1E6LA

Two-component signal transduction system d13a mutant of chey
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
b'DKELKFLVVDAFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEY
molecule tags Signaling protein
source organism Escherichia coli
publication title Towards Understanding a Molecular Switch Mechanism: Thermodynamic and Crystallographic Studies of the Signal Transduction Protein Chey
pubmed doi rcsb
total genus 42
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e6lA00
4GPAA 1JH9A 1OXKB 4PYRA 1JYEA 1TM2A 3DBIA 1KRXA 1YMUA 4YRZA 3F73A 4JA2A 1AB5A 4EVQA 3RVLA 1SXHA 1Z16A 3KLOA 1B00A 3R0JA 1QO0A 3HS3A 1JBEA 4IMIB 4MS4B 2RJNA 2CHEA 2L19A 3D8UA 5IULC 5T3YA 2GI4A 3QLVA 1JYFA 2FMFA 2VUIB 5IEJA 3MM4A 5FWXB 1P6QA 3CTPA 1PNTA 3GYBA 5FWXA 2MYTA 1XHFA 4KQ9A 1M5TA 1VPWA 1TMYA 4F12A 1M2FA 2FEWB 1NXTA 4ETNA 5HM6A 4N0PA 2Q5CA 1SXIA 4KZKA 1LJUA 2E4XA 2PAFA 2PUEA 3BBLA 3LUDA 5TPWA 1RXIA 2FSPA 3OLXA 3OLZA 4OBBA 1S8NA 2RDMA 4OG2A 3H1EA 3H5VA 4NICA 5ED4A 2PL1A 2PUAA 4Q6WA 5TQ0A 3CRNA 1HEYA 4HNRA 3FDFA 4PE5B 3TD9A 1WETA 1GUBA 2LBPA 3QLVC 2QR3A 2QVGA 4XFKA 2XDYA 3NNNA 3A3KA 3RVQA 4KVFA 1A2OA 2MSWA 3N0RA 1EWVA 2PKXA 3RVMA 1FFWA 4OLAA 3IP9A 3KLNA 3LFTA 4F3TA 1DBQA 4Z4IA 3O1JC 2R47A 4N0QA 5TQJA 4QYWA 1DRKA 1SD5A 2NT4A 1DRJA 3H1GA 5DKFA 4RU1A 1RZRA 1Z26A 2LPMA 2M1ZA 1M2EA 1YK1A 1W25A 4MR7A 1D4ZA 1DBWA 4Q7EA 3NHMA 4O1IA 4UHKA 5EWMA 4CBVA 3CHYA 3IPCA 3TO5A 1U04A 2GX6A 1DG9A 4EYKA 4KV7A 4YO7A 2QV0A 2ZWMA 1JL3A 3CKMA 3Q15C 3CFYA 2IPLA 3JVIA 3SM9A 1E6KA 1USKA 2HQOA 4RY8A 4ZPJA 6CHYA 1KMIY 4IMJB 4UHJA 3URMA 4RXMA 2VYCA 3ROTA 1QKKA 4EYOA 1YK0A 3IP5A 3OO0A 4NCAA 4Z4CA 1XHEA 4W5OA 3HJFA 4Q6BA 3IP6A 1LBIA 4O1HA 3HDGA 1ZH4A 3F6PA 2GBPA 2A9QA 2VK2A 1T34A 5FWYB 3OQMA 4RZSA 2QXYA 3CU5A 3N0XA 4ZJPA 3OQOA 4YP9A 4JOQA 2CD7A 3LUJA 1JX6A 2H3HA 3A10A 3TMYA 3ILYA 2A9RA 2IKSA 2IDMA 2DRIA 5KWSA 2PUBA 1E6MA 4MS4A 4MR8B 2AYZA 4IRXA 4FB4A 4IF4A 2L2QA 4WT7A 4G0OA 4LE1A 2HSGA 5TQ2B 4RK6A 5IUJC 3I5AA 2FQWA 4NCBA 2MSLA 5JNTA 1TLFA 5DCLA 1Z17A 3N75A 1FFSA 1YS6A 3IPAA 5IBQA 3QX8A 4KMRA 5TE9A 4YR7A 3BREA 4KK3A 3O2SB 3NBMA 3FFTA 4H3KB 3KYJB 1ZGZA 1F51E 3A0UA 4N03A 3VNAA 2YHAA 1YMVA 1QP7A 2RJOA 5EWLB 4IGAA 5B3JC 4FE4A 1TJYA 3QLUC 5JNVA 1Z2DA 4O5AA 5EWJA 4WZZA 4G0MA 3DGEC 3DZDA 4TLLB 4Z9BA 3RVOA 2PE5A 3O1HB 1EAYA 3KG2A 3LUFA 2QZJA 2JVKA 4MS1B 1QP0A 4YS6A 5GOTA 3C3KA 4RV5A 1EFAA 5TQ0B 3JS5A 5JNRA 3MQ4A 2ID9A 4MRMB 4RKRA 3OLWA 3F7NA 1ABEA 4MRMA 3UUGA 2FEPA 1NTRA 3GRCA 7ABPA 3CG4A 4G0ZA 3H5WA 1Z18A 4QYMA 1DCFA 3KYIB 4KFCA 2WRZA 3N6VA 4F8JA 2R25B 3E61A 4P98A 4WXEA 4YGXB 1JF8A 4XARA 3HM9A 3TX6A 4LE0A 1ISSA 4DN6A 3MIZA 2A9OA 1ABFA 3JPYA 4MS1A 5KQGA 1CHNA 2FQXA 4HNQA 4Z0NA 4LZLA 4B09A 4RK1A 3HEBA 5JS2A 4RK0A 4MQFB 1DC7A 4G0YA 4JP1A 4N47A 4HNSA 4RWEA 5DGCA 2P9HA 4XASA 3DLHA 2VUHB 1JWLA 2JCGA 3O21A 1FQWA 1D1QA 2MYUA 4PEVA 5IEBA 3LUAA 2FMHA 3EQZA 3G85A 3H6GA 1PEYA 4ML3A 1BDJA 3H5TA 1DC8A 1JFTA 2IYNA 5IUNC 4YV7A 5CNKA 3SY8A 3CZCA 1F4VA 5BR1A 3GV0A 4KK4A 2CWDA 5BQ3A 2TMYA 3QELB 4WUTA 4XXHA 1Z15A 3EAFA 3VNBA 4G97A 1I3CA 1APBA 4W5TA 3GWGA 3I42A 3GA5A 1RPJA 5JNSA 2IPNA 5ABPA 3T8YA 5PNTA 4Z9AA 3C97A 3QEMB 4D74A 2PLNA 4ZMSA 4RK5A 4RY9A 1QQAA 4YCSA 1U2QA 3MA0A 3H6HA 3IDOA 4EYGA 1IIBA 3T95A 1BA2A 4W5RA 2JVJA 2PMCA 4MAAA 1VKRA 3LUHA 1Z2EA 2PJUA 1JHZA 4D6YA 1MVOA 2E4VA 3CLKA 4MYRA 3H5LA 4WWHA 5KC9A 1UDRA 4Z4HA 4TMYA 4LRQA 3IP7A 4MR8A 1PHRA 1GLGA 2P4UA 3HDVA 3Q7SA 4D6XA 3C3WA 9ABPA 1ZAYA 1ISRA 1PUXA 2HQBA 2E4UA 2IPAB 5EWMB 1P6UA 2MSKA 3H5IA 4S05A 1JDPA 4EVRA 2NUBA 4Y9TA 4S04A 3GBVA 4MLDA 1P8AA 4RSMA 3SNKA 2QSJA 5IUKC 4NV3A 5I4CA 4W5QA 1E6LA 1NXXA 2ID7A 1U0SY 1RZRD 1EHCA 3O1IC 4RY0A 4RKQA 3OQNA 3QLUA 5HSGA 2PUGA 3HCWA 3HV2A 4KPYA 3ROFA 1A0OA 2WJAA 3I09A 3RVKA 2R4QA 1C0EA 4KNYA 3RQIA 4LDAA 5BRJA 5JS1A 1QNLA 1YVUA 2JB9A 3N8IA 1H9CA 3MYYA 1KGSA 1JFVA 4HYEA 4KREA 3ILHA 3QX9A 3Q7RA 5CNJA 2PUFA 2FTKE 1NXWA 4JB2A 5T7BA 3GL9A 4TLMB 3O2JA 1CEYA 1C4WA 2MYPA 2R48A 1K68A 5TPZA 2FXIA 4RXTA 1QMPA 1USGA 5TPWB 1BAPA 3KTOA 3RVRA 1XWWA 2FN9A 3I45A 4JB0A 3KSMA 4MR7B 5EWLA 5FBKA 1LK0A 2ZAYA 2J48A 2YHBA 3Q9SA 4ZMRA 1BDHA 3HO1A 3K4HA 1J56A 3D02A 3E3MA 3EJWA 3KCNA 2KYRA 3Q7TA 5CHYA 2CHFA 4G0QA 1DP4A 1MAVA 3LKVA 5HQJA 4YWHA 3O75A 1EWKA 3F6CA 5F64A 1CYEA 4Z4EA 3BILA 1DBPA 5KC8A 1OXBB 1YIOA 3S99A 1SRRA 2FLKA 3O74A 4H3HB 3HK2A 1RNLA 3RH0A 2HJ9A 3QLTA 1TVMA 3JY6A 2RGYA 3A0RB 1USIA 2FVYA 3RVSA 2HQRA 3FFXA 4ETIA 4F06A 4MR9B 1ZDMA 1A04A 5C5CA 5KQMA 2WJWA 2FW0A 1QO0D 2H0AA 6ABPA 2OENG 5E3JA 3NNDA 4IILA 1M5UA 4Z4GA 1LBHA 3FMVA 3JTEA 4L85A 2NZVG 4MQFA 1URPA 5FBHA 1QP4A 1KRWA 4TN5A 1NXPA 3SG0A 1JFSA 2E4YA 4JASB 4MS3B 2QU7A 4Z99A 3RVPA 4EVSA 2BGGA 4XAQA 3C6QA 2HPHA 1EWTA 4MQEB 3K9CA 1NXSA 2IPMA 2IOYA 3OMXA 1BVHA 4LX8A 3LKBA 1K66A 3GT7A 3EGCA 3MF4A 4OTZA 3FGZA 2NZUG 1MB3A 2QVCA 3KKEA 4L4UA 4M88A 4ETMA 5TQ2A 4E7OA 3G1WA 4MS3A 1GCGA 5DLEA 2B1JA 4DQDA 3EQ2A 1QPZA 4JAVC 2WMYA 3H1FA 2O20A 4MR9A 4H60A 4XLTA 3OM0A 5CNMA 3CS3A 5JNUA 4NQRA 1W9HA 3HUTA 3QEMA 3N0WA 2FQYA 4W5NA 3C3MA 4EYQA 3SAJA 4KRFA 5IC5A 1YS7A 3LUGA 4MLCA 5IX8A 