2DUMA

Crystal structure of hypothetical protein, ph0823
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
143
Chain Sequence
b'MFRKVLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMELKDIKEKLKEEASRKLQEKAEEVKRAFRAKNVRTIIRFGIPWDEIVKVAEEENVSLIILPSRGKLSHEFLGSTVMRVLRKTKKPVLIIKEVDEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0823
publication title Crystal structure of hypothetical protein, PH0823
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 41
structure length 143
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dumA00
3F3MA 4GU5A 3IOCA 1IQRA 2PZ8A 4H3SA 1ZUNA 4ND6A 4KR9A 1V8FA 1N2JA 3ZGZA 3I05A 4RUKA 1ZH6A 1S4MA 1XNHA 1MBZA 5DEOA 3KT0A 3ND6A 1ZH0A 1GTRA 3UY4A 1X8XA 4PBTA 1M83A 2DPLA 3AKZA 1TYAE 3ELBA 3CVVA 2D5BA 3CR8A 3X1KA 3ZJTA 3IMEA 1JECA 3FH0A 1OWLA 4MWBA 5J5AA 1SURA 3CLSD 2Z3VA 3M5WA 2EL7A 3K32A 4R0NA 1WKBA 3JXEA 1I2DA 3FY4A 4E1AA 1G8FA 1WXGA 4JYZA 1N78A 4KR6A 4UZFA 1NUSA 4OUDA 1F7UA 4WNYA 1EXDA 2E18A 4DJAA 4ZT4A 1F9AA 1U7XA 1PFYA 2R5WA 3FIUA 1QU3A 1YULA 3OP1A 3H97A 2EJCA 2A4MA 1N2IA 1OWOA 4EG8A 5H16A 3IMGA 3INNA 2RE8A 1JILA 1LI7A 3S3TA 2J07A 2PFSA 4RPIA 2HGZA 4MUIA 1TFUA 2X0KA 1EFPA 1M8PA 2IP1A 2Z09A 4K03A 1TYBE 5H7XA 1O97D 1OBHA 1JZSA 2A88A 1LW7A 1Q15A 3HFJA 4MLPA 3UK2A 4MUJA 3IOEA 3CLSC 2WB2A 4JZYA 4HJRA 4MUFA 2NSYA 3N05A 2XRYA 3DV2A 4U63A 3P0JA 1JEDA 1QRUA 1XJQA 1OWMA 3OTWA 2G36A 4ZCQA 3SP1A 2C5SA 2DXIA 1N2GA 1I6MA 1KR2A 3P52A 1FYDA 1KORA 3CLTC 3KT6A 3FHJA 5TGTA 1EUQA 3MXTA 4MW9A 3SDBA 1YUMA 3RJZA 1NSYA 1WXHA 2JA2A 5IHXA 4MW0A 3KFLA 5DK4A 1M8FA 2X1LA 2H2AA 3TZEA 1O0CA 1T9GR 1U0BB 1HYBA 3KT8A 2A7XA 3CA8A 1F4LA 1KKUA 1KAMA 3ND7A 1R6TA 5TEWA 1J20A 3PXUA 1H1TA 1K92A 3AFHA 1XNGA 3IVCA 3G5AA 2DUMA 2GOYA 2HMAA 3RK1A 4OUDB 1R6UA 4FZJA 2DERA 2CYCA 1MOPA 3MLBA 4DE5A 1T6ZA 1O97C 2YWCA 3AL0C 1COZA 5EKDA 1PG0A 1U3DA 2E89A 3CLUC 1NUPA 3NBKA 3ZXIA 2E21A 3VU8A 1OWNA 4YBRA 3COZA 1GLNA 3IOBA 3U1VA 1J70A 4CT0A 3LOQA 4Q93A 1TYDE 1LI5A 3COWA 3UC5A 1WJGA 2OQ2A 4EFKA 4MUHA 1IHOA 2QUJA 1Y42X 3GUZA 3MMXA 3CVUA 2PIDA 2WSIA 1CT9A 4DLPA 4AS1A 1GN8A 2V0GA 1PFVA 1T6YA 3SEZA 1EFPB 3PNYA 4ZCTA 1KP2A 1G8HA 1IFXA 2WQ6A 2ZUEA 1WY5A 4MUGA 3IVGA 1JEEA 1O94D 4MW4A 4MWDA 3GLVA 2QTRA 4EG6A 3P0IA 1JMVA 4YP7A 3QTTA 4EG3A 1QRTA 5DB4A 4YMIA 1QRSA 4HK4A 1QU2A 3A2KA 1O6BA 1MB2A 3ND5A 4G6ZA 1O5TA 1O96A 1NYLA 2YY5A 1H3EA 1N1DA 4GRIA 4J76A 3HGMA 1MB9A 4ZCSA 3CVWA 1O0BA 1Q19A 4ZT7A 3UOWA 3H9BA 1N77A 2QTMA 5K0SA 1U7DA 2QJFA 2A1TR 4A91A 5KWVA 4OJMX 4HPWA 1PFUA 4XSVA 1D2RA 1VBKA 4MQ6A 1X6VA 1O95D 3CLRD 3RHSA 1ILEA 1I6LA 3Q4GA 5LLTA 1Q11A 3HV0A 1WZ2A 4K0RA 2YXNA 3FG9A 1G59A 2I1LA 3DPIA 3G59A 3DO8A 1GAXA 4MUNA 4YP6A 3E27A 1NURA 3VGJA 4NZPA 2O5RA 2JAXA 1NUQA 3SZ3A 2CYAA 4EGAA 4J75A 2DEUA 4ZT2A 4G5YA 5TEVA 4R2LA 4PBRA 4KR7A 2O8VA 1J09A 4MW7A 2WQ7A 3VRHA 3D6UA 1WQ4A 1KQNA 5BNZA 2CT8A 1UFVA 2PG3A 1IVSA 2CV0A 1TQ8A 4CDMA 1YUNA 1VBNA 2HZ7A 3HMQA 4QBTA 1EE1A 2YWBA 1EFVA 3Q12A 3MLAA 4MUEA 4F4HA 2RD2A 3G6KA 4MVYA 2CUZA 4QRDA 5HG0A 2A86A 5F23A 1KQOA 3FETA 1M8JA 1NP7A 1KAQA 1KH1A 3QTBA 2IELA 4EF6A 5J59A 5LM3A 1H3FA 1KH2A 1IH8A 2JANA 4U7JA 1GPMA 2OV4A 4NDAA 1WXEA 2GKSA 3FDXA 5KCMA 3K9WA 3N9IA 3PRHA 1MRZA 2QUKA 1YI8A 1M8GA 3L92A 3COVA 3KT3A 2ZUFA 3ISJA 4QREA 2DLCX 1O96B 3IUEA 1JIKA 3N8HA 3TZLA 1JIJA 1RQGA 5FO1A 1T9GS 3RFFA 2CSXA 2NZ2A 4NATA 3TNJA 2AKEA 1R6XA 4AQ7A 1PG2A 2J09A 1G8GA 3LE8A 4CDNA 5HUHA 4X0EA 1KP3A 3HZRA 4DDHA 1H3NA 4I6GA 3COYA 4F3RA 1MJHA 4CQNA 3IMCA 1JGTA 3IUBA 3SZGA 1QTQA 4JFAA 3A04A 3RBAA 4L2IA 3IH5A 1IQ0A 1I6KA 1M1ZA 1YIAA 3AG5A 3SEQA 4DNXA 1TYCA 1OD6A 3H9CA 4G5FA 3Q10A 4MAFA 4ZCRA 4KPUB 5HUJA 1VLHA 4ARCA 2QUIA 1EJ2A 1N3LA 3H05A 4HJXA 4MWEA 1B6TA 4MUKA 4ZCPA 1GZUA 4MVCA 4MW5A 5J58A 4PY2A 3GMIA 4S1OA 2VTBA 3IVXA 2CV2A 1A8HA 4EG5A 1QJCA 1ZJWA 1K97A 1EFVB 1T6XA 3NV7A 2BTEA 1J1ZA 2GM3A 1NI5A 4MWCA 1J1UA 1NUUA 3ZJVA 2QTNA 4I6JA 1MAWA 4P2BA 3TQIA 2J4DA 1MAUA 3FNRA 1OWPA 1WXFA 1N2OA 2DR2A 4ZT3A 5KHAA 4NAHA 3ZJUA 1K4KA 4R2MA 4WSOA 4UZEA 1ULHA 4EG1A 3N2YA 4JXZA 4I6EA 4NAUA 4YP5A 1OBCA 3CLTD 5TS2A 3AIIA 2A1TS 1PFWA 3DLAA 2CYBA 3PNVA 2PZAA 1N75A 4TS1A 2IJGX 2E0IA 3IDFA 4KPUA 3AG6A 3FWKA 2D54A 4DDKA 2X1MA 1Q77A 3C8ZA 4ND7A 5JBNA 4U8HA 3D6VA 1NZJA 1O94C 3TS1A 2AZXA 1QNFA 3MUEA 1JHDA 3CVYA 3LCJA 3ZUGA 1DNPA 1KQPA 1J21A 1V47A 4NX2A 5IJXA 3UMVA 4MW1A 2XRZA 4MVWA 1WQ3A 4ZT5A 1VL2A 2J08A 1N2HA 3CLUD 2B7LA 4L2IB 3ZXSA 2A1UB 1IQUA 1K4MA 3H99A 3NBAA 3CVXA 1BS2A 1XNJA 3P0HA 1F7VA 2ZP1A 2TS1A 4KKVA 2VXOA 2X3FA 4ZT6A 2QJTA 1MC1A 2PXHA 2CV1A 2CFOA 4MVXA 1VBMA 1O95C 4Q16A 5FO0A 1QQTA 3CLRC 2J5BA 1JIIA 5AHWA 4MW2A 3X1JA 3PNBA 2AG6A 1WOYA 3FOCA 3HL4A 2VTBB 2PZBA 3BL5A 3A4IA 1NUTA 1IRXA 4PBSA 5DASA 4XFJA 4BWVA 2QUHA 3IODA 5K0TA 1EUYA 2DETA 1YIDA 1JZQA 3L93A 1FFYA 2V0CA 2Z08A 4DDMA 3TQOA 3RK0A 3FI0A 2QJOA 5FNZA 2D13A 3ZIUA 1WXIA 1M8KA 4EG4A 3SYTA 4MULA 1TEZA 5LFAA 1N2EA 3ILVA 2BYTA 4JXXA 1P7PA 3QE4A 1U3CA 2A1UA 4ARIA 1KH3A 3A05A 4MW6A 3X1MA 1GTSA 4XFDA 1N2BA 4EG7A 2A84A 2H29A
chains in the Genus database with same CATH superfamily
