1E6LA

Two-component signal transduction system d13a mutant of chey
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
DKELKFLVVDAFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Towards Understanding a Molecular Switch Mechanism: Thermodynamic and Crystallographic Studies of the Signal Transduction Protein Chey
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 42
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e6lA00
5JS2A 5KQPA 2PUGA 2PUBA 4RK0A 1ZH4A 4N0PA 1QP7A 2NZVG 1QP0A 3QEMA 3IP5A 1DCFA 2JBAB 3H1FA 5F64A 2W42A 3CS3A 2FMKA 2Q5CA 3O74A 1DBWA 3CU5A 3QLTA 1EFAA 3N0XA 1OXBB 1SD5A 4PZ0A 4RXMA 3IP7A 5I4CA 4MR7A 5DCLA 1U2PA 1CYEA 2FEPA 4KREA 1M2FA 3EDCA 5TQ2B 5IC5A 3FMVA 2LP4Y 4YGXB 3F73A 1D4ZA 1JL3A 4QYWA 1NXPA 2L18A 4WZZA 4ETNA 1JFTA 3K4HA 3Q41A 4NV3A 3HEBA 1USGA 2PL9A 2QR3A 5JNUA 1DJMA 1NXTA 1C0EA 3EQZA 3OLXA 4N76A 1VLZA 5FWYB 4F8JA 2B1JA 4IMIB 4MAAA 3HM9A 2HQBA 4GNRA 3H5OA 4MS1B 4RY8A 5JNSA 5IUJC 3HXMA 4F3TA 5IEJA 2FVYA 4LZLA 2AYZA 5FBKA 4M88A 4F11A 1VPWA 2A9QA 3NNDA 2JVJA 6ABPA 4MQEB 2R47A 2FW0A 4W5NA 3H5VA 2IPNA 5EWJB 3N0RA 4EVSA 4YO7A 1Z16A 1UDRA 5KQMA 4QICA 2QVCA 4LDAA 4KPYA 2IPAB 3A3KA 4S04A 3OQOA 2KYRA 3T95A 1NXSA 3A0RB 4NQRA 5IUKC 3I5AA 3QX9A 4NCBA 3EULA 3C6QA 3RVOA 1LJUA 3O1IC 4XARA 4Z99A 3C3WA 1ZY2A 3RVPA 2NT4A 3GA5A 3N6VA 2H0AA 5CNMA 4F06A 3LUDA 2MYPA 1T34A 1ABFA 1P6UA 2JBAA 4YWHA 5TPZD 4N41A 1FSPA 2JVKA 4EYOA 3FFXA 3SAJA 4OLBA 4TMYA 5KWSA 5CNKA 5T3YA 1FQWA 2P4UA 1PHRA 3BRQA 3EODA 2AYXA 4OBBA 5TQ2A 1SXIA 2GKGA 3Q7SA 3MMNA 1B00A 5B3JC 3KS9A 2ID7A 1NXXA 3L6UA 4ZMSA 1JDPA 5TQ0A 1BVHA 4OG2A 4ETMA 3GBPA 1BA2A 4E7OA 2FSPA 2HPHA 1L5YA 1Z18A 3EJWA 3Q7TA 5HSGA 2WJAA 1PEYA 3URMA 3OQNA 2NT3A 5PNTA 1W9HA 3NNNA 1Z25A 2IDMA 2L19A 1TJYA 1ZGGA 4XFKA 1WETA 3LTEA 1XHEA 4MS1A 3JS5A 3L49A 1QQAA 2VK2A 3G85A 4G0YA 3F6CA 2FMIA 4DADA 3DZDA 1Z12A 3GL9A 4WXMA 3RVKA 1TVMA 9ABPA 1DC8A 4GPAA 5E3JA 1YK0A 2ID9A 2IPLA 4MQFB 3H5WA 1NXVA 4KQCA 1F4VA 4IF4A 3NHZA 1LBHA 4Q7EA 4RY9A 4ZPJA 5IBQA 1QP4A 4TLLB 2FN8A 4ZMRA 1YS6A 3C97A 1EHCA 3SNKA 1BAPA 4RK7A 1RZRA 3KSMA 2IYNA 1SRRA 3CKMA 1ZN2A 4UHKA 4MS4A 3VNAA 1JFSA 2QVGA 4IGAA 4Z4HA 4Z9BA 2MSWA 5DGCA 1EAYA 1FFSA 3JVDA 3JPYA 3C3KA 3MIZA 4MR9B 3SG0A 1R8JA 3GV0A 1U8TA 3H75A 3DLHA 1OXKB 2F8TA 3H1GA 3LUJA 2ZWMA 1MVOA 4FB4A 5KQGA 2GI4A 3KCNA 1JBEA 4MGEA 2CD7A 4YR7A 2QXYA 1JYEA 1U04A 4KMRA 4F12A 1DCMA 4EVQA 3LKVA 1F51E 3O75A 4Z9AA 2X7XA 3Q9SA 4H3KB 1PNRA 3O2QB 3O2SB 5TQJA 4W5TA 4PICA 1JF8A 1BDHA 3KHTA 3M9XA 3IPAA 1HEYA 3BRSA 4N03A 4PEVA 3CG4A 4MR8B 5TPWB 4CBVA 1E6LA 4YRZA 4MS3B 5IEBA 4HNRA 4G86A 2IKSA 4EGSA 1ZITA 3KLNA 2CHEA 5FBHA 4Z4EA 4HNQA 4MRMB 2OENG 4Z4IA 4EYKA 1NATA 1I3CA 1DZ3A 2FN9A 1YIOA 4MQFA 4RY0A 4YCSA 2PUAA 1BDIA 1LK0A 3DBIA 3KG2A 4HNSA 4WWHA 5ED4A 1MB0A 2OQRA 3FFTA 4P98A 4JP1A 3H1EA 1AB5A 3DGFC 2P9HA 3H5TA 2H3HA 3DLBA 3W9SA 2O20A 3GYBA 3D02A 4N47A 2M98A 3H6GA 1E6MA 3A0UA 3TD9A 2FTKE 2PMCA 3MF4A 3I09A 4ML3A 1AB6A 4RU1A 5FWXA 2HJ9A 1KMIY 4MLDA 1RNLA 3CZ5A 1EWVA 4MR9A 1ZESA 3MYYA 1EWTA 2YHAA 2E4YA 3HUTA 4RK1A 4YLEA 5EWMA 3OLZA 4KRFA 1Z2DA 5IX8A 4TLMB 1MIHA 3TO5A 4Z4GA 4G0MA 4O1HA 3IP9A 2XDYA 4S05A 3OO0A 2FKAA 1JLKA 1JDNA 4LE2A 3FGZA 1YMVA 1DG9A 1DBQA 1YVUA 3MQ4A 3OLVA 5KC8A 3LMKA 1U0SY 3LFTA 2R48A 3RVSA 3TX6A 1Z13A 4UHJA 2V0NA 3QLUC 3FFWA 1MB3A 3HVRA 4JASB 3EAFA 1ZH2A 2VUHB 4ZYLA 1PUXA 1NTRA 4Q6WA 1VRVA 3OM1A 4XASA 1A04A 4KZKA 1D1PA 1GUBA 3KKEA 5JNRA 3ILHA 3T6KA 3NHMA 4RZSA 3F6PA 2FMFA 2FMHA 3QELB 1ZGZA 1JYFA 5FWYA 4MRMA 2LUOA 3EGCA 5ABPA 2JRLA 5GQSA 4JOQA 1JH9A 3HSYA 4LRQA 3H5IA 1JWLA 5BQ3A 4NCAA 4FE4A 4ZJPA 3HDVA 3UK0A 7ABPA 1QKKA 1JFVA 4EVRA 4WUTA 4Z4FA 2FQYA 4YV7A 4TN5A 1JX6A 1DC7A 5B3JA 3NBMA 4G0PA 4NICA 4MQEA 4MR7B 4WT7A 2J48A 3N75A 1NY5A 2QU7A 1GLGA 1Z26A 2MSLA 2A9PA 4RKQA 5EWJA 3M9WA 5EWLB 3LKBA 5KQLA 2FQXA 2WRZA 1M2EA 4IMJB 3OQMA 1QQBA 1Y1LA 4O1IA 4OTZA 1A0OA 3H6HA 2M1ZA 1VKRA 3FDFA 1ZAYA 4RK4A 3QLVC 4P1ZA 1APBA 2FLKA 4L85A 3HZHA 4RXTA 2PE5A 4OLAA 4RKRA 5HM6A 4IILA 5KC9A 4KNYA 3T8YA 2L2QA 1QPZA 4RSMA 3GBVA 4LDZA 2JB9A 1QNLA 2RGYA 2VUIB 3OMXA 4MYRA 5IULC 1K68A 3Q7RA 2RJNA 2PKXA 2A9RA 4QYMA 5DLEA 1DRJA 4RDCA 3I42A 1KRWA 4Z0NA 1E2BA 3KYJB 1J56A 1GCAA 2TMYA 2E4WA 1K66A 4JB0A 2PLNA 4LE0A 3T38A 5D2CA 3LUAA 3LUKA 4Z4CA 1LJLA 3ROFA 3RVLA 3A10A 1H9CA 4Q6BA 4D6YA 5JNWA 3QELA 1QO0D 5TE9A 3EQ2A 3IP6A 3O1JC 1U2QA 3QK7A 4LX8A 2GX6A 4ETIA 1DRKA 3GWGA 3G1WA 3MA0A 4EY3A 2R4QA 2QSJA 1YMUA 2HQOA 2CHFA 2NZUG 2ZAYA 3Q15C 3SQNA 1ABEA 3GT7A 1KGSA 4JB2A 2FXIA 3RVRA 3ILYA 4KK3A 1Z2EA 5TPZA 3CFYA 1RZRD 3N0WA 3O21A 3O1HB 1MAVA 2FEKA 3SY8A 4G0QA 4KK4A 3CRNA 1TLFA 4KQ9A 5EWLA 8ABPA 4RK5A 2PJUA 4PYRA 5TQ0B 2PUEA 4O5AA 1QMPA 4G97A 2HQRA 4G0OA 5GOTA 4B09A 1CHNA 3HV2A 1P8AA 3DGEC 3LOPA 4E7PA 3RQIA 3SM9A 3RVMA 3BILA 4YP9A 2E4VA 2FEWB 4H3HB 3S99A 2LPMA 4KV7A 1GUDA 1YK1A 3N8IA 3M6MD 3OMWA 5JNVA 2HSGA 1PNTA 4XXHA 2RDMA 4LE1A 1RPJA 4DQDA 2GBPA 4KFCA 2WJWA 2MSKA 3BBLA 4WXEA 4RXUA 2IPMA 2VYCA 1CEYA 3LUHA 4PE5B 2WY2D 4EYQA 4N0QA 4FE7A 1P2FA 5JS1A 3F7NA 2PAFA 3CNBA 1NXWA 2MYNA 1BDJA 1KRXA 3QEKA 3LUCA 1ZDMA 