1E6LA

Two-component signal transduction system d13a mutant of chey
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
127
Chain Sequence
DKELKFLVVDAFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Towards Understanding a Molecular Switch Mechanism: Thermodynamic and Crystallographic Studies of the Signal Transduction Protein Chey
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e6lA00
1FFWA 3Q7SA 3I09A 3I5AA 3QX8A 4RWEA 1F51E 1Z2DA 1NXWA 2A9OA 2NZVG 2R47A 4JASB 4MQEA 4KZKA 3T38A 5JNTA 3QEMA 3FFXA 4YLEA 4KMRA 4Q6WA 3C3MA 2YHBA 3RVNA 1BAPA 1YS6A 2H3HA 2QU7A 2E4UA 3QLVA 4KV7A 4YO7A 2NUBA 5DKFA 2FQYA 3QX9A 3CRNA 4MS4A 3GBPA 2RDMA 4JAVC 3HDVA 3LMKA 2ID9A 3KYIB 3DBIA 2M1ZA 4G97A 2LBPA 4NICA 3CHYA 3Q41A 4Z4GA 2QXYA 1DJMA 4W5RA 4Y9TA 3MYYA 4MR7B 4MR9B 4RK0A 4NCAA 3P9YA 5DGCA 3RVRA 2QVCA 1DBPA 3FFTA 3QLUC 1M5UA 2I6FA 3O1JC 3EODA 1JX6A 3H1EA 4PE5B 2FN8A 3LUGA 2PLNA 3RVMA 3IP9A 4YR7A 2MSWA 4RXMA 3SM9A 3OO1A 2WB4A 3C97A 3F6CA 2JBAB 1SRRA 2E4VA 1Z13A 3HEBA 1M2FA 1Z2EA 3KLNA 5TE9A 2VUHB 1L5ZA 4O5AA 1DCKA 3OLXA 1YVUA 2ZAYA 5EWMA 4KPYA 3FGZA 2JB9A 3O2JA 2FMFA 2FLKA 1JLKA 3IPCA 4OBBA 5T3YA 2HJ9A 3HSYA 4QICA 5TPWA 1P6UA 2Q5CA 1JHZA 4UHKA 3H5IA 3LKBA 1DRKA 3RVOA 1QO0D 1JFTA 1TJYA 5CNIA 3EQZA 4OATA 2FMHA 1QO0A 4PYRA 4WZZA 3HUTA 3H6HA 4Z4IA 4LE0A 4ZJPA 4DN6A 1SD5A 4Z4CA 1JFSA 2QV0A 5KC9A 3IP7A 1URPA 1PEYA 4H3HB 4EVSA 2WJAA 5EWLA 2MYTA 3TO5A 1PNRA 1JL3A 4M88A 3T8YA 3HXMA 3KLOA 2BGGA 4MR8A 3ROFA 2JVJA 4WXMA 2P9HA 4RXUA 4B09A 3URMA 4KRFA 4MGEA 3RVSA 2MYUA 1NXXA 1A2OA 2HSGA 1GCAA 4GNRA 5IUJC 7ABPA 3C3WA 5CNJA 1U8TA 4RK5A 4Z9BA 4QPJC 4H60A 3OLZA 2FTKE 2XDYA 4KFCA 4MS4B 1AB6A 5TQ2A 3OQMA 3CLKA 1QP7A 4WWHA 1DCFA 1EWVA 1QP0A 1ZGZA 2L19A 4JP1A 4H3KB 1PHRA 3ROTA 4RK1A 4G0YA 4F3TA 1SXHA 1A0OA 1QNLA 2IPAB 5JNWA 3RVQA 2FMKA 1RXEA 3EJWA 1RNLA 1QKKA 2AYXA 3Q9SA 1ZHHA 4MRMA 3E3MA 4Q6BA 2FKAA 4ZMSA 5KWSA 2FLWA 1FFGA 3BREA 3GL9A 3I45A 6CHYA 2F8TA 1Z18A 4PEVA 1OXKB 2FVYA 2CWDA 2M98A 5TQ0B 1S8NA 4RY0A 1BA2A 4N41A 1JFVA 5EWMB 2QR3A 3FFWA 3JPWA 5CNKA 4G0QA 1ABEA 1RZRA 2IYNA 3DLBA 5TPWB 1D2AA 1M2EA 3N75A 4Z4FA 4N03A 5GQSA 3M6MD 2MSLA 4W5TA 3MM4A 4KREA 5GOTA 4OLAA 1MAVA 1I3CA 4F8JA 2IOYA 1ABFA 4LE2A 3B2NA 3SAJA 4YP9A 2A9RA 2E4YA 1J56A 3HS3A 1WETA 1EAYA 1YTUA 3MF4A 1K66A 3Q7RA 1LBIA 1FFSA 2L18A 3OLWA 2R25B 3H6GA 4S04A 1DRJA 2GWRA 1NTRA 1ZY2A 4MR8B 5FBHA 5KQGA 1ZITA 3H1GA 4OG2A 1RXIA 4ZYLA 1A04A 3I42A 1ZAYA 5HSGA 1NXOA 3BRQA 1Z26A 2HPHA 3GA5A 2TMYA 4E7OA 1NATA 3CZ5A 1NXTA 2FQXA 5B3JA 3A0RB 3UK0A 5KC8A 3RVPA 1ISSA 4EVRA 1W25A 2A9QA 4ZMRA 2MYNA 1ISRA 3LUFA 4RV5A 3O1IC 3LUCA 3EDCA 4PICA 1M5TA 3F7NA 5KQLA 5HQJA 4W5NA 1LJUA 4RK4A 2E4WA 2B1JA 4XAQA 5FBKA 1GUBA 2GX6A 4QYMA 2F8SA 5T7BA 2IKSA 3N0XA 4P1ZA 3W9SA 4G0MA 5DTEA 3O2QB 4HNQA 4IMJB 4CBVA 2LPMA 5KQMA 2MSKA 1NXPA 4EUKA 4XLTA 2X7XA 5I4CA 4WT7A 3H5OA 1TMYA 3EGCA 3JVIA 3RVLA 3KYJB 4MRMB 4IMIB 3NBMA 4N76A 3GYBA 3QLVC 4Q7EA 2WWVD 1GLGA 1XHFA 2WY2D 4ETMA 4RSMA 4IGAA 3LUHA 4TLMB 3CS3A 4MQFB 3ILHA 2NZUG 5CNMA 3RH0A 2PUDA 4GPAA 3TMYA 1BDIA 3IDOA 3GWGA 1ZESA 4HNRA 4KQCA 2WRZA 3F73A 5FWYA 5TPZA 3JY6A 3G1WA 2CHFA 4KK4A 2JK1A 4Z9AA 1TLFA 2VUIB 3L49A 5FWXA 3T95A 1ZH2A 4RS3A 3EQ2A 1YS7A 4P98A 1EWTA 3CG4A 3VNBA 4FB4A 1VPWA 5ED4A 2NT4A 1PNTA 4DADA 5CHYA 2FQWA 3L6UA 3IP5A 1TVMA 3LKVA 3OMWA 4MQEB 3HUUA 2HQBA 3H5LA 3NNSA 3QEMB 4KQ9A 4L85A 3SNKA 3C3KA 1YMVA 3CZCA 2B4AA 3G85A 5BRAA 3DZDA 1Y1LA 2WJWA 3FMVA 3HZHA 1VRVA 2VK2A 2IDMA 4QYWA 4F11A 5JS2A 1Z17A 3TB6A 4WXEA 1MIHA 4S05A 1YK1A 3UKJA 3KTOA 2PUAA 1DG9A 4MS1A 1QP4A 4IRXA 3CTPA 4YS6A 5D2CA 1GCGA 2QW1A 3OQNA 4LDAA 3LUJA 4YV7A 1JDPA 3GT7A 4LX8A 4Z99A 4NV3A 5KQPA 3HJFA 4MYRA 4EYGA 4JOQA 2HQOA 1VKRA 3RQIA 4EVQA 3KJXA 1P8AA 2A9PA 2DRIA 3HK2A 3JS5A 1NXVA 1SXGA 1F4VA 3CNBA 2PMCA 1NY5A 1LBHA 4MLDA 3GV0A 4JA2A 4LDZA 4MR9A 3MQ4A 4MR7A 2KYRA 3BILA 1P2FA 3UUGA 4F12A 1C4WA 2LUOA 1C0EA 3KKEA 4NQRA 1YMUA 5JNSA 1RZRD 3R0JA 4N0QA 4Z0NA 5JNRA 1XWWA 1EFAA 1RPJA 4LE1A 2PKXA 2AYZA 1QQBA 3QK7A 3HO1A 2FW0A 5IUKC 1NXSA 5JS1A 1KRWA 2PL9A 3DGFC 1IIBA 5HM6A 4G0OA 1SXIA 3NHZA 1CYEA 2LIVA 1MVOA 2JVIA 3JVDA 2JRLA 4MPTA 3O21A 1CHNA 2RGYA 1KMIY 2OQRA 1EWKA 1DBWA 3IPAA 1UDRA 4O1HA 3A10A 1JYEA 5EWLB 4NCBA 3N53A 4EY3A 3KG2A 3S99A 1E6KA 4HNSA 3DGEC 4DQDA 1AB5A 2OENG 1JYFA 1R8JA 1LK0A 5BRJA 3M9XA 1FSPA 1D4ZA 1PUXA 3H5WA 3Q7TA 2FSPA 2J48A 1MB3A 4Z4EA 4IF4A 1K68A 2JCGA 2PUGA 2IPLA 1YIOA 1VLZA 3HV2A 4G0XA 2FEKA 2PUBA 3QLUA 2PL1A 1JWLA 3D8UA 3OQOA 1E2BA 5TQ2B 3NNDA 4TLLB 1U0SY 1U2PA 2FN9A 2L2QA 4RDCA 3HVRA 4MS1B 4D6XA 4ETIA 4G86A 3KS9A 3LTEA 1W9HA 3H5TA 4YRZA 4RY9A 3LUDA 4LZLA 3RVJA 3A0UA 3H1FA 4HYEA 2YHAA 3QLTA 1CEYA 2GKGA 3LFTA 4EYQA 1ZH4A 2IPNA 4FE7A 1B00A 4RZSA 4ETNA 9ABPA 4W5QA 1JH9A 2E4ZA 4ZPJA 2GBPA 1DZ3A 5IBQA 2O20A 2VYCA 2R4QA 3LOPA 6ABPA 4YWHA 5BR1A 5B3JC 3Q15C 1P6QA 3GBVA 3O2SB 5EWJA 2FEPA 4MS3A 5E3JA 1BDHA 3SY8A 4FE4A 1Z12A 5DCLA 5TPZD 3QELA 5IUNC 3E61A 3TD9A 5KI6A 1Z15A 2PUFA 1FQWA 5IC5A 5JNVA 3OM0A 5TQ0A 2RJNA 2LP4Y 1ZN2A 3OLYA 1U04A 5JNUA 1D5WA 3N0WA 3F6PA 1D1PA 1T34A 4RK7A 2W42A 3H5VA 3K9CA 4KK3A 