1E6CA 4FE4A 2OORA 5AW5A 1FSGA 2AFRA 4ZYXA 1KS2A 4OHKA 4QDJA 2IPLA 5EMKA 1T0HB 4XUDA 3W7VA 5JNSA 1EFRA 1SBIA 4BO5A 4X1KB 4RD2A 1FP6A 2IT1A 4KDCA 4WT7A 4CFYA 2PMBA 2R7AA 1GTRA 1L4UA 5A05A 5A5GA 2HA4A 1RXVA 3UFXA 1CR4A 1IB6A 2ETVA 3GY0A 4EITA 3AKZA 3ON5A 4UXHA 5L7YA 4G2NA 1CUXA 5FT9A 3THOA 3Q85A 3EC7A 1DQSA 5HFAA 1P19A 1T5SA 3FH0A 2SKEA 3GDOA 3QOFA 4ZXFA 1XGKA 2YFQA 3IUQA 3L7KA 1TCUA 4KCGA 4NZ9A 1OQAA 3DG9A 3K1AA 3N5CA 5LZ5A 2ZRLA 6REQB 3G0GA 3G8DA 5JSHA 2IPXA 3WLAA 4BZXA 1LI4A 2AJBA 2CJFA 3N0XA 4YUVA 1I4TD 1NKSA 3AUUA 4OL0A 3CH7A 2P4HX 3C8MA 3BM5A 5CH5A 2DQ4A 3AIKA 5BRAA 5KOJB 1CJVC 4F0JA 4JYZA 2JLBA 4IQ8A 4UBLA 1DBVO 4XPIA 2O8DA 4H27A 2B3DA 5KVSA 3PNMA 1TJPB 4K9KA 4EECA 5L7TA 2R86A 4F1KA 3FIUA 4N8DA 4KEAA 3KUDA 4AZSA 1K98A 1Y7TA 1VJDA 2OTCA 1E4EA 3KJHA 3MAJA 1YULA 2WFZA 2LNDA 1KNQA 2YN2A 2OK7A 3CU5A 3EEFA 3O38A 5DXJA 3W2FA 1BVHA 3KOOA 3UANA 3Q88A 4H4CA 2GBGA 3KK0A 1YOVA 3MCAA 1YJCA 3A0UA 4HWRA 2BP7A 3EEYA 4KE7A 2QW1A 2JH8A 3LQKA 4HBZA 1FDRA 3GJ7A 4D46A 3OX2A 1F14A 1XAGA 3CHYA 5CLIA 3S2IA 4Z4FA 1UBFA 1U0EA 4KR0A 8ATCA 3UGQA 1FMTA 1OSNA 4L5JA 3KZCA 1FTQA 2QN2A 4G07A 2DKFA 3EGEA 3ORHA 3F7NA 4KPGA 1M8PA 1H8HA 1WXDA 3GJ8A 3C87A 2GBCA 3GOHA 2UUBB 1ZPDA 3FHCB 3HKEA 3GFVA 5T5QA 4PNEA 3BWYA 1V7CA 4MPTA 3EDMA 3OJWA 3QWHA 3WLPA 4AMBA 4DMCA 4KDRA 2O19A 1RLOA 4MV3A 3LUBA 1QH9A 1VKJA 1F3OA 3PFCA 1F2TA 1OBFO 1OX5A 1R00A 4O3MA 3R3WA 3BA1A 4BKQA 4WLUA 3I5MA 4UU8A 3SOZA 4J0GA 2PPLA 4D8VA 2CVFA 3ZW9A 2WE8A 4CM8B 3AI2A 5EQTA 1V6CA 4DV4B 5A5EA 4D4IA 3WYBA 3PQEA 3SXUB 1J2EA 5BW8A 1YMVA 2W6JD 4ZCQA 3OJLA 3QJ5A 4W9RA 5IN4A 4N7BA 4AJ1A 4G85A 5D3MA 3ENWA 4GKAA 4JUDX 3VO2A 2F3QA 5A9RA 2JJ2D 4FYWA 2ZIFA 3FHJA 2UKDA 1JR3E 2WMDA 1Y6FA 3QMVA 3OTGA 3I32A 5MHTA 4L3VA 4WTOA 4CKWB 2BZ0A 1SXHA 2UZ3A 2HQOA 1THMA 2XZTA 4J29A 3TLZA 3TQSA 1RZUA 4AWXA 5T4BA 1O0CA 1XK6A 1RWBA 2I8AA 3NJ8A 4CE6A 3U19A 3GG2A 3AUKA 1EA7A 2ZBQA 2WTXA 4WY8A 1JI0A 2B8JA 4P82A 5TEWA 4HNVA 3PXUA 5K2OA 4PSUA 1GTG1 3VISA 1ZOIA 3EEOA 2NSHA 1CF9A 3AFHA 4TYQA 3R8CA 4TTRA 4W5JA 4BFWA 1G5HA 1ESCA 4BTVA 1MNQA 1L0BA 2VJYA 3D5QA 2PUCA 4C0WA 1M1NB 1KEVA 5BSRA 1OYOA 2VSXA 3I53A 2QBYB 1CU1A 1LQ2A 2JI6A 2GS9A 1T0PA 3TUIC 3CE6A 3AL0C 4OQDA 4XW2A 1W19A 3FR7A 4BMOB 2H4HA 4Z7QB 4DSOA 1CJMA 1VIYA 1C8VB 4PYRA 1U8AA 1XQYA 1NUPA 2FK8A 4LVCA 3IQZA 2VYFA 3U2QA 1Z4IA 3IOBA 1FDUA 1QJ4A 2IU6A 3OKFA 4BNFA 4CQJA 2Z4RA 3OM1A 1KK2A 4UM9B 3COWA 3N8IA 2H4YA 2G82A 3BCRA 3A9SA 1XPUA 4QFBA 1ESEA 3NH6A 1P62B 1PZNA 1GN8A 1QH8A 4C2BA 5DNUA 5JNRA 2AMVA 1JNXX 1T6YA 4FDAA 4LRSB 3TSAA 1V2GA 1XAIA 2IQ5A 3MWDB 9ATCA 1IFXA 2GSDA 4N3NA 3VPGA 4D8WA 2HT1A 2YKGA 1YIOA 3L8YA 1ZICA 1CJTC 2GEBA 4U1RA 4E11A 5JAPA 1RXSA 4ZYTA 4J94A 4U2FA 2WM2A 1ULSA 1VCIA 1DAGA 1GGMA 2EKLA 4QU8A 2QRGA 3DXYA 1WPXA 3NVMB 2YCLA 4C6HA 5AW1A 2VZ9A 4FQ5A 2AXNA 4YMIA 3KJGA 4IDEA 4UHKA 4UARA 2MCFA 1JLSA 5JYBA 3T0IA 2YY5A 4CL2A 1GSAA 2X5NA 3K72B 1U2TA 4K3VA 1OIVA 4KJXA 4HAWA 3ZTTA 5J47A 1X1AA 2V6JA 4HPJB 3V97A 5FPKA 2QU7A 3HGMA 1YE5A 3E1KA 4MEJA 2FEKA 4ZCSA 2RBEA 2C03A 4I9HA 5CT5A 5FR1A 3DF9A 4ZDKA 2JAUA 3GRRA 4QASA 2OXIA 4CIXA 1KAGA 4EKYA 4ER6A 5ICCA 3ZU3A 1YQTA 1V9CA 1Z0KA 2GD6A 4NH0A 2MSNA 1GG8A 1R8YA 3WLJA 3V9AA 1C2YA 4OXYA 2VAVA 4PLHA 3EIEA 2IHZA 3JQFA 2C4HA 4KAAA 3HL0A 5BOSA 1CUYA 1NM5C 3CLRD 2B4YA 1WPGA 3HKCA 3PUYA 4ID9A 2OCIA 3HV0A 4MDYA 4OMUA 5LLTA 3MGAA 1JEAA 2ZB3A 2CLHB 2PUGA 3HXTA 1FS5A 2WHPA 2BBWA 3AEKA 3ICCA 3IOMA 3RU3A 3D6NB 3HDVA 3ME5A 2P41A 1TQDA 5EXTA 4ZC1A 1X0XA 2C84A 2JCGA 3TSYA 2DBRA 4JV5B 4FYYA 3DOHA 4Q3LA 2PU7A 1W7AA 1BHJA 2GN8A 2GZMA 1EG7A 1YZ3A 2ZSEA 1TI7A 3NHSA 2NPIA 4QDKA 5CPBA 1YNSA 3L1JA 1QWSA 2PU5A 2CLSA 2AI3A 3AC0A 2WAOA 4BNDB 2VP3A 1DU4A 4AZTA 3GI1A 2AN3A 2PG3A 1Z39A 4NE9A 3ZWVA 3CZ5A 2L17A 3GN2A 5CT8A 3RARA 3BK7A 3RREA 4F96A 1RYDA 3O7MA 3PSAA 1CSEE 4QBTA 4ZMRA 4FOOA 3KUUA 4U7PB 1MN6A 3V9PA 2QR2A 2CHQA 1IWOA 2XYHA 3LT1A 1E2MA 1L7VC 2VJMB 5FUYA 3KQLA 1JB9A 2Q5OA 2BGIA 2XWJI 2WF5A 4AYXA 4S1VA 3O8RA 2CNNA 5REQA 3Q5GA 1V9SA 3EJ6A 3KP1A 3DZDA 4RHFA 2C58A 4ZDIA 3S8EA 2IYZA 4RSRA 1OGIA 4UU1A 2D1FA 5ALFA 4MV0A 3N39C 3GUHA 2CDNA 3K8ZA 4MMXB 4Q9NA 2J41A 4XYEA 3LZ6A 1UBLS 1R9NA 4MCAA 2PRJA 2XLBA 1X1RA 1U81A 1N8KA 5J2UA 1SM4A 1VIAA 1K7XB 2GN2A 1O89A 1U2GA 4LF4B 1J24A 1BDMA 1DVRA 2YTZA 1RQRA 4XB1A 1FIUA 4QA9A 3W1EA 5CTAA 2IXFA 5DCYA 1U0RA 4BRWA 1T9GS 2HZBA 1Z37A 1CDOA 1JR3D 1QAOA 3B9QA 4WESA 1L7QA 3NAGA 2WU4A 2H51A 4BE4A 2HYDA 2I78A 3AONB 4GL4A 4AWAA 1ZSVA 3V8PA 4RULA 1FF9A 1I10A 3C1TA 1EM8A 1T1EA 5EZYA 1C9MA 1KP3A 1LSSA 3IJRA 1LX6A 4GZ3A 3SOPA 1PZHA 4GE0A 1E4OA 2RFLA 3MJVA 4MYTA 1ANKA 1Z2CA 2BELA 4L5IA 5E2IA 2CKMA 2IFTA 2OV2A 5IK2D 2BWJA 1B6GA 1FFCA 4HY3A 1DGQA 3ONNA 3PFWO 4KIGA 1ZINA 4ERNA 1FYVA 1IQ0A 1OREA 3W6OA 4LY0A 3B9PA 1T43A 3CZ4A 3LGSA 4OP3A 1ZRSA 1ISMA 2QOEA 2OG1A 2DWPA 4H0CA 4D98A 2JLUA 3IPAA 5KNCD 4MV7A 5CK5A 3QYPA 4E31A 4LF6B 4E15A 3ZVKA 5T57A 3H9QA 3V2IA 5BWMA 1QS0A 2Y1EA 4GF5A 4L9SA 3VH4A 5KSYA 4AKSA 1ESZA 3DEJA 3FPGA 3M4YA 4INPA 1LS6A 2DQKA 5FD8A 2HXYA 2TSYB 3O74A 2ATVA 1ZGZA 2ZAOA 4QPDA 3F7TA 5I51A 421PA 4EZIA 2C7OA 1P7YA 1XXHE 4PO1A 3YASA 4I2VA 2C4VA 4WRRA 1D04A 3NM4A 1P4GA 1Q1QA 1P7CA 