3LUGA 4D6XA 1C4WA 1FFWA 5BR1A 3OLYA 4RV5A 2PUFA 1DCKA 4MS4B 2GWRA 1URPA 4D74A 2E4ZA 4MR8A 2FQWA 1P6QA 1FFGA 1IIBA 2B4AA 2E4XA 3CHYA 3QX8A 2JVIA 5TPWA 1LBIA 4IRXA 1ZHHA 4MS3A 4EYGA 1XHFA 3KJXA 4HYEA 4KVFA 3HDGA 1GCGA 3IDOA 4OATA 5HKOA 3JPWA 3HJFA 1Z15A 3D8UA 1NXOA 2F8SA 3KLOA 5BRAA 5IUNC 5CNJA 1TM2A 2A9OA 5BRJA 2JCGA 2R25B 4QPJC 2QW1A 4DN6A 3HO1A 3QEMB 5CHYA 5CNIA 1D2AA 3RVNA 1RXIA 3KTOA 5DKFA 3UKJA 1RXEA 3QLUA 5C5EA 2N9UA 3C3MA 3JVIA 3LUFA 4MLCA 2NUBA 1SXGA 2DRIA 4RWEA 4XAQA 3ROTA 3OLWA 3VNBA 5JNTA 4W5OA 1USIA 4H60A 3CTPA 2LBPA 3CG0A 2BGGA 3OO1A 4G0ZA 3K9CA 3CLKA 1ISSA 3B2NA 4L4UA 4EUKA 3UUGA 1L5ZA 2QV0A 1EWKA 1QO0A 2CWDA 5T7BA 2JK1A 2WWVD 2E4UA 3E61A 1D5WA 3N53A 4RS3A 5KI6A 3HUUA 1D1QA 3BREA 1A2OA 4W5RA 1M5TA 3TMYA 3RVQA 6CHYA 3OM0A 5DTEA 5C5CA 1XWWA 3TB6A 3P9YA 2MYUA 1SXHA 2L17A 1JHZA 2WB4A 2PUCA 2PUDA 5HQJA 2RJOA 2WMYA 3HS3A 3IPCA 3I45A 3NNSA 3HK2A 1YTUA 1ZVVA 3JY6A 4YS6A 3RVJA 1TMYA 1PEAA 4RK6A 3CZCA 2IOYA 1USKA 3KYIB 1DP4A 3JTEA 4MPTA 3O2JA 1M5UA 3GRCA 3H5LA 3R0JA 5FWXB 2PL1A 1DBPA 3QLVA 1ISRA 4G0XA 2FLWA 3E3MA 1S8NA 4JA2A 4W5QA 1Z17A 1E6KA 4JAVC 4XLTA 2LIVA 2YHBA 3RH0A 2I6FA 2MYTA 3MM4A 2QZJA 1W25A 5EWMB 1YS7A 4Y9TA 3HCWA
chains in the Genus database with same CATH superfamily
2O2ZA 3P96A 5JS2A 5I3CA 3IV9A 4Q16A 1BWSA 1LBEA 1NI3A 4O29A 3S1AB 4NMHA 1F0YA 1YOVA 2BGIA 3UWSA 1DHRA 2VRCD 4I55B 4ZVQA 1C7JA 2PX5A 4EW3A 4D4GA 4B4WA 3RR2A 3T41A 4DIOA 2ZYVX 4G85A 5KYYA 2HRCA 4A8HA 3UMJA 4RHCA 3OCYA 1NDHA 4JLNA 2WJ6A 4RKFA 3U3RA 1C41A 2AG6A 1V25A 3NDRA 1KDZA 1PK7A 3FPCA 3JYOA 3OHSX 4J2TA 1I5EA 3EAGA 3GROA 5D00A 4K26A 3ZHOA 3WGTA 4V38A 1M8FA 5A5DA 1YCGA 4IG4A 5HK8A 5E2AA 3RD5A 2BGKA 3VDXA 3GZJA 5C31A 3RBZA 1C0EA 1UWLA 2V7QA 1GYQA 1MQSA 4HAUA 1JQKA 1N5RA 4ABYA 2DBZA 1Z82A 4XJVA 3HM9A 3EG5A 2QZSA 4U3JA 2OQIA 3WIOA 4CW7A 1NA5A 4OBXA 5IUJC 1PU2A 2C5BA 2GM5A 3MCVA 3MGAA 1E2DA 5AUOB 3IMKA 5DV9A 4P32A 3M3PA 1ZVMA 4N39A 5ECWA 3V1UA 1O5OA 4CKEB 3CWQA 3C8DA 2VN8A 4QD3A 3UN1A 3A1TA 4BHTA 1KJIA 2D5IA 5KREA 3I2JA 4RVOA 4R01A 3MMXA 1YGYA 5G53C 2V4ZA 2NZJA 2P9JA 4KTVE 5CCDA 3KWJA 3ZWBA 3K6KA 2GEBA 4V1CI 4R8VA 5C81A 1NE7A 4EVSA 1VHJA 4M0MA 4PX2A 4GOKA 1TEHA 2FZKA 3ZDYB 5JC8A 3TVYA 1KPIA 2R8YA 2GVNA 4MEJA 3SJAA 4WZ6A 3MAGA 4GRIA 5H1YA 4PNPA 5DGIA 2NSLA 1JJBA 1SUAA 2Y9MB 4W82A 5A4FS 2C0PA 3WYFA 2ZXUA 2O50A 1MAUA 1R5JA 1UCFA 1WMFA 1ZY2A 2EIXA 5A4IS 2O4UX 3ZJTA 4CQMD 2BHLA 2H0AA 1IN4A 2WA2A 3TOXA 1EGAA 2IUSA 4IRMA 2VDNB 2KPOA 2O8DA 4CTNA 3QH4A 2GQ0A 1J33A 2W2LD 3N74A 2X8LA 4IO1A 3UWPA 1AH2A 4X94A 1PJCA 3GEEA 4CXMA 1PR1A 1FK8A 1FQWA 5I7RA 4WZBB 3RSGA 2FMUA 3EODA 2BBWA 2D0IA 2AR9A 3BIOA 4PG5A 5IARA 1P80A 2P9YA 2B7CA 5CB4B 1E61A 4MUJA 2W6JD 4TMWA 3NBKA 4YN3A 2WHRA 2ID7A 2NUAA 4LJAA 4P84A 5LVAA 1U8FO 2HWWA 4N9QA 5CW1A 3TJRA 3W04A 4ZV9A 5JH7A 2Z6UA 2Y76A 1Z5NA 1JKXA 1G4AE 4QPNA 2WJAA 3DH0A 4TLDA 1BWPA 2RGDA 4H6VA 4IHKA 1U0FA 5LP1A 4JP2A 3QRWA 5SV2A 1ZRMA 2ZI4A 3IIJA 1T1RA 1Z25A 3ZCXA 1D9ZA 4L4ZA 1V47A 5DNCA 1KKMA 6GPBA 1JQ3A 5LN1A 2PO7A 1NLFA 3PC7A 3AU9A 3CX4A 5GONA 3G85A 1FUUA 1D6NA 1R9NA 1VXOA 4LYAA 4YHHB 5DX0A 1OJLA 3PLNA 3GP5A 3M6FA 2WI8A 3L4EA 4MHSA 2EL9A 3CEJA 1A9TA 4WQMA 3MTIA 2ZCJA 3DBLB 4D9BA 4EUFA 4OL9A 3MXTA 2DQSA 1OLXA 5D85A 3EXFA 3EN0A 5FT9A 1MW9X 4GKAA 1S2OA 1U81A 3R9XB 2HADA 1HL3A 1IE3A 4KO2S 1IM2A 1SHTX 4FCCA 4QT4A 4IIXA 3ESDA 5ARDA 3PXAA 3DO5A 5LYJF 1JEEA 2CNOA 3G6WA 3OD1A 5HS4A 2ZR8A 2J07A 3ENWA 4MPPA 1EX1A 3RU7A 5F5NA 2ZWAA 3F6EX 3M49A 1XLUA 5TF4A 4BNZA 1Z74A 3MIZA 1QVVA 2Q3JA 4I3GA 4J4TA 4B6SA 4C4AA 3G5AA 2GXAA 3V4FA 1HMPA 1U9ZA 1YRQA 3BH6A 2ZDHA 2HGSA 2V6JA 2WIDA 3LQKA 4D4MA 2XZDA 1V0JA 2N0SA 1C3XA 5FD8A 2QRKA 5K8TA 3J7AC 3HLKA 1T4BA 4OO3A 2VP6A 2P9EA 3OG9A 3GOQA 1DDIA 1KIFA 1CLEA 3P2EA 4PGGA 3S8YA 2BR5A 3CA8A 3VM6A 3O75A 2AA3A 3IO5A 1P9LA 1AKRA 2H1FA 2ZTHA 4OGGA 5DMHA 1DVRA 3SVTA 3UMGA 2B6NA 4DR1B 4OUDB 4OHFA 1Q0PA 5P21A 4B3TB 2CBXA 2JLYA 2B37A 5CG1A 1CFZA 2O57A 4LOAA 3AVTA 1W9MA 1H8ED 4G5OA 4ZKEA 3AVYA 1Y89A 1Z6GA 2B8WA 4GIBA 3TIGA 3U19A 2GEVA 3LYHA 4XD7D 1R66A 1E6LA 4DNFA 2E9SA 2MJLA 5IEBA 1M7HA 1V37A 1IWOA 3AZQA 3K70D 1Y63A 4KMOA 1IXZA 3S27A 2X40A 4EAQA 3WMEA 5IFKA 1QHXA 4P4SB 4TWBA 3GU3A 2FLVA 1DQYA 1GV1A 4X45A 1GCUA 1GVHA 4BP1A 3H87A 5ITVA 3N2KB 3RTGA 4P98A 2DX7A 3ND6A 4OREX 1YQGA 4IS3A 4F6CA 2CKMA 2O20A 2YZKA 1SVUA 2ZI9A 4FEAA 4TLEA 4RFVA 1LPBB 2M6KA 1FFAA 2H65A 3WLRA 2WQ7A 4B87A 2OB1A 4V39A 1RJFA 4OQLA 3W2EA 4DT1A 5JTUA 2FW1A 4ML3A 4AROA 5IT4A 3D0QA 3RF6A 4Q01A 1QTQA 3ZZTA 1T2DA 1KA9H 2L82A 1G6OA 4KGXA 2OD9A 2ZCUA 4LK3A 4RLQA 1R1DA 4ZU1X 2ZT5A 3KZCA 3F7MA 3UIEA 2VDRB 3LBNA 2XWBF 1Q91A 2KM1A 3OLZA 5KOYA 5JD3A 1N3LA 4FYJA 4XWAA 3TSCA 3K2EA 4BN0A 1KO1A 5HKBA 4N5NA 1EDBA 2PUTA 3CPHA 4HWGA 1G9XA 1S1MA 3NIDB 5A1TA 5J4LA 3CLUC 1K63A 2C97A 2IGBA 1Z2OX 2WU8A 3KK0A 4A8JA 3VTFA 1NBIA 3L8CA 4HZGA 4JYAB 5LA6B 2O0JA 4YCBA 1UAYA 4BLVA 3UFXA 4DG8A 2FSHA 1T2FA 2EX0A 2G88A 2IC5A 3K4QA 4TQUS 1UFQA 3ZJVA 4HATA 1UMDB 4MV5A 5KSPA 3UH1A 1EJBA 2UXDB 2E0IA 2VF8A 3HVRA 3PCXA 1XTZA 1ZH2A 2VUHB 3B7GA 3HCPA 1WNFA 1KF0A 4MRPA 2QUAA 1GNPA 4UFPA 3HKDA 