2GWRA 4Z4FA 3KS9A 5JNWA 4MPTA 1NXVA 1Z12A 1DZ3A 3QELA 4OATA 1NXOA 3HVRA 3RVJA 2L17A 2N9UA 4QICA 1E2BA 5TPZD 1JDNA 1BDIA 5B3JA 1RXEA 2B4AA 2PUDA 3LUCA 1DJMA 5D2CA 1YTUA 2WB4A 4FE7A 3JPWA 5CNIA 3HZHA 2A9PA 1NATA 4EY3A 3JVDA 1R8JA 2JBAA 2FLWA 2JBAB 1FFGA 3MMNA 3EULA 1Y1LA 2FMIA 2JRLA 4F11A 1L5YA 2GKGA 3T6KA 1MB0A 2E4WA 4E7PA 3L6UA 2X7XA 3OO1A 4KQCA 4PZ0A 3LMKA 4RDCA 1ZH2A 4RK7A 1FSPA 1JLKA 3BRSA 2JK1A 2PUCA 1QQBA 1ZN2A 4RK4A 3LOPA 2E4ZA 2LIVA 3CZ5A 4G86A 5KQPA 4N76A 5HKOA 1ZY2A 2I6FA 1L5ZA 3OMWA 1GCAA 4WXMA 5EWJB 3OM1A 2JVIA 4MQEA 3TB6A 5KI6A 1VRVA 3M9XA 2FMKA 1GUDA 3NNSA 1D5WA 3CG0A 3KJXA 4GNRA 3BRQA 3UKJA 5KQLA 1Z13A 4G0PA 4OLBA 2LUOA 4DADA 3EODA 3OLYA 3OLVA 1D1PA 3EDCA 4N41A 3LTEA 3LUKA 5FWYA 3DLBA 3H75A 1SXGA 3HXMA 3HSYA 1ZITA 3NHZA 3Q41A 2FKAA 4MGEA 1NY5A 4EGSA 2WWVD 3CNBA 3KHTA 1ZESA 3O2QB 3P9YA 4QPJC 2FN8A 2LP4Y 1P2FA 4RXUA 2M98A 1D2AA 1DCMA 2L18A 1ZHHA 4EUKA 8ABPA 2MYNA 4LE2A 5DTEA 3SQNA 3B2NA 3HUUA 3T38A 1LJLA 2F8SA 1VLZA 1U8TA 1ZGGA 4G0XA 5BRAA 5GQSA 2OQRA 4YLEA 2PL9A 2QW1A 2NT3A 1AB6A 1DCKA 5C5EA 3H5OA 4RS3A 3DGFC 3QK7A 4LDZA 3QEKA 1ZVVA 4ZYLA 3N53A 1MIHA 3M6MD 2WY2D 4P1ZA 3UK0A 1Z25A 2V0NA 2F8TA 3M9WA 1PEAA 3RVNA 3FFWA 2AYXA 2W42A 4PICA 3W9SA 2FEKA 3L49A 1U2PA 1PNRA 3GBPA
chains in the Genus database with same CATH superfamily
4CPDA 2HCBA 3ZWQA 3HFRA 2AT1A 1FW6A 1XAIA 1YMUA 1X19A 4RANA 3UGTA 3C5CA 2VWPA 4DMLA 4IHQA 5A7FA 3ZU4A 1GQYA 1IIRA 2Z30A 2P9QA 2FP4A 1RYNA 3PK0A 3TLAA 4PN3A 3SLKA 3EFHA 4URFA 3ZGLA 3C3CA 2CHEA 3GW8A 2QTRA 1G5FA 4PBTA 5ALWA 3CINA 4UOZA 5MF6A 4CUKA 1KEZA 1JYFA 2FZVA 3BWVA 1YQTA 2GPTA 5CBPA 3ABIA 5IRCD 2A7XA 2QNBA 3TL3A 4G56A 4BUCA 1KYTA 1EJ6A 2PFKA 2G63A 3BZWA 1NIPA 4LV5B 1WBDA 1Q0PA 2NO9A 1M6VB 1U2GC 3Q9LA 3M1YA 3CX6A 3PGMA 1E0JA 4Y0NA 2N47A 3A36A 1KEEB 3T54A 4NKRA 2Q21A 3OLZA 1F17A 4MUAA 5C53B 4A73A 1O97D 1OPRA 3DYVA 5IAGA 3GFPA 1JEEA 1M8PA 1MT3A 1U5AA 2WHPA 2XSZA 4PZDA 3C2QA 2WYIA 4IFIA 4L1KA 1II8B 2XKBA 4MEJA 4RY2A 4WOCA 5FPQA 2ZYUX 3SVZA 5A0VA 5EVCA 2W2TA 4B47A 3QFRA 4IHJA 2FETA 1U7DA 5KSOA 1AY0A 1ZUNA 2WJHA 1ZO8A 4KFRA 1JAHA 4PPNA 5D01A 4EUEA 3BIJA 3RC7A 4ER6A 1ISIA 1HSOA 4G5SA 4B4UA 4RFLA 5F2KA 2GXAA 3W3AH 3PCRB 4AXBA 3TW8B 4N5LA 5HDQA 2JC3A 3BFJA 4P3PA 1NI5A 3K31A 3HB0A 4O1IA 4OFXA 2YN0A 4RA6A 4YRKA 1UMCB 1ZXLA 1E4OA 2ZM6B 1DG9A 1CERA 1EFVB 3E9NA 3R1IA 3E81A 3ZI4A 5JTUA 3SYNA 4MKGA 4UU7A 4FD2A 4B76A 1NBMA 3L8GA 1E4EA 4P34A 4MGYR 1KMIY 3OA2A 2PZLA 2GJ9A 2VNKA 4M3NA 5HIIA 1LJ8A 3G5LA 2CC2A 2ZJZA 3ZVNA 1MEEA 1QKKA 5BW8A 2I1WA 3V1MA 2C7BA 1N5KA 4Q6BA 4G1UC 2L69A 1MDBA 2HNKA 1FUKA 3AF4A 5E6RB 1IWBB 4CIDA 4HNAB 3BDIA 1RPZA 3F6PA 2ZROA 4W9MC 1C7EA 2FUEA 2CVHA 1IUNA 3QPVA 4WRRA 2AUTA 5B4TA 2PO7A 3Q3VA 4JOQA 1E62A 3U7FB 4D8TA 1K6IA 2YZ2A 4C2AA 2B3DA 2GLXA 5C0OE 3PFBA 3A3OA 1V3VA 2RHBA 3HXKA 3T5MA 3M6VA 4ZAGA 1OOEA 2WTXA 2O8BB 2BEUB 4Z3KA 2HXYA 4WNIA 2QTTA 3JQCA 1J8YF 3G9UA 2W00A 2FPWA 2Y05A 1U8YA 3L7KA 4GBMA 4WE3A 4LRUA 4ZVVA 1R0KA 5AVRA 4V0KA 2VHXA 2L2QA 5BMVA 2GZ1A 2PPVA 1FSSA 1G2OA 2GN0A 4GR9A 3MN1A 3UHOA 5DXAA 4AJJA 2C2YA 3A05A 3B2QA 4UXIA 3C7KA 2QUHA 2ZSHA 4JP5A 4YRTA 3C1UA 1JTFA 3RRFA 3N75A 3G8DA 5D87A 1YS6A 4R9RA 3G13A 2GPYA 4KMRA 2WB2A 4IRMA 1M1YE 4L9RA 4AJPA 3ENWA 4YR7A 3V97A 2ATCA 3NIWA 4OGWA 4WY5A 3STWA 1W76A 1FUIA 3S81A 4NU6A 4ITRC 1YDFA 3O2SB 4TROA 4AUNA 3N39C 5LYJF 2HBRA 3C3YA 3A0UA 3AMVA 2PMDA 3ZV4A 2VHQA 1GZVA 1J8QA 2H4JA 5IBPA 2WTNA 5J1TB 4P8RA 3VDMA 3HDYA 3HY4A 2OD7A 4BNFA 2QVZX 3RADC 1HO3A 2B8TA 2CXTA 4FE4A 1Q0UA 2EJVA 2QMEA 3TZBA 2AWOA 2JAUA 3RLIA 4CKXA 1T3SA 1OGIA 2G3YA 2XYHA 3HSSA 2FUG6 5BXQC 4M21A 1JXQA 2P30A 2C2HA 1CT9A 1EAYA 3UBTA 3OPYB 4HFJA 1ILEA 1S5PA 1T2EA 1K92A 2XQGA 3C7AA 2DFVA 2LDBA 1GTG1 1MF7A 3TK1A 5IVPA 4NF2A 2W0MA 1EFAA 3F3KA 2I76A 3GRYA 2ECFA 2AJ8A 2D0PB 2JJ8A 2XDWA 3DB2A 4KKXB 2JGJA 3I2YX 4YJFA 1M7BA 1LV7A 1N7JA 3PR3A 2VIIA 3E9CA 4I14A 2ADOA 1F1BA 3H5WA 5KNDA 5FP0A 3KQYA 1XLUA 1P8JA 1DELA 3K30A 3N6VA 4XJXA 1Z22A 3D4NA 4MYCA 3IIKA 4EHIA 1E32A 2HMSA 4QO8A 3JQAB 1AS2A 2EGUA 4OQMA 4M1KA 2JIZD 4EAQA 3V2IA 2VTEA 1EUDA 1ZU5A 1BOFA 1CZKA 1VHTA 2XUJA 3PUIA 3Q72A 4IFEA 3P26A 4PX3A 3ZD8A 2H92A 4X1YA 3IIEA 1DC7A 1GL3A 4PIPA 3KBOA 4N47A 1IXZA 4XASA 4AROA 3JR7A 2XUKA 5SYNA 1J9ZA 4Q7QA 1IY8A 2HU5A 5A02A 3JSXA 3SPXA 1H1LB 1UANA 2JAXA 3AL3A 2Y1FA 3L7DA 2GEJA 1V95A 4L6IA 1EAMA 4EGQA 1W46A 4Q00A 1YS4A 4D1YA 4ML3A 2Y2VA 4EQ6B 4BVEA 2NPIA 3MBOA 4Q05A 4MI3A 2VPIA 4XM1A 1JFTA 2YW2A 3JD2A 1N78A 1AN0A 3NW9A 3LE8A 2Q29A 3BD6A 1QSGA 5EMMA 3SYLA 4MV3A 4DDKA 1NF9A 2FR1A 2RJ3A 1JQDA 2GVZC 3MWEB 1EGMB 4I4TB 3OI7A 4YX9A 5A62A 4XB6B 4J6EA 4U7JA 2P2YA 2BGNA 3QELB 4D3YA 3T52A 4KVAA 1GOTA 2XRFA 1PVOA 1A1SA 1OWPA 3FSGA 1JSRA 3TIIA 3L93A 4BHTA 4HTFB 1VHLA 3FJOA 1IM5A 1P81A 4EPTA 3PLAE 1BQEA 4M6WB 3VSAA 1N5DA 1FUUA 1JLLB 5ERXA 3WGMA 4CL2A 1KEKA 2YIVX 4RK5A 1M2VB 1T4DA 3ASZA 2GJKA 4OMFG 4ROTA 5CLIA 3V7WA 1IN4A 4YHHB 3PYMA 1CIPA 3NTRA 1WLYA 3GB9A 2E6UX 1PAUA 3N3AC 4RZXA 1CP2A 1SCAA 4DF3A 3LSTA 4MRSA 5A3RA 1YUNA 2PSEA 3PUZA 2XMRA 3WC4A 2C4HA 4M76B 1IZZA 1U9ZA 2C57A 4MDFA 1X7XA 2TMKA 4Y6LA 2WPDD 3RSFA 