8ABPA 4Z4HA 1USKA 3D02A 5ABPA 5IULC 4N0PA 4TMYA 3LUAA 4OLBA 4RY8A 4PZ0A 4KNYA 1KRXA 3SQNA 4D6YA 5IX8A 1QQAA 1HEYA 4YGXB 1QPZA 3HDGA 2JVKA 5C5CA 2FEWB 2PE5A 2L17A 4TN5A 4LRQA 5HKOA 3DLHA 2PAFA 1APBA 3KHTA 2ZWMA 1D1QA 1DC7A 3BBLA 2R48A 1JDNA 3HCWA 3OLVA 4RU1A 3VNAA 3SG0A 3CU5A 1E6LA 1OXBB 3JTEA 4WUTA 3QEKA 2ID7A 1DBQA 3FDFA 1BVHA 3N6VA 2HQRA 4JB2A 3KCNA 4RK6A 4RXTA 2QSJA 3N0RA 4N47A 3JPYA 2CD7A 2WMYA 1DC8A 2MYPA 1L5YA 1PEAA 1TM2A 4RKQA 5C5EA 3GRCA 2P4UA 1USGA 3MIZA 4G0PA 3EAFA 4JB0A 2PUEA 4MAAA 1ZVVA 1DCMA 2H0AA 1ZGGA 4RKRA 2FXIA 3K4HA 4XFKA 2RJOA 4OTZA 1GUDA 1USIA 2QVGA 5F64A 1YK0A 3T6KA 1H9CA 4IILA 5EWJB 5IEJA 3ILYA 4MS3B 3TX6A 5DLEA 2JBAA 5IEBA 1BDJA 3QELB 2NT3A 5FWYB 1MB0A 1Z25A 3H75A 4L4UA 3NHMA 3O1HB 4YCSA 1QMPA 5TQJA 3CFYA 4O1IA 2GI4A 2E4XA 5FWXB 1Z16A 3HM9A 3M9WA 3EULA 1ZDMA 4XXHA 4MQFA 3O74A 1EHCA 4EYKA 3IP6A 3OO0A 4G0ZA 3MA0A 4D74A 2CHEA 4MLCA 1E6MA 2IPMA 3LUKA 1JBEA 2PUCA 3CG0A 4XARA 2QZJA 1KGSA 4XASA 2FMIA 4EGSA 4F06A 1LJLA 3N8IA 5BQ3A 3C6QA 3BRSA 3A3KA 2V0NA 1DP4A 4EYOA 4KVFA 3O75A 4ML3A 3CKMA 4E7PA 2N9UA 1JF8A 2PJUA 4UHJA 3OMXA 5PNTA 1U2QA 3RVKA 3OM1A 3KSMA 4W5OA 1XHEA 3MMNA 3NNNA
chains in the Genus database with same CATH superfamily
3WVNA 1SCUA 4P4TA 1FYFA 1OCEA 3AGPA 3I09A 4MGIR 1IBMB 4O4HA 4S1VA 4XUGB 5DNVA 3VHXA 4QWWA 1NXWA 1EQ2A 2YX1A 2HU5A 4HWOA 3RK4A 3T5BA 3I9KA 4B7CA 1Y33E 2R11A 5J23A 1GKLA 2P9ZA 4UMEA 3Q2OA 5JNTA 4TWZA 4D79A 2WYUA 3EE6A 2VHXA 2ZKLA 1DWQA 4ZEMA 2B7CA 4FKZA 1YC5A 1YR9A 1H5NA 1XCMA 2EXXA 2C7QA 4PANA 5H3CA 5AVJA 1H8HD 3ED1A 1NW9B 1ZD3A 1C9MA 4P35A 3CRRA 1VLVA 4TQ9A 3DBHA 2O8FB 2EKBA 2SHKA 4GPIB 3WNVA 2QXYA 4HXGA 4UHBA 1LBSA 2BI4A 3OCVA 2SKEA 2ZBGA 3KJFA 3BDVA 3WYAA 1M5UA 4U2EA 1KAQA 4NH4A 3T3DA 2WPDA 4CIYA 1JX6A 4GE0A 1VMDA 4RZ3A 2GA9A 1EDEA 3R3ZA 1A2KC 4M89A 5C3MA 1NBMA 4C0LA 2XCUA 3A6GA 3ETEA 1VJ0A 1V1MB 4KR0A 4Y6QA 5CXXA 2VZLA 2O5EA 2YYZA 3VX3A 4EX7A 4KH0A 5HUQA 2Q5FA 1QG0A 1BX1A 3JR7A 4KGVA 5F12A 3I9JA 5B6JA 4IDFA 4G36A 4IBOA 1XRRA 3NVMB 1CZNA 4X20A 1S2NA 3HSYA 4LV5B 4N6GA 1TKCA 2I4NA 5CVVA 3QITA 3TTYA 3KBOA 4UHKA 4ZKDA 2BSAA 1G5TA 4F2WA 2HC9A 1OWLA 1IZYA 5IN5A 5CNIA 2IBTA 3CZAA 4X24A 2IV2X 4NYIR 1KZ7B 3D81A 2WJVA 1HK7A 4CWAA 4HLNA 2B99A 5B58C 2A67A 1JKFA 2UV8A 4D3YA 4QZVA 3USES 1NUSA 1XIVA 3H86A 1HDZA 3AF3A 4W5HA 4B3MB 1CTQA 2QV0A 1NM5A 3R0XA 2CMKA 2CWWA 3IP7A 4IKPA 2G88A 2B78A 2HBQA 4UEWA 1PQ4A 1NI4A 5IK2A 1I2DA 5AIAA 5AKZA 3UGKA 1Y63A 4ND8B 4ZVOA 5A4FS 4JKOA 1MLDA 2NXJA 4OMUA 1J0DA 1L8OA 1D0VA 1OAKA 3IUYA 3GT4A 2FU5C 5T4BA 5MFZA 1T4CA 1V96A 2FJPA 2FE1A 2IYZA 4ZVTA 3M4YA 2V8OA 3Q6MA 1EK6A 2G8NA 4BMSA 1Z62A 1VLHA 2YBDA 3FY4A 4WD3A 2JZCA 3AB7A 3MS7A 3HU3A 4H7JA 1QTNA 2AI2A 3PNLA 3EEBA 1T5OA 4RK5A 1CJCA 1I0LA 3MIIA 1P4JA 3I2KA 1HYHA 5DLQC 4BYGA 1U1CA 3PQEA 1TQDA 4EKGA 3A9VA 5K0BA 4BGEA 3GA0A 4D8TA 1H05A 2OCYC 4YJHB 2UYOA 4A2QA 5BMVA 2OGZA 3MCZA 4AMZA 2C7PA 1M8PA 2DERA 4PVDA 2J0EA 4PFQA 3FVQA 4ZZ0A 3B1FA 1TF5A 4QHYA 2X13A 4Z53A 1QLWA 3NOOA 2RH4A 1TPZA 3H42B 1QKKA 3RNLA 1SK8A 3ED5A 2C59A 1ZHHA 4RTMA 4BKPA 5LMUB 4I50B 4F46A 1P8JA 5DM70 4AG3A 2J9GA 2F8TA 2XYQA 5SZKB 1UKEA 4I4CA 4G5QA 3RFXA 4UCQA 1G7RA 5EKDA 2O9JA 1FLVA 1G0NA 1D1SA 3WMRA 1QSGA 1PYGA 1GG8A 2WVGA 2GF2A 2B0JA 1JPVA 2RHBA 5K0EA 1SO8A 5JXJA 1ZR4A 3KCQA 1L3IA 4E5PA 1U5BB 2YZKA 1ZEJA 5CNKA 2IYNA 3JU3A 2HW8A 1SVOA 3Q87B 4RTOA 1R5BA 4G24A 5LSAA 1UJ2A 4OPMA 4CYMA 5ELLA 3W78A 2RHCA 4GOXA 5JYCA 4I1SA 3J7AC 1Q1QA 4FBGA 3ZGLA 4Z7JA 2RG1A 5E6UA 4MVJI 1Q6YA 1F1JA 2XCRB 2V7UA 1WMAA 1Q7BA 3MUFA 3OJFA 4GC9A 3GVXA 1KPGA 4M0DA 4UBIA 2ZDGA 3FN4A 2P65A 3DLTA 3R3XA 1VECA 2QSZA 4CL8A 4HZIA 4UE3S 4NXMB 3VJKA 3BWYA 1WETA 1N6HA 1GNVA 1VMKA 3ORRA 5FWDA 3EUEA 2CLFB 3PNSA 1VSBA 2ZRQA 3IAM6 4A82A 5L8VA 1LB1B 1FRVA 1G21B 1LPMA 2Y0BA 4H7KA 2JG3A 3D6FA 2X6QA 2GAFA 3SFVA 1LF0A 2CK3A 3BIFA 3RYFB 2EZ4A 3OLQA 4LZOA 3DCNA 1XZKA 3NC1C 3ZGZA 2W2KA 5HBRA 5I8ZA 3RS3A 1LPAB 1T0UA 1Y7IA 4ZVNA 1ISRA 2HF2A 2HIGA 4AO6A 2FXVA 5SZJA 5JCOC 4MKZA 1BN6A 4U39A 1TQHA 2H8GA 2Q5HA 4DCVA 5CEJA 1HO3A 1TRKA 2I3AA 2WPDD 4L0DA 4ZQGA 5K3CA 2OVBA 5T3UA 4XAQA 2ZAGA 1GUBA 3TBFA 3QNUA 4HV4A 4EJMA 2IXEA 1MG0A 2GCOA 4AZ0A 1YQEA 3CV3A 1NBMD 4P1ZA 5ALKA 4HDKB 2AR9A 4RLQA 3O2QB 4YXWA 1Z33A 3DJYA 5AESA 1O58A 2QZ4A 3MUOA 4CEJB 1ILWA 3FSGA 3WGJA 2RGNC 4BO7A 5LOVF 3DB2A 3U4HA 5JBIA 3EVTA 4IUCS 2JKZA 3UXMA 4B6QA 1IBKB 3LDUA 4GBJA 4YROA 3GYBA 1Z35A 4QPDA 1SQFA 3VSAA 3ORSA 4CMEA 1ETUA 2XPCA 4NEGA 1NP6A 1AKQA 3DDOA 4EB6B 4Y1FA 5PGMA 2FFAA 5HOQA 4MQFB 3THYB 3K05A 3TI7A 5LB2A 4L7VA 1SQSA 4GPAA 3RUPA 4JJKA 1JE1A 1DJOA 1X42A 3OTWA 1IVNA 1GZUA 2UVQA 4ZYTA 3ESXA 5TPZA 3IXMA 2FZCA 2A9KA 3KYCA 3DWFA 2DY0A 1YS1X 4YUYA 1WNFA 3GR6A 1W85A 1RFGE 1GGHA 1IXRC 4QOIA 1G60A 1KJWA 2WJYA 4RS3A 4XR4A 1O03A 4TTIA 3WYDA 4AG5A 3E0XA 1NPTO 4ZFNA 5IK2D 2UVPB 2NT4A 4PAGA 3ZBTA 2Q3JA 4F2PA 5BUSA 1LPBB 1QH8B 1T5DX 5I3ZA 4NPHA 1E2QA 3I4FA 1YJAA 3ZWCA 3ZHTA 1IQRA 5TQVA 5J4KA 2ZJ7A 3ESYA 4GUDA 2F48A 1BQEA 3QEMB 7ADHA 5IJWA 2DQSA 4BO9A 3SNKA 4G1MB 4F4DA 4YMLA 2IYOA 4R8SA 4DR2B 3OWHA 1E9CA 4OUDA 1WXQA 4TV8F 4XIGS 1Y1LA 4ESEA 