2P35A 3FHJA 2CHQA 2ID8A 5CYPA 1LW6E 3KKEA 3LH5A 3V8EA 1UK6A 3T4EA 4MW1A 3R5FA 1I6KA 2XR1A 4OHZA 3RBAA 5DT2A 2VBIA 4Z86A 3F0TA 1TJNA 3L8YA 2VLBA 5KUTA 4OMUA 2C1XA 5GQSA 2BGUA 3KZOA 3NGLA 2XE4A 2PWAA 1VE3A 1OLUA 1W93A 4FE4A 3FE2A 3A7EA 5IANA 3FYUA 4TSKA 4A26A 3D4IA 4NV1A 4YDRA 3CLTC 2J46A 2QORA 1N6KA 3W2HA 3MN1A 1GU0A 2ZT7A 2R6R1 1XVIA 3UG7A 1J2TA 4YV7A 3L2OB 3HCOA 3Q9NA 1VSBA 2A4MA 4AF6A 5L9AA 1ZK4A 2NIPA 1KI4A 1PFQA 3W2FA 1VBMA 4BX0A 1DRUA 4LRXA 3GT0A 3DOJA 3ZE9A 2C20A 4JBWA 1P9WA 2H51A 4YPVA 5BXYA 4IIEA 1UKVY 4BV8A 3OJOA 3PPIA 2RSLA 4KFRA 2VP2A 3GCZA 4B0PA 5DTJA 5HKKD 2DJIA 1OFTA 2G6BA 4LBWA 5A3JA 1Q6ZA 2JAXA 4MJXA 2VJMB 3CF6R 2GCOA 3CZ4A 3QLVC 4L7QA 3BWYA 4NCJA 4P2BA 1EFLA 3UNXA 3PFGA 1JB9A 4CUZA 2AXPA 2DFKB 5BT8A 1PX2A 2C9MA 4DR5B 3GB9A 3PX2A 5NULA 4BC1A 4RSMA 3IVCA 1J0XO 3DQQA 3CBQA 9ATCA 3PNOA 4NZYA 2IHNA 3FPGA 3ZLBA 2FUG1 1UAGA 2NV6A 2VUIB 1K3UB 1RRGA 1HURA 4W7SA 3U16A 1XJWA 2NQTA 1VE9A 2WYWA 4C3ZA 4C5CA 4RDCA 4JQYA 3TKAA 2BSXA 1SUWA 1ZS9A 1H5UA 5AKLA 2LZ0A 3R41A 3TD6A 4XOIA 4N8DA 3F8WA 1M3SA 3ANTA 1ZAKA 1PZHA 4G1CA 1NPYA 1E9FA 3ONWA 4J9UE 5CH5A 2EWMA 3KL4A 4DQLA 3KSAC 3EWIA 4EMTA 5LOVB 4B1FA 3TIXB 2Y1DA 3BXHA 4U8GA 4EKGA 4RX1A 2JI8A 5TE9A 3GJ0A 3DYBA 1UIMA 3N70A 1R5BA 2FR8C 4NENB 1P5FA 2AJBA 5IAAA 4O2BF 2HFKA 3PXEA 2YOHA 3B82A 4ALJA 5BYKA 3W6ZA 1N6LA 3RJZA 2WHXA 2KLHA 2CHFA 2VH2A 4ZCQA 4K9DA 3D7NA 1C2TA 4I7EA 5CLQA 1EM8A 1CZRA 4JB2A 3AP1A 3RDPA 3CVOA 3I30X 1ZSYA 4KK3A 5EIHA 3VYUB 5TPZA 1FDSA 3QKSA 4LYDA 4UBKA 1KR5A 3ADCA 4QQKA 5FO1A 1NHWA 3R4VA 5EWLA 1O94D 2XBLA 3IKMB 3SHVA 4CR7A 3M2TA 3O8LA 4DR7B 1N32B 4LOHA 3BZUA 1I1QB 3PD1A 4IUYA 1HT2E 2X0EA 1ISHA 4Q24A 3UWDA 9LDTA 1OAOC 2OGUA 4XUGB 3P9ZA 3T3NA 3V2HA 2C98A 2AQKA 1P8AA 3JQ6A 1EUDB 3O5AA 3OZTA 4GPD1 4HLNA 2FZCA 1KE2A 5KPDA 1M1NA 4YWJA 4OGWA 1BC5A 3AI1A 3GAFA 3ONDA 1Q7BA 4J07A 2VSFA 3PC6A 3WGMA 1KU0A 3SLGA 3WB2A 1R8YA 1CULC 1VHWA 1PD0A 3JYHA 4FHGA 3DO8A 4NPAA 4RPKA 3RODA 1E7WA 5C7IO 1D2CA 3BXZA 4W1PA 4BNNA 2YNMD 3ROEA 1DG3A 2RGEA 2HN9A 4IFTA 2QM3A 4LC1A 3WQBA 4OU4A 2J31A 2Q8QA 3BAZA 4ES6A 1E1RA 4GI3A 5ISMA 3QGMA 4YB8A 3QLJA 3MWEB 4Y2GA 1WHSB 1LZKA 1CRWG 1KRHA 5JS1A 4H6XA 5K6AA 3I8XA 1JHAA 3ZE7A 5LD2C 2IY7A 3FG9A 4GUAA 3NHUA 3C5WP 4MI6A 1QONA 1O9HA 2I3GA 4NZOA 4QEDA 2Z2JA 5K20A 3SGLA 2F67A 1BCSB 1P73A 5ITZB 5J58A 2KX7A 1I51A 3HADA 2D1RA 2BGTA 2HKIA 2I2CA 2OILA 3WKDA 2P75A 1IN5A 1I7LA 2VPYA 4KRGA 1A8SA 3K1TA 3L46A 4EYGA 1Q44A 5DNWA 2R3SA 3UPUA 3E3OA 2ROQA 4RCYA 3GLGA 4OATA 3TQFA 2LCIA 3DXZA 4R83A 1WDTA 2Q2OA 1GNSA 3DFFA 3F4BA 3GY0A 3I1FA 4D4IA 1DIAA 1U3DA 3BWDD 3LC2O 3FNHA 3A6PC 5EP1A 2QW1A 3A6LA 3TNFA 3KKNA 3WK5A 3F78A 1E7QA 2J9YB 3AY7A 1O3YA 1AMUA 3COWA 4DNPA 2XCLA 2DRIA 1FOEB 2FZGA 3GUUA 3JAKB 4KQXA 1W0KD 2XNHA 4K9KA 3GJQA 4C22A 4QJBA 4BVJA 4HHEA 3B52X 4O8ZA 1CRZA 2R66A 2CVHA 2DTEA 1XRLA 3CH6A 4P3YA 1LGYA 2BFPA 3O9MA 5B1DA 1YRHA 1Q3HA 1T9CA 2A1UB 3FOCA 1HDYA 1ADGA 1M8JA 1G2QA 2CWDA 5J40A 1JR3E 1NTOA 1A9XB 3OT5A 3BREA 1SU4A 2Q46A 4I0WB 2YHIA 3FRIA 3ETJA 1NC1A 4LJ5A 5B7GA 2GYUA 3FCYA 5BYJA 4UOEA 2QMQA 2WB4A 5TDHA 2OT3B 2CUZA 1ZJWA 3A3YA 1XMXA 1XV5A 2UZIR 2ZIXA 2F17A 4HNTA 2RKOA 4M1OA 3BIJA 3D8TA 4Q21A 4YS6A 1I1NA 2P65A 3VU0A 1KP3A 4U4AA 4XVCA 2HWXA 5KPJA 2NSDA 3NTOA 4KSBA 5IMBA 1CY0A 3ZU4A 2XJ9A 4BFZA 3OE7A 2PGNA 4U7WA 2OCGA 4NOKA 1JILA 3V2UA 1OZFA 5L7YA 2GEDA 3UUFA 5AYVA 2P2LA 3HU1A 3K32A 2EHDA 4QDTA 1FLDA 1IXRC 1X3LA 3IAFA 3VPAA 5L7TA 4TVKA 4YJHA 3F6RA 4UCWA 2GXUA 4IHAA 2IGTA 3IV6A 2OLEA 3JD2A 2DBVO 4N0PA 1WQ3A 3KSBC 4D9FA 1GT91 2PMBA 1QG4A 2ZSIA 1DCFA 2CLHB 3K73O 1SKBA 3H9UA 1RWMA 3QPWA 3EXHA 3EXEA 4F45A 3KEGA 1T5HX 2G4CA 1IUPA 5ALNA 3HB0A 2PX3A 2QG9A 1U2PA 1OLSB 3H0CA 4Y0VA 1XFAA 4ZRDA 1M2FA 1GIAA 1HYEA 2UKDA 3SICE 3AOGA 4I5GA 4AMVA 7AT1A 4MQ4A 1M6HA 1MJNA 1IY0A 4KKXB 4ETNA 1M6EX 1XJ0A 1ZM7A 3OETA 1NMXA 4N7RA 1IN7A 5AJXA 1E4EB 2BI8A 1CJTC 4BFTA 2X8AA 2BE9A 5CH3A 3RC3A 2DECA 4BDTA 3K0BA 2DLDA 4RSHA 1G41A 1TVKB 4JR2A 4M4SA 1WUTA 3DHYA 1C7IA 4XD2A 3LA8A 1ZZEA 1FJGB 3K8OE 3MTDA 2ZREA 3ZEIA 1C0LA 3PFWO 4FDTA 1IUNA 1EFPA 4UBNA 3NOVA 3UBMA 1Q95A 2N75A 4K6GA 2C9CA 1SVNA 2POQX 1R8QA 3OKPA 4KL8S 1X70A 4GVLA 4MUBA 1WU7A 3ND8A 1G20A 1JG2A 3DWEX 4CT5A 1USVA 3TR0A 4UXIA 5EWJB 1AKUA 1PTKA 1QX3A 4BMDA 2R87A 4ZDIA 1FS6A 3DJFA 4KPYA 5BN5B 3V1MA 4C29A 2W2XA 3REOA 4C9BA 1XTRA 1ORTA 3GJZA 1NXSA 1TIKA 2Q07A 3NS7A 1N5IA 3WLFA 1DB3A 4ZZIA 3QPUA 5K8UA 3ZD8A 4ZODA 4AIRA 2FPRA 3HV0A 3TJMA 4EJMA 1HNZB 4N41A 4EHAA 1NVVQ 3N28A 5JE8A 3STTA 2OCIA 2ZYUX 3ROZA 5JJCA 4OBWA 1XZPA 5C8YA 4LEIA 5LWQA 4DE5A 1NKSA 2YYYA 1HKHA 1X1DA 3AHFA 4O4HF 3TSOA 2ZE7A 5DM0A 3DBVO 3JATA 5H82A 3DW1X 5K3FA 2P27A 4N5MA 2Z0MA 2GKGA 3PUWA 4ZI7B 1NVFA 1DX9A 3GLFB 5AR1A 2C42A 3AUUA 3IGFA 1RC8A 1JFFB 1P8JA 3IUJA 1P29A 2WTXA 2ZJ8A 3BS4A 2H6EA 1RR6A 5B2ZA 5TQ0A 5A0TA 3IB6A 3R6WA 4FHCA 4Q9IA 4WOPA 2HPHA 3CZ9A 4MULA 2RGNA 2DTDA 5GY7A 5C18A 2QL6A 5E8RA 1LVGA 3VJRA 5DTIA 4ZVTA 2H31A 1IVSA 1K0FA 3G17A 1RIIA 3KOZA 1RJEA 4PZLA 5CLHA 3GGSA 4M8SA 4MW6A 1RQPA 3C3JA 3UOAB 4RD6A 2FMIA 1VE5A 3F74A 4EB8A 3BIXA 4TTTS 1SCJA 2A59A 1UFKA 