3CLSC
chains in the Genus database with same CATH superfamily
1B42A 1TVKA 3F98A 1SU6A 3WK4A 4EUHA 3D6AA 3NTVA 3HWX1 2QV7A 4AO8A 4LF6B 2G1UA 3Q7SA 2OG1A 2JLAA 5B3JC 1N2BA 1RXEA 3EHEA 5DYGA 1GGKA 2QQ5A 2FRDC 4R5HA 1OUMA 1EINA 2EJWA 4BV2A 2XYPA 4GPIB 5AK0A 1GT91 4NBTA 3UMGA 3D6MA 2YQZA 2PSEA 3LOPA 3AFNA 3CH5A 4M21A 3QJ5A 2H06A 2B21A 3CW8X 4RFSB 5ADWA 3IQIX 3B60A 1V6SA 3UMBA 1X0XA 2E5LB 3I1FA 4REQB 3TZQA 4EK9A 1AKRA 2V6BA 1KU6A 1WHTB 4XQ0A 1QVRA 1Y7IA 2AN3A 3TTSA 4DCSA 4UFPA 1Z5OA 3D8RA 1NI5A 2JCXA 2OO3A 5F21A 1QHHA 3JQGB 2XUKA 1X19A 1YU9A 1F06A 4BO2A 4YV2A 1B8VA 2RGEA 4MI9A 3T7JA 3LX4A 1CP3A 3SZRA 1CRQA 3F49S 3PUJA 4EVIA 4AYXA 4B35A 1JILA 5JAIA 4W1PA 1HDOA 3VDXA 4TWRA 1WR8A 5ICFA 1NVKA 1R64A 1U5BA 4MV3A 3FTFA 3NUZA 3CB2A 2R2GA 4GWLA 4PO9A 3S1AB 5JQWA 5EP1A 3ZLVA 1F2UB 5D3MA 2IXAA 3OPYB 5EXTA 4BX0A 1EP2B 3O8RA 4AI6A 4WZBE 1JLLB 3K09A 1EUCB 1T29A 5KYXA 1FFDA 2ZUWA 1E1YA 3A9RA 5JSZA 1NU6A 4MVJI 3CX6A 1NZFA 5I5GA 1X1DA 1USIA 1WIWA 2CCKA 2RHDA 3O75A 5REQB 3E8SA 4MUEA 5CLGA 1D2CA 1YQWA 1DUSA 1USUA 3MS2A 2G88A 3C6QA 4G0MA 4DWJA 4H6XA 1WU7A 2XCLA 1Y1TA 1UBRS 4R16A 2FCRA 4RKWA 4RKQA 1E58A 1U2SA 2QUZA 3IAHA 2J6BA 4DR1B 2I7DA 1W76A 5EEHA 3F8SA 3O1JC 2GAAA 2R86A 2V3WA 2FN9A 1R0SA 4CETA 2QTRA 3HVKA 6NULA 3A31A 2Z6AA 2CMKA 1T2AA 2QMOA 2WWFA 3RSLA 2IUEA 2D1SA 2ZTUA 1QKIA 4B2PA 3CN7A 3KQLA 2O59A 3TLCA 3B6EA 5CB6A 1PL0A 5J5AA 3G82C 3O03A 4OJMX 4CLHA 4CU5A 1M2EA 2Y1FA 3LXUX 3MNFA 4LVUA 5LYJB 5JRZA 2PDAA 2PX0A 2ZSAA 3DZBA 4CUKA 2LBPA 2Z2XA 3BS4A 4HDQB 1XXHA 1GILA 5FUYA 5ADVA 1PQWA 4B4VA 1K08A 3PXGA 3BHJA 4DTIA 1A5AB 1KRHA 4BASA 1KEVA 1SQGA 1G5FA 1GZSA 3BMCB 4NTZA 3IMKA 4C30A 1L5NA 3EVCA 3ZV3A 3FPKA 1AN0A 3CG0A 3A32A 1PG0A 2GNPA 3ANSA 3JATA 3N5KA 3RT7A 3AHDA 4F2DA 3RVBA 1I51A 1SC1A 2QIPA 4C29A 3HXQA 1CYDA 3CUKA 2GN9A 1J09A 5BSRA 5FLYA 1P0FA 1JQEA 2QRQA 4ENTA 5JROA 3R2JA 3EG5A 1C8KA 3PYXA 3HJCA 3WO0A 4M3NA 4AW9A 1W0JA 4C5AA 4D9CA 5KYYB 3O1HB 2Z2IA 3HCCA 4OI2A 3MT0A 1F8UA 4P7GA 5ALFA 1EWRA 3RD5A 2FSFA 3LPNA 1R0LA 2XNDA 3I9FA 3QF4B 3R3JA 3ZDYB 3JQEA 4RGBA 1AS2A 2FQ1A 3KYCA 4KQ2A 4O4IF 5F9FA 1WVMA 3MTDA 4A1OA 1ZVVA 3ZGNA 3UPUA 1GTSA 5IN4A 4YAEA 4E4RA 1GRRA 3U80A 1ABFA 2ECFA 2PZJA 4X63A 1OFIA 3MWGA 2CJXA 2J33A 2OVBA 4QDKA 2UUOA 1BS2A 3C5HA 3RABA 5K8JB 4XVUA 3DMDA 4O8ZA 1ZOIA 2E6UX 1MG0A 3IIKA 4LX8A 2FKAA 4GQBA 4JNCA 5L6LB 2XMDA 5K20A 3WLOA 4LY0A 3RB8A 2DLCX 5CYFA 1U81A 4XARA 3KVVA 2ZKIA 4FEEA 1DP4A 4I1SA 2GEFA 4QBHA 2JARA 3VZDA 4DHEA 1CJCA 1AF7A 4BJ1A 2UVPA 5ISMA 5EJGA 4QU5A 4YAFA 1I7PA 5IP5A 2IYEA 4K6HA 2OAQ1 1P2VA 3HP1A 1EHCA 4D41A 1JIJA 5EXPA 4E94A 1SBQA 1IJKA 1JMYA 5DXJA 4E14A 4E88A 1Q7RA 2V9ZA 2OAEA 3TKYA 1XMXA 4TRNA 1EM8A 3GFSA 3SXJA 4EFLA 4F3NA 1EFLA 3ZG6A 2H0QA 4LZLA 3G0IA 1RYBA 4QTXA 2PMEA 2JJ2A 3WGNA 3AFGA 3GNSA 3GY0A 5ILOA 1M34A 1HGXA 1TU4A 5TGDA 3W78A 1ZNXA 3P26A 1EUYA 2SKCA 3I9V6 4UVIA 1TO1E 2ZAIA 2Z56A 3LW8A 4M76B 1CT9A 4H59A 5EWLB 4Q18A 3V7FA 2IH2A 2VQ6A 1RQ2A 3E8XA 3TZHA 3WC4A 1Q74A 2YWCA 5TPWA 2ZIXB 5CLJA 1ZGZA 3I6ZA 3UQZA 1S7CA 1FYEA 2POCA 3OCXA 3HB9A 5B2ZA 2ZWOA 1WSBA 1R4NA 2B6NA 1SB8A 4JJKA 4B4DA 1K2VN 1TKCA 2SHKA 4NARA 2WHXA 1G4HA 1QONA 1SCQA 1BDMA 2WA2A 2X7JA 2Y1XA 3D2LA 2YVUA 3TAUA 1DIOB 3GJYA 3V4PB 2R7LA 2VYND 2WM2A 3HYRA 3W1VA 2TECE 3CNEA 4EFNA 1IBSA 5TT1A 4RD1A 4DF3A 3ESQA 4QRHA 4C4OA 3BXZA 4JJAA 5DGDA 4HWTA 5JAUA 3F6EX 3AU9A 1FX0A 2QXYA 4A82A 2I6QA 1DLIA 2LNDA 3PQFA 2ZIGA 1ZVKA 1DAKA 3FFWA 4Q16A 3BWMA 3PNSA 5E9AA 4IXDA 5LQJA 5DYNA 2POQX 3EOZA 2FI1A 5IJZA 4P86A 2HWXA 2OXRA 4TZKA 3ZWBA 3OPQA 4B33A 1JX6A 1ZC4A 4HDKB 4J0KA 3UHPA 2FNAA 5ALQA 2FMIA 2VPXA 3R6LA 1H5UA 1W29A 2PUVA 3F2VA 1MOQA 2K2WA 3AUXA 4MMYB 3DQPA 4DBLE 2VQSA 1SWVA 1LI7A 2D74A 2P7IA 4XFDA 3ROGA 1Y8RA 3MERA 2IBTA 1Y3BE 4LXUA 1CK4A 4M9RA 3FLBA 2IP1A 5FTNA 1TPYA 5ALKA 1OF1A 2J3EA 4ITUA 4IH1A 3IEIA 4P4SA 2JAWA 2HW8A 3ELUA 3P0RA 1BX1A 2PKCA 2J4FA 3X1MA 3P7MA 4G5FA 3NOVA 5JI3E 1X87A 3TNJA 4P98A 4S3MA 1T3GA 3ZNPA 1UL1X 3RUPA 2H1CA 2ZWAA 3ND7A 1GN9A 4QOFA 2P75A 4U8GA 5E4FA 5K0SA 3DHWC 1BFDA 2C3YA 4M7RA 3O8CA 3T3OA 1LLQA 1RRPA 1EFPA 1FYVA 2OCGA 4JLOA 1UBMS 4MQMA 1QHFA 3MTIA 3TG8A 3AWDA 3DPUA 5A6VA 5H3CA 3MQ4A 2RGNA 2WZBA 3PXUA 3ENQA 3WNCA 1I6LA 1YFLA 4XWTA 2ABWA 2Q9BA 2IYNA 4TS4A 3QUAA 4Q24A 5DFAA 1YHYA 2PJZA 2C03A 4HDRB 5IS2A 1GQFA 4CIAA 4YMGA 2C5LA 4NYIQ 4AZ0A 4V0OA 1EMDA 3GH1A 3GCXA 2BMFA 4QSMA 4X91A 4QGHA 5IF9A 3KUUA 3BBPA 3F0TA 4X71A 3SDSA 1HK7A 3MRSA 4EOGA 5JQGB 1DWQA 3ZH9B 2JFBA 3GG2A 5FNZA 2I8AA 