5IMSA 4Y9RA 3CUSA 4J90A 1P1JA 5FFFA 5IDYA 3U1TA 4QRDA 1UEXC 3D0KA 2VK2A 2J6CA 4W5JA 3H99A 3LRXA 1MIHA 4JQCA 4S05A 4EY8A 3L7MA 1A5AB 2PV7A 4MA5A 2QI9C 2EG9A 1GY8A 2Q27A 2QW1A 3C7TA 1DIOB 4FWIB 3UMVA 4OV6B 3VAYA 4PYNA 4C5BA 3D1VA 4Z1OA 5EGSA 5JSKA 3GT7A 5D7NA 5FR2A 3U26A 4NXNB 4ARSA 4MYRA 1COZA 2P2SA 4EL5A 1E3TA 1PL7A 2LNDA 4QQ8A 5K0LA 1PVOA 1RQNA 1WBJB 3FNFA 1JTFA 1C7RA 3PQ8A 3DWIA 1F06A 4BVLA 1IN5A 3GZTB 2R6AA 3N2KB 4MHSA 2ZWAA 1IY8A 4NCXA 4D8VA 1H2ZA 1C1HA 1US8A 3PDCA 1P80A 4TUYF 2J87A 1GRCA 3NIFB 4M7RA 3WIOA 4EA8A 3PJFA 1KO7A 3ETJA 4ZDWA 1KQFA 2IPOA 3F9CA 1XI2A 4RHXA 5TLSA 1G7SA 4HB4A 5ECYA 4EY6A 3WJAA 1RWKA 3IAS6 1ZJYA 2AJ8A 4HDQB 2X76A 3GEGA 5A4AA 3ZCVA 4RELA 3WSVA 1O89A 3RUHA 3B6IA 3JX9A 5KYVA 2X1LA 2IY7A 1P2SA 3LVBA 2F1JA 5BOSB 5FWNA 4UTXA 1Z0DA 2AQIA 4BNZA 1IY2A 2VPTA 4OD0A 5JSZB 4B43A 2PL9A 3C5HA 3LXUX 1IULA 1DUSA 2Z56A 1MH9A 2QP9X 4JITA 5JPCA 4J94A 1ZH0A 3HU5A 5B1EA 1ECLA 2WMOB 4QEKA 2WWFA 1Q14A 1Y1PA 3UY4A 4DDHA 1WULS 5LP6F 4ID3A 5JO0A 2CBGA 1CR0A 1QCCA 3HN6A 4LN1A 1XZIA 4ZRDA 5EWLB 4F3CA 2H92A 4IRMA 1TVKA 5IFKA 3N0TA 5BNZA 1YKGA 2FPOA 2GPWA 3DGEC 1PG2A 4HJRA 2V7TA 3HXKA 3GJ0A 4LI3X 2C3MA 3CLSD 3DFKA 2CK3D 3I2FA 4PPYA 3VU8A 3W4KA 5CEEA 4CKBB 5EIFA 4G1BA 4RV9A 2F8LA 4M4SA 3HLKA 4LQLA 4N8DA 4B6SA 2AOUB 1SFRA 1JMYA 1R88A 1CSEE 2V9ZA 4UC0A 3SPXA 2FEKA 4OQZA 2XZOA 2QX6A 3V8QA 1W5FA 2XGOA 3Q11A 4DNOA 1Z07A 4OM7A 4BEJA 1G66A 2RI1A 4EP1A 1QU3A 1Y1SA 3NNDA 4J1TC 3WQQA 3BK7A 1ORIA 5HF8A 1DRUA 4ZI7F 1HSOA 1N5MA 2AG8A 4OK5A 1XRQA 5KOHA 1RE0A 2DBRA 4JXXA 3CMCO 4U2DA 3NEPX 3MLBA 2BFEA 4IH9A 4NPCA 5G3YA 5K3BA 3DMTC 4KXNA 3FTNA 3ZK7A 2CV2A 4QU9A 5CM9C 5LZ4A 3TQCA 3W04A 2JCBA 4YXWD 2QY6A 2PSJA 1JQEA 2ZB4A 4I5FA 3LL4A 4X7PA 3EQ7A 1XVVA 2I4IA 2O8NA 4FYIA 4UAGA 2RKBA 1SAYA 2WG1A 5E0OA 1P2DA 5B5SA 2CVFA 1TA0A 2IXFA 4BNKA 5IC4A 4JELA 5EGNA 5K99A 1G8MA 1X94A 3GZ4A 3KQVA 1B74A 1W75A 4X7BA 1UOOA 2YS7A 3ZWNA 3U16A 2YFYA 1DWPA 1XQ6A 1JKXA 4D5EA 3HXOA 4FM9A 1UEIA 5JTTA 1GFSA 1P6QA 4CPDA 1X2BA 4GICA 4F3NA 2I99A 3BJZA 1R0ZA 4BGDA 2Y2UA 3SC3A 3QXHA 3W2FA 2XB2A 2C7OA 5TPZD 4NH0A 3T7EA 4QUJA 1L5MA 4KFTA 4HAZA 3OCWA 2JHGA 4UHDA 4XWKA 3D0QA 4HWKA 1NGSA 2GEBA 5HOEA 2ZZNA 4YY3B 2P9JA 2X0FA 2VQEB 5EESA 5BQ5A 1J7KA 2X1VA 1O6FA 2VI5A 4DJ5X 5IWCA 4JXKA 2Q49A 1UBLS 3NAZA 2L69A 4JGBA 5JNUA 4B3BA 4C6SA 1KK0A 5YASA 2ZE8A 1A7JA 4R2WA 4RK7A 4QOHA 4BNTA 4BMOB 1MABB 2F3RA 4MAMA 4RD2A 4C0XA 5L3VA 1GP2A 4IQ8A 3ORFA 3Q3IA 4JI0B 1FTNA 4WOPA 1AGNA 5BV1A 1T1RA 4EK9A 1I7LA 2I6UA 2QTMA 4WESB 1BQ3A 2IH2A 5E2BA 2GJAA 3E8XA 4B87A 3O9MA 4BNLA 5LQDA 4MKRA 4KWIA 1ML3A 3TTSA 4OBXA 1HE3A 1XL0A 3OZXA 1APBA 1VBFA 2QRKA 1VJ5A 3GJ4A 1QX4A 5JSFA 1YZFA 4MVJF 5D01A 1MW9X 2JS7A 1PWXA 4D82A 1Y5RA 4ZYVA 1I4DD 3I2GA 4EW1A 1HNXB 4QRIA 5HIIA 1P7PA 5EIAA 3PF8A 3GAZA 1ULSA 1ISGA 4R81A 4TSFA 1DKLA 1XD8A 2GK3A 2DHQA 2FRDA 5GMOA 1HG0A 3DLIA 2CEKA 4LY0A 4DSOA 1OWMA 2C4WA 1NXQA 1YS9A 3IUBA 1LDBA 2Q07A 1GA6A 5AKKA 3KJGA 3ELWA 5B30A 2A88A 3RAFC 4D9MA 4GEGA 3ZJTA 2GBIA 1XOIA 5GONF 3C8ZA 2Q6TA 5REQA 2HU8A 1L5GB 2EWVA 4AUNA 4B9AA 4LXUA 1BG6A 1UFQA 4Q7QA 5IBCA 1EM6A 1CE8A 3N8HA 4EJSC 1UBTS 2C77A 4FMCF 1O6GA 4QAQA 4FUQA 2H5EA 1WL8A 1CHDA 4N3AA 4BNVA 1T9AA 3DAYA 3QX7A 2JLWA 4DR4B 2Q5IA 4R9NA 2GDJA 2NO6A 3TSAA 3UQZA 2PAAA 3FOEC 3U4DA 3THXB 1JMVA 1KSJA 1ORVA 1E64A 2YMMA 1T3SA 2ZDQA 3GH1A 1CRZA 2C9BA 2JD0A 4KVZA 2VDOB 2B4RO 2VC2B 4GC5A 3C4QA 5T67A 4WV3A 1ZMTA 1EFVB 2GGSA 3TRFA 1SA0A 3LYAA 3FHCB 1NPDA 1AK1A 2P90A 5EPOA 3BE6A 3AM4A 4M83A 5DBEX 1OH6A 3LUKA 3T1HB 3B12A 3WKBA 4BVAA 1V5WA 1ZJ5A 2EP5A 2IX9A 2QWXA 5KCMA 4IDOA 4QODA 3WLEA 3C6QA 4KQXA 2E2WA 1BW9B 2FWMX 1PL0A 2R7LA 3BF8A 2CDRA 4OIFA 2YASA 3TINA 4FIZA 5GM2A 3M2PA 1JF8A 1FFAA 3N76A 3PXEA 3GZNB 2C9MA 1YJCA 4YDHB 4TXNA 2AXPA 4CZ2A 1ZIXA 5BSMA 1WTAA 3JARB 4HBZA 3RRYA 3WQHA 1KTIA 1C1DA 1XVAA 5LA6B 3HB0A 2NZVG 2YXPX 1F6WA 2V7PA 3WK4A 3K2EA 5CM8B 1K06A 4NBLA 1WZCA 2Q8QA 2B7LA 1G1AA 1K6JA 1N8NA 1WDMA 1NJ2A 5EFOA 4BO1A 3HFGA 1W2GA 4HJXA 4Q6WA 4TVOA 1FFDA 1GT6A 4QT0A 3VU3A 1UBMS 2C04A 3JQRA 5IVIA 1ECPA 1TM1E 1NT4A 4GOMD 3VSDA 5LDDC 2W4QA 4HSEA 5B12A 5KJFA 5L6MB 4MGYR 5JZMA 1ADJA 2V3VA 1CXZA 3D8RA 4KWHA 3DXYA 2G1AA 4QG7A 5B7QA 1J07A 3ZWPA 4G3XA 2A9VA 2W6CX 5AI4A 1Z0AA 2NADA 4Y9TA 1YOVB 3H65A 3BF7A 3SGLA 3RC8A 4ALMA 1F6BA 1KIFA 1SUSA 1DBPA 3D4PA 4MWTA 1WKVA 4PQGA 5IJXA 1GPBA 1Z0KA 4B6EA 3JAKA 4B7ZA 5HR5A 3AL2A 3IP9A 3DDZX 2VAMA 1R0KA 1WHSB 4GI7A 5HCNA 1A8UA 1V48A 4HWTA 3OO1A 1P7CA 1G20A 5HTKA 1B8PA 3E58A 4EITA 2OHGA 1NOJA 1LD3A 2BHRA 3TZ6A 3HEBA 4Y7DA 1Z13A 4HXFB 3DBOB 2J5RA 2OXIA 4JR1A 1GAEO 3QSYA 3AR3A 2KBEA 3S2YA 5CDFE 1XT6A 1BYIA 2CHGA 5IHXA 3IL2A 1R16A 1RJWA 1HH4A 1JTEA 4QJBA 4JC0A 5BSRA 3D3EA 3JD4A 4AVYA 4FJ0A 1M66A 4YEDA 5TPWA 3X3HA 4AYWA 1E3EA 4B40A 2GVNA 3CX4A 1HMPA 2V54A 1YFJA 2YS6A 4P4SB 1M34E 1SQGA 3ZWOA 2G0AA 4I1OA 1TJYA 3WL6A 2CC2A 1NJSA 1SXQA 1X9IA 3R5FA 2PM8A 1GPJA 1Z7EA 4MINA 1PW5A 1UP6A 4HEA6 5ENZA 3R7DA 4IQGA 1SD5A 4R6XA 4Z4CA 2HLPA 2FW8A 2GKSA 2J3EA 4BMDA 2F00A 3VYVA 1PEYA 1RFLA 3AUYA 1AS2A 1L5KA 2XB6A 4HDRB 3UM9A 4F4IA 3TO5A 2ZE7A 