3EXG1 3WBFA 2DHEA 1WUKS 4GPAA 2DUMA 2XH8A 1EB9A 4AZ0B 2DPYA 3NVMB 2ZU0C 5BSVA 3NHZA 1E6WA 1S3SA 1MC4A 4JIGA 1N2CB 1TL7C 3HJUA 1NZDA 4P36A 2WWTA 4IZHA 3ESAA 4MOWA 3B3FA 3JQ8B 4QBKA 4R8SA 3TUZC 1NJGA 5DBOA 4RK7A 4HVLA 1V7CA 1ZN2A 2EV9A 2BJHA 2D1FA 4QXQA 3VNAA 3BJEA 4K8RB 4ANFA 4Z4HA 3AW8A 4UVGA 2O8BB 4PZAA 5GAJA 4NJOA 1D5CA 2HT6A 2X8WA 2PZKA 4B74A 2V6BA 3NKFA 5HS6A 3V7FA 3ON5A 4OJYA 2J30A 4DIDA 1UJNA 4GMGA 3LX8A 3KEMA 4F5EA 1RBMA 1V71A 2FP4B 5KHOC 2A0XA 2G28A 1B1AA 1C3EA 1VSUA 3LFUA 2VCEA 2I2DA 5DLYA 5EPEA 4ZZ0A 2R8XA 5FR1A 2JRCA 3N2EA 3KCNA 3K71B 3AUTA 4LVNA 4IDBA 2BFFB 3PXXA 5JNLA 2G7ZA 1IHOA 1JYEA 2HQ1A 3COSA 1DTWB 1DCMA 2HHCA 3C4VA 3FHOA 1E0SA 5C5DA 4Q05A 1B1CA 4IV5A 1X8JA 3IKTA 2VXOA 4F3NA 1O4VA 4KXVA 4B8ZA 3WFJA 5JISA 3NZEA 4A5OA 4BQIA 1HE8B 2PIAA 3G59A 4YRMA 2OPBA 3KHTA 4AJ1A 1SB8A 4PLPA 5AXDA 4AMYA 2BZ0A 4EHIA 2W2OA 3MTEA 4F5YA 3GEPA 4H0CA 3NANA 3R0ZA 4OHPA 5B2EA 4M55A 1J20A 1MFZA 1Y48E 1JKJA 3B13B 1CUDA 1XRMA 1KO5A 3PCRB 3GAZA 3R3JA 3PPXA 4N3BA 5DHUA 1YZLA 3H17A 1QFZA 1FYFA 2AXNA 2FW6A 1SOVA 1UPBA 1T0BA 2R6JA 1EGHA 3CUSA 1L8AA 3C8HA 3DE1X 5ESRA 5BYAA 4J3JA 4RCZA 1LK0A 4XSVA 5TF0A 1XVUA 5IABA 1MHTA 3G5MA 1IOWA 1UBHS 2H92A 4ZCPA 3T4UA 3U6KA 1M67A 1EVQA 4FGLA 5LWHA 3UJNA 3HY3A 1QGZA 2M98A 3H19A 3H6GA 1JIQA 2W6JA 3KFXA 1Z4QA 3U31A 3A0UA 4F2DA 4LBYA 1QH1B 2CV1A 4DEXA 4LKOA 2DPXA 2AFIE 1R4ZA 4PZ9A 4GGPA 2Z4TA 3GLHE 1HLPA 2LXNA 3DKVA 2XB4A 5E4TA 1BQ3A 3UT6A 4NJMB 3EH1A 1SBIA 3KJIA 1GPBA 1WSBA 2CUTA 2I3BA 2VHCA 3D43A 2PKYX 2YHAA 3L0ZA 4GE3A 2B8TA 3DKPA 4PC7A 4YLEA 4KRFA 2R84A 2WJVA 5AKZA 3FAZA 4EFLA 3ZVRA 1JDVA 2C78A 2YWFA 2EL7A 4NCXA 2VBCA 1XQVA 2AC2A 1DQZA 1UT6A 3CRVA 2MSCB 2PX2A 3E7XA 3MJFA 4I5IA 3STYA 3FGZA 4RMIA 2IYOA 1YT5A 2HW8A 3ZY4A 1JSRA 2V7WA 1YVUA 3I5YA 3K1JA 4JBYA 5IVPA 1MZVA 1MX1A 1OGJA 2Q6LA 3NTXA 4ME6A 3T0FA 3TM4A 3VSBA 4AJ4A 3TVTA 5AKEA 3RFUA 2H2AA 4UEJA 2IDZA 4BLQA 1E2JA 3ESXA 1QWOA 4P31A 3CCCA 2IRWA 1QSGA 3RROA 3VR5A 1FP1D 1P7WA 3GJTA 3J7TA 2GN4A 1YB1A 1JMYA 4PVCA 3ZPXA 4YTEA 3R6LA 4DWOA 5I9IA 4AXBA 3KHSA 2IZZA 5LDGA 1GUBA 2NVUA 3HNOA 1FLNA 3FMPB 1YJ5A 1CZKA 1CP2A 1UQRA 4FOTA 3LDGA 3FTNA 2ORYA 3O03A 3UQZA 2BMFA 5ARBA 2UZ0A 5JFGA 2Z58A 3ZHYA 3ETCA 3AEUB 3L4BA 3PNPA 4JOQA 5G40A 3QVMA 4C7XA 4R1TA 3PBKA 3UT0A 1FTNA 2ZBDA 5M34A 1GTZA 4JROA 1Z5OA 5CFQA 4XDYA 2FPIB 1Z4PX 4EB6B 4G2TA 1PQYA 1KS2A 2IHVA 1NF2A 1JFVA 4M7WA 3K16A 3FLMA 4QTUB 4Z4FA 4CFZA 2PYIA 4O2AB 1T4CB 1JX6A 2JW5A 3A9SA 1I4OA 3BXOA 1W0JD 4MP6A 4GRDA 3GVHA 2I71A 1E92A 4YRSA 1AZLA 2XLCA 3ZU3A 4D5GA 4IKOA 4MVJM 2F3UA 1KIMA 1JBQA 4XPIB 1JTFA 4DC9A 2YQ5A 5EJ6A 1XP8A 2I8AA 2HOQA 2WRZA 3WSVA 5IJ0A 4KXMA 4YMVA 3QW4B 1JAIA 2FZ5A 1OWLA 3OUZA 4YYEA 1PX0A 3BJZA 4N5LA 1P1CA 5HTOA 4XD7A 2XUQA 5JH7F 3P9IA 1ZBQA 4RF3A 2Y66A 3OAAD 4RDXA 4P92A 1HDZA 2B3DA 5KC9A 1JH8A 1GPH1 4XUEA 3PQ4A 5JJLA 2L2QA 4LDZA 1F2TB 3F3MA 3IMCA 1EZ1A 2W93A 4P4GA 4UE3S 1M2OA 4C76A 4GPIB 3B3GA 3K2QA 3BL5A 4Z7QB 4QYMA 1DRJA 2L0XA 3C7TA 3FCOA 4BKQA 3IILA 4C3UA 1T9ZA 3RYIB 5JYBA 2DLNA 3AVWA 3BHNA 4WOKA 3HRHA 5BSMA 5TEVA 4LXGA 3VR2D 3VZBA 2TMDA 1OXUA 1M8GA 3ABIA 5F76A 3AVVA 4CQNA 3VNUA 4ZCSA 4DUGD 1AE1A 3G7SA 3LX6A 3LUKA 3RKUA 4CF3A 1GAWA 2BUAA 5BSEA 4S35A 1SVKA 4M98A 4YRIA 2VQ3A 2YJ3A 5JNWA 3FTPA 4H31A 1NUUA 2VUSA 8GPBA 1W94A 2ZJAA 1U2QA 3B1ZA 5EQDA 1GRNA 3QVKA 1DEKA 3M5WA 2YDXA 1UWCA 2NVOA 3A9UA 4S2EA 3TW8A 5IT0A 1U7OA 2BMJA 2FFJA 5LXTB 4EY3A 2QR2A 3BFPA 2D5CA 4J6FA 3NXSA 5IDXA 1Z33A 4CE6A 3VZSA 121PA 1CNEA 4NNOA 1XZAA 2A7XA 3HABA 2G8NA 3LRPA 3O90A 1FNBA 2X15A 1BG6A 4KXQA 3SJBA 5HQ3B 3ILYA 4Q82A 2Q62A 3F47A 1E6CA 2M9MA 3AJAA 4AG3A 5IWCA 2XAAA 3K9GA 3NLLA 4URYR 4LG1A 5D84A 1DCTA 1HYHA 3P0IA 2R8EA 2X9GA 1NJ2A 1S3GA 3I9MA 2RAFA 4ZO7A 2GTPA 5EAIA 1OE0A 3CRNA 4ZWNA 4KQWA 4MJLA 3U1TA 3ZHCA 1MH9A 1UR5A 4HAWA 4ZQFA 4ZVRA 1XPRA 5DHSA 4RK5A 3O4RA 4BNVA 3LCRA 2EX4A 2XUOA 2JGAA 2P1RA 2ZRLA 4V3BA 3UAOA 3GFOA 3GYGA 5CVUA 2AN4A 4RELA 2CV2A 3DAYA 3HGTA 4HXEB 5BOSA 4INJA 1XZ8A 1CIPA 1YI0A 4Q4JA 1F7UA 3MRTA 5DEIA 3BA6A 3PNQA 2C82A 3LA6A 4JX8A 4KLRA 3ZBTA 4P0PB 3YASA 2SECE 4B83A 5KTRA 1G3UA 2AL7A 1GUDA 1IPFA 3T5CA 4J7UA 5JNVA 3RUPA 3VU1A 3H3JA 3BRWD 4DARA 3PGJA 1R0ZA 3IELA 4DQDA 4AKTA 1R0XA 2GF9A 4A8TA 3SHFA 2FPKA 4RXUA 1CEYA 1JU4A 2NG1A 3PFKA 1SHKA 4PE5B 5HRAA 4KQJA 2DUNA 2FP3A 2MSNA 1YJBA 1UMKA 3U4QA 2VPPA 5KX5F 5BQFA 4AZ3A 1QUFA 3EWSA 4QLOA 1NP6A 4DSUA 1QZUA 3LUCA 1E2UA 1C4WA 3RWOA 2ZJ5A 4H27A 4MB6A 1KJJA 4JI4B 1ZOSA 1YL5A 1HUQA 4U2EA 2QF7A 1SFRA 3PTZA 5HKAA 1JDUA 4D74A 3KKMA 4UASA 2W11A 3U4DA 4MTCA 2FSVC 5HKKA 1UQUA 2TECE 4YP5A 4AUMA 2WWHA 1K9VF 1ULUA 2IUTA 2PGJA 4ZT7A 1EQAA 2Q6OA 4DZTA 3MT9A 2OHHA 4BNXA 4FLFA 3GFSA 1QYRA 4D96A 4MWEA 5IHPA 1IN8A 4U7HA 5IYZB 2JLQA 4TOIA 1T6BY 3I2YX 1W59A 4R9UC 3AF5A 3CR8A 4KGZA 3NWEA 4H17A 4S24A 4XLLA 1AGXA 4BGUA 3D3QA 3G8BA 5D8DA 5FEMA 1SUEA 1B7GO 1PF7E 1K7CA 2W6PA 3NKLA 2VSYA 2NSHA 3PQ7A 4MLPA 1U2EA 4EOGA 5BRJA 3I6IA 4AKGA 2WFLB 1EFVA 2BMEA 4NI5A 1A5AB 2F59A 4FUTA 1QF9A 4OQNA 5EE0A 5JEEA 2NX2A 4JJ8A 5JZOA 2WSSA 3AL0C 2CMGA 4LYGA 3P4XA 5G0TA 3OWHA 4L78A 3VNBA 1EWQA 3QYAA 