3OPYA 1DRJA 1KOFA 1TMKA 2VPPA 5K4GA 1VRWA 1A5TA 1Z33A 4GUDA 3C5WP 4IV8A 1AURA 2GO7A 1ZN9A 3LGXA 3R3VA 4KDFA 4F5YA 1NQOA 3IEVA 3DYIA 5EE0A 2FPWA 1FLVA 1P45A 2GEKA 1UDCA 3GLHB 3SEZA 2DR2A 3PHLA 1WXFA 4IFTA 4W6QA 4MUAA 4I55A 4JWKA 1EG7A 2RHBA 3RU2A 4LJ9A 1LTKA 4GX1A 1ZS9A 2M1ZA 4K05A 1AX9A 4P9NA 3E0QA 5HP4A 1XQYA 4UBMA 1E2GA 1MC1A 2GYYA 2AFHE 3K9NA 1JF8A 3MT9A 5E4JA 1Q44A 3TDKA 1N6PA 4HQLA 4ZEXA 4HNSA 4NKRA 1KQ3A 1OI2A 3E3NA 1CY7A 1OXXK 3QPBA 3TFQA 3K0SA 1IOZA 4YRZA 4II7A 1O4WA 1D2HA 3CKKA 1H69A 4ARCA 1N57A 4M54A 4TMVA 4Q7JB 1A9ZA 2ZT5A 3FGOA 3FNEA 1I1HA 1U9JA 3I62A 1M34E 3ZCUA 2WVJA 3ER8A 2NVUB 5FNVA 4HGOA 5LYJA 4UUQA 3PGJA 5DT2A 1KYZA 3OZWA 5KJ6A 2XEXA 1N5DA 4YJGA 3R09A 4PSKA 4TV9F 4DUPA 1LDEA 1M10A 4FU0A 5HF5A 2XYVA 1NVTA 3T1VA 1XQXA 5DHUA 2P2NA 4HMPA 4M22A 4J3NA 3UXMA 1LUAA 2ZIUB 2O8CB 2IBSA 1EUDA 4QE3A 3DKRA 4II3A 4AN1A 1IN5A 2FZVA 3LX5A 1PQ4A 2D5LA 3E3MA 2IXTA 1PYOA 5FJIA 3QBDA 4MWZA 3NEPX 3RYIB 1MG5A 5C3UA 1BO6A 3B2EA 3IMFA 4KJZA 3GPDG 1CFZA 4MV5A 5BV7A 1YS2X 4XVQA 4YFVA 4N7JA 4B76A 4ECAA 1ZW1A 3QPDA 4IHQA 3CX8A 4RWZA 1ACMA 4MICA 5JLAA 3CUTA 5JRDS 1GEGA 1ZCBA 4HB0A 4MW4A 4KL8S 4BECA 2WRZA 1R0RE 3GLGA 1E2HA 1R37A 3CLVA 2ERYA 5DLEA 5DLDA 1X80B 4PW0A 1OOEA 3QRWA 4WLUA 3TQFA 2WJZB 3TTYA 3WK7A 1V8DA 2NIPA 2PJDA 4JI4B 1JHOA 3P5BA 4TLEA 4DLPA 2GSDA 2C5FA 3EVAA 3VR5A 2D5AA 4RJ2A 2AFIB 2REXB 3A6HA 3PE3A 1H1TA 4PM4A 3CCFA 4JQSA 1G8AA 1GZDA 1ZI9A 5TVGA 1U1IA 1U0BB 1JT2A 5CIQA 1B2RA 2W4QA 1JYEA 4LOHA 1E9BA 4HAIA 1ZAYA 2M6LA 3OX3A 3U3DA 1HE8B 3NBKA 3C4JA 3LXRA 4FX5A 3ET5A 2BUCA 4TMYA 1BH6A 2JA1A 4Q21A 2BBOA 1HE2A 4L7QA 4NBWA 4NDZA 5BQPA 2AKEA 4WFJA 4OO3A 5EXEA 4B74A 1QG2A 2QLTA 2ZRLA 2F4VB 3QLTA 5ICGA 3JARA 2QDXA 4MR8B 4G5SA 4QYWA 1ZM3A 4M53A 2AFHB 5TIIA 1D9ZA 1ZD1A 3DV9A 3F5MA 1IZ8A 2ZIXA 3AIOA 4QJBA 2LCQA 1D2AA 1N0UA 2D1YA 1DQPA 5BYKA 1BEUB 1UPUA 2GK4A 3MELA 1K27A 1JIXA 2IXGA 2R5WA 5FRDA 1RKQA 4JR0A 1LTQA 1SB9A 1F9EA 2D7DA 4GZ6A 4EKDA 3BBLA 5GGYA 3ZBTA 3QXGA 3MZ0A 4TLBA 1Y8QB 3A9UA 3OO0A 5J59A 2NUPA 4BLWA 4QEKA 3E0XA 4YCDA 3UA4A 1TFUA 2XGJA 3GNQA 1RWKA 5AKHA 4FVTA 4BFVA 3AXSA 3PF9A 1CNEA 3HU5A 5DVZA 3T3HA 1FX0B 1YZNA 1SQSA 3DVSX 3QF4A 4KQWA 3ESAA 4ZOQI 1Z5UA 5K3EA 3ZJ5A 5JPDA 4IIBA 3SR3A 3EARA 1YE5A 1G8HA 1NSYA 3COPA 1NUUA 4NDNE 5A4JA 1O4VA 3FHOA 1B0AA 3NHJA 1NI3A 1ZRSA 4MKHA 2QUBA 4QRIA 1IN4A 1U9YA 3P45A 4WKPA 1ADCA 3IDZA 3RTAA 2GN2A 2EBUA 4BO8A 4BO4A 2AXQA 2BFCB 2GYUA 4UTVA 5I48A 2ADFA 1I24A 4UHFA 2FEKA 1I3CA 3OQPA 3DAYA 2FSPA 1EGAA 4MQEA 1WCWA 2VH2A 2ZRFA 3KJEA 4QBTA 4L6IA 4X6LA 2XODA 5DE3A 4OGGA 5D6OA 2QL5A 3OLXA 4P93A 1NLUA 4R8VA 1JH8A 3QU4A 3OZRA 5L4LA 2Y1GA 4XUCA 3R6GA 5C5IA 3SKXA 3WKDA 3WLTA 2X4IA 4NAUA 4KX3A 1JQJC 2AXEA 4MJ7A 2NTNA 4UE3S 5TS3A 3ESBA 3ZWPA 1YJ8A 3BCRA 1PK7A 1QJ4A 1H4TA 4WOCA 1LSUA 2JIPA 3NC1C 4YRTA 3KPVA 1R15A 1E2KA 5HBGA 5AR1A 1PEKE 2GEJA 2ZRNA 4Q12A 1EFVB 3JZFA 3VZQA 3U4QB 1S8NA 1M2KA 4DV3B 1OH7A 2CB0A 3LE8A 3EA5A 3PUHA 4R68A 4YIKA 1SVUA 1YV9A 2YMMA 3C70A 3CLSC 3L8ZA 4DIUA 1SVKA 2VI5A 3ZYCA 3BCUA 2QE7D 4ZGWA 1J8QA 1GUAA 2R8ZA 4QGAA 3SF8A 4ZZ0A 4CKBA 5I3ZA 4BFLA 1N2IA 4UZFA 3ROTA 2PUHA 3N2KB 1XPJA 1UBCA 2XKKA 3CNOA 1HL3A 1SUEA 2CFRA 3B38A 4D2IA 2BTEA 4TSKA 1C14A 3INGA 3QFTA 2ATVA 3EIXA 2JPDA 4C2UA 5FR2A 3LTEA 1JFRA 1NRWA 2NSHA 2BM0A 3HKEA 4KKXB 3E2MA 1LVHA 1ISMA 4MIEA 3QX8A 3ZU2A 3UTDA 2GCNA 3OJCA 4PR3A 5AJXA 2P9CA 4L8YA 4J7AA 1USWA 4DV1B 2EQBA 1E77A 5DBGA 3KAKA 4ZVKA 2GNAA 4QPZA 3UJAA 4FLFA 4TWBA 3UJHA 3EVFA 1XVIA 4FMPA 4F5WA 2JLUA 1PI3A 1SRRA 4JBWA 4Z4EA 1H2HA 4BNKA 1L9KA 3GZJA 1DG9A 1UBSB 4BZQA 3KZXA 4BMYA 5JT1A 1AH2A 2ZSUA 2RK6A 5CAEB 3K30A 1W5EA 1CQJB 5CVUA 4A8JB 2JANA 4A1FA 2XMQA 4Y2XA 1FSPA 1HPLA 1IEVA 1IFXA 2HIMA 3O95A 5JAMA 3H97A 1AGNA 2J48A 3KBBA 4NNOA 3UOGA 5IF3A 5JANA 1NBMA 4D9IA 4NXNB 4FYXA 4IWYA 4Z0PA 1OTHA 4OUKX 5MGNA 1JIVA 2J45A 5ILQA 3UC9A 1KI1A 3FE2A 5I7SA 1XTTA 1RQPA 2OK8A 1L7QA 5EMHA 5ICCA 5DO9A 4JQZA 4HAZA 4C01A 4JV5B 3OIDA 1GPNA 3QKIA 1UXJA 2EC5A 2CFTA 3KKEA 4XJSA 1CFJA 1J39A 4RA6A 2X1LA 2UYCA 1TK3A 4KEAA 1QX3A 3V32A 2CV2A 1NPYA 4WRRA 2DUUA 1VYHA 3R7SA 3VV2A 4OX9Y 1XMIA 2ID8A 3NBYC 3E2PA 2PBZA 3CRQA 3ISTA 2P5TB 3PUZA 4MWBA 5H9VA 5C0OE 3R3SA 2JFYA 4KE9A 4FEAA 5EZQA 2ONJA 1R0KA 1JHMA 4H08A 4UKDA 2FX3A 1HNZB 1ND6A 1ZD9A 3MQFA 5EMNA 3RC2A 3IMGA 4DWWA 1ADGA 2VYFA 2V3VA 1NDQA 1R6VA 3C6BA 1DXHA 1II9A 3OEYA 4HT3B 4JP8A 4TYWA 4M36A 4LF9B 1PX0A 3G8YA 2PU7A 4KLCA 1ENYA 5H5JA 3R0VA 4HGPA 4YUZA 3AEKB 2C7GA 2IYSA 3NKLA 1W9HA 