2FEXA 1YJQA 2ADFA 3KUUA 2PZGA 4FS8A 3SBEA 4CF6A 4QASA 3A4YA 4WDRA 3TPZA 3U3OA 1T2DA 1V9LA 4LRQA 1DUSA 2X3YA 4MR8A 3HN2A 3U40A 4L3OA 4B3XA 1RVV1 2GN1A 2LCQA 3GUYA 2BBOA 4BGEA 3KQSA 2F3RA 3F7OA 3NT4A 2ONJA 1LDBA 2DH5A 1C4KA 1SVLA 1WY5A 5LBTA 3ND9A 2M6RA 1EFVA 3LQKA 1Z82A 3AUUA 3OZVA 4KQIA 2RBGA 3VHQA 5DNYB 2DKFA 2JGDA 1QHXA 4FFMA 1O0SA 2K7FA 3UB3A 2AX4A 3PVSA 3PHIA 4D25A 1XZEA 2VCYA 3HP7A 1M34E 3O1IC 3NM5A 2ZIZA 2REXB 4BE7B 4WBNB 5AKHA 1O8CA 2C4TA 4HB4A 3GO4A 4WFJA 1SBTA 4Z8YA 4LNUA 3K2BA 3OPNA 3CMCO 4XVCA 4TLDA 3RQIA 2WHXA 5JS1A 3FOBA 3PV0A 4OSPA 2KB0A 3Q6MA 4ZXPA 2NXCA 1XALA 3MYYA 5BN5A 5JECA 2GBCA 1GPDG 2XNDA 3OZUA 3N8KA 4BNXA 4F72A 1TCVA 3BD7A 3Q7RA 1G8GA 3QNMA 1G20A 4CM4A 2B9EA 3G7UA 4XQCA 5BSFA 1KY2A 3ZXYA 2IELA 4K0RA 3ZNPA 2AXEA 1K68A 1P19A 1R2QA 2VSYA 1V8OA 3ABZA 1OBFO 3WMRA 4EUSA 2B4QA 1XWWA 4DUGD 1JJFA 2F59A 3KSMA 2PD4A 3FTPA 1TA0A 1QTNA 3E1GA 1DXYA 4JL8A 1T10A 5K3CA 5CITA 4JVSB 1BD3A 3S28A 5ALNA 4D6PA 4E09A 1JG7A 3G59A 3NUQA 3T7RA 1LWOA 2O5VA 3BSWA 1B15A 3L6EA 3B51X 3HYRA 1QZUA 4R69A 1J2TA 1VSTA 3B5IA 3IKMB 4RELA 1J06A 4X8OA 5K3FA 4OKIA 1PW7A 1MFZA 1MX5A 1NR7A 4HGZA 3HXPA 3SC2B 2H4WA 2UYGA 1DBPA 3CRW1 3TKLA 4GZ6A 5K2MA 1GAQA 2HSZA 1EDEA 3I64A 3LHFA 3OFJA 1UDBA 4N6OA 1EHIA 1UEIA 1Z6PA 3OOWA 2YASA 2BEVB 4NBLA 3MHTA 2XECA 4BMNA 1L7BA 4GC9A 4U0JA 3UT0A 2DLCX 1COWD 1P1KA 3AP2A 4EJ2A 5CCXA 3KZNA 1OWMA 3PS9A 4HGNA 2GAJA 4YLGA 3QKWA 5IJ0A 1GAXA 5E7MA 2PO5A 2FW0A 5A4AA 4RH0A 1Q15A 3VU3A 4OM7A 5GIPE 2PTGA 2GUGA 2GF0A 3KOXA 2EX1A 4PAOA 3P4YA 1K3UB 1Q1AA 2E3JA 4D45A 3GFQA 1Z62A 3IQHX 3MB5A 1CX9B 3CNHA 2BBTA 4Z99A 5CB4F 4LDPA 3QKSB 4E32A 1NVVQ 1SMKA 3KZKA 2YFHA 4C4SA 2IOYA 1KSFX 1QGDA 4QFBA 5K0FA 2Q2VA 3LZCA 2OL4A 2WJIA 2PRZA 3FGZA 3O4FA 4L4UA 3C7CB 2CGEA 3BGOS 3NBYC 5LP6A 2XQKA 5IKPA 3UWKA 5JTTA 1RRGA 3CXRA 4OA8A 1E61A 1EVKA 4P5EA 1RFGE 3LUPA 7AT1A 1TJNA 2O20A 2R97A 1BGWA 3A6EA 3GARA 2MHCA 3NDPA 2SCUA 3ZHXA 5C7OO 3OM0A 3CZ4A 5EE5B 4IVQA 1LD3A 5F78A 3T34A 4EECA 5KYUB 5EZSA 3RS3A 2CXSA 3LHSA 4EYQA 1WMEA 3CLHA 3PHBE 3HB1A 2PS0A 2C0PA 3PBKA 3HO8A 3OE5A 2AI1A 5IX8A 3CF2A 3NG1A 3VZQA 4YHBA 4L5YA 3ZD7A 4Q02A 4DMFA 3QELA 4O4HA 5EJMA 5B1EA 2GNAA 3MT9A 1EMDA 1SU6A 2BLLA 4ZVTA 1MLDA 2QSYA 2ZS7A 1MHPA 4DMCA 2WE7A 2YWHA 3V5NA 2ZI7A 3RTCA 2QG6A 1QIKA 4XFDA 4RTRA 4DA7A 1ZGAA 1R5BA 4IGKA 5FOUA 1I3OA 1T26A 3BE4A 3TWOA 4MUIA 1U7XA 1UXJA 3I0ZA 3RAGA 1WPQA 5HMMA 5IAKA 4X3CA 1TIKA 2JBAA 4X5OA 3VHXB 3LZ6A 1Z56C 2J31A 3ECSA 4YQYA 5TS2A 3MYRA 4E5VA 3AETA 1A9RA 2AEFA 2VYVA 4PZUA 3EULA 4DE5A 2JRCA 3GNLA 3K5IA 5FBRB 4WD3A 1JHDA 3AEKA 1Z9BA 1ZUNB 3AOGA 4FE3A 2G1JA 2O1EA 2GJSA 1XQWA 3AC0A 2VRCD 2NSJA 2CXRA 2EEPA 3B52X 1UWCA 1QCDA 3BGVA 5E9JA 5EMNA 3FOEC 2X2FA 4RDCA 1JNXX 4GEKA 2LVBA 4Q9HA 3LPMA 1PX2A 3VR2D 4B8ZA 2FG5A 1IBCA 4CFYA 1NRWA 1ZN2A 4G5OA 4CM9A 2OGSA 3FR7A 4A0QA 5JDIA 3GK3A 4ERXA 2B8JA 2I29A 2LIVA 2O0JA 4HGRA 3N2YA 5F1KA 7REQB 2YVQA 4DLUA 5J2TA 3DE0X 3TB6A 1NP6A 1TADA 4ZO4A 2RB5A 3ADKA 4OL0A 4UBKA 4EENA 2QL7A 5HRUA 5HUQA 1QFYA 2J1LA 5CTAA 3MIIA 2XZLA 5AW9A 4QATA 4JITA 2BW0A 3L02A 5ARCA 1ZGHA 4JLSA 1UBFA 4Y2HA 1XE3A 4G0PA 1OT3A 2ZBDA 4LUCA 2HSDA 3MJTA 4PYLA 4OGGA 1K1EA 2EATA 3ZHSA 1XDUA 3EDCA 2I2XB 5HK8A 4IG9A 1EP2B 2PMBA 1EVIA 2QYHA 1R8XA 1ZMBA 3H75A 4I4TF 5REQB 3TRJA 5JXJA 1GO2A 3KD3A 5C3MA 1NY5A 4PYOA 1GKIA 1FYEA 1KVRA 4MVJM 2ERYA 4X92A 4CKWB 1VYTA 1P2FA 1WBJB 2LP4Y 2UYQA 4JEUA 1GFIA 2C5SA 4DCGA 2PKQP 2F8SA 1ULAA 5I7VA 3DH0A 4LTNA 2PSFA 3IHLA 3OM9A 5HRAA 3EZ9A 5LDDC 2EDAA 1VLLA 2JAQA 1RHQA 3CZ9A 1SU7A 3QM1A 4O2AB 3SQXA 3DWEX 3LP8A 3R2JA 4UATA 3EFOA 3TIGA 3WHLA 3QKUA 4JP8A 3UK1A 3D8TA 1QNFA 1K5PA 4OHRA 3ZZMA 4R84A 2FNAA 4JXKA 2WUEA 1IM2A 2NQTA 5EZ6B 2PIAA 1VRWA 1NMZA 3OTOB 3FVRA 2JFVA 1OB5A 1P72A 1YRLA 3GDOA 4ACBA 5ARBA 1KZ9A 121PA 3OZGA 2BMEA 4YQEA 2IBSA 4FZVA 2JBWA 4JIGA 2FR0A 2ZIUB 3DVAB 4BBZA 4W1PA 1MD9A 3LV8A 4ZT2A 4NYIQ 4UMFA 1E8DA 1P74A 2B1QA 4Z0TA 4B45A 3RJTA 1DS6A 3GEPA 5ULLA 5GZ3A 4I5GA 4GOMD 4PU0A 2JFFA 4B6JA 3U5ZB 1PDOA 2XNJA 3L0ZA 3OQHA 5EP2A 5DI3B 5TJHA 5J47A 3MAGA 3K71B 1ZGCA 2CNNA 3HKEB 4BX0A 1GV0A 3OPYA 2AWNA 2CFSA 5AM1A 1M33A 5K0ZA 1K9VF 2VDQB 1MNAA 3DS8A 1X1DA 1KAOA 2VH5R 2GI4A 3KSBC 1MV8A 1Z36A 2PBRA 1B0UA 4YROA 1G98A 3A58B 3MM4A 2C9ZA 2N42A 1S2GA 5EXXA 5FWXA 4AJHA 4BJ3A 1M5TA 2BFMA 4JLVA 1HQCA 4B4WA 1SB9A 3C7TA 3CJTA 5LUAA 5I5EA 2ISCA 5CW2A 3KUCA 5CVUA 1ZWKA 4HPXB 5HA5A 4EABA 1T3HA 4BTVA 1EFRA 2PAFA 4EITA 4HNUA 3ZLJA 1RWWA 3NHFA 4MW0A 1QQ7A 4J0KA 1N4DA 2YJ4A 2ALJA 4MUFA 4H1TA 4S1NA 2K7ZA 2VWQA 2O06A 4AS1A 1QRAA 2E18A 2IL1A 3THYA 1U94A 3QLVC 3GJ6A 4A8JA 3BQNB 1QUEA 1U2DA 3JQAD 3N0RA 1FDIA 3ZS9A 1KDOA 1WZNA 3E18A 5FEMA 4HXGA 4ZGGA 3R6DA 2EBWA 4H18A 4QYTA 3ER8A 3G0CA 3MCUA 4G8BA 4TQ9A 4B82A 2P5TB 1XRQA 1H3EA 1H2RS 3EG9A 4K28A 1NBME 1C1DB 3DDHA 1C0IA 1N3LA 3I9V1 1LVHA 1RWXA 4CU2A 5BYAA 1M2EA 1D4ZA 1EFUA 1W4CA 1YSCA 4JCOA 5EWMA 1KQ3A 3OD5A 3RUDA 1NDUA 2RHLA 1I8TA 4D02A 1I4LD 4F21A 3A27A 4C0KA 3NC1C 3ERCA 4N3NA 1SG0A 4BX9A 2NU8B 3S70A 4O0MA 3DOFA 2K2QB 3P0HA 3URMA 3BFXA 2OHVA 4D8UA 2C9BA 1P62B 1NOJA 4RBNA 3OO0A 3C6YA 1H0RA 4OXYA 1MOQA 