3Q40A 4WOKA 5DWDA 3M1LA 4HN9A 1U02A 3MWFA 4YV1A 1J0EA 2E89A 2I2AA 1ZNWA 2XECA 3C48A 3URMA 4LNUB 1YDEA 1P2GA 4LQCA 3S2EA 1SK9A 2X9VA 1NYQA 3V7NA 4DLTA 1JXMA 1LW7A 1Q1BA 1Q1ZA 4DM7A 1BJRE 3I62A 3AKYA 5HE8A 5IUJC 2Q2VA 1K1EA 1KQOA 4BWGA 2ATEA 4H60A 1I32A 2FPRA 3PDWA 2XGJA 1TM4E 2QENA 2FUG1 1WOYA 3BXOA 4Q4HB 4RL4A 1MEEA 2F9MA 4G56A 4RCZA 2J0UB 1Z7WA 2AFHE 3AR9A 3EZNA 4EYSA 3NDPA 2KW5A 4F96A 2PNFA 5CVUA 2IHBA 4NULA 1JLLA 2R6HA 1VL0A 1DXHA 3BYZA 3GLGB 1Q44A 2CFTA 4F3TA 3PNYA 1P1CA 5DO9A 1RXEA 3DE2X 4IFTA 4HWSA 3R41A 1S8FA 5KQRA 3CKYA 4XH9B 1D3AA 3DEFA 2FKAA 3DDWA 1RZVA 2IH4A 3I45A 4E1AA 2W6IA 4ZVPA 5KTRA 2A5FA 3FPJA 3SEQA 1CUZA 3WYBA 4XOIA 2RI6A 3G8YA 5TQ0B 3QTLA 5CB0A 4X1KB 4DR3B 4DL9A 1S8NA 1GNRA 3FOWA 4DR7B 2YOGA 4P3NA 2I67A 1FS6A 1FYXA 1W2WB 3L1JA 2QR3A 3OZVA 4JMPA 2X9LA 3MWJA 5DOVA 4P34A 5ER6A 1QHSA 3IMEA 3WLTA 4EA6A 2P4HX 4JLUA 2YV4A 3ZVKA 2Z1NA 1EFCA 4JT2A 3X1YA 2QLMA 5CYGA 5KINB 3KZCA 1GPUA 4QXRA 3WA6A 3BHJA 1F2TA 4FT2A 2YQ5A 2HJVA 4PCUA 5JCJA 1JSXA 1CPYA 1QFSA 1PD1A 3PKJA 4HVTA 4MGKR 3WLLA 1C3VA 3GG2A 1PR3A 2ORED 4QX6A 1UUFA 5TF4A 4JCCA 3V8VA 3C85A 4E88A 4EG3A 4N49A 4Q4AB 3SQDA 1DBIA 1NPYA 4G2NA 1S01A 5EA2A 4YP9A 1IEQA 2P2LA 1TM3E 1SXJA 3HS3A 3A4IA 4EBFA 5JS7A 2OV2A 1EP1B 3FR7A 2OORC 1QHXA 3GEBA 3L7DA 1UAAA 5IVKA 1RPAA 4NZYA 3OLWA 1SVUA 1XAHA 2FWPA 5JC8A 3GAFA 3HDTA 1XNHA 5IT4A 2J5KA 4X1OA 4F7WA 4DBVO 5EE3A 4CMIB 4XPIB 2WIJA 1HFWA 5TJHA 1R6XA 1FS5A 3EZ2A 5DT9A 4POOA 1U94A 4R8VA 4KTTE 2GD0A 4D9FA 2OCXA 3KDSE 1NX9A 2GZSA 5L4SA 3AHIA 3T06B 1ECBA 3FGPA 4QO7A 4B80A 2ZUWA 4BLRA 3HFJA 5U4XA 1AHPA 2DPYA 4U2GA 3F7NA 2VJOA 3NH6A 3ONFA 4ARIA 3O0TA 1OYWA 1Y3IA 3I0NA 4QARA 2Q4DA 4P80A 5IARA 3FDZB 2KMLA 3HMQA 3DKPA 5KHAA 1GDTA 4GECA 1NHWA 1OLSB 3W9SA 3VM6A 3LXRA 2JAPA 1W4LA 3TLCA 4F8YA 2FUNB 4O4LF 4XLTA 1MVLA 1E0KA 3E7WA 1IQPA 1NOKA 3R4CA 3IEKA 5JMWA 3FKSA 4J91A 4MRMB 2F17A 1B6GA 1FRQA 1HEUA 3KDAA 3U48A 4CEIA 1UMDB 3KZMA 1D9XA 4GXTA 2DU8A 1E5QA 1Y8AA 1UJMA 4PIPA 1GXSB 3K0FB 4R68A 4BKQA 2PIAA 5ALXA 1F9EA 5ES3A 1OIXA 1A4RA 1PEDA 5CYOA 4KX3A 1ZNQO 3WL8A 1C7EA 2PUDA 2WZCA 1XQWA 2X40A 3ZHRA 1HQKA 1G2PA 4O2AB 5JRJA 4PHCA 3COPA 3ACCA 3K9BA 4B84A 4F38A 3MGGA 1YJQA 1BHSA 1OSNA 1OUMA 3MWEB 1T9KA 3EQ8A 1QV9A 1F8GA 5C5DA 1OTXA 3FTDA 5AVUA 1OXUA 4J1SA 1CUIA 1TLFA 1RJFA 3EGWA 4Q02A 1KL7A 3SSOA 3T95A 2HJSA 4R2XA 2QNIA 5AK5A 4PZAA 4M60A 2X0DA 4ALIA 2PO5A 3I5UA 1E0AA 1I2MA 4RZHA 1CQIA 2IEDA 5TXGA 4I8IA 1QHYA 3P9SA 1O7JA 1FSFA 1G4UR 3AR6A 3FDIA 2Q46A 4G9BA 3AOEA 4HADA 4Q9HA 4E4YA 3RJZA 1SCKA 1O77A 1YQTA 4YJFB 3MK31 4EPVA 1R74A 1V5FA 3C3KA 4L28A 3CZCA 4QPCA 3KQLA 5JD5A 5ALWA 1GL7A 5BORA 5DWVA 1XGKA 3B9PA 1ZS9A 2OECA 4ILEA 3CW8X 4PLHA 3IV9A 3N5KA 1H6CA 3MJVA 1YK1A 4C6HA 5KDOA 4BKMA 3OT1B 4AI6A 2F59A 4D4GA 1P81A 1ZK2A 2OBFA 1NVFA 3MT0A 1KP2A 3JQFA 4I5IA 5GJCA 3W2IA 3W5JA 4EQ6A 4YV7A 2VZ0A 1EB9A 3QVJA 4OHCA 4ZHQF 3FTEA 2NVUA 2Q4RA 5DZSA 2PRSA 2ZIVB 1JIKA 1U8AA 1CEEA 2X5OA 1JWBB 4NBNA 2XCTB 1YL7A 5CT4A 5GAJA 2RHHA 4ONEA 4BZXA 1K5GA 4JI7B 1BKYA 5LJLA 4DMMA 4I4NA 1SOWA 1TECE 3AGQA 1EVYA 2W6ID 4QFBA 4YCCA 1NW7A 1JP7A 4PINA 2CLMB 4JOCA 3QF7A 1K0FA 2GBGA 2B8EA 4UBNA 1RYYA 4E31A 1F12A 3EGEA 1X9GA 3RODA 2ZS7A 1MT0A 1S0UA 1WE2A 2JPDA 1GM5A 1E96A 1FVOA 4D80A 3O03A 4KPEC 2VSNA 1TT5B 4CODB 3R7FA 4REQA 5AHXA 4AC9A 2GAAA 1X7YA 3LC2O 1TC2A 3VNRA 3QK7A 1JBKA 5JCJD 5IUKC 2MSNA 2GHQA 4L3WA 2ZRAA 4LYGA 4J49A 2C94A 3K31A 1B42A 1E69A 1BXRA 4QO8A 4WRRA 1VBKA 2JFHA 2JDID 3MXTA 1J25A 1O57A 5BW4A 1F3LA 2G83A 2AR7A 2D2EA 4LFBB 3QKTA 1SXJD 2OQRA 3PENA 3ZHBA 5DBHX 2PZBA 2R6DA 4O4LB 4MPDA 2OBYA 3TZCA 5HZHA 1WXEA 1XDUA 1O8BA 3RRBA 1AUVA 3DM9B 3IULA 4YMGA 4X44A 2LXNA 4YRLA 2NW6A 4PHFA 1QKIA 4OLFA 1GIAA 3C6BA 4DDVA 4UUQA 1Z82A 1ZUHA 2AXNA 2C78A 2C8LA 2GN0A 3P19A 3TR6A 3C14C 4RETA 3VR0A 3HWSA 4HAYA 3BM5A 4DG8A 3G2LA 4V0RA 1KKLA 3RD5A 2AD5A 1MB3A 3PA8A 4DJAA 1K68A 4HVCA 1QIHA 4GS5A 1BS1A 4JBLA 2PUGA 2VBGA 4QBFA 3SF8B 3AZQA 3WB0A 1JHQA 2ECFA 3I58A 2WI8A 1RKUA 2ZUUA 1Z6GA 2OWEA 2V58A 1G59A 4PIVA 3ZU6A 3H19A 4XVRA 1XMIA 1AZLA 3L1IA 3BJRA 3W5VA 5MN6A 1XLUA 4YRZA 1E9DA 2XYVA 4RY9A 1I4TD 1P2TA 3CA8A 5GWXA 1M0WA 1SHUX 4CETA 1KEEA 2DF8A 5H5JA 3I8OA 2GKGA 2G36A 5DNWA 3PEUA 3ZZMA 1V26A 1UK9A 2AT1A 3LHKA 3CF4A 4FE7A 3U3MA 4E46A 4GDFA 1NLFA 3HUEA 2ZRBA 4IIVA 4P82A 4S0ZA 2YIJA 1WPXA 4NOMA 2FJUA 5IF3A 3PCTA 1DT3A 1OR8A 3PTAA 4GZMA 4DEXA 4ZIRA 4WZAA 3HCFA 4J3NA 4B8WA 5F7XA 2FI1A 2VOEA 4F71A 3TL6A 1USUA 2Q1YA 3GG9A 3TOZA 4OQ4A 2JI9A 4C03A 1AURA 2YVQA 4GLJA 3AKEA 3VI4B 4CHTA 5JSZA 4QM7A 3F2IA 1YVPA 2HWWA 1NZJA 3I5MA 4G8JA 3TD9A 2B8WA 3VMFA 3BJIC 4TSKA 1TNDA 4HF7A 3UGTA 4RMGA 3M6IA 3KL4A 4X63A 5IC5A 2EBHX 4HLUC 1N1MA 2XDWA 3WLFA 3OURA 3WX0A 4YRIA 4K81B 1O4WA 3GP5A 3M9LA 4BP9A 4EIWA 1X19A 3QKRA 3U61B 3DYVA 4NG4A 4OOFA 2NO5A 3W3ZB 3IH5A 2ZR7A 3HKEA 4TTRA 3PUZA 3GCGA 3NBXX 5K4GA 1YULA 5C8YF 2FPIB 1USKA 2BFDB 1ODIA 2LV8A 3KUCA 1FFYA 4HQLA 5EKTA 2N0SA 5KJEA 3DE1X 1ISFA 4JLVA 4D1YA 4QASA 4D92A 1C80A 3U3KA 1HLGA 4PTZA 4CM1A 4JT9A 5CIYA 3HXQA 1E2FA 1R4AA 2QYHA 3R7WA 2F3QA 5L40A 1H8EA 2VYFA 3GLHB 3GU3A 