3D6HA 5ED0A 1OMOA 2NU8A 3HXOA 4IQ4A 1ZA2A 2O0LA 1DBQA 1OBCA 4GP6A 2QLLA 4L9SA 1LC0A 3IGFA 4XUEA 7AT1A 4CKWA 5K6RA 3HUFA 1W46A 1Y42X 3DFZA 1QMPA 1QYRA 1U2DA 3AM5A 3UB3A 2NPOA 2NNLD 2XWSA 3C14C 3HHEA 4RUKA 1CY8A 5CA0A 3X44A 2OFWA 4L6CA 1MDFA 4FC6A 4J0CA 4Y2PA 1NKSA 3UOAB 4LYAA 3BK1A 2GD0A 3WA7A 2EDAA 4QECA 1EDBA 1PIWA 2QTTA 1G1AA 1XLVA 1XT6A 2HU2A 2O1EA 3LK7A 1YRWA 3IKJA 4E30A 1R8XA 4ZYWA 1JDZA 2NAFA 4DNXA 4U5QA 1DG1G 1OREA 3HJNA 1WMEA 1I2AA 3KQPA 1SKAA 4ID3A 2FPPA 4O4HF 1FF9A 2GXQA 1WPRA 1MAUA 3E5MA 4AD8A 4ARBA 5DTRA 4AP6A 1S3SA 1WTCA 3EIQA 3PX3A 4WADA 5LVAA 2G4VA 2WSLA 3CQ9A 4KGVA 3TGPA 2W90A 2YV4A 1QO7A 3A6PC 2QVZX 1Y7PA 4NSNA 3N75A 1A4XA 4PPFA 4CE6A 4CYMA 5G0WA 1XV5A 1QHSA 1CUIA 2J0UA 3D9QX 1QB8A 4XB2A 3IE2A 5CGQB 1JLHA 4PLVA 2XB6A 5K0EA 3K6JA 4ZT7A 1RAEA 1XCJA 2UYOA 2RE8A 1D8AA 3B2QA 3AESB 1Y4ZA 3PLNA 3V1LA 4PLZA 2ENWA 4IG4A 1TKAA 2XVXA 3G0BA 1LB1B 3EY4A 3QWAA 4DG5A 3FY4A 2GM4A 4RLSA 1ZISA 1TVCA 2B37A 4XD7A 4XX0A 3U26A 5CD9A 1CQPA 3CLTD 2FW6A 3RFUA 3NJ4A 3R5SA 4GIBA 2R62A 2YIDA 1UC4B 3CGWA 5F76A 5LZ9A 4DV6B 4OYLA 1BXKA 2PT7A 4GYYA 3HM9A 2Z3VA 1QKKA 4U02A 3COWA 4LK3A 3HEBA 2J85A 1G3IA 3M6LA 1XAIA 3EC1A 3EOAI 3L7LA 2BAGA 2BV3A 3FJYA 1CQZA 1EJ6A 4ZVSA 1I7QB 2JBAA 1YIDA 5CB0A 1VLQA 2CN1A 1KJ8A 4QYIA 2EIXA 1DBSA 2ODNA 4LYFA 1YFJA 3DKPA 3MCWA 3OPNA 1APBA 3EIEA 2WMOB 5IAAA 4XGNA 3EMVA 4Z7NB 2BWJA 4BLQA 4QL3A 3EMKA 3PRKE 2NADA 1GPWB 1DXQA 1HKHA 1K7FB 4CLOB 4C4SA 4GLOA 1LDGA 1V43A 3CKYA 3OZSA 3WJ2A 2OCPA 1V35A 4QDJA 2PWBA 3KQKA 3C7AA 1CZNA 3OMXA 1AV6A 4UAVA 4HG2A 2D7CA 5J63A 3HJAA 2H2IA 3AFOA 3PL1A 3GJ4A 4TTRA 1Y37A 3RBVA 4ZEMA 3AVPA 3OZEA 3ITEA 3NAGA 1HTWA 2UZ1B 3CF2A 4MUMA 2C5GA 4GZ5A 3BXHA 4L57A 4YN3A 2AJ8A 1N7JA 1QYDA 3CLUD 3MILA 4HBZA 1CY4A 4NS4A 2WLTA 4CWAA 1ZJJA 3IERA 4C89A 1T9GR 1TU0A 5DI3B 4YRGA 1GYRA 2IEYA 4QJ4A 2AX4A 1QXSA 2UUBB 3M9XA 1GDDA 5LWQA 3LHFA 5K0LA 3T52A 1U1GA 1Z16A 4HMOA 1XA0A 3I2FA 4Z9XA 3UWMA 2XV1A 4FHDA 3NW9A 1L7MA 3STHA 1B93A 1FTGA 1TVMA 3EXG1 3VH1A 2ZRBA 3C74A 1E3TA 5FCDA 4R6XA 3SXUB 4ZMBA 1FJXA 1X80A 4NCBA 4R2XA 3S7ZA 4WXEA 1WZEA 3ZUPA 4V0SA 1DCFA 4FILA 1OV6A 1BFKA 1XA3A 2VWGA 3LF2A 1LF5A 5AI5A 1PZNA 3JR3A 2YJNA 2YRFA 1KH1A 1U8UA 3ZVNA 4Q7MB 4H1HA 5B4UA 2EFHB 4MA4A 3S5UA 2HRBA 1W4ZA 1CIPA 2ASVA 2ZDGA 3HI6A 3MOGA 3UW1A 2C7OA 1J70A 4RHCA 3H1BA 2IZ5A 2EHJA 3OCJA 1U0LA 2QK4A 3V7NA 3G9UA 2II6A 2AT1A 3RYHB 3WMEA 1IYZA 3T9EA 2JLRA 5BNWA 1N92A 4FFRA 4LCJA 2W2PA 1OW3B 2WTAA 2ADMA 4RIGA 2YBEA 2VJYA 1T1SA 1THTA 4R3WA 3GRAA 2CXSA 1F51E 4A0GA 5L7WA 1A4RA 3A06A 1REQB 6CHYA 5HQTA 4BLTA 1DCMA 1XWIA 4BKOA 1C4KA 1I6WA 4GGMX 1UT5A 4JBHA 3LUFA 1HDIA 4A0RA 2WD9A 3M6IA 1IG3A 4H7EA 1GT6A 1U0OC 4QLBA 2J4CA 2O14A 1BW9A 4GNRA 3P9XA 4INJA 3AR5A 3QQ5A 4M0FA 1ETUA 5AM2A 1NXTA 1P1IA 4LYEA 3E35A 3MRVA 5DH9A 2AEEA 1QUFA 5HM8A 1A5ZA 2QLJA 2O6HA 2ZZNA 4GRIA 2PSJA 2WF6A 2PMBA 4HGNA 3HHPA 2I66A 3QKWA 4ZVVA 5CM2Z 4ZU6X 4CKCB 2QRPA 3CVXA 1Q7EA 1FFWA 1M0SA 2V7BA 4N39A 3IKMB 4U3JB 5MN5A 1W44A 2P30A 5FAKA 3RU7A 2LW7A 3ANXA 1CCWA 1G8MA 3HVRA 3LWZA 4MGYR 2H6EA 2P0EA 1VOTA 1CUGA 5BY2A 4OOFA 1A9QA 1Q91A 1ZLYA 4XWWA 2PGLA 3Q2IA 2H65A 4DMKA 2OBFA 4DVJA 4JUFA 1LK0A 4N7BA 3H7AA 1J42A 2RAVA 4NXMB 3UWPA 2L17A 2QRUA 3DDZX 3A6DA 3OJFA 1XF9A 3S27A 2FUCA 2OBBA 3DE2X 3IMCA 1RC8A 2PANA 3IQEA 4IY1A 4Z9AA 4Z4FA 2GUGA 5DB4A 3TM4A 4AZWA 4JT2A 1DKNA 3F3KA 5HJ5A 1G8FA 2EKQA 1T13A 1Z9BA 3EVZA 2HO5A 5MFPA 2HWYA 3IDAA 1V8ZA 5FLKA 3BRQA 1QV9A 3FAKA 2WHPB 3G6KA 4LF5B 3FCOA 3HN6A 3FNBA 4ZEWA 2H9IA 5DM60 1Y1RA 1JA1A 4KB5A 1URPA 2VDLB 4N47A 1ZD5A 4YMLA 4LI3X 4BAZA 3FRIA 5E38A 2CZQA 2PT9A 2OXFA 4J0GA 5C2JB 2P78A 3B7GA 3RNOA 5JNUA 4KPEC 4KR7A 2WPDD 1NW8A 2EEZA 2W2OA 3BZUA 3C15C 4JBLA 4JQYA 3RANA 2HU7A 2SBTA 5HZGA 3JALA 1Y5NA 2OV1A 4DABA 1GYQA 3TOXA 1M8PA 3DCJA 3PHIA 1C7RA 4OFWA 4JYZA 2Z09A 1TVKB 3ZOZA 1OZGA 2OQIA 4AJ4A 3DDCA 1CZLA 1GZ6A 4I1VA 5KTKA 1U0TA 2FDRA 3MJEA 1E1RA 3O5AA 5K0FA 1F4PA 5CDFA 5C7IO 2JFXA 3R23A 2M6SA 3WISA 4AFNA 3EUFA 3ZLUA 2D4AA 2YJ4A 4BS9A 2RGBA 3AG5A 3KTDA 4AZTA 5JNRA 4KSYA 4KUHA 2GZ2A 2JIBA 4AULA 3Q1KA 4NF2A 4BVEA 3D2AA 1YZTA 1PSZA 2ISQA 4ZQGA 3GLFB 5ESDA 3WIUA 1CEXA 1A72A 1H0KA 3GT7A 3EIHA 4O2LA 5EWMB 5KYVA 4ND8A 3EPLA 1JI3A 4G8CA 1I1QB 5CLLA 5FADA 3NALA 1OFUA 1ZGGA 3B53X 3PRHA 2WEKA 5A7HA 4RWEA 2PZLA 4YJ3A 3ZWWA 1I0ZA 3ZWAA 1W36C 1G7RA 2A5DA 2NT4A 3A4IA 4J4TA 3U1TA 3WB9A 2ZU6A 4BKUA 1Y3IA 5AUOB 3RC8A 3AYXB 3OE5A 4INOA 1FYXA 2QP3A 3T5DA 1R5NA 4JI1B 1MDBA 2R48A 3OIGA 2B34A 1XRLA 