4N8DA 5DX0A 1IQPA 4YJ3A 2VRCA 3HRKA 3MT8A 2A9QA 3IEXA 5AVKA 3V1YA 3N0XA 2AHOA 2ZR0A 2C20A 4R2LA 2QUBA 2RHMA 3H4IA 3JWIA 5FL3A 1P0MA 2RI1A 4DLAA 3RTBA 3ILYA 3RNLA 1Z5GA 1V4BA 2PRYA 2W2KA 3BEOA 3DNPA 3IR5A 3V8VA 5F52A 8GPBA 1RI4A 1JE0A 2PGJA 1E92A 5AHWA 3GEMA 4TLBA 4MR8B 1ZKMA 1IJKA 2XVAA 5JAHA 2ACWA 1V7QA 3CEAA 4KWIA 2ZRDA 2YHIA 1AV7A 1N6LA 3A7EA 3KWLA 3WGYA 5IUJC 1KBQA 2JLYA 1PWXA 1NF2A 2PRJA 2MSLA 4H3SA 1PSWA 1W5TA 4L7VA 5AICA 5CJPA 1JJ7A 1FFSA 5IYZF 5IBQA 4GX1A 2NU9B 5ELXA 1JQBA 1W44A 2QE7D 1TQ2A 4YO8A 4WK2B 4NLLA 1S02A 1H2HA 3KKQA 1S89A 2JIDA 3OC6A 3ND5A 3EC1A 3E7PA 2LV8A 4AO8A 1K8YB 3ICWA 5AW7A 1GEEA 1GNQA 1SVIA 3CH5A 1R00A 1QQTA 3MJCA 1HLDA 5L7TA 1JVNA 2RJOA 3SEAA 5DN6D 2J87A 3AVXA 2Q8QA 5F76A 1KAMA 3VZDA 3OZFA 4FW9A 4TMFA 5EEHA 5FV4A 5FOVA 2WF5A 1KPIA 3FTDA 3HFSA 3JR3A 2J3EA 5BSTA 2JEZA 4JB8A 2HA2A 2W22A 4OBWA 5ED0A 4FOPA 5CK5A 3KZOA 3IJRA 1PFUA 1D6JA 1DJQA 4HQNA 1O94D 3D6NB 4FI3C 4HPWA 4ODIA 4U39A 4WXPA 3SC3A 1BTOA 1RLMA 1MVLA 2YOGA 3ETEA 1HFWA 1NJ6A 4NV1A 5TVGA 3ZDYB 1GPBA 1WY7A 3DHWC 2R66A 3S29A 5LYJA 1PFQA 1E9SA 4FR2A 4OV6B 1SQSA 2YINC 7ABPA 2X8JB 1B8OA 5U1PA 3EUWA 4O4HB 2ZVDA 2ZDHA 4QYMA 5J5VA 2AC2A 1PL8A 1L5KA 1QRRA 4D81A 2BBWA 5CLJA 1T9GS 5AXAA 3AF6A 1PWYE 2RAUA 3MNFA 1XL0A 2FOIA 2WT9A 1OH6A 1CUSA 2FW7A 1ISSA 5LXTF 2IGBA 1E2QA 4PSVA 3SEZA 4C88A 4R2IA 5JRDS 3IQIX 2FQXA 3WAKA 4CFZA 5KKNB 2IHNA 4RK1A 4MVXA 4YMIA 1Q44A 1SXJA 3PDCA 4POAA 3RTAA 2BFFB 4LISA 2PGOA 2IEAA 3FCCA 1P2UA 1UFQA 2O4UX 5GVRA 1KZ1A 2A3NA 2G76A 4FHDA 2C4KA 2YWEA 4GF5A 5SZKB 1CQIB 3A1FA 1FRFS 3M83A 1XHLA 3T61A 3NBUA 2AE2A 4DCPA 5LNK1 4GOXA 3WI7A 4LWOA 1KORA 2Q0HA 1J8MF 2DMRA 2ZIFA 1PG2A 3BAFA 1E2DA 4AY5A 5JI3E 1VL6A 2PHZA 2XOEA 4TWIA 1DHTA 4H7EA 3A1NA 5JCJA 3AESA 5I5GA 3OCYA 2YY5A 4GMXA 2W2QA 4DTIA 3OEED 3IEMA 2HA5A 2IYZA 3B8EA 4C9BA 1ZN9A 1WABA 1IY2A 3PEUA 3R4CA 3A26A 1RXCA 1R9GA 1G19A 4DCNA 2C7OA 5JNSA 1B16A 3PDIB 4QVGA 5EJAA 3NDBB 3B1JA 3GLFA 2FN4A 2GPNA 4YCSA 4ZCPA 2UYHA 4RD0A 3JZIA 3WDKA 1J0DA 4EY4A 5HM8A 1GFWA 3U7HB 2Q3HA 3O9VA 1IIBA 2Q2OA 1WHSA 4N49A 2HI0A 1FP4B 2WWXA 4AMVA 2JVJA 2X58A 5EIHA 5EZ5A 1G4AE 1VJTA 5FULA 4F04A 2C9MA 2WABA 3ME5A 3D1VA 3H9JA 3PGJA 5JAPA 2NUPA 4MZXA 1BS9A 2QDKA 4RM2A 1TQ6A 2VDNB 1Z28A 4BLVA 3GAMA 1PR5A 4NNJA 4CKCA 3KB8A 3B6MA 4KQMA 1ST3A 3G02A 1ID1A 3IUSA 1DTSA 5IDYA 4RTKA 1O6ZA 2XYQA 3D3EA 4OLFA 4GYWA 2E4UA 3GLVA 1UXGA 1R37A 3JATB 3PFCA 4ND5A 4X1YB 4CM9D 1U6JA 4P4UA 4P7JA 2C4UA 1OF1A 1PS9A 2ID8A 5EWMB 3T99A 2BFNA 5KIAA 2IZZA 5KOJB 4QEKA 3DPUA 3NO4A 2IS6A 2H0QA 2EBHX 3LCVB 1KC3A 3AKCA 5ITZB 1G1MA 5DLPA 1KJNA 2AL7A 4O4IA 5I9SA 2J09A 3UK2A 4TSFD 3MGCA 4H4DA 3DAFA 1U0SY 4O63O 4GKKB 1DUIA 4LRTB 2FSHA 3GPCA 5HVNA 4OYLA 3BCUA 2B7BA 2RAVA 3OESA 2C94A 2YYAA 3A28A 4IJVA 4BEBA 2V4UA 3EEYA 1N6KA 5C1DA 2YR0A 3T4XA 2WUFA 3HYTA 3N8IA 3TMKA 4BECA 2HO5A 1JJIA 4KREA 2H7CA 2OZLA 1HURA 3ILHA 4CMIA 5KX5B 2PUFA 5CX1A 2DBRA 4Z9YA 1WQ1R 1TM1E 3WLEA 4KLCA 2QAGB 5LN1A 1ORVA 4QLAA 3KZXA 4NZOA 3NYQA 1ZIYA 4X7MA 3TR6A 5JSUA 2ZJ3A 2ZTSA 3BTVA 2EU8A 3WSTA 5KVSA 1Z33A 2Q41A 3FRJA 3EGXA 4L2IB 1A3CA 4CN9A 1IYZA 1IEVA 2CFIA 2FK8A 1F8UA 1J49A 1AZLA 3GUCA 1HI9A 3FPFA 1OX4B 2PYZA 3QVGA 4QX6A 3WGOA 1LK0A 1EYZA 4OLAA 2ZR9A 5HKKA 4IDBA 2JZNA 3SZRA 4D99A 2QEQA 4MRAA 4I3GA 4OGKA 5DIFA 4C78A 5EVJA 3D02A 2O19A 1VJ5A 2Y1CA 1Y89A 3C6XA 4KQ6A 4N6GA 4DTCA 5JROA 3C3AA 1EDBA 2IEBA 2VDJA 2QTVA 2IEIA 3ABQB 5EHIA 1GTSA 2Q4DA 2RAPA 1YC2A 3EAGA 3UJPA 3AT1A 5JALA 4XLLA 1I1HA 4FQ8A 4HS4A 4A0HA 3H9UA 4PR3A 1NRXA 1X1SA 2WLSA 1ECPA 1Z47A 2QR5A 1U81A 1M5RA 4TRNA 4N9WA 4BBJA 1TVMA 2C3YA 3T7TA 1GTRA 3KK0A 1HH4A 2QTFA 4CUJA 4NDAA 1CF4A 1NQXA 5BN4B 5CAEB 4EWLA 4MJLA 3SQOA 1I4WA 1G7CA 1Q1ZA 2ACEA 4YCBA 3FMFA 1SD1A 3BHJA 2B69A 1DQNA 3QY0A 5CA1F 3HCPA 1I3NA 1BXGB 4JBHA 2EF1A 3FUTA 4IIJA 4F2PA 5JQGA 1URPA 4DGSA 3FCSB 1OYOA 2JD0A 3FROA 1XKLA 3MWDB 4YRFA 4EVSA 4EKDA 3ECCA 2HPHA 1SHZA 1XRJA 4YCAA 1G20B 1XDGA 3CO5A 4N7MA 1DV2A 1YQQA 5FV7A 1P31A 1E1RD 1Q2XA 4U7GA 3VO2A 5TGDA 2B1RA 3DV0A 1NJGA 5IW8A 3K6JA 1GSOA 4K87A 3AM4A 4LY6A 4DANA 4GLLA 1J2RA 1DE0A 4WACA 3W5HA 3WVNA 5AW4A 2FJ0A 1HE2A 1GIAA 3ZNQA 5AESA 3ZHCA 3U7JA 4Y2VA 2PS1A 4P80A 4E7OA 1FL9A 3F74A 3FLAA 1G0NA 4Q1FA 5CA0B 2HIHA 1JAYA 1N6IA 4RJJA 4JAVC 3EOZA 3OKAA 5KCZA 4JNCA 1HZZA 1DKLA 4W1QA 4F4IA 1L5RA 2G0NA 2REQA 3IVAA 3HYNA 4DDUA 3L4BC 4MV7A 2FP4B 1S3SA 3EDMA 3ESXA 2YVUA 2GM5A 3OOEA 4R71A 1AKMA 3LM8A 4MVYA 2XDQA 3SAJA 1YS7A 2PMKA 2VJNA 1JG2A 2WWIA 2P6PA 2Z2YA 4BC1A 2VATA 5IT9A 2PSHA 1MX9A 4UUAA 4WFKA 2GWRA 5B64A 3NOXA 4DOMA 4X1IB 3KS9A 3FDJA 1HG1A 4MPTA 1BROA 3TCNA 4KQGA 3E6AA 4C0BA 1F2TB 3GEIA 1M2NA 3K0HA 3T3IA 1T1EA 1BDIA 1U1GA 2P6RA 1B1CA 5E8JA 4CEHA 2C3PA 1J0AA 4AN0A 4BGUA 2PUDA 1HF3A 1R1DA 1W2WB 1ZR2A 4UVEA 1EXDA 1JI3A 1WXXA 1ESCA 3LQ4A 3R3UA 4YJ2F 4FE7A 3QFFA 3M4ZA 3EDQA 2J6IA 4WGFA 3RSQA 1PL7A 2CVPA 3BL5A 4D44A 3A2LA 3BE6A 3TAHA 4AWXA 2A4MA 3BMCB 4L8WB 2J33A 3N0TA 3UXEA 3W5UA 1A50B 4IS2A 3T5AA 2O2CA 5EJ8A 2P78A 1QK4A 2ZULA 3A3NA 3DDZX 1GNLA 1X1BA 2HK8A 1Q0HA 2FMIA 2JRLA 2UYYA 4KE9A 4ENVA 2OBBA 4KDRA 4BCBA 3OBIA 2JIZA 3DFZA 