1E6LA

Two-component signal transduction system d13a mutant of chey
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
DKELKFLVVDAFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Towards Understanding a Molecular Switch Mechanism: Thermodynamic and Crystallographic Studies of the Signal Transduction Protein Chey
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 42
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e6lA00
3M9XA 4FE4A 2FEWB 4DN6A 4YO7A 5TQJA 3O1JC 3C3WA 4Z4CA 4JAVC 2LPMA 1M5UA 3DBIA 3A0RB 4JASB 1NXSA 3QELA 4EYKA 2X7XA 5FBHA 1BVHA 2HPHA 3SY8A 1QP4A 3OLWA 4QYWA 1ZVVA 3Q15C 2E4ZA 5BRAA 1ZAYA 3MF4A 4RK7A 1NTRA 3LTEA 1JFSA 2E4XA 4RY9A 4CBVA 4TLMB 1ISRA 4WXMA 4TLLB 2RGYA 3IP7A 4FE7A 2XDYA 3KHTA 2WB4A 4WUTA 4S04A 3LUHA 5HQJA 4LDAA 2JB9A 2Q5CA 1MB0A 2R48A 1ISSA 2JRLA 3C3KA 4RU1A 2FEPA 8ABPA 2GBPA 1ABFA 5DGCA 1OXBB 3VNBA 3D8UA 3F7NA 1JFVA 3HDGA 2QV0A 4Q7EA 3JY6A 5BR1A 2JCGA 1AB6A 3JVDA 1DBPA 1OXKB 4G86A 3FGZA 1XHFA 1Z17A 2MYUA 1L5ZA 4D74A 1JH9A 3OM1A 1JLKA 3IPAA 1CHNA 4YGXB 1A04A 1L5YA 1R8JA 2OENG 1SD5A 4MLDA 4KK3A 4W5OA 2BGGA 3OO0A 3URMA 3H5IA 3F6CA 5EWMB 1LBHA 1EHCA 1JWLA 3IP6A 2FMKA 2PUCA 4KFCA 3G85A 4EYGA 3OM0A 1VKRA 2WJWA 3E3MA 4RWEA 2PKXA 1YTUA 3H6HA 2MSLA 5JNVA 3MA0A 4XAQA 3GYBA 1ZH4A 3L49A 4GNRA 4XXHA 4Z99A 3GT7A 1EWKA 2O20A 1TMYA 2M1ZA 2IYNA 5TPWB 2JK1A 4KPYA 3FFTA 2VYCA 2PJUA 4YV7A 3EQZA 4OLAA 1IIBA 1YIOA 1JYFA 1YK1A 3MM4A 3CZ5A 2FQYA 2HQBA 3Q7TA 1FFSA 1ZESA 3FFWA 4LE1A 4MQEB 3C97A 4KK4A 3CTPA 4OG2A 2DRIA 1EWTA 1PNRA 1P6UA 3FFXA 2IOYA 2PLNA 3HDVA 5KC8A 1GCAA 4ZYLA 5I4CA 4EYQA 3FDFA 1ZHHA 3LUGA 4MS4B 4EVQA 1DC8A 1YS7A 4NCAA 3O74A 3CKMA 5TPWA 5E3JA 3N0RA 2VUHB 4G0YA 4QYMA 4NV3A 5KI6A 2JVIA 4MRMB 1E6KA 4P98A 4MQFB 4O1IA 1MIHA 3IPCA 1QQAA 3DLHA 4MQEA 4UHJA 3RVPA 4W5NA 2ID9A 3VNAA 3OQNA 1GCGA 3CU5A 1M2EA 3IP9A 3H5OA 1VRVA 2W42A 3Q9SA 3KCNA 3D02A 3N0XA 3QX9A 4MS4A 1ZITA 4ZMRA 1XWWA 1JX6A 2PL1A 3N8IA 1LJLA 1U2PA 1RNLA 4PICA 3H1EA 1LBIA 4DADA 4Z4FA 3CLKA 1JDNA 3A10A 4MRMA 3HSYA 1A2OA 1C4WA 3EULA 4IGAA 4MQFA 4MLCA 4NQRA 1JBEA 5IX8A 2KYRA 4O5AA 5IC5A 2QW1A 5TE9A 3I45A 3DGEC 5TPZA 2PUBA 4ETIA 1P2FA 2IPAB 4YWHA 3SNKA 4MR8B 2CWDA 3BILA 3N6VA 4KMRA 3LUCA 5JNUA 1EAYA 3ROTA 3RVRA 3RH0A 3OMWA 3T8YA 5KQMA 1QP0A 3MQ4A 1YMUA 4KRFA 5TQ2B 3K9CA 4KV7A 3EGCA 3P9YA 4WT7A 4YP9A 2JVJA 4PEVA 1DCMA 5IUKC 1VLZA 3B2NA 3W9SA 4Z4HA 1Z13A 1I3CA 2E4UA 5JNSA 4RK1A 4ETNA 2LIVA 4G0ZA 3T38A 4MR8A 1SRRA 4G0OA 4ML3A 3GL9A 4OTZA 3UKJA 3UK0A 5ED4A 5KWSA 1ZH2A 1USGA 2GWRA 2PUFA 5TQ2A 4E7OA 4ETMA 3GBPA 1BAPA 1NY5A 1MVOA 3CRNA 1JL3A 1NXVA 2LP4Y 1D5WA 3CG4A 2PL9A 3GA5A 1URPA 4MPTA 1PUXA 2F8SA 3A0UA 4F11A 2FN9A 1RPJA 3NNDA 4PYRA 2FSPA 4YS6A 3O75A 5DKFA 3TB6A 1QNLA 1QKKA 1ABEA 2IPMA 3DGFC 4L4UA 2VK2A 1TM2A 4JA2A 3RVQA 4D6XA 4D6YA 3F6PA 3QLVC 4EUKA 3TO5A 2IPNA 1Y1LA 1GLGA 5KQGA 3OLYA 5FBKA 1U0SY 4Z9AA 5CNKA 3QLUC 4RXMA 5EWLB 4EYOA 1EFAA 3H5TA 2PAFA 3KYJB 2FN8A 3FMVA 4XASA 1DZ3A 1S8NA 1PEAA 3I09A 3I5AA 5KC9A 5JS1A 1A0OA 5TPZD 1Z2EA 2F8TA 2WRZA 3HS3A 4OLBA 3C6QA 4F3TA 4EVRA 3KTOA 3H75A 5JNRA 2JVKA 3IP5A 4G0QA 2QVGA 2NT3A 3EQ2A 3T6KA 2H0AA 1E6MA 3H1GA 3OLZA 2FW0A 3ILYA 5C5CA 3NHZA 4EY3A 3E61A 4Q6WA 2FTKE 4H3HB 3Q7SA 5DCLA 5JS2A 2QZJA 4H3KB 2LUOA 4N03A 5EWLA 5C5EA 4IF4A 4ZPJA 2R4QA 2WWVD 5IEBA 5IEJA 4XARA 5HSGA 3T95A 4LE0A 1RXEA 2FMHA 2NZVG 4JB2A 1DP4A 1P6QA 4FB4A 3KLOA 1FSPA 4KQ9A 3HEBA 4HNSA 3NNSA 4ZMSA 3H1FA 2M98A 3LUKA 1KRXA 2P9HA 4F06A 3CNBA 3JPYA 3O2QB 4OBBA 1DCKA 3K4HA 1DC7A 4HYEA 2PUDA 4M88A 3OLVA 1DBWA 1ZDMA 3O2JA 1SXHA 4LRQA 3O21A 4JP1A 1D1QA 2MYTA 3KS9A 1T34A 1ZGGA 3CG0A 2PUGA 3RVOA 3RVLA 4QICA 3HUUA 2YHAA 4DQDA 4RK6A 4N41A 4OATA 5HKOA 1J56A 3HZHA 1HEYA 1RXIA 3BRQA 2FMFA 4H60A 2PUEA 3L6UA 3O2SB 1GUBA 2L17A 3A3KA 3CS3A 3OO1A 4Z9BA 4ZJPA 4PZ0A 1Z16A 1SXGA 3KYIB 3H5VA 3HK2A 2V0NA 1USKA 3MIZA 4YCSA 5KQPA 2YHBA 2A9PA 2CHEA 3CZCA 3KG2A 4Q6BA 3G1WA 4Z4EA 1QP7A 1LK0A 4L85A 3UUGA 5CNJA 4JB0A 3MMNA 3GV0A 3GBVA 1F4VA 5DTEA 3H5WA 1JDPA 4YRZA 4W5QA 3KJXA 4B09A 3RQIA 5EWJA 4XLTA 2HSGA 1QQBA 4WZZA 4EVSA 1FFWA 4RK0A 3QLVA 3HM9A 4W5TA 1RZRA 1VPWA 2NUBA 4RZSA 1ZN2A 1U04A 3N75A 5TQ0B 3QLTA 3O1HB 2FLKA 1W9HA 1U8TA 3N53A 3QLUA 3RVKA 2PE5A 4Z4IA 2ZAYA 1D2AA 1QMPA 5GQSA 4NCBA 4N0PA 4QPJC 3LUJA 1KGSA 4RKQA 2QXYA 1SXIA 3HO1A 4MS3B 2I6FA 1BA2A 3BBLA 5T7BA 1CYEA 1M2FA 2A9RA 1GUDA 1DRJA 3N0WA 3JS5A 3QEMB 2WY2D 2RJOA 3ILHA 2FXIA 4GPAA 1NXWA 5F64A 1JYEA 3M9WA 1FQWA 4IMJB 1F51E 3LFTA 4RXTA 5T3YA 3CFYA 3HV2A 3NBMA 7ABPA 2CD7A 5HM6A 3HXMA 4MYRA 1MAVA 3EAFA 3LKBA 4W5RA 3MYYA 1Z15A 2MYNA 5TQ0A 6CHYA 3OLXA 4RV5A 1JHZA 3OMXA 3JTEA 2A9QA 3KSMA 5IULC 1DCFA 3HJFA 5CNIA 5B3JC 1H9CA 2RJNA 4EGSA 2NT4A 1TVMA 4MS3A 4E7PA 2NZUG 4TMYA 3RVNA 2H3HA 3QEMA 4RXUA 4WWHA 4YR7A 2QVCA 4HNRA 4PE5B 1DJMA 1BDIA 2FQWA 1DRKA 3QEKA 2R25B 5FWYB 2HQOA 2FQXA 4S05A 1M5TA 3EODA 2RDMA 4Z4GA 4UHKA 4IMIB 3RVSA 5CHYA 3NHMA 5KQLA 1CEYA 4YLEA 3LOPA 1Z18A 1Z2DA 2FVYA 4Z0NA 3H5LA 2FLWA 1D1PA 1XHEA 4RK4A 1PHRA 2VUIB 5BQ3A 6ABPA 2CHFA 4MAAA 1YS6A 1NXOA 4LZLA 4TN5A 3RVJA 4IRXA 2JBAB 2QSJA 1YK0A 2B4AA 1MB3A 