3TE6A 1GZVA 4P3OA 3TLYA 1LBSA 1RWBA 2XYRA 4FJ1A 2N1MA 3AKYA 4G81A 4HAWA 3RRFA 1NW5A 2QTBA 2RBEA 4JYBA 4RDHA 2A57A 3A6KA 4RIIA 5CNMA 1TZJA 3UMRA 1GUYA 3VPSA 2GDZA 1MC4A 1YHNA 3RVMA 2AQIA 4QXAA 4XJVA 2DPXA 4R9UC 2NTEA 5DBIA 2PS1A 3NHLA 2W2KB 1EZ1A 4A5OA 4D8TA 2HA6A 2IHTA 3R41A 3S8MA 3ZJTA 2DC1A 4U7HA 3FVTA 5EMKA 1TF7A 2C31A 5K3FA 2KW5A 4F71A 1WXDA 5AW4A 3BRCA 2PCJA 3B5EA 1D03A 2WUVA 3LP6A 3IHLA 3MK31 3JQDA 3R7BA 4A8TA 4Z7OB 2V6FA 3F1KA 2I99A 3R3YA 5IZCA 3EZNA 3H4MA 3O8OA 1GTVA 1UJNA 5AKLA 3IAM6 4PGMA 5ECYA 5LDHA 5KVVA 1W25A 5THXA 2AOVA 5AKKA 1QTNA 3EFHA 3DMGA 1D4ZA 1EFCA 4B3CA 6Q21A 2IUYA 2BONA 4DCMA 3RF7A 4LMRA 4QBIA 2P0YA 3AY0A 3DVRX 2B9VA 2H1OA 1UK7A 1KSJA 3GVXA 4CL3A 5D7BA 1XZGA 3N58A 2OC9A 3EG9B 4CKCA 2NOAA 3NNSA 4N3NA 4ARVA 4BKQA 2IY7A 3E6AA 3KQHA 4J91A 4FI3C 1MZVA 4XQEA 1YB5A 4IWXA 3I3OA 1M72A 3RC1A 1LRLA 5E6RA 2PWPA 4W8HA 1PFWA 1TA9A 1NAIA 3B5IA 3HADA 1NURA 4B7XA 2CY0A 4A16A 3D43A 3QU5A 2E89A 3D5TA 4RL4A 4HGYA 4C05A 3H9CA 3FZQA 3QV1A 2R4QA 4QM7A 3T5PA 3KB2A 2OL4A 3AJ8A 3MD9A 1UFOA 3DE6X 3FPBA 2R6R1 2FQWA 5U1PA 3LAWA 2C97A 1Y33E 2HSDA 3EE6A 1EVYA 1PLLA 2XBMA 5K7SA 1EM6A 3G13A 2QSUA 1SXQA 2G36A 5LXTF 2D1FA 4D4IA 3H16A 3T95A 4ND4A 3ZYZA 1R0CA 4IJ6A 4G09A 5AHOA 4B3XA 3HXTA 3IUYA 4XYBA 2WB4A 1B26A 4PQYA 1PU2A 2RMKA 5H70A 1Z56C 3W2HA 1T24A 1U90A 1T5SA 3KTAB 4CEIA 1M2FA 1YQUA 5DTJA 4YHHB 1DC4A 2FPRA 3OECA 1JMVA 1ADBA 4ACBA 3I1JA 3QJYA 3X2SA 4BGVA 1KY2A 3G9TA 1GTG1 4KCGA 2R2AA 4ER3A 2FZ5A 5CXXA 2BGJA 4BNTA 4FNOA 1LNZA 3K9HA 3BQ9A 4LNAA 5EVJA 5KNCA 4BTVA 2DT8A 1UWCA 1L8AA 3B82A 1ZRNA 2IYYA 3W5DA 4RCZA 2Z08A 1UKEA 1IUPA 4EI7A 3OH8A 3KT8A 3TSZA 5JZVA 1JG6A 2PMDA 4BO1A 1JPJA 3RUEA 4IPTA 4XYGA 3VU1A 4ZRNA 1EK6A 2D1QA 3E61A 2EJTA 5LP1A 3W2EA 4FQ8A 3CLTC 4UNRA 5JH7F 1FFXA 1M74A 5E4TA 3KR0A 5D1HA 3RTCA 4PFSA 2B0CA 4TOIA 3DBHA 3H87A 4ILKA 1KFJB 3G2JA 4ALKA 4EZBA 2ZJYA 2EAUA 3VU9B 3JAKB 1V5EA 2UZ3A 4C04A 4W9RA 4NENA 4QTUB 4YJ3B 2I2DA 1CYEA 3GOHA 2ZCUA 3ZE0B 4GMGA 3N39C 3VKWA 1BHQ1 1T1GA 1W7AA 3U3OA 3T9CA 1CV2A 2XVZA 5JD4A 1FP1D 2CZCA 2JJQA 3NDPA 4DM3A 1XX6A 2C2BA 1AZWA 3DTTA 2O2ZA 2A1TR 3GLQA 4C43A 3W7AA 3KRTA 1AQNA 5AFSA 4CIXA 4WXPA 2H0RA 1J33A 2Q6OA 4QEDA 2R751 3NEJA 5REQA 4MV0A 4H18A 2F3SA 4EG6A 4R9NA 2FR8A 4BC1A 1IHXA 4MQLA 4L9RA 4K40A 1TOAA 3QYJA 4ABTA 4GOOD 1H4SA 4GPTA 3H1EA 2F7SA 2ESRA 4OMFG 5F4ZA 3E82A 1X74A 1U0FA 3TM5A 2I65A 3K94A 3P2KA 3LQQA 1EFTA 4WZAE 4OBBA 2ZJ1A 1HDRA 2L2QA 1Y5LA 2DH6A 2VHEA 4N6OA 4Y67A 2HMTA 1H9CA 1U5AA 3MCZA 1X1QA 4K6KA 4PXYA 1RQ7A 4URUR 4FYHA 4HXYA 4X8OA 2BCJQ 1ORWA 1JJ7A 2WSIA 2C94A 2F2TA 1FDSA 3OUTA 2C59A 4ZYXA 2GPTA 1FSFA 3KK0A 4YRRA 2L82A 4MWDA 2EV9A 1X0VA 2Q9CA 1E1QA 3WWYA 5KTPA 4M99A 4K9PA 3V8PA 1C1HA 4MWTA 1DX6A 4CMEA 4TMWA 4R4JA 3LP8A 3D3WB 4RTNA 4D02A 1FCJA 1WRBA 3LA6A 1Y6JA 1RI3A 1C9KA 5AVUA 1VJCA 4ZEVA 5IN5A 2VQEB 4RTKA 4JT9A 1MQ9A 2GJAA 5EAIA 3HDQA 4QDTA 4X94A 4COOA 5DHQA 1QPBA 1CIJA 4ZYVA 4BEBA 4B3FX 4JT8A 5I01A 1ODTC 1T2VA 2BI8A 2OLJA 1CUJA 2QRLA 4FFLA 4OQXA 3ICEA 4EMSA 1OI3A 3BF8A 5BMVF 1H3EA 3MMZA 1VXOA 2VDKB 1J90A 3PGLA 5DEOA 2F1RA 2VCYA 5KNDA 5KYYA 1M5RA 3KZVA 1E7SA 2V45A 4EGQA 2V55B 2GGSA 2J3DA 2YV1A 2ZIAA 3QW4B 4OD0A 3NFYA 4CG1A 5IKMA 4YJDA 1P5ZB 1W1UA 2DSNA 5HRAA 4D26A 3MCUA 2NU9A 2MOKA 4J4HA 3QF7A 5JDIC 3V55A 2FPGA 4GVPA 1QU3A 5ABPA 2OBLA 1QKJA 2YW2A 4XCXA 4XASA 5FQNA 4YAUA 2I87A 5F64A 2EP7A 1ZMBA 4FZVA 2X0DA 2WMDA 3WV5A 4DIOA 4WH0A 1DDGA 3D3QA 3AFMA 5EXDA 5DP1A 4ZKEA 1N5LA 3BDVA 2H1VA 5KKAA 4B32A 4PG4A 2WQZA 5CGZA 1NBWB 1RTKA 3GAAA 4BP1A 3EK2A 4PVDA 3AEQA 3ROKA 4YCMA 3SM3A 2VSFA 3EQ8A 1QNLA 2OV6A 2P7HA 4URXR 4C2AA 1N1EA 1NDUA 2JLBA 3G5UA 4JGBA 3QX3A 1L3BA 3QI2A 2HRZA 1PUXA 1F20A 1Y3AA 4H1TA 4D82A 2NNWB 4R8KA 5EHGA 1IOLA 4GMXA 1F7VA 1QTQA 3I9JA 3K8OE 5J23A 3EGDB 4FFPA 4RVNA 3TJZA 3U60B 1C7IA 3HB5X 2AFIA 3L7MA 2CWDA 3PT9A 1O97C 1UWVA 5BWCA 4NJMA 2HJWA 1FTSA 4JU8A 5CFOA 1OKKA 1WKBA 9MHTA 3R5FA 5TMPA 3HVUA 2IV7A 2FHPA 1N9GA 2F4NA 2QTHA 5C1OA 1LXCA 5KAMA 3PQ3A 3NHBA 4DL9A 2EJUA 3CX4A 4UUMA 4IO0A 4BJ5A 1S7GA 5EPUA 3AY3A 3G0GA 4KE8A 3IDQA 1DAOA 2H0AA 4GS5A 1MW9X 2PHZA 3K20A 4QDZA 4Y2YA 4J07A 5DN6A 4KR2A 3VUEA 3E3LA 2JJYA 4GE3A 1G60A 1WKVA 3D6NB 3DCYA 3Q3VA 2PBFA 4GWKA 4H3VA 4LF7B 3PQCA 1C7JA 1NX9A 2O2JA 3CX3A 4JXKA 1B4DA 4F2WA 3KJQA 1YB7A 1OR8A 1ZK1A 1OZ0A 2Z9CA 3TZCA 3NVKI 4N0MA 1SRQA 2E4WA 2GCPA 2X22A 4KR9A 2CMGA 1EPUA 1KJ9A 4IHJF 4WTOA 4BDTA 4TKVA 5AKJA 5KJCA 4RE5A 1SG0A 1Z36A 3RLFA 3R4VA 3PUVA 2ODAA 4PAWA 2Q4TA 5DBFA 