2H8GA 1FDIA 1PG5A 5FPQA 1E5TA 5K05A 1CXZA 1QH8B 1UODA 2RE8A 2H16A 2HSEA 4GM0A 2LBPA 3LPCA 3KOWA 3OO1A 5E4YA 1W6RA 1Z0IA 3FA2A 4QFDA 1COZA 1LPPA 3QVGB 3RC9A 2QVBA 1U94A 2JD1A 1F1JA 2A94A 1OX6A 5JVDB 4BZZA 2AK3A 4LQLA 1JQBA 4KRXA 2JGFA 3QEOA 5DSTA 1N2JA 1TXGA 4UBOA 4FYYA 2C99A 1TA9A 2H5EA 1D1QA 4I50B 1JW9B 2ZJ1A 3O92A 1MIOA 4KZPA 3UHAA 1NG9A 1W5TA 2DETA 1MB2A 2NU6B 4UTVA 2VJLA 2J5QA 4BAUA 2BGJA 2I9PA 1CG6A 2FKNA 4C1BA 4NVRA 2DMRA 1QRSA 3C6XA 3UQYS 2QXUA 1DAMA 1PDWA 3OPNA 4JLPA 2WWFA 3E70C 4R81A 2BW0A 4P4UA 1L7VC 4IWNA 4ARSA 2AC4A 2FR0A 2O6HA 4L3WA 4CMKA 2ZS8A 3CZCA 1Y1KE 1JLRA 4JY7A 1KK2A 2JIMA 5HJEA 2PT9A 1NI4B 1O94A 4HDMA 2VK8A 3P2MA 3JQRA 1SUFA 1H2AS 1RS0A 3BXEA 3KALA 3QG5A 4GDMA 3V8MA 5GADl 1OHHA 4ZOEA 4H18A 1J8MF 2H1CA 1XMPA 4LMBA 3F7TA 3OA0A 1IH8A 3BEOA 2EQBA 3PC8C 1MOZA 2YRXA 4I46A 5AM0A 3WXMA 2DFDA 4WA8A 2BI7A 5HW0A 2A3NA 4YACA 1ZP6A 4RE5A 4B7ZA 1GNRA 2WVAA 2PUGA 3EPRA 1U0JA 3KKPA 1GKIA 3B20A 1XMOB 5J63A 3RVBA 1LPSA 5BN3A 2OWEA 1E2HA 1RJ9B 1XAJA 3TZ6A 1IY1A 3ZY3A 1Q17A 1FXWA 3AXSA 1DIOB 4P8RA 3CS3A 5CA0B 2COUA 4MQ6A 1IB6A 3P9NA 3QLTA 2WJYA 3REGA 3QBDA 2NUPA 3QI7A 4DDHA 4V1CB 1G291 5LP6C 3RT1A 4CHTA 2XMCA 1U1FA 3M6UA 4QYIB 1U7ZA 3D3WA 4K6MA 1VJ0A 2WJPA 1QDLB 3ND7A 4KYVA 1K9SA 1Z62A 4S2UA 2Y93A 3L0BA 4UNQA 4Z2YA 1QIMA 1ISJA 1MAAA 4PC6A 1XZEA 1I30A 5LQCA 4ZJUA 3D6NB 2HNAA 1UKCA 4E51A 3KC2A 2PXXA 4ZPXA 2JIOA 2AWNA 4KDEA 2FRVA 1SRQA 2VP3A 4MUGA 2PM8A 3H2SA 1L3CA 3BVPA 1YBHA 3NYRA 4LX0A 4XDZA 4BO3A 1SD1A 1DPGA 3WC4A 5JWOA 3TZHA 4DMHA 1L7XA 3RUDA 5JRJA 4RY8A 5JR3A 1I8TA 2IHZA 2AN1A 1QV6A 2R1VB 4KUHA 2B9VA 4GLOA 1GGJA 4IIUA 1PGPA 1EG2A 2OP1A 3AQ4A 3INNA 4KI0A 5DHFA 3UPTA 2BVNA 2XWSA 1WULS 4L74A 5IU6A 1FYDA 2PBZA 4NBUA 1XO1A 4MQEB 2XEDA 2R47A 2G77B 3FN4A 4FSDA 1GAQA 2WVJA 1KI6A 4YMWA 4O4LA 1YCDA 2IUFA 2BBSA 2OBXA 3HVUA 2D7DA 1MOPA 1ZNZA 3LGAA 4LDAA 4QICA 1CZNA 4FEGA 5FUQA 4J4BA 4LRSB 5C52B 3A3KA 2UZ4A 4URWR 4ER6A 4CTOA 2Q5HA 2WJGA 3FXAA 3LBFA 2J32A 1ND5A 1OBVA 2V5VA 1MFPA 2QL5A 2B30A 3RVOA 4XGRA 2PD6A 2ZRKA 3R20A 3IBFA 4IMRA 5KYVA 1PCXA 3S1AA 2CYCA 4A1OA 4C5BA 3GA5A 1ZK2A 1BXRA 4F06A 1TRHA 5JSHA 1ZKMA 3UH0A 2UXBB 5J23A 2XVAA 4K6OA 4EHKA 1D1SA 3WFZA 3QVJA 5B55A 2H4FA 5FEUA 4AKHA 4LHXA 1G8MA 3QPDA 3I9NA 4NULA 3GDWA 1LSSA 2P0EA 3SYNA 1Z7BA 2PRKA 4YUVA 3ZDFA 1XAHA 3DG9A 4FGSA 2G7MC 3IOBA 1XTUA 1SBTA 2CMFA 3DV9A 4FI3F 2EYUA 3TLBA 1A1SA 3G7NA 1CJSA 2AMJA 3PXCX 3L5OA 1YUBA 4ETMA 4JUFA 1YSCA 3P0FA 3OOYA 3PT5A 4FJ2A 4G1UC 3UV6A 4ZGWA 2Z5LA 5IZCA 4PQFA 1ZINA 2FSUA 5AJVB 5DI3B 3URMA 3UYLA 4TWAA 4ZOQI 5AXCA 3EEQA 4IVNA 4RYDA 2BY4A 2ORIA 4LHVA 5LDHA 1P33A 1GAXA 1LX7A 4N18A 3ZTWA 1XHEA 2SNIE 3NJ8A 4KACA 1LWNA 3U49A 3M5CA 4P2GA 1Q12A 2F64A 5ERXA 2IV3A 1JEJA 4BRSA 1GG9A 2W98A 3T3EA 4O0LA 4E14A 4FDMA 2Y4OA 4EQ6A 1QO7A 2FGJA 3GUYA 2VDWB 4CLHA 5A0VA 4RJJA 4Y6PA 2W6OA 3PE3A 3EB9A 4C43A 5B57C 1VL6A 1PSWA 3DVRX 4MUHA 4PRZA 1H2XA 2BP7B 3LWZA 4MZXA 2AKAB 3A1NA 3GMIA 4P81A 5EUBA 4B80A 4BNWA 2VT7A 2HMAA 2OYSA 1W4BA 4F5ZA 1S8AA 4R9SA 5EMHA 2IYXA 1GKLA 3ZEAA 3CUTA 4E1BA 1KDTA 4XVRA 1TW2A 2EZ4A 3EZLA 4BLPA 2AB0A 3THWA 3UC9A 2QD2A 4GEGA 3QU9A 1M1YB 4XTRA 4AVYA 3LX4A 1T91A 4HLQB 2R97A 4EI8A 5HTKA 4M9RA 1Y4DE 1B8OA 1Z28A 2P8JA 4TYWA 4M0PA 4UPDA 3V42A 4HQKA 3HI6A 1CS0B 3WLMA 4Z2AA 3PFHA 1Z6QA 4JJGA 4X3PA 4FXOA 1EH5A 1UQTA 1QGOA 1JEOA 3TMAA 3ZLJA 4B34A 1X7WB 1FTGA 4WZBA 4DEYA 1SWWA 3DBHB 3ZZNA 1BKDR 3G2HA 1ZR4A 5H7XA 1KU6A 3AR9A 5CB4A 1BQEA 2ESRA 4HVAA 3OCUA 5KEIA 1I36A 2CLKB 1TJ3A 1Z6ZA 1IWPB 3DD5A 4Q4DA 4WH0A 2C94A 3WO1A 4TXLA 4QNNA 1Y33E 5DOVA 4FWTA 1MAWA 1UL1X 1JDJA 3C70A 3SS9X 4E4RA 1N6RA 4OEHA 1Y82A 2H11A 4U2BA 5BW4A 1EHYA 1OT3A 2QVLA 3IPRA 1W4LA 5DYTA 3ND5A 1O6BA 1XI2A 1CUJA 1CUYA 3MPOA 1GAJA 2PT7A 3WHIA 3AJRA 4JX9A 4EGSA 1T10A 4YONB 2CHEA 2EHJA 1FTQA 3SVZA 3FMOB 3LV8A 3RBVA 3RM3A 4DANA 1OB2A 2CK3D 4L9SA 3KV1A 1XCJA 4F9GA 4TTVA 3WLOA 3ZWOA 3KAJA 3DBIA 2C84A 1BDIA 5ED4A 1G7SA 3LHFA 3UENA 4OHYA 1Z75A 2LCFA 3HP1A 4HLUA 3E22B 3L7AA 4P53A 2PSSA 1LI7A 3IOEA 1VBFA 2QRPA 4MQBA 4OXNA 4H59A 4RY2A 1F5SA 1L8LA 3W9SA 4J1TA 1CB7A 3GDHA 1R5NA 3D02A 1BXGB 3IXMA 2HDHA 2BELA 1OD6A 4YQZA 1TTQB 4PLCA 1YACA 4MVJA 3TGWA 5FWXA 3AF2A 2NO0A 3AV0B 4X6UA 1RJGA 2PQ2A 2PA3A 3A6GA 5AWFC 3TAUA 4PWYA 4FEYA 4G9BA 3VU3A 1Y4SA 1Z38A 5LU9A 3QIVA 1XRJA 2OE2A 3EIOA 4Y2PA 2FG5A 5BORA 1N2GA 1ZOOA 4Q47A 4F21A 5TMBA 2BKXA 3ZDEA 5KYGA 1EXVA 1JIKA 2O23A 1ZVKA 1OKKA 1VB3A 2JLAA 2Q4EA 1FUIA 1JIIA 1N1DA 2PZBA 3EC2A 2ZUWA 3F96A 4R1NA 3SSMA 1IHPA 1KAOA 3V1LA 4EJ6A 4YV0A 1XMSA 4PFJA 1UOEA 4NBTA 3O84A 4GX2A 2V65A 1T3LA 1PZMA 3SLRA 3LFTA 3RG2A 4RLSA 1O1YA 3RVSA 2XPCA 4H0NA 1BO6A 4EQZA 2Q7DA 3ESYA 1GLVA 2OZVA 5FNVB 3TXYA 1ISFA 1B6SA 3FIJA 2ZYAA 4QC2A 5A5EA 3O1LA 5HZKA 3Q12A 3SE7A 3DDHA 1QIHA 3BXPA 3TL3A 3FPAA 1TFUA 4C2TA 4WBSA 2GJ9A 3LW7A 1CRLA 4ND4A 1UZLA 4IXWA 4AY4A 1UXKA 1I01A 1X15A 4H4EA 3TJZA 1I10A 3PNKA 1JYFA 2XVMA 4RPIA 5TVGA 4DC1A 2ZFUA 2CDCA 2EWWA 4IOMA 5FORA 3I4FA 3C3PA 1JH9A 3U39A 3V8PA 3FCUB 4MQUA 4QUIA 4INAA 3H5IA 4UNNA 3WWEA 5AKGA 3V6MA 2P30A 1W87A 1ADCA 1DAHA 2AIRA 2P5YA 1PJ3A 1PL8A 