2E4YA 2ZWMA 3C3MA 4RKRA 4RY0A 1RZRD 1E6LA 2MYPA 3GRCA 3JVIA 1ZY2A 4KVFA 1NXXA 1JFTA 5FWYA 5IUJC 3SAJA 4F8JA 3CHYA 3SQNA 3DLBA 2E4VA 4O1HA 2AYXA 1NXPA 4LX8A 3Q41A 3HCWA 4G0XA 4MR7B 4RDCA 5IUNC 3OQOA 1BDHA 5GOTA 1QO0A 3S99A 1LJUA 3F73A 2MSKA 3TMYA 5FWXB 2IPLA 5D2CA 3I42A 5CNMA 1AB5A 3ROFA 2JBAA 3QK7A 4N76A 2IKSA 4RK5A 1KMIY 4JOQA 1DG9A 2L2QA 1TJYA 3LMKA 2AYZA 4N0QA 2QR3A 4KZKA 2PUAA 2WJAA 5EWMA 2E4WA 3NNNA 1YVUA 4MR9B 1QPZA 2MSWA 4P1ZA 1PEYA 1NXTA 2L19A 4G0PA 3KKEA 4WXEA 1WETA 3BRSA 3BREA 3EDCA 5EWJB 4KNYA 3HVRA 5ABPA 4MR7A 3TX6A 3HUTA 1PNTA 3JPWA 4KREA 5FWXA 3M6MD 2OQRA 1TLFA 2TMYA 5PNTA 2WMYA 3DZDA 3LUFA 5JNTA 2HQRA 2GI4A 2L18A 4Y9TA 1E2BA 1Z25A 1B00A 2FEKA 1P8AA 2J48A 2GKGA 1UDRA 1K68A 2A9OA 4RSMA 5B3JA 1Z26A 4LE2A 4KQCA 4MR9A 3EJWA 3R0JA 3O1IC 1ZGZA 4RY8A 1NATA 3RVMA 1APBA 2R47A 3Q7RA 1JF8A 4HNQA 1KRWA 5BRJA 4F12A 4MGEA 5IBQA 1W25A 4MS1B 3SG0A 1U2QA 1YMVA 3QX8A 2P4UA 3LUDA 3H6GA 3LUAA 3QELB 2LBPA 1FFGA 1DBQA 2QU7A 9ABPA 2GX6A 2N9UA 2PMCA 3SM9A 4N47A 3TD9A 3OQMA 1C0EA 1USIA 4XFKA 4IILA 3IDOA 2HJ9A 1K66A 2FMIA 5DLEA 2FKAA 3LKVA 2B1JA 3KLNA 4LDZA 4NICA 1BDJA 2ID7A 4G0MA 4RS3A 5JNWA 3GWGA 1QO0D 1D4ZA 1EWVA 2IDMA 4G97A 1Z12A 4MS1A
chains in the Genus database with same CATH superfamily
2BRUC 3O1JC 3C3WA 3S68A 3KZCA 5DNUA 1U2SA 1M5UA 4DPLA 3CV3A 3A0RB 5AP9A 3EISA 2QRKA 2P0AA 4C01A 4GPZA 2FW8A 9ATCA 1DAOA 1TIBA 3C4QA 3PFIA 1P7PA 1HORA 2CBXA 1Z8NA 5C37A 5J4KA 1ZVVA 3QX7A 5L7WA 3EVGA 3QI2A 4E03A 1ZP6A 4HLUC 4G01B 1ANKA 2R8YA 3B53X 3GY0A 2X5XA 4G67A 3EIOA 4KLAA 4OB7A 1JPVA 2A92A 4HS4A 4IP0A 2RHTA 4JJ4A 3HB7A 4DL9A 1M1YA 3KE8A 3L46A 3A1WA 1XNGA 5HQ3B 4XWYA 2L42A 2W8BA 1CUFA 4B1FA 4EFMA 5K8TA 3RSLA 1PR0A 8ABPA 1JDUA 3ZHYA 1J23A 1JJFA 2DUJA 3AM3A 1FUKA 2ODTX 4XWTA 4EELA 3BS4A 4F4UA 3IT0A 5C8DA 1VTKA 3ZDEA 4NXNB 3L5KA 3L8MA 2WUGA 7GPBA 3R9IA 1NX9A 3OD5A 4DC0A 1YO6A 4ND7A 3TTSA 1CVIA 2EX4A 3FYDA 3K5WA 3OFKA 3MFYA 3UO8B 2ZIVB 2NQ2C 4X1YA 5AOAA 3MCZA 4HH4A 2M2IA 2VHZA 3COWA 3VO2A 4DLWA 3CNLA 1OLUB 1T0UA 4ZO6A 5EP2A 5A4JA 4II2A 5E9JA 5JAZA 4ZQFA 1NG1A 2ERXA 1G1AA 1WF3A 1UC9A 3F6CA 5ALQA 2XT9A 1YONA 4JT8A 3PEFA 1YZUA 4KJXA 2VF5X 3L41A 4ZCQA 1A9TA 1KI2A 3VV2A 2R6AA 3GROA 3LZDA 5K3DA 4AUNA 4CLOA 5FTLA 4GNRA 2C61A 2CVZA 4FD3A 4PPQA 4R2MA 5CLHA 2OILA 3WG9A 5LQNA 2QX9A 3ICPA 4HH0A 3DMPA 3JATA 3PIIA 1SCJA 3H1TA 4N49A 1TYAE 2AX3A 5AHOA 1A8QA 4TZ6A 3MMZA 5I9MA 2RG7A 4PFJA 5FQNA 4RKFA 3AOEA 4FDUA 5EP1A 4ES6A 3V8MA 4U2FA 1U2TA 4WHMA 4BKUA 2O59A 3RYCA 1TJ3A 2NSJA 3T7JA 3L6BA 2HCRA 2IFTA 2Y1DA 5IDYA 3ZEIA 4QXRA 1XMSA 1D3AA 2B34A 4UU1A 3TKLA 3WMFA 1EBBA 1ZHHA 3OZSA 3W1EA 5IZ4A 2QN8A 3E0XA 4DUZB 1WXXA 4AYXA 1DKNA 1SQ5A 5GZ3A 2WM8A 1HR0B 3P20A 4KO2S 4BUCA 2XXAA 1B0AA 2AG8A 4IWNA 4GW3A 3PUXA 3UYKA 5K6AA 4JP8A 1XV5A 1NNEA 5D3MB 2XVMA 4MUGA 1RYDA 4O1IA 1QQAA 4HNHA 3S2UA 4QXPA 2EJBA 5LXTB 2D4HA 4DYDA 5JR3A 3VYSB 3DMNA 4FINA 4PX2A 4ENRA 2HO5A 2Q46A 3HVJA 2PGNA 3R7NA 1KP2A 1ULZA 3EGIA 3VBCA 1RXCA 2A94A 2E37A 4MHSA 5KVCA 3DPIA 5KYGA 2QR5A 5G4KA 2ATCA 2VQFB 3L05A 4ZMRA 1JAZA 4K9QA 3LPMA 1EDZA 1K7CA 3DMDA 2GXAA 1G64A 4GGOA 4GM0A 5D6OA 4QDKA 1IY9A 3DR5A 5CA1B 5EIWA 4DADA 3P0HA 1NBIA 5KQLA 2BMAA 1WDWB 5TT0A 2R62A 3X1XA 5CM9C 4KO1S 3ACCA 2HZBA 4MQFA 2VPYA 4BX0A 5C1OA 5IKPA 1OILA 1W9MA 4CMEC 4HGRA 2YHUA 4D96A 4AP5A 4RNDB 1FBTA 1SK9A 1L7EA 1TYEB 3DBLA 5KNBH 1E0DA 4MHTA 5KDOA 5KINB 1IXSB 3OMLA 3ZLJA 1XRNA 3C8ZA 4Q4JB 1TPYA 2ZUUA 2AE2A 5FHRA 1C8VB 3PPXA 2G9ZA 3MG9A 3T7TA 5KDDA 3Q7EA 2BHLA 2AG0A 3I92A 5FUBA 3AR9A 4E3WA 1EFRA 1QP0A 3AJEA 1BEZA 3COZA 3O8OB 4IZOA 2W83A 3SKVA 1I4EB 3X2SA 2VQEB 2Y76A 1AQYA 4WT7A 5CM2Z 1R0RE 5JSHA 4BWFB 2R1ZA 1XQWA 1VIVA 3B2NA 3RTEA 1TC1A 3EASA 1DOZA 3ZVMA 2ET6A 3VNVA 4P81A 1A8HA 5BSKA 2VO1A 1UWLA 2ZRIA 5BORA 4ROSA 5JBQA 1B3BA 4KWHA 3VA7A 1IE3A 2G6BA 1WSBA 1SRRA 1WWKA 3GA0A 1EE2A 3NC0C 3H0CA 3B51X 2YVLA 2FWAA 4HYTA 1PG5A 5DYYA 1T8YA 1TVEA 3UKJA 1NMSA 3UQYS 5JH7F 3THWA 3ZG6A 2O19A 2HF7A 2ZANA 3AYZB 1ZH2A 4X7RA 3I3SR 4ZIRB 1TGYA 2JCYA 1PT9A 3NC4A 1ODKA 1T3LA 1U5AA 2ODNA 2ZYTX 3L8CA 4QGGA 1EJBA 4D4GA 3T7KA 2OAP1 4A7PA 3JX9A 3WL8A 2XZDA 4QHYA 1P75A 2DUMA 1NA5A 4YJHB 1HSZA 1JJAA 4P08A 5TGTA 1RD4A 4FUQA 4CI9A 1SWWA 1JAIA 4GOXA 1FYWA 1GN8A 1ZK3A 3RDPA 4JK3A 1ZCZA 4JROA 3CZRA 3M6UA 3ZY3A 2R2AA 4QYIA 3GRYA 1RP1A 1ABEA 2AFHB 2PV0A 1QFJA 3KKOA 3OCJA 3BK2A 5DMXA 4C29A 3MUOA 1IFXA 4ZDWA 3AMVA 2VK2A 2G40A 3WS7A 1UFOA 3R9XB 2EJCA 3IERA 1GDHA 2I78A 2ATEA 3CURA 4KX5A 3K0SA 3OKCA 4DBLC 3RREA 3O95A 2I54A 1XQ6A 2ZRGA 3E7WA 3TLZA 3TZLA 3H5TA 1G9SA 1KFCB 1E3DA 1LBTA 4YMWA 4QRHA 3CUWA 5DN9A 3NDRA 5AVVA 4QNRA 3HN7A 1WNTA 4LXQA 5BQFA 1IL0A 4B4KA 4QM7A 2VTDA 2OV3A 2G9VA 2C97A 1TEHA 3H87A 5LP6B 1CUSA 4J7CA 1EX6A 3K9LA 3CNEA 4CG1A 3E7XA 4EHBA 1AK1A 1D2NA 3H75A 3WGHA 3EFOA 2VAWA 1UKAA 3A58B 3BJEA 3Q72A 2F3QA 2OCIA 2DR2A 1GEEA 3ADBA 4FE3A 3CKYA 4B4DA 4HK4A 1QGED 4BRUA 3DEKA 2YXDA 5E0KB 4DIUA 2HT1A 1S6YA 4KJZA 1V8FA 4MV6A 5DX8A 3UOGA 2AN5A 3LT1A 1O58A 4DSOA 1T9BA 2ZQZA 3EVTA 4MVJD 4XARA 1XTKA 3O93A 4LE0A 3KQNA 3HPRA 1E1MA 2RHLA 1KVUA 2A0YA 3IQIX 2IZ1A 3W8DA 3HLYA 4ADSG 