2ZREA 1S6YA 3AZOA 3TI9A 2GKSA 2W11A 3DL0A 3ZIAA 5JS7A 3OQHA 3T38A 4MWGA 1KGSA 2AG1A 1H4VB 1NXSA 1TPZA 2AZDA 2HBYA 2ZG6A 4UPVA 2Q28A 3S0JA 1I80A 1T5BA 1L1QA 2NXEA 4B4UA 5F12A 4CF5A 4RMNA 1A5SB 2QKYA 2OV4A 4RZXA 2W6CX 1T10A 2O2IA 2VLBA 1RADA 4RM2A 4IDAA 3RVOA 3GB9A 3QA9A 1KOLA 3T9DA 3I9OA 1C3EA 5BUCA 1YDMA 1JR3A 1WDWB 3JSXA 3GVPA 2GM3A 5GV7A 3OOYA 4LYGA 4YXFA 4KW7A 4L95C 4WZZA 3H6HA 2CHEA 1LV7A 4QBFA 3L3BA 4BO6A 4DLWA 5FOQA 4QFCA 1C8BA 5DSTA 3CTPA 3M1IA 5BPFA 5TT0A 5DMHA 2F1HA 5G2OA 3ZCTA 1G6KA 1LWOA 1J2YA 4LWQA 4TL6A 4KUEA 1ICIA 1YA4A 3L02A 2H4FA 2B1RA 5J9FA 4QJ5A 1C9DB 2AG0A 3BERA 4XLTA 2QBYA 1K6XA 5D86A 1XK7A 3A3OA 1S2GA 1NJ5A 5EMLA 5A1JA 4KO1S 5AKEA 1UOPA 3GFBA 2GBFA 2YBDA 1J20A 2I7CA 3KO8A 3L0OA 2HQ1A 1DAIA 3WAKA 1POWA 3DBVO 1H8EA 4LJKA 1DC3A 3ORYA 3OLWA 1KO1A 4JBXA 4K8RB 5ALPA 4MR8A 3SSNA 1MX1A 3FLMA 2Q8QA 5JO0A 1A8IA 4EW1A 2OV2A 1AQUA 1B15A 1VCHA 4RIHA 4ITRC 4BMOB 4EGJA 7REQB 4LIPD 5HZMA 2C78A 4WK4B 3W0LB 4MYRA 2XF8A 4D98A 1YNSA 2JGRA 1D6NA 1UXHA 4Y3UA 1E4VA 3QPUA 1TTHA 2FSHA 2Y0CA 3HSSA 1GQQA 1J56A 1QCYA 3AO0B 3HU3A 3ICCA 3PUWA 4HFJA 4N5NA 3PIIA 4ZO6A 3LBAA 3LU1A 4D46A 2AG5A 2DPGA 3EXHB 1XO1A 1J7KA 1HG0A 4YI3A 1EGVB 2X6QA 4AJKA 2C4TA 2I4LA 5FWDA 3RC9A 1JEDA 2G0AA 4QPPA 5AW6A 3HGQA 5KOIA 2RC6A 4HVLA 3MBIA 3WLEA 2HF2A 1V47A 3BIJA 3BXOA 4XIFA 4BWYA 3F2IA 5E1BA 1IK6A 3CWCA 3G7UA 2X0JA 3PIDA 4RC9A 4BHTA 1DL5A 1THZA 1XKXA 3LDAA 3K92A 3PUXA 4KSBA 5FX2A 5I9LA 1FYWA 1P9RA 2C77A 4GOXA 4W5NA 4J0JA 1NN1A 4MV7A 1WO8A 1KEWA 3KE9A 4C0LA 2NZ8A 3KOXA 4RO0A 3WKBA 3BMQA 2EVWX 1P1KA 5JR3A 1SUWA 2XB9A 2JFWA 4RQTA 4UHJA 5EUCA 4D9MA 4IIEA 5L7YA 2CBZA 3FTCA 1NNSA 5ECDA 4C7OB 4ZQHA 4BB5A 1NW6A 2BZGA 1YH3A 1CQWA 3JQAA 1RPZA 1FFYA 1NLMA 1P74A 5F77A 5CFLA 4CG2A 3I28A 2C9CA 1CC1S 1T2EA 2XADA 3GRVA 4QNRA 4WXHA 3BL8A 2WU3A 2ZTMA 3Q6MA 5DHAA 5FPTA 3LVFO 4QPNA 1CY6A 1QYCA 3MBOA 5DCUA 3KSAC 1Z8HA 3OCYA 2Y68A 2Q3FA 1Z18A 1SIWA 2XQJA 5TEVA 3AVTA 2O23A 2C2XA 3V4SA 3TQRA 2C29D 2X0RA 4DIKA 2I29A 4ENRA 5BUZA 3CHYA 4PAGA 3NTRA 1ZINA 3IDSA 3F5SA 2A0WA 1Q22A 3KQUA 1P5RA 3N8GA 3KJXA 5B1SA 3REFA 4ESEA 4EY5A 5GY7A 3W77A 1XZBA 5FFFA 1MAVA 1SVLA 2RHJA 3WBJA 4DR2B 2BSQA 3V7WA 1KVSA 2J5RA 1E9CA 4IWNA 4NH4A 2BHTA 2GZAA 2W7TA 5CK5A 2VG8A 3P2JA 4F9FA 3UMMA 2V9CA 1T1JA 3B13B 1HLGA 2ZUUA 4IDQA 3QLVC 3T5GA 1J8DA 4DILA 5DYIA 1RYFA 1YL7A 4CF3A 5ICSA 1OE0A 1M2WA 2P8SA 3T1OA 5C53B 5F3WB 4G0WA 4WNYA 4YCBA 2ZJOA 1JAZA 3AUAA 2AJLI 3I9NA 1YASA 1R9MA 3IKVA 2H5LA 5HFJA 1N6RA 3ZTYA 3ZW8A 5KTTA 1FRFS 2O2YA 2XWBF 4UM5A 4E22A 4ZO7A 1TCCA 4MGKR 2FB9A 3A2MA 3UK7A 4QVGA 3L49A 5HJ7A 3TYXA 4KXNA 3K09C 3H5TA 2IX9A 3EVTA 2BDUA 2ZJ2A 2DCMA 4INPA 4R40A 4B7ZA 4GYWA 4TS1A 2LDXA 5KPDA 1D7AA 2WWTA 4F7DA 1R0ZA 5GP1A 4WAUA 4B09A 3SNKA 2OESA 4FQ5A 4JLVA 2QR2A 3VTZA 2XUPA 3TUZC 6REQB 1LX7A 4BAUA 3LTNC 1ORTA 2WHEA 2PT6A 3ZJYA 1MMFB 1JHVA 3LT5A 2P0AA 4ZQEA 1L1FA 2FP4B 4GE0A 4X3OA 4C0SA 2OYCA 2V59A 1MF7A 1N2XA 2YHIA 4ZI2A 1YZFA 2GD2A 2QB5A 4LYYA 1Y6ZA 5J4VA 3PFCA 1KJIA 3S28A 5L3RA 5LP6A 3Q4GA 3JYOA 4B6OA 2NZXA 2SNIE 3R0XA 1LDMA 5DHFA 3OJLA 3EZLA 3UPTA 2O8FB 4M9UA 4RF2A 1RCUA 4CEJA 4KVZA 2NU7A 2C9ZA 4ESHA 3CW9A 4M1QA 2B7BA 1XNJA 3JQ7A 3JYLA 1SC9A 2V7GA 3QKUA 1G3UA 1K8XB 2EWVA 3CH4B 5H4GA 2RH4A 4B2YA 2CVHA 5DGIA 1E7MA 5B3LA 4JI0B 2O50A 1BWQA 4P80A 4LMPA 4MYCA 2X76A 3FNGA 1JWBB 5M04A 4NK4A 5E7MA 3ZZTA 3QBTA 1E3SA 4TMXA 1DAPA 3SHVA 4URHA 4RQAA 4ZVRA 3AM1A 3DZCA 4TYPA 1OBFO 4FEYA 1HDZA 3U37A 4OA8A 3FCAA 3OQNA 3P1JA 4DHWA 1RPTA 3FSRA 2X0IA 1DRVA 1XZEA 2X9GA 3O4JA 1EIWA 3GUCA 2GXUA 4PN3A 1BVRA 1WCXA 3HY3A 1A9YA 1SQ6A 3ETNA 4LHEA 1A9OA 3IAEA 3MWKA 4QQFA 2XOXA 1KZHA 1AMNA 1Z68A 1Z0DA 2NUPB 4IGEA 4XIGS 4DSOA 1MW8X 3DE1X 2B5OA 3O4VA 4OHFA 5HZHA 4YR9A 1RQNA 2VP0A 1DU4A 4S0ZA 1Q0TA 1HORA 3A28A 1AHNA 3SFZA 1EK5A 2GCEA 4UFNA 5LMUB 3BIFA 3K1JA 3VO1A 1FEZA 3HCRA 3ZU6A 3S1SA 2PX2A 3FCEA 4EPTA 2QQ0A 4QBGB 4N49A 1E64A 4U2DA 4MTLA 4G5YA 5LKRA 5EE5B 3UFXA 4UDXX 2DJ5A 4IIJA 1IN8A 2F8LA 1MCZA 4YQYA 4CCAA 3FOZA 1F2DA 2XA9A 1VGVA 3K1TA 3GELA 4MP8A 3TG2A 1GWNA 1L5RA 1X1CA 4L0DA 3LLUA 4B45A 4RM3A 4W9MC 1YKGA 2FW1A 1PJRA 3LC1O 4EARA 3RAEC 4N76A 1TRHA 2QW1A 1SIBE 1NJ8A 3OP4A 3QUCA 4CM9A 4U4AA 1AO0A 4ZTBA 2PXAA 2BW0A 4D9HA 2Q1YA 5FUWA 2QBYB 1QU2A 2OPBA 3LBIA 5EIBC 1LBTA 1NT2A 3HZHA 3ML1A 3IAXA 4BV8A 5KB3A 3KT0A 3PYLA 4TX1A 1P19A 2A92A 4I08A 2Q1UA 2WSSA 4NBRA 1DNPA 1L4BA 3S2IA 1J24A 3OHSX 2JHCA 5EJAA 4AL4A 4AT1A 1BD3A 3LIIA 4KX5A 4KNVA 4LJ8A 4TGLA 1VP3A 3AJDA 3ZHCA 