2VF4X 3JVUA 4G23A 4P3XA 1BOOA 3E05A 2E5FA 3N2KA 3WZ2A 2P2YA 4JLKA 1MCZA 3F9IA 4GG1A 4K9QA 1CX9B 3BHJA 1XK6A 3T1VA 5DBIA 4N9WA 3MZ0A 4DV4B 2GN0A 1LQUA 3BWBA 2A86A 3FVTA 3ZDBA 3IIMA 4DQKA 1IZZA 1L4HA 4LJ8A 1Z26A 1DAPA 1T1GA 3OEED 2EEPA 2WNHA 1XJCA 1Z45A 2BEWA 4TWJA 5DSXA 4E4TA 3TN7A 4CL2A 3HLYA 4ND7A 2P7IA 1QP8A 3K72B 5B1EA 3GVXA 3JWIA 2D8AA 3FKSA 1C7FA 1M6VB 1BH2A 3AWIA 4ZOLF 4S1VA 2XYPA 3UZUA 1DKLA 1YVEI 2AQIA 2JAQA 5FCDA 1ZW6A 2QI9F 5H4GA 2QAGB 3RK0A 3B1YA 4UATA 1CK4A 4CKBB 5MGNA 5AHWA 4TMZA 1NJFA 1VMIA 4B4OA 3T8YA 5JRDS 2AYYA 2Y2UA 3EW9A 3AQIA 5EEHA 3RG8A 3ZJUA 1KOGA 5GWXA 1C8VB 5LA6A 4Y1EA 3MELA 1TNDA 1ZCAA 2H54A 4HDCA 1WP9A 5IULC 4Q7MB 2XQIA 1I3LA 4ZARA 1UMDA 2PJZA 3OZAA 4D4KA 3Q6NA 5L6MB 2G3YA 2NQ2C 1RE0A 3HUDA 4KO8A 2Q0HA 4P3KA 4C4OA 5F7OA 1A8QA 1SEPA 4Z0PA 5AW8A 1LB1B 1RM3A 5K6TA 4X85A 5GTDA 4FR2A 2A5LA 4P93A 1PR2A 1U9JA 1AQNA 1G0NA 2VIIA 5LQKA 1AF4A 1KZ1A 4MIOA 2HRQA 4KE8A 4F97A 3CINA 4IIYA 2WM8A 4CMAA 4CRWB 4OY3A 1UXHA 3E7PA 3ZHZA 1XMQB 4FZ3A 4BY9E 4KH1A 2ZXEA 1U3GA 5B3KA 1AU9A 4OA5A 4OSEA 1TM5E 2BEKA 2HK7A 3UMRA 3M3DA 4YPOA 2X0RA 3K0FB 4ZVVA 4IPTA 3CX6A 3BMXA 2FJPA 3RIGA 3WL4A 2QTGA 1L9KA 3RVRA 1XNQB 1YRYE 3CV3A 3QWIA 4JSYA 1XYYA 3VUFA 4KLNA 3O21A 2PY6A 4BE7B 3T1TA 1NQTA 4CIXA 3PSHA 4NFHA 3N7UA 2ZE8A 3C15C 3PKZA 2B1GA 3IAUA 5AW7A 1AHPA 5KZMB 3DEJA 4YFVA 1WTCA 2EP8A 4XTCS 5EMKA 3GFBA 4NEGA 3RFVA 2RB5A 4F7WA 3X1MA 3VAZA 1QMPA 1UUFA 2PRIA 2F43B 2HQRA 4G97A 4QVGA 3MUFA 4ZT4A 2VJMA 1P7ZA 2XY4A 3JQFC 1NZFA 1RQGA 2H1LA 5JQGA 3SQOA 3TVDA 4CG3A 2MMGA 2WP0A 1C4KA 4U6SA 2DKFA 2GJKA 1YA8A 1M34E 3HRKA 1T9AA 5K7SA 1QRAA 1M9NA 1W0CA 4LNAA 2CZQA 4IS2A 3IBCA 4TLCA 4JLSA 1YULA 3ZW8A 2GBPA 4GW3A 4R9NA 5K0CA 4GSLA 3NOQA 4QLBA 2IPMA 5JJBA 1UK7A 2X8JB 1VKOA 1CQJB 2EEZA 2J67A 1Y8QA 1ZICA 3KXDA 3LY5A 4Q9NA 2WY2D 4X64B 4I1IA 5AVYA 1NQAO 2CDAA 4G5YA 1PSZA 1DINA 2ZITA 3F7NA 4H1VA 1W0JA 1YS1X 2F1HA 1XDUA 1K6IA 2CJPA 1GEEA 3HDHA 1DKNA 2XVZA 3BN3A 3KJFA 1I0LA 4IW3B 2PUFA 1A27A 4FKZA 1IJFA 1MC5A 4RORA 5DNDA 1Z4KA 4EEXA 4XIYA 4YBZA 5K8IA 5LOVA 2O8EA 2ZUVA 2YW9A 2D06A 3AEQA 3C98A 3FWHA 3BPSA 4NENA 5JALA 1CEEA 1T2NA 2LTAA 1YMQA 2ZJ3A 3NFRA 2O0KA 2NQ8A 4DLXA 3GJ7A 4DTCA 4OUKX 4OJNA 1UXOA 4R7GA 2D5LA 3S81A 3EDMA 3FETA 2C2ZA 3KLPX 4YJDA 3OAAA 1NVMB 1U9IA 1P81A 5FX2A 2WIAA 1U28A 3DQPA 1ID1A 5A9RA 1TLTA 5HBGA 2BRUA 4MP8A 1XZKA 2WZCA 1BJTA 2FZVA 4JVNA 2PR7A 4PR0A 1LKZA 2R25B 5DX8A 3WWZA 1OY1A 1E0AA 2R7MA 2B92A 4U39A 2ASEA 4PSAA 2XRMA 2ZBQA 5CHYA 5ALXA 4MVWA 1H93A 1YB4A 1GAEO 1NGSA 3H1TA 3KNZA 1Y1TA 4UZFA 3I6MA 1H4SA 4FLEA 2B8NA 4UKDA 4DJTA 1Z47A 1USIA 2Q0QA 2D74A 2HJSA 1AGRA 4HEHA 4H60A 1CR2A 3DAOA 1PYOA 3BD8A 3RHZA 1N2IA 3L41A 2YOGA 1AC5A 2AFHE 2OYCA 1R0CA 2ENWA 4BX3A 3IX7A 3SZOA 3LUPA 1BCRA 3KXPA 3CX3A 3V2GA 2QZPA 2ZG6A 5FIUA 3VYVA 4KMSA 5D1HA 4HGPA 4BCBA 4E94A 4F3RA 4FN4A 3NVAA 2YUTA 1QHEA 3PQ5A 1N2XA 3BL8A 5KTYA 2IXTA 3ZHVA 3CLVA 1N3BA 2MR5A 3MWEA 4UVEA 1WHSA 3JD3A 3L82B 4NDNE 3I37X 3PDHA 1LS1A 3FNBA 1QPBA 1G55A 3PGKA 4IHQA 1P7PA 5HM8A 3SHOA 3JY6A 2M6RA 3IEPA 3WFIA 2NGRA 1Q0SA 2Q2WA 3ZCRA 2YNMC 5CR9A 3DEYX 1BHJA 4FKMA 1BCSA 1DQSA 1HLGA 5EP3A 5ITZA 1KAHA 4P5DA 1E9RA 4NCIA 2G1KA 3G2LA 3RANA 1O96B 2QD5A 2ZE6A 4L5CA 2ZULA 1T0HB 3HB1A 3W3ZB 4H08A 1XZJA 1WKBA 3PNBA 2BN4A 4BOYA 5J2TB 4W5QA 1S8NA 2EJTA 2J3HA 2YFYA 3A4LA 4P38A 3REQA 5LJLA 2XXJA 4DRXA 1SU7A 1ZK1A 4FDLA 1JTEA 3RSZA 1IJBA 4RZXA 4PNHA 2W43A 1EDOA 2FN7A 2YX1A 4AP9A 1K7EB 5FF9A 4Z53A 2GPBA 3FYSA 4JEHA 3V4SA 1C8BA 3KZXA 1QVAA 1T0JB 2NZVG 3JRWA 4QYSA 4R3WA 1L7QA 4XFJA 3CZAA 3X0DA 1E79D 1RMQA 2Q8NA 1IBRA 1RU3A 3JAKA 3KV3O 1B43A 2H4YA 4HAXA 2IKQA 2ZQ5A 4KDCA 4CL8A 4EB0A 4Z3KA 2XB6A 4UUQA 1OI3A 1IBSA 4IXTA 4Q1VA 1ISPA 2DPLA 4FNMA 1GNVA 1I7DA 2ZK7A 4DQVA 4L8LA 1Q1EA 3AF4A 4JEUA 4NTZA 2Q6IA 4FFPA 3RRNA 2AD5A 5JBQA 1MJGM 5BSWA 1NXPA 5JU6A 3G5TA 2PV7A 3HJRA 1VMKA 3H8WA 4WECA 3Q41A 4NV3A 4MGIR 3SYTA 5C80A 4GU5A 2B7BA 3G9XA 2OYRA 4JR1A 1Y8RB 4FSXA 3W3AD 4Z51A 4F8JA 1PKXA 3T06B 4F6LA 4POOA 1RVDA 3ISJA 3RHSA 1QOQB 3MYRA 4M0FA 3UCFA 3IEKA 1G9SA 4Y2SA 3U3DA 4CCAA 5J4VA 3AL3A 2OECA 1PRYA 1T0PA 4WESB 1GPMA 1P4AA 2OQVA 1WL8A 1PIWA 5KNDA 5C53B 2Y05A 5FV4A 5CRIA 2H85A 2AYZA 3IR6A 2XUIA 1UJ4A 2AHRA 4RZQA 3IUQA 3VR6D 1VPWA 4MKFA 1PQUA 4N3AA 1NPTO 1UOOA 4Z49A 2WWGA 4B0OA 3DYVA 1HLDA 1I2ZA 3UXHA 4L07A 1GCIA 4MV4A 4BO8A 5JECA 4BXOB 3HB4X 4WGFA 3IKVA 1S01A 2HRDA 1KTVA 2IYQA 2BDEA 2ONZA 2P78A 1X86B 3IT1A 1KYVA 1YO6A 2P1ZA 3GNQA 3LCCA 3LK6A 3LL4A 1PL0A 3FVQA 3G89A 5AJZA 5D5HA 5EJ2A 1QZ3A 4TUYF 1L3IA 3C6QA 3RB8A 4CQLB 3TEFA 2E82A 3LP6A 5B4VA 3ZHQA 2R4UA 2X0IA 3WMFA 5CG2A 3ZVKA 1WW2A 4MPRA 5HRCA 4HRVA 5TB5A 1NVKA 2BGMA 1BIFA 4ALNA 4RTLA 3DD1A 1GM5A 3CT4A 4MIEA 1JSZA 1P74A 5BNWA 5FBQB 3ELDA 3WP1B 4Q4LA 3E3NA 1M1UA 3JZMA 3HFSA 5AD1A 3UV7A 1XL0A 3IBTA 4I1VA 2YZ7A 3BRQA 1P1FA 3GDFA 4WIAA 3QVXA 3WNVA 4EMSA 2BR3A 1NQUA 4CVNA 1GZ4A 1KQPA 2NPFA 2DPHA 2EW1A 4K88A 1IM8A 1FE8A 3GRZA 3K9LA 3M1LA 3MWKA 4RA6B 3RT7A 3HXOA 4EHJA 3MWFA 2O2IA 5KTMA 4KW7A 3WGKA 3OY7A 4RQAA 1L5YA 2FFHA 3N07A 1E4EA 4D0SA 1XDSA 1C9KA 2DE0X 1QQ7A 4RFLA 3N5KA 