4XPZA 3BX1A 4PG7A 2XE8A 3OZRA 4DBLE 4EX6A 2VTDA 3BBLA 3PQFA 1U7OA 4GXQA 2R85A 4KO8A 3BN3A 1MV5A 1SOAA 2GAOA 2IYPA 2OYSA 1N0IA 1QHGA 2QTRA 3C74A 1HE1C 3L8CA 4J6FA 4L8YA 5IAOA 1FJXA 1OXBB 2IYXA 4RD4A 5A5EA 1A1VA 3F5FA 4JYZA 3E53A 2AJTA 3F7MA 1KS9A 4KFRA 4NR0A 3WRYA 3FROA 5HQ3A 2YY5A 1U7TA 2ZIZA 3TJZA 3P0JA 3NHWA 4TQAA 2ZRGA 3T4EA 2P9EA 3LKZA 4FW9A 4O0MA 5K20A 4V24A 3RUIA 3U49A 5IHPA 1FJ2A 4WX2B 1M0SA 4G4SP 1C0IA 1IZ8A 2IEBA 4W5WA 1TW2A 2RK6A 2VF4X 2YHUA 3DBLA 3H16A 4ARVA 1H3EA 2BMDA 4WKPA 3TL2A 4TVSA 1KI9A 1PNQA 2CCGA 1DKOA 2VP6A 4FHGA 4TS9A 4UW9A 3RT1A 4R3WA 1XZPA 5E38A 1JVBA 3GQBB 4BC1A 2I91A 4G89A 5FUBA 3TW4A 3EF1A 4J0JA 3SJAA 4AWXA 1GUDA 1NL3A 3HL4A 2VJQA 3E3LA 5HJ2A 1RJEA 1S9HA 4P2BA 4QGHA 3VH3A 3VX4A 5IG2A 3QPAA 2RGBA 5U9CA 1JT9A 2C3OA 4OQMA 2HA2A 3I05A 4WGFA 1Y9AA 3TQIA 1E2JA 3CVWA 2BSXA 1SVSA 2UZ1A 4OJTA 3N2ZB 1BOFA 1J70A 1YI1A 2P2CA 3NPAA 4XX0A 4DMLA 1G8KA 1H1LA 3IUPA 2QTHA 1DO2A 4UAUA 3VJMA 4G8BA 4C7OA 2HIHA 3HJHA 2ZRHA 1R6DA 3K8YA 1JU9A 1HQYE 1XVIA 5EZ5A 5LXTB 5DTIA 3ZQ4A 3B7WA 1Z45A 1KSHA 5B7GA 2VCEA 5K09A 3LGXA 2PBFA 3WB2A 2AJCA 1M8GA 4EHFA 5KTOA 5E4FA 1OC4A 5ALFA 4CJXA 3BGDA 3F2VA 1M67A 2R7KA 4JOSA 4XARA 3D7MA 2XYHA 3IUQA 1RQPA 4BFZA 4BO2A 5BQ3A 1PR1A 1YQWA 3IBGA 2R7MA 4JI3B 1JDVA 2WSYB 4P3OA 4X85A 4FOLA 4A2WA 3EHEA 3H83A 1WS6A 3F3YA 4AZSA 4CKEA 2VL7A 1DXQA 3NNNA 5ETJA 3RQIA 2WKWA 3GGDA 4C4YA 3IT0A 4B0OA 1QORA 3TK1A 4RHFA 4CG2A 2AMYA 4Q4CA 4D0SA 3WK7A 3GFTA 4MRVA 2O2SA 2R47A 3T0FA 1ZPDA 4PQYA 4WIAA 4EZBA 4A36A 4NABA 5ALSA 4ZT7A 5IT9A 1V5EA 1HE5A 1U9JA 2JFUA 1QAMA 4OJKA 1UP4A 1NQUA 3FJ1A 3FW1A 4MRAA 5EJEA 1VG0B 2ZWOA 2I4TA 1SY7A 2XH8A 3DE4X 2VTBB 4BB0A 3ASVA 3QLVA 1OWOA 5C8YB 3T1YB 3R3VA 4I7EA 4FDAA 3GBPA 4ISBA 4MVJP 1O95C 4RF5A 5KTMA 1OAOC 1A8QA 1MQ8B 1NFRA 3MRXA 4KQ2A 4RVSA 1L6IA 2FLVA 4F9TA 1AKYA 3D3WA 2Y71A 4QHSA 4MR9B 3FBWA 2G08A 3CH7A 2BZSA 2Z3VA 1FTWA 3DDUA 1V5GA 2ZJ4A 3QPBA 2B34A 3U4IA 4WHMA 1PK7A 5EZSA 2Q7OE 5AW3A 2ZANA 2AUMA 5DMHA 2I6FA 4G37A 3UK7A 4NE9A 1RHRA 3HWRA 3IJPA 4FFVA 5C4GB 1T6BY 3KNZA 3SI7A 1JKJA 3TLEA 5MN5A 3KSZO 1CUCA 4KB5A 3PUYA 2FPMA 3CZRA 1CR6A 2OAP1 3H9JA 5DGIA 5LP6C 1ZRMA 3T0IA 1Z37A 5CUQA 4QC2A 4QXMA 2O8EA 1X92A 4O6VA 1U9IC 1L2TA 1L5ZA 2GS9A 1SG6A 4XRRA 3TOXA 3WWPA 5JXHA 2C31A 3AI3A 3HHEA 4PONA 3GCZA 3GPIA 1ZK3A 3PQ2A 2UAGA 1MEOA 2G6TA 1SHLA 1XYYA 2I1WA 3D5TA 3R3UA 3GCXA 2R97A 3NX4A 2O1EA 1ENPA 2O2DA 2XMGA 1F5SA 1MRNA 2Y1DA 3D8NA 3RTCA 2WWGA 1QUFA 5KWEA 2GTHA 4FEYA 1DRKA 5JH7F 1CRQA 2AFRA 4RSHA 4RMJA 4JX8A 4FN5A 5LUBA 1GZDA 4CV3A 4O4JF 3SEAA 1J8MF 4TZ6A 1KRHA 4R0NA 1XBTA 3C6XA 1TK2A 1XQYA 4LNAA 1V1RB 3X1MA 1QU2A 2HXSA 2IHUA 4XWYA 1I2BA 2C0PA 2LCIA 3OZAA 4HLCA 2AZDA 1HYEA 4DE5A 1HNWB 5LYJF 2X5KO 1JJFA 3OCCA 4Q03A 1E2UA 4YT5A 3TEMA 3I83A 3AEUB 3WKCA 4QLBA 3IVAA 1B93A 1G1MA 1YZUA 2V98A 3VYWA 5JCZA 3EIXA 3WK8A 1KH2A 1X7ZB 2CBXA 3H5NA 1GQOA 4YC7A 1A5SB 4QU5A 2IZ0A 3Q8XB 4KO4S 4Y6OA 1P7VA 3BZWA 3SXUA 4A0FA 1V9LA 2IEGA 2V7BA 1CNEA 2YXNA 4YJ2A 1ZH8A 3NYWA 2J85A 2ALJA 2FEOA 7ABPA 1EFKA 1RC0A 3LQ1A 4M53A 4Z9BA 1ZN8A 1V11B 4KFCA 1UFVA 4D4HA 4NK4A 4QYSA 3OT4A 5HJ7A 4NECA 2CF5A 3UC9A 1O0BA 4HN2A 2L19A 2EERA 1T29A 2FR8A 2Z57A 3KOYA 3QTTA 4UOQA 4H3KB 1J0BA 3RJ9A 4WCFB 3WMGA 1RW4A 4HB0A 2Q9UA 4QOJA 2IDJA 4DA6A 3L4BA 3SCZA 2BGTA 3RC3A 3VGPA 2NU8A 1Q0RA 2IHYA 3RVQA 2LR0A 3O7WA 1J99A 3RKUA 3JQAB 2AZXA 3PNQA 2CHUA 3FHTA 4D99A 2IV7A 4CU2A 2O4UX 5CD9A 4IW3B 4BMXA 1FFXB 1GZ7A 3G2KA 4DJDC 1U8XX 2RH5A 4DILA 1M1YB 2Y1FA 3T4UA 3I30X 4FLFA 3C5CA 3WADA 3WMWA 2G71A 2C2XA 4L4XA 1LDMA 5HDQA 4RLSA 2CLIB 4RQBA 5JJBA 2R1VB 1P77A 2VAPA 3FVVA 1N0HA 3BSYA 4EECA 1R6UA 3DB1A 3EDOA 4RESA 3K1TA 2ZJOA 3GEMA 2P1RA 3RS7A 4LXQA 5JY6A 2PFGA 4BQIA 1RWNA 1L5SA 3YASA 2HMYB 2I1QA 1VRWA 2V7GA 2CLEB 5BW8A 3F6SA 3P5BA 4W6QA 1Q1AA 5GOTA 1WV0A 1QIGA 4F8JA 1FY2A 3EPJA 3QVGB 4HKTA 4NV0A 2HUPA 2ODAA 3OLCX 1GGEA 3ZH9B 1EFHA 3QPDA 3DVSX 1OU4A 4MWZA 1QANA 1VKZA 4BLOA 4YV2A 5FUVA 3H9UA 3IQXA 1XE3A 4F3RA 5ESDA 1DKRA 2Q1UA 3E1GA 2W6JA 3Q7RA 4IIJB 4IX1A 4O2BF 3LK6A 3TMKA 1J20A 2HRZA 3H2GA 1UT8A 1U9ZA 3STHA 4A2CA 1HWYA 5K6AC 2JH8A 5I7EA 2W0SA 1L4EA 5ENDA 2QN9A 2BEVB 4FLMA 5B1IA 1PZGA 4M9UA 3MUNA 1G19A 1TAGA 2XDQA 3I39X 3WL5A 4B7UA 2O19A 1WKBA 4O0LA 4TT8A 1W25A 3EIUA 3AW9A 2WWTA 1L8LA 4WLFA 5B1SA 4JL5A 3EVBA 4Z0TA 3IAM1 3AJ9A 4U3JA 2OAGA 1UBNA 4FGZA 4R71A 4URXR 2QLJA 2ISQA 5TF0A 5E9QA 5IMBA 1OW3B 3A3YA 4ZTZB 1R9GA 3GVPA 4OQPA 4NBRA 2NXCA 1EMDA 5CK4A 3EGDB 3NM5A 1SU6A 4LDJA 5EEHA 3TOSA 1XRLA 5DM2A 1VYUA 4O4IB 2H65A 2I3BA 4Q1FA 4QTUB 3TOCA 4BV9A 3ZD7A 1SUPA 1Z0SA 3ID6C 1PSZA 4LVUA 1Z38A 3H5OA 1CY6A 1M76A 1BVUA 2GRJA 3ITDA 4G09A 4KN8A 2ZRNA 3IBTA 1H2YA 2PBZA 4X3OA 5DM1A 3CGWA 1KYYA 5FEMA 4ICIA 1WUKS 1Q12A 5LLSA 1EE9A 2H4WA 3PU6A 1FRZA 1XUOA 3RFFA 4CRWB 4JBGA 3K0CA 4LOLA 3MYRA 3NS7A 4OXIA 3BFPA 2HOQA 3GA7A 2BZ1A 4XGNA 1JI0A 5D51S 2AX4A 4LGMA 4M9RA 3BL6A 1JJ7A 2ADMA 4ZEXA 5KU1A 1FZTA 1NG1A 1ICIA 3DUWA 3GOQA 4KQCA 1DAOA 2C83A 2CMDA 3FJOA 1QYRA 1T8WA 2A14A 5FWYA 3T7KA 1SHTX 1B2LA 2YXDA 3CZMA 3D8TA 3PRJA 2JFXA 4UKDA 3S8MA 3IQZA 4U1RA 2HBRA 1R0CA 2O52A 