3AFGA 3NU1A 2C54A 1HPLA 1QVRA 3LI2A 1Y89A 5LSAA 4RTNA 1SIUA 1UOPA 3LIIA 3AR4A 2ZJ7A 5IYZF 3QG5A 1C3JA 5K2MA 3R74A 2QN9A 3MXOA 3ZDQA 3VR6A 2OFWA 1CUDA 3DOOA 3EIFA 4LDQA 5I47A 3JYQA 3TQIA 5HGJA 4DG5A 3ZWAA 5KKNB 5B58C 5K8LA 4Q1FA 5DNAA 4DQVA 3FNRA 2A1IA 1L5YA 4RETA 4AIIA 2C97A 1R0XA 1B0UA 2JJ8A 3GX1A 3LL7A 3B20A 4PLTA 5ALSA 5CVEA 1ZZGA 3TNYA 2C5AA 4I50F 1D6JA 3SKVA 3NTXA 2M6KA 2J5XA 3BAZA 3E2MA 5FWDA 5LQCA 3ZJUA 2YR0A 2FETA 1Y3IA 3RIHA 3I2JA 1Q1EA 2I8CA 4G0ZA 4PLWA 4EG1A 3HEAA 1X8LA 1UQTA 5KHLB 3G2LA 4WD3A 3QPWA 1MPXA 3VOBA 2OY0A 1NWCA 4RGYA 3S0JA 4HDSB 5EUQB 4MQEA 2AHRA 4O2RA 1QPZA 5TPZA 5BSWA 2HU5A 4X00A 1MG0A 3I42A 3F8TA 3Q3IA 4TS1A 2VZ8A 4OI1A 4DLTA 1TCBA 3GROA 1A7UA 2PZMA 3ZHUA 4NCKA 1X9GA 4DF3A 4PRYA 3GLRA 3GEIA 1I7NA 3NONA 3LIPA 2EG5A 4JUIA 2IIQA 2B4TO 3SJZA 5IUNC 1QWOA 3FYUC 5AK5A 4DWWA 3KLNA 4RSHA 4KTTE 1DHTA 4JEMA 2G77B 1PSDA 2AGVA 3HH8A 5EPEA 4JXJA 3CVYA 3CM0A 2P3LA 4ETMA 2AI1A 3KQPA 2C99A 5JJIA 4HL6A 4LF8B 3R7FA 3FFXA 3U7EB 1NN1A 5JDIA 1M7GA 2IPMA 5FWXB 5K0BA 4JFRA 4UOQA 2VG8A 2IE8A 1WKVA 3WLTA 2FPGB 5AVKA 2HIHA 4BO7A 4MVWA 3DKKA 1T8RA 1YKGA 3AESA 4DSZA 1GNPA 2HB6A 4ZT5A 4D0GA 4RFSB 5IYZB 2J87A 1RYFA 3EQ7A 4A0QA 1LS1A 1V1JA 1PK7A 1BA3A 1XZIA 2D0OB 3AF3A 5CXXA 5HDQA 4F72A 2DWCA 2VUIB 2B2XA 1DDIA 2OGZA 3SBDA 1E99A 3EIHA 4JVNA 1N0UA 5I7SA 4DYHA 5IJ9A 1KA9H 3FD8A 3DTVD 4LQLA 3NANA 3TGLA 2PBZA 4QELA 2B6NA 4DMMA 1BD4A 1OLSB 2PQ0A 3EGOA 4AS3A 1FP7A 4MVXA 3D1LA 3SF0A 3KOYA 2JIZD 2C98A 1KZGB 2QT9A 3ZD8A 1KY3A 2ZJOA 4RXTA 3SS7X 3WP1B 4F85A 2I6UA 4MW2A 1P7WA 3MB8A 3QU7A 2EKDA 3T1YB 2IXEA 2DJIA 1GSIA 1DX9A 2VTBB 2ZE6A 1QORA 1V43A 4FSHA 4ZGBA 3EA4A 3V7UA 1H85A 3J7TA 1IRXA 3VH3A 2Q3HA 1QDLB 2DR3A 1QHNA 2CLFB 2TRSB 2CEAA 3ORSA 3SSMA 1A8IA 2ONCA 1T24A 3PZRA 4M1YA 2IC5A 3OF2A 4CMKA 2B36A 4IQ4A 4A5OA 1QHHB 1FFSA 3EXHA 3A3NA 5A0TA 2FMUA 2BZGA 3ZZUA 1JSCA 5ADWA 4B0OA 2GEFA 3B78A 1GD1O 5B53A 2ZUBA 2PZFA 3B3QA 3EODA 2CVOA 4DLRA 4E2XA 4MYRA 2VDWA 3ZIUA 1EBFA 1LJ8A 3BJRA 3BVPA 1OX6A 2F1HA 2BEKA 2VZ0A 4JOQA 5K6TA 1IY0A 2PSHA 3OF3A 3R8XA 2FMXA 5KQRA 2CNWA 3U0VA 1G8MA 4BAUA 4G63A 5TQ2B 4IZ6A 4AF8A 3STHA 3A05A 1H23A 5LR6A 1NJSA 5F3WB 3X1MA 1GTSA 2V03A 5AQ1A 1W4AA 2AMFA 5KC8A 1KARA 2A84A 4CIVA 2PUFA 3LA6A 4A0HA 1SULA 3V3TA 1Y5MA 1GKLA 2PZ8A 2OXCA 4OGWA 4Q7JB 5IEBA 4NCAA 3SK0A 1DS6A 1HUQA 5KVVA 3O73A 2ZQ5A 3H18A 2HAEA 1BWPA 1X19A 2V58A 2YYSA 4Q21A 5AT1A 5DEOA 2B82A 2P8JA 3EH2A 2GPNA 1I4OA 3A3PA 3A32A 3BWXA 3WMFA 2C0CA 1BYUA 4M1EA 3G7NA 1N6OA 3REQA 3NHAA 1E3IA 1C4WA 3S68A 1HF3A 2W8ZA 4PBTA 1BFKA 3RANA 1N9GB 2HKIA 2XNCA 3EGIA 2JCVA 3IMKA 5DBOA 3ZCXA 3R3UA 1M6VB 2IGTA 3CR8A 1YCHA 4DBLE 4DPMA 2Y05A 4BNVA 1J56A 1Z33A 4YRLA 2CNKA 3L6OO 3B60A 4BGDA 1TYZA 5J1TB 2I9KA 3ZQ6A 1O77A 1IJFA 2XWSA 3OZAA 1E92A 1LD3A 1SR8A 3V1YA 5ITWA 1Q6YA 2AX4A 4TS4A 1S89A 1U1IA 1FDIA 1NJ8A 4ZQFA 4ZYYA 3EZ2A 4GYYA 1DC8A 4X60A 3W2HA 1AKVA 1TM4E 2QM7A 3ESXA 4EFNA 2KX7A 4M9UA 2WJPA 5T8KC 4RK4A 4HDNA 4D6XA 1N78A 4DMHA 5KWJA 2R65A 3CNOA 3CKLA 1NOIA 2GAIA 1PGPA 4CEJA 1NVDA 1RPNA 4W5QA 1F9EA 3JD0A 5EMLA 3RRMA 3RUHA 4OFXA 1WZCA 1FP2A 1Z0SA 4RPCA 5FP0A 2J48A 2ZCUA 5DBHX 1EZ1A 1ABFA 2R5WA 5CYGA 1XVIA 2WVGA 4EHHA 3HFGA 1L5WA 4IHKA 5D6OA 3S1LA 4B3TB 5AVSA 1V8DA 2QPOA 3R4CA 5ITSA 3V7YA 3I73A 3KQTA 4ND8B 3ZBUA 1E89A 4X97A 3ZZTA 1U2ZA 2HM7A 3INNA 5FUMA 1J5PA 1YB2A 4TXMA 3VBEA 1LI7A 4LE1A 2PKRA 4ZOQI 3X0DA 2BCGY 1IAVA 1V37A 4K46A 3KLOA 2NXNA 1O58A 3GJ0A 3MWLA 3ZTWA 1E1RD 4BP3A 3OPQA 4GRDA 2HLDA 2VYND 2FJPA 1H9BA 4MQUA 3KDSE 3FCUB 3WB2A 5LP6C 1C7IA 4KL8S 1ADFA 1G98A 4LQCA 4AX8A 4K2AA 1XZBA 2F62A 3UYLA 1XK7A 1BNCA 4DQ0A 4RL4A 1A5SB 2BHLA 3HLTA 4L75A 4E4YA 1OFHA 1QIFA 3OOWA 2H59A 1LW7A 3E9YA 5BN4B 2Z6QA 3W4IA 3JPYA 3JWIA 1RJGA 4MLPA 4XOIA 1WB6A 2WUGA 5F2EA 3FOFC 3MWEA 1HBJA 2JPDA 3C6KA 4GMDA 3JQPA 4BMYA 2P5UA 4W7IA 5JBQA 2OV6A 1GEEA 3IQGX 2OVBA 2V7BA 3SMVA 1IY2A 1US8B 2CXNA 1CF4A 1SA0A 3ETEA 3VPFA 5ADHA 3IAM6 4PLGA 3W3AH 3DGFC 2HF8A 2ASEA 4N49A 4Z2AA 1MB3A 3D8HA 2Q4DA 3ER9A 3EFHA 1R0ZA 4GUDA 4R5HA 1T2AA 4H1HA 4P98A 1JEQB 3SM3A 1I3LA 2VHXA 3SLRA 1I6MA 1WMAA 4A0RA 1JLLA 3R7LA 4EIWA 3I9MA 1W46A 2VI5A 3PXCX 3IQHX 1N3YA 2QN1A 4DLLA 3TB6A 3MK31 2O3JA 2W2VA 3I9V1 2EKZA 4RGBA 5HCUA 3DHYA 3T41A 4AMVA 4YFYA 1WULS 2J59A 5AK3A 4UBMA 3N74A 4B7AA 4LBYA 1A0OA 3LF1A 4ZICA 1M73E 2RI6A 1V2HE 4CLOA 1VPDA 1U65A 2XEXA 1G3RA 5JY1A 1GT91 1LLCA 5I4CA 1WCXA 5ARBA 3RIYA 4E2YA 5JLJA 1I2BA 2F8MA 3NTOA 3ZDCA 4KKXB 4NFLA 3OD5A 1VIMA 1I36A 3ZE8A 2PL9A 3DPUA 3E61A 4EJFA 1GR0A 1YZKA 1S8FA 3DDUA 4PONA 4BZQA 1JWAB 4DC9A 1I1HA 2ZXUA 1WMSA 1R6UA 2EEZA 2WG0A 1UCFA 3DXZA 3VHXA 4R0VA 4GPIB 4M98A 4M1TA 3EZ6A 1NV8A 1T6ZA 3HB7A 3DC7A 3WTCA 4EX7A 1KSJA 2QROA 2FMHA 1N5MA 1XQ1A 3GVCA 3RFVA 3S2YA 4B6GA 2H1CA 1CUGA 2BFEB 2XUOA 2JAQA 3QV2A 4FUQA 4LHYA 2VJAA 4LKOA 4MWSA 3V4PB 3ZCPA 2Y77A 4KX5A 2YIJA 3G2KA 4QNRA 5IAAA 3GD5A 1ORDA 1YA6A 2BBOA 3DDHA 3OOJA 1Z7YA 1PUJA 1QB8A 3HCNA 3RRJA 1J90A 2RAVA 5LQSA 1O5OA 2VDUE 1I4EB 4FYXA 4P93A 5K6AA 2UUPA 4P0PB 4DCPA 2C1EA 2ZRMA 3O1IC 2BW0A 3VJKA 3ZCUA 4BYMA 3OQMA 2XZLA 2YJTD 3OPNA 2XVXA 3BSWA 5JSQA 4TV9B 3BIWA 