1NVEA 4RGVA 3KZNA 4ZA2A 2BC9A 1TJYA 2VT3A 2ZRDA 3OQIB 2G40A 2VHJA 4K6FA 1N1EA 2Z3WA 3DL0A 1DWQA 1L5WA 4QYTA 4ASUD 5KSWB 3K0AB 1KOJA 4GOND 2A2ZA 1SQGA 1ENOA 1NC3A 2BUBA 3VR4A 1X13A 5JPDA 1YIAA 1IPHA 2DWOA 1PW5A 2EGUA 3G8AA 3IURA 2VHVA 2BONA 3ZVNA 4DG5A 3NFYA 1XC7A 2M1XA 3A9WA 3D31A 2PFSA 2P6NA 3GDOA 3TDMA 4YRAA 1O5TA 2J9ZB 1GV0A 2RKBA 3L7YA 5ECYA 2XNCA 5FUBA 4YREA 1RZRA 4R54A 1BA3A 3KLMX 1ZC3A 2P68A 4M9QA 3AJEA 4V0OA 1NW7A 3SX0A 3LVBA 1FBTA 2CXSA 1HFKA 2VHUA 4EG6A 2ZYDA 3LLVA 4NLLA 2OFXA 1FRZA 3R3SA 4Z9BA 4DV7B 1EAYA 3JVDA 1X9HA 1Z4OA 3JPYA 4RVCA 5H0IA 3FBTA 3T1NA 2IIVA 2IEYA 2IEAA 3GLIA 1R6TA 2NV2B 4NOMA 5L53A 1BVRA 1DT3A 1SG9A 1Z7GA 3CUKA 4FJ0A 4HFRA 1E1KA 2JGJA 3DLHA 2QP4A 5ALEA 3RSOA 1BTOA 3LUJA 4NU0A 4P7KA 5T8KA 4COOA 1RQ2A 4NZNA 4WZAA 4K6CA 4AJJA 4FB4A 1T26A 2E18A 5AHOA 4AJEA 2R8BA 1VPLA 3PNYA 3B6ZA 2BM0A 4AXXA 1Y7LA 1FFXA 1XKLA 3KD2A 2ECKA 2VEOA 1VA4A 5DYYA 4ZI7A 3GLFA 3NHFA 5J43A 1RE1A 1TK2A 4QE3A 4HFJA 2CXPA 3NJRA 4WFJA 4G09A 2CVFA 3FOZA 2JGLA 3WL3A 1NOKA 4BU1A 1NMYA 5CVVA 1XD9A 2QUJA 1NV9A 2PHZA 3DKRA 3RU2A 4BUCA 3C6MA 3DO6A 3E9CA 3X1XA 1KHTA 2X9VA 5L3ZA 2J0QA 5E4JA 5MN6A 4HWOA 2O0HA 3BK2A 4J91A 4P0QB 4BV2A 3LGXA 2OXFA 5J1TB 1SXJA 2V7UA 3BICA 1YF3A 2ACEA 5IP5A 3BUSA 2UYHA 1RI5A 1R16A 3F97A 3NHBA 2E21A 2ZSJA 1NATA 2RGAA 1YFKA 3B51X 1N0HA 4OFXA 3PWTA 1SG6A 1P4HA 1M2JA 1YIOA 3IOCA 2IDKA 4M0KA 5H3HA 3EIFA 4CCYB 3U60B 3SR4A 1N2CA 4RD0A 4RS4A 1MB0A 3D0OA 2VOEA 2J0SA 3DGFC 4YO8A 3VZPA 4KAFA 1IATA 1VYHA 1YDHA 4UJ5A 1EZ4A 2X6QA 4IY1A 2JZCA 3GYBA 2HJGA 5CYOA 1FXWF 1VGRA 3RREA 3R7AA 5KWJA 4ZCRA 2WNSA 1E6MA 1KFJB 1WUHS 1XQ1A 4DMMA 3M82A 4BMSA 2V03A 1OZHA 4PFSA 3TSYA 4YXWD 2RK4A 1K97A 4EKDA 1JPUA 1ZMTA 4RU1A 1G8KA 3T94A 4BL5A 1ECFA 1E4YA 1G7RA 2I22A 4JLVA 1UC9A 4RGQA 5EMLA 3SC3A 1WZUA 1N25A 3I3OA 3SFZA 2HLHA 4YX9A 2GEKA 1GGHA 5DOZA 4URUR 1FFDA 2JLXA 1M2WA 4PW0A 2XUKA 2GCGA 5DBEX 1MIHA 2DUWA 5M29A 1L2TA 3G9QA 5B37A 1D6SA 2GA8A 2X0NA 4D8UA 4QGFA 1OBOA 3PHGA 2GUWA 4DXHA 3RC8A 5J5CA 3R8XA 1JIJA 1DTWA 3OJEA 4I36A 1RYZA 3EHEA 1DG9A 2HMYB 3EEBA 5IKOA 5JAZA 2B4YA 4XDGA 3KE8A 5SZKB 2NXWA 3RIMA 2IELA 3GX1A 3FGPA 4ZAZA 3AW9A 1QU3A 3R5XA 2FU5C 4AMBA 2HC9A 1J24A 5DWQA 2W83A 1X7YB 5FI3A 3WHLA 4ITUA 1MB3A 4XIIA 1II8B 2YZ2A 5FA6A 4LFAB 1U2ZA 4BP9A 1AHNA 1O6FA 2X13A 3OM1A 1SC1A 1TO1E 2PS1A 3E27A 3G9ZA 3KEOA 1JMVA 1D1PA 4C4ZA 1E9CA 1TK3A 3S2SA 4OQZA 4BP3A 3SF8B 4PZYA 4KIWA 4RZSA 5JFTA 1H3NA 5AI4A 2V1XA 2Y3IA 4RTPA 2H0QA 3NEYA 4TXNA 1IMOA 3I1YA 5B2FA 4LMPA 1LSUA 4YK7A 1R2QA 2OORC 3TDKA 3S8EA 1I4EB 2W2KB 1S02A 4RLFA 1CY1A 5FTWA 4A4DA 1Z5VA 4F4FA 2FN3A 2GBGA 4J2HA 1OBFO 2FX2A 1FDOA 4LY0A 1QKKA 5BV0A 3HB9A 2BTEA 3ZDAA 4WUTA 3ZNQA 2QHXA 4JB3A 4QXPA 5EIAA 4LIPD 4C06A 3GZ4A 3CLSC 3FNGA 3PFIA 4E5KA 5KB3A 4Q02A 5IK2A 3WE7A 5EA2A 4G9GA 2YIMA 3ZGZA 3LC7O 1MF7A 4KBFA 2OXEA 3M9WA 3QOFA 2JARA 3PUYA 4KVAA 2NTJA 2P3SA 5B3LA 2QX4A 1M5RA 3SZRA 2HA5A 2C3YA 5FP0A 2WUGA 4Y3UA 2E1RA 3SMQA 1S6YA 4OTZA 3SWWA 2GASA 3KYCA 4BVFA 4OL0A 1J90A 1T6XA 2I9KA 1ZIXA 4PO1A 1HORA 1TGYA 5C4GB 2HBZA 4PCUA 2VJPA 5HIMA 3O9ZA 4U6QA 4I4NA 4IILA 3WLSA 3OPVA 3H2GA 3QOYA 5H83A 4XM2A 4LZJA 5LB2A 3OMXA 3IPXA 3T9EA 2CK3A 3HCNA 4R2KA 4J0EA 1YZKA 1Z2AA 1Z6YA 4L4SA 1YKGA 3E23A 4FFNA 3TRKA 3C7DB 3PGXA 4B7CA 1NE2A 2OAQ1 1QE5A 1VZ2A 1G2IA 1NM5C 4GI7A 2TMYA 3A4IA 4ZI3A 1NQVA 1KFCB 3TZQA 5LQNA 3P9SA 3LUAA 2QLJA 2RHLA 4C7OB 3IVRA 3ELBA 3R3WA 2ATCA 2D62A 1U1DA 3M2PA 3MT0A 1NNSA 3A10A 3ZH2A 4DPMA 3V8BA 1L5LA 4CETA 4IJVA 4UW9A 4JUCA 4K0KB 2ZSAA 4Y0NA 2ZTSA 3AM4A 4E6EA 4PZUA 5KYTA 3KQUA 4ZYWA 3OBIA 5IN4A 4WN3A 1AHIA 3D0KA 5D3ZA 4E03A 4DCPA 1ZM4A 1I1OA 2PVSA 3ANSA 2SHKA 1LPNA 3TZBA 3BX1A 2P62A 3VAAA 4ZCTA 1WSAA 2QYOA 5A4AA 4O2AA 4U9HS 4UM5A 4D6PA 2FF7A 1NULA 3RSCA 1TCBA 2PRYA 3R5SA 1YJXA 4MB2A 5K03A 3BXFA 4XPIA 4PANA 2XKKA 2GO1A 2CXTA 1N3YA 2R65A 4TZKA 4E2YA 1CBUA 4OGLA 4W5HA 3WWYA 2QG6A 4GGOA 2CZGA 3AOEC 3MAJA 4X60A 4B84A 4DIBA 4DUZB 2QLLA 2I62A 1P7YA 2X22A 2JATA 3QU2A 1DFGA 4PSUA 3RJTA 1KSJA 4MNTA 1VJ5A 4FQ7A 1NW5A 5K2OA 4HDSB 2OHFA 3EZ6A 5EJGA 2XHEA 1YK1A 4YUXA 2IBSA 1ZXLA 4IQ0A 4MWSA 4TT3D 1ZONA 5BV8A 3BF7A 1FRQA 1MQAA 4DFDA 1AS2A 3QVUA 5A4JA 2QXTA 1C81A 3I2HA 3BBLA 2XNDA 3FY4A 4IFEA 4MGZR 4NE7A 1HSOA 1JSLA 1JP7A 1PJRA 1U9IC 3RYIA 5DM4A 3NHYA 3GG2A 4M83A 2BEUB 5ENVA 1KYXA 4DLVA 4ZT5A 2R8PA 1GZ7A 4MLZA 3QF4B 4D45A 3NO4A 4ZAFA 1A76A 3HR4A 3M6LA 1FFWA 4KOAA 3WYBA 3OEEA 3B70A 4BFXA 2G06A 1UP6A 4O2BB 4XGKA 2IBTA 5KOHB 4GPZA 1DIHA 4N7BA 4CIBA 5B5SA 2PL3A 3BIFA 3ZU5A 2B1IA 2JPDA 3UT5B 3MJRA 1XKTA 3K09A 5EHIA 1SC6A 3TNJA 5LXTA 1NLMA 4NJEB 4MVJF 3A2MA 2E55A 3BEDA 2HBRA 5A62A 1KFEB 5CAEB 1Y1PA 1E3QA 5DJ5A 4LSWA 3AP3A 1UP7A 2RG7A 2UAGA 1X1CA 5J47A 4XYGA 4D25A 5HQ3A 2DT5A 5LZ4A 3KLOA 1HDCA 1S2IA 5IUNC 3G82C 3IDAA 4RPHA 4TYPA 2HLPA 4A0RA 5L8VA 1RZRD 3ZZMA 3RVNA 3OD5A 4HRYA 3UJ6A 1JA0A 1N92A 3U0VA 2W0SA 3QXHA 1E59A 2INGX 4A0QA 4EO4A 1U9YA 4FGUA 4MV7A 1BYUA 4G24A 3V4OA 1HE3A 1QZXA 1RKQA 4CCSA 1P2BA 4L0MA 1I14A 2DFPA 4YDSA 1FFYA 2VF2A 3EX7C 5LFAA 1WXFA 4JT2A 3VOTA 4MUEA 4CIDA 2WE7A 3CF4A 3GGPA 1NVXQ 1WLYA 1IY8A 3FYHA 