5B6IA 1LQ2A 4DA4A 4TWAA 3D0OA 2I3GA 2X2PA 2HCJB 2ZSFA 5EOVA 2JI4A 4M83A 1K7EB 4YRJA 4JN6B 1FJGB 2EYQA 4F06A 1KRXA 1E79D 1U1CA 2DPMA 4OHFA 4UUMA 1NIJA 4XQ9A 5F3DA 4ZYUA 4JJIA 1DSSG 1ORHA 2EDAA 3KSAC 3DG9A 4MZXA 4UM8B 4ZOBA 5CG1A 3JQRA 4EI8A 3BPSA 4O4IB 1E9EA 1XC7A 3I5UA 1YHZA 1I0LA 4B6GA 1OIWA 1REQA 2GUGA 3GHYA 2EERA 2OB1A 2ZSEA 3IVAA 3VBEA 2EJVA 3CRRA 2C92A 2OG2A 3NB0A 1VGRA 2O8VA 4PSCA 4TYMA 4E5KA 2FGKA 2IV3A 3WKDA 4IVQA 3H9EO 4EUNA 5AKXA 2OBYA 3AIOA 4MTCA 1DWOA 1J2EA 3AX6A 4CHTA 3BXPA 1EUCB 2YS7A 3AKYA 4YRTA 2VA9A 2VDPB 5FT9A 2OKGA 3LL7A 1KO5A 1H5QA 1TJNA 2AD5A 2PNJA 4BQSA 2AFIA 5JZ9A 1VJ5A 4URWR 3MIZA 2ZRPA 2RH5A 3MCTA 4I1SA 1H66A 4KTTE 2CHEA 4L8VA 4LOLA 4A10A 5BQXA 5K0GA 3S7TA 4DR7B 5M3BA 3U3ZA 3OFSA 4AZWA 3LG2A 4Z4EA 1MJHA 3N0TA 1CF4A 1RCTE 3AFNA 2HRCA 4HAOA 4C0AC 5L7YA 4WGFA 3GJQA 1QLHA 4JLSA 2AZTA 2Q1UA 4KBYA 4B71A 4QGFA 4D97A 4CTMA 2DBVO 1U63A 2A1TS 3RQIA 1K92A 4DF3A 2OGUA 3B6MA 2O7SA 1U3WA 3KEOA 3HM9A 2ZBQA 2PUWA 1E7YA 1KAOA 3DZKA 3KFVA 3S2YA 3UCXA 3UMGA 4A6DA 4Z4IA 1SCIA 3A14A 5HZGA 3KB8A 1KDZA 3EGXA 1AMOA 1HE4A 2IK8A 4NULA 3CINA 2AKEA 3H1PA 5AKHA 4JYBA 1D8TA 2NVWA 2NXWA 4OF4A 5C7OO 3B48A 3KJGA 4B85A 4BP8A 2I6FA 1ORDA 4I4NA 4YMTA 4ARSA 1GUDA 4UVDA 3U60B 3B20A 2G80A 2RJOA 3K2QA 3PVZA 1BROA 2X58A 4DR4B 3EGEA 1J8QA 1F4LA 3QPVA 2G9UA 3RFXA 1SIWA 2CJPA 3HN2A 3P9IA 2HU2A 1VPDA 3EAFA 1RLIA 3G23A 1NW7A 2Z09A 3LKBA 5KNCH 1KMCA 2IS2A 4HDQB 2ZR0A 4K8OA 3FDZB 3S2GA 4PC7A 2DKNA 3OLXA 5B2EA 4LF5B 5KKNB 2H48A 2A9QA 2IP2A 3DPUA 3ELWA 3H2IA 4XDYA 4X61A 1H9CA 1DO2A 1HZJA 4MV9A 4M0KA 1GZ6A 1K6MA 3AETB 3OCUA 4BU1A 3PX2A 2WG2A 4RFLA 4W7HA 4DE5A 3DDHA 5AW3A 5M7EA 3HB5X 1ML4A 3T94A 5IXSA 3DHVA 1E2QA 3NTUA 2OYCA 1XEWX 1Q20A 2BFDA 3GLHB 1DRVA 1FX0A 1K08A 1N75A 2YVKA 3P9XA 1F20A 1PJSA 1RTKA 2QRHA 1M7HA 3ZY6A 2GHIA 3CYFA 3MXTA 4H7PA 2Z04A 3IOEA 4HDNA 2GZHA 3WKCA 1EG7A 4GE0A 3HQ4O 2CDNA 1C3OA 3SEZA 4RK4A 4WL0A 3RSFA 4DA6A 4BNTA 4RVOA 1H4SA 2VRCD 3OD1A 4ITVA 2QPTA 5K1ZA 3TQRA 5BNTA 2GBIA 3LE8A 4FX5A 4XPZA 3AHGA 2X4DA 1XCBA 1M5RA 3ZYCA 1DKQA 2ZROA 2HMWA 2IVFA 3QTBA 1YK0A 4TTQA 1PI3A 1U02A 4BUZA 1W35A 4QG3A 1XMIA 3O4JA 3ZWDA 4ZRNA 3WHIA 1BWSA 4UNSA 1SQ6A 4ZRMA 3NDBB 3MJFA 4QAQA 1W1UA 2I3DA 2YVUA 4GOLD 4PQFA 5JMTA 2JEOA 2INGX 2YL2A 5CBKA 3FUCA 1NLZA 4F93B 1N3YA 2HNKA 2CHUA 2QW8A 3DLBA 1CTQA 1TRKA 3B6IA 3DC7A 5IAOA 1N8SA 2KMLA 3N8HA 4GR5A 4E30A 1RWNA 3BM5A 2AYXA 2Z8YM 3NVDA 3SQXA 3ORHA 1N2CE 3IUYA 1Z62A 1U2GA 1MC4A 3OOEA 1PFGA 2IPLA 3K9GA 1W96A 4TKVB 4UDXX 5FWXB 2Z2JA 1S2GA 2XNCA 2X5OA 2SECE 1XLVA 4XD7D 3AF1A 3GPCA 4YAEA 4FBMA 1TJYA 3JVEA 1G66A 2XA9A 3KHKA 4EFNA 2AUMA 2H2DA 1GILA 4F1KA 2FZGA 1SXJA 3VR5H 1QPZA 5MGNA 2MSWA 1JTEA 4P1ZA 4FR2A 2QBYB 2YJTD 3KVOA 2QDKA 4ASUD 4WXEA 2W2PA 4OKSA 2RKOA 1G41A 4AROA 4MUKA 1F4PA 4H31A 5I5EA 2FF5A 3A1VA 2HKIA 5B1DA 4HRAA 1YBHA 1KBOA 2WMYA 4DMKA 1M34B 2R44A 3DZDA 2EV9A 4KPGA 2V7EA 5F78A 1U11A 1G8JA 2AC2A 1CVRA 2VJMB 3ASZA 3BWEA 3WJAA 5JHHB 2A9OA 1DKMA 2OZLB 2Z6VA 1X7ZA 3B36A 3BRWD 5LKRA 1T4CB 5IWAB 3OT1A 3EEBA 4U63A 1NU8A 2H0RA 2R6CA 3R0JA 3O1IC 2C0PA 3P0FA 4B81A 4CMBA 4WXYB 4IH4A 4JJGA 4WK4B 1IY1A 2GBGA 1CUWA 5HS4A 5BSGA 1GPYA 1NBMD 1GPWB 1RC0A 2GASA 1CUEA 2Y4NA 4JXJA 4CNQA 3LVBA 4DUGA 4MWTA 5A62A 3U7HB 5HBGA 4AQDA 3A3YA 3LUDA 1LDMA 1MNQA 1ZQ1A 5FH9A 3HXQA 2ONZA 4MNTA 5BUSA 4CMHA 4B3JA 3L18A 4WFJA 4RBNA 3X43A 1I0ZA 1OI4A 1MQ8B 2J3EA 2Z1MA 3ESZA 5H5JA 3TAXA 2I3AA 1E66A 1R74A 2WIDA 4PR0A 4BO3A 4O2BF 4R1PA 1WSAA 1UP6A 4IJUA 3NXSA 5GVSA 5KWVA 4AF7A 1K7SN 2Z08A 1HT1E 4M7OA 1QAOA 2LVBA 4NICA 1BIFA 4WKNA 3JVUA 5LZ5A 1XAIA 5B7QA 4L8YA 3H8JA 1LZKA 1Q84A 4CKZA 3U16A 3DT9A 3VDQA 5A0VA 1ONOA 4KFUA 4LX0A 4M53A 3W34A 1NPTO 1RT9A 2VG8A 5FKJA 5FOXA 1XZEA 3G2HA 2REBA 1WD5A 3C7TA 1NJ2A 1TZJA 1WCV1 2VBCA 3DZFA 1GCOA 5KMGB 5EJ5A 2C94A 4J29A 4WLOA 1BVRA 4J3JA 2VPQA 4JL6A 4WECA 1OSNA 5JXGA 5KTKA 2E4XA 2B2XA 3ZXIA 2RH9B 2R85A 5M5BA 4D26A 2ZWVA 1GM5A 5BR4A 3DWEX 3HYNA 4QWMA 1HX7A 1Q3HA 2IZOA 1I1HA 3D8BA 3RIHA 3P9NA 3R3HA 4DTCA 1EXMA 4E5PA 2QL9A 2XA2A 3KDSE 4UQOA 4EI2A 1HYEA 3R8FA 5B1YA 1JFVA 4PG8A 2IHVA 3NIFB 1N2BA 1DX4A 4U6QA 4YQEA 3T99A 3MWEA 5C3UA 4DNPA 3MPUA 1Z5VA 3CC8A 1MXFA 3H9JA 3IELA 5KOHB 4NDAA 3PUWA 3W8FA 5FYDA 2PL3A 5IJ9B 5EINA 4L02A 2ZI4A 1U9IC 3L6CA 3L7MA 1R8QA 4UBIA 3WFIA 3CUVA 2WJPA 3D59A 4C2UA 3G5AA 4RHXA 1UBCA 2GEJA 2CN1A 4KUEA 4KXYA 4BP3A 2QMUA 4NEQA 1ZK0A 3KKLA 1GTZA 4C03A 5AVWA 4OHMA 4DJDC 3AIIA 3L07A 5E4TA 4QDTA 2Q6OA 1ONBA 1N5IA 3O9VA 1FYEA 1HZZC 2J08A 3MAGA 1AN0A 2OK8A 3CA8A 4FNMA 3I4CA 4HN4B 4I14A 4P35A 1E3JA 4QBKA 3P0JA 2V59A 4QGAA 1JLMA 1AKYA 5FCDA 5IU6A 1XNRB 3ZIDA 1DTWB 1PR5A 2BR3A 4HWRA 3W3ZB 2QDXA 2Y0DA 4CTNA 1YBMA 2VJPA 1CRQA 2ECOA 4QJ5A 1Z0AA 2YC2C 1IM8A 2JK1A 5K8CA 3ZR4B 4BOYA 4DSAA 1GGEA 2YV1A 3LDAA 4L6IA 3U6KA 1X7XA 3IP8A 4P5PA 3BBPA 3GFVA 3I1FA 2AZ4A 3FIUA 4WGGA 4QLBA 3Q0EA 5J5AA 1A9SA 1Q92A 3AIKA 2PEYA 1H2RS 2CXXA 3TBHA 3I32A 3AKZA 1W73A 5A6VA 2H1OA 4DB2A 2BI4A 1HMYA 1CR6A 4MQEB 1N78A 3WAGA 4E2FA 3C3PA 3BMOA 4U8GA 1DIOB 3A9TA 4M9UA 1CQJB 4KSBA 4AMGA 4DZZA 1ZJWA 3ZNQA 1XD2A 1JBKA 3H99A 3UEOA 