2EQAA 4YHHB 1M6WA 2JBHA 5J5VA 4MV6A 3T1HB 2J6IA 1WUYA 1TFRA 3E1GA 1TA0A 1TU4A 3H11B 3GVIA 4G5QA 4O2AA 4TN1A 3TKAA 2FGJA 2HUNA 2EFEB 3IVGA 3PFGA 4H6PA 1FDWA 4F2PA 3IUYA 3HYTA 1QR2A 1HEUA 3EW9A 1EP9A 3I39X 2VT6A 1UANA 1RM3A 1BGWA 3AH8A 1Y9AA 3P1JA 1JFSA 5KTOA 2EYQA 4BMVA 3TD9A 4J7CA 4I14A 5CCBA 4C08A 4G2TA 3LUCA 3UJAA 1RPJA 3QVJA 3DMDA 2NO1A 3DOUA 2OEPA 3QG1A 2HHHB 2F6RA 3RDPA 5IN5A 1PYOA 2F1KA 2R1UA 3SXJA 2IZ7A 4FFSA 2VQFB 2QUZA 5EEGA 1E0KA 2ZBPA 1T8WA 1N4AA 2NUPA 3U3ZA 4CMIA 1S6YA 4JB2A 4ZT7A 3PUJA 3KJQA 3FRJA 3MFYA 1G8JA 1P91A 3GA0A 4UAUA 5K4HA 3PUZA 5DLDA 5G0VA 3BK1A 2IV3A 2VPPA 4I36A 1AXGA 2FYTA 2PWBA 4UOEA 1K6EA 4N4AA 1XF1A 2FPIA 4B8WA 5C46F 5KKAA 4QM6A 1PS0A 1GFWA 2CBGA 2XYQA 2HL6A 1PL0A 3A4LA 3R44A 4HXFB 3WNZA 1KEZA 3L4BA 3WWCA 1OU0A 3PXAA 2RI0A 5CVDA 3RHSA 3UB3A 5IDXA 5CFNA 2AUNA 1AO0A 3L4KA 3HB1A 5MF6A 3LBIA 2WT4A 4KC0A 4EA7A 1L5HA 4K7JA 4R68A 4X7PA 4TTSA 2QMYA 3MRVA 3BX1A 4QYIA 4R9UC 4BAGA 5A0FA 4RWEA 2E4XA 5JSFA 2OZPA 3ABRB 2G8NA 2XCQA 3II6X 2YJ4A 2P5TB 3FPLA 4IJVA 5G4KA 2HSWA 1ZCFA 4XARA 1NNEA 3AQ4A 4ZT2A 4N65A 3TTWA 4R2LA 5IX8A 1Q6ZA 1G18A 2FP4B 3J7AC 2ACVA 2HCBA 4JHXA 1FK8A 3N2NA 1BRTA 4FEYA 4B5KA 1U02A 2P30A 2XHZA 4IO0A 3IP9A 4EA8A 3SHFA 5BN3A 1KY2A 2CT8A 3N7AA 1KRXA 1ZDMA 1LPBB 1NBIA 1SKUA 2V7GA 3L4SO 1FFDA 2CVZA 1YUNA 2VWGA 3I04A 1ARZA 2I4LA 4X93A 5K3FB 4GPZA 2ZDGA 2YWBA 4RIHA 6LDHA 2ODAA 2XMPA 2BFPA 3Q2KA 4MUEA 2WUWE 3HHEA 1P17A 1CFJA 3FUTA 3HBFA 1ORRA 1W5BA 5K3BA 2FUG1 2PUDA 4QRDA 3KR1A 5LXTF 1IOVA 1GPAA 1UAGA 3LVBA 3ZBQA 4B75A 1ZD1A 3KYCA 3CUSA 3CRVA 3O4RA 2WAYA 3KUXA 2PWYA 4EF4A 1PS9A 1FFEA 2POQX 3C3MA 5JU6A 5E1OA 4BHTA 3CLKA 1GNRA 3EN0A 1DWPA 4EDFA 4DUZB 2VXCA 2XCIA 3THWB 2R6HA 3QLJA 4RA9A 3M7IA 1T36A 1ML4A 1AS2A 2F8SA 3SI7A 1A95A 3W8RA 4F2WA 3HLKA 3TYXA 1CQJB 3CIFA 4H6VA 4TWIA 2WABA 5SICE 5ECGC 1FRVA 2ZI4A 3OJCA 2DY0A 3ODPA 5I9IA 2JC3A 3GVXA 1BJRE 1F06A 3KT3A 5K1ZA 1YRWA 3RC3A 1M0TA 2NUBA 1AUOA 2Q4RA 3EIOA 3HSYA 5AW8A 3G2QA 1CR6A 4W7HA 1M2VB 5AVZA 4L0DA 5JRZA 3D3JA 4QAQA 4M8KA 1CJBA 4U8GA 3LKBA 4NYIQ 7YASA 4PLPA 4P4SA 1NXVA 4X1YB 4NYJR 3B3JA 3STVA 2AOUA 3EQ6A 4Q34A 2VJOA 1MW9X 4KX3A 1Z22A 1ZK3A 2HGSA 5IDVA 5HK8A 1PJBA 4ZVKA 1YJAA 4I1OA 2NYRA 2ZT6A 3KBBA 3ZH2A 1GAQA 4N01A 4EAAA 4YV2A 2Y2VA 5HUHA 1LDEA 3IUSA 4FOSA 5CTJA 4P7FA 3C7KA 2O8DB 4R4JA 2XNHA 3BSYA 1EHIA 3C3CA 4ALNA 2AWOA 4ZEVA 1PFKA 2UYOA 3A6FA 4KLZA 1WUHS 3CRQA 5D85A 1JPVA 1EUDB 5KNDA 4JBNA 4QOSA 7ADHA 5BT9A 3THSA 3EVCA 2JDID 2OPHA 3IIEA 3SEQA 5SZHB 4X63A 1Z5OA 5JI2E 2FPUA 3T7EA 3ZV6A 4GWKA 4AUNA 3A1SA 3BB3A 3R76A 1HT3A 4ZCRA 1MKYA 4XR4A 2AA3A 1VTKA 1WHSA 1BH2A 4RZQA 4Y6QA 2DSTA 3QLUC 1FPMA 2QUIA 4LXHA 1H1DA 1JQBA 5AM5A 3RPEA 5K8CA 1UBMS 1QG4A 4MUKA 1URPA 4J1NA 3ZDZB 5IABA 1ZVVA 4FKBA 5E7MA 2P3QA 2HWUA 4TTJA 1F2DA 2CL5A 2VBIA 4B1FA 3DC2A 5JQGF 1J99A 1XRQA 5EP3A 4D82A 3MBOA 4NY1A 2RK4A 3T7JA 4BQPA 4DA7A 1NX6A 2JJ1A 4CMAA 2KWIA 3DDWA 4NONA 4D9NA 2Q28A 1IOZA 4KITB 4HUTA 3W2EA 5IG2A 3OIUA 4LJRA 1NI5A 2FPPB 3WGQA 2FZGA 4Q9AA 1IHXA 1NGSA 4F6RB 4RXUA 4E4RA 2BKUA 3PCXA 4RZ3A 2QM0A 1ZCZA 4HVLA 4YMVA 3RVQA 5GWXA 4G86A 4J0IA 4DDUA 3NXSA 4X1IB 4D9EA 5A5FA 3H5TA 1CUSA 1CUJA 4FD2A 3KB1A 2VP6A 2EDCA 4GMKA 3MAGA 4GLOA 3UK6A 3HB0A 1LBTA 4L4YA 3E70C 1GT6A 1OY1A 3OCYA 3SFVA 2CLOB 3A06A 1EK5A 4EYSA 2Y0PA 5C80A 4MUMA 3E5NA 2NADA 3LCRA 4E5YA 4C0XA 1T1RA 2O2YA 3T3OA 5F2OA 4KQKA 3RSHA 3JWHA 4J7AA 1SQSA 3FIJA 4BNJA 4A2PA 2OBXA 4G0MA 2IZ5A 2W2NA 1IDN1 3TOVA 2QZ9A 3PXGA 4WCFC 4MKZA 4O5OA 1OA1A 2HU2A 5FYQA 4US0R 1KEEA 4X8MA 4F7WA 2W93A 5EJAA 1DTWB 5I7FA 1V1MB 2QAGB 3D81A 2QLLA 4ZI3A 2V9PA 1FP4A 2JAHA 3QU2A 4A8JA 4OBXA 4RVCA 1NZJA 1TM7E 4E5NA 1VKHA 3MHPA 4E5KA 3U61B 2AJ8A 5ITVA 3M3DA 1SC1A 4I3HA 2CMFA 2PH7A 3EGDB 3H5VA 1G9SA 1Z2OX 5CNMA 3VJRA 4WNCA 3R5HA 2C4NA 2POCA 3CE9A 4OM8A 3U4CA 3I45A 3GGDA 1SUSA 2PGOA 5EPOA 4LNAA 1A72A 3G0IA 4EVSA 1UBOS 5JMTA 5FFFA 3K15A 3K0SA 1GV1A 3NOVA 3PU6A 3AHHA 1N2HA 2BEUA 4NBTA 4R1PA 2OAQ1 5CB6A 2NVUB 2ZYTX 1F60A 3D54D 5CDYA 3AUTA 1IQUA 3K0AB 5JWOA 4BO3A 1HH4A 2FSIA 1V4NA 1XMQB 1K66A 1AH2A 3K9HA 1H2FA 4PYIA 5DV9A 4FMPA 1RTKA 2D4AA 2PQMA 3IV6A 5DVZA 2G63A 2NTEA 2VXOA 2ZE5A 3B6ZA 4LOLA 2L42A 2QD1A 1O95C 3ECAA 5B12A 3EQ8A 4JBYA 5FOQA 1EK2A 4ENPA 3C5WP 4NNOA 2Q8QA 3N07A 3AFIA 1IZZA 5BP7A 3NM6B 4GXNA 3FOCA 2WUVA 4AT1A 4ZAGA 5T41A 5DCLA 3JQAD 1MGPA 2COKA 1AGPA 1QFJA 2GO7A 2QYOA 3I0ZA 3IBFA 3ZGYA 2AG0A 3HSSA 3V5NA 1T9DA 4A1OA 5K0TA 1LV7A 5IBQA 2C3YA 2TMGA 2OBNA 1YK0A 3UK0A 3L0OA 1RAEA 5D84A 3GDWA 1ZVMA 4LDJA 3U39A 2ZJ1A 4L73A 3CS3A 4QJ4A 1JEJA 3HCPA 4IP0A 3U44B 1ZONA 2HJSA 1FU8A 1OLOA 3OX1A 3VNVA 1X14A 3O5AA 5ITZA 1QGED 1IU9A 3COPA 1TEZA 3WRXA 2AMJA 5BMVF 3MWGA 4JVMA 3AJAA 4NRDA 3D1JA 3CMCO 5J63A 2CMHA 3A6PC 3PEYA 3E2PA 1PR3A 2ZANA 4F5EA 1P5JA 1D9XA 1KMNA 5IS2A 3AXTA 1ULUA 3AUFA 1I0LA 3KU1A 2EJVA 1L7DA 1A7JA 3KLPX 4RPLA 3V46A 4CM9A 2N47A 4P34A 1MOQA 1RJ9B 2H29A 1NRIA 1RRMA 2XTAA 1QQ7A 3EVTA 5MGNA 3FRIA 2L0XA 3DBRA 3O8BA 4WK4B 5AP9A 2HDHA 3I64A 4V0MA 3GRKA 5AVQA 1E2BA 2GT1A 2IDKA 2HR1A 3ND6A 1ZH0A 3CUUA 1IJEA 1CDEA 1PU2A 2FWNA 4NI5A 4JBHA 4TLBA 1ODCA 1SKQA 3TAXA 