3X1DA 1SN7A 2XYPA 1Q1NA 5A3VA 4MW1A 1W4ZA 4DGQA 2IH5A 3V8NA 2VHVA 3JARA 3M4YA 4UUPA 1EVQA 3ABOB 3D0QA 3C16C 5EKUA 4JMLA 3UPDA 3P9XA 1RYBA 1YF3A 4CL8A 1MEOA 2O3QA 3T7JA 5AIBA 3WLAA 4G4IA 3FTFA 2PA3A 2I6FA 1NBAA 3AR4A 3TZEA 4WXMA 5IJ9A 5CB4A 1MP0A 3QEBZ 3GT3A 2FPGB 4NDZA 3TRHA 1SCQA 3ORQA 1HNNA 3UC5A 4DQUA 1F0KA 3HXLA 1XFAA 4W7HA 3VPDA 4DY4A 5KVCA 3BRQA 2ZUEA 2ZIVB 5D3ZA 1L7NA 1MA3A 3EODA 3O47A 3C87A 3CLVA 2DERA 2GHTA 4FGZA 1IOZA 3LUKA 4EZIA 1X1QA 3WK4A 1VZ2A 1QU2A 3KL4A 1L5VA 3DB1A 3R8XA 1RQXA 5I8WA 1QF9A 2XZOA 3CUEF 3IDQA 4FSXA 4NP6A 1YASA 2YBEA 4G5QA 5ICCA 1UT8A 4D96A 4E70A 5M04A 1W4AA 1RRPA 1SA0B 1WTCA 3ND6A 1LTQA 3P9YA 4QC2A 4YFYA 2WSMA 2EFDB 5HW0A 1HEUA 4MA5A 2PXXA 1F06A 3KXKA 3L4SO 4X93A 3TD6A 1FJ2A 3PSAA 4YACA 1Z7YA 5H68A 3KSDO 2VSOA 1SCDA 1GPWB 3QUSA 1Q57A 2FSFA 3VR6D 2BUBA 1U7WA 1LBQA 2OBLA 3IJEB 1W88A 1FQKA 2AZMA 2O7QA 2A67A 4WNAB 1Q1BA 2CHQA 3KR0A 4NNPA 2X42A 4YMUA 2NM0A 1CHDA 2DQ4A 5DXJA 3WL7A 3X1XA 1WM1A 2VCEA 2YFQA 1TUGA 1YL6A 4UASA 5E6UA 5JY1A 2OHGA 2ZQYA 1FOEB 1G0OA 4PYQA 1RQNA 1T9ZA 4X1KA 5EXEA 1I2ZA 1W5SA 1GYQA 4PG4A 1NZFA 2IUYA 2WIJA 3DAHA 4GGOA 5H9WA 4F1JA 3RVNA 4Z2AA 4RTLA 3BB4A 3MWGA 1BWPA 4M38A 3GPDG 1E3TA 2CNBA 4LJLA 4Y6PA 3OTWA 3U13A 3AVTA 2HBQA 2V54A 4HDMB 1U2GA 3GBPA 4OI1A 3SS7X 2KHZA 1P1BA 1JH9A 1J24A 1T0PA 1YZKA 3FZEA 3GCDA 3Q2IA 4CR8A 1VLVA 1XPOA 2R62A 1EVYA 2Z8XA 2AF4C 4L50A 1TLLA 1P2BA 3P0EA 3AQ4A 1SXHA 2RHOA 2X40A 3ZHTA 3NAZA 5F51A 5H1YA 4A5OA 2QQ5A 3QU7A 3O3NB 3PPIA 2Q4RA 2ZJ7A 4NG5A 4C43A 1XTSA 1USWA 2P1ZA 4QUEA 2RC6A 1H2BA 5GTDA 1CZRA 5IKEA 2ISQA 5ILQA 4A0RA 1FIUA 1NN5A 5EGNA 1ENPA 2HWKA 1BE8A 3DOOA 1GRQA 1PEDA 4ZHSA 1RJEA 3F3MA 5LQKA 3HCAA 5AI0A 2QTHA 3OWHA 5AVYA 3IQGX 4AKGA 3VPGA 2VQ6A 3RJ9A 3IERA 3PEWA 1F0NA 2O3SA 3DBHB 3P9NA 4QFCA 2BEKA 3NDJA 1FPQA 1YB6A 2W2LA 3FD8A 5EJ7A 5HKBA 2REBA 3A25A 5C35A 1KY3A 3QH4A 1CY8A 4DR2B 4RC9A 2QAIA 3IIJA 2HZBA 4H9GA 1ML4A 4GC5A 4YP0A 1H9BA 2H3EA 4CDRA 4JVNA 1C81A 2VHEA 1NC1A 3QIVA 3WTBA 2ZAGA 4M1YA 4CDGA 3HBMA 4EKYA 3RVMA 2ZB3A 2J7PD 1Q84A 2ZQ5A 3AOEC 3JQ8B 3LFTA 1ZD8A 4FR0A 1L5MA 5DNVA 4EHBA 3A31A 3LIIA 1YE5A 1ZL0A 3FYUB 4JBYA 2EGHA 3FMGA 5A3SA 2HLPA 4QYWA 2BWJA 3IQXA 1VLQA 2J7KA 4QOGA 4QARA 4PNZA 3H1GA 1HGXA 4ACAA 3RS2A 2PEYA 2WK1A 3NEJA 3QW2A 2AOWA 4HDRB 2J45A 3PX3A 3WBJA 1A82A 1FVOA 4ZZIA 1NUPA 4HXFB 1XEXB 2GGSA 2GX6A 3IMEA 4JJ8A 4NHEA 3A14A 3SZOA 3W2TA 3BULA 5FTJA 4LOIA 1XCJA 4PLGA 3G2MA 2PEZA 3ZI7A 4YMGA 4RY8A 2BFCA 2EIXA 3UVEA 1U1DA 3H6KA 2H51A 1JE1A 1SEVA 2J0VA 1CIVA 1KVQA 1Z0IA 1YK0A 3K0BA 4Y2PA 4IJQA 4BE4A 1HQKA 1Y3DE 1R0WA 1JIJA 2JLAA 4NE9A 1PFVA 3H3JA 3KE8A 1WHSB 1PR0A 2EXXA 1RAHA 5KAMA 5LB4A 1QS0B 4M1EA 2FMUA 4F85A 4FDMA 1QOPB 3I76A 3OJ0A 2CD7A 3GGCA 3GRKA 2O3RA 2OYSA 4KXLA 2HF2A 3KZCA 4IHKA 3RM3A 2VTVA 3FCYA 2FLVA 3HLTA 4OHKA 2ZB8A 4RF3A 3U17A 5K09A 1VCMA 2OO5A 3PKIA 1EUYA 4R8VA 3LDGA 2GZRA 4LYJA 2J5XA 2A30A 3HCFA 1JFFB 1RTTA 2X9NA 1WU8A 1AV6A 2ZYRA 1NVKA 3TSOA 4PLTA 3ABRB 2X0EA 2ATEA 2WU4A 4LZZA 5HZHA 1KI1A 1RLJA 1XQVA 4BKRA 3A2NA 4PSDA 1UL1X 1QAQA 4DL9A 4M89A 1EGQA 4IVRA 4XQ9A 1MJGA 3KLMX 3ODGA 4PCLA 5F2EA 5EJEA 1ESZA 1HMPA 4OIFA 1FFAA 2HF8A 3O3OB 5DPMA 4UQLA 4D4KA 1N75A 4IWXA 1JUDA 2K6GA 1Z7GA 4MB6A 4LZAA 1RPTA 3P45A 1F0PA 3TSCA 5F9MA 5CBPB 3F49S 4I3HA 3VU0A 3PGLA 1VOTA 4O4JF 1YKSA 1U7TA 5B3JC 1IJEA 1TJYA 3EFOB 1CY7A 1BKYA 5DHQA 3T9BA 3CX7A 1OD6A 1LC3A 3GZNB 1BVYF 5A4IS 5L4LA 4CXMA 2WIKA 4G0MA 2VNAA 3N5CA 1O95D 5JAOA 4H7KA 2Q4OA 1AO0A 2XNKA 2ZAMA 3ORYA 4R41A 4CM8A 2ON6A 1Q0TA 2RK6A 2I2WA 1NSYA 4L76A 1A5ZA 2GAIA 4EUFA 3DE6X 4KOEC 1X80A 2PX5A 2YL2A 4DV7B 3BKXA 5B6PA 4B7AA 4RKRA 5B5SA 2QI9F 2WAMA 3WR5A 4HAYA 5CDHA 4RVOA 3GCXA 2NGRA 3O8QB 4GX0A 3TLKA 3VYWA 2OM6A 1FMLA 1KFCB 3LY5A 3CWZA 5KOHB 2RGNA 4JLWA 3TRFA 1R8YA 2WAOA 3E61A 4HF7A 3DZBA 4PR0A 2BZ1A 3Q0IA 2PMEA 1CZLA 3I9NA 1W0JD 3MIZA 3TNYA 4Z0NA 2VF2A 1I4EB 3G5TA 1QC5B 3GCWA 3OA0A 2C07A 3L7NA 4NU8X 3AHIA 4OK5A 3AG6A 4K3UA 1EBFA 2E85A 4LC0A 2G9ZA 3ZH2A 1UF9A 2CN1A 4XSVA 1KJYA 3GVCA 4ZQEA 4K2HA 1RYYA 2YXPX 4GXRA 5E9QA 3D3KA 3O38A 4LMPA 5AW3A 1XLWA 4OY3A 1AURA 2KW5A 3HJTA 1TAQA 3H2KA 4GZ3A 3UAYA 3ESDA 3GDWA 3U7RA 3VM6A 4M36A 1D1SA 2PIDA 4IIUA 1GGHA 1T6XA 1ADBA 1P7WA 2OMKA 3D0RA 1SRQA 4GWLA 1UOOA 1O6CA 4N39A 1V3QE 3UT5B 1R9JA 3C6ZA 2DVMA 2APJA 3DUFB 1TJ4A 1PGQA 2WJJA 4KK4A 3GMSA 4LBYA 4DSTA 4B17A 5FPHA 3PQ6A 1TD1A 5FUBA 1XJ5A 2Z95A 3BFVA 3HU2A 4XYMA 5JPDA 4V0RA 1U3UA 3CUYA 4CM7A 2B34A 3TVTA 2MSCB 3WRVA 1U2SA 3OTGA 1JQ3A 1RPJA 3M1LA 4CQMB 4FIZA 4YRAA 4HAIA 1V1RB 4LY3A 5ALKA 3ZGNA 1T9KA 1FTSA 1W6UA 2BZ0A 3C97A 3E7FA 3TPFA 4C7XA 4D74A 2W2VA 2ZXFA 4M8IA 3U1BA 4NBVA 4ZJYA 1MV5A 2H4HA 2PVCA 3ZHBA 4F4UA 3WP0A 5KOJA 2JIRA 3AP1A 1ZK0A 1XSEA 4FNGA 4L0MA 3V55A 1B6RA 2VVTA 1T8SA 3VOTA 4XSGA 4D9EA 3WKEA 2X8JA 3NTVA 4TSKA 2Q07A 4JMPA 4XD7A 1E98A 4PZLA 3KAQA 4EH1A 1SA0A 2BLNA 2N3ZA 2XB6A 1E7QA 4MKXA 3W6NA 4BNUA 5I51A 1A97A 2NTJA 1YZUA 5K0EA 5L3VA 1EFPB 3IQZA 1O97C 1IUKA 1KI4A 4BNGA 2J0EA 2PZMA 4Z7JA 3AUXA 3LLSA 1Y1QA 2VHTA 3L6CA 4RCVA 4JT9A 3WRYA 2O0HA 1LKZA 3EH2A 1Q95A 3MSXA 4CYMA 3VA7A 4IICA 4MCIA 3DR5A 