3AB7A 1QV7A 5JXHA 1YI1A 3M3PA 3BWYA 3DOUA 3FYTA 3G5AA 4NMWA 1OAOA 4MA0A 3UH0A 2HU8A 3S40A 1MIOB 1ODLA 4F1WA 2DXIA 3TECE 4JVOA 1QHGA 3GQBB 2XNJA 1QGOA 4QQKA 4OQFA 2G1JA 1KFKB 4PC3A 2PGNA 3GA5A 3C41J 1Z47A 4N82A 3DE0X 4KAXA 4W1RA 3PNLA 3LUPA 3TBHA 3GK3A 3PTLA 3T3PB 2BZSA 2A5LA 1E69A 3K0FB 2JLQA 1CP2A 3P2YA 3R7DA 4IFBA 4CMCA 5KOHB 4Q9NA 1SXJA 2ACVA 3ILVA 4TT3D 3NTOA 4MV1A 3O73A 4XX1A 1VPEA 4WASA 5GV8A 3NHYA 3GIWA 3FOEC 1NBOA 3B1XA 5JMWA 4IUCS 3N76A 4YMSA 3EQ6A 1CZRA 1C30A 2I3DA 2NPFA 3U7QA 3WP0A 1UM8A 1JDSA 4M98A 5AQEA 1RRVA 2BH9A 1RT9A 5E0OA 3WLIA 3K5IA 4AJIA 4B9EA 2YC2C 3ZZ1A 3F6CA 1ULSA 3WWPA 4RKRA 3JW8A 3UN1A 3DMFA 4B6GA 1WBBA 2Y92A 1H2RS 1I0IA 2R6AA 2HDNB 3AF5A 5AKXA 3ZS8A 3FMFA 3HCDA 2CF5A 4GX2A 4R98A 1RAAA 3ZCPA 1YUNA 1M2OA 3HCOA 3ZUGA 1HKUA 4Y1EA 4E2ZA 4R5MA 4S1PA 1YJXA 3GQVA 1PNQA 3RUDA 1SXJD 1UH5A 1I4DD 4I1RA 1JIUA 1LQUA 1QK5A 3WRYA 1RCTE 2GEBA 4PICA 2XDAA 1H22A 4QFBA 3LBFA 4AB1A 1GQOA 3CXUA 4A0FA 3I73A 1VZ2A 1XYYA 2NZYA 2AZTA 1VSUA 2C1ZA 3PSHA 4KN6A 4ONEA 3DW1X 3L6EA 4AJ1A 4GNKA 5FD8A 4R3UC 2AJTA 1GOTA 3CF0A 1J5PA 5HGJA 5AUNB 2JIZA 1F2TA 5B30A 5AM4A 2FG5A 5BT9A 1QGUA 1ZP6A 2GRAA 1YWGO 1HLFA 1Q5PA 4I5FA 4NPHA 4KGXA 1VHLA 3WTBA 5C81A 2ZWIA 4F8EA 5BRNA 1WP4A 2P65A 2VSOA 1OC2A 4BNLA 3F7NA 1YK0A 4Y9UA 3JRNA 3G0DA 3GV0A 1LPSA 2R6ZA 3EEQA 4UVEA 4BRSA 4BIMA 5I7FA 2IPMA 3G6WA 2C61A 3D4PA 3ZHVA 3W5AA 1QQ6A 1F6DA 4HZUB 4C4YA 1ECJA 2ORVA 3Q8WA 3DZDA 4EW3A 2FEWB 4TKUB 2PZ8A 4F3CA 1K88A 4MRRA 1XTRA 5LBIA 4CCYB 4WBNA 4FDAA 1T0UA 4JLKA 2FP4A 4DSTA 1H0RA 3LP5A 4MB2A 3IKLA 2VHCA 1YFZA 5JZMA 3MWYW 3VAAA 4U7PB 3ZZUA 1XMQB 2JI7A 5H82A 3TUIC 4DANA 1L8XA 1U1CA 4PX3A 2P3OA 4PAMA 3A14A 3BMOB 3CZCA 2IHKA 3O4GA 4Q37A 1VLLA 3N8KA 1N33B 1XELA 1KJWA 1ESCA 4P33A 2HC9A 1NR1A 2MR5A 2PEYA 4MEBA 1H0HA 4UASA 5DGCA 3RCBA 4QGBA 4BZPA 1INLA 2QV0A 4FPXA 1IBKB 4J8PA 3NP7A 1RKXA 3IURA 3B9PA 1T4DA 1SUBA 4ZHQA 2RHHA 2ORYA 1KYTA 3WK8A 2P9FA 1E2QA 2QN6A 3QFRA 1T2FA 4MYDA 3S5JA 4HVCA 4OLJA 4LBWA 1EVZA 4Q4CA 2IV2X 1XXHB 3OWOA 1WUIS 4CV3A 4KFTA 3L7KA 4E1VA 3BUSA 4I8XA 3M7IA 4ZICA 2O7RA 3JQ7B 2ZAGA 3SNHA 3TTTA 1W6RA 1K5DA 3IP9A 4OAPA 3K70D 1G8PA 1QP8A 1BGVA 2OA0A 2CXTA 5JSUA 5GZ3A 1PYGA 1FU4A 3OQJA 2GZDA 1W0JD 5KWIA 2WYOA 4BNVA 3E9YA 1JDTA 4ZTUB 4WCDA 1A9PA 5FTMA 2RFLA 3Q7TA 3HDVA 3LZ6A 5HEKA 4LQCA 1OZAA 4S0XA 5HJ2A 4PLHA 4QVKA 4IX1A 1LPBB 3I0MA 1U04A 1UEXC 4WK0B 2CE2X 4RTOA 4KFRA 1HYQA 4B0PA 3AILA 3L1HA 3BRSA 1DV1A 2ZR0A 3K0AA 3JWIA 4EBFA 1B3BA 4JUIA 1TQ8A 4DMRA 1FB5A 5LU8A 1VSBA 4O59O 4M55A 4BY9E 3KPYA 6ABPA 1KKUA 1GNLA 3IULA 1KPHA 3WV4A 3U4QA 2P4QA 3DUFB 2QRNA 3E03A 4QYIB 3V42A 4C0XA 2I62A 2H31A 3MINA 4IJKA 4JSRA 1BTOA 4D81A 2NSJA 5JVDA 2ROQA 4EI8A 1GLNA 1X2BA 3HN2A 3LC2O 2ZRCA 3AVUA 2D7JA 2CFIA 1Z75A 3HFSA 4EJSC 5KNBD 1F2UA 4JGGA 1E89A 4CQJA 4NBUA 2V5UA 5SY4A 2GEDA 3U4AA 1AM4D 2XRYA 3GBSA 1SU7A 4OM8A 1NW3A 1J2JA 1Z0FA 4UNNA 5FOWA 4BEJA 3EPPA 3MPOA 3T1YB 1FRVA 2A9QA 3ZCXA 5A3RA 4DJAA 2XVYA 4HF7A 3KZCA 3D81A 4I3GA 5LFAA 3C45A 4KIGA 2GZ3A 2VRBA 1BW9B 2NPIA 3WGZA 3R9XB 5JISA 1O0CA 1X7HA 1KHHA 1E2LA 4WVFA 3G8CA 2EATA 3KZMA 3R9IA 3CNBA 3CZ5A 3AOGA 4HDSA 1G21E 1X9IA 1YCHA 1CJSA 2WIKA 3N2LA 5ESRA 2OYRA 1IONA 3LPCA 3QXJA 4I9GA 3TKAA 2AYXA 4CGYA 2CLDX 3WZ2A 2KBEA 1OBVA 4AJJA 2RIRA 4ZZ3A 5ALVA 1TUIA 4KQFA 2GWRA 3CZ9A 3KL4A 3NIBA 3UKDA 2BFPA 1IEWA 1J8YF 4XWYA 2VRCD 2JIRA 4TRMA 1GYPA 1A9XB 1FPMA 3EG9A 2MWMA 3WBFA 1FMLA 1A9RA 3ONVA 4IMIB 1ZOSA 3T3MB 4N5IX 2W6ID 1NLZA 2B3DA 4MINA 4AMUA 3F78A 1C2YA 4HQRA 4BNMA 4F96A 4Z49A 1LW6E 4X84A 5IVPA 1MC5A 5KQMA 4BYGA 2ZJ7A 3GJTA 4PU0A 4G07A 1VIVA 1A2BA 4V1CA 1E2JA 1UKZA 3LL4A 4AXBA 2ACEA 2ZBUA 2PWAA 3ZU4A 4X66B 3JQPA 2LD4A 4OKIA 4W5OA 1KMCA 1M8KA 1Z38A 3OZGA 2PZFA 2Y05A 5K99A 1FC0A 4OHOA 3T0GA 1SUPA 3WFZA 4OU5A 1UXOA 1UAGA 4PBRA 2PUJA 1EEHA 5BWNA 2ANCA 5DM1A 4CUJA 3I04M 4OMDA 1TUBB 3QNMA 1UMBA 4F2PA 1P62B 4TTIA 4MR9B 5G53C 3FPLA 1U0SY 1JFLA 1NQXA 2RGAA 3W34A 1YMUA 4B8WA 4FB4A 1PNVA 4V03A 1MVLA 3DJFA 1D4OA 1IQRA 1ZEJA 2RJOA 2YMPA 1L5KA 3RG2A 1C8VB 3K9LA 3U7HB 1ZKDA 4QT0A 3VR4H 5F2NA 2B7CA 1ZUNA 1YOVA 2FQQA 4IEFB 5CIWA 2FV8A 1ZITA 1OWMA 2AK2A 2EFYA 3OPXA 3BWXA 4TN5A 5AW9A 5KQRA 2G6BA 1DE0A 3OM1A 1GCOA 1T5LA 4ENWA 1DBVO 1SQ5A 1SXPA 4KWEA 1MHTA 1K66A 1KVTA 1I6MA 2CSUA 4OB8A 3KPWA 1QRUA 1MTOA 1SKQA 5PNTA 4J2TA 2PX3A 4I7EA 3VYUB 1EUZA 3COJA 1ENPA 4FYIA 1C8LA 3KEFA 2ZYHA 4I6JA 4EEXA 5JEEA 5KX5F 5ALEA 3H2IA 5I7RA 1K5HA 1JG2A 1UADA 4OBXA 3T7AA 1ZQ9A 4KWCA 4BV3A 1KIMA 4QYTA 