5DK6A 1PTJC 2MTBA 1N2GA 3FDFA 3NBFA 5A4KA 2WWFA 1DC8A 2JHPA 4KE7A 4RIEA 1XPRA 3FVQA 1AHPA 3HCRA 5K0NA 2PQ6A 1EH5A 4RGQA 4MUAA 4ZGWA 2YMQA 4R1SA 3JARA 3PVCA 4ND8B 5I8WA 3JASB 2P75A 5ADWA 2UXDB 2BTQA 4RIIA 1WXQA 3CLUC 3A36A 3WK5A 4OP2A 1Q2XA 1ZR4A 4QPPA 4CKCA 4MB2A 3AR2A 4QDUA 1Y1KE 2OD2A 4FQ5A 2VBGA 3INYA 4IIGA 3QE4A 5H70A 2OWDA 1NNUA 3EXHA 4J1TA 1RYFA 2EF0A 2JLYA 1DT5A 3LT5A 4GOND 2OFXA 4LXYA 4QD3A 4XPIB 2HR1A 3EWIA 4YLYA 1M54A 3BMXA 4K1LA 4Y9UA 1US8A 3WKBA 4C06A 2QKYA 4GVPA 1BW9B 4K6KA 3R3XA 4UTVA 1XKQA 4HLCA 2O8BB 2IUEA 2QVXX 1EK2A 4EO4A 2PL1A 3IR7A 4P36A 1UPCA 2DH5A 4KHPB 4MWEA 1OWMA 2PT6A 4KGZA 3A10A 1JIUA 3PQEA 4CUKA 4R2KA 4O6VA 1A7UA 3S2ZA 3SD7A 3SQLA 4A8JB 4M0LA 1RQGA 2KYRA 2OV6A 2DBYA 3OH8A 4IMRA 4PLCA 3EK2A 5CVUA 5IC5A 2PN1A 5ETJA 2RAUA 1YVPA 4X5OA 1ARZA 3X1YA 4B31A 1T5HX 1L5FA 4ETIA 4Y8VA 4DMCA 4FHCA 1AZTA 3PKZA 2J4CA 3U2QA 3NV7A 1Z47A 5K3FA 2CBZA 3V4OA 3VC3A 1YRHA 2GFIA 5AXAA 1EAYA 3QU2A 4E2YA 4AW9A 3OZAA 3VX4A 1NZDA 4HFJA 3VPHA 2GJ4A 5K05A 5JZBA 5KQMA 2I2BA 5L9AA 4HD8A 1T6XA 1BKYA 5CAEA 5C31A 4L8WB 4DDHA 2AEMA 3WHKA 4ENTA 2Q2OA 1RPNA 1UPXA 3Q87B 4QWWA 1A8UA 3BIJA 3TI9A 5TY0A 3QKTA 3SP1A 1E3QA 2I76A 3K31A 4QXQA 3EXIB 1X9HA 4Z4HA 1VHQA 4B7AA 4R1NA 4RE6A 3RLIA 3V1TC 4BFCA 4I6EA 2Q9AA 1KI4A 1CRZA 1QIKA 1E9SA 2QZ9A 3EC2A 3IIJA 3HC7A 3P5SA 4TKUA 4WKCA 3V5NA 3MS7A 2IX3A 3HCDA 4JQOA 4HNTA 3W2FA 1LNSA 1OWOA 3VUFA 1YKGA 1DC3A 1JHQA 1FYFA 5AJXA 2FG7C 1PT7A 1WXWA 2ZYSA 4PINA 3MCWA 4V0ME 2O14A 2QD2A 4MH0R 1T3TA 2E49A 1UT6A 3KRTA 4MPTA 4Y2SA 1XDBA 5FFMA 1SU8A 2W2OA 1INLA 1MV8A 4TVKA 4ZKEA 4CM9D 4L57A 5CFZA 2PVSA 1RIFA 3DMHA 4FW8A 4OHUA 1W46A 1DIAA 4OB6A 4PZZA 5H0IA 5COAA 1WZUA 2QAGA 3BICA 3BD8A 3RNLA 3DGFC 1A71A 3ZXXA 2IRWA 4NMHA 5I6DA 2PA3A 1TM2A 2XJ9A 4QOIA 3DZIA 1I10A 1FDUA 1XCJA 1SULA 5T41A 2ZDQA 4FMBB 1CDEA 2K6GA 1LSUA 1YR7A 4JUBA 1L4KA 3CN9A 1A50B 1GT6A 5A05A 4AO7A 3O8CA 3QLUC 3VRHA 2B82A 2QI9C 4HEJA 1XTTA 3V7NA 5F51A 4YA6A 3ZZNA 1KI1A 1LX6A 1FVHA 3VTAA 1RXVA 4XM2A 5LIRA 1ZMTA 4MW9A 4GLFA 1EHYA 4M8KA 3TK1A 4BNDB 9ABPA 1F2TB 3IP5A 4BLSA 4FKZA 2PX3A 1A82A 1YZHA 4G0QA 4BLWA 4HZGA 4D6PA 5JCOC 2ZUEA 4FPXA 1KHHA 4AWXA 3ILYA 4H0CA 1OU0A 4GOOD 5A5GA 1K6JA 1N2EA 5EJIA 2AF3C 5JVDB 4B2LA 3PC6A 4MO9A 5JO0A 4NBLA 4UUNA 1QQ6A 2E5LB 1D0SA 4NYIR 4JGGA 1FFDA 3M1IA 4R98A 4XQEA 2PTHA 4B46A 4OMDA 1RYYA 1UQRA 2WG1A 3R24A 3F4BA 1W93A 4LRYA 5FTWA 3VR4D 5CB6A 3TG8A 1ZUNB 1G21A 2A35A 1UL1X 1E3WA 2JNWA 4JITA 4R83A 3IP1A 3K1ZA 4FFVA 5L3VA 1ATZA 3A37A 2NVBA 3B9BA 1AGXA 1O9GA 3ZK8A 1CZNA 2OBMA 1DP4A 3NOVA 1U7PA 4NYMR 1SHZA 2OY0A 3I28A 2AKAB 3VVBA 3RUDA 1KAHA 3ZE1B 3HEBA 4MUHA 2V4MA 4CTJA 1JI0A 4A26A 1RQRA 1JA1A 3I53A 1T8RA 4H0FA 5FAXA 1DCKA 3T9BA 4HNAA 1UBMS 1A9QA 1BQ4A 2Q5FA 3NH6A 1SXHA 2X9LA 3PQ3A 4K5QA 1U6IA 4NENB 4UM5A 2I4OA 1MO3A 4JLJA 1PDOA 3KS9A 5HIIA 3VYRB 1X39A 3JAWA 3KCQA 5DWVA 1YZ3A 2QMQA 5FPTA 3TOCA 3BFKA 1NN3A 2X8JA 3D6VA 5CEFA 1F8GA 4QJIA 2JLVA 1HDRA 4MVYA 5ES3A 5JJKA 1HEYA 1NL3A 1L7NA 4FDMA 4WCFA 4G4GA 4JHXA 1GUBA 4ALIA 2WJYA 2ZYIA 3CS3A 3LDUA 4GM4A 4A0SA 3AVWA 3ICOA 2FR0A 3OX2A 4UTZA 3VSAA 5D85A 5KNDA 3M6IA 3UIEA 1JQEA 1F9AA 5AK6A 5B2FA 1USKA 1IZ7A 3CH7A 5CLGA 3V2GA 1V3VA 4XGQA 1VPEA 2ASVA 1ZCJA 4F8EA 2R1TB 2ICAA 3ETNA 2QVYX 2F8MA 2O6HA 3G2QA 4HQKA 4WZAA 4KOEC 3VSEA 1FP4A 2VHVA 5L4LA 1IM2A 4P3OA 1K4YA 1U6JA 3KJXA 4RA9A 5J1TB 4CEHB 1BDMA 4O1MA 1Q17A 2CDRA 3DZGA 4FP9A 2A57A 2J0EA 4JGBA 3VAYA 2QQ5A 2H2AA 1FXWF 4J7UA 3V2HA 3TLBA 4Q18A 3MD0A 3U3MA 3JQDA 3QHPA 4NFYA 2H7CA 1K98A 1KK1A 3LLMA 1ZN2A 1RVV1 4DCUA 5F2NA 4P4UA 2FLKA 2FOIA 5K01A 1AX9A 2PE5A 3RHZA 3Q3IA 3PU6A 4D99A 1QMPA 2VPXA 3COVA 2OBNA 4GQIA 5JCPA 1VLLA 1K5DA 1GPUA 2IX9A 1HDIA 2ECQA 3HJBA 4RKQA 3S0JA 4IVPA 1SXIA 5DRTA 2YXLA 1CYEA 2YVQA 3CPHA 1QYXA 4LSMA 1FJHA 2GK4A 1OASA 3JWIA 4OM8A 4PHGA 3QWHA 1IBLB 5EXDA 1J2YA 4D8XA 4US2R 1VQ1A 3BAZA 2BMJA 1WHTA 3HV2A 1Y4AE 5DHAA 4JJKA 1ADFA 5FBVB 3FN4A 4QXMA 5JCJD 5BVHB 1OI7A 1P8JA 4QXAA 3A1CA 3MYYA 3HGMA 1Z06A 4YRRA 1EK5A 5EPUA 5TQ0A 2V0CA 3GCXA 4CEIA 1RP7A 1KI8A 1TUGA 1W76A 3VX3A 4MVJG 3GFSA 4C04A 2C5FA 1G2OA 2X5KO 4OXNA 2HBYA 2Q5QA 1UINA 1YMQA 4HWTA 3ZKAA 4KU4A 3DHWC 4E7PA 4F2GA 4YQFA 4RJTA 3L4BA 4ZV4A 3FKSA 2HREA 2EFGA 4QU8A 2H3HA 3U44B 1A72A 4P7JA 1OFUA 5BMVF 2EZ4A 3PC8A 3PUKA 4HWPA 3WGUA 4CMIB 4NG4A 2HJSA 5LZ4A 1LWOA 2KE5A 3L8FA 3V1MA 2Q27A 4JBGA 3SOPA 3T5CA 3LX8A 5JDCC 4PZLA 4CCSA 2EFEB 1J2JA 2R3SA 1C50A 2J6BA 3ZW9A 1D4FA 1RM0A 3GD5A 2JL1A 4I99A 4CT0A 3T7DA 1MF7A 2FSSA 3TZKA 4LBVA 4CL2A 2XCRB 2ZIAA 3DOIA 3FCXA 4J0CA 1ML3A 4AZTA 2D7DA 4N8DA 2V6IA 2PMBA 4ZJYA 4HGZA 3FI9A 3FWKA 1VMDA 2WG0A 5EI5A 4GQAA 3A3PA 3THOA 4Z1OA 1UBOS 3T12A 4RDHA 1N25A 2PH3A 1R3UA 1VL1A 1J0DA 1WDMA 1YUNA 3PITA 4L5AA 1DU4A 5A06A 3ENVA 4LKOA 3GUUA 4YP7A 3SJZA 3MERA 2Z98A 4JT9A 1KYYA 2BGWA 3GPLA 3GRCA 4GRAA 4ZMBA 2CT8A 3B1XA 3SSAA 3H19A 4Q9DA 2DJIA 3WLNA 1Z63A 5GWXA 1R5OA 3OHMA 4XDZA 4ZOCA 1YQTA 3IT2A 5I9TA 1KMHB 1DBVO 2CE2X 4O4LA 2NUPB 2XXJA 1MRZA 4LJ4A 4BQQA 5M2QA 4YCCA 3B6EA 2E4VA 3GEHA 4G0NA 3T5TA 2JJ1D 4LX8A 1KI3A 1GRQA 2Q3EA 1W36D 5GOTA 1X80A 4NR0A 3H2SA 