3T06B 4Z7JA 2XB9A 5DGIA 1JVNA 2ZWOA 2DPLA 2BEVB 2WF6A 3OZCA 5NULA 4LJSA 4FLEA 2ZITA 4JMLA 3WL7A 2RK6A 4RA6A 3PJRA 1UPTA 2DSNA 3N3AC 4JJ8A 4QSMA 3QVMA 1Q21A 1SURA 3WL3A 4GZMA 4YT5A 3JASB 4JLVA 2L69A 1X2BA 4LA4A 2WY2D 1DDOA 4K6GA 2G9QA 1P1CA 1AB6A 1DKMA 5C3UA 3WGJA 3DE3X 2BONA 2X9NA 5K03A 1QAMA 2HWXA 3OZFA 3RS5A 1BKYA 1OVMA 2F3PA 3HUUA 4GM4A 4OLAA 3QVLA 3AV3A 3W0LB 3RC7A 4OUDA 2ZS8A 5C8YF 2BFFA 1P39A 4EW2A 2E18A 4DJAA 2FG6C 3OVMA 1UZNA 4MRSA 4RK5A 3ZK7A 3BMXA 4ZT4A 3VO9A 3FCSB 3DNMA 1KK3A 5BSHA 2G0TA 2JCSA 5LJLA 3OCZA 1CHNA 2JGAA 2YZMA 4BEBA 5L3VA 2OKCA 1ZYUA 2HMTA 3ZDBA 2NV6A 2C5GA 1RAGA 2W37A 3BWVA 5H16A 1K8YB 1RCFA 2HRQA 4BIIA 1ZI6A 2MYTA 2FVYA 5C8VA 2ZM5A 1RXIA 5LB4A 1B8OA 1PUIA 2FW7A 2FUEA 4LYJA 1HKHA 1WW8A 5TQ0B 4ARUA 3BOSA 2QLJA 2C07A 2I3DA 5BUQA 5BSEA 1IUOA 1OJLA 1P6UA 2NYUA 3SFZA 2P6RA 3MOGA 4TWBA 5A7HA 4ARAA 1FBTA 2ORVA 4N7MA 4P4UA 1OAOC 5KPJA 5H7XA 5JOQA 3SC4A 3P9ZA 2DG2A 1PZXA 4UHHA 1AK1A 4EDHA 3IQDB 5EIEA 1JZSA 2OFPA 3UV6A 4L8FA 1YAJA 1XU9A 2AOWA 1JJAA 1M0SA 1NE7A 4TZ0A 3CPEA 5HQTA 2J7PA 4JZYA 3UWSA 5H81A 3EISA 1XELA 3H65A 3Q1KA 4O4HA 3CUTA 1PQYA 3UHPA 3SWWA 1W2GA 3TMYA 2CF6A 3IV9A 3PC7A 4R5MA 1L5MA 1D3AA 1PV1A 3PNOA 1P8JA 5C8YB 1LDNA 4ON9A 5EKUA 5FOUA 5FUWA 2E7ZA 2PYDA 3AW9A 5DT2A 1ULAA 1V0JA 4LHEA 4TM7A 3WFIA 2QMHA 4ND3A 3UC9A 3UWOA 4FNGA 4WFJA 2JKZA 3GK3A 3BWEA 3C3WA 3E82A 3LHFA 4R41A 4L72A 1VG8A 2OXTA 3RT1A 2EWVA 2XNSA 3UMBA 2R3SA 4F21A 3VZRA 1DJQA 1GQQA 3C7AA 3WB1A 2Y6VA 1WBDA 4MQFB 2VQ6A 3RVPA 2I65A 3S55A 5JPDA 1T9GR 3E8SA 2EIXA 3BS4A 4DB4A 4ECAA 4B2PA 2JBAA 4TMXA 3I2FA 1GQSA 1ZMXA 2JVJA 4R2KA 3UJ6A 3OETA 1H2BA 3C5VA 4LXXA 5A4AA 2QHXA 4LZJA 3VXKA 4OHVA 3CURA 5FUVA 4V2IA 2HMAA 5H3HA 3RK1A 1Y4AE 1BZYA 1MJGM 1TUIA 2G7ZA 1KSGA 3A6EA 1MOPA 1Y4DE 3QVUA 4X44A 3X2SA 5B1EA 3FTEA 1MVOA 1Q0SA 3JARA 1UK9A 2VDPB 1OC4A 3PNSA 2ZVJA 1Y1LA 1J7KA 1WMEA 2GF0A 2NO7A 4L1KA 4M8IA 4KRGA 3HVKA 4NZZA 3RW9A 3TLGB 3W2GA 5K9ZA 4BQIA 3ZXIA 2E21A 5E9AA 1BEZA 2O8FB 4PTLA 3I4CA 4X8LA 2EGGA 4HCJA 4LYEA 3VBCA 3HN7A 3S99A 4CT0A 5J4VA 4JB3A 2Q2VA 2JFWA 3BWDD 3H8SA 1F2VA 3NVAA 3OQPA 2O0HA 4OGKA 1WM1A 1ZX1A 5K3AA 4FGJA 2IYSA 2GCPA 4JP1A 2NZUG 4L57A 1JA9A 2GJ4A 2Z4TA 3CO5A 1E4VA 5KVCA 3P9XA 2V0GA 4CKBA 1LZLA 1Y8RB 3NIWA 3AFOA 2EOAA 3CNQS 1KI1A 4LNUB 4P54A 1VIVA 3DZCA 3NAMA 4YJ3B 2GXAA 3PRKE 1MQSA 2IW1A 3FBWA 2I5PO 2YNMC 1DAMA 3QOWA 3I1FA 3GLHB 4JK3A 4EGFA 1VZ3A 5JHHB 1W30A 3GLVA 2VVTA 4F71A 5EJ4A 3AEQA 3GAMA 4ZOCA 1W1IA 3ROTA 2VBGA 3X1XA 1Y6JA 1KI6B 2W4QA 3RIXA 4BEJA 3DB1A 4L27A 1PV4A 2UZAA 4PE5B 5EJGA 5KYVA 5KNLA 3L77A 2ZR9A 3HN2A 3R0IA 4MTLA 1E32A 2FW9A 4PFQA 5BNIA 1SUWA 1XX6A 2TMYA 2V7PA 3GFRA 3QLVC 4MRMB 4TUYB 4Z4EA 4JOBA 2GM4A 4QFDA 1BWSA 3VR4H 1FLVA 2V8BA 4X95A 5SY4A 3Q8LA 1TL7C 3KPJA 1GNTA 3R6DA 3NR2A 1JXOA 4K3UA 3THYA 2P62A 4D1YA 1JLHA 1KP9A 4D0SA 2I66A 1XROA 3CBGA 3RSZA 1H42A 2NUTB 3OM8A 3RGGA 3AF4A 3RKUA 5BURA 3PR2B 1DJPA 3GEBA 1NBAA 3NHPA 2QK4A 2XT6A 3OLZA 3QBTA 4G5SA 4E70A 4XB2A 3QVKA 3FCCA 1FYWA 3BFVA 3IL2A 1GSOA 1RXUA 3LGAA 4MS1A 1PD1A 4WOJA 1ILEA 2PX5A 1AXEA 2YMPA 3IELA 4HUJA 4AMZA 1K9VF 1R50A 4RPJA 1GAEO 2CUTA 3FB1A 1ZJ6A 3DP9A 3IBTA 1DT3A 4IZIA 1I1QB 1NURA 2CWWA 4GVPA 3VHRA 4NZPA 4EHLA 2VHVA 1U5BB 1TIBA 3EGCA 3U49A 3KQWA 3O3MB 3EY9A 1RS0A 1XLVA 5BQXA 3T38A 3QHPA 2QZJA 9LDTA 3WNDA 1TCAA 3HJAA 5TEVA 4D80A 3X1WA 3KR0A 1W73A 2QX7A 5D8DA 1II8B 4WK2B 2Z2JA 1I14A 1FDTA 3CEAA 1WQ4A 4KFSA 2AFIB 1NQ5A 4WOCA 1F51E 5E6UB 2VJNA 3D5EA 4LDRA 1X7YB 4K9RA 4PG8A 2WK1A 4RVGA 1DAPA 4TTIA 3HMQA 4IOKA 1FNSA 2A9QA 4CMEA 1EE1A 1JI3A 2G04A 4YJFB 3RIGA 3GRFA 1R74A 1W6RA 4OI2A 4XD7A 3LHSA 1KDTA 5ALZA 2B21A 3KQQA 1EHYA 5I4IA 2II6A 4RY9A 1DCMA 4BMXA 2PSSA 4U2DA 4CL3A 2GHTA 3NEYA 3SNKA 4DANA 3W9BA 4F6LA 2R7MA 5HVNA 4TMYA 4FE7A 4F3KA 4CODB 4K28A 4NICA 5I8PA 4GKKB 2GUGA 3RTEA 2IELA 2D7DA 1Y3AA 3DZGA 1XMVA 3GLFA 5HJEA 2ODEA 3L0YA 4N6OA 3V1NA 1L8XA 5FLXA 4WFIA 1M9NA 2JVIA 2J0SA 4W99A 3ZXXA 3WJ1A 3JSXA 3P0FA 3DB2A 2GKSA 4Z9FA 1GG5A 3F6PA 1Y3BE 2R2GA 3H2YA 3ZHTA 5LDHA 1A77A 1XUOA 1VJCA 1KFCB 4JOCA 5CNIA 3SJAA 1SVMA 1FXWA 2HTFA 4L95C 4EA9A 1I3MA 4P31A 1H6DA 2WYVA 2VATA 3R0ZA 2ZUFA 3BJIC 3CF4G 2QG4A 3VX4A 1M3SA 3A2LA 2EX0A 2ZIEA 4R8SA 1C3LA 4BB5A 4RY8A 4PCLA 1TVEA 2WPDD 1RQGA 2IYUA 2QE7D 4KUHA 4JL6A 1SZJG 2JIPA 1UMBB 3QM1A 5EWJA 3H8VA 3GRVA 2ZE8A 3JAKA 1HDEA 4DT1B 4BNWA 3WQBA 2V54A 1K8XB 3C8HA 2UV8A 5CD1A 2J0QA 3PRYA 1U0JA 2BKLA 4DG9A 4E13A 4LI0A 3BCHA 4REQA 5HTKA 1VMIA 2H2GA 3OWXA 4JI3B 4F8EA 1U3GA 3ZIAD 2NU7B 2Q9CA 3F2IA 4DAEA 3DBIA 2CVQA 4X24A 1ULZA 1JLRA 4L8WB 1KRWA 2EG9A 2PVCA 1L3IA 2VJBA 4X41A 1DQZA 2JH3A 2L2QA 4J1QA 4EJ6A 1PTJA 3Q2OA 4JQZA 3ZY6A 1WTAA 2ZJZA 2BN4A 2G4LA 3ADBA 5KSZA 4LQDA 4CKXA 1ZK2A 4IIGA 2WJ4A 1I3CA 1GA6A 1OD6A 1XTSA 1BJTA 1NNI1 3KZOA 4W5TA 3H5RA 3GMDA 2XMZA 3LF2A 4WMLA 3Q15C 2ZEJA 2X8JB 3OPYI 3TPCA 4AJEA 4URHA 4UBIA 3K71B 2MDTA 4PGMA 1O7JA 5JD3A 1B6TA 2GPJA 5WRFA 1NVWQ 2HDNB 3ANMA 3HCCA 2D3WA 4L6CA 1G2PA 1Z5ZA 5FBRB 4YRGA 3EWAA 4FLFA 3U7GA 3BMCB 3TFQA 4J0CA 1EXWA 1C3EA 1GVHA 4XVHA 3WYEA 2AVNA 2ATIA 3B5JA 2ZB7A 5EJ9A 4FK8A 1J1ZA 1JB1A 3KR2A 4ND1A 