1KY3A 4N18A 1J5PA 3V8RA 1EHIA 5DNDA 2CCJA 4DG9A 1EZZA 5C1PA 4KITB 5I9NA 4PSKA 1EWTA 4L2IB 3MCVA 2F4NA 3WGNA 3NDBB 2PWPA 4J16C 5C3UA 4EG0A 3L4JA 2EFEB 4RDXA 2J3IA 4LXTA 4ZU3A 3HCDA 3GJSA 3W9UA 2CXHA 4PM4A 4CNBA 3C6YA 3CB4A 3HACA 4AP6A 2I71A 5J1TB 1S5PA 4B7AA 2X9NA 4R01A 2VHQA 1XZQA 4HQRA 4KQ9A 4L85A 4UNQA 1XHLA 1WVMA 1ZRHA 3GJ5A 4TM7A 1RABA 1YMVA 1FQJA 4K86A 5EZ6B 3VTAA 1KYWA 1MQAA 2OBBA 3OFND 1C3OA 4YQFA 2QMUA 2RHOA 2ZZMA 4I9NA 5CH5A 5FUQA 1Z06A 2XXJA 1R4MA 5ADHA 2PJRA 4H35A 2XVMA 5FOQA 3H9CA 5KNCH 2EDAA 3OQNA 4DWOA 1DKUA 1Q17A 1X39A 1L4UA 1BXGB 1JDZA 2WKPA 2QTBA 3KHKA 3ANLA 2HMUA 2PMFA 4LX8A 4OKNA 2IYRA 3D7KA 4RD3A 3RBZA 3RKSA 3RYHA 1MB2A 5BSGA 1E79A 3D4IA 3DAFA 3W6OA 2PCLA 2NQ2C 3ROMA 4BU0A 2OK8A 3GLFB 3VHRA 2W2QA 3K70C 3ZWVA 3HADA 4QTZA 1TX4B 4L0QA 4UD2A 2O8FA 1OKKD 2PX0A 4Q9DA 3CNBA 1Q0ZA 4ZDJA 2VP5A 1JEAA 2OC9A 4KRYA 4GI1A 1S2IA 1IUNA 2GEKA 1P2FA 1DZIA 3UHJA 2Q5LA 2RHGB 1GNTA 1OVGA 1SB8A 2IW1A 3EA4A 5D5PA 5TVKA 2GA8A 4GR5A 5DOZA 1EG7A 4CDGA 2G0TA 3HO1A 3IHWA 3SIPA 5M34A 1T5BA 3SE7A 3TJRA 1KRWA 5DISB 2IYEA 4BO6A 5KNDH 3VBEA 3GFRA 1KO4A 4PG6A 1KVSA 4PCVA 3U7JA 3DOCA 3R7NA 3PCXA 3RNOA 1XNQB 3RWBA 1VYVA 1ZX1A 5EXTA 1NJ5A 2XEDA 3S29A 5IM4A 3QG1A 1MP0A 4E11A 3AY3A 1TZ2A 2W6JD 2C4KA 2C3YA 3V9PA 2I8AA 4EENA 2QVBA 4ND4A 3DKRA 3L84A 1VYHA 3M1YA 4BGVA 1AGYA 5IVDA 1TMGE 2QRMA 2ZRDA 3ROGA 4HNSA 4E2YA 1DKMA 3UJAA 5KIAA 5ULLA 1Y5NA 1LK0A 3DTVA 5THXA 1NW6A 2LD4A 1B8VA 2R65A 3FJYA 3OM9A 2FDRA 3IS3A 4JEMA 3FSEA 1KDRA 3HUDA 4XLZA 4MICA 5DEIA 1M1UA 2I1VB 3PR1A 3F49S 3ZJ4A 3QLUA 1JI3A 2HZBA 1G3QA 2FMTA 2P3SA 2DT8A 1FX0B 1BO6A 1EFUA 3WGIA 1CV2A 1GILA 1Y3CE 2RH9B 4ZAXA 3ZIAA 1KR5A 1T8YA 5GPBA 3IB3A 3U4MA 2Q3HA 3KE8A 1DJPA 5EVCA 2XRMA 2OYCA 3LUDA 3A0UA 3PSAA 1JFFB 3KYBA 4FYHA 2X2OA 3ESAA 2XVZA 4NX2A 3AF2A 4UEQA 1IBRA 3OTIA 2C4TA 2UZAA 1K8ZB 1DELA 3L46A 5CJ2A 5F23A 5KKCA 1XA0A 1M74A 1UXHA 4LZNA 2ERXA 3CSDA 2CCKA 2WWYA 4KVGA 3AEZA 3R0QA 4YJHA 1XTTA 1JBQA 1MTZA 2QL5A 4WN9B 2VCHA 4QELA 4ARAA 2QM3A 1L7MA 3DW3X 4OQYA 2VT2A 5JEEA 2DMRA 2X22A 2PMEA 7REQA 2ZT7A 3Q5DA 1N4DA 3H4VA 3LIIA 4AW9A 3MHTA 1LUAA 7YASA 4DNQA 3DVLA 3L0YA 5G2OA 1NZDA 2B3TA 1FNNA 1Z5ZA 1I24A 1JAHA 2X7HA 3EVNA 3W79A 4W9RA 3C16C 4TV9A 4ZARA 3LUBA 2QRVB 5FV4A 5JAHA 5CBPA 2RGUA 3EEIA 2HPVA 3KKLA 1A72A 1N3YA 1FP1D 1AE1A 3GF4A 4F84A 5KX5A 3INTA 4ND1A 3SLRA 5CW2A 3FETA 3VZSA 1GN9A 1DU4A 2QRUA 2R00C 2WTNA 2Q8NA 3A32A 4GBED 4NMWA 2OSVA 4DGQA 5HHTA 1D1PA 1SCAA 1U5BA 2YW9A 2EZUA 3HLTA 2PL3A 1L7XA 4GKJB 3ECCA 3ZQ6A 1I51A 4L22A 1E2NA 3ADBA 3HV0A 2CJXA 5FBRB 3HXTA 5JHHB 5EIEA 2OLJA 2C2KA 5I7SA 4Q18A 3I9V6 1XXLA 4WADA 1GQ2A 4YGXB 4B6JA 1VGVA 2IE0A 3FAZA 1E3LA 1PWZA 4HUTA 1UOQA 4GP9A 4FDMA 1IJBA 2P4SA 2ZG6A 3CUKA 4RYLA 5FI1B 2YVKA 5BWCA 5F7OA 5KPDA 1U98A 4C21A 3V6MA 4W99A 3KHTA 3VPFA 4KFUA 4QLAA 1MDFA 1YB4A 1G8PA 3F8TA 3A2LA 4MJ7A 3E48A 5JW6A 2WF8A 3B3AA 3AHEA 3GEPA 3NUGA 4LIPD 2F3PA 2YDXA 3PXDA 1GRQA 2ID4A 1ZL2A 1VCIA 3QWFA 3RPEA 2YR0A 1UFRA 2YIDA 4QJ4A 4RD6A 4TLDA 3FTQA 3KQMA 1JDBB 4FYJA 1VCHA 4BMCA 4QT4A 4DPMA 3X0DA 4AS3A 3ME5A 1N9KA 1D6SA 4HS4A 4KACA 2HJHA 3H1PA 4ZOBA 2FSHA 3VSCA 1LS1A 1NRIA 4PLTA 3LT2A 1L5YA 1CYDA 1GNLA 3MJEA 5ILQA 3GRCA 1NSFA 1D2NA 3RLIA 5MGNA 1RWPA 1USGA 2IEIA 4IIDA 4XWAA 2BI8A 2EZ8A 1T0PA 2HHAA 2QEQA 4X84A 3GNTA 3ITEA 4ENPA 2HRDA 1UEJA 4BNMA 1BGVA 1Q0HA 1Z8NA 2RAPA 2VG8A 3IT1A 3PVCA 2BLNA 3KELA 3OP1A 3V8NA 5JISA 4LK3A 4M2LA 4QGAA 5JQGF 1PFUA 1GGKA 1C4KA 3KD3A 4LHXA 5ALGA 5IEJA 3ZZTA 1I5EA 4YJGB 3IQIX 4EH1A 4CEJA 3OCJA 4CNQA 5C0OE 1BDJA 3RSFA 1EIZA 2NT3A 1MB0A 2P6NA 1PWHA 2HUNA 5EJMA 2WNIA 1SELA 3CCFA 3KPVA 3QH4A 3ISJA 1I5OA 2VFAA 4MUBA 2G6BA 2HSDA 4M7PA 4O1IA 3O82A 1TAHA 4U7FA 1ZDMA 3L8DA 4XXHA 5H82A 4MQFA 3LUPA 1QXSA 1A5ZA 3E4DA 4HFNA 4GP6A 4WJKB 3L7AA 1NQVA 2CHEA 5H3HA 4X00A 3I4LA 4RVUA 2R6CA 2I55A 2NZWA 1ZFNA 3OOEA 4YB8A 4EG1A 1IN7A 1DP4A 2OHIA 3P2EA 5GM1A 4U7DA 2VDWA 3AVPA 1YJBA 2GCEA 4MUAA 4H77A 4PGHA 1GYRA 3R6DA 4IXTA 4RPCA 1GG9A 1T2CA 1FJGB 2UUOA 4E15A 2CSUA 1XMOB 1KF0A 4XVHA 1VPVA 4TMVA 1DMRA 3A1SA 3R6TA 2V6GA 1DG1G 1F51E 4J2HA 1MV8A 4L0CA 1D2HA 4DCSA 3D2LA 1NBEA 1JW9B 1U2GC 1Z28A 3BJEA 1PL6A 3OMLA 5G41A 2OZEA 1LPNA 3VR5D 5L4LA 4YMVA 1TUBB 4CG1A 1DJLA 3BK1A 3EOZA 5A4MS 2BR5A 2QTAA 4CLOA 3QEMA 3CX7A 2NV0A 3HKCB 5KYGA 4Y1GA 4LBWA 2F55A 1PDOA 5JG7A 3VTZA 3D6TB 3TRKA 1PFKA 1C14A 2FQYA 1KDPA 4OFZA 4TMKA 1ATIA 4ND2A 2BHLA 3HDVA 2IUUA 1JHUA 4F86A 2BR3A 2X0NA 2WT8A 4GSKA 1H3FA 2DBQA 1QVRA 1ZGHA 4CMBA 3T7AA 3H18A 4YQEA 4U63A 1AT1A 1NUPA 5T4FA 3ORHA 3VA7A 1DFHA 1E7RA 4G5RA 4QTXA 4AYXA 1DC4A 4CE6A 3M6UA 3T7JA 1D03A 4OQLA 1GSHA 2BEWB 2B1QA 1AUQA 3OZIA 4PE5B 3SOPA 1OI2A 5JY1A 4IWXA 3WHPA 2WB2A 8ATCA 3FF1A 3LOQA 2EJCA 3N59A 4J4TA 2OL4A 3DM5A 2ONZA 3K9NA 4FGUA 4KE8A 1YBVA 2AUNA 1BQ4A 3G0BA 4HZUA 4JB3A 1XDBA 2IYYA 3KSBC 1JZTA 2N47A 5FFMA 2I87A 3I6MA 4IO1A 1NP3A 1H0HA 4YJDA 3ZV6A 4I4TF 5IKPA 1P74A 1V47A 2V4MA 3Q3EA 4BLTA 1SKBA 1T2DA 3CRW1 1NBOA 3VKFA 4ISCA 4Q21A 3C8DA 2GEUA 3IUEA 4FX2A 3D8HA 4OQQA 3TW0A 4MNTA 5GJBA 2ZTHA 1RAEA 1K5HA 3A25A 3CN9A 1HLPA 1R0WA 3FPBA 5BOSA 