1KBZA 1THZA 3PTAA 3RC7A 2ORWA 3OZSA 1BVUA 1L1QA 3QF7A 2C9BA 1I0ZA 4JJIA 5KYKA 3RTCA 1NF8A 2PZMA 4W5RA 1LDMA 3JZAA 4TRMA 3RVQA 3OM0A 4HF7A 2DHRA 3SLKA 1BXKA 1OT5A 3ETLA 4PZDA 3P9YA 4Q3CA 3UATA 4X97A 4D3XA 4D9GA 5FA5A 2E5LB 1AV7A 4XE5A 3TQSA 5HQJA 1TKBA 2WMYA 1BX3A 2CE7A 1CSEE 4GKVA 4TL9A 4F3YA 2IE8A 2PGOA 3SR0A 2AX3A 3VI4B 1JXAA 1DQRA 2P1DA 3NC1C 1UPAA 1L0BA 2PX4A 3AEKB 3R3YA 2IOYA 1XTQA 4LMRA 2XWJI 3G68A 5SY9A 4HTAA 2XZTA 5K01A 3GQVA 3KRTA 4ILKA 1RM5A 1X1RA 2W22A 4K28A 4DY4A 2JI9A 1QX4A 5DHPA 2VRWA 1FS5A 2EFYA 4GZ3A 4GBMA 4MVJE 2ISCA 4BNHA 4I3FA 4DMFA 3IQGX 2XTMA 1PDOA 4H1UA 4M9CA 2HB6A 4AJ9A 2OV4A 1Y7IA 5B7NA 4OD0A 2ZPAA 3QY9A 1J2YA 1YS7A 2HA2A 3OTHA 5IYZA 3LY9A 1T8YA 4YRNA 2J6HA 5JSKA 1QP0A 5LNK6 1PZEA 4P4LA 1P9OA 5ALRA 4OP3A 1D8AA 2HIMA 4KXWA 4LXXA 3S5UA 3VO2A 4C7VA 1Q0TA 2HR1A 3TZCA 1V8OA 1OILA 4U2DA 4DJEC 3L0OA 2Z1MA 1XZNA 1KE1A 4XRRA 1TAGA 3NASA 3SCZA 3L4JA 1BS1A 1YB2A 2AMVA 3L77A 1D4ZA 3PJEA 1JL3A 1CUBA 2CL0X 1RXVA 3QYJA 4QYWA 2ODEA 5FOUA 1BSVA 3TFWA 2YWJA 3K4HA 3LRTA 3ORRA 3GJRA 3V8RA 3FF4A 5AH0A 4BZWA 5CDYA 1DEOA 2Z5GA 3EQZA 4N7JA 4I50A 1L5NA 3P2KA 5I9BA 1ZJ6A 5DTRA 1AIPA 2NU6A 2V7TA 1IZYA 2FPLA 3H0KA 4MAAA 4O4IA 1AKNA 2PAAA 3L8HA 4WKCA 4BEBA 2WMNB 4QQFA 5JHGB 3IUBA 3K6SB 4EKNB 1YZ3A 2H4HA 2ZIUB 2OPHA 5HZHA 3NT4A 3P27A 1VKZA 4GZ5A 3PDJA 5EUCA 4LZLA 1Z4JA 4A2PA 7MDHA 3JQBA 4ENVA 2P9ZA 3PZRA 2JVJA 4R0NA 3UXMA 4TM7A 5DHQA 1NI4A 1H5QA 4QGBA 4W5NA 3H5VA 2ADMA 1CZHA 2LDXA 4KQHA 3AERB 1J9GA 4BIIA 1SUSA 2JZNA 4ZQGA 2NMVA 1Z16A 4ZDJA 1AZTA 3O8RA 1XRSB 1Q57A 2G80A 3FCEA 3JQAB 1DIRA 4XW2A 4ATNA 4B7XA 4C0QC 4QOIA 1IAVA 4AYTA 1OU0A 1QCCA 5JSZA 2ZJ6A 3EG9B 1JEYB 1JS1X 4NXNB 2UYQA 2D1TA 2LKCA 2ZQZA 3RSSA 4FU0A 5FPYA 4HP8A 4MDFA 1H1DA 2B7LA 2NT4A 1RJ9A 1XVVA 4OX9Y 4RQTA 3KPYA 5JQGF 3LUDA 5E7IA 4D46A 3ZQ4A 3AXTA 1OYWA 4ON9A 3LLUA 4AQDA 4UXHA 2PVCA 4YQYA 5CA0A 1R9GA 3O3OB 2IYYA 3SYRA 3WADA 4MV6A 1JMKC 4BFSA 5F1OA 1H9BA 3UCXA 4B8YA 3K9FC 1ZA1A 4K6HA 1D6MA 1LVUA 1A50B 3FJ1A 3JW8A 2KHZA 4KO4S 2WHEA 2V7GA 4YDQA 3A1DA 2KQUA 4QYIA 4X84A 4B4UA 3P0EA 1UADA 3E0QA 5AM2A 2XBMA 2J59A 1HTTA 1ZL0A 1NXXA 2LIPA 3MINA 1BS9A 5K1ZA 5CVTA 2RHCA 5DGXA 4TSFD 2GR9A 2HRZA 3WMXA 3PEUA 1G3IA 3N6RA 5JPIA 3VVMA 4E7OA 3OZVA 1ECLA 2QWXA 5INTA 4WLOA 3G0HA 2QMYA 2QDKA 3PGLA 3H11B 1IY2A 4I5DA 2BMDA 1E1NA 2Z9DA 1UZNA 4QUGA 1VYVA 5CDFA 2POCA 3D7MA 1ECGA 1TT5B 3LTEA 4Z9FA 1PR4A 5B58C 2HCTA 1WVGA 2LDBA 5CK5A 1IBCA 3KXKA 4B44A 4MYHA 3ETHA 2HJHA 2GETA 1Z5WA 4AM8A 4QX6A 1Z4NA 2ZYTX 1GY8A 1XL1A 3RE1A 2VDUE 4BB5A 3VU8A 2ZWOA 1NAIA 2AJ8A 5CT8A 4Z54A 2C8KA 3F6BX 2P40A 3ONEA 4YQFA 1E69A 3QMVA 3NWBA 1J6UA 1LC3A 3VR3A 4HB0A 4EF5A 1N78A 3C6ZA 4PLTA 2HMUA 1L5HB 2GS9A 2GTIA 2C4NA 1FP7A 2ZTMA 3IRVA 1QU2A 2O2JA 2QK4A 3CBGA 1UF9A 1SM4A 4JVSB 4RO0A 3AJ8A 2WAXA 4TVSA 4HO1X 3OX3A 5BWLA 1H8HD 5HR5A 5E1OA 4F1WA 4E08A 1SOWA 5CITA 3WGUA 2P2DA 1JLLA 4EYSA 5FWAA 5C34B 3QKRB 1KMQA 1U3UA 1D9XA 1WMEA 3O8QB 3GIDA 4NYJQ 3F8TA 1X9GA 2LR0A 3M8KA 1ORVA 4FNGA 4IIVA 4OP1A 3RABA 4DNXA 4JL5A 2G1PA 4PQYA 1A97A 3SXUB 1R0SA 2WEKA 4O4HB 1D2MA 3UVEA 4KX3A 1QZZA 4PZPA 4EHNA 2E1PA 2HU2A 3WWPA 4K3VA 5DMXA 4B3CA 1NURA 4HX2A 4F56A 3IBSA 2GZAA 2WF9A 4G4IA 2WOOA 1U04A 2JDID 3NC0C 4OX9B 3TQOA 1GQFA 1UKBA 2XGMA 3W5JA 3F1KA 2PD4A 5AUQA 5KVAA 3Q9SA 2IEDA 421PA 4J43A 2V74B 3COJA 2VF7A 3HY6A 3JZFA 4QDXA 4WKOA 4XVQA 3ZW7A 4B3HA 3THYB 2A88A 1M75A 4BNIA 4WERA 3IA7A 1P19A 4CM7A 1OC4A 1U7UA 4XA8A 3OTIA 2BEJA 3H4VA 4C4TA 2X0FA 2C96A 3B3JA 1DJNA 4L7VA 4V0LA 1ST3A 3MBKA 2A8YA 4KKVA 4YI5A 2QN3A 4YJ3A 3UOGA 1SUPA 1KO7A 2HU8A 1SQ6A 4MUMA 3GJXC 2DWCA 4WY5A 2VDWA 4DBLC 4Z4EA 3M6VA 3NATA 4HNQA 1ORRA 1MABB 2IW3A 4MRMB 4BJ3A 4E2ZA 1F2UB 1CWUA 1IEXA 2LKDA 2QRLA 1BN6A 2CVOA 4UREA 1L1FA 2RHRA 4AECA 4KX5A 4YCSA 4R69A 2PUAA 3CVUA 3QKWA 3KDSE 4GM1A 1C1YA 3ZHSA 1LCIA 1ZMXA 4MCAA 4CJXA 3S6JA 1F9AA 2GRJA 2GESA 3ZIDA 2HUPA 2D4HA 3F90A 2ZUDA 1JQDA 4OXIA 5KNCA 4K03A 4DLZA 2AFIB 3HWWA 3UAWA 3ZDZB 3GLHB 2X1VA 1KYIA 3NR2A 3IQIX 4FD3A 5EZSA 2HMWA 1H4QA 3SX2A 4W9NC 4DHWA 2TSYB 2UUAB 4QFCA 3F67A 1F8GA 1EWTA 3L7DA 1UBFA 1HG1A 3QITA 4L9AA 3U62A 2VSOA 5KS2A 1CS0A 4FFRA 1EESA 1WMSA 4LRUA 4TLMB 3B78A 5IF9A 3GJ8A 4JOCA 4E33A 1O95A 2HEIA 3A32A 4ASUA 4BO2A 3IQDB 2OV3A 3EVAA 4C0AC 3DBHA 3UHFA 1JDNA 5KYUB 1TZCA 4RZHA 2PSEA 3ZUPA 3ADBA 1II0A 1JHUA 1HE1C 1WMAA 2VQSA 3KYDB 5F2EA 1UFOA 1V1MA 4P5PA 3HPQA 1SCBA 5DASA 2GEUA 5FAXA 4HH1A 3PX7A 2I2BA 1NBOA 2QRHA 2XUGA 3CMMA 1K8RA 2J3LA 3QLUC 1T0UA 4QPPA 2B21A 2J9FA 2X2PA 3PNLA 4RJKA 1PWEA 4QU8A 2W00A 4ZYLA 3C16C 2H5JA 5D51S 1DXYA 1GTSA 4IV8A 4RTSA 1J0DA 3W9YA 4BQOA 1CVLA 4ER5A 5JARA 2PPLA 3KT8A 2O1SA 1A04A 3DTVB 1HM5A 1SVWA 1Q22A 1XZBA 4XWTA 2DBRA 4DYVA 1SU8A 5KKAA 1XD2B 4RD1A 4L8GA 5CU7A 1RRVA 2GUGA 2P6OA 1ZGZA 3Q2KA 5D87A 3G23A 1LBTA 1BW9A 3WDKA 1SN7A 2APJA 1ZFNA 2V45A 5DBHX 4AL4A 3KQOA 1UM9A 3OQHA 4QT0A 3T3MB 4BZQA 1N7GA 1OI7A 4CT0A 1YOVB 2PQ0A 1IQ0A 1AZSC 3E22A 1CQIB 1MV5A 3NT5A 1YFJA 4D26A 3DPSA 1IU9A 4M53A 3DOUA 5C3UA 2H4WA 1Z6AA 1BXGA 2FWBA 3IERA 3PX3A 2XJ4A 4RM3A 3U40A 5KYYB 2ACKA 4DGQA 5JZMA 2I3DA 4QTTB 3WHPA