2X23A 1TA4A 3M82A 7ABPA 3QELB 3SJBA 3B1JA 1RJDA 4JLAA 4RHTA 3W7VA 4ENPA 1RQXA 2UUPA 2WJ4A 4HK4A 3I3SR 2IYQA 3C6ZA 5DXFA 1HUQA 3FHCB 3T54A 1UBHS 4AZ0B 4UOEA 4UUAA 2GTHA 1BHSA 2AR9A 4AO6A 5MN4A 1RW4A 1RP1A 4H4DA 5BQFA 2JD0A 1QOPB 1N5KA 4CM5A 1YCGA 3I04A 3JQ8A 1P8AA 4H31A 5B57C 4M89A 2OG2A 3QPCA 3EWIA 1S2DA 3RARA 2RGXA 3C2QA 1ZN2A 2FWPA 3HC7A 1E3QA 2QRJA 1Z12A 1E32A 3IV7A 4A2QA 1XPUA 2QNIA 3EISA 1DZ3A 3QKTA 1RMQA 4MZDA 1E4EA 3K0CA 4ZOEA 1D0IA 1FU7A 1CQIA 4J3JA 5IEJA 2YTZA 3PTZA 4MKRA 2V5VA 2QE7A 3BQNB 4B40A 4BV9A 3L8CA 1XTJA 1WHSB 4PRLA 2VHVA 1QLJA 5EIEA 3H9JA 4BQSA 3TXAA 5I3CA 2DZDA 1XLTC 4CF4A 1N77A 4BP3A 1GZ4A 1KJQA 1TF2A 2Q2OA 3R3UA 1C7EA 1S96A 1EVEA 2WT9A 3UAWA 1IZYA 2JD2A 2RK4A 2ZPAA 5CA1F 1C5KA 3KUXA 4W8OA 4DLKA 4LF4B 4K86A 1H2WA 2Q0XA 1KSGA 5I7AA 1PWHA 4MMXB 2RJ3A 1N2CA 2FFRA 4GD3Q 5BSKA 2GFHA 1X15A 1P33A 2RCNA 4S1NA 2HMYB 2IA5A 3KDSE 5IYZF 2B25A 4WJKB 1A9XA 2H5EA 4US1R 1HO3A 3LC7O 4CZ2A 1VYTA 2C8LA 2B9EA 2JFQA 3GGOA 3LK6A 4LRUA 1CUSA 5IK2D 4QVIA 4PTZA 3Q3IA 3ZDEA 2F3PA 1Z15A 4QJIA 3PUYA 3GUHA 1A04A 1GSOA 2QL6A 3ADKA 3PXEA 2QW8A 4OPMA 2J3QA 1QJCA 2JASA 2XSZA 5BOVA 4MVJP 3ZE6A 2ZRKA 1WMSA 1PR9A 1HDCA 3ZGXA 1W94A 1T25A 1NG9A 3STWA 1KRXA 1ZWKA 3L01A 3TQCA 1O94C 3IBTA 3OPMA 4NZYA 1Y8ZA 1YC5A 3UW3A 1WBJB 1JQAA 2V1XA 3PJDA 2IS2A 4L1KA 2C92A 4BLPA 4UHKA 1IN1A 1JXAA 4G65A 2Z5FA 4N6GA 4FFBA 1WD5A 2VNJA 3R7WA 1ZESA 4LGCA 4XM0A 3VAZA 1MJNA 1XAHA 3C7CB 3ZC3A 5EZYB 5JYDA 2WIFA 1CUHA 4KXXA 1TKRA 3MWEB 1A2OA 3JQ6A 4NNPA 3I30X 4WN3A 4DMHA 1B8OA 5KMGA 1TIPA 4IW3B 5F7JA 1P3DA 3KFLA 3PR1A 2ZM6B 4D42A 3GZNB 2XCSB 2DECA 2Y0BA 2BFCA 4PZEA 5KHOC 2HXSA 3U4MA 3OU6A 1NRXA 2J3MA 3EVEA 4YONB 3FPSA 4Y2GA 3QE0A 4KXFB 1V5WA 3JTMA 1UEIA 4YALA 5TC4A 1BX3A 4A0SA 4OHVA 3LW7A 1JFFA 5B53A 4RACA 3WRXA 4BBJA 5EZYF 4DLTA 1B1AA 1EX6A 1UMDA 4UCXA 1W87A 2EEPA 3ISVA 3VSAA 4IKEA 2OR3A 1LI5A 4LI0A 1II0A 1LKZA 2H7YA 3GEBA 2GN0A 2CJWB 1CUZA 1LS6A 3Q0TA 2OCYC 3WP1B 1IXYA 3KOUA 1Q77A 3HDGA 5F1PA 4HNHA 1GAJA 3C97A 3AGQA 2MINA 4MRMA 3U3JA 4P0PB 1V6CA 3AJRA 1VL0A 3B51X 4GPEA 3DMRA 2FQXA 1TYAE 1GQ2A 4NU5A 4DMCA 3EDYA 5F7ZA 3DE4X 2IIBA 3V8QA 5BYAA 1KO4A 2PS3A 4J90A 1XJQA 4MLCA 4PFJA 5IJWA 3QHAA 3GDWA 4R69A 2WJPA 4E5KA 3E7WA 1V37A 1CB0A 4MIYA 2ZZMA 2XOKA 5JADA 3W4IA 3PVCA 4FCWA 1ZOOA 2JFPA 2KQUA 5EIOA 2G4CA 2ASEA 2VZEA 2OB2A 3OF3A 5FPKA 3NXSA 4CMAA 2HPHA 2JKZA 4YAOA 2WJ6A 4EZIA 5I4BA 1VE6A 4LJSA 1O94A 2WSBA 1GSAA 1SPXA 2B2CA 2FK8A 3G7NA 2Y77A 2HCJB 3RBAA 3FSGD 1WTAA 1X1SA 2P2ZA 2PLWA 3BMOA 3DMHA 2FPGB 4NJEA 4NV0A 2KS6A 1WZCA 2P2DA 1RWPA 1IHUA 3SPXA 4ZJUA 1OWLA 3NAZA 4DMLA 5JG7A 1JSLA 1ZUHA 3HJFA 3OJOA 1N5MA 3VJKA 1SC6A 2AC7A 3HP7A 1AKWA 4Q7LA 2O8NA 5CM9C 3LHIA 3A36A 3R74A 2IPOA 1GCUA 2HCRA 2A86A 2BVNA 4M0LA 3WR5A 3KDPA 1ZM9A 1MKYA 4DVGA 4E6PA 1AKTA 5AUQA 2Y4NA 5LPNA 1RZRA 2WTMA 4ATNA 1LJUA 2ZZKA 4EABA 1XXHE 4HDCA 1ZKMA 2JFNA 3I2KA 4OHXA 4Q3CA 4AURA 1CPYA 2F00A 3C3KA 2AVDA 3EODA 4O25A 5E9JA 5JFTA 1TQDA 2KLHA 4D1YA 5K8UA 4IDPA 1RU3A 4UZSA 2YQ4A 5AM0A 5A62A 3NYRA 1ZGHA 4MZXA 5JZ9A 2FETA 2HV9A 2AMJA 1R0XA 1GFIA 4WJLA 3ZLJA 2AS0A 4EF6A 2QL9A 3UG6A 3F9RA 1XKQA 5K0NA 2HCBA 1ONNA 3VU9A 1ZNQO 2J0UB 2PAAA 2WHYA 4JLJA 2G1AA 4QYSA 2I3ZA 1PUIA 1QCDA 1XVTA 4BKPA 4DLUA 4KQ6A 5KS2A 1ZUWA 3UT5A 4NG4A 4CDRA 3LZCA 4LRTB 1KQGA 2H2FA 3AESA 3D7NA 2CV0A 1TM4E 3HKDB 1NNLA 4JB3A 1GL9B 2V0NA 1ODKA 2IYUA 2IW3A 4JH0A 5G1NA 3EYWA 2PKQP 4YMVA 2VDPB 2ZJ8A 4QICA 3CS3A 2EGUA 2YFYA 2PH1A 3QKRA 1HQCA 2WWGA 2PZEA 2UV8A 5EHXA 3NC4A 4MUJA 4F06A 1KOJA 1ONOA 4R1PA 5ALGA 4C7MA 2PU5A 2IYTA 4MPJA 2J0EA 1TI7A 1U7ZA 4TT3A 2XJ4A 4M2LA 4WE3A 5H83A 4B7AA 3K70C 3EMDA 1TEZA 3TVYA 4PCVA 1UKCA 2D2XA 3E53A 3ZJ4A 2VT3A 2WZDA 3SR0A 2VF7A 3ZW9A 3Q2KA 4PZAA 1USGA 2AL7A 5SZIA 3AUJB 1PZFA 3PGXA 4FSHA 1WABA 2Z1DA 2Z3ZA 5TE9A 821PA 1Y7LA 3I6YA 3PCRB 5BORA 2VAVA 1VHDA 3AG6A 4N0EA 1DBIA 3GD5A 3QX7A 4NWIA 5AK6A 3O3NB 5ECWA 5F4BA 3K1AB 3MQ2A 4DUYB 3C85A 4M9QA 3T7DA 3HWSA 3JWGA 5GJVC 3ZQKA 2GTPA 4ZHQF 1JEEA 4AY3A 3II6X 4FWBA 5GVSA 4IKPA 1JDBB 1G64A 3EDCA 3KZNA 1MB4A 1QBKC 3CCBA 3V80A 1JSZA 2F3QA 2QJFA 4XVHA 3ZDBA 4PYQA 5JU6A 4HDSB 3M6AA 3H6KA 1V1MB 4XWOA 1XJCA 1ZA1A 2CNDA 3IPLA 3D3WA 4MO2A 4P83A 5C51B 1V95A 1YR1A 1Y6FA 3Q3HA 1WHSA 4C0WA 4XDZA 1PW7A 3EPRA 4YLEA 5EQJB 3R76A 1Q3KA 3DMTC 3GDFA 4ZJPA 1XRMA 2H2AA 1M7BA 5KC8A 1Y5MA 3F74A 3FR8A 4KIJA 2G63A 4LE1A 1ZVQA 2VA9A 3FW1A 1I01A 4DR3B 2O57A 3REQB 1M9NA 5KC9A 2COEA 4R05A 5AIAA 2R6FA 4V0ME 1PW5A 2HJVA 2XI4A 3L40A 4R0MA 4YV7A 