3TEFA 1PQPA 4HWRA 2IY7A 4QTYA 2F55A 2R1TB 4KTTE 1VCIA 2WSSA 1BEEA 4KQEA 4WOBA 4ZQIA 2J9ZB 3SNKA 4W5QA 2IH4A 4J1TA 5LQSA 5IMSA 4J07A 1AHNA 3D7SA 4Z9FA 2JA1A 2W6OA 1X92A 3R40A 3JVUA 3MXTA 1OLSB 3TQIA 3W2GA 5A7GA 4ZCTA 5IPFA 1RKBA 1YCDA 3AB8A 4IOJA 1M2GA 2PKCA 3H8JA 1H1DA 4NMMA 2R87A 1KDYA 4NG4A 3SZMA 4MCAA 3G9TA 1KP2A 2Q1UA 1RWOA 2R4QA 3IJPA 4HDNA 2QN9A 4AJ2A 3OFKA 1LPAB 1ADJA 1XWIA 1YVUA 3L7LA 3AXTA 2PWBA 1K5DA 1O94C 3IDAA 2WZCA 4PC6A 3SX2A 1PYOA 2FW8A 2GYVA 3IT1A 3QX9A 4H59A 3ZGOA 3K1AA 2XXBA 3KELA 1DWOA 1EKXA 3TPCA 4HX5A 2ZTLA 4RH3A 2DUMA 1VJDA 3CT4A 3I39X 4RXTA 4N0MA 4YXWD 5IFLA 1LZLA 1A4RA 4D26A 3EN0A 3G2HA 2IVZA 4CMJA 3ZWXA 1JLMA 3TM5A 4I50F 1UWLA 1KOFA 2DKOA 6Q21A 3NETA 3LCCA 2H2FA 3CLRD 3PHCA 2GDJA 7REQA 1BWRA 2H6EA 3AVUA 1PZGA 2F1KA 1T24A 3FLBA 4MP8A 5E4FA 1XTRA 3HEMA 1LLDA 3QBDA 3SYTA 1WXWA 1Z0UA 3FUVA 5I3CA 3ZE8A 1MAVA 5HQJA 4NS1A 3UV6A 1ZJWA 3GNQA 5F64A 4AUMA 5LMZA 4TKUA 1CUEA 3JAMA 1RYZA 1XZMA 3UM9A 8LDHA 4Q47A 4R1NA 3X1JA 2CSUA 4OB8A 4RJTA 1YIOA 3B3FA 4BB0A 4KJZA 1EX7A 3O74A 1ORTA 4H17A 3RROA 4EFKA 3FKJA 2PQMA 1UPUA 3SVLA 1ADFA 5CM8B 3T5TA 1UBEA 2IEZA 2GCEA 4MXDA 1GZ3A 5CGZA 4JZYA 3JWEA 2OFWA 1GDDA 1VB3A 4BQNA 4WASA 4CKWA 2B92A 1B0AA 1JDZA 2VXOA 5J9FA 4MR9B 1MORA 1MW9X 1E79A 1ZDMA 3F9IA 1J0CA 1QLJA 3H1AA 4OH7A 4XJSA 1XZKA 4ZRDA 4HH1A 4K6FA 5D1NA 3OX2A 4FBLA 3ACBA 2Y0PA 1SXJB 2X19A 3V3TA 5BV7A 4OHFA 4TTQA 2WU8A 1KRWA 4JT2A 4L0DA 2WNHA 3LFHA 2WEKA 4D4JA 2XRMA 1HDCA 4MWEA 5EMJA 4TN5A 4DWJA 2RHRA 4TT3A 1C3VA 1JAXA 1WXQA 2GLUA 1X1CA 2X8AA 2VBFA 3E53A 1T2FA 1C4XA 1R6TA 3B53X 1J2EA 1BKSB 3FW1A 3Q7PA 4A6PA 1NQOA 3H42B 3HLKA 4URUR 3H1TA 3RS0A 3AR8A 1TFUA 4M9ZA 4MKHA 1HYEA 2CUNA 1GT91 1K4YA 5AOCA 3SN6A 2ROQA 4FHCA 3R9KA 1AHHA 1JIIA 3JZDA 5HCNA 1YGYA 1ZI9A 4F2WA 3P0FA 5SY6A 3O2NA 1MJHA 1RWPA 5DHPA 1K5GA 1M9NA 2R1UA 1BZYA 3BKWA 2HQ1A 2ODEA 4HDMA 1E2GA 2JJMA 2OK8A 3R7FA 3CRMA 4IJKA 1RD4A 2VP3A 1G4HA 4TMZA 4M0FA 2JGDB 4RGVA 1FJXA 4QPZA 3O90A 1KYXA 3L0BA 3T0FA 3ND7A 4BCCA 2BGIA 4FXOA 4R81A 2I3BA 5B7PA 4DSAA 2C3UA 1YU6A 4DXAA 4WXHA 1UUFA 4MWSA 4H6XA 5AM2A 3RIGA 3MD0A 3ZBQA 2CFOA 1M8JA 3KUXA 1CZHA 1RI5A 3L07A 3SQMA 1ZXBA 2AXPA 3HG7A 1DVRA 1ZM2A 3A2MA 4RTSA 1SKUA 2HSWA 5B3JA 1Q50A 4M49A 4X44A 5LZ4A 5B4UA 3TFWA 3PF8A 2HHLA 4ABYA 4X62B 1HDYA 1PD0A 1G63A 2WB4A 5J3JA 1PVVA 1EP9A 1K7CA 1SEPA 2RHHA 2E1RA 2G1AA 4DV6B 2FWRA 3K2QA 4YUYA 3QEOA 2Z2IA 1J0XO 2OFPA 4DSNA 3PQ4A 1UPTA 1LQ2A 2I4RA 2ZWVA 1R8JA 3I1YA 1VLHA 3G9ZA 3C3JA 1OPXA 1PJRA 3CV3A 2FP3A 1PR3A 3DAPA 1L5QA 1LDYA 5IJ9B 1RCFA 2GWHA 2OCGA 4FGSA 5JZSA 1F48A 3LXRA 4XWWA 1NNEA 1PKXA 1QXSA 1KYVA 1FFYA 5K4HA 1FNNA 1IN8A 1QHEA 2C8JA 2AW3A 2HLDA 1UBMS 4RF4A 2GARA 1Z2OX 1JHPA 4P82A 4P38A 4DRYA 1OI4A 2XIJA 4AJ1A 1AKRA 2HSJA 3PZRA 4L95C 2Q3CA 2QL5A 2R5NA 4BO0A 3MK31 4JENA 4PNHA 5BYKA 1XDBA 5FWDA 5BQ5A 3V34A 5JCJD 5KTMA 4OXXA 1BH2A 4WKPA 4HWOA 4DR3B 2OCDA 2ZBFA 1Z0SA 4N76A 3JWJA 3T9EA 3ZIUA 2O8EA 1P5HA 3GXOA 1DAEA 1GNPA 5EWJB 4GLJA 3TVYA 3PYXA 4QYIB 4Z0HO 2HADA 1XDSA 1XNHA 1PR9A 1GUDA 2WHRA 2FOXA 2FF5A 4HGPA 3IUMA 4RYDA 2CLHB 3VPHA 3HCBA 5AKXA 3THWA 3QPBA 3TEMA 1KYZA 2P79A 4UQOA 5AHRA 1FP2A 2CBGA 4Q19A 3PB3A 1SZPA 4F92B 5AW2A 4FQ5A 4RKEA 1Y5RA 4Z7QB 5FI1B 2VWHA 3DLIA 4XVHA 4DMHA 3VH2A 3DLBA 2I9PA 2WJYA 4PNEA 4IHJB 1PZHA 3QTBA 3QYFA 4HLDA 5L6LB 1E2IA 2I2CA 3IALA 5DI9A 2ZWAA 3H9EO 1CQWA 4LTDA 3UJ7A 1JR3A 4F91B 2YCBA 4BNYA 1I6LA 4EGJA 5KNCH 3B2NA 2A86A 4OFWA 4WZ6A 2AKYA 1FVFA 2WD8A 2YWFA 1D0VA 1YQWA 5GQSA 2OQRA 1M76A 3ZR4B 5CB6A 4B1FA 1V3TA 2I4MA 2QSUA 2I87A 4RA6B 5CD9A 1CUGA 3GHYA 3QGMA 5EXPA 4FJ0A 5FO1A 4ZI7B 1LBEA 4U7DA 2NTVA 4NMWA 4JI0B 3CH4B 2JDIA 5BN4A 5CAEA 3GHHA 4DCSA 1XLTA 3C14C 2DHQA 1UOEA 2ZZKA 2AN1A 2BMVA 3K9LA 4H1VA 3DQQA 4JYBA 5EMHA 3DL4A 5IP5A 5C37A 2C2BA 3FM9A 3DUWA 2HWUA 5JMWA 4TXLA 1ZICA 1Y5LA 3GEEA 5H16A 3FE2A 3FVQA 2OVFA 2W42A 1P3JA 1Q7GA 1Y82A 3PC7A 1G3QA 4KQ1A 2BRUA 1P77A 4WDQA 4M8LA 4DZTA 1P1CA 3DBIA 2FSUA 4YRZA 1N2GA 4NAUA 3GGPA 1L8XA 2FFHA 2OV8A 3EW7A 1KE2A 3RVLA 3DNFA 3DV0B 2B4TO 4OSOA 3VR3D 2D59A 3W4KA 3IYLW 4UTRA 1I2BA 1FNDA 1GWNA 4RL6A 2VN8A 1S7CA 1GTJ1 5DTIA 3S8EA 1IK6A 1N1GA 4G36A 4LHWA 4K0KB 2VUIB 4PF1A 4PGFA 2FV8A 4KIGA 4EW2A 2PKWA 4GQAA 1KFEB 1XHFA 2QTNA 1KS2A 4KAAA 5D3KA 1T0JB 1M2FA 1DFGA 1TA9A 2HZ7A 2GXQA 5C1OA 1J2YA 1ODLA 1G17A 2AB0A 3T5BA 3R4VA 2AZXA 5F5XA 2Q5CA 3ZWPA 4FFRA 3EUEA 4ZT4A 4CCYA 9LDBA 1RXYA 1EEXB 3KLBA 2YVLA 4QGBA 1U9IC 2IOFA 4IUBS 1R0SA 4B3JA 4ZAWA 3UUWA 5DEIA 1Z3IX 4BP8A 3TAUA 3R5SA 3I0NA 2H9AA 2IHKA 4G65A 4TXHA 2GA8A 1X94A 4IINA 3GT4A 3IHKA 3ORHA 2CVQA 4K88A 3Q3IA 4V03A 3KHUA 4Q9LA 2YVAA 4Y1FA 3E27A 1GUBA 1EVLA 3LYHA 3QE4A 4A4DA 1JR4A 4FUTA 1JAIA 1SCKA 2C4WA 4KVFA 1Z88A 4OP2A 5T4FA 1LSOA 3TL6A 4B6RA 4EATA 3EGIA 1JH8A 2GSDA 1CQJB 1TF2A 1UFOA 5C46F 4J0DA 3LOUA 4WN9A 2I03A 1SVNA 1DRJA 2NT4A 5DKFA 4BO4A 1L4LA 1RS0A 4XR9A 3NP9A 4XTCS 3M4NA 4B7XA 1JDBB 1JZTA 1OVMA 2FFBA 3AJEA 3GD7A 1N9KA 3K92A 4IX1A 4L8GA 1X3SA 5EIAA 3TO5A 2CV2A 1FUEA 4G5RA 2NX2A 4U6NA 3ENVA 1CPYA 1NJFA 3CKMA 1JL3A 3E9RA 3K1JA 3T7SA 1AJEA 2IPLA 4K8RB 1VPTA 4OP1A 2W8BB 2WZBA 1F9AA 3FPSA 