4EZEA 2HRZA 3KXKA 2R6FA 4JT9A 1BE8A 2RG1A 4LE0A 1O5IA 4RWZA 3WSWA 4C06A 4D57A 1DC6A 2HF2A 3E9RA 1OW3B 1JIVA 3T0GA 1F6BA 5K09A 5MFZA 1XALA 2QX9A 3L7JA 1SU7A 3WISA 3KEMA 1DIAA 1ZA1A 2C2XA 2P65A 2X9QA 3T94A 2AI2A 3E81A 4F93B 3WJ7A 5KHAA 3B7WA 4AJJA 5KYXB 1Y9ZA 1YS4A 2FSUA 3NEJA 2CLEB 1I0ZA 3I9KA 4WSOA 3CN9A 1ULHA 5JFTA 2QX4A 4E94A 5P21A 5ICSA 2JFFA 1E9FA 3N8KA 4PQFA 5ALOA 1RWWA 2Q2NA 3AB8A 3WWZA 2H08A 3JVEA 1RBYA 1CUUA 3ITDA 3MOIA 4TN5A 3IS3A 1JU4A 4JBWA 2IX3A 2XXBA 2GCEA 3GEHA 4BX9A 3SSNA 3DV0A 5JC1A 1JFFA 1KBZA 1D1QA 2JNWA 3TTSA 3ZKAA 1YHNA 1XPJA 4JR0A 4ZDJA 1SBNE 1XD2A 1GRNA 3NT2A 2O8BB 4CU2A 3GLGA 2IYRA 3C8ZA 4IQFA 4CQLA 3F8WA 2W6CX 3BBPA 3FDZA 2D5LA 3PQFA 1XEWX 3CPSA 4G5HA 3JQFC 3LCVB 4INZA 3FW1A 3G3EA 4M1KA 4MHSA 4OI4A 3MJTA 3ZUGA 3DMTC 1OTHA 5C1DA 2ECPA 2FR0A 1DC4A 2YZ7A 1RZRA 3NOXA 4L0MA 4XQ9A 3W79A 1I5EA 4FILA 3RYIB 4TKUA 2DRIA 2R1TB 4J6EA 3AETA 4PXAA 2OUIA 2PV0A 4JBXA 4TLAA 5KJEA 3WSVA 4MB0A 3UENA 2ZBEA 1CY2A 4GMGA 3EZ7A 3SPXA 4NENA 2Q6KA 3LG2A 4P4NA 4WVFA 4KXUA 2A1UB 4LW8A 5AKJA 4DIFA 2P67A 5A4KA 5KREA 4AU1A 5KX5F 1IXYA 1K27A 3D0QA 3SHOA 3ZVMA 3ETDA 4JZKA 1VE1A 2V7WA 4NYMQ 3ZWCA 4RW0A 5ED4A 3E58A 1K2WA 5CX1B 5DBIA 1XQXA 5DM70 1PBNA 2PGNA 2FQXA 4RM2A 2IY7A 1NJ6A 1BQ3A 4YAGA 2Z9CA 3CLRC 5AHXA 1MABB 1AN9A 1C3VA 3LQQA 3TPFA 3Q8KA 4W5NA 3RKSA 1TMOA 1X7ZB 4UAVA 2XY4A 5AUNB 2QNBA 1HYQA 3S8YA 2BUBA 2W6NA 2CNLA 2HY7A 3FLAA 4JQSA 3UBMA 1XJWA 4L76A 2Y8EA 5SZKB 2XEDA 1GKIA 4QOIA 3NLLA 3EVNA 1PX0A 2DBQA 3KPYA 1NR7A 3L93A 1W0CA 2PIAA 2VL7A 3DQZA 4QTXA 4R6WA 3ND8A 4DPKA 2Z9BA 5JNLA 5FI5A 3KL4A 1UDXA 1ZBQA 2BHRA 3FI0A 4Y9UA 3VPAA 1WF6A 3HI6A 4Q37A 3FMGA 3HUFA 5L4NA 6ABPA 4RIIA 1UXGA 1XMJA 5DE3A 4EHFA 3B52X 1FS6A 2V9CA 5DRTA 1DEAA 2ZI5A 5JNVA 2H1SA 1OXUA 1X7DA 2ZT7A 3AXSA 1SD1A 4H0NA 2ZG6A 3QJYA 4HTAA 1N2EA 5C4GB 4C0SA 5J2TA 1GL6A 4CF7A 2YMMA 4DWVA 3B2EA 1P7PA 2PZJA 3QE4A 3D6HA 4KWEA 4XD2A 5H83A 4JXXA 5JWRA 2C59A 4YMGA 2JS7A 4IGEA 3UO8B 4YMLA 1IG3A 2J5QA 3INRA 2JIDA 3LUDA 2WNSA 1S8AA 2R7LA 1IRIA 4WV3A 1F5NA 7REQA 3EIWA 1BX1A 3BGDA 2MINB 4MS3A 1NI4A 3ZGZA 2AX3A 2V4ZA 1P2TA 2IU4A 2JLYA 5J4LA 2HU7A 5LU9A 1A9RA 2ACKA 4YLGA 1E0SA 3ZTYA 1NNSA 1JAXA 3NDPA 2E85A 1ADJA 2IEDA 5FA8A 3TE7A 5EHQA 1V3TA 4DSUA 3UV7A 4YCJA 3QNMA 1O8BA 1QDEA 2GZDA 3R09A 4UUQA 3OUZA 1QFYA 1U2SA 4GZ5A 1JQEA 3F3SA 4X9XA 1YS9A 2Z2KA 1EDDA 1OWLA 1ST3A 1NJGA 2FEOA 3AHIA 2NTYC 3G8AA 4Z49A 4DV0B 3PS9A 4Q47A 1S3IA 1YZNA 1ILWA 3M9LA 1OKKA 1J9GA 2EL7A 2WF8A 3A3YA 2R00A 3PI6A 4XDYA 2IXBA 3U81A 1G20E 4AY2A 1NQTA 1LTQA 3FVRA 3O83A 4ZAWA 2JFPA 3TDKA 1SK8A 2VRNA 2F17A 1IN1A 1FRFS 2VRCA 1B74A 1CVRA 1RR6A 4Q4JB 1VLZA 5EXSA 4A6EA 3D8TA 2V7EA 1RKVA 1NUSA 2R84A 1NE2A 1VLJA 4ZPXA 3EMVA 1HEIA 1E5VA 1GKKA 1NDHA 3NUGA 4IWNA 4TKVA 5AUPB 3MB5A 3HN6A 5CDGA 2RGNA 5T3YA 1NHWA 3LKZA 4ZZ2A 2GFHA 3PC3A 2PX0A 4FNAA 4HEQA 1D2MA 1KYTA 2Y92A 2IOHA 5A6SA 5AVJA 5EXEA 4E0BA 3FLEA 2V4MA 2FSHA 3H9UA 3H97A 1IJKA 3T95A 4WN9B 1OWOA 1U04A 1V45E 3X1ZA 1MV8A 2Z98A 4KLNA 4ESHA 4QEKA 3PLAE 2RE8A 1EFUA 1D03A 3IAEA 5A7GA 1NG1A 1NBME 2J07A 3CEHA 4P92A 1QANA 4X54A 4RLSA 3U3KA 2V65A 5CIQA 2RGYA 3K0CC 4BO2A 3A2MA 1PT7A 3JCZA 4Q9DA 5FQOA 4YRNA 5LQJA 4LXUA 1ISSA 2HMYB 3BZWA 2ID7A 3DHNA 2IUFA 3KHTA 5CJPA 1JKMA 5AJXA 4MUIA 1TFUA 4RDHA 4W6ZA 2FUNB 1EWRA 4EEXA 2JCYA 5KSOA 1E20A 1KSFX 2C61A 5JAZA 4ESEA 4CIWA 1CCWA 3AEUB 3I5AA 2V6BA 3LY8A 1OLXB 3ORRA 2YVKA 3CJQA 4RE6A 4Z4HA 4KQFA 2HK8A 5K8JB 1XP8A 4J1TA 2VUSA 1L1RA 1AKRA 2XBUA 2MSLA 1QPBA 2Y6UA 4AJNA 4YJGA 4AC9A 4C04A 3KUCA 3K1ZA 4IDDA 4W7SA 4YAEA 2WT8A 3LWZA 3UK2A 1XZDA 5CH3A 4URXR 1D7OA 2VQ3A 4HJRA 1E2GA 5E9QA 1ML3A 4O2BF 5BOVA 3TOXA 4W8HA 3PEFA 5DN6A 5A4JA 1ES9A 4LIPD 2C7GA 1H2XA 4K87A 3B48A 1E59A 4HF7A 1V6AA 1PWYE 4RYLA 4XM0A 3WIDA 1KU0A 4AVYA 2Y1WA 2FW1A 4O0LA 2C5SA 4YMWA 3UJCA 3BMOB 4AG6A 1FYDA 4UDOA 1KORA 3QXGA 5EE1A 4A2CA 4PAGA 1KR5A 3TGPA 2UU9B 3INYA 4P0QB 4NFYA 5JPCA 4RX1A 4CN9A 3RRNA 3EBOA 2VK2A 3NHLA 2UVDA 3FGOA 1ZD8A 3TZEA 5L3QA 1B76A 1N7JA 2Q4EA 1MXFA 1SUBA 1XRSB 2YMLA 3A6LA 4UW9A 1LJLA 4PZEA 4RPKA 1O6FA 5AUQA 4PNZA 4BTEA 3CA8A 4BLRA 1VL6A 3S8MA 1X7WA 2HJGA 1YR8A 1YDFA 2WJAA 5KO2A 1KMIY 1P0PA 3DAFA 1LPAB 1SCBA 2C7VA 2H3EA 2ZJ6A 2ZWAA 2QS9A 4QXPA 1E2PA 2BJVA 5D1NA 4YWJA 3WGKA 4ER7A 4F3YA 2Q99A 3GGSA 4LG1A 1IK4A 2PEYA 3GPCA 4XB6B 2BH9A 1AHIA 3M3HA 4Q3DA 4FZJA 4CF4A 2H2FA 1OZHA 2VJQA 5EKXA 5F7XA 5IFLA 2ZT8A 4Z9XA 3WYCA 1P5RA 4PO9A 4YTEA 3H5IA 5CYOA 5IXYA 3NDIA 3ZY3A 5DMXA 5F9FA 2R66A 4GICA 3SSAA 4M1MA 3SIPA 1PG0A 4EHIA 4G9EA 5HQ3B 2P69A 5CYPA 1GTL1 3ZE7A 4X84A 4LZWA 5HMLA 4DHWA 2IIVA 1HG1A 5JQGA 1BHO1 1MAHA 4P1ZA 1AGXA 1I80A 4EGCB 2IGBA 3UC5A 2IP4A 1DKQA 4NV1A 3RODA 1EP1B 2NO0A 2YZKA 4NCIA 5KU7A 1FVFA 1TW3A 4MKGA 4MMYB 2A59A 1CVLA 3HA5A 4UDNA 1PJAA 3N2KA 3ZHVA 1QM5A 2DVMA 3OM9A 2XUJA 4QM7A 1ITZA 3I2HA 3G7UA 3T7SA 2VPQA 1D0SA 1V6SA 3GARA 1OH5A 1REQB 1U5AA 2ZYRA 1OOEA 4B71A 3DFFA 5BSFA 2PKWA 3TSCA 4BE9A 1O94D 3HB5X 5U4XA 3OQHA 3TL2A 5JJCA 1G3IA 4BLQA 3HBLA 2CCGA 4M7OA 3FSGD 5EIBD 2NSDA 4D0LB 5EC8A 4MQMA 1U7UA 4BEWA 5IZCA 3AERA 4R7TA 1F1BA 4I66A 3NKVA 1ZQ1A 1E7RA 4J91A 4MPDA 3UTCA 