3ROFA 2XMGA 1BH6A 5DPMA 4RK5A 3QG1A 4DHWA 4GSYA 4DT1B 3D0KA 5LL6P 1S8OA 2RE8A 1XXHA 4ZVOA 5I7UA 1UKBA 3QBEA 4ARZA 4FMDF 3WO1A 3G2IA 2FMXA 4JUDX 3SE0A 3U40A 1IOLA 4B3FX 4GI7A 4UULA 5LD2B 1GR0A 2DT8A 2BLLA 2UVPA 4JR2A 4M1TA 3B52X 5G0TA 3UB3A 5E2AA 3GT4A 1TW2A 3KKEA 3BFJA 3JYQA 4Q7MB 3UNXA 3BREA 3F5SA 1NF2A 2Z6AA 1JEAA 1I3OA 3WMEA 5GMOA 1VXOA 3HYSA 1B73A 1DXHA 2ZRJA 1NYQA 1TYCA 1TF2A 4YUZA 1TLFA 1GL3A 4XGKA 1B4DA 4HDRB 4LCBA 1R9MA 2FEKA 4DDKA 1NLMA 4FXPA 5CDSA 3S8YA 2X9GA 1JR4A 5EUBA 1NC3A 1Z6QA 4EQ6B 4Y2UA 3TLGB 2R11A 3DE0X 4LE2A 3SR0A 3AI2A 2QHXA 3BRCA 1PF7E 1M76A 4OQFA 2V6GA 2XODA 4X90A 5E8RA 1ZR2A 5B3KA 1MW9X 2GLXA 1G8YA 3WB0A 5BYAA 3SG0A 1P3DA 1BE0A 1T5LA 1W25A 3P94A 1N3BA 4UREA 3IAM6 4II7A 4YRDA 1GSOA 1Y34E 4FZJA 4BNLA 1BMDA 2D1RA 4FQ8A 3O1LA 4Q01A 5DT9A 3ZWPA 4KPEC 4WESB 4MYDA 4R1UA 3PUIA 2XADA 4ZVMA 1PW5A 1MPXA 3LUAA 4ZTBA 4DBLE 4Q1FA 4DMMA 2C2GA 3I4LA 1LS6A 3HDYA 3R0QA 3VPGA 2R6R1 3ZOKA 3ENWA 4Q7JB 2XECA 2ZI5A 1TJPB 4XFKA 2C5SA 3SYMA 1WB6A 3ZJ5A 4HY3A 1K66A 2CLEB 4PC1A 1ZD8A 4UHFA 1KAMA 5IT5A 4KOAA 2MSCB 4EI7A 1V5WA 3ORSA 1N7GA 1VKHA 3GG2A 4TRJA 3RBVA 3LHKA 4NZPA 2FY8A 3FKJA 3HJAA 3KR0A 4DQVA 3I4FA 2C5LA 3A9UA 1B8OA 3FAKA 2FEWB 5FDFA 3UB4A 5LLDA 3KT6A 3HBJA 1Z6GA 3T06B 4RTJA 3A4VA 4INZA 2CFTA 2WQ6A 1V1MB 1W0CA 1ORWA 3BTUA 4F5DA 1YFZA 4WZBE 5CXXA 5HKKD 4PSAA 2ACKA 2EKZA 1S01A 3GUCA 4NBSA 4NBKA 1OX4A 3WJ2A 1P5FA 3OESA 3PGVA 2GN0A 3T3HA 1NM5A 4YJ3B 3PFBA 3T5PA 4IYJA 2P3SA 3GP8A 1H3FA 3MTGA 4TLMB 4C78A 3IAS1 4C5CA 2D6FA 3M6VA 5E4JA 1OLXB 1OZHA 2WSBA 3BWVA 3H11B 5E6SB 5HQJA 2GLUA 3OJ0A 3RTCA 3VU3A 2RHBA 1VPTA 2Q5CA 3VC2A 3NHBA 1QQTA 1IY8A 1JQJC 3W4IA 2BBSA 3S81A 3F7NA 3NU1A 2ZE8A 2JCGA 2JZOA 4MICA 1LC3A 4HDMB 5DNCA 4IJ5A 4TRRA 1U5CA 5DNYB 3GJZA 1PHPA 3VI4B 2CLDX 1AHIA 1A76A 1X9IA 4PW0A 4BVAA 3EXFA 5ICEA 4IO1A 1W4BA 1SOAA 1AKWA 1N7HA 1TVCA 3OAAD 1EFDN 2FFJA 2R87A 3IEUA 4B35A 3OZIA 2C9DA 4E07A 1VMIA 3KOXA 3GZJA 3CKKA 4CFZA 4D57A 3PEEA 2Z5LA 3JYOA 3FY4A 1P2BA 4NZNA 1OHHA 3C5CA 1WXFA 1K5GA 4OQXA 3NOXA 2PUCA 4KFCA 2ERYA 1RMQA 2GEDA 2H9YA 2BONA 2UYGA 5LZ8A 1FLDA 1UBGA 3K05A 4KACA 1YDMA 4M9SA 4HEA6 4OAQA 4M1QA 4RVCA 1TO6A 2Y71A 1A9RA 1M72A 3L79A 1L4BA 1V39A 4B73A 1Q1NA 1A4XA 1YL6A 1C5KA 2IU4A 2R4UA 4UHEA 4AN1A 2OV1A 4KGDA 1WZIA 1XTUA 2O1EA 1W4LA 1HDXA 2WC1A 1BYIA 2LRHA 3CLTC 4IZIA 4NCXA 3FOZA 5IPFA 2F3RA 2ZSAA 3I9KA 4JLWA 1R5BA 1TZMA 4UCXA 5B6JA 2D13A 1OGJA 1UCFA 4ND1A 2GJSA 3LC7O 4QUGA 4QPCA 3DTVB 4WNAA 3O4VA 2DQYA 4Q4DA 4PYLA 2IZ5A 5BSHA 4J9VA 1J07A 2BC9A 1P1KA 5LCXA 2ID8A 1ZNWA 4XIFA 5LU8A 4JP3A 1WLSA 2UXCB 3I6QA 1S9HA 2O0LA 3TQIA 1I7NA 1GRRA 1BFKA 1WE2A 2BRUA 4R9SA 5TPWA 3H8WA 5G3ZA 2X0DA 1UXOA 3ONVA 4Z8YA 3GLGA 4R2JA 3L2OB 4CQNA 1L4LA 3SBXA 3H2ZA 2ZSKA 1EE1A 4JVMA 5BSUA 2VUTA 1O6GA 4CODB 2XMBA 3FZNA 1F7UA 1RCUA 1EDEA 4QOSA 5KYYB 3LBIA 2JARA 3KJIA 3Q6IA 1XTBA 4Y6RA 2BHRA 2BKEA 5E2BA 1EQUA 3DC2A 3I2IA 1IBSA 4JBYA 3F2IA 4I4TF 3OT4A 4RACA 5I7HA 1DKLA 2WWTA 1R4AA 3AU8A 1QYWA 1ZJYA 1LK5A 3GVCA 3GXOA 1Z2OX 1RRPA 3RYHB 1Q16A 3UBTA 4KFTA 4OQ4A 1KVRA 5CIWA 3FOWA 1I9GA 4P2BA 1WEKA 1JX6A 3S1AA 2JFNA 2P2GA 1SC6A 1N1GA 1RNLA 2WOJA 3NYIA 4PX5A 1IU9A 4OHZA 2WJ3A 3WMXA 4ZJZA 1D03A 2QMHA 2J8ZA 1HPLA 4IDAA 5CX4A 4BEBA 2E48A 3AP1A 3WQBA 1D0VA 2H1WA 4R5HA 5FNVA 1GL6A 2I2DA 3RAJA 4AY5A 3TD2A 2DR0A 2QMZA 4OL0A 4A4DA 4GZ3A 4YECA 1DDOA 2QW1A 4IVRA 1GZ4A 1Y6QA 3NFRA 1Z6YA 3O8QA 3O91A 5GM2A 1X9GA 1HO3A 1P2FA 1ZKMA 3BGSA 3QVGA 3ZEAA 1AU9A 2ZYAA 4MR8B 5BQ5A 4A6PA 2RHWA 1Y6JA 2WMNB 4W99A 1P2GA 2B1IA 4PZUA 1ZSNA 5E6UB 4LJAA 1EP1B 5BOSB 2NAFA 2CXTA 1I4OA 3OMWA 3T8YA 2ZP1A 2B83A 1YMUA 2PLAA 2IWRA 1XELA 3LHSA 1Z22A 2AG6A 4KPUA 5BN4B 2JVJA 3TMKA 2BHNA 2X13A 4DBVO 5REQB 3KQTA 1J42A 2NVUA 3EXAA 5A04A 5EQJB 2OVFA 4LNUA 2VNHA 4NTZA 4TLBA 4LY6A 5E1MA 3RCBA 4EGCB 4RK1A 5B1EA 1LPOA 2XYHA 2M6LA 3N8KA 4Y0VA 1MLDA 4A92A 4CE6A 1CG6A 4DC9A 2YMMA 2HV8A 1UJMA 2JEYA 3ZWMA 2WPDA 3MTAA 2Q5LA 5I7SA 4IUYA 1USGA 3EQ7A 2PNFA 1TX4B 3W6ZA 1TW3A 2AOXA 3IKMB 3OZGA 1RI4A 2XQKA 1AZSC 2CVOA 2WJGA 1DHRA 4JKYA 3ZZUA 1XZIA 1JIVA 1LSOA 2DWPA 2HFJA 2ZB7A 2VTBB 3EX7C 2FPSA 1W5FA 1W44A 1OJLA 2R8PA 2F8SA 1JHMA 1WPXA 1UEXC 4O4HA 2QENA 2WA2A 3PHHA 4RSHA 3TGLA 2VCEA 2IYYA 3ZS9A 4NF2A 1BC5A 3W5BA 2C3YA 2OP0A 2H1CA 4WADA 1U7WA 3RK1A 3VNUA 3E5MA 4LRSB 3Q5DA 3T5GA 1VIDA 2CXHA 3RW9A 4JWTA 2GN2A 4HADA 4MWZA 2CY0A 2HSDA 2JJMA 3WK4A 4D6YA 1UDCA 3CPJB 5FI5A 3HSKA 5TVGA 3ZIAA 1JNYA 1LTHR 4J49A 2P9ZA 4IIUA 3OLYA 4YAOA 5IT0A 3PCTA 5EIBD 4L5YA 4OQNA 2FN8A 2GO1A 3EBLA 1FVOA 3RFTA 3HKCB 4XLZA 4QGSA 1RPTA 5J43A 1Q91A 1VIYA 4EDFA 3E4DA 2FZKA 4GS5A 4H6VA 2FSVC 5JXHA 5BW5A 4ZDJA 1UK9A 2PBRA 1DMSA 1B8PA 1XVLA 3TZQA 4F3TA 4B17A 4IKOA 5AH0A 1R2QA 1UBEA 3DLTA 4AJNA 3K70B 4E4RA 4K28A 2QLTA 1Z7EA 4D9CA 3KC2A 1UJ4A 4UEQA 3M6XA 1E98A 3JRNA 1HQKA 5LOVB 2NV6A 3D2AA 1Z4OA 3RFCA 4XEHA 2I1WA 4CMEA 3OFND 4NS1A 3H7AA 2XY4A 3JZDA 3RS9A 4PCLA 1H5UA 1LPMA 3N2EA 5J63A 3IAUA 3CCFA 4MZDA 3AFHA 1SC9A 5LJIA 5IXJA 1QC5A 1F2UB 1P2DA 1SEVA 2ZJYA 3NC1C 3AEUA 4GDFA 1YZKA 3PNVA 3X44A 5KTPA 5ALTA 1SA0B 5ENDA 2ENUA 4WMLA 4Y2JA 1C3JA 3ZWAA 