5JSHA 3GLHE 4QEZA 1T6YA 2EF0A 3KHKA 1WMAA 3R24A 1AVTA 4ZOLA 4F8YA 4JZKA 3IP5A 1T9DA 2AJTA 3D8NA 3H4TA 3PPXA 3RSLA 2CCKA 3NIFB 1BGVA 2HRCA 1L1FA 5IM4A 5ANRB 1CB7A 4HQFA 2W6NA 4FMPA 4YAJA 3V3KA 4BQPA 3PI6A 3L9WA 2WWWA 1AM4D 1Q5PA 2SECE 3P1JA 4JROA 4QHYA 4XQ0A 2P7HA 4G6ZA 3NAGA 5A5EA 3WYEA 2MSDB 3Q1LA 1W49A 2H5LA 3GD5A 3KIPA 3PHJA 2XQJA 4NBKA 4XD2A 2Z1MA 3RHFA 1Z6TA 1ZVJA 3H65A 3REQA 4R05A 3CMMA 3HB5X 1KEWA 1NLFA 4BB6A 3WMEA 3PTZA 1KA9H 3D6FA 5IJWA 4RK6A 4Q7LA 2ZPUA 1TZ2A 4U6QA 4AJ9A 4G1CA 3AH8A 3IURA 4MRVA 2WVGA 3PQFA 2F3TA 1ESNA 2CVZA 2JCXA 4HAZA 1NULA 2WPDA 3CJRA 1XRRA 4N3BA 3TQOA 3FG9A 2DBQA 4OQFA 3SQLA 1U0GA 1YULA 3KL2A 4BWGA 4RTPA 5BYJA 2MMCA 2GTHA 4W4TA 1RIFA 4M8NE 4WOKA 1RMYA 2QB5A 3IGFA 3TBFA 1JALA 4NRDA 4K1LA 4DV0B 1QOQB 3CQ9A 4UDNA 1GRVA 3WJ2A 1VJ0A 3G8AA 3N2GA 3TX2A 4JI7B 1RMTA 4Z53A 5CBKA 1RLIA 2Q2WA 1W5BA 5AI5A 5A9TA 1AQIA 1XOIA 3DVSX 4OJTA 4BLPA 1AQNA 4HI0E 2C42A 1WQ3A 4P2BA 2H5IA 3T41A 1O6BA 4G9EA 3P7MA 4DW8A 3VV2A 3ZK9A 2FF7A 4QNRA 1H0HA 1AS3A 5DM2A 1XGKA 3WV4A 2ERCA 3AY0A 1OREA 3A6GA 2V7QD 4LHVA 1A8HA 2DAPA 2WUVA 3Q7EA 3QVWA 4ZYTA 4P7GA 3A4IA 3JQ7A 2GEKA 3QQ5A 4JY7A 4PG5A 3ZX5A 3F7NA 1NG9A 3V8MA 1GA4A 1RLOA 4EO9A 2HFKA 3BHIA 2GD0A 5EAIA 4IO0A 4YJKA 1QTIA 5ER9A 4A15A 4C4RA 2C97A 2J3IA 2FZKA 3I5MA 2HYIC 3CSUA 3IMFA 4TS4A 3ZBPA 3CLUC 2YWBA 4UAUA 4XARA 5EQJB 4MYSA 3ZIDA 5A7HA 5JW6A 1DUVG 4FCCA 1XP5A 4MS1A 3UTCA 1BDMA 5KQGA 1RI1A 1QGED 1VPEA 1AQUA 1B6SA 1J70A 3LFUA 3QXJA 4KN5A 4LVUA 4CMBA 2DPLA 3HEBA 1JA9A 4F7WA 3RBVA 5HX7A 4BE9A 4H7HA 4JJGA 3AI1A 4MQ5A 4RVNA 4IIJF 5L3RA 4EF4A 2VUHB 1JWLA 4QGGA 1ULSA 3DEJA 4FLMA 1OZHA 5FA8A 4JKYA 1C30B 3X1KA 5J43A 4V2UA 1WDWB 2AW5A 1V43A 2UYCA 1UBSB 2O8FA 4ZT3A 3W9YA 3EIFA 2QYTA 3LNTA 3TINA 4DNXA 5TS3A 3ZDBA 1SG9A 4BV3A 4QAQA 3WKBA 2D74A 1RM5A 5BN1A 2QJRA 4P3XA 3M6WA 5E3IA 2BGUA 4Q3KA 5HE8A 5T6BA 5A6SA 5IXSA 1N2CA 2JFNA 4DFDA 5C81A 3CC8A 2NO6A 1FFHA 1U8FO 2F1OA 3O8LA 5DGHA 4I1RA 3S0JA 4E07A 3BDAA 1A9PA 1XU4A 1Z4OA 2J9RA 4YRSA 3BM5A 1W1WA 3MWKA 4UMEA 5HRCA 1UC5B 1TZJA 3OURA 5CK4A 2RI6A 4MVWA 5FBQB 4LDRA 4D80A 1W52X 2YOFA 1ZFNA 4AUEA 3VU9A 2R6ZA 3BX1A 3NGMA 4BVGA 4B3IA 3G2PA 3LY7A 3SQDA 3SEQA 2OAP1 3I6MA 3L46A 1UDWA 4HK4A 1QQAA 1KH2A 2DJIA 1U2QA 3EVZA 1U8ZA 3B20A 3T35A 3IH5A 4RULA 1N32B 3VPBA 4AXXA 3KDAA 2GSWA 1V45E 1BA2A 2RCYA 3UJAA 4QUKA 5IXYA 3GRUA 3LPNA 5AM0A 4EHLA 1T3TA 1BCSA 2YC2C 4ZAXA 4K81B 3LUBA 1P5RA 2ZU0C 4B33A 1P0IA 3ZY4A 4AULA 4S1TA 4JBGA 1OR8A 5EZQA 2IU3A 3VYRB 5ENVA 1H6CA 3CN7A 3ETJA 2Z2KA 1OV4A 2NNWB 2D7DA 2DWOA 5J63A 2G1PA 1PUXA 2V7PA 3QXCA 1KU0A 1ZK3A 5E6SA 1GNVA 4OHBA 4HH3C 4EP1A 1ZSNA 2NUBA 1SUDA 2ZE6A 4WMLA 2AD1A 1TYCA 2EEZA 4XGKA 1G16A 3JWPA 3P2JA 3RRMA 4DY6A 1I30A 4OHUA 2QROA 3GLGB 2PRIA 4DPKA 1E6LA 1ISGA 3M8KA 3EXIA 3OP1A 1YVPA 2O2EA 1B8VA 1Z4KA 2Q1SA 3UC9A 3RS7A 3LPAA 1LF0A 4U4AA 1SBHA 1BMQA 3OFND 5K5EA 1GVNB 3HV2A 3ZJVA 1ZNZA 4KPYA 4D9IA 4ZO8A 3FSGD 5T8KC 3VI4B 3DWGA 5HUHA 2WMNB 3UMJA 1QG0A 2XNDD 2DQSA 3ANMA 4ITVA 1Y3CE 4Q3DA 1TJ5A 4D56A 3V1NA 1WW8A 2GPAA 4K9NA 3RFXA 1WVIA 4QDKA 4LV6A 2PMFA 3EZGA 4PM4A 2Y71A 4QNMA 4WSOA 3O8RA 3DPIA 4PAMA 1AKYA 1KPHA 4JP2A 5A9SA 2BH9A 3G79A 2ZRAA 1QIDA 3KYCB 3Q1KA 3RC9A 3ZCSA 6NULA 3OEYA 4IQFA 5DH9A 1OASA 1C7QA 4HMQA 3TUIC 5FBKA 2BFFA 1I36A 1LNQA 1E7YA 3NOQA 4KUGA 5GJWC 1VHJA 2P0AA 2M1XA 4X94A 3NORA 4JQOA 4MKRA 2O8EB 5L4SA 4E15A 3EFBA 5LD2C 4DB2A 4G2TA 2X8BA 1MENA 5SZJA 2IQ5A 4QIHA 1NMYA 1OTYA 5KX5F 3V8QA 4ZOAA 4URVR 1Q22A 3FYUA 5B1HA 1GYPA 3SJAA 4KSBA 3SSMA 1XEWY 1A2KC 1WIWA 1L4FA 4LNHA 2Q5EA 2QJWA 3A1VA 2WDZA 4GSKA 2J0UB 3ZXUB 4BXOB 1GLVA 1ODFA 3KZVA 4MVJI 4MV1A 3W8DA 1C1YA 3EWNA 4YVFA 3SZ3A 1A4XA 1JSXA 1DRVA 2HQRA 4IIVA 4TM7A 3OQPA 4LIPD 4WZAA 1OXUA 4BS9A 4ZEXA 4YT8A 3RG2A 1CUCA 5GINE 4TXJA 2VJQA 2X6QA 3GCZA 4NFYA 4L4ZA 6ABPA 1KK2A 1LLQA 5DGDA 2Q49A 5HBRA 5H7XA 3GLFB 1IN6A 3RT1A 1LSJA 4DJDC 3ZD6A 3S4YA 3THXA 4JKIA 4WJKB 1LBHA 1TM5E 1U9JA 1X70A 3FMVA 2H17A 8AT1A 3OCJA 4J43A 5DNCA 1CZUA 3D2AA 2WIAA 3FFBA 3DEZA 5F77A 3I8OA 4IFTA 3RVPA 5A4KA 4GDFA 1CUWA 4NH4A 4OLHA 4XCQA 2I3AA 2W71A 3WGKA 3TN7A 3H7IA 1ZNQO 3IB3A 2EKBA 1QKJA 1WDKA 2NSLA 2V7EA 4KFSA 3A9VA 5FBWB 5FWAA 2IZ7A 1CRWG 1L7EA 4EELA 4CKCB 2Q3FA 3NHJA 3BJEA 2ZT8A 1PZXA 2WJ6A 4KO8A 5DT9A 3ER6A 5MFPA 4YCNA 1MB3A 3IUQA 5C7IO 4X61A 2Y9PB 4BVAA 1TL7C 4EJ0A 4MS3A 4BN4A 2ZI6A 4FONA 3WZ2A 2ZJYA 4AMZA 3K05A 3CB2A 5E4TA 2QJTA 3WIBA 1M1ZA 3RGWS 4PYNA 4XJTA 3ADBA 2BFPA 4PYKA 5BUQA 5I6DA 1W9HA 4Q12A 2FQYA 3WWEA 2G9RA 1S0UA 3JQQA 3FUXA 2Y76A 3UKDA 3U4DA 4KRFA 2O05A 3SHVA 5JSKA 1BEUB 1JLHA 2QUAA 4YJ2A 3BH7A 3DXXA 4W1RA 4J1TC 4U7FA 4JVLA 3IQFA 1VGQA 5JFTA 1W4LA 4LJ7A 2BSXA 2L17A 5AJUA 4BC0A 3EX7C 1EE9A 2N9UA 2R0QC 1Z8NA 2EJTA 3Q8MA 4ECEA 2IIVA 3NT5A 2VUUA 5JUWA 3F3YA 1OBOA 1FLDA 3AJDA 4FIDA 3DFUA 2NU6B 5JVDA 2YV1A 5D2CA 2P9GA 4CGYA 3EQ7A 2DWUA 5CNIA 3H0CA 4CM8B 2FG6C 2XAAA 4AN4A 3HFJA 3M70A 4V0SA 4KQKA 2FPIB 2Z58A 3K2IA 1U8UA 1QO7A 2XEXA 4MJ3A 3R3HA 2G1UA 4LF8B 1JHRA 1ZM7A 3PITA 4DCUA 1B8PA 2IYRA 2Z43A 2BELA 3OIVA 4HR7A 5DW3A 4LGCA 3OMLA 3WHIA 2R65A 4UBJA 4JI4B 2LKCA 5J40A 1E8NA 3ACDA 