5CBKA 5K0TA 3O6VA 4MITA 1L5RA 3JASA 2Q5CA 3IP8A 2ZYIA 3AF0A 3TLAA 2D8MA 2RGAA 2YV5A 4AO7A 3HYLA 1ZIOA 3UJHA 2IU4A 2FN7A 4EJFA 3IMKA 4EL0A 3HBJA 2XDAA 2W48A 3F1LA 1HEIA 1TB4A 3GRKA 1LDYA 2LZ0A 3AVQA 3LPNA 1XYVA 2I3DA 3LYHA 3OESA 3UAWA 3HSKA 2NUPA 2O3TA 5JAZA 2B2NA 1JEQA 2JAUA 2BMJA 4TXLA 4RD1A 3GGJA 1ZQ9A 4OP3A 5EWLA 1CUVA 1GZSA 3LT4A 4JEUA 4IDGA 4B81A 4WXPA 4DRZA 1VOTA 1DGQA 3E5MA 1BIFA 1PR5A 2Y68A 1K3UB 1OBVA 3F8SA 4K8OA 4HGNA 3ZJ5A 5L4NA 2MYUA 2XY4A 1SUFA 4HEA1 3TN7A 1UBGA 2AOUA 1YDFA 2IZOA 1GCAA 2VHCA 3MRTA 3NB0A 1GZVA 3ZVRA 1Y6FA 3CISA 1ISPA 3UAYA 3V97A 1P62B 3WK6A 4DT1B 2G5GX 4I5EA 1IL0A 4LYJA 5HGJA 4NNPA 4NZPA 4HLQB 3SKYA 3ZBQA 5FLXA 2NNLD 3PWTA 4HD8A 4DM3A 1XRMA 2XWQA 4U5XA 3GEEA 3ASYA 4PWYA 1EUCA 4WA8A 2Q5OA 2IOFK 1EBBA 1PHRA 3ROTA 2XQGA 3SBEA 3EA0A 3L06A 5JJIA 3M2TA 4FQ7A 5DN6D 1IHOA 1VP9A 1VSVA 3LWZA 4LMPA 5F78A 3HMKA 3RVBA 3DUFB 2ZUEA 3L92A 4IJWA 1U3GA 4OXXA 2ZTSA 3S2IA 1S8AA 1TAUA 3E3MA 3JZMA 1U0LA 1KK3A 4QDUA 3LVQE 4II3A 3S2GA 4DMHA 1X8LA 2H5LA 2J67A 3LP6A 3W7AA 2Q4TA 2FEMA 1NR5A 3CQ9A 1JSRA 2Z2XA 1A9RA 4OFWA 2HO4A 2RARA 3EDMA 5K2MA 2W58A 3UMBA 4QYXA 4UHFA 2PUWA 3M1IA 1XKLA 4K03A 4X66B 5G1PA 4NEQA 2OXCA 4XGQA 1MQ9A 2C5FA 3C5VA 3LBIA 3QF4B 3T3IA 3PGKA 4F2HA 4WCVA 4DLAA 3NDIA 4F6RA 1ZRNA 1I7QB 3WGMA 4KREA 1CDDA 3VJRA 3TZLA 3IPYA 1QAOA 2YZGA 5EE9A 2DFTA 2BN4A 2A94A 1ULTA 3AM3A 1HE8B 4IWYA 2EIXA 3IYLW 2BFNA 3E9YA 2X23A 1WB5A 1SGWA 2AA3A 3B2NA 5KTPA 2E49A 3ZDQA 3DF9A 2XCSB 1KYZA 1WW3A 2G9NA 4XQ9A 2DPGA 1MJHA 2AOXA 3RS0A 1BH2A 3VU1A 1RM0A 3MTDA 1FZQA 1JV2B 4L51A 2RK4A 3COSA 1VG9B 2XBLA 3DDSA 3AEKA 2YJZA 3M6FA 4X65B 3U31A 1UDCA 1U8FO 3K30A 4QD3A 4CM4B 2E6KA 1GITA 3FPCA 4R8KA 2IYVA 3PWZA 3JWHA 3ZK9A 2QX7A 3WC4A 3OJXA 1B16A 1D0SA 2NO4A 2E5LB 4D57A 4ODIA 1GPH1 4WE3A 1L5HA 2PZEA 3PEEA 4F56A 4B5KA 3W77A 4MKFA 4P0QB 1XPUA 4MARA 3EZ6A 1NVMB 1D04A 5C34B 3U62A 4ZOEA 4MW5A 5KQLA 1TFUA 2ATIA 4V1CI 2P2DA 5KVQA 3OQPA 2REBA 3GD7A 1GCUA 3U7QB 4PYIA 1BU5A 2JGDA 5I7FA 2ILTA 2PGNA 3LOUA 1YZ3A 1FU8A 5DTEA 4FMDF 1TTTA 1IM5A 1NMXA 1C7IA 1VG8A 2QJWA 4OU5A 3VVMA 2HJRA 4DFDA 3CLHA 3EXEA 4Y2YA 4EKIA 5JMTA 5JQWA 1NQOA 3NQ41 3TJMA 3AEXA 3GN2A 4MZDA 3LE8A 4XGRA 1RTTA 2YH2A 1EESA 4KPGA 4QSMA 2HK7A 5LQNA 3EYAA 2IHZA 4P5PA 3DXZA 1LRKA 2K2QB 2OC4A 1ZI9A 4HVAA 5EVJA 4GKAA 1T5IA 5EJ5A 1Y42X 2Q0SA 3H4TA 3JQGA 3DCIA 5BOVA 1O8CA 5AM2A 1H2WA 2WAYA 3A6FA 3LLSA 5IP5A 4DC9A 1D2EA 1RBZA 2A35A 3NJ8A 4DV1B 1BDIA 2YZ7A 5CVCA 1ADCA 5C9ZA 2BC9A 4WCFC 4A4DA 1G9TA 1WCYA 5FWAA 4DBZA 4Y2UA 5BSVA 3A1UA 1MIOA 5FQNA 3WWCA 4WAUA 4F5DA 3UXEA 5GINE 3HUFA 1UM9A 2O2CA 1SHJA 2B69A 2VUIB 3D5QA 4OU4A 5CHEA 5BT9A 3O8RA 2JI8A 4HQ0A 3GJ7A 4R5HA 1EUYA 1KMHB 2ZYAA 4RMNA 2R9VA 4ND3A 4FKMA 4WKOA 3ZNPA 3AVUA 5KNBH 3GMIA 3LQ2A 3QYFA 4HL6A 4XR9A 5K0NA 4JODA 3UA3A 4UREA 3R76A 1VCMA 2GPAA 2BI7A 2GFHA 2WYOA 1AUOA 1JQAA 1XFDA 5BVGB 2FPXA 2QZSA 2DEUA 1L5QA 5C2JB 5CEFA 3NATA 2HTFA 5HXAA 1CUXA 3TTVA 2XVXA 2B4AA 4KZPA 5BT8A 3QFTA 5BRAA 3DZDA 5GVSA 1F4LA 3GMDA 5EAIA 3G89A 2PKQO 3DMGA 2ZJFA 2VUTA 2V5UA 4WKNA 1BEEA 1RQ7A 2CNNA 2EGGA 2W6OA 2Z08A 3E8MA 4HDMB 3TF5A 3LZ6A 2BHNA 5BN4B 1OB2A 1F0PA 4Q12A 1Z6TA 3CTPA 3OUZA 2C4UA 2NYRA 3ZD6A 2I29A 1V2GA 1CZRA 2PS3A 3EZLA 4JI2B 1UWKA 2CW5A 4LHZA 3WFZA 5KQSA 5LLTA 3IKTA 4GPD1 4JI1B 4N7BA 2BGMA 1PSWA 4G23A 4JOQA 2XMDA 3M5PA 1JR3E 4MTCA 4HDNA 5BWOA 4KXLA 2VO1A 3F96A 4F4UA 3DPSA 1WMFA 4B2IA 5F21A 4MVJG 2GF0A 4KQHA 1RHMA 1B0ZA 4B4VA 2W00A 4LHSA 5E3IA 4FGJA 1ZW6A 3H9BA 2K4MA 3UUEA 2CDAA 3AYXB 4GQIA 1Z6XA 2DFKB 4ZGBA 2LUOA 4KUGA 4J0IA 1C0EA 1ZMXA 3KKEA 2A3NA 4P32A 3I9OA 4RJJA 3ZDRA 4KXQA 5AVKA 1RT9A 1XWWA 2R60A 1ZD8A 3LFHA 4GOKA 3VO2A 5EZYF 2FG6C 3C1UA 5H0IA 1RMTA 3PQDA 1SUDA 4LDQA 4B4OA 2J6BA 1YR6A 4B71A 4QDZA 1QG6A 1SOMA 1Y4SA 2G09A 4I4LA 4XE5A 5JTUA 2VUUA 1XPOA 3PIRA 1KMIY 1XTRA 1L4MA 4YACA 3ZHSA 4EHAA 3AQIA 2OXEA 2WG2A 1NQAO 3A1CA 3PNKA 1WCXA 1DTEA 1JYEA 3DR3A 1O95D 1KTVA 3VR3A 1F6DA 3HB5X 2A5YB 2D7DA 4QYIA 1GV1A 1JR4A 4HYQA 4IJVA 4DNFA 1T36B 3KQNA 2H1WA 1NNLA 1AQLA 1EGAA 3DAGA 1ZIPA 3LU1A 4J9UE 3T5MA 4KGXA 4M87A 1Z4LA 2WJIA 3NIDB 2P8SA 2Y1WA 1NW5A 4BUZA 3RVDA 1O94C 3FGOA 5K8CA 4KFSA 1UWCA 1FDIA 1JU4A 3Q6IA 2Z6AA 1IRIA 1TLLA 1UDWA 2OV8A 2VIIA 3MGCA 2CDNA 5I5GA 4D6XA 4YT4A 6ABPA 4G86A 2Z5FA 1N2HA 1A8SA 3LTEA 4B3CA 1BRTA 3H5TA 3MTAA 1JAYA 2EHJA 4HOYA 2GSWA 4I9FA 4LNUA 4RACA 3G88A 1TQ8A 5ALJA 4ZZ2A 4LOIA 3RVJA 3TE7A 3PE4A 1CU1A 3I37X 1IM8A 2WT4A 3WYFA 3SZGA 1W5AA 3AKDA 1N25A 4QVGA 2N46A 3V48A 3KSRA 3SE0A 3TDNA 3ZBPA 4EYQA 1WO8A 2Q6OA 4B8YA 4CMGA 4Q4HA 1DX4A 4W5QA 3IGFA 5LP1A 5K3FB 1Z5UA 1VI2A 3HEMA 2BKUA 3S1AB 2Z4RA 2Z5GA 3CM0A 3BSWA 4R2LA 2PA3A 1Q74A 2PH1A 4R54A 4HAIA 4P4UA 3PUVA 3GLGA 4I9UA 5CLJA 5EXSA 1MC5A 4AG6A 1HDYA 2ZI7A 2F3UA 1N9GB 4PPFA 3ZXIA 1P31A 1C0KA 5U1PA 5C7LO 3OZBA 4HK4A 1DG3A 1WZEA 3PWKA 4IMPA 4PC3A 1BDHA 2PTGA 5SYMA 3DLAA 2NU9A 2PWBA 2WYVA 2DBYA 5I9MA 5A5DA 3UFXB 4LBVA 2DUUA 4V0OA 5CR9A 4B3DA 4QPZA 4A23A 2VJPA 3DMNA 3HNRA 1EGHA 4B0PA 1RCUA 5TQ0A 4OHVA 1GG5A 4WZBB 2PY6A 5DNAA 3TGWA 4M8LA 3H04A 3WGUA 3OU6A 1R5JA 2QQEA 3S3TA 1GFZA 2VVTA 