4ARCA 1JLRA 1BX3A 3ETDA 4H9GA 2LDBA 5CGQB 1GPMA 4CGZA 2RHMA 1NJ1A 2B8NA 1RHUA 4ZZ3A 3K0AA 4K26A 3WWZA 4V24A 4UNPA 3UFBA 1GRVA 1A4UA 2GWHA 3GQBB 2BV3A 2WIGA 1XL0A 1QIDA 3RANA 1NI4B 4L0DA 4DQDA 3BC1A 1TAGA 1O3YA 4ZT7A 5TV2A 4G8DA 3QPDA 4ITRC 4NABA 1BD4A 4UDYX 4OATA 5AKYA 1MEEA 1LSSA 2OTCA 3SF0A 3QGMA 3SGLA 4D56A 4Q1CA 5DLPA 2HQSA 2PUHA 2R5NA 4GL4A 4JT2A 4OHBA 4RIGA 4BB9A 1QG0A 3ZDAA 4S1PA 4M0UA 2P6UA 1WUJS 2HXGA 2QTGA 3FG9A 4KQHA 4KQMA 2XKBA 2PX4A 5FXMA 1QYDA 2CFSA 3DB2A 2Q2WA 1NYTA 4OYHA 2DBQA 2QTVA 1VGQA 1HYGA 2JFFA 3HJHA 3Q3VA 5CK4A 1XPUA 4IGKA 1HFKA 1JFFB 2ASEA 2GBLA 3L6EA 3JYLA 1ESEA 2N42A 3H0KA 1K86A 3GV0A 1YQGA 4XVCA 1CQXA 1Y8RB 2OD9A 1UAYA 4NBVA 4NCIA 1I6KA 4PG6A 2ZT7A 4P54A 3SIWA 1VCNA 2HSGA 3H5RA 3THWB 4Q7QA 3TRDA 1L7BA 4RK0A 4IUCS 2X8AA 4X20A 1UMDB 2NUBA 1XZBA 2YIMA 1HURA 2ZM5A 2RHDA 1EP2B 1SVKA 1NMXA 2OXFA 3K0FA 1G20A 1OFGA 2YX1A 5DOVA 3RVKA 4AFNA 2NAPA 1MX9A 4I2VA 2AE1A 2Z2XA 2E2WA 4O4JB 4KQXA 5T4HA 1L5HB 1NDHA 3OQVA 2GDZA 4XYBA 2A5GA 2NXJA 3NOOA 2IYZA 4QUJA 4R8RA 5HILA 3S5JA 4JBHA 5A1TA 4G4IA 2VJKA 2JFVA 2P2SA 3EIXA 1BOFA 4F6RB 2F9LA 4QQRA 1YHYA 4FCCA 4LRWA 3RT7A 3ZE9A 3QEMB 3ZHZA 1BSVA 1F0YA 4B32A 2Q50A 4EZIA 2QN1A 1ZN9A 2JS7A 2WD8A 1L9KA 1N33B 1CPYA 3GZ4A 4ITUA 4KN8A 1N9GA 1ODLA 1ZUIA 2BFEA 1CRWG 2ZAOA 1DKRA 2EZ9A 2G5CA 2FX2A 3BF7A 3F8WA 4YBRA 1KS9A 3TG2A 3MBIA 2MYNA 4M38A 4P53A 2PKEA 1KEPA 1P44A 1SUFA 2GD1O 5KSZA 5KYWB 3DCNA 4RV5A 3K8OE 5H81A 1IXKA 1CC1S 3CIOA 3ZCRA 3U7IA 4DLAA 2QTBA 5B3JC 2BZ0A 4FC6A 3NTVA 3U1TA 4MI3A 1YVDA 3BFXA 2R8XA 4IDCA 4OUKX 5D6NA 1F17A 1X15A 3CH5A 1Z4JA 3OUTA 2Z58A 2RHHA 4FFRA 4PZEA 4WEOA 4QU5A 4PE5B 1POXA 2C1EA 2D3WA 3FSGA 2DAPA 3HY4A 1ENYA 3IV9A 4KXFB 4ZVTA 4E88A 1BDIA 1H1LB 1IHYA 1KI9A 1ZUWA 2EP5A 2OORC 2X6QA 4FOOA 3UW1A 3NWOA 2HQOA 4PLPA 5CT5A 1TPZA 4BWVA 3LRTA 4UHHA 2GA9A 3NJ4A 5AESA 3HVHA 3RYIA 4U6NA 2AR0A 3F67A 5HJ7A 3BKWA 2VH1A 5JXIA 1RQXA 1AUQA 1NHGA 3BOSA 4FLMA 4PN7A 2UV8A 3PNPA 5A3VA 3PG5A 3R5HA 4FUTA 2GEKA 4EG0A 1KEZA 1J5PA 3GGDA 4MQMA 2OCDA 4HYQA 4E1AA 3FAZA 1E9AA 4NCNA 3NBQA 1E77A 2J31A 4TN5A 4YHBA 4MIEA 2Y6UA 1QF7A 4QL3A 1YE8A 2GRAA 1XDGA 3O83A 2IL1A 3MQFA 4HTAA 4YNBA 1MB3A 3TL6A 4OGFA 5B7NA 2VAVA 5LQKA 5GONA 2WI8A 3JVIA 4MGZR 3SE7A 4XR9A 1NXXA 1NJ6A 4RA6B 1OXVA 1L7QA 5LWHA 4DZTA 1PT6A 3HWX1 3CHYA 3LS2A 4JX8A 4HL6A 3TINA 1REQB 4ZI3A 4DXAA 1ZOSA 4XGIA 4GSLA 1NP7A 1NFFA 3BE8A 4K40A 3WQSB 5KOIA 1Y1QA 3SLGA 4JVSB 4QUKA 4Y9RA 1BGXT 1XA4A 2R9VA 4XCVA 3BZBA 1NW8A 3C14C 4ARAA 2ODAA 2BGMA 1J39A 1EEXB 2NV2B 3UK7A 3WBJA 2FSGA 5JXWA 4CU2A 1KZ4A 3F2VA 5JAUA 4IEIA 4CIVA 1D0IA 4YX9A 4JYCA 4JELA 4LKRA 1FP6A 1YS4A 3JCZA 3EDOA 1CNEA 4Z8XA 3T35A 4U4AA 4N0QA 1H94A 5IFKA 3NEJA 4R1QA 3ZQ6A 3AR4A 2NM0A 4TTRA 2B7LA 4JL8A 1WSWA 1P31A 2I9PA 3FUTA 4L6CA 4Q9JA 3RU9A 1YQXA 2YOGA 1QS0B 2XCOA 1W2HA 2XEDA 3NJ8A 4I1VA 1ECLA 3G59A 3U7GA 2W2LD 5A0FA 3NX4A 5AW7A 3BRSA 2V1XA 4XR4A 3VOBA 2NTNA 2PX8A 5EGNA 2C82A 3F74A 2ZYUX 5HOEA 2RC5A 1CDOA 4ZI2A 1NKTA 2G76A 1GNTA 4U9IS 3BWYA 4DEXA 2JJ8A 4PR3A 2OQRA 4OQYA 5PNTA 3TF5A 2P2CA 3SFZA 1NVWQ 1M8PA 2XYVA 2HQRA 2H31A 4ED9A 3M82A 1OYWA 1FJ2A 1P8AA 1SU4A 3IAFA 5EEGA 1CUBA 2ZJBA 1RWMA 1U3VA 2FG6C 3M2PA 1AVTA 3GLFB 1UPTA 5KOYA 3LW8A 2D7CA 2IUFA 3TTTA 1SHJA 4PG4A 4UARA 2XQGA 3URKA 3V46A 3VZPA 4H08A 5ITSA 3K1TA 1NATA 3ML1A 1X8JA 1H23A 3Q7RA 3BD6A 4K6FA 4PIMA 5FL7D 2J5KA 2XUOA 3A31A 3C15C 4NIMA 3ACDA 2PD6A 1QOZA 3FTEA 2PD4A 3FBWA 1UZLA 4TV9B 4AULA 1C30A 1QE0A 2OZPA 4PZCA 1NRWA 2AYYA 4ER3A 5FPKA 2RI6A 2GLTA 2XYQA 3GCWA 4IHJA 3NHRA 2OM2A 1SKQA 2H07A 2JDID 3A9CA 3EXG2 4RJJA 3IURA 4BKMA 4GPBA 4IHAA 4Z0TA 4EJMA 4MMXB 5E38A 4KR6A 2NUTA 3TXYA 4BX2A 1XU9A 1GGVA 2H1IA 1P17A 1PJLA 1U90A 2NYRA 4MQLA 4QG7A 2F62A 3A28A 3BEOA 3WQQA 4AJJA 3WK9A 2ZR7A 2FV8A 1ZBQA 2C0CA 1U31A 2R4TA 1A1SA 3CE6A 3CUEF 3HVUA 4XW2A 2NPFA 2EHDA 4PC6A 5JPDA 3WYGA 1C80A 5JZOA 1JXQA 5D8DA 2NU8B 4DIFA 2VWHA 4INAA 4D0SA 4F0JA 1DLIA 1X7YB 2O7VA 2QNIA 2JFPA 4S3MA 1W5AA 2VT6A 3PQ7A 1S89A 1G5TA 3CJQA 3FETA 3QI7A 5C4IA 5I7VA 4X3OA 5AJVB 4UBKA 3E81A 4QZVA 1O0BA 3DBHB 2HRRA 2LNDA 2HJRA 4IM7A 4RIHA 2PRZA 2VJOA 1XR3A 4WOCA 1A5BB 1M6YA 4K05A 2HSJA 5A3RA 1U28C 5JV5A 2FEXA 2GCGA 2J9FB 2VYVA 2YN2A 3KT3A 4QOGA 4DLNA 2RJ3A 2MR5A 1T3ZA 2RGYA 2MSEB 3DJFA 4HO1X 4IINA 4JLUA 4GYKA 3JQQA 4DHEA 4S04A 1MC5A 3RRJA 1AT1A 3EGDA 4HS9A 2D1FA 3FHTA 1E9VA 2JRCA 1V11A 2C20A 2D06A 3MB8A 3AVPA 3CIFA 2XH8A 3W6PA 4BZPA 1J1UA 4OK5A 2AX4A 2QLFA 3P9CA 5CPBA 1T6ZA 3IODA 4FZVA 1HYHA 4XCXA 1HSOA 2AMYA 4PYOA 3OOYA 2D54A 3OOWA 4HPJB 3AR6A 3NM4A 1HLPA 1CP3A 4NC9A 4L7VA 4O29A 3PK0A 4PGFA 3T0GA 4BVBA 3B60A 3P4XA 3BGWA 1FDRA 1GQ2A 2HJHA 2D2EA 2EC5A 3B82A 2QSZA 2D8AA 3BULA 1SD5A 2CXPA 2G3YA 1Q1BA 2DT5A 2VXOA 3ULKA 4AK9A 1Y6FA 1KA9H 2HNAA 3KLMX 3HFJA 2YWJA 4IH1A 4PC2A 4RD3A 1EHCA 1T0HB 3IEKA 2PKQO 4ZO8A 4I6JA 2EG5A 4R31A 3TRJA 4W4TA 2WJWA 3SZGA 1OFIA 2JFHA 1WXHA 1H8EA 3N1UA 3I9V1 4HUJA 1ZH4A 1M2HA 4Q3EA 3DB1A 4QX6A 4UNNA 4ESOA 1AKQA 1JH8A 1I4LD 3KOMA 3ZLBA 5A2GA 3E03A 5C1IA 3UK6A 2Q62A 2IYNA 3RHFA 5CD9A 4BCDA 2IIPA 3UMYA 1N0VC 4PQYA 2HB6A 2CJYA 3FCCA 5FPYA 