4YI3A 5I48A 3LHIA 1POXA 3IAXA 1L7OA 2JPDA 4LQCA 4U9IS 2F1IA 1AE1A 3VH3A 1E66A 4XEHA 5I8ZA 2QM3A 1AUOA 3KUDA 2NO0A 4J0QA 3QVKA 3L7JA 4LSZA 4N7JA 3RYTC 2DFLA 1T43A 1NBOA 2G6BA 4P81A 1JIXA 1CUJA 2OV6A 3S3TA 5JATA 1T25A 4YN3A 1OH5A 1QYCA 2C00A 2PUWA 3GJ0A 1D8TA 4UD2A 4J0HA 2WWGA 4Q9IA 1ZK2A 3EUFA 2EERA 2ZJ0A 1UZLA 3EDOA 1ZS9A 3VC3A 5BUCA 4XRGA 1SAYA 5CDSA 2FFJA 3JQ6A 3OLYA 1UKVY 1KF0A 1JB9A 1DRWA 4PGGA 5T8KA 5GONA 4S1WA 4HZUB 4Q9DA 3ITKA 1YS2X 1QZXA 5K0TA 3RIMA 1QYDA 1ZITA 1YBMA 3ONFA 1VTKA 1GGVA 1ECBA 1RWQA 1TC2A 4GLFA 4MGEA 5CT9A 2WWVD 4E31A 3S1LA 2K2WA 2XWPA 3DE5X 3FA2A 3DBVO 3G2KA 2BL4A 4YRCA 3TCKA 3VR5H 2X13A 4URHA 3HUUA 2ZYDA 5BMVF 2FN7A 2W4MA 3LC7O 4JHXA 4MWZA 3T4PA 4C7OB 3PTAA 2DFNA 4CUZA 4CKEB 2IDJA 2YRFA 4ZYZA 2R8PA 2IUUA 3QUCA 3KFXA 2R8OA 1R0RE 4PPGA 3JAKA 3NR2A 2G71A 2PJDA 2X4LA 1E9FA 4XX0A 1TF7A 5DGXA 2GBLA 2DLDA 1TTPB 3ESCA 3EA4A 3QTTA 3QK7A 2V5VA 3E8SA 4BVFA 5IAAA 2D0IA 5LKRA 1H85A 4JEMA 5A04A 3JRXA 2UV8A 2E48A 4P1ZA 1IK4A 2JAPA 5G4LA 1NW5A 5AI9A 1X15A 1EGHA 3M5PA 4PHGA 1JQLB 1WS6A 2QKYA 2I7VA 2CHGA 3MLEA 1LLFA 1P5JA 2Q45A 5HFJA 5KQSA 3MTAA 4NOJA 4KAFA 4KXXA 2IRWA 4V02A 1XJ0A 2D5CA 3U0BA 5CDTA 1TQDA 1O6GA 1T6BY 3GZJA 5BP7A 3B1FA 2FCAA 3DEKA 2V9CA 2ZBEA 3WQHA 3TNFA 1UKCA 1W35A 4LMRA 5KBYA 2JFHA 2O8DA 4DM3A 1AB5A 1Z7WA 3TTTA 4EY6A 1WXEA 4M7RA 3OEHD 2JCSA 4D4GA 1DX9A 3FMOB 3NAMA 4URWR 2ZANA 3D9QX 4LXHA 2R3SA 3D8UA 3SXJA 1OUMA 3HU1A 3FVTA 4PFQA 4UEWA 3W5IA 5EIXA 3QG1A 1I32A 3VKHA 1YR8A 1M34A 4UHKA 5CVCA 1SULA 3HP1A 4J16A 5CM9C 3NWEA 3NOVA 4Y2XA 2VNIA 1D2EA 1WCXA 4EMSA 2WFZA 3PG5A 4JOSA 3RWBA 3UIEA 2BN4A 2C1XA 3H7AA 5LA6B 3MRTA 2Q1WA 2B9VA 2R2GA 2EARA 4LDNA 4XE5A 5LQUA 5JI2E 4QBFA 1AGYA 1L9KA 2IUSA 5F3RA 3VR6A 4ZANA 4OG2A 3UCEA 1PX0A 3J81k 3JYHA 2NACA 1E0DA 4L4XA 4YJFB 4BJ5A 1ZJ4A 5HF6A 5G02A 5P21A 2VHJA 3TLMA 1DV1A 1N0IA 1RAGA 2AE1A 1Z6YA 1F2DA 2FZCA 4QODA 2WWYA 3Q10A 1N6HA 3U7EB 4LK3A 3ZBUA 1Y5MA 1UBTS 4GBJA 4QUAA 2Y77A 2PKXA 4EBBA 5EHXA 3FR8A 3PIDA 3WL6A 3UYLA 2QZSA 5EXDA 3EW9A 3UGKA 1DAGA 2NO5A 3DCJA 1DIAA 1QZTA 3ZV6A 1KO8A 4MP3A 4RD2A 3VDRA 1JILA 2TMDA 4PRLA 1PJBA 3AO0B 1EINA 5F33A 1XZPA 1RMQA 1T4CB 2RGUA 4G3XA 2M32A 3MBKA 1FTQA 3T5DA 2HK6A 4LFAB 2C3MA 2GJ8A 2R1ZA 3IPCA 1CZNA 2C03A 3E7DA 4II2A 4LXGA 3VR2A 5ICEA 1ZQ9A 4CF7A 1SOUA 4F5YA 4P35A 3LVBA 1Y6FA 3WZMA 4RCYA 1MMFB 1SU8A 5ETJA 4TTSA 1E9CA 3ESQA 4HAOA 2H29A 3ROTA 4CQLB 2JKZA 3A9UA 2C5LA 3HA7A 4FWBA 4QAJA 4BMPB 4M1QA 3P9PA 5JAZA 3CF6R 5B2EA 2EW1A 1G5TA 5BMVB 5IABA 3K35A 1CUDA 3KVNA 4L5IA 1EDOA 2YJGA 1ZA2A 3H86A 1XCOA 5ALUA 2PJZA 3SM3A 3LG2A 4DR4B 3SBXA 1UDXA 3LW7A 4JXXA 1XXLA 1WB4A 3SC4A 1VKZA 2QW8A 1YVEI 4C0LA 3TMYA 1U2RA 3SKYA 1I3MA 3ZTTA 3N07A 3T1VA 1PZMA 3TSAA 1NLUA 5H82A 3PEVA 1A9ZA 2IZ1A 3P0RA 4MS4A 2C4NA 2QRJA 4WKBA 1U28A 3GLTA 2BFEA 5K6TA 1R88A 2AN5A 2VDPB 1K8RA 1ODCA 4MEAA 2QLMA 3U4AA 4B83A 2BKXA 3B6EA 3C3PA 1KU6A 1G6KA 4WLOA 5GPBA 2HCFA 2HCTA 3LYLA 1HORA 4MV6A 4E5NA 3B7WA 4AY3A 3V7UA 1XTKA 2W83A 3KE9A 5KYGA 4ASUD 3CSSA 3BREA 4B3TB 3R5JA 1SCIA 2D5LA 4MIYA 5D8DA 5KTYA 3UWPA 1R9NA 1IPFA 5DBIA 4MRNA 2Q9AA 1L4MA 3QYPA 1GPMA 2YXEA 1P9OA 3C1TA 1NW4A 4XOUA 3A1EA 2CJXA 1HRKA 3EA0A 1H69A 3E5RA 1P80A 2YV2A 2O5EA 1Q0QA 3CNLA 1GRCA 1XJQA 5JMPA 2I99A 1IC6A 3NCHA 4P3OA 1G5HA 3SR4A 2H7VA 4QXOA 3O92A 3PXBA 2WVJA 5F1YA 5FORA 2IHBA 2EP7A 3O1HB 4B2YA 5L95A 1CVRA 5C80A 3RJ5A 3IQDB 1V41E 4XD7D 4E2FA 5CVEA 2YYYA 4RIEA 2GR9A 4ZVMA 1UM9A 1DJLA 3ASUA 4NONA 1KOJA 3LBHA 2G7MC 1AK2A 4UVHA 3MGAA 4MRMA 3BXEA 4BNZA 1WUHS 2A9FA 4J0CA 5BOSA 1C7RA 1HE8B 3QWIA 3U7GA 3IOCA 1CULC 1NUQA 1J25A 4B0PA 4F8JA 1B8NA 1NA5A 1UH5A 3Q85A 2WNSA 4J0EA 2YN2A 1K0UA 4MAFA 1ZCZA 3C41J 4KXUA 2V9ZA 3EVFA 3DZCA 2AHRA 3F67A 2FWAA 4GGPA 4LE0A 3IRUA 4S12A 5DWDA 3S40A 2OORC 1NQTA 4JKOA 3CPEA 1BYUA 3BSSA 5DXFA 2Z1NA 3N2KB 3N05A 4KJXA 3ZWCA 1TFRA 4HEHA 4REOA 2VEDA 4B09A 4QVIA 2V6FA 3E3OA 3USZA 3MJRA 4D98A 2J59A 3W5BA 5K1ZA 1B6TA 4H3VA 2A57A 1YBFA 1SOAA 5ALJA 2XMZA 1FQWA 4QVKA 3G6KA 2RD2A 5TXGA 1UMDA 4HGYA 2QG9A 3JQGB 4QYIA 4B6SA 4QPCA 1L8AA 2ZSEA 3L92A 3KXDA 1LDEA 2O8CA 4RZ3A 5IUNC 3IVCA 3PA6A 5IXJA 4YFVA 3F5MA 5H3CA 5KVQA 3ZVLA 3K70B 3G89A 2PH5A 3AB7A 4I2NA 1EUCA 3JV7A 1Z45A 4KNWA 1Y81A 5BNWA 1WZIA 4GKVA 1BHSA 1O94A 1Y5IA 3SF8A 4MYDA 1A77A 1L7XA 4TQUS 1NBMD 4V3CA 5BO5A 1HR0B 4XJVA 4RKWA 3VGJA 2ZU6A 3HL4A 1X7YA 4LMAA 1P4HA 4IDEA 3WL4A 4HGQA 1NIJA 2RG1A 4JC8A 1FRZA 2O57A 3MA0A 3T7CA 3W8EA 2W5UA 5GY7A 4LI0A 3AYXB 3JTMA 2FWIA 1I5RA 4UZEA 2I4OA 4M98A 1E3JA 1S2NA 1N6RA 4JEIA 4AKEA 1ZMTA 2XB2A 1MB9A 2XCRB 4MAAA 2WYOA 4B32A 5CB8A 3W34A 4D0RA 1F6DA 2F3PA 5HIKA 1Y8AA 3OSZA 2P2DA 1XF9A 3VKVA 3HWX1 1Y7HA 1XZBA 1F7UA 5AK6A 4TVBA 4A2PA 1YE3A 2Q6KA 2ANBA 2PFGA 5HEKA 1FMTA 1D6NA 1JIQA 1VSVA 4HG2A 2GASA 1EFKA 2QK4A 1YD7A 3Q2KA 3K4PA 1IN1A 2AQ8A 4Y9TA 3BWCA 2B7CA 4ICIA 4BEWA 1Y3IA 2BBSA 3BJIC 4A2CA 1RDFA 4EI9A 1WLSA 1EWYA 1S8FA 1UKZA 2QD4A 2JI9A 1E3WA 5THXA 4AY6A 1TT5B 3I9KA 2RHTA 4NV3A 1TVCA 4UU1A 2B0JA 1ESMA 1JBQA 2Y1GA 3GUZA 3KCQA 3MBIA 4MVJA 3EWIA 5I9TA 5LZ8A 3VISA 1D04A 1XTQA 1FXSA 3NTLA 5CDUA 4PNPA 2C4MA 3MTEA 2CDCA 2WJAA 3I09A