3OG9A 4M1ZA 1YNOA 4U7WA 4F0JA 1WVIA 3IJEB 3RWMB 4MKFA 1SBCA 3UMSA 2YMLA 3ITKA 4HYYA 1Q0UA 3WHKA 4E5YA 5LUAA 1GLVA 3ICWA 4NZPA 1RJ9B 4UVGA 1W49A 2ZFUA 3WGVA 2IF0A 2OB1A 4JAVC 2NU9B 4IZ6A 4O3FA 1TADA 3FUVA 3GG9A 5ELMA 4B82A 4C3VA 4LF8B 4RA9A 3D1VA 2VWQA 3U2QA 3P52A 3A11A 1ZOPA 3BTOA 4D4GA 4JKYA 4F45A 2EDCA 2QDKA 4JUDX 4O0LA 4QDXA 4EGAA 1II8A 3Q98A 4Q34A 1SMKA 2Z83A 2N1BA 3KQSA 4CM8B 2WZQA 3I01M 4MQBA 2Q2VA 2EX0A 3W3AA 2F17A 4UEOA 2FN4A 3IR6A 4Q02A 5AQ1A 5DN9A 3Q85A 5TQ2B 2VK4A 4EYSA 2AOWA 1EDEA 4JOCA 1SOVA 1UJ5A 2QD4A 3SY8A 2J9GA 3RYHA 5BN4A 5JAZA 3E2IA 3H6GA 3NI2A 5KREA 2WAYA 2EW8A 5C1IA 3SZUA 2DGDA 2XQGA 2E4XA 4EO4A 4U2KA 5JS8A 3GLFE 2IHNA 1DX9A 1O6CA 3EFBA 4X3PA 3IXQA 1ZUNB 5AOBA 4Q3KA 1M1YE 1XL0A 2AKAB 2B98A 4IHJB 1I4OA 1UT8A 2VHWA 3JY6A 3MCVA 3U5ZB 2UYHA 1BMTA 1SELA 3AR8A 2R84A 1Z73A 5ES4B 3ZGLA 2WHQA 1T8WA 4B48A 4U7GA 5EKDA 4EKGA 1Z88A 4FT2A 1PJBA 2ALJA 2Y93A 2W6QA 1Z6YA 4MULA 1VHJA 3JPWA 1Y6RA 2QM3A 4GECA 4KAAA 1F6BA 1V11A 2O06A 3CRVA 4FFVA 2WD7B 4P53A 4D4HA 4KI7A 2BFBA 1JFTA 3MJHA 1L7OA 3MMXA 3N2GA 4GX5A 3NT2A 4MYSA 4B2IA 5FDFA 4BVGA 1GGJA 3ZK7A 1CEYA 1YCDA 4IUDS 1QK4A 3L8HA 3MTQA 2HHJA 1ZBDA 3BWCA 1E6MA 3PQ7A 1KP9A 4A03A 3QQPA 3EIOA 3CG4A 3MM4A 1IE3A 4BFYA 4EVRA 4C76A 4DR7B 4MS1A 3HJTA 2VXBA 3LMKA 3X1XA 2H3EA 3HEAA 1LRJA 5DKFA 4V0MA 2HLNA 1X70A 2FSVA 2NO5A 2YJGA 5HDBB 3ZU5A 1YZLA 3ILYA 2UYQA 3FFAA 1AY0A 3G7SA 5FH9A 3HM2A 1IZ0A 1D5WA 1K7YA 5H68A 3O8LA 2XTMA 3WIDA 5AD1A 1VJRA 1UIMA 3E9EA 1KDRA 3QWBA 3RADC 2R87A 1PZXA 1RS0A 3OPYI 3DOEA 2HOQA 3O3MB 2JVIA 1WW8A 4DR6B 4P34A 4L5BA 3IEMA 4P5DA 5C18A 3DO5A 1R18A 3O0DA 3Q11A 4L8LA 1N4DA 3E5RA 4OAQA 1Q6YA 1OAAA 1RJGA 3GEIA 4KO4S 2XZOA 1F4VA 3ZTWA 1V5FA 1J0BA 1VKJA 4GF5A 1FFHA 2X8LA 3E18A 3GEPA 1I13A 3OHPA 3SIWA 4BTLA 3I23A 2Z4SA 3LWDA 4LZZA 4J7CA 1V16B 1BYUA 1GFWA 4U6SA 5EZSA 3HB7A 2MSEB 3LUAA 3PNQA 5I7OA 4DDMA 2GVZC 2ZJZA 3KOZA 5FTWA 3ZQJA 3IE0A 4ZOLB 3KKQA 3OF5A 4C9BA 4DRYA 4LJLA 2GZ1A 1Z7EA 4V38A 1CUWA 1PJ8A 2DPLA 3IVCA 3M4YA 4CT5A 4JD5A 4D96A 5BMVB 1JFFB 4BZWA 3A0UA 4HDAA 4N5LA 4CTMA 4IKOA 4ZARA 2VDOB 3AUUA 1ULBA 4UVHA 1NNUA 4L15A 1E5VA 3SVLA 5IBCA 3FDFA 5HF6A 1V41E 2P90A 4K9SA 3ZZ0A 4O02B 1E0JA 1CEEA 4YPOA 1ADJA 5T4HA 4MW5A 1TUGA 3UMFA 1EEXB 2D6FA 3IS3A 2AQHA 3IX7A 3EHDA 4HH4A 2VBGA 4KOAA 5EWJB 5FPYA 4TWJA 1USKA 5J40A 3JQFC 3UV6A 4N65A 3X1DA 4MR7B 1HI9A 3WOHA 3EUAA 3ZCRA 4OA5A 4QM6A 3EWAA 4J0QA 5FULA 1ESZA 2H2DA 4TPKA 4B8YA 3HL0A 3IBFA 2OEPA 4PGHA 4F9EA 1KZ9A 8ADHA 5IT4A 1AQJA 8ATCA 1RQLA 4HQ6A 1NBME 1U8XX 3GP5A 3EF0A 3T4EA 5JZOA 1EFPB 1UM9B 4Q1CA 5TNXA 2E21A 4BB9A 2QX4A 4RE6A 3RI3A 3GHHA 3U31A 1D1TA 1C7ZA 1YZKA 4Z9YA 1TTQB 2PIDA 1DJOA 4FKZA 2CDNA 3HRHA 2ZYVX 1Z6AA 3IVAA 1KERA 2ILTA 3AL2A 1E96A 4N8EA 3TQSA 1TC1A 5GM2A 5L9AA 5HKKD 4ZRMA 4FGJA 4JSYA 4OHYA 2V7XA 1Z7BA 4RHXA 4UHCA 1KK1A 3RSSA 4QOGA 1FP6A 1SCKA 5CFZA 3QEJA 1JEAA 2XLCA 5A0TA 3C8UA 5F1KA 5B5SA 4GP9A 3G8AA 1H1DA 5FEMA 1N5OX 2F90A 2C96A 1Y1QA 3O7MA 2IH4A 1L4HA 4FFOA 4IOLA 4BNZA 4LY3A 2O1XA 2FMHA 1KEKA 1KWGA 3BICA 4GAEA 1ACJA 3U0VA 1HFWA 3JQAB 1O0BA 1DJPA 1O8BA 2P40A 3TW8B 3LT0A 3A6JA 1A8SA 1K8RA 3N0TA 2H57A 5BQOA 4DCNA 3F7OA 4RTSA 4L0CA 4PIVA 4C21A 4JYMA 4F60A 1PG2A 1R4AA 2HX1A 1PT7A 3NS7A 2XZDA 4KGDA 4ZVPA 4PQFA 3ICVA 1JG3A 4OQEA 1XEXA 3L6RA 2CFCA 1RBMA 2F9MA 1Q6ZA 3N8IA 1C30B 2NYRA 4JODA 1MX9A 1NBAA 3U7QB 1H23A 3L77A 5LJIA 5CW2A 2IXFA 4JLWA 1C1DA 4GUAA 2W70A 1HG1A 1G291 2VCEA 1ZQ1A 3BDIA 2NACA 2Q6KA 3DQZA 3AJAA 3WIOA 3WK9A 4AN4A 5ILGA 2A6PA 4JJGA 3V46A 4PZDA 5ER6A 3PC6A 2OKGA 5BSUA 3IOCA 3UHJA 4DT1B 4M0DA 3DNPA 1FU8A 3RQIA 2VUTA 1MRNA 3JQFA 4QU0A 1G5QA 5KUTA 3KB6A 5C8DA 2VTBB 1AN9A 3C3YA 5FNVB 3V1YA 1TIKA 4RF4A 3CVUA 1U0HC 1FFEA 4LWOA 4OK3A 1M6VA 1SIUA 1TC2A 1KJZA 2GASA 2QUKA 2ZBRA 3K5HA 3QTBA 2P1ZA 2VJOA 1JR3D 1NMQA 7REQA 3WGLA 4GXQA 5KTSA 3NAQA 2NM0A 1RM0A 4B6JA 1BDHA 3MUFA 3QKSA 5KHLB 3H9BA 1R4MB 3D59A 1OFTA 4IV5A 4JXXA 1K0UA 1F2TB 1QQ5A 2O2DA 4MCIA 4YMWA 1OGIA 2QXUA 4FBMA 5ENDA 1SVIA 1NTRA 1Q1AA 1P2DA 3C6YA 5FBLB 4HLNA 4WMLA 3ZIAD 3VHQA 1ZD4A 4C6HA 1OYOA 2WTEA 3PQEA 3TK1A 2Y1DA 3IUQA 5KNDH 4OQNA 4JENA 4H4CA 3I5MA 5GAJA 3GEDA 3KNZA 2CVQA 3KR2A 4YBZA 1OLUA 4EYEA 4D0SA 1F60A 1A7KA 1K1EA 4FINA 2YFHA 4HDKA 3SP1A 3U9LA 3T3GA 1SKMA 1IJBA 4QUBA 1QF6A 3I58A 3RVQA 4A2CA 2PGDA 4JYAB 2RGCA 4Q48A 3KQOA 1UBKS 3LBNA 1KY3A 3OOJA 1R74A 2O07A 4M0UA 4Z99A 1M67A 4V3BA 4IHJA 1HMPA 1R3DA 1AKNA 3BJZA 1DAFA 2I2CA 1WCIA 5CDFE 1PTJA 3RU3A 2WKRA 3AM3A 2XYGA 4IXTA