3B9PA 3L0OA 3MGCA 4OLAA 5C4GB 1ZMXA 2XUJA 2HWYA 3FWHA 2VZ8A 1EFCA 3Q7TA 1ZXBA 4MUNA 1NR5A 1RQNA 3QLEA 4BMNA 2WNHA 3RJ5A 3KX2A 5EHIA 3QIVA 2BW0A 1K3TA 4FK8A 1X7ZB 2ZBUA 5FTKA 3E2IA 3OT1B 1NFQA 3M5DA 4C4AA 4CQLA 1X8XA 5LXTF 1ULAA 4RTOA 3BCRA 2ZJ5A 3FFXA 3G5MA 3CZQA 3KIPA 3JQBC 3KUCA 3P2IA 4ZYLA 3G5LA 3WFJA 3G5TA 4RZUA 2QRLA 4UU0A 3GCZA 3KR9A 4REMA 3DFUA 1C7IA 1JDSA 2YV4A 5FBRB 3ZJ4A 3UPTA 1E7RA 3UV6A 3R4CA 4F4HA 8ADHA 4R9VA 4G0YA 1GTRA 1RI5A 2ZT5A 2H29A 3KZNA 3M83A 4H4EA 2OPHA 5CA1F 2VN8A 3EB9A 5ELLA 1Z2NX 4BQNA 1QWSA 4B7UA 2VDUE 1T8SA 2NG1A 3FR8A 2VF2A 1WOYA 4DGSA 4RPHA 1A5TA 3IDSA 5D01A 3B5EA 1BJRE 1MKYA 4GIBA 2P1ZA 4UBMA 1S7CA 1DZIA 1Q7CA 1KDRA 1PU2A 1FZQA 3KVRA 4IJVA 3OJEA 4RQAA 2BFCB 4MS4A 2WSMA 2Z30A 1BE6A 1PZMA 2PUTA 3DOOA 4ZWNA 2YKGA 3BWBA 3CWCA 2Q3DA 1XWWA 1T9CA 3MBOA 1U4SA 2FRDC 2OXRA 1T3GA 4JR0A 2C2ZA 1U2PA 4B43A 2B0JA 1HK7A 1E5QA 1LPSA 1PV1A 1DQPA 4LVOA 2V9ZA 5FBWB 3WXBA 4BHTA 5DXFA 4BMPB 1MJGM 4ZT3A 8LDHA 2FFHA 4DLBA 3DV0B 1SVMA 3BWCA 3LP6A 4TZTA 4MUJA 4YAWA 4YVFA 5ITWA 4Z2YA 4FIZA 4C7JA 5TE9A 1U1FA 2ZBFA 4FGJA 1XF1A 4JFRA 2HTFA 1PFYA 5HE9A 1FB5A 3ABSB 3T9AA 3M4NA 2M6RA 3V33A 2EF1A 4H59A 3ZVNA 3MZ0A 2OO3A 4U2CA 4BV2A 2P6OA 1KC3A 3IKVA 2PS3A 3KELA 3AV0B 4G2NA 3ROTA 1TQ4A 3ZXYA 3GEEA 1AM4D 1FLNA 3RWOA 3PD0A 3IKTA 1HZZA 2OCXA 4ZI5A 1BCRB 1JR3A 4BASA 1S5PA 3QWIA 1NFRA 1SVNA 2YR0A 4CFSA 3DQZA 4P4LA 1HBJA 4UE6A 1NVEA 3D4LA 1SVSA 2PX0A 3FNIA 2J3JA 2ZB4A 2NU9B 1AHHA 4MVJE 3FFAA 2IXFA 1R15A 3W9SA 4TYYA 1Z13A 2ZRCA 3AC0A 2N3ZA 3JAMA 2Q0QA 2O1SA 4UXHA 4RD2A 3HKDB 1I32A 4E46A 1L5WA 1E1CA 3F7OA 1EX9A 4Q3BA 2W8ZA 2XAUA 4HQOA 1MO4A 3D8SA 3WGLA 3L82B 3VR6H 4C4YA 1ZIDA 1E2FA 4I5GA 4IX9A 5I7FA 5KYUB 4U8HA 3TW4A 2WJVA 3LY9A 2G9NA 5DDIP 3SOZA 5AW5A 1EFLA 2DQKA 4S1OA 2R8EA 2PMDA 3DEAA 4JBIA 4E7OA 3GBPA 2GM4A 4KMSA 1KFKB 1QH9A 1ODIA 4JFAA 5AQ1A 1PTJA 2J85A 2PD3A 3MPOA 3FBGA 3NP7A 2I3ZA 4CG2A 3HL4A 4QUDA 3C2QA 2RHOA 4MCAA 3RV3A 5B64A 5HFNA 2H4FA 1XA0A 5G41A 4U0JA 4PYRA 1X7XB 4FCTA 4I4IA 1CE8B 1VZ2A 1UPAA 5LP6F 1CUZA 4AG6A 2LD4A 1FRVA 3C3EA 4L9RA 4DQXA 3IDZA 1VE9A 5JWHA 4FJ0A 4EUKA 1V3QE 4MVCA 1XTQA 1CD5A 1G5IA 2C04A 4WCVA 5KKAA 2OXTA 4E15A 3U31A 3LM8A 5TIIA 5F1KA 3RS4A 2P6PA 5C5DA 4LEIA 3KTAA 4EF6A 3MELA 3HS3A 3DZ8A 1NJSA 4XJTA 1VZ3A 4OL9A 3JARB 2IXGA 2DE0X 2H8KA 1JLLB 4TSKA 1M9NA 4G5OA 3UJDA 1Z7WA 2XGOA 5CTJA 2CYAA 1J25A 4YCAA 2KB0A 2EXXA 1JAYA 1FSGA 1W2WB 2DBRA 2FPXA 2OC9A 1UXJA 2BFPA 1XGKA 2ZB8A 3CF6R 3QNMA 4MWGA 4CKCB 1EVLA 3HNOA 1XRQA 3K1YA 2ZKIA 4L95C 4DV1B 3M3HA 2Q0HA 3ITNA 1Y6ZA 3ZVLA 1CJVC 1TAHA 2KSQA 3G8AA 4OHKA 5I9SA 2VRNA 4HH1A 3VH1A 4DRXA 5A4MS 4DR5B 3RBXA 3ICCA 5C5EA 3KOYA 1J99A 1LVHA 5LIPA 2XD9A 1O95C 4AIIA 5MHTA 3O2NA 5CA0B 1L3CA 3TS1A 1VBMA 4WKPA 3ITEA 4W7SA 2VF4X 4RS4A 5THQA 3ZV5A 1GDTA 4YREA 2QROA 2AW5A 3HMKA 3LPAA 4ZT5A 3RT1A 3THRA 2XOEA 3D1VA 3DDZX 4I6GA 5DFAA 5EUQB 3ZK9A 1GPDG 1MC1A 4DCSA 2RMKA 1Z35A 2VJDA 1ZGGA 3VVLA 4C43A 5AVXA 2PUGA 4F97A 5JAHA 2OUIA 1Y98A 5FOVA 5KHAA 4L72A 5F3WB 3KTDA 5JNLA 2Q3CA 1JBQA 1L5NA 2DBZA 4LDRA 3U1VA 4P4SA 2P4HX 4TUYB 1KMQA 2XE6A 4WACA 2X7JA 4UKDA 5E0OA 3WQRA 4B82A 4DA7A 2OSBA 4FONA 4RO0A 3V4FA 3KJFA 2ZXUA 2Q5EA 1YULA 2QOEA 2H59A 3TDKA 5IASA 3UA3A 4AAYA 4PCVA 1M2VA 2VH2A 4QTYA 4YK7A 3WAKA 1P0QA 3QYJA 5KQPA 3NPAA 3OZWA 2JHCA 1JVBA 1X42A 2EJWA 2ZWPA 4Q3AA 1GIAA 4GT1A 4LC0A 4NX2A 1QP7A 3WZ2A 1L5OA 3OCYA 5FV4A 4L85A 1KR5A 3JD3A 2P2DA 1ISPA 4NYJR 3H2BA 1CJSA 1GPJA 2ORWA 5CLFA 3HRIA 1G291 1JEYB 1TOAA 2RAPA 2F1IA 4TKUB 4DXHA 4WBNB 1IAQA 5J4VA 5SYMA 3J80A 1X1TA 5J2TA 3DHNA 3W2EA 4WZZA 3OIDA 4Z4QA 5LDHA 2BFFB 4JBXA 2H2IA 5KBYA 2ZIFA 3IQEA 1MBZA 3RPEA 3QLUA 3VYWA 1DINA 4ZOLB 5A9RA 3Q7QA 2E5WA 3KFXA 1GVHA 1TC2A 1SR8A 3L8EA 1R9JA 2WV7A 4P5DA 5DM1A 4TWJA 5C8VA 1W5SA 4FDVA 4FTWA 1M8FA 5HF6A 3WP1B 4AZ3A 4S2EA 4D79A 4US0R 1GSHA 1NVDA 2NNLD 4H18A 4L9SA 4AP6A 2V3CC 4GPAA 1QG2A 2C0QA 4N40A 4AURA 1ZNQO 5JCOA 1AS0A 4Q12A 4EY5A 3M1YA 2RGRA 1FFXB 3ID6C 1XOIA 2EP7A 1UOEA 3IC5A 3N5KA 1T36A 3KOZA 3HXMA 2YFYA 5U4QA 1MABA 3AFOA 4F56A 3VDMA 4YP0A 1CFZA 5H8WA 4KN9S 3PTZA 2BTOA 2DH6A 3QTTA 1GP2A 4GOMD 4J0GA 3NWBA 2P9JA 4LMPA 1AQNA 1CY7A 1LPBB 3WLAA 3P19A 1UM9A 2ZOSA 3VOTA 5IULC 1M2OB 3DO6A 4NK4A 1YXMA 4WKOA 1ZUD1 2RJNA 4OREX 3H18A 1FS6A 5JI3E 1EVIA 1UKCA 4JI8B 3KOOA 3WXMA 1JTFA 3PD7A 4LYJA 3DAHA 5AW1A 1P2SA 1EINA 2H52A 3HXKA 4W1RA 4TKLA 4ZVLA 4A1OA 3H65A 4S05A 1ESNA 4AJ1A 3AERA 4HLQB 3OZ7A 2P27A 3NHMA 3THYA 1MFPA 2LCFA 1ZSVA 5I9LA 3NG1A 1HNNA 5CLQA 4KFSA 3GN2A 2FLWA 1E0JA 2XUZA 2VUIB 3KO8A 3E58A 2A88A 5KYXB 1N2CB 3DDCA 4FQ7A 3LTNC 4ZO4A 3GC6A 4HEHA 4B0PA 2IV2X 2WTXA 5LZ9A 1NBME 5JZSA 4R1MA 1IPEA 2BGIA 1AKEA 5SZIA 1MNAA 4M1OA 3EXEA 2H54A 3BQNB 5AM2A 1MX5A 4JVNA 4RY0A 2EGGA 5AOCA 2DHEA 2PRKA 2W6OA 1NQAO 1XRRA 1XWFA 2J3MA 2YIDA 1C0PA 3A2LA 3ITDA 2EWVA 1U7UA 3O0DA 3E15A 4GX0A 4JC8A 2C5AA 4B80A 4BVHA 3OJXA 4MUIA 1VDZA 2X14A 3KKZA 4KDCA 5DO9A 3R8XA 3W5UA 2YN4A 1K06A 3D8TA 3T3IA 4KNWA 4WCFB 3W7VA 4N5DA 1Q0QA 3RS8A 2MSKA 4ERNA 1AO0A 1TKRA 1E2EA 3AF3A 3DVLA 4TTIA 4AL4A 3WA7A 2PXCA 5K3EA 2J0UB 5HG0A 3RARA 3RS0A 3WAJA 3R7SA 