2ANBA 3WE7A 1X8JA 4OEHA 2FWAA 3BYZA 1UKZA 2VHTA 3GL9A 1OYYA 3GYBA 3LUGA 2BFCA 2NVWA 4WADA 2I2DA 3EXG2 1JQDA 2JATA 5DWQA 2DFDA 1WZEA 4Y3UA 5BSTA 3O4GA 3WK8A 1AZWA 1JDVA 5DGTA 4FKZA 4JI6B 1U8FO 2Q0QA 1E6WA 4CUKA 3CH4B 5KYYB 2ZIGA 1E9CA 2FQQA 2GAJA 2GB4A 2N46A 4OCZA 4D42A 1MIOB 4UVHA 1FFXA 1PQWA 2XYVA 4WQMA 5DX8A 5JCOA 4H1TA 4OK6A 4RACA 4ZV7A 4FFMA 2FOLA 4F2GA 4BB9A 4RPGA 2QTMA 5EJ6A 3I8OA 2WKSA 2IL1A 4GDMA 3CCBA 2OR3A 3I30X 3VR1A 4GEKA 2UZ1A 4ENSA 1PFUA 3RU2A 4DG8A 1PT5A 2XE6A 2C9OA 3V4FA 3D9QX 3BERA 2K87A 1T1IA 2QVXX 1E2UA 2OBBA 2PMEA 1F8GA 3SYLA 3PCTA 5GAJA 2X0DA 5BUZA 4H6XA 5KMGA 1JKIA 1LWOA 3M6UA 3LQ2A 4LTDA 3VZPA 5K3OA 3HKBB 3P8ZA 2CB9A 2Q6IA 3C3JA 8GPBA 5KCZA 3CZCA 1E2KA 3QXCA 3WNQA 3UJ9A 2PSJA 1IMJA 1I3KA 3L1IA 5T7BA 3HQ4O 2XMSA 5F21A 2XGMA 1P5FA 1F6DA 1WWKA 3G9ZA 3OO1A 3QW4B 4J75A 4ALLA 4ERXA 4WZBE 1Q7BA 1XO1A 3G2MA 4PBRA 4RL6A 3VU3A 4CV1A 3C6ZA 1BWQA 1X2EA 1RHJA 3A1FA 3TR6A 5BWLA 1UMCA 4RHUA 1YJQA 2FGKA 2OV3A 4M99A 1NBMD 2X8AA 4HGZA 2ZPAA 2P2NA 3D6UA 5C7LO 2OQIA 5DMHA 3FX2A 4ZC8A 2CV0A 1F4PA 3IKLA 4TTVA 2Y67A 4CEIB 1MJNA 3C3PA 2GWHA 2XYPA 4HHEA 5ECWA 1M1YE 5L6MB 1FNBA 1WPRA 2IYAA 4M6WB 5JO0A 2C1XA 4F4HA 1JQKA 3MTQA 4G4IA 2QTLA 4JNKA 5DP1A 2VQSA 4AWBA 4DYDA 1L4KA 1R10A 2WJZB 3RC1A 2D6FA 2XDQA 4E5VA 3GR6A 2VN8A 4YP9A 4F9EA 1G5PA 1P74A 1G21E 4P80A 4C7KA 3VM6A 1T2FA 4RV4A 2EP5A 3VYRB 3CIOA 4QVIA 1JYSA 5C51B 4KVGA 4TROA 5H82A 2BGWA 3T5GA 2WTBA 3JZDA 4AB1A 4KN9S 5HE9A 4BFSA 4M0FA 5PNTA 1Z4KA 4K9QA 2VK1A 4PFSA 4RQUA 1N9ZA 2IY9A 4JVSB 4DCCA 1T29A 4HKTA 3AHGA 4QYMA 5BMVA 2XTNA 2QUKA 3G2PA 3GBVA 3RBZA 4NJMB 2XQKA 2JFHA 1LBEA 6PFKA 1PL7A 4QFCA 1I7QB 1PQPA 4X3PA 3A1UA 4FZRA 4YJHA 3A25A 1DO0A 4QREA 5KOHA 1E3DA 2BFNA 1PI3A 4B6JA 5KU1A 3TCNA 3WVNA 3L7DA 1HE1C 1P5ZB 3RYFB 4B45A 1YFLA 4QSHA 4IINA 4YJ2B 4EW6A 3U13A 1USWA 4N6GA 1Z6QA 4PPYA 3VAZA 2H00A 2XB8A 3X1YA 5C8DA 4NXNB 2BI4A 2QF7A 1O4VA 3KKZA 1GZ7A 2LW7A 2UYGA 4JQYA 1QBKC 4LJ8A 1UKVY 2RC6A 3PWSA 3D2BA 3QFRA 1HR0B 3E35A 4DCMA 4A9AA 2H0RA 4WY5A 1T8PA 1H3NA 5DHFA 3Q9UA 4QGAA 5KB3A 2VDKB 1WXWA 3M1AA 4AY3A 1G2OA 1SXGA 5KTPA 5BYKA 1C1DA 2AK2A 4FXOA 4BWFB 1RWMA 1SCJA 5A3JA 2H1LA 2QTFA 4BLVA 1JF8A 5DKFA 1PZGA 5DGDA 1O08A 2IYLD 3AG5A 3KO8A 1B93A 2YFKA 4OF4A 3WGUA 2VHYA 2JGRA 3GT0A 5AFSA 4GP9A 1NKTA 4R71A 3HEBA 3JY6A 1MNAA 4W1PA 1USKA 2VPYA 1KQFA 1SUIA 1KZ4A 2FZEA 3MINA 3AR7A 4KQ9A 2HA0A 4K9OA 4KNYA 3SQNA 4BO0A 4KVFA 2JFQA 1L7OA 2PS3A 1S1MA 4XEHA 2VDMB 2F55A 1IEQA 4IQ0A 2X86A 4WCDA 4BGIA 5JISA 3RH0A 1IYZA 1RI3A 2Z56A 4EP1A 3TL3A 2F7SA 1EFVB 4K6HA 3JD4A 2O2ZA 4TVOA 2ZM6B 4E5PA 1KF0A 3K7EA 4OD0A 4QOFA 1UM8A 5C32A 1SXJB 4PFKA 1CRQA 1B00A 1L4FA 1XTJA 1ZOLA 3ANLA 4K26A 4PC6A 4A7PA 1K7EB 4BN0A 3RTGA 1BFDA 1GGKA 4AICA 2O8CA 1PDWA 5JCZA 1BCRB 2CJWB 3MT8A 2J4DA 3I1JA 5EQFA 5FFNA 4BP8A 5H9WA 2H5EA 3KOUA 4D41A 1CP3A 1I2AA 3GLUA 4D45A 3FNGA 3RFXA 5GQSA 4JH0A 4J2TA 3GHYA 5L51A 1E3MA 1GUDA 1RXEA 2EBWA 5BR4A 5LYJF 2ZULA 3BXPA 2HO4A 2HYIC 3HXKA 1FTNA 2CN1A 3OWOA 4DSNA 2CVPA 4EQ6B 4EB8A 3AIIA 4RPHA 1P0MA 2FH5B 1FW6A 2I80A 3CCFA 2ERCA 2WJWA 3NWPA 1YHYA 4RH3A 1DFIA 1SCUB 2OQVA 4PS1A 4DIMA 2VCHA 4PPFA 5FOSA 3TG2A 3PV0A 2XXAA 2ZYHA 4HLCA 1TTHA 4BXOA 4MEBA 4RNCA 3TS1A 5JXGA 4N0PA 4MQ4A 1H2HA 4X8OA 1JHDA 4V02A 3MPUA 4C7MA 3LCJA 2Q5QA 5E4FA 5GIPE 1U31A 3E3NA 1VSVA 3GGCA 2ETXA 5FBHA 5GTDA 4M88A 1P9OA 5KNBD 3KB2A 3ETGA 4XVRA 1V47A 4M38A 3LPAA 1ZMTA 1LWNA 2ZJ2A 4KAFA 1YUBA 2OLEA 4UNPA 2FRDA 1Z0UA 5H4GA 1W581 2XRZA 3CNNA 5ESDA 1X9IA 1NX9A 1JE1A 4OU4A 4URUR 1D2EA 1B73A 2W2PA 1GPH1 4R69A 3VX3A 4EX6A 4KN5A 4DBLC 4IFTA 3WQHA 1QV7A 2WHYA 4DCGA 4E33A 4Q39A 2GM5A 2VYVD 1WA5A 5LKRA 2B1GA 3FMFA 1QHGA 2ZSHA 4P58A 2WWGA 5FOXA 1NXSA 3ZVLA 5CIWA 1EXMA 1ENOA 1QZTA 3T8YA 1P4RA 3QYJA 2PO7A 3LFHA 4HAIA 1QC5B 4RTJA 4K9SA 2OO3A 2PUJA 4X71A 2NU8A 5LYJB 1E2QA 4P3PA 3COJA 4MHTA 1YTUA 2BM9A 2W9XA 5ALNA 3L7MA 2W43A 4HAZA 3L18A 1OFVA 3IPYA 1GXSA 2E82A 1A9XA 5LZ9A 3A9RA 3C1OA 1JALA 4LMRA 2I22A 4IYJA 3KKMA 1M5TA 2D1YA 2D2FA 5GONB 3RYHB 1E6LA 3M82A 3AIOA 4M3NA 4UNRA 5FBVB 1HQDA 2R0QC 4RORA 2PTGA 1YR2A 3B5IA 2C96A 1ODKA 3ZG6A 3DM9B 2QJOA 2OGTA 4OPMA 2KW5A 4OMDA 4M53A 1DKUA 2M9MA 5SYMA 1C14A 1IG0A 1Z88A 2F4VB 3R7SA 1JDSA 3PYXA 5LIRA 5E4JA 3CJRA 1M8KA 1JG3A 3KM0A 3KQNA 1QCCA 1T0IA 1V5WA 2Y66A 5JO9A 4YACA 3EG9A 4B6FA 5LFAA 2AN9A 4DQDA 4Y2YA 4AS2A 2A0WA 4BCBA 3K73O 5FWYB 1IBKB 3C6MA 4N41A 5HIKA 4PGHA 2VTDA 3H2SA 2QIPA 4GPAA 4MO2A 5HBGA 4BECA 2C9BA 1U9YA 4BATA 3QVTA 3OIGA 2DLNA 2CFRA 2XQJA 1G21A 2HQSA 1SUPA 4OKNA 4XSGA 2HHAA 4M36A 2VT7A 2P6OA 3N8NA 3LKDA 1HE8B 2X15A 4IBOA 4OV6B 3SX4A 5EPUA 4GKJB 3K9BA 2X2PA 3C5EA 3LDAA 1ORWA 3NO4A 4ND6A 3K05A 2M2IA 1P6QA 3BWCA 4MKHA 2DFKB 4ZU3A 3GFSA 2WR8A 3T5BA 3TZCA 3EJWA 3UUEA 4ZVVA 4MGYR 4IIYA 1OTXA 3RF7A 3TLCA 3VDMA 2PMCA 1PIWA 3DAPA 4LHZA 1PX2A 2PWPA 3GIWA 1GLGA 4WEQA 4DV3B 4LMAA 5C31A 3L84A 1X70A 3ORYA 4Y0NA 4PGAA 2FFAA 4Z51A 3IB6A 5AJZA 1R8QA 3SKXA 2C2HA 1KXZA 1XQ6A 1GCUA 3L8MA 1A50B 3W5HA 2OYCA 1G8PA 2FSSA 3VSCA 4BNLA 3DDZX 3G9XA 3U3MA 4HXEB 1M0EA 3PC4A 4UBKA 1XVAA 3JWGA 3HY4A 5DLQC 4V0LA 1T6BY 2GLUA 3Q5EA 2FOIA 