3IBSA 1JHDA 1M1NA 2XUHA 3N0WA 4KQKA 4JC5A 4W7HA 4CIVA 4FC6A 3NKVA 1ITZA 2G1JA 3ZNOA 1Q3KA 4I9GA 4C43A 2EW8A 3MTBA 3DDCA 5TMDA 2Q3FA 1RAGA 2FPKA 2OBMA 1P5ZB 2ZXUA 4HH0A 3DVRX 3LQQA 5FYDA 2O8BB 2AFIE 2EOAA 2ZYVX 3OWXA 1FNMA 1T1GA 3LRPA 4DQUA 4F2DA 5ALQA 3CNOA 2FB9A 3HDGA 2Z5VA 3R4VA 1HPLA 3W2GA 4AJ1A 2D1RA 2W8ZA 4WNAB 2DKNA 4NOJA 5FORA 4NZ9A 4JUDX 4YJ3B 1D1QA 2WW8A 2CVHA 3URKA 1DFGA 1J5XA 1TMKA 2C61A 3HJAA 2EGHA 3EIEA 4G25A 4P0TA 2IZ6A 5DGHA 6AT1A 2G72A 5INTA 1JHVA 1WG8A 2BTQB 1TYAE 1M8FA 1Q0LA 2X42A 4FJ2A 3HY3A 3VPHA 1E1QA 2QSYA 3LQFA 5IDWA 3H8WA 2I78A 3EXG2 4XPIA 1NE2A 4JQSA 3ZCTA 3UPTA 3BIJA 3KR2A 2XB8A 3X1KA 3WGZA 1UMBB 4RXTA 3A28A 3GH3A 3TDMA 1E1KA 2JLBA 1NP7A 1OZ0A 5DI3A 3IEPA 3WIEA 4DB4A 1XJCA 2CD7A 3FWNA 4Z9FA 1Z2PX 4EGJA 3NYQA 1DIRA 1M72A 1ZO8A 2QK4A 1AC5A 5C5EA 2P4UA 4EUHA 5EHQA 1JNYA 1HZZA 4G0PA 1GT91 1IYZA 1DCMA 2YVUA 3QUTA 2IC5A 2QAJA 2A5GA 2H1IA 3ZWYA 2H1RA 4YQZA 2YFKA 1EQAA 2K5UA 2WAXA 1L4FA 1HOXA 1OLSA 5JVDB 1KRXA 3TLKA 4TKZA 4JC8A 4B48A 2Y1KA 2OM2A 1H0KA 2J5BA 4N5LA 4H6VA 3WB1A 1GKYA 1T3HA 4G4JA 4OQFA 1ORTA 2HZ7A 2HCJB 1KVUA 1SKAA 3NHMA 3CVYA 2YJ4A 1I4WA 5DBOA 1Z5OA 2JLQA 1K6MA 4K9LA 1UMDA 2R7AA 2I6QA 3AB3A 3LCRA 3R7SA 3UJ8A 4M0PA 4HWGA 4F8EA 1IJKA 1XU9A 3HM9A 5FUXA 5TGTA 3RYTC 1K7XB 2CLKB 2V7VA 3G9TA 3DYBA 4BFYA 5FNVB 4GEKA 2D06A 3WLJA 3ZEIA 3VR3D 4C29A 4EYKA 4CEHB 3K6JA 2HA4A 4GMHA 2QVYX 1OLUB 4G0ZA 3CO5A 4O2AA 1C8BA 2HCBA 4PN7A 4MDEA 1KGSA 2QT0A 3GHYA 2OYRA 3MWEA 5COQA 1ISJA 3MTIA 5KDLA 4QGSA 3KQHA 1FVFA 2FPWA 3DOUA 3D0OA 4UEOA 2HA5A 4YAOA 3TFWA 1LQUA 2VNKA 2XXBA 3EGOA 3JQ7B 3OMXA 5E6SA 3HVJA 3T54A 4DY6A 2QPOA 3VC3A 4PNEA 5ADUS 1NNEA 1XHEA 2HA6A 3O2JA 1XVUA 3X2SA 2YKGA 5DW3A 3B51X 4Q24A 2DB3A 3K1AB 3W5HA 4BBZA 2FRVA 4UHEA 4M8SA 1XALA 3ZGOA 2J3LA 4Y67A 4J0FA 1T3ZA 1I7PA 2BFPA 4B7XA 4JFRA 3TQTA 3WHLA 4UTPA 3NC4A 1M6VA 4BN0A 4UM5A 1W96A 1TYDE 3DL0A 4B9EA 4KMRA 4S24A 1N3BA 5AKEA 3IT2A 1JHRA 3CPEA 1UPTA 3IR7A 4Y9DA 4ACBA 3CLRC 3PDIB 2BTEA 3IR6A 2A0KA 4UBJA 1CJTC 2H1LA 4NAHA 4MS4A 4F4FA 2QIPA 2VHVA 4WOBA 3LMKA 1ABBA 1C8LA 1QRDA 3ZWXA 4M22A 2FCAA 4NICA 1LI4A 3IRVA 2IY8A 1SU8A 1YZVA 5KYUB 2A4KA 1LVHA 1GZ6A 1GU1A 2A59A 1J00A 3NWPA 5EINA 3P0HA 3U3OA 5JDIA 1XWFA 4IPTA 2K7ZA 4PLVA 4ZHSA 1U7HA 4JR0A 2G25A 4OAOA 4MYDA 5C46F 5KSYA 1GAQA 3L82B 1AKRA 1T2FA 3R5JA 3F46A 3EPPA 4IQ4A 1IUPA 2IY9A 1YOBA 2B82A 4YAGA 1OA0A 1P33A 3K7EA 3KKZA 1D6MA 3QVUA 2GCPA 2P2NA 1SRRA 2E4VA 3MB8A 3D1LA 3FRIA 3JQ9A 1NJ6A 1JDBC 1RYMA 4PFJA 4IIHA 5FOUA 1SU4A 3H3XA 5HILA 3OLXA 2GYVA 2HYDA 4EPXA 5JAUA 4M36A 3HKDB 3AR7A 3IOEA 4PSUA 1XLTC 1X0XA 4XEHA 3AU8A 1AU9A 2FLKA 1N7GA 3IPCA 2O8DB 1UOEA 1KYTA 1QK4A 1ODTC 4BZWA 3LI2A 1JLSA 1VJTA 4IIBA 3M6AA 5A1TA 3QYAA 4LYAA 2NSLA 1FTYA 1JHZA 2WSLA 2YCLA 3H5IA 4B85A 4DUPA 4EMSA 3V4RA 1NAIA 4EY4A 2RKOA 3BPSA 1GGJA 3I6BA 3LPMA 3ISVA 4JP5A 4INJA 1XEFA 5BUQA 2J30A 1J09A 4W6ZA 1H6BA 3H84A 1JLRA 1JFSA 3BC1A 2YWEA 4PLGA 1URPA 4ROTA 2ONJA 1KI1A 2ENUA 4H3HB 1EFRA 4U00A 1SCUB 2WQZA 3KVVA 1YSCA 4IEFB 4EVSA 2HREA 2MCFA 4V1CB 3LQYA 4O4HB 4EUSA 1E1QD 5JLAA 1LSOA 4YRDA 1AJEA 2H08A 5CRIA 3G2HA 3HXMA 3EVAA 3V4LA 4X95A 4I9HA 5BWBA 2PT7A 3C98A 2PZLA 4P7FA 4IH4A 5KTYA 5FOTA 1GYPA 5B1HA 4ALJA 4NJMA 5SY4A 4O8CA 1Y8RA 3W6UA 2RD2A 5AUNB 1IZ0A 5DIZA 1RI3A 5HEKA 1ZINA 1U8TA 4QUIA 5DGTA 3UCEA 1GA4A 2Z30A 3GRZA 3DAPA 1SBNE 4NMXB 2QORA 1FW8A 1Q22A 3QMVA 4MIOA 3DBHB 1ZGZA 3OE4A 5DRTA 1AXRA 2WSMA 3TKYA 4B3HA 1B4DA 3EN0A 1U2ZA 1I6MA 3MUEA 4IIGA 4PPGA 3UMFA 3TE6A 2O57A 3OF3A 4GT1A 2PMDA 2V0GA 3CF0A 2CL5A 5K8JB 3AY7A 1JJVA 1LLUA 1B3BA 2YRXA 4WKBA 4MW1A 4H1UA 4Q15A 3TSCA 2HN9A 1V9SA 4XI9A 3TW8A 3IDAA 3L9WA 4QA9A 4LWPA 3T0GA 4R9RA 3P71T 5AW7A 4FOTA 5ALLA 3OFKA 3ZUPA 5DHPA 3HVHA 3KT8A 4FNOA 4ACAA 4PEVA 1XEXA 3AF4A 4S12A 3ZKAA 3F3KA 3FNHA 5CK5A 4ZQIA 4X71A 5IDQA 2GN4A 1E98A 2A1TS 2I9KA 1FCJA 2ZIUB 1V4VA 1FQOA 2DBVO 3E35A 4I08A 2WWRA 3ABOB 3TBKA 3JPWA 3M4NA 4TL7A 1UPAA 1T9CA 2PRKA 1G5QA 1V6SA 2Q41A 3DLBA 4X20B 3UJPA 2XQKA 3UH0A 1D2AA 3WBKA 4EA7A 1BMTA 1JXQA 1S4MA 2ZR9A 3MN1A 4YMWA 3K6RA 5EOVA 2HKIA 3WLOA 5JCOA 3SS7X 5BXQC 3JRNA 4UFOA 3AF6A 2VTKA 4Q3BA 4HGZA 1Y7PA 4MKGA 4BP1A 4BJ5A 4EB0A 4CIDA 4G81A 2B8JA 4EHHA 1QRTA 4U7WA 1ODFA 2FPIA 3B1KA 4H18A 1BX0A 4F72A 5AVRA 1NI4B 4MGZR 2ZB2A 1S6YA 3S7TA 1QV7A 3TFQA 3TLGB 5ITWA 1YUBA 3ZX5A 1AXGA 1U7ZA 2BRUC 3CLTC 3UJBA 1XXHB 3VHLB 4W8GA 1RXIA 1ZRSA 2NZ2A 1CERA 3I42A 3C3BA 4L4RA 1NXOA 1ZAYA 2VNIA 2V9PA 5DSXA 4JA0A 4PX9A 5DXFA 4F4HA 2JHFA 2ERYA 3L6EA 5HKLA 2WIDA 4IHJF 5B3JA 3ZHOA 5FPYA 4C3ZA 1SBTA 4XWGA 1UADA 2IXBA 3AIIA 4IYRA 1CP2A 4OQDA 5C32A 1J22A 2PMKA 3H0EA 3FZNA 5JAOA 1V0JA 1UQRA 5BMVB 2EX1A 2OQVA 4ITUA 3J81A 1PK8A 2GX6A 2QT9A 4YI3A 1S7GA 2XJ4A 3R3WA 4BL5A 1KI4A 2GRUA 2VDRB 1DIHA 1VKHA 2P6PA 2TS1A 3GFBA 2LPMA 4OXNA 3IQHX 4UATA 2IDKA 3S81A 1U7UA 3D6UA 1DAKA 3LPDA 4DSTA 4MUEA 3NBMA 3PPWA 2O06A 4G5HA 3BB3A 3P9CA 3QU5A 4ZU6X 1PG5A 4I66A 2IBSA 3N3BC 4MKHA 1B8NA 2PXAA 2D1TA 1SKUA 3LUHA 5ARBA 2QD1A 1W1WA 5AJZA 3ILHA 5K3EA 3HPQA 1KYVA 3FPAA 3DO6A 1Z4OA 4JS0A 4KYUA 3E82A 4IG9A 3RH0A 4UPEA 1WLYA 3R6WA 4KL8S 1NG9A