4BNKA 2C8JA 2QTMA 4OYLA 5DU2A 5CH5A 1I6WA 1ZWKA 1Q7BA 2BM8A 2RBKA 3BHMA 3GFRA 1SUAA 3QPUA 4DIMA 4BB0A 3DW1X 3VPBA 1IDN1 1DEKA 2YXEA 4F60A 3O38A 1QXSA 2I66A 2ZRDA 3NKFA 4OP1A 4AZVA 3A4YA 3U09A 4V39A 1K8QA 3EDCA 2QQFA 4F71A 4E4YA 4MMYB 2WIFA 3KALA 1GT91 3VKFA 5F9HA 3A6EA 3BB4A 3L7KA 1ZONA 1UOOA 4H6PA 3KXLA 3M6MD 2JFZA 4M7PA 1ZH6A 1Y7HA 4W8OA 5EIOA 1XPJA 1J8FA 1T6NA 4OFWA 1KO8A 3DH0A 4JDUA 3BDAA 2QT9A 1Q0HA 3F4LA 1D6NA 1MIOA 1YRWA 2J48A 2Q5OA 1KEWA 2YY7A 3OG9A 2JLRA 2PG3A 3E53A 1E0KA 1WMDA 5AVZA 2V6FA 2A1UB 3M89A 4BDTA 1CY2A 2JGDA 4R2WA 3AG5A 3A6DA 4EL0A 2J3KA 2IC5A 2W2VA 3V1YA 1V4NA 2HM7A 2R47A 3RRMA 1QIJA 1W7AA 5BUCA 2SNIE 4JVOA 4Y2HA 1EI9A 2G67A 1Y3BE 5E7JA 3LC2O 5TGDA 1XDDA 5F1PA 4E0BA 2DERA 3UAGA 1JEOA 1KJYA 2PMFA 1XZNA 1QFZA 5CFQA 3OURA 1RFGE 4NV1A 2C9OA 3W5SA 3QELB 4POOA 5JDCA 3B3GA 2QUJA 1EUQA 1DBQA 2P11A 2BEWB 3IB6A 5FI1B 5EPEA 3VGJA 4D3FA 3QMVA 1GPLA 3CQ9A 1G3IA 1O97C 3W06A 2JAWA 1G7SA 1LV7A 3CWQA 3LKVA 4A5SA 1CRPA 2PLWA 2H08A 4G1UC 3NHYA 4J16C 3ABIA 1V1RA 3ANYB 4KKXB 1KEUA 3AILA 4UASA 1D4ZA 2YWXA 1Q77A 3AESA 3RIYA 4C07A 4DG8A 1YB4A 4WDRA 5FOTA 2WZCA 4M87A 4B9EA 1PVDA 2C57A 2DQZA 3V32A 3J7TA 1EUZA 4YO8A 2WMOB 1UIMA 4BO7A 1Z5ZA 1DTSA 2LPMA 1OFHA 3P26A 2FUNB 2X1MA 4AJ4A 4FGZA 5CYGA 2JZNA 2R97A 4N4AA 4R2XA 5B7PA 5D1NA 2BEKA 3SY8A 1SBIA 4BL5A 3VR2A 2FPPA 1GXSA 2I4MA 2X77A 2IZ7A 4DY6A 2ILTA 4HF7A 4I9HA 1CHDA 2IIBA 1ZAYA 1PSDA 1XAGA 3AEZA 3GFBA 4MW7A 2O1WA 3LTEA 3ZQKA 1WSDA 4HQ0A 4XVQA 4HMQA 4RY9A 3ZVRA 3DO8A 2HV9A 3FZGA 4KXQA 2UXBB 1UZMA 1KK2A 4R8LA 5IC6A 3A1NA 3I6BA 4JEUA 4MRNA 3NIDB 4R4JA 4UJ5A 1WX1A 2VTKA 4L2IA 2WF6A 1K6IA 4XUGB 4YJKA 3VUEA 4BV3A 5FUXA 3I05A 4ZXPA 3BF8A 2M6KA 3ZYZA 1EDOA 3VNBA 3EFEA 1UKEA 3GEDA 4E1VA 4A8PA 3ICQB 1N5JA 2P8JA 3ABOB 1L6IA 3PBKA 5IAEA 3QKSA 1B8NA 4UDOA 5BSFA 1HLFA 3MQ2A 1I9CA 1L3IA 1XHFA 1XZGA 2B20A 3FLEA 4FEYA 1KVTA 3SMQA 2VAPA 1RYNA 2NPIA 1X80B 5DLYA 3ELDA 3NZEA 1XG5A 3Q1LA 4I1UA 3U62A 4EB6B 3GLIA 1YR1A 3JQ8B 3H13A 4X6LA 4RTNA 4NH4A 3GRFA 3L02A 4PONA 2JI9A 1OMOA 3FF1A 3JAKA 4G09A 3RTAA 4DUGD 1YIAA 2A14A 2CZGA 4KBFA 3PD1A 4NYIQ 1QX4A 3I30X 2F9FA 4DJJA 2FHSA 4NSNA 4U5XA 4JI6B 3IVCA 3V4ZA 1NPYA 2RARA 3NDIA 1R6UA 4XUEA 2C3MA 4EYGA 3A8TA 2G8NA 2UVPB 3HWSA 3ADDA 3BE6A 3AUYA 2EZUA 4I66A 2WIBA 3C3BA 4NNPA 4V1CA 1ID1A 3MAAC 3FGPA 3RRNA 4CF3A 3M81A 1Z07A 1J8MF 2A9KA 1RRFA 4C6TB 3KTFA 4BO9A 1RMYA 4TLEA 2XVAA 2PJUA 4LOHA 5AK3A 4KIFA 1PWZA 1V8BA 2R7LA 4GNKA 5DGTA 1Z3CA 4M6WB 5F7JA 5CFOA 3PEYA 3NW9A 2NO5A 1H0HA 1HT0A 1QPBA 1YOVB 4JJAA 4MCIA 1CLUA 5FTJA 3WKAA 2VL7A 5GADl 1CDDA 4Y3UA 2PYZA 2V7PA 3GRAA 3IVGA 3ZZ1A 4NMXB 4Y1GA 5K4GA 3IOCA 1P6UA 4N3CA 4FDTA 5I4CA 5JJIA 1PLJA 4TMXA 1QCZA 3GRPA 1UBLS 1U5BA 1G4UR 1V2GA 2A5FA 3FSEA 4KLCA 4KXXA 3Q98A 4NLLA 3WOHA 3W3AH 3WYCA 2O8DA 3VYUB 3LLVA 1T5DX 3O3MB 1ECBA 1XEXA 3O8BA 1L5RA 1NQUA 1SBHA 3ZUGA 1QH1A 1E9RA 1K2WA 1K2VN 3DKRA 4BNWA 4BMOB 2EZTA 5AD1A 3DF9A 3I37X 4TTJA 3DEYX 3R74A 4YUAA 3HNPA 4K9KA 3DYVA 1D9XA 2HUNA 1Z83A 4AECA 5DNDA 1NBOA 1R16A 4P8RA 3PL5A 4MGIR 4Y2RA 5DRYA 5IP5A 3VNAA 5ITZB 3PA6A 4LJ8A 3ZE7A 5E6RB 4QTXA 1VRVA 4D9MA 4L8FA 5T4EA 3LOQA 5FEUA 3SC4A 6LDHA 2FSFA 2IHYA 2RHRA 1FK8A 1EUDB 1T0PA 4NE2A 1FUEA 5ICMA 4KWCA 1RC8A 5FF9A 4AY4A 3N8IA 3RYFA 4M99A 4YCJA 4WE3A 4KN6A 5EVJA 4F9EA 1U3TA 3HSYA 1XZFA 3LQRA 2YHIB 2IEYA 2K4MA 2Q4OA 1PJQA 4IGAA 4N3GA 2YWCA 3ANLA 5BNIA 3MK31 2AK3A 1KSJA 3JWHA 3KJEA 2N0SA 1JG2A 1MFZA 2FWMX 1CZRA 3KQUA 4NOMA 5TPZA 3S40A 5JARA 4J3NA 3JQGA 1S2LA 4DQUA 1H2ZA 3BAFA 4K6GA 2XVXA 2QUHA 1N2XA 1CY8A 4EOGA 5IAGA 3VR3D 2ONJA 3OU7A 1ZD9A 1E8DA 1MZVA 2ST1A 3ICEA 4BCCA 1CUDA 3TZEA 1RZVA 1YQDA 5HK9A 2OWEA 3RRFA 1IJBA 4DFDA 5FPQA 3AGPA 4MUXA 5TS3A 3BGVA 5EXEA 3TW0A 3WL5A 3X2EA 4CKEA 3BMNA 1KSFX 4WK0B 1NW6A 2BGKA 1VHTA 4MW2A 4BO8A 1PNQA 3INGA 1W19A 1P7WA 4EITA 3JSXA 1S3SA 5K9ZA 4N3AA 2OM6A 5CFRA 1RBZA 1ZXLA 2ES4A 2FDCA 1K8YB 1TQ8A 3U3DA 2IHTA 1CS0B 1Y3FE 1Q19A 1NF3A 5I3CA 3PDHA 1DOAA 5B4TA 1FIUA 1FF9A 3TBKA 5C51B 1ODJA 2WJHA 1Y5RA 4ZHQB 5JSZB 4YB8A 2W98A 1N6HA 1RW4A 3IUMA 3VPXA 5AJHA 3G13A 3F6YA 3SZLA 1D4AA 2R68A 3L6RA 3V6LA 6AT1A 5LM3A 1OYOA 1XRJA 3C6MA 5AYVA 2AMVA 1BU8A 1NXVA 3K35A 2PZFA 4U9UA 4M37A 5CITA 1R6BX 1VLJA 4FZRA 3CB2A 4F11A 4WA8A 2AJDA 1HETA 2P79A 1SUCA 2A0UA 3HKBA 2X5NA 3R75A 2RB5A 2D2IA 3JRXA 4AP9A 2HOQA 4YS6A 4K0KB 1YD7A 1A9XB 4MK4A 2V98A 2JZCA 2AHOA 4LYEA 2VDLB 3OEHA 4MYSA 4POAA 5DYIA 2QMOA 2SKEA 3RVQA 3SEFA 2Q3HA 2Y2VA 2AN3A 4QUBA 3OLCX 3WHPA 3AWDA 5A3SA 2FQQA 2IPNA 3L77A 1P2UA 3C8UA 3QPAA 4M1EA 4X71A 5SICE 1BH2A 5MGBA 2W71A 4AUMA 5C52B 4K88A 5BR8B 3EA5A 3OX3A 5JVDF 3EZ2A 4HOYA 1R5NA 4ZICA 4J6FA 4J94A 2DEUA 3LNTA 2WM9B 4IIJB 3F49S 3NHAA 3WLHA 3TOVA 1T10A 1DARA 4JWKA 4L4ZA 5DF1A 4LXHA 1JAXA 5GP1A 4HEQA 2JJQA 1GKIA 3KEMA 3TIXB 2IYSA 2MT9A 2YYSA 3ZE8A 4F6CA 3V7YA 4KZPA 5EJMA 1E60A 5JH7A 3G9XA 2P9BA 1DIRA 3EN0A 3CMMA 3GT0A 1CVLA 3ZWBA 2WHPA 1JPUA 5C8YB 2OBBA 3JQAA 4KYIB 4ZOEA 4EPYA 1HOXA 4NAUA 1ILEA 1QWOA 2WWYA 1I5OA 2JGFA 2ZBDA 2QORA 4JV5B 1ZEJA 4RANA 1I0IA 3WLRA 1RXEA 2Q28A 4BX9A 1J97A 1GKKA 1DIGA 1P6QA 5CH8A 2W6JA 3O8DA