3QEOA 3QPBA 3VPBA 4Q1CA 4UDXX 5CW2A 1PJ2A 3ROKA 1BE0A 1K7YA 3JRXA 4Z4GA 2QW0X 5A0VA 1B1CA 5EYPA 2OHIA 5DHSA 2BLLA 2FQWA 2YVQA 4ZI2A 5LZ2A 2R44A 2YXDA 4IV8A 4RKFA 2P40A 3HJCA 5K8VA 1F7UA 1YS1X 3KELA 4X85A 3CZRA 5IUJC 4ZOLB 1MDBA 1D09A 2PKCA 3L1VA 3RJTA 3INGA 1OILA 121PA 4FZ3A 5HKKA 4BZZA 1PFYA 2QX6A 4U00A 1PVDA 4JEUA 4GPTA 4G24A 3OZRA 4ENQA 1DQNA 5BXQC 4GLJA 3HRIA 3QEKA 2JFUA 2AZMA 5IULC 1PG5A 1D8TA 1N2IA 1JVSA 4H6WA 1ZK0A 1Z6ZA 3I01M 2O50A 3A14A 1AS0A 4I7EA 1J8VA 5K3CA 3PHCA 5AM3A 4WGFA 2FPLA 2J9FA 4RJLA 1TIKA 1FUKA 4X1KA 1Y1TA 1UMDA 2M98A 1AF7A 1J0BA 3IB3A 4Q7QA 2XCSB 3EZLA 1YRLA 1M2GA 3AHCA 1XIVA 2RJOA 1AKNA 1JDJA 3TDNA 4B73A 4PU0A 3URKA 2REBA 4X3CA 4XH9B 2YJ6A 2H17A 4RGVA 1NL3A 4Y2PA 4EA6A 4NMMA 4MI1A 3DEZA 3G5UA 1USVA 5F1YA 4WEOA 2XWBF 3HFJA 3TXYA 2GA9A 1P4HA 4MGZR 4YGYA 5EJIA 3TFWA 1BXGB 4A8JC 2FXIA 1KYYA 2G71A 3L4EA 5F5LA 4AJPA 4GXQA 3HCAA 1KDVA 1E3JA 2R48A 1C9NA 5KOJA 1LTKA 1DBSA 3S2FA 3GIDA 2JRLA 1T9ZA 3BTVA 4MUFA 4PPNA 1CB7A 4X7BA 3UIEA 1RQ2A 3FFWA 4RHCA 4LXGA 3SM9A 4C4PA 2LZ0A 2WILA 3GFOA 1V39A 3V4RA 2IEAA 2R68A 4Y7CA 3FUCA 3RHFA 2FWRA 1TK3A 1G9TA 3K2BA 2WVHA 5IKXA 2BM1A 2X9LA 3GZJA 3M3PA 4ZHQB 2CHEA 4BZPA 3CRW1 4UNSA 2G8LA 2FPSA 1Q1NA 2Z1MA 3M6LA 4NC9A 1ND6A 4WN3A 1AIPA 1NATA 1YU6A 1Z47A 4G26A 5A5VA 1VSTA 3OM0A 1GGHA 1YR3A 3K0FB 3ZXYA 2QRKA 4Z7NB 5BV2P 1QIIA 1WXHA 2VC2B 2DUWA 2PQ6A 3AR8A 3U7HB 1U1EA 1V41E 3BREA 3KJIA 4L3WA 5DK4A 1YB4A 5HF5A 3TR5A 1U4NA 1E9SA 3PDIA 3DFMA 1ISRA 1BN7A 1JHOA 2QVGA 4FP9A 4ZYZA 5KYWB 4WFQA 2P9YA 1XAJA 1T4MA 3TEJA 2I7XA 3TO5A 4ETWA 2Y76A 4BNNA 5C7YA 5TPWA 3DOIA 1R6TA 3WXBA 1MO4A 2EFDB 4OQFA 1XRRA 1N5OX 3CYFA 2VPWA 3NKFA 4UCFA 1NVEA 2IOFA 5K0NA 4OO3A 1YZQA 5HBRA 2W4MA 4RLHA 1FCJA 4JUAA 2O1SA 3GGJA 1C0LA 3SHTA 2IYVA 3ONWA 4BWGA 2GTIA 4PXSA 1G5RA 3HLYA 1DCKA 2B98A 5FA6A 1TIPA 4FEGA 4EGJA 1ZKDA 2WG2A 3PXXA 1HXHA 2RGEA 2WYHA 3UJPA 3P45A 1K3UB 1MEEA 2R25B 3DE6X 1LSUA 3K2QA 3MD9A 3W3AA 4UTXA 1EUCA 2ORED 4EB6A 3WRWA 1PJLA 2H1WA 2AFHA 2ZU0C 3OI7A 5IDYA 1U7HA 2R96A 3M49A 1MF7A 1UEJA 2A8YA 3FWHA 3DT6A 4HPXB 5HEKA 3UBTA 3FOZA 3R3SA 4Y2JA 3HMKA 4HSEA 2RDMA 4J0FA 3T7AA 3GUUA 3SXUA 3N5KA 4MUHA 3L40A 1IHOA 3UAWA 3GFQA 5LWHA 1ZD5A 1O54A 2DBVO 5KNCH 4UJ3A 4JXKA 1KZYC 1PVOA 3DAGA 4FMCB 2OT3B 5CLGA 1H0KA 4M0EA 2P6PA 4R6XA 3KYBA 2R8BA 1LV8A 1RE0A 4JLWA 4MR9B 4B76A 2J31A 2ZYWX 4NTZA 4DUGD 3SF8A 4AY4A 4O4IB 1D6NA 3OD1A 4ETIA 3HXPA 1YVDA 2QRPA 1GM5A 4CKWA 4AJKA 4MUGA 1CRLA 1K4YA 2IE0A 1P1BA 4UM9D 4TXLA 2PH5A 1NMSA 3N3BC 3GVPA 1K7FB 3ETCA 3H4VA 3DAYA 4Q03A 5TC4A 4C5BA 2GJ9A 2A5YB 1CEEA 1M2HA 4BL5A 5EHNA 4D4LA 4KDFA 2HT6A 3P94A 2ALJA 1NXTA 2QYSA 2W98A 4QLBA 1EVQA 1JR2A 4XZ3A 4P83A 2NUAA 5JH7F 4LBWA 2QM3A 3C5CA 1M1NA 3E5HA 4RMGA 1YS7A 1B6SA 4WOPA 2K7FA 2QBYA 3AP1A 1N0HA 3MS7A 4DARA 1QUEA 4MUBA 3K6SB 2R8ZA 3UUWA 1SKYB 3D4OA 3Q9LA 4GNRA 2QMEA 3GELA 3DBHB 4JQOA 1GKYA 2EBHX 5C8XA 5BWCA 1M2JA 4IVPA 4KH1A 2F9LA 5JEEA 1I6LA 3Q4GA 2PXXA 4ZYVA 5K0EA 1WZ2A 5THKA 1C30B 1COWA 1V16A 1D2CA 1Z16A 3IDAA 1ENZA 2FQ1A 1E1QA 3E27A 2V5UA 3MWDA 5FIUA 3MS4A 4B34A 1VCNA 2IYXA 2GXUA 3F3YA 5KYUA 4B2LA 5JSZB 2HJ9A 3G0CA 3NTVA 4V24A 1YZUA 1GFIA 2X4LA 1TW2A 2DR0A 1J7JA 1EGMB 1NXOA 4I2NA 2CYAA 1JKJB 3B82A 2FFRA 5CW1A 3VNQA 4RTLA 2PT9A 1CJUC 2I6SA 2V1XA 3C14C 4URVR 3RUDA 3Q8MA 3AF1A 3LQ4A 2A0UA 2IIPA 2CB0A 4PZ0A 2XCLA 1RYMA 4TTPA 1VYTA 4HVAA 4GOKA 1DI0A 2E9SA 1E69A 3D6MA 5H68A 2I3GA 2BZSA 2WWYA 1L7RA 2VIIA 4I9FA 5JD5A 5LU8A 1E64A 4DILA 5CG1A 3SQWA 1Z0AA 4H08A 3FE2A 2G6TA 4JX9A 4QBGB 1V3VA 4LJ6A 3VR5D 1S2OA 1MP0A 1ISPA 1O0SA 3FMOB 2CE7A 4P3KA 5DSTA 1OIXA 3VV2A 4AZ3B 4ZI7F 1FYEA 5D3QA 5HG0A 2PTHA 3MJ4A 3F6CA 5LB2A 3KJZA 2NYAA 1R4AA 4MR7A 2PMKA 3TQFA 5FBKA 3FNFA 1L4NA 1VC2A 1SWWA 2J6BA 1TKCA 3BE6A 1R37A 2Z04A 3IEIA 3SQLA 2AE1A 5BMOA 4NDAA 1U4OA 1GUFA 2PUVA 3BICA 3IIKA 2Z5VA 2DPXA 2FV8A 3H5AA 4UE3S 2VP4A 3F4LA 3SN6A 5GGYA 2GYYA 5AVOA 2Z43A 1Z7EA 2BGRA 3IDQA 2I55A 4FHZA 4B7UA 4I4TB 3D2CA 5FDFA 1N5IA 2DH5A 2FW8A 3D2AA 3PJEA 4IFBA 3CH6A 1ZD3A 3IBSA 3M83A 1ONOA 4B48A 3FCAA 4WDRA 1OI2A 2Q7XA 1NW5A 4W63A 1QHFA 1V11B 2I71A 4BJ1A 1KAHA 4X6YA 3I2IA 1V8BA 1PJTA 4TLEA 2ISQA 3KUKA 4CN8A 1W1WA 3IBGA 4GOMD 3KSRA 5BQ3A 2KBEA 5I7EA 3NV9A 3GA7A 4GH5A 1R6XA 3OAAA 1KKMA 2HA5A 3HO8A 3DE1X 2GCOB 1X80B 4NV0A 2D5CA 2WWFA 4G4JA 4LOHA 3V4ZA 4CEHB 3ABQB 1NVVQ 2RHHA 4Y2XA 4OHWA 3WGOA 2QDKA 4RLQA 5DNYB 4F3RA 1AUQA 1MJHA 1Q7CA 1U0LA 2BGTA 3BIOA 1Y80A 1WKCA 4FCCA 2IYPA 1USIA 2VSOA 1XCLA 3GDFA 4HNSA 4AZWA 1HNNA 1C9YA 5J3JA 2IH5A 1G8SA 2VJMA 2XZOA 4RMHA 3S81A 3HA3A 4KXNA 4GBGA 3K09C 5ED0A 1UBCA 1XDDA 3GPDG 2G9ZA 3M6MD 3AT1A 3QF7A 1ZGJA 2C4TA 4FWBA 4B81A 4F4DA 3F97A 3GLQA 3LW7A 5LZ8A 1YMQA 5BR1A 1JXMA 1DRJA 4EY6A 4YT2A 1T35A 1T0BA 1PNOA 1QO9A 1POWA 4B0PA 4J7XA 4D26A 1D6SA 5ESXA 2AL7A 3NBFA 1DIHA 4YUAA 2ST1A 5LYYA 1QYWA 2UXDB 1G6Q1 4J16C 1XZHA 3VR3A 3W6UA 4JI8B 4HUQA 5T4HA 1E3SA 1SVUA 5J58A 3AB3A 3OPYA 5JLAA 5HYVA 2O5VA 5EQJB 3FWPA 4EUSA 2PRYA 1KQGA 2LVBA 4F4FA 2GCIA 4HXGA 2WTAA 1X38A 2ZOSA 3KYIB 4G0YA 4HC4A 3AW8A 4LRUA 3R0XA 4FTWA 4IWXA 5AW6A 4YS6A 3VU9B 3RVSA 3UJ7A 2YWEA 2RCNA 4FDUA 2I76A